2WZ8A

Family 35 carbohydrate binding module from clostridium thermocellum
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
142
structure length
135
Chain Sequence
TINVYEAEDPANTLGGAAVRQRDNAASGGQYVGWIGNGSNNYLQFNNVYVPQAGTYRMVVQFANAEVFNVVDRYCSISVNGGPEKGHYFFNTRGWNTYRTDIIDVYLNAGNNTIRFYNGTSGSYAPNIDKIAIAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Signature Active Site Architectures Illuminate the Molecular Basis for Ligand Specificity in Family 35 Carbohydrate Binding Module .
pubmed doi rcsb
source organism Clostridium thermocellum
molecule tags Sugar binding protein
molecule keywords CELLULOSOME PROTEIN DOCKERIN TYPE I
total genus 32
structure length 135
sequence length 142
ec nomenclature
pdb deposition date 2009-11-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2wz8A00
4DEQA 3T0AA 4A4AA 1UYYA 1GNYA 5CYYA 5HXMA 3HN3A 2VC9A 3MO4A 4P5YA 2VM9A 3AC0A 3WNLA 3T08A 3E1F1 5EIYB 1JYXA 1CZSA 2VZVA 5B4NA 1J83A 5JR2A 3NRUA 1YQ2A 2VZPA 4XUTA 4BDVB 2W92A 4A41A 2Y6HA 1W0NA 3A21A 2EIBA 4QDSA 3GXUA 2JD9A 1UY3A 2WDBA 3VD9A 4A45A 1H6XA 1GQPA 1I5PA 3A23A 4OZOA 2J1TA 4CUCA 1PX3A 2W91A 1HN1A 2YFZA 2VZTA 2QQNA 2VCAA 4JKLA 5C7GA 5LA0A 1P8JA 5A1AA 3D3AA 1W99A 4JX0A 4L0PA 3HNYM 1CZVA 1T2XA 3CDZB 3WNMA 4BK5A 3P1IA 1UY2A 2WAOA 4CU8A 2W3JA 1D7PM 4A6OA 1W8OA 3WF0A 1SG3A 5EJZB 3SKVA 3FHQA 2QQJA 4UOJA 3F2ZA 3VDAA 5JXGA 4P00B 1GOGA 3HJRA 5F7UA 3IDAA 2J1RA 3OBAA 2W94A 3THDA 3VDBA 2E31A 2ZEWA 2JKXA 3OGVA 5LA2A 2VZOA 4RYDA 3HPNA 2VZ3A 1J84A 2XONA 3I97A 3SEEA 2VL4A 2E33A 5EJ1B 4AG4A 2ZEYA 2W46A 2Y64A 3CMGA 4MGQA 4DXRA 1KGYA 3DYPA 5I0DA 1DP0A 2WQ8A 2WUHA 3I3DA 2W1WA 5FUIA 3WNKA 2EIEA 3I3EA 5LCWL 1KEXA 1PMJX 2CDPA 2E26A 3OB8A 4QX0A 4ARYA 2Y6KA 2VQTA 3MUZ1 4XVHA 2ID4A 2W1SA 3SEPA 5IHRA 1K45A 2X05A 4QAWA 2BZDA 2XOMA 2VQUA 4M4RA 4OUEA 2JE8A 1JZ3A 4A44A 4OMCA 1ULOA 3I2IA 2C9KA 5G05L 4CVUA 3NQHA 2VOTA 1O59A 3NNGA 2ORZA 2W1QA 2YG0A 2EIDA 3J7HA 3C8XA 2W1UA 2Y6JA 1DLCA 4XUOA 1GU3A 1F4AA 4QB2A 3GM8A 1O8SA 4YPJA 2YC4A 4PT6A 2YC2A 3I3BA 3K4DA 1OF3A 1WCQA 3ACIA 4D0QA 4DUWA 3ACFA 2WZEA 1JYWA 2Y6GA 3A7QA 5JXJA 2VMEA 3T0DA 4UI9L 1UWWA 4QB6A 2QQOA 3I2FA 4Z2AA 2YFUA 3LQCA 3I2JA 1NAEA 3VD5A 1L7RA 3C7EA 2VMFA 1JYNA 5C71A 3HNBM 4XURA 4XZUG 4W50A 4QX2A 3PUIA 2W47A 1JU3A 3SKJE 1JZ6A 3P6BA 4KWUA 5C70A 1K3IA 3T2QA 1XPWA 2CDOA 4ZXEA 3I2HA 2EICA 1L7QA 1US3A 2W87A 2W95A 2XQXA 3MV11 2Y6LA 4LPLA 4XUQA 1EUUA 3T2PA 5DMYA 5DPNA 4MO3M 3C7GA 3K75B 3K77A 4W8JA 3OEAA 3UETA 3BN6A 3OEBA 4D8MA 3WF2A 3WF4A 5HPOA 3VD7A 2ZXQA 3HNMA 4MOAA 1W9TA 2PQSA 4GZ9A 2WZ8A 2J1AA 4BXSV 2VJXA 1JI6A 3FHAA 1K12A 3DECA 3LEKA 2J1EA 4JKKA 2VZUA 3IB3A 4PF1A 4QX3A 5IFPA 1OD3A 4JHZA 1JZ2A 2LS6A 1UY1A 4ZZ8A 2BGOA 5DN2A 1UMHA 2WYSA 1OH4A 2WN2A 1F4HA 4CU9A 2L9LA 5JXHA 4LKSA 2VO5A 3I2GA 2VTFA 3UNPA 5IJRA 1GUIA 1RYYA 3VDCA 3CIHA 3C7FA 4DXTA 3WNNA 2J7MA 2QQIA 4ZZ5A 1UY0A 2V72A 3ABZA 4BJ0A 1K42A 1UXZA 2X09A 2R7EB 4DUXA 4MADA 2VCBA 5JUVA 4KI5M 3WNOA 3GDBA 3WF3A 2WABA 2WO1A 2DDUA 2VZSA 4QDQA 4A42A 3ECQA 3W5MA 1CIYA 2DCKA 5G04L 2YB7A 2VZ1A 4CU7A 3ACHA 1O8PA 1GOHA 1H6YA 4GWJA 1PX4A 3IAQA 2LW8A 1UX7A 1CZTA 1OT5A 3LPFA 3IIIA 3LE0A 4FI9A 1W8NA 3PUHA 3CZUA 2V4VA 3CZJA 2VCCA 1CX1A 4ET7A 1DYOA 3OGSA 3DYMA 2WAAA 2J22A 2W5FA 1US2A 4TXWA 3W5NA 2BERA 4XUPA 2VR4A 4GWIA 3U37A 1WKYA 3IAPA 3CQOA 2VMCA 2WN3A 1JZ5A 4HG6B 3WEZA 1JZ4A 4QPWA 2RVAA 2ZEXA 3WF1A 4A3ZA 1NKGA 1PMHX 3GGLA 2J1VA 4E8CA 5J1XA 3K4ZA 3NJXA 2ZEZA 1MPXA 3LEGA 1UYXA 4ARXA 4QDRA 5JXIA 1EUTA 5DQ0A 3ZM8A 3THCA 4DEVA 2B4KA 2W9XA 2B9VA 4JKMA 5JMOA 3VD4A 3ACGA 4MGSA 3C7HA 4BK4A 2QQKA 2XHNA 3OGRA 2DCJA 3A22A 1NX9A 3I2KA 2Y8KA 2V5DA 2HLEA 4W4ZA 2RJ2A 3MV01 2RV9A 1LNSA 2HYXA 3BGAA 3DYOA 3T0BA 2QQLA 4M4PA 4AAXA 2C4XA 3FN9A 5B4XA 3HOBA 3EB7A 1XNAA 4DUVA 4ZY9A 4IUGA 1R64A 5IYYA 2JDAA 1GOFA 2WO2A 4CUBA 4DXSA 1UYZA 1UZ0A 2ORXA 1UY4A 4OMDA 5CZKA 1OF4A 3LPGA 2VZQA 3C7OA 1NUKA 3WNPA 4CU6A 4XUNA 1JYVA 3T2OA 1JZ8A 1JU4A 3CKHA 4UAPA 1W9SA 2Z4FA 1IQDC 1XNTA 3NJVA 3MUY1 2QQMA 4KMQA 2BBAA 2VMDA 5LA1A 4CUAA 3OG2A 1JHJA 1UMIA 2KD7A 2BGPA 4PQQA 3T09A 5IFTA 1TG7A 1XC6A 3WQBA 3K46A 4QB1A 4OYUA 1TVGA 1UXXX 2OKXA 2J1UA 1W9WA 2E32A 3JXSA 1SDDB 3WSOA 4LQRA 4E8DA 1GMMA 4RN5A 2X10A 2QBXA 4P08A 1SHWB 4LHSA 3FL7A 4QX1A 1BHGA 3MBWA 3EYPA 4P02B 2C26A 4TTGA 3HEIA 3ETPA 3LEIA 1ULPA 3UESA 2VZRA 2J1SA 3VD3A 2WO3A 2WBKA 3K4AA 1JZ7A
chains in the Genus database with same CATH superfamily
3AXDA 4DEQA 4FXGB 1TMF3 1OD5A 4A4AA 1COV3 2PHWA 1GNYA 5HXMA 3ZN6B 3ZSKA 1LEDA 1W8TA 1WD3A 4YVWA 5C5UA 5FXZA 3LDRA 1N3OA 3APBA 4HKLA 3WNLA 3T08A 3DGTA 2B45X 4D6RA 4TYSA 2WS92 4BQ2A 3BB6A 4RS5A 4R9BA 1NLQA 2VZVA 1J83A 4YW2A 1H2LA 4AEDA 5JR2A 1V9U1 5FMCA 4NRQA 3U11A 5J7MA 1YQ2A 2BV4A 4IV1C 4E9KA 4M01A 5F8PA 1PM7A 4XUTA 5EFUA 3AXEA 5LASA 4EZ4A 4N90A 1W0NA 2YUEA 3V0BA 2D6NA 2EIBA 3ACLA 3C2UA 3WW3A 1IHMA 5FZ6A 1HB4A 2ZGOA 4HSJA 4NIIA 3VD9A 1YC61 3GZUC 5FZDA 1GQPA 4EE2A 1IS4A 4MX3A 1F2NA 5C5TA 4YM1A 4LLOA 4OZOA 4ZS3A 4MGTA 4LK7A 5CVRA 1ZRFA 2BYVE 1LOEA 5C3QA 4LO6B 3PVOA 2ZZQA 4BISA 1GKBA 4PLNA 5I0SA 5AFBA 2YFZA 2R072 3S5AA 2A70A 1CAWA 4JKLA 4QGLA 4RS5B 2HKXA 4AI3A 1P8JA 4GA9A 3HQXA 4XTMA 4AL9A 2XL7A 3RZKA 3E5QA 1QH7A 2YGMA 1QQP3 3KF3A 5ACA1 4L0PA 2XUMA 2XJTA 1CZVA 2R0FA 3CDZB 3VZNA 1RUG3 2HWE3 3IPVB 1NCRB 3MEPA 2XJSA 1R1A3 3KVBA 2W3JA 3GALA 3MIEA 3PHMA 1HB2A 1D7PM 5DAQA 3MIFA 4RQPA 1S0DA 1W8OA 2IXIA 4HVOA 4AVBA 1SG3A 2ZZJA 2UY9A 3FHQA 2QQJA 3KT7A 1Y43B 5ERLA 2JIJA 4UOJA 4XAEA 1BMV1 2Y26A 4JV4A 1G6NA 2VULA 1VB4A 4Q4W3 2NM1A 4Z07A 1LGCA 5HCBA 4K1YA 3W9AA 4YW5A 1WBLA 1WW7A 1GOGA 4DPNA 1KD7A 2ZKNA 2QE3A 1JS9A 5F7UA 3HWJA 2Z69A 4LHNA 2J1RA 4FPFA 4QPGA 3B7MA 1PNFA 2E31A 2WT0A 4C1XA 2HWC1 4CDUA 3OGVA 3AP6A 1VBA3 2WNVB 2VZOA 4AI8A 5F5CA 3TN91 3I97A 2XBO1 5T5PA 4DINB 2IXLA 1RUJ2 1W0PA 4IEYA 1PM4A 3VZLA 1QXJA 2ZEYA 2FDHA 1ODNA 2W46A 4COUA 3CMGA 4FFGA 5ANNA 1DQ0A 2LM3A 1ZYBA 1DQ5A 1BBT2 4Q27A 4QU1A 5F3EA 4DXRA 2IC1A 5DDJ2 2RM22 5D2AA 2WUHA 2IXCA 1O5LA 3I3DA 1QGLA 3VBUB 1WMXA 1KFUL 1QMJA 3O1VA 5FLJA 2PHDA 2V73A 1FMD3 3I3EA 2XLAA 5KC6A 5LCWL 1KEXA 1BVP1 4I0AA 3QACA 5FZGA 3PMSA 4W65A 4QX0A 1S2BA 2Y6KA 2WZR1 2P37A 5E88A 5GLVA 1X33A 2PLV3 3MUZ1 4XVHA 3PL0A 5JOWA 1VBD2 3W20A 2JDHA 4KL1A 3SEPA 1IPJA 1O3QA 1R083 1XYOA 4QAWA 1H8TB 3RZGA 1R1ZA 4M0HA 1CWPA 4GQ7A 3VL8A 4COVA 4M4RA 4YVWC 1YFUA 2JG9B 1SFYA 2GMEA 3IDBB 1GANA 4JVAA 4OUEA 4Q29A 4QD2A 1MS1A 2JDUA 5FQ0B 3UGHA 2VTXJ 4WZCA 3FUQA 4LBNA 4A44A 4CPBA 2DCTA 1WMDA 2RS32 5FZFA 4QQHA 2AREA 3NQHA 3DXTA 4HN0A 2VOTA 1AR92 1UPSA 4YWAA 3WDTA 5IK8A 2ORZA 2W1QA 1RMU2 2YG0A 1HRI1 4YZ4A 4AE2A 2EIDA 2Q5TA 5LK7B 3NV1A 1Y4WA 1NA1A 1VRH2 4LJHA 4JDNA 4WM7C 4LXLA 1UZZA 1YQCA 3B5LB 3ST7A 4ZU4A 2FD8A 1MS0A 5HI0A 1EY2A 4LO7A 3R4UA 4BQXA 4DY3A 1DLCA 2XJVA 3M7AA 4JTOA 2BWCA 3B3QE 4BOWA 5FXVA 4UFKA 4XTPA 5GLZA 2RM23 3ZFGB 4EWAA 3GM8A 1PVC1 4HONA 1O8SA 3POYA 2ZKLA 5A80A 2DURA 3RNSA 3I3BA 3WG1A 1VMHA 2K0GA 1WCQA 2XJRA 2Q30A 3ACIA 3ACFA 2W68A 4XABA 1AR83 3LCPA 4Q4Y1 1X8EA 4UFHA 1JYWA 2VMEA 4FQZA 1QU0A 1OQDA 1REFA 2OPWA 1IQAA 4GMP3 4W6XA 4AQ2A 4NRMA 4QB6A 1UOBA 4CCEA 3NKGA 1MQTC 2CTVA 1XE7A 2A3WA 3IT8A 3LQCA 3H3ZA 3RG0A 3USSA 3I2JA 3ZPOA 1NAEA 1CAXB 3RJ2X 1EYBA 3H1WA 4FPOB 3C7EA 3FUOA 4YM0A 2RG4A 1OLMA 3H7YA 1QY4A 1W06A 2YC0A 4X8PA 3SNMA 5C71A 1FATA 3TB0A 5JDBA 5DUVA 1JXNA 3CNAA 3V56A 4AFAA 1DDLA 4FTBA 5H9SA 3LEMA 4DFSA 2ET1A 2PHRA 3SKJE 5C33A 4LR4A 3DPRB 3MPBA 3QLQA 3A0NA 2D43A 3SC7X 1APNA 5C70A 3T2QA 2A6WA 2AUYA 2DU0A 4J25A 4N43C 2JDZA 3MF6A 2VBPA 2H0VA 3FHIB 4LTAA 5CG9A 1O3SA 3KVAA 4ZXEA 2DFCA 2EICA 5LEKA 2ZGNA 2EAAA 2XQXA 1XQNA 4FFIA 1MS8A 4LPLA 2D6OX 2R063 5FBJA 5SV8A 4CDUC 3JBG3 3T2PA 2LALA 1YIFA 1RINA 5FLIA 4HVQA 4N53C 5FJHA 5C8CA 4MO3M 3C7GA 2OUHA 3K75B 4CP0A 5HCHA 4O9EA 3H8UA 2VECA 4GALA 2XKOA 4D69A 5SV5A 2FDGA 1NZIA 3OSDA 1NLSA 3WDWA 4D8MA 3OEBA 2WSUA 4Z8BA 5IK5A 3TN93 4IESA 2XMLA 1OSGA 3KB5A 4CDQC 5HPOA 1XXNA 4Y1VA 1A78A 1UAIA 5CKNA 1AXZA 3QD6A 2CSGA 1W9TA 4K21A 4Q0SA 4WVWA 2CAUA 2BNMA 2EXIA 1PMIA 2J1AA 3J7NA 3GYDA 4UW4A 2R49A 4C91A 4EZHA 4PJYA 4LBQB 5J48A 5BNNA 5DABA 1X9TA 5C9AA 2ADDA 3B94A 1HRI3 3POIA 4LULA 2RS11 1GWKA 2IFWA 3ZFFA 5K8SA 5LY2A 3HBZA 4IEOA 3VZMA 1OD3A 4JHZA 2VMIA 3DV8A 3ZXDA 1JZ2A 5FPZA 4UBHA 2YZ4A 4YW7A 4DOUA 1W6OA 1ND2B 5JIUA 2BGOA 2HWD2 4V2WA 1UMHA 3VBFA 2WYSA 1C5IA 1OH4A 2WN2A 1GV9A 1JTZX 1VIWB 3M3IA 1MVQA 3L2HA 4BHPA 1Z0HA 2VO5A 2PHXA 2OPKA 5J3UA 4MGZE 1OURA 1LECA 2GNMA 3AMMA 4QHOA 5FYHA 5FYCA 2JG9A 3VDCA 4IEPA 4UFJA 1YYNA 5GZGA 1I9RA 1DGRN 2IVIB 2VNRA 2XL9A 4IQPA 4O65A 4DXTA 3K48A 2EALA 4ZZ5A 2OQ6A 4BJ0A 3LFMA 5I93A 1K42A 2X09A 2R7EB 2QQPA 1ULGA 1QJY3 1SLBA 4YZ1A 5JLVA 1VBA2 1TME2 2VTXA 3TAYA 3BTYA 1BVVA 3FBYA 5JUVA 2YBKA 1Q8PA 4FTEA 3BALA 3GDBA 3M3QA 4HT1T 4HXCA 4CP2A 2GC2A 3VKLA 4XEZA 1CIYA 1E5SA 1M06G 1O7FA 2VZ1A 3VBHA 3NNLA 3DPRC 3JB4C 1AYN3 1O8PA 1AR81 3ACHA 3GZAA 3PDQA 4UW6A 5T50A 5DDJ3 5FK7A 1V9U3 1HDKA 3AMPA 1H6YA 2O8OA 2ZJCA 4I3PA 3OYWB 5FY9A 4RFT0 4W6YA 4QGMA 1PX4A 3WOGA 1OUSA 4HKWA 4NHMA 2G9ZA 2LW8A 4I02A 3I59A 4I3GA 1XSQA 4XOGA 2Q8OA 4IEZA 1CJPA 1RUD2 1PO23 5FPBA 2FDKA 1BEV1 4V2VA 3NNJA 4YVSB 5K9YA 2HBUA 1LHWA 1FOD2 4IERA 1MQTB 1TE1B 5FO9B 2FQPA 3D0SA 2B39A 3DYMA 5GZFA 4MHUA 3DKWA 1AR71 4W6WA 4JZRA 3WW1A 3CBNA 4XFHA 2EXKA 2VW1A 1CN1A 4XAAA 1UU5A 1WW5A 3HT1A 4AVTA 4CRQA 1VE0A 1WKYA 3IAPA 3B69A 5C3SA 4MV2A 2VMCA 3U07A 2VPVA 3VBUC 3FBMA 1QJX3 3WEZA 5FIXA 4HN1A 1JZ4A 3ZXFA 3C3VA 4LMFA 5A3OA 2ZEXA 3PMEA 3AYEA 3WF1A 3WW2A 2I45A 2BVVA 3RMYA 4A3ZA 4XF4A 1YFXA 1EV13 2J1VA 5C3OA 3PVBB 3OGGA 5I91A 5FZEA 5J1XA 3NJXA 5CNAA 3TRSB 3O1OA 1RXFA 2VE1A 5A3TA 2YHJA 1JMUB 3ZXEA 2CGNA 3BPZA 1HJFA 4XFAA 2B4KA 2W9XA 3D6EA 4JKMA 3ZN4A 1UKGA 1VJ2A 3ITQA 3C7HA 5CEHA 4Q8LA 4FCAA 3W58A 4BK4A 4HPKB 2QQKA 3VBSC 3H3UA 2YGLA 2TBVA 3I2KA 5FY7A 2Y8KA 1PGL2 1BQPA 4UBGA 2VOKA 5JPMB 1RHI3 2HYXA 1XU2A 4Q4V1 4QU2A 3F95A 1Q43A 3EBRA 5FYZA 1IKQA 4OVEA 2BRTA 1QXPA 2R043 5FYIA 3E5XA 4Y20B 1UO9A 2DYCA 2I2SA 1HV1A 4IV3B 4ZONA 5HCFA 1AX1A 2HWB2 2LRPA 3VZKA 4L9BA 1XRUA 4Q2FA 1VBC3 4L2NA 1VBB2 2JDKA 3DN7A 2WA4A 1QQP2 5T5JA 5IAXA 4ZY9A 1JH5A 2R1BA 4IUGA 5DAXA 4NHXA 1JUHA 2RR12 1CAUA 1HKDA 2G19A 3NKTA 1CAXA 1VBD3 1HRV2 2ZA9A 4DXSA 1JOBA 1UYZA 1STMA 4Y5SA 5CZKA 5FYUA 3OPZA 1FT9A 3J7MA 5F1RA 3AX4A 1GP6A 1MEC3 1JODA 1O6UA 1RC6A 3ATGA 3O7OA 2RDQA 3CLPA 4Q4Y3 3T3YA 4L97A 3B01A 4OQ8A 1QOTA 5EWSA 2JG8C 3NV4A 1V6OA 3B9IA 1W9SA 3VBHC 3I49A 3DPRA 5FYYA 1SBEA 1NYWA 5FY8A 4JGZC 3KV4A 4DY5A 2QQMA 2VVDA 1ONAA 3MLJA 4YW3A 4C1WA 1LOCA 2BBAA 2VMDA 5LA1A 4P9JA 1LODA 4EQVA 2AENA 2ZCWA 4XMIA 4D7YA 2B9UA 2KD7A 3PTRB 4I0BA 5JSOA 4YRDA 4LKDA 5IFTA 2VGDA 1A8MA 2Q8CA 4AOCA 1XC6A 2OZ6A 1VBB3 4Y5TA 4QB1A 3JCIA 5KWRA 2D6MA 4CDWC 3ROUA 1SQ4A 3K3OA 3H0OA 4GJYA 3N7LA 4QKBA 5FQ0A 2YYOA 1ZRRA 1FPN2 2RJLA 2ZS6B 1GMMA 2EVXA 2YPDA 2MNGA 1Q56A 4CXXA 3GCWA 4WVZA 5GZCA 1RUE2 4DRVA 1LHUA 5HCAA 3RSJA 2D5FA 1LHVA 4TTGA 4K3UA 4AQ6A 2BQPA 1OA4A 2UU8A 2WFF2 4FT8A 2Y0IA 4XYXA 1XNKA 3VD3A 1ND2A 3AZWA 1C57A 1ACCA 4EN0A 5JOZA 5C3RA 3Q8EA 2XJPA 5EHDA 5HXVA 1H8VA 2EIGA 1UZWA 5JPNB 3E97A 5L9RA 3INAA 4I30A 4AGRA 3R4SA 4IEXA 4XBNA 3T0AA 3ZO0B 5CYYA 3AB0A 2VC9A 3ZIXA 4NHLA 4LE4A 3N4MA 3MO4A 3OCPA 1KQRA 5CFDA 5FY1A 4OI1A 1V6JA 1V6NA 2RDSA 2R062 3QCWA 5EIYB 4Q0VA 3JBG2 5ABJC 5B4NA 3B9CA 4IXLA 1WA6X 2D6LX 4RQPC 4UW3A 1GWLA 1RL3A 1G9AA 1EV11 1RUI2 3M3EA 2QQWA 4YVWB 4INDA 2VZPA 3M2MA 1W6MA 4PCRA 4QKNA 5EQUA 5GLTA 3WG4A 2W92A 4KBBA 4A41A 4GKYA 3FFQA 3PJYA 3FE5A 5A7QA 4Q4X2 4AZZA 4EWEA 4RR3A 2OQ7A 3GXUA 3I54A 4P14A 1HJGA 1UY3A 3GHMA 3ZXJA 1MZ5A 4A45A 3ZR5A 3J8F3 1Y9MA 1H6XA 4AR2A 3GBFA 1F9KA 1I5PA 3NJZA 2H6CA 2PAEA 1ODMA 1VBC1 4XXPA 3IBMA 1DG6A 3V0AB 1QWRA 5FP9A 2VZTA 1W8HA 5C7GA 2RS53 3KGZA 3JU9A 1PZ9A 3H8OA 4LBOA 1Q8SA 1DGLA 1LOFC 3D3AA 1FX5A 2HWD3 2ZMLA 4QXHA 3WXPA 3ORJA 1RVF3 4PLOA 4A7KA 4RGKA 2HWE2 2WL1A 4XFIA 4GH4B 3BKZA 1Z7S1 2WQ4A 2XR4A 3P1IA 2WAOA 1E5IA 4WM8C 2AZ5A 2R32A 2ARCA 4UWDA 2RDRA 1RUG2 4CEYA 4FPHA 4AXOA 1W8WA 1AL22 4J6GA 5EJZB 1PO11 5FBZA 3SKVA 1F5FA 3ZLIA 2DUPA 1W39A 2VNOA 3AKQA 4DMIA 4CEWC 5HBAA 1UIKA 3F2ZA 3GNEA 3KS7A 3TYJA 5LWBA 4CCLA 1C5HA 4YNIA 4HK8A 1G8WA 5FY0A 2D6PA 3AYCA 1XSRA 4P9WA 3WD5A 1BK0A 5C9AB 1JBCA 4IEWA 2OS2A 3IDAA 5DUWA 5DAVA 1WLWA 3LIHA 2Y33A 4K8FA 1RHI1 2W94A 1TEIA 5AVPA 2ZEWA 4CDWA 2OT7A 4BPZA 2P5BA 4OQ9A 3NAPC 1QKQA 2VZ3A 1J84A 1DU3D 3SH5A 4YARA 1W2TA 4XDQA 4TLGA 1IZ3A 4K6BA 1BYHA 1TMF1 1RVF2 2R0HA 2VL4A 4HLTA 3ZN6A 3LIGA 4BQYA 1Q8VA 4AG4A 4QQ2A 2Y64A 1IS3A 1S1AA 3WQ7A 5FKBA 1KGYA 2AEYA 3MF9A 1DP0A 3ZXKA 2GC1A 4KQ7A 2WQ8A 4Y26A 1ZZ6A 4XJZA 5DAWA 4YW1A 2HYKA 1CQ9A 4QQLA 3M3CA 2WIIB 5D1IA 2CDPA 4LIUA 1S4CA 2E26A 1OVPA 2V4AA 2EXJA 1GZWA 2DVAA 4LA3A 4IEUA 2Z5WA 2E53A 2E51A 1HV0A 1KJLA 4Q8KA 1K45A 1GFF2 1VPHA 2D44A 1U5ZA 2UYAA 3VBOC 1S0EA 2XOMA 3PUQA 1Y9GA 4NUBA 4B8EA 1CIWA 2VQUA 4LORA 1R081 4QM8A 4XFBA 1A6CA 1N47A 5CFCC 2JE8A 2PQQA 1JZ3A 2HH9A 3O1SA 4OMCA 5FPAA 2TNFA 1K5JA 1RJ7A 2IUWA 5G05L 3RZZA 1HX6A 4CVUA 5ABJA 1IPKA 1POQA 4PDWB 4XC9A 1LHOA 2ZGSA 1CAUB 2HWF2 5E1RA 2IVJA 3ZMNA 2WWJA 1DIWA 1W8UA 2VH9A 2XDVA 1N3QA 1SPPA 3H9AA 2CY6A 4IE7A 3T1MA 3VBRC 2Y6JA 5F9TA 4XBLA 2KXLA 1VRH3 4N43A 2FDJA 3OGJA 1GZTA 4XUOA 3FC0A 1KDMA 1BZWA 4DRRA 4FPEA 4MLOA 2K2SA 1ENQA 1REDA 4YPJA 4E2SA 2YC2A 1LU2A 2WRAA 2CGPA 4D0QA 1TNFA 3AYDA 2WZEA 4UYBA 2Y6GA 2VAUA 4OUMA 4BCUA 2V09A 3RQ0A 3AMHA 5AC92 4JGYB 2NYYA 2D3PA 3DUIA 2QQOA 4COYA 4IE6A 4AEJA 4HPKA 5L7OB 3VDDA 1LOFA 2QZ2A 4CDQA 5BYNA 2ARXA 1DGWA 3DF0A 3VD5A 2K46A 3JD73 3D5OA 3BTAA 4I2OA 2GNTA 5IVYA 2VMHA 3GCXA 1UOFA 3UKTA 4YZ3A 2BFUL 2A3YA 2NN8A 4ISRA 4XW3A 4GIQA 4AI2A 4NOTA 2RS13 5A7PA 4AQSA 4XURA 2BDRA 5L9BA 4ZPIA 4FP3A 1GQGA 4AYUA 4CEWA 2QKDA 1JU3A 1H2KA 1EP0A 3N9QA 4FOQA 1JZ6A 1BK1A 3MIGA 2HBTA 4KWUA 2XXZA 5FFOC 3ZSMA 3KD4A 1XE8A 4G3YC 3O1RA 3WUCA 1HQNA 2JEMA 3RYPA 1CD3G 5EJ3A 3ZXGA 4P9IA 3WZ1A 2PLV1 3WR0A 4XQ4A 1ND3A 1R1A2 2PHLA 2W87A 2WNUB 3MV11 2ZGKA 5FZ4A 2WS93 2JJ6A 3PUAA 4QWNA 5K0UA 3V64A 3I3MA 3VBHB 1SZBA 1B35C 1PO22 4PHZA 4WVMA 5F6LB 4CCDA 2VVEA 1ZBA2 4AWDA 3ZYBA 5EV7A 4Q4W2 4ONUA 5LBBA 3WF2A 1IOAA 5F6KA 4JCKA 2GMMA 1EPWA 3W59A 2Y34A 2JD4A 4MXWA 5FZ1A 1SLIA 2VNGA 3HNMA 1QNYA 1GSLA 1EAH1 1VAKA 4CDWB 3E5UA 4HMZA 5FZLA 2ZGUA 3P3NA 5LATA 1AR93 2VOXA 4XFFA 5E16A 4BXSV 1ALYA 1RUF2 1JYCA 1JI6A 3PJQA 2MEV1 3OYWA 4D94A 5KHGA 1L7LA 4AHYA 3FHAA 1AVBA 3LEKA 4TWTA 3MI8A 4JQTA 2NMNA 3IB3A 3AFGA 2ZHLA 2LS6A 5FZBA 4BA6A 1UF2C 5LRSA 1H4GA 1QJX1 2QCSB 1C8M2 3IDCB 1YJLA 4JGZA 5EZWA 2J42A 4BQ3A 3ZYPA 4E4HA 3HN1A 5FPXA 5CFCA 4CCCA 5FV3A 4MYEA 2L9LA 2NZ9A 1E5HA 1NCRA 1LR5A 1FI2A 2XQRA 1Y3TA 1HB1A 1MEC2 2K9ZA 3EMRA 3VBSB 5IJRA 3LF7A 5FCCA 2LUWA 3CL1A 3ZYJB 3M3OA 1PVC3 1GNZA 1ZBA3 4ZHNA 3BI3A 2J7MA 2RMU1 2WFF3 3KHBA 1CAWB 2W08A 1ZRIA 4P5HA 1ZRCA 1TNRA 1UXZA 3VB9A 5F5IA 1EPZA 1RUH3 3CJIB 1AF9A 4DUXA 4CCOA 4LE3A 5C8WA 4M0NA 2RS33 3CEWA 1MR5A 3RJRA 3VBUA 1UYPA 3HD8B 4MSVA 3OD4A 2WABA 2WO1A 2AH2A 4A42A 1LEMA 1J1TA 2B7YA 3GHNA 1ULFA 2DCKA 3AKRA 5G04L 5B2GB 2YB7A 3W5MA 4BLIA 2VUCA 3E6CC 1W3VA 3PU8A 1RUC2 3R0RA 1WMEA 2ERFA 4ZKTB 3N9NA 2CWMA 3AJYA 3PIJA 3HIFA 3VDDC 5I8YA 4P9LA 3GZEA 2Q1ZB 3O1TA 1HIXA 4M3CB 4X6RB 5D8AA 1UX7A 3A4UA 5KHIA 1DQ4A 4CCJA 3I4IA 1HB3A 2E7AA 3IIIA 5C4WC 5F5QA 5T52A 3LE0A 5BPXA 2QDNA 5FZIA 1UU4A 3NNFA 4PBPA 5A3UA 2BEOA 2V4VA 5CU1A 1DGWX 1RUH2 2VCCA 4L92A 3AZXA 1CX1A 4ET7A 4LITA 1FOD3 4UW5A 4AW7A 1CGPA 3OGSA 3WG2A 2P4EA 3O5SA 3TEWA 2EXHA 1XNDA 1W6QB 1WLCA 4FOYA 1VBE1 1W8ZA 4TXWA 4RHV2 4CE8A 4D7TA 3AL6A 1U0AA 1AR73 5GALA 1JYTA 2WNUA 4XUPA 1R091 2PA7A 1ZBE1 1AXKA 1XOYA 5DG1A 4EROA 1RUC3 1X7NA 4IGPA 3ILNA 3UGGA 1JZ5A 1J1LA 1N3PA 1Q8QA 2DTWA 3RWNA 3WUDA 5APAA 2A6XA 3M8LA 1PMHX 4HKOA 4KWLA 2PHTA 4AF9A 1LULA 2D97A 3GGLA 4GB31 1N1VA 3FZ3A 4R52A 1FMD1 1WW4A 2UWCA 1MPXA 4XFGA 4ARXA 4Q0QA 2GC3A 4OFGA 4AQTA 2Z42A 3WHTA 5AVAA 3BCWA 3H7JA 2YV8A 2WZPP 3ZM8A 4CA9A 1ZRDA 1KDKA 2F17A 4TZDA 1X50A 2DUOA 1WW6A 3AP7A 4YW6A 2DCJA 4S2FA 5E6HA 3JD72 2XPJA 4LT5A 1QJY1 4JAAA 3NVCA 5FJKA 4AI0A 4WM8A 1GQHA 3MV01 1HXS2 2DVGA 2WYFA 2ZGRA 2R041 3LZZA 3ENRA 5JAXA 4MVTA 1ZZBA 2WC2A 1UL9A 5GZEA 5FZ3A 3SQOA 3WDYA 1AR62 2X29A 4AHWA 1D2SA 1WCKA 1NCRC 3B00A 3WNXA 2C4XA 2RS51 3FN9A 3WP3A 5B4XA 2ZX3A 2VQ0A 3ME2A 2GSYA 2YU1A 1AYN1 3CHXA 3SMHA 4E2QA 2P3YA 5CAZA 2I74A 4I09A 4NIAA 4NIDA 4LHKA 3KV6A 2ZHMA 3MFAA 5FZHA 5CB7A 5I0UA 4RS5C 1YUDA 4CUBA 4Q26A 2NP0A 4BLJA 1QDOA 3N9LA 5IVEA 3IZOA 4NIGA 3LPGA 4NWWA 4HETA 1NCQC 3PTYA 3CU7A 4K7JA 5LBEA 1SLCA 3ETQA 1QJU3 1UZVA 5T55A 4R9CA 2VQAA 5FMDA 3SISA 3T2OA 1JYVA 1FNYA 1GICA 1UX6A 1NXMA 1SLAA 4N53B 3HMYA 4UAPA 2CGOA 3POEA 2D40A 3RI8A 3UT0A 4XJAA 2Z4FA 2JECA 1W0OA 4B4QA 4H14A 3NJVA 1RTVA 2EA7A 2ZACA 5D8AB 4MHRA 5EYYA 1AYM2 5A6QA 1ND2C 1G9DA 4K8RB 4XDOA 5FPUA 2DBIA 3B93A 1RUF3 2GP5A 2Z2SB 3OG2A 1D4M2 2E9QA 4OUSA 1GZCA 4B4PA 2Y38A 3N3HA 3URFA 3R4DB 1X8MA 3OUHA 4Q4V3 4ES8A 1YQ6A 3KWVA 4GH4C 4ORFA 5FPVA 5HV4A 4FTSA 1MS5A 2W0XA 4E4DX 1ZZCA 4X6QB 3WQBA 1W05A 5A33A 3UKNA 3KT4A 1XNBA 4AHZA 3Q8BA 2GU9A 1BXHA 4I01A 1W2OA 5IWFA 2OKXA 3RS6A 3MLLA 4A6SA 2A6ZA 1KFXL 4PQ9A 4QGNA 3ZPYA 1FPN3 5GM0A 1QJZA 1PGW2 2IFRA 2PMWB 4BE3A 4E4ZA 3SITA 3ZIWA 1ASJ3 3QOPA 4D6SA 3DXUA 2SLIA 2QBXA 2X10A 4LO8A 3WW4A 4XCBA 3AMNA 3O1UA 1SHWB 2GH8A 4LHSA 3ZFGA 1RIRA 4HSLA 4QX1A 5F3IA 4AVCA 1SACA 1GBGA 3MBWA 3NNMA 1GZWB 1BMV2 4AAPA 4FAGA 4LK6A 1OA3A 3ETPA 4YGEA 4E27A 2OYZA 2XB6C 5A6YA 2WWSA 4YG3A 2O14A 3SCHA 1OVSA 3UESA 4NAMA 4XF3A 3CF6E 1SMVA 4Q0UA 3MIHA 2ZAAA 4QPGC 2WT1A 3T30A 2ZX2A 2C0ZA 4RQPB 2VXJA 3JQWA 4XF0A 5FZ9A 2JDPA 2WO3A 2WBKA 4YYOA 3U75A 5J98B 2HWC2 1NY71 3K4AA 5BNPC 3BOPA 4WM7B 5BNNB 1E5RA 3ES4A 1LRHA 1RUJ1 1YHFA 3ZKYA 1H9WA 3WV6A 3AC0A 1YXWA 1GP5A 2QNKA 2QQVA 5FY5A 2FMDA 5BNPB 4M00A 2P34A 3ZYRA 2P17A 3RZLA 3M4FA 4HZFA 5DDJ1 3ZYFA 2RM21 3NRUA 4P9GA 4YSFA 4XF1A 3EJKA 3D0JA 1ASJ1 5L7OC 3FLRA 1NE6A 1WCDJ 1RUNA 3VL9A 4SLIA 1RUI3 5FMOL 4Y1YA 4LOSA 1ULDA 1H1IA 2Y6HA 2ZGPA 3A21A 2P3JA 2WZR2 4QDSA 4UF0B 2WDBA 1LKNA 2D7FA 3M70A 1VBD1 1URXA 2JG8B 4R9AA 4AVAA 4N9HA 1GLHA 5DG2A 4QHBA 3A23A 1IKPA 1W6MB 3J8F2 5CKMA 3U0ZA 1PX3A 2W91A 4UT5A 3NAPA 1D2QA 3HT2A 1COV2 1PIV2 5K0UC 1POV3 3LWCA 3NMBA 3WCSA 3ZSLA 2HWC3 3BUCA 1AZDA 5LA0A 4M3CE 4TN7A 1MVEA 5LEJA 1WLDA 2PAKA 5CFDB 1W99A 1HRI2 4JQRA 4DO0A 4COWA 3MW3A 1RUJ3 4JX0A 5H9QA 1V6LA 1VRH1 4PDWC 3KT1A 3UJQA 2MPFA 3TWIA 4ISQA 3WNMA 3MPPG 1J3QA 4BK5A 4CDXB 1QJU1 2OIIA 2ZX1A 4D7SA 1W28A 3VKFC 5F39A 1J3PA 4Y5Z0 2WFPA 4EWDA 1C8NA 5FO7B 4A6OA 3KV5A 3ZVXA 1PVC2 3BVCA 3WF0A 1H8TC 4FOVA 1O4ZA 5A32B 1BKZA 1W6OB 4S2DA 4HFSA 5JSRA 5L9VA 4Y22A 4RR3B 3V0BB 1SCSA 1POV0 4Q4Y2 1YLLA 5KHKA 5JXGA 2XHKA 1MZ6A 1MQTA 1H4HA 3OBTA 4N8MA 3ZXLA 4A7YA 3QH7A 5IW0A 1JHNA 3KMHA 3O0VA 5JCTA 2A75A 2JX9A 3VDBA 1V6IA 3WCRA 3BODA 2JKXA 3HAGA 3ZKUA 1SBDA 3AZZA 5CA6A 2VW2A 4BQ4A 4MXWB 2HJIA 2ARBA 1Z78A 2A7AA 1DZRA 3J26N 4HANA 4LO5B 3WG3A 4A7ZA 2ZABA 4NPLA 3CJXA 3SEEA 3R6SA 5EJ1B 4LO4B 3RPQA 4H7MA 4ZS2A 2WS91 2HWB3 4Q1PA 3DKQA 2W2IA 5I0DA 1HW5A 1F35A 1I5ZA 1KS4A 1QJFA 1V9U2 4YZ5A 5FUIA 3AYAA 4FPLA 4QXKA 4K40A 5JI9A 2FDIA 3VZJA 3OB8A 4F7ZA 4ARYA 3MDPA 3I2OA 5H9PA 3ZYGA 5GKAC 2ID4A 1GP4A 2D6KA 2W1SA 4A2UA 1HRV3 1XYNA 3UYJA 1CJDA 5BNQA 3MW2A 1G9BA 4C8DA 3RYRA 4XETA 1JYIA 1VMJA 1LHNA 3O14A 1OKQA 4WM8B 4BB3A 3BOWA 1H2MA 2R071 1H30A 2WKKA 2C9KA 3A0KA 5FTTC 3OJBA 4RFRB 1UNBA 4NN0A 3PU3A 2OXBA 3PNAA 2QQUA 4LNVA 3NNGA 4JDOA 4CP9B 4EN9B 4YM3A 1YQ8A 5L7OA 4XACA 3C8XA 5D21A 5ACA2 1NZCA 5BNNC 3ELNA 2C5DA 3WDVA 1LCLA 3I7DA 2W1UA 2CHHA 2RJKA 2F4LA 3VHNA 1CAVB 1U5XA 4LBLA 4LUMA 1QJEA 4QXBA 4Y1UA 1W3XA 3RVHA 4KH9A 5T54A 4BU2A 1GU3A 1YJKA 2VVFA 1TZOA 2YC4A 1FYUA 1IGOA 3MLKA 4PT6A 4QPGB 3KGLA 3N9PA 5FZOA 3K4DA 4EN8B 2HWD1 1OF3A 3WINE 4DUWA 1B35A 1K5MC 5JXJA 1U12A 2TUNA 3H3LA 2ILMA 4UI9L 1UWWA 2ES3A 1UN1A 3MIDA 2P3KA 3AP5A 4IW3A 4Q4X3 4IE4A 2WO7A 3I2FA 4Z2AA 1XU1A 5KC5A 1VR3A 3TEYA 3LDBA 2KA3A 5JR7B 1YEWA 5DUXA 2VMFA 5ABJB 2DBNA 4K9SA 4NVPA 3TN92 2XBO2 4HL0A 3AVRA 5LB6A 5FZKA 5C6CA 3HNBM 1DZQA 3EQEA 2JXAA 5CADA 1JUIA 5FZMA 1VBA1 1TME1 1NE4A 3NV2A 4E4SA 4XZUG 4W50A 4QX2A 2VUDA 3PUIA 1RMU3 2W47A 4PIZA 4YW4A 2CNAA 1BBT1 3ON7A 2ZMNA 4Z2WA 3PURA 4FXKB 4J1WA 1W90A 1AJKA 1K3IA 1C1LA 1OXCA 1XPWA 3KLSA 2XVGA 1HN0A 3I59B 4DNYA 4BQ1A 5JZGC 1O4YA 2CDOA 1AR82 5IUQA 2XWJB 3KV9A 3T1LA 1L7QA 1PHMA 2PXJA 2W95A 3U4SA 4B1MA 1PGSA 2BJSA 3JZVA 4XUQA 1EUUA 3AKPA 4B29A 1O3RA 5FPLA 1GYKA 5DPNA 3NL1A 2ATFA 3VHOA 5FLHA 4R9DA 4W8JA 2EF6A 2XGXA 3EXUA 3RI9A 3UETA 1RUD1 3OUIA 4CDQB 2XJQA 5JWPA 3E6BA 4LLFA 3TBDA 4CTEA 1BEV2 3LA2A 2LROA 3ZX7A 5FWEA 4AFBA 2X5IA 1FOD1 2RS31 4B4RA 5M0TA 4IDZA 3VD7A 2OW4A 3T2TA 5KHHA 2OA2A 1G86A 1B35B 2CAVA 4ES9A 5F3CA 1AR91 4MOAA 2PQSA 4GZ9A 4BYYA 4RHV3 1RMU1 2XBO3 5EYXA 1AR72 3NW4A 4DXZA 3ZYHA 1EAH3 2VJXA 4FBFA 4L99A 5FREA 4BQWA 2XLGA 1WCUA 3POBA 3QBQA 4Y33A 1YQ5A 4AEKA 1Y9QA 4FQ4A 5A7SA 3DECA 4WM7A 2J1EA 4JKKA 2E7QA 4N43B 5EPAA 2VY0A 1R093 2VZUA 4PF1A 4QX3A 4NJ4A 5A7WA 3SXWA 4Z82A 4JRAA 2JIGA 2Y60A 1UY1A 2G9FA 4ZZ8A 2BOIA 3VBFB 1YCIA 2A6YA 1ST8A 3IDEA 3KF5A 4N7IA 5D8AC 2R1DA 5F2WA 3IN9A 2GMPA 3FLTA 1F4HA 4Y4RA 2RHPA 4CU9A 5C4WA 1VB2A 5LRRA 4XJWA 2ZOEB 4LKSA 3DL3A 1SDWA 4H55A 5GLUA 2EAKA 3USUB 3UNPA 2BBVA 1GUIA 4CYDA 3ILFA 3I2DA 2QJVA 3H8XA 4AVSA 3C7FA 3POFA 4LBQA 3WT3A 1NCQB 3WNNA 2QQIA 2WA3A 1UY0A 1DLLA 4OI2A 4EV0A 3IMNA 1QDCA 1DHKB 4NPMA 3LAGA 5IK4A 2WLPA 2WNOA 3WX5A 1K5MB 4HK9A 4MADA 5JVVA 4BMEA 1KITA 2WNUC 5J36A 1ENSA 3KZ4C 3KHCA 1PGL1 1S0FA 4FAHA 5KXDA 2VD7A 3PUSA 3WF3A 2JB8A 4Q4V2 4A3XA 4PIXA 1AX2A 1WMFA 2VZSA 3ZFGC 3OOXA 3ECQA 4AGGA 2PAMA 4H3WA 4IV3C 2ZPXA 1H2NA 3ZR6A 4LOTA 2ENRA 4CU7A 4ZU7A 5L73A 1GOHA 2GZWA 3O0XA 4QKDA 1G9CA 3HQRA 3SCGA 2JICA 5FOBB 4Q5OA 1NG0A 1LGBA 4AEDB 4B3NA 5KBFA 4GWJA 1O4TA 1NQJA 3J9SA 4CSWA 2NPIA 3L2YA 3LPFA 4N53A 5C8CC 5BNPA 1YIPA 1L3JA 4FI9A 4NRPA 3RZHA 3PUHA 5FZ8A 3CZUA 2X5IB 5ANQA 4AFDA 4EJRA 3MW4A 3CZJA 1DFQA 1DYOA 1VLNA 4JGYC 4QQPA 5DAPA 4DQAA 4E2GA 5BNOC 5J96B 3OTFA 3HVDA 3TNPB 4AI9A 5C4WB 3FJSA 4MGKE 1LJ7A 5IVBA 1PIV3 3I3QA 2J22A 5KXBA 2R073 1AL0G 2W52A 1US2A 1ZBE3 4N7UA 2BERA 5CISA 5L36A 3WP4A 3U37A 1Q3EA 3CQOA 4BMBA 2RS12 4O7XA 4YM2A 2XG3A 3LFIA 4HG6B 3KQ4B 2QTWB 3J4UH 2XWBB 4QPWA 3ZFFC 4XF9A 1J59A 3V65A 3AM2A 1OFNA 5KHJA 2BU9A 1A3KA 2JENA 4YG0A 2H0BA 2JDYA 4OI0A 3THTA 1OPOA 1D0HA 4URTA 1WUVA 3BYWA 4IE5A 5FXWA 2V5YA 4GB33 3RWKX 2PHUA 3M1HA 3LEGA 1UYXA 4HVRA 5DZFA 3USUA 4QDRA 4ATFA 3CJIC 2OUJA 5DUUA 5I8SA 3NAPB 5FYVA 1EUTA 5DQ0A 4FPKA 3T4VA 1FPN1 1OA2A 2JG9C 2ZBJA 3ZMOA 4DEVA 5A6XA 2B9VA 4AHXA 2JWPA 4YVSC 3LA3A 5JMOA 1QXRA 2ZX4A 5JI7A 2AR6A 2D3RA 4GXLA 4R4ZA 3SH4A 5C8CB 2A6VA 2DTYA 1RUE1 2DVBA 4WVMB 3OGRA 1O91A 1SBFA 3A22A 2O8QA 5F3GA 4ZU5A 2HLEA 3OUJA 4GD4A 1ND3B 1AJOA 4BZ4A 4QQOA 2RV9A 1LNSA 2OVUA 4RL7A 5LK5A 4LKFA 4XPVA 5A3LA 3R05A 5A7NA 1H8TA 2BOJA 5FP3A 1SCRA 1IS5A 5JOYA 1C4RA 2JDMA 5A6ZA 1VP6A 1OKOA 2C9AA 3HOBA 4U36A 2F6BA 4QT6A 3EB7A 2BPA2 4Z1VA 2LTNA 5FP4A 2X53S 1SPPB 4DUVA 3POSA 1LB2A 5CFDC 5DZGA 1QNWA 1R64A 5IYYA 2JDAA 3K51A 3THPA 5H9RA 4NROA 3GBWA 5LY1A 1OLQA 2DCZA 1Y7BA 4NAOA 5K7PA 1OHFA 4OMDA 1BJQA 1OF4A 2VZQA 3EHKA 2QUOA 3C7OA 4OCTA 1ZX5A 3WNPA 2YU2A 2VBDA 4XUNA 5FMOS 3WVJA 4JDMA 1T6GC 1UPIA 4NHKA 3S57A 1JZ8A 4CXYA 4IV3A 2YY1A 3JB8A 4CXWA 2Q1FA 4YFWA 4CEWB 5BXXA 3NV3A 5FUPA 1U5YA 1HLCA 1CVNA 5J09A 1V70A 1KXGA 1ZZ9A 2B46X 1DZTA 1KS5A 2NQYA 1VBC2 4G9SB 1JHJA 1UMIA 3Q9OA 3D82A 4CDXC 2BGPA 4PQQA 2QZ3A 3T09A 4LBQD 1TG7A 1H1MA 1WZXA 3U1XA 3GBGA 2UWAA 3WP6A 2TEPA 2NMOA 1HQLA 2Y6FA 1AHSA 1OI6A 1ZNPA 1BLZA 1UQXA 4MXVA 5FRAA 3RMXA 4QPIC 5FYSA 4OYUA 4KBZA 5A7OA 2J1UA 4JGYA 1X9PA 3JXSA 3T4HB 1SDDB 4B7KA 2HWE1 5JIAA 2UURA 3RRDA 1Z7S2 5FYMA 2HEYF 4GKXA 1AX0A 1V6KA 3ZFEA 3MIBA 2WNVA 4GWNA 4LQRA 3UGFA 4E8DA 1XYPA 4BH9A 2BWAA 2VBBA 2UY8A 4XIKA 3O0WA 5FZCA 2ZGMA 2DV9A 3AK0A 2WINB 3GF6A 5A3PA 3I8TA 1BHGA 2IXHA 2PFWA 5LA9A 3VBSA 4FOWA 3EYPA 4ASKA 2C26A 1GZ9A 4L8QA 4XILA 1T6BX 2GH2A 3HBKA 4M3CF 4GJZA 5LW9A 1N1YA 1YRZA 4JC1A 1RB8G 1RGSA 2VZRA 1VBE3 5FZ0A 2Q0AA 4NO4A 4NR1A 4HOOA 3ZXAC 1UIJA 2FCTA 2HWB1 3PLQA 1AR63 3WDXA 1WLTA 3TOJA 3VGIA 5F37A 2JB4A 4FPCA 2XKPA 1VBB1 1JZ7A 1QQP1 5FK8A 4FPYA 4MGIE 2VW0A 1SEFA 2WR9A 3VKMA 1DQ2A 3VBRB 1UYYA 3O12A 3HN3A 4P9XA 1TMF2 1RVF1 2G4IA 1Z7S3 4P5YA 2VM9A 2RR11 1W04A 4WVVA 2KR2A 3E1F1 4XJUA 5FP7A 1S0CA 1D4VB 4AGVA 1HRV1 4PIYA 1JYXA 3B02A 3POJA 1CZSA 4AK3A 4LBMA 2Q4SA 1LOBA 3V0AA 3S0MA 3S30A 1UKRA 3VHRA 4GMP0 2D3SA 3H1MA 3KCYA 3OY8A 5F5AA 3GJAA 3TEZA 3OBZA 1W9FA 4BDVB 4XQDA 3VBOB 2AEZA 2JG8A 1YI7A 3BPSA 3KSCA 2CV6A 4LEJA 1C1FA 2JD9A 4BIFA 2PTMA 1FV2A 4WBBA 4XE9A 1GNHA 4XIOA 5JMCA 3UL2A 4CEYB 2BUKA 2MHFA 2J1TA 3NSTA 4IEVA 4CUCA 1J3RA 2CL2A 2CU5A 2G1MA 4X8NA 1HXS3 3G7DA 4XJ8A 4YGCA 1HN1A 4NWVA 3E6DA 3GJBA 4PBOA 2QQNA 2VCAA 1W2UA 4NE9A 4R4XA 2ADEA 3ILRA 3VKOA 3P5BA 3MZHA 4QX7A 4Y1ZA 4QPIB 1PNGA 4XHBA 5ACA3 2FZ1A 2HWF1 5IAVA 4CZSA 5A1AA 1IG0A 4OHVA 2F4PA 2BVBA 3LKJA 1YFWA 1JW6A 3SH3A 3HNYM 1CONA 5FY4A 1T2XA 3H42B 4XZPA 4CP1A 3ZFEB 1ULEA 3LD8A 1UY2A 1H0BA 4IGOA 4CU8A 4O61A 4TLFA 2VMGA 1N1SA 2GP3A 4LA2A 4B7EA 1DYKA 2FDFA 5FZAA 4JGZB 1UZYA 4CDXA 4GMP1 5FP8A 3VDAA 1AUYA 1YWKA 3N36A 4P00B 1CPNA 2E63A 1YI9A 5A1FA 5AC91 5BUVA 1OC1A 2WFF1 3IMMA 2BW8A 3OY8B 3HJRA 1B09A 3EO6A 2B42B 3PVEA 4QPIA 5FZOB 2MEV3 3OBAA 3THDA 5IVFA 3UKVA 4WV8A 5LA2A 5GZDA 2BP6A 3VUOA 4RGAA 4RYDA 3HPNA 2IXJA 2XONA 1I1EA 2E7TA 2UWBA 3ZFEC 1CAVA 1ZVFA 1O3TA 1D4M3 3BIWE 3ES1A 1LAJA 5C3PA 3AL5A 3ALQA 2E33A 3LDKA 3OD0A 5FWJA 1H9PA 1JOJA 1VAMA 3LB9A 1C28A 1O5UA 1DGRA 1OUXA 2XH6A 1PK6A 5FZ7A 2R061 1PZ8A 2DFBA 4MGQA 3JBG1 2IXKA 1S55A 4QPYA 3DYPA 2IZWA 2ZX0A 2JE9A 5K0UB 4KNCA 4RSUA 2NLRA 2ZTNA 1EV12 3MGUA 1V6MA 1RUI1 2W1WA 1G7YA 1OLRA 1PO13 2Y0OA 4MH0E 3WNKA 4GWMA 3WLUA 2EIEA 2PYTA 3LOIA 3WDUA 1OMIA 1PMJX 1QOOA 2PLV2 5FYTA 1OOPA 4QMAA 1K5MA 4Q4X1 5IVVA 4XFCA 1R1A1 1W2AX 2B8MA 4NPRA 2VQTA 3MICA 2XJUA 4SBVA 4QHZA 4RR3C 4QKFA 1MACA 5IHRA 4CCNA 3HQUA 5BNOB 4Q1RA 2X05A 1PO21 2BZDA 3Q8CA 1OH3A 4LBJA 2P1BA 3H8RA 5IVJA 5AC93 3N7JA 1POV1 4IV1B 2VOWA 3JUUA 2C6SA 3POWA 2GC0A 2ETEA 4IGQA 4IL7A 4DIQA 1LESA 3ZYIB 2GN3A 1S0JA 1NOVA 1ULOA 3I2IA 3VN4A 2D5HA 4ASLA 1W6NA 1ZM1A 5IATA 2BNOA 2P2KA 3VV1A 1NLRA 5AFEA 5JOXA 1EAH2 1O59A 1A8DA 3WQ0A 3J7HA 5JSPA 1RUF1 1LU1A 3VDDB 1J58A 4C0HA 1QIQA 4QX5A 3ZFFB 1REEA 1IPSA 1FXZA 5JZGA 4HBNA 1UD1A 4NMIA 1RUG1 1MS4A 4IETA 1F4AA 4QB2A 4MG2A 1ENXA 5CIRA 5IK7A 3IKWA 1AL21 2ZMKA 2FHRA 3W21A 3UK9A 4OI4A 4AVVA 1PO12 4CEYC 4B1LA 1C8M1 4IEQA 5GLWA 4XHXA 5A3NA 2CYFA 2RDNA 4PI0A 1WGPA 4YGDA 5KR7A 1RUOA 4K1ZA 2DCYA 3A7QA 3T0DA 1GWMA 2E6VA 1QOSA 3MHZA 1MEC1 1WD4A 2JKBA 2IWGB 1KRIA 3H50A 1RHI2 2X5IC 1NA1B 2YFUA 3D8CA 5LBFA 5BY5A 5T5OA 2FCUA 2RE9A 5FMBA 4JTNA 1L7RA 4OHXA 2YBPA 3KQRA 3U78A 1JYNA 2DVDA 3TEXA 5GJ6A 4BQ5A 4YFZA 4MGYE 1S0BA 2VCMA 1UU6A 2ET7A 1I3HA 3FFZA 2Q8EA 4UFMA 2ARAA 4IV1A 1VMFA 2DWRA 5DXDA 1X36A 3LSEA 1DF0A 1LENA 2A1XA 2HWF3 4IE0A 4S2GA 3KCXA 2R30A 2A71A 4YVSA 1LTEA 4OHYA 1F15A 1N1TA 3P6BA 4QXCA 5A1LA 2RR13 1RJ8A 2WQZC 1NQDA 2XUEA 4MZUA 4Y4YA 3ZSEA 4CUGA 1IG3A 1C8M3 1F8VA 2W39A 4GULA 1ZA7A 4CCMA 2WWUA 3AZVA 1RUC1 3O1MA 1OFSA 1OOPB 3MFCA 3I2HA 3BTXA 2HEWF 2QDRA 1US3A 3IM0A 3O1PA 2Y6LA 4DB5A 1YFYA 3SHRA 5DMYA 1W2NA 3P3PA 4OZXA 3AFKA 3BTZA 3K77A 4KG8A 3OEAA 1R082 3X29B 3VBOA 1RUE3 1PK6B 3BN6A 1F5JA 2A5ZA 1CR7A 5FYBA 1PK6C 1UOGA 1OBNA 1WA4A 3RYKA 3WF4A 1V0AA 4UXAA 4KWKA 4BIOA 2ZXQA 4AFCA 2QFEA 4Y20A 3QH6A 2WZ8A 4OHWA 1SLLA 1VBE2 5FKCA 1SFPA 4BWOA 2X8KA 1OOPC 2JE7A 3HR9A 1XNCA 1R092 3RZMA 1K12A 2OZJA 3VBRA 2ZHKA 5JZGB 2GNDA 5LBCA 5I0RA 2FZ2A 1XB9A 3IIAA 3BIEA 5IFPA 1W9YA 3ZOIA 3FMGA 1CESA 2XVKA 5IVCA 3RDIA 2DU1A 1LGNA 5DN2A 3RGBA 4MUVA 1LOGA 4GB32 1KJRA 2B5HA 3AKTA 1W8FA 2CWSA 1XBFA 3GZTB 1FMD2 1W6NB 4FSJA 1CPMA 3LA7A 5JXHA 3RFRA 3OPTA 3I2GA 1W6PA 2VTFA 2N7GA 4KU8A 4QX8A 3WP5A 5HV0A 1RYYA 4KGQA 2YXSA 4QM9A 3CIHA 4P9YA 1UCXA 2DF7A 3S5QA 5FO8B 2Q1MA 1U5IA 1C3HA 2V72A 3ABZA 5BNOA 5F2SA 3N9OA 4LBKA 4RD7A 2BNNA 2D98A 4FPGA 2C24A 2FCVA 4M3CA 1W6PB 2P3IA 2VOVA 2WT2A 2VCBA 3JD71 2XLFA 3RZJA 3Q8FA 3N7KA 3VKNA 1QJY2 3ZDVA 2ZAHA 4KI5M 3WNOA 5DZEA 1RITA 4XMAA 1OQEA 1NT0A 3VHPA 2R042 2R6QA 2WNEA 1TQ5A 2P6HA 2DDUA 2R16A 2PN5A 2WSVA 4H7LA 4KGGA 4OLLA 4QDQA 4F3JA 4DS0A 5FOJB 5A7WB 4WZFA 1YO8A 2RS52 3K2OA 4COZA 1JOPA 3BU0A 5T5LA 3KM5A 2YROA 2AGSA 1I6XA 4K20A 1AYN2 4FPJA 1ND3C 3NJYA 2FMYA 5A70A 3CJIA 3IAQA 4FVVA 2UYBA 2D93A 1CZTA 2Q8DA 2GN7A 3WY6A 4D3WA 1OT5A 1ZBA1 2KM2A 2A73B 5FDBA 2H6BA 2RMU3 3MYXA 3AKSA 4N9IA 4Q4W1 3TNQA 2VNVA 1NCQA 1AL23 1SLTA 1W8NA 3K3NA 3SLIA 1CX4A 1G9FA 2O1QA 1NA1C 1RUD3 2A3XA 3AVSA 4XXAA 2XVLA 1S2EA 2Z79A 2YBSA 3U10A 3AZYA 4FFFA 1BCXA 1OLME 2GALA 1ZZ8A 4XBQA 3ZDSA 4YLZA 1W03A 2WAAA 4Y22B 2W5FA 5A32A 5TSWA 4AEMA 4F83A 3W5NA 3NWKA 1A34A 4OHZA 2MEV2 4F8AA 2YMZA 2VR4A 3IWZA 3POGA 4GWIA 3PVNA 1AYM1 3OBRA 1S0GA 2QVSB 1OPMA 1FAYA 2WN3A 1ZA4A 1Q5OA 3Q8AA 2G9GA 4GH4A 1D4M1 3PIGA 1BBT3 2RVAA 2VXRA 1ZREA 1QJX2 4EN6B 1NXD1 1S2KA 4JHTA 4ZXKA 1LOAA 1NKGA 4G4FA 2VUJA 4PI2A 2BTVC 4E8CA 3L9JT 1XJAA 4C90A 3OF1A 3K4ZA 1AXYA 3FLPA 1UMZA 2ZEZA 2WLQA 1V00A 3FWEA 4S2HA 5FAXA 3U4XA 4CCKA 5CBLA 4BM8A 5JXIA 5E89A 1H1AA 1PGW1 4AI1A 2AYHA 4Q0PA 4LKEA 4LUKA 5CFCB 3THCA 2RMU2 1WCSA 1QH6A 3VD4A 3ACGA 4MGSA 5EXOA 1UW8A 1IS6A 4ITCA 5F32A 4DZGA 5LZ6A 2XHNA 4I0WB 5I0TA 4AFMA 3AJZA 3CO2A 3VZOA 2PELA 4JRLA 2DVFA 1NX9A 2HEVF 3N7MA 3S7IA 1D0GA 3U14A 2O0OA 2V5DA 4AEDC 1E57A 3LSDA 4W4ZA 5J37A 2RJ2A 5KXCA 1QF3A 2P6CA 3BGAA 3DYOA 4UFLA 3T0BA 4GAZA 5A3WA 2QQLA 3KCCA 1ZZ7A 3SCFA 4Z92B 4M4PA 2WJSA 4AAXA 4RA0A 4LHLA 4XCAA 2GDFA 3UV9A 4META 2DUQA 4XQWA 3DCQA 4L11A 1NY72 4EYUA 4NHYA 3OPWA 5FR3A 1DCSA 1XNAA 2AC1A 5CG8A 4ASMB 1ENRA 2AACA 3JQXA 1DQ1A 4YG6A 3WQ1A 3S7EA 3N9MA 3D4KA 1GOFA 2BGCA 2GNBA 3AP9A 4R8HA 2I07B 1QEXA 2PHFA 4D6QA 5IT6A 2WO2A 2WNVC 4OULA 2BFUS 1FNZA 4TSVA 1UZ0A 2ORXA 1UY4A 4FFHA 5E8AA 1NUKA 1RUH1 3G6JB 3BU7A 1PZ7A 4BXFA 4CU6A 2ZHNA 5T3NA 4EN7B 5C9AC 4YZ2A 1ASJ2 3J7LA 1JU4A 5BV6A 3CKHA 3NO8A 4RHV1 4U2AA 3N35A 3WHUA 2ZGTA 5ISLA 1IQDC 1XNTA 1SFNA 3MUY1 4CDUB 5FUNA 4H2AA 1BEV3 1VRBA 3VBFC 1ZBE2 2C1FA 4KMQA 3DEMA 5EP9A 1TME3 5KXEA 2ZGLA 4CUAA 1MS3A 1VAVA 3AP4A 3J8F1 4J1XA 2ZGQA 3ZSJA 1JN2P 1MZEA 4KU7A 3VLBB 1HQWA 1MS9A 1OQ1A 1COV1 5L19A 1PIV1 4Y1XA 1S0IA 3S6PA 4URAA 1F31A 2VU9A 4YGBA 5A3MA 1X82A 3LGRA 1RXGA 3K46A 5CKQA 4LIVA 5A33B 1QHDA 4NIHA 1TVGA 1UXXX 1GR3A 4PDWA 1W9WA 1DYPA 2E32A 3ASIA 3WSOA 4XDPA 4ATEA 3FX3A 4PLMA 4FP2A 1VALA 4CPBD 1WWYA 1DQ6A 3ZN5A 1QJU2 2SBAA 4RN5A 1UOJA 4UFIA 2VUAA 1Q8OA 1WBFA 2GAUA 4P08A 4RGGA 4Y24A 2YPJA 5FXXA 1FV3A 2WZR3 4XJ9A 3FL7A 1MZFA 4Y3OA 2FBEA 3UJOA 4V1PA 1XE0A 1DBNA 3AMQA 3H1YA 2OX0A 4PF5A 4P02B 1AYM3 3HEIA 1PVXA 3LEIA 4O9GA 1HXS1 4KG0A 1ULPA 2JDNA 5K4LA 1ULCA 5I8TA 2J1SA 1AR61 4C0BA 4CP9A 2YDEA 1M4WA 1W6QA 4KWJA 1YNAA 2VG9A 3IPVA 4FO9A 4UF0A 3LOBA
chains in the Genus database with same CATH topology
4DEQA 3T0AA 4A4AA 1UYYA 1GNYA 5CYYA 5HXMA 3HN3A 2VC9A 3MO4A 4P5YA 2VM9A 3AC0A 3WNLA 3T08A 3E1F1 5EIYB 1JYXA 1CZSA 2VZVA 5B4NA 1J83A 5JR2A 3NRUA 1YQ2A 2VZPA 4XUTA 4BDVB 2W92A 4A41A 2Y6HA 1W0NA 3A21A 2EIBA 4QDSA 3GXUA 2JD9A 1UY3A 2WDBA 3VD9A 4A45A 1H6XA 1GQPA 1I5PA 3A23A 4OZOA 2J1TA 4CUCA 1PX3A 2W91A 1HN1A 2YFZA 2VZTA 2QQNA 2VCAA 4JKLA 5C7GA 5LA0A 1P8JA 5A1AA 3D3AA 1W99A 4JX0A 4L0PA 3HNYM 1CZVA 1T2XA 3CDZB 3WNMA 4BK5A 3P1IA 1UY2A 2WAOA 4CU8A 2W3JA 1D7PM 4A6OA 1W8OA 3WF0A 1SG3A 5EJZB 3SKVA 3FHQA 2QQJA 4UOJA 3F2ZA 3VDAA 5JXGA 4P00B 1GOGA 3HJRA 5F7UA 3IDAA 2J1RA 3OBAA 2W94A 3THDA 3VDBA 2E31A 2ZEWA 2JKXA 3OGVA 5LA2A 2VZOA 4RYDA 3HPNA 2VZ3A 1J84A 2XONA 3I97A 3SEEA 2VL4A 2E33A 5EJ1B 4AG4A 2ZEYA 2W46A 2Y64A 3CMGA 4MGQA 4DXRA 1KGYA 3DYPA 5I0DA 1DP0A 2WQ8A 2WUHA 3I3DA 2W1WA 5FUIA 3WNKA 2EIEA 3I3EA 5LCWL 1KEXA 1PMJX 2CDPA 2E26A 3OB8A 4QX0A 4ARYA 2Y6KA 2VQTA 3MUZ1 4XVHA 2ID4A 2W1SA 3SEPA 5IHRA 1K45A 2X05A 4QAWA 2BZDA 2XOMA 2VQUA 4M4RA 4OUEA 2JE8A 1JZ3A 4A44A 4OMCA 1ULOA 3I2IA 2C9KA 5G05L 4CVUA 3NQHA 2VOTA 1O59A 3NNGA 2ORZA 2W1QA 2YG0A 2EIDA 3J7HA 3C8XA 2W1UA 2Y6JA 1DLCA 4XUOA 1GU3A 1F4AA 4QB2A 3GM8A 1O8SA 4YPJA 2YC4A 4PT6A 2YC2A 3I3BA 3K4DA 1OF3A 1WCQA 3ACIA 4D0QA 4DUWA 3ACFA 2WZEA 1JYWA 2Y6GA 3A7QA 5JXJA 2VMEA 3T0DA 4UI9L 1UWWA 4QB6A 2QQOA 3I2FA 4Z2AA 2YFUA 3LQCA 3I2JA 1NAEA 3VD5A 1L7RA 3C7EA 2VMFA 1JYNA 5C71A 3HNBM 4XURA 4XZUG 4W50A 4QX2A 3PUIA 2W47A 1JU3A 3SKJE 1JZ6A 3P6BA 4KWUA 5C70A 1K3IA 3T2QA 1XPWA 2CDOA 4ZXEA 3I2HA 2EICA 1L7QA 1US3A 2W87A 2W95A 2XQXA 3MV11 2Y6LA 4LPLA 4XUQA 1EUUA 3T2PA 5DMYA 5DPNA 4MO3M 3C7GA 3K75B 3K77A 4W8JA 3OEAA 3UETA 3BN6A 3OEBA 4D8MA 3WF2A 3WF4A 5HPOA 3VD7A 2ZXQA 3HNMA 4MOAA 1W9TA 2PQSA 4GZ9A 2WZ8A 2J1AA 4BXSV 2VJXA 1JI6A 3FHAA 1K12A 3DECA 3LEKA 2J1EA 4JKKA 2VZUA 3IB3A 4PF1A 4QX3A 5IFPA 1OD3A 4JHZA 1JZ2A 2LS6A 1UY1A 4ZZ8A 2BGOA 5DN2A 1UMHA 2WYSA 1OH4A 2WN2A 1F4HA 4CU9A 2L9LA 5JXHA 4LKSA 2VO5A 3I2GA 2VTFA 3UNPA 5IJRA 1GUIA 1RYYA 3VDCA 3CIHA 3C7FA 4DXTA 3WNNA 2J7MA 2QQIA 4ZZ5A 1UY0A 2V72A 3ABZA 4BJ0A 1K42A 1UXZA 2X09A 2R7EB 4DUXA 4MADA 2VCBA 5JUVA 4KI5M 3WNOA 3GDBA 3WF3A 2WABA 2WO1A 2DDUA 2VZSA 4QDQA 4A42A 3ECQA 3W5MA 1CIYA 2DCKA 5G04L 2YB7A 2VZ1A 4CU7A 3ACHA 1O8PA 1GOHA 1H6YA 4GWJA 1PX4A 3IAQA 2LW8A 1UX7A 1CZTA 1OT5A 3LPFA 3IIIA 3LE0A 4FI9A 1W8NA 3PUHA 3CZUA 2V4VA 3CZJA 2VCCA 1CX1A 4ET7A 1DYOA 3OGSA 3DYMA 2WAAA 2J22A 2W5FA 1US2A 4TXWA 3W5NA 2BERA 4XUPA 2VR4A 4GWIA 3U37A 1WKYA 3IAPA 3CQOA 2VMCA 2WN3A 1JZ5A 4HG6B 3WEZA 1JZ4A 4QPWA 2RVAA 2ZEXA 3WF1A 4A3ZA 1NKGA 1PMHX 3GGLA 2J1VA 4E8CA 5J1XA 3K4ZA 3NJXA 2ZEZA 1MPXA 3LEGA 1UYXA 4ARXA 4QDRA 5JXIA 1EUTA 5DQ0A 3ZM8A 3THCA 4DEVA 2B4KA 2W9XA 2B9VA 4JKMA 5JMOA 3VD4A 3ACGA 4MGSA 3C7HA 4BK4A 2QQKA 2XHNA 3OGRA 2DCJA 3A22A 1NX9A 3I2KA 2Y8KA 2V5DA 2HLEA 4W4ZA 2RJ2A 3MV01 2RV9A 1LNSA 2HYXA 3BGAA 3DYOA 3T0BA 2QQLA 4M4PA 4AAXA 2C4XA 3FN9A 5B4XA 3HOBA 3EB7A 1XNAA 4DUVA 4ZY9A 4IUGA 1R64A 5IYYA 2JDAA 1GOFA 2WO2A 4CUBA 4DXSA 1UYZA 1UZ0A 2ORXA 1UY4A 4OMDA 5CZKA 1OF4A 3LPGA 2VZQA 3C7OA 1NUKA 3WNPA 4CU6A 4XUNA 1JYVA 3T2OA 1JZ8A 1JU4A 3CKHA 4UAPA 1W9SA 2Z4FA 1IQDC 1XNTA 3NJVA 3MUY1 2QQMA 4KMQA 2BBAA 2VMDA 5LA1A 4CUAA 3OG2A 1JHJA 1UMIA 2KD7A 2BGPA 4PQQA 3T09A 5IFTA 1TG7A 1XC6A 3WQBA 3K46A 4QB1A 4OYUA 1TVGA 1UXXX 2OKXA 2J1UA 1W9WA 2E32A 3JXSA 1SDDB 3WSOA 4LQRA 4E8DA 1GMMA 4RN5A 2X10A 2QBXA 4P08A 1SHWB 4LHSA 3FL7A 4QX1A 1BHGA 3MBWA 3EYPA 4P02B 2C26A 4TTGA 3HEIA 3ETPA 3LEIA 1ULPA 3UESA 2VZRA 2J1SA 3VD3A 2WO3A 2WBKA 3K4AA 1JZ7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DEQ A;  3T0A A;  4A4A A;  1UYY A;  1GNY A;  5CYY A;  5HXM A;  3HN3 A;  2VC9 A;  3MO4 A;  4P5Y A;  2VM9 A;  3AC0 A;  3WNL A;  3T08 A;  3E1F 1;  5EIY B;  1JYX A;  1CZS A;  2VZV A;  5B4N A;  1J83 A;  5JR2 A;  3NRU A;  1YQ2 A;  2VZP A;  4XUT A;  4BDV B;  2W92 A;  4A41 A;  2Y6H A;  1W0N A;  3A21 A;  2EIB A;  4QDS A;  3GXU A;  2JD9 A;  1UY3 A;  2WDB A;  3VD9 A;  4A45 A;  1H6X A;  1GQP A;  1I5P A;  3A23 A;  4OZO A;  2J1T A;  4CUC A;  1PX3 A;  2W91 A;  1HN1 A;  2YFZ A;  2VZT A;  2QQN A;  2VCA A;  4JKL A;  5C7G A;  5LA0 A;  1P8J A;  5A1A A;  3D3A A;  1W99 A;  4JX0 A;  4L0P A;  3HNY M;  1CZV A;  1T2X A;  3CDZ B;  3WNM A;  4BK5 A;  3P1I A;  1UY2 A;  2WAO A;  4CU8 A;  2W3J A;  1D7P M;  4A6O A;  1W8O A;  3WF0 A;  1SG3 A;  5EJZ B;  3SKV A;  3FHQ A;  2QQJ A;  4UOJ A;  3F2Z A;  3VDA A;  5JXG A;  4P00 B;  1GOG A;  3HJR A;  5F7U A;  3IDA A;  2J1R A;  3OBA A;  2W94 A;  3THD A;  3VDB A;  2E31 A;  2ZEW A;  2JKX A;  3OGV A;  5LA2 A;  2VZO A;  4RYD A;  3HPN A;  2VZ3 A;  1J84 A;  2XON A;  3I97 A;  3SEE A;  2VL4 A;  2E33 A;  5EJ1 B;  4AG4 A;  2ZEY A;  2W46 A;  2Y64 A;  3CMG A;  4MGQ A;  4DXR A;  1KGY A;  3DYP A;  5I0D A;  1DP0 A;  2WQ8 A;  2WUH A;  3I3D A;  2W1W A;  5FUI A;  3WNK A;  2EIE A;  3I3E A;  5LCW L;  1KEX A;  1PMJ X;  2CDP A;  2E26 A;  3OB8 A;  4QX0 A;  4ARY A;  2Y6K A;  2VQT A;  3MUZ 1;  4XVH A;  2ID4 A;  2W1S A;  3SEP A;  5IHR A;  1K45 A;  2X05 A;  4QAW A;  2BZD A;  2XOM A;  2VQU A;  4M4R A;  4OUE A;  2JE8 A;  1JZ3 A;  4A44 A;  4OMC A;  1ULO A;  3I2I A;  2C9K A;  5G05 L;  4CVU A;  3NQH A;  2VOT A;  1O59 A;  3NNG A;  2ORZ A;  2W1Q A;  2YG0 A;  2EID A;  3J7H A;  3C8X A;  2W1U A;  2Y6J A;  1DLC A;  4XUO A;  1GU3 A;  1F4A A;  4QB2 A;  3GM8 A;  1O8S A;  4YPJ A;  2YC4 A;  4PT6 A;  2YC2 A;  3I3B A;  3K4D A;  1OF3 A;  1WCQ A;  3ACI A;  4D0Q A;  4DUW A;  3ACF A;  2WZE A;  1JYW A;  2Y6G A;  3A7Q A;  5JXJ A;  2VME A;  3T0D A;  4UI9 L;  1UWW A;  4QB6 A;  2QQO A;  3I2F A;  4Z2A A;  2YFU A;  3LQC A;  3I2J A;  1NAE A;  3VD5 A;  1L7R A;  3C7E A;  2VMF A;  1JYN A;  5C71 A;  3HNB M;  4XUR A;  4XZU G;  4W50 A;  4QX2 A;  3PUI A;  2W47 A;  1JU3 A;  3SKJ E;  1JZ6 A;  3P6B A;  4KWU A;  5C70 A;  1K3I A;  3T2Q A;  1XPW A;  2CDO A;  4ZXE A;  3I2H A;  2EIC A;  1L7Q A;  1US3 A;  2W87 A;  2W95 A;  2XQX A;  3MV1 1;  2Y6L A;  4LPL A;  4XUQ A;  1EUU A;  3T2P A;  5DMY A;  5DPN A;  4MO3 M;  3C7G A;  3K75 B;  3K77 A;  4W8J A;  3OEA A;  3UET A;  3BN6 A;  3OEB A;  4D8M A;  3WF2 A;  3WF4 A;  5HPO A;  3VD7 A;  2ZXQ A;  3HNM A;  4MOA A;  1W9T A;  2PQS A;  4GZ9 A;  2WZ8 A;  2J1A A;  4BXS V;  2VJX A;  1JI6 A;  3FHA A;  1K12 A;  3DEC A;  3LEK A;  2J1E A;  4JKK A;  2VZU A;  3IB3 A;  4PF1 A;  4QX3 A;  5IFP A;  1OD3 A;  4JHZ A;  1JZ2 A;  2LS6 A;  1UY1 A;  4ZZ8 A;  2BGO A;  5DN2 A;  1UMH A;  2WYS A;  1OH4 A;  2WN2 A;  1F4H A;  4CU9 A;  2L9L A;  5JXH A;  4LKS A;  2VO5 A;  3I2G A;  2VTF A;  3UNP A;  5IJR A;  1GUI A;  1RYY A;  3VDC A;  3CIH A;  3C7F A;  4DXT A;  3WNN A;  2J7M A;  2QQI A;  4ZZ5 A;  1UY0 A;  2V72 A;  3ABZ A;  4BJ0 A;  1K42 A;  1UXZ A;  2X09 A;  2R7E B;  4DUX A;  4MAD A;  2VCB A;  5JUV A;  4KI5 M;  3WNO A;  3GDB A;  3WF3 A;  2WAB A;  2WO1 A;  2DDU A;  2VZS A;  4QDQ A;  4A42 A;  3ECQ A;  3W5M A;  1CIY A;  2DCK A;  5G04 L;  2YB7 A;  2VZ1 A;  4CU7 A;  3ACH A;  1O8P A;  1GOH A;  1H6Y A;  4GWJ A;  1PX4 A;  3IAQ A;  2LW8 A;  1UX7 A;  1CZT A;  1OT5 A;  3LPF A;  3III A;  3LE0 A;  4FI9 A;  1W8N A;  3PUH A;  3CZU A;  2V4V A;  3CZJ A;  2VCC A;  1CX1 A;  4ET7 A;  1DYO A;  3OGS A;  3DYM A;  2WAA A;  2J22 A;  2W5F A;  1US2 A;  4TXW A;  3W5N A;  2BER A;  4XUP A;  2VR4 A;  4GWI A;  3U37 A;  1WKY A;  3IAP A;  3CQO A;  2VMC A;  2WN3 A;  1JZ5 A;  4HG6 B;  3WEZ A;  1JZ4 A;  4QPW A;  2RVA A;  2ZEX A;  3WF1 A;  4A3Z A;  1NKG A;  1PMH X;  3GGL A;  2J1V A;  4E8C A;  5J1X A;  3K4Z A;  3NJX A;  2ZEZ A;  1MPX A;  3LEG A;  1UYX A;  4ARX A;  4QDR A;  5JXI A;  1EUT A;  5DQ0 A;  3ZM8 A;  3THC A;  4DEV A;  2B4K A;  2W9X A;  2B9V A;  4JKM A;  5JMO A;  3VD4 A;  3ACG A;  4MGS A;  3C7H A;  4BK4 A;  2QQK A;  2XHN A;  3OGR A;  2DCJ A;  3A22 A;  1NX9 A;  3I2K A;  2Y8K A;  2V5D A;  2HLE A;  4W4Z A;  2RJ2 A;  3MV0 1;  2RV9 A;  1LNS A;  2HYX A;  3BGA A;  3DYO A;  3T0B A;  2QQL A;  4M4P A;  4AAX A;  2C4X A;  3FN9 A;  5B4X A;  3HOB A;  3EB7 A;  1XNA A;  4DUV A;  4ZY9 A;  4IUG A;  1R64 A;  5IYY A;  2JDA A;  1GOF A;  2WO2 A;  4CUB A;  4DXS A;  1UYZ A;  1UZ0 A;  2ORX A;  1UY4 A;  4OMD A;  5CZK A;  1OF4 A;  3LPG A;  2VZQ A;  3C7O A;  1NUK A;  3WNP A;  4CU6 A;  4XUN A;  1JYV A;  3T2O A;  1JZ8 A;  1JU4 A;  3CKH A;  4UAP A;  1W9S A;  2Z4F A;  1IQD C;  1XNT A;  3NJV A;  3MUY 1;  2QQM A;  4KMQ A;  2BBA A;  2VMD A;  5LA1 A;  4CUA A;  3OG2 A;  1JHJ A;  1UMI A;  2KD7 A;  2BGP A;  4PQQ A;  3T09 A;  5IFT A;  1TG7 A;  1XC6 A;  3WQB A;  3K46 A;  4QB1 A;  4OYU A;  1TVG A;  1UXX X;  2OKX A;  2J1U A;  1W9W A;  2E32 A;  3JXS A;  1SDD B;  3WSO A;  4LQR A;  4E8D A;  1GMM A;  4RN5 A;  2X10 A;  2QBX A;  4P08 A;  1SHW B;  4LHS A;  3FL7 A;  4QX1 A;  1BHG A;  3MBW A;  3EYP A;  4P02 B;  2C26 A;  4TTG A;  3HEI A;  3ETP A;  3LEI A;  1ULP A;  3UES A;  2VZR A;  2J1S A;  3VD3 A;  2WO3 A;  2WBK A;  3K4A A;  1JZ7 A; 
#chains in the Genus database with same CATH topology
 3AXD A;  4DEQ A;  4FXG B;  1TMF 3;  1OD5 A;  4A4A A;  1COV 3;  2PHW A;  1GNY A;  5HXM A;  3ZN6 B;  3ZSK A;  1LED A;  1W8T A;  1WD3 A;  4YVW A;  5C5U A;  5FXZ A;  3LDR A;  1N3O A;  3APB A;  4HKL A;  3WNL A;  3T08 A;  3DGT A;  2B45 X;  4D6R A;  4TYS A;  2WS9 2;  4BQ2 A;  3BB6 A;  4RS5 A;  4R9B A;  1NLQ A;  2VZV A;  1J83 A;  4YW2 A;  1H2L A;  4AED A;  5JR2 A;  1V9U 1;  5FMC A;  4NRQ A;  3U11 A;  5J7M A;  1YQ2 A;  2BV4 A;  4IV1 C;  4E9K A;  4M01 A;  5F8P A;  1PM7 A;  4XUT A;  5EFU A;  3AXE A;  5LAS A;  4EZ4 A;  4N90 A;  1W0N A;  2YUE A;  3V0B A;  2D6N A;  2EIB A;  3ACL A;  3C2U A;  3WW3 A;  1IHM A;  5FZ6 A;  1HB4 A;  2ZGO A;  4HSJ A;  4NII A;  3VD9 A;  1YC6 1;  3GZU C;  5FZD A;  1GQP A;  4EE2 A;  1IS4 A;  4MX3 A;  1F2N A;  5C5T A;  4YM1 A;  4LLO A;  4OZO A;  4ZS3 A;  4MGT A;  4LK7 A;  5CVR A;  1ZRF A;  2BYV E;  1LOE A;  5C3Q A;  4LO6 B;  3PVO A;  2ZZQ A;  4BIS A;  1GKB A;  4PLN A;  5I0S A;  5AFB A;  2YFZ A;  2R07 2;  3S5A A;  2A70 A;  1CAW A;  4JKL A;  4QGL A;  4RS5 B;  2HKX A;  4AI3 A;  1P8J A;  4GA9 A;  3HQX A;  4XTM A;  4AL9 A;  2XL7 A;  3RZK A;  3E5Q A;  1QH7 A;  2YGM A;  1QQP 3;  3KF3 A;  5ACA 1;  4L0P A;  2XUM A;  2XJT A;  1CZV A;  2R0F A;  3CDZ B;  3VZN A;  1RUG 3;  2HWE 3;  3IPV B;  1NCR B;  3MEP A;  2XJS A;  1R1A 3;  3KVB A;  2W3J A;  3GAL A;  3MIE A;  3PHM A;  1HB2 A;  1D7P M;  5DAQ A;  3MIF A;  4RQP A;  1S0D A;  1W8O A;  2IXI A;  4HVO A;  4AVB A;  1SG3 A;  2ZZJ A;  2UY9 A;  3FHQ A;  2QQJ A;  3KT7 A;  1Y43 B;  5ERL A;  2JIJ A;  4UOJ A;  4XAE A;  1BMV 1;  2Y26 A;  4JV4 A;  1G6N A;  2VUL A;  1VB4 A;  4Q4W 3;  2NM1 A;  4Z07 A;  1LGC A;  5HCB A;  4K1Y A;  3W9A A;  4YW5 A;  1WBL A;  1WW7 A;  1GOG A;  4DPN A;  1KD7 A;  2ZKN A;  2QE3 A;  1JS9 A;  5F7U A;  3HWJ A;  2Z69 A;  4LHN A;  2J1R A;  4FPF A;  4QPG A;  3B7M A;  1PNF A;  2E31 A;  2WT0 A;  4C1X A;  2HWC 1;  4CDU A;  3OGV A;  3AP6 A;  1VBA 3;  2WNV B;  2VZO A;  4AI8 A;  5F5C A;  3TN9 1;  3I97 A;  2XBO 1;  5T5P A;  4DIN B;  2IXL A;  1RUJ 2;  1W0P A;  4IEY A;  1PM4 A;  3VZL A;  1QXJ A;  2ZEY A;  2FDH A;  1ODN A;  2W46 A;  4COU A;  3CMG A;  4FFG A;  5ANN A;  1DQ0 A;  2LM3 A;  1ZYB A;  1DQ5 A;  1BBT 2;  4Q27 A;  4QU1 A;  5F3E A;  4DXR A;  2IC1 A;  5DDJ 2;  2RM2 2;  5D2A A;  2WUH A;  2IXC A;  1O5L A;  3I3D A;  1QGL A;  3VBU B;  1WMX A;  1KFU L;  1QMJ A;  3O1V A;  5FLJ A;  2PHD A;  2V73 A;  1FMD 3;  3I3E A;  2XLA A;  5KC6 A;  5LCW L;  1KEX A;  1BVP 1;  4I0A A;  3QAC A;  5FZG A;  3PMS A;  4W65 A;  4QX0 A;  1S2B A;  2Y6K A;  2WZR 1;  2P37 A;  5E88 A;  5GLV A;  1X33 A;  2PLV 3;  3MUZ 1;  4XVH A;  3PL0 A;  5JOW A;  1VBD 2;  3W20 A;  2JDH A;  4KL1 A;  3SEP A;  1IPJ A;  1O3Q A;  1R08 3;  1XYO A;  4QAW A;  1H8T B;  3RZG A;  1R1Z A;  4M0H A;  1CWP A;  4GQ7 A;  3VL8 A;  4COV A;  4M4R A;  4YVW C;  1YFU A;  2JG9 B;  1SFY A;  2GME A;  3IDB B;  1GAN A;  4JVA A;  4OUE A;  4Q29 A;  4QD2 A;  1MS1 A;  2JDU A;  5FQ0 B;  3UGH A;  2VTX J;  4WZC A;  3FUQ A;  4LBN A;  4A44 A;  4CPB A;  2DCT A;  1WMD A;  2RS3 2;  5FZF A;  4QQH A;  2ARE A;  3NQH A;  3DXT A;  4HN0 A;  2VOT A;  1AR9 2;  1UPS A;  4YWA A;  3WDT A;  5IK8 A;  2ORZ A;  2W1Q A;  1RMU 2;  2YG0 A;  1HRI 1;  4YZ4 A;  4AE2 A;  2EID A;  2Q5T A;  5LK7 B;  3NV1 A;  1Y4W A;  1NA1 A;  1VRH 2;  4LJH A;  4JDN A;  4WM7 C;  4LXL A;  1UZZ A;  1YQC A;  3B5L B;  3ST7 A;  4ZU4 A;  2FD8 A;  1MS0 A;  5HI0 A;  1EY2 A;  4LO7 A;  3R4U A;  4BQX A;  4DY3 A;  1DLC A;  2XJV A;  3M7A A;  4JTO A;  2BWC A;  3B3Q E;  4BOW A;  5FXV A;  4UFK A;  4XTP A;  5GLZ A;  2RM2 3;  3ZFG B;  4EWA A;  3GM8 A;  1PVC 1;  4HON A;  1O8S A;  3POY A;  2ZKL A;  5A80 A;  2DUR A;  3RNS A;  3I3B A;  3WG1 A;  1VMH A;  2K0G A;  1WCQ A;  2XJR A;  2Q30 A;  3ACI A;  3ACF A;  2W68 A;  4XAB A;  1AR8 3;  3LCP A;  4Q4Y 1;  1X8E A;  4UFH A;  1JYW A;  2VME A;  4FQZ A;  1QU0 A;  1OQD A;  1REF A;  2OPW A;  1IQA A;  4GMP 3;  4W6X A;  4AQ2 A;  4NRM A;  4QB6 A;  1UOB A;  4CCE A;  3NKG A;  1MQT C;  2CTV A;  1XE7 A;  2A3W A;  3IT8 A;  3LQC A;  3H3Z A;  3RG0 A;  3USS A;  3I2J A;  3ZPO A;  1NAE A;  1CAX B;  3RJ2 X;  1EYB A;  3H1W A;  4FPO B;  3C7E A;  3FUO A;  4YM0 A;  2RG4 A;  1OLM A;  3H7Y A;  1QY4 A;  1W06 A;  2YC0 A;  4X8P A;  3SNM A;  5C71 A;  1FAT A;  3TB0 A;  5JDB A;  5DUV A;  1JXN A;  3CNA A;  3V56 A;  4AFA A;  1DDL A;  4FTB A;  5H9S A;  3LEM A;  4DFS A;  2ET1 A;  2PHR A;  3SKJ E;  5C33 A;  4LR4 A;  3DPR B;  3MPB A;  3QLQ A;  3A0N A;  2D43 A;  3SC7 X;  1APN A;  5C70 A;  3T2Q A;  2A6W A;  2AUY A;  2DU0 A;  4J25 A;  4N43 C;  2JDZ A;  3MF6 A;  2VBP A;  2H0V A;  3FHI B;  4LTA A;  5CG9 A;  1O3S A;  3KVA A;  4ZXE A;  2DFC A;  2EIC A;  5LEK A;  2ZGN A;  2EAA A;  2XQX A;  1XQN A;  4FFI A;  1MS8 A;  4LPL A;  2D6O X;  2R06 3;  5FBJ A;  5SV8 A;  4CDU C;  3JBG 3;  3T2P A;  2LAL A;  1YIF A;  1RIN A;  5FLI A;  4HVQ A;  4N53 C;  5FJH A;  5C8C A;  4MO3 M;  3C7G A;  2OUH A;  3K75 B;  4CP0 A;  5HCH A;  4O9E A;  3H8U A;  2VEC A;  4GAL A;  2XKO A;  4D69 A;  5SV5 A;  2FDG A;  1NZI A;  3OSD A;  1NLS A;  3WDW A;  4D8M A;  3OEB A;  2WSU A;  4Z8B A;  5IK5 A;  3TN9 3;  4IES A;  2XML A;  1OSG A;  3KB5 A;  4CDQ C;  5HPO A;  1XXN A;  4Y1V A;  1A78 A;  1UAI A;  5CKN A;  1AXZ A;  3QD6 A;  2CSG A;  1W9T A;  4K21 A;  4Q0S A;  4WVW A;  2CAU A;  2BNM A;  2EXI A;  1PMI A;  2J1A A;  3J7N A;  3GYD A;  4UW4 A;  2R49 A;  4C91 A;  4EZH A;  4PJY A;  4LBQ B;  5J48 A;  5BNN A;  5DAB A;  1X9T A;  5C9A A;  2ADD A;  3B94 A;  1HRI 3;  3POI A;  4LUL A;  2RS1 1;  1GWK A;  2IFW A;  3ZFF A;  5K8S A;  5LY2 A;  3HBZ A;  4IEO A;  3VZM A;  1OD3 A;  4JHZ A;  2VMI A;  3DV8 A;  3ZXD A;  1JZ2 A;  5FPZ A;  4UBH A;  2YZ4 A;  4YW7 A;  4DOU A;  1W6O A;  1ND2 B;  5JIU A;  2BGO A;  2HWD 2;  4V2W A;  1UMH A;  3VBF A;  2WYS A;  1C5I A;  1OH4 A;  2WN2 A;  1GV9 A;  1JTZ X;  1VIW B;  3M3I A;  1MVQ A;  3L2H A;  4BHP A;  1Z0H A;  2VO5 A;  2PHX A;  2OPK A;  5J3U A;  4MGZ E;  1OUR A;  1LEC A;  2GNM A;  3AMM A;  4QHO A;  5FYH A;  5FYC A;  2JG9 A;  3VDC A;  4IEP A;  4UFJ A;  1YYN A;  5GZG A;  1I9R A;  1DGR N;  2IVI B;  2VNR A;  2XL9 A;  4IQP A;  4O65 A;  4DXT A;  3K48 A;  2EAL A;  4ZZ5 A;  2OQ6 A;  4BJ0 A;  3LFM A;  5I93 A;  1K42 A;  2X09 A;  2R7E B;  2QQP A;  1ULG A;  1QJY 3;  1SLB A;  4YZ1 A;  5JLV A;  1VBA 2;  1TME 2;  2VTX A;  3TAY A;  3BTY A;  1BVV A;  3FBY A;  5JUV A;  2YBK A;  1Q8P A;  4FTE A;  3BAL A;  3GDB A;  3M3Q A;  4HT1 T;  4HXC A;  4CP2 A;  2GC2 A;  3VKL A;  4XEZ A;  1CIY A;  1E5S A;  1M06 G;  1O7F A;  2VZ1 A;  3VBH A;  3NNL A;  3DPR C;  3JB4 C;  1AYN 3;  1O8P A;  1AR8 1;  3ACH A;  3GZA A;  3PDQ A;  4UW6 A;  5T50 A;  5DDJ 3;  5FK7 A;  1V9U 3;  1HDK A;  3AMP A;  1H6Y A;  2O8O A;  2ZJC A;  4I3P A;  3OYW B;  5FY9 A;  4RFT 0;  4W6Y A;  4QGM A;  1PX4 A;  3WOG A;  1OUS A;  4HKW A;  4NHM A;  2G9Z A;  2LW8 A;  4I02 A;  3I59 A;  4I3G A;  1XSQ A;  4XOG A;  2Q8O A;  4IEZ A;  1CJP A;  1RUD 2;  1PO2 3;  5FPB A;  2FDK A;  1BEV 1;  4V2V A;  3NNJ A;  4YVS B;  5K9Y A;  2HBU A;  1LHW A;  1FOD 2;  4IER A;  1MQT B;  1TE1 B;  5FO9 B;  2FQP A;  3D0S A;  2B39 A;  3DYM A;  5GZF A;  4MHU A;  3DKW A;  1AR7 1;  4W6W A;  4JZR A;  3WW1 A;  3CBN A;  4XFH A;  2EXK A;  2VW1 A;  1CN1 A;  4XAA A;  1UU5 A;  1WW5 A;  3HT1 A;  4AVT A;  4CRQ A;  1VE0 A;  1WKY A;  3IAP A;  3B69 A;  5C3S A;  4MV2 A;  2VMC A;  3U07 A;  2VPV A;  3VBU C;  3FBM A;  1QJX 3;  3WEZ A;  5FIX A;  4HN1 A;  1JZ4 A;  3ZXF A;  3C3V A;  4LMF A;  5A3O A;  2ZEX A;  3PME A;  3AYE A;  3WF1 A;  3WW2 A;  2I45 A;  2BVV A;  3RMY A;  4A3Z A;  4XF4 A;  1YFX A;  1EV1 3;  2J1V A;  5C3O A;  3PVB B;  3OGG A;  5I91 A;  5FZE A;  5J1X A;  3NJX A;  5CNA A;  3TRS B;  3O1O A;  1RXF A;  2VE1 A;  5A3T A;  2YHJ A;  1JMU B;  3ZXE A;  2CGN A;  3BPZ A;  1HJF A;  4XFA A;  2B4K A;  2W9X A;  3D6E A;  4JKM A;  3ZN4 A;  1UKG A;  1VJ2 A;  3ITQ A;  3C7H A;  5CEH A;  4Q8L A;  4FCA A;  3W58 A;  4BK4 A;  4HPK B;  2QQK A;  3VBS C;  3H3U A;  2YGL A;  2TBV A;  3I2K A;  5FY7 A;  2Y8K A;  1PGL 2;  1BQP A;  4UBG A;  2VOK A;  5JPM B;  1RHI 3;  2HYX A;  1XU2 A;  4Q4V 1;  4QU2 A;  3F95 A;  1Q43 A;  3EBR A;  5FYZ A;  1IKQ A;  4OVE A;  2BRT A;  1QXP A;  2R04 3;  5FYI A;  3E5X A;  4Y20 B;  1UO9 A;  2DYC A;  2I2S A;  1HV1 A;  4IV3 B;  4ZON A;  5HCF A;  1AX1 A;  2HWB 2;  2LRP A;  3VZK A;  4L9B A;  1XRU A;  4Q2F A;  1VBC 3;  4L2N A;  1VBB 2;  2JDK A;  3DN7 A;  2WA4 A;  1QQP 2;  5T5J A;  5IAX A;  4ZY9 A;  1JH5 A;  2R1B A;  4IUG A;  5DAX A;  4NHX A;  1JUH A;  2RR1 2;  1CAU A;  1HKD A;  2G19 A;  3NKT A;  1CAX A;  1VBD 3;  1HRV 2;  2ZA9 A;  4DXS A;  1JOB A;  1UYZ A;  1STM A;  4Y5S A;  5CZK A;  5FYU A;  3OPZ A;  1FT9 A;  3J7M A;  5F1R A;  3AX4 A;  1GP6 A;  1MEC 3;  1JOD A;  1O6U A;  1RC6 A;  3ATG A;  3O7O A;  2RDQ A;  3CLP A;  4Q4Y 3;  3T3Y A;  4L97 A;  3B01 A;  4OQ8 A;  1QOT A;  5EWS A;  2JG8 C;  3NV4 A;  1V6O A;  3B9I A;  1W9S A;  3VBH C;  3I49 A;  3DPR A;  5FYY A;  1SBE A;  1NYW A;  5FY8 A;  4JGZ C;  3KV4 A;  4DY5 A;  2QQM A;  2VVD A;  1ONA A;  3MLJ A;  4YW3 A;  4C1W A;  1LOC A;  2BBA A;  2VMD A;  5LA1 A;  4P9J A;  1LOD A;  4EQV A;  2AEN A;  2ZCW A;  4XMI A;  4D7Y A;  2B9U A;  2KD7 A;  3PTR B;  4I0B A;  5JSO A;  4YRD A;  4LKD A;  5IFT A;  2VGD A;  1A8M A;  2Q8C A;  4AOC A;  1XC6 A;  2OZ6 A;  1VBB 3;  4Y5T A;  4QB1 A;  3JCI A;  5KWR A;  2D6M A;  4CDW C;  3ROU A;  1SQ4 A;  3K3O A;  3H0O A;  4GJY A;  3N7L A;  4QKB A;  5FQ0 A;  2YYO A;  1ZRR A;  1FPN 2;  2RJL A;  2ZS6 B;  1GMM A;  2EVX A;  2YPD A;  2MNG A;  1Q56 A;  4CXX A;  3GCW A;  4WVZ A;  5GZC A;  1RUE 2;  4DRV A;  1LHU A;  5HCA A;  3RSJ A;  2D5F A;  1LHV A;  4TTG A;  4K3U A;  4AQ6 A;  2BQP A;  1OA4 A;  2UU8 A;  2WFF 2;  4FT8 A;  2Y0I A;  4XYX A;  1XNK A;  3VD3 A;  1ND2 A;  3AZW A;  1C57 A;  1ACC A;  4EN0 A;  5JOZ A;  5C3R A;  3Q8E A;  2XJP A;  5EHD A;  5HXV A;  1H8V A;  2EIG A;  1UZW A;  5JPN B;  3E97 A;  5L9R A;  3INA A;  4I30 A;  4AGR A;  3R4S A;  4IEX A;  4XBN A;  3T0A A;  3ZO0 B;  5CYY A;  3AB0 A;  2VC9 A;  3ZIX A;  4NHL A;  4LE4 A;  3N4M A;  3MO4 A;  3OCP A;  1KQR A;  5CFD A;  5FY1 A;  4OI1 A;  1V6J A;  1V6N A;  2RDS A;  2R06 2;  3QCW A;  5EIY B;  4Q0V A;  3JBG 2;  5ABJ C;  5B4N A;  3B9C A;  4IXL A;  1WA6 X;  2D6L X;  4RQP C;  4UW3 A;  1GWL A;  1RL3 A;  1G9A A;  1EV1 1;  1RUI 2;  3M3E A;  2QQW A;  4YVW B;  4IND A;  2VZP A;  3M2M A;  1W6M A;  4PCR A;  4QKN A;  5EQU A;  5GLT A;  3WG4 A;  2W92 A;  4KBB A;  4A41 A;  4GKY A;  3FFQ A;  3PJY A;  3FE5 A;  5A7Q A;  4Q4X 2;  4AZZ A;  4EWE A;  4RR3 A;  2OQ7 A;  3GXU A;  3I54 A;  4P14 A;  1HJG A;  1UY3 A;  3GHM A;  3ZXJ A;  1MZ5 A;  4A45 A;  3ZR5 A;  3J8F 3;  1Y9M A;  1H6X A;  4AR2 A;  3GBF A;  1F9K A;  1I5P A;  3NJZ A;  2H6C A;  2PAE A;  1ODM A;  1VBC 1;  4XXP A;  3IBM A;  1DG6 A;  3V0A B;  1QWR A;  5FP9 A;  2VZT A;  1W8H A;  5C7G A;  2RS5 3;  3KGZ A;  3JU9 A;  1PZ9 A;  3H8O A;  4LBO A;  1Q8S A;  1DGL A;  1LOF C;  3D3A A;  1FX5 A;  2HWD 3;  2ZML A;  4QXH A;  3WXP A;  3ORJ A;  1RVF 3;  4PLO A;  4A7K A;  4RGK A;  2HWE 2;  2WL1 A;  4XFI A;  4GH4 B;  3BKZ A;  1Z7S 1;  2WQ4 A;  2XR4 A;  3P1I A;  2WAO A;  1E5I A;  4WM8 C;  2AZ5 A;  2R32 A;  2ARC A;  4UWD A;  2RDR A;  1RUG 2;  4CEY A;  4FPH A;  4AXO A;  1W8W A;  1AL2 2;  4J6G A;  5EJZ B;  1PO1 1;  5FBZ A;  3SKV A;  1F5F A;  3ZLI A;  2DUP A;  1W39 A;  2VNO A;  3AKQ A;  4DMI A;  4CEW C;  5HBA A;  1UIK A;  3F2Z A;  3GNE A;  3KS7 A;  3TYJ A;  5LWB A;  4CCL A;  1C5H A;  4YNI A;  4HK8 A;  1G8W A;  5FY0 A;  2D6P A;  3AYC A;  1XSR A;  4P9W A;  3WD5 A;  1BK0 A;  5C9A B;  1JBC A;  4IEW A;  2OS2 A;  3IDA A;  5DUW A;  5DAV A;  1WLW A;  3LIH A;  2Y33 A;  4K8F A;  1RHI 1;  2W94 A;  1TEI A;  5AVP A;  2ZEW A;  4CDW A;  2OT7 A;  4BPZ A;  2P5B A;  4OQ9 A;  3NAP C;  1QKQ A;  2VZ3 A;  1J84 A;  1DU3 D;  3SH5 A;  4YAR A;  1W2T A;  4XDQ A;  4TLG A;  1IZ3 A;  4K6B A;  1BYH A;  1TMF 1;  1RVF 2;  2R0H A;  2VL4 A;  4HLT A;  3ZN6 A;  3LIG A;  4BQY A;  1Q8V A;  4AG4 A;  4QQ2 A;  2Y64 A;  1IS3 A;  1S1A A;  3WQ7 A;  5FKB A;  1KGY A;  2AEY A;  3MF9 A;  1DP0 A;  3ZXK A;  2GC1 A;  4KQ7 A;  2WQ8 A;  4Y26 A;  1ZZ6 A;  4XJZ A;  5DAW A;  4YW1 A;  2HYK A;  1CQ9 A;  4QQL A;  3M3C A;  2WII B;  5D1I A;  2CDP A;  4LIU A;  1S4C A;  2E26 A;  1OVP A;  2V4A A;  2EXJ A;  1GZW A;  2DVA A;  4LA3 A;  4IEU A;  2Z5W A;  2E53 A;  2E51 A;  1HV0 A;  1KJL A;  4Q8K A;  1K45 A;  1GFF 2;  1VPH A;  2D44 A;  1U5Z A;  2UYA A;  3VBO C;  1S0E A;  2XOM A;  3PUQ A;  1Y9G A;  4NUB A;  4B8E A;  1CIW A;  2VQU A;  4LOR A;  1R08 1;  4QM8 A;  4XFB A;  1A6C A;  1N47 A;  5CFC C;  2JE8 A;  2PQQ A;  1JZ3 A;  2HH9 A;  3O1S A;  4OMC A;  5FPA A;  2TNF A;  1K5J A;  1RJ7 A;  2IUW A;  5G05 L;  3RZZ A;  1HX6 A;  4CVU A;  5ABJ A;  1IPK A;  1POQ A;  4PDW B;  4XC9 A;  1LHO A;  2ZGS A;  1CAU B;  2HWF 2;  5E1R A;  2IVJ A;  3ZMN A;  2WWJ A;  1DIW A;  1W8U A;  2VH9 A;  2XDV A;  1N3Q A;  1SPP A;  3H9A A;  2CY6 A;  4IE7 A;  3T1M A;  3VBR C;  2Y6J A;  5F9T A;  4XBL A;  2KXL A;  1VRH 3;  4N43 A;  2FDJ A;  3OGJ A;  1GZT A;  4XUO A;  3FC0 A;  1KDM A;  1BZW A;  4DRR A;  4FPE A;  4MLO A;  2K2S A;  1ENQ A;  1RED A;  4YPJ A;  4E2S A;  2YC2 A;  1LU2 A;  2WRA A;  2CGP A;  4D0Q A;  1TNF A;  3AYD A;  2WZE A;  4UYB A;  2Y6G A;  2VAU A;  4OUM A;  4BCU A;  2V09 A;  3RQ0 A;  3AMH A;  5AC9 2;  4JGY B;  2NYY A;  2D3P A;  3DUI A;  2QQO A;  4COY A;  4IE6 A;  4AEJ A;  4HPK A;  5L7O B;  3VDD A;  1LOF A;  2QZ2 A;  4CDQ A;  5BYN A;  2ARX A;  1DGW A;  3DF0 A;  3VD5 A;  2K46 A;  3JD7 3;  3D5O A;  3BTA A;  4I2O A;  2GNT A;  5IVY A;  2VMH A;  3GCX A;  1UOF A;  3UKT A;  4YZ3 A;  2BFU L;  2A3Y A;  2NN8 A;  4ISR A;  4XW3 A;  4GIQ A;  4AI2 A;  4NOT A;  2RS1 3;  5A7P A;  4AQS A;  4XUR A;  2BDR A;  5L9B A;  4ZPI A;  4FP3 A;  1GQG A;  4AYU A;  4CEW A;  2QKD A;  1JU3 A;  1H2K A;  1EP0 A;  3N9Q A;  4FOQ A;  1JZ6 A;  1BK1 A;  3MIG A;  2HBT A;  4KWU A;  2XXZ A;  5FFO C;  3ZSM A;  3KD4 A;  1XE8 A;  4G3Y C;  3O1R A;  3WUC A;  1HQN A;  2JEM A;  3RYP A;  1CD3 G;  5EJ3 A;  3ZXG A;  4P9I A;  3WZ1 A;  2PLV 1;  3WR0 A;  4XQ4 A;  1ND3 A;  1R1A 2;  2PHL A;  2W87 A;  2WNU B;  3MV1 1;  2ZGK A;  5FZ4 A;  2WS9 3;  2JJ6 A;  3PUA A;  4QWN A;  5K0U A;  3V64 A;  3I3M A;  3VBH B;  1SZB A;  1B35 C;  1PO2 2;  4PHZ A;  4WVM A;  5F6L B;  4CCD A;  2VVE A;  1ZBA 2;  4AWD A;  3ZYB A;  5EV7 A;  4Q4W 2;  4ONU A;  5LBB A;  3WF2 A;  1IOA A;  5F6K A;  4JCK A;  2GMM A;  1EPW A;  3W59 A;  2Y34 A;  2JD4 A;  4MXW A;  5FZ1 A;  1SLI A;  2VNG A;  3HNM A;  1QNY A;  1GSL A;  1EAH 1;  1VAK A;  4CDW B;  3E5U A;  4HMZ A;  5FZL A;  2ZGU A;  3P3N A;  5LAT A;  1AR9 3;  2VOX A;  4XFF A;  5E16 A;  4BXS V;  1ALY A;  1RUF 2;  1JYC A;  1JI6 A;  3PJQ A;  2MEV 1;  3OYW A;  4D94 A;  5KHG A;  1L7L A;  4AHY A;  3FHA A;  1AVB A;  3LEK A;  4TWT A;  3MI8 A;  4JQT A;  2NMN A;  3IB3 A;  3AFG A;  2ZHL A;  2LS6 A;  5FZB A;  4BA6 A;  1UF2 C;  5LRS A;  1H4G A;  1QJX 1;  2QCS B;  1C8M 2;  3IDC B;  1YJL A;  4JGZ A;  5EZW A;  2J42 A;  4BQ3 A;  3ZYP A;  4E4H A;  3HN1 A;  5FPX A;  5CFC A;  4CCC A;  5FV3 A;  4MYE A;  2L9L A;  2NZ9 A;  1E5H A;  1NCR A;  1LR5 A;  1FI2 A;  2XQR A;  1Y3T A;  1HB1 A;  1MEC 2;  2K9Z A;  3EMR A;  3VBS B;  5IJR A;  3LF7 A;  5FCC A;  2LUW A;  3CL1 A;  3ZYJ B;  3M3O A;  1PVC 3;  1GNZ A;  1ZBA 3;  4ZHN A;  3BI3 A;  2J7M A;  2RMU 1;  2WFF 3;  3KHB A;  1CAW B;  2W08 A;  1ZRI A;  4P5H A;  1ZRC A;  1TNR A;  1UXZ A;  3VB9 A;  5F5I A;  1EPZ A;  1RUH 3;  3CJI B;  1AF9 A;  4DUX A;  4CCO A;  4LE3 A;  5C8W A;  4M0N A;  2RS3 3;  3CEW A;  1MR5 A;  3RJR A;  3VBU A;  1UYP A;  3HD8 B;  4MSV A;  3OD4 A;  2WAB A;  2WO1 A;  2AH2 A;  4A42 A;  1LEM A;  1J1T A;  2B7Y A;  3GHN A;  1ULF A;  2DCK A;  3AKR A;  5G04 L;  5B2G B;  2YB7 A;  3W5M A;  4BLI A;  2VUC A;  3E6C C;  1W3V A;  3PU8 A;  1RUC 2;  3R0R A;  1WME A;  2ERF A;  4ZKT B;  3N9N A;  2CWM A;  3AJY A;  3PIJ A;  3HIF A;  3VDD C;  5I8Y A;  4P9L A;  3GZE A;  2Q1Z B;  3O1T A;  1HIX A;  4M3C B;  4X6R B;  5D8A A;  1UX7 A;  3A4U A;  5KHI A;  1DQ4 A;  4CCJ A;  3I4I A;  1HB3 A;  2E7A A;  3III A;  5C4W C;  5F5Q A;  5T52 A;  3LE0 A;  5BPX A;  2QDN A;  5FZI A;  1UU4 A;  3NNF A;  4PBP A;  5A3U A;  2BEO A;  2V4V A;  5CU1 A;  1DGW X;  1RUH 2;  2VCC A;  4L92 A;  3AZX A;  1CX1 A;  4ET7 A;  4LIT A;  1FOD 3;  4UW5 A;  4AW7 A;  1CGP A;  3OGS A;  3WG2 A;  2P4E A;  3O5S A;  3TEW A;  2EXH A;  1XND A;  1W6Q B;  1WLC A;  4FOY A;  1VBE 1;  1W8Z A;  4TXW A;  4RHV 2;  4CE8 A;  4D7T A;  3AL6 A;  1U0A A;  1AR7 3;  5GAL A;  1JYT A;  2WNU A;  4XUP A;  1R09 1;  2PA7 A;  1ZBE 1;  1AXK A;  1XOY A;  5DG1 A;  4ERO A;  1RUC 3;  1X7N A;  4IGP A;  3ILN A;  3UGG A;  1JZ5 A;  1J1L A;  1N3P A;  1Q8Q A;  2DTW A;  3RWN A;  3WUD A;  5APA A;  2A6X A;  3M8L A;  1PMH X;  4HKO A;  4KWL A;  2PHT A;  4AF9 A;  1LUL A;  2D97 A;  3GGL A;  4GB3 1;  1N1V A;  3FZ3 A;  4R52 A;  1FMD 1;  1WW4 A;  2UWC A;  1MPX A;  4XFG A;  4ARX A;  4Q0Q A;  2GC3 A;  4OFG A;  4AQT A;  2Z42 A;  3WHT A;  5AVA A;  3BCW A;  3H7J A;  2YV8 A;  2WZP P;  3ZM8 A;  4CA9 A;  1ZRD A;  1KDK A;  2F17 A;  4TZD A;  1X50 A;  2DUO A;  1WW6 A;  3AP7 A;  4YW6 A;  2DCJ A;  4S2F A;  5E6H A;  3JD7 2;  2XPJ A;  4LT5 A;  1QJY 1;  4JAA A;  3NVC A;  5FJK A;  4AI0 A;  4WM8 A;  1GQH A;  3MV0 1;  1HXS 2;  2DVG A;  2WYF A;  2ZGR A;  2R04 1;  3LZZ A;  3ENR A;  5JAX A;  4MVT A;  1ZZB A;  2WC2 A;  1UL9 A;  5GZE A;  5FZ3 A;  3SQO A;  3WDY A;  1AR6 2;  2X29 A;  4AHW A;  1D2S A;  1WCK A;  1NCR C;  3B00 A;  3WNX A;  2C4X A;  2RS5 1;  3FN9 A;  3WP3 A;  5B4X A;  2ZX3 A;  2VQ0 A;  3ME2 A;  2GSY A;  2YU1 A;  1AYN 1;  3CHX A;  3SMH A;  4E2Q A;  2P3Y A;  5CAZ A;  2I74 A;  4I09 A;  4NIA A;  4NID A;  4LHK A;  3KV6 A;  2ZHM A;  3MFA A;  5FZH A;  5CB7 A;  5I0U A;  4RS5 C;  1YUD A;  4CUB A;  4Q26 A;  2NP0 A;  4BLJ A;  1QDO A;  3N9L A;  5IVE A;  3IZO A;  4NIG A;  3LPG A;  4NWW A;  4HET A;  1NCQ C;  3PTY A;  3CU7 A;  4K7J A;  5LBE A;  1SLC A;  3ETQ A;  1QJU 3;  1UZV A;  5T55 A;  4R9C A;  2VQA A;  5FMD A;  3SIS A;  3T2O A;  1JYV A;  1FNY A;  1GIC A;  1UX6 A;  1NXM A;  1SLA A;  4N53 B;  3HMY A;  4UAP A;  2CGO A;  3POE A;  2D40 A;  3RI8 A;  3UT0 A;  4XJA A;  2Z4F A;  2JEC A;  1W0O A;  4B4Q A;  4H14 A;  3NJV A;  1RTV A;  2EA7 A;  2ZAC A;  5D8A B;  4MHR A;  5EYY A;  1AYM 2;  5A6Q A;  1ND2 C;  1G9D A;  4K8R B;  4XDO A;  5FPU A;  2DBI A;  3B93 A;  1RUF 3;  2GP5 A;  2Z2S B;  3OG2 A;  1D4M 2;  2E9Q A;  4OUS A;  1GZC A;  4B4P A;  2Y38 A;  3N3H A;  3URF A;  3R4D B;  1X8M A;  3OUH A;  4Q4V 3;  4ES8 A;  1YQ6 A;  3KWV A;  4GH4 C;  4ORF A;  5FPV A;  5HV4 A;  4FTS A;  1MS5 A;  2W0X A;  4E4D X;  1ZZC A;  4X6Q B;  3WQB A;  1W05 A;  5A33 A;  3UKN A;  3KT4 A;  1XNB A;  4AHZ A;  3Q8B A;  2GU9 A;  1BXH A;  4I01 A;  1W2O A;  5IWF A;  2OKX A;  3RS6 A;  3MLL A;  4A6S A;  2A6Z A;  1KFX L;  4PQ9 A;  4QGN A;  3ZPY A;  1FPN 3;  5GM0 A;  1QJZ A;  1PGW 2;  2IFR A;  2PMW B;  4BE3 A;  4E4Z A;  3SIT A;  3ZIW A;  1ASJ 3;  3QOP A;  4D6S A;  3DXU A;  2SLI A;  2QBX A;  2X10 A;  4LO8 A;  3WW4 A;  4XCB A;  3AMN A;  3O1U A;  1SHW B;  2GH8 A;  4LHS A;  3ZFG A;  1RIR A;  4HSL A;  4QX1 A;  5F3I A;  4AVC A;  1SAC A;  1GBG A;  3MBW A;  3NNM A;  1GZW B;  1BMV 2;  4AAP A;  4FAG A;  4LK6 A;  1OA3 A;  3ETP A;  4YGE A;  4E27 A;  2OYZ A;  2XB6 C;  5A6Y A;  2WWS A;  4YG3 A;  2O14 A;  3SCH A;  1OVS A;  3UES A;  4NAM A;  4XF3 A;  3CF6 E;  1SMV A;  4Q0U A;  3MIH A;  2ZAA A;  4QPG C;  2WT1 A;  3T30 A;  2ZX2 A;  2C0Z A;  4RQP B;  2VXJ A;  3JQW A;  4XF0 A;  5FZ9 A;  2JDP A;  2WO3 A;  2WBK A;  4YYO A;  3U75 A;  5J98 B;  2HWC 2;  1NY7 1;  3K4A A;  5BNP C;  3BOP A;  4WM7 B;  5BNN B;  1E5R A;  3ES4 A;  1LRH A;  1RUJ 1;  1YHF A;  3ZKY A;  1H9W A;  3WV6 A;  3AC0 A;  1YXW A;  1GP5 A;  2QNK A;  2QQV A;  5FY5 A;  2FMD A;  5BNP B;  4M00 A;  2P34 A;  3ZYR A;  2P17 A;  3RZL A;  3M4F A;  4HZF A;  5DDJ 1;  3ZYF A;  2RM2 1;  3NRU A;  4P9G A;  4YSF A;  4XF1 A;  3EJK A;  3D0J A;  1ASJ 1;  5L7O C;  3FLR A;  1NE6 A;  1WCD J;  1RUN A;  3VL9 A;  4SLI A;  1RUI 3;  5FMO L;  4Y1Y A;  4LOS A;  1ULD A;  1H1I A;  2Y6H A;  2ZGP A;  3A21 A;  2P3J A;  2WZR 2;  4QDS A;  4UF0 B;  2WDB A;  1LKN A;  2D7F A;  3M70 A;  1VBD 1;  1URX A;  2JG8 B;  4R9A A;  4AVA A;  4N9H A;  1GLH A;  5DG2 A;  4QHB A;  3A23 A;  1IKP A;  1W6M B;  3J8F 2;  5CKM A;  3U0Z A;  1PX3 A;  2W91 A;  4UT5 A;  3NAP A;  1D2Q A;  3HT2 A;  1COV 2;  1PIV 2;  5K0U C;  1POV 3;  3LWC A;  3NMB A;  3WCS A;  3ZSL A;  2HWC 3;  3BUC A;  1AZD A;  5LA0 A;  4M3C E;  4TN7 A;  1MVE A;  5LEJ A;  1WLD A;  2PAK A;  5CFD B;  1W99 A;  1HRI 2;  4JQR A;  4DO0 A;  4COW A;  3MW3 A;  1RUJ 3;  4JX0 A;  5H9Q A;  1V6L A;  1VRH 1;  4PDW C;  3KT1 A;  3UJQ A;  2MPF A;  3TWI A;  4ISQ A;  3WNM A;  3MPP G;  1J3Q A;  4BK5 A;  4CDX B;  1QJU 1;  2OII A;  2ZX1 A;  4D7S A;  1W28 A;  3VKF C;  5F39 A;  1J3P A;  4Y5Z 0;  2WFP A;  4EWD A;  1C8N A;  5FO7 B;  4A6O A;  3KV5 A;  3ZVX A;  1PVC 2;  3BVC A;  3WF0 A;  1H8T C;  4FOV A;  1O4Z A;  5A32 B;  1BKZ A;  1W6O B;  4S2D A;  4HFS A;  5JSR A;  5L9V A;  4Y22 A;  4RR3 B;  3V0B B;  1SCS A;  1POV 0;  4Q4Y 2;  1YLL A;  5KHK A;  5JXG A;  2XHK A;  1MZ6 A;  1MQT A;  1H4H A;  3OBT A;  4N8M A;  3ZXL A;  4A7Y A;  3QH7 A;  5IW0 A;  1JHN A;  3KMH A;  3O0V A;  5JCT A;  2A75 A;  2JX9 A;  3VDB A;  1V6I A;  3WCR A;  3BOD A;  2JKX A;  3HAG A;  3ZKU A;  1SBD A;  3AZZ A;  5CA6 A;  2VW2 A;  4BQ4 A;  4MXW B;  2HJI A;  2ARB A;  1Z78 A;  2A7A A;  1DZR A;  3J26 N;  4HAN A;  4LO5 B;  3WG3 A;  4A7Z A;  2ZAB A;  4NPL A;  3CJX A;  3SEE A;  3R6S A;  5EJ1 B;  4LO4 B;  3RPQ A;  4H7M A;  4ZS2 A;  2WS9 1;  2HWB 3;  4Q1P A;  3DKQ A;  2W2I A;  5I0D A;  1HW5 A;  1F35 A;  1I5Z A;  1KS4 A;  1QJF A;  1V9U 2;  4YZ5 A;  5FUI A;  3AYA A;  4FPL A;  4QXK A;  4K40 A;  5JI9 A;  2FDI A;  3VZJ A;  3OB8 A;  4F7Z A;  4ARY A;  3MDP A;  3I2O A;  5H9P A;  3ZYG A;  5GKA C;  2ID4 A;  1GP4 A;  2D6K A;  2W1S A;  4A2U A;  1HRV 3;  1XYN A;  3UYJ A;  1CJD A;  5BNQ A;  3MW2 A;  1G9B A;  4C8D A;  3RYR A;  4XET A;  1JYI A;  1VMJ A;  1LHN A;  3O14 A;  1OKQ A;  4WM8 B;  4BB3 A;  3BOW A;  1H2M A;  2R07 1;  1H30 A;  2WKK A;  2C9K A;  3A0K A;  5FTT C;  3OJB A;  4RFR B;  1UNB A;  4NN0 A;  3PU3 A;  2OXB A;  3PNA A;  2QQU A;  4LNV A;  3NNG A;  4JDO A;  4CP9 B;  4EN9 B;  4YM3 A;  1YQ8 A;  5L7O A;  4XAC A;  3C8X A;  5D21 A;  5ACA 2;  1NZC A;  5BNN C;  3ELN A;  2C5D A;  3WDV A;  1LCL A;  3I7D A;  2W1U A;  2CHH A;  2RJK A;  2F4L A;  3VHN A;  1CAV B;  1U5X A;  4LBL A;  4LUM A;  1QJE A;  4QXB A;  4Y1U A;  1W3X A;  3RVH A;  4KH9 A;  5T54 A;  4BU2 A;  1GU3 A;  1YJK A;  2VVF A;  1TZO A;  2YC4 A;  1FYU A;  1IGO A;  3MLK A;  4PT6 A;  4QPG B;  3KGL A;  3N9P A;  5FZO A;  3K4D A;  4EN8 B;  2HWD 1;  1OF3 A;  3WIN E;  4DUW A;  1B35 A;  1K5M C;  5JXJ A;  1U12 A;  2TUN A;  3H3L A;  2ILM A;  4UI9 L;  1UWW A;  2ES3 A;  1UN1 A;  3MID A;  2P3K A;  3AP5 A;  4IW3 A;  4Q4X 3;  4IE4 A;  2WO7 A;  3I2F A;  4Z2A A;  1XU1 A;  5KC5 A;  1VR3 A;  3TEY A;  3LDB A;  2KA3 A;  5JR7 B;  1YEW A;  5DUX A;  2VMF A;  5ABJ B;  2DBN A;  4K9S A;  4NVP A;  3TN9 2;  2XBO 2;  4HL0 A;  3AVR A;  5LB6 A;  5FZK A;  5C6C A;  3HNB M;  1DZQ A;  3EQE A;  2JXA A;  5CAD A;  1JUI A;  5FZM A;  1VBA 1;  1TME 1;  1NE4 A;  3NV2 A;  4E4S A;  4XZU G;  4W50 A;  4QX2 A;  2VUD A;  3PUI A;  1RMU 3;  2W47 A;  4PIZ A;  4YW4 A;  2CNA A;  1BBT 1;  3ON7 A;  2ZMN A;  4Z2W A;  3PUR A;  4FXK B;  4J1W A;  1W90 A;  1AJK A;  1K3I A;  1C1L A;  1OXC A;  1XPW A;  3KLS A;  2XVG A;  1HN0 A;  3I59 B;  4DNY A;  4BQ1 A;  5JZG C;  1O4Y A;  2CDO A;  1AR8 2;  5IUQ A;  2XWJ B;  3KV9 A;  3T1L A;  1L7Q A;  1PHM A;  2PXJ A;  2W95 A;  3U4S A;  4B1M A;  1PGS A;  2BJS A;  3JZV A;  4XUQ A;  1EUU A;  3AKP A;  4B29 A;  1O3R A;  5FPL A;  1GYK A;  5DPN A;  3NL1 A;  2ATF A;  3VHO A;  5FLH A;  4R9D A;  4W8J A;  2EF6 A;  2XGX A;  3EXU A;  3RI9 A;  3UET A;  1RUD 1;  3OUI A;  4CDQ B;  2XJQ A;  5JWP A;  3E6B A;  4LLF A;  3TBD A;  4CTE A;  1BEV 2;  3LA2 A;  2LRO A;  3ZX7 A;  5FWE A;  4AFB A;  2X5I A;  1FOD 1;  2RS3 1;  4B4R A;  5M0T A;  4IDZ A;  3VD7 A;  2OW4 A;  3T2T A;  5KHH A;  2OA2 A;  1G86 A;  1B35 B;  2CAV A;  4ES9 A;  5F3C A;  1AR9 1;  4MOA A;  2PQS A;  4GZ9 A;  4BYY A;  4RHV 3;  1RMU 1;  2XBO 3;  5EYX A;  1AR7 2;  3NW4 A;  4DXZ A;  3ZYH A;  1EAH 3;  2VJX A;  4FBF A;  4L99 A;  5FRE A;  4BQW A;  2XLG A;  1WCU A;  3POB A;  3QBQ A;  4Y33 A;  1YQ5 A;  4AEK A;  1Y9Q A;  4FQ4 A;  5A7S A;  3DEC A;  4WM7 A;  2J1E A;  4JKK A;  2E7Q A;  4N43 B;  5EPA A;  2VY0 A;  1R09 3;  2VZU A;  4PF1 A;  4QX3 A;  4NJ4 A;  5A7W A;  3SXW A;  4Z82 A;  4JRA A;  2JIG A;  2Y60 A;  1UY1 A;  2G9F A;  4ZZ8 A;  2BOI A;  3VBF B;  1YCI A;  2A6Y A;  1ST8 A;  3IDE A;  3KF5 A;  4N7I A;  5D8A C;  2R1D A;  5F2W A;  3IN9 A;  2GMP A;  3FLT A;  1F4H A;  4Y4R A;  2RHP A;  4CU9 A;  5C4W A;  1VB2 A;  5LRR A;  4XJW A;  2ZOE B;  4LKS A;  3DL3 A;  1SDW A;  4H55 A;  5GLU A;  2EAK A;  3USU B;  3UNP A;  2BBV A;  1GUI A;  4CYD A;  3ILF A;  3I2D A;  2QJV A;  3H8X A;  4AVS A;  3C7F A;  3POF A;  4LBQ A;  3WT3 A;  1NCQ B;  3WNN A;  2QQI A;  2WA3 A;  1UY0 A;  1DLL A;  4OI2 A;  4EV0 A;  3IMN A;  1QDC A;  1DHK B;  4NPM A;  3LAG A;  5IK4 A;  2WLP A;  2WNO A;  3WX5 A;  1K5M B;  4HK9 A;  4MAD A;  5JVV A;  4BME A;  1KIT A;  2WNU C;  5J36 A;  1ENS A;  3KZ4 C;  3KHC A;  1PGL 1;  1S0F A;  4FAH A;  5KXD A;  2VD7 A;  3PUS A;  3WF3 A;  2JB8 A;  4Q4V 2;  4A3X A;  4PIX A;  1AX2 A;  1WMF A;  2VZS A;  3ZFG C;  3OOX A;  3ECQ A;  4AGG A;  2PAM A;  4H3W A;  4IV3 C;  2ZPX A;  1H2N A;  3ZR6 A;  4LOT A;  2ENR A;  4CU7 A;  4ZU7 A;  5L73 A;  1GOH A;  2GZW A;  3O0X A;  4QKD A;  1G9C A;  3HQR A;  3SCG A;  2JIC A;  5FOB B;  4Q5O A;  1NG0 A;  1LGB A;  4AED B;  4B3N A;  5KBF A;  4GWJ A;  1O4T A;  1NQJ A;  3J9S A;  4CSW A;  2NPI A;  3L2Y A;  3LPF A;  4N53 A;  5C8C C;  5BNP A;  1YIP A;  1L3J A;  4FI9 A;  4NRP A;  3RZH A;  3PUH A;  5FZ8 A;  3CZU A;  2X5I B;  5ANQ A;  4AFD A;  4EJR A;  3MW4 A;  3CZJ A;  1DFQ A;  1DYO A;  1VLN A;  4JGY C;  4QQP A;  5DAP A;  4DQA A;  4E2G A;  5BNO C;  5J96 B;  3OTF A;  3HVD A;  3TNP B;  4AI9 A;  5C4W B;  3FJS A;  4MGK E;  1LJ7 A;  5IVB A;  1PIV 3;  3I3Q A;  2J22 A;  5KXB A;  2R07 3;  1AL0 G;  2W52 A;  1US2 A;  1ZBE 3;  4N7U A;  2BER A;  5CIS A;  5L36 A;  3WP4 A;  3U37 A;  1Q3E A;  3CQO A;  4BMB A;  2RS1 2;  4O7X A;  4YM2 A;  2XG3 A;  3LFI A;  4HG6 B;  3KQ4 B;  2QTW B;  3J4U H;  2XWB B;  4QPW A;  3ZFF C;  4XF9 A;  1J59 A;  3V65 A;  3AM2 A;  1OFN A;  5KHJ A;  2BU9 A;  1A3K A;  2JEN A;  4YG0 A;  2H0B A;  2JDY A;  4OI0 A;  3THT A;  1OPO A;  1D0H A;  4URT A;  1WUV A;  3BYW A;  4IE5 A;  5FXW A;  2V5Y A;  4GB3 3;  3RWK X;  2PHU A;  3M1H A;  3LEG A;  1UYX A;  4HVR A;  5DZF A;  3USU A;  4QDR A;  4ATF A;  3CJI C;  2OUJ A;  5DUU A;  5I8S A;  3NAP B;  5FYV A;  1EUT A;  5DQ0 A;  4FPK A;  3T4V A;  1FPN 1;  1OA2 A;  2JG9 C;  2ZBJ A;  3ZMO A;  4DEV A;  5A6X A;  2B9V A;  4AHX A;  2JWP A;  4YVS C;  3LA3 A;  5JMO A;  1QXR A;  2ZX4 A;  5JI7 A;  2AR6 A;  2D3R A;  4GXL A;  4R4Z A;  3SH4 A;  5C8C B;  2A6V A;  2DTY A;  1RUE 1;  2DVB A;  4WVM B;  3OGR A;  1O91 A;  1SBF A;  3A22 A;  2O8Q A;  5F3G A;  4ZU5 A;  2HLE A;  3OUJ A;  4GD4 A;  1ND3 B;  1AJO A;  4BZ4 A;  4QQO A;  2RV9 A;  1LNS A;  2OVU A;  4RL7 A;  5LK5 A;  4LKF A;  4XPV A;  5A3L A;  3R05 A;  5A7N A;  1H8T A;  2BOJ A;  5FP3 A;  1SCR A;  1IS5 A;  5JOY A;  1C4R A;  2JDM A;  5A6Z A;  1VP6 A;  1OKO A;  2C9A A;  3HOB A;  4U36 A;  2F6B A;  4QT6 A;  3EB7 A;  2BPA 2;  4Z1V A;  2LTN A;  5FP4 A;  2X53 S;  1SPP B;  4DUV A;  3POS A;  1LB2 A;  5CFD C;  5DZG A;  1QNW A;  1R64 A;  5IYY A;  2JDA A;  3K51 A;  3THP A;  5H9R A;  4NRO A;  3GBW A;  5LY1 A;  1OLQ A;  2DCZ A;  1Y7B A;  4NAO A;  5K7P A;  1OHF A;  4OMD A;  1BJQ A;  1OF4 A;  2VZQ A;  3EHK A;  2QUO A;  3C7O A;  4OCT A;  1ZX5 A;  3WNP A;  2YU2 A;  2VBD A;  4XUN A;  5FMO S;  3WVJ A;  4JDM A;  1T6G C;  1UPI A;  4NHK A;  3S57 A;  1JZ8 A;  4CXY A;  4IV3 A;  2YY1 A;  3JB8 A;  4CXW A;  2Q1F A;  4YFW A;  4CEW B;  5BXX A;  3NV3 A;  5FUP A;  1U5Y A;  1HLC A;  1CVN A;  5J09 A;  1V70 A;  1KXG A;  1ZZ9 A;  2B46 X;  1DZT A;  1KS5 A;  2NQY A;  1VBC 2;  4G9S B;  1JHJ A;  1UMI A;  3Q9O A;  3D82 A;  4CDX C;  2BGP A;  4PQQ A;  2QZ3 A;  3T09 A;  4LBQ D;  1TG7 A;  1H1M A;  1WZX A;  3U1X A;  3GBG A;  2UWA A;  3WP6 A;  2TEP A;  2NMO A;  1HQL A;  2Y6F A;  1AHS A;  1OI6 A;  1ZNP A;  1BLZ A;  1UQX A;  4MXV A;  5FRA A;  3RMX A;  4QPI C;  5FYS A;  4OYU A;  4KBZ A;  5A7O A;  2J1U A;  4JGY A;  1X9P A;  3JXS A;  3T4H B;  1SDD B;  4B7K A;  2HWE 1;  5JIA A;  2UUR A;  3RRD A;  1Z7S 2;  5FYM A;  2HEY F;  4GKX A;  1AX0 A;  1V6K A;  3ZFE A;  3MIB A;  2WNV A;  4GWN A;  4LQR A;  3UGF A;  4E8D A;  1XYP A;  4BH9 A;  2BWA A;  2VBB A;  2UY8 A;  4XIK A;  3O0W A;  5FZC A;  2ZGM A;  2DV9 A;  3AK0 A;  2WIN B;  3GF6 A;  5A3P A;  3I8T A;  1BHG A;  2IXH A;  2PFW A;  5LA9 A;  3VBS A;  4FOW A;  3EYP A;  4ASK A;  2C26 A;  1GZ9 A;  4L8Q A;  4XIL A;  1T6B X;  2GH2 A;  3HBK A;  4M3C F;  4GJZ A;  5LW9 A;  1N1Y A;  1YRZ A;  4JC1 A;  1RB8 G;  1RGS A;  2VZR A;  1VBE 3;  5FZ0 A;  2Q0A A;  4NO4 A;  4NR1 A;  4HOO A;  3ZXA C;  1UIJ A;  2FCT A;  2HWB 1;  3PLQ A;  1AR6 3;  3WDX A;  1WLT A;  3TOJ A;  3VGI A;  5F37 A;  2JB4 A;  4FPC A;  2XKP A;  1VBB 1;  1JZ7 A;  1QQP 1;  5FK8 A;  4FPY A;  4MGI E;  2VW0 A;  1SEF A;  2WR9 A;  3VKM A;  1DQ2 A;  3VBR B;  1UYY A;  3O12 A;  3HN3 A;  4P9X A;  1TMF 2;  1RVF 1;  2G4I A;  1Z7S 3;  4P5Y A;  2VM9 A;  2RR1 1;  1W04 A;  4WVV A;  2KR2 A;  3E1F 1;  4XJU A;  5FP7 A;  1S0C A;  1D4V B;  4AGV A;  1HRV 1;  4PIY A;  1JYX A;  3B02 A;  3POJ A;  1CZS A;  4AK3 A;  4LBM A;  2Q4S A;  1LOB A;  3V0A A;  3S0M A;  3S30 A;  1UKR A;  3VHR A;  4GMP 0;  2D3S A;  3H1M A;  3KCY A;  3OY8 A;  5F5A A;  3GJA A;  3TEZ A;  3OBZ A;  1W9F A;  4BDV B;  4XQD A;  3VBO B;  2AEZ A;  2JG8 A;  1YI7 A;  3BPS A;  3KSC A;  2CV6 A;  4LEJ A;  1C1F A;  2JD9 A;  4BIF A;  2PTM A;  1FV2 A;  4WBB A;  4XE9 A;  1GNH A;  4XIO A;  5JMC A;  3UL2 A;  4CEY B;  2BUK A;  2MHF A;  2J1T A;  3NST A;  4IEV A;  4CUC A;  1J3R A;  2CL2 A;  2CU5 A;  2G1M A;  4X8N A;  1HXS 3;  3G7D A;  4XJ8 A;  4YGC A;  1HN1 A;  4NWV A;  3E6D A;  3GJB A;  4PBO A;  2QQN A;  2VCA A;  1W2U A;  4NE9 A;  4R4X A;  2ADE A;  3ILR A;  3VKO A;  3P5B A;  3MZH A;  4QX7 A;  4Y1Z A;  4QPI B;  1PNG A;  4XHB A;  5ACA 3;  2FZ1 A;  2HWF 1;  5IAV A;  4CZS A;  5A1A A;  1IG0 A;  4OHV A;  2F4P A;  2BVB A;  3LKJ A;  1YFW A;  1JW6 A;  3SH3 A;  3HNY M;  1CON A;  5FY4 A;  1T2X A;  3H42 B;  4XZP A;  4CP1 A;  3ZFE B;  1ULE A;  3LD8 A;  1UY2 A;  1H0B A;  4IGO A;  4CU8 A;  4O61 A;  4TLF A;  2VMG A;  1N1S A;  2GP3 A;  4LA2 A;  4B7E A;  1DYK A;  2FDF A;  5FZA A;  4JGZ B;  1UZY A;  4CDX A;  4GMP 1;  5FP8 A;  3VDA A;  1AUY A;  1YWK A;  3N36 A;  4P00 B;  1CPN A;  2E63 A;  1YI9 A;  5A1F A;  5AC9 1;  5BUV A;  1OC1 A;  2WFF 1;  3IMM A;  2BW8 A;  3OY8 B;  3HJR A;  1B09 A;  3EO6 A;  2B42 B;  3PVE A;  4QPI A;  5FZO B;  2MEV 3;  3OBA A;  3THD A;  5IVF A;  3UKV A;  4WV8 A;  5LA2 A;  5GZD A;  2BP6 A;  3VUO A;  4RGA A;  4RYD A;  3HPN A;  2IXJ A;  2XON A;  1I1E A;  2E7T A;  2UWB A;  3ZFE C;  1CAV A;  1ZVF A;  1O3T A;  1D4M 3;  3BIW E;  3ES1 A;  1LAJ A;  5C3P A;  3AL5 A;  3ALQ A;  2E33 A;  3LDK A;  3OD0 A;  5FWJ A;  1H9P A;  1JOJ A;  1VAM A;  3LB9 A;  1C28 A;  1O5U A;  1DGR A;  1OUX A;  2XH6 A;  1PK6 A;  5FZ7 A;  2R06 1;  1PZ8 A;  2DFB A;  4MGQ A;  3JBG 1;  2IXK A;  1S55 A;  4QPY A;  3DYP A;  2IZW A;  2ZX0 A;  2JE9 A;  5K0U B;  4KNC A;  4RSU A;  2NLR A;  2ZTN A;  1EV1 2;  3MGU A;  1V6M A;  1RUI 1;  2W1W A;  1G7Y A;  1OLR A;  1PO1 3;  2Y0O A;  4MH0 E;  3WNK A;  4GWM A;  3WLU A;  2EIE A;  2PYT A;  3LOI A;  3WDU A;  1OMI A;  1PMJ X;  1QOO A;  2PLV 2;  5FYT A;  1OOP A;  4QMA A;  1K5M A;  4Q4X 1;  5IVV A;  4XFC A;  1R1A 1;  1W2A X;  2B8M A;  4NPR A;  2VQT A;  3MIC A;  2XJU A;  4SBV A;  4QHZ A;  4RR3 C;  4QKF A;  1MAC A;  5IHR A;  4CCN A;  3HQU A;  5BNO B;  4Q1R A;  2X05 A;  1PO2 1;  2BZD A;  3Q8C A;  1OH3 A;  4LBJ A;  2P1B A;  3H8R A;  5IVJ A;  5AC9 3;  3N7J A;  1POV 1;  4IV1 B;  2VOW A;  3JUU A;  2C6S A;  3POW A;  2GC0 A;  2ETE A;  4IGQ A;  4IL7 A;  4DIQ A;  1LES A;  3ZYI B;  2GN3 A;  1S0J A;  1NOV A;  1ULO A;  3I2I A;  3VN4 A;  2D5H A;  4ASL A;  1W6N A;  1ZM1 A;  5IAT A;  2BNO A;  2P2K A;  3VV1 A;  1NLR A;  5AFE A;  5JOX A;  1EAH 2;  1O59 A;  1A8D A;  3WQ0 A;  3J7H A;  5JSP A;  1RUF 1;  1LU1 A;  3VDD B;  1J58 A;  4C0H A;  1QIQ A;  4QX5 A;  3ZFF B;  1REE A;  1IPS A;  1FXZ A;  5JZG A;  4HBN A;  1UD1 A;  4NMI A;  1RUG 1;  1MS4 A;  4IET A;  1F4A A;  4QB2 A;  4MG2 A;  1ENX A;  5CIR A;  5IK7 A;  3IKW A;  1AL2 1;  2ZMK A;  2FHR A;  3W21 A;  3UK9 A;  4OI4 A;  4AVV A;  1PO1 2;  4CEY C;  4B1L A;  1C8M 1;  4IEQ A;  5GLW A;  4XHX A;  5A3N A;  2CYF A;  2RDN A;  4PI0 A;  1WGP A;  4YGD A;  5KR7 A;  1RUO A;  4K1Z A;  2DCY A;  3A7Q A;  3T0D A;  1GWM A;  2E6V A;  1QOS A;  3MHZ A;  1MEC 1;  1WD4 A;  2JKB A;  2IWG B;  1KRI A;  3H50 A;  1RHI 2;  2X5I C;  1NA1 B;  2YFU A;  3D8C A;  5LBF A;  5BY5 A;  5T5O A;  2FCU A;  2RE9 A;  5FMB A;  4JTN A;  1L7R A;  4OHX A;  2YBP A;  3KQR A;  3U78 A;  1JYN A;  2DVD A;  3TEX A;  5GJ6 A;  4BQ5 A;  4YFZ A;  4MGY E;  1S0B A;  2VCM A;  1UU6 A;  2ET7 A;  1I3H A;  3FFZ A;  2Q8E A;  4UFM A;  2ARA A;  4IV1 A;  1VMF A;  2DWR A;  5DXD A;  1X36 A;  3LSE A;  1DF0 A;  1LEN A;  2A1X A;  2HWF 3;  4IE0 A;  4S2G A;  3KCX A;  2R30 A;  2A71 A;  4YVS A;  1LTE A;  4OHY A;  1F15 A;  1N1T A;  3P6B A;  4QXC A;  5A1L A;  2RR1 3;  1RJ8 A;  2WQZ C;  1NQD A;  2XUE A;  4MZU A;  4Y4Y A;  3ZSE A;  4CUG A;  1IG3 A;  1C8M 3;  1F8V A;  2W39 A;  4GUL A;  1ZA7 A;  4CCM A;  2WWU A;  3AZV A;  1RUC 1;  3O1M A;  1OFS A;  1OOP B;  3MFC A;  3I2H A;  3BTX A;  2HEW F;  2QDR A;  1US3 A;  3IM0 A;  3O1P A;  2Y6L A;  4DB5 A;  1YFY A;  3SHR A;  5DMY A;  1W2N A;  3P3P A;  4OZX A;  3AFK A;  3BTZ A;  3K77 A;  4KG8 A;  3OEA A;  1R08 2;  3X29 B;  3VBO A;  1RUE 3;  1PK6 B;  3BN6 A;  1F5J A;  2A5Z A;  1CR7 A;  5FYB A;  1PK6 C;  1UOG A;  1OBN A;  1WA4 A;  3RYK A;  3WF4 A;  1V0A A;  4UXA A;  4KWK A;  4BIO A;  2ZXQ A;  4AFC A;  2QFE A;  4Y20 A;  3QH6 A;  2WZ8 A;  4OHW A;  1SLL A;  1VBE 2;  5FKC A;  1SFP A;  4BWO A;  2X8K A;  1OOP C;  2JE7 A;  3HR9 A;  1XNC A;  1R09 2;  3RZM A;  1K12 A;  2OZJ A;  3VBR A;  2ZHK A;  5JZG B;  2GND A;  5LBC A;  5I0R A;  2FZ2 A;  1XB9 A;  3IIA A;  3BIE A;  5IFP A;  1W9Y A;  3ZOI A;  3FMG A;  1CES A;  2XVK A;  5IVC A;  3RDI A;  2DU1 A;  1LGN A;  5DN2 A;  3RGB A;  4MUV A;  1LOG A;  4GB3 2;  1KJR A;  2B5H A;  3AKT A;  1W8F A;  2CWS A;  1XBF A;  3GZT B;  1FMD 2;  1W6N B;  4FSJ A;  1CPM A;  3LA7 A;  5JXH A;  3RFR A;  3OPT A;  3I2G A;  1W6P A;  2VTF A;  2N7G A;  4KU8 A;  4QX8 A;  3WP5 A;  5HV0 A;  1RYY A;  4KGQ A;  2YXS A;  4QM9 A;  3CIH A;  4P9Y A;  1UCX A;  2DF7 A;  3S5Q A;  5FO8 B;  2Q1M A;  1U5I A;  1C3H A;  2V72 A;  3ABZ A;  5BNO A;  5F2S A;  3N9O A;  4LBK A;  4RD7 A;  2BNN A;  2D98 A;  4FPG A;  2C24 A;  2FCV A;  4M3C A;  1W6P B;  2P3I A;  2VOV A;  2WT2 A;  2VCB A;  3JD7 1;  2XLF A;  3RZJ A;  3Q8F A;  3N7K A;  3VKN A;  1QJY 2;  3ZDV A;  2ZAH A;  4KI5 M;  3WNO A;  5DZE A;  1RIT A;  4XMA A;  1OQE A;  1NT0 A;  3VHP A;  2R04 2;  2R6Q A;  2WNE A;  1TQ5 A;  2P6H A;  2DDU A;  2R16 A;  2PN5 A;  2WSV A;  4H7L A;  4KGG A;  4OLL A;  4QDQ A;  4F3J A;  4DS0 A;  5FOJ B;  5A7W B;  4WZF A;  1YO8 A;  2RS5 2;  3K2O A;  4COZ A;  1JOP A;  3BU0 A;  5T5L A;  3KM5 A;  2YRO A;  2AGS A;  1I6X A;  4K20 A;  1AYN 2;  4FPJ A;  1ND3 C;  3NJY A;  2FMY A;  5A70 A;  3CJI A;  3IAQ A;  4FVV A;  2UYB A;  2D93 A;  1CZT A;  2Q8D A;  2GN7 A;  3WY6 A;  4D3W A;  1OT5 A;  1ZBA 1;  2KM2 A;  2A73 B;  5FDB A;  2H6B A;  2RMU 3;  3MYX A;  3AKS A;  4N9I A;  4Q4W 1;  3TNQ A;  2VNV A;  1NCQ A;  1AL2 3;  1SLT A;  1W8N A;  3K3N A;  3SLI A;  1CX4 A;  1G9F A;  2O1Q A;  1NA1 C;  1RUD 3;  2A3X A;  3AVS A;  4XXA A;  2XVL A;  1S2E A;  2Z79 A;  2YBS A;  3U10 A;  3AZY A;  4FFF A;  1BCX A;  1OLM E;  2GAL A;  1ZZ8 A;  4XBQ A;  3ZDS A;  4YLZ A;  1W03 A;  2WAA A;  4Y22 B;  2W5F A;  5A32 A;  5TSW A;  4AEM A;  4F83 A;  3W5N A;  3NWK A;  1A34 A;  4OHZ A;  2MEV 2;  4F8A A;  2YMZ A;  2VR4 A;  3IWZ A;  3POG A;  4GWI A;  3PVN A;  1AYM 1;  3OBR A;  1S0G A;  2QVS B;  1OPM A;  1FAY A;  2WN3 A;  1ZA4 A;  1Q5O A;  3Q8A A;  2G9G A;  4GH4 A;  1D4M 1;  3PIG A;  1BBT 3;  2RVA A;  2VXR A;  1ZRE A;  1QJX 2;  4EN6 B;  1NXD 1;  1S2K A;  4JHT A;  4ZXK A;  1LOA A;  1NKG A;  4G4F A;  2VUJ A;  4PI2 A;  2BTV C;  4E8C A;  3L9J T;  1XJA A;  4C90 A;  3OF1 A;  3K4Z A;  1AXY A;  3FLP A;  1UMZ A;  2ZEZ A;  2WLQ A;  1V00 A;  3FWE A;  4S2H A;  5FAX A;  3U4X A;  4CCK A;  5CBL A;  4BM8 A;  5JXI A;  5E89 A;  1H1A A;  1PGW 1;  4AI1 A;  2AYH A;  4Q0P A;  4LKE A;  4LUK A;  5CFC B;  3THC A;  2RMU 2;  1WCS A;  1QH6 A;  3VD4 A;  3ACG A;  4MGS A;  5EXO A;  1UW8 A;  1IS6 A;  4ITC A;  5F32 A;  4DZG A;  5LZ6 A;  2XHN A;  4I0W B;  5I0T A;  4AFM A;  3AJZ A;  3CO2 A;  3VZO A;  2PEL A;  4JRL A;  2DVF A;  1NX9 A;  2HEV F;  3N7M A;  3S7I A;  1D0G A;  3U14 A;  2O0O A;  2V5D A;  4AED C;  1E57 A;  3LSD A;  4W4Z A;  5J37 A;  2RJ2 A;  5KXC A;  1QF3 A;  2P6C A;  3BGA A;  3DYO A;  4UFL A;  3T0B A;  4GAZ A;  5A3W A;  2QQL A;  3KCC A;  1ZZ7 A;  3SCF A;  4Z92 B;  4M4P A;  2WJS A;  4AAX A;  4RA0 A;  4LHL A;  4XCA A;  2GDF A;  3UV9 A;  4MET A;  2DUQ A;  4XQW A;  3DCQ A;  4L11 A;  1NY7 2;  4EYU A;  4NHY A;  3OPW A;  5FR3 A;  1DCS A;  1XNA A;  2AC1 A;  5CG8 A;  4ASM B;  1ENR A;  2AAC A;  3JQX A;  1DQ1 A;  4YG6 A;  3WQ1 A;  3S7E A;  3N9M A;  3D4K A;  1GOF A;  2BGC A;  2GNB A;  3AP9 A;  4R8H A;  2I07 B;  1QEX A;  2PHF A;  4D6Q A;  5IT6 A;  2WO2 A;  2WNV C;  4OUL A;  2BFU S;  1FNZ A;  4TSV A;  1UZ0 A;  2ORX A;  1UY4 A;  4FFH A;  5E8A A;  1NUK A;  1RUH 1;  3G6J B;  3BU7 A;  1PZ7 A;  4BXF A;  4CU6 A;  2ZHN A;  5T3N A;  4EN7 B;  5C9A C;  4YZ2 A;  1ASJ 2;  3J7L A;  1JU4 A;  5BV6 A;  3CKH A;  3NO8 A;  4RHV 1;  4U2A A;  3N35 A;  3WHU A;  2ZGT A;  5ISL A;  1IQD C;  1XNT A;  1SFN A;  3MUY 1;  4CDU B;  5FUN A;  4H2A A;  1BEV 3;  1VRB A;  3VBF C;  1ZBE 2;  2C1F A;  4KMQ A;  3DEM A;  5EP9 A;  1TME 3;  5KXE A;  2ZGL A;  4CUA A;  1MS3 A;  1VAV A;  3AP4 A;  3J8F 1;  4J1X A;  2ZGQ A;  3ZSJ A;  1JN2 P;  1MZE A;  4KU7 A;  3VLB B;  1HQW A;  1MS9 A;  1OQ1 A;  1COV 1;  5L19 A;  1PIV 1;  4Y1X A;  1S0I A;  3S6P A;  4URA A;  1F31 A;  2VU9 A;  4YGB A;  5A3M A;  1X82 A;  3LGR A;  1RXG A;  3K46 A;  5CKQ A;  4LIV A;  5A33 B;  1QHD A;  4NIH A;  1TVG A;  1UXX X;  1GR3 A;  4PDW A;  1W9W A;  1DYP A;  2E32 A;  3ASI A;  3WSO A;  4XDP A;  4ATE A;  3FX3 A;  4PLM A;  4FP2 A;  1VAL A;  4CPB D;  1WWY A;  1DQ6 A;  3ZN5 A;  1QJU 2;  2SBA A;  4RN5 A;  1UOJ A;  4UFI A;  2VUA A;  1Q8O A;  1WBF A;  2GAU A;  4P08 A;  4RGG A;  4Y24 A;  2YPJ A;  5FXX A;  1FV3 A;  2WZR 3;  4XJ9 A;  3FL7 A;  1MZF A;  4Y3O A;  2FBE A;  3UJO A;  4V1P A;  1XE0 A;  1DBN A;  3AMQ A;  3H1Y A;  2OX0 A;  4PF5 A;  4P02 B;  1AYM 3;  3HEI A;  1PVX A;  3LEI A;  4O9G A;  1HXS 1;  4KG0 A;  1ULP A;  2JDN A;  5K4L A;  1ULC A;  5I8T A;  2J1S A;  1AR6 1;  4C0B A;  4CP9 A;  2YDE A;  1M4W A;  1W6Q A;  4KWJ A;  1YNA A;  2VG9 A;  3IPV A;  4FO9 A;  4UF0 A;  3LOB A; 
#chains in the Genus database with same CATH homology
 4DEQ A;  3T0A A;  4A4A A;  1UYY A;  1GNY A;  5CYY A;  5HXM A;  3HN3 A;  2VC9 A;  3MO4 A;  4P5Y A;  2VM9 A;  3AC0 A;  3WNL A;  3T08 A;  3E1F 1;  5EIY B;  1JYX A;  1CZS A;  2VZV A;  5B4N A;  1J83 A;  5JR2 A;  3NRU A;  1YQ2 A;  2VZP A;  4XUT A;  4BDV B;  2W92 A;  4A41 A;  2Y6H A;  1W0N A;  3A21 A;  2EIB A;  4QDS A;  3GXU A;  2JD9 A;  1UY3 A;  2WDB A;  3VD9 A;  4A45 A;  1H6X A;  1GQP A;  1I5P A;  3A23 A;  4OZO A;  2J1T A;  4CUC A;  1PX3 A;  2W91 A;  1HN1 A;  2YFZ A;  2VZT A;  2QQN A;  2VCA A;  4JKL A;  5C7G A;  5LA0 A;  1P8J A;  5A1A A;  3D3A A;  1W99 A;  4JX0 A;  4L0P A;  3HNY M;  1CZV A;  1T2X A;  3CDZ B;  3WNM A;  4BK5 A;  3P1I A;  1UY2 A;  2WAO A;  4CU8 A;  2W3J A;  1D7P M;  4A6O A;  1W8O A;  3WF0 A;  1SG3 A;  5EJZ B;  3SKV A;  3FHQ A;  2QQJ A;  4UOJ A;  3F2Z A;  3VDA A;  5JXG A;  4P00 B;  1GOG A;  3HJR A;  5F7U A;  3IDA A;  2J1R A;  3OBA A;  2W94 A;  3THD A;  3VDB A;  2E31 A;  2ZEW A;  2JKX A;  3OGV A;  5LA2 A;  2VZO A;  4RYD A;  3HPN A;  2VZ3 A;  1J84 A;  2XON A;  3I97 A;  3SEE A;  2VL4 A;  2E33 A;  5EJ1 B;  4AG4 A;  2ZEY A;  2W46 A;  2Y64 A;  3CMG A;  4MGQ A;  4DXR A;  1KGY A;  3DYP A;  5I0D A;  1DP0 A;  2WQ8 A;  2WUH A;  3I3D A;  2W1W A;  5FUI A;  3WNK A;  2EIE A;  3I3E A;  5LCW L;  1KEX A;  1PMJ X;  2CDP A;  2E26 A;  3OB8 A;  4QX0 A;  4ARY A;  2Y6K A;  2VQT A;  3MUZ 1;  4XVH A;  2ID4 A;  2W1S A;  3SEP A;  5IHR A;  1K45 A;  2X05 A;  4QAW A;  2BZD A;  2XOM A;  2VQU A;  4M4R A;  4OUE A;  2JE8 A;  1JZ3 A;  4A44 A;  4OMC A;  1ULO A;  3I2I A;  2C9K A;  5G05 L;  4CVU A;  3NQH A;  2VOT A;  1O59 A;  3NNG A;  2ORZ A;  2W1Q A;  2YG0 A;  2EID A;  3J7H A;  3C8X A;  2W1U A;  2Y6J A;  1DLC A;  4XUO A;  1GU3 A;  1F4A A;  4QB2 A;  3GM8 A;  1O8S A;  4YPJ A;  2YC4 A;  4PT6 A;  2YC2 A;  3I3B A;  3K4D A;  1OF3 A;  1WCQ A;  3ACI A;  4D0Q A;  4DUW A;  3ACF A;  2WZE A;  1JYW A;  2Y6G A;  3A7Q A;  5JXJ A;  2VME A;  3T0D A;  4UI9 L;  1UWW A;  4QB6 A;  2QQO A;  3I2F A;  4Z2A A;  2YFU A;  3LQC A;  3I2J A;  1NAE A;  3VD5 A;  1L7R A;  3C7E A;  2VMF A;  1JYN A;  5C71 A;  3HNB M;  4XUR A;  4XZU G;  4W50 A;  4QX2 A;  3PUI A;  2W47 A;  1JU3 A;  3SKJ E;  1JZ6 A;  3P6B A;  4KWU A;  5C70 A;  1K3I A;  3T2Q A;  1XPW A;  2CDO A;  4ZXE A;  3I2H A;  2EIC A;  1L7Q A;  1US3 A;  2W87 A;  2W95 A;  2XQX A;  3MV1 1;  2Y6L A;  4LPL A;  4XUQ A;  1EUU A;  3T2P A;  5DMY A;  5DPN A;  4MO3 M;  3C7G A;  3K75 B;  3K77 A;  4W8J A;  3OEA A;  3UET A;  3BN6 A;  3OEB A;  4D8M A;  3WF2 A;  3WF4 A;  5HPO A;  3VD7 A;  2ZXQ A;  3HNM A;  4MOA A;  1W9T A;  2PQS A;  4GZ9 A;  2WZ8 A;  2J1A A;  4BXS V;  2VJX A;  1JI6 A;  3FHA A;  1K12 A;  3DEC A;  3LEK A;  2J1E A;  4JKK A;  2VZU A;  3IB3 A;  4PF1 A;  4QX3 A;  5IFP A;  1OD3 A;  4JHZ A;  1JZ2 A;  2LS6 A;  1UY1 A;  4ZZ8 A;  2BGO A;  5DN2 A;  1UMH A;  2WYS A;  1OH4 A;  2WN2 A;  1F4H A;  4CU9 A;  2L9L A;  5JXH A;  4LKS A;  2VO5 A;  3I2G A;  2VTF A;  3UNP A;  5IJR A;  1GUI A;  1RYY A;  3VDC A;  3CIH A;  3C7F A;  4DXT A;  3WNN A;  2J7M A;  2QQI A;  4ZZ5 A;  1UY0 A;  2V72 A;  3ABZ A;  4BJ0 A;  1K42 A;  1UXZ A;  2X09 A;  2R7E B;  4DUX A;  4MAD A;  2VCB A;  5JUV A;  4KI5 M;  3WNO A;  3GDB A;  3WF3 A;  2WAB A;  2WO1 A;  2DDU A;  2VZS A;  4QDQ A;  4A42 A;  3ECQ A;  3W5M A;  1CIY A;  2DCK A;  5G04 L;  2YB7 A;  2VZ1 A;  4CU7 A;  3ACH A;  1O8P A;  1GOH A;  1H6Y A;  4GWJ A;  1PX4 A;  3IAQ A;  2LW8 A;  1UX7 A;  1CZT A;  1OT5 A;  3LPF A;  3III A;  3LE0 A;  4FI9 A;  1W8N A;  3PUH A;  3CZU A;  2V4V A;  3CZJ A;  2VCC A;  1CX1 A;  4ET7 A;  1DYO A;  3OGS A;  3DYM A;  2WAA A;  2J22 A;  2W5F A;  1US2 A;  4TXW A;  3W5N A;  2BER A;  4XUP A;  2VR4 A;  4GWI A;  3U37 A;  1WKY A;  3IAP A;  3CQO A;  2VMC A;  2WN3 A;  1JZ5 A;  4HG6 B;  3WEZ A;  1JZ4 A;  4QPW A;  2RVA A;  2ZEX A;  3WF1 A;  4A3Z A;  1NKG A;  1PMH X;  3GGL A;  2J1V A;  4E8C A;  5J1X A;  3K4Z A;  3NJX A;  2ZEZ A;  1MPX A;  3LEG A;  1UYX A;  4ARX A;  4QDR A;  5JXI A;  1EUT A;  5DQ0 A;  3ZM8 A;  3THC A;  4DEV A;  2B4K A;  2W9X A;  2B9V A;  4JKM A;  5JMO A;  3VD4 A;  3ACG A;  4MGS A;  3C7H A;  4BK4 A;  2QQK A;  2XHN A;  3OGR A;  2DCJ A;  3A22 A;  1NX9 A;  3I2K A;  2Y8K A;  2V5D A;  2HLE A;  4W4Z A;  2RJ2 A;  3MV0 1;  2RV9 A;  1LNS A;  2HYX A;  3BGA A;  3DYO A;  3T0B A;  2QQL A;  4M4P A;  4AAX A;  2C4X A;  3FN9 A;  5B4X A;  3HOB A;  3EB7 A;  1XNA A;  4DUV A;  4ZY9 A;  4IUG A;  1R64 A;  5IYY A;  2JDA A;  1GOF A;  2WO2 A;  4CUB A;  4DXS A;  1UYZ A;  1UZ0 A;  2ORX A;  1UY4 A;  4OMD A;  5CZK A;  1OF4 A;  3LPG A;  2VZQ A;  3C7O A;  1NUK A;  3WNP A;  4CU6 A;  4XUN A;  1JYV A;  3T2O A;  1JZ8 A;  1JU4 A;  3CKH A;  4UAP A;  1W9S A;  2Z4F A;  1IQD C;  1XNT A;  3NJV A;  3MUY 1;  2QQM A;  4KMQ A;  2BBA A;  2VMD A;  5LA1 A;  4CUA A;  3OG2 A;  1JHJ A;  1UMI A;  2KD7 A;  2BGP A;  4PQQ A;  3T09 A;  5IFT A;  1TG7 A;  1XC6 A;  3WQB A;  3K46 A;  4QB1 A;  4OYU A;  1TVG A;  1UXX X;  2OKX A;  2J1U A;  1W9W A;  2E32 A;  3JXS A;  1SDD B;  3WSO A;  4LQR A;  4E8D A;  1GMM A;  4RN5 A;  2X10 A;  2QBX A;  4P08 A;  1SHW B;  4LHS A;  3FL7 A;  4QX1 A;  1BHG A;  3MBW A;  3EYP A;  4P02 B;  2C26 A;  4TTG A;  3HEI A;  3ETP A;  3LEI A;  1ULP A;  3UES A;  2VZR A;  2J1S A;  3VD3 A;  2WO3 A;  2WBK A;  3K4A A;  1JZ7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...