1QQP1

Foot-and-mouth disease virus/ oligosaccharide receptor complex.
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
210
structure length
188
Chain Sequence
TTSAGESADPVTTTVENYGGETQIQRRQHTDVSFIMDRFVKVTPQNQINILDLMQVPSHTLVGALLRASTYYFSDLEIAVKHEGDLTWVPNGAPEKALDNTTNPTAYHKAPLTRLALPYTAPHRVLATVYNGECRTLPTSFNYGAIKATRVTELLYRMKRAETYCPRPLLAIHPTEARHKQKIVAPVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords PROTEIN (GENOME POLYPROTEIN)
publication title The structure and function of a foot-and-mouth disease virus-oligosaccharide receptor complex.
pubmed doi rcsb
total genus 39
structure length 188
sequence length 210
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1999-05-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1qqp100
2RS13 1RHI2 3ZFGA 2R073 1ND3B 1NY72 2WZR1 2RS12 1NCQA 3FBMA 5J98B 3VBFC 1HRV1 2VQ0A 2R072 5DDJ3 3VBOB 2HWB2 4QPIA 1RUC2 1FPN1 4YVSA 5DDJ2 4CDWA 1RVF3 4IV3A 2WFF2 3M8LA 1NA1A 2HWD1 4GB31 4N53C 5JZGC 3VBSC 2IZWA 1QQP1 2RS51 3ZFGB 3ZFFC 1IHMA 1AUYA 3NAPC 1NCQB 2RMU3 2RM23 1DDLA 4CDXA 4JGZA 1PGL1 2RMU2 4QPIB 2RM22 4YVSB 1FPN3 1BMV2 4CDWB 1C8M3 3JD73 4WM7A 1AR83 1NA1B 2BFUS 1QJX2 3VDDC 4Q4X3 5CFCC 1MQTC 1AR82 2ZTNA 1RUH1 3JBG3 1VB4A 5C8CC 4GMP1 2ZZQA 4Q4X2 3VBUA 1PGW1 3JBG2 4CDXB 4GH4A 2R061 2WWSA 4JGYB 3DPRC 2BPA2 1OHFA 1R083 1R1A2 1EV11 5ACA2 3JB4C 3CJIC 4WM7B 1E57A 1R082 2HWE1 1AYM2 3HAGA 3S6PA 4N43C 4CEYA 5C4WC 3VBUB 1NOVA 1R091 4GH4B 2RR12 1VBB2 2MEV2 1AR73 1VAKA 1VRH1 1AR72 1B35C 1AR91 5BNNA 4RQPC 1BEV3 4RS5C 4RFT0 4QPGC 2HWE3 1PIV3 2WS93 4CEYB 1BEV2 1POV3 2WS92 2ZAHA 1R093 5K0UC 4EJRA 4WM8A 3TN91 1VRH3 5BNNB 1ND2A 1ASJ3 4PDWA 1RHI1 5L7OB 4FSJA 2WLPA 1ASJ2 1RUF2 1NY71 4IV1A 2Y26A 2RS11 5BNOC 2R071 1K5MC 2HWB1 4YVWA 1RUC1 4WM8B 1MEC2 5DDJ1 1RUG2 3TN93 2WFF1 1RUI3 3VBFA 1AYN2 4PDWB 1VBE2 1VBA2 1CD3G 1RUD2 1FOD2 4IV1B 4NWWA 4Q4V2 5D8AB 4YVWB 2HWB3 2RMU1 4N53A 1RUC3 2RM21 2X5IC 2GH8A 1BMV1 1VB2A 5JZGA 3VBSA 3ZFFA 2WFF3 5ABJB 3NAPA 1Z7S2 1QJX1 3VBFB 5CFDC 1C8M1 1NCRC 3JD71 1OOPC 1AR81 1QJU2 4Q4X1 3JBG1 1QJY3 4N53B 1ZBE2 3VDDA 2TBVA 5CFCA 1MQTA 1QJY2 1R1A1 5ACA1 1SMVA 3VBSB 5JZGB 5C8CA 1R081 1QJX3 1COV3 4IV3B 1HXS2 1V9U3 3DPRA 1COV2 4CDQC 1RUE2 4FTSA 2XBO2 1V9U2 3VBHC 2RR11 3CJIA 2XPJA 2MEV1 3VDDB 4N43A 3J8F2 1MQTB 4JGZB 5C9AC 1R1A3 5ACA3 1AR71 5C8CB 2WZR2 4Y5Z0 2BFUL 5C4WA 1HRV2 1BBT3 1AYM3 5LK7B 2R042 1BEV1 3VBRC 1BBT2 2BUKA 1PIV1 2WS91 1POV1 4SBVA 1B35A 2HWD2 4BCUA 1VBC3 4JGYC 4Q4W3 3CJIB 2RR13 4RQPA 1TMF2 5FMOS 1VBB3 4RS5A 4QPGA 2MEV3 5FOJB 1QQP2 1VBC2 4N43B 4Q4W2 1F8VA 5A32A 5C4WB 4GMP0 2HWF2 4Q4Y3 5K0UA 1ASJ1 1RUF1 4Q4Y2 4NWVA 4RQPB 4QPGB 1MEC1 1RUH2 1VBD2 1RUG1 1HQNA 5A32B 1PGW2 1D4M3 1ZBA2 4CEWC 2RS32 5BNOA 1VBE1 1D4M2 2R062 1K5MA 4RR3C 1F2NA 1RUI1 1PO22 1VBA1 1RUF3 4Q4V1 2HWC2 3ZFEC 1MEC3 1RUG3 1X33A 1RMU3 1Z7S1 5L7OC 1AYN3 1RMU2 5BNOB 1VBE3 1K5MB 1ND2B 1QJU1 2X5IA 1HRI2 1VBA3 1RUD3 1FOD3 1AR92 1RUJ3 4CDUC 2PLV3 4Q4V3 1FMD2 1ZBE1 1CJDA 1RUJ2 5CFDA 2PLV2 1NCRA 1QJY1 1H8TC 1OOPA 5BNPC 1TME2 1EAH2 1Z7S3 3JB8A 4Y4YA 1AL22 4AEDC 2FZ2A 2X5IB 1COV1 1QJU3 1RUE1 1AR62 1ND3C 5D8AC 1V9U1 5GKAC 1X36A 5AC92 1A6CA 1ZBE3 5CFDB 1PVC3 3VBOC 3J8F1 1NCRB 1OOPB 1PO13 5ABJC 1PVC2 4Z92B 4CDQA 1PO12 1W39A 2R041 3VBHA 3ZFFB 4LLFA 3NAPB 3ZXAC 1BBT1 1HXS3 1AYM1 4RHV3 1RUE3 3ZFGC 5C9AA 2XBO3 1NCQC 4RHV2 1RVF2 1TMF1 1NG0A 1VBC1 4Q4W1 4QPIC 3J8F3 1VBB1 4YVSC 3VBRA 2WZR3 4CDWC 4CDQB 5CFCB 1HRV3 4IV3C 2DF7A 1NA1C 3VBHB 2HWF1 2R043 4JGYA 1GFF2 4Q4Y1 5C9AB 1FPN2 2HWD3 3DPRB 4GB33 1TMF3 4CDXC 1C8M2 3JD72 4JGZC 1VBD1 1QQP3 4GB32 2BBVA 2RS53 3VBRB 1ZBA1 2RS52 4WM7C 2RS31 1D4M1 2QQPA 2HWF3 1PO21 3IDEA 1PGL2 3VBUC 5FMOL 2HWC1 1HX6A 4GH4C 4CEWA 1B35B 1RUH3 1VBD3 4GMP3 4RR3A 5A33A 4RS5B 1ZBA3 1RMU1 2RS33 2R063 1POV0 4CEYC 3ZFEA 1AYN1 1PO23 1HRI1 1EV13 2GSYA 5K0UB 5J96B 1RUD1 1EV12 1FOD1 1FMD1 2HWC3 1RUJ1 5L7OA 2PLV1 4CEWB 1C8NA 2HWE2 1PIV2 4RR3B 5A33B 1TME1 5BNNC 1EAH1 4FTBA 4CDUA 1AL21 1R092 3ZFEB 1HRI3 1AL0G 1H8TA 5BNPA 1AR93 1AR61 1VRH2 1M06G 5AC91 1FMD3 4AEDA 1WCDJ 4WM8C 1PVC1 1TME3 1RB8G 1PO11 1EAH3 1ND3A 1ND2C 5D8AA 4CDUB 1AL23 1OPOA 4PDWC 4FTEA 3VBOA 1H8TB 5BNPB 1AR63 4IV1C 1HXS1 5ABJA 3TN92 4RHV1 1RVF1 5AC93 2XBO1 1RHI3 1RUI2 2FZ1A 4YVWC 4AEDB 3LOBA 1QJZA
chains in the Genus database with same CATH superfamily
3UL2A 2XJSA 2QNKA 3VDBA 1C1LA 2R073 3SQOA 1ND3B 2Z5WA 4NE9A 3BTXA 3J4UH 5FYVA 5T50A 1YCIA 4DIQA 2EXHA 1RYYA 1I5PA 2VQ0A 2R072 3AXDA 5DDJ3 4UWDA 2VC9A 3IMMA 3AJYA 2WABA 3LE0A 1GQPA 3OBRA 1AX2A 5ANNA 4D94A 2E51A 4PIZA 1W6OA 5DDJ2 4CCNA 3GXUA 1J59A 1VAMA 1YEWA 4CDWA 4YWAA 1RVF3 5FYMA 1ULPA 3OY8B 3H8XA 4M3CB 2YFUA 3M8LA 5T55A 2AGSA 2HWD1 1N3OA 2JDPA 4CCLA 4YZ4A 4ZHNA 1UPIA 1ZZ7A 1XYNA 2Y6FA 4ARYA 1QQP1 2WYFA 3ZFFC 1SBEA 4XURA 3THDA 1AUYA 1SCSA 4OUEA 4KBBA 3BTZA 2RM23 2VULA 1BYHA 1DGLA 2FDFA 1L7LA 2BW8A 3KZ4C 4JGZA 1DDLA 3V0BA 5C3RA 5DXDA 3O12A 1LULA 1PGL1 2RM22 2AACA 1W6OB 1QU0A 3GF6A 3RI8A 3PUSA 4CDWB 1S0DA 2ZGUA 4QXKA 2A70A 3JD73 3S30A 2BOIA 2IXHA 3T1MA 5JSPA 1XNDA 4I0BA 3RMYA 4OHVA 5FZOA 1WW6A 4LKFA 1MQTC 1JZ8A 2ZTNA 3INAA 3Q8EA 1JZ4A 5C8CC 4GMP1 5LK5A 3ZYJB 4XVHA 1YQ6A 3W59A 3MW3A 3V0BB 2C4XA 4ZPIA 1KJRA 2ZGTA 3VD7A 4GAZA 4HN1A 1HB3A 4G4FA 5DABA 3U1XA 4I2OA 1SLLA 3IT8A 1OHFA 2R32A 3RYRA 5C3QA 3TEYA 3WNOA 1V6IA 2DVDA 4HG6B 2HH9A 3JB4C 4RN5A 3T4VA 4NHLA 4JTNA 4BQ3A 4XFFA 1J3QA 2EIDA 1LU1A 2HWE1 1AYM2 4UI9L 1VJ2A 5FZGA 5L9BA 4ZS2A 5FLHA 5FZOB 3S6PA 5AFBA 2WAAA 3BTYA 3ORJA 4E4ZA 2Q1FA 3H42B 3AMPA 3BPZA 5J7MA 3B01A 3M70A 4W50A 4CCMA 4XFHA 1R091 3N9MA 4MO3M 1GICA 4BIFA 2B9UA 2J1VA 3RNSA 3MHZA 2LW8A 3QH6A 1VBB2 2ATFA 4NPMA 4ET7A 1YI9A 1Y9QA 2C0ZA 3WF4A 4AVSA 1H6YA 3MIFA 1AR91 3FLTA 4CP0A 4RQPC 2OX0A 4RFT0 3WXPA 4QPGC 2HWE3 5FLJA 4F7ZA 2W1QA 4GJZA 4D7SA 2WS93 4AVBA 2UWCA 4QQHA 4WVMA 4UFIA 1DQ4A 5IAVA 1RC6A 4AZZA 4R9BA 3WW1A 2WS92 5A3TA 1FAYA 3Q8FA 5FZEA 3JQXA 1EY2A 3TEXA 1R093 2AYHA 2VW0A 3M3CA 1OLME 2JG9C 3N7JA 3VN4A 4OHYA 1CAXA 4FP2A 4CVUA 3POGA 4YG6A 1YFUA 3MLKA 2VY0A 3UKTA 4B8EA 4MLOA 3I2IA 5LASA 3I2DA 4BQXA 3J7HA 4JRLA 4DXRA 4C0HA 1QOSA 4HMZA 4IXLA 1LOGA 4OMDA 4B29A 4QKBA 4W8JA 1ND2A 4O7XA 3P6BA 4A41A 1ASJ3 2VZOA 3GJBA 4Y5TA 1S0CA 4PDWA 1OD3A 4IGPA 4WVVA 4WVMB 4H3WA 3SCHA 1K5JA 3V65A 4P9XA 1ASJ2 4XFAA 3AKPA 3DKWA 1NY71 1KGYA 4AW7A 2RS11 4KI5M 3PJYA 3VB9A 4ES9A 1WCKA 5JOYA 1CAXB 5HPOA 4YVWA 2ZMKA 1B09A 1OBNA 1YXWA 1W8TA 3HNBM 4NIDA 4MGTA 4IE7A 4CTEA 4COVA 5FWEA 2QCSB 2XVLA 1RUI3 4YGBA 1VAVA 4LMFA 4N8MA 3UETA 4PDWB 2ZA9A 1V6OA 4LTAA 1XE8A 5JAXA 3U14A 4GWIA 4Q0UA 4LBOA 4HSLA 1OUSA 3MW2A 4NWWA 2LM3A 4YARA 3MBWA 3CO2A 4Y1UA 5C33A 4YVWB 2RMU1 2Y6JA 1BMV1 2AENA 5C71A 4RL7A 4RYDA 4OI0A 3AYDA 2CYFA 4AL9A 4ISRA 1F4HA 1JUHA 5ABJB 1X7NA 4OFGA 1GQGA 1Z7S2 4JAAA 5DZFA 4B7EA 4NAMA 1H4HA 3BKZA 1PX3A 3WNMA 2DUPA 4Q4X1 2DU1A 2OXBA 5FREA 1QWRA 1W90A 3B69A 5FZ4A 5C3PA 1UZZA 1XNBA 1QIQA 1W8FA 3WHUA 4A7KA 4URAA 5A3NA 1NAEA 2UY9A 1I3HA 1ZA7A 4ATEA 4DINB 5CFCA 2XJPA 3POWA 3B94A 1SMVA 3M4FA 4HETA 4K21A 2E6VA 2OPWA 4CUGA 4ITCA 1R081 3ME2A 4JKLA 5EWSA 5C3SA 3E6DA 5BY5A 4ONUA 5HV4A 4FPJA 3VD9A 3DEMA 3MIHA 2VNOA 5CZKA 5K9YA 2XG3A 1ST8A 1GYKA 4UBHA 1GBGA 1WA6X 3PTYA 2DWRA 4MUVA 4DXZA 5L73A 2HBUA 1H8VA 2RR11 3CJIA 2XPJA 2VM9A 3OD0A 4JDNA 4PI0A 4ARXA 4EV0A 5DAVA 3WNPA 2OVUA 3HMYA 2JDYA 4MXVA 1DHKB 1PVXA 2NPIA 5GALA 2WZR2 2J1UA 3KVBA 5C4WA 4UYBA 4G9SB 3UJQA 3I3MA 3GDBA 4KU8A 3V56A 2Y6GA 3KSCA 4YGCA 2R042 4FOVA 3VZKA 5BPXA 2JE8A 2BUKA 1DFQA 3PUQA 2ZX0A 2JE7A 1JZ3A 4MXWB 1KDMA 5C5UA 1VPHA 3GHMA 3R05A 4BQ5A 3FZ3A 1B35A 3FUOA 3H1WA 4XIOA 4BDVB 1D0GA 4Q4W3 3CJIB 2RR13 1GUIA 3B3QE 1W2AX 2VH9A 4HKWA 1OH3A 2ZGNA 5KXBA 5D21A 5FP8A 3N9QA 4Q4W2 5F7UA 1F8VA 1UYXA 4DUXA 3ZIXA 5FK7A 2G9ZA 4LIVA 4N7UA 1PZ9A 5C4WB 2WT0A 1JOJA 3NKGA 1BXHA 1IPJA 3BIWE 4LO7A 4YM3A 5CAZA 3K51A 1BCXA 1LB2A 3WQBA 5IVEA 3T0DA 2JB8A 4XILA 4COZA 4L99A 1XRUA 4QAWA 1GKBA 1YQ5A 1ENQA 2B7YA 3SKJE 3OGJA 4EN8B 1W6PA 1MEC1 5IT6A 5LA1A 1VBD2 1RUG1 4XZPA 4MGYE 4CXXA 4YM1A 3WUCA 1UKGA 1J3RA 1IGOA 1LGNA 2G19A 2K0GA 3NJVA 2GP5A 2PXJA 1GQHA 2A6XA 4OI4A 2ILMA 4E8DA 1CGPA 4YSFA 1TE1B 1N1SA 3NV4A 4G3YC 2DVBA 1U5ZA 4PI2A 4XQDA 4C0BA 4CEWC 1VBE1 3A0NA 2DUOA 2X09A 4RR3C 4XDOA 4X6QB 1PO22 5EXOA 1QDCA 3LA2A 1UPSA 3DCQA 3UK9A 3VKFC 4NO4A 2R1BA 1O4TA 1OFSA 4I09A 5BV6A 2FHRA 1NQDA 2Q5TA 3M7AA 4XCAA 5F37A 4YW2A 1W6PB 2VZRA 1MEC3 1I1EA 1RUG3 1X33A 5EHDA 5J1XA 3B02A 3AX4A 2QJVA 2VUJA 1Q8OA 2PAEA 3QOPA 3M3OA 5E89A 3CZJA 3KS7A 4LXLA 2P6CA 2WNUC 1VBE3 3U07A 4E9KA 1MPXA 3DXUA 4FBFA 4FPYA 3JQWA 2A75A 3BCWA 2VE1A 3E6CC 2W1UA 1UMZA 1DGRN 2HEYF 4NIHA 3IDAA 4YGEA 4L2NA 5GZGA 2PFWA 2WT2A 3RQ0A 1W04A 1K42A 1LRHA 1Q8PA 3PIJA 1HV1A 1ZBE1 3AYAA 1LODA 5FP3A 4H55A 5T54A 1W3XA 1NCRA 1OOPA 5JUVA 4HVQA 2OYZA 3MF9A 2D3RA 5FO8B 4RSUA 2PYTA 3ST7A 3W9AA 1CPNA 2YY1A 3HJRA 4XFCA 2W47A 3WF3A 1IS6A 3JB8A 4UFHA 5CKNA 1GZTA 4FOYA 2DBIA 3I2GA 1FYUA 3TNPB 1XOYA 2MHFA 1JH5A 5LW9A 5FZDA 1HDKA 4QKNA 2I45A 2JDNA 3SH3A 2CAUA 3UGFA 1OUXA 2ID4A 2WSUA 4HONA 2ZAAA 3AYCA 1GANA 3CEWA 1ZBE3 2VUDA 1NCRB 1OOPB 4LNVA 4AYUA 3IWZA 1I6XA 4O9EA 3ALQA 1RXFA 2ARAA 4IEZA 3USSA 4CDQA 3WCRA 4HT1T 2QQMA 1GP4A 5HCHA 1W39A 2V72A 1LR5A 3VBHA 4AHXA 4YPJA 1Y43B 3HBZA 3NAPB 1BBT1 4IE4A 3ZXAC 1ZREA 3WSOA 3UESA 3ZFGC 1FXZA 5C9AA 3WUDA 3CF6E 4A6SA 3FE5A 3FMGA 1XPWA 3KF5A 4Z2WA 2ADEA 1Y9GA 3ZYGA 1V6JA 2XB6C 3PUHA 1NG0A 2ET7A 3OYWA 4NVPA 1VBC1 3FHAA 3LD8A 2RJ2A 3QH7A 2G1MA 3I4IA 3WNXA 1W9WA 2VCBA 5F3EA 2XXZA 4AOCA 2OZ6A 4CDQB 1CIYA 1HRV3 1V00A 2LALA 3C7HA 1GNHA 4IV3C 2DF7A 1MVEA 3VBHB 4EYUA 2BQPA 3LGRA 1ZZ8A 3C2UA 3GGLA 4KWUA 1YQCA 4Q0QA 3K4AA 1GFF2 3LCPA 2AEZA 5IW0A 1LEDA 4JDOA 5LB6A 5C9AB 4K8FA 4BA6A 1PZ7A 2WN3A 5A3PA 4Q8KA 3DPRB 4XBLA 4GB33 2AC1A 4W4ZA 5CA6A 3LA3A 2DCTA 1DQ1A 3Q8CA 4HSJA 4LO5B 1QH6A 2JB4A 2ZHNA 2RDSA 3OYWB 4YM0A 1W8UA 3PJQA 4FFIA 4AWDA 3S5AA 4GB32 1G8WA 3AVRA 3FUQA 3G6JB 4EZ4A 4L0PA 3OJBA 5E88A 2ZHMA 5FZ1A 5HXMA 2RS31 2EICA 3VL9A 1U0AA 3GBFA 2QQPA 3OF1A 3FL7A 3FX3A 3LSDA 4LBQA 3WVJA 4K8RB 5FTTC 1ZYBA 5F3GA 1KS4A 2YC2A 3LDRA 4NROA 5FXXA 2F6BA 2YGMA 1LOBA 2Z2SB 3THCA 1MS9A 2IUWA 4UFJA 1F5JA 3EB7A 1BVP1 1OLRA 2HWC1 3JCIA 4QQPA 4GH4C 1Y3TA 2Q8DA 1SLAA 1UZ0A 2ET1A 1MS8A 5A3OA 1W9SA 3ZXLA 4COWA 3LFMA 4RS5B 4K3UA 5KXCA 4ZS3A 1W03A 4A7ZA 3N7KA 1HJFA 1EUTA 1JOBA 2RS33 2WQ4A 3U78A 2PQSA 3FJSA 2IXLA 4LK7A 4XXPA 4LBQB 3LPFA 4DS0A 2IXKA 4AGRA 5FO7B 2Q8EA 1FI2A 2C1FA 1HRI1 2JEMA 3M1HA 2CWSA 3AP6A 4GIQA 1ULCA 3SCGA 4EWDA 3MW4A 3T1LA 5J96B 1I9RA 3HPNA 2QQUA 2B9VA 1RUD1 1H1AA 1OLMA 1DP0A 1PHMA 2HWC3 5DZGA 5F9TA 1JXNA 1C8NA 1IS5A 1BKZA 1X50A 2D5FA 2ZEYA 2IXIA 4LLOA 1NYWA 2X8KA 2XWJB 4TXWA 4YZ5A 2F4LA 5BNNC 1MZEA 3ITQA 3VLBB 1H1IA 1W2NA 2E53A 1LNSA 1QGLA 2ZKNA 4R8HA 4XUNA 4HVOA 2VBDA 2Y6KA 1REFA 3N9LA 5CBLA 1T6GC 1WD4A 2QVSB 1HRI3 2E33A 5BNPA 2Y38A 4XHXA 2H0VA 3WDXA 4LKEA 3MV01 2IWGB 1SHWB 1ZVFA 2ENRA 4HK8A 4JZRA 1WCDJ 3VDAA 2WA4A 3OD4A 4WM8C 1LGCA 1W0NA 2W39A 4GALA 3OEAA 5IYYA 2I74A 3AK0A 2VNVA 3KHCA 3NV2A 1RB8G 1MZ6A 3U11A 1XU1A 4FFHA 4DB5A 1HW5A 2XJUA 3ILFA 4AQ2A 5AVPA 3WDVA 3AZXA 4BQYA 1OA4A 3VBOA 2VECA 4QX2A 1FATA 5BNPB 1G86A 2W08A 3PU3A 3HEIA 2C5DA 4IV1C 1HXS1 1JI6A 4R4ZA 1SDDB 3Q8BA 4RHV1 3WP5A 3GZEA 1GP5A 4Q0SA 5EP9A 4CZSA 3EBRA 4Z2AA 3VHOA 4R9AA 1QXPA 3BALA 4LR4A 2GN7A 3ZYPA 2NMOA 2D7FA 4MGQA 2OS2A 3P5BA 2AUYA 5FO9B 1C5HA 4QQLA 4YG0A 4BHPA 3VZJA 3AZWA 1UU5A 3DN7A 2BOJA 4FO9A 3RPQA 4OUMA 2CGPA 3P3NA 3AZZA 3VBOB 2HWB2 1P8JA 1U12A 1U5YA 2VOTA 4YVSA 2ADDA 1CQ9A 1QOTA 1N47A 3POFA 2P37A 2E31A 2X10A 3IDCB 4FVVA 4AHYA 4Y33A 3N3HA 5F3IA 4CP9A 1DGWX 4N53C 2PHXA 2VBPA 1GNZA 5JZGC 3I97A 5IVYA 3VBSC 3I2OA 4AQSA 4FP3A 2ARCA 4QPWA 5FLIA 5I91A 4LBKA 3KVAA 2F4PA 1XSQA 4GWJA 3AZYA 4K6BA 2FQPA 3A7QA 3GNEA 3PMEA 1SG3A 5KXDA 5FIXA 2VMIA 2QQOA 3M3QA 5H9PA 1JYNA 4OI1A 3BUCA 4YVSB 2LTNA 4O65A 1UO9A 1GWLA 4RGGA 4LBNA 3FFQA 1ULGA 1C8M3 2ES3A 4WM7A 2BFUS 3KT4A 2KA3A 1J84A 1W8OA 2WYSA 3HWJA 4QXHA 3BI3A 1KRIA 1PZ8A 1RUH1 2R6QA 1VB4A 3MPBA 1C28A 1SPPA 4PQ9A 5EYXA 4QX7A 1UY0A 1AJKA 3TOJA 3VKLA 2XONA 4C8DA 4UW6A 3H1YA 3RVHA 4YZ1A 4EE2A 3PMSA 3LA7A 3ACIA 2RG4A 2R061 2WWSA 2CDOA 4CP1A 4JGYB 5FPUA 2DFCA 2BU9A 1C5IA 5A7OA 1EV11 2VZ3A 4WM7B 3O1MA 2BYVE 4XFBA 2IXCA 3ZMOA 4LOSA 4XC9A 2P34A 4CEYA 4FPGA 2B45X 5FZ9A 3CKHA 1YFYA 3TBDA 1SPPB 2DCKA 2WNOA 4Y1VA 1KFUL 1NOVA 2WZEA 2VZUA 3SH5A 4IE5A 3N7MA 3C3VA 1OT5A 2JG8A 2ZX4A 4AAXA 3D8CA 2CAVA 3KQ4B 2Y64A 3ILNA 5JVVA 5HCAA 1VAKA 4E4DX 2BGOA 4BU2A 3IIAA 4LQRA 1UD1A 5L19A 4ASMB 1BEV3 4P9LA 4WV8A 2P3IA 5DUUA 1V0AA 5ANQA 4AAPA 4DY3A 4L9BA 1SFYA 1PIV3 3H3ZA 4CEYB 2R16A 1OXCA 1ACCA 1BEV2 1UIKA 4JRAA 5G05L 1UZVA 4UFLA 1SEFA 3K4DA 3AKTA 4TYSA 3FN9A 2DUQA 3BVCA 2D98A 1APNA 2ZAHA 1XYPA 4OQ9A 5JWPA 1Y7BA 4BISA 2WO2A 2JG8B 5K0UC 4YW3A 4LT5A 1X9PA 1GZWA 1GR3A 1UZWA 2L9LA 1KITA 4IE6A 3D3AA 1W6MA 1D4VB 5A7WA 4EJRA 1IG3A 3OGSA 1KQRA 4M0HA 4YW7A 4BQ2A 4IEWA 4X8NA 4QQOA 3I2FA 5FMBA 3SKVA 4EWAA 4NIGA 2ZGLA 4BMBA 4MSVA 3POIA 2UYBA 2VUCA 5JXGA 5L7OB 5KHIA 3C7FA 3VGIA 3WQ0A 2WLPA 3ZO0B 5A6ZA 1XNKA 4AGGA 1RIRA 4IUGA 2BVBA 4ZZ8A 2K46A 2R071 5FYYA 3T2QA 5BNOC 4BXFA 1OLQA 1GZWB 5J37A 1W6MB 1XXNA 5A7WB 5DDJ1 3DUIA 3ZOIA 1PMJX 3VHRA 1WMFA 2ZGOA 3BU7A 3GALA 4BQ4A 3MLJA 4BYYA 2P5BA 2W95A 1GWMA 4XYXA 3KF3A 1AYN2 1W2TA 1S2EA 1FNYA 2GMEA 2GNDA 2ZOEB 3OB8A 1RJ7A 3VZLA 4AI2A 5A6YA 1H1MA 1FOD2 3ZYRA 4S2HA 4A45A 3QD6A 5AFEA 2QKDA 1SLCA 4Y1XA 1IS3A 5F1RA 1H2KA 4Q4V2 3IN9A 4V1PA 5D8AB 1IPSA 1LESA 2G9GA 2JECA 3AL5A 3K2OA 3K3NA 2RM21 3GCWA 3V0AA 3BOPA 4JHTA 3LF7A 1TZOA 1O59A 2N7GA 5LA9A 4NIIA 3RZJA 3ZFFA 4DZGA 1IZ3A 5DAWA 3AFKA 3FHIB 2GDFA 4XMAA 4M4RA 1HN1A 4O9GA 3ZLIA 5CFDC 5JIUA 2A6YA 5FPZA 3JD71 4Z8BA 1NXD1 1O5UA 4DNYA 4Y22A 1LOCA 4AFAA 3PDQA 2W91A 4XJUA 1UX7A 1WCSA 4IGQA 2J1SA 4RGKA 1ZRRA 4QKFA 4XF0A 4WBBA 4BIOA 3OEBA 1QJY3 1RUNA 3O5SA 2XUEA 3GHNA 4DMIA 3V0AB 1REEA 3OBZA 3PURA 2A3XA 1MQTA 1QJY2 3FLRA 4K1ZA 3L9JT 5JI7A 5C8CA 3T0BA 1UY2A 5I0TA 1VMHA 1XB9A 4XACA 3R4DB 2VBBA 3OUJA 4P5YA 3RFRA 2XQRA 5AVAA 1DYKA 2JENA 4Y22B 4FAGA 1V9U3 4CYDA 3ELNA 1N1YA 1RUE2 5IWFA 4FTSA 3HVDA 2LUWA 4Q26A 2WNEA 2XBO2 1QHDA 1V9U2 3SEPA 3ZSLA 1UNBA 5D1IA 4FFGA 3S57A 2BNNA 4B1MA 3J7MA 5A3UA 2BNMA 5FY5A 3WDWA 3AP4A 1MQTB 4JGZB 4LJHA 1PNFA 5C8CB 1CZVA 1OD5A 3OBAA 5GZEA 2BFUL 1F9KA 4IEPA 1JODA 3KQRA 3D5OA 3AYEA 5B4NA 1AYM3 3NNLA 4FPOB 2V5DA 4GXLA 4PF1A 3VBRC 1F5FA 2BEOA 3JZVA 3EXUA 4LO6B 2WQZC 4MGZE 5E1RA 2WS91 1EPWA 4QWNA 4X6RB 4Y4RA 4E8CA 3RRDA 2FDKA 5L9VA 1ENSA 2HWD2 1AVBA 1LHOA 2YDEA 4AQ6A 4BCUA 4RQPA 5KC5A 1ODNA 1TMF2 1VBB3 5FMOS 4QPGA 2XGXA 2XJVA 5I8SA 3GZTB 4D7YA 1ZM1A 1QQP2 4HOOA 2PHDA 2W52A 4QM9A 2UY8A 4AEJA 4BB3A 2CDPA 4I30A 5DUXA 4XOGA 5EJ1B 1O5LA 1NQJA 2WBKA 1LENA 5EFUA 2CNAA 2JG9A 2KD7A 2H0BA 2HWF2 5LY1A 5DQ0A 5F2WA 1ASJ1 1JZ6A 5A7PA 3U4SA 4J25A 4V2VA 4S2FA 4LBMA 5HI0A 2VW1A 5FYSA 4RQPB 5FZ3A 3DYMA 5IVVA 1RJ8A 4QPGB 1E5HA 2D6KA 3HIFA 1DF0A 4CCDA 1HQNA 3SEEA 1STMA 1W06A 4GJYA 5T5OA 5FZ6A 3T0AA 4GWMA 5FJKA 1D4M3 3VZMA 4J6GA 5JOWA 1ZBA2 4QXCA 1IOAA 3VDCA 3KLSA 4LKDA 3VKNA 4FPFA 2WO1A 4GZ9A 2JG9B 2WUHA 1D4M2 4QB6A 3LOIA 3UKNA 5FWJA 1JZ7A 1RUI1 4Y5SA 1YHFA 2VTXA 4BM8A 1IKPA 1JYWA 3NW4A 1OSGA 3EMRA 1N1TA 2ORZA 2ZEWA 4CCEA 2ARXA 1S2BA 3MEPA 3LEMA 1W3VA 4N9IA 4OVEA 3O14A 2FMDA 2VQAA 4RGAA 1W6NA 1RMU3 3MFCA 4AI1A 5FBJA 3FLPA 1Z7S1 1UIJA 2FD8A 1CR7A 2BRTA 1RMU2 3R4UA 5LCWL 3O0VA 5F5AA 1ND2B 2GP3A 4OI2A 5LBBA 4BK4A 4HLTA 4Q8LA 5CVRA 1IQDC 3OPWA 2YPJA 1AR92 3CMGA 2FDHA 2QTWB 1RUJ3 4IEYA 2QZ3A 2PLV3 4CDUC 5DAXA 1FT9A 1JUIA 2XHKA 4I0AA 4C1XA 1UYYA 3BIEA 3E5QA 1FMD2 3RS6A 1RUJ2 2PLV2 5DG1A 5I8YA 4XUPA 1H8TC 4XXAA 1MZ5A 1VLNA 2W1WA 1W6NB 3C8XA 3UGGA 1W6QA 4NIAA 3QACA 5EJ3A 3PIGA 5T5JA 5ISLA 1EAH2 3H8OA 1Z7S3 2VOVA 3D6EA 4FPHA 1XE0A 1AL22 2W87A 5JIAA 2WNVC 2FZ2A 1OKQA 4A4AA 1WLDA 4I3PA 3VKOA 3PU8A 4D3WA 1WWYA 1DCSA 1D2SA 4QDQA 1GZ9A 4GA9A 3FC0A 1H4GA 4IEOA 3SCFA 1ULOA 4LBJA 5DUVA 1AR62 1PM7A 5F5IA 5IFTA 3LEGA 1LHVA 1A6CA 2JWPA 1PVC3 3WT3A 3LWCA 4LITA 3EJKA 1PO13 4A2UA 1G9AA 2QQIA 5ABJC 1PVC2 3IBMA 3PHMA 1QEXA 1PO12 4FT8A 1AXKA 5KBFA 3L2HA 3Q9OA 2ZHKA 2R041 4XHBA 1EP0A 5FP4A 2AREA 2OKXA 1UWWA 1I5ZA 1IS4A 4K40A 4IESA 2GC1A 2W0XA 1A8DA 4H7MA 4IEXA 4PHZA 1JOPA 2GU9A 3CDZB 3H9AA 5CKMA 3UKVA 1R64A 4P9YA 3K75B 1NCQC 4QU2A 5DG2A 2CGNA 4GQ7A 4F83A 1CWPA 2O0OA 3N9PA 5GZDA 5K7PA 5DMYA 2DDUA 2K9ZA 1NE6A 1ZRIA 4Q4W1 4QPIC 2DCZA 4QPYA 5CISA 5LRRA 2WZR3 1S0BA 3SH4A 3POSA 5JDBA 1W9TA 5CFCB 1N3QA 3SHRA 5A3LA 1NA1C 2DTWA 3IB3A 3SNMA 2R043 3OOXA 4QX5A 5FAXA 4FPKA 3NNFA 3QBQA 4CA9A 3LKJA 5HCBA 4UF0A 4MGIE 2JD9A 2WWUA 1FPN2 2WINB 5I8TA 4XUOA 2XJQA 2CY6A 3KCYA 3GCXA 4QX3A 1VBD1 4NJ4A 4DXSA 1JW6A 2BBVA 2JDUA 2RS53 2YBKA 4OUSA 2J1TA 3ETPA 4MOAA 3O1PA 1O3QA 2HYXA 1YIPA 2OIIA 5JSRA 2RS52 3A21A 5FMCA 2HBTA 1AJOA 2GALA 4JC1A 3W58A 4NOTA 1AZDA 4AHWA 1PO21 2YC0A 2E7AA 1L3JA 3IDEA 4UF0B 1YUDA 5FJHA 3EQEA 3VBUC 2ZGQA 5FMOL 5I0UA 5JMOA 3LB9A 1LTEA 3WW4A 2C24A 4MYEA 2NN8A 4CEWA 1B35B 1VBD3 2ZX2A 3ON7A 4M0NA 4XUQA 1SACA 4RR3A 5A33A 5C3OA 1LHNA 2A6WA 4XIKA 4QMAA 3LIGA 3NNGA 1LOFC 1DGWA 5FZKA 4BQWA 2QQVA 2VPVA 2I07B 1POV0 2JDHA 4TTGA 1PO23 2PHLA 1Y9MA 2YU1A 3ES4A 1OFNA 2GSYA 3B9IA 4ASLA 5FZBA 3SMHA 4EROA 3SC7X 3ILRA 1WLTA 1J58A 2CTVA 4BLIA 4CEWB 5FP7A 2WNUA 2Q8OA 2WN2A 4AEKA 4RR3B 1JU3A 4LOTA 2DCYA 5A33B 2XJRA 3WQ7A 5F5CA 1S0IA 3ZXKA 2B39A 1SFNA 4QHOA 2Y6LA 2HYKA 1WBLA 2YROA 4DY5A 2K2SA 4HZFA 3MIDA 2VMGA 4H14A 3E1F1 5FPLA 2Y6HA 4XQWA 5FV3A 2B8MA 2OW4A 1VRH2 1LCLA 3AMHA 5JMCA 3FHQA 4QGNA 5GZFA 3ZN5A 1S0GA 4AVAA 2P4EA 5FZLA 1H2LA 2WNUB 4DEVA 3IIIA 4JTOA 5I0RA 4J1WA 5FYIA 4IL7A 5IVJA 1XE7A 4M00A 2JICA 4CUBA 3CBNA 3WG2A 1F35A 3MDPA 3AVSA 2D6MA 2BGPA 4KG0A 2YHJA 4LULA 3TN92 2NP0A 1OURA 3N4MA 3VD5A 2ZS6B 2X53S 1RHI3 4KG8A 2FZ1A 5FKBA 4C91A 1H2MA 2XLGA 2XR4A 5F5QA 3I8TA 1RHI2 3VKMA 3ZFGA 1Z0HA 4HANA 5EJZB 2XH6A 2R0HA 3FBMA 4W65A 5J98B 3VBFC 1HRV1 4LA2A 5IUQA 2JDAA 3ACLA 1LEMA 1RUC2 2VTFA 4OZOA 2YFZA 3ZN4A 4P9IA 3H3LA 4IV3A 3KV6A 2WFF2 1JYIA 4GB31 3IAQA 4EN7B 4JHZA 2WFPA 1BZWA 1KEXA 5EYYA 2ZX1A 5A7NA 3ZFGB 2AR6A 1IHMA 1CX1A 3N7LA 3TWIA 3NAPC 3ZKUA 3CQOA 1PGSA 4R4XA 4XAAA 5FZIA 4CDXA 3AFGA 5A3WA 2VR4A 4LUKA 5GLTA 2XJTA 5HV0A 3MPPG 5DAQA 1K3IA 1EPZA 4A3XA 5J3UA 1JZ2A 4P08A 2RVAA 1QF3A 5IHRA 1V6LA 2WSVA 1AR83 4KWLA 2B5HA 3I3QA 5GLUA 1HQLA 1WKYA 1QJX2 4XCBA 4UT5A 3VDDC 5GJ6A 4Y3OA 2Q1MA 4IERA 2A6VA 3EYPA 1AR82 3JBG3 2DFBA 4DPNA 1MS1A 3VUOA 2ZZQA 3D0JA 1UYPA 2YBSA 3WG3A 1IQAA 1PGW1 3JBG2 3K46A 4QX8A 5CNAA 2DTYA 4CDXB 5FYBA 4GH4A 2A3WA 4HFSA 2VZSA 4CP2A 1US3A 5EQUA 3DPRC 4QXBA 3WZ1A 3W5MA 2BPA2 3DKQA 5JCTA 1GNYA 1R1A2 1ULDA 3S7EA 3X29B 5FK8A 5ACA2 5GZCA 1YNAA 4GWNA 3DECA 1E57A 2QQNA 2Z4FA 5GLWA 5C7GA 1WA4A 4N43C 5K4LA 3WDTA 2YPDA 4OULA 5GLZA 3VD3A 4AVTA 1HIXA 2A3YA 2ZXQA 1RUOA 4CU7A 5E6HA 3TEWA 4FOQA 4EN0A 2DU0A 3K4ZA 5T3NA 4BK5A 4GH4B 4PBPA 5BNQA 2DVFA 2MEV2 1IKQA 1AR73 3ENRA 4Q5OA 3KV9A 1ULEA 5LBFA 2OUJA 3IZOA 2PHTA 5L36A 3BU0A 1AR72 5BNNA 2VMCA 3RWNA 2CL2A 1UU4A 4RS5C 4Z07A 1V70A 4FXKB 4M3CF 4QHBA 2WC2A 1ENXA 1POV3 3RZHA 2EIEA 5FZAA 1POQA 4AI8A 2E26A 2JKXA 1MS0A 2WWJA 3ZSEA 2ZGKA 2ORXA 4DXTA 2D6PA 2PHRA 4WM8A 3THPA 3M2MA 4OLLA 4Y1ZA 1H9WA 4LBLA 5SV8A 5BNNB 2D6LX 2GMPA 1DGRA 3WF2A 5C70A 2QQKA 1YQ2A 2XHNA 1WMXA 4P14A 3WNLA 3ABZA 4XF9A 2NQYA 1E5RA 4U36A 1LECA 1QJFA 2W5FA 3R0RA 4P5HA 2VNGA 4FSJA 1NE4A 1RUF2 1H6XA 2O8OA 2WT1A 2VMHA 2Y26A 4IV1A 2ZJCA 3O1OA 3H50A 1A8MA 1F31A 1NLSA 4AE2A 2LROA 2JD4A 5G04L 4JVAA 1K5MC 1OMIA 2ZACA 2HWB1 3I49A 4W6XA 1ZX5A 1RINA 2B42B 3NWKA 1U5XA 4WM8B 2VZQA 3NL1A 4WZCA 1UU6A 2BTVC 2D43A 1O6UA 1CN1A 3C7GA 5LATA 2ZCWA 1WW4A 4JQRA 1UKRA 1DBNA 1BVVA 1HKDA 2JDMA 5FPVA 3ZR5A 3C7EA 4U2AA 5IVBA 1HJGA 4DUVA 1CJPA 1LU2A 1VBA2 1FNZA 1RUD2 2UWBA 4IV1B 1KXGA 4YYOA 3SXWA 3JUUA 3RMXA 4MVTA 1RGSA 3NO8A 1OF4A 4RFRB 3SITA 2HWB3 3AJZA 1VIWB 1WMDA 2IXJA 2X5IC 2P3KA 2GH8A 3LDBA 4N53A 5DPNA 4AK3A 4D6QA 1UX6A 1VB2A 1W99A 3HNMA 4B7KA 3VBSA 5JZGA 5A1AA 2Q30A 2A7AA 3O7OA 1O7FA 1C4RA 1SFPA 2V73A 4NRMA 5B4XA 3LEIA 3BTAA 4I01A 1C8M1 1KD7A 4JDMA 5CG9A 4NHYA 3KV4A 1WLCA 2A73B 4BH9A 4FI9A 3HQXA 1QJU2 2KXLA 1PK6C 2Y8KA 3H7YA 3RYKA 4PT6A 3WP4A 1S0JA 5EIYB 3I54A 4Z82A 5DUWA 4ZZ5A 4ZONA 4NRPA 5IJRA 2UWAA 3MUY1 4NHMA 4D6SA 5H9QA 3ZSKA 2YYOA 3AKRA 5CADA 2YC4A 2X05A 4CE8A 1YLLA 2PN5A 4N53B 3OGGA 1DQ5A 3RZLA 2VU9A 2VCCA 5JZGB 3VBSB 5IK5A 4MGKE 3GM8A 5IVCA 4COYA 4NHXA 5FUIA 1COV3 4B3NA 1VE0A 1UOFA 3AL6A 1TNFA 1VRBA 4QU1A 5FP9A 1GV9A 1HXS2 2XWBB 2DBNA 4CP9B 4META 1COV2 1JHNA 3LQCA 1CAWA 4XBQA 1YYNA 4JCKA 2HEWF 1DIWA 2VQTA 2VZTA 2ZGRA 3ZX7A 1AX1A 4NR1A 1T2XA 3ACGA 3RG0A 2GMMA 2D97A 5LRSA 2WDBA 2YUEA 3FWEA 3J8F2 1S0EA 1FV2A 2PELA 4YRDA 3KCCA 4F3JA 3T4HB 4R52A 4JV4A 1VMJA 3AP7A 1R1ZA 4OYUA 1C1FA 1OC1A 2CWMA 4H7LA 4IGOA 4CUCA 4YFWA 1BEV1 3I2JA 3AMQA 4RA0A 3S7IA 3WP3A 1PIV1 2H6CA 1OPMA 1CAWB 1VALA 1AXYA 4HKLA 4P02B 4XTMA 2E7QA 1UOGA 4NMIA 4JGYC 5FQ0A 1W0OA 1W8ZA 1GOHA 3P1IA 5FYZA 4TSVA 2OT7A 3RZGA 5FKCA 2WO7A 4MHRA 1O8SA 3ACHA 5I0DA 2PAKA 3DV8A 4GMP0 1PNGA 5BXXA 2HJIA 3ZDVA 4Q4Y3 4GULA 5K0UA 4E27A 4E4SA 5A3MA 4KQ7A 2EXJA 4AHZA 1J1TA 4DQAA 3AZVA 2PTMA 3LEKA 1XC6A 4LEJA 4OMCA 4Q4Y2 3WNKA 1G7YA 2OQ7A 4JKMA 3W21A 4AI0A 5KR7A 3OUHA 2D44A 4NWVA 5CG8A 5FUNA 3URFA 5FQ0B 1UMIA 5F6KA 1RUH2 3DL3A 4L11A 1VR3A 3ZPOA 3O1RA 5KHGA 1HQWA 1TQ5A 1JYXA 1FX5A 4P9WA 1UW8A 3AC0A 4BOWA 1BLZA 2R062 3JXSA 1D0HA 3POYA 5BNOA 5A80A 2P6HA 1F2NA 2EAAA 3VD4A 5CYYA 1Q56A 2PHFA 5DAPA 5HCFA 2BERA 2WQ8A 5T52A 2KM2A 4BWOA 4Q4V1 3NNJA 2Z69A 4N9HA 3ZFEC 1NXMA 5CB7A 4A7YA 4YNIA 3L2YA 2VZPA 4GKYA 4ORFA 2RDNA 4QD2A 4YW5A 1QDOA 4HBNA 1D2QA 2GAUA 2DVGA 3USUA 4A3ZA 5C5TA 4YFZA 2VO5A 4I02A 5L7OC 1AYN3 5KHHA 2ERFA 5BNOB 1O91A 1YJLA 2AZ5A 3BODA 3MICA 3OPZA 4XMIA 3UJOA 1KS5A 3ZYBA 5IK8A 4LIUA 1S0FA 4OHZA 3O1UA 2OA2A 1GP6A 1FOD3 1TVGA 4LE4A 4P9GA 4SLIA 1ZZBA 2J1AA 4PBOA 4OQ8A 4Q4V3 4LPLA 5GM0A 5JPNB 1JU4A 3E6BA 5CFDA 2V09A 3WDUA 5FZHA 1QJY1 5I93A 4D7TA 2GZWA 1OKOA 3AP9A 1TME2 3USUB 4K1YA 5IVFA 2VOKA 1YJKA 4ISQA 5IK7A 2PAMA 5FZMA 1JYCA 4Y4YA 3AM2A 4AEDC 1SQ4A 3PL0A 1S4CA 2YZ4A 4MGSA 5JLVA 1V6MA 1DLLA 1RUE1 2V5YA 1WBFA 1Q8SA 1QKQA 4UBGA 1VMFA 1ND3C 2NZ9A 1X8MA 1V9U1 2JJ6A 2VTXJ 1DQ0A 3H1MA 1RITA 3PNAA 5D8AC 2VL4A 5GKAC 2EALA 2WAOA 5AC92 4B4PA 4BMEA 5CFDB 3WDYA 2RJLA 3UV9A 3J7NA 2JIGA 3WG4A 3J9SA 5JXHA 2VMDA 2JX9A 1OQDA 4M4PA 4R9CA 3WF1A 2P17A 1Y4WA 2PHWA 4AG4A 4AQTA 3DYPA 4IETA 1UN1A 3AXEA 4KH9A 4LLFA 3NKTA 4QKDA 4YG3A 3ZFFB 3ZDSA 5KHKA 4HVRA 1BK1A 4CU8A 1AYM1 3T09A 1NZIA 5GLVA 4CXYA 1XU2A 1RUE3 5FXWA 4XF3A 4K7JA 3KB5A 5B2GB 3NJYA 1ZZCA 2XBO3 5A1FA 4NN0A 1UY4A 1RVF2 1TMF1 2ETEA 2QQJA 4HK9A 4XJ8A 2UURA 3V64A 3ZSJA 4PIYA 1W8WA 4LE3A 1VBB1 3VBRA 2VZ1A 1H9PA 1NLRA 4RD7A 3RDIA 4WVZA 4CDWC 4Q2FA 4LO8A 2J7MA 4J1XA 1N1VA 4DUWA 5T5LA 4KGGA 3I2HA 2HWF1 5H9SA 4CPBA 5FZ8A 2XL9A 1HB1A 3PTRB 4IE0A 2LRPA 4I0WB 2VVEA 2VCMA 4BXSV 1G9DA 5FPAA 4LK6A 3LDKA 3HN3A 2HWD3 1MVQA 2GNMA 1TMF3 4DRVA 3JD72 4JGZC 4OCTA 1QQP3 3HD8B 3PVBB 3VBRB 5CIRA 3ECQA 1SZBA 1WW7A 1LHUA 1ZBA1 1ODMA 2W3JA 2VOXA 2QBXA 3D4KA 3KM5A 2O1QA 1O8PA 2VOWA 5F8PA 2Q8CA 5I0SA 5FY9A 1D4M1 4GKXA 5TSWA 2HWF3 4DOUA 3S5QA 2XKPA 2BZDA 2JXAA 3OGVA 4XJWA 1TEIA 1PGL2 1W8HA 4KL1A 3OTFA 2XUMA 2QDNA 2BJSA 2EF6A 1OQEA 1OI6A 4AFCA 1UXZA 2JDZA 3W20A 4TLFA 1PMIA 4V2WA 5DZEA 5FY8A 3ZIWA 3RZMA 2J42A 1O4ZA 1XQNA 4GMP3 1EYBA 2YGLA 5FZ7A 4GD4A 5BYNA 1ZBA3 4L92A 2YG0A 1RMU1 3T2TA 1IPKA 2NYYA 2W46A 3O0XA 3VZOA 2DURA 1LAJA 4QX1A 1JBCA 1RL3A 1JYVA 1QH7A 4AEMA 2FCUA 1Z78A 4AR2A 5FUPA 3ZVXA 2IFWA 4UW5A 3TNQA 2BVVA 4XFIA 1UYZA 4LORA 5JOXA 1FMD1 4KBZA 5K8SA 1MACA 1J1LA 1RUJ1 2PLV1 3OG2A 4XUTA 1URXA 2HWE2 1KDKA 3MZHA 3THTA 4N7IA 4DO0A 3O1VA 4FQZA 3U37A 1J3PA 2WIIB 3RJ2X 2BP6A 2OPKA 2XVGA 3OGRA 1OVSA 1EAH1 3P3PA 1HB4A 3KMHA 4CDUA 1AL21 3ZPYA 4Y20A 1R092 4PF5A 2VGDA 4AFMA 1Q5OA 4INDA 4UW4A 2CHHA 3IAPA 1N3PA 1YFXA 4QHZA 1AL0G 1H8TA 2TUNA 1AR93 1AR61 1H30A 4E2SA 1CX4A 1MS5A 1UMHA 4IDZA 5FXZA 2V4VA 1FMD3 4AI3A 2QQLA 4XJZA 4P00B 4PLOA 2EA7A 2FDJA 2WNVA 4XTPA 1S55A 1CZTA 1PVC1 4QT6A 5FYTA 3MI8A 4WVWA 4F8AA 3VHPA 1PO11 3DF0A 1EAH3 1ND2C 4CDUB 1W9YA 1L7RA 3OBTA 1AL23 1OPOA 1DYPA 4Y20B 5A7QA 4PDWC 2EAKA 1NUKA 2Y33A 5SV5A 3PVNA 2J1EA 3A23A 1H8TB 3OUIA 3B00A 1AR63 5ABJA 5EPAA 3MIGA 3H8RA 5FYCA 1JHJA 2OUHA 1RUI2 2F17A 2GNBA 4YVWC 3WX5A 2WNVB 1QJZA 3LOBA 1SCRA 3N9OA 2RS13 2VXJA 2VW2A 4XZUG 3DYOA 4R9DA 4JX0A 1NY72 2PMWB 3R4SA 2WZR1 3HT1A 2RS12 1W6QB 1NCQA 2NMNA 3MIEA 4HN0A 4OHXA 4YW6A 1QNYA 3CJXA 3KV5A 2YV8A 4XEZA 3ZYHA 4BPZA 1OVPA 2UU8A 4Y26A 4QPIA 2E7TA 1FPN1 4A6OA 4TZDA 1DLCA 1BK0A 2TNFA 2FBEA 4XF4A 4ZU4A 2VCAA 4XW3A 5FFOC 3T08A 3SISA 1JS9A 4MZUA 5CEHA 1NA1A 1JMUB 1WW5A 2W68A 3H3UA 4PJYA 2IFRA 4PCRA 3ZXFA 5FDBA 3D0SA 2IZWA 3KCXA 3U10A 2RS51 3AMNA 2A71A 3BGAA 3KD4A 1H0BA 3H7JA 4NPLA 4NPRA 4ZU7A 1NCQB 1SBFA 2R49A 2RMU3 2VG9A 5F39A 3WLUA 2ZMLA 5KWRA 1ULFA 2RMU2 1XNAA 3B7MA 4QPIB 1FPN3 1BMV2 3RZZA 2QDRA 4OHWA 2C9KA 1ZNPA 2DYCA 3IPVA 4FOWA 4YGDA 4D69A 5LEKA 1NA1B 1DZQA 2R7EB 3POBA 4L97A 4Q4X3 3ASIA 5CFCC 2VVFA 1W28A 1ZRCA 4MXWA 5IAXA 1PMHX 1YFWA 2AH2A 4EZHA 3NRUA 4Q4X2 3M3IA 1AHSA 2QZ2A 2NLRA 3VBUA 2CSGA 3BN6A 2XDVA 3HT2A 4W6YA 5CKQA 4YM2A 1Q3EA 3WCSA 4K9SA 4XPVA 3NJXA 4QM8A 3CLPA 4CCJA 4ES8A 1R083 1LOFA 1GWKA 1LJ7A 3IPVB 4AXOA 1DQ2A 3CJIC 5KHJA 1XNCA 1UF2C 3U0ZA 3ZYFA 1R082 1BHGA 4CPBD 3HAGA 2ARBA 5FY1A 3GZAA 4XF1A 1UY1A 2DV9A 2ZEXA 2RDQA 1WMEA 3E97A 2LS6A 5C4WC 3VBUB 2XVKA 3LAGA 5LBCA 1GOGA 1G9BA 2A1XA 1ALYA 1O3TA 2RR12 3C7OA 2D3SA 2WJSA 3VBOC 4XDPA 3ZXJA 2B46X 2X29A 3RZKA 2IVIB 3M3EA 1VRH1 2ZKLA 2WZ8A 5FPXA 1O3RA 3GBWA 1B35C 1J83A 2A6ZA 3LIHA 3AKSA 2WRAA 1UAIA 2E63A 3CU7A 2CU5A 2SBAA 4IEVA 4CU9A 3UNPA 1RXGA 2W9XA 4EWEA 2QUOA 1DU3D 2MNGA 1OH4A 1D7PM 5FY0A 5A6QA 5A6XA 4YZ2A 1BJQA 3TYJA 3G7DA 5FR3A 4AF9A 3RSJA 2IC1A 2PA7A 4FPLA 5LWBA 2Y0IA 1A3KA 1YC61 3WW2A 4EN6B 3D82A 3TN91 5C8WA 1VRH3 1AF9A 1ZZ9A 3NV3A 2A5ZA 2GC0A 2VXRA 3IKWA 2CGOA 3K3OA 2XL7A 3WR0A 3NV1A 1QNWA 2EIGA 1RHI1 2C6SA 2HLEA 1Q8QA 2YU2A 3NNMA 1NT0A 1US2A 2WZPP 3ZYIB 3E5UA 2EXKA 1C57A 5JR7B 1GU3A 2VJXA 5F6LB 4IEQA 1KFXL 5ERLA 3U75A 2W94A 1JTZX 1RUC1 5BUVA 4A44A 1MEC2 3KT1A 4CRQA 3AP5A 1RUG2 1DZTA 2D6OX 1Q8VA 1UOBA 3CHXA 5T5PA 4XDQA 2EXIA 3J7LA 1WUVA 3OSDA 3TN93 5LZ6A 3RYPA 2WFF1 2G9FA 2WL1A 4QGLA 4N90A 3VBFA 1DG6A 3WY6A 5IATA 3LZZA 1VBE2 4ZY9A 3ZKYA 5JSOA 4KWKA 4EQVA 3LPGA 5FZCA 3BPSA 3KT7A 2YMZA 1QY4A 1CD3G 4QDSA 3J26N 2V4AA 2P2KA 4OZXA 2MPFA 4UOJA 1C3HA 3ZR6A 5A1LA 2AEYA 4XJ9A 5EZWA 3UT0A 1VP6A 4M3CE 5APAA 4A42A 2FMYA 4FXGB 1RUC3 3F95A 1W8NA 3BB6A 2ZGMA 2WR9A 2E9QA 4KU7A 1NZCA 2WFF3 1HN0A 1GZCA 3LFIA 3NAPA 1QJX1 3ZMNA 3VBFB 3ES1A 4IEUA 1NCRC 2P3YA 1OOPC 1AR81 1K12A 2ZGSA 4PLMA 4CCOA 5HBAA 4LKSA 1YO8A 2W1SA 1O4YA 4MV2A 3JBG1 4XFGA 3A0KA 2BNOA 4Q0PA 3I3BA 3LSEA 4HKOA 1F4AA 1ZBE2 5JR2A 3VDDA 2BBAA 2TBVA 2VQUA 1R1A1 5ACA1 5JXIA 5F2SA 1XYOA 2RHPA 1T6BX 4CCKA 1QJX3 2C26A 1HLCA 4IV3B 2BV4A 3FBYA 1W0PA 2FCVA 3DPRA 3N9NA 1CPMA 4CSWA 4CDQC 4I3GA 4LUMA 4E2QA 1WLWA 3B9CA 4Z1VA 3ZXDA 3PLQA 3VBHC 1IG0A 3GZUC 3SLIA 3K77A 3DXTA 3MO4A 2VUAA 3PVOA 2MEV1 1QOOA 1G9CA 2Q4SA 3VDDB 3KGLA 1REDA 4N43A 5C9AC 4AFBA 5A70A 1EUUA 1R1A3 3Q8AA 5ACA3 1AR71 4Y5Z0 5FYUA 5FXVA 2GC2A 2O8QA 3UGHA 1HRV2 4NUBA 2ZABA 1BBT3 5LY2A 5LK7B 3PUIA 1GLHA 4Q0VA 1Q43A 4UW3A 4KGQA 2DVAA 4PLNA 2G4IA 1BBT2 1LOAA 2O14A 2DCJA 3B5LB 1NLQA 3WINE 3IMNA 1POV1 4SBVA 4B1LA 2WKKA 3PUAA 2XQXA 1VBC3 3F2ZA 4ZU5A 1PX4A 4QQ2A 5FPBA 3FFZA 2PQQA 1XSRA 4RS5A 4ZXEA 2UYAA 5L9RA 2MEV3 5FOJB 2R1DA 5EV7A 3UYJA 4N43B 1VBC2 1ZZ6A 4X8PA 5A32A 3KWVA 2J22A 3GBGA 1UOJA 5JXJA 2NM1A 3BOWA 2Q0AA 4S2GA 2VMEA 2XLAA 2Y34A 5J36A 1JZ5A 3W5NA 3MLLA 3I3DA 3ZSMA 3NSTA 1RUF1 1W2OA 4LHNA 1CIWA 1RTVA 2RJKA 2WLQA 4XAEA 1DZRA 4CCCA 3EHKA 4Y1YA 2Y60A 1KJLA 1E5SA 4QB1A 1DYOA 3RJRA 1WD3A 1M4WA 1LKNA 5M0TA 4L8QA 5A32B 1W2UA 4QDRA 4LA3A 1PGW2 4KMQA 2VNRA 1QXRA 4S2DA 2WA3A 1W9FA 1X82A 4B4QA 3MGUA 4C1WA 4CUAA 1V6KA 2RS32 5LA2A 1K5MA 3CIHA 1LOEA 4Y24A 5LBEA 1VBA1 1RUF3 4PQQA 5C6CA 3RI9A 1UQXA 4CDXC 2EVXA 2EIBA 4AFDA 5JOZA 3HNYM 1NKGA 3I2KA 2HWC2 3PVEA 4IW3A 1K45A 1BQPA 3AB0A 4C90A 4M01A 2FCTA 2ZMNA 2OQ6A 3EO6A 1OQ1A 4CXWA 1PM4A 4P9JA 2XMLA 3VV1A 1CAUA 3ZXGA 4FAHA 2Q1ZB 3JU9A 3ZN6A 1GSLA 1K5MB 1ENRA 1QJU1 2X5IA 4O61A 5DN2A 1HRI2 1S1AA 1VBA3 1GMMA 1RUD3 2TEPA 1CAVA 1OA2A 4KNCA 5E16A 5FZ0A 4IQPA 4D0QA 2BGCA 1JN2P 2JIJA 2R30A 3DGTA 1G6NA 2H6BA 1UXXX 2W92A 1TG7A 1CJDA 3MFAA 4XQ4A 1XBFA 3I3EA 2D5HA 5BNPC 3APBA 1PK6A 1YI7A 3WW3A 2ZHLA 1CAUB 4FPEA 3HBKA 1X9TA 3RGBA 3I59A 4TLGA 3O0WA 3ZN6B 2HKXA 5H9RA 2JE9A 4B4RA 5JI9A 3WP6A 2QFEA 1COV1 1QJU3 1H2NA 2X5IB 2P3JA 2GH2A 1CAVB 2YXSA 3A4UA 1SLIA 4BJ0A 2BWAA 3T2PA 3POJA 3AMMA 4YLZA 5D2AA 1X36A 2ZBJA 4MHUA 4UXAA 2IVJA 1MS3A 2B4KA 2SLIA 2Z79A 1WCUA 3HN1A 3J8F1 4XE9A 3TAYA 4XABA 4DFSA 1HV0A 2VD7A 4XETA 2WO3A 3CL1A 1PK6B 3VHNA 4Z92B 3CNAA 5FOBB 3MF6A 3TEZA 1HB2A 2PHUA 1SDWA 3I59B 4QGMA 1QMJA 1XJAA 5HXVA 3TB0A 3H8UA 1XNTA 3WEZA 3S0MA 1E5IA 1A34A 1HXS3 2ZPXA 4HPKA 1SLBA 4RHV3 5CU1A 1UZYA 3MV11 4Q1RA 1GOFA 2XOMA 2R0FA 4RHV2 4E2GA 1YQ8A 1SLTA 1DQ6A 4Q29A 4AGVA 1MS4A 2BWCA 2D3PA 3J8F3 2D6NA 4NRQA 4YVSC 3OPTA 4AVVA 3RWKX 4EN9B 5LA0A 5A7SA 4ATFA 4UFMA 2QE3A 3KGZA 3WQ1A 4JGYA 4FFFA 3ACFA 5FY4A 3NVCA 4W6WA 3H0OA 1CONA 3HQUA 4HPKB 4TN7A 4YZ3A 4XBNA 4Q4Y1 5LEJA 3I7DA 4ASKA 3ETQA 2Y0OA 5J09A 5FRAA 2KR2A 4D6RA 1C8M2 2Z42A 1YRZA 2ZZJA 1A78A 3IM0A 4FQ4A 1O3SA 4LHKA 1CVNA 2RV9A 5E8AA 4E4HA 3AKQA 3KHBA 3POEA 4BQ1A 4WZFA 3O1TA 4WM7C 5JPMB 1U5IA 3QCWA 4AI9A 2FDIA 2JKBA 3WNNA 4ZXKA 1MR5A 5FZFA 4LO4B 4URTA 3ATGA 1LGBA 1OF3A 1UL9A 3HOBA 3MUZ1 4JKKA 4MH0E 4QX0A 4D8MA 1ZRFA 2ZEZA 3MIBA 1CZSA 2VZVA 4FCAA 3K48A 5KXEA 3GYDA 3E5XA 4ZKTB 1CESA 4PIXA 2C9AA 1HX6A 1QXJA 1W05A 3WV6A 3T30A 2GC3A 3CZUA 1RUH3 3NJZA 4Q1PA 4BZ4A 2ZX3A 3WG1A 4MADA 4QB2A 2GNTA 2VMFA 2VAUA 1FV3A 3B93A 2J1RA 4NHKA 2R063 4JQTA 3ROUA 1QJEA 4CEYC 4LHLA 4FPCA 3ZFEA 1AYN1 3HQRA 2D93A 1EV13 1ONAA 5K0UB 4HXCA 1NX9A 4BLJA 2VVDA 3N36A 2QQWA 4LBQD 4Q27A 4DRRA 1EV12 1FOD1 1LHWA 5IFPA 2JG8C 3T2OA 4KWJA 1AXZA 2P1BA 5FCCA 3ZM8A 5L7OA 4DEQA 1PIV2 3NQHA 4H2AA 2CV6A 1YWKA 3WOGA 4UFKA 2OZJA 1TME1 2RDRA 1UCXA 2GN3A 4MG2A 3O1SA 1JYTA 4FTBA 3T3YA 4BE3A 1S2KA 2D40A 4NAOA 3WF0A 2RE9A 1UY3A 3WHTA 4CU6A 3U4XA 2FDGA 1WZXA 3HR9A 3ZFEB 2W2IA 4LHSA 5J48A 4COUA 4TWTA 4YW4A 1V6NA 2YB7A 3QLQA 4UAPA 3VZNA 5FYHA 1SBDA 5KC6A 1M06G 4MX3A 2YBPA 5AC91 4XJAA 3OCPA 4AEDA 3A22A 5F3CA 3GJAA 3NMBA 1OA3A 5F32A 2E32A 3IDBB 3ZXEA 2BDRA 3MYXA 4K20A 2XLFA 5FY7A 1TME3 3WD5A 1WGPA 5IK4A 3N35A 1ND3A 5D8AA 4AVCA 1TNRA 1ZA4A 4FTEA 2ZGPA 3TRSB 1L7QA 2XKOA 1MZFA 1YIFA 4YW1A 3R6SA 1WCQA 1RVF1 3BYWA 5FMDA 1ZRDA 1G9FA 1X8EA 1F15A 3OY8A 3VL8A 4HL0A 2XBO1 2JDKA 4M3CA 5AC93 2HEVF 5FBZA 4AEDB 2I2SA 1AX0A
chains in the Genus database with same CATH topology
3UL2A 2XJSA 2QNKA 1C1LA 2R073 1ND3B 2Z5WA 3J4UH 5T50A 1YCIA 2EXHA 2VQ0A 2R072 3AXDA 5DDJ3 3AJYA 3OBRA 1AX2A 4D94A 2E51A 4PIZA 1W6OA 5DDJ2 1J59A 1VAMA 4CDWA 1RVF3 3OY8B 4M3CB 3M8LA 5T55A 2AGSA 2HWD1 1N3OA 4YZ4A 1UPIA 1ZZ7A 1XYNA 1QQP1 3ZFFC 1SBEA 1AUYA 1SCSA 4KBBA 2RM23 2VULA 1BYHA 1DGLA 1DDLA 2BW8A 3KZ4C 4JGZA 3V0BA 5DXDA 3O12A 1LULA 1PGL1 2RM22 1W6OB 1QU0A 3GF6A 3RI8A 4CDWB 1S0DA 2ZGUA 4QXKA 2A70A 3JD73 3S30A 2IXHA 3T1MA 5JSPA 1XNDA 4I0BA 3RMYA 4OHVA 1WW6A 1MQTC 2ZTNA 3INAA 5C8CC 4GMP1 5LK5A 3ZYJB 3W59A 3MW3A 3V0BB 1KJRA 2ZGTA 4HN1A 4G4FA 4I2OA 1SLLA 3IT8A 1OHFA 2R32A 3RYRA 1V6IA 2DVDA 3JB4C 4NHLA 4JTNA 4XFFA 1J3QA 2HWE1 1LU1A 1AYM2 1VJ2A 3S6PA 5FLHA 5AFBA 4E4ZA 3AMPA 3BPZA 5J7MA 3B01A 3M70A 4XFHA 1R091 4BIFA 1GICA 2B9UA 3RNSA 3QH6A 1VBB2 2ATFA 1YI9A 1Y9QA 2C0ZA 4AVSA 3MIFA 1AR91 3FLTA 4CP0A 4RQPC 4RFT0 3WXPA 4QPGC 2HWE3 5FLJA 4F7ZA 4D7SA 2WS93 4AVBA 2UWCA 4QQHA 4WVMA 1DQ4A 1RC6A 4R9BA 3WW1A 2WS92 1FAYA 4AQ2A 3JQXA 1EY2A 1R093 2AYHA 2VW0A 3M3CA 2JG9C 3N7JA 3VN4A 4OHYA 1CAXA 4FP2A 4YG6A 1YFUA 3MLKA 2VY0A 3UKTA 4B8EA 4MLOA 3I2DA 4JRLA 4C0HA 1QOSA 4HMZA 4IXLA 1LOGA 4B29A 1ND2A 1ASJ3 1S0CA 4PDWA 4WVVA 4WVMB 4H3WA 3SCHA 3V65A 4P9XA 1ASJ2 4XFAA 3AKPA 3DKWA 1NY71 4AW7A 2RS11 3PJYA 4ES9A 1WCKA 5JOYA 1CAXB 4YVWA 2ZMKA 1B09A 1YXWA 4CTEA 4COVA 2QCSB 2XVLA 1RUI3 4YGBA 1VAVA 4PDWB 2ZA9A 1V6OA 4LTAA 1XE8A 5JAXA 4Q0UA 4LBOA 4HSLA 3MW2A 4NWWA 2LM3A 4YARA 3CO2A 4Y1UA 5C33A 4YVWB 2RMU1 1BMV1 2AENA 4RL7A 4OI0A 3AYDA 2CYFA 4ISRA 1JUHA 5ABJB 1X7NA 4OFGA 1GQGA 1Z7S2 4JAAA 5DZFA 4B7EA 1H4HA 2DUPA 4Q4X1 2DU1A 5FREA 1QWRA 3B69A 1UZZA 1XNBA 3WHUA 4A7KA 2UY9A 1I3HA 4DINB 4ATEA 5CFCA 2XJPA 3POWA 3B94A 1SMVA 3M4FA 4HETA 4K21A 2E6VA 4ITCA 1R081 3ME2A 5EWSA 3E6DA 5BY5A 4ONUA 4FPJA 3MIHA 2VNOA 5K9YA 2XG3A 1GYKA 4UBHA 1GBGA 3PTYA 2DWRA 4MUVA 4DXZA 5L73A 1H8VA 2RR11 3CJIA 2XPJA 3OD0A 4JDNA 4EV0A 2OVUA 3HMYA 4MXVA 1DHKB 1PVXA 2NPIA 5GALA 2WZR2 5C4WA 4G9SB 3UJQA 4KU8A 3V56A 3KSCA 4YGCA 2R042 4FOVA 3VZKA 5BPXA 2BUKA 1DFQA 2ZX0A 2JE7A 4MXWB 1KDMA 3R05A 3GHMA 3FZ3A 1B35A 3FUOA 3H1WA 4XIOA 1D0GA 4Q4W3 3CJIB 2RR13 3B3QE 2VH9A 4HKWA 2ZGNA 5KXBA 4Q4W2 1F8VA 3ZIXA 4N7UA 1PZ9A 5C4WB 2WT0A 1JOJA 3NKGA 1BXHA 1IPJA 3BIWE 4LO7A 4YM3A 5CAZA 3K51A 1BCXA 1LB2A 4COZA 4XILA 4L99A 1XRUA 1GKBA 1ENQA 2B7YA 3OGJA 4EN8B 1W6PA 1MEC1 5IT6A 1VBD2 1RUG1 4XZPA 4MGYE 4YM1A 3WUCA 1UKGA 1J3RA 1IGOA 1LGNA 2K0GA 4OI4A 1GQHA 2A6XA 1CGPA 2ILMA 4YSFA 1TE1B 1N1SA 3NV4A 4G3YC 2DVBA 1U5ZA 4C0BA 4XQDA 4CEWC 1VBE1 3A0NA 2DUOA 4RR3C 4X6QB 1PO22 5EXOA 1QDCA 3LA2A 1UPSA 3UK9A 3VKFC 4NO4A 2R1BA 1O4TA 1OFSA 4I09A 5BV6A 2FHRA 1NQDA 2Q5TA 3M7AA 4YW2A 1W6PB 1MEC3 1I1EA 1RUG3 1X33A 3B02A 3AX4A 2QJVA 2VUJA 1Q8OA 2PAEA 3QOPA 3M3OA 5E89A 3KS7A 3U07A 5KC6A 2WNUC 1VBE3 4E9KA 4FBFA 4FPYA 3JQWA 2A75A 3BCWA 3E6CC 1UMZA 1DGRN 2HEYF 4YGEA 4L2NA 5GZGA 2PFWA 2WT2A 3RQ0A 1LRHA 1Q8PA 1HV1A 1ZBE1 3AYAA 1LODA 4H55A 5T54A 1NCRA 1OOPA 4HVQA 2OYZA 3MF9A 2D3RA 5FO8B 4RSUA 2PYTA 3ST7A 3W9AA 1CPNA 2YY1A 4XFCA 1IS6A 3JB8A 4FOYA 1FYUA 3TNPB 2MHFA 1JH5A 1HDKA 2I45A 3SH3A 2CAUA 2WSUA 2ZAAA 3AYCA 1GANA 3CEWA 1ZBE3 1NCRB 1OOPB 4LNVA 4AYUA 3IWZA 1I6XA 4O9EA 3ALQA 4IEZA 3USSA 4CDQA 3WCRA 4HT1T 1W39A 1LR5A 3VBHA 4AHXA 1Y43B 3HBZA 3NAPB 1BBT1 3ZXAC 1ZREA 3ZFGC 1FXZA 5C9AA 3WUDA 3CF6E 3FE5A 3FMGA 4Z2WA 3ZYGA 1V6JA 2XB6C 1NG0A 2ET7A 3OYWA 4NVPA 1VBC1 3QH7A 3I4IA 3WNXA 2OZ6A 4CDQB 1HRV3 1V00A 2LALA 4IV3C 1GNHA 2DF7A 1MVEA 3VBHB 2BQPA 3LGRA 1ZZ8A 3C2UA 4Q0QA 1GFF2 3LCPA 1LEDA 4JDOA 5C9AB 4K8FA 4BA6A 1PZ7A 4Q8KA 3DPRB 4XBLA 4GB33 5CA6A 3LA3A 2DCTA 1DQ1A 4HSJA 4CDXC 4LO5B 1QH6A 4YM0A 2ZHNA 3OYWB 4AWDA 3PJQA 4GB32 1G8WA 3FUQA 3G6JB 3OJBA 5E88A 2ZHMA 2RS31 3VL9A 1U0AA 3GBFA 2QQPA 3OF1A 3FX3A 3LSDA 4LBQA 3WVJA 5FTTC 1ZYBA 1KS4A 2F6BA 2YGMA 1LOBA 2Z2SB 1MS9A 1F5JA 3JCIA 1BVP1 1OLRA 2HWC1 4QQPA 4GH4C 1Y3TA 1SLAA 2ET1A 1MS8A 3ZXLA 4COWA 4RS5B 4K3UA 5KXCA 4A7ZA 3N7KA 2RS33 2WQ4A 4ZKTB 3FJSA 2IXLA 4XXPA 4LBQB 4DS0A 2IXKA 4AGRA 5FO7B 1FI2A 2C1FA 1HRI1 2JEMA 3M1HA 2CWSA 3AP6A 4GIQA 1ULCA 3SCGA 4EWDA 3MW4A 3T1LA 5J96B 1I9RA 1RUD1 1H1AA 1PHMA 2HWC3 5DZGA 5F9TA 1JXNA 1C8NA 1IS5A 1BKZA 1X50A 2D5FA 4LLOA 2IXIA 1NYWA 2X8KA 2XWJB 4YZ5A 5BNNC 1MZEA 3VLBB 1H1IA 2E53A 1QGLA 2ZKNA 4R8HA 4HVOA 1REFA 5CBLA 1T6GC 1WD4A 2QVSB 1HRI3 5BNPA 2Y38A 4XHXA 2H0VA 3WDXA 2IWGB 1ZVFA 2ENRA 4HK8A 1WCDJ 2WA4A 3OD4A 4WM8C 1LGCA 2W39A 4GALA 2I74A 3AK0A 3NV2A 1RB8G 1MZ6A 3U11A 1XU1A 4DB5A 1HW5A 2XJUA 3ILFA 5AVPA 3WDVA 3AZXA 1OA4A 3VBOA 2VECA 1FATA 5BNPB 1G86A 2W08A 5T3NA 4R4ZA 2C5DA 4IV1C 1HXS1 3WP5A 4RHV1 4Q0SA 4CZSA 3EBRA 3VHOA 4R9AA 1QXPA 3BALA 4LR4A 2GN7A 3ZYPA 2NMOA 2D7FA 2AUYA 5FO9B 1C5HA 4QQLA 4YG0A 4BHPA 3VZJA 3AZWA 1UU5A 3DN7A 4FO9A 3RPQA 4OUMA 2CGPA 3P3NA 3AZZA 3VBOB 2HWB2 1U12A 1U5YA 4YVSA 1CQ9A 1QOTA 1N47A 2P37A 3IDCB 4FVVA 4AHYA 3N3HA 1DGWX 4N53C 2PHXA 1GNZA 5JZGC 3VBSC 4AQSA 4FP3A 5FLIA 5I91A 4LBKA 2F4PA 3AZYA 4K6BA 2FQPA 3GNEA 3PMEA 5KXDA 2VMIA 3M3QA 5H9PA 4OI1A 4YVSB 2LTNA 4RGGA 4LBNA 3FFQA 1ULGA 1C8M3 2ES3A 4WM7A 2BFUS 3KT4A 2KA3A 3HWJA 1KRIA 1PZ8A 1RUH1 2R6QA 1VB4A 1C28A 4PQ9A 5EYXA 1AJKA 3TOJA 3VKLA 4UW6A 3H1YA 4YZ1A 3PMSA 3LA7A 2R061 2WWSA 4CP1A 4JGYB 2DFCA 1C5IA 1EV11 4WM7B 2BYVE 4XFBA 2IXCA 3ZMOA 2P34A 4CEYA 4FPGA 2B45X 1YFYA 3TBDA 2DCKA 4Y1VA 1KFUL 1NOVA 3SH5A 3N7MA 3C3VA 2JG8A 2ZX4A 3D8CA 2CAVA 3ILNA 5JVVA 5HCAA 1VAKA 4E4DX 3IIAA 1UD1A 5L19A 4ASMB 1BEV3 4P9LA 4WV8A 2P3IA 5DUUA 4DY3A 4L9BA 1SFYA 1PIV3 3H3ZA 4CEYB 2R16A 1UIKA 1BEV2 4JRAA 1SEFA 3AKTA 4TYSA 2DUQA 2D98A 1APNA 2ZAHA 1XYPA 5JWPA 1Y7BA 2JG8B 5K0UC 4YW3A 4LT5A 1GZWA 1GR3A 1KITA 4EJRA 1W6MA 1D4VB 1KQRA 4M0HA 4IEWA 4X8NA 4QQOA 4EWAA 2ZGLA 4BMBA 4MSVA 2UYBA 5L7OB 5KHIA 3VGIA 3WQ0A 2WLPA 3ZO0B 1XNKA 4AGGA 1RIRA 2BVBA 5BNOC 2R071 1OLQA 1GZWB 5J37A 1W6MB 1XXNA 5DDJ1 3DUIA 3VHRA 1WMFA 2ZGOA 3BU7A 3GALA 3MLJA 4BYYA 4XYXA 1AYN2 2ZOEB 1FNYA 2GMEA 2GNDA 3VZLA 1RJ7A 4AI2A 1H1MA 1FOD2 3ZYRA 4S2HA 5AFEA 3QD6A 2QKDA 1SLCA 4Y1XA 1IS3A 5F1RA 1H2KA 4Q4V2 3IN9A 4V1PA 5D8AB 1LESA 2G9GA 2JECA 3V0AA 2RM21 3BOPA 2N7GA 3ZFFA 4DZGA 1IZ3A 3AFKA 3FHIB 2GDFA 4XMAA 5CFDC 4O9GA 5JIUA 2A6YA 5FPZA 3JD71 4Z8BA 1NXD1 1O5UA 4DNYA 4Y22A 1LOCA 4AFAA 4XJUA 1WCSA 4XF0A 1ZRRA 4WBBA 4BIOA 1RUNA 1QJY3 3O5SA 3GHNA 4DMIA 3V0AB 1REEA 2A3XA 1MQTA 1QJY2 3FLRA 4K1ZA 3L9JT 5JI7A 5C8CA 5I0TA 3R4DB 5AVAA 1DYKA 2JENA 4Y22B 4FAGA 1V9U3 4CYDA 3ELNA 1N1YA 1RUE2 4FTSA 2LUWA 4Q26A 2WNEA 2XBO2 1QHDA 1V9U2 3ZSLA 5D1IA 2BNNA 2BNMA 3WDWA 3AP4A 1MQTB 4JGZB 1PNFA 5C8CB 1OD5A 5GZEA 2BFUL 1F9KA 4IEPA 3KQRA 3D5OA 3AYEA 1AYM3 4FPOB 4GXLA 3VBRC 1F5FA 2BEOA 3JZVA 3EXUA 4LO6B 2WQZC 4MGZE 5E1RA 2WS91 1EPWA 4X6RB 3RRDA 1ENSA 2HWD2 1LHOA 1AVBA 2YDEA 4AQ6A 4BCUA 4RQPA 5KC5A 1TMF2 5FMOS 1VBB3 4QPGA 2XGXA 2XJVA 5I8SA 3GZTB 4D7YA 1ZM1A 1QQP2 2PHDA 2W52A 4QM9A 2UY8A 4AEJA 4I30A 5DUXA 4XOGA 1O5LA 1NQJA 1LENA 5EFUA 2CNAA 2JG9A 2H0BA 2HWF2 1ASJ1 4S2FA 4LBMA 5HI0A 2VW1A 4RQPB 1RJ8A 4QPGB 2D6KA 3HIFA 1DF0A 1HQNA 5T5OA 4GWMA 3VZMA 1D4M3 4J6GA 5JOWA 1ZBA2 1IOAA 3KLSA 3VKNA 4FPFA 2JG9B 3UKNA 1D4M2 3LOIA 1RUI1 1YHFA 4BM8A 1IKPA 3NW4A 1OSGA 1N1TA 2ARXA 1S2BA 3MEPA 4N9IA 4OVEA 3O14A 2FMDA 2VQAA 4RGAA 1W6NA 1RMU3 3MFCA 4AI1A 3FLPA 1Z7S1 1UIJA 1CR7A 1RMU2 3R4UA 3O0VA 1ND2B 4OI2A 4HLTA 4Q8LA 5CVRA 2YPJA 1AR92 1RUJ3 4IEYA 2QZ3A 2PLV3 4CDUC 1FT9A 1JUIA 2XHKA 4I0AA 4C1XA 3E5QA 1FMD2 3RS6A 1RUJ2 2PLV2 5DG1A 5I8YA 1H8TC 4XXAA 1MZ5A 1VLNA 1W6NB 1W6QA 3QACA 5EJ3A 5T5JA 1EAH2 1Z7S3 2VOVA 3D6EA 4FPHA 1AL22 5JIAA 2WNVC 2FZ2A 1OKQA 1WLDA 4I3PA 3VKOA 4D3WA 1D2SA 1GZ9A 4GA9A 3FC0A 1H4GA 4IEOA 3SCFA 4LBJA 5DUVA 1AR62 1PM7A 1LHVA 1A6CA 1PVC3 3WT3A 3LWCA 3EJKA 1PO13 4A2UA 1G9AA 5ABJC 1PVC2 3IBMA 3PHMA 1PO12 4FT8A 1AXKA 5KBFA 3L2HA 3Q9OA 2ZHKA 2R041 4XHBA 1EP0A 2AREA 1I5ZA 1IS4A 4K40A 4IESA 2GC1A 2W0XA 1A8DA 4H7MA 4IEXA 2GU9A 3H9AA 3UKVA 4P9YA 1NCQC 4QU2A 5DG2A 2CGNA 4GQ7A 4F83A 2O0OA 5GZDA 5K7PA 2K9ZA 1NE6A 4Q4W1 4QPIC 2DCZA 4QPYA 5LRRA 2WZR3 1S0BA 3SH4A 3POSA 5JDBA 5CFCB 1N3QA 3SHRA 5A3LA 1NA1C 2DTWA 3SNMA 2R043 4QX5A 5FAXA 4FPKA 3QBQA 3LKJA 5HCBA 4MGIE 1FPN2 2WINB 5I8TA 2XJQA 2CY6A 3KCYA 1VBD1 1JW6A 2BBVA 2RS53 4OUSA 1O3QA 5JSRA 1YIPA 2OIIA 2RS52 1AJOA 2GALA 4JC1A 3W58A 4NOTA 1AZDA 4AHWA 1PO21 2YC0A 2E7AA 1L3JA 3IDEA 1YUDA 3EQEA 3VBUC 2ZGQA 5FMOL 5I0UA 3LB9A 1LTEA 3WW4A 4MYEA 2NN8A 4CEWA 1B35B 1VBD3 2ZX2A 4M0NA 1SACA 4RR3A 5A33A 1LHNA 2A6WA 4XIKA 4QMAA 1LOFC 1DGWA 2VPVA 2I07B 1POV0 1PO23 2PHLA 3ES4A 1OFNA 2GSYA 3B9IA 4ASLA 3SMHA 4EROA 3ILRA 1WLTA 1J58A 2CTVA 4BLIA 4CEWB 2WNUA 2Q8OA 4AEKA 4RR3B 5A33B 2DCYA 2XJRA 3WQ7A 1S0IA 3ZXKA 2B39A 1SFNA 2HYKA 1WBLA 2YROA 4DY5A 2K2SA 4HZFA 3MIDA 2VMGA 4H14A 4XQWA 2B8MA 2OW4A 1VRH2 1LCLA 3AMHA 5JMCA 4QGNA 5GZFA 3ZN5A 4AVAA 1S0GA 1H2LA 2WNUB 4JTOA 5I0RA 4J1WA 4IL7A 1XE7A 4M00A 2JICA 3WG2A 3MDPA 2D6MA 4KG0A 2YHJA 4LULA 3TN92 2NP0A 3N4MA 2ZS6B 2X53S 1RHI3 4KG8A 2FZ1A 4C91A 1H2MA 2XLGA 5F5QA 3I8TA 1RHI2 3VKMA 3ZFGA 1Z0HA 4HANA 2XH6A 2R0HA 3FBMA 4W65A 5J98B 3VBFC 1HRV1 4LA2A 5IUQA 3ACLA 1LEMA 1RUC2 3ZN4A 4P9IA 4IV3A 2WFF2 1JYIA 4GB31 4EN7B 2WFPA 1BZWA 5EYYA 2ZX1A 3ZFGB 2AR6A 1IHMA 3N7LA 3TWIA 3NAPC 1PGSA 4R4XA 4CDXA 3AFGA 5GLTA 4LUKA 2XJTA 3MPPG 1EPZA 4A3XA 5J3UA 1QF3A 1V6LA 2WSVA 1AR83 4KWLA 2B5HA 5GLUA 1HQLA 1QJX2 3VDDC 5GJ6A 2Q1MA 4IERA 2A6VA 1AR82 3JBG3 2DFBA 4DPNA 1MS1A 3VUOA 2ZZQA 3D0JA 3WG3A 1IQAA 1PGW1 3JBG2 5CNAA 2DTYA 4CDXB 4GH4A 2A3WA 4HFSA 4CP2A 3DPRC 3WZ1A 2BPA2 5JCTA 3S7EA 1R1A2 1ULDA 3X29B 5ACA2 5GZCA 1YNAA 4GWNA 1E57A 5GLWA 1WA4A 4N43C 3WDTA 4OULA 5GLZA 4AVTA 1HIXA 2A3YA 1RUOA 4FOQA 4EN0A 2DU0A 4GH4B 4PBPA 5BNQA 2DVFA 2MEV2 1IKQA 1AR73 3ENRA 1ULEA 2OUJA 2PHTA 5L36A 1AR72 5BNNA 3RWNA 2CL2A 1UU4A 4RS5C 4Z07A 1V70A 4FXKB 4M3CF 4QHBA 2WC2A 1ENXA 1POV3 4AI8A 1MS0A 2ZGKA 2D6PA 2PHRA 4WM8A 3THPA 3M2MA 4OLLA 4Y1ZA 1H9WA 4LBLA 5SV8A 5BNNB 2D6LX 2GMPA 1DGRA 4P14A 4XF9A 2NQYA 4U36A 1LECA 3R0RA 4P5HA 2VNGA 4FSJA 1NE4A 1RUF2 2O8OA 2WT1A 4IV1A 2VMHA 2Y26A 2ZJCA 3H50A 1A8MA 1F31A 1NLSA 4AE2A 2JD4A 4JVAA 1K5MC 1OMIA 2ZACA 2HWB1 4W6XA 1RINA 1ZX5A 2B42B 3NWKA 1U5XA 4WM8B 3NL1A 4WZCA 1UU6A 2BTVC 2D43A 1CN1A 2ZCWA 1WW4A 4JQRA 1UKRA 1DBNA 1BVVA 1HKDA 4U2AA 1CJPA 1LU2A 1VBA2 1FNZA 1RUD2 2UWBA 4IV1B 1KXGA 4YYOA 3SXWA 3JUUA 3RMXA 4MVTA 1RGSA 3NO8A 3SITA 2HWB3 3AJZA 1VIWB 1WMDA 2IXJA 2X5IC 2P3KA 2GH8A 4N53A 4AK3A 1UX6A 1VB2A 4B7KA 5JZGA 3VBSA 2Q30A 2A7AA 3O7OA 1O7FA 1C4RA 2V73A 4JDMA 3BTAA 4I01A 1C8M1 1KD7A 5CG9A 1WLCA 2A73B 4BH9A 3HQXA 1QJU2 2KXLA 1PK6C 3H7YA 3RYK<