1QQP1

Foot-and-mouth disease virus/ oligosaccharide receptor complex.
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
210
structure length
188
Chain Sequence
b'TTSAGESADPVTTTVENYGGETQIQRRQHTDVSFIMDRFVKVTPQNQINILDLMQVPSHTLVGALLRASTYYFSDLEIAVKHEGDLTWVPNGAPEKALDNTTNPTAYHKAPLTRLALPYTAPHRVLATVYNGECRTLPTSFNYGAIKATRVTELLYRMKRAETYCPRPLLAIHPTEARHKQKIVAPVK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (GENOME POLYPROTEIN)
publication title The structure and function of a foot-and-mouth disease virus-oligosaccharide receptor complex.
pubmed doi rcsb
molecule tags Virus
total genus 39
structure length 188
sequence length 210
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1999-05-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1qqp100
3ZFGC 4YVWB 1NA1A 1HX6A 3ZFEB 4GMP1 2WS91 4QPGB 1RUH1 2BFUL 1PGL2 4Q4Y3 4RFT0 1RUJ3 1FPN1 3ZFFC 3VBHB 4CDXA 2Y26A 5K0UA 5BNNA 1QJX3 1AYN1 3J8F3 1VBE1 3S6PA 5CFCB 4FTEA 3FBMA 1VBB1 2XBO3 4FTBA 3NAPB 4Q4Y2 1AR91 4Q4W3 4N43A 2HWC2 2XBO2 1VRH1 4WM7A 2RMU1 1RUI3 1COV1 2VQ0A 2MEV1 1R092 1B35C 2X5IA 1AYM1 1RUE2 3JD73 1HXS1 1VAKA 1C8M2 4PDWC 1FMD3 4Q4W2 4RHV1 1E57A 2HWF3 1PO23 1Z7S3 4AEDB 4CDQA 5L7OB 4YVSC 2HWB1 1ZBE1 1NG0A 4GMP3 1NA1B 2GSYA 4CDUA 1FMD2 1M06G 1WCDJ 1FOD2 4GB31 2WS93 1PO22 1Z7S2 1RUH3 3VDDA 2BBVA 1V9U1 5FMOS 4CEYA 4IV3A 1RUF3 5BNPC 1AR62 1PGL1 1ND2A 1FPN3 2ZAHA 4CDXB 5BNNB 5K0UB 2WFF3 1RUH2 1VBE3 1RMU3 1K5MA 1X33A 2HWD2 1RB8G 5ABJC 2FZ1A 4CEWC 5C9AC 2PLV1 1R081 4RQPC 1AR93 1BBT1 5A32A 1OHFA 3ZFFA 5C8CC 1AYN2 1VBE2 1PO12 1W39A 4N43B 1CD3G 5DDJ1 1VBB2 1VRH3 2RMU3 1AR71 1ASJ1 4WM7B 1COV3 1POV1 2MEV3 4FTSA 1AR92 5FMOL 1HXS3 1R091 3VBFC 5BNOC 1RUD3 1VB2A 1PIV1 1HRV3 4CDQB 1VRH2 2BUKA 5JZGB 2RMU2 1COV2 2HWB3 2R043 1ZBE3 2MEV2 2QQPA 1AYM2 2R061 1CJDA 1HXS2 4CDUB 4QPIC 4RHV2 4WM8A 1HRI1 2IZWA 4PDWA 3VDDB 1V9U3 4IV1C 1RVF1 1VBD2 4IV3B 1ZBE2 1R1A1 2RS51 1MQTC 2GH8A 4Q4X2 4YVSA 1AR61 1ND2B 2ZTNA 4GB32 2RS32 1V9U2 1K5MB 3VBUC 4GMP0 4Z92B 2HWD1 1NCQC 4CDWC 1QJU1 1R083 5ACA1 5BNPA 4FSJA 1NY71 4JGZC 5A32B 3IDEA 3ZFFB 1H8TA 5D8AA 5DDJ3 2HWC3 1AR73 1ASJ3 1PO11 1AL0G 3JBG1 5ABJA 1POV3 2PLV2 4CEWA 1R082 4QPGC 5C9AA 1BBT2 1R093 4RQPA 1RUE3 4LLFA 2RR11 3LOBA 4GH4C 1C8M3 1PIV3 5DDJ2 3VBSC 1AR72 1ASJ2 1RUG2 1DDLA 5CFCC 3CJIA 4WM8B 1HRI3 1PIV2 1FOD3 3VBOC 4JGYC 2R062 1VBD1 2RS53 1AR63 2WZR2 1RHI1 4YVSB 2ZZQA 2XPJA 4Q4X1 1HRI2 1MEC1 4RS5C 1RVF2 5CFDC 2RS31 2HWD3 1TME1 1ND3C 1R1A2 2RS52 4N53A 4AEDC 5BNPB 2RS12 3ZXAC 1MQTA 1PVC1 3ZFGA 1AYN3 1D4M2 1H8TB 1NA1C 5D8AB 1PO13 1VBB3 1ZBA1 1QJU2 5ABJB 5ACA2 4CEWB 1NCQA 1NCRC 1NY72 4Q4V1 5C9AB 2RR13 4RQPB 1TMF2 4JGZA 3JBG2 2DF7A 4Y4YA 1RUG1 2TBVA 1F8VA 2RM21 1AYM3 2X5IB 2RR12 2R072 3CJIB 5LK7B 4RHV3 1POV0 1C8NA 1VBA1 4GH4A 3VBRC 3DPRC 3VBSA 1VBD3 4Y5Z0 2FZ2A 1RHI3 2BPA2 3HAGA 1QJX1 4Q4X3 5C4WC 2WZR1 5CFCA 1B35A 1MEC3 4GB33 1AR82 2RS33 3VBOA 5AC91 1TME3 4JGYA 4CEYB 1PGW2 3JB8A 2WWSA 1OPOA 1RHI2 4N53B 5JZGC 1MQTB 3ZFGB 1MEC2 2RS11 4RS5A 1RUI1 4CDUC 1TME2 1D4M1 1BEV1 1ZBA3 4RR3C 5CFDA 1QJZA 3JD71 2PLV3 1ND3A 1SMVA 4Q4V3 1PVC2 1F2NA 2HWF1 1BBT3 1OOPC 4IV3C 1VBC1 1AL22 4JGZB 5A33A 4NWWA 1TMF1 4YVWC 3ZFEC 1ZBA2 1RUG3 2RM23 1EAH1 4Q4V2 1K5MC 5J98B 1NCRA 1QQP2 2WLPA 2R071 1VBA3 4GH4B 1RUF1 5C8CA 3M8LA 3VBSB 3VBHC 3JB4C 1RUC1 2RM22 1EV11 2R063 2WZR3 3TN91 2WFF1 1RMU1 1B35B 1VBA2 3NAPC 2HWE1 3VBFA 5BNOA 4PDWB 1IHMA 1AR81 3VBRA 5AC93 1RVF3 3VBOB 4JGYB 3DPRA 1RUJ2 1PGW1 1R1A3 4SBVA 5J96B 1A6CA 1QJX2 3J8F2 2RS13 5C4WA 1AUYA 4QPIA 4RS5B 5FOJB 5AC92 1D4M3 1BEV3 1NOVA 1BMV1 4WM8C 5CFDB 4IV1A 1QJU3 1QJY1 5ACA3 1ND3B 1RUD1 5GKAC 1VBC3 5JZGA 1HRV1 5L7OC 1TMF3 5A33B 1RUI2 1AL21 2R041 1BEV2 3JBG3 3JD72 4NWVA 4RR3A 1EAH3 3VBUA 2HWF2 4CDWA 1VBC2 1NCRB 1HQNA 2R073 1GFF2 1OOPA 1QQP1 5C8CB 4YVWA 3ZFEA 1RUC3 4CDXC 1EAH2 1EV13 5BNNC 5K0UC 1H8TC 5D8AC 2WS92 3TN93 4QPGA 2HWE3 1RUF2 1AR83 3VBFB 5BNOB 3VBRB 1VB4A 1FPN2 1RUC2 3DPRB 1EV12 3VBHA 4Q4Y1 1RUJ1 3TN92 2WFF2 4N43C 1RMU2 1X36A 4WM7C 5C4WB 2HWE2 3J8F1 2HWC1 4QPIB 3NAPA 2XBO1 2X5IC 3CJIC 4IV1B 1QJY3 1RUE1 2BFUS 4Q4W1 1C8M1 4CDQC 1PVC3 1AL23 4EJRA 1BMV2 1QJY2 1RUD2 4RR3B 3VBUB 4BCUA 1NCQB 3VDDC 1FMD1 4CDWB 1FOD1 1HRV2 4CEYC 4AEDA 1PO21 1Z7S1 1QQP3 2R042 1OOPB 2HWB2 4N53C 5L7OA 1ND2C
chains in the Genus database with same CATH superfamily
2A5ZA 1HX6A 3ZFEB 1V6NA 4HONA 4JHZA 4MXWA 3FLRA 4COWA 2JG9B 2D3RA 3PVNA 3G6JB 3VGIA 3LEIA 1UD1A 1WCSA 3V0AA 4XIKA 1ULCA 3T2TA 2QFEA 4QPGB 2ES3A 2RDNA 3MLKA 2ZHLA 5DAVA 4XQ4A 5BYNA 1S0FA 3BYWA 4O9GA 5JOYA 2NPIA 4NE9A 5B2GB 3I8TA 3I2DA 2XONA 1QF3A 4RFT0 1LEMA 3ZFFC 3WG2A 4PBOA 1OLRA 2CAVA 4XEZA 4BMEA 2VCCA 2VMEA 3T08A 1DQ4A 1C5IA 1VBE1 2XUEA 3ATGA 3FUOA 3IT8A 2XJTA 3J8F3 4I09A 4LIVA 4DUWA 4M01A 4AVSA 4FTBA 3HT2A 5C8WA 1I6XA 1GNYA 2VW0A 1Z0HA 4XJ9A 2WJSA 2GNDA 3LE0A 3I2OA 4URTA 3ACIA 1KFUL 4Q4W3 3PL0A 1U5XA 1XSRA 5DN2A 1WMEA 5FPXA 5FLIA 1G9FA 5FY9A 4LA2A 3R0RA 2QDNA 1UU4A 1DQ2A 4HK9A 3CZJA 1AJKA 2C5DA 5FZ7A 1KS5A 1WD3A 2VMIA 2W94A 2VQ0A 3KV9A 5IVBA 1BQPA 4LXLA 1B35C 3T2OA 1WMFA 4FPYA 4Y20B 1G86A 4NN0A 1QXJA 4D8MA 1VAKA 1PZ9A 1C8M2 3MIDA 4PDWC 4Q4W2 1JTZX 1Y9GA 3FHIB 1H9WA 2WABA 5E16A 4H3WA 2B45X 1UNBA 3AP4A 3UETA 5KC5A 2OVUA 5A7SA 1K42A 2BU9A 1PM4A 3PMSA 4YVSC 1HJFA 4EV0A 4A3ZA 2BW8A 1NA1B 2J1SA 5F7UA 4K7JA 3TEZA 4MX3A 3BPZA 1DIWA 1H4HA 4AZZA 1YFUA 4AGGA 2GC1A 2XJQA 1WCDJ 1FOD2 5IVYA 4CPBD 2D98A 4DINB 3VDDA 3A0KA 5A7PA 3AMMA 4MVTA 1ULEA 1V9U1 5CG8A 2OUHA 1H6XA 1SLIA 1WA4A 4Y5SA 3IZOA 3ZN6B 5APAA 4BK4A 5A1AA 5BNPC 4I0AA 3M1HA 1PGL1 3OD0A 1FPN3 5LBBA 1XNAA 3L2YA 5H9RA 1E5RA 4CCNA 4OI0A 2QZ3A 4K6BA 4Q0SA 5BNNB 4YGBA 2B7YA 4AVTA 4PQQA 1RB8G 1X33A 4Y22B 5ABJC 3RZKA 1ONAA 2CGOA 4B8EA 3HBZA 3DL3A 3LDBA 3OEAA 4A2UA 2VQTA 2QBXA 2PLV1 2BRTA 3MGUA 5FPLA 3PIGA 5B4XA 4ZZ8A 3MI8A 2IFWA 4LKFA 3NO8A 3OY8B 1H8VA 2UYBA 2VNRA 4XJUA 4NIDA 1XQNA 3HT1A 1QY4A 4LHKA 1O8PA 3GJBA 3EJKA 4LBMA 3KD4A 5JUVA 1O4TA 4N43B 4C8DA 3ACFA 2W08A 1W0NA 5A3UA 4RGAA 1VRH3 3HVDA 2RMU3 1AR71 1ASJ1 3FN9A 4QKDA 5H9QA 1COV3 1I3HA 1POV1 2MEV3 2ZKLA 2GZWA 4W6XA 1HXS3 5CYYA 4DOUA 5BNOC 1A78A 5CZKA 3USUA 1VB2A 1PIV1 2DBNA 2XMLA 3AX4A 1GMMA 5JOXA 1VRH2 2BUKA 2RMU2 3WW1A 2P3IA 1COV2 4XBNA 2MEV2 2QQPA 2W95A 1H30A 1CR7A 1PGSA 1EYBA 2EA7A 5FPAA 4OI1A 1HXS2 1CIWA 1WLCA 1ZX5A 3DUIA 2DVAA 2JJ6A 4FCAA 4F8AA 1LESA 1JS9A 2IZWA 2VOTA 1BVVA 2XHKA 2PAEA 3LIGA 3GZTB 3NL1A 5L9BA 5FO8B 2PHTA 1DBNA 4NVPA 4QB2A 4XZUG 4BIFA 5FDBA 3ILNA 2UWBA 1W03A 2AH2A 4GKYA 5HXMA 5I0DA 4BQXA 4UW5A 3WLUA 5FTTC 1YIPA 3AFGA 3NNMA 5A3NA 4D7TA 4N8MA 4V1PA 1DCSA 3T0BA 4M3CE 3ELNA 2VGDA 4FP2A 4JQRA 3U78A 3K3OA 4LULA 5T5PA 2E51A 3LAGA 4LBNA 3HMYA 5DZGA 4LUMA 2YHJA 3KCYA 3NNGA 4RYDA 4ZPIA 5ACA1 5LCWL 1V0AA 5LY1A 1S1AA 3FFZA 4AR2A 4LK6A 4RA0A 3UJOA 2XQRA 2RHPA 3RYKA 2AC1A 3ZFFB 2YPDA 3MV01 2DFBA 4Q29A 5F6KA 1H8TA 4BQ5A 4EZHA 3IMMA 3FC0A 5JSOA 3PTYA 5FZIA 4HETA 4QXKA 4OUEA 2UURA 4ZU5A 3ZXFA 4ZONA 1I9RA 2ZAAA 2V4VA 1JODA 2XGXA 3SH4A 1W8HA 1PMIA 2WWUA 4KH9A 5C9AA 1R093 3IBMA 4IGQA 5EJ1B 5C3RA 4RQPA 3WDWA 1WWYA 1OQDA 2RR11 3AYEA 4GH4C 4JTNA 5G04L 1UU5A 3MW3A 3WZ1A 5LA0A 2XUMA 3IAPA 1K3IA 4GIQA 1OH4A 4QDSA 3U75A 3B94A 3ZYJB 1UQXA 4Y5TA 3ZXJA 2VMGA 4YZ4A 5HXVA 2ZEYA 4S2DA 5IVFA 2P3JA 3I3DA 1X9TA 1JHNA 3GCXA 1AF9A 1OD5A 1UY1A 3I2FA 3LB9A 4JGYC 5JAXA 3BB6A 4O61A 3FJSA 4PI2A 1ULFA 4L92A 3ABZA 1VBD1 4QGMA 2CSGA 2VMDA 4BLJA 3RI8A 1AR63 3RG0A 4YVSB 4GKXA 4HANA 3WP5A 2E6VA 1DZTA 1ZRRA 1UOJA 2ZMNA 2YY1A 4D3WA 1U5IA 5K8SA 1JYIA 3CF6E 3POBA 3C7GA 1W06A 3AP5A 3SHRA 1RVF2 5EJZB 3VDCA 4BQ1A 2D43A 3HNBM 4TSVA 2BWCA 1R1A2 2LRPA 1JYCA 1O5UA 2A6XA 2JDAA 2XWJB 3PIJA 4FPCA 4AEDC 5BNPB 1OSGA 3QH7A 3ZFGA 5JCTA 3N9MA 4UFHA 3ES1A 4AYUA 2UY8A 2NZ9A 4NRPA 3M3EA 4WVMA 3P3NA 1NXD1 4NRMA 1PO13 5AVAA 3H8RA 2WL1A 1VBB3 1ZBA1 5ABJB 5ISLA 2JD9A 1OFNA 5F32A 2YU1A 1J3PA 4XF1A 1LHOA 4KWLA 4V2WA 4FQZA 2WA3A 3ACGA 2CNAA 1TVGA 4FPKA 4O9EA 1LOBA 4FOWA 4L2NA 1C5HA 2EIBA 2OQ6A 4XOGA 5FY0A 1OF3A 1F15A 4FVVA 3MW4A 4QAWA 5T5JA 4Y4YA 4JKMA 4HVOA 3MIEA 4Y33A 4AGVA 3OD4A 1RUG1 3V0BA 3IB3A 3MV11 4XXPA 1W8ZA 3GZUC 5A7OA 1AYM3 1DGWX 1VAVA 3ZXEA 1G9DA 3O1TA 2X5IB 2R072 4OULA 3RZMA 3ZO0B 1RJ7A 2HJIA 3POJA 5LATA 4AFDA 1VBA1 3CL1A 2DDUA 1UMHA 1Q43A 1DG6A 3H9AA 1WW7A 3NJYA 2IVJA 1MR5A 3NJVA 1D0GA 2FZ2A 3K4ZA 1ZA4A 1AHSA 1TQ5A 2VXRA 4MGSA 1NZIA 2MPFA 3QACA 2BPA2 2WIIB 3C2UA 5HCFA 2WINB 2WZR1 4DPNA 2FDHA 1JYXA 1MEC3 2XJSA 2TNFA 1CZTA 3B5LB 1WLTA 2FCUA 3ZKUA 5CBLA 3EQEA 3PUQA 4CXYA 2PHLA 4UF0A 2AACA 1TME3 2BTVC 2P4EA 3WDYA 2WWSA 3TEYA 4HPKA 2FDJA 2Q1FA 1UAIA 3IN9A 4LBOA 1CQ9A 3LFIA 3OGGA 1S0EA 4N53B 4YRDA 2VCBA 5EZWA 2JWPA 5C7GA 1MEC2 3KHBA 2A75A 2PFWA 1N3OA 1W3VA 4I02A 5KBFA 3NKTA 1UYXA 4LK7A 2D6NA 1TME2 4IEVA 1D4M1 4CUBA 2IXKA 4BYYA 5B4NA 1QH7A 1QDOA 2JG8A 4XTMA 4NIHA 1IPSA 2SBAA 3I2KA 4GJYA 4Q4V3 1JU3A 3VUOA 2H6BA 2AENA 3NV1A 3LFMA 5A7WB 2IFRA 3RWNA 1WMXA 2VVDA 1O3SA 1OOPC 4HT1T 1YWKA 4XAEA 4MZUA 2CTVA 1CX1A 3MICA 3LSEA 1O6UA 1TMF1 3MFAA 1PZ7A 2HH9A 4MOAA 3C8XA 5FQ0B 3IPVA 4QX1A 4DXZA 1WUVA 5DG1A 3PUHA 5KXDA 3KSCA 3RJ2X 3SMHA 4PIZA 1WCQA 4Q4V2 5LEJA 1CAWB 3KCXA 4P02B 2A7AA 2EIEA 2JDMA 4XDPA 2ZGLA 5J09A 1W6OB 5FLHA 1QQP2 1OKOA 2WLPA 4CCOA 4TXWA 1UXZA 4GH4B 1ULPA 2ZX2A 3HQXA 4HKLA 4V2VA 5F3EA 2JDNA 3KS7A 1UPIA 1DHKB 2XH6A 3ZSLA 1JZ3A 4Y3OA 4YYOA 3NKGA 3ECQA 4FPFA 4QX7A 5JIUA 3JB4C 4YZ2A 2PHDA 5FZDA 2V5DA 5EHDA 2R063 4QKFA 5GLTA 4U36A 1ALYA 1YQ6A 1ZA7A 3AM2A 1GZTA 4N9HA 3L2HA 2BOIA 2HWE1 1KJRA 2QQOA 4AE2A 3PUAA 3LIHA 1AR81 2LM3A 3NW4A 2FHRA 3N7JA 4RD7A 2RV9A 1MS9A 1WKYA 3VBRA 2PA7A 4JGYB 2HEWF 4S2GA 4ARYA 2FDKA 3AK0A 1KITA 3UKNA 1Y43B 1SACA 1A6CA 5HV4A 5J96B 2ZXQA 3H50A 3NNFA 3UV9A 4AEJA 5C3SA 3ZXKA 1C4RA 2E9QA 3H1MA 3LEMA 3NNJA 1Z78A 1UW8A 1AUYA 3SC7X 4XBLA 3UYJA 1ZZBA 1XNBA 2WDBA 5FP4A 1BMV1 5KXCA 1OVSA 3OTFA 2RJ2A 5I8SA 4Q5OA 2DCJA 3N9PA 3R4DB 4LO8A 5FJHA 3WF4A 5GKAC 1PX4A 2WNUC 2XLFA 2Q8EA 4QU2A 2CDOA 5EFUA 1JUIA 5L7OC 2Q1ZB 3IKWA 3N9QA 1D4VB 4QXBA 3AKSA 2V4AA 1WCKA 5EJ3A 1ZRFA 1YFYA 2A3WA 2OT7A 5EYYA 4ES8A 4YM3A 1EAH3 3ZIWA 2YB7A 3LOIA 3OGVA 4IE6A 5CKQA 3UJQA 3JU9A 3VHPA 2IXIA 5LA2A 1YO8A 2OS2A 3WDVA 4A4AA 4IUGA 3OPWA 2ZX4A 1W6MA 1SDDB 3H7JA 4BPZA 3H42B 4B7KA 3JUUA 2R16A 4XF4A 2E63A 3M3OA 5DUVA 1DYKA 1MZ6A 1DQ6A 4CDXC 1EAH2 4F83A 3M4FA 1H8TC 2ID4A 3VZLA 3P5BA 3TN93 2BJSA 4FAHA 3USSA 1H4GA 4LBLA 1QGLA 2N7GA 4D6SA 1UKGA 4P9LA 4XZPA 3K51A 5F2SA 1IZ3A 3BU0A 3N9NA 4Y1VA 2WNVC 5E89A 3GXUA 3ZN5A 4HVRA 2VZRA 1MS0A 4DZGA 5CEHA 1S55A 2L9LA 3ST7A 3ZSKA 1XJAA 4QGNA 3VBHA 1Q8SA 5FZAA 2VBPA 2WAOA 3TN92 1MS8A 4KWKA 4DXTA 3NJZA 1RMU2 4EN9B 4B1MA 4XJ8A 3OPTA 4WM7C 1G9CA 5FZFA 1GZCA 2E32A 4NRQA 3NAPA 1B09A 3FX3A 1Q3EA 3PLQA 4ARXA 4BU2A 4JRLA 3UK9A 2P3KA 2RJLA 3JQWA 3POFA 5J36A 5FXXA 3MIBA 5AFEA 4ZKTB 4Z07A 3S5AA 1PVC3 5FWEA 5FZBA 4IXLA 4JHTA 4YW4A 1W8NA 3MPPG 2D6MA 3MIHA 4LLOA 4ONUA 4PT6A 2BERA 2XVKA 1OLME 5FUNA 4E4ZA 1SG3A 4AI1A 4EJRA 1N3PA 2P2KA 4LO7A 4AFMA 2XOMA 1QDCA 2ZGPA 5FZOB 1GQGA 3O7OA 3WP4A 4UXAA 1RUD2 3VBUB 3KT7A 1FMD1 3NNLA 4CDWB 3SITA 1DFQA 1Z7S1 2YV8A 5IJRA 2J7MA 4AI0A 1XE0A 3HEIA 2R042 1OOPB 4PLNA 2ET1A 3EYPA 5BY5A 4I3GA 1OF4A 4INDA 1C28A 2R7EB 2W9XA 3ZFGC 3WCSA 2ZX3A 1SPPB 1X50A 1XYPA 2LALA 2VNVA 4GMP1 3RSJA 1UY2A 4R9CA 1HJGA 4A7ZA 3HN1A 4I0WB 1QNYA 3CMGA 2ZGQA 2GP3A 2WS91 5LEKA 1FATA 1RUH1 1SLCA 4HL0A 4P5HA 4AK3A 2VNGA 3PHMA 5A7QA 1WBLA 3ZSJA 1PGL2 2GN3A 2E7QA 1W6PA 4PIYA 5LASA 4PI0A 1ZZ8A 4IERA 3O0XA 3BPSA 3U0ZA 1RUJ3 2MHFA 1DGRA 2Y26A 5K0UA 3PDQA 3SNMA 1XOYA 2CL2A 5FY1A 2EXJA 3AKQA 5FBJA 2Y6LA 5CFCB 5A3MA 4FTEA 3Q9OA 3FBMA 5JLVA 1VBB1 4J1WA 4BQ3A 3EXUA 3IWZA 4AQ2A 1VMHA 3L9JT 3OSDA 2QKDA 3QBQA 4P9XA 1AR91 4OUSA 1GKBA 4ZXKA 1OBNA 5GLUA 3WNLA 2GC0A 3A0NA 4JCKA 1X82A 3AVRA 4C0BA 3CLPA 4GD4A 4UYBA 2G9ZA 4NPLA 3LPFA 4YSFA 5F8PA 4HG6B 4NOTA 1RUI3 4L0PA 1AJOA 4AEKA 2X5IA 1AYM1 3MUZ1 2UYAA 1RUE2 1ZRDA 3JD73 2X29A 3HQUA 1FAYA 1LENA 2VECA 3R4SA 1XE8A 4RGGA 2QNKA 3ZSMA 4XFAA 4CDQA 2WT1A 4OHXA 1I5ZA 1OKQA 2G19A 2WNUB 1X8EA 2ZGMA 2A71A 1EPWA 1FX5A 4Y1YA 5L7OB 5T5LA 4FFIA 1ZBE1 2WKKA 3DECA 2FDGA 3BUCA 3TWIA 5E6HA 1W2UA 4CDUA 5C33A 2BWAA 4QT6A 2ZHNA 4LEJA 1NUKA 1D7PM 4OUMA 4UFKA 3J26N 2KD7A 1CAVB 2A6VA 1F5JA 5HI0A 4DY5A 5IT6A 4IV3A 1K45A 1YQ5A 1JU4A 1UYZA 3LEKA 4HK8A 2C4XA 4QX8A 1NLSA 5JI9A 4JDOA 4QX5A 4B1LA 1KXGA 1ND2A 2EALA 1SBEA 1CGPA 1XBFA 2ZAHA 5FLJA 4CDXB 4CP9A 2D3PA 3HIFA 5IVJA 2R0HA 4R8HA 5DAWA 2WFF3 3FFQA 5I8TA 5A3LA 1SBFA 3E97A 5FYZA 3H0OA 4FOVA 2W1UA 2WT2A 3PVEA 4XHBA 2WNVB 4EE2A 5J37A 1YJLA 1CZVA 1KGYA 4EWAA 1YLLA 1OHFA 3SCHA 4AI3A 5CADA 1AYN2 3KQ4B 2VZUA 1W39A 2YGLA 1GP6A 5IK8A 2C9KA 3J7MA 4WM7B 5FPBA 1LODA 1UIKA 1LHWA 2DUQA 1XE7A 2WO3A 4TLFA 3POGA 4IEUA 2Y6GA 1O59A 1RGSA 2CDPA 3WDTA 3KVAA 1LRHA 4AWDA 3UT0A 1CZSA 3MZHA 1JW6A 4HOOA 2ZGRA 3N7MA 2B9UA 4KBBA 4WVVA 3I3MA 1UWWA 2XL9A 4O7XA 3LDRA 2HWB3 2AEZA 2ZS6B 3PVOA 2R061 4FI9A 1WA6X 1KRIA 3KWVA 3PU3A 3ZSEA 1H2LA 4K1ZA 2HKXA 2OKXA 4QWNA 4E4SA 4RHV2 5ANQA 2HLEA 4GJZA 4RN5A 5C3OA 3CJXA 5E88A 1LEDA 4N9IA 2PHXA 1POQA 5IVEA 1VBD2 4Q0PA 3VKNA 4NPRA 1A8DA 5LK5A 2RS51 3T3YA 2F4LA 2GH8A 2P37A 1JYWA 3GCWA 2ZTNA 3QH6A 4GB32 4QM9A 3NV2A 4AI2A 2ZABA 2F4PA 1JOBA 1RYYA 1UY3A 2XWBB 4XJZA 1FI2A 4D6RA 1K5MB 3N36A 3AZWA 5IK5A 5LRSA 2HWD1 5HCHA 1NCQC 5FZ6A 5A6YA 1S0DA 2DU0A 2QVSB 1R083 2DCKA 1LR5A 2XR4A 1EY2A 4UFJA 1SEFA 4IEZA 3WF2A 3NWKA 2IVIB 5A32B 1EUUA 2ZGKA 2C24A 3M3CA 1FNZA 3TEWA 1PX3A 5DDJ3 5D1IA 1JMUB 2BNNA 4C90A 2LUWA 1ENSA 4P14A 2QQWA 3AYCA 2NMOA 4QDRA 4AI8A 1R082 4CEWA 4H55A 4QHBA 3K48A 2ZGOA 3T4HB 4RFRB 1BBT2 5FAXA 4O65A 5E1RA 2O8OA 4LLFA 3U11A 1XRUA 2OPWA 1C8M3 2VU9A 2DVDA 4KWJA 5C3PA 3D0SA 2Y60A 5DDJ2 4P9JA 5EPAA 4OZXA 3WNXA 1KDMA 4YM0A 3TAYA 4U2AA 4CP2A 3OYWA 1RUG2 3IDAA 4NPMA 3RYRA 4BXSV 1DDLA 3POIA 2EIGA 3H8UA 4TZDA 2QZ2A 2E7TA 4UW6A 4LNVA 3THCA 5JXJA 4LHSA 4Q27A 3CJIA 2JECA 4AAXA 1Q8PA 1O7FA 1HRI3 4WM8B 3VDAA 2E33A 1FOD3 1OA2A 1VRBA 3VBOC 1S2KA 2EICA 3R05A 4CU9A 2JB8A 3TNQA 2D97A 2Q4SA 3UESA 1I1EA 4MG2A 2PHFA 3OG2A 4NJ4A 4ZZ5A 2VULA 2WZ8A 4YZ1A 1DF0A 2WZR2 3H8OA 1DGRN 2ZZQA 4Q4X1 1H2MA 1HRI2 1NE6A 4RS5C 3O1MA 2VUAA 3AVSA 4YPJA 3EBRA 2VZOA 1XB9A 2RS31 3ZN4A 1AVBA 4HKWA 3H1YA 4B3NA 1IS5A 1ND3C 4E8DA 4YLZA 3RZJA 1HN1A 2ZMLA 4P9IA 3E5UA 2X05A 2Q0AA 1MQTA 1PVC1 4K20A 4M3CA 2YFZA 2AYHA 3WUDA 4OHZA 4OHWA 1UO9A 4K3UA 2G1MA 4GWMA 1KS4A 2XG3A 2WZPP 1D4M2 5D8AB 1IOAA 4FOYA 5FP9A 3U14A 2JE9A 2WQ8A 2VPVA 3KV4A 1QJU2 4OHYA 2DFCA 3Q8FA 3I2GA 5DABA 3O14A 1NY72 3KV6A 1QU0A 3JXSA 1Y9QA 2VOKA 4CU8A 1TMF2 4JGZA 3WW4A 3TNPB 4UI9L 5KHKA 3JBG2 3M3QA 1HB1A 2Y6FA 3K2OA 4KI5M 2DF7A 2VUDA 4GXLA 4Y26A 1DGLA 1JZ6A 1XU1A 4QQLA 3ZMNA 4AQ6A 1PZ8A 5A70A 3VHOA 2TBVA 2RM21 2FMYA 5FZHA 4GWIA 4XACA 1GOGA 4UWDA 4Y1UA 1RL3A 3TB0A 2ETEA 4C1WA 5JPNB 4W50A 1C8NA 2VZ3A 3VN4A 3VBSA 1I5PA 2OA2A 3FHQA 3KGZA 3LPGA 5JIAA 5F3CA 1UZWA 5DMYA 4Y5Z0 1BXHA 4HZFA 2XB6C 4JV4A 3T1MA 2WNEA 1RHI3 2JDKA 3RNSA 3WP3A 4FFGA 5CFCA 2ADEA 4CU6A 2V73A 1AR82 1T6GC 4YNIA 1YHFA 2ZJCA 3ACHA 2PAMA 4COVA 4PLOA 1W90A 5AC91 4OI4A 3WD5A 3GM8A 3WF0A 4CEYB 5D2AA 2BOJA 4WVWA 2A70A 3HNMA 1RHI2 1RXGA 1GV9A 5JZGC 4JAAA 4LIUA 5A3OA 2RS11 1PVXA 3ZIXA 1CAUB 4D69A 2HEYF 4PLMA 5C3QA 2XJUA 4J6GA 3I59A 1BJQA 5I0RA 1RUI1 5IK4A 3RPQA 4CDUC 5BUVA 5L9VA 1BEV1 5CFDA 5DZEA 1JZ8A 1W9TA 1PK6C 3JD71 1YFWA 3GBGA 2GMMA 2VNOA 3I54A 2OXBA 1YJKA 1A34A 3I3EA 5C6CA 4IV3C 1SLTA 1VBC1 2VW2A 4YVWC 4NHKA 1SLBA 3DXUA 1SBDA 2D6LX 5JVVA 1DYOA 2PHWA 3SISA 2IXCA 5FREA 5JXGA 4CSWA 3RZZA 2YG0A 2XJPA 2QQNA 4AFBA 4N7IA 2WBKA 5J98B 4R9BA 1A8MA 1JI6A 1NCRA 5FUIA 1OC1A 3MLJA 3N35A 3KT4A 4JC1A 4LO4B 3TBDA 1YFXA 3ZM8A 2HYKA 3HNYM 4YARA 3NQHA 4W4ZA 5A6XA 1PM7A 4BXFA 5C8CA 1G9BA 4H2AA 2ILMA 2W92A 1VAMA 3VD7A 1EV11 1VALA 3APBA 1KJLA 2WFF1 1IS6A 1IKQA 3S30A 5BV6A 1B35B 2W1WA 1S0JA 2OW4A 2VM9A 2XL7A 4KWUA 3WNNA 5CKMA 3BI3A 3VBFA 4QM8A 4PDWB 5KHHA 1IHMA 3ZXGA 2YBSA 3FL7A 1RVF3 3VBOB 2R49A 3DPRA 2VG9A 3NMBA 4F3JA 3PMEA 4YM2A 3ROUA 1PGW1 1R1A3 1RC6A 1V6MA 1QJX2 1R1ZA 4P08A 4YZ3A 4EN6B 4NUBA 3WDUA 3B9CA 1YC61 5FZCA 3AJZA 5C4WA 4DRVA 1OD3A 5FK7A 3E6CC 1VJ2A 2YFUA 4QPIA 1WMDA 1GYKA 3GF6A 2LTNA 4RS5B 5FOJB 2HYXA 1YUDA 1ZRIA 1NOVA 4WZFA 2ZEXA 4IV1A 4FFHA 1QNWA 4XBQA 1ND3B 4GALA 1YNAA 2BDRA 2D40A 5A1LA 4NIGA 4HBNA 4XAAA 4QB6A 3ZPYA 3EHKA 2DU1A 3ILFA 2DVGA 5A33B 4Y1XA 3RWKX 2JIJA 1AL21 3OOXA 3LCPA 4AXOA 3E6BA 1O3RA 4CA9A 5EV7A 3I2HA 3PVBB 3OUHA 1W6QB 1MVQA 4ZU7A 1LOFA 3EMRA 4CPBA 4RR3A 3MF9A 3ZYFA 1O91A 1UCXA 3GBWA 4AHXA 2HWF2 5I0SA 3FBYA 1HQNA 3GHNA 2R073 2NP0A 3WF1A 1CAXB 2H0VA 2D93A 2Y8KA 4XYXA 3ILRA 4MHRA 5FWJA 4FT8A 5FV3A 3ZFEA 1RUC3 3DF0A 1LJ7A 5L73A 4XUQA 5BNQA 5FFOC 2JG9A 5D21A 3FWEA 2BEOA 2WS92 2EXKA 3GHMA 4QPGA 5FYBA 5F6LB 4XJWA 5T54A 4YFWA 2P17A 5LBEA 4LBQB 5JWPA 1RUF2 2D7FA 2PQSA 4CXXA 1XNTA 5TSWA 1UZYA 2JE8A 5BNOB 1WCUA 5KHIA 3I3QA 3T2QA 2YPJA 4DIQA 1RUC2 3MEPA 4CUGA 2QQVA 3U1XA 3R6SA 3LSDA 1W2NA 1KFXL 1Q5OA 4BQWA 1CWPA 4OZOA 1GOFA 2GN7A 1UOFA 3BKZA 2UWAA 2I07B 3J8F1 2QTWB 1AX2A 3WX5A 2OPKA 3RMYA 4Q0VA 2Z5WA 3CJIC 4BWOA 3OUIA 1XYNA 3CDZB 2LS6A 1QJY3 2DV9A 1TNRA 4Y1ZA 5DXDA 3GNEA 1QOSA 3C7EA 1C8M1 1O4ZA 4Q4W1 3I2JA 3ZYPA 2ZKNA 1G8WA 2CWSA 3WXPA 3O1PA 4FQ4A 5FY5A 5A6ZA 3DV8A 4CYDA 4COZA 1XNDA 1LHNA 5SV8A 5C5TA 4M4PA 4CUAA 4Y20A 3JQXA 1FV2A 1QJY2 5A1FA 4LHLA 2Q8DA 1OUXA 1ULGA 2ATFA 4IDZA 3VDDC 1PK6B 4XETA 3T2PA 4BCUA 1JXNA 1FOD1 1HRV2 1LCLA 4YGEA 4H14A 5LA9A 4XCAA 2RDQA 1QQP3 2K9ZA 4B4RA 1DLCA 4ASKA 2KXLA 1ZREA 2YDEA 3ACLA 4YVWB 1NA1A 4HVQA 4QX0A 2WYSA 1GZWB 4DEQA 5T5OA 1BZWA 2YUEA 4JKKA 4KGQA 2GALA 3POYA 2QDRA 2H6CA 1PMHX 3THDA 4FPLA 5A3PA 1JZ5A 1SLAA 4FPHA 5GLWA 3ZN6A 1YIFA 2YC2A 4AVVA 4BISA 4I30A 1ENXA 3LA3A 3T0DA 4Q4Y3 1FPN1 4MV2A 4QHOA 3SEPA 2Y33A 5BNNA 1LOAA 4A41A 3AC0A 3PJYA 5GLZA 5BPXA 1BK0A 2W2IA 4NHYA 1GANA 1F4AA 2PXJA 4Y22A 4Z2WA 1EPZA 1Y3TA 4QKBA 3WOGA 4AHYA 2XBO3 1D2SA 4DS0A 2JENA 4JQTA 3PUIA 2VTFA 2WQ4A 5F2WA 2C1FA 1BYHA 4LBQD 1JZ2A 4XFCA 5JMOA 4E9KA 3E5QA 4Q4Y2 4NHXA 2P5BA 3OY8A 2D6PA 3CIHA 4MH0E 2CYFA 2ZX1A 5T50A 3AP9A 1SZBA 4URAA 3J7NA 4N43A 2HWC2 3U07A 1JYTA 1JBCA 4L99A 1GLHA 2XBO2 1VRH1 2LW8A 1P8JA 1D2QA 2RMU1 3BU7A 5FZ8A 4ZXEA 1X7NA 1COV1 1HV1A 5GZFA 2MEV1 2JD4A 4ZS2A 4CU7A 4PJYA 2XHNA 1OPMA 1HB3A 1HXS1 2GNBA 4UBHA 1LOGA 1LNSA 1H0BA 1OLMA 1E57A 1PMJX 2YC0A 3IIIA 4LMFA 2TUNA 1MS5A 4YG0A 1PO23 4NROA 4AEDB 1XYOA 3SH5A 3NV4A 2VY0A 3NV3A 3B69A 1LOCA 2VW1A 3U10A 3GALA 4IEPA 3UGGA 2GDFA 2JXAA 3THPA 1N3QA 3OBZA 2CAUA 4MXWB 3AYDA 4IE7A 4R9AA 5GZDA 5IAVA 2VC9A 3KQRA 1MZFA 3OBAA 3V0AB 1PO22 2WA4A 2BBVA 5F5QA 5F3IA 3WHUA 2Z4FA 3EB7A 4JX0A 3ZYBA 4CEYA 2PELA 1LB2A 3TRSB 2JEMA 2OUJA 4QMAA 2B42B 4BLIA 1LHVA 1YQ2A 5L9RA 4BE3A 5LWBA 3GGLA 4GAZA 2D6OX 4PF5A 4DQAA 2RG4A 2PAKA 1RINA 5L19A 4EN8B 3AZZA 3C7FA 4NIIA 2XDVA 5EXOA 5H9PA 2AEYA 2V09A 2XKPA 3ITQA 1DZQA 1Y4WA 3N9LA 1VBE3 4XFFA 1RMU3 4NHMA 2HWD2 2FZ1A 2X10A 4MGTA 3LA2A 4G4FA 2W39A 5AVPA 5KR7A 2VJXA 4ISQA 5C9AC 5A7NA 2B9VA 1AXYA 2BGOA 4A45A 4RQPC 1QKQA 2ZGTA 3V64A 1OI6A 4GQ7A 4P9WA 4RSUA 3ZFFA 5C8CC 1VBE2 1V00A 3N4MA 2VMHA 2BZDA 1CD3G 4COYA 2E53A 4Q1RA 3V65A 3PNAA 4MUVA 1F9KA 4J25A 4FTSA 4CP1A 1U0AA 4TYSA 1QOTA 5I8YA 1R091 1ULDA 3ZPOA 3HR9A 3VBFC 5KWRA 4XQWA 1RUD3 2BVVA 3ZDVA 1N1YA 2VR4A 2JIGA 3CNAA 1F4HA 1SFPA 1UMIA 3A7QA 3D82A 5ANNA 1HW5A 1KD7A 5F9TA 4Q26A 2R043 2C9AA 5FKCA 3SEEA 2QCSB 3ZYHA 2VE1A 5F3GA 3K4DA 3AJYA 2VZPA 4L9BA 1UPSA 5F5CA 4QPIC 4IEXA 1GP4A 3MUY1 4Q8LA 4HSLA 4PDWA 5JXHA 4AFCA 3T4VA 3RI9A 3VDDB 4E27A 1V9U3 4IV1C 1X9PA 1RVF1 1NLRA 2GC2A 3LQCA 3ME2A 4YM1A 1CONA 4XQDA 1T6BX 3IM0A 4GZ9A 1R1A1 1UOGA 3I97A 3AP7A 4YVSA 4Q4X2 2XLAA 1AR61 1IGOA 3CO2A 2C6SA 1XC6A 3K77A 1O5LA 2VZ1A 1SCSA 5JR2A 1SDWA 2YXSA 2ZX0A 1URXA 2RS32 4UFMA 1V9U2 1W28A 3K46A 4GWJA 4Z92B 4DEVA 4ET7A 1UY4A 2PTMA 3THTA 2VD7A 1STMA 2VO5A 2WZEA 2VOXA 2RVAA 3S5QA 5BNPA 1IS4A 3VL8A 4FSJA 3FUQA 2OQ7A 2VVFA 5CKNA 3W21A 4IE4A 2VTXA 1GUIA 3IDEA 4JZRA 4PIXA 3VKMA 2EF6A 4FBFA 1NX9A 2OZJA 4FAGA 5IVVA 4I2OA 1C57A 3AZVA 5CU1A 1AR73 1ASJ3 1PO11 1UZ0A 1AL0G 3ALQA 3O1UA 5ABJA 4W8JA 1POV3 2PLV2 2J22A 2WO2A 4OHVA 4YZ5A 1WZXA 4A3XA 2NQYA 1OA3A 2P3YA 4QPGC 4ZS3A 4GULA 3KHCA 4UT5A 2VZVA 3RDIA 4MYEA 1MS3A 1RUE3 3JCIA 4CVUA 5J7MA 1UL9A 4QHZA 3INAA 1PIV3 2W46A 3POSA 3USUB 1W0PA 1AR72 1ASJ2 3N3HA 2XQXA 2WWJA 1J58A 5FUPA 2IWGB 3WP6A 2E7AA 2D6KA 3W20A 2B4KA 5GJ6A 2YMZA 3M2MA 5HPOA 5DAXA 2W0XA 5BXXA 4B4QA 4PQ9A 4CE8A 3KF5A 4Y24A 5IWFA 1PIV2 4LPLA 1GR3A 3IDBB 3B01A 1J3RA 5A3WA 1NE4A 4R4XA 3VHNA 2VBBA 4Y4RA 2GNTA 3WW2A 1TZOA 4D7YA 1FYUA 1D0HA 1NQJA 1YEWA 1QIQA 5FXVA 3Q8BA 1U5ZA 4XFBA 5FOBB 3OEBA 5M0TA 4L97A 2XPJA 1OT5A 3KLSA 2R1BA 1MEC1 4AL9A 2CY6A 3O12A 1W8WA 3NRUA 1CX4A 3BCWA 4GWNA 1UN1A 3GZAA 4META 5EQUA 1RTVA 2JG8C 4PCRA 2YROA 1NAEA 1TME1 2XJRA 3B7MA 3E5XA 1WW6A 5FYCA 4N53A 2K0GA 4I3PA 2RS12 4K9SA 3VD9A 4OFGA 3K3NA 5DAPA 3ZKYA 2VVEA 1N1SA 5T3NA 2DUPA 4OVEA 5H9SA 1IKPA 1QMJA 1AYN3 1NA1C 1H8TB 4JKLA 4AAPA 4BDVB 1IG3A 2W1SA 5T55A 1Y7BA 2QQJA 5ACA2 3ZDSA 1K5JA 3I4IA 4EWEA 3B3QE 4AI9A 5FO9B 4Q4V1 2QQUA 5C9AB 4BZ4A 5A7WA 1JH5A 2RR13 4E8CA 4RQPB 4QXHA 2GNMA 1YCIA 5JOZA 1T2XA 1XU2A 1MZ5A 1XNCA 4GA9A 4MGKE 5FQ0A 1WD4A 4Z2AA 5JPMB 4CP0A 3NSTA 1JUHA 4DUXA 3O1OA 2DTYA 1CAWA 2QE3A 1DU3D 4OMDA 3AKRA 2YU2A 2RR12 1W6OA 3ZYRA 5DAQA 1JOPA 2A6WA 1IQDC 4RHV3 3POEA 1POV0 4GH4A 2FBEA 3VBRC 4ASLA 5IW0A 3WF3A 1DQ1A 2J42A 3BODA 4XUOA 4D94A 1N1VA 1RXFA 1QHDA 4D6QA 2B46X 3P3PA 1Q8QA 1VBD3 2VCAA 4XDQA 1RIRA 4BM8A 1JYNA 2ZZJA 4R9DA 2JE7A 3H7YA 1O8SA 2O0OA 3HAGA 4UW4A 4BQ2A 5KXBA 1N1TA 3H8XA 4HXCA 3AXEA 2ZCWA 3AMHA 1AX1A 4GB33 3VKLA 3KGLA 3HPNA 4IE5A 5K4LA 4JGYA 1V6OA 3SCFA 1MACA 1PGW2 3JB8A 2DURA 3K4AA 3Q8EA 5K7PA 2WQZC 2E31A 3PJQA 2V72A 2Q8OA 3K75B 2JDYA 3D8CA 4AHWA 4FFFA 5IFTA 4XHXA 1KEXA 2ENRA 4JRAA 2ARCA 3G7DA 4KU8A 5FMCA 3ZFGB 1AX0A 4AFAA 3TYJA 5IFPA 4Z8BA 2CHHA 5FYUA 5F39A 1H9PA 2ZBJA 4XDOA 1ZBA3 3AB0A 2AR6A 2DTWA 1OH3A 4LKDA 5CG9A 4BMBA 1UYYA 3X29B 1F2NA 2ORZA 1ZZ7A 1BBT3 4S2FA 4KBZA 1UX7A 1AL22 4QDQA 5CB7A 3RFRA 5C70A 4PF1A 4NWWA 4QU1A 1CIYA 5I91A 2BGCA 1ZBA2 3T30A 4UBGA 3BOWA 1HIXA 2I2SA 1RUG3 2IC1A 4ZHNA 1JZ4A 5T52A 3V0BB 1EAH1 2A73B 1IQAA 4IQPA 3O1VA 2WUHA 4QQ2A 3FHAA 1VBA3 1DGWA 3VZKA 4CUCA 3O5SA 3VHRA 3OBRA 5IYYA 2BP6A 4LTAA 1E5HA 3VBHC 2GP5A 4BQYA 1LU1A 2I45A 2RDSA 4NAOA 2WZR3 1ZZCA 4NMIA 1UIJA 3TN91 1RMU1 1VBA2 3NAPC 5FYMA 2AGSA 1IPJA 3WG4A 3OGRA 2PYTA 1O3QA 1UMZA 1ODNA 1DQ5A 4IEYA 4K8RB 4UF0B 3DXTA 4G9SB 2HEVF 3KF3A 4HPKB 4SBVA 4CRQA 4HN1A 2X53S 1J84A 1W8UA 4PBPA 3J8F2 3RYPA 4XFHA 5J3UA 5FZGA 2VBDA 1GSLA 3OPZA 2ADDA 3NJXA 1W3XA 1OMIA 2JKBA 1D4M3 5FBZA 4UW3A 3POWA 4DUVA 1AZDA 2JG8B 3WV6A 5GZCA 3U4SA 1QJU3 1RUD1 1GQHA 3AL6A 3KM5A 3VZJA 5FY4A 3DN7A 4P5YA 1OA4A 2OZ6A 4HN0A 2ZMKA 4M00A 5K9YA 5E8AA 1TMF3 4BJ0A 2WSVA 4DFSA 2R041 1XXNA 4YW3A 3GDBA 5FZOA 2HBTA 5LRRA 3IPVB 2WT0A 3JBG3 2X09A 1PNFA 4RL7A 5LA1A 1RJ8A 2UU8A 3DYOA 4NWVA 3RMXA 3VBUA 3W5MA 2G9FA 3MFCA 3Q8AA 4K21A 4CDWA 1BKZA 4QPYA 3HD8B 4XVHA 2A3YA 4LUKA 1OUSA 2GC3A 2VL4A 4LJHA 3A21A 4Z82A 2CGNA 1OOPA 3URFA 4TTGA 5JI7A 2WNOA 2HBUA 4JDMA 2FCTA 4ZY9A 1SPPA 4MLOA 5FO7B 4LBJA 5DUXA 4BHPA 4B4PA 5J48A 5K0UC 4KL1A 3V56A 4UFIA 3VDBA 4P9YA 2QUOA 5LW9A 4E4HA 3PTRB 2VMFA 4IEWA 1CVNA 3VZMA 1UX6A 1YI7A 1ENRA 2HWE3 4FPOB 1GWKA 2FDFA 1AR83 2ZGSA 1K12A 1X8MA 3MIFA 1WW4A 4M4RA 3VBRB 1FT9A 3DCQA 3PUSA 5CNAA 2W91A 1FPN2 1QWRA 3WW3A 2NYYA 4XJAA 5AFBA 3MF6A 3OGSA 1RUJ1 4AVBA 4C91A 4IGOA 2W1QA 2JICA 2OX0A 4N7UA 1FNYA 2DCZA 3H3LA 1O4YA 1NZCA 2HWE2 3OBTA 3SKVA 4A7YA 4Q2FA 4E2GA 2X5IC 1KQRA 1BK1A 4YW6A 1S0CA 5CA6A 5I0TA 1W9FA 1RUE1 2ARXA 3VKOA 2BFUS 2KM2A 4BK5A 2QJVA 4CDQC 2BNMA 3N7LA 4TN7A 2O1QA 3DKQA 4KG8A 2XVGA 2WO7A 3HWJA 1SFYA 1BCXA 2ORXA 1GWMA 3KV5A 4LOTA 1BMV2 4AOCA 2BNOA 3FMGA 5GALA 2EAAA 3WG1A 1EUTA 5FZ4A 5LY2A 3ZLIA 1NCQB 4XE9A 1QH6A 2NN8A 3MIGA 5DUUA 4CCJA 4FXGB 4EN7B 2R30A 5LZ6A 2P1BA 2WNUA 4D7SA 4WZCA 4N53C 5J1XA 4QQOA 5L7OA 1W6MB 1FV3A 4HFSA 3WY6A 5EYXA 3LKJA 1ND2C 1JOJA 5JSPA 1C3HA 4PHZA 1GWLA 2J1UA 1XSQA 2ZEWA 2I74A 3C7OA 3IMNA 4A6OA 2VQUA 1GZ9A 3CBNA 1Y9MA 4S2HA 3AP6A 2IXLA 4FPEA 2KA3A 1CAVA 2W52A 4J1XA 4BB3A 4XMIA 1C1LA 2BFUL 2WN3A 1OVPA 1DP0A 1YI9A 4AG4A 1U5YA 4OLLA 3LD8A 4NIAA 3WT3A 2VCMA 1LU2A 5JOWA 3VBHB 4CDXA 2WSUA 1F5FA 1QJX3 4IEOA 5CVRA 3WNPA 1AYN1 2ET7A 1GU3A 5FPZA 5FZKA 3S6PA 4B7EA 5IVCA 4QPWA 3SKJE 4C0HA 2NMNA 5FMDA 4JVAA 4M0NA 5IUQA 4QX3A 4KG0A 2WRAA 2EIDA 3NAPB 1BHGA 3H1WA 1US2A 2WNVA 3W59A 3ZOIA 2FCVA 4HLTA 2Y34A 4MXVA 1NYWA 5FZEA 5FZ3A 1H1AA 3FLTA 1JN2P 3MW2A 5C71A 3B02A 1MZEA 4ITCA 2JDHA 3MLLA 2WLQA 4BQ4A 2J1VA 1CJPA 4DMIA 4WM7A 3AMQA 2J1AA 4QXCA 1S4CA 2Z2SB 4QB1A 3OUJA 1R092 1R64A 3VL9A 5FKBA 5FZ1A 3W5NA 3CHXA 1W8FA 1ZYBA 1REEA 5A6QA 3S57A 3UKTA 1FMD3 4RHV1 3Q8CA 2HWF3 3HJRA 2ERFA 1Z7S3 4CCEA 3BIWE 2JDUA 2X8KA 2H0BA 4Q8KA 1VP6A 2HWB1 1NG0A 1US3A 1KDKA 3ASIA 2EXHA 4GMP3 2GSYA 3QOPA 4DRRA 5F37A 1ZVFA 1FMD2 4AVAA 2ZEZA 3ETQA 1M06G 3DYMA 4GB31 2WS93 1Z7S2 1RUH3 3BALA 1W99A 1EP0A 5FMOS 3UKVA 3UGHA 1DZRA 1RUF3 1V6IA 2A6ZA 1AR62 1W6PB 2BQPA 3J7HA 3VV1A 5JDBA 4L8QA 4ATEA 1SFNA 3WINE 4CXWA 3UL2A 4IEQA 1LAJA 2W47A 5A80A 5K0UB 4QKNA 1RUH2 1JZ7A 1HV0A 1TG7A 1ULOA 1K5MA 2J1EA 4XW3A 3AL5A 2Q30A 4CEWC 1QJEA 1UOBA 4X8PA 1J59A 1NQDA 2IXHA 4BOWA 4HSJA 2ZGNA 4YWAA 1Q8OA 1OXCA 1R081 1V6JA 2DVBA 1AR93 3WHTA 1PHMA 3FLPA 1BBT1 1LHUA 1UZVA 1WLWA 2DCYA 2Y6KA 2YZ4A 2EXIA 4JDNA 4KU7A 1L7LA 1H2KA 3SH3A 3TEXA 1OFSA 1PO12 4FPGA 3KCCA 4XFGA 5DDJ1 2OIIA 1VBB2 4G3YC 1AXKA 2GU9A 2XKOA 4M0HA 1AR92 2FQPA 2RE9A 5FMOL 3WNKA 5FZ0A 3WDXA 5IK7A 4KQ7A 2VZSA 3DEMA 1YYNA 3MO4A 2F17A 1C1FA 1CPMA 1H6YA 1HRV3 1S2EA 4CDQB 5JZGB 3WQ1A 1H1MA 3KMHA 3E1F1 4YG6A 3LWCA 1ZBE3 3B9IA 4MGYE 4LE3A 1AYM2 4L11A 1CJDA 4LORA 1QEXA 1FXZA 5JR7B 3CQOA 1YXWA 4CDUB 3TOJA 2G4IA 1E5IA 4EZ4A 3JZVA 4WM8A 5F5AA 3ON7A 5EIYB 1HRI1 2Z79A 3U4XA 1ZM1A 3QCWA 5FYSA 4MGZE 2C0ZA 3I7DA 3CZUA 2QQKA 4IV3B 1ZBE2 3KT1A 5EP9A 1G6NA 2WYFA 1MQTC 2AREA 1L3JA 2VAUA 3WQBA 4COUA 5GZGA 1ND2B 1GP5A 1V6LA 4YW1A 4I0BA 4IW3A 1M4WA 1W04A 3R4UA 4FO9A 4CP9B 3PU8A 4XMAA 2R32A 5CIRA 3ZYIB 1SHWB 2YC4A 3OF1A 3C7HA 4GMP0 1W6NB 4UAPA 3VBUC 2BV4A 1ZZ6A 5L36A 4E2SA 3P1IA 4CDWC 3B93A 1QJU1 2D3SA 2IXJA 3ES4A 5LBCA 3KB5A 3C3VA 1NY71 4CCDA 4JGZC 5KC6A 3BTXA 5FP7A 1W2TA 1QXPA 2Y0IA 5D8AA 5IATA 4AQTA 4YGCA 1ENQA 2HWC3 1QOOA 4OYUA 5FXZA 3MPBA 1O3TA 1REFA 2JX9A 2ZGUA 3AXDA 3JBG1 3O0WA 2DCTA 4NAMA 1GNHA 3RJRA 3T09A 2JB4A 4AHZA 2XVLA 3U37A 5KHJA 2ZOEB 2GH2A 5FYYA 4XF9A 3WUCA 5FMBA 5FRAA 4FPJA 4OCTA 3LOBA 4Z1VA 1YQ8A 3I49A 2V5YA 4ORFA 3VBSC 5CAZA 1GOHA 1YQCA 1OLQA 2ZA9A 4QQHA 3GZEA 4YW7A 4OQ9A 5JMCA 1UF2C 1UKRA 1WBFA 2VUCA 5CFCC 2DYCA 3W58A 5FP3A 4BA6A 3F95A 1J83A 1E5SA 4MO3M 2W5FA 3NVCA 5FPVA 1J3QA 1AXZA 4XCBA 2W68A 2NLRA 3OJBA 5ERLA 3BN6A 1OQEA 1SQ4A 1CESA 2CV6A 1HB4A 3A22A 2R062 3ZX7A 5FP8A 2RS53 4BIOA 1LGBA 3AMNA 3MYXA 1F31A 2E26A 1A3KA 1RHI1 2PQQA 2AUYA 2LROA 2P34A 2Y64A 3D3AA 4IL7A 1G7YA 2EVXA 2B8MA 2RDRA 2YGMA 3WVJA 3IDCB 1HB2A 4W65A 5CFDC 4CZSA 2ZHKA 2HWD3 3AZYA 2A3XA 5GM0A 3O0VA 1QXRA 1IG0A 4XUNA 2RS52 1WLDA 2DUOA 1MPXA 3OB8A 2VTXJ 3ZXAC 1CAUA 1VMFA 3M7AA 2RJKA 5HV0A 4LKSA 3ETPA 1UZZA 2G9GA 3B00A 4K1YA 4A7KA 3DKWA 1TEIA 5LBFA 1H1IA 1W8OA 1V70A 3ENRA 3OCPA 3WNMA 4AW7A 2YBKA 1NCQA 4ISRA 1VMJA 4CEWB 1NCRC 3WR0A 4XIOA 4ASMB 3GYDA 4IGPA 3A23A 3FZ3A 3RRDA 2JKXA 2D44A 4X6RB 5FR3A 4UOJA 4YW5A 3BVCA 4LO6B 4AEMA 3VZNA 1IS3A 4K40A 2ARBA 3QD6A 5FZMA 4A44A 5I93A 3BTZA 3M70A 3OYWB 1UY0A 4IETA 4UFLA 4XXAA 5I0UA 4ES9A 2K46A 4F7ZA 5IAXA 4EQVA 5FYHA 1LGCA 1GNZA 3WEZA 2UWCA 4XUTA 1F8VA 1L7QA 2A6YA 3MHZA 5F1RA 1MS4A 2FD8A 3CJIB 5LK7B 4H7LA 3ZR5A 4AGRA 1DLLA 2ZHMA 4DY3A 4LT5A 4KMQA 1WW5A 3DPRC 3T0AA 4AVCA 5HCAA 1PNGA 2XJVA 1RUOA 3RZLA 1NKGA 4R52A 1UYPA 4MHUA 4MSVA 3J7LA 3LDKA 3PURA 1QJX1 2WFPA 4MGIE 4Q4X3 4XF0A 5C4WC 5JSRA 1B35A 1BLZA 1U12A 2PN5A 1TE1B 4KNCA 5FYIA 3RQ0A 3BTAA 3RGBA 3WQ7A 2CU5A 2SLIA 4DB5A 2XXZA 4Q1PA 2J1RA 5DPNA 3AKPA 4CCCA 2RS33 2R0FA 2TEPA 2Z42A 4YFZA 3VBOA 1ODMA 2NM1A 3AMPA 1Q56A 1OPOA 2DBIA 1LOEA 3H3ZA 4CCMA 5CISA 3VD4A 5LB6A 2FDIA 4WBBA 3RZGA 2VZQA 4TLGA 1MQTB 4M3CB 2VXJA 2DVFA 2JDPA 2W3JA 3I2IA 3GJAA 2Y6JA 2VOWA 4LBKA 3ORJA 1BVP1 2P6HA 1APNA 4RS5A 2WO1A 4MADA 3AFKA 1LOFC 1YRZA 4XF3A 2Y6HA 4RR3C 4ZU4A 4OMCA 5KXEA 4E4DX 1QJZA 1OQ1A 4FXKB 2DWRA 2PLV3 1GICA 1ND3A 1SMVA 4LQRA 5FZLA 5GZEA 3SXWA 4CCLA 2CGPA 1PVC2 4D0QA 2HWF1 2O14A 4LHNA 4Q0QA 4AQSA 2Y0OA 2EAKA 5GLVA 4JGZB 3LGRA 5A33A 3T1LA 3WSOA 3ZMOA 2VQAA 3BGAA 1J1TA 1ACCA 3A4UA 5KHGA 3ZFEC 2WAAA 5FK8A 1LGNA 1W6QA 3P6BA 4P00B 4N90A 4X8NA 2JG9C 1HLCA 4W6YA 1ST8A 1V6KA 2RM23 1ZNPA 1K5MC 4OQ8A 3SCGA 1Q8VA 2BBAA 3VKFC 4XC9A 1JHJA 2R071 1CAXA 3E6DA 4W6WA 5HBAA 4M3CF 1LTEA 2VH9A 1RUF1 2VUJA 3M8LA 3VBSB 2D5FA 2YYOA 1RUC1 2BYVE 5FY7A 2PHRA 2RM22 3KZ4C 3HBKA 1W0OA 5FYVA 1G9AA 4XTPA 2ZACA 1REDA 3DGTA 3ZVXA 3AKTA 4NO4A 3O1SA 1XPWA 2XLGA 4I01A 4C1XA 4LO5B 1NLQA 4LBQA 5DG2A 4QQPA 4RGKA 3GBFA 5BNOA 4K8FA 1LECA 3UNPA 5AC93 3EO6A 2IUWA 4ATFA 2YBPA 1RUJ2 2OYZA 1W9SA 4XURA 3J9SA 3VD5A 4WVZA 5IHRA 3F2ZA 3H3UA 2ZPXA 3HOBA 1ZZ9A 2RS13 3W9AA 5HCBA 1VLNA 1QJFA 2B39A 3N9OA 1HDKA 4IESA 2P6CA 5FIXA 2QQMA 3I59B 3UGFA 5AC92 1BEV3 4MGQA 4SLIA 3ZXDA 1GBGA 3OGJA 3BIEA 4WM8C 5CFDB 4BH9A 3BTYA 1W2OA 1H2NA 1TNFA 3WG3A 4A42A 1QJY1 3D6EA 5ACA3 4WV8A 4CTEA 3D0JA 1W05A 4LE4A 1W2AX 3ZR6A 4LA3A 3HN3A 2WC2A 4B29A 1VBC3 5JZGA 1DYPA 2GMPA 1HRV1 2Q1MA 1HQWA 4YGDA 4A6SA 1CN1A 1RUI2 3ZXLA 4JTOA 1BEV2 1SCRA 2J1TA 5FXWA 3BOPA 1W9YA 1WGPA 3RS6A 2C26A 4EN0A 3RVHA 3JD72 2BVBA 4FP3A 2W87A 4LITA 3HQRA 4LR4A 4OI2A 4AF9A 3J4UH 5FCCA 1ZRCA 1PK6A 5DQ0A 4XPVA 2ARAA 3S7EA 1VBC2 1NCRB 4R4ZA 2F6BA 1GFF2 3IIAA 4KGGA 3AZXA 4QGLA 5FZ9A 3LZZA 4DNYA 1QQP1 3S0MA 4X6QB 2CWMA 5C8CB 4YVWA 3D4KA 1HKDA 5DUWA 2BGPA 1EV13 1S2BA 3LA7A 4IE0A 1GZWA 4EYUA 5BNNC 2AZ5A 5D8AC 5G05L 4XABA 3SLIA 1MVEA 3SQOA 1HQLA 1IPKA 1GQPA 4Q0UA 2Q8CA 5EWSA 2VMCA 1VE0A 3I3BA 1W6NA 2D5HA 1RITA 2KR2A 4LKEA 3O1RA 4TWTA 3VBFB 1UU6A 1L7RA 1VPHA 4HMZA 2Z69A 3S7IA 1VB4A 5FY8A 4E2QA 3CEWA 1NXMA 3DPRB 1EV12 3LEGA 3QLQA 4NHLA 1DQ0A 4NR1A 4XFIA 3VLBB 4Q4Y1 3D5OA 2JDZA 1W8TA 2WFF2 4N43C 3LF7A 4CCKA 2B5HA 4XILA 3RZHA 1X36A 5C4WB 1VIWB 2PHUA 5JXIA 2HWC1 1VR3A 1S0IA 4YG3A 1MS1A 4QPIB 3CU7A 4DO0A 1CPNA 2XBO1 3N7KA 2QQIA 1S0GA 3VB9A 4HKOA 2K2SA 4IV1B 5F5IA 1HN0A 4LOSA 2Q5TA 3VD3A 5A32A 1S0BA 1NT0A 1JYVA 4P9GA 1F35A 1OURA 3MBWA 2VOVA 3AYAA 5SV5A 2VZTA 5A3TA 2GMEA 1AL23 1J1LA 3FE5A 2FMDA 3M3IA 4FOQA 4H7MA 2GAUA 4YW2A 4DXRA 2R1DA 5FYTA 4WVMB 5FPUA 5C5UA 2WN2A 2A1XA 3WCRA 4DXSA 3DYPA 5DZFA 4EWDA 4QD2A 4RR3B 1LULA 1SLLA 3ZYGA 1RUNA 2R6QA 4XUPA 3VZOA 4CEYC 4AEDA 1UXXX 5FJKA 1PO21 3WQ0A 1LKNA 3MDPA 2MNGA 3WNOA 4QX2A 2UY9A 1W9WA 3KVBA 2HWB2 2QQLA 2PMWB 1XNKA 2O8QA 3CKHA 3IAQA 2Y38A 1N47A 4EROA 2WR9A
chains in the Genus database with same CATH topology
2A5ZA 1HX6A 3ZFEB 1V6NA 4MXWA 3FLRA 4COWA 2JG9B 2D3RA 3PVNA 3G6JB 3VGIA 3V0AA 1UD1A 1WCSA 4XIKA 1ULCA 3T2TA 2QFEA 4QPGB 2ES3A 3MLKA 2ZHLA 4XQ4A 5BYNA 1S0FA 4O9GA 5JOYA 2NPIA 5B2GB 3I8TA 3I2DA 1QF3A 4RFT0 1LEMA 3ZFFC 3WG2A 4PBOA 1OLRA 2CAVA 4XEZA 4BMEA 1DQ4A 1C5IA 1VBE1 3FUOA 3ATGA 3IT8A 3J8F3 2XJTA 4I09A 4M01A 4AVSA 4FTBA 3HT2A 5C8WA 1I6XA 2VW0A 1Z0HA 4XJ9A 2WJSA 2GNDA 4URTA 1KFUL 4Q4W3 1U5XA 1WMEA 5FPXA 5FLIA 1G9FA 4LA2A 3R0RA 2QDNA 1UU4A 1DQ2A 4HK9A 1AJKA 2C5DA 1KS5A 1WD3A 2VMIA 2VQ0A 1BQPA 1B35C 1WMFA 4FPYA 4Y20B 1G86A 4NN0A 1QXJA 1PZ9A 1VAKA 1C8M2 3MIDA 4PDWC 4Q4W2 1JTZX 3FHIB 1H9WA 5E16A 4H3WA 2B45X 3AP4A 5KC5A 2OVUA 3PMSA 4YVSC 4EV0A 2BW8A 1NA1B 4K7JA 4MX3A 3BPZA 1DIWA 1H4HA 1YFUA 4AGGA 2GC1A 2XJQA 1WCDJ 1FOD2 2D98A 4DINB 3VDDA 3A0KA 3AMMA 4MVTA 1ULEA 1V9U1 5CG8A 2OUHA 1SLIA 1WA4A 3ZN6B 5BNPC 4I0AA 3M1HA 1PGL1 3OD0A 1FPN3 3L2YA 5H9RA 4OI0A 2QZ3A 4K6BA 4Q0SA 5BNNB 4YGBA 2B7YA 4AVTA 1RB8G 1X33A 4Y22B 5ABJC 1ONAA 2CGOA 4B8EA 3HBZA 3DL3A 4A2UA 2PLV1 3MGUA 3MI8A 2IFWA 4XJUA 3NO8A 3OY8B 1H8VA 2UYBA 2VNRA 1XQNA 3HT1A 1QY4A 4LHKA 3EJKA 4LBMA 3KD4A 1O4TA 4N43B 2W08A 4RGAA 1VRH3 2RMU3 1AR71 1ASJ1 5H9QA 1COV3 1I3HA 1POV1 2MEV3 2ZKLA 2GZWA 4W6XA 1HXS3 4DOUA 5BNOC 1A78A 3USUA 1VB2A 1PIV1 3AX4A 5JOXA 1VRH2 2BUKA 2RMU2 3WW1A 2P3IA 1COV2 4XBNA 2MEV2 2QQPA 1H30A 1CR7A 1PGSA 1EYBA 2EA7A 4OI1A 1HXS2 1CIWA 1WLCA 1ZX5A 3DUIA 2DVAA 2JJ6A 4FCAA 4F8AA 1LESA 2IZWA 2XHKA 1BVVA 2PAEA 3GZTB 3NL1A 5FO8B 2PHTA 1DBNA 4NVPA 4BIFA 5FDBA 3ILNA 2UWBA 2AH2A 4GKYA 4UW5A 3WLUA 5FTTC 1YIPA 3AFGA 4D7TA 4V1PA 4M3CE 3ELNA 2VGDA 4FP2A 4JQRA 4LULA 5T5PA 2E51A 3LAGA 4LBNA 3HMYA 5DZGA 4LUMA 2YHJA 3KCYA 5ACA1 1S1AA 3FFZA 4RA0A 3UJOA 2RHPA 3RYKA 3ZFFB 2DFBA 4Q29A 5F6KA 1H8TA 5JSOA 3FC0A 3PTYA 4HETA 4QXKA 4ZU5A 2UURA 3ZXFA 1I9RA 2ZAAA 3SH4A 2XGXA 1PMIA 5C9AA 4KH9A 1R093 3IBMA 4RQPA 3WDWA 2RR11 1OQDA 3AYEA 4GH4C 4JTNA 1UU5A 3MW3A 3WZ1A 2XUMA 4GIQA 3B94A 3ZYJB 3ZXJA 2VMGA 4YZ4A 5HXVA 4S2DA 2P3JA 1JHNA 1AF9A 1OD5A 5JAXA 3LB9A 4JGYC 3BB6A 3FJSA 1ULFA 4L92A 1VBD1 4QGMA 4BLJA 3RI8A 1AR63 3RG0A 4YVSB 4GKXA 4HANA 3WP5A 2E6VA 1DZTA 1ZRRA 2ZMNA 4D3WA 2YY1A 5K8SA 1U5IA 1JYIA 3CF6E 3AP5A 3SHRA 1RVF2 4BQ1A 2D43A 4TSVA 2BWCA 1R1A2 1JYCA 1O5UA 2A6XA 2XWJB 4FPCA 4AEDC 5BNPB 1OSGA 3QH7A 3ZFGA 5JCTA 3ES1A 4AYUA 2UY8A 2NZ9A 3M3EA 4WVMA 3P3NA 1NXD1 1PO13 5AVAA 2WL1A 1VBB3 1ZBA1 5ABJB 1OFNA 1J3PA 4XF1A 1LHOA 4KWLA 4FQZA 2WA3A 2CNAA 4FPKA 4O9EA 1LOBA 4FOWA 4L2NA 1C5HA 4XOGA 4FVVA 3MW4A 5T5JA 4Y4YA 4AGVA 4HVOA 3MIEA 3OD4A 1RUG1 3V0BA 4XXPA 3GZUC 3ZXEA 1G9DA 1AYM3 1DGWX 1VAVA 2X5IB 2R072 4OULA 3ZO0B 1RJ7A 2HJIA 4AFDA 1VBA1 3CL1A 1Q43A 1DG6A 3H9AA 1WW7A 1MR5A 1D0GA 2FZ2A 1ZA4A 1AHSA 1TQ5A 2VXRA 3QACA 2MPFA 2BPA2 2WIIB 3C2UA 5HCFA 2WINB 2WZR1 4DPNA 1MEC3 2XJSA 2TNFA 3B5LB 1WLTA 5CBLA 3EQEA 2PHLA 1TME3 2BTVC 3WDYA 2WWSA 4HPKA 4N53B 4LBOA 1UAIA 3IN9A 1CQ9A 3OGGA 1S0EA 4YRDA 5EZWA 1MEC2 2A75A 2PFWA 1N3OA 4I02A 5KBFA 3NKTA 2D6NA 1TME2 4IEVA 1D4M1 2IXKA 4BYYA 1QH7A 1QDOA 2JG8A 4XTMA 2SBAA 4Q4V3 3VUOA 2H6BA 2AENA 3NV1A 3RWNA 2IFRA 2VVDA 1O3SA 1OOPC 4HT1T 1YWKA 4MZUA 2CTVA 3MICA 3LSEA 1TMF1 3MFAA 1PZ7A 5FQ0B 3IPVA 4DXZA 1WUVA 5DG1A 5KXDA 3KSCA 3SMHA 4PIZA 4Q4V2 5LEJA 1CAWB 3KCXA 2A7AA 5J09A 2ZGLA 1W6OB 5FLHA 1QQP2 2WLPA 4GH4B 2ZX2A 3HQXA 4HKLA 3KS7A 1UPIA 1DHKB 2XH6A 3ZSLA 4YYOA 3NKGA 3ECQA 4FPFA 5JIUA 3JB4C 4YZ2A 2PHDA 5GLTA 2R063 4U36A 1ALYA 3AM2A 4N9HA 3L2HA 2HWE1 1KJRA 4AE2A 1AR81 2LM3A 3NW4A 2FHRA 3N7JA 4RD7A 3VBRA 1MS9A 2PA7A 4JGYB 2HEWF 4S2GA 3AK0A 1KITA 3UKNA 1Y43B 1SACA 1A6CA 5J96B 3H50A 3UV9A 4AEJA 3ZXKA 1C4RA 2E9QA 3H1MA 1Z78A 1UW8A 1AUYA 4XBLA 1ZZBA 1XNBA 1BMV1 5KXCA 3OTFA 5I8SA 2DCJA 4LO8A 3R4DB 5GKAC 2WNUC 2XLFA 4QU2A 5EFUA 1JUIA 5L7OC 2Q1ZB 3IKWA 1D4VB 1ZRFA 3AKSA 5EJ3A 1WCKA 1YFYA 2A3WA 5EYYA 4ES8A 4YM3A 1EAH3 3ZIWA 3LOIA 3UJQA 3JU9A 3VHPA 2IXIA 1YO8A 3WDVA 2ZX4A 1W6MA 3H7JA 4BPZA 4B7KA 3JUUA 2R16A 4XF4A 2E63A 3M3OA 5DUVA 1DYKA 1MZ6A 1DQ6A 4CDXC 1EAH2 4F83A 3M4FA 1H8TC 3VZLA 3TN93 4FAHA 3USSA 1H4GA 4LBLA 1QGLA 2N7GA 1UKGA 4P9LA 4XZPA 3K51A 1IZ3A 5E89A 4Y1VA 2WNVC 3ZN5A 4DZGA 4HVRA 1MS0A 1S55A 3ST7A 3ZSKA 4QGNA 3VBHA 1Q8SA 3TN92 1MS8A 4KWKA 3NJZA 1RMU2 4EN9B 4XJ8A 4WM7C 1G9CA 1GZCA 3NAPA 1B09A 3FX3A 1Q3EA 3PLQA 4JRLA 3UK9A 2P3KA 2RJLA 3JQWA 5J36A 3MIBA 5AFEA 4ZKTB 4Z07A 1PVC3 4IXLA 4YW4A 3MPPG 4ONUA 2D6MA 3MIHA 4LLOA 2XVKA 4E4ZA 4AI1A 4EJRA 1N3PA 2P2KA 4LO7A 4AFMA 1QDCA 2ZGPA 1GQGA 3O7OA 3WP4A 4UXAA 1RUD2 3VBUB 3KT7A 1FMD1 4CDWB 3SITA 1DFQA 1Z7S1 2YV8A 4AI0A 2R042 1OOPB 4PLNA 2ET1A 5BY5A 4I3GA 4INDA 1C28A 3ZFGC 3WCSA 2ZX3A 1XYPA 1X50A 4GMP1 2LALA 3RSJA 4R9CA 4A7ZA 3HN1A 4I0WB 1QNYA 2ZGQA 2WS91 5LEKA 1FATA 1RUH1 1SLCA 4HL0A 4P5HA 4AK3A 2VNGA 3PHMA 1WBLA 3ZSJA 1PGL2 2GN3A 2E7QA 1W6PA 4PIYA 1ZZ8A 4IERA 3O0XA 3U0ZA 1RUJ3 2MHFA 1DGRA 2Y26A 5K0UA 3SNMA 2CL2A 2EXJA 3AKQA 5CFCB 5A3MA 4FTEA 3Q9OA 3FBMA 5JLVA 1VBB1 4J1WA 3EXUA 3IWZA 4AQ2A 3L9JT 2QKDA 3QBQA 4P9XA 1AR91 4OUSA 1GKBA 4ZXKA 5GLUA 2GC0A 3A0NA 4JCKA 1X82A 4C0BA 3CLPA 4YSFA 4NOTA 1RUI3 1AJOA 4AEKA 2X5IA 1AYM1 2UYAA 1RUE2 1ZRDA 3JD73 2X29A 1FAYA 1LENA 2VECA 3R4SA 1XE8A 4RGGA 2QNKA 3ZSMA 4XFAA 4CDQA 2WT1A 4OHXA 1I5ZA 1OKQA 2WNUB 1X8EA 2ZGMA 2A71A 1EPWA 1FX5A 4Y1YA 5L7OB 5T5LA 1ZBE1 2WKKA 3TWIA 1W2UA 4CDUA 5C33A 2BWAA 4QT6A 2ZHNA 4LEJA 4OUMA 3J26N 1CAVB 2A6VA 1F5JA 5HI0A 4DY5A 5IT6A 4IV3A 4HK8A 5JI9A 1NLSA 4JDOA 4QX5A 1KXGA 1ND2A 2EALA 1SBEA 1CGPA 2ZAHA 5FLJA 4CDXB 2D3PA 3HIFA 2R0HA 4R8HA 2WFF3 3FFQA 5I8TA 5A3LA 1SBFA 3E97A 3H0OA 4FOVA 2WT2A 3PVEA 4XHBA 2WNVB 5J37A 1YJLA 4EWAA 1YLLA 1OHFA 3SCHA 4AI3A 5CADA 1AYN2 1W39A 2YGLA 5IK8A 4WM7B 1LODA 1UIKA 1LHWA 2DUQA 1XE7A 4TLFA 4IEUA 3WDTA 1RGSA 1LRHA 4AWDA 3MZHA 1JW6A 2ZGRA 3N7MA 2B9UA 4KBBA 4WVVA 2XL9A 2HWB3 2ZS6B 3PVOA 2R061 1KRIA 3ZSEA 1H2LA 4K1ZA 2HKXA 4E4SA 4RHV2 3CJXA 5E88A 1LEDA 4N9IA 2PHXA 1VBD2 4Q0PA 3VKNA 4NPRA 1A8DA 5LK5A 2RS51 2GH8A 2P37A 3QH6A 2ZTNA 4GB32 4QM9A 3NV2A 4AI2A 2ZABA 2F4PA 2XWBB 4XJZA 1FI2A 1K5MB 3N36A 3AZWA 5IK5A 5LRSA 2HWD1 1NCQC 1S0DA 2DU0A 2QVSB 1R083 2DCKA 1LR5A 1EY2A 1SEFA 4IEZA 3NWKA 5A32B 2ZGKA 3M3CA 1FNZA 5DDJ3 5D1IA 2BNNA 4C90A 2LUWA 1ENSA 4P14A 3AYCA 4AI8A 2NMOA 4CEWA 1R082 4H55A 4QHBA 3K48A 2ZGOA 1BBT2 5FAXA 5E1RA 2O8OA 4LLFA 3U11A 1XRUA 2VU9A 1C8M3 4KWJA 2DVDA 3D0SA 5DDJ2 4P9JA 4OZXA 3WNXA 1KDMA 4YM0A 3TAYA 4U2AA 4CP2A 3OYWA 1RUG2 3RYRA 1DDLA 2EIGA 3H8UA 4TZDA 2QZ2A 2E7TA 4UW6A 4LNVA 4Q27A 3CJIA 2JECA 1Q8PA 1O7FA 1HRI3 4WM8B 1FOD3 1OA2A 3VBOC 1S2KA 3R05A 3TNQA 2D97A 2Q4SA 1I1EA 2PHFA 2VULA 4YZ1A 2WZR2 1DF0A 1DGRN 2ZZQA 4Q4X1 1H2MA 1HRI2 1NE6A 4RS5C 2VUAA 3EBRA 2RS31 3ZN4A 1AVBA 4HKWA 3H1YA 4B3NA 1IS5A 1ND3C 4YLZA 2ZMLA 4P9IA 3E5UA 2Q0AA 1MQTA 1PVC1 4K20A 4M3CA 3WUDA 2AYHA 4OHZA 4OHWA 4K3UA 4GWMA 1KS4A 2XG3A 2WZPP 1D4M2 5D8AB 1IOAA 4FOYA 2JE9A 2VPVA 1QJU2 4OHYA 2DFCA 3O14A 1NY72 1QU0A 1Y9QA 2VOKA 1TMF2 4JGZA 3WW4A 3TNPB 5KHKA 3JBG2 3M3QA 4Y26A 2DF7A 4GXLA 1DGLA 1XU1A 4QQLA 3ZMNA 4AQ6A 1PZ8A 3VHOA 2TBVA 2RM21 2FMYA 3TB0A 4Y1UA 1RL3A 4C1WA 2ETEA 5JPNB 1C8NA 3VN4A 3VBSA 2OA2A 3KGZA 5JIAA 4Y5Z0 1BXHA 4HZFA 2XB6C 4JV4A 3T1MA 2WNEA 1RHI3 3RNSA 3WP3A 5CFCA 2V73A 1AR82 1T6GC 4YNIA 1YHFA 2ZJCA 2PAMA 4COVA 4PLOA 5AC91 4OI4A 3WD5A 4CEYB 4WVWA 2A70A 1RHI2 1GV9A 5JZGC 4JAAA 3ZIXA 2RS11 1PVXA 1CAUB 4D69A 2HEYF 4PLMA 2XJUA 4J6GA 3I59A 1BJQA 5I0RA 1RUI1 5IK4A 3RPQA 4CDUC 5BUVA 1BEV1 5CFDA 5DZEA 1PK6C 3JD71 1YFWA 3GBGA 2GMMA 2VNOA 3I54A 1YJKA 5C6CA 4IV3C 1SLTA 1VBC1 2VW2A 4YVWC 4NHKA 1SLBA 1SBDA 2D6LX 5JVVA 2PHWA 3SISA 2IXCA 5FREA 3RZZA 2XJPA 4AFBA 4N7IA 5J98B 4R9BA 1A8MA 1NCRA 3MLJA 3N35A 3KT4A 4JC1A 4LO4B 3TBDA 1YFXA 2HYKA 4YARA 1PM7A 5C8CA 1G9BA 2ILMA 1VAMA 1EV11 1VALA 3APBA 1KJLA 2WFF1 1IS6A 1IKQA 3S30A 5BV6A 1B35B 1S0JA 2OW4A 2XL7A 3VBFA 4QM8A 4PDWB 5KHHA 1IHMA 3ZXGA 1RVF3 3VBOB 2R49A 3DPRA 2VG9A 4F3JA 3PMEA 4YM2A 3ROUA 1PGW1 1R1A3 1RC6A 1V6MA 1QJX2 1R1ZA 4YZ3A 4EN6B 3WDUA 3B9CA 3AJZA 5C4WA 4DRVA 3E6CC 1VJ2A 4QPIA 1WMDA 1GYKA 3GF6A 2LTNA 4RS5B 5FOJB 1YUDA 4WZFA 1NOVA 4IV1A 1QNWA 4XBQA 1ND3B 4GALA 1YNAA 2D40A 4HBNA 3ZPYA 3EHKA 2DU1A 3ILFA 2DVGA 5A33B 4Y1XA 1AL21 3LCPA 4AXOA 3E6BA 1O3RA 3PVBB 1W6QB 1MVQA 4ZU7A 1LOFA 4RR3A 3MF9A 1O91A 1UCXA 3GBWA 4AHXA 2HWF2 5I0SA 3FBYA 1HQNA 3GHNA 2R073 2NP0A 1CAXB 2H0VA 2D93A 4XYXA 3ILRA 4FT8A 3ZFEA 1RUC3 3DF0A 1LJ7A 5L73A 5BNQA 5FFOC 2JG9A 3FWEA 2BEOA 2WS92 2EXKA 3GHMA 4QPGA 5F6LB 4XJWA 5T54A 4YFWA 2P17A 4LBQB 5JWPA 1RUF2 2D7FA 5BNOB 5TSWA 1UZYA 5KHIA 2YPJA 1RUC2 3MEPA 3R6SA 3LSDA 1KFXL 1Q5OA 2GN7A 2UWAA 2I07B 3J8F1 1AX2A 3WX5A 2OPKA 3RMYA 4Q0VA 2Z5WA 3CJIC 4BWOA 1XYNA 1QJY3 2DV9A 1TNRA 4Y1ZA 5DXDA 3GNEA 1QOSA 4Q4W1 1C8M1 1O4ZA 3ZYPA 2ZKNA 1G8WA 2CWSA 3WXPA 4FQ4A 3DV8A 4CYDA 4COZA 1XNDA 1LHNA 5SV8A 4Y20A 3JQXA 1FV2A 1QJY2 4LHLA 4BCUA 1ULGA 2ATFA 3VDDC 1PK6B 4XETA 1JXNA 1FOD1 1HRV2 1LCLA 4YGEA 4H14A 1QQP3 2K9ZA 4B4RA 2KXLA 1ZREA 2YDEA 3ACLA 4YVWB 1NA1A 4HVQA 1GZWB 5T5OA 1BZWA 2YUEA 4KGQA 2GALA 3POYA 2QDRA 2H6CA 4FPLA 1SLAA 4FPHA 5GLWA 3ZN6A 1YIFA 4AVVA 4I30A 1ENXA 3LA3A 4Q4Y3 1FPN1 4MV2A 5BNNA 1LOAA 3PJYA 5GLZA 5BPXA 1GANA 4Y22A 4Z2WA 1EPZA 1Y3TA 3WOGA 4AHYA 2XBO3 1D2SA 4DS0A 2JENA 2WQ4A 2C1FA 1BYHA 4LBQD 4XFCA 4E9KA 3E5QA 4Q4Y2 4MH0E 3OY8A 2D6PA 2CYFA 2ZX1A 5T50A 3AP9A 4N43A 2HWC2 3U07A 1JBCA 4L99A 1GLHA 2XBO2 1VRH1 1D2QA 2RMU1 3BU7A 1X7NA 1COV1 1HV1A 5GZFA 2MEV1 2JD4A 4PJYA 1OPMA 1HXS1 2GNBA 4UBHA 1LOGA 1H0BA 1E57A 2YC0A 2TUNA 1MS5A 4YG0A 1PO23 4AEDB 1XYOA 3SH5A 3NV4A 2VY0A 3NV3A 3B69A 1LOCA 2VW1A 3U10A 3GALA 4IEPA 2GDFA 2JXAA 3THPA 1N3QA 2CAUA 4MXWB 3AYDA 5GZDA 4R9AA 3KQRA 1MZFA 3V0AB 1PO22 2WA4A 2BBVA 5F5QA 3WHUA 4CEYA 2PELA 1LB2A 3TRSB 2JEMA 2OUJA 4QMAA 2B42B 4BLIA 1LHVA 4BE3A 4PF5A 2D6OX 4DQAA 2PAKA 1RINA 5L19A 4EN8B 3AZZA 5EXOA 5H9PA 2V09A 2XKPA 1DZQA 4XFFA 1VBE3 1RMU3 4NHMA 2HWD2 2FZ1A 3LA2A 4G4FA 2W39A 5AVPA 4ISQA 5C9AC 1AXYA 4RQPC 1QKQA 2ZGTA 3V64A 1OI6A 4GQ7A 4P9WA 4RSUA 3ZFFA 5C8CC 1VBE2 1V00A 3N4MA 2VMHA 4COYA 1CD3G 2E53A 4Q1RA 3V65A 3PNAA 4MUVA 1F9KA 4FTSA 4CP1A 1U0AA 4TYSA 1QOTA 5I8YA 1R091 1ULDA 3HR9A 3VBFC 5KWRA 4XQWA 1RUD3 2BVVA 1N1YA 3CNAA 3D82A 1HW5A 1KD7A 5F9TA 4Q26A 2R043 2C9AA 2QCSB 3AJYA 4L9BA 1UPSA 4QPIC 4IEXA 4Q8LA 4HSLA 4PDWA 4AFCA 3RI9A 3VDDB 4E27A 1V9U3 4IV1C 1RVF1 1NLRA 2GC2A 3ME2A 4YM1A 1CONA 4XQDA 3IM0A 1R1A1 3AP7A 4YVSA 4Q4X2 2XLAA 1AR61 1IGOA 3CO2A 1O5LA 1SCSA 1SDWA 2YXSA 2ZX0A 1URXA 2RS32 1V9U2 4Z92B 2PTMA 3THTA 2VOXA 5BNPA 4FSJA 1IS4A 3VL8A 3FUQA 2VVFA 3IDEA 4PIXA 3VKMA 2EF6A 4FBFA