1QQP1

Foot-and-mouth disease virus/ oligosaccharide receptor complex.
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
210
structure length
188
Chain Sequence
TTSAGESADPVTTTVENYGGETQIQRRQHTDVSFIMDRFVKVTPQNQINILDLMQVPSHTLVGALLRASTYYFSDLEIAVKHEGDLTWVPNGAPEKALDNTTNPTAYHKAPLTRLALPYTAPHRVLATVYNGECRTLPTSFNYGAIKATRVTELLYRMKRAETYCPRPLLAIHPTEARHKQKIVAPVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (GENOME POLYPROTEIN)
publication title The structure and function of a foot-and-mouth disease virus-oligosaccharide receptor complex.
pubmed doi rcsb
molecule tags Virus
total genus 39
structure length 188
sequence length 210
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1999-05-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1qqp100
5C9AB 2RM22 1AYN1 1VBB1 4GMP1 3NAPA 1RMU3 1POV1 1HRV3 1RUE1 1F8VA 4SBVA 5BNPB 2RM21 1RUI2 2FZ2A 3JD73 1EAH2 1RUF3 1AR82 1PVC2 2R063 5GKAC 4N43B 4JGZB 5L7OA 1RUI1 1EAH1 4EJRA 4RQPA 4CDWC 5LK7B 1NOVA 2RS32 1PGL2 1AR81 2XPJA 1PVC1 1R082 1X36A 2RMU3 1AR62 5JZGC 3VBSA 4N43C 5K0UB 5AC93 5CFDA 1D4M3 1MQTB 2RS31 4Q4X3 4CDUB 1PGL1 1M06G 1R081 1AUYA 3DPRA 1AR61 5BNPA 5C4WB 3IDEA 1NCRB 1V9U3 4JGYB 5K0UC 1H8TA 1MQTC 2ZTNA 4AEDB 3VBRC 4WM8C 1B35A 3CJIC 4CEYC 1RVF2 1VBE3 2MEV2 3VBOB 3ZFGB 4GMP0 4JGYC 1NCQA 4QPIA 1POV0 4RHV3 1QQP2 1PIV3 2FZ1A 1RUJ2 1RVF1 1FPN2 1RHI2 2MEV1 2HWE3 1ZBA3 5ABJB 1EV13 1R1A2 1QQP1 1NA1A 4RR3B 4LLFA 1PO22 1RUJ1 1FPN1 1RUG2 1RHI1 4RS5B 1BEV2 1ND2C 1C8M2 2HWF2 1VBC2 3JBG3 3J8F2 1WCDJ 4Q4V3 1R1A1 2HWB3 2WFF3 4RR3C 1PO21 1RUC2 1RUG1 3NAPB 3HAGA 1BEV1 3JB8A 4RS5C 1QJU2 2X5IA 1C8M1 2HWF1 1VRH2 1VBC1 3J8F1 1CD3G 1VB4A 5DDJ2 1RUC1 1TMF2 2R073 1PO11 1SMVA 3NAPC 1QJU1 1AR93 4GH4A 1VRH1 3M8LA 1ASJ2 4YVSC 1MEC2 1HRV2 4GB33 5DDJ1 5L7OB 4YVWB 2WS93 4RQPB 1TMF1 4WM7C 4IV1A 1RB8G 1R092 5ACA2 5D8AA 4CDXA 4FTEA 1HRI3 1ASJ1 4CEWA 1MEC1 1HXS3 1HRV1 2HWC2 1ND3A 3ZFFC 3VBUA 1E57A 3VBSB 3ZFEC 5L7OC 1RUH2 2XBO2 2GH8A 3VDDA 4RQPC 5CFDB 1R091 5ACA1 3DPRB 1ZBE3 2HWC1 4N53A 4NWWA 1RUH1 5C9AC 2XBO1 4NWVA 2BPA2 1FOD3 1H8TB 5CFDC 5AC92 1B35B 1D4M2 3DPRC 5BNPC 1C8NA 5CFCA 1VAKA 4YVWA 2HWD2 5J98B 1NCQB 4QPIB 4FTBA 5C8CA 5AC91 1D4M1 1AYN3 3VBFA 1VBB3 1RUD3 4GMP3 1AL0G 1TME2 1POV3 2HWD1 1RUE3 1FMD2 4JGZC 1NCQC 1COV2 4IV3A 1VBE2 4QPIC 2BUKA 2ZAHA 2RM23 1W39A 1NA1B 5BNOB 1AL22 4RFT0 1TME1 1FMD1 1Z7S2 1COV1 1VBE1 4CDUC 1ZBA2 1VBD3 1BMV2 2IZWA 1NA1C 1AL21 1EV12 5C4WC 1QJY3 1AR83 1PVC3 2RR13 1Z7S1 2X5IB 1NCRC 1ZBA1 4AEDC 1BMV1 3JBG2 1EV11 4Q4V2 2BFUL 2HWB2 2WFF2 2X5IC 3ZFGC 3VBOC 4GH4B 5A32B 1HQNA 1AR63 2BBVA 4Q4Y3 3JBG1 5JZGA 5BNOA 4Q4V1 2HWB1 2WFF1 4IV1B 2BFUS 1QJX2 5FMOL 5FOJB 5D8AB 4CDXB 5ABJC 4CEWB 1ND3B 3VBUB 4Z92B 1AR73 3VDDB 1QJX1 3ZXAC 5FMOS 2RS52 3TN93 4CDXC 4WM8A 1RVF3 3VBHA 4N53B 3VBUC 3LOBA 4CEYA 3VDDC 4FTSA 1BBT3 1VBA3 2RS51 5A32A 3S6PA 1RMU2 3FBMA 5CFCB 4QPGB 1ZBE2 1DDLA 5C8CB 3JD72 1OOPA 1QJZA 1PO23 3VBFB 1RMU1 1RUG3 1AYM3 1RUF2 2R043 1X33A 5CFCC 2QQPA 1ZBE1 4Y5Z0 2R062 4YVWC 2HWF3 5A33A 1VBC3 4IV3B 1ND2A 5C8CC 3JD71 2TBVA 1GFF2 2PLV3 1RUC3 3VBFC 1RUF1 1IHMA 1PO13 4PDWA 4CDQA 3VBSC 2R061 1RUD2 1VRH3 2RMU2 4IV3C 4Q4W3 1K5MA 5DDJ3 2Y26A 2WZR3 4Q4X2 1TMF3 2RS13 4QPGA 1RUD1 2RMU1 1ASJ3 1MEC3 1H8TC 1OHFA 1V9U2 5BNNA 4YVSA 1B35C 4Q4X1 1NY72 2WWSA 1VBD2 4CDWB 1R093 4WM7A 5ACA3 1QJY2 2HWC3 2RR12 1V9U1 4BCUA 1RUH3 2XBO3 1NY71 3ZFFA 5JZGB 3ZFEA 4RHV2 1VBD1 1PIV2 1QJY1 2RR11 2HWE2 1F2NA 1RUI3 1EAH3 4RHV1 4Q4Y2 5BNOC 2WLPA 5C9AA 5J96B 3JB4C 1PIV1 3VBRB 4WM8B 2HWE1 3VBHB 2HWD3 3CJIB 4CEYB 4Q4Y1 2VQ0A 1PGW2 2RS33 4CDWA 1AR72 1R083 1VB2A 1TME3 3VBHC 1FMD3 3TN92 2GSYA 1COV3 1PGW1 4N43A 4JGZA 4FSJA 1AR71 1A6CA 1OOPB 2DF7A 2R072 1BBT2 4GH4C 1AL23 1VBA2 3TN91 1AR92 1Z7S3 5A33B 4GB32 5K0UA 1ND2B 2WS92 4IV1C 1MQTA 1OOPC 2R071 4CDUA 1BBT1 5D8AC 3VBRA 1VBA1 4CEWC 4PDWB 1ND3C 1AR91 4CDQB 2MEV3 1HRI2 3CJIA 1AYM2 5C4WA 2R042 1HXS2 4GB31 1K5MB 1NCRA 2WS91 4JGYA 1QQP3 1NG0A 4AEDA 1RUJ3 1FPN3 1RHI3 4PDWC 4N53C 4CDQC 1HRI1 2PLV2 1AYM1 2R041 1HXS1 1PO12 3ZFGA 3VBOA 1K5MC 1R1A3 5BNNB 1FOD2 4YVSB 4Q4W2 4Y4YA 1HX6A 1QJX3 1BEV3 2PLV1 4QPGC 2WZR2 1CJDA 4WM7B 1C8M3 2RS12 3J8F3 5ABJA 1FOD1 5BNNC 2ZZQA 4Q4W1 3ZFFB 3ZFEB 4RR3A 2WZR1 1QJU3 1AYN2 2RS53 1VBB2 2RS11 4RS5A 1OPOA 1RUE2
chains in the Genus database with same CATH superfamily
4L2NA 3EMRA 1F9KA 4GAZA 2E7QA 4BLIA 5T5PA 1WMEA 4DXRA 2ZABA 5A6ZA 1H4GA 3NNLA 4DY5A 1AYN1 4AR2A 5GLTA 1VBB1 2W94A 3U4SA 4NPLA 4PF1A 1YXWA 4D0QA 1U5ZA 1WCUA 2K9ZA 3PIJA 4P14A 4GA9A 1JUHA 2WNUC 3KHBA 4AAPA 3N7LA 3W9AA 5FY4A 4K1YA 5FZ7A 5A7NA 4AHZA 2RE9A 1EAH2 3JD73 3USUB 1BYHA 2IVIB 1RUF3 5IJRA 3UL2A 1WA6X 1PVC2 4IEXA 3O1RA 3I3QA 2EA7A 1DYKA 4MGZE 5FO8B 2KR2A 3I3EA 4P5YA 4BQYA 1SHWB 1AXYA 1WMFA 2N7GA 4JGZB 5FY7A 3DEMA 5FFOC 4NR1A 4CE8A 1OMIA 3VD3A 4OUSA 4ZS3A 5GZDA 4PI0A 2CWMA 3SKVA 2PHXA 4FO9A 3WV6A 3GGLA 1X36A 4FOQA 2GC2A 3O0WA 2G9GA 4MV2A 4XFCA 2UY8A 3DGTA 3W21A 1JYNA 2WO2A 4N43C 5K0UB 2X29A 5M0TA 2ORZA 2WO1A 5CFDA 1QU0A 1DHKB 2R6QA 2RS31 4Q4X3 3ZOIA 4Z1VA 2NMNA 1R081 5FXWA 4OI2A 4DS0A 1LJ7A 1AR61 5BNPA 1LKNA 1SFNA 3R4UA 5C4WB 1YHFA 4S2DA 1ENSA 4OHXA 4NAOA 2VTFA 4JGYB 1WCSA 1W9FA 3IMNA 3ES4A 5F5AA 1H2LA 2PQQA 4HMZA 4YW7A 2ZTNA 5FYIA 3VBRC 2GC1A 5IVVA 4M3CE 1CIWA 2ZZJA 2GALA 1WMXA 4QAWA 3KVBA 4CYDA 3T2OA 4F83A 2DUPA 5EJ3A 1VBE3 4BLJA 3DYOA 1NX9A 1NCQA 2IUWA 5FYHA 4M0NA 4RHV3 2P4EA 2J1RA 1XPWA 3UYJA 2OPWA 1NE4A 4W50A 4Y20A 4AGRA 4I0AA 5KXEA 2MNGA 1FPN2 2XJTA 3N9PA 3ZYFA 3Q8CA 2MEV1 2E7AA 3A7QA 1W8ZA 5ABJB 1RL3A 4XCAA 4EQVA 2VTXJ 1EV13 2WFPA 3VHRA 5LEKA 3AP5A 1X9PA 3A21A 2VMFA 3RVHA 2ZX1A 2D5FA 2BW8A 4XUNA 4NHMA 1CONA 3OCPA 1I6XA 5FZ6A 1C8M2 1GWMA 1SLCA 4N9IA 5FMCA 3V0BB 2JDYA 4NO4A 1WCDJ 2WSUA 3ASIA 3POFA 3Q8EA 5BPXA 2HWB3 4LIVA 4AFCA 4AQ6A 4QKDA 4GKYA 4BMEA 3ZDSA 2HEWF 3C7EA 1RUG1 3VL9A 3NAPB 1W3VA 1CZTA 1K45A 1BEV1 1CAXA 1W90A 2E9QA 3G6JB 1QJU2 5LA1A 2HWF1 4JCKA 2KM2A 3ZXKA 2EAKA 1C28A 1VBC1 4XFHA 2YXSA 4XIOA 1CD3G 5CB7A 5I91A 1VB4A 1YQ2A 3N9MA 4GJYA 5LB6A 1O3SA 4DEVA 2DDUA 4QB1A 2C26A 2R073 1EY2A 3HN3A 3NQHA 4XAAA 2BGPA 1AR93 2QKDA 4OZOA 2W92A 2IVJA 3EXUA 5CKMA 1IKQA 1ASJ2 4YVSC 1I3HA 4BXFA 3ETQA 4YVWB 1QDOA 3PTRB 4KU8A 2AEZA 3WNNA 2P37A 3FUOA 4JVAA 4ZXKA 2D6PA 4BISA 3GJAA 2EIDA 2E31A 5E88A 3WW3A 1UQXA 1R092 1S0JA 2LTNA 1H1MA 5FP8A 1HRV1 2CL2A 5FZFA 3ZFFC 1E57A 5L7OC 2YZ4A 1N3PA 3GYDA 2XBO2 1XYOA 2J1TA 3L9JT 4RQPC 3V64A 4ES9A 1MVQA 4YZ3A 3MLKA 1JYCA 1VAVA 2YDEA 5DUWA 3V0AB 3DPRB 5DPNA 2B8MA 1SEFA 2HWC1 3SEPA 4A4AA 3RYRA 3RZGA 3ABZA 4LMFA 2YFZA 4FXGB 2YYOA 2VNGA 1V6OA 3K75B 2D97A 5C3PA 3HEIA 4CXYA 4MHUA 3CDZB 3LD8A 5A1FA 1UOFA 1PM7A 5L19A 4P9GA 5L36A 4NVPA 2DUQA 2XONA 1IQDC 3GCWA 4MH0E 3O1MA 4QDRA 1C8NA 4KNCA 4NRPA 1F15A 4L92A 3FJSA 3I2JA 4FTBA 3MPBA 5AC91 1ACCA 5A6XA 4MGTA 4D6RA 4IE6A 3HQUA 3ZKUA 3RMXA 3MPPG 3FC0A 3T2PA 1TE1B 1X7NA 1POV3 2HWD1 1RUE3 5IT6A 1UY3A 1S0DA 1YJLA 4AI0A 1VBE2 1C5HA 1KFUL 5AVAA 1UWWA 3ZXLA 2A73B 2JG9B 3K4DA 4IQPA 4A3ZA 2YBPA 4CCOA 3KSCA 3I49A 5BNOB 4LBJA 1KEXA 2VCBA 1AL22 1Q43A 4FPFA 1UNBA 1YEWA 1YIPA 1TME1 4MXVA 4COZA 4GZ9A 2V72A 5A3NA 1XNCA 4MXWB 1Z7S2 1ZVFA 4QD2A 5F32A 1COV1 1W8NA 4BK5A 3QLQA 5E1RA 4FPOB 3WW4A 2UU8A 1RGSA 3OUIA 4RFRB 2WQ8A 4CDUC 4CPBA 3VKOA 1BMV2 2IZWA 3RI8A 4OI4A 3RI9A 5KHIA 2JWPA 3VZMA 4AL9A 3U75A 1EV12 4UXAA 4XDQA 4KG0A 2JG8A 1AR83 1WZXA 1OUSA 1PVXA 3K48A 3LEIA 3HNBM 4Y1YA 3UJQA 3E5UA 4PIXA 4IEYA 1HW5A 5JPMB 4QPYA 4AEDC 1P8JA 3SXWA 1WBFA 1N1SA 3VZOA 1GOGA 4NHLA 4LA2A 3UT0A 1HKDA 3WT3A 2HWB2 2P6HA 2QVSB 4QU1A 5FP3A 3EO6A 3MUY1 1X8EA 2X5IC 4HPKB 4P9YA 3ZVXA 4DQAA 1PK6A 1C5IA 5A32B 3MICA 1O91A 2YG0A 1HQNA 4Q4Y3 1UO9A 3N9OA 2FHRA 3JBG1 4Q4V1 4LKEA 2VUJA 3S57A 3IN9A 4HN1A 5K4LA 1WMDA 1NZIA 1OC1A 2WFF1 3E1F1 4IV1B 1BXHA 4RSUA 4EV0A 2QJVA 2ZEWA 3NV2A 5JOXA 3KV9A 5D8AB 3U11A 1CAUA 2ZKNA 4NOTA 4CCMA 3PUAA 3MI8A 4IEVA 4BXSV 1ND3B 5CAZA 1IPKA 3ORJA 1W9WA 3U07A 4META 5FZ3A 3VBUB 1LULA 1SDDB 4Z92B 4YGDA 4OHVA 3RSJA 4XJAA 3P3NA 2HYKA 3W5NA 3UNPA 5LBCA 2G9FA 4C1WA 5FMOS 1BCXA 2RS52 4CDXC 4CVUA 4WM8A 4H7LA 4Z07A 5F3IA 3VUOA 1RVF3 2F6BA 3APBA 3J7HA 3UGGA 3VBHA 4ZY9A 5SV5A 4Q8KA 5J7MA 4CEYA 2OQ6A 3OGGA 3ZR6A 5EYXA 1UXZA 3EBRA 4IE0A 1VPHA 1OLRA 4C8DA 2H6CA 5JUVA 5IYYA 1UL9A 5LATA 5FAXA 1H0BA 5FPAA 3S6PA 2JICA 2WINB 4P9XA 4FBFA 3AKTA 4XDOA 1E5SA 3AZWA 3R6SA 2ZEXA 3S5AA 3MV01 1BKZA 3FBYA 2WDBA 5C8CB 1QKQA 4KBZA 5EQUA 1LHNA 3HQRA 2UWCA 5JI7A 5CKNA 1DU3D 3VBFB 1H6YA 5BV6A 2D7FA 1AYM3 2R043 4PBOA 1X33A 2OW4A 3OPTA 4YG0A 5FKBA 3ZYPA 1ODNA 1LOCA 1ZBE1 4OZXA 5EJZB 1SG3A 5FK8A 3FE5A 1UPSA 4XACA 4QMAA 2RVAA 3PUIA 4ATFA 5F6LB 2RJ2A 2P3JA 3JD71 3ZXGA 2D6MA 3N7JA 2KD7A 1GFF2 4W6WA 3ITQA 3TWIA 1CN1A 1RUC3 4ARYA 5LBFA 3BU0A 1MR5A 1RUF1 2VQTA 3OPZA 4XMAA 1G8WA 2YPDA 2YU1A 2Q8OA 4AVTA 1GNYA 3AM2A 4BYYA 2RMU2 2B42B 4IV3C 5D21A 4DEQA 1W6NB 2A6YA 2WNUB 4H14A 1LOFA 3MBWA 4PLMA 2XLGA 1S0CA 2WZPP 5GZFA 2WR9A 1S0EA 2A1XA 2RS13 3AFKA 4L9BA 5FZOA 3VHOA 3ECQA 1YFUA 3M1HA 3ZM8A 4R9BA 4DB5A 4XQDA 2WABA 2B9VA 4LBQD 4GWJA 3AK0A 1QIQA 3KGZA 3WDTA 1XE7A 3MGUA 4PCRA 4Q4X1 2WWSA 2VUCA 1LU1A 5FBJA 3CNAA 4MLOA 1Q3EA 2VXJA 4LPLA 3T2TA 1GKBA 1DGRN 1IS6A 4XILA 4XETA 1CZVA 4A41A 1LESA 1ZZ6A 1NY71 3OTFA 4LHKA 1XXNA 1OVSA 3WD5A 1TG7A 4D6QA 5JIUA 5FLIA 1PIV2 2B39A 5K9YA 4Q8LA 2UYBA 5H9SA 4LNVA 4YM3A 1JI6A 5AFEA 4NROA 3HR9A 3VL8A 2RDQA 1HLCA 2EXIA 1TQ5A 4Q4Y2 4RHV1 2EALA 3WNXA 5J48A 3CZJA 3AYAA 2BNMA 5A7WB 1AHSA 2W2IA 3JB4C 2W5FA 3GALA 3OYWB 2NMOA 4Q1RA 3VBRB 2W68A 4LOSA 3LA3A 1JZ3A 4COWA 3PJQA 3ZYBA 2QQNA 3AKSA 2VQ0A 2Y34A 4W65A 2RS33 4KWUA 1UZYA 4CDWA 2XUMA 4BZ4A 4FPEA 2WIIB 3USUA 5DMYA 1R083 4LBMA 3UESA 1LECA 3KVAA 2DU1A 4J1WA 4JC1A 3OBZA 1RC6A 1VB2A 3G7DA 3NJZA 4Q0UA 1PNFA 5FUNA 1FMD3 3O1UA 5FPZA 4BQ1A 3K3OA 2ZGKA 5LA9A 4JGZA 4BMBA 4FSJA 3I2KA 1AR71 3T1LA 3AYDA 3QBQA 3IM0A 3ATGA 5KBFA 3M2MA 4YZ5A 2GMMA 3TN91 1BQPA 2PMWB 4EWAA 2R1DA 2YPJA 1W0PA 5F2WA 5A33B 1XNBA 2A6WA 2JKBA 2UYAA 3IDCB 5K0UA 2D93A 4J25A 3OY8B 4OCTA 2ZHNA 1XJAA 4A45A 1OOPC 2R071 3MIBA 1BBT1 2E7TA 3PJYA 2ZA9A 5EZWA 3RDIA 4OUMA 4FXKB 1BHGA 3THCA 3NSTA 1AR91 2HEVF 2MEV3 3LE0A 4RL7A 1HRI2 4CDQB 3CJIA 5ANNA 1AYM2 5C4WA 2R042 1I9RA 1RYYA 4FI9A 4QT6A 2WL1A 4CP0A 1CPMA 1JU4A 3MO4A 3BVCA 1QOOA 3ES1A 3IAQA 3MIEA 4JGYA 1F4AA 5FRAA 5T50A 3KLSA 1VMHA 4K20A 1NG0A 2CAVA 4LO5B 5EPAA 5DABA 5I0SA 3B5LB 3QH7A 4N53C 3RJRA 2WLQA 2GDFA 1HN0A 5BNNB 5I93A 4YVSB 1RJ8A 1V6NA 3AP7A 4UYBA 2FD8A 1XYNA 3H3ZA 3RGBA 1Y9QA 4M3CF 1HX6A 2JDMA 1W2UA 2VUAA 3EHKA 2W0XA 3VN4A 2R1BA 1BEV3 2BWAA 3AYEA 3HN1A 4QKNA 4QPGC 3NV4A 5GLZA 3SCHA 2RS12 1SBDA 4XJ8A 4L99A 1WCQA 3OGSA 4D7TA 5ABJA 2W1WA 2ZGNA 4QXKA 5FXVA 3ZFFB 3HNYM 1AF9A 2QCSB 5C5TA 2GNTA 2I07B 1AYN2 2PXJA 3E97A 1VBB2 3T08A 3HJRA 4YLZA 4O7XA 4Q5OA 1JYIA 2W87A 2J7MA 3QH6A 5KWRA 3V0BA 1A34A 2YFUA 2JDHA 1QH7A 1NZCA 4P5HA 1JYVA 5AVPA 3AMNA 4I02A 1AJKA 3NAPA 3N9LA 5FTTC 1VRBA 5ERLA 1RMU3 1H9WA 3AZZA 1POV1 1HRV3 1RUE1 2KA3A 3F95A 3VKMA 1A8MA 3MLLA 1J3QA 4LR4A 4NN0A 4Y5SA 1OF4A 4W8JA 3VZKA 2WAOA 5JSPA 5EJ1B 1T6GC 3ZSJA 2ZEYA 5DG2A 4A7ZA 2EXJA 3FHAA 5IVYA 5TSWA 1DBNA 1YYNA 2XHNA 5FZBA 4K1ZA 4S2GA 1L7LA 5JAXA 5JLVA 3M3QA 5FWEA 4URAA 3S5QA 3NV1A 4HLTA 4I3PA 1RUI1 4QX1A 3M7AA 5FLHA 5LY2A 5C33A 2D98A 2A3YA 2OX0A 2RS32 3H7YA 3FLTA 3ZX7A 1AR81 3WNLA 1R082 2L9LA 2Z69A 3ZYIB 2CSGA 1W6QB 1JXNA 4AFAA 1UXXX 4MZUA 1G6NA 4XOGA 4AEKA 3H3LA 1AR62 1VAMA 3S7IA 4A42A 1Q8PA 3BPSA 4XFBA 1GP4A 4D6SA 4IESA 2BNNA 5AC93 1QH6A 4XF3A 4Y4RA 4CDUB 1PGL1 3H3UA 4IGPA 2XJSA 3V0AA 2J1EA 2GMEA 2TUNA 3DPRA 3M3OA 2P1BA 2ZHKA 1E5RA 3D8CA 1O3QA 3J7MA 2X53S 4IEUA 4A44A 1S0FA 5IW0A 5A80A 1YIFA 4HETA 1H6XA 1LTEA 3Q9OA 1MQTC 4FP3A 3NVCA 2VMGA 4IETA 4X6RB 1LGBA 4Z2AA 4AEDB 3WF2A 4ZZ8A 4Q27A 5T54A 5GLVA 1REDA 1Z0HA 3E6CC 3ROUA 3WCRA 2D3SA 1JS9A 4XYXA 3SCGA 3POJA 2MEV2 1Q8QA 3HWJA 5F5QA 4YW4A 1AX2A 3WP6A 3W5MA 1GZCA 1POV0 4AVVA 1ZRRA 4XABA 4DUVA 1GP6A 2CY6A 3GHMA 2VZ1A 1LENA 1ZZ7A 5EV7A 5FPVA 2W47A 1RVF1 1GNHA 1X8MA 4DFSA 5FZ1A 3I2OA 2C24A 4OULA 2HWE3 3RPQA 4EN0A 2ILMA 4MADA 1OQ1A 2DYCA 3OD0A 3EQEA 3CL1A 3NO8A 2JG9A 3POIA 3KT7A 3ZYGA 5JXIA 1RTVA 1KQRA 1RUJ1 2JE9A 1RUG2 1GZ9A 1RHI1 1UKGA 1IGOA 3GM8A 3HQXA 5FY0A 5H9PA 1BEV2 4CUAA 2Y6HA 4MXWA 1XNAA 2QQMA 4TLFA 1ND2C 2HWF2 3I7DA 4XMIA 1VBC2 3JBG3 3GDBA 4D3WA 4Q4V3 3AXDA 2WAAA 3NV3A 4XCBA 5HV0A 1US2A 2GAUA 2WFF3 3E5XA 4RR3C 4XAEA 4COYA 1NAEA 5FQ0B 3GF6A 4GD4A 3HAGA 3T0AA 5FLJA 3JB8A 4RS5C 3ACHA 1JUIA 1E5IA 4AFDA 2PHFA 1DZQA 3IPVA 3RRDA 1W8TA 2GZWA 1JODA 5DAPA 5JOYA 3JZVA 4YZ2A 5L9VA 2VW1A 1YRZA 3SHRA 4M01A 2W46A 1RUC1 1BJQA 4DMIA 3UETA 4ZZ5A 2CV6A 2WQZC 2BEOA 4HPKA 4LE3A 2CHHA 3K4AA 1UMHA 5D1IA 1YQCA 5FY1A 3M8LA 1JW6A 3LPGA 4D69A 1HRV2 1OD3A 4XUTA 4GB33 2WWUA 1UYYA 1OXCA 2ATFA 1NLRA 3GHNA 3WSOA 4AWDA 4WM7C 3WDWA 3N3HA 4AXOA 1FNZA 3AVSA 4IV1A 3LZZA 4FTEA 5D8AA 5FR3A 1O7FA 2YC0A 3ACLA 3MFAA 2ADEA 1SLBA 2GNMA 4CU6A 1HXS3 2HWC2 3VZLA 1ND3A 4QM8A 3VBUA 1GV9A 4JV4A 3NJXA 2WNOA 1CESA 3PURA 3A0KA 1S1AA 5F39A 4UFHA 3WINE 3AMQA 4ASMB 3HOBA 3NWKA 1SPPB 1ZBE3 5CG9A 4FFGA 1V6KA 3WG3A 2V4AA 1Z78A 1U5YA 3F2ZA 3I59B 1V6MA 4DNYA 3VGIA 1Y3TA 3ILFA 3HT1A 3C7GA 1W3XA 3KV5A 3NJYA 4JX0A 4O61A 2YB7A 1FOD3 3T4VA 1W0OA 3T0BA 5CFDC 5FZHA 1AJOA 5GJ6A 4OLLA 5AC92 4X6QB 4CA9A 1ZZ8A 2UWAA 4YGBA 1OLME 1DGRA 2DVAA 3I2IA 3IDAA 1W6OA 4HSJA 5G05L 5BNPC 1UX6A 4DPNA 1O8PA 2ZMLA 4TTGA 2HWD2 3I3MA 1WD4A 4FOWA 5J98B 1DP0A 2Y6FA 4NPRA 4QPIB 3T4HB 3KZ4C 5C8CA 1W05A 4O9GA 5CA6A 2XQRA 3HD8B 1D4M1 3KF5A 4XZUG 2J42A 4P08A 5FYSA 3VBFA 3TNQA 4B7EA 1PGSA 4YWAA 4KG8A 4M00A 1AL0G 1TME2 1XB9A 2QQIA 3FX3A 4E2GA 2VOVA 4DUXA 2VM9A 1C57A 4WZFA 1NCQC 1COV2 2VMCA 4E4ZA 5F3CA 2BUKA 1NUKA 2ZAHA 2RM23 2YMZA 1HB2A 2W9XA 2Y0OA 1NA1B 1UN1A 4LXLA 5EXOA 4ZS2A 1US3A 2FDHA 2FDFA 1YFYA 4RFT0 4LKFA 2Y6KA 4UOJA 4BIOA 2PHLA 3GJBA 1FMD1 1JHNA 4XXAA 1HV1A 2RG4A 1LOBA 4UW3A 3D0JA 3WDUA 1W6NA 1UMZA 2WNUA 2DCKA 4YYOA 1L7QA 3DKWA 1MS8A 1JZ8A 2VO5A 3ZKYA 4OQ9A 5T5LA 4XJ9A 1W6PB 2QDNA 2ZX4A 3PDQA 5IK8A 2Q1FA 5KC5A 1ZBA1 4LIUA 2PTMA 2R0FA 4YNIA 3WG1A 4HSLA 3JBG2 4I0BA 3POWA 4IEPA 2CDOA 1W8FA 4Q4V2 1Y4WA 3QCWA 4COUA 2WFF2 5JPNB 2V5DA 5C7GA 1KFXL 2A3XA 3ZFGC 3PNAA 5CISA 2WBKA 4LJHA 4OMDA 1G9AA 4MHRA 3ZSEA 1UCXA 2CGOA 1JOBA 2YROA 1CIYA 2R49A 4N7UA 4FQ4A 5FXZA 5JI9A 4ZU4A 3H8OA 4D7YA 5HCFA 5FMOL 3RYPA 2OIIA 5IVEA 2Y60A 4RGGA 4BQ4A 1UAIA 1AX0A 2A71A 3BI3A 1AR73 1V00A 5FY5A 2JECA 4V2WA 3VDDB 4PHZA 1SLIA 5A7WA 3NL1A 4AVSA 1SCSA 1KGYA 3OYWA 4GULA 4JDMA 4HL0A 3TN93 4HKLA 2Y6GA 1G9FA 3A23A 3IIAA 1LODA 4N53B 4PT6A 2CU5A 4LO6B 3LOBA 5I0DA 5KR7A 1FXZA 5BY5A 1GYKA 1KJRA 2Y8KA 2VCCA 3RQ0A 1BBT3 1VE0A 3DCQA 1HIXA 4UW4A 2VZQA 1NQJA 4XBNA 4AQTA 2BRTA 2ES3A 4QPWA 3ZIXA 2ERFA 3O7OA 2AACA 1ULDA 4UW6A 3ZSMA 2K0GA 4QPGB 3NNFA 5CFCB 1ZBE2 3O1TA 1JZ2A 1S0BA 2VC9A 1KITA 3D82A 3UKNA 3BYWA 1UPIA 2BYVE 3JD72 3R4SA 2KXLA 1K42A 2DU0A 1PO23 3ILRA 5H9RA 3FFZA 1RMU1 3MW3A 1RUF2 4EN9B 5I0RA 5IK5A 4B1MA 3ZMOA 2QQPA 3OBRA 2JJ6A 2JXAA 4NMIA 3ZO0B 4CU8A 5A33A 5FYZA 3IT8A 3OY8A 4ZU5A 1N1VA 4HVOA 1VR3A 2BGOA 3LF7A 5LEJA 3H8RA 1T2XA 4IW3A 2VW0A 4OMCA 4BH9A 1IHMA 1SFPA 4NRMA 1S2KA 1O5UA 1IG3A 1UZVA 4CDQA 3VBSC 4S2HA 1XNKA 1KJLA 3A22A 2NPIA 2VD7A 1VRH3 2XKOA 3WF1A 4KI5M 4CCDA 3N9NA 4URTA 2JIJA 4YW1A 1QGLA 1WW6A 2VZSA 3L2YA 5DDJ3 1GU3A 2AR6A 3JXSA 2YC4A 5FZIA 2A6ZA 4Q4X2 1TMF3 1LOGA 1SCRA 2BVBA 2XL7A 4NPMA 1ST8A 3WDXA 4XZPA 3SEEA 4CCNA 5A1AA 2BDRA 3NKGA 3WY6A 4AI1A 4RA0A 2ZOEB 3MUZ1 1OSGA 1OH3A 2VJXA 4QM9A 1MEC3 1H8TC 5A3PA 1OHFA 1XSRA 4GQ7A 2IC1A 5BNNA 4YVSA 2G9ZA 1B35C 1MS3A 4XTMA 2WYFA 1I1EA 1K3IA 1NY72 4XBQA 2P6CA 4HOOA 4TZDA 2HH9A 3AP4A 3JCIA 3ZPOA 2JG8C 4OI1A 4PIZA 1DQ6A 5ACA3 1JH5A 5KHKA 3RZHA 4N90A 4ES8A 2HEYF 1SDWA 3FUQA 2FQPA 2BOJA 5KC6A 3U78A 1TVGA 3BOWA 1RUH3 2JB4A 3LEMA 3POSA 4KGQA 3ZFFA 1UZZA 4I2OA 1H4HA 1S0GA 1JTZX 3B01A 3POBA 2Q5TA 1VBD1 4LK7A 4PF5A 4RHV2 1DQ4A 4WVVA 3POGA 2C0ZA 1XU2A 2CNAA 4AE2A 4CTEA 4BE3A 4CUGA 3OOXA 3UK9A 3AJYA 3FL7A 5I8YA 1UD1A 1QJY1 3FMGA 1LAJA 4LITA 2RR11 1JYXA 5JVVA 3RWNA 3K2OA 4ISQA 5CEHA 1DZTA 2IXJA 2JDNA 1RUI3 3O0XA 4WVMB 2QTWB 3I2FA 4CCJA 1UX7A 3M3IA 4CPBD 3RNSA 4ONUA 3R0RA 3O5SA 2NZ9A 2JD4A 2OXBA 2Z5WA 3MF9A 2ZGMA 4XF4A 4P9IA 2NLRA 3OGVA 5L9RA 3TOJA 2HWE1 2BP6A 2WT1A 2ZX2A 2YU2A 1MS1A 4QXHA 5FXXA 3THDA 5HXVA 3WCSA 1BK1A 2Z4FA 5T3NA 3RS6A 2FBEA 1AR72 1IKPA 3P5BA 3B93A 4UF0B 2B9UA 5FJHA 2ZX3A 1V6JA 1EPWA 4O9EA 5FP7A 1QOTA 3R05A 3WQ7A 3VBHC 5C8WA 3TN92 3T09A 2IWGB 3U0ZA 4AZZA 3UJOA 1Y43B 1CX1A 1SBFA 2P3KA 3FN9A 1JOJA 1JBCA 2AEYA 3FHIB 3BN6A 2R072 1UW8A 1BBT2 4GH4C 4KWKA 5F3EA 1QNWA 4TYSA 5BNQA 1J3RA 2DCJA 1O3RA 1QXJA 1AR92 1W6QA 5FKCA 2CWSA 4FAGA 5FCCA 1W2OA 1NYWA 1DFQA 2VW2A 3MYXA 5EFUA 1ND2B 3N36A 4AHXA 4Y1VA 4PJYA 4M3CB 1MZ5A 3WP5A 4CDUA 1NXMA 1VBA1 4CEWC 5F5CA 1KD7A 4PDWB 1GNZA 1IPJA 3LFIA 3TEZA 3VHPA 3MFCA 2EIBA 4JKMA 2E51A 4GB31 3KCCA 4QXCA 4C0HA 5GZCA 1K5MB 2NYYA 1AX1A 5FO7B 3O14A 2BU9A 4JDOA 1GZTA 4KBBA 4Q0VA 2ZGSA 4LO8A 2ZPXA 4AEDA 2ET1A 1RUJ3 5IWFA 1REEA 1RHI3 1F5JA 2VH9A 4JDNA 4JRAA 4Y5TA 1O4ZA 4MGSA 4CEWA 1V70A 3KV4A 5IAVA 1H8VA 1HXS1 4MSVA 2YGMA 2V4VA 1W8UA 5F8PA 4DIQA 2XB6C 3ILNA 1VJ2A 1PZ9A 4D8MA 1LOFC 3GNEA 1WGPA 1VMJA 3Q8FA 4BK4A 5KHGA 1ZA4A 3T0DA 5E16A 3KCXA 2OT7A 1QJX3 2WNEA 1PZ8A 4WM7B 5IFPA 3MV11 3S7EA 3KV6A 3BIWE 3WQ0A 1UU4A 2ZXQA 3RZMA 1M4WA 4DINB 3B3QE 4B4RA 4LT5A 1FOD1 3ACFA 4Q4W1 4A6SA 2QQUA 5FYBA 4HVRA 4LKSA 1GQGA 3B00A 2CGNA 2PAMA 4ZPIA 3H0OA 4QQ2A 2JIGA 3A0NA 1J58A 1RITA 3LIGA 5A7PA 2DTYA 4XQWA 4J6GA 4IXLA 1OPOA 1RUE2 4IERA 4AHYA 1L7RA 4LBLA 1NLSA 3FLPA 3KGLA 1U5IA 2GNBA 3LEGA 5EP9A 5LRRA 2E63A 1LU2A 2W95A 3MIFA 1VALA 2VZUA 1HDKA 2ZGPA 1LEMA 4FFFA 4MO3M 4XW3A 4XUOA 1D4VB 1TZOA 3OEAA 3AKPA 3VDAA 1O6UA 4MGQA 3WHTA 2VZPA 1F8VA 5BNPB 3CHXA 4B4QA 2R30A 1BK0A 3K3NA 1C3HA 1OFSA 1UOJA 2BOIA 2RM21 4N8MA 1RUI2 3IMMA 1CAVB 4LO4B 2P5BA 3BOPA 5JIAA 1AR82 1BVVA 2YBKA 1V0AA 4QXBA 3TYJA 4XC9A 5J09A 2R063 1IPSA 1FYUA 2IXHA 3P1IA 1HV0A 4N43B 4KL1A 4EWEA 2OUJA 2H6BA 3OGJA 4CDWC 1H9PA 4I30A 1NOVA 4UWDA 1N1TA 2JDPA 1PGL2 1XNDA 4XF1A 1GOFA 4Q1PA 4QQHA 5F6KA 3WF0A 3ELNA 4Y20B 3O1PA 5HXMA 1UMIA 1ULEA 5JXJA 5JZGC 4NJ4A 3AMMA 3SC7X 2H0VA 1QXPA 1D4M3 3PU8A 4XHXA 1JYWA 4A7YA 1M06G 4IEOA 2Z2SB 1AUYA 4X8NA 4LQRA 3FLRA 1SPPA 4MYEA 3IB3A 5C3QA 3I59A 2ARBA 3IDEA 1HB4A 2VL4A 3GZEA 5FUPA 2XR4A 2C9AA 1RUOA 1V9U3 5FREA 5K0UC 2ZMKA 2OPKA 3I54A 2XQXA 2P17A 2FDGA 2AZ5A 3DL3A 2Y0IA 3E5QA 5KXCA 3I3DA 4NIAA 1WLCA 4XBLA 3W58A 4HT1T 2WNVC 4FAHA 1IS5A 3CJIC 1RVF2 2XVKA 5E6HA 1J1TA 4QB6A 3ZFGB 3GBWA 4JGYC 3NRUA 2PAEA 1QXRA 4QPIA 1LHWA 2VPVA 2WO7A 2DUOA 4WV8A 2EXKA 2FZ1A 4CZSA 1RUJ2 4L97A 2XXZA 1RHI2 1OQDA 2Q30A 2VZVA 3B9IA 2ARCA 4P9JA 1ZBA3 4IEWA 1UY1A 4FPKA 1Y7BA 1DQ1A 5FMDA 1F4HA 2RHPA 4ZHNA 3IAPA 3TEWA 1QQP1 2C9KA 3ME2A 1NA1A 4K6BA 1W8HA 1WLTA 2XJUA 4OYUA 1QMJA 4BHPA 5FIXA 1OI6A 1XQNA 2DBIA 1DQ0A 2O1QA 2QE3A 2WZ8A 1ENRA 1UYPA 5FZEA 4F8AA 2BZDA 1OKQA 4LHNA 1H1IA 2DCTA 1URXA 5A7QA 2VECA 2W08A 5FJKA 2IFRA 3WVJA 1R1A1 2SBAA 1JZ5A 5GZGA 1PO21 3J7NA 4AQ2A 1RUC2 2AH2A 3PUHA 2FDIA 4OI0A 1G86A 1W6PA 1ZZBA 3O1OA 4LO7A 4Q29A 1G9DA 1I5ZA 1BZWA 3J8F1 3J26N 5FZCA 2OZ6A 3HNMA 3WZ1A 2ZCWA 3KCYA 2J1SA 4GXLA 1SLTA 4P9WA 5FZ9A 4CCLA 1OA3A 5JSOA 3NAPC 4QX2A 5GLUA 3TEYA 2IXCA 4QHBA 4BPZA 4QKFA 5FYYA 1VRH1 2SLIA 3LB9A 2AUYA 3D4KA 2QDRA 5CADA 4BA6A 3BIEA 2JDAA 3HT2A 5FYTA 5DDJ1 3VDBA 5L7OB 4XHBA 2WS93 5GLWA 3LEKA 3AC0A 4RQPB 4B29A 3VD7A 1IG0A 1TMF1 3ZIWA 4BQ2A 2VTXA 2QQKA 4CUBA 1UIKA 2JEMA 1NLQA 5C71A 4FQZA 1RB8G 5IHRA 2VNRA 2NP0A 1W28A 1OF3A 1UYXA 2DVBA 1MEC1 4B3NA 2HJIA 3VBSB 3ZFEC 1DGWA 2ADDA 2AGSA 1PMHX 2PHWA 4JZRA 3VDDA 3AKQA 3BTZA 1ZM1A 2EIEA 4E4SA 2GC0A 4CSWA 2DTWA 2O8QA 1VIWB 4PI2A 2XH6A 1LGNA 3CIHA 3ZN5A 5ACA1 2C1FA 1TNRA 3SMHA 2W91A 5FO9B 4Y22B 3O1VA 2G1MA 3AP9A 1OFNA 4LOTA 1WLWA 3OG2A 4N53A 4YARA 1HB1A 1RUH1 2I74A 5C9AC 1DLLA 1CJPA 2VQAA 2BPA2 3PVBB 4H3WA 1H8TB 1UY0A 1CAWB 2WYSA 4R9CA 1IQAA 4XFIA 4E8CA 2LW8A 3MIDA 1B35B 2YGLA 3DXTA 1D4M2 3CLPA 3LDKA 4B7KA 3DPRC 2ZBJA 3MZHA 4HFSA 2OS2A 2JG8B 2ZAAA 5CFCA 4FPHA 4FCAA 4TN7A 4YVWA 3WHUA 5C6CA 1OA4A 1ZRFA 2Z79A 2PHTA 2QNKA 4JHTA 2XJVA 1JU3A 3DUIA 1QEXA 3ZDVA 1WCKA 3WX5A 4UI9L 1UIJA 4AW7A 3SKJE 3VKLA 4GMP3 3M70A 3BTYA 1A8DA 4NUBA 3ZXJA 4AK3A 4E2SA 3O0VA 3AB0A 1MZFA 1FMD2 1HJFA 3H50A 4COVA 1J83A 4CP2A 1JN2P 1WWYA 3VD4A 1O3TA 2BQPA 4W6YA 1ULGA 5LY1A 2ZGUA 1MS5A 1YI7A 3H7JA 2Y6JA 2VVFA 4QHZA 5K7PA 3HVDA 4ZU7A 3GZTB 4MUVA 4Y33A 3PHMA 4YM1A 4F7ZA 4LA3A 5LBBA 5HBAA 1MS9A 4XF0A 2O0OA 3T1MA 2VVEA 1MACA 1OKOA 2A6XA 1ZBA2 3I2DA 4GALA 4XQ4A 1VBD3 1LEDA 4FPCA 2VUDA 2A70A 1EUTA 3BTXA 3LGRA 4A2UA 3OB8A 2DVGA 4NIIA 1QJY3 2LUWA 1GZWB 4XUPA 4BB3A 4Y1XA 1PVC3 2RR13 5HI0A 2X5IB 1NCRC 3U10A 1LHOA 3ON7A 2FCTA 3LOIA 4G4FA 1VP6A 2W52A 3HMYA 4NHKA 5CVRA 2AREA 2B45X 4LK6A 3WG4A 1EYBA 4JKKA 2BNOA 1D0HA 2QQVA 1W9TA 3INAA 2IXKA 5HV4A 4J1XA 3TAYA 3VBOC 1GUIA 4GH4B 1HQLA 4QX7A 4NIGA 4JQTA 1LNSA 3AMHA 2PQSA 3CJXA 5HCHA 4XJWA 5BNOA 4YFZA 2X05A 3U14A 3U1XA 5DZGA 3WEZA 4BU2A 2B7YA 2BFUS 5FZLA 3Q8AA 4CDXB 4NHYA 4CEWB 2V5YA 4HN0A 4RN5A 1QJEA 1SQ4A 4WVMA 5FWJA 1EP0A 1HQWA 4JAAA 1O59A 1UOGA 4V1PA 4S2FA 2VR4A 3DF0A 4UW5A 2ZS6B 4BQ5A 1QJX1 3RZKA 3AMPA 2JDKA 2NQYA 1HJGA 4IEQA 4YW5A 2R32A 3CMGA 4XF9A 4Z82A 4AI3A 3N4MA 4EN8B 1XOYA 3AJZA 4IEZA 3VBUC 4IGOA 3VD9A 2XJQA 4YG6A 4EWDA 3ZYJB 3OJBA 1YCIA 1VBA3 4ET7A 4UFLA 4UF0A 2GC3A 3T3YA 2W1SA 3LAGA 2ENRA 4UBGA 1DYOA 4AFMA 5A32A 1RMU2 4DXSA 1YO8A 3BGAA 5FZOB 3FBMA 4WVWA 3TBDA 3TNPB 4LBQB 5LCWL 4HONA 2ZJCA 5FZ4A 5DAXA 4ZKTB 3M4FA 4INDA 4QX8A 2C4XA 4UAPA 4XPVA 3DV8A 5AFBA 2I45A 2ID4A 1DZRA 3PTYA 2BERA 2GN7A 4LBNA 1QJZA 4R4ZA 3KWVA 4TXWA 4MGKE 5H9QA 1R64A 4Y5Z0 3O12A 5IFTA 4L0PA 5ISLA 3HPNA 5I0TA 4IV3B 1ND2A 5C8CC 2C6SA 5JWPA 1W8WA 4M3CA 2J1VA 1SLLA 4YM2A 1J1LA 1XE0A 1F5FA 3VBFC 3WDYA 1CPNA 1PO13 4PDWA 2A5ZA 2R061 4EE2A 2YHJA 4MGIE 5A6YA 2WKKA 3SLIA 3KF3A 4WZCA 2ZEZA 4Q4W3 1K5MA 2TEPA 3LQCA 3KS7A 5JDBA 3NW4A 1CR7A 1KDMA 2DWRA 2Y26A 3CKHA 2PYTA 3GCXA 3H42B 5FZ0A 3TRSB 5E8AA 5HPOA 1Y9MA 3C2UA 4FT8A 2VGDA 4ITCA 4EZ4A 4R52A 2J1AA 2B46X 4XE9A 1JZ6A 1RUD1 4L8QA 5BXXA 4HXCA 1ASJ3 4B8EA 1OURA 1WW7A 1CZSA 3LWCA 5C3OA 4P9LA 5HCBA 3SISA 4K3UA 4YSFA 2JB8A 2OZJA 3NNMA 2QZ2A 1APNA 4I01A 1VBD2 4QDQA 4CDWB 3VLBB 1R093 4WM7A 3ETPA 1RUNA 2ZGLA 5CYYA 4CP9B 1QJY2 2RR12 5C3SA 1V9U1 4BCUA 4CCCA 2XBO3 4DO0A 5JZGB 2WA4A 3GZAA 2VY0A 3T30A 1GOHA 5C70A 4XJUA 3CO2A 1Y9GA 3RWKX 1SLAA 2XJPA 2LROA 4OHYA 2HWE2 1F2NA 2DFCA 3LDBA 1J3PA 4BQ3A 2XWBB 3C7HA 5F2SA 4IGQA 2PHUA 3OPWA 1QY4A 2XVGA 5J96B 4FVVA 1OA2A 5FZDA 5I0UA 3VV1A 3H1YA 3AXEA 4AVAA 4YGCA 4BWOA 1DIWA 2XWJB 1W2AX 2FDKA 3A4UA 1ZYBA 5DAWA 3AZYA 4PQQA 2WNVB 2EVXA 5LWBA 3CJIB 5FYCA 4WBBA 5DUXA 1W6MB 3DXUA 5E89A 4CCEA 3K77A 1V6LA 3J9SA 2EXHA 3C8XA 4N9HA 1CAVA 1GR3A 3KT4A 5JCTA 4LTAA 3WUCA 1J59A 1RINA 3LSEA 5JR7B 4Y24A 1QNYA 5A70A 1LR5A 4GWMA 2IXIA 1Q8VA 1OUXA 1DF0A 4KQ7A 1YNAA 4QB2A 4AQSA 1SZBA 2EIGA 1JOPA 2UY9A 2WN3A 1PGW1 4N43A 5EYYA 5A3LA 2ZGTA 1A6CA 1QJFA 2LRPA 1OOPB 2DF7A 3OBTA 4CRQA 1S2EA 3WW1A 1AL23 2FMDA 3P3PA 3UGHA 1ZZ9A 1VBA2 3BU7A 1NQDA 1Z7S3 4KWJA 4U2AA 2CAUA 1GQHA 4XXPA 3AX4A 5GZEA 2GMPA 4QDSA 4GB32 4UT5A 5K8SA 4YFWA 2F4LA 3D6EA 2IXLA 3THTA 1CX4A 3VBRA 2WC2A 1Q5OA 4RGKA 1XBFA 1F31A 2BGCA 2HBTA 4R8HA 4HG6B 3ACIA 4F3JA 3W20A 3PMEA 3K46A 1CGPA 2ZHLA 1WA4A 1C4RA 1HXS2 5T55A 5B4NA 4HK8A 1DQ2A 2WS91 3JUUA 4N7IA 5IUQA 3VZNA 4LORA 1QQP3 4JHZA 3VKFC 4BQWA 3WQ1A 4JTNA 2XMLA 2ZGQA 4AVCA 5KHHA 3JQWA 4IE7A 3WNKA 5T52A 4CDQC 4M4PA 1YC61 1O5LA 1DGWX 1PO12 3D0SA 1OH4A 5DZEA 2VQUA 3QACA 3KMHA 2WRAA 1W04A 1XSQA 3USSA 3ZFGA 1R1A3 5CNAA 1FOD2 2R16A 5LW9A 4YZ4A 4Q4W2 4E9KA 4TLGA 2DFBA 4Y4YA 1STMA 4PQ9A 3LA2A 3H8UA 4ATEA 2E6VA 1RIRA 2QQWA 1OBNA 2PLV1 4LE4A 5LA2A 1S0IA 3AZXA 1KDKA 3PVEA 1CVNA 4QQPA 1E5HA 1S55A 3J8F3 4QQLA 1XYPA 2CYFA 2VMDA 4A3XA 4XVHA 2AENA 3OGRA 2VMHA 5BNNC 2ZGOA 3BTAA 4RGAA 4CP1A 5C3RA 5SV8A 3ZFEB 2XL9A 2JE7A 5A6QA 2WZR1 3AL6A 2GN3A 3FZ3A 3WNMA 1LGCA 2RS53 4LBKA 5FY9A 1UU5A 4XFGA 4BQXA 2GH2A 3I2HA 4C91A 2TNFA 3IKWA 1UZ0A 2JKXA 1CQ9A 4BOWA 4DY3A 1U5XA 4U36A 2MPFA 3M3CA 4FPJA 4CU7A 1FAYA 2RM22 5C9AB 3KB5A 5FDBA 5J36A 3PMSA 4GIQA 2RDNA 4GMP1 1ENXA 2VBBA 3AYCA 3WUDA 2Q8EA 4K8FA 4P02B 4C90A 1LOEA 1UYZA 4QX0A 5DUVA 1UY4A 1O8SA 3BB6A 5I8TA 1DCSA 1UU6A 2EF6A 3LPFA 4OFGA 2D40A 2XGXA 2P2KA 4FPGA 4SBVA 4AI9A 3C7FA 2FZ2A 5EIYB 3VB9A 1WD3A 3B69A 4HKWA 1GMMA 4UBHA 4OHZA 3BPZA 4OVEA 4QX3A 4R4XA 3RFRA 4C1XA 5FOBB 1DYPA 2A75A 2E32A 5FZKA 1W2NA 4DXTA 1PMIA 3KD4A 2WWJA 2XJRA 4W4ZA 5GKAC 5APAA 3ZN6B 3AKRA 4E8DA 2PN5A 4LKDA 1AXKA 2JD9A 5DAQA 1W0NA 4CUCA 5L7OA 1EAH1 4DOUA 2JE8A 4RQPA 1ULPA 4EJRA 2QFEA 4JKLA 5LK7B 2PFWA 5L9BA 2XG3A 4M4RA 2ARXA 3SH3A 3WW2A 4BM8A 1PK6C 3TEXA 2XPJA 1PVC1 1W99A 3DYMA 4TWTA 5FV3A 5IVBA 5L73A 2YBSA 5B4XA 1PZ7A 4DXZA 2RMU3 3M3EA 2VZ3A 4LLOA 3VBSA 4AAXA 3TB0A 3GXUA 4GKXA 2W1QA 3H9AA 3JU9A 1IS4A 1MQTB 4AI2A 4QGNA 3PVOA 4PLOA 2XVLA 2Y6LA 4D7SA 3SH5A 4Y22A 1FI2A 3OBAA 5DAVA 3KQ4B 3NKTA 2FDJA 2OKXA 2BTVC 1NCRB 5EWSA 2YV8A 2E33A 1H8TA 1XE8A 3NMBA 4XFFA 1CAWA 1LOAA 2WJSA 3CU7A 3WP3A 3ZYRA 1QF3A 4WM8C 1B35A 1KS4A 1C1FA 2X10A 3GZUC 4YRDA 2WSVA 3ZN4A 4ZXEA 1A78A 1K12A 5FP9A 4CEYC 2X09A 2Q4SA 3ZSKA 3EB7A 3VBOB 3FHQA 4GMP0 5FY8A 4Z2WA 4E27A 3IPVB 3V56A 4AG4A 2O8OA 2EICA 2GNDA 1LRHA 3AVRA 2XLFA 1LCLA 1W9SA 5LZ6A 2VMIA 4AF9A 1QQP2 1ZRIA 1UOBA 1PIV3 4H55A 1GQPA 2J22A 4Q2FA 5GALA 3ZLIA 3WQBA 1F35A 4K8RB 4DUWA 4EZHA 1U0AA 2D3RA 2LALA 3PUQA 2B4KA 5FPXA 5FZMA 1SBEA 2K46A 2YY1A 2K2SA 4MX3A 5C5UA 3T2QA 1R1A2 4A6OA 2BV4A 1SFYA 1DLCA 4RR3B 1ENQA 1W8OA 4FOVA 4LLFA 1PO22 4E4DX 1FPN1 3EJKA 4RS5B 5A7OA 5F9TA 3MW2A 1YJKA 4AEMA 5A3TA 3J8F2 1D2QA 2VOXA 5A3WA 3KQRA 1IZ3A 1X82A 4LHLA 4R9DA 2HBUA 1IS3A 3VKNA 4AGGA 2OUHA 3BCWA 1R1ZA 5JMOA 1YFXA 1GZWA 1ULFA 1H30A 4CXXA 3ST7A 5IATA 2X5IA 1OT5A 3H1MA 4Y3OA 3VDCA 1C8M1 2F17A 1PMJX 1VRH2 3ACGA 2Q8DA 3GBGA 3QOPA 2WT2A 5DDJ2 3EYPA 4XIKA 4OUEA 4XDPA 4FP2A 1EPZA 3I2GA 1TMF2 4FOYA 1YFWA 4MG2A 1PO11 1SMVA 2VNOA 1GANA 1QJU1 3MLJA 2VBPA 4CXWA 5CU1A 2ZKLA 2D6NA 4GH4A 3OD4A 4RYDA 3LFMA 2O14A 5T5JA 1W6OB 1MEC2 4AYUA 4Z8BA 2Q8CA 1ZREA 3X29B 4QHOA 4TSVA 1TNFA 1UKRA 4WVZA 4UFMA 5JR2A 5FK7A 5FP4A 2D43A 2HKXA 3AFGA 3SQOA 2UURA 4X8PA 5ACA2 2ZHMA 4CDXA 1IOAA 1HRI3 2XDVA 4IL7A 1ASJ1 4IUGA 3POEA 1GP5A 1RXFA 1WBLA 2WN2A 2VBDA 1MZ6A 2QZ3A 4GWNA 4RD7A 5IVFA 2QQOA 1RUH2 4EN7B 2GH8A 5FYUA 1PNGA 4G3YC 5FQ0A 2YUEA 5CFDB 1LHUA 4YZ1A 5F5IA 5F7UA 4EN6B 3DYPA 1NT0A 1R091 3LCPA 1SACA 1TEIA 2DVDA 3HBZA 4NRQA 3SNMA 3UGFA 4HBNA 2PHDA 3RYKA 5KXDA 2LS6A 5J37A 1N3QA 4NWWA 2CDPA 4CU9A 1QOSA 3DKQA 5A3MA 3RG0A 1I5PA 2XBO1 4NWVA 3KHCA 4OQ8A 2PA7A 3WF3A 2DV9A 4GWIA 2OYZA 1OD5A 3P6BA 3O1SA 5DZFA 3ZXFA 1B09A 2QUOA 1JMUB 1POQA 1EUUA 2VZRA 3QD6A 2VOKA 1WLDA 1O4YA 1YUDA 2WO3A 3CF6E 3SH4A 5FPUA 4M0HA 5J1XA 5FZ8A 4LBOA 1VAKA 4LBQA 1L3JA 4Q0SA 4MOAA 3SITA 5J3UA 1NCQB 3ZSLA 4EROA 4AI8A 5JSRA 3B02A 4K9SA 1G9BA 4PIYA 1AYN3 1ZZCA 1VBB3 1RUD3 3I8TA 1ONAA 2JENA 3MIHA 1ALYA 4JGZC 3R4DB 1YQ6A 4R9AA 3ZXDA 3U4XA 4IV3A 4QPIC 3HIFA 3BUCA 4FFHA 4HVQA 5FPLA 3MDPA 1W39A 1REFA 3JQXA 2R0HA 1JZ7A 3LKJA 3L2HA 4HANA 5FUIA 5FYVA 3POYA 1PHMA 4XFAA 1QWRA 2X8KA 1WKYA 4LULA 3DN7A 2ZGRA 2ZX0A 1VBE1 5BUVA 3URFA 3HBKA 2VU9A 2XUEA 1JYTA 1NA1C 1Q8OA 1AL21 1N1YA 5C4WC 1W9YA 2I2SA 1CAXB 3CBNA 1Z7S1 1G9CA 3S0MA 1PX4A 2QQJA 2NM1A 2WQ4A 1KS5A 5FPBA 1BMV1 1WW5A 3WG2A 2DVFA 1YQ5A 3LDRA 4UFIA 5A3UA 1EV11 4YW6A 5IK7A 1VLNA 3H1WA 2BFUL 5IVCA 3WP4A 1GWLA 3N9QA 2J1UA 2FMYA 3NNGA 1ZX5A 3S30A 3MHZA 2OQ7A 4CP9A 3I3BA 3J4UH 1AR63 3K51A 4NIHA 2BBVA 2GP5A 2AC1A 1DGLA 2ORXA 1X9TA 3N35A 1JZ4A 2Q1ZB 1NKGA 4KH9A 5JZGA 4ARXA 3WDVA 3MW4A 3OEBA 2W3JA 2HWB1 1UF2C 3FWEA 4AFBA 2QQLA 3IIIA 5IVJA 1RXGA 1QJX2 2ZMNA 5FOJB 5ABJC 5D2AA 2HLEA 2QBXA 3KT1A 4QKBA 5LA0A 1MPXA 3N7MA 4HKOA 5G04L 1ZRDA 5FZAA 4FPLA 3RJ2X 4AOCA 5A3OA 5KXBA 3CZUA 2RV9A 2MHFA 4KGGA 4LUMA 1W03A 1C1LA 3ZXAC 4LEJA 1S4CA 2CTVA 2G19A 2VZTA 3U37A 3DECA 3E6DA 5CIRA 5F37A 2BVVA 2DCYA 4KWLA 2VCAA 2WNVA 2D44A 5F1RA 3MF6A 1W6MA 3PLQA 3FFQA 3VDDC 2ET7A 4FTSA 1QDCA 5FYMA 2VZOA 4Y26A 1D0GA 1MS4A 4HK9A 2RJKA 2RS51 4NIDA 1UY2A 1YI9A 5T5OA 4UFKA 4IDZA 1GICA 4XTPA 1MZEA 5EHDA 4Q0PA 4AVBA 2VOWA 3PVNA 4NAMA 2YC2A 1DDLA 1OPMA 2F4PA 3OUJA 4ASLA 2B5HA 3THPA 3MEPA 1PM4A 4KU7A 5FMBA 1UZWA 4NE9A 2D3PA 3PIGA 1Q56A 1OOPA 4XJZA 1KRIA 3I4IA 5DUUA 2EAAA 1NE6A 4B1LA 4Q26A 4FFIA 1RUG3 2DURA 3B7MA 3NNJA 3PU3A 5JXHA 5F3GA 2Y64A 1YQ8A 3ALQA 3W59A 2WUHA 5CFCC 4E2QA 2R062 2XKPA 4YVWC 2HWF3 4LHSA 4A7KA 3Q8BA 5I8SA 3C3VA 1VBC3 2Z42A 1W06A 1BLZA 2BJSA 4G9SB 3B94A 2RDRA 4OHWA 4QU2A 3H8XA 2TBVA 2P34A 4BJ0A 2RDSA 2PLV3 2UWBA 4YPJA 2VAUA 1QHDA 3VZJA 2WZEA 1FV3A 1RUD2 5JOZA 4SLIA 3D5OA 3ENRA 4EYUA 3CEWA 3B9CA 1JHJA 5B2GB 5GM0A 5FBZA 4MVTA 1XU1A 1FT9A 2PHRA 4YG3A 4E4HA 2WZR3 4YW2A 5LK5A 4NHXA 2VE1A 4QPGA 2D6OX 3MIGA 2A7AA 2XHKA 1FX5A 4JRLA 3WR0A 1VMFA 4IE4A 2RMU1 1Q8SA 5DXDA 4FPYA 2E53A 3BODA 4QQOA 2CGPA 1V9U2 1AVBA 2H0BA 1FNYA 2DCZA 2A3WA 2WA3A 1LB2A 3LIHA 4Y1ZA 4HZFA 1ZNPA 1J84A 4JTOA 5ANQA 5JOWA 2Q1MA 2D5HA 2JX9A 4DRVA 3J7LA 5KHJA 4AGVA 1PK6B 4I3GA 2HWC3 4YW3A 3WNOA 1PX3A 1CWPA 2WT0A 3IDBB 4MGYE 1WUVA 2ARAA 3BALA 4QX5A 4Y1UA 2C5DA 4W6XA 2ZACA 3ZFEA 2A6VA 3AP6A 2R7EB 1GBGA 2Y33A 2G4IA 2RJLA 2FCVA 4ORFA 3SCFA 1KXGA 1CAUB 3KM5A 5IAXA 4DRRA 3VHNA 1HN1A 2ETEA 2JG9C 1EAH3 3ZXEA 1H2MA 1N3OA 1YLLA 2W1UA 5BNOC 2WLPA 2PAKA 2VULA 5C9AA 5JXGA 3BKZA 2D6LX 2P3IA 4AHWA 3PUSA 1A3KA 1PIV1 1XNTA 2PELA 1H1AA 4IE5A 3RZJA 4WM8B 1AXZA 5A7SA 1ZA7A 4CCKA 2Q0AA 3VBHB 1NXD1 1WW4A 2HWD3 3IZOA 4CEYB 4PBPA 4Q4Y1 5A1LA 1PGW2 3OF1A 2VNVA 2VG9A 4PLNA 3RMYA 4QGLA 4K40A 1D2SA 2E26A 1W2TA 4K21A 5FZGA 5IK4A 1OVPA 2GU9A 4YM0A 3ZR5A 5CBLA 1O4TA 1TME3 2HYXA 4XUQA 4I09A 4ZONA 3AL5A 2GSYA 4O65A 4KMQA 5JMCA 3ZN6A 1COV3 4B4PA 2VXRA 3ZPYA 5LASA 2DBNA 1ULOA 5LRSA 4L11A 4QGMA 4XURA 3NJVA 3LA7A 3ZMNA 4BDVB 3OUHA 1N47A 2P3YA 3UKVA 3UKTA 5CG8A 4H7MA 4DZGA 1HB3A 3CQOA 4YGEA 2D6KA 3IBMA 1MS0A 1XC6A 2Y38A 1GLHA 4AEJA 1MVEA 2WS92 3WLUA 3E6BA 4IV1C 4K7JA 5DG1A 1MQTA 1YWKA 5D8AC 3RZLA 4ASKA 2JDUA 1OLMA 4Q0QA 2XLAA 1ND3C 1H2NA 5DQ0A 4ISRA 5LBEA 1X50A 1NCRA 3VD5A 4UFJA 4V2VA 2GP3A 1ODMA 1DQ5A 1RJ7A 3WXPA 1K5JA 3AZVA 1GSLA 3K4ZA 1FPN3 4C0BA 1FV2A 3RZZA 4PDWC 1DG6A 1HRI1 1LHVA 2PLV2 3I97A 3OSDA 1AYM1 4XEZA 2R041 1ZRCA 5CZKA 1S2BA 3LSDA 1OQEA 2VVDA 3VBOA 1FATA 1K5MC 2OVUA 3WNPA 4BIFA 2V73A 4QWNA 3UV9A 2VCMA 4H2AA 4JQRA 5BYNA 1OLQA 2WZR2 1CJDA 2LM3A 3N7KA 3WOGA 2BWCA 4LUKA 1C8M3 1AZDA 2JDZA 1H2KA 5DN2A 4D94A 2IFWA 3C7OA 3V65A 1V6IA 3WF4A 1ULCA 2AYHA 2ZZQA 2W39A 1T6BX 2V09A 3GBFA 2XOMA 2OA2A 4I0WB 4RR3A 1QJU3 2FCUA 2VMEA 3ZYHA 2NN8A 1G7YA 3PL0A 1XRUA 2RS11 4P00B 5CKQA 1GWKA 1U12A 1BVP1 4RS5A 2BBAA 4GJZA 3D3AA 3IWZA 2VOTA 1D7PM 5HCAA
chains in the Genus database with same CATH topology
4L2NA 1F9KA 2E7QA 4BLIA 5T5PA 1WMEA 2ZABA 1H4GA 4DY5A 1AYN1 5GLTA 1VBB1 1YXWA 1U5ZA 4P14A 2K9ZA 4GA9A 1JUHA 2WNUC 3N7LA 3W9AA 4K1YA 4AHZA 2RE9A 1EAH2 3JD73 3USUB 1BYHA 1RUF3 3UL2A 1PVC2 4IEXA 2EA7A 1DYKA 4MGZE 5FO8B 1AXYA 1WMFA 2N7GA 4JGZB 5FFOC 4NR1A 1OMIA 4OUSA 5GZDA 2CWMA 2PHXA 4FO9A 3WV6A 1X36A 4FOQA 2GC2A 3O0WA 2G9GA 4MV2A 4XFCA 2UY8A 3DGTA 4N43C 5K0UB 2X29A 5CFDA 1QU0A 1DHKB 2R6QA 2RS31 4Q4X3 4Z1VA 2NMNA 1R081 4OI2A 4DS0A 1LJ7A 1AR61 5BNPA 1LKNA 1SFNA 3R4UA 5C4WB 1YHFA 4S2DA 1ENSA 4OHXA 4JGYB 1WCSA 3IMNA 3ES4A 1H2LA 2PQQA 4HMZA 2ZTNA 3VBRC 2GC1A 4M3CE 1CIWA 2ZZJA 2GALA 4CYDA 4F83A 2DUPA 5EJ3A 1VBE3 4BLJA 1NCQA 4M0NA 4RHV3 1NE4A 4Y20A 4AGRA 4I0AA 5KXEA 2MNGA 1FPN2 2XJTA 2MEV1 2E7AA 5ABJB 1RL3A 1EV13 2WFPA 3VHRA 5LEKA 3AP5A 2ZX1A 2D5FA 2BW8A 4NHMA 1CONA 3OCPA 1I6XA 1C8M2 1SLCA 4N9IA 3V0BB 4NO4A 1WCDJ 2WSUA 3ASIA 5BPXA 2HWB3 4AFCA 4AQ6A 4GKYA 4BMEA 3ZDSA 2HEWF 1RUG1 3VL9A 3NAPB 1BEV1 1CAXA 2E9QA 3G6JB 1QJU2 2HWF1 4JCKA 2KM2A 3ZXKA 2EAKA 1C28A 1VBC1 4XFHA 2YXSA 4XIOA 1CD3G 5CB7A 5I91A 1VB4A 1O3SA 2R073 1EY2A 1AR93 2QKDA 3EXUA 1IKQA 1ASJ2 4YVSC 1I3HA 3ETQA 4YVWB 1QDOA 4KU8A 2P37A 3FUOA 4JVAA 4ZXKA 2D6PA 5E88A 3WW3A 1R092 1S0JA 2LTNA 1H1MA 1HRV1 2CL2A 3ZFFC 1E57A 5L7OC 2YZ4A 1N3PA 3GYDA 2XBO2 1XYOA 3L9JT 3V64A 4RQPC 4ES9A 1MVQA 4YZ3A 3MLKA 1JYCA 1VAVA 2YDEA 5DUWA 3V0AB 3DPRB 2B8MA 1SEFA 2HWC1 3RYRA 4FXGB 2YYOA 2VNGA 1V6OA 2D97A 1PM7A 5L19A 4P9GA 5L36A 4NVPA 2DUQA 4MH0E 1C8NA 4KNCA 4L92A 3FJSA 4FTBA 3MPBA 5AC91 3RMXA 3MPPG 3FC0A 1TE1B 1X7NA 1POV3 2HWD1 1RUE3 5IT6A 1S0DA 1YJLA 4AI0A 1VBE2 1C5HA 1KFUL 5AVAA 2A73B 2JG9B 4IQPA 3KSCA 5BNOB 4LBJA 1AL22 1Q43A 4FPFA 1YIPA 1TME1 4MXVA 4COZA 1XNCA 4MXWB 1Z7S2 1ZVFA 4QD2A 1COV1 3QLQA 5E1RA 4FPOB 3WW4A 2UU8A 1RGSA 4CDUC 3VKOA 1BMV2 2IZWA 3RI8A 4OI4A 3RI9A 5KHIA 3VZMA 1EV12 4UXAA 4XDQA 4KG0A 2JG8A 1AR83 3UJQA 1PVXA 3K48A 4Y1YA 3E5UA 4PIXA 4IEYA 1HW5A 5JPMB 4QPYA 4AEDC 3SXWA 1WBFA 1N1SA 3VZOA 4NHLA 4LA2A 1HKDA 3WT3A 2HWB2 2QVSB 3EO6A 4HPKB 1X8EA 2X5IC 4P9YA 3ZVXA 4DQAA 1PK6A 1C5IA 5A32B 3MICA 1O91A 1HQNA 4Q4Y3 2FHRA 3JBG1 4Q4V1 2VUJA 3IN9A 4HN1A 1WMDA 2WFF1 4IV1B 4RSUA 1BXHA 4EV0A 2QJVA 3NV2A 5JOXA 5D8AB 3U11A 1CAUA 2ZKNA 4NOTA 3MI8A 4IEVA 5CAZA 1ND3B 1IPKA 3VBUB 3U07A 4META 1LULA 4Z92B 4YGDA 4OHVA 3RSJA 4XJAA 3P3NA 2HYKA 2G9FA 4C1WA 5FMOS 1BCXA 2RS52 4CDXC 3VUOA 4WM8A 4H7LA 4Z07A 1RVF3 2F6BA 3APBA 4Q8KA 3VBHA 5J7MA 5SV5A 4CEYA 3OGGA 5EYXA 3EBRA 1OLRA 2H6CA 1UL9A 5FAXA 1H0BA 3S6PA 2JICA 2WINB 4P9XA 4FBFA 3AKTA 3R6SA 3AZWA 1BKZA 3FBYA 5C8CB 1QKQA 1LHNA 5JI7A 2UWCA 1DU3D 3VBFB 5BV6A 2D7FA 1AYM3 2R043 4PBOA 1X33A 2OW4A 4YG0A 3ZYPA 1ZBE1 1LOCA 4OZXA 3FE5A 1UPSA 4QMAA 4ATFA 5F6LB 2P3JA 3JD71 3ZXGA 2D6MA 3N7JA 1GFF2 4W6WA 3TWIA 1CN1A 1RUC3 1MR5A 1RUF1 3OPZA 4XMAA 1G8WA 2Q8OA 4AVTA 3AM2A 4BYYA 2RMU2 2B42B 4IV3C 1W6NB 2A6YA 2WNUB 4H14A 1LOFA 4PLMA 2XLGA 1S0CA 2WZPP 5GZFA 1S0EA 2RS13 3AFKA 4L9BA 3VHOA 3ECQA 1YFUA 3M1HA 4R9BA 4DB5A 4XQDA 4LBQD 3AK0A 3KGZA 3WDTA 1XE7A 3MGUA 4PCRA 4Q4X1 2WWSA 1LU1A 3CNAA 4MLOA 1Q3EA 3T2TA 1GKBA 1DGRN 1IS6A 4XILA 4XETA 1LESA 1ZZ6A 1NY71 3OTFA 4LHKA 1XXNA 3WD5A 5JIUA 5FLIA 1PIV2 2B39A 5K9YA 4Q8LA 2UYBA 5H9SA 4LNVA 4YM3A 5AFEA 3HR9A 3VL8A 1HLCA 2EXIA 1TQ5A 4Q4Y2 4RHV1 2EALA 3WNXA 5J48A 3AYAA 2BNMA 1AHSA 3JB4C 3OYWB 3GALA 2NMOA 4Q1RA 3VBRB 2W68A 3LA3A 4COWA 3PJQA 3AKSA 2VQ0A 4W65A 2RS33 1UZYA 4CDWA 2XUMA 4BZ4A 4FPEA 2WIIB 3USUA 1R083 4LBMA 1LECA 2DU1A 4J1WA 4JC1A 1RC6A 1VB2A 3G7DA 3NJZA 4Q0UA 1PNFA 1FMD3 5FPZA 4BQ1A 2ZGKA 4JGZA 4BMBA 4FSJA 1AR71 3T1LA 3AYDA 3QBQA 3IM0A 3ATGA 5KBFA 3M2MA 4YZ5A 2GMMA 3TN91 1BQPA 4EWAA 2R1DA 2YPJA 1W0PA 5A33B 1XNBA 2A6WA 2JKBA 2UYAA 3IDCB 5K0UA 2D93A 3OY8B 2ZHNA 1OOPC 2R071 3MIBA 1BBT1 2E7TA 3PJYA 2ZA9A 5EZWA 3RDIA 4OUMA 4FXKB 3NSTA 1AR91 2HEVF 2MEV3 4CDQB 4RL7A 1HRI2 3CJIA 1AYM2 5C4WA 2R042 1I9RA 4QT6A 2WL1A 4CP0A 1CPMA 4JGYA 3MIEA 1QOOA 3ES1A 5T50A 5FRAA 3KLSA 4K20A 1NG0A 2CAVA 4LO5B 5I0SA 3B5LB 3QH7A 4N53C 3RJRA 2WLQA 2GDFA 5BNNB 5I93A 4YVSB 1RJ8A 1V6NA 3AP7A 1XYNA 3H3ZA 1Y9QA 4M3CF 1HX6A 2VUAA 1W2UA 3EHKA 2W0XA 3VN4A 2R1BA 1BEV3 2BWAA 3AYEA 3HN1A 4QPGC 5GLZA 3NV4A 3SCHA 2RS12 1SBDA 4XJ8A 4L99A 4D7TA 5ABJA 2ZGNA 4QXKA 3ZFFB 1AF9A 2QCSB 2GNTA 2I07B 1AYN2 3E97A 1VBB2 4YLZA 1JYIA 3QH6A 5KWRA 3V0BA 1QH7A 1NZCA 4P5HA 5AVPA 3AMNA 4I02A 1AJKA 3NAPA 5FTTC 1RMU3 1H9WA 3AZZA 1POV1 1HRV3 1RUE1 2KA3A 3VKMA 1A8MA 3MLLA 1J3QA 4LR4A 4NN0A 5JSPA 3VZKA 3ZSJA 1T6GC 5DG2A 4A7ZA 2EXJA 5TSWA 1DBNA 1YYNA 4K1ZA 4S2GA 5JAXA 5JLVA 3M3QA 3NV1A 4HLTA 4I3PA 1RUI1 3M7AA 5FLHA 5C33A 2D98A 2A3YA 2RS32 3H7YA 3FLTA 3ZX7A 1AR81 1R082 2Z69A 3ZYIB 1W6QB 1JXNA 4AFAA 4MZUA 1G6NA 4XOGA 4AEKA 1AR62 1VAMA 3S7IA 1Q8PA 4XFBA 4IESA 2BNNA 5AC93 1QH6A 4XF3A 4CDUB 1PGL1 3H3UA 2XJSA 3V0AA 2GMEA 2TUNA 3DPRA 3M3OA 2ZHKA 3D8CA 1O3QA 2X53S 4IEUA 1S0FA 1YIFA 4HETA 1LTEA 3Q9OA 1MQTC 4FP3A 3NVCA 2VMGA 4IETA 4X6RB 1LGBA 4AEDB 4Q27A 5T54A 5GLVA 1REDA 1Z0HA 3E6CC 3ROUA 3WCRA 2D3SA 4XYXA 3SCGA 2MEV2 1Q8QA 3HWJA 5F5QA 4YW4A 1AX2A 3WP6A 1GZCA 1POV0 4AVVA 1ZRRA 2CY6A 3GHMA 1LENA 1ZZ7A 5EV7A 1RVF1 1GNHA 1X8MA 4DFSA 4OULA 2HWE3 3RPQA 4EN0A 2ILMA 1OQ1A 2DYCA 3OD0A 3EQEA 3CL1A 3NO8A 2JG9A 3KT7A 3ZYGA 1RTVA 1KQRA 1RUJ1 2JE9A 1RUG2 1GZ9A 1RHI1 1UKGA 1IGOA 3HQXA 5H9PA 1BEV2 4MXWA 4TLFA 1ND2C 2HWF2 3I7DA 4XMIA 1VBC2 3JBG3 4D3WA 4Q4V3 3AXDA 3NV3A 2GAUA 2WFF3 3E5XA 4RR3C 4COYA 5FQ0B 3GF6A 3HAGA 5FLJA 3JB8A 4RS5C 1JUIA 4AFDA 2PHFA 1DZQA 3IPVA 3RRDA 2GZWA 5JOYA 3JZVA 4YZ2A 2VW1A 1YRZA 3SHRA 4M01A 1RUC1 1BJQA 4DMIA 2CV6A 2WQZC 2BEOA 4HPKA 4LE3A 5D1IA 3M8LA 1JW6A 4D69A 1HRV2 4GB33 2ATFA 1NLRA 3GHNA 4AWDA 4WM7C 3WDWA 3N3HA 4AXOA 1FNZA 4IV1A 3LZZA 4FTEA 5D8AA 1O7FA 2YC0A 3ACLA 3MFAA 2GNMA 1SLBA 1HXS3 2HWC2 3VZLA 1ND3A 4QM8A 3VBUA 1GV9A 4JV4A 1CESA 3A0KA 1S1AA 3WINE 3AMQA 4ASMB 3NWKA 1ZBE3 5CG9A 1V6KA 3WG3A 4DNYA 1Z78A 1U5YA 3I59B 1V6MA 3VGIA 1Y3TA 3ILFA 3HT1A 3ZXLA 1FOD3 1W0OA 5CFDC 1AJOA 5GJ6A 4OLLA 5AC92 4X6QB 1ZZ8A 2UWAA 4YGBA 4HSJA 1DGRA 2DVAA 1W6OA 5BNPC 1UX6A 4DPNA 2ZMLA 2HWD2 1WD4A 4FOWA 5J98B 4NPRA 4QPIB 3KZ4C 5C8CA 4O9GA 5CA6A 3HD8B 1D4M1 3VBFA 3TNQA 4B7EA 1PGSA 4KG8A 4M00A 1AL0G 1TME2 3FX3A 4E2GA 2VOVA 1C57A 4WZFA 1NCQC 1COV2 4E4ZA 2BUKA 2ZAHA 2YMZA 2RM23 2Y0OA 1NA1B 1UN1A 5EXOA 1YFYA 4RFT0 4BIOA 2PHLA 1FMD1 1JHNA 4XXAA 1HV1A 1LOBA 4UW3A 3D0JA 3WDUA 1W6NA 1UMZA 2WNUA 2DCKA 4YYOA 3DKWA 1MS8A 5T5LA 4XJ9A 1W6PB 2QDNA 2ZX4A 5IK8A 5KC5A 1ZBA1 2PTMA 2R0FA 4YNIA 3WG1A 4HSLA 3JBG2 4I0BA 3POWA 4IEPA 4Q4V2 3QCWA 4COUA 2WFF2 5JPNB 1KFXL 2A3XA 3ZFGC 3PNAA 1G9AA 3ZSEA 1UCXA 2CGOA 2YROA 2R49A 4N7UA 4FQ4A 5JI9A 4ZU4A 4D7YA 5HCFA 5FMOL 3RYPA 2OIIA 4RGGA 1UAIA 1AX0A 2A71A 1AR73 1V00A 2JECA 3VDDB 1SLIA 4AVSA 3NL1A 1SCSA 3OYWA 4GULA 4JDMA 4HL0A 3TN93 4HKLA 1G9FA 3IIAA 1LODA 4N53B 4LO6B 3LOBA 1FXZA 5BY5A 1GYKA 1KJRA 3RQ0A 1BBT3 1HIXA 4UW4A 1NQJA 4XBNA 4AQTA 2ES3A 3ZIXA 2ERFA 3O7OA 1ULDA 4UW6A 3ZSMA 2K0GA 4QPGB 5CFCB 1ZBE2 1S0BA 1KITA 3D82A 3UKNA 1UPIA 2BYVE 3JD72 3R4SA 2KXLA 2DU0A 1PO23 3ILRA 5H9RA 3FFZA 1RMU1 3MW3A 1RUF2 4EN9B 5I0RA 5IK5A 3ZMOA 2QQPA 3OBRA 2JJ6A 2JXAA 3ZO0B 5A33A 3IT8A 3OY8A 4ZU5A 1N1VA 4HVOA 1VR3A 5LEJA 4BH9A 2VW0A 1IHMA 1S2KA 1O5UA 4CDQA 3VBSC 4S2HA 1XNKA 1KJLA 2NPIA 2XKOA 1VRH3 4URTA 4YW1A 1QGLA 1WW6A 3L2YA 5DDJ3 2AR6A 2A6ZA 4Q4X2 1TMF3 1LOGA 1SCRA 2BVBA 2XL7A 3WDXA 4XZPA 3WY6A 3NKGA 4AI1A 4RA0A 2ZOEB 1OSGA 4QM9A 1MEC3 1H8TC 1OHFA 4GQ7A 2IC1A 5BNNA 4YVSA 1B35C 1MS3A 4XTMA 1I1EA 1NY72 4XBQA 4TZDA 3AP4A 3JCIA 2JG8C 4OI1A 4PIZA 1DQ6A 5ACA3 1JH5A 5KHKA 4N90A 4ES8A 2HEYF 1SDWA 3FUQA 2FQPA 5KC6A 3BOWA 1RUH3 3POSA 4KGQA 3ZFFA 1UZZA 4I2OA 1H4HA 1S0GA 1JTZX 3B01A 4RHV2 2Q5TA 1VBD1 4PF5A 1DQ4A 4WVVA 4CTEA 2C0ZA 1XU2A 2CNAA 4AE2A 4BE3A 3UK9A 3AJYA 5I8YA 1UD1A 1QJY1 3FMGA 2RR11 5JVVA 3RWNA 4ISQA 1DZTA 2IXJA 4WVMB 1RUI3 3O0XA 3M3IA 3RNSA 4ONUA 3R0RA 3O5SA 2NZ9A 2JD4A 2Z5WA 3MF9A 2ZGMA 4XF4A 4P9IA 2NLRA 3TOJA 2HWE1 2WT1A 2ZX2A 1MS1A 5HXVA 3WCSA 1BK1A 5T3NA 3RS6A 2FBEA 1AR72 1IKPA 3B93A 2B9UA 2ZX3A 1V6JA 1EPWA 4O9EA 1QOTA 3R05A 3WQ7A 3VBHC 5C8WA 3TN92 3U0ZA 2IWGB 3UJOA 1Y43B 1SBFA 2P3KA 1JOJA 1JBCA 3FHIB 2R072 1UW8A 1BBT2 4GH4C 4KWKA 5BNQA 1QNWA 4TYSA 1J3RA 2DCJA 1O3RA 1QXJA 1AR92 1W6QA 2CWSA 4FAGA 5FCCA 1NYWA 1DFQA 2VW2A 3MYXA 5EFUA 1ND2B 3N36A 4AHXA 4Y1VA 4PJYA 4M3CB 1MZ5A 3WP5A 4CDUA 1NXMA 1VBA1 4CEWC 1KD7A 4PDWB 1GNZA 1IPJA 3VHPA 3MFCA 2E51A 4GB31 3KCCA 5GZCA 4C0HA 1K5MB 2NYYA 1AX1A 5FO7B 3O14A 4JDOA 4Q0VA 4KBBA 2ZGSA 4LO8A 2ZPXA 4AEDA 2ET1A 1RUJ3 1REEA 1RHI3 1F5JA 2VH9A 4JDNA 4JRAA 1O4ZA 1V70A 1H8VA 1HXS1 4MSVA 2YGMA 2XB6C 3ILNA 1VJ2A 1PZ9A 1LOFC 3GNEA 1WGPA 5KHGA 1ZA4A 5E16A 3KCXA 1QJX3 2WNEA 1PZ8A 4WM7B 3S7EA 3BIWE 3WQ0A 1UU4A 1M4WA 4DINB 3B3QE 4B4RA 4LT5A 1FOD1 4Q4W1 4HVRA 1GQGA 3B00A 2CGNA 2PAMA 3H0OA 4QQ2A 3A0NA 1J58A 1RITA 2DTYA 4XQWA 4J6GA 4IXLA 1OPOA 1RUE2 4IERA 4AHYA 4LBLA 1NLSA 3FLPA 3KGLA 1U5IA 2GNBA 5LRRA 2E63A 1LU2A 3MIFA 1VALA 1HDKA 2ZGPA 1LEMA 4XW3A 1D4VB 3AKPA 3WHTA 1F8VA 5BNPB 4B4QA 2R30A 1C3HA 1OFSA 2RM21 1RUI2 1CAVB 4LO4B 3BOPA 5JIAA 1AR82 1BVVA 3TYJA 5J09A 2R063 1FYUA 2IXHA 4N43B 1HV0A 4KL1A 4EWEA 2OUJA 2H6BA 3OGJA 4CDWC 1H9PA 4I30A 1NOVA 1N1TA 1PGL2 1XNDA 4XF1A 4QQHA 4Q1PA 5F6KA 3ELNA 4Y20B 1ULEA 5JZGC 3AMMA 2H0VA 1QXPA 1D4M3 4XHXA 4A7YA 1M06G 4IEOA 2Z2SB 1AUYA 4X8NA 3FLRA 4MYEA 3I59A 2ARBA 3IDEA 1RUOA 2C9AA 1V9U3 5FREA 5K0UC 2ZMKA 2OPKA 3I54A 2P17A 2AZ5A 3DL3A 2Y0IA 3E5QA 5KXCA 1WLCA 4XBLA 3W58A 4HT1T 2WNVC 4FAHA 1IS5A 3CJIC 1RVF2 2XVKA 1J1TA 3ZFGB 3GBWA 4JGYC 2PAEA 1QXRA 4QPIA 1LHWA 2VPVA 2DUOA 4WV8A 2EXKA 2FZ1A 4CZSA 1RUJ2 4L97A 1RHI2 1OQDA 2Q30A 3B9IA 4P9JA 1ZBA3 4IEWA 4FPKA 1Y7BA 1DQ1A 2RHPA 1QQP1 3ME2A 1NA1A 4K6BA 1WLTA 2XJUA 1QMJA 4BHPA 1OI6A 1XQNA 2O1QA 1DQ0A 2QE3A 4F8AA 1ENRA 1OKQA 4LHNA 1H1IA 2DCTA 1URXA 2VECA 2W08A 2IFRA 3WVJA 1R1A1 2SBAA 5GZGA 1PO21 4AQ2A 1RUC2 2AH2A 4OI0A 1G86A 1W6PA 1ZZBA 4LO7A 4Q29A 1G9DA 1I5ZA 1BZWA 3J8F1 3J26N 2OZ6A 3WZ1A 2ZCWA 3KCYA 4P9WA 4GXLA 1SLTA 5JSOA 1OA3A 3NAPC 5GLUA 2IXCA 4QHBA 4BPZA 1VRH1 2SLIA 3LB9A 2AUYA 3D4KA 2QDRA 5CADA 4BA6A 3HT2A 5DDJ1 5L7OB 4XHBA 2WS93 5GLWA 4B29A 4RQPB 1TMF1 3ZIWA 1UIKA 2JEMA 4FQZA 1RB8G 2VNRA 2NP0A 2DVBA 1MEC1 4B3NA 2HJIA 3VBSB 3ZFEC 1DGWA 2AGSA 2PHWA 3VDDA 3AKQA 1ZM1A 4E4SA 2GC0A 2DTWA 2O8QA 1VIWB 2XH6A 1LGNA 3ZN5A 5ACA1 2C1FA 1TNRA 3SMHA 5FO9B 4Y22B 3AP9A 1OFNA 4N53A 1WLWA 4YARA 1RUH1 2I74A 5C9AC 1DLLA 1CJPA 2VQAA 2BPA2 3PVBB 4H3WA 1H8TB 1CAWB 4R9CA 1IQAA 4XFIA 3MIDA 1B35B 2YGLA 1D4M2 3CLPA 4B7KA 3DPRC