2WZ8A

Family 35 carbohydrate binding module from clostridium thermocellum
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
142
structure length
135
Chain Sequence
TINVYEAEDPANTLGGAAVRQRDNAASGGQYVGWIGNGSNNYLQFNNVYVPQAGTYRMVVQFANAEVFNVVDRYCSISVNGGPEKGHYFFNTRGWNTYRTDIIDVYLNAGNNTIRFYNGTSGSYAPNIDKIAIAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CELLULOSOME PROTEIN DOCKERIN TYPE I
publication title Signature Active Site Architectures Illuminate the Molecular Basis for Ligand Specificity in Family 35 Carbohydrate Binding Module .
pubmed doi rcsb
source organism Clostridium thermocellum
molecule tags Sugar binding protein
total genus 32
structure length 135
sequence length 142
ec nomenclature
pdb deposition date 2009-11-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2wz8A00
3VDAA 1UY4A 4MADA 3IDAA 3WF2A 3K4ZA 1WKYA 1O59A 1OT5A 4ZY9A 3NJVA 1CZVA 3ACIA 5B4NA 1HN1A 2W95A 2B4KA 3T08A 2Y6LA 2VQUA 4ET7A 1GOFA 3HNYM 1UYYA 2YB7A 4QAWA 2Y6KA 3WF4A 1K12A 2WO2A 4QDRA 4A42A 4YPJA 3WNPA 3LEKA 1CZSA 1P8JA 3T0DA 4OMCA 3T2PA 1JZ6A 2VZRA 2HLEA 2VQTA 5LA1A 3LPFA 3I97A 2ID4A 3A21A 4JKKA 3PUIA 1NX9A 4CU7A 2VJXA 2VL4A 1IQDC 1W9SA 3GGLA 4QB2A 2W46A 4AAXA 3U37A 2ORZA 4RN5A 2E33A 3MV11 1GOHA 2JDAA 4DEVA 3MBWA 2WYSA 5JXGA 3SEPA 4KI5M 2WAAA 4LHSA 1GNYA 2XQXA 3IAQA 3ACHA 3D3AA 3NJXA 4P02B 2J1EA 5JR2A 1NAEA 2JE8A 5DPNA 1JZ7A 2VC9A 2J1VA 2J1RA 1R64A 1ULOA 1XNTA 3T0AA 4M4PA 3VDCA 3W5NA 4BXSV 1YQ2A 3F2ZA 4JX0A 3OGRA 2W91A 1XC6A 3EYPA 4XUNA 5CZKA 3SEEA 3WNNA 5EIYB 4JKMA 1UMIA 1GOGA 1UX7A 1L7QA 3C7FA 4PT6A 2BGPA 1PX3A 2J1TA 2BBAA 5J1XA 4XZUG 3P1IA 4MO3M 4QX0A 1PX4A 4FI9A 1W0NA 3MUY1 2WO1A 1XPWA 5HPOA 3CZJA 3UNPA 2X10A 4DEQA 3UETA 2EIBA 3ZM8A 4W4ZA 5DN2A 3THDA 2WBKA 4A6OA 4UOJA 1UZ0A 3OGSA 4Z2AA 4XVHA 4LKSA 5IJRA 3MO4A 2WN2A 3LPGA 3IAPA 1DP0A 2QQOA 4GZ9A 1O8PA 5LA2A 3OGVA 1KEXA 3THCA 4CU8A 4QDSA 2VCBA 5JUVA 4CUAA 1UY2A 2VZUA 2PQSA 3C8XA 1UY1A 4CUCA 4CU6A 5A1AA 1DLCA 3K75B 5JXJA 3NRUA 4DXTA 5IFPA 2X05A 2DCJA 5EJZB 2Y6GA 1CX1A 4DXRA 1OF3A 2R7EB 3OG2A 1BHGA 3NQHA 2W1QA 4BJ0A 2YG0A 1UYZA 4E8DA 2B9VA 5JXHA 3K4AA 3K46A 1SG3A 2V72A 2ZEXA 4QDQA 2QQNA 5B4XA 3CZUA 1W9WA 3WEZA 2Y6HA 4ARXA 3ACGA 4XUOA 4A45A 3JXSA 1GUIA 4QPWA 5IHRA 1D7PM 2W1SA 2Y8KA 5I0DA 3I2HA 5HXMA 3LE0A 4OUEA 3HEIA 5LA0A 3E1F1 2RV9A 1SHWB 3IIIA 4IUGA 2VZOA 5JMOA 4BK4A 2VZSA 3IB3A 4JHZA 3WNMA 3WF1A 3VD9A 1JZ4A 5C7GA 3C7EA 1CIYA 2J22A 1W9TA 2JD9A 3ECQA 4ZZ8A 4P08A 3A7QA 3I3BA 1UY0A 1PMJX 2J1SA 3VD7A 3MV01 1RYYA 5G05L 4XUTA 2W3JA 2VTFA 2ZEWA 2QQMA 3FHQA 1I5PA 1CZTA 3I2IA 3W5MA 2W92A 2V5DA 2YFZA 2WO3A 2WQ8A 3I2KA 2VZQA 4QX1A 1JU3A 1OD3A 3LQCA 4A44A 2JKXA 2XHNA 1K45A 1K3IA 3HOBA 3T0BA 1JHJA 1L7RA 2OKXA 4DXSA 2ZXQA 1WCQA 2L9LA 3EB7A 2VCAA 4BK5A 2EICA 2LS6A 3I2FA 3A23A 4W8JA 3WSOA 1JZ5A 4ZZ5A 2Y64A 4DUXA 4DUVA 2RJ2A 3CIHA 2KD7A 3BN6A 3P6BA 2WABA 3DECA 4MGQA 2WUHA 3FHAA 3VD3A 2LW8A 2VZTA 5IFTA 3J7HA 1H6YA 4UI9L 4DUWA 4OYUA 2ZEZA 4D0QA 2XONA 4ARYA 1F4AA 3ETPA 4PF1A 3CQOA 2BZDA 2E32A 4M4RA 1GU3A 2VZ1A 2QQLA 3T2QA 4LQRA 1JZ8A 2QQKA 3C7OA 3NNGA 2RVAA 5CYYA 2ORXA 1H6XA 2WAOA 1JYVA 2W1WA 2CDOA 3WNKA 1JZ3A 5DMYA 1UMHA 4KWUA 1W8OA 2ZEYA 5DQ0A 2VZVA 3DYPA 1ULPA 1DYOA 4D8MA 2VZ3A 1JYNA 1JZ2A 3OB8A 5C71A 4BDVB 2CDPA 2XOMA 4OZOA 4GWIA 4HG6B 2C4XA 1KGYA 1JU4A 1JYWA 4RYDA 3SKJE 4CUBA 3LEIA 1MPXA 5FUIA 3WF0A 3A22A 4ZXEA 2DDUA 4GWJA 3WNLA 1UWWA 3BGAA 2V4VA 3K4DA 5EJ1B 3C7HA 4XUQA 5F7UA 1NKGA 4A41A 2W5FA 2WN3A 5IYYA 2EIEA 2W47A 1TG7A 1JYXA 4MGSA 4JKLA 1SDDB 3DYOA 3C7GA 2WZEA 2YFUA 3PUHA 1OH4A 4QX2A 1TVGA 4UAPA 2VCCA 4QX3A 1UXZA 2QBXA 2YC4A 3WQBA 2BERA 3I2GA 1W99A 3MUZ1 1F4HA 3CKHA 2BGOA 1US3A 3FN9A 3HN3A 3VD4A 2VM9A 3T09A 2VMFA 2J1UA 1US2A 4CU9A 1EUTA 3OEAA 2W1UA 1J84A 3WF3A 1K42A 1J83A 1UYXA 3I3DA 4A3ZA 4P00B 3GM8A 4A4AA 1UXXX 4XURA 2HYXA 3GDBA 3T2OA 4L0PA 3VDBA 1OF4A 3I3EA 1LNSA 4QB6A 2Z4FA 3DYMA 2VMEA 3CMGA 4TXWA 1XNAA 2E31A 1GMMA 2Y6JA 3UESA 1T2XA 4CVUA 3HNMA 4KMQA 2VZPA 4XUPA 4TTGA 1GQPA 2DCKA 2EIDA 3WNOA 1NUKA 2QQJA 4W50A 2C9KA 2W94A 2J7MA 3I2JA 4AG4A 2VMCA 4OMDA 3ACFA 4P5YA 1O8SA 2E26A 2WDBA 2VR4A 3K77A 3GXUA 2QQIA 4PQQA 1JI6A 5G04L 3ABZA 1EUUA 2YC2A 3OBAA 1PMHX 2WZ8A 2VO5A 3FL7A 3HJRA 2W9XA 3OEBA 5JXIA 3AC0A 2J1AA 4MOAA 2VOTA 5C70A 2VMDA 1UY3A 5LCWL 4LPLA 2W87A 2C26A 3HNBM 4QB1A 3SKVA 3LEGA 4E8CA 3CDZB 3HPNA 2X09A 1W8NA 3VD5A
chains in the Genus database with same CATH superfamily
1MVQA 3RMYA 2RG4A 4CCMA 3TYJA 4FAHA 4MADA 3K4ZA 4LIVA 3BTAA 1K5JA 1L3JA 5EP9A 1OT5A 4MG2A 5FZBA 5I8YA 2V5YA 3VBHB 4GB31 3J9SA 2AH2A 5A7SA 2Y33A 4EN6B 5B4NA 2W95A 1SPPA 5CFDA 1PO13 4O65A 1WBLA 4IEVA 2NLRA 3I8TA 2Y0IA 1GFF2 1GOFA 3MLKA 5FO9B 4C1XA 3KQRA 2B46X 4UW5A 2Y6KA 3WF4A 1K12A 2DVFA 2ZACA 2YGLA 4LO5B 3KT4A 1UPIA 3WW4A 2E7QA 3AVSA 4Z82A 5FK8A 4A42A 4IV1B 4YPJA 3WNPA 4BQ4A 3BUCA 2P5BA 1RXFA 3GZTB 3LCPA 1CZSA 5LASA 2GNTA 3O7OA 3VBFB 4LBQD 1WW7A 5DAQA 2ZMNA 5LA1A 4PF5A 3LPFA 1BJQA 3I97A 4P9GA 3B94A 3N9NA 2ZX3A 3I2DA 3E6CC 1VBB1 3Q8EA 1QQP2 1XU1A 4B29A 5FXXA 4K6BA 1C3HA 1GZTA 2VW1A 4PI2A 1UPSA 4AQ2A 4EQVA 2NZ9A 3Q8BA 2ZAHA 2ZTNA 4BA6A 1W9SA 4AQ6A 5FOBB 3GGLA 3LDKA 2BWAA 3ILRA 1XOYA 3CO2A 4QB2A 1N3QA 3B69A 4BLJA 3U37A 4CCOA 2RJKA 2E33A 2FDJA 2VBDA 1RUH3 2A3XA 4ZU4A 5FYTA 1AX1A 4EN9B 1WWYA 3LIGA 1W06A 2VD7A 1WMXA 4DEVA 4UFIA 4XIOA 1IG3A 3MBWA 4QQ2A 5JXGA 3SH4A 4OZXA 2VUAA 2WAAA 4LHSA 3RS6A 3SEPA 1S2KA 4K8RB 3NJXA 4CCCA 3LA7A 5C9AC 3ZO0B 2J1VA 2JDPA 2J1RA 1R64A 3J26N 2ZHLA 1XNTA 4M4PA 4PQ9A 4OLLA 1PK6A 2XJTA 5ERLA 1GICA 1G9AA 4HZFA 4BXSV 1WCUA 3CL1A 4JX0A 5FY0A 5L9VA 5EIYB 1XC6A 3EYPA 2YPJA 4EWEA 5L7OB 1PZ7A 1ASJ1 3DPRB 5FZOB 1UMIA 2P3YA 1CAWB 3POJA 1WMFA 1MEC3 2CU5A 2BGPA 2R32A 1R1A1 4A6SA 3LAGA 1LTEA 4AE2A 3DV8A 4MLOA 1IPSA 1UMZA 1OLQA 3HQUA 4ISRA 2PHTA 4LEJA 4CDWA 2P3KA 1PX4A 2R042 1AYN3 2RMU3 1FI2A 2W08A 3MW2A 1WUVA 3MUY1 4HVOA 5GLTA 1KITA 5FXZA 1HXS3 5AC93 3OUJA 2ZBJA 3CBNA 2VW2A 4LK6A 1YQCA 5C3SA 1PZ9A 4AFBA 2ZGNA 5F8PA 3U4XA 4BPZA 1QIQA 1XYNA 2ENRA 2RE9A 4W4ZA 5BNOA 2G1MA 5FPXA 4KGQA 4UOJA 4JQRA 1ACCA 2CYFA 4BXFA 4XTPA 2AUYA 2PAEA 1YYNA 1MS1A 1AR62 1QJEA 4JZRA 3U78A 1DYKA 3MO4A 1OSGA 2WN2A 2BJSA 3POEA 4IESA 1GV9A 3NWKA 1RUD2 1UOFA 4XDPA 1XYPA 4CDQA 2WS93 3UKVA 3CJXA 2HEWF 4L97A 2RS13 3O12A 5BYNA 4HSLA 1EV12 1U5YA 1GZWB 2JDNA 4K21A 3ME2A 1VAKA 3OGVA 2C9AA 1HIXA 1FAYA 2XL7A 5BNNA 1H8TC 4QDSA 2VCBA 5JUVA 3LWCA 1SDWA 3MYXA 3R6SA 1X33A 1JUIA 2VZUA 3BODA 3BPSA 3PURA 4L11A 5JVVA 4AAPA 4Y4RA 4XHBA 4P9LA 4AEKA 1FV3A 3WDWA 5JXJA 1OMIA 4CU6A 5A1AA 3IKWA 4LBLA 1AL22 3NRUA 1ODMA 1AR72 2X05A 3OJBA 2VVFA 3GBWA 1MZEA 3OBRA 2WWSA 4W65A 1J59A 2DVGA 2R7EB 3NW4A 3OG2A 2EA7A 4A3XA 5BNPA 1STMA 5CB7A 3VBSA 4MGYE 2ET1A 4GWMA 4LK7A 1AR83 3OBTA 1W6MB 1F31A 5FIXA 4CCDA 1FYUA 1LGBA 3GCWA 4RR3C 5C8CC 4YVWB 4E8DA 5FYBA 3N7LA 1RMU1 2E9QA 4IGQA 4TZDA 4INDA 1FMD3 2WNUC 5IVBA 4HKWA 4NOTA 2AGSA 4DB5A 3KCCA 1W9FA 2EIGA 1S0DA 5B4XA 4LBOA 2XVLA 3E5XA 4BWOA 1W9WA 2JD4A 4KGGA 3OPZA 1YFUA 5LW9A 3Q8CA 1DZTA 4ARXA 5IK5A 4MGKE 1DGRA 1Z0HA 2F17A 4XUOA 5EWSA 4NVPA 5EZWA 4A45A 1Q8QA 3U11A 2GC3A 3N7KA 1VBC1 5FZFA 2PHDA 2Q1ZB 5I0DA 2UYAA 4ORFA 4XJ9A 5IK4A 3I2HA 4ZU7A 4EN0A 4Y1UA 3HEIA 5E1RA 4CPBD 4HMZA 4XXPA 3VDDB 1DHKB 1W90A 3IIIA 4IUGA 3POSA 1VRH1 3U4SA 5F9TA 3SC7X 1Z7S1 2ARCA 4RQPB 5FMBA 2VZSA 2R0FA 3AZZA 3C2UA 2WFF2 4JHZA 1AR91 3WNMA 4Z8BA 1ENQA 2KM2A 1BBT3 3T4VA 4MGTA 4K1ZA 5C7GA 3HT2A 1XU2A 4Z2WA 2J22A 4TLGA 4UF0B 1W9TA 4OI4A 4BMEA 1PO23 1CIWA 3UYJA 3V64A 2V73A 1PMJX 1RJ7A 2LM3A 2J1SA 3VD7A 3MV01 1I6XA 2E63A 1YI7A 2W3JA 3KSCA 3RJ2X 3N9OA 1QQP1 1QOSA 2OPKA 3AKTA 3J8F2 4YG0A 5T5JA 4IV3C 3VHPA 3WDYA 1J1LA 1WLDA 1XB9A 3JD72 3SCFA 2YV8A 3TAYA 1H8VA 5HCFA 1SPPB 2UURA 5CAZA 3BOWA 5FBJA 1G9DA 1Y9MA 4Q4Y2 2UY9A 2WQ8A 3DEMA 2XVGA 4E2SA 2YDEA 1IS3A 3VZOA 4XPVA 1K3IA 1MS9A 2WZR2 4HL0A 3SXWA 4Z07A 1GQHA 2AYHA 3AL5A 4OUSA 3I54A 4CDXC 1AL0G 4NAMA 1Q8VA 1HB4A 2Y26A 5LK5A 3IT8A 3M3IA 1IS6A 2JEMA 4BK5A 3I2FA 1IQAA 2WSUA 3PDQA 3WSOA 1RUI3 1O3RA 1DQ1A 5FBZA 1H4HA 1KQRA 3A4UA 1JYCA 2PA7A 2Q1FA 1RHI3 5IVYA 2ZKNA 2AACA 2RM21 1SCSA 3CIHA 2GMMA 2UY8A 1RUF3 3BN6A 3FC0A 4HBNA 4BQWA 4MXVA 3P6BA 2HWF3 2WABA 4IEZA 2Q5TA 1KJLA 1OOPC 4DY5A 1DIWA 1NYWA 4XF1A 4B4RA 2VZTA 4IW3A 4Q4W3 5FZMA 1UCXA 4C1WA 2FDIA 5IFTA 3M2MA 4XFGA 4CDUC 2Q8OA 4HETA 1JXNA 1YUDA 2GN7A 5CEHA 4JVAA 1LEMA 2EXIA 3U75A 4Q4X3 1O4ZA 4RFRB 2GNMA 4V1PA 4NR1A 3HD8B 2H6CA 3PIGA 3ETPA 3H42B 2Q8DA 3CHXA 2BZDA 3ZMNA 4M4RA 2WINB 3WT3A 3AP4A 4XBNA 4AI2A 5GKAC 1LB2A 4IV1C 4GH4A 4META 2RR11 4XW3A 3E5QA 2QQKA 2YUEA 4H7LA 2HEYF 5FPUA 2QUOA 1QOOA 4ASKA 1QJFA 3AB0A 3AMQA 2E7TA 2ORXA 3ZLIA 4LBQA 5E8AA 3L2HA 1H9PA 1PO12 1RUNA 1GNZA 1GWKA 1R093 1UW8A 2VTXA 2OX0A 2YYOA 4NROA 2YHJA 4Q2FA 5IUQA 3W20A 4FTBA 1N3OA 4OVEA 4PDWA 4CDWB 2K9ZA 1UMHA 2PAMA 4QXKA 5A70A 1QJX3 4CEWA 5KHIA 3O1VA 1X82A 5KHGA 4BQ2A 5CIRA 1ZBE3 2QZ2A 3EBRA 4KG0A 4LULA 1W39A 2EXJA 4CTEA 4JDOA 1M4WA 4R4ZA 1YFXA 1YJLA 2OUHA 3A0NA 3L9JT 3M3OA 3VZLA 4AHZA 1XBFA 2XOMA 2YBPA 1ZX5A 3ZOIA 4GWIA 1RUOA 1UYPA 5KWRA 1GQGA 2C4XA 2MEV3 2XGXA 2CY6A 5BNOB 3DF0A 3AJYA 4NPRA 5CNAA 1AR71 3FFZA 4RYDA 4IGPA 2IFWA 5DUWA 3SKJE 4CUBA 2FDHA 2HH9A 1SBEA 3PVNA 5IK8A 3MF6A 4Q29A 4QHOA 5EV7A 1LOEA 3OPTA 3S30A 5K0UA 4CDQB 3BGAA 3MICA 3K4DA 5CU1A 3RNSA 5EJ1B 3S7IA 5J7MA 5KC6A 3BTXA 5HI0A 4OI1A 5F7UA 1LU2A 2QQUA 2ZMKA 5F39A 2YY1A 1JOBA 2HJIA 5A3TA 1JYXA 2FCUA 2XJSA 5C33A 3POIA 5IYYA 2W47A 3AYAA 3FHIB 5GLVA 4BB3A 3AMHA 1YQ8A 2VXJA 4BQXA 2O8OA 5I8TA 1SDDB 3DYOA 2IVJA 5IK7A 1OH4A 2IZWA 2O1QA 4FOYA 2DTYA 1HV1A 1YCIA 5EYXA 4DZGA 2FD8A 3AP7A 3SITA 1ALYA 1LJ7A 2BERA 2CNAA 1W04A 3AYEA 4KU7A 2VW0A 2JENA 3ZYPA 1PNGA 5KXEA 1KJRA 2D6OX 2WNVC 1AYM3 3V65A 3ZXAC 4CSWA 5JI9A 5BNPB 4OQ9A 3VBSB 2R6QA 3B7MA 2VM9A 2ZHNA 2GMEA 2BFUL 5CFCC 2WT0A 2XDVA 5FJKA 1VBD3 2RMU2 1AYN2 1MS3A 2WNOA 4RS5C 2XLAA 3AP9A 4RD7A 1W2UA 1HXS2 5AC92 3I3DA 2BNMA 1NCQA 3DL3A 3FFQA 3VKLA 4A3ZA 4P00B 2ZOEB 4H3WA 5CBLA 4X6RB 3OUHA 4H2AA 3N36A 4H7MA 2MPFA 4XURA 4AEDA 3GDBA 3R4SA 4Y22A 4YM1A 3T2OA 3OSDA 4FP3A 4CDXA 2BP6A 2HWE1 1QH7A 3I3EA 1LNSA 4XJWA 5D21A 2AEZA 5D8AA 2Z4FA 3J8F1 2DBIA 2JIGA 1T6BX 2ZPXA 4SLIA 1GMMA 3UESA 1T2XA 3AVRA 5FAXA 4B7EA 1WA6X 1D4M2 1XNKA 1POV3 2WS92 4AFCA 4FCAA 4XUPA 4Y20B 4TTGA 4XYXA 4QHBA 2DCKA 3Q9OA 1VMHA 2RS12 2P1BA 4LHNA 2OVUA 2Q8CA 5LBEA 1QXRA 1HRV1 2W94A 2CHHA 2J7MA 3I2JA 2NP0A 3ZN5A 3AJZA 4HK9A 2WT1A 3N3HA 4K3UA 4HFSA 2PMWB 1O8SA 3KCYA 3QLQA 4GIQA 2VR4A 2XUEA 3JB8A 5T55A 4HONA 4UBGA 5DG2A 4N9HA 1WA4A 3GZAA 2AC1A 2OQ7A 2QQIA 3NKTA 5A6ZA 2BV4A 4PQQA 4IE4A 3MLJA 1NA1A 3WDTA 2QJVA 1D0HA 1ENSA 2UU8A 5DUXA 2DUQA 5FZ8A 1Q43A 1W6PA 3N7JA 1BVP1 3OBAA 2DCZA 5FZCA 2WZ8A 2R1DA 2AR6A 4QGLA 1O4YA 4LHKA 1LGNA 4YW6A 3AC0A 2A75A 4FFIA 2RHPA 1AR82 1D0GA 3MPPG 2A3YA 4W6XA 3RI8A 5BUVA 1HRI3 5EQUA 2D6PA 3VZMA 2GSYA 3H1YA 1FPN3 3KB5A 4LPLA 3WR0A 1OBNA 2ZGKA 2WFPA 4IE5A 2ET7A 4G4FA 4XHXA 1QJU3 3WZ1A 3MW3A 5ABJA 3RSJA 3CJIA 4HT1T 4B4QA 4OI0A 1JODA 3VD5A 4RQPC 4Y3OA 2A6XA 5L9BA 1IHMA 3SHRA 1WKYA 2ZGLA 3K2OA 3H9AA 1REEA 3MEPA 3OTFA 4ZY9A 5FPAA 5BXXA 4B4PA 5CISA 1CZVA 1AX2A 1APNA 2O14A 2JKBA 4ZPIA 1X8MA 1UOBA 4DOUA 1FX5A 3HIFA 4LBKA 5DAVA 2PAKA 4CCKA 3MDPA 5LA9A 4ET7A 1AJOA 2P2KA 3HNYM 4LO6B 3VBUA 4FAGA 4JRLA 4C0BA 2XMLA 3O1RA 5A6XA 3VBRB 4O9EA 4DFSA 2IXHA 4QDRA 1GP4A 1SMVA 3SQOA 3WDUA 4IERA 4BK4A 5IVVA 1POV0 3ZSJA 1BBT2 3BIWE 4NWVA 4D6SA 1ZNPA 4N53C 4LMFA 5EJ3A 2VPVA 4FOWA 1NCRA 1P8JA 4ZKTB 3T0DA 2Y6FA 3WCSA 3MIFA 1PO22 2R061 2WA3A 3NJYA 4OMCA 2B5HA 2D3RA 4WM7B 5L19A 3S57A 1H9WA 2X5IA 5FP4A 2E53A 2VNGA 3I3QA 4WM8A 2D5HA 3SCHA 5KHJA 1W0OA 2PLV2 1K5MA 5ACA1 4JKKA 1LECA 2ZS6B 4S2GA 2G9ZA 3FE5A 1W8TA 4NUBA 4URAA 1NX9A 1RVF3 3O1OA 4CU7A 2VJXA 5HBAA 4MXWB 4GH4B 1XQNA 3AX4A 2RS33 3NL1A 2GZWA 2UWCA 3MIEA 4AXOA 1W03A 5K7PA 1JHNA 1X8EA 2W46A 1G9CA 2XJVA 3JBG1 4LBQB 3CEWA 4F7ZA 3ZR6A 1PGSA 3NV2A 1VBA3 3GBFA 3H8UA 3KD4A 3R05A 5A3LA 3VKMA 2JDAA 4PDWB 1RUC3 1GP6A 4A7ZA 4GKXA 3VBOB 2XUMA 1WLTA 4AVCA 2ZA9A 4XAEA 1OUXA 5LEKA 2PHUA 3IAQA 2YC0A 2VBBA 4CEWB 2BPA2 2J1EA 1NAEA 1TMF3 4LLFA 1ND2C 4NHXA 4Q0QA 4D3WA 1QXJA 1ULOA 2HEVF 1W2TA 4H55A 1RUI2 2QNKA 2Y34A 1WCKA 2W91A 3WNNA 3SEEA 2K46A 3IPVA 4GA9A 3LD8A 1H0BA 3H3UA 4JKMA 5FZ0A 1RHI2 4HOOA 1L7QA 1XXNA 5HCHA 4PT6A 2JJ6A 4IE6A 2J1TA 1ZRDA 3WDVA 5IATA 2KXLA 1RUF2 3P1IA 4MO3M 4QX0A 4CE8A 4RL7A 2HWF2 2VULA 2VUCA 4FT8A 2JECA 3UL2A 3WP5A 3N9LA 4DMIA 2HWC3 2TBVA 2BYVE 4Q4W2 3QH7A 2D3SA 4RHV3 5DDJ3 3ETQA 3B9IA 5AC91 1XPWA 4PBOA 5FZLA 1AUYA 1BEV1 1SFNA 3CZJA 4L99A 1X36A 4NRQA 4Q4X2 1SLBA 3TN93 1ZBA3 1V9U1 5SV5A 2EIBA 4Y1XA 1NLSA 4CRQA 3THDA 2WBKA 2XJUA 4A6OA 4XJZA 3DUIA 2GH2A 3ZMOA 5IJRA 3BTZA 1HKDA 4KBZA 3LPGA 4NIAA 2DCYA 4QPGA 4BYYA 2HWD1 4Q4V3 4BISA 1QNWA 1IGOA 3D8CA 3E5UA 3IAPA 3MGUA 4N90A 1UN1A 4XF9A 4DXZA 1Q3EA 1A3KA 1D4M1 3F95A 3PLQA 5C8CA 4AHYA 3DCQA 3JQWA 2R073 4QU1A 3GBGA 1FNYA 3SCGA 4EROA 5B2GB 1KEXA 1N3PA 4NAOA 1FOD3 4NIIA 2QDRA 4IEPA 4D6QA 2JICA 5I8SA 1RB8G 4YLZA 5FJHA 2W0XA 1NCQB 2PQSA 3TEXA 3C8XA 3TNPB 1UY1A 4CUCA 3EJKA 1X9TA 4AEDB 2A70A 4Y22B 4CP0A 5FZ4A 4AL9A 2MEV2 1CESA 4QQHA 3X29B 4DXTA 5IFPA 1KS5A 1W6NA 2RDRA 4W6WA 1V6LA 3I3MA 4JV4A 3FLTA 4M01A 4P5HA 1BHGA 4NPMA 5JZGA 1W05A 1BLZA 1GWLA 2XL9A 4BJ0A 5LZ6A 1ZRRA 2JG9A 2W68A 2ZJCA 1H2NA 4URTA 1H1AA 1AR81 2D44A 4COVA 4ZU5A 1HLCA 4HVRA 5FR3A 5JOZA 1PVC3 1SG3A 5FPVA 4LXLA 1GR3A 1Q8SA 1F8VA 4TSVA 2QZ3A 4OUMA 4LUMA 1RUJ3 4R9BA 1OLMA 3SH3A 4GMP1 3NJZA 1ZRIA 3ZXKA 1ZZ6A 4FOVA 4YARA 3S0MA 3WOGA 3N4MA 3H8RA 1MQTB 3M3QA 3ACGA 4G9SB 4B3NA 1UU4A 3SNMA 1BKZA 4PLNA 4QPWA 5IHRA 1W0PA 4AGRA 3ROUA 2W1SA 4FQZA 4R9AA 4NIHA 5HXMA 4LR4A 3RZLA 1NA1B 1EAH3 5LK7B 1I1EA 4QX8A 1NLQA 5LA0A 1W6PB 4YVSA 1BCXA 4IEXA 2F4PA 3ZYIB 1JTZX 1OURA 2JG8A 3MPBA 2WQ4A 2FQPA 5T5OA 2VZOA 3KGLA 5FZDA 3SMHA 2XXZA 2ZABA 5FY7A 3T3YA 4FBFA 5FZEA 4FXKB 3IB3A 5HV4A 5JIUA 1LRHA 3VD9A 1OLRA 4Y26A 4COYA 1VBD2 1JZ4A 2SLIA 4R8HA 1NY71 1LOGA 2ZZQA 1E5SA 5FLHA 3ECQA 1LULA 4FXGB 5C4WA 4P08A 2OS2A 2ZGSA 1PO21 1W8HA 1MR5A 1U5IA 2XJPA 5ABJB 1QF3A 1UY0A 3CJIB 2BOJA 4JQTA 3AKQA 4CP1A 1PGL1 4AHXA 1RYYA 4YRDA 4K7JA 3QH6A 5G05L 4YG6A 2NMNA 3N35A 3AP6A 5AFBA 1BXHA 2PLV1 1O4TA 3C3VA 1DDLA 1ND3C 1YRZA 3WD5A 1OPOA 3QOPA 1C8NA 4IDZA 4XCAA 3QD6A 3ZFEC 5D1IA 2W92A 3MFCA 3EMRA 4CP9A 1NOVA 2WL1A 3NAPB 5KHKA 4QM8A 1UO9A 2XBO3 2VZQA 4CEYB 3WP3A 2DTWA 3GCXA 3LEMA 3VBUB 4A44A 3ZPOA 1DQ0A 2XHNA 4FQ4A 4AVSA 3HOBA 5FCCA 2OKXA 2A6WA 1HQNA 2D98A 2KA3A 1COV1 4L92A 5FTTC 3U0ZA 2L9LA 3EB7A 5F3EA 3ZFGB 3VLBB 5C3OA 1SFPA 1JOPA 2OZJA 3A23A 3ZYJB 4YZ2A 1NCRB 1KXGA 5KXCA 3EHKA 3OOXA 2BNNA 2A6VA 4BMBA 4YZ1A 3U07A 5CKQA 1RUI1 5K8SA 4GALA 4JGYC 1WLCA 4WZCA 4DUXA 1GSLA 1GBGA 1XNCA 1YQ6A 4P9JA 2QQVA 5C6CA 3O0XA 1YIPA 4KU8A 4AQSA 3FUOA 2KD7A 4Y1ZA 1MS0A 1ZA7A 3DECA 4MGQA 5IVFA 1OA4A 2WUHA 4C90A 1G6NA 1YFYA 1LOFC 4YM3A 4XFAA 1LOCA 1SLLA 1VAMA 2N7GA 2B45X 2WA4A 1LCLA 3RJRA 3TEZA 5A7WB 4XDOA 4LOTA 4D0QA 4ZXKA 2F6BA 1FPN2 2XONA 1URXA 2VCMA 1QMJA 3THTA 5FZIA 3WNXA 1UZZA 4FP2A 4C91A 1YJKA 4PF1A 2E51A 2NYYA 3CQOA 4ASMB 2XHKA 1X7NA 3VBRC 3VL9A 2A71A 3UJOA 5FO8B 1G9BA 1F5JA 3I59A 1EYBA 2VZ1A 2JB8A 3TRSB 3D0JA 4LQRA 2XKOA 2AENA 2IXCA 4NN0A 1JZ8A 2PXJA 2A5ZA 4JGZC 3VHRA 2PHWA 4NWWA 2FZ2A 2RVAA 5CYYA 1B35C 4WM7C 3IBMA 5LB6A 2VNOA 1RC6A 3B00A 3KGZA 2CWMA 4NO4A 3WX5A 5FY1A 3ZR5A 3HWJA 5C3PA 1OQ1A 2CDOA 5DG1A 4LORA 4O61A 3W9AA 4CCLA 1PIV3 1WD3A 1R083 3POBA 1IS5A 3IM0A 1V6OA 4M3CA 1MZFA 3B02A 5A7PA 1JN2P 2VUJA 4QPIB 3V0BA 2DV9A 2A6ZA 2Y60A 1CWPA 4K9SA 1U5XA 1DYOA 1ULPA 3BALA 4WZFA 2VZ3A 1HN0A 5A7NA 3V56A 3UT0A 4D8MA 2VVDA 3OB8A 4CXXA 2CDPA 3ACLA 4GB33 4O7XA 3VDDC 3MZHA 4EJRA 4N43B 3VBOC 5FYUA 5FY5A 2ZGQA 2MEV1 1JYWA 1W9YA 3HR9A 1YLLA 3O14A 1ZZ9A 3OYWA 4J25A 3LEIA 4KBBA 2OA2A 5JIAA 1SZBA 5LRRA 5FUIA 2FDKA 1GP5A 1RVF2 2JE9A 5FKCA 4ZXEA 3SISA 4QPGB 1FNZA 1QGLA 1YO8A 3WG1A 3WNLA 2RS32 5DABA 3LFIA 4XUQA 1CAXB 5FDBA 5A3MA 2W5FA 5I0SA 5TSWA 3KHBA 4XC9A 4Y1VA 3ZIXA 4HK8A 3PMSA 5I91A 4MGSA 5C3QA 1CPMA 1QJZA 1HJFA 4LE3A 1VBB3 5EYYA 5T5LA 4QMAA 1V6NA 1D2SA 2XJQA 1LHVA 2WO7A 4YW1A 4QX3A 4XQWA 3V0AA 1ZREA 3WHTA 5I0RA 2R0HA 2YBKA 3WQBA 2BTVC 2QDNA 3I2GA 4HKOA 5GZFA 5FYMA 3VZKA 2VTXJ 4M00A 4S2DA 3KZ4C 2EF6A 2BGOA 3TEWA 4QXBA 1PVXA 3HN3A 2QKDA 2FBEA 5JZGB 3RZJA 1HJGA 1J58A 3H1MA 5CFDB 2JG9B 5DAWA 2CGNA 1RUE3 3LDRA 3AKSA 4YSFA 4CU9A 2B7YA 1VBE3 3OEAA 3O1PA 2CAVA 1UKRA 5H9PA 1J84A 1HQLA 1RGSA 2HWC2 1VBD1 1UU5A 4W6YA 3J7NA 3OY8A 4RHV2 3WF3A 4E9KA 3FLRA 2ZAAA 2D6MA 5DDJ2 4XFFA 4YGEA 1WMEA 2D7FA 3GM8A 4ES9A 4YW4A 4OHWA 4XCBA 2D40A 2HYXA 1ZBA2 2YU1A 3E6BA 4QKFA 1ASJ3 4Y33A 3KVAA 4QB6A 4XQ4A 4EE2A 3ZFFC 1BYHA 1ZZ8A 3TOJA 3LA2A 1JBCA 1R1A3 2EAAA 3CMGA 4LKFA 1H2MA 3T4HB 1OUSA 1XNAA 2C1FA 3NNJA 4Q26A 4UYBA 1S1AA 3K48A 1N47A 2HKXA 2QQWA 4KMQA 4V2WA 4YVSB 2OXBA 5FREA 2R30A 4HLTA 4KWLA 4QKNA 3KHCA 2P6HA 2JG8B 1POV1 2BUKA 2DVBA 2EIDA 2W2IA 4OQ8A 4DNYA 2R072 4MV2A 1OA3A 2R041 3OBZA 3VBHC 1IPJA 4Z92B 3A0KA 4AG4A 3ZVXA 1H1IA 1MZ5A 1UQXA 4OMDA 3ACFA 4BHPA 3ZXDA 4PIXA 1C5IA 2SBAA 1ZA4A 3AMMA 4Q0SA 3K77A 3W21A 2FHRA 3WW3A 4UW6A 1DG6A 2B9UA 3RZGA 1VP6A 4YW3A 1S0GA 4Y5Z0 3PTRB 1YHFA 1H8TA 1JI6A 1NZIA 2A73B 2ZHMA 3BVCA 5G04L 4TLFA 4XJAA 1AR61 1PK6B 4IEOA 2X29A 4BU2A 2VO5A 1H30A 2YROA 1DGWA 3HJRA 3OEBA 1MQTC 1RUD1 2OQ6A 2WJSA 3VBFC 5JXIA 3S5AA 2WWJA 3KV6A 5BV6A 4IEYA 3RFRA 1WZXA 4OCTA 2VOTA 5A6QA 4R52A 2DWRA 3ES4A 1B35A 4BQ1A 3KS7A 1EV11 1PVC2 5A32A 4D94A 4QM9A 4CCNA 4QQLA 1FPN1 2LRPA 1D2QA 1RUJ2 4Q0VA 3LA3A 4I01A 3GNEA 1XE8A 4R4XA 4IE0A 4IEWA 4RR3A 4K20A 2Z5WA 5F6LB 2X09A 1Q8OA 1W8NA 4LO4B 5FRAA 3WXPA 4B8EA 4FPGA 1UY4A 3IDAA 3WF2A 4FFFA 4JDMA 5DAPA 2WNUA 5JLVA 1LESA 4LIUA 3NJVA 4AFMA 3ACIA 3MIGA 2VMHA 1AL21 4K40A 4QU2A 1HN1A 2WRAA 2Z42A 4EN8B 3MW4A 4QGMA 3WVJA 1OC1A 4GXLA 5IVCA 1EAH2 2B4KA 3POFA 2Y6LA 2OZ6A 4HN1A 4RGAA 1UYYA 3WQ1A 2YB7A 3WCRA 3ATGA 4UXAA 1JYIA 2WO2A 4QQPA 3P5BA 1V6KA 3ZYGA 1AF9A 3KF3A 1RUH2 4GJZA 4LKDA 2AZ5A 5L7OC 3DPRC 4JTOA 4BH9A 1JYNA 2CTVA 2VAUA 2OUJA 3LEKA 5FZ7A 5GZCA 1QDOA 1S0EA 4CEYC 2GC0A 2P4EA 5BNNB 1VBC3 4E4HA 2VZRA 1ZVFA 3O1MA 3RMXA 4IXLA 4WVMA 4YNIA 5J98B 2VQTA 5A3PA 4FOQA 4QWNA 1DZQA 1YIFA 2ID4A 3AXDA 2PQQA 2P34A 3I59B 5J09A 3PUIA 1OVPA 4J6GA 5C8WA 2A6YA 1O6UA 1W2AX 2ZGRA 5FYSA 3ZFGC 1VRH3 2VL4A 5I0UA 4EWDA 1Z7S3 3T2TA 1XSQA 4DRVA 4MX3A 1NLRA 1AR93 3BPZA 2ORZA 4RN5A 1WW5A 5A7OA 4IE7A 1Y43B 3IDCB 1MEC2 3EXUA 5C9AA 3G6JB 2XBO2 3M1HA 4IV3A 4N9IA 1GOHA 2I74A 3PVOA 1UZWA 2WYSA 3NNLA 3BU7A 2WFF1 1ZRFA 1GNYA 5E16A 3AYDA 5FPBA 3ACHA 2EALA 3D3AA 1TME3 5JR2A 3O0WA 2JE8A 3V0BB 3S6PA 2PHXA 4XILA 4LKEA 4E4ZA 2CL2A 1LHNA 1GANA 1QQP3 3NV4A 1SBFA 1QJY3 3T0AA 1REDA 5JSOA 3VDCA 1CGPA 4FPKA 1SACA 2NMOA 3ZSEA 5J3UA 3F2ZA 3O1TA 4P14A 5CZKA 1CD3G 5FYCA 1YNAA 2JX9A 1QH6A 3PVEA 2EAKA 2E6VA 3OYWB 1GOGA 4XETA 5LBBA 3C7FA 3JD71 1WW6A 4OHXA 2JWPA 1PX3A 2BBAA 5FYIA 4XZUG 4IEUA 3M7AA 3H3ZA 3ITQA 4XDQA 1W6OA 2NM1A 1Z78A 1LOAA 4C0HA 2KR2A 4FI9A 4Q4Y1 1UL9A 2RS53 5F5QA 1W0NA 1JUHA 4GD4A 3RDIA 3ZKUA 3D82A 3RZHA 1WD4A 2WZR1 2JDMA 2BQPA 2BOIA 4KWJA 5DDJ1 5HPOA 1B09A 3UNPA 1OOPA 1Q5OA 3ZXEA 2X10A 3PU3A 4DEQA 3UETA 3EO6A 3ZM8A 1MS4A 1S4CA 1SLAA 5DN2A 4PBPA 4YVWC 2RDNA 5A3OA 3S7EA 4CDUA 3J4UH 1U5ZA 1VB4A 1KFXL 1UZ0A 2D5FA 2RM23 1AZDA 4QPIC 3V0AB 4Z2AA 4YM0A 4JDNA 1O5LA 3FBMA 4LKSA 4Y4YA 1CPNA 1F9KA 2I45A 3R4DB 4AVVA 1UIKA 2O0OA 5KHHA 3LOBA 4Q1PA 5FMDA 3FWEA 4Q0PA 3GZUC 4GZ9A 4YM2A 4IV1A 3KV4A 4XFCA 5JDBA 2LALA 4UT5A 5FFOC 5FYVA 2R071 1R082 1HDKA 3VBFA 1IOAA 2GH8A 3T1LA 4I2OA 1LAJA 4Q8LA 4NIDA 3ON7A 2WNEA 3OPWA 3OY8B 2CV6A 4L9BA 1FMD2 2IVIB 2WT2A 3AK0A 1M06G 2IC1A 3VHOA 4MGZE 2RR13 4IQPA 5T52A 2ZGMA 1A6CA 1DLCA 1XE0A 3K75B 4GB32 5FZ9A 1SQ4A 3L2YA 3VKNA 2DCJA 5DUUA 4FFGA 5CKNA 3BIEA 4Q1RA 3ST7A 5I93A 3VL8A 3WY6A 1OF3A 4DXRA 2A1XA 4ZHNA 3NQHA 4HXCA 5J96B 2GC2A 4BE3A 1OI6A 3ZSLA 2HBUA 1PO11 3PMEA 2B9VA 3O5SA 2GU9A 4RGKA 1QWRA 2ZEXA 3RVHA 1YQ5A 1W8FA 4CXWA 2CGOA 1SFYA 4XFBA 4P9YA 2XQRA 1RUJ1 3VB9A 4LITA 5EHDA 5CFDC 1BMV2 1AVBA 4XAAA 2DVDA 1DBNA 2YGMA 1AR73 1VBB2 3M4FA 4X8NA 3H7YA 3JQXA 4KG8A 5L7OA 3M70A 4PCRA 2BDRA 4OHZA 3JXSA 3WG2A 4GJYA 5H9QA 1D7PM 2Y8KA 4B1LA 1PGW2 1OPMA 2PTMA 4XFIA 5BY5A 2BVVA 4JAAA 4Y1YA 4OUEA 3ZDVA 2G9GA 1ENXA 1SHWB 4NPLA 5BNQA 4UW4A 5DZGA 2XLFA 3VN4A 5C3RA 2FMDA 1SLTA 2WC2A 2WQZC 2ZGOA 3IN9A 4PIYA 3VV1A 4BIOA 4K8FA 4YW2A 3UKTA 3UGHA 3Q8FA 4Y24A 2JDKA 3MIHA 5JMOA 5FP8A 4ZS2A 4CZSA 1RUE2 3KT1A 4HPKA 2VQ0A 4AVBA 5LEJA 1WCDJ 1RUH1 3WP6A 1A34A 2WNVA 1VBE2 1J3RA 5F32A 2HYKA 2BNOA 1LU1A 3C7EA 3HQRA 5A32B 3WG4A 4BZ4A 5F37A 2FCVA 1KDKA 1SEFA 1O91A 2VXRA 3M8LA 3MFAA 4FPHA 4P9WA 1U0AA 1NQDA 4AVTA 2DF7A 3I3BA 5C8CB 1V6IA 1GLHA 1LOBA 4AI9A 3NV1A 5CFCA 2A3WA 3RWKX 5FK7A 2WWUA 1S2EA 2XPJA 1UOGA 2OT7A 4XUTA 4BQ5A 2VTFA 4RS5A 4PJYA 2TNFA 1TE1B 4CYDA 2QQMA 3FHQA 2WNUB 1C57A 1W3XA 3FLPA 3HN1A 4NRMA 2J42A 3I2IA 3W5MA 4GULA 4NJ4A 4XF3A 5DXDA 4KQ7A 1GZWA 5E89A 2UWBA 4YZ4A 3IDBB 2BVBA 1JMUB 3KF5A 2GP3A 2YFZA 3DXTA 2YXSA 2WO3A 5F6KA 3IZOA 4GQ7A 5GALA 1JS9A 3FJSA 1MEC1 3KM5A 3LQCA 4YGBA 5HXVA 2ZX0A 1VR3A 2JKXA 5T3NA 1CN1A 1PK6C 5K0UB 3WHUA 1Y9GA 4AYUA 1CAVA 1JHJA 1MVEA 3ZN6A 2RMU1 5FPLA 1AYN1 4DXSA 2ZXQA 5GLZA 1KDMA 1WCQA 2JDUA 1V6JA 2HWE3 4XFHA 1HW5A 3LGRA 4I02A 1HXS1 3KT7A 3J8F3 2FMYA 5H9RA 4XQDA 5CA6A 2VY0A 4I0WB 4RFT0 1JZ5A 4ZZ5A 3JZVA 5JAXA 1S55A 4WVMB 4CDWC 4NRPA 1AHSA 2VNVA 4PLOA 1CJPA 1RJ8A 3NVCA 5IAVA 1YXWA 4DUVA 1ULDA 3KWVA 2D6LX 3OUIA 1HQWA 2D6NA 4OFGA 4B7KA 4E27A 3Q8AA 2Q8EA 2BGCA 2IUWA 2VECA 4FFHA 3WUDA 1C8M3 3ZYRA 1HRV3 3FHAA 3VGIA 1GWMA 3HMYA 2IXJA 4DPNA 5BNOC 2WS91 2FCTA 3J7HA 3ENRA 4DUWA 1R092 4IV3B 5F2SA 1PZ8A 2RS11 3MIDA 4OYUA 5A3NA 2ZEZA 2GDFA 1F35A 1TNFA 2P37A 3MI8A 1RIRA 2JDHA 2B42B 1NG0A 1D4VB 1GZCA 1QJX2 5FMCA 1F4AA 2GAUA 5A7QA 4ARYA 4CDQC 4CP2A 4IL7A 2IFRA 1ZBE2 1TNRA 2Z2SB 5GZDA 2E32A 1W2NA 1GU3A 3T2QA 2QQLA 2Q30A 1I5ZA 1X50A 2Z79A 3H8OA 5H9SA 4QX7A 4CDXB 1A78A 3AFKA 2VUDA 3OF1A 4HKLA 5KR7A 3BYWA 1NQJA 2A7AA 2I07B 1UX6A 3PUSA 4UFMA 5FY9A 5D8AB 5BNNC 2DFBA 4RQPA 2WAOA 1JYVA 2YU2A 1ENRA 5CVRA 3G7DA 3SLIA 3R4UA 1PM4A 1BQPA 3NSTA 4MVTA 3QBQA 5AVAA 1JZ3A 1V00A 5DMYA 5F2WA 4CUGA 4UF0A 1W6OB 1QY4A 2P3IA 2WYFA 1C1LA 3RZZA 3VZNA 4TWTA 2PYTA 5DQ0A 2VZVA 5JI7A 5K4LA 3DYPA 4Q0UA 3USUA 1YC61 4JCKA 4BQ3A 2AREA 5BNPC 1FMD1 2QTWB 4LBJA 1VLNA 3LIHA 4WVZA 3VBSC 1OOPB 2ERFA 4OZOA 3DKWA 3POYA 4KH9A 4HG6B 4OHVA 1VBC2 3JCIA 5LBCA 3O0VA 2GNDA 2BU9A 1W6QA 2MNGA 4CDUB 5FWJA 5JOWA 5SV8A 3D5OA 4N53A 4UFLA 3WF0A 3BKZA 3H7JA 1DU3D 5FXVA 2DDUA 1VRH2 4GWJA 4Q27A 4LBMA 4C8DA 4QD2A 1Z7S2 3AXEA 1KFUL 3KQ4B 1AR92 1AYM2 3SH5A 3GZEA 3UKNA 2BBVA 2B39A 3INAA 4FVVA 1AXYA 1EP0A 4H14A 2VQAA 5FXWA 2R063 4FO9A 1UZVA 1W8ZA 1LKNA 2EIEA 5FP7A 1U12A 1S0FA 2G4IA 2GNBA 4JKLA 1ZYBA 4PHZA 4FPCA 4DQAA 5FKBA 3RWNA 1BMV1 2WZEA 1BBT1 3PUHA 1TME2 2GC1A 4QX2A 2GMPA 5ACA3 2ZCWA 4AR2A 1VALA 3AZVA 5LWBA 1UXZA 2QBXA 3E6DA 2YC4A 4RSUA 3RQ0A 3WUCA 4YYOA 1QJY2 3PIJA 1V0AA 1WW4A 3PTYA 5D2AA 2PFWA 5J48A 1S0IA 1PGW1 3OGJA 3MUZ1 3T30A 1F4HA 3JBG3 4IGOA 5HCAA 2K0GA 3CKHA 4Q8KA 5BPXA 4XXAA 4AZZA 1ND2A 4M0NA 1UKGA 3ILFA 4LLOA 1LHOA 2WR9A 4YZ5A 3VD4A 5KXBA 3VKOA 4YWAA 5A3WA 2JDZA 2P17A 4TN7A 1AXZA 1J3PA 2J1UA 5F1RA 4F8AA 3BI3A 1Y3TA 1RUE1 4LBNA 4HANA 5A1FA 3AZWA 2RS52 4LUKA 1VBE1 1DLLA 3PU8A 1UYXA 5LBFA 3FBYA 3KV5A 4LNVA 4A4AA 1YEWA 3BOPA 3HAGA 5ISLA 4L0PA 3VDBA 1IKQA 1OF4A 1TEIA 1VRBA 3GALA 1C4RA 3DYMA 2E7AA 2RM22 1G7YA 2H6BA 2X5IB 2XB6C 1OFSA 2ADDA 2IXLA 2LUWA 3P3NA 1DGWX 4WM8B 2E31A 1QNYA 3ZXGA 4NHLA 3AKPA 1K5MB 2XJRA 4CXYA 1RHI1 4XMIA 1Y7BA 3USSA 2VZPA 4COUA 4LA2A 3GHMA 3N9MA 1WCSA 2XVKA 1GQPA 1RUF1 4G3YC 4OULA 4S2HA 4JTNA 2HWF1 2EXHA 1NUKA 2QQJA 1BEV3 1LEDA 3D0SA 3PVBB 3VKFC 1CAUA 4AGVA 2WLQA 1DQ6A 1V9U3 1X9PA 4HPKB 1PM7A 1HRI2 1OA2A 2VMCA 4Q4W1 5FZ6A 4Y5SA 4MUVA 4AVAA 2WNVB 4EWAA 1ZZCA 1R1ZA 4P5YA 1OH3A 4NHMA 4RA0A 1IG0A 2WDBA 3BCWA 1ZRCA 4Q4X1 4DRRA 2PHLA 3PHMA 3H0OA 1QJU2 5C5TA 3E97A 3GXUA 5CFCB 2HWD3 2RR12 1WBFA 1VMJA 4J1XA 4XEZA 1RUG3 3DXUA 4RS5B 5FZAA 1D4M3 3ABZA 5JWPA 4ATEA 1XYOA 1CX4A 1UD1A 4ZS3A 1PMHX 3U1XA 3FL7A 1JYTA 3CLPA 1Y9QA 4XE9A 5CADA 3U14A 1ULEA 2X8KA 3IPVB 3ZDSA 2J1AA 5L36A 1NE4A 4OHYA 1BK1A 5A80A 2ZMLA 3FMGA 2VMDA 3EQEA 2PHFA 2ETEA 1HB3A 1R091 2WLPA 4BQYA 1XJAA 5LCWL 3W59A 4EZHA 2W87A 3CU7A 2HWB3 2VOKA 1OQDA 3HNBM 4FPYA 4GH4C 1CAVB 1ST8A 3ZN6B 3SKVA 4E8CA 5FOJB 2OYZA 1QJX1 2ZGPA 2H0VA 3VDAA 4YFWA 1OLME 1DYPA 1ZBE1 1C5HA 2ILMA 3RYKA 5FZ1A 3ZSKA 2ES3A 1UIJA 3B01A 1O59A 3AL6A 1IS4A 2VH9A 4PDWC 4X8PA 2DFCA 4U36A 4AK3A 3AZXA 5IVJA 1S0BA 4UBHA 4CEWC 4FPFA 4WBBA 2HBTA 3ZPYA 2C5DA 3T08A 1ODNA 2VQUA 2WSVA 1E5RA 1VPHA 1G9FA 2DURA 4XBLA 3MHZA 3I2OA 4QAWA 5F3GA 1OVSA 3ELNA 1E5HA 3IMNA 4AI1A 1RINA 3KV9A 4GMP3 1A8DA 3CF6E 4YGCA 1VBA2 4XTMA 1H2KA 4NHYA 3TB0A 1JW6A 1RUC2 2DU1A 2JXAA 3NKGA 5DZEA 3WW2A 2TUNA 4AHWA 5LRSA 2OIIA 1JZ6A 3T2PA 4GWNA 4JRAA 1G86A 2BRTA 2HLEA 2JE7A 1FATA 1ULCA 4Z1VA 3I7DA 5K0UC 2JDYA 2QFEA 1Q56A 1TMF2 1CONA 3B5LB 5JOXA 3A21A 3ZYFA 5A1LA 4X6QB 1LHWA 5FYHA 3I4IA 3PL0A 4YZ3A 4UFHA 3R0RA 1IQDC 4Y20A 3U10A 2Z69A 2YMZA 3LF7A 1O3TA 3LB9A 1W6NB 2P3JA 1ZZBA 2D6KA 4HSJA 4AAXA 3CNAA 1S2BA 3ZYHA 3MV11 4NIGA 1AYM1 5GJ6A 1ND3A 1W3VA 4A2UA 4I3PA 4AW7A 5HV0A 1GZ9A 3ZFEA 2ZHKA 4KI5M 3NNFA 4EYUA 2XQXA 4PI0A 1F15A 4P02B 2EXKA 3ASIA 3WQ7A 4BCUA 5DPNA 3WINE 1JOJA 2JB4A 1NXD1 1TME1 2VC9A 3USUB 1JZ7A 5CG9A 2HWE2 3ZSMA 2PLV3 1JH5A 3N7MA 3TWIA 2WIIB 5EFUA 1UNBA 2B8MA 1VAVA 4FPEA 1QJY1 5IW0A 2VGDA 3TN92 3W5NA 1N1VA 1YQ2A 1BVVA 4IEQA 5FLIA 1O7FA 4DINB 3OGRA 4XUNA 1W6QB 3H50A 3KLSA 4XACA 1OKOA 3WV6A 5IT6A 3GF6A 5L9RA 1UX7A 4N53B 4LT5A 2RDSA 3UGFA 1NCQC 2UWAA 5J1XA 1NZCA 5FV3A 2XWJB 5FZKA 1N1YA 3BB6A 1EPZA 4Q4V2 3LFMA 4JGYA 1C8M2 2VU9A 4N7IA 1HRV2 4AEDC 1COV3 5FWEA 4XJUA 4BLIA 1H2LA 2RS51 4FPOB 2WO1A 5D8AC 3HQXA 4CCEA 5GLUA 4D6RA 4FTSA 2WZPP 4AEMA 1DF0A 3MF9A 5AFEA 4GMP0 2R1BA 3VZJA 3O1UA 1FOD2 3LSEA 2C0ZA 2QCSB 3ZXJA 2BEOA 5T5PA 1LOFA 3H1WA 2ARXA 5GZGA 4I0BA 5A33A 5C4WB 2EVXA 3ES1A 1DGRN 2P6CA 3J7MA 5FPZA 3OGSA 4AI8A 4XVHA 2PELA 1LODA 1XSRA 4QQOA 1ULGA 3PUAA 3BU0A 2ZGTA 4NHKA 2Q1MA 5FP9A 2D97A 1RITA 1DP0A 1HB1A 5T50A 1LGCA 1ND2B 3OGGA 2V4AA 3VBRA 5JCTA 2QQOA 5LY2A 2VOWA 1J3QA 4P9XA 4ATFA 1C28A 1O8PA 4YW7A 4BM8A 4FTEA 4CP9B 5LA2A 5F5CA 1WLWA 4AWDA 3H3LA 3DKQA 4JGZA 1UAIA 4WM7A 3THCA 4CU8A 1F5FA 1HRI1 1NA1C 1NXMA 5DZFA 5FO7B 5T54A 5IAXA 2CSGA 4CUAA 4MZUA 4OI2A 2JIJA 1SCRA 4M3CE 3W58A 1UY2A 4FPJA 3D4KA 1MACA 4EN7B 2VG9A 4UFKA 1QJU1 2MHFA 2NN8A 5AVPA 5JOYA 1LHUA 4MXWA 1W28A 2VVEA 4LOSA 1QHDA 4ASLA 5EJZB 2Y6GA 1CX1A 2ZGUA 4CCJA 2BFUS 1VE0A 1F2NA 3ZXFA 5JR7B 2CGPA 3JU9A 2W1QA 3VDDA 1CQ9A 2YG0A 1XNBA 4E4DX 1UYZA 1OQEA 2BWCA 5ABJC 3VBOA 1A8MA 1PHMA 1RMU3 3CJIC 5C5UA 5JXHA 3K4AA 3K46A 5FQ0A 2V72A 3PJYA 4YW5A 1QDCA 3TNQA 2DU0A 1VMFA 4QDQA 2QQNA 3K51A 1CAUB 5GZEA 2R062 4F3JA 3CZUA 4MH0E 3GYDA 2ATFA 3NAPC 3WEZA 2Y6HA 2QE3A 4QXCA 3OD0A 3PNAA 4COZA 5KC5A 3AMNA 3VBUC 5ACA2 1MS5A 1GUIA 2PHRA 1TZOA 1H4GA 1G8WA 4AFDA 1W2OA 3LE0A 1CJDA 1E5IA 1KS4A 2VNRA 4AOCA 2W39A 4J1WA 3BTYA 3E1F1 3JBG2 2RV9A 4LO8A 1L7LA 5EXOA 1RVF1 1NCRC 2ZKLA 3POGA 3HBKA 5CKMA 2RS31 3M3EA 5I0TA 1QKQA 3LDBA 2X5IC 4MHRA 4WM8C 3WF1A 3NNMA 4AQTA 1SLIA 1VBA1 3M3CA 4P9IA 1K5MC 4NE9A 4XF0A 1CIYA 2ADEA 1RL3A 2JD9A 5JPNB 4ZZ8A 2QQPA 1RUC1 4M3CB 4YGDA 3A7QA 5K9YA 2IXIA 4KWKA 4EV0A 1XRUA 2NPIA 1N1TA 1TMF1 5J36A 3THPA 2ZEWA 4AI0A 3NO8A 5JSRA 3T1MA 2OPWA 3ZKYA 1I5PA 1H1MA 1CZTA 1OD5A 1SLCA 3GJBA 2DCTA 3PUQA 2V5DA 2VE1A 3KMHA 1OXCA 4GKYA 2DBNA 4V2VA 5FZGA 1OFNA 3TBDA 1PNFA 4SBVA 4ZONA 4COWA 2I2SA 3APBA 3D6EA 5FY4A 3I2KA 3ZYBA 4E4SA 4QX1A 4BOWA 1Q8PA 3ZFFA 1JU3A 1OD3A 4I0AA 2IXKA 4I30A 4I3GA 4AF9A 1K45A 3ORJA 4LO7A 2VOVA 4M0HA 1DGLA 3IMMA 3LKJA 3JB4C 4MHUA 3T0BA 5CG8A 1QEXA 4LE4A 1L7RA 4HN0A 4XMAA 1BEV2 4BIFA 4O9GA 1UZYA 1V9U2 1OKQA 2HWC1 1KRIA 1Y4WA 1MZ6A 1S0JA 4RHV1 3H8XA 2VCAA 2EICA 2LS6A 5DAXA 4FPLA 4W8JA 1W8UA 2VOXA 5DUVA 1I9RA 4NMIA 4LJHA 4U2AA 5ANQA 1I3HA 3DN7A 3VBHA 3TN91 4DO0A 4WVWA 1VJ2A 2DYCA 2G9FA 1ZBA1 2Y64A 2XWBB 3AM2A 3QCWA 4QT6A 4UWDA 5FYZA 3ZX7A 1HV0A 4KL1A 2HWD2 2R16A 1CR7A 1FT9A 4XOGA 3GJAA 3RGBA 3RYRA 1AXKA 1RUG2 1LENA 2RJ2A 3N9QA 4I09A 1ONAA 4DY3A 3AP5A 5FUNA 1BZWA 3FZ3A 2R043 5EPAA 4JHTA 4S2FA 2YZ4A 4Q4V1 2LW8A 3VD3A 1C8M1 3FX3A 1ZM1A 1HB2A 4N43C 5F3IA 1SBDA 1H6YA 2F4LA 4UI9L 1OHFA 5FUPA 5FZHA 3RG0A 1WMDA 4DS0A 2Y38A 1ND3B 4N7UA 1PIV2 4IETA 2UYBA 5FLJA 3ZFEB 1MQTA 5A3UA 2HWB2 3RYPA 4WV8A 4QPGC 4LA3A 1DQ2A 1FOD1 3ZXLA 1N1SA 3QACA 3DGTA 5LATA 3ZIWA 4WVVA 4FSJA 1CVNA 2RDQA 4E2GA 2ARAA 3WW1A 1V6MA 3I49A 5J37A 1AR63 1EY2A 4ES8A 3K3OA 3LOIA 1GYKA 2AEYA 1O3SA 3B3QE 1RUD3 4B1MA 3C7OA 3NNGA 1UF2C 4QPYA 4L8QA 1XNDA 1W8WA 1H6XA 1NT0A 4XF4A 5A6YA 2W1WA 1EV13 1KD7A 3WNKA 4EZ4A 2GP5A 3AMPA 2K2SA 1S0CA 3RI9A 1O5UA 2NQYA 4JGYB 4CPBA 3RZKA 1DZRA 4KWUA 1W8OA 1YI9A 2ZEYA 4LTAA 4PLMA 1RXGA 1PVC1 3AFGA 4ISQA 5IVEA 3URFA 2LROA 2QVSB 1GKBA 2DVAA 3AZYA 1JZ2A 1BK0A 2ZX2A 5HCBA 2D93A 5C71A 4UFJA 4BDVB 5JZGC 3HVDA 1AL23 2PN5A 2JG9C 1KGYA 1JU4A 4K1YA 5A33B 3VHNA 3WP4A 3DPRA 5FZOA 1CAWA 3NAPA 1VIWB 4RGGA 1MPXA 4QHZA 3O1SA 1HX6A 3A22A 4CEYA 4D69A 5APAA 3TEYA 1H8TB 2XLGA 2IWGB 2XKPA 1UWWA 2ZX1A 1EAH1 2V4VA 3AYCA 2C6SA 4JC1A 3WDXA 5JMCA 1E57A 3C7HA 3NV3A 1YWKA 1NKGA 4A41A 3IDEA 3ZFGA 2XH6A 1DCSA 1NY72 2WN3A 1VB2A 3HBZA 4JGZB 1TG7A 4PIZA 3GHNA 1UOJA 2YBSA 3IWZA 1B35B 3C7GA 1GNHA 2D3PA 2YFUA 1PGL2 2RJLA 4YVSC 2ZZJA 2OW4A 1TVGA 2CWSA 4UAPA 4QKDA 2VCCA 2JG8C 1DQ4A 5JPMB 3J7LA 4R9CA 4RR3B 2XG3A 3K3NA 4XJ8A 4AEJA 1FV2A 1W99A 3LSDA 4XBQA 2Q4SA 2R49A 1ASJ2 1FXZA 3ALQA 1US3A 3FN9A 5F5IA 1R1A2 1WGPA 4D7YA 2FDGA 3KVBA 2X53S 5C4WC 3PJQA 5FYYA 2DUPA 2H0BA 3T09A 3MIBA 4ONUA 2VMFA 3B9CA 4QX5A 2VMIA 2WFF3 5A7WA 4A7YA 2Y0OA 4XABA 1US2A 1EUTA 3UV9A 4MGIE 4AGGA 4N8MA 3LZZA 2FZ1A 1COV2 2W1UA 2XBO1 1UU6A 3OCPA 5FQ0B 1K42A 2C24A 5FMOS 4M3CF 3UK9A 1J83A 1DQ5A 4UW3A 1QOTA 3AKRA 1EPWA 1MS8A 2YPDA 4E2QA 5E88A 4KNCA 3ZN4A 1UXXX 5KBFA 1REFA 2XR4A 3B93A 1O3QA 3RPQA 4DIQA 4GAZA 1POQA 3N9PA 4YG3A 4Y5TA 3JD73 4D7TA 2VMEA 4AI3A 2GN3A 5F5AA 2VBPA 4QXHA 4LHLA 4TXWA 3OD4A 5E6HA 3WLUA 4A7KA 1IZ3A 5JSPA 1IPKA 2Y6JA 1W6MA 2FDFA 5FP3A 3POWA 5F3CA 4Q4Y3 4QGNA 4CVUA 3HNMA 4YVWA 2D43A 4QPIA 2WZR3 3JUUA 3WG3A 3UGGA 5FZ3A 3MLLA 3VUOA 1J1TA 4TYSA 4W50A 3WNOA 2BW8A 5IWFA 2C9KA 3HT1A 3RZMA 4XZPA 5GLWA 5KXDA 5C9AB 1IKPA 4MSVA 5L73A 4MYEA 4N43A 4XIKA 4AFAA 3ILNA 2E26A 4D7SA 2TEPA 4R9DA 4L2NA 5FY8A 4QKBA 1C1FA 1AX0A 1ULFA 2ZX4A 1PMIA 3P3PA 1XE7A 1T6GC 1AJKA 1EUUA 3KCXA 2V09A 4ITCA 4CA9A 1RUG1 2GALA 2DUOA 2WKKA 2YC2A 5GM0A 3RRDA 3WQ0A 1CAXA 2CAUA 1QXPA 2W9XA 1NE6A 5ANNA 1LR5A 4MOAA 1QU0A 2G19A 5C70A 2W52A 5LY1A 1RMU2 5M0TA 1UY3A 2LTNA 3ZFFB 4YFZA 4HVQA 1TQ5A 2VMGA 2C26A 4Q5OA 1PIV1 1ZZ7A 2Q0AA 4QB1A 1R081 2O8QA 1V70A 1YFWA 3UJQA 3IIAA 1DFQA 2HWB1 4F83A 3LEGA 3FUQA 3S5QA 3CDZB 5FMOL 3HPNA 3NMBA 1RTVA 2ARBA
chains in the Genus database with same CATH topology
3VDAA 1UY4A 4MADA 3IDAA 3WF2A 3K4ZA 1WKYA 1O59A 1OT5A 4ZY9A 3NJVA 1CZVA 3ACIA 5B4NA 1HN1A 2W95A 2B4KA 3T08A 2Y6LA 2VQUA 4ET7A 1GOFA 3HNYM 1UYYA 2YB7A 4QAWA 2Y6KA 3WF4A 1K12A 2WO2A 4QDRA 4A42A 4YPJA 3WNPA 3LEKA 1CZSA 1P8JA 3T0DA 4OMCA 3T2PA 1JZ6A 2VZRA 2HLEA 2VQTA 5LA1A 3LPFA 3I97A 2ID4A 3A21A 4JKKA 3PUIA 1NX9A 4CU7A 2VJXA 2VL4A 1IQDC 1W9SA 3GGLA 4QB2A 2W46A 4AAXA 3U37A 2ORZA 4RN5A 2E33A 3MV11 1GOHA 2JDAA 4DEVA 3MBWA 2WYSA 5JXGA 3SEPA 4KI5M 2WAAA 4LHSA 1GNYA 2XQXA 3IAQA 3ACHA 3D3AA 3NJXA 4P02B 2J1EA 5JR2A 1NAEA 2JE8A 5DPNA 1JZ7A 2VC9A 2J1VA 2J1RA 1R64A 1ULOA 1XNTA 3T0AA 4M4PA 3VDCA 3W5NA 4BXSV 1YQ2A 3F2ZA 4JX0A 3OGRA 2W91A 1XC6A 3EYPA 4XUNA 5CZKA 3SEEA 3WNNA 5EIYB 4JKMA 1UMIA 1GOGA 1UX7A 1L7QA 3C7FA 4PT6A 2BGPA 1PX3A 2J1TA 2BBAA 5J1XA 4XZUG 3P1IA 4MO3M 4QX0A 1PX4A 4FI9A 1W0NA 3MUY1 2WO1A 1XPWA 5HPOA 3CZJA 3UNPA 2X10A 4DEQA 3UETA 2EIBA 3ZM8A 4W4ZA 5DN2A 3THDA 2WBKA 4A6OA 4UOJA 1UZ0A 3OGSA 4Z2AA 4XVHA 4LKSA 5IJRA 3MO4A 2WN2A 3LPGA 3IAPA 1DP0A 2QQOA 4GZ9A 1O8PA 5LA2A 3OGVA 1KEXA 3THCA 4CU8A 4QDSA 2VCBA 5JUVA 4CUAA 1UY2A 2VZUA 2PQSA 3C8XA 1UY1A 4CUCA 4CU6A 5A1AA 1DLCA 3K75B 5JXJA 3NRUA 4DXTA 5IFPA 2X05A 2DCJA 5EJZB 2Y6GA 1CX1A 4DXRA 1OF3A 2R7EB 3OG2A 1BHGA 3NQHA 2W1QA 4BJ0A 2YG0A 1UYZA 4E8DA 2B9VA 5JXHA 3K4AA 3K46A 1SG3A 2V72A 2ZEXA 4QDQA 2QQNA 5B4XA 3CZUA 1W9WA 3WEZA 2Y6HA 4ARXA 3ACGA 4XUOA 4A45A 3JXSA 1GUIA 4QPWA 5IHRA 1D7PM 2W1SA 2Y8KA 5I0DA 3I2HA 5HXMA 3LE0A 4OUEA 3HEIA 5LA0A 3E1F1 2RV9A 1SHWB 3IIIA 4IUGA 2VZOA 5JMOA 4BK4A 2VZSA 3IB3A 4JHZA 3WNMA 3WF1A 3VD9A 1JZ4A 5C7GA 3C7EA 1CIYA 2J22A 1W9TA 2JD9A 3ECQA 4ZZ8A 4P08A 3A7QA 3I3BA 1UY0A 1PMJX 2J1SA 3VD7A 3MV01 1RYYA 5G05L 4XUTA 2W3JA 2VTFA 2ZEWA 2QQMA 3FHQA 1I5PA 1CZTA 3I2IA 3W5MA 2W92A 2V5DA 2YFZA 2WO3A 2WQ8A 3I2KA 2VZQA 4QX1A 1JU3A 1OD3A 3LQCA 4A44A 2JKXA 2XHNA 1K45A 1K3IA 3HOBA 3T0BA 1JHJA 1L7RA 2OKXA 4DXSA 2ZXQA 1WCQA 2L9LA 3EB7A 2VCAA 4BK5A 2EICA 2LS6A 3I2FA 3A23A 4W8JA 3WSOA 1JZ5A 4ZZ5A 2Y64A 4DUXA 4DUVA 2RJ2A 3CIHA 2KD7A 3BN6A 3P6BA 2WABA 3DECA 4MGQA 2WUHA 3FHAA 3VD3A 2LW8A 2VZTA 5IFTA 3J7HA 1H6YA 4UI9L 4DUWA 4OYUA 2ZEZA 4D0QA 2XONA 4ARYA 1F4AA 3ETPA 4PF1A 3CQOA 2BZDA 2E32A 4M4RA 1GU3A 2VZ1A 2QQLA 3T2QA 4LQRA 1JZ8A 2QQKA 3C7OA 3NNGA 2RVAA 5CYYA 2ORXA 1H6XA 2WAOA 1JYVA 2W1WA 2CDOA 3WNKA 1JZ3A 5DMYA 1UMHA 4KWUA 1W8OA 2ZEYA 5DQ0A 2VZVA 3DYPA 1ULPA 1DYOA 4D8MA 2VZ3A 1JYNA 1JZ2A 3OB8A 5C71A 4BDVB 2CDPA 2XOMA 4OZOA 4GWIA 4HG6B 2C4XA 1KGYA 1JU4A 1JYWA 4RYDA 3SKJE 4CUBA 3LEIA 1MPXA 5FUIA 3WF0A 3A22A 4ZXEA 2DDUA 4GWJA 3WNLA 1UWWA 3BGAA 2V4VA 3K4DA 5EJ1B 3C7HA 4XUQA 5F7UA 1NKGA 4A41A 2W5FA 2WN3A 5IYYA 2EIEA 2W47A 1TG7A 1JYXA 4MGSA 4JKLA 1SDDB 3DYOA 3C7GA 2WZEA 2YFUA 3PUHA 1OH4A 4QX2A 1TVGA 4UAPA 2VCCA 4QX3A 1UXZA 2QBXA 2YC4A 3WQBA 2BERA 3I2GA 1W99A 3MUZ1 1F4HA 3CKHA 2BGOA 1US3A 3FN9A 3HN3A 3VD4A 2VM9A 3T09A 2VMFA 2J1UA 1US2A 4CU9A 1EUTA 3OEAA 2W1UA 1J84A 3WF3A 1K42A 1J83A 1UYXA 3I3DA 4A3ZA 4P00B 3GM8A 4A4AA 1UXXX 4XURA 2HYXA 3GDBA 3T2OA 4L0PA 3VDBA 1OF4A 3I3EA 1LNSA 4QB6A 2Z4FA 3DYMA 2VMEA 3CMGA 4TXWA 1XNAA 2E31A 1GMMA 2Y6JA 3UESA 1T2XA 4CVUA 3HNMA 4KMQA 2VZPA 4XUPA 4TTGA 1GQPA 2DCKA 2EIDA 3WNOA 1NUKA 2QQJA 4W50A 2C9KA 2W94A 2J7MA 3I2JA 4AG4A 2VMCA 4OMDA 3ACFA 4P5YA 1O8SA 2E26A 2WDBA 2VR4A 3K77A 3GXUA 2QQIA 4PQQA 1JI6A 5G04L 3ABZA 1EUUA 2YC2A 3OBAA 1PMHX 2WZ8A 2VO5A 3FL7A 3HJRA 2W9XA 3OEBA 5JXIA 3AC0A 2J1AA 4MOAA 2VOTA 5C70A 2VMDA 1UY3A 5LCWL 4LPLA 2W87A 2C26A 3HNBM 4QB1A 3SKVA 3LEGA 4E8CA 3CDZB 3HPNA 2X09A 1W8NA 3VD5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VDA A;  1UY4 A;  4MAD A;  3IDA A;  3WF2 A;  3K4Z A;  1WKY A;  1O59 A;  1OT5 A;  4ZY9 A;  3NJV A;  1CZV A;  3ACI A;  5B4N A;  1HN1 A;  2W95 A;  2B4K A;  3T08 A;  2Y6L A;  2VQU A;  4ET7 A;  1GOF A;  3HNY M;  1UYY A;  2YB7 A;  4QAW A;  2Y6K A;  3WF4 A;  1K12 A;  2WO2 A;  4QDR A;  4A42 A;  4YPJ A;  3WNP A;  3LEK A;  1CZS A;  1P8J A;  3T0D A;  4OMC A;  3T2P A;  1JZ6 A;  2VZR A;  2HLE A;  2VQT A;  5LA1 A;  3LPF A;  3I97 A;  2ID4 A;  3A21 A;  4JKK A;  3PUI A;  1NX9 A;  4CU7 A;  2VJX A;  2VL4 A;  1IQD C;  1W9S A;  3GGL A;  4QB2 A;  2W46 A;  4AAX A;  3U37 A;  2ORZ A;  4RN5 A;  2E33 A;  3MV1 1;  1GOH A;  2JDA A;  4DEV A;  3MBW A;  2WYS A;  5JXG A;  3SEP A;  4KI5 M;  2WAA A;  4LHS A;  1GNY A;  2XQX A;  3IAQ A;  3ACH A;  3D3A A;  3NJX A;  4P02 B;  2J1E A;  5JR2 A;  1NAE A;  2JE8 A;  5DPN A;  1JZ7 A;  2VC9 A;  2J1V A;  2J1R A;  1R64 A;  1ULO A;  1XNT A;  3T0A A;  4M4P A;  3VDC A;  3W5N A;  4BXS V;  1YQ2 A;  3F2Z A;  4JX0 A;  3OGR A;  2W91 A;  1XC6 A;  3EYP A;  4XUN A;  5CZK A;  3SEE A;  3WNN A;  5EIY B;  4JKM A;  1UMI A;  1GOG A;  1UX7 A;  1L7Q A;  3C7F A;  4PT6 A;  2BGP A;  1PX3 A;  2J1T A;  2BBA A;  5J1X A;  4XZU G;  3P1I A;  4MO3 M;  4QX0 A;  1PX4 A;  4FI9 A;  1W0N A;  3MUY 1;  2WO1 A;  1XPW A;  5HPO A;  3CZJ A;  3UNP A;  2X10 A;  4DEQ A;  3UET A;  2EIB A;  3ZM8 A;  4W4Z A;  5DN2 A;  3THD A;  2WBK A;  4A6O A;  4UOJ A;  1UZ0 A;  3OGS A;  4Z2A A;  4XVH A;  4LKS A;  5IJR A;  3MO4 A;  2WN2 A;  3LPG A;  3IAP A;  1DP0 A;  2QQO A;  4GZ9 A;  1O8P A;  5LA2 A;  3OGV A;  1KEX A;  3THC A;  4CU8 A;  4QDS A;  2VCB A;  5JUV A;  4CUA A;  1UY2 A;  2VZU A;  2PQS A;  3C8X A;  1UY1 A;  4CUC A;  4CU6 A;  5A1A A;  1DLC A;  3K75 B;  5JXJ A;  3NRU A;  4DXT A;  5IFP A;  2X05 A;  2DCJ A;  5EJZ B;  2Y6G A;  1CX1 A;  4DXR A;  1OF3 A;  2R7E B;  3OG2 A;  1BHG A;  3NQH A;  2W1Q A;  4BJ0 A;  2YG0 A;  1UYZ A;  4E8D A;  2B9V A;  5JXH A;  3K4A A;  3K46 A;  1SG3 A;  2V72 A;  2ZEX A;  4QDQ A;  2QQN A;  5B4X A;  3CZU A;  1W9W A;  3WEZ A;  2Y6H A;  4ARX A;  3ACG A;  4XUO A;  4A45 A;  3JXS A;  1GUI A;  4QPW A;  5IHR A;  1D7P M;  2W1S A;  2Y8K A;  5I0D A;  3I2H A;  5HXM A;  3LE0 A;  4OUE A;  3HEI A;  5LA0 A;  3E1F 1;  2RV9 A;  1SHW B;  3III A;  4IUG A;  2VZO A;  5JMO A;  4BK4 A;  2VZS A;  3IB3 A;  4JHZ A;  3WNM A;  3WF1 A;  3VD9 A;  1JZ4 A;  5C7G A;  3C7E A;  1CIY A;  2J22 A;  1W9T A;  2JD9 A;  3ECQ A;  4ZZ8 A;  4P08 A;  3A7Q A;  3I3B A;  1UY0 A;  1PMJ X;  2J1S A;  3VD7 A;  3MV0 1;  1RYY A;  5G05 L;  4XUT A;  2W3J A;  2VTF A;  2ZEW A;  2QQM A;  3FHQ A;  1I5P A;  1CZT A;  3I2I A;  3W5M A;  2W92 A;  2V5D A;  2YFZ A;  2WO3 A;  2WQ8 A;  3I2K A;  2VZQ A;  4QX1 A;  1JU3 A;  1OD3 A;  3LQC A;  4A44 A;  2JKX A;  2XHN A;  1K45 A;  1K3I A;  3HOB A;  3T0B A;  1JHJ A;  1L7R A;  2OKX A;  4DXS A;  2ZXQ A;  1WCQ A;  2L9L A;  3EB7 A;  2VCA A;  4BK5 A;  2EIC A;  2LS6 A;  3I2F A;  3A23 A;  4W8J A;  3WSO A;  1JZ5 A;  4ZZ5 A;  2Y64 A;  4DUX A;  4DUV A;  2RJ2 A;  3CIH A;  2KD7 A;  3BN6 A;  3P6B A;  2WAB A;  3DEC A;  4MGQ A;  2WUH A;  3FHA A;  3VD3 A;  2LW8 A;  2VZT A;  5IFT A;  3J7H A;  1H6Y A;  4UI9 L;  4DUW A;  4OYU A;  2ZEZ A;  4D0Q A;  2XON A;  4ARY A;  1F4A A;  3ETP A;  4PF1 A;  3CQO A;  2BZD A;  2E32 A;  4M4R A;  1GU3 A;  2VZ1 A;  2QQL A;  3T2Q A;  4LQR A;  1JZ8 A;  2QQK A;  3C7O A;  3NNG A;  2RVA A;  5CYY A;  2ORX A;  1H6X A;  2WAO A;  1JYV A;  2W1W A;  2CDO A;  3WNK A;  1JZ3 A;  5DMY A;  1UMH A;  4KWU A;  1W8O A;  2ZEY A;  5DQ0 A;  2VZV A;  3DYP A;  1ULP A;  1DYO A;  4D8M A;  2VZ3 A;  1JYN A;  1JZ2 A;  3OB8 A;  5C71 A;  4BDV B;  2CDP A;  2XOM A;  4OZO A;  4GWI A;  4HG6 B;  2C4X A;  1KGY A;  1JU4 A;  1JYW A;  4RYD A;  3SKJ E;  4CUB A;  3LEI A;  1MPX A;  5FUI A;  3WF0 A;  3A22 A;  4ZXE A;  2DDU A;  4GWJ A;  3WNL A;  1UWW A;  3BGA A;  2V4V A;  3K4D A;  5EJ1 B;  3C7H A;  4XUQ A;  5F7U A;  1NKG A;  4A41 A;  2W5F A;  2WN3 A;  5IYY A;  2EIE A;  2W47 A;  1TG7 A;  1JYX A;  4MGS A;  4JKL A;  1SDD B;  3DYO A;  3C7G A;  2WZE A;  2YFU A;  3PUH A;  1OH4 A;  4QX2 A;  1TVG A;  4UAP A;  2VCC A;  4QX3 A;  1UXZ A;  2QBX A;  2YC4 A;  3WQB A;  2BER A;  3I2G A;  1W99 A;  3MUZ 1;  1F4H A;  3CKH A;  2BGO A;  1US3 A;  3FN9 A;  3HN3 A;  3VD4 A;  2VM9 A;  3T09 A;  2VMF A;  2J1U A;  1US2 A;  4CU9 A;  1EUT A;  3OEA A;  2W1U A;  1J84 A;  3WF3 A;  1K42 A;  1J83 A;  1UYX A;  3I3D A;  4A3Z A;  4P00 B;  3GM8 A;  4A4A A;  1UXX X;  4XUR A;  2HYX A;  3GDB A;  3T2O A;  4L0P A;  3VDB A;  1OF4 A;  3I3E A;  1LNS A;  4QB6 A;  2Z4F A;  3DYM A;  2VME A;  3CMG A;  4TXW A;  1XNA A;  2E31 A;  1GMM A;  2Y6J A;  3UES A;  1T2X A;  4CVU A;  3HNM A;  4KMQ A;  2VZP A;  4XUP A;  4TTG A;  1GQP A;  2DCK A;  2EID A;  3WNO A;  1NUK A;  2QQJ A;  4W50 A;  2C9K A;  2W94 A;  2J7M A;  3I2J A;  4AG4 A;  2VMC A;  4OMD A;  3ACF A;  4P5Y A;  1O8S A;  2E26 A;  2WDB A;  2VR4 A;  3K77 A;  3GXU A;  2QQI A;  4PQQ A;  1JI6 A;  5G04 L;  3ABZ A;  1EUU A;  2YC2 A;  3OBA A;  1PMH X;  2WZ8 A;  2VO5 A;  3FL7 A;  3HJR A;  2W9X A;  3OEB A;  5JXI A;  3AC0 A;  2J1A A;  4MOA A;  2VOT A;  5C70 A;  2VMD A;  1UY3 A;  5LCW L;  4LPL A;  2W87 A;  2C26 A;  3HNB M;  4QB1 A;  3SKV A;  3LEG A;  4E8C A;  3CDZ B;  3HPN A;  2X09 A;  1W8N A;  3VD5 A; 
#chains in the Genus database with same CATH topology
 1MVQ A;  3RMY A;  2RG4 A;  4CCM A;  3TYJ A;  4FAH A;  4MAD A;  3K4Z A;  4LIV A;  3BTA A;  1K5J A;  1L3J A;  5EP9 A;  1OT5 A;  4MG2 A;  5FZB A;  5I8Y A;  2V5Y A;  3VBH B;  4GB3 1;  3J9S A;  2AH2 A;  5A7S A;  2Y33 A;  4EN6 B;  5B4N A;  2W95 A;  1SPP A;  5CFD A;  1PO1 3;  4O65 A;  1WBL A;  4IEV A;  2NLR A;  3I8T A;  2Y0I A;  1GFF 2;  1GOF A;  3MLK A;  5FO9 B;  4C1X A;  3KQR A;  2B46 X;  4UW5 A;  2Y6K A;  3WF4 A;  1K12 A;  2DVF A;  2ZAC A;  2YGL A;  4LO5 B;  3KT4 A;  1UPI A;  3WW4 A;  2E7Q A;  3AVS A;  4Z82 A;  5FK8 A;  4A42 A;  4IV1 B;  4YPJ A;  3WNP A;  4BQ4 A;  3BUC A;  2P5B A;  1RXF A;  3GZT B;  3LCP A;  1CZS A;  5LAS A;  2GNT A;  3O7O A;  3VBF B;  4LBQ D;  1WW7 A;  5DAQ A;  2ZMN A;  5LA1 A;  4PF5 A;  3LPF A;  1BJQ A;  3I97 A;  4P9G A;  3B94 A;  3N9N A;  2ZX3 A;  3I2D A;  3E6C C;  1VBB 1;  3Q8E A;  1QQP 2;  1XU1 A;  4B29 A;  5FXX A;  4K6B A;  1C3H A;  1GZT A;  2VW1 A;  4PI2 A;  1UPS A;  4AQ2 A;  4EQV A;  2NZ9 A;  3Q8B A;  2ZAH A;  2ZTN A;  4BA6 A;  1W9S A;  4AQ6 A;  5FOB B;  3GGL A;  3LDK A;  2BWA A;  3ILR A;  1XOY A;  3CO2 A;  4QB2 A;  1N3Q A;  3B69 A;  4BLJ A;  3U37 A;  4CCO A;  2RJK A;  2E33 A;  2FDJ A;  2VBD A;  1RUH 3;  2A3X A;  4ZU4 A;  5FYT A;  1AX1 A;  4EN9 B;  1WWY A;  3LIG A;  1W06 A;  2VD7 A;  1WMX A;  4DEV A;  4UFI A;  4XIO A;  1IG3 A;  3MBW A;  4QQ2 A;  5JXG A;  3SH4 A;  4OZX A;  2VUA A;  2WAA A;  4LHS A;  3RS6 A;  3SEP A;  1S2K A;  4K8R B;  3NJX A;  4CCC A;  3LA7 A;  5C9A C;  3ZO0 B;  2J1V A;  2JDP A;  2J1R A;  1R64 A;  3J26 N;  2ZHL A;  1XNT A;  4M4P A;  4PQ9 A;  4OLL A;  1PK6 A;  2XJT A;  5ERL A;  1GIC A;  1G9A A;  4HZF A;  4BXS V;  1WCU A;  3CL1 A;  4JX0 A;  5FY0 A;  5L9V A;  5EIY B;  1XC6 A;  3EYP A;  2YPJ A;  4EWE A;  5L7O B;  1PZ7 A;  1ASJ 1;  3DPR B;  5FZO B;  1UMI A;  2P3Y A;  1CAW B;  3POJ A;  1WMF A;  1MEC 3;  2CU5 A;  2BGP A;  2R32 A;  1R1A 1;  4A6S A;  3LAG A;  1LTE A;  4AE2 A;  3DV8 A;  4MLO A;  1IPS A;  1UMZ A;  1OLQ A;  3HQU A;  4ISR A;  2PHT A;  4LEJ A;  4CDW A;  2P3K A;  1PX4 A;  2R04 2;  1AYN 3;  2RMU 3;  1FI2 A;  2W08 A;  3MW2 A;  1WUV A;  3MUY 1;  4HVO A;  5GLT A;  1KIT A;  5FXZ A;  1HXS 3;  5AC9 3;  3OUJ A;  2ZBJ A;  3CBN A;  2VW2 A;  4LK6 A;  1YQC A;  5C3S A;  1PZ9 A;  4AFB A;  2ZGN A;  5F8P A;  3U4X A;  4BPZ A;  1QIQ A;  1XYN A;  2ENR A;  2RE9 A;  4W4Z A;  5BNO A;  2G1M A;  5FPX A;  4KGQ A;  4UOJ A;  4JQR A;  1ACC A;  2CYF A;  4BXF A;  4XTP A;  2AUY A;  2PAE A;  1YYN A;  1MS1 A;  1AR6 2;  1QJE A;  4JZR A;  3U78 A;  1DYK A;  3MO4 A;  1OSG A;  2WN2 A;  2BJS A;  3POE A;  4IES A;  1GV9 A;  3NWK A;  1RUD 2;  1UOF A;  4XDP A;  1XYP A;  4CDQ A;  2WS9 3;  3UKV A;  3CJX A;  2HEW F;  4L97 A;  2RS1 3;  3O12 A;  5BYN A;  4HSL A;  1EV1 2;  1U5Y A;  1GZW B;  2JDN A;  4K21 A;  3ME2 A;  1VAK A;  3OGV A;  2C9A A;  1HIX A;  1FAY A;  2XL7 A;  5BNN A;  1H8T C;  4QDS A;  2VCB A;  5JUV A;  3LWC A;  1SDW A;  3MYX A;  3R6S A;  1X33 A;  1JUI A;  2VZU A;  3BOD A;  3BPS A;  3PUR A;  4L11 A;  5JVV A;  4AAP A;  4Y4R A;  4XHB A;  4P9L A;  4AEK A;  1FV3 A;  3WDW A;  5JXJ A;  1OMI A;  4CU6 A;  5A1A A;  3IKW A;  4LBL A;  1AL2 2;  3NRU A;  1ODM A;  1AR7 2;  2X05 A;  3OJB A;  2VVF A;  3GBW A;  1MZE A;  3OBR A;  2WWS A;  4W65 A;  1J59 A;  2DVG A;  2R7E B;  3NW4 A;  3OG2 A;  2EA7 A;  4A3X A;  5BNP A;  1STM A;  5CB7 A;  3VBS A;  4MGY E;  2ET1 A;  4GWM A;  4LK7 A;  1AR8 3;  3OBT A;  1W6M B;  1F31 A;  5FIX A;  4CCD A;  1FYU A;  1LGB A;  3GCW A;  4RR3 C;  5C8C C;  4YVW B;  4E8D A;  5FYB A;  3N7L A;  1RMU 1;  2E9Q A;  4IGQ A;  4TZD A;  4IND A;  1FMD 3;  2WNU C;  5IVB A;  4HKW A;  4NOT A;  2AGS A;  4DB5 A;  3KCC A;  1W9F A;  2EIG A;  1S0D A;  5B4X A;  4LBO A;  2XVL A;  3E5X A;  4BWO A;  1W9W A;  2JD4 A;  4KGG A;  3OPZ A;  1YFU A;  5LW9 A;  3Q8C A;  1DZT A;  4ARX A;  5IK5 A;  4MGK E;  1DGR A;  1Z0H A;  2F17 A;  4XUO A;  5EWS A;  4NVP A;  5EZW A;  4A45 A;  1Q8Q A;  3U11 A;  2GC3 A;  3N7K A;  1VBC 1;  5FZF A;  2PHD A;  2Q1Z B;  5I0D A;  2UYA A;  4ORF A;  4XJ9 A;  5IK4 A;  3I2H A;  4ZU7 A;  4EN0 A;  4Y1U A;  3HEI A;  5E1R A;  4CPB D;  4HMZ A;  4XXP A;  3VDD B;  1DHK B;  1W90 A;  3III A;  4IUG A;  3POS A;  1VRH 1;  3U4S A;  5F9T A;  3SC7 X;  1Z7S 1;  2ARC A;  4RQP B;  5FMB A;  2VZS A;  2R0F A;  3AZZ A;  3C2U A;  2WFF 2;  4JHZ A;  1AR9 1;  3WNM A;  4Z8B A;  1ENQ A;  2KM2 A;  1BBT 3;  3T4V A;  4MGT A;  4K1Z A;  5C7G A;  3HT2 A;  1XU2 A;  4Z2W A;  2J22 A;  4TLG A;  4UF0 B;  1W9T A;  4OI4 A;  4BME A;  1PO2 3;  1CIW A;  3UYJ A;  3V64 A;  2V73 A;  1PMJ X;  1RJ7 A;  2LM3 A;  2J1S A;  3VD7 A;  3MV0 1;  1I6X A;  2E63 A;  1YI7 A;  2W3J A;  3KSC A;  3RJ2 X;  3N9O A;  1QQP 1;  1QOS A;  2OPK A;  3AKT A;  3J8F 2;  4YG0 A;  5T5J A;  4IV3 C;  3VHP A;  3WDY A;  1J1L A;  1WLD A;  1XB9 A;  3JD7 2;  3SCF A;  2YV8 A;  3TAY A;  1H8V A;  5HCF A;  1SPP B;  2UUR A;  5CAZ A;  3BOW A;  5FBJ A;  1G9D A;  1Y9M A;  4Q4Y 2;  2UY9 A;  2WQ8 A;  3DEM A;  2XVG A;  4E2S A;  2YDE A;  1IS3 A;  3VZO A;  4XPV A;  1K3I A;  1MS9 A;  2WZR 2;  4HL0 A;  3SXW A;  4Z07 A;  1GQH A;  2AYH A;  3AL5 A;  4OUS A;  3I54 A;  4CDX C;  1AL0 G;  4NAM A;  1Q8V A;  1HB4 A;  2Y26 A;  5LK5 A;  3IT8 A;  3M3I A;  1IS6 A;  2JEM A;  4BK5 A;  3I2F A;  1IQA A;  2WSU A;  3PDQ A;  3WSO A;  1RUI 3;  1O3R A;  1DQ1 A;  5FBZ A;  1H4H A;  1KQR A;  3A4U A;  1JYC A;  2PA7 A;  2Q1F A;  1RHI 3;  5IVY A;  2ZKN A;  2AAC A;  2RM2 1;  1SCS A;  3CIH A;  2GMM A;  2UY8 A;  1RUF 3;  3BN6 A;  3FC0 A;  4HBN A;  4BQW A;  4MXV A;  3P6B A;  2HWF 3;  2WAB A;  4IEZ A;  2Q5T A;  1KJL A;  1OOP C;  4DY5 A;  1DIW A;  1NYW A;  4XF1 A;  4B4R A;  2VZT A;  4IW3 A;  4Q4W 3;  5FZM A;  1UCX A;  4C1W A;  2FDI A;  5IFT A;  3M2M A;  4XFG A;  4CDU C;  2Q8O A;  4HET A;  1JXN A;  1YUD A;  2GN7 A;  5CEH A;  4JVA A;  1LEM A;  2EXI A;  3U75 A;  4Q4X 3;  1O4Z A;  4RFR B;  2GNM A;  4V1P A;  4NR1 A;  3HD8 B;  2H6C A;  3PIG A;  3ETP A;  3H42 B;  2Q8D A;  3CHX A;  2BZD A;  3ZMN A;  4M4R A;  2WIN B;  3WT3 A;  3AP4 A;  4XBN A;  4AI2 A;  5GKA C;  1LB2 A;  4IV1 C;  4GH4 A;  4MET A;  2RR1 1;  4XW3 A;  3E5Q A;  2QQK A;  2YUE A;  4H7L A;  2HEY F;  5FPU A;  2QUO A;  1QOO A;  4ASK A;  1QJF A;  3AB0 A;  3AMQ A;  2E7T A;  2ORX A;  3ZLI A;  4LBQ A;  5E8A A;  3L2H A;  1H9P A;  1PO1 2;  1RUN A;  1GNZ A;  1GWK A;  1R09 3;  1UW8 A;  2VTX A;  2OX0 A;  2YYO A;  4NRO A;  2YHJ A;  4Q2F A;  5IUQ A;  3W20 A;  4FTB A;  1N3O A;  4OVE A;  4PDW A;  4CDW B;  2K9Z A;  1UMH A;  2PAM A;  4QXK A;  5A70 A;  1QJX 3;  4CEW A;  5KHI A;  3O1V A;  1X82 A;  5KHG A;  4BQ2 A;  5CIR A;  1ZBE 3;  2QZ2 A;  3EBR A;  4KG0 A;  4LUL A;  1W39 A;  2EXJ A;  4CTE A;  4JDO A;  1M4W A;  4R4Z A;  1YFX A;  1YJL A;  2OUH A;  3A0N A;  3L9J T;  3M3O A;  3VZL A;  4AHZ A;  1XBF A;  2XOM A;  2YBP A;  1ZX5 A;  3ZOI A;  4GWI A;  1RUO A;  1UYP A;  5KWR A;  1GQG A;  2C4X A;  2MEV 3;  2XGX A;  2CY6 A;  5BNO B;  3DF0 A;  3AJY A;  4NPR A;  5CNA A;  1AR7 1;  3FFZ A;  4RYD A;  4IGP A;  2IFW A;  5DUW A;  3SKJ E;  4CUB A;  2FDH A;  2HH9 A;  1SBE A;  3PVN A;  5IK8 A;  3MF6 A;  4Q29 A;  4QHO A;  5EV7 A;  1LOE A;  3OPT A;  3S30 A;  5K0U A;  4CDQ B;  3BGA A;  3MIC A;  3K4D A;  5CU1 A;  3RNS A;  5EJ1 B;  3S7I A;  5J7M A;  5KC6 A;  3BTX A;  5HI0 A;  4OI1 A;  5F7U A;  1LU2 A;  2QQU A;  2ZMK A;  5F39 A;  2YY1 A;  1JOB A;  2HJI A;  5A3T A;  1JYX A;  2FCU A;  2XJS A;  5C33 A;  3POI A;  5IYY A;  2W47 A;  3AYA A;  3FHI B;  5GLV A;  4BB3 A;  3AMH A;  1YQ8 A;  2VXJ A;  4BQX A;  2O8O A;  5I8T A;  1SDD B;  3DYO A;  2IVJ A;  5IK7 A;  1OH4 A;  2IZW A;  2O1Q A;  4FOY A;  2DTY A;  1HV1 A;  1YCI A;  5EYX A;  4DZG A;  2FD8 A;  3AP7 A;  3SIT A;  1ALY A;  1LJ7 A;  2BER A;  2CNA A;  1W04 A;  3AYE A;  4KU7 A;  2VW0 A;  2JEN A;  3ZYP A;  1PNG A;  5KXE A;  1KJR A;  2D6O X;  2WNV C;  1AYM 3;  3V65 A;  3ZXA C;  4CSW A;  5JI9 A;  5BNP B;  4OQ9 A;  3VBS B;  2R6Q A;  3B7M A;  2VM9 A;  2ZHN A;  2GME A;  2BFU L;  5CFC C;  2WT0 A;  2XDV A;  5FJK A;  1VBD 3;  2RMU 2;  1AYN 2;  1MS3 A;  2WNO A;  4RS5 C;  2XLA A;  3AP9 A;  4RD7 A;  1W2U A;  1HXS 2;  5AC9 2;  3I3D A;  2BNM A;  1NCQ A;  3DL3 A;  3FFQ A;  3VKL A;  4A3Z A;  4P00 B;  2ZOE B;  4H3W A;  5CBL A;  4X6R B;  3OUH A;  4H2A A;  3N36 A;  4H7M A;  2MPF A;  4XUR A;  4AED A;  3GDB A;  3R4S A;  4Y22 A;  4YM1 A;  3T2O A;  3OSD A;  4FP3 A;  4CDX A;  2BP6 A;  2HWE 1;  1QH7 A;  3I3E A;  1LNS A;  4XJW A;  5D21 A;  2AEZ A;  5D8A A;  2Z4F A;  3J8F 1;  2DBI A;  2JIG A;  1T6B X;  2ZPX A;  4SLI A;  1GMM A;  3UES A;  1T2X A;  3AVR A;  5FAX A;  4B7E A;  1WA6 X;  1D4M 2;  1XNK A;  1POV 3;  2WS9 2;  4AFC A;  4FCA A;  4XUP A;  4Y20 B;  4TTG A;  4XYX A;  4QHB A;  2DCK A;  3Q9O A;  1VMH A;  2RS1 2;  2P1B A;  4LHN A;  2OVU A;  2Q8C A;  5LBE A;  1QXR A;  1HRV 1;  2W94 A;  2CHH A;  2J7M A;  3I2J A;  2NP0 A;  3ZN5 A;  3AJZ A;  4HK9 A;  2WT1 A;  3N3H A;  4K3U A;  4HFS A;  2PMW B;  1O8S A;  3KCY A;  3QLQ A;  4GIQ A;  2VR4 A;  2XUE A;  3JB8 A;  5T55 A;  4HON A;  4UBG A;  5DG2 A;  4N9H A;  1WA4 A;  3GZA A;  2AC1 A;  2OQ7 A;  2QQI A;  3NKT A;  5A6Z A;  2BV4 A;  4PQQ A;  4IE4 A;  3MLJ A;  1NA1 A;  3WDT A;  2QJV A;  1D0H A;  1ENS A;  2UU8 A;  5DUX A;  2DUQ A;  5FZ8 A;  1Q43 A;  1W6P A;  3N7J A;  1BVP 1;  3OBA A;  2DCZ A;  5FZC A;  2WZ8 A;  2R1D A;  2AR6 A;  4QGL A;  1O4Y A;  4LHK A;  1LGN A;  4YW6 A;  3AC0 A;  2A75 A;  4FFI A;  2RHP A;  1AR8 2;  1D0G A;  3MPP G;  2A3Y A;  4W6X A;  3RI8 A;  5BUV A;  1HRI 3;  5EQU A;  2D6P A;  3VZM A;  2GSY A;  3H1Y A;  1FPN 3;  3KB5 A;  4LPL A;  3WR0 A;  1OBN A;  2ZGK A;  2WFP A;  4IE5 A;  2ET7 A;  4G4F A;  4XHX A;  1QJU 3;  3WZ1 A;  3MW3 A;  5ABJ A;  3RSJ A;  3CJI A;  4HT1 T;  4B4Q A;  4OI0 A;  1JOD A;  3VD5 A;  4RQP C;  4Y3O A;  2A6X A;  5L9B A;  1IHM A;  3SHR A;  1WKY A;  2ZGL A;  3K2O A;  3H9A A;  1REE A;  3MEP A;  3OTF A;  4ZY9 A;  5FPA A;  5BXX A;  4B4P A;  5CIS A;  1CZV A;  1AX2 A;  1APN A;  2O14 A;  2JKB A;  4ZPI A;  1X8M A;  1UOB A;  4DOU A;  1FX5 A;  3HIF A;  4LBK A;  5DAV A;  2PAK A;  4CCK A;  3MDP A;  5LA9 A;  4ET7 A;  1AJO A;  2P2K A;  3HNY M;  4LO6 B;  3VBU A;  4FAG A;  4JRL A;  4C0B A;  2XML A;  3O1R A;  5A6X A;  3VBR B;  4O9E A;  4DFS A;  2IXH A;  4QDR A;  1GP4 A;  1SMV A;  3SQO A;  3WDU A;  4IER A;  4BK4 A;  5IVV A;  1POV 0;  3ZSJ A;  1BBT 2;  3BIW E;  4NWV A;  4D6S A;  1ZNP A;  4N53 C;  4LMF A;  5EJ3 A;  2VPV A;  4FOW A;  1NCR A;  1P8J A;  4ZKT B;  3T0D A;  2Y6F A;  3WCS A;  3MIF A;  1PO2 2;  2R06 1;  2WA3 A;  3NJY A;  4OMC A;  2B5H A;  2D3R A;  4WM7 B;  5L19 A;  3S57 A;  1H9W A;  2X5I A;  5FP4 A;  2E53 A;  2VNG A;  3I3Q A;  4WM8 A;  2D5H A;  3SCH A;  5KHJ A;  1W0O A;  2PLV 2;  1K5M A;  5ACA 1;  4JKK A;  1LEC A;  2ZS6 B;  4S2G A;  2G9Z A;  3FE5 A;  1W8T A;  4NUB A;  4URA A;  1NX9 A;  1RVF 3;  3O1O A;  4CU7 A;  2VJX A;  5HBA A;  4MXW B;  4GH4 B;  1XQN A;  3AX4 A;  2RS3 3;  3NL1 A;  2GZW A;  2UWC A;  3MIE A;  4AXO A;  1W03 A;  5K7P A;  1JHN A;  1X8E A;  2W46 A;  1G9C A;  2XJV A;  3JBG 1;  4LBQ B;  3CEW A;  4F7Z A;  3ZR6 A;  1PGS A;  3NV2 A;  1VBA 3;  3GBF A;  3H8U A;  3KD4 A;  3R05 A;  5A3L A;  3VKM A;  2JDA A;  4PDW B;  1RUC 3;  1GP6 A;  4A7Z A;  4GKX A;  3VBO B;  2XUM A;  1WLT A;  4AVC A;  2ZA9 A;  4XAE A;  1OUX A;  5LEK A;  2PHU A;  3IAQ A;  2YC0 A;  2VBB A;  4CEW B;  2BPA 2;  2J1E A;  1NAE A;  1TMF 3;  4LLF A;  1ND2 C;  4NHX A;  4Q0Q A;  4D3W A;  1QXJ A;  1ULO A;  2HEV F;  1W2T A;  4H55 A;  1RUI 2;  2QNK A;  2Y34 A;  1WCK A;  2W91 A;  3WNN A;  3SEE A;  2K46 A;  3IPV A;  4GA9 A;  3LD8 A;  1H0B A;  3H3U A;  4JKM A;  5FZ0 A;  1RHI 2;  4HOO A;  1L7Q A;  1XXN A;  5HCH A;  4PT6 A;  2JJ6 A;  4IE6 A;  2J1T A;  1ZRD A;  3WDV A;  5IAT A;  2KXL A;  1RUF 2;  3P1I A;  4MO3 M;  4QX0 A;  4CE8 A;  4RL7 A;  2HWF 2;  2VUL A;  2VUC A;  4FT8 A;  2JEC A;  3UL2 A;  3WP5 A;  3N9L A;  4DMI A;  2HWC 3;  2TBV A;  2BYV E;  4Q4W 2;  3QH7 A;  2D3S A;  4RHV 3;  5DDJ 3;  3ETQ A;  3B9I A;  5AC9 1;  1XPW A;  4PBO A;  5FZL A;  1AUY A;  1BEV 1;  1SFN A;  3CZJ A;  4L99 A;  1X36 A;  4NRQ A;  4Q4X 2;  1SLB A;  3TN9 3;  1ZBA 3;  1V9U 1;  5SV5 A;  2EIB A;  4Y1X A;  1NLS A;  4CRQ A;  3THD A;  2WBK A;  2XJU A;  4A6O A;  4XJZ A;  3DUI A;  2GH2 A;  3ZMO A;  5IJR A;  3BTZ A;  1HKD A;  4KBZ A;  3LPG A;  4NIA A;  2DCY A;  4QPG A;  4BYY A;  2HWD 1;  4Q4V 3;  4BIS A;  1QNW A;  1IGO A;  3D8C A;  3E5U A;  3IAP A;  3MGU A;  4N90 A;  1UN1 A;  4XF9 A;  4DXZ A;  1Q3E A;  1A3K A;  1D4M 1;  3F95 A;  3PLQ A;  5C8C A;  4AHY A;  3DCQ A;  3JQW A;  2R07 3;  4QU1 A;  3GBG A;  1FNY A;  3SCG A;  4ERO A;  5B2G B;  1KEX A;  1N3P A;  4NAO A;  1FOD 3;  4NII A;  2QDR A;  4IEP A;  4D6Q A;  2JIC A;  5I8S A;  1RB8 G;  4YLZ A;  5FJH A;  2W0X A;  1NCQ B;  2PQS A;  3TEX A;  3C8X A;  3TNP B;  1UY1 A;  4CUC A;  3EJK A;  1X9T A;  4AED B;  2A70 A;  4Y22 B;  4CP0 A;  5FZ4 A;  4AL9 A;  2MEV 2;  1CES A;  4QQH A;  3X29 B;  4DXT A;  5IFP A;  1KS5 A;  1W6N A;  2RDR A;  4W6W A;  1V6L A;  3I3M A;  4JV4 A;  3FLT A;  4M01 A;  4P5H A;  1BHG A;  4NPM A;  5JZG A;  1W05 A;  1BLZ A;  1GWL A;  2XL9 A;  4BJ0 A;  5LZ6 A;  1ZRR A;  2JG9 A;  2W68 A;  2ZJC A;  1H2N A;  4URT A;  1H1A A;  1AR8 1;  2D44 A;  4COV A;  4ZU5 A;  1HLC A;  4HVR A;  5FR3 A;  5JOZ A;  1PVC 3;  1SG3 A;  5FPV A;  4LXL A;  1GR3 A;  1Q8S A;  1F8V A;  4TSV A;  2QZ3 A;  4OUM A;  4LUM A;  1RUJ 3;  4R9B A;  1OLM A;  3SH3 A;  4GMP 1;  3NJZ A;  1ZRI A;  3ZXK A;  1ZZ6 A;  4FOV A;  4YAR A;  3S0M A;  3WOG A;  3N4M A;  3H8R A;  1MQT B;  3M3Q A;  3ACG A;  4G9S B;  4B3N A;  1UU4 A;  3SNM A;  1BKZ A;  4PLN A;  4QPW A;  5IHR A;  1W0P A;  4AGR A;  3ROU A;  2W1S A;  4FQZ A;  4R9A A;  4NIH A;  5HXM A;  4LR4 A;  3RZL A;  1NA1 B;  1EAH 3;  5LK7 B;  1I1E A;  4QX8 A;  1NLQ A;  5LA0 A;  1W6P B;  4YVS A;  1BCX A;  4IEX A;  2F4P A;  3ZYI B;  1JTZ X;  1OUR A;  2JG8 A;  3MPB A;  2WQ4 A;  2FQP A;  5T5O A;  2VZO A;  3KGL A;  5FZD A;  3SMH A;  2XXZ A;  2ZAB A;  5FY7 A;  3T3Y A;  4FBF A;  5FZE A;  4FXK B;  3IB3 A;  5HV4 A;  5JIU A;  1LRH A;  3VD9 A;  1OLR A;  4Y26 A;  4COY A;  1VBD 2;  1JZ4 A;  2SLI A;  4R8H A;  1NY7 1;  1LOG A;  2ZZQ A;  1E5S A;  5FLH A;  3ECQ A;  1LUL A;  4FXG B;  5C4W A;  4P08 A;  2OS2 A;  2ZGS A;  1PO2 1;  1W8H A;  1MR5 A;  1U5I A;  2XJP A;  5ABJ B;  1QF3 A;  1UY0 A;  3CJI B;  2BOJ A;  4JQT A;  3AKQ A;  4CP1 A;  1PGL 1;  4AHX A;  1RYY A;  4YRD A;  4K7J A;  3QH6 A;  5G05 L;  4YG6 A;  2NMN A;  3N35 A;  3AP6 A;  5AFB A;  1BXH A;  2PLV 1;  1O4T A;  3C3V A;  1DDL A;  1ND3 C;  1YRZ A;  3WD5 A;  1OPO A;  3QOP A;  1C8N A;  4IDZ A;  4XCA A;  3QD6 A;  3ZFE C;  5D1I A;  2W92 A;  3MFC A;  3EMR A;  4CP9 A;  1NOV A;  2WL1 A;  3NAP B;  5KHK A;  4QM8 A;  1UO9 A;  2XBO 3;  2VZQ A;  4CEY B;  3WP3 A;  2DTW A;  3GCX A;  3LEM A;  3VBU B;  4A44 A;  3ZPO A;  1DQ0 A;  2XHN A;  4FQ4 A;  4AVS A;  3HOB A;  5FCC A;  2OKX A;  2A6W A;  1HQN A;  2D98 A;  2KA3 A;  1COV 1;  4L92 A;  5FTT C;  3U0Z A;  2L9L A;  3EB7 A;  5F3E A;  3ZFG B;  3VLB B;  5C3O A;  1SFP A;  1JOP A;  2OZJ A;  3A23 A;  3ZYJ B;  4YZ2 A;  1NCR B;  1KXG A;  5KXC A;  3EHK A;  3OOX A;  2BNN A;  2A6V A;  4BMB A;  4YZ1 A;  3U07 A;  5CKQ A;  1RUI 1;  5K8S A;  4GAL A;  4JGY C;  1WLC A;  4WZC A;  4DUX A;  1GSL A;  1GBG A;  1XNC A;  1YQ6 A;  4P9J A;  2QQV A;  5C6C A;  3O0X A;  1YIP A;  4KU8 A;  4AQS A;  3FUO A;  2KD7 A;  4Y1Z A;  1MS0 A;  1ZA7 A;  3DEC A;  4MGQ A;  5IVF A;  1OA4 A;  2WUH A;  4C90 A;  1G6N A;  1YFY A;  1LOF C;  4YM3 A;  4XFA A;  1LOC A;  1SLL A;  1VAM A;  2N7G A;  2B45 X;  2WA4 A;  1LCL A;  3RJR A;  3TEZ A;  5A7W B;  4XDO A;  4LOT A;  4D0Q A;  4ZXK A;  2F6B A;  1FPN 2;  2XON A;  1URX A;  2VCM A;  1QMJ A;  3THT A;  5FZI A;  3WNX A;  1UZZ A;  4FP2 A;  4C91 A;  1YJK A;  4PF1 A;  2E51 A;  2NYY A;  3CQO A;  4ASM B;  2XHK A;  1X7N A;  3VBR C;  3VL9 A;  2A71 A;  3UJO A;  5FO8 B;  1G9B A;  1F5J A;  3I59 A;  1EYB A;  2VZ1 A;  2JB8 A;  3TRS B;  3D0J A;  4LQR A;  2XKO A;  2AEN A;  2IXC A;  4NN0 A;  1JZ8 A;  2PXJ A;  2A5Z A;  4JGZ C;  3VHR A;  2PHW A;  4NWW A;  2FZ2 A;  2RVA A;  5CYY A;  1B35 C;  4WM7 C;  3IBM A;  5LB6 A;  2VNO A;  1RC6 A;  3B00 A;  3KGZ A;  2CWM A;  4NO4 A;  3WX5 A;  5FY1 A;  3ZR5 A;  3HWJ A;  5C3P A;  1OQ1 A;  2CDO A;  5DG1 A;  4LOR A;  4O61 A;  3W9A A;  4CCL A;  1PIV 3;  1WD3 A;  1R08 3;  3POB A;  1IS5 A;  3IM0 A;  1V6O A;  4M3C A;  1MZF A;  3B02 A;  5A7P A;  1JN2 P;  2VUJ A;  4QPI B;  3V0B A;  2DV9 A;  2A6Z A;  2Y60 A;  1CWP A;  4K9S A;  1U5X A;  1DYO A;  1ULP A;  3BAL A;  4WZF A;  2VZ3 A;  1HN0 A;  5A7N A;  3V56 A;  3UT0 A;  4D8M A;  2VVD A;  3OB8 A;  4CXX A;  2CDP A;  3ACL A;  4GB3 3;  4O7X A;  3VDD C;  3MZH A;  4EJR A;  4N43 B;  3VBO C;  5FYU A;  5FY5 A;  2ZGQ A;  2MEV 1;  1JYW A;  1W9Y A;  3HR9 A;  1YLL A;  3O14 A;  1ZZ9 A;  3OYW A;  4J25 A;  3LEI A;  4KBB A;  2OA2 A;  5JIA A;  1SZB A;  5LRR A;  5FUI A;  2FDK A;  1GP5 A;  1RVF 2;  2JE9 A;  5FKC A;  4ZXE A;  3SIS A;  4QPG B;  1FNZ A;  1QGL A;  1YO8 A;  3WG1 A;  3WNL A;  2RS3 2;  5DAB A;  3LFI A;  4XUQ A;  1CAX B;  5FDB A;  5A3M A;  2W5F A;  5I0S A;  5TSW A;  3KHB A;  4XC9 A;  4Y1V A;  3ZIX A;  4HK8 A;  3PMS A;  5I91 A;  4MGS A;  5C3Q A;  1CPM A;  1QJZ A;  1HJF A;  4LE3 A;  1VBB 3;  5EYY A;  5T5L A;  4QMA A;  1V6N A;  1D2S A;  2XJQ A;  1LHV A;  2WO7 A;  4YW1 A;  4QX3 A;  4XQW A;  3V0A A;  1ZRE A;  3WHT A;  5I0R A;  2R0H A;  2YBK A;  3WQB A;  2BTV C;  2QDN A;  3I2G A;  4HKO A;  5GZF A;  5FYM A;  3VZK A;  2VTX J;  4M00 A;  4S2D A;  3KZ4 C;  2EF6 A;  2BGO A;  3TEW A;  4QXB A;  1PVX A;  3HN3 A;  2QKD A;  2FBE A;  5JZG B;  3RZJ A;  1HJG A;  1J58 A;  3H1M A;  5CFD B;  2JG9 B;  5DAW A;  2CGN A;  1RUE 3;  3LDR A;  3AKS A;  4YSF A;  4CU9 A;  2B7Y A;  1VBE 3;  3OEA A;  3O1P A;  2CAV A;  1UKR A;  5H9P A;  1J84 A;  1HQL A;  1RGS A;  2HWC 2;  1VBD 1;  1UU5 A;  4W6Y A;  3J7N A;  3OY8 A;  4RHV 2;  3WF3 A;  4E9K A;  3FLR A;  2ZAA A;  2D6M A;  5DDJ 2;  4XFF A;  4YGE A;  1WME A;  2D7F A;  3GM8 A;  4ES9 A;  4YW4 A;  4OHW A;  4XCB A;  2D40 A;  2HYX A;  1ZBA 2;  2YU1 A;  3E6B A;  4QKF A;  1ASJ 3;  4Y33 A;  3KVA A;  4QB6 A;  4XQ4 A;  4EE2 A;  3ZFF C;  1BYH A;  1ZZ8 A;  3TOJ A;  3LA2 A;  1JBC A;  1R1A 3;  2EAA A;  3CMG A;  4LKF A;  1H2M A;  3T4H B;  1OUS A;  1XNA A;  2C1F A;  3NNJ A;  4Q26 A;  4UYB A;  1S1A A;  3K48 A;  1N47 A;  2HKX A;  2QQW A;  4KMQ A;  4V2W A;  4YVS B;  2OXB A;  5FRE A;  2R30 A;  4HLT A;  4KWL A;  4QKN A;  3KHC A;  2P6H A;  2JG8 B;  1POV 1;  2BUK A;  2DVB A;  2EID A;  2W2I A;  4OQ8 A;  4DNY A;  2R07 2;  4MV2 A;  1OA3 A;  2R04 1;  3OBZ A;  3VBH C;  1IPJ A;  4Z92 B;  3A0K A;  4AG4 A;  3ZVX A;  1H1I A;  1MZ5 A;  1UQX A;  4OMD A;  3ACF A;  4BHP A;  3ZXD A;  4PIX A;  1C5I A;  2SBA A;  1ZA4 A;  3AMM A;  4Q0S A;  3K77 A;  3W21 A;  2FHR A;  3WW3 A;  4UW6 A;  1DG6 A;  2B9U A;  3RZG A;  1VP6 A;  4YW3 A;  1S0G A;  4Y5Z 0;  3PTR B;  1YHF A;  1H8T A;  1JI6 A;  1NZI A;  2A73 B;  2ZHM A;  3BVC A;  5G04 L;  4TLF A;  4XJA A;  1AR6 1;  1PK6 B;  4IEO A;  2X29 A;  4BU2 A;  2VO5 A;  1H30 A;  2YRO A;  1DGW A;  3HJR A;  3OEB A;  1MQT C;  1RUD 1;  2OQ6 A;  2WJS A;  3VBF C;  5JXI A;  3S5A A;  2WWJ A;  3KV6 A;  5BV6 A;  4IEY A;  3RFR A;  1WZX A;  4OCT A;  2VOT A;  5A6Q A;  4R52 A;  2DWR A;  3ES4 A;  1B35 A;  4BQ1 A;  3KS7 A;  1EV1 1;  1PVC 2;  5A32 A;  4D94 A;  4QM9 A;  4CCN A;  4QQL A;  1FPN 1;  2LRP A;  1D2Q A;  1RUJ 2;  4Q0V A;  3LA3 A;  4I01 A;  3GNE A;  1XE8 A;  4R4X A;  4IE0 A;  4IEW A;  4RR3 A;  4K20 A;  2Z5W A;  5F6L B;  2X09 A;  1Q8O A;  1W8N A;  4LO4 B;  5FRA A;  3WXP A;  4B8E A;  4FPG A;  1UY4 A;  3IDA A;  3WF2 A;  4FFF A;  4JDM A;  5DAP A;  2WNU A;  5JLV A;  1LES A;  4LIU A;  3NJV A;  4AFM A;  3ACI A;  3MIG A;  2VMH A;  1AL2 1;  4K40 A;  4QU2 A;  1HN1 A;  2WRA A;  2Z42 A;  4EN8 B;  3MW4 A;  4QGM A;  3WVJ A;  1OC1 A;  4GXL A;  5IVC A;  1EAH 2;  2B4K A;  3POF A;  2Y6L A;  2OZ6 A;  4HN1 A;  4RGA A;  1UYY A;  3WQ1 A;  2YB7 A;  3WCR A;  3ATG A;  4UXA A;  1JYI A;  2WO2 A;  4QQP A;  3P5B A;  1V6K A;  3ZYG A;  1AF9 A;  3KF3 A;  1RUH 2;  4GJZ A;  4LKD A;  2AZ5 A;  5L7O C;  3DPR C;  4JTO A;  4BH9 A;  1JYN A;  2CTV A;  2VAU A;  2OUJ A;  3LEK A;  5FZ7 A;  5GZC A;  1QDO A;  1S0E A;  4CEY C;  2GC0 A;  2P4E A;  5BNN B;  1VBC 3;  4E4H A;  2VZR A;  1ZVF A;  3O1M A;  3RMX A;  4IXL A;  4WVM A;  4YNI A;  5J98 B;  2VQT A;  5A3P A;  4FOQ A;  4QWN A;  1DZQ A;  1YIF A;  2ID4 A;  3AXD A;  2PQQ A;  2P34 A;  3I59 B;  5J09 A;  3PUI A;  1OVP A;  4J6G A;  5C8W A;  2A6Y A;  1O6U A;  1W2A X;  2ZGR A;  5FYS A;  3ZFG C;  1VRH 3;  2VL4 A;  5I0U A;  4EWD A;  1Z7S 3;  3T2T A;  1XSQ A;  4DRV A;  4MX3 A;  1NLR A;  1AR9 3;  3BPZ A;  2ORZ A;  4RN5 A;  1WW5 A;  5A7O A;  4IE7 A;  1Y43 B;  3IDC B;  1MEC 2;  3EXU A;  5C9A A;  3G6J B;  2XBO 2;  3M1H A;  4IV3 A;  4N9I A;  1GOH A;  2I74 A;  3PVO A;  1UZW A;  2WYS A;  3NNL A;  3BU7 A;  2WFF 1;  1ZRF A;  1GNY A;  5E16 A;  3AYD A;  5FPB A;  3ACH A;  2EAL A;  3D3A A;  1TME 3;  5JR2 A;  3O0W A;  2JE8 A;  3V0B B;  3S6P A;  2PHX A;  4XIL A;  4LKE A;  4E4Z A;  2CL2 A;  1LHN A;  1GAN A;  1QQP 3;  3NV4 A;  1SBF A;  1QJY 3;  3T0A A;  1RED A;  5JSO A;  3VDC A;  1CGP A;  4FPK A;  1SAC A;  2NMO A;  3ZSE A;  5J3U A;  3F2Z A;  3O1T A;  4P14 A;  5CZK A;  1CD3 G;  5FYC A;  1YNA A;  2JX9 A;  1QH6 A;  3PVE A;  2EAK A;  2E6V A;  3OYW B;  1GOG A;  4XET A;  5LBB A;  3C7F A;  3JD7 1;  1WW6 A;  4OHX A;  2JWP A;  1PX3 A;  2BBA A;  5FYI A;  4XZU G;  4IEU A;  3M7A A;  3H3Z A;  3ITQ A;  4XDQ A;  1W6O A;  2NM1 A;  1Z78 A;  1LOA A;  4C0H A;  2KR2 A;  4FI9 A;  4Q4Y 1;  1UL9 A;  2RS5 3;  5F5Q A;  1W0N A;  1JUH A;  4GD4 A;  3RDI A;  3ZKU A;  3D82 A;  3RZH A;  1WD4 A;  2WZR 1;  2JDM A;  2BQP A;  2BOI A;  4KWJ A;  5DDJ 1;  5HPO A;  1B09 A;  3UNP A;  1OOP A;  1Q5O A;  3ZXE A;  2X10 A;  3PU3 A;  4DEQ A;  3UET A;  3EO6 A;  3ZM8 A;  1MS4 A;  1S4C A;  1SLA A;  5DN2 A;  4PBP A;  4YVW C;  2RDN A;  5A3O A;  3S7E A;  4CDU A;  3J4U H;  1U5Z A;  1VB4 A;  1KFX L;  1UZ0 A;  2D5F A;  2RM2 3;  1AZD A;  4QPI C;  3V0A B;  4Z2A A;  4YM0 A;  4JDN A;  1O5L A;  3FBM A;  4LKS A;  4Y4Y A;  1CPN A;  1F9K A;  2I45 A;  3R4D B;  4AVV A;  1UIK A;  2O0O A;  5KHH A;  3LOB A;  4Q1P A;  5FMD A;  3FWE A;  4Q0P A;  3GZU C;  4GZ9 A;  4YM2 A;  4IV1 A;  3KV4 A;  4XFC A;  5JDB A;  2LAL A;  4UT5 A;  5FFO C;  5FYV A;  2R07 1;  1R08 2;  1HDK A;  3VBF A;  1IOA A;  2GH8 A;  3T1L A;  4I2O A;  1LAJ A;  4Q8L A;  4NID A;  3ON7 A;  2WNE A;  3OPW A;  3OY8 B;  2CV6 A;  4L9B A;  1FMD 2;  2IVI B;  2WT2 A;  3AK0 A;  1M06 G;  2IC1 A;  3VHO A;  4MGZ E;  2RR1 3;  4IQP A;  5T52 A;  2ZGM A;  1A6C A;  1DLC A;  1XE0 A;  3K75 B;  4GB3 2;  5FZ9 A;  1SQ4 A;  3L2Y A;  3VKN A;  2DCJ A;  5DUU A;  4FFG A;  5CKN A;  3BIE A;  4Q1R A;  3ST7 A;  5I93 A;  3VL8 A;  3WY6 A;  1OF3 A;  4DXR A;  2A1X A;  4ZHN A;  3NQH A;  4HXC A;  5J96 B;  2GC2 A;  4BE3 A;  1OI6 A;  3ZSL A;  2HBU A;  1PO1 1;  3PME A;  2B9V A;  3O5S A;  2GU9 A;  4RGK A;  1QWR A;  2ZEX A;  3RVH A;  1YQ5 A;  1W8F A;  4CXW A;  2CGO A;  1SFY A;  4XFB A;  4P9Y A;  2XQR A;  1RUJ 1;  3VB9 A;  4LIT A;  5EHD A;  5CFD C;  1BMV 2;  1AVB A;  4XAA A;  2DVD A;  1DBN A;  2YGM A;  1AR7 3;  1VBB 2;  3M4F A;  4X8N A;  3H7Y A;  3JQX A;  4KG8 A;  5L7O A;  3M70 A;  4PCR A;  2BDR A;  4OHZ A;  3JXS A;  3WG2 A;  4GJY A;  5H9Q A;  1D7P M;  2Y8K A;  4B1L A;  1PGW 2;  1OPM A;  2PTM A;  4XFI A;  5BY5 A;  2BVV A;  4JAA A;  4Y1Y A;  4OUE A;  3ZDV A;  2G9G A;  1ENX A;  1SHW B;  4NPL A;  5BNQ A;  4UW4 A;  5DZG A;  2XLF A;  3VN4 A;  5C3R A;  2FMD A;  1SLT A;  2WC2 A;  2WQZ C;  2ZGO A;  3IN9 A;  4PIY A;  3VV1 A;  4BIO A;  4K8F A;  4YW2 A;  3UKT A;  3UGH A;  3Q8F A;  4Y24 A;  2JDK A;  3MIH A;  5JMO A;  5FP8 A;  4ZS2 A;  4CZS A;  1RUE 2;  3KT1 A;  4HPK A;  2VQ0 A;  4AVB A;  5LEJ A;  1WCD J;  1RUH 1;  3WP6 A;  1A34 A;  2WNV A;  1VBE 2;  1J3R A;  5F32 A;  2HYK A;  2BNO A;  1LU1 A;  3C7E A;  3HQR A;  5A32 B;  3WG4 A;  4BZ4 A;  5F37 A;  2FCV A;  1KDK A;  1SEF A;  1O91 A;  2VXR A;  3M8L A;  3MFA A;  4FPH A;  4P9W A;  1U0A A;  1NQD A;  4AVT A;  2DF7 A;  3I3B A;  5C8C B;  1V6I A;  1GLH A;  1LOB A;  4AI9 A;  3NV1 A;  5CFC A;  2A3W A;  3RWK X;  5FK7 A;  2WWU A;  1S2E A;  2XPJ A;  1UOG A;  2OT7 A;  4XUT A;  4BQ5 A;  2VTF A;  4RS5 A;  4PJY A;  2TNF A;  1TE1 B;  4CYD A;  2QQM A;  3FHQ A;  2WNU B;  1C57 A;  1W3X A;  3FLP A;  3HN1 A;  4NRM A;  2J42 A;  3I2I A;  3W5M A;  4GUL A;  4NJ4 A;  4XF3 A;  5DXD A;  4KQ7 A;  1GZW A;  5E89 A;  2UWB A;  4YZ4 A;  3IDB B;  2BVB A;  1JMU B;  3KF5 A;  2GP3 A;  2YFZ A;  3DXT A;  2YXS A;  2WO3 A;  5F6K A;  3IZO A;  4GQ7 A;  5GAL A;  1JS9 A;  3FJS A;  1MEC 1;  3KM5 A;  3LQC A;  4YGB A;  5HXV A;  2ZX0 A;  1VR3 A;  2JKX A;  5T3N A;  1CN1 A;  1PK6 C;  5K0U B;  3WHU A;  1Y9G A;  4AYU A;  1CAV A;  1JHJ A;  1MVE A;  3ZN6 A;  2RMU 1;  5FPL A;  1AYN 1;  4DXS A;  2ZXQ A;  5GLZ A;  1KDM A;  1WCQ A;  2JDU A;  1V6J A;  2HWE 3;  4XFH A;  1HW5 A;  3LGR A;  4I02 A;  1HXS 1;  3KT7 A;  3J8F 3;  2FMY A;  5H9R A;  4XQD A;  5CA6 A;  2VY0 A;  4I0W B;  4RFT 0;  1JZ5 A;  4ZZ5 A;  3JZV A;  5JAX A;  1S55 A;  4WVM B;  4CDW C;  4NRP A;  1AHS A;  2VNV A;  4PLO A;  1CJP A;  1RJ8 A;  3NVC A;  5IAV A;  1YXW A;  4DUV A;  1ULD A;  3KWV A;  2D6L X;  3OUI A;  1HQW A;  2D6N A;  4OFG A;  4B7K A;  4E27 A;  3Q8A A;  2Q8E A;  2BGC A;  2IUW A;  2VEC A;  4FFH A;  3WUD A;  1C8M 3;  3ZYR A;  1HRV 3;  3FHA A;  3VGI A;  1GWM A;  3HMY A;  2IXJ A;  4DPN A;  5BNO C;  2WS9 1;  2FCT A;  3J7H A;  3ENR A;  4DUW A;  1R09 2;  4IV3 B;  5F2S A;  1PZ8 A;  2RS1 1;  3MID A;  4OYU A;  5A3N A;  2ZEZ A;  2GDF A;  1F35 A;  1TNF A;  2P37 A;  3MI8 A;  1RIR A;  2JDH A;  2B42 B;  1NG0 A;  1D4V B;  1GZC A;  1QJX 2;  5FMC A;  1F4A A;  2GAU A;  5A7Q A;  4ARY A;  4CDQ C;  4CP2 A;  4IL7 A;  2IFR A;  1ZBE 2;  1TNR A;  2Z2S B;  5GZD A;  2E32 A;  1W2N A;  1GU3 A;  3T2Q A;  2QQL A;  2Q30 A;  1I5Z A;  1X50 A;  2Z79 A;  3H8O A;  5H9S A;  4QX7 A;  4CDX B;  1A78 A;  3AFK A;  2VUD A;  3OF1 A;  4HKL A;  5KR7 A;  3BYW A;  1NQJ A;  2A7A A;  2I07 B;  1UX6 A;  3PUS A;  4UFM A;  5FY9 A;  5D8A B;  5BNN C;  2DFB A;  4RQP A;  2WAO A;  1JYV A;  2YU2 A;  1ENR A;  5CVR A;  3G7D A;  3SLI A;  3R4U A;  1PM4 A;  1BQP A;  3NST A;  4MVT A;  3QBQ A;  5AVA A;  1JZ3 A;  1V00 A;  5DMY A;  5F2W A;  4CUG A;  4UF0 A;  1W6O B;  1QY4 A;  2P3I A;  2WYF A;  1C1L A;  3RZZ A;  3VZN A;  4TWT A;  2PYT A;  5DQ0 A;  2VZV A;  5JI7 A;  5K4L A;  3DYP A;  4Q0U A;  3USU A;  1YC6 1;  4JCK A;  4BQ3 A;  2ARE A;  5BNP C;  1FMD 1;  2QTW B;  4LBJ A;  1VLN A;  3LIH A;  4WVZ A;  3VBS C;  1OOP B;  2ERF A;  4OZO A;  3DKW A;  3POY A;  4KH9 A;  4HG6 B;  4OHV A;  1VBC 2;  3JCI A;  5LBC A;  3O0V A;  2GND A;  2BU9 A;  1W6Q A;  2MNG A;  4CDU B;  5FWJ A;  5JOW A;  5SV8 A;  3D5O A;  4N53 A;  4UFL A;  3WF0 A;  3BKZ A;  3H7J A;  1DU3 D;  5FXV A;  2DDU A;  1VRH 2;  4GWJ A;  4Q27 A;  4LBM A;  4C8D A;  4QD2 A;  1Z7S 2;  3AXE A;  1KFU L;  3KQ4 B;  1AR9 2;  1AYM 2;  3SH5 A;  3GZE A;  3UKN A;  2BBV A;  2B39 A;  3INA A;  4FVV A;  1AXY A;  1EP0 A;  4H14 A;  2VQA A;  5FXW A;  2R06 3;  4FO9 A;  1UZV A;  1W8Z A;  1LKN A;  2EIE A;  5FP7 A;  1U12 A;  1S0F A;  2G4I A;  2GNB A;  4JKL A;  1ZYB A;  4PHZ A;  4FPC A;  4DQA A;  5FKB A;  3RWN A;  1BMV 1;  2WZE A;  1BBT 1;  3PUH A;  1TME 2;  2GC1 A;  4QX2 A;  2GMP A;  5ACA 3;  2ZCW A;  4AR2 A;  1VAL A;  3AZV A;  5LWB A;  1UXZ A;  2QBX A;  3E6D A;  2YC4 A;  4RSU A;  3RQ0 A;  3WUC A;  4YYO A;  1QJY 2;  3PIJ A;  1V0A A;  1WW4 A;  3PTY A;  5D2A A;  2PFW A;  5J48 A;  1S0I A;  1PGW 1;  3OGJ A;  3MUZ 1;  3T30 A;  1F4H A;  3JBG 3;  4IGO A;  5HCA A;  2K0G A;  3CKH A;  4Q8K A;  5BPX A;  4XXA A;  4AZZ A;  1ND2 A;  4M0N A;  1UKG A;  3ILF A;  4LLO A;  1LHO A;  2WR9 A;  4YZ5 A;  3VD4 A;  5KXB A;  3VKO A;  4YWA A;  5A3W A;  2JDZ A;  2P17 A;  4TN7 A;  1AXZ A;  1J3P A;  2J1U A;  5F1R A;  4F8A A;  3BI3 A;  1Y3T A;  1RUE 1;  4LBN A;  4HAN A;  5A1F A;  3AZW A;  2RS5 2;  4LUK A;  1VBE 1;  1DLL A;  3PU8 A;  1UYX A;  5LBF A;  3FBY A;  3KV5 A;  4LNV A;  4A4A A;  1YEW A;  3BOP A;  3HAG A;  5ISL A;  4L0P A;  3VDB A;  1IKQ A;  1OF4 A;  1TEI A;  1VRB A;  3GAL A;  1C4R A;  3DYM A;  2E7A A;  2RM2 2;  1G7Y A;  2H6B A;  2X5I B;  2XB6 C;  1OFS A;  2ADD A;  2IXL A;  2LUW A;  3P3N A;  1DGW X;  4WM8 B;  2E31 A;  1QNY A;  3ZXG A;  4NHL A;  3AKP A;  1K5M B;  2XJR A;  4CXY A;  1RHI 1;  4XMI A;  1Y7B A;  3USS A;  2VZP A;  4COU A;  4LA2 A;  3GHM A;  3N9M A;  1WCS A;  2XVK A;  1GQP A;  1RUF 1;  4G3Y C;  4OUL A;  4S2H A;  4JTN A;  2HWF 1;  2EXH A;  1NUK A;  2QQJ A;  1BEV 3;  1LED A;  3D0S A;  3PVB B;  3VKF C;  1CAU A;  4AGV A;  2WLQ A;  1DQ6 A;  1V9U 3;  1X9P A;  4HPK B;  1PM7 A;  1HRI 2;  1OA2 A;  2VMC A;  4Q4W 1;  5FZ6 A;  4Y5S A;  4MUV A;  4AVA A;  2WNV B;  4EWA A;  1ZZC A;  1R1Z A;  4P5Y A;  1OH3 A;  4NHM A;  4RA0 A;  1IG0 A;  2WDB A;  3BCW A;  1ZRC A;  4Q4X 1;  4DRR A;  2PHL A;  3PHM A;  3H0O A;  1QJU 2;  5C5T A;  3E97 A;  3GXU A;  5CFC B;  2HWD 3;  2RR1 2;  1WBF A;  1VMJ A;  4J1X A;  4XEZ A;  1RUG 3;  3DXU A;  4RS5 B;  5FZA A;  1D4M 3;  3ABZ A;  5JWP A;  4ATE A;  1XYO A;  1CX4 A;  1UD1 A;  4ZS3 A;  1PMH X;  3U1X A;  3FL7 A;  1JYT A;  3CLP A;  1Y9Q A;  4XE9 A;  5CAD A;  3U14 A;  1ULE A;  2X8K A;  3IPV B;  3ZDS A;  2J1A A;  5L36 A;  1NE4 A;  4OHY A;  1BK1 A;  5A80 A;  2ZML A;  3FMG A;  2VMD A;  3EQE A;  2PHF A;  2ETE A;  1HB3 A;  1R09 1;  2WLP A;  4BQY A;  1XJA A;  5LCW L;  3W59 A;  4EZH A;  2W87 A;  3CU7 A;  2HWB 3;  2VOK A;  1OQD A;  3HNB M;  4FPY A;  4GH4 C;  1CAV B;  1ST8 A;  3ZN6 B;  3SKV A;  4E8C A;  5FOJ B;  2OYZ A;  1QJX 1;  2ZGP A;  2H0V A;  3VDA A;  4YFW A;  1OLM E;  1DYP A;  1ZBE 1;  1C5H A;  2ILM A;  3RYK A;  5FZ1 A;  3ZSK A;  2ES3 A;  1UIJ A;  3B01 A;  1O59 A;  3AL6 A;  1IS4 A;  2VH9 A;  4PDW C;  4X8P A;  2DFC A;  4U36 A;  4AK3 A;  3AZX A;  5IVJ A;  1S0B A;  4UBH A;  4CEW C;  4FPF A;  4WBB A;  2HBT A;  3ZPY A;  2C5D A;  3T08 A;  1ODN A;  2VQU A;  2WSV A;  1E5R A;  1VPH A;  1G9F A;  2DUR A;  4XBL A;  3MHZ A;  3I2O A;  4QAW A;  5F3G A;  1OVS A;  3ELN A;  1E5H A;  3IMN A;  4AI1 A;  1RIN A;  3KV9 A;  4GMP 3;  1A8D A;  3CF6 E;  4YGC A;  1VBA 2;  4XTM A;  1H2K A;  4NHY A;  3TB0 A;  1JW6 A;  1RUC 2;  2DU1 A;  2JXA A;  3NKG A;  5DZE A;  3WW2 A;  2TUN A;  4AHW A;  5LRS A;  2OII A;  1JZ6 A;  3T2P A;  4GWN A;  4JRA A;  1G86 A;  2BRT A;  2HLE A;  2JE7 A;  1FAT A;  1ULC A;  4Z1V A;  3I7D A;  5K0U C;  2JDY A;  2QFE A;  1Q56 A;  1TMF 2;  1CON A;  3B5L B;  5JOX A;  3A21 A;  3ZYF A;  5A1L A;  4X6Q B;  1LHW A;  5FYH A;  3I4I A;  3PL0 A;  4YZ3 A;  4UFH A;  3R0R A;  1IQD C;  4Y20 A;  3U10 A;  2Z69 A;  2YMZ A;  3LF7 A;  1O3T A;  3LB9 A;  1W6N B;  2P3J A;  1ZZB A;  2D6K A;  4HSJ A;  4AAX A;  3CNA A;  1S2B A;  3ZYH A;  3MV1 1;  4NIG A;  1AYM 1;  5GJ6 A;  1ND3 A;  1W3V A;  4A2U A;  4I3P A;  4AW7 A;  5HV0 A;  1GZ9 A;  3ZFE A;  2ZHK A;  4KI5 M;  3NNF A;  4EYU A;  2XQX A;  4PI0 A;  1F15 A;  4P02 B;  2EXK A;  3ASI A;  3WQ7 A;  4BCU A;  5DPN A;  3WIN E;  1JOJ A;  2JB4 A;  1NXD 1;  1TME 1;  2VC9 A;  3USU B;  1JZ7 A;  5CG9 A;  2HWE 2;  3ZSM A;  2PLV 3;  1JH5 A;  3N7M A;  3TWI A;  2WII B;  5EFU A;  1UNB A;  2B8M A;  1VAV A;  4FPE A;  1QJY 1;  5IW0 A;  2VGD A;  3TN9 2;  3W5N A;  1N1V A;  1YQ2 A;  1BVV A;  4IEQ A;  5FLI A;  1O7F A;  4DIN B;  3OGR A;  4XUN A;  1W6Q B;  3H50 A;  3KLS A;  4XAC A;  1OKO A;  3WV6 A;  5IT6 A;  3GF6 A;  5L9R A;  1UX7 A;  4N53 B;  4LT5 A;  2RDS A;  3UGF A;  1NCQ C;  2UWA A;  5J1X A;  1NZC A;  5FV3 A;  2XWJ B;  5FZK A;  1N1Y A;  3BB6 A;  1EPZ A;  4Q4V 2;  3LFM A;  4JGY A;  1C8M 2;  2VU9 A;  4N7I A;  1HRV 2;  4AED C;  1COV 3;  5FWE A;  4XJU A;  4BLI A;  1H2L A;  2RS5 1;  4FPO B;  2WO1 A;  5D8A C;  3HQX A;  4CCE A;  5GLU A;  4D6R A;  4FTS A;  2WZP P;  4AEM A;  1DF0 A;  3MF9 A;  5AFE A;  4GMP 0;  2R1B A;  3VZJ A;  3O1U A;  1FOD 2;  3LSE A;  2C0Z A;  2QCS B;  3ZXJ A;  2BEO A;  5T5P A;  1LOF A;  3H1W A;  2ARX A;  5GZG A;  4I0B A;  5A33 A;  5C4W B;  2EVX A;  3ES1 A;  1DGR N;  2P6C A;  3J7M A;  5FPZ A;  3OGS A;  4AI8 A;  4XVH A;  2PEL A;  1LOD A;  1XSR A;  4QQO A;  1ULG A;  3PUA A;  3BU0 A;  2ZGT A;  4NHK A;  2Q1M A;  5FP9 A;  2D97 A;  1RIT A;  1DP0 A;  1HB1 A;  5T50 A;  1LGC A;  1ND2 B;  3OGG A;  2V4A A;  3VBR A;  5JCT A;  2QQO A;  5LY2 A;  2VOW A;  1J3Q A;  4P9X A;  4ATF A;  1C28 A;  1O8P A;  4YW7 A;  4BM8 A;  4FTE A;  4CP9 B;  5LA2 A;  5F5C A;  1WLW A;  4AWD A;  3H3L A;  3DKQ A;  4JGZ A;  1UAI A;  4WM7 A;  3THC A;  4CU8 A;  1F5F A;  1HRI 1;  1NA1 C;  1NXM A;  5DZF A;  5FO7 B;  5T54 A;  5IAX A;  2CSG A;  4CUA A;  4MZU A;  4OI2 A;  2JIJ A;  1SCR A;  4M3C E;  3W58 A;  1UY2 A;  4FPJ A;  3D4K A;  1MAC A;  4EN7 B;  2VG9 A;  4UFK A;  1QJU 1;  2MHF A;  2NN8 A;  5AVP A;  5JOY A;  1LHU A;  4MXW A;  1W28 A;  2VVE A;  4LOS A;  1QHD A;  4ASL A;  5EJZ B;  2Y6G A;  1CX1 A;  2ZGU A;  4CCJ A;  2BFU S;  1VE0 A;  1F2N A;  3ZXF A;  5JR7 B;  2CGP A;  3JU9 A;  2W1Q A;  3VDD A;  1CQ9 A;  2YG0 A;  1XNB A;  4E4D X;  1UYZ A;  1OQE A;  2BWC A;  5ABJ C;  3VBO A;  1A8M A;  1PHM A;  1RMU 3;  3CJI C;  5C5U A;  5JXH A;  3K4A A;  3K46 A;  5FQ0 A;  2V72 A;  3PJY A;  4YW5 A;  1QDC A;  3TNQ A;  2DU0 A;  1VMF A;  4QDQ A;  2QQN A;  3K51 A;  1CAU B;  5GZE A;  2R06 2;  4F3J A;  3CZU A;  4MH0 E;  3GYD A;  2ATF A;  3NAP C;  3WEZ A;  2Y6H A;  2QE3 A;  4QXC A;  3OD0 A;  3PNA A;  4COZ A;  5KC5 A;  3AMN A;  3VBU C;  5ACA 2;  1MS5 A;  1GUI A;  2PHR A;  1TZO A;  1H4G A;  1G8W A;  4AFD A;  1W2O A;  3LE0 A;  1CJD A;  1E5I A;  1KS4 A;  2VNR A;  4AOC A;  2W39 A;  4J1W A;  3BTY A;  3E1F 1;  3JBG 2;  2RV9 A;  4LO8 A;  1L7L A;  5EXO A;  1RVF 1;  1NCR C;  2ZKL A;  3POG A;  3HBK A;  5CKM A;  2RS3 1;  3M3E A;  5I0T A;  1QKQ A;  3LDB A;  2X5I C;  4MHR A;  4WM8 C;  3WF1 A;  3NNM A;  4AQT A;  1SLI A;  1VBA 1;  3M3C A;  4P9I A;  1K5M C;  4NE9 A;  4XF0 A;  1CIY A;  2ADE A;  1RL3 A;  2JD9 A;  5JPN B;  4ZZ8 A;  2QQP A;  1RUC 1;  4M3C B;  4YGD A;  3A7Q A;  5K9Y A;  2IXI A;  4KWK A;  4EV0 A;  1XRU A;  2NPI A;  1N1T A;  1TMF 1;  5J36 A;  3THP A;  2ZEW A;  4AI0 A;  3NO8 A;  5JSR A;  3T1M A;  2OPW A;  3ZKY A;  1I5P A;  1H1M A;  1CZT A;  1OD5 A;  1SLC A;  3GJB A;  2DCT A;  3PUQ A;  2V5D A;  2VE1 A;  3KMH A;  1OXC A;  4GKY A;  2DBN A;  4V2V A;  5FZG A;  1OFN A;  3TBD A;  1PNF A;  4SBV A;  4ZON A;  4COW A;  2I2S A;  3APB A;  3D6E A;  5FY4 A;  3I2K A;  3ZYB A;  4E4S A;  4QX1 A;  4BOW A;  1Q8P A;  3ZFF A;  1JU3 A;  1OD3 A;  4I0A A;  2IXK A;  4I30 A;  4I3G A;  4AF9 A;  1K45 A;  3ORJ A;  4LO7 A;  2VOV A;  4M0H A;  1DGL A;  3IMM A;  3LKJ A;  3JB4 C;  4MHU A;  3T0B A;  5CG8 A;  1QEX A;  4LE4 A;  1L7R A;  4HN0 A;  4XMA A;  1BEV 2;  4BIF A;  4O9G A;  1UZY A;  1V9U 2;  1OKQ A;  2HWC 1;  1KRI A;  1Y4W A;  1MZ6 A;  1S0J A;  4RHV 1;  3H8X A;  2VCA A;  2EIC A;  2LS6 A;  5DAX A;  4FPL A;  4W8J A;  1W8U A;  2VOX A;  5DUV A;  1I9R A;  4NMI A;  4LJH A;  4U2A A;  5ANQ A;  1I3H A;  3DN7 A;  3VBH A;  3TN9 1;  4DO0 A;  4WVW A;  1VJ2 A;  2DYC A;  2G9F A;  1ZBA 1;  2Y64 A;  2XWB B;  3AM2 A;  3QCW A;  4QT6 A;  4UWD A;  5FYZ A;  3ZX7 A;  1HV0 A;  4KL1 A;  2HWD 2;  2R16 A;  1CR7 A;  1FT9 A;  4XOG A;  3GJA A;  3RGB A;  3RYR A;  1AXK A;  1RUG 2;  1LEN A;  2RJ2 A;  3N9Q A;  4I09 A;  1ONA A;  4DY3 A;  3AP5 A;  5FUN A;  1BZW A;  3FZ3 A;  2R04 3;  5EPA A;  4JHT A;  4S2F A;  2YZ4 A;  4Q4V 1;  2LW8 A;  3VD3 A;  1C8M 1;  3FX3 A;  1ZM1 A;  1HB2 A;  4N43 C;  5F3I A;  1SBD A;  1H6Y A;  2F4L A;  4UI9 L;  1OHF A;  5FUP A;  5FZH A;  3RG0 A;  1WMD A;  4DS0 A;  2Y38 A;  1ND3 B;  4N7U A;  1PIV 2;  4IET A;  2UYB A;  5FLJ A;  3ZFE B;  1MQT A;  5A3U A;  2HWB 2;  3RYP A;  4WV8 A;  4QPG C;  4LA3 A;  1DQ2 A;  1FOD 1;  3ZXL A;  1N1S A;  3QAC A;  3DGT A;  5LAT A;  3ZIW A;  4WVV A;  4FSJ A;  1CVN A;  2RDQ A;  4E2G A;  2ARA A;  3WW1 A;  1V6M A;  3I49 A;  5J37 A;  1AR6 3;  1EY2 A;  4ES8 A;  3K3O A;  3LOI A;  1GYK A;  2AEY A;  1O3S A;  3B3Q E;  1RUD 3;  4B1M A;  3C7O A;  3NNG A;  1UF2 C;  4QPY A;  4L8Q A;  1XND A;  1W8W A;  1H6X A;  1NT0 A;  4XF4 A;  5A6Y A;  2W1W A;  1EV1 3;  1KD7 A;  3WNK A;  4EZ4 A;  2GP5 A;  3AMP A;  2K2S A;  1S0C A;  3RI9 A;  1O5U A;  2NQY A;  4JGY B;  4CPB A;  3RZK A;  1DZR A;  4KWU A;  1W8O A;  1YI9 A;  2ZEY A;  4LTA A;  4PLM A;  1RXG A;  1PVC 1;  3AFG A;  4ISQ A;  5IVE A;  3URF A;  2LRO A;  2QVS B;  1GKB A;  2DVA A;  3AZY A;  1JZ2 A;  1BK0 A;  2ZX2 A;  5HCB A;  2D93 A;  5C71 A;  4UFJ A;  4BDV B;  5JZG C;  3HVD A;  1AL2 3;  2PN5 A;  2JG9 C;  1KGY A;  1JU4 A;  4K1Y A;  5A33 B;  3VHN A;  3WP4 A;  3DPR A;  5FZO A;  1CAW A;  3NAP A;  1VIW B;  4RGG A;  1MPX A;  4QHZ A;  3O1S A;  1HX6 A;  3A22 A;  4CEY A;  4D69 A;  5APA A;  3TEY A;  1H8T B;  2XLG A;  2IWG B;  2XKP A;  1UWW A;  2ZX1 A;  1EAH 1;  2V4V A;  3AYC A;  2C6S A;  4JC1 A;  3WDX A;  5JMC A;  1E57 A;  3C7H A;  3NV3 A;  1YWK A;  1NKG A;  4A41 A;  3IDE A;  3ZFG A;  2XH6 A;  1DCS A;  1NY7 2;  2WN3 A;  1VB2 A;  3HBZ A;  4JGZ B;  1TG7 A;  4PIZ A;  3GHN A;  1UOJ A;  2YBS A;  3IWZ A;  1B35 B;  3C7G A;  1GNH A;  2D3P A;  2YFU A;  1PGL 2;  2RJL A;  4YVS C;  2ZZJ A;  2OW4 A;  1TVG A;  2CWS A;  4UAP A;  4QKD A;  2VCC A;  2JG8 C;  1DQ4 A;  5JPM B;  3J7L A;  4R9C A;  4RR3 B;  2XG3 A;  3K3N A;  4XJ8 A;  4AEJ A;  1FV2 A;  1W99 A;  3LSD A;  4XBQ A;  2Q4S A;  2R49 A;  1ASJ 2;  1FXZ A;  3ALQ A;  1US3 A;  3FN9 A;  5F5I A;  1R1A 2;  1WGP A;  4D7Y A;  2FDG A;  3KVB A;  2X53 S;  5C4W C;  3PJQ A;  5FYY A;  2DUP A;  2H0B A;  3T09 A;  3MIB A;  4ONU A;  2VMF A;  3B9C A;  4QX5 A;  2VMI A;  2WFF 3;  5A7W A;  4A7Y A;  2Y0O A;  4XAB A;  1US2 A;  1EUT A;  3UV9 A;  4MGI E;  4AGG A;  4N8M A;  3LZZ A;  2FZ1 A;  1COV 2;  2W1U A;  2XBO 1;  1UU6 A;  3OCP A;  5FQ0 B;  1K42 A;  2C24 A;  5FMO S;  4M3C F;  3UK9 A;  1J83 A;  1DQ5 A;  4UW3 A;  1QOT A;  3AKR A;  1EPW A;  1MS8 A;  2YPD A;  4E2Q A;  5E88 A;  4KNC A;  3ZN4 A;  1UXX X;  5KBF A;  1REF A;  2XR4 A;  3B93 A;  1O3Q A;  3RPQ A;  4DIQ A;  4GAZ A;  1POQ A;  3N9P A;  4YG3 A;  4Y5T A;  3JD7 3;  4D7T A;  2VME A;  4AI3 A;  2GN3 A;  5F5A A;  2VBP A;  4QXH A;  4LHL A;  4TXW A;  3OD4 A;  5E6H A;  3WLU A;  4A7K A;  1IZ3 A;  5JSP A;  1IPK A;  2Y6J A;  1W6M A;  2FDF A;  5FP3 A;  3POW A;  5F3C A;  4Q4Y 3;  4QGN A;  4CVU A;  3HNM A;  4YVW A;  2D43 A;  4QPI A;  2WZR 3;  3JUU A;  3WG3 A;  3UGG A;  5FZ3 A;  3MLL A;  3VUO A;  1J1T A;  4TYS A;  4W50 A;  3WNO A;  2BW8 A;  5IWF A;  2C9K A;  3HT1 A;  3RZM A;  4XZP A;  5GLW A;  5KXD A;  5C9A B;  1IKP A;  4MSV A;  5L73 A;  4MYE A;  4N43 A;  4XIK A;  4AFA A;  3ILN A;  2E26 A;  4D7S A;  2TEP A;  4R9D A;  4L2N A;  5FY8 A;  4QKB A;  1C1F A;  1AX0 A;  1ULF A;  2ZX4 A;  1PMI A;  3P3P A;  1XE7 A;  1T6G C;  1AJK A;  1EUU A;  3KCX A;  2V09 A;  4ITC A;  4CA9 A;  1RUG 1;  2GAL A;  2DUO A;  2WKK A;  2YC2 A;  5GM0 A;  3RRD A;  3WQ0 A;  1CAX A;  2CAU A;  1QXP A;  2W9X A;  1NE6 A;  5ANN A;  1LR5 A;  4MOA A;  1QU0 A;  2G19 A;  5C70 A;  2W52 A;  5LY1 A;  1RMU 2;  5M0T A;  1UY3 A;  2LTN A;  3ZFF B;  4YFZ A;  4HVQ A;  1TQ5 A;  2VMG A;  2C26 A;  4Q5O A;  1PIV 1;  1ZZ7 A;  2Q0A A;  4QB1 A;  1R08 1;  2O8Q A;  1V70 A;  1YFW A;  3UJQ A;  3IIA A;  1DFQ A;  2HWB 1;  4F83 A;  3LEG A;  3FUQ A;  3S5Q A;  3CDZ B;  5FMO L;  3HPN A;  3NMB A;  1RTV A;  2ARB A; 
#chains in the Genus database with same CATH homology
 3VDA A;  1UY4 A;  4MAD A;  3IDA A;  3WF2 A;  3K4Z A;  1WKY A;  1O59 A;  1OT5 A;  4ZY9 A;  3NJV A;  1CZV A;  3ACI A;  5B4N A;  1HN1 A;  2W95 A;  2B4K A;  3T08 A;  2Y6L A;  2VQU A;  4ET7 A;  1GOF A;  3HNY M;  1UYY A;  2YB7 A;  4QAW A;  2Y6K A;  3WF4 A;  1K12 A;  2WO2 A;  4QDR A;  4A42 A;  4YPJ A;  3WNP A;  3LEK A;  1CZS A;  1P8J A;  3T0D A;  4OMC A;  3T2P A;  1JZ6 A;  2VZR A;  2HLE A;  2VQT A;  5LA1 A;  3LPF A;  3I97 A;  2ID4 A;  3A21 A;  4JKK A;  3PUI A;  1NX9 A;  4CU7 A;  2VJX A;  2VL4 A;  1IQD C;  1W9S A;  3GGL A;  4QB2 A;  2W46 A;  4AAX A;  3U37 A;  2ORZ A;  4RN5 A;  2E33 A;  3MV1 1;  1GOH A;  2JDA A;  4DEV A;  3MBW A;  2WYS A;  5JXG A;  3SEP A;  4KI5 M;  2WAA A;  4LHS A;  1GNY A;  2XQX A;  3IAQ A;  3ACH A;  3D3A A;  3NJX A;  4P02 B;  2J1E A;  5JR2 A;  1NAE A;  2JE8 A;  5DPN A;  1JZ7 A;  2VC9 A;  2J1V A;  2J1R A;  1R64 A;  1ULO A;  1XNT A;  3T0A A;  4M4P A;  3VDC A;  3W5N A;  4BXS V;  1YQ2 A;  3F2Z A;  4JX0 A;  3OGR A;  2W91 A;  1XC6 A;  3EYP A;  4XUN A;  5CZK A;  3SEE A;  3WNN A;  5EIY B;  4JKM A;  1UMI A;  1GOG A;  1UX7 A;  1L7Q A;  3C7F A;  4PT6 A;  2BGP A;  1PX3 A;  2J1T A;  2BBA A;  5J1X A;  4XZU G;  3P1I A;  4MO3 M;  4QX0 A;  1PX4 A;  4FI9 A;  1W0N A;  3MUY 1;  2WO1 A;  1XPW A;  5HPO A;  3CZJ A;  3UNP A;  2X10 A;  4DEQ A;  3UET A;  2EIB A;  3ZM8 A;  4W4Z A;  5DN2 A;  3THD A;  2WBK A;  4A6O A;  4UOJ A;  1UZ0 A;  3OGS A;  4Z2A A;  4XVH A;  4LKS A;  5IJR A;  3MO4 A;  2WN2 A;  3LPG A;  3IAP A;  1DP0 A;  2QQO A;  4GZ9 A;  1O8P A;  5LA2 A;  3OGV A;  1KEX A;  3THC A;  4CU8 A;  4QDS A;  2VCB A;  5JUV A;  4CUA A;  1UY2 A;  2VZU A;  2PQS A;  3C8X A;  1UY1 A;  4CUC A;  4CU6 A;  5A1A A;  1DLC A;  3K75 B;  5JXJ A;  3NRU A;  4DXT A;  5IFP A;  2X05 A;  2DCJ A;  5EJZ B;  2Y6G A;  1CX1 A;  4DXR A;  1OF3 A;  2R7E B;  3OG2 A;  1BHG A;  3NQH A;  2W1Q A;  4BJ0 A;  2YG0 A;  1UYZ A;  4E8D A;  2B9V A;  5JXH A;  3K4A A;  3K46 A;  1SG3 A;  2V72 A;  2ZEX A;  4QDQ A;  2QQN A;  5B4X A;  3CZU A;  1W9W A;  3WEZ A;  2Y6H A;  4ARX A;  3ACG A;  4XUO A;  4A45 A;  3JXS A;  1GUI A;  4QPW A;  5IHR A;  1D7P M;  2W1S A;  2Y8K A;  5I0D A;  3I2H A;  5HXM A;  3LE0 A;  4OUE A;  3HEI A;  5LA0 A;  3E1F 1;  2RV9 A;  1SHW B;  3III A;  4IUG A;  2VZO A;  5JMO A;  4BK4 A;  2VZS A;  3IB3 A;  4JHZ A;  3WNM A;  3WF1 A;  3VD9 A;  1JZ4 A;  5C7G A;  3C7E A;  1CIY A;  2J22 A;  1W9T A;  2JD9 A;  3ECQ A;  4ZZ8 A;  4P08 A;  3A7Q A;  3I3B A;  1UY0 A;  1PMJ X;  2J1S A;  3VD7 A;  3MV0 1;  1RYY A;  5G05 L;  4XUT A;  2W3J A;  2VTF A;  2ZEW A;  2QQM A;  3FHQ A;  1I5P A;  1CZT A;  3I2I A;  3W5M A;  2W92 A;  2V5D A;  2YFZ A;  2WO3 A;  2WQ8 A;  3I2K A;  2VZQ A;  4QX1 A;  1JU3 A;  1OD3 A;  3LQC A;  4A44 A;  2JKX A;  2XHN A;  1K45 A;  1K3I A;  3HOB A;  3T0B A;  1JHJ A;  1L7R A;  2OKX A;  4DXS A;  2ZXQ A;  1WCQ A;  2L9L A;  3EB7 A;  2VCA A;  4BK5 A;  2EIC A;  2LS6 A;  3I2F A;  3A23 A;  4W8J A;  3WSO A;  1JZ5 A;  4ZZ5 A;  2Y64 A;  4DUX A;  4DUV A;  2RJ2 A;  3CIH A;  2KD7 A;  3BN6 A;  3P6B A;  2WAB A;  3DEC A;  4MGQ A;  2WUH A;  3FHA A;  3VD3 A;  2LW8 A;  2VZT A;  5IFT A;  3J7H A;  1H6Y A;  4UI9 L;  4DUW A;  4OYU A;  2ZEZ A;  4D0Q A;  2XON A;  4ARY A;  1F4A A;  3ETP A;  4PF1 A;  3CQO A;  2BZD A;  2E32 A;  4M4R A;  1GU3 A;  2VZ1 A;  2QQL A;  3T2Q A;  4LQR A;  1JZ8 A;  2QQK A;  3C7O A;  3NNG A;  2RVA A;  5CYY A;  2ORX A;  1H6X A;  2WAO A;  1JYV A;  2W1W A;  2CDO A;  3WNK A;  1JZ3 A;  5DMY A;  1UMH A;  4KWU A;  1W8O A;  2ZEY A;  5DQ0 A;  2VZV A;  3DYP A;  1ULP A;  1DYO A;  4D8M A;  2VZ3 A;  1JYN A;  1JZ2 A;  3OB8 A;  5C71 A;  4BDV B;  2CDP A;  2XOM A;  4OZO A;  4GWI A;  4HG6 B;  2C4X A;  1KGY A;  1JU4 A;  1JYW A;  4RYD A;  3SKJ E;  4CUB A;  3LEI A;  1MPX A;  5FUI A;  3WF0 A;  3A22 A;  4ZXE A;  2DDU A;  4GWJ A;  3WNL A;  1UWW A;  3BGA A;  2V4V A;  3K4D A;  5EJ1 B;  3C7H A;  4XUQ A;  5F7U A;  1NKG A;  4A41 A;  2W5F A;  2WN3 A;  5IYY A;  2EIE A;  2W47 A;  1TG7 A;  1JYX A;  4MGS A;  4JKL A;  1SDD B;  3DYO A;  3C7G A;  2WZE A;  2YFU A;  3PUH A;  1OH4 A;  4QX2 A;  1TVG A;  4UAP A;  2VCC A;  4QX3 A;  1UXZ A;  2QBX A;  2YC4 A;  3WQB A;  2BER A;  3I2G A;  1W99 A;  3MUZ 1;  1F4H A;  3CKH A;  2BGO A;  1US3 A;  3FN9 A;  3HN3 A;  3VD4 A;  2VM9 A;  3T09 A;  2VMF A;  2J1U A;  1US2 A;  4CU9 A;  1EUT A;  3OEA A;  2W1U A;  1J84 A;  3WF3 A;  1K42 A;  1J83 A;  1UYX A;  3I3D A;  4A3Z A;  4P00 B;  3GM8 A;  4A4A A;  1UXX X;  4XUR A;  2HYX A;  3GDB A;  3T2O A;  4L0P A;  3VDB A;  1OF4 A;  3I3E A;  1LNS A;  4QB6 A;  2Z4F A;  3DYM A;  2VME A;  3CMG A;  4TXW A;  1XNA A;  2E31 A;  1GMM A;  2Y6J A;  3UES A;  1T2X A;  4CVU A;  3HNM A;  4KMQ A;  2VZP A;  4XUP A;  4TTG A;  1GQP A;  2DCK A;  2EID A;  3WNO A;  1NUK A;  2QQJ A;  4W50 A;  2C9K A;  2W94 A;  2J7M A;  3I2J A;  4AG4 A;  2VMC A;  4OMD A;  3ACF A;  4P5Y A;  1O8S A;  2E26 A;  2WDB A;  2VR4 A;  3K77 A;  3GXU A;  2QQI A;  4PQQ A;  1JI6 A;  5G04 L;  3ABZ A;  1EUU A;  2YC2 A;  3OBA A;  1PMH X;  2WZ8 A;  2VO5 A;  3FL7 A;  3HJR A;  2W9X A;  3OEB A;  5JXI A;  3AC0 A;  2J1A A;  4MOA A;  2VOT A;  5C70 A;  2VMD A;  1UY3 A;  5LCW L;  4LPL A;  2W87 A;  2C26 A;  3HNB M;  4QB1 A;  3SKV A;  3LEG A;  4E8C A;  3CDZ B;  3HPN A;  2X09 A;  1W8N A;  3VD5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...