1QQP1

Foot-and-mouth disease virus/ oligosaccharide receptor complex.
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
210
structure length
188
Chain Sequence
TTSAGESADPVTTTVENYGGETQIQRRQHTDVSFIMDRFVKVTPQNQINILDLMQVPSHTLVGALLRASTYYFSDLEIAVKHEGDLTWVPNGAPEKALDNTTNPTAYHKAPLTRLALPYTAPHRVLATVYNGECRTLPTSFNYGAIKATRVTELLYRMKRAETYCPRPLLAIHPTEARHKQKIVAPVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure and function of a foot-and-mouth disease virus-oligosaccharide receptor complex.
pubmed doi rcsb
molecule tags Virus
molecule keywords PROTEIN (GENOME POLYPROTEIN)
total genus 39
structure length 188
sequence length 210
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1999-05-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1qqp100
1VBA1 1RUE3 1R092 5LK7B 1RUI3 1VBE2 1C8M3 4YVWB 1NY71 3DPRA 1FPN1 3JBG3 3HAGA 1H8TC 2WFF2 3VBOC 4IV1C 2VQ0A 1AR71 4EJRA 1OHFA 1AR72 4QPIC 1PIV3 1ND3A 5CFDB 4RHV3 1ASJ3 1V9U3 1NCRA 1CJDA 1NY72 2HWF2 1DDLA 3DPRC 2X5IC 2BFUL 1VBA2 1Z7S1 1EV11 1RUG2 4CDUC 1VBE3 4SBVA 1VB2A 2HWB3 3FBMA 1QJX3 2GSYA 2WZR1 5JZGC 2HWC2 4WM7B 3TN91 4GH4A 1EAH1 4JGZC 4GH4C 4RHV2 3ZFGB 1ND2A 4CDXC 2RS33 2RMU1 1PVC1 2WZR2 4PDWB 1ASJ2 1QQP3 5DDJ1 1C8M1 1RUG3 5CFCA 3VBRC 2R041 4Q4W3 2MEV3 1RUG1 4RR3C 5A32B 2FZ1A 3ZFFC 1QJY3 1B35B 1QQP1 5BNOA 1PGL2 1MQTB 1RUI2 1COV1 1BBT1 4CEWA 5C4WC 2RS51 3VBSC 4CEYB 1K5MC 1NCRB 5BNOB 5BNPC 2WS93 1FPN2 1NCQC 1OOPC 3J8F3 4CDWA 4YVWA 5ABJB 3ZFEC 2RR12 1R091 1Z7S3 3JD72 1GFF2 1QJY1 4WM7A 1RHI3 4YVSC 4GB33 1RUJ3 3ZFGA 1RUD2 2HWE2 4JGZB 2RS12 5ABJA 2HWB2 4IV3C 1NOVA 3VBUC 1VBB2 1TMF3 5A32A 1QJX1 1BBT2 1F8VA 1HRI3 1R083 1RUJ1 5CFCB 1COV2 1RHI1 1RUF2 3M8LA 1BMV1 1ZBA2 4CEWC 4NWVA 1AYN1 1TME2 4AEDC 5ACA1 4Q4Y3 3ZFFA 2HWD1 5AC92 1HX6A 1M06G 2X5IB 4QPIB 2RR13 4N43C 3LOBA 1RMU1 5DDJ2 5C4WB 1FOD2 2TBVA 1ASJ1 2DF7A 1PVC2 1NA1B 1D4M2 1ND2B 4JGYB 1VBD1 2R073 5FMOS 1EAH2 1V9U2 2XBO1 1COV3 1PO22 4N43B 3JB8A 3ZFGC 1RUH2 1VBC2 4YVSA 4FSJA 5AC93 5JZGB 2BBVA 1NA1C 4AEDB 1VBA3 2WWSA 2WS92 4CDUA 1PO12 1R1A3 4NWWA 2HWF1 1PVC3 2RS31 5BNPA 1AR92 2RMU3 1FOD3 1ZBE1 2ZTNA 5D8AA 1EAH3 1AL21 1FMD2 4QPGA 2FZ2A 2R072 4QPGC 1F2NA 4IV3A 3IDEA 3CJIA 1AL22 1FMD1 1VB4A 4PDWA 4CEYC 5C4WA 4IV1A 1ND3B 1RUH3 1AR91 1WCDJ 2XPJA 1POV1 3VBFA 1VBE1 1EV13 2BFUS 4GH4B 2HWD3 1C8NA 2RM21 1POV3 3VBRA 1HRV3 5C8CB 4RQPA 4WM8A 1X33A 1NA1A 1PO11 4RR3A 4LLFA 1RUC2 1NCQA 2R043 3VBHC 4CDWC 5C9AB 1AL0G 4CDQA 1OOPB 5A33B 2ZAHA 4CDUB 1FMD3 1AR73 2Y26A 1TMF1 5JZGA 1FPN3 5L7OA 4RS5A 1PIV1 4YVSB 1NCQB 1PGW1 2QQPA 4GB31 2GH8A 1HRV2 5C9AA 4QPGB 1QJU2 4JGYA 1HRV1 5CFCC 1R093 1AR82 5ACA2 5K0UA 4IV3B 2HWE3 1ZBA1 1RVF2 3CJIC 1MQTA 1BBT3 4IV1B 4CDXA 4N53A 1MEC1 1VBB3 4CEWB 3CJIB 2HWB1 1HRI2 1H8TA 1R082 1QJZA 1RB8G 3ZXAC 2HWE1 1RUD1 4RFT0 5FOJB 4WM7C 1HXS2 4Q4Y2 3DPRB 1AYM1 4BCUA 1QJY2 3VBRB 4CDXB 3VBOB 3ZFEA 2MEV2 4GMP1 3JD71 1IHMA 1OOPA 2MEV1 3VDDB 4RQPC 1K5MB 1CD3G 1D4M3 2R062 4Q4W1 4YVWC 2X5IA 1HXS1 5A33A 2PLV2 1VRH3 3VDDA 3VBHB 4Y5Z0 3VBSA 1HRI1 1ND3C 1R081 3JB4C 5D8AB 1MQTC 2RS52 1BEV2 2IZWA 1ZBE2 1HXS3 4FTBA 1PO23 1PGL1 1QQP2 1RUE2 1AR81 3J8F1 4Q4X2 1AR62 4JGYC 5J96B 2WS91 1AUYA 1HQNA 3VBSB 4GB32 4CDWB 1VBC1 1AYN3 1RUH1 1PGW2 2BUKA 1AR83 5BNNB 1ND2C 1PIV2 5FMOL 5BNPB 4RHV1 2XBO2 4Q4V3 3JBG1 1V9U1 4Y4YA 1TMF2 3JBG2 4JGZA 1H8TB 4N53C 2WFF3 1AL23 1E57A 1ZBA3 5CFDA 1FOD1 3S6PA 1RMU2 3VBUB 1RUC1 5BNNC 4WM8C 1B35A 5DDJ3 4N43A 2BPA2 1EV12 3ZFFB 1Z7S2 3J8F2 1AR61 2HWD2 4Q4X1 2RM22 1RUE1 1SMVA 1TME1 1AYN2 4GMP0 4CEYA 2HWC3 1RHI2 1RUJ2 5C8CC 3TN93 5J98B 1RUC3 1BEV1 1QJX2 4QPIA 5K0UB 2WLPA 4PDWC 1MEC3 1VBB1 1A6CA 2PLV3 2XBO3 2R071 4RS5B 3VBUA 2WFF1 3VBOA 2PLV1 3NAPA 5D8AC 2WZR3 1BEV3 2RS32 1POV0 2R061 4Q4W2 1RMU3 4FTSA 1PO13 5L7OB 1TME3 2RR11 3VBFB 5BNNA 1AR63 4Q4X3 1AYM2 5ACA3 4RQPB 4FTEA 1QJU3 3NAPB 4Q4Y1 1AR93 3VBFC 1K5MA 1X36A 3NAPC 1PO21 1RVF3 1MEC2 5C8CA 1VAKA 4Q4V2 1VBD2 1RUI1 1RVF1 1D4M1 5K0UC 5GKAC 4GMP3 1VRH1 5BNOC 1VBC3 1R1A1 2R063 2R042 1QJU1 1AYM3 1NG0A 1B35C 1R1A2 1C8M2 3ZFEB 5AC91 1VRH2 5C9AC 5CFDC 3JD73 1NCRC 4AEDA 2RM23 2RMU2 1OPOA 1BMV2 1RUF1 4RS5C 4Q4V1 5L7OC 2RS13 2ZZQA 5ABJC 3TN92 1RUD3 2RS53 2HWC1 1VBD3 1ZBE3 4N53B 4WM8B 2RS11 4CDQB 4Z92B 1W39A 2HWF3 1RUF3 3VDDC 3VBHA 4CDQC 4RR3B
chains in the Genus database with same CATH superfamily
4B1LA 2WZEA 4YW1A 3KZ4C 4EROA 3CO2A 1RUE3 3HR9A 4OUEA 3WW1A 5LK7B 3PTYA 3ORJA 2O14A 2XQXA 1AZDA 3LEGA 3HT1A 3LFMA 4UF0A 4FPKA 2JDUA 1XSRA 3VL9A 1XC6A 4FPLA 2VPVA 3HAGA 1UU4A 1RXGA 4M4PA 1LECA 4BU2A 5J36A 1AR71 4EJRA 3UK9A 2ORXA 4BQ1A 4QX0A 2ZPXA 2BBAA 5D21A 1ND3A 2KA3A 1UOBA 3S7EA 3HMYA 4V1PA 2VVEA 5DUWA 4A7KA 1ASJ3 5EHDA 3Q8CA 1CQ9A 2O8OA 1CJDA 1WCSA 2HWF2 3NNJA 4FAGA 3WDYA 3WP6A 3HD8B 3OGRA 4AL9A 1FNYA 1RXFA 1EV11 2P17A 3ASIA 3UJOA 3VV1A 4QT6A 3PVNA 4LO7A 5FRAA 5F1RA 2OYZA 1XU2A 1OURA 2ET1A 3IWZA 3B7MA 2JX9A 2A75A 2XWJB 3K3OA 2A6VA 1G9DA 4Q0VA 2VECA 3MIEA 2AREA 4NHKA 5FLIA 3OUHA 1GSLA 2VTXJ 1DCSA 5I8YA 4CUBA 2V09A 3RZJA 3ES1A 1CX1A 1QMJA 1U5ZA 3FZ3A 4I30A 3FL7A 4ORFA 1IQAA 1NQJA 1S0JA 3KT7A 4BJ0A 1DFQA 3N9LA 3H8XA 1V6LA 2RMU1 2VAUA 4M0HA 1Z78A 2YV8A 4WZCA 4P9JA 2NYYA 4AAPA 5DDJ1 5FBJA 2XJVA 1C8M1 3O1VA 2G9GA 1X7NA 3E5XA 4XJ9A 5FZ3A 2X29A 3LEKA 4Y20A 5DUVA 5EXOA 2VR4A 3VHRA 1Y9QA 2EIBA 3K46A 3OBRA 4Q4W3 1YO8A 4AVBA 3DL3A 3POIA 4HMZA 2XGXA 2WUHA 3NJYA 5A6YA 2DCTA 5JXHA 4H55A 4CVUA 1EUUA 4XMIA 3WW4A 4A44A 4LKDA 2ID4A 2QNKA 1RUI2 2XKPA 4Y1VA 1COV1 4BQ2A 5JSOA 1JHJA 2C9AA 4MHUA 3TYJA 2WR9A 1WW5A 5IK4A 3IB3A 2RS51 4QQOA 1Q43A 3MYXA 1HDKA 4AHXA 4IE0A 2XJUA 4GZ9A 2W46A 4HETA 4KU8A 1BJQA 3WNLA 1LGBA 3BGAA 1SDWA 3N36A 3VDAA 1K5MC 1SFYA 1UXXX 1FATA 4AYUA 5BNOB 5JR2A 1CAUA 2QQOA 3GHMA 3MFCA 2V5DA 1GP6A 4ATFA 2C4XA 1NCQC 3J8F3 4IXLA 5H9RA 2VCCA 4F7ZA 1YJKA 5ABJB 3WG3A 5T50A 3JD72 4MGQA 5C3SA 1NYWA 1GFF2 1O4TA 1S0FA 4MHRA 4L2NA 4WM7A 2JD9A 1OSGA 3LIGA 5LY2A 2D93A 2DUPA 4EV0A 1IKPA 5BV6A 1XE7A 1RUJ3 4GB33 4YG6A 1ODNA 4JGZB 5IK7A 1W8FA 4HLTA 5FP9A 2JKXA 2GC1A 2QQLA 4XJAA 4YGEA 1UZ0A 1NOVA 3AP7A 2YGMA 5IVEA 1YNAA 3OPTA 5FPAA 1RUF2 4LBQD 5A3PA 3WG2A 2WSVA 2J1RA 5DQ0A 4CA9A 2VY0A 5IVFA 1IQDC 3BB6A 4Q4Y3 2XVLA 4XHBA 4CP9B 5CKNA 1JOPA 1WLTA 3BU0A 4D7YA 5KC5A 3MICA 1LESA 1L7RA 5FYVA 4C91A 4TLFA 5A80A 2J1SA 2D6NA 4XXAA 3LOBA 5GLZA 2AENA 5FR3A 1RMU1 4JHTA 4AI1A 1FOD2 2TBVA 1JODA 2ZX0A 4XIOA 3I2KA 2BNOA 1XNCA 2OVUA 4JGYB 3ZMNA 4RL7A 5K9YA 5FMOS 1DLLA 3BOPA 3BU7A 1V9U2 3UKTA 4HSJA 3SH5A 2FDIA 4QKNA 4ASLA 3VKNA 4PJYA 3JB8A 4XZUG 5JI9A 1UZVA 1VBC2 1PZ9A 4YVSA 5BPXA 2FDHA 1DLCA 1XE0A 1R64A 3SCFA 3HPNA 1IZ3A 2BBVA 3POSA 4AEDB 4HKOA 2WWSA 3JCIA 4DRRA 1WD4A 2BVBA 1PO12 4LHKA 3WLUA 2K0GA 3PTRB 5FK7A 3ZSKA 4XMAA 4K21A 4WVVA 5C5TA 3I3DA 1PVXA 2XLFA 5A1FA 3CKHA 2HWF1 4S2DA 2D43A 1GANA 4DNYA 3I2IA 2P2KA 2Q8DA 1R1ZA 1O4ZA 1JH5A 1FMD2 2JDYA 5D8AA 3TAYA 2ZGNA 5IWFA 2D6OX 2QQIA 2YBPA 2R072 3EMRA 5F5CA 4QPGC 5EJ3A 5FK8A 2I45A 2RJ2A 1RL3A 2W91A 3KSCA 3NV3A 1K12A 2JIJA 3CJIA 1U0AA 2AZ5A 5E88A 1OH3A 4KGQA 2UY9A 4QB2A 4CTEA 4IV1A 2XJQA 5JPMB 1GV9A 3OB8A 3NL1A 3OJBA 2P6HA 1WCDJ 3IKWA 4QQHA 3C7OA 3B5LB 4CCEA 1VP6A 5LWBA 4MGSA 5TSWA 1EV13 2JEMA 4Q8LA 2BFUS 3WDUA 3ZMOA 2QKDA 2HWD3 3UNPA 1JZ2A 3QOPA 5C8CB 1UOGA 3IM0A 1NA1A 4O9GA 3QCWA 4XILA 2QUOA 4OI1A 2BERA 4LULA 1XJAA 1RUC2 1NCQA 1S0DA 2R043 2ZEWA 3VBHC 2FDGA 3MFAA 2I2SA 4MYEA 1NT0A 4FBFA 2WA3A 3OPZA 1OOPB 3S7IA 4OI0A 1W6MA 3SKVA 1UZYA 5A33B 2I74A 2ZAHA 4HXCA 1QXPA 3VKMA 3Q9OA 5I0TA 5DAVA 1FPN3 5L7OA 4V2WA 2CGOA 3BALA 4P00B 4YVSB 4KH9A 3U78A 2ZGMA 1PNGA 3ZYRA 5A6ZA 2NM1A 4QX5A 3WP4A 2GN3A 4P9IA 5ISLA 3B02A 3N7KA 5FY8A 2VULA 3ZYPA 4XBNA 2BNMA 2GH8A 3B93A 3PUQA 3AZVA 1TVGA 2ERFA 2JXAA 4LXLA 4YZ5A 2YU1A 2WYFA 5HXVA 1JZ5A 2ORZA 1W2OA 4LO8A 3WQ1A 5F5AA 5CISA 1AR82 2JDAA 2P37A 3AVRA 2CL2A 2PFWA 4NPMA 4LE3A 3SH4A 1VLNA 4CZSA 4FAHA 5CAZA 1W9FA 3CJIC 4DMIA 3NV1A 1ZZ6A 1OQ1A 2XDVA 4OFGA 1BBT3 1GP5A 1WA6X 4IV1B 1FNZA 2VNVA 4N53A 4OHVA 4X8NA 4XFCA 1VBB3 1M4WA 4MGZE 3CJIB 1QH7A 2HWB1 2IVIB 3FHIB 4OUMA 4QDQA 1H8TA 3T09A 5DMYA 1RB8G 3WF0A 3ZXAC 1UKRA 2A1XA 4AVTA 5LA0A 3VDCA 5FYBA 3IT8A 4GALA 1HXS2 4GWMA 1LU1A 4H7LA 2W3JA 5FXWA 1CAWA 4V2VA 1E5RA 4CDXB 1OKQA 4QU2A 1GNHA 3ZFEA 5C70A 2MEV2 2JG9B 4YGCA 2Z79A 5CG9A 2BDRA 2VNGA 3ZXLA 4G4FA 4XFAA 5I8SA 1K5MB 3S0MA 3J7LA 1VAVA 2GH2A 2X5IA 4R4XA 3TWIA 3BIWE 2Z2SB 3VD4A 1SLBA 1W99A 3I97A 4XC9A 3OY8A 3LDRA 3LCPA 5KXEA 1UXZA 3VBHB 1J1LA 5JXIA 3VBSA 1GNZA 1HRI1 1OLME 3H7JA 1URXA 2JDMA 4P9WA 5D8AB 3NRUA 1W0PA 3BTZA 5GLTA 3HQUA 3T2QA 5HV4A 3WF4A 1O59A 3VGIA 3FX3A 3ZXEA 1LOAA 4LHLA 4IEVA 3MZHA 2D3PA 2E7AA 2P3KA 5JI7A 4FTBA 2VXRA 1DF0A 2PXJA 4I0AA 4R52A 4XF0A 5KR7A 3VHOA 2MHFA 4LK6A 4XF4A 5FBZA 4XXPA 3SITA 1AR62 5FZLA 1CESA 2HKXA 3A7QA 3WP3A 1KFUL 4AZZA 1L3JA 2VVDA 1YYNA 2GNTA 2GU9A 3AZWA 5ANNA 3KHCA 1H2NA 4RN5A 3USUA 2EIDA 5DZFA 3IDBB 1UPSA 1W6OB 4QU1A 4U36A 1VBC1 4CDWB 1AYN3 2RG4A 1WWYA 3EBRA 5JOZA 1ZX5A 1PGW2 1V6NA 3K75B 5C71A 5IATA 5BNPB 4NJ4A 3KGLA 3NMBA 2VH9A 1W2AX 3ACGA 5A7PA 2ZHNA 4QDRA 1H8TB 1FI2A 2HH9A 3Q8FA 3ZYFA 4DOUA 5EPAA 1K42A 1WMDA 1E57A 1I5ZA 4NIHA 1POQA 5CFDA 1AX2A 5FYHA 3E6DA 5FO9B 5HPOA 4YWAA 2WWUA 3M3IA 2ZCWA 3JQXA 3MV11 3X29B 5LBEA 4NUBA 4NROA 3AKTA 3U07A 4P02B 4RGKA 4WM8C 3U37A 4LBQA 3K3NA 3Q8BA 1OD5A 3LAGA 1B35A 4BWOA 3GBWA 5EYYA 1WA4A 2ZMKA 4ES8A 2VMCA 3GDBA 3VL8A 1AR61 4AI9A 4NHLA 1XQNA 2ZHLA 3CBNA 1TME1 4PCRA 1AYN2 4FFHA 1AF9A 2B9UA 2YBKA 4Y26A 1NKGA 1SPPA 5C3QA 2W94A 5HXMA 2A6WA 5FZHA 2QZ3A 5J98B 2QTWB 4QPIA 1LOFC 3POFA 2R6QA 2D98A 2WLQA 1H2MA 3EHKA 3QLQA 4ZU4A 3AL5A 3EXUA 4FXKB 4AF9A 5IHRA 1ULFA 1OKOA 2A3YA 4FPOB 4XJZA 3VBUA 2DURA 3D4KA 5T55A 4EZHA 3APBA 2PLV1 2JG8A 2VZRA 4FPEA 4K6BA 4IE6A 1CAVB 5DAPA 1XYOA 1LOBA 1IG0A 3HNYM 2AC1A 4Q4W2 1AVBA 3C7EA 4MGTA 3TEYA 4OUSA 5KHJA 2GALA 5FZ4A 4C8DA 1TME3 2RR11 1JYVA 4P9GA 3BTYA 3H7YA 2K9ZA 3IN9A 4IQPA 4Q4X3 5SV8A 2CSGA 1Q3EA 3HVDA 1QJU3 4BOWA 1SLCA 4G3YC 1DZRA 1QDOA 5ACA3 4YRDA 1K5MA 2WDBA 2FCVA 4XEZA 2H0VA 1FV3A 1MS4A 3SC7X 1A3KA 1OPMA 2Y38A 4DUVA 4R9BA 4E27A 1PO21 4LHNA 5FJKA 1MEC2 2W1UA 4NRMA 5A6QA 1JYWA 1ZRIA 4K40A 3J4UH 3MLJA 4MXVA 4NHMA 4N9IA 1KRIA 2YPDA 1VAKA 3VZLA 1VBD2 2WN2A 4TN7A 2C6SA 5LRRA 1D4M1 4BM8A 1X50A 5FZKA 4QGNA 1LEDA 4Y33A 2GNDA 3WCRA 2VNRA 4GMP3 3H1MA 1S0IA 1VRH1 1LOGA 1XPWA 4FOVA 5BNOC 3LDKA 2R042 4OI4A 1QJU1 5FCCA 1DGWA 2X05A 4FPFA 1BK1A 4BB3A 3VZOA 4H7MA 1JYTA 1YJLA 2IUWA 1W3VA 5FJHA 2EXHA 5A1LA 1JZ3A 4L0PA 5LRSA 3I3BA 5JIAA 1OPOA 1H1AA 3H42B 1V70A 2R1DA 2WNUA 4Q4V1 4E2QA 2W1SA 2ZZQA 4WVZA 4JC1A 1RUD3 1NQDA 1W28A 2BGCA 2ZGOA 2HWC1 2D97A 3MPPG 3OD4A 1FT9A 1VBD3 4AI8A 3WVJA 2XLAA 5FO8B 1W6NB 4Q2FA 4WM8B 2JG8B 2RS11 4CDQB 2XH6A 2HWF3 4OI2A 4FPCA 1Q8VA 3P5BA 3VDDC 3CHXA 3AYDA 1QKQA 3K51A 2ZGSA 1QNYA 1NXD1 1US3A 1YCIA 4FFFA 1CZVA 4IGPA 4FP3A 1ZVFA 3M1HA 1YRZA 3LF7A 2ZGPA 1R092 2E63A 4W50A 3MBWA 5L9BA 4HSLA 2VZTA 2JG9A 4AG4A 1C8M3 3PNAA 4UFJA 4YVWB 1NY71 2WA4A 5LA2A 3ZLIA 3M4FA 3N9PA 4D69A 1H8TC 3JZVA 5KHHA 1YFXA 3GJAA 4HFSA 4BMBA 4B4RA 2NP0A 1KD7A 2G1MA 5C3PA 4QPIC 3THDA 2QQKA 1O3QA 3MLLA 3T0BA 3C7HA 2YMZA 2JDNA 1XNBA 3ITQA 4BHPA 3VDBA 1LB2A 5LEJA 1V9U3 4L99A 4A42A 2Y34A 1NY72 4CUGA 1DDLA 3DPRC 4OZXA 4AEJA 2R49A 3FHAA 1UF2C 3AMQA 4PBPA 1JTZX 2QDNA 5F39A 3WR0A 4HBNA 4OQ9A 3VD5A 3BYWA 4DEQA 2WINB 4HONA 1RUG2 2BOIA 4JQTA 4BISA 2WO3A 4CDUC 3SNMA 4GWJA 1CZSA 5BNQA 2DVBA 3IAPA 3RRDA 3AMNA 4QX8A 2VMGA 1C5IA 2FQPA 3TOJA 1H6YA 2WNEA 4HPKB 1VB2A 4CP1A 1ZZ7A 1SDDB 2GSYA 2PAEA 2WZR1 3INAA 4OQ8A 2BW8A 5H9PA 3ZOIA 5FQ0A 2HWC2 3CZJA 3NJVA 1WBLA 4OLLA 3TN91 5JPNB 5I0RA 3MIDA 5LBBA 2VE1A 2C0ZA 1LHWA 2JDPA 4ZXEA 1ND2A 4R9CA 4FP2A 1F15A 4XF3A 4CDXC 3FBYA 3M3QA 4TLGA 1PVC1 4NPRA 5FQ0B 3WNMA 2VMHA 4PDWB 1ASJ2 3M7AA 1FX5A 1DQ1A 3VD7A 1PK6B 3NNGA 4A6OA 3IPVA 2QQWA 3ILFA 4KMQA 3WCSA 2W87A 3KT4A 3V0AB 1Y9MA 2MNGA 2R041 2VNOA 4PLOA 5LW9A 2MEV3 1SBEA 2AACA 4RR3C 5A32B 3UESA 5JOWA 1PZ8A 2AGSA 1QJY3 3ZYIB 4AVSA 2EAKA 1B35B 1QQP1 1SLIA 3C7FA 3ZM8A 4COVA 3LSDA 1REEA 2VOXA 5BYNA 3U0ZA 3VKOA 2JD4A 3BN6A 3AMPA 3GXUA 5FPLA 5HBAA 4C1WA 3R4SA 2WT2A 1CX4A 3VBSC 3WQ0A 2DTWA 4XUTA 1ODMA 2HYXA 1NX9A 1YUDA 3CIHA 3NNLA 3PDQA 3PJYA 2RE9A 2SBAA 3FMGA 3POBA 1UIJA 4XQ4A 4Y20B 3DN7A 4FPGA 5F32A 4YM3A 1S55A 3ZYGA 2WS93 1FPN2 1TQ5A 3VN4A 1GZCA 1WW4A 2VMDA 3A21A 4CDWA 1OOPC 3ZSLA 4QDSA 3URFA 2XJRA 1RC6A 2RR12 2B5HA 1Z7S3 1B09A 1D4VB 1HLCA 4PF1A 1NZCA 3I2FA 3ZR5A 4AAXA 1OLRA 4E4ZA 3I8TA 3TNPB 2PHXA 4BQ3A 5JOXA 1RHI3 4YVSC 5F7UA 1GBGA 3OSDA 4FOQA 4QX1A 2HWE2 3I2JA 4N7UA 4JQRA 2K2SA 5GZDA 2GP3A 3LA3A 3FC0A 3AJYA 5ABJA 3B69A 3PL0A 1PMJX 2LUWA 3L9JT 2E9QA 3I2OA 1KJRA 2OUJA 3RJ2X 5A32A 1MPXA 1O3SA 1D0HA 4D7SA 2P1BA 3O1PA 2VBDA 1COV2 1RHI1 2XVKA 3VZKA 1BMV1 4YFZA 4CEWC 3SCGA 5JMCA 4NN0A 1AYN1 1TME2 4KL1A 3FLPA 5LEKA 4NIDA 1SCRA 1SBDA 4XCAA 5HCFA 3ZFFA 2HWD1 1W6QA 5IVVA 5AFBA 1HX6A 3C3VA 3K2OA 2ILMA 1O7FA 4G9SB 1QU0A 2J1TA 4QPIB 4QWNA 1M06G 3WNKA 4N43C 2JIGA 1SPPB 3M3CA 3T3YA 3MIHA 1EUTA 2BVVA 5DDJ2 5C4WB 4HKWA 4LBMA 3H8UA 3WXPA 2DYCA 1REDA 3KVBA 1CIYA 3N7LA 1ZRDA 2J1UA 3IBMA 3RGBA 2DV9A 4CPBD 1DG6A 4B1MA 4QXKA 4PBOA 1JMUB 1CPNA 2WZ8A 1NXMA 2XBO1 5FPXA 2WWJA 1V6MA 5GLVA 4DXZA 2G19A 5F3EA 2BJSA 4HOOA 1JUIA 4N43B 3NNMA 1JYIA 1MR5A 1SFPA 5FXXA 1X9TA 3U1XA 3RYPA 5AC93 3ZIWA 2RHPA 4L97A 4XYXA 2B42B 2DBNA 3J7HA 3K4DA 4RYDA 1UW8A 4XFBA 1DBNA 3O0VA 1R1A3 2VG9A 4E8DA 2LS6A 1ST8A 3O5SA 2RVAA 4NWWA 3V0AA 2WNVB 2VO5A 1PZ7A 3B94A 4BQXA 4CU7A 3F95A 1TNRA 3CNAA 4CP0A 1DIWA 2VL4A 3N4MA 5IFTA 1ZBE1 2Y60A 2V4VA 1CPMA 4UFIA 3RZGA 4PQQA 4FFIA 5F3IA 5FZFA 1JS9A 2ARCA 3E1F1 4DXTA 4EN9B 1H1IA 5LBCA 2X10A 5JIUA 1I1EA 4PHZA 1OA4A 1F2NA 4IV3A 1RUOA 2L9LA 5LATA 4D94A 1AL22 1OUXA 3K48A 5DABA 5C4WA 2JECA 1VRBA 1HJGA 1ND3B 1AR91 1RUH3 1AX0A 1V6JA 1PMIA 2E7TA 3FN9A 2XPJA 3BKZA 3VBFA 1HJFA 1VBE1 1MZ6A 1YI9A 5CIRA 3LQCA 4GH4B 2JJ6A 2NPIA 3ETPA 5EQUA 1HRV3 3RYRA 4RQPA 2D6MA 1OFNA 1W6NA 2OX0A 1RINA 2OUHA 4WM8A 1QWRA 5FYSA 5FPUA 2VMFA 3EB7A 3OUIA 3R0RA 3FUQA 1DGWX 4ARYA 5FLHA 5J1XA 2QJVA 2AEYA 3NNFA 3POYA 2UWAA 2C9KA 1AJKA 1XXNA 4CDQA 2YFZA 4XBLA 3AP4A 1XOYA 1LJ7A 5T54A 3DKWA 3OF1A 4X8PA 3ST7A 1AR73 2Q4SA 2Y26A 3DXUA 2YPJA 4LA3A 1DU3D 5GM0A 4LTAA 2VZVA 4URAA 4RS5A 3ZR6A 2G9FA 1SHWB 2VZ1A 1NCQB 2F4LA 2PHDA 3ETQA 3KQRA 4CXXA 2CDPA 3HN3A 5T3NA 2ZGKA 2ZX2A 3AXEA 2DUQA 4A41A 2W08A 2YZ4A 4CCKA 3C7GA 3ZN4A 2D5FA 5C9AA 4H3WA 1ENSA 1UYYA 1GYKA 5M0TA 4OHXA 3ZYHA 4UBGA 2W2IA 1HRV1 4Z8BA 3ZSEA 1WLDA 3H9AA 5ANQA 3WG1A 4FPYA 1GQPA 3WHTA 2YFUA 1T6BX 4Y4RA 1ZBA1 3WF1A 2EXJA 2Q8OA 2WNVC 4UW6A 4HZFA 2RJKA 5C5UA 4D8MA 5DUUA 2ZEZA 3EJKA 1BYHA 3A0NA 4UAPA 4Y1UA 3LE0A 5CKQA 4CE8A 4ET7A 3WNPA 4KWKA 4COWA 4LHSA 4WBBA 1R082 3CU7A 2VUJA 3V0BA 3AK0A 2BRTA 1U5XA 5IVCA 2FDJA 3SHRA 5LBFA 4XZPA 3WW2A 1GLHA 4BQ5A 4QPYA 3VHNA 3DPRB 1UZZA 1AYM1 2WQZC 1QJY2 3KCYA 4IUGA 5CADA 3U4XA 5EZWA 3H0OA 4GMP1 4OHWA 2XHKA 1OOPA 5I0DA 1H30A 3GCWA 1VMJA 2NMNA 4EN6B 1CD3G 1D4M3 2BOJA 4YVWC 2VUAA 4AK3A 3E5QA 4INDA 4LLOA 1OFSA 3GYDA 1MACA 5A33A 1PM4A 1F5FA 2JE9A 4DINB 1LAJA 1KGYA 2EXKA 4Y5Z0 1OA3A 1R081 2AYHA 2VW2A 3USSA 3GM8A 1MQTC 2B39A 2W1QA 1BEV2 4HANA 4K8RB 1UQXA 1US2A 3NV2A 4Q0QA 3VZNA 2DCZA 1O8SA 1VIWB 1PO23 4FVVA 5KXDA 2D6PA 1UKGA 4HN1A 1H1MA 4I02A 4I09A 5EP9A 5E6HA 3J8F1 1VR3A 2Q5TA 4XOGA 4AHYA 4GAZA 3QACA 4JGYC 3U4SA 4O9EA 1EPWA 1W05A 2KXLA 1XE8A 3H50A 3O14A 2VVFA 2Q1FA 3CJXA 3LZZA 1GMMA 1NZIA 4XBQA 1W6QB 1LRHA 2ZGLA 3I59B 4EQVA 3RNSA 2XWBB 4QHZA 3UGFA 5G05L 1PIV2 2DU0A 4KQ7A 2Y6GA 1F4AA 2ZEYA 5FZ8A 2E31A 1UYXA 2QZ2A 1V9U1 1ZZ8A 1GZTA 1WCUA 1QIQA 1TMF2 4UBHA 1S0EA 5J7MA 4ZZ8A 2WFF3 1AL23 4P9YA 3JUUA 4PI2A 4DZGA 3SISA 1ZBA3 2AR6A 2CTVA 1IS6A 3N35A 4P14A 1QDCA 3LKJA 1KXGA 1FOD1 5FZBA 4D6RA 5HV0A 1RMU2 3OYWB 1U5YA 1QOOA 2IFWA 4JCKA 3U10A 4DY5A 1DP0A 3LEIA 3M70A 4Z07A 5BNNC 4XFGA 1UYZA 1CZTA 5FY4A 2CAUA 5DDJ3 3UETA 3N9OA 1WW7A 5FZ7A 3ZSMA 5IFPA 3IIAA 1XNKA 1Z7S2 1C1FA 3O1MA 1RUE1 1SMVA 5CG8A 3R4DB 2HEWF 4YPJA 5GLWA 5FIXA 2HWC3 4CUAA 4ZU5A 1EYBA 3T4HB 1ZRCA 2AH2A 2KR2A 2BP6A 1VMHA 2PQQA 1GR3A 2WLPA 2YBSA 1LTEA 1MEC3 1XB9A 4PDWC 3ZXFA 3IZOA 3ON7A 5EJ1B 4MH0E 4NRQA 1W6MB 5CZKA 5DG1A 5A3LA 4P08A 1U5IA 2WFF1 3I2HA 4IESA 5DXDA 5FAXA 5H9QA 2ARBA 2E33A 2WZR3 2X09A 3BTAA 2J1AA 4IEYA 2RS32 1POV0 1OLMA 2R061 3QH7A 2WSUA 1SZBA 4B7EA 4XUNA 5CNAA 3QD6A 3O1OA 3JQWA 1TZOA 3OGVA 4NAMA 1ENQA 3R6SA 3PVOA 4LO6B 4RR3B 3ZX7A 4RQPB 3V64A 4FTEA 4N9HA 3NAPB 4YW7A 1IGOA 1N1TA 1OC1A 2JE8A 2WNOA 4E9KA 2FDFA 3MW4A 2GC2A 3L2YA 4DXSA 1RYYA 4O61A 4MGIE 3S5QA 3D82A 1RVF3 5A6XA 4ARXA 1KDKA 1W8NA 2VW1A 2WN3A 3RI8A 5C6CA 3KQ4B 5BUVA 1MVQA 2R32A 4R4ZA 4W65A 3BODA 2Y6JA 4BPZA 2H6CA 1RUI1 3A22A 4KG8A 4BZ4A 3IPVB 2OIIA 2VJXA 4DPNA 4Y24A 2BGOA 2GN7A 2Z42A 4KBBA 5DPNA 2VZSA 1LHNA 1BZWA 5AVAA 4J1WA 4Q0UA 4RD7A 5GKAC 2VQAA 3PURA 4YZ1A 1O8PA 2LRPA 1A34A 2Y6HA 1GOFA 1R1A1 2R063 3O7OA 4XDQA 1TG7A 1W3XA 3RWNA 3SEEA 2VD7A 2EAAA 2DFBA 1R1A2 2D7FA 1C8M2 1N1YA 2YUEA 4UWDA 3AM2A 3ZFEB 3ZXKA 5C9AC 3MIFA 4DRVA 1LGNA 1NCRC 2IC1A 2RM23 2RMU2 1G9CA 2Z5WA 4NVPA 2ZX3A 4MUVA 2E53A 4RS5C 4BLIA 1AHSA 2IXLA 2D6LX 3AVSA 1GKBA 2V5YA 1I9RA 4BA6A 5L7OC 2GNMA 2W68A 1TNFA 1YXWA 2RS53 3WZ1A 1NE4A 4N53B 3ZN6B 4AQ6A 4FQZA 1OD3A 3VD3A 1KFXL 1RUF3 2RDQA 3N9NA 3NWKA 4QQ2A 5I0SA 1JN2P 2VXJA 4JTOA 5JLVA 4CDQC 3AFKA 3LGRA 1WMXA 4XF1A 4QHBA 5A1AA 2W5FA 2VZOA 3J7NA 5FXVA 2FBEA 3B9IA 4K9SA 5KC6A 1OQEA 3E97A 2XKOA 1RUI3 4JKLA 4Y22A 5C3OA 3ZO0B 2JDHA 2DU1A 2DCJA 1UMIA 2JG8C 2GMEA 1FV2A 2RV9A 3BVCA 3DPRA 5FDBA 4EN8B 3JBG3 3H8OA 1Q8QA 1S4CA 2XHNA 4TSVA 1PMHX 1WMFA 5GJ6A 5IVYA 1H8VA 2VZPA 2C26A 3WNNA 4XABA 3ECQA 2DTYA 4X6RB 2CDOA 2O8QA 1OHFA 5FKBA 2KM2A 5A7SA 1AR72 4Y3OA 4EWAA 3EQEA 4KWUA 4HT1T 3ZKYA 2FD8A 4RHV3 5GZCA 2B9VA 4LPLA 3S57A 1H6XA 5FOBB 4I2OA 4DS0A 4EZ4A 3N7JA 1QJFA 3KF3A 4CU9A 2B46X 3NJXA 2NZ9A 4MVTA 3UGHA 3VD9A 2F17A 2Y6FA 1Z7S1 1LULA 3ILRA 4LITA 1W90A 2NMOA 1MS0A 5DAWA 1G9BA 3LB9A 2R1BA 3CZUA 2J7MA 1W8HA 1RITA 3LOIA 3D3AA 2PHUA 2NQYA 1H4GA 2PYTA 3AP9A 1PGSA 3IMMA 4Q5OA 5FKCA 4AGRA 2ZZJA 4GULA 5IVJA 1Q56A 5FYZA 1UWWA 2WC2A 3WNOA 3GZUC 1KS4A 3AMHA 5JZGC 4GWNA 4XFIA 4GKXA 4COYA 5K7PA 3DXTA 2DDUA 2DCKA 1OA2A 1MS8A 4JGZC 4BXFA 4GH4C 4RHV2 3ZFGB 4JTNA 5T5JA 1F31A 2WZR2 2A6ZA 1CAWB 1K45A 2W39A 4I3PA 4YM2A 1O3TA 4OHZA 1QQP3 3ZDSA 2JB4A 1UMZA 1W6OA 1HW5A 4XF9A 2DWRA 5K8SA 3RG0A 1OI6A 3S30A 5CFCA 1F4HA 2X53S 4BK4A 3AB0A 2CWMA 4LKFA 2VMIA 3DKQA 1GOGA 1RUG1 4GA9A 3PUAA 1IKQA 4IETA 4W8JA 3WDXA 4UFKA 3O1UA 1ZYBA 1ACCA 2DVAA 5FFOC 1PGL2 1XYNA 3HBZA 1LHUA 5L9RA 2XONA 4LIUA 3VKFC 1BBT1 3KM5A 4CEWA 3PVEA 4FCAA 4QAWA 1AJOA 4R9DA 1DGRA 4YW3A 1F9KA 4CYDA 2J1VA 3N3HA 2ZHKA 4MZUA 4AE2A 1UY0A 1ZA7A 2GMMA 4META 1JBCA 3GALA 4PQ9A 4DB5A 5BNPC 4CP2A 2E26A 4I0WB 1QEXA 4IEQA 4D6SA 2Y8KA 3AZYA 4AVVA 4CCMA 4YZ3A 3WDTA 3KVAA 3ZFEC 4BQ4A 5FZIA 1R091 2WJSA 2XXZA 1IS5A 1E5IA 4YLZA 5C33A 3I2DA 4LBJA 4LKEA 1F5JA 5APAA 1CAUB 3PHMA 1J3QA 1O3RA 4JKKA 4L9BA 1NAEA 1RUD2 2V72A 3ZPYA 2RS12 4D6QA 4HVRA 1AXZA 2P34A 4IV3C 4S2FA 4YG3A 3WW3A 2XL9A 3VBUC 4HK8A 1J3RA 1VBB2 1K3IA 1TMF3 3GJBA 3HQXA 4LBKA 3RVHA 1QJX1 3TEWA 4PIZA 1F8VA 1HRI3 4WVMA 5I93A 5CFCB 1XNDA 4BXSV 1HKDA 5FY5A 2YGLA 4CUCA 1ZBA2 2ZAAA 3CQOA 5FZ0A 4AEDC 4GJYA 5ACA1 1YHFA 1Y4WA 5D2AA 4LOTA 1ZRRA 4HN0A 4BMEA 4CCOA 1S2BA 2P3YA 1MVEA 2RR13 3DV8A 4QM9A 4E4DX 4LMFA 2VZQA 2A3WA 2CHHA 5GALA 4AEMA 3FLTA 4BIOA 2ZABA 5E1RA 5IVBA 5G04L 3F2ZA 1D4M2 1APNA 2IXJA 3O1SA 3I3MA 3DECA 3RPQA 1OT5A 5LB6A 2VQUA 4MGYE 1DQ0A 2Y33A 1EAH2 3NSTA 5FZMA 1N47A 3WHUA 3RQ0A 1CR7A 3WINE 4QKFA 1W04A 1PO22 4CCCA 1PX3A 2PMWB 2VZUA 3IMNA 3ZFGC 1RUH2 3VUOA 3AJZA 2VTXA 2GP5A 2VU9A 5A7WB 4BQWA 4GKYA 2WNUB 1W0OA 5T5PA 5JWPA 4FSJA 5JR7B 3WV6A 5JZGB 3MF6A 1NA1C 3MHZA 1D7PM 1O91A 1KDMA 1KEXA 2OA2A 3UL2A 2D6KA 3W58A 4CDUA 1WUVA 3MW3A 4YW6A 2CV6A 2CY6A 1OLQA 2ZMNA 4H14A 4Q0SA 3MIBA 1E5HA 1T2XA 2UURA 4EYUA 5DAQA 2EIGA 5F6LB 2RS31 1C5HA 1S0CA 1AR92 4JDMA 1KS5A 1WCKA 4CU8A 2XQRA 1EAH3 1AL21 3S5AA 5HCHA 4CXYA 3AL6A 1CAXA 3GZTB 2QQMA 3NV4A 3O1RA 3BTXA 1UNBA 2FHRA 4NR1A 1PX4A 4COZA 4XE9A 5IYYA 1A8DA 3UKVA 1NUKA 2N7GA 4O65A 1W8TA 4UW3A 3W20A 1BQPA 3EO6A 1DQ2A 5FP8A 4OVEA 2ZX1A 4AGVA 3TEXA 1H0BA 1O5LA 4Z2AA 3PLQA 4IGQA 4LUKA 3PVBB 4MADA 5FP4A 3HIFA 1POV3 3MUY1 3VBRA 4AI0A 4CPBA 4QMAA 4PLMA 1X33A 1LR5A 1H9PA 1GWMA 4KI5M 4RR3A 3BOWA 2PHFA 3SQOA 4Z2WA 5LK5A 4JHZA 1CN1A 4GQ7A 2YG0A 4K8FA 3HBKA 2ZGTA 1HB4A 4KWJA 3WOGA 5L36A 4SLIA 1UZWA 1D2SA 2Q0AA 4M00A 2W52A 3D0JA 3J26N 4JDNA 3AP6A 1XYPA 1XNTA 4CDUB 2ATFA 4R8HA 1UN1A 1TMF1 3FHQA 5JZGA 2VCAA 4QD2A 2LROA 4JDOA 1W8OA 2ZHMA 3WNXA 5HCAA 3POGA 1RJ7A 1PIV1 2RDRA 4BIFA 2JDKA 3G6JB 1N3PA 1PGW1 2B7YA 4HK9A 4LOSA 5F2WA 2D3RA 1JZ7A 4IEXA 3DEMA 1L7QA 2SLIA 3ACLA 2G4IA 4XJWA 1C1LA 4QPGB 2PAKA 1LCLA 1HB1A 1DZTA 1X8EA 4NIAA 3GCXA 4JGYA 3PU3A 5KXBA 2VOKA 3ES4A 2J22A 3W59A 5CFCC 1HQWA 2WT1A 5ACA2 3HT2A 1J84A 5K0UA 1IS3A 3WG4A 2IXCA 4IV3B 3W9AA 1RVF2 3KV4A 4I01A 2PHTA 4MG2A 3AZXA 1VAMA 2IFRA 3UT0A 1UPIA 5FO7B 4CDXA 2Q8EA 1H2LA 2QQUA 4IE7A 2JKBA 4AXOA 4CEWB 4ZZ5A 2YROA 5D1IA 1HRI2 3A23A 4NHYA 1QJZA 4Q27A 4DY3A 3SEPA 1IOAA 2HWE1 1A8MA 4UYBA 1RUD1 4Y1YA 5FPBA 4NRPA 4XHXA 4WM7C 5FOJB 4AGGA 4E2SA 1N1VA 3RZHA 4Q4Y2 3HOBA 5FZ6A 1JHNA 2HYKA 1HIXA 1QOTA 3FWEA 3P6BA 1GWLA 4E4HA 1BK0A 4BCUA 3T4VA 4F83A 3VBRB 3LIHA 4R9AA 1W8ZA 1GQGA 2CYFA 4K1YA 2EF6A 1PNFA 2MEV1 2JDZA 4Z82A 2GZWA 4RQPC 3VDDB 5FUPA 3LEMA 3UGGA 2XUMA 1G7YA 2R062 3GNEA 5FREA 3WT3A 2P5BA 3E5UA 1Q8SA 3WD5A 2CGPA 2ZJCA 1J3PA 4QGMA 3ZKUA 2OW4A 4NPLA 1VRH3 1GZWA 2RDSA 1W8WA 2K46A 3USUB 3TEZA 5FYUA 2O0OA 1IPKA 2ZOEB 2Y64A 1YIPA 3MIGA 2UWBA 3GBFA 3NKTA 3H8RA 1WMEA 1S2KA 2FCUA 4OMDA 4WV8A 4S2GA 1DHKB 1HXS3 2JICA 1NLRA 4Q1RA 3BCWA 4PI0A 1ULCA 2BV4A 2WKKA 5EJZB 5A7NA 4L8QA 1PGL1 1QQP2 1X8MA 1OVPA 2ZGQA 1RUE2 1YQ8A 1AR81 4Q4X2 3WEZA 4OZOA 1WGPA 4QXCA 3WF3A 4A7YA 3O0XA 4CRQA 1YFYA 1ZZCA 1FAYA 4IE5A 5J96B 2WS91 3PU8A 5F5IA 3MW2A 3OCPA 1W0NA 4J6GA 4MO3M 4PT6A 4DQAA 3VBSB 2VQTA 4YNIA 1W2NA 4UFMA 2GC0A 3HNMA 3OGSA 2P4EA 5B2GB 4W4ZA 1RJ8A 5FXZA 3RYKA 2BUKA 1AR83 2JWPA 4QXBA 5BNNB 5LZ6A 4XTPA 1ND2C 2VBPA 4YW4A 4DUWA 1UU5A 1YIFA 4GIQA 4RHV1 4Q4V3 3JBG1 4Y4YA 5GZGA 5LCWL 4L11A 3JBG2 1MS1A 4OYUA 5AFEA 2XJSA 5IT6A 2DUOA 2FMYA 5I0UA 3LSEA 3HJRA 4UI9L 4HVQA 3MO4A 5FY9A 1JOBA 2WL1A 4HKLA 2WFPA 1UMHA 2B4KA 2A3XA 5F6KA 1J59A 1N3OA 1PK6C 1YQCA 5EWSA 2UWCA 1IG3A 4IW3A 4XQWA 5FZOB 3KHBA 3VZMA 1OXCA 3POWA 3VZJA 1YC61 2Z69A 5FV3A 3KCXA 3LA2A 5CU1A 3T2TA 1HB3A 3AKRA 1Y3TA 1UY2A 4JRAA 4N43A 1WCQA 2W0XA 4CP9A 4NIIA 2BWAA 4Q4X1 5EV7A 1YQ5A 2ADDA 1Z0HA 3CL1A 3CF6E 1JU4A 4KNCA 2D3SA 3KB5A 4GMP0 4CEYA 4C0HA 1NLQA 4DFSA 3FFQA 2VUCA 1RUJ2 3OGGA 3WY6A 2GNBA 5C8CC 1DGLA 4LBLA 1QJX2 1UIKA 2VBBA 2ZGRA 4UT5A 4UW4A 5K0UB 4EN7B 5LA1A 1VBB1 2EIEA 3KGZA 1PHMA 3PUHA 4XAEA 4YGDA 1IS4A 1WD3A 2WT0A 2XBO3 2R071 3T2PA 4EWDA 1DQ6A 1XSQA 4RGGA 1S0GA 5FLJA 2P6CA 4E2GA 1UYPA 3K77A 3VBOA 4BYYA 2W1WA 2H6BA 4ZXKA 5FMDA 1SQ4A 5FUNA 4MOAA 5KHGA 5DZGA 5A3MA 1RMU3 4LO5B 2XJTA 5FYTA 3AFGA 4FTSA 4GJZA 4KBZA 3AX4A 1REFA 4QHOA 3VBFB 5L7OB 1C57A 3OY8B 1ULEA 4YW5A 1AR63 1AYM2 1X82A 4LO4B 3ROUA 3JU9A 4EE2A 4Q4Y1 3VBFC 4QB6A 4B29A 4DXRA 3CEWA 1X36A 1XBFA 3WDWA 4BLJA 3ATGA 5F8PA 1JW6A 5E8AA 1GZ9A 4M3CF 1BHGA 2TNFA 2ZKLA 1YWKA 1GICA 2VOVA 5C8CA 1YQ2A 4CCLA 5L19A 4NAOA 4Q4V2 4C90A 3AKQA 2FZ2A 1RVF1 3N7MA 4D3WA 2X8KA 5CKMA 3POJA 4AW7A 5C8WA 5FZGA 3OG2A 1F35A 4YSFA 5K0UC 4HL0A 4M0NA 1EP0A 4AI2A 2W95A 2JENA 1ZREA 3AXDA 2DFCA 3KV5A 3ALQA 4N8MA 5T5OA 3DYMA 1AYM3 3SLIA 4AFCA 2PELA 3W21A 4XUPA 4ASMB 1RUNA 2QQNA 4LR4A 3U14A 3WSOA 1RTVA 4AR2A 1SLLA 2A6YA 4IE4A 2W47A 1DQ5A 2OQ7A 2PA7A 2ET7A 3JD73 4LBNA 2UYAA 4LT5A 4XFFA 4AEDA 1N3QA 4MX3A 1ULOA 3HN1A 5IUQA 1RUF1 1BMV2 1UY4A 2BU9A 3ACHA 5T52A 3OEAA 1SEFA 3ABZA 1H9WA 3LWCA 1WLCA 3WP5A 3OTFA 3SKJE 3UJQA 4IEWA 1LHOA 1O4YA 5AVPA 3SCHA 4HG6B 2XJPA 4PIYA 5FYYA 3ZYJB 4LBOA 3NQHA 1G6NA 4Z92B 4Y1XA 3RMYA 2OQ6A 1V6IA 4ISRA 1HB2A 1H4HA 3VBHA 4I3GA 4FT8A 1N1SA 2CNAA 5JXJA 3MDPA 5E89A 3K4ZA 3ZDVA 1OVSA 2Q1ZB 5F9TA 2ZEXA 1J1TA 2LALA 3TBDA 3CLPA 4UF0B 1ZZBA 4LE4A 2PHWA 1VBA1 4D7TA 3O1TA 1W9SA 4TYSA 3O12A 4W6WA 5FYIA 4KGGA 2WRAA 3TB0A 4YG0A 1W06A 5H9SA 1VBE2 4B4PA 4YGBA 3LD8A 1KJLA 3SMHA 1G9AA 1YFWA 1FPN1 2DBIA 2E51A 2GMPA 1HV0A 2A5ZA 4QX2A 3KT1A 2E7QA 2WFF2 3VBOC 4IV1C 5KHKA 3MEPA 2VQ0A 1HV1A 3H1WA 3OBZA 1XU1A 4TXWA 4A3ZA 1GZWB 5FZEA 4YW2A 2VCBA 4Z1VA 1PIV3 1EPZA 2PHRA 4AHZA 1LOFA 4AFBA 5JDBA 1TE1B 2EA7A 1LGCA 5F2SA 2PQSA 5CFDB 1OMIA 3AYCA 2EICA 1V6OA 1NCRA 1DYOA 1RIRA 3C8XA 3E6CC 2WNVA 1GNYA 1WKYA 2YU2A 3I7DA 1JYXA 4N90A 4AFDA 1BXHA 2B8MA 2X5IC 4A45A 5JSRA 2YC4A 2BFUL 4ZY9A 1VBA2 5DUXA 4K1ZA 3NJZA 5FZAA 4AQTA 3D6EA 4M4RA 5HCBA 1VBE3 4PLNA 2QCSB 4Y5TA 5FWEA 3IDAA 2Q1MA 2Y6KA 2YXSA 1YQ6A 2FDKA 5EYXA 5E16A 3ZXDA 4SBVA 1J83A 2HWB3 3FBMA 3PUIA 3OBTA 1QJX3 2XOMA 1HN1A 2IXIA 1DYKA 3A4UA 4AHWA 2YDEA 4COUA 2A7AA 4FOYA 4TZDA 3DYPA 4WM7B 3ENRA 3NKGA 3DF0A 4XFHA 4GH4A 1EAH1 1QF3A 1X9PA 2PHLA 3ZXGA 2O1QA 5FY7A 1BKZA 4KWLA 4UXAA 2RS33 2UY8A 3LFIA 3OUJA 5FMBA 4FFGA 3FJSA 5GZEA 1GWKA 2CGNA 3IDCB 3OGJA 2XVGA 4X6QB 4LUMA 5JXGA 4JRLA 1WW6A 1P8JA 2HLEA 3UYJA 1RUG3 2W92A 4TTGA 5EIYB 1GP4A 3VBRC 4BE3A 1CVNA 5FY0A 4XDOA 4BK5A 1JYCA 1V6KA 4QKDA 2FZ1A 3ZFFC 1CAVA 3TNQA 1QH6A 5FZ1A 3N9QA 2JE7A 5BNOA 1MQTB 2EALA 1MZEA 3KMHA 3RZMA 2QQJA 4P5YA 2Q30A 3OOXA 4ZU7A 5C4WC 4IGOA 5FUIA 2BQPA 2CAVA 3M2MA 2DVDA 4CU6A 4XW3A 3Q8AA 4DUXA 1OF4A 2VW0A 2YC0A 4CEYB 2QE3A 2PTMA 4LQRA 5J48A 4ITCA 4M3CB 2J42A 1NCRB 3WDVA 4WZFA 1CAXB 1JUHA 1QJEA 4Q0PA 2FCTA 5F3CA 1ALYA 4BDVB 4XAAA 2ZX4A 1MZFA 4FPJA 5F3GA 4YVWA 1SBFA 4E8CA 1KITA 3HEIA 4M3CA 2OPKA 4Q1PA 1OUSA 4ZHNA 4K20A 2BTVC 2ZS6B 4QXHA 3VHPA 4IEPA 1QY4A 5IJRA 1MZ5A 1IPSA 4LA2A 1QJY1 3B9CA 5FYCA 3ZXJA 4NMIA 2UYBA 1CGPA 3TRSB 4B8EA 3M3EA 3ACIA 3ZFGA 4IDZA 2VTFA 4YARA 3P1IA 3T08A 2ADEA 1BLZA 2IVJA 1OQDA 4QX7A 5A3WA 2HWB2 5IK8A 2LW8A 4AVAA 1SCSA 2PAMA 3POEA 3B00A 3W5NA 1BBT2 1R083 1RUJ1 1UX6A 4JAAA 1S0BA 4MLOA 3M8LA 5LA9A 5J09A 3ZPOA 4IEZA 1LODA 2R30A 4NWVA 3LPFA 2HEYF 2OPWA 1UOFA 1W9WA 2VCMA 1JZ4A 3T1LA 5AC92 2BWCA 1MS9A 2X5IB 1QNWA 3THCA 4AEKA 4W6YA 3ZVXA 4D0QA 4Y22B 2MPFA 2OZJA 1GQHA 3RSJA 3WQ7A 3DGTA 1NE6A 4P9LA 1LOEA 2V73A 4FO9A 3D8CA 1MS3A 2XR4A 3AC0A 2P3JA 3H3UA 4PIXA 1STMA 3P3NA 3KWVA 4M3CE 5A70A 1ASJ1 2DF7A 1NLSA 5JCTA 3GGLA 1PVC2 2E6VA 3RI9A 1NA1B 1ND2B 1JU3A 2HEVF 2Z4FA 3MPBA 4OMCA 3D5OA 4DO0A 1CJPA 1VBD1 5SV5A 2R073 2DCYA 1UL9A 3C2UA 4RA0A 1IPJA 4J25A 3OEBA 2HBUA 2XUEA 4YYOA 1COV3 2ES3A 4FI9A 2Y0IA 5JOYA 4YM0A 5FZ9A 5C3RA 2XMLA 1CIWA 3MUZ1 4NOTA 3MGUA 3I3EA 4IEOA 4Q26A 2ZMLA 2WQ8A 1O6UA 4IERA 2GAUA 3NO8A 3U11A 1UX7A 1VBA3 3A0KA 2WS92 4ZS3A 5DAXA 1JI6A 5JAXA 3ME2A 3IIIA 2BZDA 4QX3A 5FY1A 3ILNA 5CVRA 1OBNA 4LEJA 3LPGA 5J3UA 3T30A 2AUYA 1PVC3 5BNPA 2ARAA 2RMU3 4XJ8A 1G8WA 5A3NA 1FOD3 5IAXA 3AYAA 2YY1A 2ZTNA 3ACFA 1XNAA 4QQLA 5CBLA 1BCXA 5KWRA 1ZA4A 3KCCA 2XB6C 4QPGA 2I07B 1W2TA 2VMEA 4JV4A 2DVFA 4K3UA 5FPZA 3HNBM 3IDEA 4DEVA 3AZZA 2C1FA 1FMD1 1VB4A 5T5LA 4LK7A 4NE9A 3RZZA 4PDWA 5CA6A 3T0DA 4CEYC 3AMMA 4QB1A 1LOCA 2W9XA 4QPWA 1VMFA 4YM1A 4XACA 1JZ8A 1POV1 2G9ZA 4RFRB 1CONA 4FPHA 3M3OA 1A78A 3OYWA 3THTA 3SXWA 5C7GA 1W9YA 2LM3A 1Q8PA 1C8NA 2RM21 2WO2A 2A73B 3PMSA 4L92A 5DZEA 5BXXA 4LJHA 5L73A 3HQRA 5LY1A 1PO11 3DUIA 5KXCA 1C4RA 5DN2A 3V56A 4LIVA 4C1XA 2R0HA 2TUNA 4LLFA 4XJUA 5B4XA 5A3OA 1D0GA 4XDPA 4CDWC 3H1YA 5C9AB 1AL0G 2P3IA 5FYMA 1PM7A 4C0BA 1T6GC 4LNVA 4XETA 3AYEA 4ATEA 5FP7A 1SG3A 2OKXA 3GHNA 4JZRA 1FMD3 4LORA 1D2QA 2VGDA 1ENXA 4JX0A 4XIKA 1AXKA 1LEMA 2F4PA 3O0WA 1SLAA 3D0SA 3KLSA 5FZCA 4XUOA 2GC3A 2QQPA 1BVP1 2IWGB 2VOWA 3JXSA 3FE5A 1I5PA 2WZPP 4FQ4A 1S2EA 4GB31 5FTTC 3HWJA 3VLBB 1TEIA 2HBTA 4B7KA 1HRV2 3MI8A 1LKNA 2R0FA 3ELNA 2QBXA 1ULDA 3N9MA 1QJU2 4QQPA 4ZKTB 3FUOA 5KHIA 2VOTA 2EXIA 3ZN6A 4NIGA 1VJ2A 2HJIA 4RGAA 4ASKA 5JSPA 5B4NA 1R093 4WVWA 5J37A 2BNNA 4OHYA 5L9VA 4FOWA 4MSVA 3ZSJA 4F3JA 5CB7A 2HWE3 1I6XA 3KF5A 5CEHA 3RFRA 2ZBJA 3VB9A 1MQTA 4URTA 4XCBA 1UCXA 3AKPA 3EYPA 1MEC1 1SLTA 1QHDA 1W03A 3DCQA 5BY5A 4A3XA 4EN0A 4LKSA 1ZM1A 3PIGA 3WUDA 1G9FA 3LA7A 4RFT0 2GDFA 1C3HA 4A2UA 4ZONA 4CCJA 1AXYA 3I54A 4KG0A 2JG9C 1KQRA 3P3PA 3KV6A 2RJLA 1JZ6A 2KD7A 4MV2A 2OZ6A 3VBOB 3UKNA 2R7EB 3FLRA 1UOJA 3JD71 1IHMA 3QBQA 1UY1A 2WO7A 4ONUA 1BVVA 2BEOA 4Y1ZA 2QDRA 4Q4W1 3WX5A 1YLLA 1QXJA 2TEPA 3RZLA 4U2AA 2ENRA 1HXS1 2WYSA 2PLV2 3GF6A 1QGLA 2OXBA 2Y0OA 3R4UA 4ISQA 1UO9A 1XRUA 4J1XA 3VDDA 2D40A 4QM8A 5IK5A 1ND3C 2V4AA 2WAOA 2J1EA 3IAQA 4H2AA 1VE0A 4NO4A 3JB4C 4FXGB 2LTNA 4IEUA 2B45X 2RS52 2WNUC 3CMGA 2ZA9A 2ZXQA 3WF2A 3J9SA 2IZWA 1QXRA 1WBFA 1ZBE2 4E4SA 5A3UA 2YB7A 2YHJA 4TWTA 5IAVA 3ZYBA 4B3NA 2WBKA 5JMOA 2UU8A 3SH3A 5A3TA 4XTMA 1ENRA 5HI0A 1C28A 1Y43B 1GUIA 4EWEA 1GOHA 4ES9A 5ERLA 4S2HA 1ONAA 1O5UA 2AEZA 2ARXA 4UW5A 5F5QA 1YEWA 3PMEA 1AUYA 1YFUA 2QFEA 3UV9A 1HQNA 3AKSA 4MGKE 3Q8EA 3ZN5A 4NHXA 5FWJA 4JVAA 5LASA 1DYPA 2VZ3A 4GB32 4N7IA 1RGSA 3RMXA 1PK6A 3DYOA 5A7QA 1RUH1 2XLGA 2E32A 4F8AA 3B3QE 4A6SA 4A4AA 5FMOL 5GZFA 2XBO2 3I2GA 4OCTA 3KD4A 5DG2A 4JGZA 2XL7A 3W5MA 1ULGA 3H3LA 4N53C 1LHVA 5IW0A 4GD4A 1S1AA 2DVGA 4QKBA 3RJRA 1UAIA 2R16A 3I4IA 5F37A 4PF5A 4HVOA 3S6PA 2VC9A 1U12A 4RSUA 3VBUB 1OH4A 2WABA 1ULPA 1RUC1 4CCNA 1W9TA 1W8UA 5A7WA 3OD0A 1LNSA 3K4AA 2VM9A 2BPA2 1EV12 3GZEA 3I59A 5FMCA 3ZFFB 3FFZA 4OULA 3J8F2 2HWD2 3I49A 2RM22 1WZXA 2OS2A 3GBGA 1AX1A 1VALA 3U75A 3MF9A 4MXWA 3L2HA 4YFWA 1RHI2 1V0AA 3V65A 4A7ZA 4YZ2A 1W2UA 4UFLA 5GLUA 3AP5A 3T0AA 1RUC3 1BEV1 3TN93 4W6XA 3T1MA 1FXZA 1SFNA 4ZS2A 1E5SA 1Q5OA 3LDBA 1A6CA 1I3HA 2PLV3 3MLKA 5I8TA 4GXLA 4BQYA 4AI3A 4RS5B 5FZOA 4DIQA 1K5JA 2BGPA 1LENA 3THPA 2WIIB 2OT7A 4AQSA 3NAPA 5D8AC 1DZQA 1V00A 2IXKA 1BEV3 3GZAA 1QOSA 1OF3A 2IXHA 4I0BA 5FPVA 5A7OA 4Q8KA 3BPSA 1FYUA 3NVCA 1PO13 4B4QA 1LU2A 4AQ2A 2WO1A 2PN5A 5JUVA 4AFMA 1Y7BA 1DGRN 2WAAA 1ZZ9A 2ZGUA 4AWDA 1SACA 3OPWA 1W6PB 2QVSB 3CDZB 3PIJA 3RWKX 5BNNA 4CSWA 2QQVA 3R05A 4UOJA 1WLWA 1AR93 1DQ4A 5CYYA 1VPHA 4CCDA 1UD1A 2A6XA 3NAPC 4AVCA 2ZKNA 1HN0A 1G86A 3BUCA 1EY2A 1UU6A 5JVVA 4JKMA 3BPZA 3KV9A 5FP3A 1Q8OA 2C5DA 2NLRA 3E6BA 2XG3A 3OBAA 3VKLA 4ZPIA 3NW4A 2A71A 2YC2A 2JB8A 4MXWB 2D5HA 2WQ4A 1J58A 1GU3A 1JXNA 3H3ZA 4P5HA 5I91A 3I3QA 3RS6A 2BYVE 3RZKA 1CWPA 4XVHA 5K4LA 1HQLA 2Y6LA 4YZ4A 2CWSA 1VBC3 4KU7A 4XURA 3RDIA 3WUCA 3MV01 1JOJA 4QGLA 1NG0A 3PJQA 3V0BB 2EVXA 1B35C 2C24A 4XUQA 2CU5A 4Q29A 5AC91 1VRH2 3BIEA 4UFHA 3G7DA 2VUDA 5CFDC 2ETEA 1H2KA 2F6BA 2NN8A 5KBFA 3J7MA 4P9XA 1JYNA 1ZRFA 4HPKA 2RDNA 4M01A 5FZDA 1L7LA 2H0BA 3ZIXA 2FMDA 2YYOA 1Y9GA 2RS13 4WVMB 3T2OA 4XPVA 4AOCA 4K7JA 5ABJC 3TN92 3WQBA 1W6PA 1MS5A 2D44A 1ZBE3 3B01A 3PUSA 4XQDA 4LBQB 4AFAA 2ZACA 1ZNPA 1W39A 4BH9A 3BI3A 4GWIA 4O7XA 3QH6A 4IL7A 2Q8CA 1YI7A 1UY3A 4Y5SA 2A70A 4CXWA 3KS7A 5EFUA
chains in the Genus database with same CATH topology
4YW1A 3KZ4C 4EROA 3CO2A 1RUE3 3HR9A 3WW1A 5LK7B 3PTYA 1AZDA 3HT1A 4FPKA 3VL9A 4FPLA 2VPVA 3HAGA 1UU4A 1LECA 5J36A 1AR71 4EJRA 3UK9A 4BQ1A 2ZPXA 1ND3A 2KA3A 3S7EA 4A7KA 3HMYA 4V1PA 2VVEA 5DUWA 1ASJ3 1CQ9A 2O8OA 1CJDA 1WCSA 2HWF2 4FAGA 3WDYA 3WP6A 3HD8B 1FNYA 1EV11 2P17A 3ASIA 3UJOA 3VV1A 4QT6A 3PVNA 4LO7A 5FRAA 5F1RA 2OYZA 1XU2A 2ET1A 3IWZA 3B7MA 2JX9A 2A75A 2XWJB 2A6VA 1G9DA 4Q0VA 2VECA 3MIEA 2AREA 4NHKA 5FLIA 1GSLA 5I8YA 2V09A 3ES1A 1QMJA 1U5ZA 3FZ3A 4I30A 4ORFA 4BWOA 1IQAA 1NQJA 1S0JA 3KT7A 1DFQA 1V6LA 2RMU1 4M0HA 1Z78A 2YV8A 4WZCA 4P9JA 2NYYA 5DDJ1 2XJVA 1C8M1 2G9GA 1X7NA 3E5XA 4XJ9A 2X29A 4Y20A 5DUVA 5EXOA 3VHRA 1Y9QA 4Q4W3 3OBRA 1YO8A 4AVBA 3DL3A 4HMZA 2XGXA 2DCTA 4H55A 4XMIA 3WW4A 2XKPA 2QNKA 1RUI2 4Y1VA 5JSOA 1COV1 2C9AA 3TYJA 1WW5A 5IK4A 2RS51 4QQOA 1Q43A 3MYXA 1HDKA 4AHXA 2XJUA 4HETA 4KU8A 1BJQA 1LGBA 3N36A 1SDWA 4AYUA 1K5MC 1SFYA 1FATA 5BNOB 1CAUA 3GHMA 3MFCA 4ATFA 4IXLA 1NCQC 3J8F3 5H9RA 4F7ZA 1YJKA 5ABJB 3WG3A 5T50A 3JD72 1NYWA 1GFF2 1O4TA 1S0FA 4L2NA 4WM7A 1OSGA 4EV0A 2D93A 2DUPA 5BV6A 1IKPA 1XE7A 1RUJ3 4GB33 4YG6A 4JGZB 5IK7A 4HLTA 2GC1A 4YGEA 4XJAA 1NOVA 3AP7A 2YGMA 1YNAA 1RUF2 4LBQD 3WG2A 2WSVA 2VY0A 3BB6A 4Q4Y3 2XVLA 4XHBA 1WLTA 4D7YA 5KC5A 3MICA 1LESA 4C91A 4TLFA 2D6NA 4XXAA 3LOBA 5GLZA 2AENA 1RMU1 4AI1A 1FOD2 2TBVA 2ZX0A 4XIOA 2BNOA 1XNCA 2OVUA 4JGYB 3ZMNA 4RL7A 5K9YA 5FMOS 1DLLA 3BOPA 3BU7A 1V9U2 3UKTA 4HSJA 3SH5A 4ASLA 3VKNA 4PJYA 3JB8A 5JI9A 1VBC2 5BPXA 1PZ9A 4YVSA 3SCFA 1IZ3A 2BBVA 3POSA 4AEDB 4HKOA 2WWSA 3JCIA 4DRRA 1WD4A 2BVBA 1PO12 4LHKA 3WLUA 2K0GA 3ZSKA 4XMAA 4K21A 4WVVA 1PVXA 2XLFA 2HWF1 4S2DA 2D43A 1GANA 4DNYA 2P2KA 1R1ZA 1O4ZA 1JH5A 1FMD2 5D8AA 3TAYA 2ZGNA 2FZ2A 2D6OX 2R072 4QPGC 5EJ3A 2I45A 3NV3A 1RL3A 3KSCA 3CJIA 1U0AA 2AZ5A 5E88A 4KGQA 2UY9A 4CTEA 4IV1A 2XJQA 5JPMB 1GV9A 3NL1A 3OJBA 1WCDJ 3IKWA 4QQHA 3B5LB 1VP6A 5TSWA 1EV13 2JEMA 4Q8LA 2BFUS 3WDUA 3ZMOA 2QKDA 2HWD3 3QOPA 5C8CB 3IM0A 1NA1A 4O9GA 3QCWA 4XILA 2QUOA 4OI1A 4LULA 1RUC2 1NCQA 1S0DA 2R043 3VBHC 3MFAA 2I2SA 4MYEA 4FBFA 2WA3A 3OPZA 1OOPB 3S7IA 4OI0A 1W6MA 1UZYA 5A33B 2I74A 2ZAHA 1QXPA 3VKMA 3Q9OA 5I0TA 1FPN3 5L7OA 2CGOA 3BALA 4YVSB 4KH9A 2ZGMA 1PNGA 3ZYRA 2NM1A 4QX5A 3WP4A 2GN3A 4P9IA 3B02A 3N7KA 2VULA 3ZYPA 4XBNA 2BNMA 2GH8A 3B93A 3AZVA 2ERFA 2JXAA 4YZ5A 5HXVA 4LO8A 3WQ1A 1AR82 2P37A 2CL2A 2PFWA 4LE3A 3SH4A 1VLNA 4CZSA 4FAHA 5CAZA 3CJIC 4DMIA 3NV1A 1ZZ6A 1OQ1A 4OFGA 1BBT3 4IV1B 1FNZA 4N53A 4OHVA 4X8NA 4XFCA 1VBB3 1M4WA 4MGZE 3CJIB 1QH7A 2HWB1 3FHIB 4OUMA 1H8TA 1RB8G 3ZXAC 4AVTA 1UKRA 3IT8A 4GALA 1HXS2 4GWMA 1LU1A 4H7LA 1CAWA 4CDXB 1OKQA 4QU2A 1GNHA 3ZFEA 2MEV2 2JG9B 4YGCA 2Z79A 5CG9A 2VNGA 3ZXLA 4G4FA 4XFAA 5I8SA 1K5MB 3S0MA 1VAVA 2GH2A 2X5IA 4R4XA 3TWIA 3BIWE 2Z2SB 1SLBA 3OY8A 3LCPA 5KXEA 3VBHB 1J1LA 3VBSA 1GNZA 1HRI1 3H7JA 1URXA 4P9WA 5D8AB 1W0PA 5GLTA 3VGIA 3FX3A 3ZXEA 1LOAA 4LHLA 4IEVA 3MZHA 2D3PA 2E7AA 2P3KA 5JI7A 4FTBA 2VXRA 1DF0A 4I0AA 4R52A 4XF0A 3VHOA 2MHFA 5FBZA 4XF4A 4XXPA 3SITA 1AR62 1CESA 2HKXA 3WP3A 1KFUL 1L3JA 2VVDA 1YYNA 2GNTA 2GU9A 3AZWA 1H2NA 3USUA 5DZFA 3IDBB 1UPSA 1W6OB 4U36A 4CDWB 1VBC1 1AYN3 3EBRA 5JOZA 1ZX5A 1PGW2 1V6NA 5BNPB 3KGLA 2VH9A 2ZHNA 1H8TB 1FI2A 4DOUA 1WMDA 1E57A 1I5ZA 5CFDA 1AX2A 3E6DA 5FO9B 3M3IA 2ZCWA 3JQXA 3X29B 3U07A 3AKTA 4WM8C 4LBQA 1OD5A 3LAGA 1B35A 3GBWA 5EYYA 1WA4A 2ZMKA 4ES8A 3VL8A 1AR61 4NHLA 1XQNA 2ZHLA 1TME1 4PCRA 1AYN2 1AF9A 2B9UA 4Y26A 2A6WA 2QZ3A 5J98B 4QPIA 1LOFC 4ZU4A 2R6QA 2D98A 2WLQA 1H2MA 3EHKA 3QLQA 4FXKB 3EXUA 4AF9A 1ULFA 2A3YA 4FPOB 4XJZA 3VBUA 2DURA 3D4KA 5T55A 3APBA 2PLV1 2JG8A 4FPEA 4K6BA 1CAVB 1XYOA 1LOBA 4Q4W2 1AVBA 4OUSA 5KHJA 2GALA 1TME3 2RR11 4P9GA 3H7YA 2K9ZA 3IN9A 4IQPA 4Q4X3 5SV8A 4BOWA 1Q3EA 5ACA3 1QJU3 1SLCA 4G3YC 1DZRA 1QDOA 4YRDA 1K5MA 4XEZA 2H0VA 1FV3A 1MS4A 1A3KA 1OPMA 2Y38A 4R9BA 4E27A 1PO21 4LHNA 1MEC2 4K40A 3J4UH 3MLJA 4MXVA 4NHMA 4N9IA 1KRIA 1VAKA 3VZLA 1VBD2 5LRRA 1D4M1 4BM8A 1X50A 4QGNA 1LEDA 3WCRA 2GNDA 2VNRA 4GMP3 3H1MA 1S0IA 1VRH1 1LOGA 4FOVA 5BNOC 2R042 4OI4A 1QJU1 5FCCA 1DGWA 4FPFA 1BK1A 3VZOA 4H7MA 1YJLA 2EXHA 5LRSA 5JIAA 1OPOA 1H1AA 1V70A 2R1DA 2WNUA 4Q4V1 4E2QA 2ZZQA 4WVZA 4JC1A 1RUD3 1NQDA 2BGCA 2ZGOA 2HWC1 2D97A 3MPPG 3OD4A 1FT9A 1VBD3 4AI8A 3WVJA 2XLAA 5FO8B 1W6NB 4Q2FA 4WM8B 2JG8B 2RS11 4CDQB 2XH6A 2HWF3 4OI2A 4FPCA 1Q8VA 3VDDC 3AYDA 1QKQA 3K51A 2ZGSA 1QNYA 1NXD1 1YCIA 4FP3A 1ZVFA 3M1HA 1YRZA 2ZGPA 1R092 2E63A 4HSLA 2JG9A 4AG4A 1C8M3 3PNAA 4YVWB 1NY71 2WA4A 3M4FA 4D69A 1H8TC 3JZVA 5KHHA 1YFXA 4HFSA 4BMBA 4B4RA 2NP0A 1KD7A 4QPIC 1O3QA 3MLLA 2YMZA 1XNBA 4BHPA 1LB2A 5LEJA 1V9U3 4L99A 1NY72 1DDLA 3DPRC 4OZXA 4AEJA 2R49A 1UF2C 3AMQA 4PBPA 1JTZX 2QDNA 3WR0A 4HBNA 2WINB 1RUG2 4CDUC 3SNMA 5BNQA 2DVBA 3RRDA 3AMNA 2VMGA 1C5IA 2FQPA 3TOJA 2WNEA 4HPKB 1VB2A 4CP1A 1ZZ7A 2GSYA 2PAEA 2WZR1 3INAA 2BW8A 5H9PA 5FQ0A 2HWC2 4OLLA 3TN91 1WBLA 5JPNB 5I0RA 3MIDA 2C0ZA 1LHWA 1ND2A 4R9CA 4FP2A 4XF3A 4CDXC 3FBYA 3M3QA 1PVC1 4NPRA 5FQ0B 2VMHA 4PDWB 1ASJ2 3M7AA 1FX5A 1DQ1A 1PK6B 3IPVA 3ILFA 3WCSA 3KT4A 3V0AB 2R041 2MNGA 4PLOA 2VNOA 2MEV3 1SBEA 4RR3C 5A32B 5JOWA 1PZ8A 2AGSA 1QJY3 3ZYIB 4AVSA 2EAKA 1B35B 1QQP1 1SLIA 4COVA 3LSDA 1REEA 2VOXA 5BYNA 3U0ZA 3VKOA 2JD4A 3AMPA 5HBAA 4C1WA 3R4SA 2WT2A 1CX4A 3VBSC 3WQ0A 2DTWA 1YUDA 3PJYA 2RE9A 2SBAA 3FMGA 1UIJA 4XQ4A 4Y20B 3DN7A 4FPGA 4YM3A 1S55A 3ZYGA 2WS93 1FPN2 1TQ5A 3VN4A 1GZCA 1WW4A 4CDWA 1OOPC 3ZSLA 3URFA 2XJRA 1RC6A 2RR12 2B5HA 1Z7S3 1B09A 1D4VB 1HLCA 1NZCA 1OLRA 4E4ZA 3I8TA 3TNPB 2PHXA 5JOXA 1RHI3 4YVSC 1GBGA 4FOQA 2HWE2 4N7UA 4JQRA 2K2SA 5GZDA 3LA3A 3FC0A 3AJYA 5ABJA 3B69A 2LUWA 3L9JT 2E9QA 1KJRA 2OUJA 3RJ2X 5A32A 1O3SA 1D0HA 4D7SA 1COV2 1RHI1 2XVKA 3VZKA 1BMV1 4YFZA 4CEWC 3SCGA 5JMCA 4NN0A 1AYN1 1TME2 4KL1A 3FLPA 5LEKA 1SCRA 1SBDA 5HCFA 3ZFFA 2HWD1 1W6QA 5AFBA 1HX6A 3C3VA 1M06G 2ILMA 1O7FA 4G9SB 1QU0A 4QPIB 4N43C 3M3CA 3MIHA 2BVVA 5DDJ2 5C4WB 4HKWA 4LBMA 3H8UA 3WXPA 2DYCA 1REDA 3N7LA 1ZRDA 3IBMA 2DV9A 1DG6A 4QXKA 4PBOA 1CPNA 1NXMA 2XBO1 5FPXA 5GLVA 1V6MA 4DXZA 1JUIA 4N43B 1JYIA 1MR5A 3RYPA 5AC93 3ZIWA 2RHPA 4L97A 4XYXA 2B42B 1UW8A 4XFBA 1DBNA 3O0VA 1R1A3 2VG9A 4NWWA 3O5SA 3V0AA 2WNVB 1PZ7A 3B94A 1TNRA 3CNAA 4CP0A 1DIWA 3N4MA 1ZBE1 1CPMA 4EN9B 1H1IA 5JIUA 1I1EA 1OA4A 1F2NA 4IV3A 1RUOA 4D94A 1AL22 3K48A 5C4WA 2JECA 1ND3B 1RUH3 1AR91 1AX0A 1V6JA 1PMIA 2E7TA 2XPJA 3VBFA 1VBE1 1YI9A 1MZ6A 5CIRA 4GH4B 2JJ6A 2NPIA 1HRV3 3RYRA 4RQPA 1W6NA 1OFNA 2D6MA 4WM8A 1RINA 2OUHA 1QWRA 3R0RA 3FUQA 1DGWX 5FLHA 2QJVA 3POYA 2UWAA 1AJKA 1XXNA 4CDQA 4XBLA 3AP4A 1LJ7A 5T54A 3DKWA 3OF1A 4X8PA 3ST7A 1AR73 2Q4SA 2Y26A 2YPJA 4LA3A 1DU3D 5GM0A 4LTAA 4RS5A 2G9FA 1NCQB 2PHDA 3ETQA 3KQRA 5T3NA 2ZGKA 2ZX2A 3AXEA 2DUQA 2W08A 2YZ4A 3ZN4A 2D5FA 5C9AA 4H3WA 1ENSA 1GYKA 4OHXA 4UBGA 4Z8BA 1HRV1 3ZSEA 1WLDA 3H9AA 3WG1A 4FPYA 3WHTA 1ZBA1 2EXJA 2Q8OA 2WNVC 4UW6A 4HZFA 2RJKA 5DUUA 3EJKA 1BYHA 3A0NA 4Y1UA 4KWKA 4COWA 4WBBA 1R082 3CU7A 2VUJA 3V0BA 3AK0A 1U5XA 3SHRA 4XZPA 1GLHA 4QPYA 3VHNA 3DPRB 1UZZA 1AYM1 2WQZC 1QJY2 3KCYA 5CADA 3U4XA 5EZWA 3H0OA 4GMP1 4OHWA 2XHKA 1OOPA 1H30A 2NMNA 4EN6B 1CD3G 1D4M3 4YVWC 2VUAA 4AK3A 3E5QA 4INDA 4LLOA 1OFSA 3GYDA 1MACA 5A33A 1F5FA 2JE9A 4DINB 2EXKA 4Y5Z0 1OA3A 1R081 2AYHA 2VW2A 3USSA 1MQTC 2B39A 1BEV2 4HANA 3WQ7A 3NV2A 4Q0QA 3VZNA 5KXDA 2DCZA 1VIWB 1PO23 4FVVA 2D6PA 1UKGA 4HN1A 1H1MA 4I02A 4I09A 3J8F1 1VR3A 2Q5TA 4XOGA 4AHYA 3QACA 4JGYC 4O9EA 1EPWA 2KXLA 1XE8A 3H50A 3O14A 2VVFA 3CJXA 3LZZA 4XBQA 1W6QB 1LRHA 2ZGLA 3I59B 3RNSA 2XWBB 1PIV2 2DU0A 4KQ7A 2QZ2A 4UBHA 1V9U1 1ZZ8A 1TMF2 1S0EA 5J7MA 2WFF3 1AL23 4P9YA 3JUUA 4DZGA 3SISA 1ZBA3 2AR6A 1IS6A 2CTVA 3N35A 4P14A 1QDCA 3LKJA 1KXGA 1FOD1 1RMU2 3OYWB 1U5YA 1QOOA 2IFWA 4JCKA 3U10A 4DY5A 3M70A 4Z07A 5BNNC 4XFGA 2CAUA 5DDJ3 1WW7A 3ZSMA 3IIAA 1XNKA 1Z7S2 1C1FA 1RUE1 1SMVA 5CG8A 3R4DB 2HEWF 5GLWA 2HWC3 4ZU5A 1EYBA 1ZRCA 2AH2A 2PQQA 1GR3A 2WLPA 1LTEA 1MEC3 4PDWC 3ZXFA 4MH0E 1W6MB 5DG1A 5A3LA 1U5IA 2WFF1 4IESA 5DXDA 5FAXA 5H9QA 2ARBA 2WZR3 3BTAA 4IEYA 2RS32 1POV0 2R061 3QH7A 2WSUA 4B7EA 5CNAA 3QD6A 3JQWA 1ENQA 3R6SA 3PVOA 4LO6B 4RR3B 3ZX7A 4RQPB 3V64A 4FTEA 4N9HA 3NAPB 1IGOA 1N1TA 4E9KA 3MW4A 2GC2A 3L2YA 4MGIE 3D82A 1RVF3 5C6CA 1KDKA 2VW1A 3RI8A 5BUVA 1MVQA 2R32A 4R4ZA 4W65A 3BODA 4BPZA 4BZ4A 2H6CA 1RUI1 4KG8A 3IPVB 2OIIA 4DPNA 4Y24A 2Z42A 2GN7A 4KBBA 1LHNA 1BZWA 5AVAA 4J1WA 4Q0UA 4RD7A 5GKAC 2VQAA 4YZ1A 4XDQA 1R1A1 2R063 3O7OA 3RWNA 2EAAA 2DFBA 1R1A2 2D7FA 1C8M2 1N1YA 2YUEA 3AM2A 3ZFEB 3ZXKA 5C9AC 3MIFA 4DRVA 1LGNA 1NCRC 2IC1A 2RM23 2RMU2 1G9CA 2Z5WA 4NVPA 2ZX3A 4MUVA 2E53A 4RS5C 4BLIA 1AHSA 2IXLA 2D6LX 4BA6A 1GKBA 2V5YA 1I9RA 5L7OC 2GNMA 2W68A 1TNFA 1YXWA 2RS53 3WZ1A 1NE4A 4N53B 3ZN6B 4AQ6A 4FQZA 1KFXL 1RUF3 3NWKA 4QQ2A 5I0SA 1JN2P 4JTOA 5JLVA 4CDQC 3AFKA 3LGRA 4XF1A 4QHBA 2FBEA 3B9IA 4K9SA 5KC6A 1OQEA 3E97A 2XKOA 1RUI3 4Y22A 3ZO0B 2DU1A 2DCJA 2JG8C 2GMEA 1FV2A 3DPRA 5FDBA 4EN8B 3JBG3 1Q8QA 4TSVA 5GJ6A 1WMFA 1H8VA 3ECQA 2DTYA 4X6RB 2O8QA 1OHFA 2KM2A 1AR72 4EWAA 3EQEA 4HT1T 4RHV3 5GZCA 5FOBB 4I2OA 4DS0A 3N7JA 2B46X 2NZ9A 4MVTA 1Z7S1 1LULA 3ILRA 2NMOA 1MS0A 1G9BA 3LB9A 2R1BA 1RITA 3LOIA 2PHUA 2NQYA 1H4GA 2PYTA 3AP9A 1PGSA 4AGRA 2ZZJA 4GULA 1Q56A 2WC2A 3GZUC 1KS4A 3AMHA 5JZGC 4GWNA 4XFIA 4GKXA 4COYA 5K7PA 2DCKA 1OA2A 1MS8A 4JGZC 4GH4C 4RHV2 3ZFGB 4JTNA 5T5JA 1F31A 2WZR2 2A6ZA 1CAWB 2W39A 1O3TA 4I3PA 4YM2A 4OHZA 1QQP3 3ZDSA 1UMZA 1W6OA 1HW5A 4XF9A 2DWRA 5K8SA 3RG0A 1OI6A 3S30A 5CFCA 2X53S 3AB0A 2CWMA 2VMIA 1RUG1 4GA9A 1IKQA 4IETA 3WDXA 1ZYBA 2DVAA 5FFOC 1PGL2 1XYNA 3HBZA 1LHUA 3VKFC 1BBT1 3KM5A 4CEWA 3PVEA 4FCAA 1AJOA 4R9DA 1DGRA 4YW3A 1F9KA 4CYDA 3N3HA 2ZHKA 4MZUA 4AE2A 2GMMA 4META 1JBCA 3GALA 4PQ9A 4DB5A 5BNPC 4CP2A 4IEQA 4I0WB 4AVVA 3AZYA 4YZ3A 3WDTA 3ZFEC 1R091 2WJSA 1IS5A 4YLZA 5C33A 3I2DA 4LBJA 1F5JA 1CAUB 3PHMA 1J3QA 1O3RA 4L9BA 1RUD2 3ZPYA 2RS12 4HVRA 1AXZA 2P34A 4IV3C 4S2FA 4YG3A 3WW3A 2XL9A 3VBUC 4HK8A 1J3RA 1VBB2 1TMF3 3HQXA 4LBKA 1QJX1 4PIZA 1F8VA 1HRI3 4WVMA 5I93A 5CFCB 1XNDA 1HKDA 2YGLA 1ZBA2 2ZAAA 4AEDC 5ACA1 1YHFA 1ZRRA 4HN0A 4BMEA 1S2BA 3DV8A 1MVEA 2RR13 4QM9A 4E4DX 2A3WA 5GALA 4AEMA 3FLTA 4BIOA 2ZABA 5E1RA 1D4M2 1APNA 2IXJA 3RPQA 4MGYE 1DQ0A 3NSTA 1EAH2 1N47A 3WHUA 3RQ0A 1CR7A 3WINE 1PO22 3IMNA 3ZFGC 1RUH2 3VUOA 3AJZA 2VU9A 5JWPA 4GKYA 2WNUB 1W0OA 5T5PA 4FSJA 5JR7B 3WV6A 5JZGB 3MF6A 1NA1C 1O91A 1KDMA 3UL2A 2OA2A 3W58A 2D6KA 4CDUA 1WUVA 3MW3A 2CV6A 2CY6A 1OLQA 2ZMNA 4H14A 4Q0SA 3MIBA 2UURA 2EIGA 5F6LB 2RS31 1C5HA 1S0CA 1AR92 4JDMA 1KS5A 1WCKA 1EAH3 1AL21 3GZTB