2WZ8A

Family 35 carbohydrate binding module from clostridium thermocellum
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
142
structure length
135
Chain Sequence
b'TINVYEAEDPANTLGGAAVRQRDNAASGGQYVGWIGNGSNNYLQFNNVYVPQAGTYRMVVQFANAEVFNVVDRYCSISVNGGPEKGHYFFNTRGWNTYRTDIIDVYLNAGNNTIRFYNGTSGSYAPNIDKIAIAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CELLULOSOME PROTEIN DOCKERIN TYPE I
publication title Signature Active Site Architectures Illuminate the Molecular Basis for Ligand Specificity in Family 35 Carbohydrate Binding Module .
pubmed doi rcsb
source organism Clostridium thermocellum
molecule tags Sugar binding protein
total genus 32
structure length 135
sequence length 142
ec nomenclature
pdb deposition date 2009-11-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2wz8A00
1JYWA 3A22A 2WBKA 1OD3A 4GWIA 4KMQA 2QQKA 2VJXA 2KD7A 3T0AA 1H6YA 2BERA 1JZ8A 3VD7A 2CDOA 3K46A 3I2IA 4M4RA 1J84A 5JMOA 5B4NA 2VZSA 2VM9A 3I97A 1JYNA 1JZ2A 2EICA 3UNPA 2VMCA 3CMGA 2WO1A 1EUUA 1SDDB 1W9WA 3K4AA 4GWJA 4P08A 1DYOA 1OT5A 2WO3A 2VMFA 3D3AA 5IYYA 3FN9A 1K3IA 4XURA 4Z2AA 5LA0A 1KGYA 3IAQA 4PQQA 5CZKA 3AC0A 2QQOA 4XUTA 2PQSA 1R64A 1T2XA 1UYXA 2B4KA 3VD3A 1O8SA 3WNOA 2Y6GA 2VQUA 2Y6LA 3WNLA 3GM8A 1W8OA 4QX0A 2LW8A 2X09A 1NX9A 1H6XA 2WYSA 5IFTA 3W5MA 2C9KA 2VCAA 2XONA 4BJ0A 1JI6A 2W91A 3NJVA 1GOGA 2ZEZA 5DQ0A 1PMHX 2E32A 5DN2A 3WNNA 4BK5A 4QB6A 1W0NA 1GOFA 2YFUA 3CIHA 4JKLA 1DP0A 1UYYA 2WAAA 5HPOA 2RJ2A 2BGOA 2WZ8A 4A44A 2VMEA 4TXWA 4QX1A 4ZZ8A 1K45A 2YG0A 3SKJE 3VD9A 2VC9A 3MUY1 2VCBA 3BGAA 3THCA 2WDBA 1CX1A 5A1AA 3T2QA 2J1UA 4XZUG 3I2HA 4RN5A 1JHJA 4CU9A 2VQTA 2XHNA 3LEIA 4LKSA 4LHSA 4D8MA 5JXIA 3I3EA 1IQDC 2W5FA 3I3DA 2W1QA 1NKGA 1UY1A 4M4PA 3DYMA 4MO3M 1UWWA 2X10A 2QQIA 4QDSA 5JR2A 3A23A 1W8NA 4A42A 5JUVA 1DLCA 3OEBA 3IAPA 1HN1A 5LA2A 1RYYA 5EIYB 3E1F1 5IHRA 2W95A 4MADA 5HXMA 3ACGA 3OGSA 2J1AA 5LA1A 1L7QA 4QB1A 3DECA 3T2PA 3CDZB 3T09A 2ZEWA 4XUOA 4JHZA 3PUIA 3IDAA 4HG6B 4ET7A 1GMMA 2QQJA 3P1IA 1PMJX 1SG3A 1UX7A 4QX2A 3ZM8A 3ACFA 4DXRA 4QX3A 1JZ6A 4CVUA 3CZJA 4DUVA 3ETPA 5JXJA 3I2GA 4CUCA 4XUPA 4CUBA 2VL4A 2QQLA 3C7FA 2EIDA 2HLEA 1UYZA 2VO5A 3OGRA 5EJZB 1XC6A 3U37A 5IFPA 3GXUA 2EIBA 1O59A 3NQHA 4XUNA 1W99A 2JKXA 3WNPA 2YC2A 4TTGA 3THDA 4A4AA 3VD5A 1CZTA 2J1EA 3HEIA 3HNBM 5LCWL 2J1TA 4W4ZA 3J7HA 4YPJA 3FHQA 5IJRA 2ID4A 1I5PA 5B4XA 1UMIA 4AAXA 2VZ1A 3W5NA 2YFZA 2VZQA 1F4HA 1YQ2A 1JU4A 4E8CA 2Y64A 2Y8KA 2ORXA 2LS6A 3VD4A 3PUHA 3HN3A 3WF2A 3VDCA 4DXTA 2WUHA 2R7EB 1JU3A 4W50A 3FL7A 3SEEA 2J1RA 3K4DA 1OH4A 3ACIA 2E31A 2WZEA 2EIEA 2L9LA 3LEKA 2WABA 4QDRA 4ARXA 1LNSA 2VZPA 2VOTA 3DYOA 2VZOA 4QB2A 1CZVA 4BXSV 2W1SA 4ZXEA 1JYVA 4CU6A 1JZ7A 3HJRA 3K75B 1P8JA 2WQ8A 5I0DA 3WNKA 4P02B 3WF3A 4KI5M 4DEVA 4JX0A 2E26A 1TVGA 3T2OA 3VDAA 2QBXA 3IB3A 3LPGA 4KWUA 4QDQA 5G05L 1BHGA 3HNMA 1XPWA 1TG7A 2W46A 1L7RA 1W9SA 2CDPA 2DCKA 4JKMA 2YB7A 5EJ1B 2VZUA 1O8PA 2ZXQA 3GDBA 4OYUA 1XNAA 3K77A 4OMDA 2DDUA 3T0DA 3C7GA 4OZOA 3MO4A 2QQNA 1UY3A 3OBAA 2WN3A 2OKXA 3T0BA 4CUAA 4DEQA 2ORZA 3MV11 3NRUA 3OEAA 1NAEA 1WKYA 3P6BA 3OGVA 2QQMA 4BDVB 4W8JA 1CIYA 4L0PA 4ARYA 1K12A 2W3JA 1MPXA 4P5YA 1UZ0A 3LPFA 2WN2A 3C8XA 3CZUA 2BZDA 4A45A 1XNTA 3C7OA 5C71A 4DUXA 5CYYA 2J1SA 1GOHA 2E33A 4AG4A 4E8DA 3HPNA 1EUTA 3I2KA 1GNYA 4LQRA 2W94A 3UETA 2Y6KA 1US2A 3LE0A 4DUWA 1W9TA 2XOMA 2V4VA 2J7MA 2C26A 1UY2A 4IUGA 3F2ZA 2J22A 3I3BA 4JKKA 3WQBA 1PX4A 4MOAA 2WO2A 2DCJA 2RV9A 1D7PM 1JYXA 4FI9A 1NUKA 1UMHA 3ECQA 4D0QA 2ZEYA 2W92A 1UXZA 2W87A 1OF3A 2VZVA 4LPLA 4A6OA 3OB8A 2Y6HA 1UY0A 2W47A 2J1VA 3JXSA 3GGLA 5DPNA 2VZ3A 3FHAA 2Y6JA 4RYDA 5JXHA 3EYPA 1J83A 1SHWB 3EB7A 3NNGA 1UXXX 3I2JA 4A41A 4XVHA 4BK4A 2HYXA 2JE8A 2YC4A 1GUIA 4A3ZA 1KEXA 4ZZ5A 4QAWA 1JZ3A 3HOBA 3WNMA 4GZ9A 3OG2A 4CU7A 3WF4A 2VCCA 1GU3A 1WCQA 1F4AA 1JZ5A 5DMYA 3BN6A 4MGQA 3MBWA 3C7HA 1JZ4A 4DXSA 2VZTA 3A21A 4OUEA 5JXGA 3LEGA 3CKHA 1K42A 1ULOA 2VZRA 2W1WA 3VDBA 2W9XA 4MGSA 5G04L 3SKVA 2BBAA 2ZEXA 3C7EA 5C70A 2JDAA 3HNYM 5FUIA 2V5DA 2C4XA 5F7UA 2VR4A 4UAPA 2RVAA 3WEZA 1ULPA 1PX3A 3I2FA 2XQXA 1GQPA 1CZSA 3ACHA 1US3A 4PT6A 2VMDA 3WF0A 2B9VA 4ZY9A 3NJXA 2JD9A 3K4ZA 4P00B 4QPWA 2Z4FA 5J1XA 1UY4A 4OMCA 4CU8A 2V72A 3MV01 3WSOA 3A7QA 4UOJA 3WF1A 3MUZ1 3SEPA 4PF1A 5C7GA 4XUQA 1OF4A 3IIIA 3T08A 4UI9L 2X05A 3LQCA 2VTFA 3CQOA 3UESA 3ABZA 3DYPA 2W1UA 2WAOA 2BGPA
chains in the Genus database with same CATH superfamily
2V5YA 5C4WB 3KQRA 5DUUA 5A7WB 1H2NA 2WBKA 3MFCA 3H7JA 1ZZ6A 2G4IA 3IMMA 1X36A 2YGLA 1H4HA 1T6BX 1MS0A 3CJIB 2KD7A 1COV2 1H6YA 2OA2A 4N53B 1KS4A 2BERA 4D69A 4Q1RA 5GALA 3S30A 2HWB3 1Q8QA 4ATEA 1ND2B 4M4RA 2NYYA 4PI0A 3R05A 4NIDA 4FPHA 3LKJA 4MXWA 1QGLA 5F5CA 3I59B 5I0UA 1AR71 3TRSB 2JDYA 3CJIA 3E6CC 4BQ4A 3UNPA 2VMCA 3OPWA 4CP1A 4N53A 4CCKA 1LOFA 2IWGB 1F9KA 3VDDC 3KMHA 4L99A 4N7UA 1DYOA 1OT5A 2YBSA 3UKNA 1DQ0A 2VMFA 2XL7A 3D3AA 5J37A 2DF7A 2XJQA 2ARCA 2GNBA 1ASJ3 1PGSA 1YWKA 3I59A 2BFUL 4XURA 4OQ9A 1DHKB 1CPMA 4Y5SA 4D7SA 4BHPA 1GICA 2VH9A 1KD7A 1XRUA 1YXWA 4A7ZA 5FZHA 4PQQA 1O7FA 4BPZA 2R49A 3E6DA 1R092 2PQSA 1VBC2 2VECA 5LY2A 2XLAA 2ZBJA 2VUAA 2WLPA 1O8SA 2AREA 3CJXA 2HWE2 3BOWA 4Y4YA 1RB8G 2ZX4A 4UFMA 2Y6LA 3DV8A 3VBRB 3KZ4C 1OMIA 1FAYA 1UYPA 1RUJ3 3INAA 1G9BA 3ALQA 4QX8A 1PGL1 2E7QA 1LEMA 4AOCA 1DQ6A 4QXKA 1KJRA 2W91A 2N7GA 2VULA 4BU2A 4E4HA 3O1UA 1VBE1 1QH7A 2RR12 2YBPA 3DKQA 4ZS2A 2ZX2A 5J09A 5F2SA 5L36A 3CO2A 1ONAA 1RUG1 3PHMA 5LK5A 3CIHA 3VBRA 4JKLA 1DP0A 2BQPA 4XFIA 2E51A 4BMBA 4NPLA 5HPOA 4RS5B 4IV1B 3KLSA 2VMEA 4QQ2A 4B1MA 4TXWA 2WFPA 4D7TA 4Z2WA 2GC3A 3HMYA 2UWCA 1UKGA 4FFHA 3J8F1 4NIGA 4PBPA 1S0BA 4AEDB 5BNNB 1V00A 2VC9A 1C8M1 1DQ1A 3MUY1 4UFLA 5C4WC 4I0AA 4GB32 2WDBA 5GJ6A 1H9PA 1CX1A 5JDBA 1A3KA 2ES3A 3NKTA 3QBQA 3ASIA 2D40A 3CJIC 4IEOA 1UOBA 4WM8B 4Q8LA 2QE3A 1QF3A 4RS5A 1CN1A 1LOFC 1JHJA 1LKNA 5T55A 3LDRA 4O61A 1AR93 4XOGA 2O14A 1DQ2A 1ND2C 1Z7S2 4W6WA 3KGZA 4AEDA 5FZEA 3VZOA 1F5JA 4D8MA 4M0HA 1TMF1 4I3GA 4AI2A 1NKGA 4LJHA 1VAKA 1Y9MA 1UAIA 3NV4A 1ENQA 1C4RA 5JR2A 3NKGA 3RG0A 2A3XA 4WM8A 4A42A 5JUVA 1DLCA 1L3JA 2OPWA 2Q1ZB 5KHGA 1QXPA 5T3NA 5I91A 3KSCA 2VBBA 4K6BA 1NY72 2A6WA 4UFJA 1N3OA 2DBIA 1M06G 1SLTA 5E1RA 2SLIA 5HXMA 2JG9B 1HW5A 1L7QA 2R1DA 1W05A 4Y4RA 4XJ9A 5DZGA 4TLFA 1WCSA 4YYOA 3T2PA 4E4SA 1O3TA 4H7LA 2JDPA 2ZGRA 3ZSMA 4ES8A 1AYM3 1CGPA 3WHTA 2OIIA 5A7OA 1BYHA 3ORJA 4LKEA 3IDAA 3UKTA 1LJ7A 3MIDA 1F5FA 1RUF1 1RMU2 1HRI1 2R062 2YUEA 4ET7A 5J3UA 5FYCA 5JOZA 4IW3A 2FDGA 1OQ1A 1SG3A 5GLZA 1CIWA 1DCSA 1Q8VA 5IVEA 1H2MA 2X5IB 3ZM8A 2JG9A 4JC1A 1MEC1 4DS0A 5J96B 2P3YA 4JRAA 4PIZA 5JXJA 4XF0A 2IUWA 1AR81 2EA7A 2R071 3GZAA 5FZKA 3NO8A 3RYKA 4U2AA 1TNFA 2BFUS 2WR9A 3RSJA 3C2UA 1X9PA 4A6SA 4N9HA 4XDPA 3LWCA 1FV2A 4LITA 5EJZB 2HEYF 3U37A 2X5IA 3GJBA 5IFPA 2V09A 3GXUA 3ZDSA 1ND3B 4Q4W1 3H42B 1ENSA 3ZYRA 5FR3A 5FJKA 3LEMA 3U0ZA 2GDFA 5KC6A 3BI3A 1RUI2 4IQPA 4QPGB 2BU9A 3ZR6A 4TTGA 4HXCA 1K5MB 2WS93 2MEV1 4E2GA 4RS5C 4IV1C 4Y24A 3VN4A 3N7LA 5FCCA 2WC2A 3HEIA 4KNCA 2RJKA 2Q8DA 2DVGA 2J1TA 1QQP2 4Y22B 5EZWA 3J7HA 4AEDC 2C0ZA 5BNNC 4META 1ND3A 2HJIA 1GANA 1CJDA 3NV2A 4LMFA 4XC9A 5IJRA 4BM8A 4YG0A 3WP5A 3NV1A 3AK0A 2OX0A 4XPVA 4YW1A 1YQCA 3POBA 2VTXA 3LGRA 4QPGA 2BDRA 5C9AA 2VMHA 1K5MA 5J98B 1JXNA 1PIV2 2VZ1A 2WQZC 5I0RA 2JG8B 2YY1A 2DCTA 5BYNA 4R4XA 1BEV3 3S57A 5T50A 5CG8A 1ZBA3 2VZQA 1UQXA 2VVFA 2C1FA 2GP3A 1XE7A 3AKSA 2VD7A 3OD4A 1LESA 2PHRA 4IESA 5BY5A 4CEWB 1W6QA 2AEYA 3T1LA 2QJVA 1WUVA 3HN3A 4M3CB 1W8TA 3H8UA 2WUHA 4XW3A 5FY4A 4HK8A 4IEQA 2JG8A 4W50A 3LCPA 1KQRA 1LCLA 1U5IA 2XJPA 1VBD1 1PGW1 5LRSA 4L9BA 4IE5A 1WW7A 2XXZA 1JW6A 3ACIA 4P9IA 3QD6A 4J25A 4CEWA 2E31A 1RUC3 3THPA 3VUOA 5HI0A 1DGWX 1FOD3 1NQJA 2ATFA 5JSRA 5FMOL 3DKWA 4M3CA 1Q8PA 2WABA 4E27A 1LU1A 4AGGA 2VZOA 1F8VA 1CZVA 4HN1A 4BXSV 2W1SA 2C24A 5F32A 1A8MA 5FYVA 3JQXA 4AI3A 1OSGA 4DRRA 4CU6A 3HJRA 4KQ7A 4C1XA 1WWYA 3WNKA 3FLTA 1RUD3 4BISA 4XACA 1MVEA 2PAMA 1Y43B 1W6PB 5ANQA 3A0NA 2PHLA 4KI5M 5FTTC 4CEYB 4QHOA 2ADDA 3KHCA 1LRHA 1RVF3 1H8TB 2GC2A 1OURA 2ZX1A 3IB3A 4QKBA 1R1A3 1UU4A 2AUYA 4KWUA 4RGGA 5GZEA 2WNOA 4LA2A 4QDQA 5G05L 1BHGA 5C3RA 5I8SA 4HKWA 4PHZA 1W9SA 4JKMA 2CDPA 5T54A 3UV9A 4ZHNA 1AYN1 1W6PA 3MIGA 4P9GA 4CEYA 3TBDA 3POYA 2ZXQA 3GDBA 4QPGC 1XNAA 1K5MC 3K77A 4COZA 3WZ1A 5FFOC 3KQ4B 2WKKA 4ZS3A 4XABA 2R043 4LEJA 5IVCA 5FKCA 2CU5A 3O12A 4FFIA 1PNGA 5IUQA 1W0OA 2XL9A 3MW4A 2XUEA 2Q8EA 4XQDA 4YM1A 3WHUA 1KITA 3FUQA 3PVNA 4D94A 5FQ0A 2YPJA 1PHMA 2BGCA 4Q0QA 4CDQB 1GZWB 2QQNA 2B7YA 2PHUA 2JG8C 4L92A 2Z42A 2OUJA 5FYYA 3UGGA 5T5JA 2WN3A 4FTSA 1XJAA 2DU1A 3RZHA 2RMU2 4XF3A 4CEWC 5D2AA 2DVAA 2FD8A 3UGFA 4YGCA 5D21A 3PURA 4CDQA 1NAEA 1WKYA 4JGYC 3UGHA 2A6VA 1CIYA 2ENRA 3HAGA 2EAAA 2VQ0A 3GHNA 3AFGA 4XILA 4DIQA 1YCIA 1S2EA 4GWNA 3CZUA 1E5IA 1XNTA 4DUXA 3OGJA 2JKBA 4WZFA 5DDJ2 1LU2A 3ATGA 1GOHA 3O0WA 1UPIA 5FUNA 2A6ZA 3GZUC 4QWNA 4QU1A 1QJU1 2Q1MA 1WA6X 1US2A 4KGGA 3SCFA 1RHI1 2YDEA 5GZDA 1YLLA 1W9TA 4LBLA 4P9WA 4CPBA 1VBC1 2C26A 1VRH1 1UY2A 1JS9A 2VXJA 2A3WA 2FMDA 5M0TA 3B02A 2HWE1 4EYUA 1AF9A 1XE8A 4QQPA 4MOAA 2WSUA 5FZIA 3UYJA 5FYTA 1YRZA 4XJWA 2DCJA 3HIFA 2P34A 5FPBA 1NUKA 4Q4Y2 4IGOA 3AXDA 3SC7X 2RM22 3NL1A 4CEYC 2Y0OA 3MIBA 1UCXA 5K8SA 3ECQA 4GKYA 3VGIA 1AR72 4BZ4A 1SLBA 4LORA 1OF3A 1H8TC 3QCWA 4Q4V3 2VZVA 4GMP0 4LPLA 5C3QA 2GMPA 4B3NA 5FMCA 2RR11 1PM4A 2ARXA 1JTZX 2G9FA 5E16A 1PO13 1S0EA 1TQ5A 3ME2A 1DGRA 5BNPB 4AGRA 2Z2SB 1X7NA 4QQLA 2E63A 3UL2A 2P1BA 1VBB1 3EHKA 4NN0A 4X8PA 4DO0A 3RZJA 5T5PA 4HL0A 1X82A 4AQ2A 1J83A 1H0BA 2HWF3 5FXZA 4QGNA 3ZN5A 2JD4A 3VHOA 3T1MA 1HJGA 4DY3A 2IXIA 4K40A 2AGSA 4XBQA 3EBRA 1IZ3A 2I74A 3JD72 4XVHA 5IVJA 1MACA 1DZRA 2JE8A 3N9QA 4MLOA 2CHHA 2P3JA 1S0IA 4K9SA 3I2OA 3NNLA 1YQ8A 5BNQA 1WA4A 5BNPA 2BRTA 4CRQA 1JZ3A 1YFWA 2WZR1 1QJX3 4QX5A 1HLCA 3MF9A 5FLJA 2D6LX 2XHKA 1JUHA 2VCCA 5K7PA 1JZ5A 2CGOA 4L11A 3U11A 3MBWA 1L7LA 3VV1A 1H1AA 1NCQB 3AP6A 4RHV3 4JCKA 2JIJA 4O9GA 2YV8A 1WBFA 4CYDA 1VBE2 2KXLA 3KF3A 1SPPB 4QQHA 1XU1A 4IE0A 2PMWB 3PU3A 4BQ3A 5CBLA 1RUG2 1RUE2 1V6OA 4BIOA 5KXEA 2K9ZA 4LE4A 3CKHA 4AVCA 1ULDA 4RFRB 4K20A 3ZXGA 2Q5TA 1I9RA 1ULOA 4K3UA 1ZBE3 1XYPA 1UO9A 1C5HA 1UX6A 1WMEA 2UY9A 3RS6A 5CFCA 1NCQA 4J1XA 2BBAA 4BE3A 2SBAA 3AYAA 3J8F2 4C91A 1NT0A 2JDAA 2QDRA 2GSYA 1SPPA 2A75A 3BALA 1HIXA 2YYOA 4TZDA 2VR4A 5EFUA 4XBLA 3N36A 3SITA 1PX3A 3I2FA 4K7JA 2LM3A 3IWZA 4AHXA 1O6UA 2XKOA 1RUH3 5FPAA 3VZKA 4EN8B 1W3VA 4FO9A 4H2AA 2DFBA 2ZACA 2HKXA 3B5LB 5E89A 2O0OA 4QMAA 4FAGA 2B9VA 2QZ3A 2OZJA 2OQ6A 2RG4A 5A32B 1XNDA 4AI8A 2EVXA 1XB9A 2ZGNA 5J1XA 3ZMNA 2XB6C 3KV9A 1A34A 2VOKA 4RQPB 5F39A 1S0CA 4DRVA 3WSOA 1EPZA 4CDXC 3PMEA 3WD5A 1W6OB 4NOTA 4IEUA 2CNAA 3WF1A 3JZVA 4JQRA 4PF1A 5C7GA 3UJOA 2CGPA 5GZGA 3T08A 5EP9A 4EE2A 4WVMA 2IXLA 5A7NA 2UY8A 3M2MA 2VW2A 1RUI1 2VTFA 4LBNA 3I4IA 5A80A 3C3VA 4FPJA 4RQPA 2WAOA 2BGPA 2PA7A 2IXCA 4URAA 4FPYA 4J6GA 4DPNA 4NHKA 1W6OA 3JBG3 1C3HA 3MIHA 3JU9A 1FI2A 1QQP1 1D4M1 2FQPA 4YM2A 2QQKA 1COV3 2VJXA 2Y34A 1HRI2 3O7OA 3OSDA 4QHBA 1PMIA 2RS52 4NPMA 1VBA3 2Q1FA 5CNAA 2K2SA 3OPTA 3VD7A 4B7EA 2CDOA 5APAA 5DG1A 3LFMA 2DWRA 1MEC2 1POV1 4NWWA 3RI8A 4O65A 4AFDA 2DTYA 4WZCA 5K0UB 4I30A 1AR82 3WCSA 2R072 2W39A 4XJZA 3MDPA 1JYNA 2EICA 2EIGA 2WWSA 1MZ5A 1IHMA 2ZMLA 4JDMA 1YFUA 1F2NA 1DQ4A 2P3KA 2BOJA 2G1MA 1ST8A 3IBMA 4NUBA 3JUUA 1ZX5A 5FYHA 4CP0A 4PLMA 1KRIA 2F4PA 4LO6B 5DAQA 1O3QA 2WO3A 3LAGA 5L9VA 5LW9A 2D5FA 2K46A 4I3PA 5K0UA 2RS32 5IYYA 5F3CA 4PBOA 2Q0AA 4YARA 5LA0A 1W8WA 5AC92 1NA1B 2W52A 4FBFA 2FDIA 2B9UA 3AC0A 1TE1B 3AYDA 4LKDA 1APNA 4CP2A 2R32A 1UYXA 4KBZA 1W3XA 4QPIB 3HBZA 2B4KA 1WW4A 2LUWA 4N43A 1O91A 4MGYE 1GSLA 5FLHA 4P9JA 4YGBA 3NWKA 3VBOC 1EAH2 4NAOA 4FTBA 3LFIA 3WNLA 1XOYA 2VGDA 4AF9A 1OPOA 2P5BA 2PXJA 5FO8B 2LW8A 3B69A 4FOQA 3CEWA 3CLPA 5A3MA 3IKWA 1UNBA 5GLTA 5F3EA 5IFTA 4MV2A 2VCAA 2ZZJA 1JI6A 1RTVA 1ZA7A 2FCTA 1V6LA 1W90A 3NJVA 4QPIA 2BVVA 2NN8A 2WO7A 4LBMA 4PIXA 4IE7A 5FP9A 3WNNA 4QB6A 1GOFA 5EJ3A 4BQ2A 4M0NA 1D2QA 5EPAA 1PO23 1X8MA 1SFYA 1BVVA 4CCOA 1J58A 2RJ2A 5GLWA 1D4VB 2WZ8A 3KT7A 3V64A 1VBD2 5A6YA 3RFRA 5BUVA 5JOXA 2JE9A 4IE6A 3WCRA 3ZYBA 4GALA 1DU3D 4QX1A 1HJFA 5FPVA 4NO4A 3SKJE 5GZCA 2ZX3A 1AR63 4AR2A 3H8RA 1AL23 1V6NA 5I0SA 2HEWF 2GNMA 2QQUA 1FXZA 1VMHA 4GB33 3BGAA 5A1AA 1XXNA 3VDDA 2ZABA 2V4AA 4AK3A 1TNRA 2VNGA 3ZN6A 4FXGB 1IG3A 3W20A 1YC61 5DAWA 4LBJA 5JIAA 4DNYA 5IAXA 2WWJA 2FZ1A 3ZXKA 1Z7S3 4XJAA 2OW4A 3THTA 5CKMA 2OUHA 1V6IA 2VMGA 1BXHA 4H55A 5JXIA 3ES1A 3S5AA 2RDQA 4Y33A 3VBFB 3N3HA 1POQA 2W5FA 3I3DA 5K0UC 2W1QA 3HBKA 1UY1A 3V0AB 5D1IA 1UWWA 2R30A 2QQIA 2X10A 4IERA 4AXOA 2B8MA 2XH6A 1IS4A 1W2OA 2QZ2A 4CCLA 3VZLA 2CYFA 2XPJA 3NNMA 1OOPB 1N1SA 3I2DA 2FMYA 1FNZA 4UW4A 2W95A 4IGQA 1MZ6A 4MADA 1AYN2 1MZEA 2R1BA 3CHXA 4GH4B 4NRPA 5B2GB 3MLJA 3RZGA 4HT1T 1DF0A 3DECA 3V0AA 3VKMA 3T09A 4TLGA 1FPN1 1NA1C 4CP9A 4A7YA 1VRBA 2XJRA 3KV4A 3Q8AA 2R063 1EV11 1N47A 2AEZA 2CAVA 1GMMA 2K0GA 2VMIA 1PMJX 1UX7A 5LRRA 2HBUA 5FY7A 4SLIA 1YQ6A 4EZ4A 3O0VA 2NPIA 5A6XA 3L9JT 3CZJA 4FFGA 4CVUA 3O1PA 4LA3A 4DUVA 5FO9B 3I2GA 1AZDA 2Y33A 4YFZA 2Q30A 2PHFA 4XUPA 4R52A 3U14A 3DXUA 4IE4A 3ZXAC 5A3PA 5JI9A 1LHWA 1D0GA 4Q4Y1 3RMYA 2HLEA 2I45A 2VO5A 2RM21 4YWAA 1J1LA 4NROA 1TME3 1XC6A 1RIRA 1JBCA 1X8EA 2JIGA 5FY0A 5A7WA 5C4WA 3ZO0B 2WS91 4CXWA 3MZHA 3KV5A 3ZFGB 2VOVA 3KWVA 3PTRB 4OHWA 2ZA9A 4QKDA 4E4DX 2AACA 3IM0A 3VKLA 1DGWA 1Y9GA 1XNBA 3KF5A 2AC1A 2GN3A 5A3LA 4DB5A 1HRV1 1S2KA 1ZM1A 1ND2A 1I5ZA 4GAZA 3ZFEB 2UWBA 5CA6A 5FBJA 4A4AA 3VD5A 3WQ7A 3OBZA 1AVBA 4BLJA 2Q4SA 3IIAA 4NRMA 4W4ZA 4INDA 3AKTA 3ZFGA 3FHQA 2YC0A 1QJU2 1QH6A 4NR1A 5GZFA 2VTXJ 4JQTA 1RHI2 5TSWA 1I6XA 5B4XA 1RUNA 1UMIA 1MS3A 3O0XA 1LGCA 1BBT2 3ZPOA 1YIPA 3SNMA 2NM1A 3JD71 1VRH2 2BVBA 3W5NA 3ZFEA 3M7AA 5T52A 2P6CA 3S7IA 1GWMA 1F4HA 2OS2A 3RZZA 3WDTA 4AW7A 3TNPB 1C1LA 5LY1A 1VJ2A 1SQ4A 4QXHA 1OA4A 4R8HA 4AEKA 3VBFC 4COYA 2BJSA 3ZMOA 4B4RA 2LS6A 4PDWC 4Q27A 3WY6A 5JPMB 2JENA 2O8QA 4KU8A 5F3GA 1S0DA 5DAXA 4F3JA 5FYSA 3VDCA 2R7EB 4ONUA 3M1HA 1A8DA 1Y9QA 1BLZA 2FDJA 4W6XA 4COWA 3BKZA 5HBAA 1FOD1 3SEEA 1OOPC 1HQWA 2J1RA 4NE9A 5FZCA 1ODNA 1OH4A 3ES4A 4NVPA 4AVVA 1RUE1 3RWNA 1CR7A 3B3QE 3ZXFA 3GCWA 4UT5A 4YW3A 4GH4C 3AB0A 2PLV2 2EIEA 1JYCA 2DV9A 4YSFA 3AMPA 1VBB2 1U5ZA 1LNSA 2R0HA 4L97A 4MHUA 5CFDB 1AX0A 2VZPA 1PVXA 3DYOA 2CL2A 1YNAA 2CY6A 2JXAA 4K1YA 2HWC1 4MX3A 1JOPA 2DVBA 3PTYA 4LLFA 5FK7A 1JYVA 2CGNA 2PHTA 1W39A 3FLPA 3AP7A 1DBNA 2D97A 5I0DA 1PK6B 2GNDA 4RD7A 1O4YA 1H4GA 1WLCA 4YW2A 2CTVA 5IW0A 2WZR2 4UWDA 2H0BA 3AVSA 4IV1A 1IS3A 3HT2A 3LDKA 4GA9A 2PQQA 5DUXA 5F5IA 3KV6A 4AFBA 4DY5A 4B4PA 5ACA1 1AX2A 2W08A 4JX0A 2E26A 1O5LA 2DTWA 3T2OA 3VDAA 1JN2P 1YI9A 3J4UH 4Q5OA 4AYUA 4CCDA 3WT3A 3LPGA 3UK9A 3L2HA 5BNNA 1OVPA 1RITA 4CCCA 5LATA 2O1QA 3HNMA 4BQ1A 3BUCA 5FXWA 4NIAA 1PK6A 2ZGOA 3ZFGC 3G6JB 5DAVA 2R041 4FFFA 5A6QA 1TEIA 2YB7A 4QXCA 5FZAA 2IXKA 4FPOB 5CKNA 2W2IA 1O8PA 4A3XA 5FJHA 3USUB 5JOYA 4YVWB 4JTNA 2VW1A 3TEZA 3ZFEC 3M3QA 3Q8EA 2P37A 4FOYA 3K2OA 1HB3A 2P6HA 3R4UA 1KFXL 4MGTA 5AVPA 1R082 3DPRB 4OZOA 1WZXA 2WIIB 4LO8A 3AP5A 3MO4A 1WLWA 1KXGA 1LHNA 1N1VA 2A3YA 1PZ7A 4WVZA 5JOWA 4M01A 5CB7A 1UY3A 2RS51 3DGTA 3L2YA 3ZSLA 4EN6B 2AH2A 1WGPA 2XBO1 4KG8A 2OKXA 1VB2A 3T0BA 4CUAA 5C3OA 5FO7B 2RMU3 1G9CA 2Y6FA 3J7MA 2JDHA 2A73B 4ORFA 4FPLA 4BYYA 5FAXA 2W0XA 2P3IA 1E5SA 2NMOA 3KVBA 3VKFC 3ZSKA 1IG0A 3U4XA 3TB0A 3OGVA 4HZFA 4NIIA 4YRDA 2GP5A 2GAUA 2W3JA 2ZGSA 3DUIA 3ILNA 3AP4A 4P5YA 3URFA 2WLQA 3GHMA 2QFEA 3LPFA 4BQ5A 5H9QA 1W28A 2WN2A 1ZVFA 4LULA 2HBTA 4PCRA 1QMJA 3AJYA 2GU9A 4UXAA 5FIXA 2AR6A 2RS31 5CYYA 1OLME 4AG4A 2D44A 5FZMA 1GP6A 5GLVA 1LHVA 4RR3B 5AC91 1TMF3 4LQRA 3UETA 1UF2C 2Q8OA 3VL9A 3VBUB 5CFDC 1T6GC 1UD1A 3D4KA 3LE0A 4YZ1A 3LSEA 2WRAA 2V4VA 1V6KA 2J7MA 1D4M2 4RL7A 3RDIA 1IOAA 2KR2A 4IUGA 4XZPA 2J22A 3APBA 2LRPA 3UT0A 2DCYA 3JCIA 3WDYA 4LK7A 5I8TA 3WQBA 5KXBA 1EAH1 1ZRFA 1PK6C 4Q0SA 5FBZA 1OUXA 2WO2A 1LAJA 1D7PM 5F37A 4RR3A 1OFNA 2VBDA 4OHYA 3IT8A 3PNAA 5H9SA 4YW7A 1HDKA 3AZXA 3NAPC 4D0QA 3HT1A 1AR73 2EXJA 2ZEYA 4Y22A 1UXZA 4IEPA 4HN0A 1GKBA 1GZCA 4MVTA 3BCWA 4LLOA 4QX7A 1B35B 3OB8A 4R9DA 1F35A 5E88A 1QOOA 2WT1A 1Y4WA 2Y6HA 3JB8A 5A3OA 1IPKA 2GZWA 4JGYB 4G9SB 3AM2A 1N3PA 1SLLA 1CVNA 3BTAA 3KT1A 1BMV2 3SH4A 2RHPA 3E97A 4OUMA 1S2BA 4YVWC 3FBYA 3PUSA 1PVC1 1UZYA 2QQWA 4MXVA 5EYYA 3NNGA 1QJZA 4HONA 4OHZA 3J7LA 4A41A 4RSUA 2VPVA 3DPRC 1Q8SA 4JHTA 3S7EA 4JGYA 3WDVA 3LA3A 1E5HA 1GUIA 4KWLA 3D8CA 1HXS1 5FXXA 1RUJ2 1WCKA 4RGKA 1UOJA 4QAWA 4ZZ5A 1VLNA 3HOBA 3MIFA 2YPDA 3WNMA 1ENXA 4GZ9A 3S5QA 3W59A 1UU5A 4BQWA 2B5HA 3OG2A 4CU7A 3OUIA 4MSVA 2C6SA 1DLLA 4AEMA 5KHJA 1GU3A 1WCQA 1F4AA 2ZGUA 4XEZA 3K3OA 1I3HA 3TN91 3WG1A 5CKQA 2PELA 5ISLA 2BWAA 4XDQA 1ULCA 4M00A 1JZ4A 1W9FA 5IVBA 1BJQA 4Q4X3 4DZGA 1HN0A 4UBGA 4QPIC 1RUG3 1Z78A 1G9DA 3CU7A 3EJKA 5LBBA 5IK4A 4NPRA 5EYXA 4MGZE 4Q2FA 2VZRA 1FMD3 1PNFA 1FX5A 5HCBA 5HCAA 2P4EA 4MGSA 3Q8BA 4YG6A 3FJSA 1U5XA 1UOFA 3WR0A 2ZEXA 3C7EA 2X8KA 3HNYM 1ZRRA 2VNOA 4RR3C 4UFKA 2V5DA 3RJ2X 3WW1A 1H8TA 1C8M3 5C6CA 5F7UA 3VBUC 2ADEA 4UAPA 4KWKA 2HH9A 1AR92 2RVAA 4YZ2A 5A1LA 1IPSA 4UFIA 3MYXA 4AQTA 5FK8A 1RJ7A 5EHDA 2XQXA 1PZ9A 3RI9A 2IZWA 1HB4A 2TBVA 3BU0A 2VG9A 3HD8B 4Y1YA 4EWAA 1US3A 3PMSA 4PT6A 4UW6A 5L19A 5AVAA 2GC1A 4JV4A 2JD9A 3FLRA 3AKRA 3K4ZA 3MGUA 4IDZA 4NMIA 4XYXA 3GZTB 5FZOB 1GZTA 4FOWA 5KHKA 5FYZA 1YHFA 1Q5OA 4CDWC 4QKNA 2GH8A 1YJKA 4OMCA 2V72A 1NYWA 3MV01 1E57A 4ATFA 1B35C 3A7QA 4ES9A 3W21A 1AX1A 4UOJA 5KXCA 1NZIA 3UKVA 2RS11 2WWUA 4BQYA 1GZWA 4QM9A 1W2TA 4GKXA 1J59A 1AYM2 4LOSA 5FZOA 3S6PA 2XG3A 1V9U3 2ZGMA 2H0VA 3HVDA 4HK9A 3ABZA 2W1UA 5FYIA 3VHRA 1JYWA 4EN7B 1FPN2 1REEA 1OD3A 1NG0A 1KS5A 1RUOA 1YYNA 1RUF3 1EV12 3AMHA 1HRI3 2G9GA 2GMEA 2DVFA 2ZHMA 3B9IA 4KMQA 5DAPA 5KWRA 1JZ8A 3N9OA 2NP0A 1VALA 5F6LB 3I2IA 1BBT1 2A1XA 3R4DB 4A7KA 4K1ZA 1J84A 2ETEA 2GALA 4KBBA 3RZKA 4Y5Z0 2AZ5A 2FZ2A 1AR83 1ZA4A 2R073 4ZU5A 2VZSA 4QKFA 3IZOA 2VM9A 3I97A 3AX4A 3ILRA 1XSRA 1FATA 5T5LA 4LNVA 1UIJA 1EPWA 3WW3A 3ZYHA 2XMLA 2WO1A 4L2NA 1EUUA 3CL1A 2IXHA 1SDDB 3SH3A 1W9WA 2TEPA 3QACA 2WS92 2PYTA 4XF9A 4XIOA 2PFWA 4Q4W3 4S2DA 5FMOS 2KM2A 3U78A 4CDUB 1IGOA 4CDXB 5EWSA 1UN1A 5KBFA 1LGNA 3FN9A 3R6SA 1K3IA 1HRV2 2MEV3 3IAQA 3LIGA 5F2WA 4AWDA 4NHXA 2O8OA 3AYCA 4IXLA 1VMFA 1UKRA 1RXGA 2PLV1 3VBHC 4YFWA 4XUTA 4AVBA 1EY2A 1T2XA 2P17A 2VAUA 3PVBB 1QKQA 4WVVA 3VBSC 2CSGA 4B1LA 1IKQA 5F9TA 3BTZA 2YMZA 3VKOA 4CDXA 2ZHKA 3M3IA 3N9NA 4OI2A 3CF6E 4LT5A 1BEV2 1O4TA 4Q29A 3POSA 4FTEA 2Y6GA 4EN9B 3T2TA 1H9WA 3U4SA 2NQYA 3KVAA 4QX0A 4UF0B 4PI2A 2RJLA 1AXKA 4GMP3 4UYBA 3EMRA 3AYEA 2HWD3 4RGAA 2WYSA 1BVP1 1PO21 2XONA 2JWPA 4BJ0A 1XQNA 4F7ZA 5CAZA 2LALA 5FREA 1GOGA 4IV3B 5JLVA 5DN2A 4BK5A 3QLQA 5LB6A 1W0NA 1O5UA 4I02A 4ZXKA 2DBNA 2XLGA 2F4LA 2NMNA 1W0PA 3T4VA 2ZGLA 4UF0A 1SCRA 1RUC2 3RRDA 3RZMA 4XTMA 4K8FA 2VY0A 2WAAA 1FOD2 2BGOA 4BA6A 3GBGA 4EV0A 4R9AA 4A44A 2UURA 1QWRA 2UWAA 1M4WA 3ZPYA 5A33B 1PM7A 3I54A 5FYMA 2BUKA 4IV3A 1OXCA 4PLOA 4HKOA 2YG0A 4Z8BA 3VD9A 4OVEA 4LOTA 3B00A 4XDOA 5C3PA 3E5XA 5JZGB 2NLRA 2VCBA 3THCA 1SEFA 2P2KA 1VP6A 3E5UA 3M3EA 3MIEA 1YJLA 2OT7A 4TWTA 1AJOA 4M3CF 5FP3A 3SXWA 1R081 2HWC2 4Z92B 4I01A 4R9BA 4XZUG 1RUD2 3KS7A 3I2HA 4CU9A 1CAWB 1AXYA 1NLSA 2WFF3 2VQTA 2XHNA 3DXTA 4LKSA 5E8AA 3VBOB 1VE0A 2ZGTA 2BP6A 1IQDC 2D6KA 2ZGPA 5ACA2 5ABJB 4GD4A 4LIUA 3KHBA 2WNUB 4COVA 4DXZA 3ZYFA 5C3SA 1S4CA 2WL1A 3FFQA 4NHMA 4QXBA 1B09A 3FMGA 3IAPA 1X33A 1WCUA 3N35A 3VBOA 2ET7A 5EIYB 4CDUC 2R042 3RYPA 3VL8A 5ABJA 1QJY1 2J1AA 2WJSA 3OGSA 4XTPA 4LO4B 4QB1A 3J9SA 4AHWA 5LA1A 3TEWA 2WNUA 3CDZB 3FHIB 5F5QA 3ZIXA 3BTYA 2EF6A 1A6CA 4XUOA 2OZ6A 2VQAA 3KD4A 4JHZA 4LBQB 3RGBA 4C90A 2UYBA 4N8MA 2YZ4A 5A32A 2MPFA 3KT4A 4HG6B 1GFF2 5IVFA 2WNEA 1CJPA 1OBNA 1VIWB 3B7MA 1OI6A 2HWB1 3M4FA 4HMZA 1CAVB 3ROUA 1ULGA 3K48A 1W8ZA 4XETA 2TUNA 2PHDA 1J3QA 4QX3A 3TAYA 1RGSA 2I07B 1C8NA 1OFSA 3ETPA 1OD5A 2DVDA 2GMMA 1QJFA 4IL7A 3AZVA 3KCCA 3T4HB 4CUCA 2XBO2 4CUBA 3ZXLA 4AFCA 2R6QA 3FFZA 3HQXA 2D43A 3OGRA 4HLTA 4IV3C 4P9YA 5C5UA 2Y26A 4Z82A 2EIBA 1GQHA 4ZKTB 3AZYA 2JKXA 3WNPA 1RINA 3T30A 2WNVB 1ZZ7A 4AE2A 2ZOEB 1ASJ1 1BK0A 1G86A 5IATA 4XHBA 3IN9A 5GM0A 1GBGA 1DG6A 1U12A 1HKDA 2EXHA 1LGBA 3MW3A 4FQ4A 1CZTA 2J1EA 3HNBM 2VOWA 4S2HA 5DUVA 3TOJA 1BMV1 1W9YA 3POGA 3A0KA 4FP2A 1ODMA 2JECA 2R16A 4D7YA 5I8YA 1O3SA 4OHXA 1I5PA 4XXAA 5JZGC 1QJU3 4H14A 4EQVA 1KDKA 1LHOA 2VVDA 2WNVA 4UFHA 2A5ZA 1R093 3POJA 1VPHA 2ZHNA 1VBC3 4AVTA 4ISRA 4AAXA 1CWPA 3AKQA 3AZWA 3LA2A 2JDUA 4JDNA 1QOSA 3V65A 3BIWE 4BCUA 2HWE3 4AI1A 1RUJ1 2DYCA 4IETA 2IC1A 2Y8KA 2B39A 4AHYA 1NA1A 5ABJC 5J48A 1SLIA 3IDBB 5LBFA 3PUHA 2WNUC 3PUAA 3WF2A 3Q8CA 3WDXA 3LSDA 3AFKA 3EO6A 1D0HA 2A7AA 2BW8A 2NZ9A 5LEJA 4ZU4A 4C8DA 1GP5A 4TSVA 5LA9A 2RR13 2OVUA 2CWMA 5FUPA 5JI7A 3K4DA 4WM7C 3POIA 4XFFA 2ZTNA 1S55A 4YW6A 5BXXA 1O4ZA 1VMJA 2E6VA 2WZEA 3LOBA 4FPGA 5EV7A 4FPEA 4Y1UA 3LEKA 4GJYA 1VBB3 3LOIA 4KWJA 1PVC2 4QDRA 5C8WA 2VOTA 4QB2A 5LK7B 1LOGA 2XVGA 3PU8A 4O9EA 5E6HA 5JPNB 2X53S 2YHJA 2XDVA 1WD4A 1JZ7A 3J26N 3K75B 1AR91 3JQWA 1HXS2 3J7NA 1QOTA 3M70A 4V2VA 3WF3A 4YGDA 4G4FA 3WUDA 4Y26A 4BIFA 1YO8A 4U36A 1ZZCA 2R0FA 2B45X 2QNKA 1OPMA 2V73A 4RHV2 1KDMA 5DZFA 4Q0PA 4MG2A 1AUYA 3ZDVA 3TN92 1TVGA 2BWCA 2QBXA 5IAVA 2ZAHA 4QU2A 1W2UA 1LOBA 3FE5A 3RMXA 4YZ4A 4PDWB 2GN7A 4KG0A 1LOAA 1ZBE2 4UW5A 5EJ1B 5KXDA 2X29A 4AAPA 2WNVC 5K4LA 1DIWA 3NVCA 3F95A 5FY1A 4OYUA 3WDWA 1O3RA 1SCSA 4M3CE 1W6NB 3MFAA 3LB9A 2Z79A 3AMNA 4MH0E 3VLBB 2BPA2 1AYM1 4Y20B 3VBFA 2DDUA 4AFMA 4PDWA 4PQ9A 3C7GA 1S0FA 1RUH2 2W68A 3OYWB 4XMIA 3ZR5A 1AHSA 5IK8A 3OCPA 2WT0A 3ZN4A 4HVQA 3UJQA 3TEYA 1SLAA 3VB9A 2IFRA 4HANA 4LBQD 1OOPA 2C5DA 1RMU3 1GLHA 4DOUA 4Y20A 1IQAA 3TYJA 2VBPA 3OBAA 4GH4A 5IVYA 2QKDA 3O1OA 3WQ1A 5FDBA 4DEQA 3OTFA 4IEVA 2DU0A 3OYWA 1WLTA 3MV11 1N3QA 5HXVA 2JDKA 4LR4A 3OEAA 1LOEA 4E9KA 3POEA 3GBWA 3MPPG 3P6BA 1Q3EA 2QQMA 4NAMA 5EQUA 4HKLA 1RJ8A 4ARYA 1K12A 1MPXA 1UZ0A 3P5BA 1POV0 1XU2A 1H30A 5JSPA 2RS12 4GXLA 1DQ5A 3C8XA 2B42B 2UU8A 4P5HA 2BZDA 4OI0A 4A45A 4MXWB 3C7OA 5C71A 1LECA 3JBG2 2J1SA 3RYRA 4A2UA 5CG9A 1RUI3 1WD3A 1G8WA 4QQOA 1RXFA 3CBNA 5FP7A 1C1FA 1EUTA 3I2KA 3MHZA 5IVVA 3OUJA 4BLIA 1LR5A 1VBA2 4DUWA 1VAMA 2B46X 4MGIE 1QQP3 4OULA 3ZX7A 1MS1A 1D4M3 4B7KA 4Q1PA 2Y38A 5LZ6A 1YEWA 2JEMA 1BEV1 5F3IA 2ARBA 1NXD1 1ZBA1 4FQZA 4LIVA 1POV3 2H6BA 2RV9A 4LTAA 1PIV3 2ZHLA 3RWKX 3WQ0A 1W03A 3VHPA 1JYXA 1UPSA 2HEVF 5DXDA 3PVOA 2FDFA 2JDMA 4NHLA 4Q26A 1HQLA 4S2GA 4P9XA 5CADA 2Y0IA 2OQ7A 2W92A 3AP9A 1QXJA 4YW4A 1XSQA 3SCHA 1BK1A 1GQGA 4KU7A 5HCHA 4CXXA 1HV1A 1OH3A 4D6SA 1GWKA 4AGVA 4L8QA 4AFAA 5CIRA 1CD3G 1RUC1 1S0JA 3ENRA 5FPUA 1ZRDA 3FZ3A 1SFNA 3GGLA 3PIJA 5DPNA 1URXA 5DZEA 3OBRA 5JSOA 2VZ3A 2D6MA 1LODA 3D0SA 4H3WA 2Y6JA 4IGPA 4LBOA 3GNEA 4RYDA 3H3ZA 2Q8CA 3VKNA 3RVHA 5JXHA 3V0BB 3N7MA 3PDQA 1MZFA 4JGZC 3EB7A 1XYOA 2VOXA 3AJZA 3NNFA 4QHZA 4P14A 2JICA 2ZMKA 2JDZA 4BK4A 4TYSA 4CCEA 3ZVXA 5FZ0A 5KHIA 3ZXEA 3O1RA 3AZZA 1HV0A 1KEXA 4QPYA 4CUGA 2XWBB 5KC5A 2WA3A 5FZDA 1RUD1 3AVRA 3CNAA 4LHNA 3ZFFC 5I93A 3V0BA 1EP0A 1OVSA 4BXFA 4HOOA 4OI1A 1MQTC 4DQAA 2ZAAA 4Q4X1 3PL0A 4LK6A 3BN6A 4MGQA 1RVF1 1CONA 1F31A 2QTWB 1H2KA 2DCZA 1IPJA 1PO22 1R1A1 1IKPA 5CFDA 4CXYA 3BVCA 1VR3A 3OY8B 3SLIA 2VZTA 3B9CA 4FPCA 1V6JA 3NAPB 4OUEA 1FMD1 1UZZA 4XFAA 4XQ4A 5A7QA 1LTEA 3QH7A 2WA4A 3NMBA 4FCAA 1UOGA 1AR62 3VDBA 1AL22 1XYNA 2W9XA 4XQWA 3D5OA 2VU9A 4F83A 2XVKA 5JMCA 5FPZA 1DDLA 5G04L 4EJRA 3SKVA 3E5QA 3OY8A 4FT8A 1U0AA 3WW2A 3AMQA 4V2WA 3NAPA 4BQXA 1J3RA 2LROA 4YM3A 5FUIA 1BKZA 4N53C 4XF4A 1OHFA 1OA3A 1YUDA 2E53A 5F6KA 1MR5A 1ULPA 1KFUL 2YROA 4FVVA 3I49A 4LO7A 3W9AA 2IFWA 5A7SA 1Y7BA 3N9PA 3WW4A 2OXBA 1STMA 4ZPIA 1GQPA 1CZSA 2IXJA 3ACHA 1RC6A 3AL6A 4Q0VA 1UZWA 4FPFA 4HSJA 5A3TA 3SQOA 1QNYA 2D6OX 3DN7A 1JUIA 5FP4A 3USUA 4YVWA 4ZY9A 3NJXA 5AFEA 1H8VA 2ILMA 3V56A 1SBDA 5FPXA 1CPNA 4P00B 3WV6A 2Z4FA 1GP4A 2ZCWA 3MEPA 3MLLA 5A3UA 3WG3A 3DPRA 5FYUA 3ZXJA 4DMIA 1LEDA 1UMZA 3OBTA 2XR4A 1V9U1 3SEPA 4URTA 1N1TA 1ZRCA 3M8LA 4EN0A 4ASMB 5ANNA 3H3LA 1W04A 2QUOA 4IEXA 2X05A 3WNXA 3H1WA 4OHVA 1QJY2 5BNOB 1J1TA 1NXMA 3HQRA 3OD0A 3R0RA 1GWLA 5C5TA 1G9AA 2BTVC 1GV9A 1TZOA 4FSJA 1RL3A 1FPN3 5LASA 3A22A 1WLDA 3I3QA 5DDJ3 1UZVA 2QQPA 4N7IA 1SMVA 3D0JA 4GWIA 5LBEA 1EV13 3VBRC 3T0AA 4RA0A 4Y1XA 1FNYA 4IEWA 2ZS6B 5FY8A 2VNRA 1DGRN 4KGQA 2HWB2 1G6NA 3K46A 4WVWA 3POFA 4GULA 5BNOA 3ZYIB 3H1MA 1D2SA 3QOPA 3TWIA 2VE1A 5IWFA 3N7JA 5HV4A 5JMOA 1ZZ9A 4E4ZA 5B4NA 1TME2 3ZKYA 2JJ6A 5L9RA 1JZ2A 4Q4V1 3CMGA 4LUMA 4Q4Y3 1H1MA 2PAEA 3GJAA 2RM23 3VBUA 4ASLA 1JH5A 5C9AB 2ZGKA 3K4AA 3KB5A 4GWJA 2DUPA 4ZONA 4P08A 4CDWB 1QDCA 1SDWA 4NIHA 3RNSA 1PO11 2G9ZA 4XF1A 5JAXA 4UBHA 3MW2A 4OLLA 5FZ6A 1ASJ2 1F15A 4ASKA 4E2QA 1HRV3 3I8TA 1E5RA 2FBEA 4Z2AA 2XQRA 1KGYA 4GWMA 4R9CA 1LB2A 1W6QB 3BB6A 4XE9A 2HWF1 4AHZA 1QNWA 2Z69A 1ENRA 1C5IA 1QHDA 2QQOA 5CZKA 4CZSA 1REDA 3R4SA 4AEJA 1R64A 4CDWA 4WM8C 5KR7A 3BPSA 2VUDA 3ZYJB 2QCSB 5FZLA 3ACLA 3S0MA 3U10A 3VD3A 1B35A 2XKPA 4GMP1 4CCMA 1NQDA 2HWD1 2VUCA 3WNOA 1GZ9A 2VQUA 5FZFA 3HN1A 3O1TA 3H8XA 3JD73 1GNHA 1LOCA 1QJX1 1W8OA 2FCUA 3GM8A 2X09A 4FPKA 1JOJA 1NX9A 1H6XA 2WT2A 5A3WA 1NOVA 4LXLA 3DF0A 2QQVA 3W5MA 1DYPA 2C9KA 4JDOA 5JWPA 1J3PA 2ZEZA 4RHV1 5DQ0A 4S2FA 1PMHX 1UL9A 2E32A 2XVLA 4PLNA 2BNOA 3VZNA 4XCBA 4FAHA 4I2OA 3H3UA 2XJTA 2J42A 3FBMA 2DUOA 4X6RB 2ZKNA 3GF6A 2YFUA 1HQNA 4HVRA 5FZ7A 5C33A 4LHLA 3N7KA 2JG9C 1UYYA 2ZGQA 1VBE3 3FWEA 2BOIA 5FXVA 5T5OA 1EYBA 1ZBE1 4MHRA 4BWOA 3HWJA 1RUE3 3MICA 3HQUA 4YZ3A 3W58A 2DUQA 3DL3A 1S1AA 4ZZ8A 4ISQA 3U1XA 1K45A 5BNOC 4AL9A 1YFXA 2EXIA 5BV6A 1DZTA 1AJKA 1OQEA 1BZWA 1QU0A 2G19A 2JDNA 1H1IA 2WFF1 2X5IC 4XFHA 5SV8A 5A3NA 3J8F3 3T2QA 3VBHB 1SFPA 2HWC3 2J1UA 1RUH1 3HR9A 2PTMA 1JYTA 3PJQA 4RN5A 3VBSB 2DFCA 4Y5TA 1GNZA 4Z1VA 5LEKA 1K5JA 4QM8A 2HYKA 4EROA 3LEIA 3NNJA 3H8OA 3VHNA 1G7YA 1OA2A 3AL5A 3SH5A 4LHSA 3WG2A 2ZPXA 1G9FA 3NW4A 1WMDA 4WBBA 3I3EA 5JR7B 5ACA3 3BPZA 4M4PA 3DYMA 4MO3M 3VBHA 1ND3C 4QDSA 5IT6A 3A23A 1W8NA 2VNVA 1SZBA 2EXKA 5FQ0B 3VBSA 1W8HA 3OEBA 4OQ8A 1ZREA 1ZNPA 5C9AC 4XMAA 1HN1A 5LA2A 1RYYA 2MHFA 1W8FA 3P3NA 5FV3A 2UYAA 5FOJB 2VCMA 5K9YA 3E1F1 4HETA 1LENA 5FP8A 4B29A 5IHRA 5J7MA 5FPLA 1I1EA 2XJSA 4MZUA 1YIFA 3ACGA 3H50A 5FZBA 3N4MA 2RE9A 5HV0A 3AMMA 1SBEA 4XIKA 2ZEWA 2D7FA 3PUIA 3GBFA 1Z0HA 1WMFA 2YBKA 3JBG1 4IEZA 1BQPA 4KH9A 1C57A 4XJUA 4Y1ZA 1COV1 5KHHA 1YQ5A 3P3PA 2QQJA 3P1IA 3GALA 1VBA1 4LO5B 2XJUA 2RDRA 4QX2A 5FKBA 2JE7A 2FCVA 4OCTA 5ERLA 3ACFA 4DXRA 3BODA 2A6XA 5FYBA 1OKOA 4ZU7A 5EXOA 4CSWA 2Z5WA 2XJVA 5DABA 5F5AA 4B8EA 1JZ6A 3IMNA 4SBVA 2KA3A 1IS6A 2RS53 1ALYA 1N1YA 4OZXA 3WDUA 1CX4A 4XFGA 2XBO3 5FRAA 2VL4A 5DUWA 2QQLA 1MEC3 2F6BA 3C7FA 5FZ3A 4YGEA 2EIDA 2TNFA 3RQ0A 1V70A 1UYZA 2ZMNA 4C0HA 3WINE 3H9AA 4AQ6A 3DEMA 3ZSEA 4XAAA 3NQHA 1O59A 4XUNA 2VXRA 2WYFA 1W99A 1ZYBA 2ZKLA 1PZ8A 2I2SA 4I0WB 4PIYA 2YC2A 4MGKE 5FLIA 1HB1A 3THDA 1DGLA 1NCRB 1ACCA 1Y3TA 1OUSA 1TMF2 1FV3A 4OFGA 2PAKA 2YGMA 4COUA 2RS33 3ZKUA 5LCWL 1R091 3NV3A 1VB4A 1Q43A 4YPJA 5IK5A 4TN7A 3H1YA 2ID4A 5AC93 4WV8A 4K8RB 4C1WA 1XBFA 1S0GA 2WSVA 2XGXA 3AXEA 2A70A 3O14A 4FP3A 2ET1A 1OLRA 4JVAA 4QT6A 3WP4A 1BCXA 1NCRA 5HCFA 2FDHA 4CDUA 1CESA 2GH2A 2YFZA 1DZQA 1JHNA 2D98A 3OGGA 4JZRA 1EAH3 1W6MB 1ZBA2 4EZHA 5FMBA 4BH9A 1YQ2A 1JU4A 1CAUB 4E8CA 2Y64A 3H7YA 2ORXA 3A4UA 5D8AB 4NJ4A 3VD4A 3PVEA 5A7PA 4XFBA 1FT9A 3IDCB 3Q8FA 3BYWA 4DXTA 5A6ZA 3LIHA 4J1WA 3I3MA 3SHRA 5CISA 1JU3A 3FL7A 3E6BA 2D5HA 1W6MA 3MLKA 1MS4A 4GJZA 1XE0A 1CAUA 3N9LA 4Z07A 2D3SA 2E9QA 1MS9A 4GQ7A 5D8AA 3FC0A 3USSA 4XHXA 1AR61 2EAKA 4W65A 1AL21 1VBD3 2L9LA 5BPXA 1PVC3 4ARXA 4HFSA 4GB31 3KCXA 3ZYGA 4NHYA 2VVEA 4KL1A 2F17A 1UU6A 4BMEA 4D6RA 4CDQC 5AFBA 2VW0A 1QIQA 3N9MA 2RDNA 4ZXEA 3MPBA 2QVSB 3H0OA 3NJZA 1X9TA 4CTEA 1HXS3 1P8JA 1W2NA 1Z7S1 2WQ8A 2E7TA 3MI8A 4FOVA 4P02B 3PLQA 2E7AA 1JODA 3ITQA 5CFCB 4XCAA 1PGL2 3M3CA 3D82A 5A33A 1HX6A 4DEVA 3OUHA 3U07A 2CAUA 3ZOIA 3TN93 4Q4X2 1OQDA 4AVAA 2GNTA 1RVF2 5SV5A 2ERFA 1AXZA 1R1A2 4YLZA 5C8CB 5JZGA 4F8AA 3RZLA 3WLUA 3GCXA 1NY71 1XPWA 1TG7A 1FMD2 2W46A 1L7RA 2DCKA 2EALA 4IEYA 3B94A 4XFCA 1SBFA 3Q9OA 4Y1VA 3ZYPA 2VZUA 2XUMA 1CAWA 4NRQA 3T3YA 1CAXB 5L9BA 1NCRC 4WM7B 4HVOA 3LZZA 1C8M2 1A78A 4OMDA 3KCYA 1AYN3 1JMUB 5C8CA 5FZ9A 3BIEA 3T0DA 5H9RA 4DFSA 1OLMA 2R061 1WCDJ 1RMU1 1ULEA 3BOPA 2QDNA 4CA9A 5JIUA 5DG2A 1GR3A 3G7DA 1JOBA 2A71A 1LULA 4D3WA 5FMDA 2YXSA 1CAXA 4AQSA 3ZLIA 4WM7A 5F1RA 4WVMB 2GC0A 4JTOA 1V0AA 4PF5A 3O1SA 3O1VA 1ULFA 3WP6A 2JB8A 3ZSJA 2ZJCA 2WQ4A 3M3OA 2BEOA 4LKFA 4X6QB 4YVSB 3WX5A 2XLFA 1GYKA 2PHWA 1OC1A 1OLQA 2ORZA 2D3PA 5D8AC 1TME1 2D93A 1LHUA 3NRUA 4LBQA 4XJ8A 4GIQA 2A6YA 4BDVB 1Q8OA 4E2SA 4W8JA 4L0PA 1XNCA 5BNPC 1CAVA 1V9U2 1W2AX 2RS13 3ZXDA 3OOXA 2D6NA 4CPBD 2PHXA 4YVSA 3RPQA 1WMXA 1JYIA 4EWDA 2BYVE 3IPVB 1NLRA 3EXUA 5JVVA 1KJLA 2E33A 5FZGA 1MVQA 3PIGA 4E8DA 3HPNA 4EWEA 1RUF2 3K51A 3MF6A 1GNYA 3I7DA 2W94A 2Y6KA 1NE6A 4ITCA 2XOMA 2YU1A 4PJYA 3D6EA 4H7MA 5FWEA 5FOBB 3WP3A 1PIV1 5FY5A 5FZ1A 1REFA 5FZ8A 4HBNA 2IVIB 1QY4A 3F2ZA 1DFQA 1QDOA 5L7OB 4V1PA 3IPVA 1RHI3 1UW8A 3I3BA 4JKKA 5GKAC 1PX4A 1BBT3 1Q56A 2JB4A 3VZMA 5A70A 5CFCC 1VRH3 2H6CA 4FI9A 4FXKB 4JRLA 1NCQC 1SACA 1NLQA 1QXRA 1UMHA 2Y60A 4OI4A 4YW5A 3ST7A 2W87A 4Q4W2 4CCNA 2CWSA 3ON7A 4Q4V2 1W8UA 4N43B 3U75A 3X29B 4A6OA 4C0BA 5C8CC 3JB4C 1MS5A 5L7OA 2CV6A 4BB3A 1SLCA 3AKPA 2D6PA 5CEHA 2MEV2 1UY0A 3ZIWA 2W47A 3WVJA 1PO12 4O7XA 2J1VA 5A1FA 3JXSA 4Q0UA 1FYUA 3FHAA 2OPKA 2BBVA 2YU2A 4LUKA 4B4QA 3EYPA 5JCTA 4XXPA 3WG4A 1SHWB 2HWF2 2PLV3 3RJRA 3OF1A 1UXXX 3I2JA 1YFYA 2HYXA 3FUOA 2YC4A 4HPKB 4MYEA 3GYDA 4A3ZA 3WUCA 4N90A 4N9IA 2HWD2 1H2LA 1CQ9A 1HB2A 1NE4A 1YI7A 3WXPA 1QJX2 1C28A 1V6MA 4NWVA 4BOWA 1NZCA 5FZ4A 5L73A 3O1MA 3WF4A 4LBKA 1W06A 2MNGA 5DMYA 4RQPC 4AZZA 4YVSC 3GZEA 2WZR3 1R1ZA 3QH6A 1WW6A 2WINB 3C7HA 3POWA 4Y3OA 4CCJA 4HPKA 4I09A 4YZ5A 2D3RA 4K21A 3PUQA 3VDDB 2DURA 4JAAA 4DXSA 4XBNA 3PJYA 3ZN6B 3A21A 2ARAA 3IDEA 5JXGA 1PGW2 1ZZBA 2VUJA 4P9LA 2PN5A 5FWJA 4Q8KA 3ETQA 3LEGA 3LF7A 1K42A 5H9PA 2W1WA 3K3NA 4LE3A 3NSTA 3SISA 5CVRA 1ZRIA 2BNMA 3ELNA 1ZZ8A 2ZX0A 3LD8A 3NJYA 5F8PA 4G3YC 4HSLA 4R4ZA 5C70A 1WW5A 3LDBA 4RFT0 4AI0A 4AI9A 2C4XA 1QJEA 3B93A 3TNQA 4YM0A 3BU7A 4DINB 3FX3A 1MS8A 1U5YA 2WFF2 4JGZB 2WZPP 3WEZA 3WOGA 1R083 1X50A 5L7OC 1WBLA 2FHRA 3VZJA 5FY9A 4D6QA 3O5SA 2ZZQA 2VMDA 4QGLA 3SMHA 3WF0A 2RMU1 5IK7A 5GLUA 1W6NA 3ZFFB 1VAVA 4CP9B 1QEXA 4QGMA 4X8NA 4AVSA 4CE8A 4QPWA 4JGZA 1MQTB 1XNKA 3ILFA 2RDSA 2IVJA 1UY4A 5CU1A 3EQEA 2OYZA 2FDKA 4CU8A 3LA7A 4N43C 1IS5A 1DYKA 1UIKA 3DCQA 4LHKA 3SCGA 3MUZ1 5I0TA 2JX9A 3OPZA 4XAEA 2AENA 3KGLA 1OF4A 4XUQA 5LBCA 3IIIA 4MUVA 4W6YA 4UI9L 3ZFFA 4QD2A 3BTXA 3KM5A 3OJBA 2LTNA 4YNIA 5DDJ1 1OKQA 2BNNA 2XWJB 4I0BA 4YG3A 3TEXA 1AL0G 1QJY3 3LQCA 3B01A 4UW3A 1MQTA 5LWBA 3CQOA 3UESA 5J36A 4OUSA 3DYPA 2AYHA 2BV4A 2C9AA
chains in the Genus database with same CATH topology
1JYWA 3A22A 2WBKA 1OD3A 4GWIA 4KMQA 2QQKA 2VJXA 2KD7A 3T0AA 1H6YA 2BERA 1JZ8A 3VD7A 2CDOA 3K46A 3I2IA 4M4RA 1J84A 5JMOA 5B4NA 2VZSA 2VM9A 3I97A 1JYNA 1JZ2A 2EICA 3UNPA 2VMCA 3CMGA 2WO1A 1EUUA 1SDDB 1W9WA 3K4AA 4GWJA 4P08A 1DYOA 1OT5A 2WO3A 2VMFA 3D3AA 5IYYA 3FN9A 1K3IA 4XURA 4Z2AA 5LA0A 1KGYA 3IAQA 4PQQA 5CZKA 3AC0A 2QQOA 4XUTA 2PQSA 1R64A 1T2XA 1UYXA 2B4KA 3VD3A 1O8SA 3WNOA 2Y6GA 2VQUA 2Y6LA 3WNLA 3GM8A 1W8OA 4QX0A 2LW8A 2X09A 1NX9A 1H6XA 2WYSA 5IFTA 3W5MA 2C9KA 2VCAA 2XONA 4BJ0A 1JI6A 2W91A 3NJVA 1GOGA 2ZEZA 5DQ0A 1PMHX 2E32A 5DN2A 3WNNA 4BK5A 4QB6A 1W0NA 1GOFA 2YFUA 3CIHA 4JKLA 1DP0A 1UYYA 2WAAA 5HPOA 2RJ2A 2BGOA 2WZ8A 4A44A 2VMEA 4TXWA 4QX1A 4ZZ8A 1K45A 2YG0A 3SKJE 3VD9A 2VC9A 3MUY1 2VCBA 3BGAA 3THCA 2WDBA 1CX1A 5A1AA 3T2QA 2J1UA 4XZUG 3I2HA 4RN5A 1JHJA 4CU9A 2VQTA 2XHNA 3LEIA 4LKSA 4LHSA 4D8MA 5JXIA 3I3EA 1IQDC 2W5FA 3I3DA 2W1QA 1NKGA 1UY1A 4M4PA 3DYMA 4MO3M 1UWWA 2X10A 2QQIA 4QDSA 5JR2A 3A23A 1W8NA 4A42A 5JUVA 1DLCA 3OEBA 3IAPA 1HN1A 5LA2A 1RYYA 5EIYB 3E1F1 5IHRA 2W95A 4MADA 5HXMA 3ACGA 3OGSA 2J1AA 5LA1A 1L7QA 4QB1A 3DECA 3T2PA 3CDZB 3T09A 2ZEWA 4XUOA 4JHZA 3PUIA 3IDAA 4HG6B 4ET7A 1GMMA 2QQJA 3P1IA 1PMJX 1SG3A 1UX7A 4QX2A 3ZM8A 3ACFA 4DXRA 4QX3A 1JZ6A 4CVUA 3CZJA 4DUVA 3ETPA 5JXJA 3I2GA 4CUCA 4XUPA 4CUBA 2VL4A 2QQLA 3C7FA 2EIDA 2HLEA 1UYZA 2VO5A 3OGRA 5EJZB 1XC6A 3U37A 5IFPA 3GXUA 2EIBA 1O59A 3NQHA 4XUNA 1W99A 2JKXA 3WNPA 2YC2A 4TTGA 3THDA 4A4AA 3VD5A 1CZTA 2J1EA 3HEIA 3HNBM 5LCWL 2J1TA 4W4ZA 3J7HA 4YPJA 3FHQA 5IJRA 2ID4A 1I5PA 5B4XA 1UMIA 4AAXA 2VZ1A 3W5NA 2YFZA 2VZQA 1F4HA 1YQ2A 1JU4A 4E8CA 2Y64A 2Y8KA 2ORXA 2LS6A 3VD4A 3PUHA 3HN3A 3WF2A 3VDCA 4DXTA 2WUHA 2R7EB 1JU3A 4W50A 3FL7A 3SEEA 2J1RA 3K4DA 1OH4A 3ACIA 2E31A 2WZEA 2EIEA 2L9LA 3LEKA 2WABA 4QDRA 4ARXA 1LNSA 2VZPA 2VOTA 3DYOA 2VZOA 4QB2A 1CZVA 4BXSV 2W1SA 4ZXEA 1JYVA 4CU6A 1JZ7A 3HJRA 3K75B 1P8JA 2WQ8A 5I0DA 3WNKA 4P02B 3WF3A 4KI5M 4DEVA 4JX0A 2E26A 1TVGA 3T2OA 3VDAA 2QBXA 3IB3A 3LPGA 4KWUA 4QDQA 5G05L 1BHGA 3HNMA 1XPWA 1TG7A 2W46A 1L7RA 1W9SA 2CDPA 2DCKA 4JKMA 2YB7A 5EJ1B 2VZUA 1O8PA 2ZXQA 3GDBA 4OYUA 1XNAA 3K77A 4OMDA 2DDUA 3T0DA 3C7GA 4OZOA 3MO4A 2QQNA 1UY3A 3OBAA 2WN3A 2OKXA 3T0BA 4CUAA 4DEQA 2ORZA 3MV11 3NRUA 3OEAA 1NAEA 1WKYA 3P6BA 3OGVA 2QQMA 4BDVB 4W8JA 1CIYA 4L0PA 4ARYA 1K12A 2W3JA 1MPXA 4P5YA 1UZ0A 3LPFA 2WN2A 3C8XA 3CZUA 2BZDA 4A45A 1XNTA 3C7OA 5C71A 4DUXA 5CYYA 2J1SA 1GOHA 2E33A 4AG4A 4E8DA 3HPNA 1EUTA 3I2KA 1GNYA 4LQRA 2W94A 3UETA 2Y6KA 1US2A 3LE0A 4DUWA 1W9TA 2XOMA 2V4VA 2J7MA 2C26A 1UY2A 4IUGA 3F2ZA 2J22A 3I3BA 4JKKA 3WQBA 1PX4A 4MOAA 2WO2A 2DCJA 2RV9A 1D7PM 1JYXA 4FI9A 1NUKA 1UMHA 3ECQA 4D0QA 2ZEYA 2W92A 1UXZA 2W87A 1OF3A 2VZVA 4LPLA 4A6OA 3OB8A 2Y6HA 1UY0A 2W47A 2J1VA 3JXSA 3GGLA 5DPNA 2VZ3A 3FHAA 2Y6JA 4RYDA 5JXHA 3EYPA 1J83A 1SHWB 3EB7A 3NNGA 1UXXX 3I2JA 4A41A 4XVHA 4BK4A 2HYXA 2JE8A 2YC4A 1GUIA 4A3ZA 1KEXA 4ZZ5A 4QAWA 1JZ3A 3HOBA 3WNMA 4GZ9A 3OG2A 4CU7A 3WF4A 2VCCA 1GU3A 1WCQA 1F4AA 1JZ5A 5DMYA 3BN6A 4MGQA 3MBWA 3C7HA 1JZ4A 4DXSA 2VZTA 3A21A 4OUEA 5JXGA 3LEGA 3CKHA 1K42A 1ULOA 2VZRA 2W1WA 3VDBA 2W9XA 4MGSA 5G04L 3SKVA 2BBAA 2ZEXA 3C7EA 5C70A 2JDAA 3HNYM 5FUIA 2V5DA 2C4XA 5F7UA 2VR4A 4UAPA 2RVAA 3WEZA 1ULPA 1PX3A 3I2FA 2XQXA 1GQPA 1CZSA 3ACHA 1US3A 4PT6A 2VMDA 3WF0A 2B9VA 4ZY9A 3NJXA 2JD9A 3K4ZA 4P00B 4QPWA 2Z4FA 5J1XA 1UY4A 4OMCA 4CU8A 2V72A 3MV01 3WSOA 3A7QA 4UOJA 3WF1A 3MUZ1 3SEPA 4PF1A 5C7GA 4XUQA 1OF4A 3IIIA 3T08A 4UI9L 2X05A 3LQCA 2VTFA 3CQOA 3UESA 3ABZA 3DYPA 2W1UA 2WAOA 2BGPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JYW A;  3A22 A;  2WBK A;  1OD3 A;  4GWI A;  4KMQ A;  2QQK A;  2VJX A;  2KD7 A;  3T0A A;  1H6Y A;  2BER A;  1JZ8 A;  3VD7 A;  2CDO A;  3K46 A;  3I2I A;  4M4R A;  1J84 A;  5JMO A;  5B4N A;  2VZS A;  2VM9 A;  3I97 A;  1JYN A;  1JZ2 A;  2EIC A;  3UNP A;  2VMC A;  3CMG A;  2WO1 A;  1EUU A;  1SDD B;  1W9W A;  3K4A A;  4GWJ A;  4P08 A;  1DYO A;  1OT5 A;  2WO3 A;  2VMF A;  3D3A A;  5IYY A;  3FN9 A;  1K3I A;  4XUR A;  4Z2A A;  5LA0 A;  1KGY A;  3IAQ A;  4PQQ A;  5CZK A;  3AC0 A;  2QQO A;  4XUT A;  2PQS A;  1R64 A;  1T2X A;  1UYX A;  2B4K A;  3VD3 A;  1O8S A;  3WNO A;  2Y6G A;  2VQU A;  2Y6L A;  3WNL A;  3GM8 A;  1W8O A;  4QX0 A;  2LW8 A;  2X09 A;  1NX9 A;  1H6X A;  2WYS A;  5IFT A;  3W5M A;  2C9K A;  2VCA A;  2XON A;  4BJ0 A;  1JI6 A;  2W91 A;  3NJV A;  1GOG A;  2ZEZ A;  5DQ0 A;  1PMH X;  2E32 A;  5DN2 A;  3WNN A;  4BK5 A;  4QB6 A;  1W0N A;  1GOF A;  2YFU A;  3CIH A;  4JKL A;  1DP0 A;  1UYY A;  2WAA A;  5HPO A;  2RJ2 A;  2BGO A;  2WZ8 A;  4A44 A;  2VME A;  4TXW A;  4QX1 A;  4ZZ8 A;  1K45 A;  2YG0 A;  3SKJ E;  3VD9 A;  2VC9 A;  3MUY 1;  2VCB A;  3BGA A;  3THC A;  2WDB A;  1CX1 A;  5A1A A;  3T2Q A;  2J1U A;  4XZU G;  3I2H A;  4RN5 A;  1JHJ A;  4CU9 A;  2VQT A;  2XHN A;  3LEI A;  4LKS A;  4LHS A;  4D8M A;  5JXI A;  3I3E A;  1IQD C;  2W5F A;  3I3D A;  2W1Q A;  1NKG A;  1UY1 A;  4M4P A;  3DYM A;  4MO3 M;  1UWW A;  2X10 A;  2QQI A;  4QDS A;  5JR2 A;  3A23 A;  1W8N A;  4A42 A;  5JUV A;  1DLC A;  3OEB A;  3IAP A;  1HN1 A;  5LA2 A;  1RYY A;  5EIY B;  3E1F 1;  5IHR A;  2W95 A;  4MAD A;  5HXM A;  3ACG A;  3OGS A;  2J1A A;  5LA1 A;  1L7Q A;  4QB1 A;  3DEC A;  3T2P A;  3CDZ B;  3T09 A;  2ZEW A;  4XUO A;  4JHZ A;  3PUI A;  3IDA A;  4HG6 B;  4ET7 A;  1GMM A;  2QQJ A;  3P1I A;  1PMJ X;  1SG3 A;  1UX7 A;  4QX2 A;  3ZM8 A;  3ACF A;  4DXR A;  4QX3 A;  1JZ6 A;  4CVU A;  3CZJ A;  4DUV A;  3ETP A;  5JXJ A;  3I2G A;  4CUC A;  4XUP A;  4CUB A;  2VL4 A;  2QQL A;  3C7F A;  2EID A;  2HLE A;  1UYZ A;  2VO5 A;  3OGR A;  5EJZ B;  1XC6 A;  3U37 A;  5IFP A;  3GXU A;  2EIB A;  1O59 A;  3NQH A;  4XUN A;  1W99 A;  2JKX A;  3WNP A;  2YC2 A;  4TTG A;  3THD A;  4A4A A;  3VD5 A;  1CZT A;  2J1E A;  3HEI A;  3HNB M;  5LCW L;  2J1T A;  4W4Z A;  3J7H A;  4YPJ A;  3FHQ A;  5IJR A;  2ID4 A;  1I5P A;  5B4X A;  1UMI A;  4AAX A;  2VZ1 A;  3W5N A;  2YFZ A;  2VZQ A;  1F4H A;  1YQ2 A;  1JU4 A;  4E8C A;  2Y64 A;  2Y8K A;  2ORX A;  2LS6 A;  3VD4 A;  3PUH A;  3HN3 A;  3WF2 A;  3VDC A;  4DXT A;  2WUH A;  2R7E B;  1JU3 A;  4W50 A;  3FL7 A;  3SEE A;  2J1R A;  3K4D A;  1OH4 A;  3ACI A;  2E31 A;  2WZE A;  2EIE A;  2L9L A;  3LEK A;  2WAB A;  4QDR A;  4ARX A;  1LNS A;  2VZP A;  2VOT A;  3DYO A;  2VZO A;  4QB2 A;  1CZV A;  4BXS V;  2W1S A;  4ZXE A;  1JYV A;  4CU6 A;  1JZ7 A;  3HJR A;  3K75 B;  1P8J A;  2WQ8 A;  5I0D A;  3WNK A;  4P02 B;  3WF3 A;  4KI5 M;  4DEV A;  4JX0 A;  2E26 A;  1TVG A;  3T2O A;  3VDA A;  2QBX A;  3IB3 A;  3LPG A;  4KWU A;  4QDQ A;  5G05 L;  1BHG A;  3HNM A;  1XPW A;  1TG7 A;  2W46 A;  1L7R A;  1W9S A;  2CDP A;  2DCK A;  4JKM A;  2YB7 A;  5EJ1 B;  2VZU A;  1O8P A;  2ZXQ A;  3GDB A;  4OYU A;  1XNA A;  3K77 A;  4OMD A;  2DDU A;  3T0D A;  3C7G A;  4OZO A;  3MO4 A;  2QQN A;  1UY3 A;  3OBA A;  2WN3 A;  2OKX A;  3T0B A;  4CUA A;  4DEQ A;  2ORZ A;  3MV1 1;  3NRU A;  3OEA A;  1NAE A;  1WKY A;  3P6B A;  3OGV A;  2QQM A;  4BDV B;  4W8J A;  1CIY A;  4L0P A;  4ARY A;  1K12 A;  2W3J A;  1MPX A;  4P5Y A;  1UZ0 A;  3LPF A;  2WN2 A;  3C8X A;  3CZU A;  2BZD A;  4A45 A;  1XNT A;  3C7O A;  5C71 A;  4DUX A;  5CYY A;  2J1S A;  1GOH A;  2E33 A;  4AG4 A;  4E8D A;  3HPN A;  1EUT A;  3I2K A;  1GNY A;  4LQR A;  2W94 A;  3UET A;  2Y6K A;  1US2 A;  3LE0 A;  4DUW A;  1W9T A;  2XOM A;  2V4V A;  2J7M A;  2C26 A;  1UY2 A;  4IUG A;  3F2Z A;  2J22 A;  3I3B A;  4JKK A;  3WQB A;  1PX4 A;  4MOA A;  2WO2 A;  2DCJ A;  2RV9 A;  1D7P M;  1JYX A;  4FI9 A;  1NUK A;  1UMH A;  3ECQ A;  4D0Q A;  2ZEY A;  2W92 A;  1UXZ A;  2W87 A;  1OF3 A;  2VZV A;  4LPL A;  4A6O A;  3OB8 A;  2Y6H A;  1UY0 A;  2W47 A;  2J1V A;  3JXS A;  3GGL A;  5DPN A;  2VZ3 A;  3FHA A;  2Y6J A;  4RYD A;  5JXH A;  3EYP A;  1J83 A;  1SHW B;  3EB7 A;  3NNG A;  1UXX X;  3I2J A;  4A41 A;  4XVH A;  4BK4 A;  2HYX A;  2JE8 A;  2YC4 A;  1GUI A;  4A3Z A;  1KEX A;  4ZZ5 A;  4QAW A;  1JZ3 A;  3HOB A;  3WNM A;  4GZ9 A;  3OG2 A;  4CU7 A;  3WF4 A;  2VCC A;  1GU3 A;  1WCQ A;  1F4A A;  1JZ5 A;  5DMY A;  3BN6 A;  4MGQ A;  3MBW A;  3C7H A;  1JZ4 A;  4DXS A;  2VZT A;  3A21 A;  4OUE A;  5JXG A;  3LEG A;  3CKH A;  1K42 A;  1ULO A;  2VZR A;  2W1W A;  3VDB A;  2W9X A;  4MGS A;  5G04 L;  3SKV A;  2BBA A;  2ZEX A;  3C7E A;  5C70 A;  2JDA A;  3HNY M;  5FUI A;  2V5D A;  2C4X A;  5F7U A;  2VR4 A;  4UAP A;  2RVA A;  3WEZ A;  1ULP A;  1PX3 A;  3I2F A;  2XQX A;  1GQP A;  1CZS A;  3ACH A;  1US3 A;  4PT6 A;  2VMD A;  3WF0 A;  2B9V A;  4ZY9 A;  3NJX A;  2JD9 A;  3K4Z A;  4P00 B;  4QPW A;  2Z4F A;  5J1X A;  1UY4 A;  4OMC A;  4CU8 A;  2V72 A;  3MV0 1;  3WSO A;  3A7Q A;  4UOJ A;  3WF1 A;  3MUZ 1;  3SEP A;  4PF1 A;  5C7G A;  4XUQ A;  1OF4 A;  3III A;  3T08 A;  4UI9 L;  2X05 A;  3LQC A;  2VTF A;  3CQO A;  3UES A;  3ABZ A;  3DYP A;  2W1U A;  2WAO A;  2BGP A; 
#chains in the Genus database with same CATH topology
 2V5Y A;  5C4W B;  3KQR A;  5DUU A;  5A7W B;  1H2N A;  2WBK A;  3MFC A;  3H7J A;  1ZZ6 A;  2G4I A;  3IMM A;  1X36 A;  2YGL A;  1H4H A;  1T6B X;  1MS0 A;  3CJI B;  2KD7 A;  1COV 2;  1H6Y A;  2OA2 A;  4N53 B;  1KS4 A;  2BER A;  4D69 A;  4Q1R A;  5GAL A;  3S30 A;  2HWB 3;  1Q8Q A;  4ATE A;  1ND2 B;  4M4R A;  2NYY A;  4PI0 A;  3R05 A;  4NID A;  4FPH A;  3LKJ A;  4MXW A;  1QGL A;  5F5C A;  3I59 B;  5I0U A;  1AR7 1;  3TRS B;  2JDY A;  3CJI A;  3E6C C;  4BQ4 A;  3UNP A;  2VMC A;  3OPW A;  4CP1 A;  4N53 A;  4CCK A;  1LOF A;  2IWG B;  1F9K A;  3VDD C;  3KMH A;  4L99 A;  4N7U A;  1DYO A;  1OT5 A;  2YBS A;  3UKN A;  1DQ0 A;  2VMF A;  2XL7 A;  3D3A A;  5J37 A;  2DF7 A;  2XJQ A;  2ARC A;  2GNB A;  1ASJ 3;  1PGS A;  1YWK A;  3I59 A;  2BFU L;  4XUR A;  4OQ9 A;  1DHK B;  1CPM A;  4Y5S A;  4D7S A;  4BHP A;  1GIC A;  2VH9 A;  1KD7 A;  1XRU A;  1YXW A;  4A7Z A;  5FZH A;  4PQQ A;  1O7F A;  4BPZ A;  2R49 A;  3E6D A;  1R09 2;  2PQS A;  1VBC 2;  2VEC A;  5LY2 A;  2XLA A;  2ZBJ A;  2VUA A;  2WLP A;  1O8S A;  2ARE A;  3CJX A;  2HWE 2;  3BOW A;  4Y4Y A;  1RB8 G;  2ZX4 A;  4UFM A;  2Y6L A;  3DV8 A;  3VBR B;  3KZ4 C;  1OMI A;  1FAY A;  1UYP A;  1RUJ 3;  3INA A;  1G9B A;  3ALQ A;  4QX8 A;  1PGL 1;  2E7Q A;  1LEM A;  4AOC A;  1DQ6 A;  4QXK A;  1KJR A;  2W91 A;  2N7G A;  2VUL A;  4BU2 A;  4E4H A;  3O1U A;  1VBE 1;  1QH7 A;  2RR1 2;  2YBP A;  3DKQ A;  4ZS2 A;  2ZX2 A;  5J09 A;  5F2S A;  5L36 A;  3CO2 A;  1ONA A;  1RUG 1;  3PHM A;  5LK5 A;  3CIH A;  3VBR A;  4JKL A;  1DP0 A;  2BQP A;  4XFI A;  2E51 A;  4BMB A;  4NPL A;  5HPO A;  4RS5 B;  4IV1 B;  3KLS A;  2VME A;  4QQ2 A;  4B1M A;  4TXW A;  2WFP A;  4D7T A;  4Z2W A;  2GC3 A;  3HMY A;  2UWC A;  1UKG A;  4FFH A;  3J8F 1;  4NIG A;  4PBP A;  1S0B A;  4AED B;  5BNN B;  1V00 A;  2VC9 A;  1C8M 1;  1DQ1 A;  3MUY 1;  4UFL A;  5C4W C;  4I0A A;  4GB3 2;  2WDB A;  5GJ6 A;  1H9P A;  1CX1 A;  5JDB A;  1A3K A;  2ES3 A;  3NKT A;  3QBQ A;  3ASI A;  2D40 A;  3CJI C;  4IEO A;  1UOB A;  4WM8 B;  4Q8L A;  2QE3 A;  1QF3 A;  4RS5 A;  1CN1 A;  1LOF C;  1JHJ A;  1LKN A;  5T55 A;  3LDR A;  4O61 A;  1AR9 3;  4XOG A;  2O14 A;  1DQ2 A;  1ND2 C;  1Z7S 2;  4W6W A;  3KGZ A;  4AED A;  5FZE A;  3VZO A;  1F5J A;  4D8M A;  4M0H A;  1TMF 1;  4I3G A;  4AI2 A;  1NKG A;  4LJH A;  1VAK A;  1Y9M A;  1UAI A;  3NV4 A;  1ENQ A;  1C4R A;  5JR2 A;  3NKG A;  3RG0 A;  2A3X A;  4WM8 A;  4A42 A;  5JUV A;  1DLC A;  1L3J A;  2OPW A;  2Q1Z B;  5KHG A;  1QXP A;  5T3N A;  5I91 A;  3KSC A;  2VBB A;  4K6B A;  1NY7 2;  2A6W A;  4UFJ A;  1N3O A;  2DBI A;  1M06 G;  1SLT A;  5E1R A;  2SLI A;  5HXM A;  2JG9 B;  1HW5 A;  1L7Q A;  2R1D A;  1W05 A;  4Y4R A;  4XJ9 A;  5DZG A;  4TLF A;  1WCS A;  4YYO A;  3T2P A;  4E4S A;  1O3T A;  4H7L A;  2JDP A;  2ZGR A;  3ZSM A;  4ES8 A;  1AYM 3;  1CGP A;  3WHT A;  2OII A;  5A7O A;  1BYH A;  3ORJ A;  4LKE A;  3IDA A;  3UKT A;  1LJ7 A;  3MID A;  1F5F A;  1RUF 1;  1RMU 2;  1HRI 1;  2R06 2;  2YUE A;  4ET7 A;  5J3U A;  5FYC A;  5JOZ A;  4IW3 A;  2FDG A;  1OQ1 A;  1SG3 A;  5GLZ A;  1CIW A;  1DCS A;  1Q8V A;  5IVE A;  1H2M A;  2X5I B;  3ZM8 A;  2JG9 A;  4JC1 A;  1MEC 1;  4DS0 A;  5J96 B;  2P3Y A;  4JRA A;  4PIZ A;  5JXJ A;  4XF0 A;  2IUW A;  1AR8 1;  2EA7 A;  2R07 1;  3GZA A;  5FZK A;  3NO8 A;  3RYK A;  4U2A A;  1TNF A;  2BFU S;  2WR9 A;  3RSJ A;  3C2U A;  1X9P A;  4A6S A;  4N9H A;  4XDP A;  3LWC A;  1FV2 A;  4LIT A;  5EJZ B;  2HEY F;  3U37 A;  2X5I A;  3GJB A;  5IFP A;  2V09 A;  3GXU A;  3ZDS A;  1ND3 B;  4Q4W 1;  3H42 B;  1ENS A;  3ZYR A;  5FR3 A;  5FJK A;  3LEM A;  3U0Z A;  2GDF A;  5KC6 A;  3BI3 A;  1RUI 2;  4IQP A;  4QPG B;  2BU9 A;  3ZR6 A;  4TTG A;  4HXC A;  1K5M B;  2WS9 3;  2MEV 1;  4E2G A;  4RS5 C;  4IV1 C;  4Y24 A;  3VN4 A;  3N7L A;  5FCC A;  2WC2 A;  3HEI A;  4KNC A;  2RJK A;  2Q8D A;  2DVG A;  2J1T A;  1QQP 2;  4Y22 B;  5EZW A;  3J7H A;  4AED C;  2C0Z A;  5BNN C;  4MET A;  1ND3 A;  2HJI A;  1GAN A;  1CJD A;  3NV2 A;  4LMF A;  4XC9 A;  5IJR A;  4BM8 A;  4YG0 A;  3WP5 A;  3NV1 A;  3AK0 A;  2OX0 A;  4XPV A;  4YW1 A;  1YQC A;  3POB A;  2VTX A;  3LGR A;  4QPG A;  2BDR A;  5C9A A;  2VMH A;  1K5M A;  5J98 B;  1JXN A;  1PIV 2;  2VZ1 A;  2WQZ C;  5I0R A;  2JG8 B;  2YY1 A;  2DCT A;  5BYN A;  4R4X A;  1BEV 3;  3S57 A;  5T50 A;  5CG8 A;  1ZBA 3;  2VZQ A;  1UQX A;  2VVF A;  2C1F A;  2GP3 A;  1XE7 A;  3AKS A;  2VD7 A;  3OD4 A;  1LES A;  2PHR A;  4IES A;  5BY5 A;  4CEW B;  1W6Q A;  2AEY A;  3T1L A;  2QJV A;  1WUV A;  3HN3 A;  4M3C B;  1W8T A;  3H8U A;  2WUH A;  4XW3 A;  5FY4 A;  4HK8 A;  4IEQ A;  2JG8 A;  4W50 A;  3LCP A;  1KQR A;  1LCL A;  1U5I A;  2XJP A;  1VBD 1;  1PGW 1;  5LRS A;  4L9B A;  4IE5 A;  1WW7 A;  2XXZ A;  1JW6 A;  3ACI A;  4P9I A;  3QD6 A;  4J25 A;  4CEW A;  2E31 A;  1RUC 3;  3THP A;  3VUO A;  5HI0 A;  1DGW X;  1FOD 3;  1NQJ A;  2ATF A;  5JSR A;  5FMO L;  3DKW A;  4M3C A;  1Q8P A;  2WAB A;  4E27 A;  1LU1 A;  4AGG A;  2VZO A;  1F8V A;  1CZV A;  4HN1 A;  4BXS V;  2W1S A;  2C24 A;  5F32 A;  1A8M A;  5FYV A;  3JQX A;  4AI3 A;  1OSG A;  4DRR A;  4CU6 A;  3HJR A;  4KQ7 A;  4C1X A;  1WWY A;  3WNK A;  3FLT A;  1RUD 3;  4BIS A;  4XAC A;  1MVE A;  2PAM A;  1Y43 B;  1W6P B;  5ANQ A;  3A0N A;  2PHL A;  4KI5 M;  5FTT C;  4CEY B;  4QHO A;  2ADD A;  3KHC A;  1LRH A;  1RVF 3;  1H8T B;  2GC2 A;  1OUR A;  2ZX1 A;  3IB3 A;  4QKB A;  1R1A 3;  1UU4 A;  2AUY A;  4KWU A;  4RGG A;  5GZE A;  2WNO A;  4LA2 A;  4QDQ A;  5G05 L;  1BHG A;  5C3R A;  5I8S A;  4HKW A;  4PHZ A;  1W9S A;  4JKM A;  2CDP A;  5T54 A;  3UV9 A;  4ZHN A;  1AYN 1;  1W6P A;  3MIG A;  4P9G A;  4CEY A;  3TBD A;  3POY A;  2ZXQ A;  3GDB A;  4QPG C;  1XNA A;  1K5M C;  3K77 A;  4COZ A;  3WZ1 A;  5FFO C;  3KQ4 B;  2WKK A;  4ZS3 A;  4XAB A;  2R04 3;  4LEJ A;  5IVC A;  5FKC A;  2CU5 A;  3O12 A;  4FFI A;  1PNG A;  5IUQ A;  1W0O A;  2XL9 A;  3MW4 A;  2XUE A;  2Q8E A;  4XQD A;  4YM1 A;  3WHU A;  1KIT A;  3FUQ A;  3PVN A;  4D94 A;  5FQ0 A;  2YPJ A;  1PHM A;  2BGC A;  4Q0Q A;  4CDQ B;  1GZW B;  2QQN A;  2B7Y A;  2PHU A;  2JG8 C;  4L92 A;  2Z42 A;  2OUJ A;  5FYY A;  3UGG A;  5T5J A;  2WN3 A;  4FTS A;  1XJA A;  2DU1 A;  3RZH A;  2RMU 2;  4XF3 A;  4CEW C;  5D2A A;  2DVA A;  2FD8 A;  3UGF A;  4YGC A;  5D21 A;  3PUR A;  4CDQ A;  1NAE A;  1WKY A;  4JGY C;  3UGH A;  2A6V A;  1CIY A;  2ENR A;  3HAG A;  2EAA A;  2VQ0 A;  3GHN A;  3AFG A;  4XIL A;  4DIQ A;  1YCI A;  1S2E A;  4GWN A;  3CZU A;  1E5I A;  1XNT A;  4DUX A;  3OGJ A;  2JKB A;  4WZF A;  5DDJ 2;  1LU2 A;  3ATG A;  1GOH A;  3O0W A;  1UPI A;  5FUN A;  2A6Z A;  3GZU C;  4QWN A;  4QU1 A;  1QJU 1;  2Q1M A;  1WA6 X;  1US2 A;  4KGG A;  3SCF A;  1RHI 1;  2YDE A;  5GZD A;  1YLL A;  1W9T A;  4LBL A;  4P9W A;  4CPB A;  1VBC 1;  2C26 A;  1VRH 1;  1UY2 A;  1JS9 A;  2VXJ A;  2A3W A;  2FMD A;  5M0T A;  3B02 A;  2HWE 1;  4EYU A;  1AF9 A;  1XE8 A;  4QQP A;  4MOA A;  2WSU A;  5FZI A;  3UYJ A;  5FYT A;  1YRZ A;  4XJW A;  2DCJ A;  3HIF A;  2P34 A;  5FPB A;  1NUK A;  4Q4Y 2;  4IGO A;  3AXD A;  3SC7 X;  2RM2 2;  3NL1 A;  4CEY C;  2Y0O A;  3MIB A;  1UCX A;  5K8S A;  3ECQ A;  4GKY A;  3VGI A;  1AR7 2;  4BZ4 A;  1SLB A;  4LOR A;  1OF3 A;  1H8T C;  3QCW A;  4Q4V 3;  2VZV A;  4GMP 0;  4LPL A;  5C3Q A;  2GMP A;  4B3N A;  5FMC A;  2RR1 1;  1PM4 A;  2ARX A;  1JTZ X;  2G9F A;  5E16 A;  1PO1 3;  1S0E A;  1TQ5 A;  3ME2 A;  1DGR A;  5BNP B;  4AGR A;  2Z2S B;  1X7N A;  4QQL A;  2E63 A;  3UL2 A;  2P1B A;  1VBB 1;  3EHK A;  4NN0 A;  4X8P A;  4DO0 A;  3RZJ A;  5T5P A;  4HL0 A;  1X82 A;  4AQ2 A;  1J83 A;  1H0B A;  2HWF 3;  5FXZ A;  4QGN A;  3ZN5 A;  2JD4 A;  3VHO A;  3T1M A;  1HJG A;  4DY3 A;  2IXI A;  4K40 A;  2AGS A;  4XBQ A;  3EBR A;  1IZ3 A;  2I74 A;  3JD7 2;  4XVH A;  5IVJ A;  1MAC A;  1DZR A;  2JE8 A;  3N9Q A;  4MLO A;  2CHH A;  2P3J A;  1S0I A;  4K9S A;  3I2O A;  3NNL A;  1YQ8 A;  5BNQ A;  1WA4 A;  5BNP A;  2BRT A;  4CRQ A;  1JZ3 A;  1YFW A;  2WZR 1;  1QJX 3;  4QX5 A;  1HLC A;  3MF9 A;  5FLJ A;  2D6L X;  2XHK A;  1JUH A;  2VCC A;  5K7P A;  1JZ5 A;  2CGO A;  4L11 A;  3U11 A;  3MBW A;  1L7L A;  3VV1 A;  1H1A A;  1NCQ B;  3AP6 A;  4RHV 3;  4JCK A;  2JIJ A;  4O9G A;  2YV8 A;  1WBF A;  4CYD A;  1VBE 2;  2KXL A;  3KF3 A;  1SPP B;  4QQH A;  1XU1 A;  4IE0 A;  2PMW B;  3PU3 A;  4BQ3 A;  5CBL A;  1RUG 2;  1RUE 2;  1V6O A;  4BIO A;  5KXE A;  2K9Z A;  4LE4 A;  3CKH A;  4AVC A;  1ULD A;  4RFR B;  4K20 A;  3ZXG A;  2Q5T A;  1I9R A;  1ULO A;  4K3U A;  1ZBE 3;  1XYP A;  1UO9 A;  1C5H A;  1UX6 A;  1WME A;  2UY9 A;  3RS6 A;  5CFC A;  1NCQ A;  4J1X A;  2BBA A;  4BE3 A;  2SBA A;  3AYA A;  3J8F 2;  4C91 A;  1NT0 A;  2JDA A;  2QDR A;  2GSY A;  1SPP A;  2A75 A;  3BAL A;  1HIX A;  2YYO A;  4TZD A;  2VR4 A;  5EFU A;  4XBL A;  3N36 A;  3SIT A;  1PX3 A;  3I2F A;  4K7J A;  2LM3 A;  3IWZ A;  4AHX A;  1O6U A;  2XKO A;  1RUH 3;  5FPA A;  3VZK A;  4EN8 B;  1W3V A;  4FO9 A;  4H2A A;  2DFB A;  2ZAC A;  2HKX A;  3B5L B;  5E89 A;  2O0O A;  4QMA A;  4FAG A;  2B9V A;  2QZ3 A;  2OZJ A;  2OQ6 A;  2RG4 A;  5A32 B;  1XND A;  4AI8 A;  2EVX A;  1XB9 A;  2ZGN A;  5J1X A;  3ZMN A;  2XB6 C;  3KV9 A;  1A34 A;  2VOK A;  4RQP B;  5F39 A;  1S0C A;  4DRV A;  3WSO A;  1EPZ A;  4CDX C;  3PME A;  3WD5 A;  1W6O B;  4NOT A;  4IEU A;  2CNA A;  3WF1 A;  3JZV A;  4JQR A;  4PF1 A;  5C7G A;  3UJO A;  2CGP A;  5GZG A;  3T08 A;  5EP9 A;  4EE2 A;  4WVM A;  2IXL A;  5A7N A;  2UY8 A;  3M2M A;  2VW2 A;  1RUI 1;  2VTF A;  4LBN A;  3I4I A;  5A80 A;  3C3V A;  4FPJ A;  4RQP A;  2WAO A;  2BGP A;  2PA7 A;  2IXC A;  4URA A;  4FPY A;  4J6G A;  4DPN A;  4NHK A;  1W6O A;  3JBG 3;  1C3H A;  3MIH A;  3JU9 A;  1FI2 A;  1QQP 1;  1D4M 1;  2FQP A;  4YM2 A;  2QQK A;  1COV 3;  2VJX A;  2Y34 A;  1HRI 2;  3O7O A;  3OSD A;  4QHB A;  1PMI A;  2RS5 2;  4NPM A;  1VBA 3;  2Q1F A;  5CNA A;  2K2S A;  3OPT A;  3VD7 A;  4B7E A;  2CDO A;  5APA A;  5DG1 A;  3LFM A;  2DWR A;  1MEC 2;  1POV 1;  4NWW A;  3RI8 A;  4O65 A;  4AFD A;  2DTY A;  4WZC A;  5K0U B;  4I30 A;  1AR8 2;  3WCS A;  2R07 2;  2W39 A;  4XJZ A;  3MDP A;  1JYN A;  2EIC A;  2EIG A;  2WWS A;  1MZ5 A;  1IHM A;  2ZML A;  4JDM A;  1YFU A;  1F2N A;  1DQ4 A;  2P3K A;  2BOJ A;  2G1M A;  1ST8 A;  3IBM A;  4NUB A;  3JUU A;  1ZX5 A;  5FYH A;  4CP0 A;  4PLM A;  1KRI A;  2F4P A;  4LO6 B;  5DAQ A;  1O3Q A;  2WO3 A;  3LAG A;  5L9V A;  5LW9 A;  2D5F A;  2K46 A;  4I3P A;  5K0U A;  2RS3 2;  5IYY A;  5F3C A;  4PBO A;  2Q0A A;  4YAR A;  5LA0 A;  1W8W A;  5AC9 2;  1NA1 B;  2W52 A;  4FBF A;  2FDI A;  2B9U A;  3AC0 A;  1TE1 B;  3AYD A;  4LKD A;  1APN A;  4CP2 A;  2R32 A;  1UYX A;  4KBZ A;  1W3X A;  4QPI B;  3HBZ A;  2B4K A;  1WW4 A;  2LUW A;  4N43 A;  1O91 A;  4MGY E;  1GSL A;  5FLH A;  4P9J A;  4YGB A;  3NWK A;  3VBO C;  1EAH 2;  4NAO A;  4FTB A;  3LFI A;  3WNL A;  1XOY A;  2VGD A;  4AF9 A;  1OPO A;  2P5B A;  2PXJ A;  5FO8 B;  2LW8 A;  3B69 A;  4FOQ A;  3CEW A;  3CLP A;  5A3M A;  3IKW A;  1UNB A;  5GLT A;  5F3E A;  5IFT A;  4MV2 A;  2VCA A;  2ZZJ A;  1JI6 A;  1RTV A;  1ZA7 A;  2FCT A;  1V6L A;  1W90 A;  3NJV A;  4QPI A;  2BVV A;  2NN8 A;  2WO7 A;  4LBM A;  4PIX A;  4IE7 A;  5FP9 A;  3WNN A;  4QB6 A;  1GOF A;  5EJ3 A;  4BQ2 A;  4M0N A;  1D2Q A;  5EPA A;  1PO2 3;  1X8M A;  1SFY A;  1BVV A;  4CCO A;  1J58 A;  2RJ2 A;  5GLW A;  1D4V B;  2WZ8 A;  3KT7 A;  3V64 A;  1VBD 2;  5A6Y A;  3RFR A;  5BUV A;  5JOX A;  2JE9 A;  4IE6 A;  3WCR A;  3ZYB A;  4GAL A;  1DU3 D;  4QX1 A;  1HJF A;  5FPV A;  4NO4 A;  3SKJ E;  5GZC A;  2ZX3 A;  1AR6 3;  4AR2 A;  3H8R A;  1AL2 3;  1V6N A;  5I0S A;  2HEW F;  2GNM A;  2QQU A;  1FXZ A;  1VMH A;  4GB3 3;  3BGA A;  5A1A A;  1XXN A;  3VDD A;  2ZAB A;  2V4A A;  4AK3 A;  1TNR A;  2VNG A;  3ZN6 A;  4FXG B;  1IG3 A;  3W20 A;  1YC6 1;  5DAW A;  4LBJ A;  5JIA A;  4DNY A;  5IAX A;  2WWJ A;  2FZ1 A;  3ZXK A;  1Z7S 3;  4XJA A;  2OW4 A;  3THT A;  5CKM A;  2OUH A;  1V6I A;  2VMG A;  1BXH A;  4H55 A;  5JXI A;  3ES1 A;  3S5A A;  2RDQ A;  4Y33 A;  3VBF B;  3N3H A;  1POQ A;  2W5F A;  3I3D A;  5K0U C;  2W1Q A;  3HBK A;  1UY1 A;  3V0A B;  5D1I A;  1UWW A;  2R30 A;  2QQI A;  2X10 A;  4IER A;  4AXO A;  2B8M A;  2XH6 A;  1IS4 A;  1W2O A;  2QZ2 A;  4CCL A;  3VZL A;  2CYF A;  2XPJ A;  3NNM A;  1OOP B;  1N1S A;  3I2D A;  2FMY A;  1FNZ A;  4UW4 A;  2W95 A;  4IGQ A;  1MZ6 A;  4MAD A;  1AYN 2;  1MZE A;  2R1B A;  3CHX A;  4GH4 B;  4NRP A;  5B2G B;  3MLJ A;  3RZG A;  4HT1 T;  1DF0 A;  3DEC A;  3V0A A;  3VKM A;  3T09 A;  4TLG A;  1FPN 1;  1NA1 C;  4CP9 A;  4A7Y A;  1VRB A;  2XJR A;  3KV4 A;  3Q8A A;  2R06 3;  1EV1 1;  1N47 A;  2AEZ A;  2CAV A;  1GMM A;  2K0G A;  2VMI A;  1PMJ X;  1UX7 A;  5LRR A;  2HBU A;  5FY7 A;  4SLI A;  1YQ6 A;  4EZ4 A;  3O0V A;  2NPI A;  5A6X A;  3L9J T;  3CZJ A;  4FFG A;  4CVU A;  3O1P A;  4LA3 A;  4DUV A;  5FO9 B;  3I2G A;  1AZD A;  2Y33 A;  4YFZ A;  2Q30 A;  2PHF A;  4XUP A;  4R52 A;  3U14 A;  3DXU A;  4IE4 A;  3ZXA C;  5A3P A;  5JI9 A;  1LHW A;  1D0G A;  4Q4Y 1;  3RMY A;  2HLE A;  2I45 A;  2VO5 A;  2RM2 1;  4YWA A;  1J1L A;  4NRO A;  1TME 3;  1XC6 A;  1RIR A;  1JBC A;  1X8E A;  2JIG A;  5FY0 A;  5A7W A;  5C4W A;  3ZO0 B;  2WS9 1;  4CXW A;  3MZH A;  3KV5 A;  3ZFG B;  2VOV A;  3KWV A;  3PTR B;  4OHW A;  2ZA9 A;  4QKD A;  4E4D X;  2AAC A;  3IM0 A;  3VKL A;  1DGW A;  1Y9G A;  1XNB A;  3KF5 A;  2AC1 A;  2GN3 A;  5A3L A;  4DB5 A;  1HRV 1;  1S2K A;  1ZM1 A;  1ND2 A;  1I5Z A;  4GAZ A;  3ZFE B;  2UWB A;  5CA6 A;  5FBJ A;  4A4A A;  3VD5 A;  3WQ7 A;  3OBZ A;  1AVB A;  4BLJ A;  2Q4S A;  3IIA A;  4NRM A;  4W4Z A;  4IND A;  3AKT A;  3ZFG A;  3FHQ A;  2YC0 A;  1QJU 2;  1QH6 A;  4NR1 A;  5GZF A;  2VTX J;  4JQT A;  1RHI 2;  5TSW A;  1I6X A;  5B4X A;  1RUN A;  1UMI A;  1MS3 A;  3O0X A;  1LGC A;  1BBT 2;  3ZPO A;  1YIP A;  3SNM A;  2NM1 A;  3JD7 1;  1VRH 2;  2BVB A;  3W5N A;  3ZFE A;  3M7A A;  5T52 A;  2P6C A;  3S7I A;  1GWM A;  1F4H A;  2OS2 A;  3RZZ A;  3WDT A;  4AW7 A;  3TNP B;  1C1L A;  5LY1 A;  1VJ2 A;  1SQ4 A;  4QXH A;  1OA4 A;  4R8H A;  4AEK A;  3VBF C;  4COY A;  2BJS A;  3ZMO A;  4B4R A;  2LS6 A;  4PDW C;  4Q27 A;  3WY6 A;  5JPM B;  2JEN A;  2O8Q A;  4KU8 A;  5F3G A;  1S0D A;  5DAX A;  4F3J A;  5FYS A;  3VDC A;  2R7E B;  4ONU A;  3M1H A;  1A8D A;  1Y9Q A;  1BLZ A;  2FDJ A;  4W6X A;  4COW A;  3BKZ A;  5HBA A;  1FOD 1;  3SEE A;  1OOP C;  1HQW A;  2J1R A;  4NE9 A;  5FZC A;  1ODN A;  1OH4 A;  3ES4 A;  4NVP A;  4AVV A;  1RUE 1;  3RWN A;  1CR7 A;  3B3Q E;  3ZXF A;  3GCW A;  4UT5 A;  4YW3 A;  4GH4 C;  3AB0 A;  2PLV 2;  2EIE A;  1JYC A;  2DV9 A;  4YSF A;  3AMP A;  1VBB 2;  1U5Z A;  1LNS A;  2R0H A;  4L97 A;  4MHU A;  5CFD B;  1AX0 A;  2VZP A;  1PVX A;  3DYO A;  2CL2 A;  1YNA A;  2CY6 A;  2JXA A;  4K1Y A;  2HWC 1;  4MX3 A;  1JOP A;  2DVB A;  3PTY A;  4LLF A;  5FK7 A;  1JYV A;  2CGN A;  2PHT A;  1W39 A;  3FLP A;  3AP7 A;  1DBN A;  2D97 A;  5I0D A;  1PK6 B;  2GND A;  4RD7 A;  1O4Y A;  1H4G A;  1WLC A;  4YW2 A;  2CTV A;  5IW0 A;  2WZR 2;  4UWD A;  2H0B A;  3AVS A;  4IV1 A;  1IS3 A;  3HT2 A;  3LDK A;  4GA9 A;  2PQQ A;  5DUX A;  5F5I A;  3KV6 A;  4AFB A;  4DY5 A;  4B4P A;  5ACA 1;  1AX2 A;  2W08 A;  4JX0 A;  2E26 A;  1O5L A;  2DTW A;  3T2O A;  3VDA A;  1JN2 P;  1YI9 A;  3J4U H;  4Q5O A;  4AYU A;  4CCD A;  3WT3 A;  3LPG A;  3UK9 A;  3L2H A;  5BNN A;  1OVP A;  1RIT A;  4CCC A;  5LAT A;  2O1Q A;  3HNM A;  4BQ1 A;  3BUC A;  5FXW A;  4NIA A;  1PK6 A;  2ZGO A;  3ZFG C;  3G6J B;  5DAV A;  2R04 1;  4FFF A;  5A6Q A;  1TEI A;  2YB7 A;  4QXC A;  5FZA A;  2IXK A;  4FPO B;  5CKN A;  2W2I A;  1O8P A;  4A3X A;  5FJH A;  3USU B;  5JOY A;  4YVW B;  4JTN A;  2VW1 A;  3TEZ A;  3ZFE C;  3M3Q A;  3Q8E A;  2P37 A;  4FOY A;  3K2O A;  1HB3 A;  2P6H A;  3R4U A;  1KFX L;  4MGT A;  5AVP A;  1R08 2;  3DPR B;  4OZO A;  1WZX A;  2WII B;  4LO8 A;  3AP5 A;  3MO4 A;  1WLW A;  1KXG A;  1LHN A;  1N1V A;  2A3Y A;  1PZ7 A;  4WVZ A;  5JOW A;  4M01 A;  5CB7 A;  1UY3 A;  2RS5 1;  3DGT A;  3L2Y A;  3ZSL A;  4EN6 B;  2AH2 A;  1WGP A;  2XBO 1;  4KG8 A;  2OKX A;  1VB2 A;  3T0B A;  4CUA A;  5C3O A;  5FO7 B;  2RMU 3;  1G9C A;  2Y6F A;  3J7M A;  2JDH A;  2A73 B;  4ORF A;  4FPL A;  4BYY A;  5FAX A;  2W0X A;  2P3I A;  1E5S A;  2NMO A;  3KVB A;  3VKF C;  3ZSK A;  1IG0 A;  3U4X A;  3TB0 A;  3OGV A;  4HZF A;  4NII A;  4YRD A;  2GP5 A;  2GAU A;  2W3J A;  2ZGS A;  3DUI A;  3ILN A;  3AP4 A;  4P5Y A;  3URF A;  2WLQ A;  3GHM A;  2QFE A;  3LPF A;  4BQ5 A;  5H9Q A;  1W28 A;  2WN2 A;  1ZVF A;  4LUL A;  2HBT A;  4PCR A;  1QMJ A;  3AJY A;  2GU9 A;  4UXA A;  5FIX A;  2AR6 A;  2RS3 1;  5CYY A;  1OLM E;  4AG4 A;  2D44 A;  5FZM A;  1GP6 A;  5GLV A;  1LHV A;  4RR3 B;  5AC9 1;  1TMF 3;  4LQR A;  3UET A;  1UF2 C;  2Q8O A;  3VL9 A;  3VBU B;  5CFD C;  1T6G C;  1UD1 A;  3D4K A;  3LE0 A;  4YZ1 A;  3LSE A;  2WRA A;  2V4V A;  1V6K A;  2J7M A;  1D4M 2;  4RL7 A;  3RDI A;  1IOA A;  2KR2 A;  4IUG A;  4XZP A;  2J22 A;  3APB A;  2LRP A;  3UT0 A;  2DCY A;  3JCI A;  3WDY A;  4LK7 A;  5I8T A;  3WQB A;  5KXB A;  1EAH 1;  1ZRF A;  1PK6 C;  4Q0S A;  5FBZ A;  1OUX A;  2WO2 A;  1LAJ A;  1D7P M;  5F37 A;  4RR3 A;  1OFN A;  2VBD A;  4OHY A;  3IT8 A;  3PNA A;  5H9S A;  4YW7 A;  1HDK A;  3AZX A;  3NAP C;  4D0Q A;  3HT1 A;  1AR7 3;  2EXJ A;  2ZEY A;  4Y22 A;  1UXZ A;  4IEP A;  4HN0 A;  1GKB A;  1GZC A;  4MVT A;  3BCW A;  4LLO A;  4QX7 A;  1B35 B;  3OB8 A;  4R9D A;  1F35 A;  5E88 A;  1QOO A;  2WT1 A;  1Y4W A;  2Y6H A;  3JB8 A;  5A3O A;  1IPK A;  2GZW A;  4JGY B;  4G9S B;  3AM2 A;  1N3P A;  1SLL A;  1CVN A;  3BTA A;  3KT1 A;  1BMV 2;  3SH4 A;  2RHP A;  3E97 A;  4OUM A;  1S2B A;  4YVW C;  3FBY A;  3PUS A;  1PVC 1;  1UZY A;  2QQW A;  4MXV A;  5EYY A;  3NNG A;  1QJZ A;  4HON A;  4OHZ A;  3J7L A;  4A41 A;  4RSU A;  2VPV A;  3DPR C;  1Q8S A;  4JHT A;  3S7E A;  4JGY A;  3WDV A;  3LA3 A;  1E5H A;  1GUI A;  4KWL A;  3D8C A;  1HXS 1;  5FXX A;  1RUJ 2;  1WCK A;  4RGK A;  1UOJ A;  4QAW A;  4ZZ5 A;  1VLN A;  3HOB A;  3MIF A;  2YPD A;  3WNM A;  1ENX A;  4GZ9 A;  3S5Q A;  3W59 A;  1UU5 A;  4BQW A;  2B5H A;  3OG2 A;  4CU7 A;  3OUI A;  4MSV A;  2C6S A;  1DLL A;  4AEM A;  5KHJ A;  1GU3 A;  1WCQ A;  1F4A A;  2ZGU A;  4XEZ A;  3K3O A;  1I3H A;  3TN9 1;  3WG1 A;  5CKQ A;  2PEL A;  5ISL A;  2BWA A;  4XDQ A;  1ULC A;  4M00 A;  1JZ4 A;  1W9F A;  5IVB A;  1BJQ A;  4Q4X 3;  4DZG A;  1HN0 A;  4UBG A;  4QPI C;  1RUG 3;  1Z78 A;  1G9D A;  3CU7 A;  3EJK A;  5LBB A;  5IK4 A;  4NPR A;  5EYX A;  4MGZ E;  4Q2F A;  2VZR A;  1FMD 3;  1PNF A;  1FX5 A;  5HCB A;  5HCA A;  2P4E A;  4MGS A;  3Q8B A;  4YG6 A;  3FJS A;  1U5X A;  1UOF A;  3WR0 A;  2ZEX A;  3C7E A;  2X8K A;  3HNY M;  1ZRR A;  2VNO A;  4RR3 C;  4UFK A;  2V5D A;  3RJ2 X;  3WW1 A;  1H8T A;  1C8M 3;  5C6C A;  5F7U A;  3VBU C;  2ADE A;  4UAP A;  4KWK A;  2HH9 A;  1AR9 2;  2RVA A;  4YZ2 A;  5A1L A;  1IPS A;  4UFI A;  3MYX A;  4AQT A;  5FK8 A;  1RJ7 A;  5EHD A;  2XQX A;  1PZ9 A;  3RI9 A;  2IZW A;  1HB4 A;  2TBV A;  3BU0 A;  2VG9 A;  3HD8 B;  4Y1Y A;  4EWA A;  1US3 A;  3PMS A;  4PT6 A;  4UW6 A;  5L19 A;  5AVA A;  2GC1 A;  4JV4 A;  2JD9 A;  3FLR A;  3AKR A;  3K4Z A;  3MGU A;  4IDZ A;  4NMI A;  4XYX A;  3GZT B;  5FZO B;  1GZT A;  4FOW A;  5KHK A;  5FYZ A;  1YHF A;  1Q5O A;  4CDW C;  4QKN A;  2GH8 A;  1YJK A;  4OMC A;  2V72 A;  1NYW A;  3MV0 1;  1E57 A;  4ATF A;  1B35 C;  3A7Q A;  4ES9 A;  3W21 A;  1AX1 A;  4UOJ A;  5KXC A;  1NZI A;  3UKV A;  2RS1 1;  2WWU A;  4BQY A;  1GZW A;  4QM9 A;  1W2T A;  4GKX A;  1J59 A;  1AYM 2;  4LOS A;  5FZO A;  3S6P A;  2XG3 A;  1V9U 3;  2ZGM A;  2H0V A;  3HVD A;  4HK9 A;  3ABZ A;  2W1U A;  5FYI A;  3VHR A;  1JYW A;  4EN7 B;  1FPN 2;  1REE A;  1OD3 A;  1NG0 A;  1KS5 A;  1RUO A;  1YYN A;  1RUF 3;  1EV1 2;  3AMH A;  1HRI 3;  2G9G A;  2GME A;  2DVF A;  2ZHM A;  3B9I A;  4KMQ A;  5DAP A;  5KWR A;  1JZ8 A;  3N9O A;  2NP0 A;  1VAL A;  5F6L B;  3I2I A;  1BBT 1;  2A1X A;  3R4D B;  4A7K A;  4K1Z A;  1J84 A;  2ETE A;  2GAL A;  4KBB A;  3RZK A;  4Y5Z 0;  2AZ5 A;  2FZ2 A;  1AR8 3;  1ZA4 A;  2R07 3;  4ZU5 A;  2VZS A;  4QKF A;  3IZO A;  2VM9 A;  3I97 A;  3AX4 A;  3ILR A;  1XSR A;  1FAT A;  5T5L A;  4LNV A;  1UIJ A;  1EPW A;  3WW3 A;  3ZYH A;  2XML A;  2WO1 A;  4L2N A;  1EUU A;  3CL1 A;  2IXH A;  1SDD B;  3SH3 A;  1W9W A;  2TEP A;  3QAC A;  2WS9 2;  2PYT A;  4XF9 A;  4XIO A;  2PFW A;  4Q4W 3;  4S2D A;  5FMO S;  2KM2 A;  3U78 A;  4CDU B;  1IGO A;  4CDX B;  5EWS A;  1UN1 A;  5KBF A;  1LGN A;  3FN9 A;  3R6S A;  1K3I A;  1HRV 2;  2MEV 3;  3IAQ A;  3LIG A;  5F2W A;  4AWD A;  4NHX A;  2O8O A;  3AYC A;  4IXL A;  1VMF A;  1UKR A;  1RXG A;  2PLV 1;  3VBH C;  4YFW A;  4XUT A;  4AVB A;  1EY2 A;  1T2X A;  2P17 A;  2VAU A;  3PVB B;  1QKQ A;  4WVV A;  3VBS C;  2CSG A;  4B1L A;  1IKQ A;  5F9T A;  3BTZ A;  2YMZ A;  3VKO A;  4CDX A;  2ZHK A;  3M3I A;  3N9N A;  4OI2 A;  3CF6 E;  4LT5 A;  1BEV 2;  1O4T A;  4Q29 A;  3POS A;  4FTE A;  2Y6G A;  4EN9 B;  3T2T A;  1H9W A;  3U4S A;  2NQY A;  3KVA A;  4QX0 A;  4UF0 B;  4PI2 A;  2RJL A;  1AXK A;  4GMP 3;  4UYB A;  3EMR A;  3AYE A;  2HWD 3;  4RGA A;  2WYS A;  1BVP 1;  1PO2 1;  2XON A;  2JWP A;  4BJ0 A;  1XQN A;  4F7Z A;  5CAZ A;  2LAL A;  5FRE A;  1GOG A;  4IV3 B;  5JLV A;  5DN2 A;  4BK5 A;  3QLQ A;  5LB6 A;  1W0N A;  1O5U A;  4I02 A;  4ZXK A;  2DBN A;  2XLG A;  2F4L A;  2NMN A;  1W0P A;  3T4V A;  2ZGL A;  4UF0 A;  1SCR A;  1RUC 2;  3RRD A;  3RZM A;  4XTM A;  4K8F A;  2VY0 A;  2WAA A;  1FOD 2;  2BGO A;  4BA6 A;  3GBG A;  4EV0 A;  4R9A A;  4A44 A;  2UUR A;  1QWR A;  2UWA A;  1M4W A;  3ZPY A;  5A33 B;  1PM7 A;  3I54 A;  5FYM A;  2BUK A;  4IV3 A;  1OXC A;  4PLO A;  4HKO A;  2YG0 A;  4Z8B A;  3VD9 A;  4OVE A;  4LOT A;  3B00 A;  4XDO A;  5C3P A;  3E5X A;  5JZG B;  2NLR A;  2VCB A;  3THC A;  1SEF A;  2P2K A;  1VP6 A;  3E5U A;  3M3E A;  3MIE A;  1YJL A;  2OT7 A;  4TWT A;  1AJO A;  4M3C F;  5FP3 A;  3SXW A;  1R08 1;  2HWC 2;  4Z92 B;  4I01 A;  4R9B A;  4XZU G;  1RUD 2;  3KS7 A;  3I2H A;  4CU9 A;  1CAW B;  1AXY A;  1NLS A;  2WFF 3;  2VQT A;  2XHN A;  3DXT A;  4LKS A;  5E8A A;  3VBO B;  1VE0 A;  2ZGT A;  2BP6 A;  1IQD C;  2D6K A;  2ZGP A;  5ACA 2;  5ABJ B;  4GD4 A;  4LIU A;  3KHB A;  2WNU B;  4COV A;  4DXZ A;  3ZYF A;  5C3S A;  1S4C A;  2WL1 A;  3FFQ A;  4NHM A;  4QXB A;  1B09 A;  3FMG A;  3IAP A;  1X33 A;  1WCU A;  3N35 A;  3VBO A;  2ET7 A;  5EIY B;  4CDU C;  2R04 2;  3RYP A;  3VL8 A;  5ABJ A;  1QJY 1;  2J1A A;  2WJS A;  3OGS A;  4XTP A;  4LO4 B;  4QB1 A;  3J9S A;  4AHW A;  5LA1 A;  3TEW A;  2WNU A;  3CDZ B;  3FHI B;  5F5Q A;  3ZIX A;  3BTY A;  2EF6 A;  1A6C A;  4XUO A;  2OZ6 A;  2VQA A;  3KD4 A;  4JHZ A;  4LBQ B;  3RGB A;  4C90 A;  2UYB A;  4N8M A;  2YZ4 A;  5A32 A;  2MPF A;  3KT4 A;  4HG6 B;  1GFF 2;  5IVF A;  2WNE A;  1CJP A;  1OBN A;  1VIW B;  3B7M A;  1OI6 A;  2HWB 1;  3M4F A;  4HMZ A;  1CAV B;  3ROU A;  1ULG A;  3K48 A;  1W8Z A;  4XET A;  2TUN A;  2PHD A;  1J3Q A;  4QX3 A;  3TAY A;  1RGS A;  2I07 B;  1C8N A;  1OFS A;  3ETP A;  1OD5 A;  2DVD A;  2GMM A;  1QJF A;  4IL7 A;  3AZV A;  3KCC A;  3T4H B;  4CUC A;  2XBO 2;  4CUB A;  3ZXL A;  4AFC A;  2R6Q A;  3FFZ A;  3HQX A;  2D43 A;  3OGR A;  4HLT A;  4IV3 C;  4P9Y A;  5C5U A;  2Y26 A;  4Z82 A;  2EIB A;  1GQH A;  4ZKT B;  3AZY A;  2JKX A;  3WNP A;  1RIN A;  3T30 A;  2WNV B;  1ZZ7 A;  4AE2 A;  2ZOE B;  1ASJ 1;  1BK0 A;  1G86 A;  5IAT A;  4XHB A;  3IN9 A;  5GM0 A;  1GBG A;  1DG6 A;  1U12 A;  1HKD A;  2EXH A;  1LGB A;  3MW3 A;  4FQ4 A;  1CZT A;  2J1E A;  3HNB M;  2VOW A;  4S2H A;  5DUV A;  3TOJ A;  1BMV 1;  1W9Y A;  3POG A;  3A0K A;  4FP2 A;  1ODM A;  2JEC A;  2R16 A;  4D7Y A;  5I8Y A;  1O3S A;  4OHX A;  1I5P A;  4XXA A;  5JZG C;  1QJU 3;  4H14 A;  4EQV A;  1KDK A;  1LHO A;  2VVD A;  2WNV A;  4UFH A;  2A5Z A;  1R09 3;  3POJ A;  1VPH A;  2ZHN A;  1VBC 3;  4AVT A;  4ISR A;  4AAX A;  1CWP A;  3AKQ A;  3AZW A;  3LA2 A;  2JDU A;  4JDN A;  1QOS A;  3V65 A;  3BIW E;  4BCU A;  2HWE 3;  4AI1 A;  1RUJ 1;  2DYC A;  4IET A;  2IC1 A;  2Y8K A;  2B39 A;  4AHY A;  1NA1 A;  5ABJ C;  5J48 A;  1SLI A;  3IDB B;  5LBF A;  3PUH A;  2WNU C;  3PUA A;  3WF2 A;  3Q8C A;  3WDX A;  3LSD A;  3AFK A;  3EO6 A;  1D0H A;  2A7A A;  2BW8 A;  2NZ9 A;  5LEJ A;  4ZU4 A;  4C8D A;  1GP5 A;  4TSV A;  5LA9 A;  2RR1 3;  2OVU A;  2CWM A;  5FUP A;  5JI7 A;  3K4D A;  4WM7 C;  3POI A;  4XFF A;  2ZTN A;  1S55 A;  4YW6 A;  5BXX A;  1O4Z A;  1VMJ A;  2E6V A;  2WZE A;  3LOB A;  4FPG A;  5EV7 A;  4FPE A;  4Y1U A;  3LEK A;  4GJY A;  1VBB 3;  3LOI A;  4KWJ A;  1PVC 2;  4QDR A;  5C8W A;  2VOT A;  4QB2 A;  5LK7 B;  1LOG A;  2XVG A;  3PU8 A;  4O9E A;  5E6H A;  5JPN B;  2X53 S;  2YHJ A;  2XDV A;  1WD4 A;  1JZ7 A;  3J26 N;  3K75 B;  1AR9 1;  3JQW A;  1HXS 2;  3J7N A;  1QOT A;  3M70 A;  4V2V A;  3WF3 A;  4YGD A;  4G4F A;  3WUD A;  4Y26 A;  4BIF A;  1YO8 A;  4U36 A;  1ZZC A;  2R0F A;  2B45 X;  2QNK A;  1OPM A;  2V73 A;  4RHV 2;  1KDM A;  5DZF A;  4Q0P A;  4MG2 A;  1AUY A;  3ZDV A;  3TN9 2;  1TVG A;  2BWC A;  2QBX A;  5IAV A;  2ZAH A;  4QU2 A;  1W2U A;  1LOB A;  3FE5 A;  3RMX A;  4YZ4 A;  4PDW B;  2GN7 A;  4KG0 A;  1LOA A;  1ZBE 2;  4UW5 A;  5EJ1 B;  5KXD A;  2X29 A;  4AAP A;  2WNV C;  5K4L A;  1DIW A;  3NVC A;  3F95 A;  5FY1 A;  4OYU A;  3WDW A;  1O3R A;  1SCS A;  4M3C E;  1W6N B;  3MFA A;  3LB9 A;  2Z79 A;  3AMN A;  4MH0 E;  3VLB B;  2BPA 2;  1AYM 1;  4Y20 B;  3VBF A;  2DDU A;  4AFM A;  4PDW A;  4PQ9 A;  3C7G A;  1S0F A;  1RUH 2;  2W68 A;  3OYW B;  4XMI A;  3ZR5 A;  1AHS A;  5IK8 A;  3OCP A;  2WT0 A;  3ZN4 A;  4HVQ A;  3UJQ A;  3TEY A;  1SLA A;  3VB9 A;  2IFR A;  4HAN A;  4LBQ D;  1OOP A;  2C5D A;  1RMU 3;  1GLH A;  4DOU A;  4Y20 A;  1IQA A;  3TYJ A;  2VBP A;  3OBA A;  4GH4 A;  5IVY A;  2QKD A;  3O1O A;  3WQ1 A;  5FDB A;  4DEQ A;  3OTF A;  4IEV A;  2DU0 A;  3OYW A;  1WLT A;  3MV1 1;  1N3Q A;  5HXV A;  2JDK A;  4LR4 A;  3OEA A;  1LOE A;  4E9K A;  3POE A;  3GBW A;  3MPP G;  3P6B A;  1Q3E A;  2QQM A;  4NAM A;  5EQU A;  4HKL A;  1RJ8 A;  4ARY A;  1K12 A;  1MPX A;  1UZ0 A;  3P5B A;  1POV 0;  1XU2 A;  1H30 A;  5JSP A;  2RS1 2;  4GXL A;  1DQ5 A;  3C8X A;  2B42 B;  2UU8 A;  4P5H A;  2BZD A;  4OI0 A;  4A45 A;  4MXW B;  3C7O A;  5C71 A;  1LEC A;  3JBG 2;  2J1S A;  3RYR A;  4A2U A;  5CG9 A;  1RUI 3;  1WD3 A;  1G8W A;  4QQO A;  1RXF A;  3CBN A;  5FP7 A;  1C1F A;  1EUT A;  3I2K A;  3MHZ A;  5IVV A;  3OUJ A;  4BLI A;  1LR5 A;  1VBA 2;  4DUW A;  1VAM A;  2B46 X;  4MGI E;  1QQP 3;  4OUL A;  3ZX7 A;  1MS1 A;  1D4M 3;  4B7K A;  4Q1P A;  2Y38 A;  5LZ6 A;  1YEW A;  2JEM A;  1BEV 1;  5F3I A;  2ARB A;  1NXD 1;  1ZBA 1;  4FQZ A;  4LIV A;  1POV 3;  2H6B A;  2RV9 A;  4LTA A;  1PIV 3;  2ZHL A;  3RWK X;  3WQ0 A;  1W03 A;  3VHP A;  1JYX A;  1UPS A;  2HEV F;  5DXD A;  3PVO A;  2FDF A;  2JDM A;  4NHL A;  4Q26 A;  1HQL A;  4S2G A;  4P9X A;  5CAD A;  2Y0I A;  2OQ7 A;  2W92 A;  3AP9 A;  1QXJ A;  4YW4 A;  1XSQ A;  3SCH A;  1BK1 A;  1GQG A;  4KU7 A;  5HCH A;  4CXX A;  1HV1 A;  1OH3 A;  4D6S A;  1GWK A;  4AGV A;  4L8Q A;  4AFA A;  5CIR A;  1CD3 G;  1RUC 1;  1S0J A;  3ENR A;  5FPU A;  1ZRD A;  3FZ3 A;  1SFN A;  3GGL A;  3PIJ A;  5DPN A;  1URX A;  5DZE A;  3OBR A;  5JSO A;  2VZ3 A;  2D6M A;  1LOD A;  3D0S A;  4H3W A;  2Y6J A;  4IGP A;  4LBO A;  3GNE A;  4RYD A;  3H3Z A;  2Q8C A;  3VKN A;  3RVH A;  5JXH A;  3V0B B;  3N7M A;  3PDQ A;  1MZF A;  4JGZ C;  3EB7 A;  1XYO A;  2VOX A;  3AJZ A;  3NNF A;  4QHZ A;  4P14 A;  2JIC A;  2ZMK A;  2JDZ A;  4BK4 A;  4TYS A;  4CCE A;  3ZVX A;  5FZ0 A;  5KHI A;  3ZXE A;  3O1R A;  3AZZ A;  1HV0 A;  1KEX A;  4QPY A;  4CUG A;  2XWB B;  5KC5 A;  2WA3 A;  5FZD A;  1RUD 1;  3AVR A;  3CNA A;  4LHN A;  3ZFF C;  5I93 A;  3V0B A;  1EP0 A;  1OVS A;  4BXF A;  4HOO A;  4OI1 A;  1MQT C;  4DQA A;  2ZAA A;  4Q4X 1;  3PL0 A;  4LK6 A;  3BN6 A;  4MGQ A;  1RVF 1;  1CON A;  1F31 A;  2QTW B;  1H2K A;  2DCZ A;  1IPJ A;  1PO2 2;  1R1A 1;  1IKP A;  5CFD A;  4CXY A;  3BVC A;  1VR3 A;  3OY8 B;  3SLI A;  2VZT A;  3B9C A;  4FPC A;  1V6J A;  3NAP B;  4OUE A;  1FMD 1;  1UZZ A;  4XFA A;  4XQ4 A;  5A7Q A;  1LTE A;  3QH7 A;  2WA4 A;  3NMB A;  4FCA A;  1UOG A;  1AR6 2;  3VDB A;  1AL2 2;  1XYN A;  2W9X A;  4XQW A;  3D5O A;  2VU9 A;  4F83 A;  2XVK A;  5JMC A;  5FPZ A;  1DDL A;  5G04 L;  4EJR A;  3SKV A;  3E5Q A;  3OY8 A;  4FT8 A;  1U0A A;  3WW2 A;  3AMQ A;  4V2W A;  3NAP A;  4BQX A;  1J3R A;  2LRO A;  4YM3 A;  5FUI A;  1BKZ A;  4N53 C;  4XF4 A;  1OHF A;  1OA3 A;  1YUD A;  2E53 A;  5F6K A;  1MR5 A;  1ULP A;  1KFU L;  2YRO A;  4FVV A;  3I49 A;  4LO7 A;  3W9A A;  2IFW A;  5A7S A;  1Y7B A;  3N9P A;  3WW4 A;  2OXB A;  1STM A;  4ZPI A;  1GQP A;  1CZS A;  2IXJ A;  3ACH A;  1RC6 A;  3AL6 A;  4Q0V A;  1UZW A;  4FPF A;  4HSJ A;  5A3T A;  3SQO A;  1QNY A;  2D6O X;  3DN7 A;  1JUI A;  5FP4 A;  3USU A;  4YVW A;  4ZY9 A;  3NJX A;  5AFE A;  1H8V A;  2ILM A;  3V56 A;  1SBD A;  5FPX A;  1CPN A;  4P00 B;  3WV6 A;  2Z4F A;  1GP4 A;  2ZCW A;  3MEP A;  3MLL A;  5A3U A;  3WG3 A;  3DPR A;  5FYU A;  3ZXJ A;  4DMI A;  1LED A;  1UMZ A;  3OBT A;  2XR4 A;  1V9U 1;  3SEP A;  4URT A;  1N1T A;  1ZRC A;  3M8L A;  4EN0 A;  4ASM B;  5ANN A;  3H3L A;  1W04 A;  2QUO A;  4IEX A;  2X05 A;  3WNX A;  3H1W A;  4OHV A;  1QJY 2;  5BNO B;  1J1T A;  1NXM A;  3HQR A;  3OD0 A;  3R0R A;  1GWL A;  5C5T A;  1G9A A;  2BTV C;  1GV9 A;  1TZO A;  4FSJ A;  1RL3 A;  1FPN 3;  5LAS A;  3A22 A;  1WLD A;  3I3Q A;  5DDJ 3;  1UZV A;  2QQP A;  4N7I A;  1SMV A;  3D0J A;  4GWI A;  5LBE A;  1EV1 3;  3VBR C;  3T0A A;  4RA0 A;  4Y1X A;  1FNY A;  4IEW A;  2ZS6 B;  5FY8 A;  2VNR A;  1DGR N;  4KGQ A;  2HWB 2;  1G6N A;  3K46 A;  4WVW A;  3POF A;  4GUL A;  5BNO A;  3ZYI B;  3H1M A;  1D2S A;  3QOP A;  3TWI A;  2VE1 A;  5IWF A;  3N7J A;  5HV4 A;  5JMO A;  1ZZ9 A;  4E4Z A;  5B4N A;  1TME 2;  3ZKY A;  2JJ6 A;  5L9R A;  1JZ2 A;  4Q4V 1;  3CMG A;  4LUM A;  4Q4Y 3;  1H1M A;  2PAE A;  3GJA A;  2RM2 3;  3VBU A;  4ASL A;  1JH5 A;  5C9A B;  2ZGK A;  3K4A A;  3KB5 A;  4GWJ A;  2DUP A;  4ZON A;  4P08 A;  4CDW B;  1QDC A;  1SDW A;  4NIH A;  3RNS A;  1PO1 1;  2G9Z A;  4XF1 A;  5JAX A;  4UBH A;  3MW2 A;  4OLL A;  5FZ6 A;  1ASJ 2;  1F15 A;  4ASK A;  4E2Q A;  1HRV 3;  3I8T A;  1E5R A;  2FBE A;  4Z2A A;  2XQR A;  1KGY A;  4GWM A;  4R9C A;  1LB2 A;  1W6Q B;  3BB6 A;  4XE9 A;  2HWF 1;  4AHZ A;  1QNW A;  2Z69 A;  1ENR A;  1C5I A;  1QHD A;  2QQO A;  5CZK A;  4CZS A;  1RED A;  3R4S A;  4AEJ A;  1R64 A;  4CDW A;  4WM8 C;  5KR7 A;  3BPS A;  2VUD A;  3ZYJ B;  2QCS B;  5FZL A;  3ACL A;  3S0M A;  3U10 A;  3VD3 A;  1B35 A;  2XKP A;  4GMP 1;  4CCM A;  1NQD A;  2HWD 1;  2VUC A;  3WNO A;  1GZ9 A;  2VQU A;  5FZF A;  3HN1 A;  3O1T A;  3H8X A;  3JD7 3;  1GNH A;  1LOC A;  1QJX 1;  1W8O A;  2FCU A;  3GM8 A;  2X09 A;  4FPK A;  1JOJ A;  1NX9 A;  1H6X A;  2WT2 A;  5A3W A;  1NOV A;  4LXL A;  3DF0 A;  2QQV A;  3W5M A;  1DYP A;  2C9K A;  4JDO A;  5JWP A;  1J3P A;  2ZEZ A;  4RHV 1;  5DQ0 A;  4S2F A;  1PMH X;  1UL9 A;  2E32 A;  2XVL A;  4PLN A;  2BNO A;  3VZN A;  4XCB A;  4FAH A;  4I2O A;  3H3U A;  2XJT A;  2J42 A;  3FBM A;  2DUO A;  4X6R B;  2ZKN A;  3GF6 A;  2YFU A;  1HQN A;  4HVR A;  5FZ7 A;  5C33 A;  4LHL A;  3N7K A;  2JG9 C;  1UYY A;  2ZGQ A;  1VBE 3;  3FWE A;  2BOI A;  5FXV A;  5T5O A;  1EYB A;  1ZBE 1;  4MHR A;  4BWO A;  3HWJ A;  1RUE 3;  3MIC A;  3HQU A;  4YZ3 A;  3W58 A;  2DUQ A;  3DL3 A;  1S1A A;  4ZZ8 A;  4ISQ A;  3U1X A;  1K45 A;  5BNO C;  4AL9 A;  1YFX A;  2EXI A;  5BV6 A;  1DZT A;  1AJK A;  1OQE A;  1BZW A;  1QU0 A;  2G19 A;  2JDN A;  1H1I A;  2WFF 1;  2X5I C;  4XFH A;  5SV8 A;  5A3N A;  3J8F 3;  3T2Q A;  3VBH B;  1SFP A;  2HWC 3;  2J1U A;  1RUH 1;  3HR9 A;  2PTM A;  1JYT A;  3PJQ A;  4RN5 A;  3VBS B;  2DFC A;  4Y5T A;  1GNZ A;  4Z1V A;  5LEK A;  1K5J A;  4QM8 A;  2HYK A;  4ERO A;  3LEI A;  3NNJ A;  3H8O A;  3VHN A;  1G7Y A;  1OA2 A;  3AL5 A;  3SH5 A;  4LHS A;  3WG2 A;  2ZPX A;  1G9F A;  3NW4 A;  1WMD A;  4WBB A;  3I3E A;  5JR7 B;  5ACA 3;  3BPZ A;  4M4P A;  3DYM A;  4MO3 M;  3VBH A;  1ND3 C;  4QDS A;  5IT6 A;  3A23 A;  1W8N A;  2VNV A;  1SZB A;  2EXK A;  5FQ0 B;  3VBS A;  1W8H A;  3OEB A;  4OQ8 A;  1ZRE A;  1ZNP A;  5C9A C;  4XMA A;  1HN1 A;  5LA2 A;  1RYY A;  2MHF A;  1W8F A;  3P3N A;  5FV3 A;  2UYA A;  5FOJ B;  2VCM A;  5K9Y A;  3E1F 1;  4HET A;  1LEN A;  5FP8 A;  4B29 A;  5IHR A;  5J7M A;  5FPL A;  1I1E A;  2XJS A;  4MZU A;  1YIF A;  3ACG A;  3H50 A;  5FZB A;  3N4M A;  2RE9 A;  5HV0 A;  3AMM A;  1SBE A;  4XIK A;  2ZEW A;  2D7F A;  3PUI A;  3GBF A;  1Z0H A;  1WMF A;  2YBK A;  3JBG 1;  4IEZ A;  1BQP A;  4KH9 A;  1C57 A;  4XJU A;  4Y1Z A;  1COV 1;  5KHH A;  1YQ5 A;  3P3P A;  2QQJ A;  3P1I A;  3GAL A;  1VBA 1;  4LO5 B;  2XJU A;  2RDR A;  4QX2 A;  5FKB A;  2JE7 A;  2FCV A;  4OCT A;  5ERL A;  3ACF A;  4DXR A;  3BOD A;  2A6X A;  5FYB A;  1OKO A;  4ZU7 A;  5EXO A;  4CSW A;  2Z5W A;  2XJV A;  5DAB A;  5F5A A;  4B8E A;  1JZ6 A;  3IMN A;  4SBV A;  2KA3 A;  1IS6 A;  2RS5 3;  1ALY A;  1N1Y A;  4OZX A;  3WDU A;  1CX4 A;  4XFG A;  2XBO 3;  5FRA A;  2VL4 A;  5DUW A;  2QQL A;  1MEC 3;  2F6B A;  3C7F A;  5FZ3 A;  4YGE A;  2EID A;  2TNF A;  3RQ0 A;  1V70 A;  1UYZ A;  2ZMN A;  4C0H A;  3WIN E;  3H9A A;  4AQ6 A;  3DEM A;  3ZSE A;  4XAA A;  3NQH A;  1O59 A;  4XUN A;  2VXR A;  2WYF A;  1W99 A;  1ZYB A;  2ZKL A;  1PZ8 A;  2I2S A;  4I0W B;  4PIY A;  2YC2 A;  4MGK E;  5FLI A;  1HB1 A;  3THD A;  1DGL A;  1NCR B;  1ACC A;  1Y3T A;  1OUS A;  1TMF 2;  1FV3 A;  4OFG A;  2PAK A;  2YGM A;  4COU A;  2RS3 3;  3ZKU A;  5LCW L;  1R09 1;  3NV3 A;  1VB4 A;  1Q43 A;  4YPJ A;  5IK5 A;  4TN7 A;  3H1Y A;  2ID4 A;  5AC9 3;  4WV8 A;  4K8R B;  4C1W A;  1XBF A;  1S0G A;  2WSV A;  2XGX A;  3AXE A;  2A70 A;  3O14 A;  4FP3 A;  2ET1 A;  1OLR A;  4JVA A;  4QT6 A;  3WP4 A;  1BCX A;  1NCR A;  5HCF A;  2FDH A;  4CDU A;  1CES A;  2GH2 A;  2YFZ A;  1DZQ A;  1JHN A;  2D98 A;  3OGG A;  4JZR A;  1EAH 3;  1W6M B;  1ZBA 2;  4EZH A;  5FMB A;  4BH9 A;  1YQ2 A;  1JU4 A;  1CAU B;  4E8C A;  2Y64 A;  3H7Y A;  2ORX A;  3A4U A;  5D8A B;  4NJ4 A;  3VD4 A;  3PVE A;  5A7P A;  4XFB A;  1FT9 A;  3IDC B;  3Q8F A;  3BYW A;  4DXT A;  5A6Z A;  3LIH A;  4J1W A;  3I3M A;  3SHR A;  5CIS A;  1JU3 A;  3FL7 A;  3E6B A;  2D5H A;  1W6M A;  3MLK A;  1MS4 A;  4GJZ A;  1XE0 A;  1CAU A;  3N9L A;  4Z07 A;  2D3S A;  2E9Q A;  1MS9 A;  4GQ7 A;  5D8A A;  3FC0 A;  3USS A;  4XHX A;  1AR6 1;  2EAK A;  4W65 A;  1AL2 1;  1VBD 3;  2L9L A;  5BPX A;  1PVC 3;  4ARX A;  4HFS A;  4GB3 1;  3KCX A;  3ZYG A;  4NHY A;  2VVE A;  4KL1 A;  2F17 A;  1UU6 A;  4BME A;  4D6R A;  4CDQ C;  5AFB A;  2VW0 A;  1QIQ A;  3N9M A;  2RDN A;  4ZXE A;  3MPB A;  2QVS B;  3H0O A;  3NJZ A;  1X9T A;  4CTE A;  1HXS 3;  1P8J A;  1W2N A;  1Z7S 1;  2WQ8 A;  2E7T A;  3MI8 A;  4FOV A;  4P02 B;  3PLQ A;  2E7A A;  1JOD A;  3ITQ A;  5CFC B;  4XCA A;  1PGL 2;  3M3C A;  3D82 A;  5A33 A;  1HX6 A;  4DEV A;  3OUH A;  3U07 A;  2CAU A;  3ZOI A;  3TN9 3;  4Q4X 2;  1OQD A;  4AVA A;  2GNT A;  1RVF 2;  5SV5 A;  2ERF A;  1AXZ A;  1R1A 2;  4YLZ A;  5C8C B;  5JZG A;  4F8A A;  3RZL A;  3WLU A;  3GCX A;  1NY7 1;  1XPW A;  1TG7 A;  1FMD 2;  2W46 A;  1L7R A;  2DCK A;  2EAL A;  4IEY A;  3B94 A;  4XFC A;  1SBF A;  3Q9O A;  4Y1V A;  3ZYP A;  2VZU A;  2XUM A;  1CAW A;  4NRQ A;  3T3Y A;  1CAX B;  5L9B A;  1NCR C;  4WM7 B;  4HVO A;  3LZZ A;  1C8M 2;  1A78 A;  4OMD A;  3KCY A;  1AYN 3;  1JMU B;  5C8C A;  5FZ9 A;  3BIE A;  3T0D A;  5H9R A;  4DFS A;  1OLM A;  2R06 1;  1WCD J;  1RMU 1;  1ULE A;  3BOP A;  2QDN A;  4CA9 A;  5JIU A;  5DG2 A;  1GR3 A;  3G7D A;  1JOB A;  2A71 A;  1LUL A;  4D3W A;  5FMD A;  2YXS A;  1CAX A;  4AQS A;  3ZLI A;  4WM7 A;  5F1R A;  4WVM B;  2GC0 A;  4JTO A;  1V0A A;  4PF5 A;  3O1S A;  3O1V A;  1ULF A;  3WP6 A;  2JB8 A;  3ZSJ A;  2ZJC A;  2WQ4 A;  3M3O A;  2BEO A;  4LKF A;  4X6Q B;  4YVS B;  3WX5 A;  2XLF A;  1GYK A;  2PHW A;  1OC1 A;  1OLQ A;  2ORZ A;  2D3P A;  5D8A C;  1TME 1;  2D93 A;  1LHU A;  3NRU A;  4LBQ A;  4XJ8 A;  4GIQ A;  2A6Y A;  4BDV B;  1Q8O A;  4E2S A;  4W8J A;  4L0P A;  1XNC A;  5BNP C;  1CAV A;  1V9U 2;  1W2A X;  2RS1 3;  3ZXD A;  3OOX A;  2D6N A;  4CPB D;  2PHX A;  4YVS A;  3RPQ A;  1WMX A;  1JYI A;  4EWD A;  2BYV E;  3IPV B;  1NLR A;  3EXU A;  5JVV A;  1KJL A;  2E33 A;  5FZG A;  1MVQ A;  3PIG A;  4E8D A;  3HPN A;  4EWE A;  1RUF 2;  3K51 A;  3MF6 A;  1GNY A;  3I7D A;  2W94 A;  2Y6K A;  1NE6 A;  4ITC A;  2XOM A;  2YU1 A;  4PJY A;  3D6E A;  4H7M A;  5FWE A;  5FOB B;  3WP3 A;  1PIV 1;  5FY5 A;  5FZ1 A;  1REF A;  5FZ8 A;  4HBN A;  2IVI B;  1QY4 A;  3F2Z A;  1DFQ A;  1QDO A;  5L7O B;  4V1P A;  3IPV A;  1RHI 3;  1UW8 A;  3I3B A;  4JKK A;  5GKA C;  1PX4 A;  1BBT 3;  1Q56 A;  2JB4 A;  3VZM A;  5A70 A;  5CFC C;  1VRH 3;  2H6C A;  4FI9 A;  4FXK B;  4JRL A;  1NCQ C;  1SAC A;  1NLQ A;  1QXR A;  1UMH A;  2Y60 A;  4OI4 A;  4YW5 A;  3ST7 A;  2W87 A;  4Q4W 2;  4CCN A;  2CWS A;  3ON7 A;  4Q4V 2;  1W8U A;  4N43 B;  3U75 A;  3X29 B;  4A6O A;  4C0B A;  5C8C C;  3JB4 C;  1MS5 A;  5L7O A;  2CV6 A;  4BB3 A;  1SLC A;  3AKP A;  2D6P A;  5CEH A;  2MEV 2;  1UY0 A;  3ZIW A;  2W47 A;  3WVJ A;  1PO1 2;  4O7X A;  2J1V A;  5A1F A;  3JXS A;  4Q0U A;  1FYU A;  3FHA A;  2OPK A;  2BBV A;  2YU2 A;  4LUK A;  4B4Q A;  3EYP A;  5JCT A;  4XXP A;  3WG4 A;  1SHW B;  2HWF 2;  2PLV 3;  3RJR A;  3OF1 A;  1UXX X;  3I2J A;  1YFY A;  2HYX A;  3FUO A;  2YC4 A;  4HPK B;  4MYE A;  3GYD A;  4A3Z A;  3WUC A;  4N90 A;  4N9I A;  2HWD 2;  1H2L A;  1CQ9 A;  1HB2 A;  1NE4 A;  1YI7 A;  3WXP A;  1QJX 2;  1C28 A;  1V6M A;  4NWV A;  4BOW A;  1NZC A;  5FZ4 A;  5L73 A;  3O1M A;  3WF4 A;  4LBK A;  1W06 A;  2MNG A;  5DMY A;  4RQP C;  4AZZ A;  4YVS C;  3GZE A;  2WZR 3;  1R1Z A;  3QH6 A;  1WW6 A;  2WIN B;  3C7H A;  3POW A;  4Y3O A;  4CCJ A;  4HPK A;  4I09 A;  4YZ5 A;  2D3R A;  4K21 A;  3PUQ A;  3VDD B;  2DUR A;  4JAA A;  4DXS A;  4XBN A;  3PJY A;  3ZN6 B;  3A21 A;  2ARA A;  3IDE A;  5JXG A;  1PGW 2;  1ZZB A;  2VUJ A;  4P9L A;  2PN5 A;  5FWJ A;  4Q8K A;  3ETQ A;  3LEG A;  3LF7 A;  1K42 A;  5H9P A;  2W1W A;  3K3N A;  4LE3 A;  3NST A;  3SIS A;  5CVR A;  1ZRI A;  2BNM A;  3ELN A;  1ZZ8 A;  2ZX0 A;  3LD8 A;  3NJY A;  5F8P A;  4G3Y C;  4HSL A;  4R4Z A;  5C70 A;  1WW5 A;  3LDB A;  4RFT 0;  4AI0 A;  4AI9 A;  2C4X A;  1QJE A;  3B93 A;  3TNQ A;  4YM0 A;  3BU7 A;  4DIN B;  3FX3 A;  1MS8 A;  1U5Y A;  2WFF 2;  4JGZ B;  2WZP P;  3WEZ A;  3WOG A;  1R08 3;  1X50 A;  5L7O C;  1WBL A;  2FHR A;  3VZJ A;  5FY9 A;  4D6Q A;  3O5S A;  2ZZQ A;  2VMD A;  4QGL A;  3SMH A;  3WF0 A;  2RMU 1;  5IK7 A;  5GLU A;  1W6N A;  3ZFF B;  1VAV A;  4CP9 B;  1QEX A;  4QGM A;  4X8N A;  4AVS A;  4CE8 A;  4QPW A;  4JGZ A;  1MQT B;  1XNK A;  3ILF A;  2RDS A;  2IVJ A;  1UY4 A;  5CU1 A;  3EQE A;  2OYZ A;  2FDK A;  4CU8 A;  3LA7 A;  4N43 C;  1IS5 A;  1DYK A;  1UIK A;  3DCQ A;  4LHK A;  3SCG A;  3MUZ 1;  5I0T A;  2JX9 A;  3OPZ A;  4XAE A;  2AEN A;  3KGL A;  1OF4 A;  4XUQ A;  5LBC A;  3III A;  4MUV A;  4W6Y A;  4UI9 L;  3ZFF A;  4QD2 A;  3BTX A;  3KM5 A;  3OJB A;  2LTN A;  4YNI A;  5DDJ 1;  1OKQ A;  2BNN A;  2XWJ B;  4I0B A;  4YG3 A;  3TEX A;  1AL0 G;  1QJY 3;  3LQC A;  3B01 A;  4UW3 A;  1MQT A;  5LWB A;  3CQO A;  3UES A;  5J36 A;  4OUS A;  3DYP A;  2AYH A;  2BV4 A;  2C9A A; 
#chains in the Genus database with same CATH homology
 1JYW A;  3A22 A;  2WBK A;  1OD3 A;  4GWI A;  4KMQ A;  2QQK A;  2VJX A;  2KD7 A;  3T0A A;  1H6Y A;  2BER A;  1JZ8 A;  3VD7 A;  2CDO A;  3K46 A;  3I2I A;  4M4R A;  1J84 A;  5JMO A;  5B4N A;  2VZS A;  2VM9 A;  3I97 A;  1JYN A;  1JZ2 A;  2EIC A;  3UNP A;  2VMC A;  3CMG A;  2WO1 A;  1EUU A;  1SDD B;  1W9W A;  3K4A A;  4GWJ A;  4P08 A;  1DYO A;  1OT5 A;  2WO3 A;  2VMF A;  3D3A A;  5IYY A;  3FN9 A;  1K3I A;  4XUR A;  4Z2A A;  5LA0 A;  1KGY A;  3IAQ A;  4PQQ A;  5CZK A;  3AC0 A;  2QQO A;  4XUT A;  2PQS A;  1R64 A;  1T2X A;  1UYX A;  2B4K A;  3VD3 A;  1O8S A;  3WNO A;  2Y6G A;  2VQU A;  2Y6L A;  3WNL A;  3GM8 A;  1W8O A;  4QX0 A;  2LW8 A;  2X09 A;  1NX9 A;  1H6X A;  2WYS A;  5IFT A;  3W5M A;  2C9K A;  2VCA A;  2XON A;  4BJ0 A;  1JI6 A;  2W91 A;  3NJV A;  1GOG A;  2ZEZ A;  5DQ0 A;  1PMH X;  2E32 A;  5DN2 A;  3WNN A;  4BK5 A;  4QB6 A;  1W0N A;  1GOF A;  2YFU A;  3CIH A;  4JKL A;  1DP0 A;  1UYY A;  2WAA A;  5HPO A;  2RJ2 A;  2BGO A;  2WZ8 A;  4A44 A;  2VME A;  4TXW A;  4QX1 A;  4ZZ8 A;  1K45 A;  2YG0 A;  3SKJ E;  3VD9 A;  2VC9 A;  3MUY 1;  2VCB A;  3BGA A;  3THC A;  2WDB A;  1CX1 A;  5A1A A;  3T2Q A;  2J1U A;  4XZU G;  3I2H A;  4RN5 A;  1JHJ A;  4CU9 A;  2VQT A;  2XHN A;  3LEI A;  4LKS A;  4LHS A;  4D8M A;  5JXI A;  3I3E A;  1IQD C;  2W5F A;  3I3D A;  2W1Q A;  1NKG A;  1UY1 A;  4M4P A;  3DYM A;  4MO3 M;  1UWW A;  2X10 A;  2QQI A;  4QDS A;  5JR2 A;  3A23 A;  1W8N A;  4A42 A;  5JUV A;  1DLC A;  3OEB A;  3IAP A;  1HN1 A;  5LA2 A;  1RYY A;  5EIY B;  3E1F 1;  5IHR A;  2W95 A;  4MAD A;  5HXM A;  3ACG A;  3OGS A;  2J1A A;  5LA1 A;  1L7Q A;  4QB1 A;  3DEC A;  3T2P A;  3CDZ B;  3T09 A;  2ZEW A;  4XUO A;  4JHZ A;  3PUI A;  3IDA A;  4HG6 B;  4ET7 A;  1GMM A;  2QQJ A;  3P1I A;  1PMJ X;  1SG3 A;  1UX7 A;  4QX2 A;  3ZM8 A;  3ACF A;  4DXR A;  4QX3 A;  1JZ6 A;  4CVU A;  3CZJ A;  4DUV A;  3ETP A;  5JXJ A;  3I2G A;  4CUC A;  4XUP A;  4CUB A;  2VL4 A;  2QQL A;  3C7F A;  2EID A;  2HLE A;  1UYZ A;  2VO5 A;  3OGR A;  5EJZ B;  1XC6 A;  3U37 A;  5IFP A;  3GXU A;  2EIB A;  1O59 A;  3NQH A;  4XUN A;  1W99 A;  2JKX A;  3WNP A;  2YC2 A;  4TTG A;  3THD A;  4A4A A;  3VD5 A;  1CZT A;  2J1E A;  3HEI A;  3HNB M;  5LCW L;  2J1T A;  4W4Z A;  3J7H A;  4YPJ A;  3FHQ A;  5IJR A;  2ID4 A;  1I5P A;  5B4X A;  1UMI A;  4AAX A;  2VZ1 A;  3W5N A;  2YFZ A;  2VZQ A;  1F4H A;  1YQ2 A;  1JU4 A;  4E8C A;  2Y64 A;  2Y8K A;  2ORX A;  2LS6 A;  3VD4 A;  3PUH A;  3HN3 A;  3WF2 A;  3VDC A;  4DXT A;  2WUH A;  2R7E B;  1JU3 A;  4W50 A;  3FL7 A;  3SEE A;  2J1R A;  3K4D A;  1OH4 A;  3ACI A;  2E31 A;  2WZE A;  2EIE A;  2L9L A;  3LEK A;  2WAB A;  4QDR A;  4ARX A;  1LNS A;  2VZP A;  2VOT A;  3DYO A;  2VZO A;  4QB2 A;  1CZV A;  4BXS V;  2W1S A;  4ZXE A;  1JYV A;  4CU6 A;  1JZ7 A;  3HJR A;  3K75 B;  1P8J A;  2WQ8 A;  5I0D A;  3WNK A;  4P02 B;  3WF3 A;  4KI5 M;  4DEV A;  4JX0 A;  2E26 A;  1TVG A;  3T2O A;  3VDA A;  2QBX A;  3IB3 A;  3LPG A;  4KWU A;  4QDQ A;  5G05 L;  1BHG A;  3HNM A;  1XPW A;  1TG7 A;  2W46 A;  1L7R A;  1W9S A;  2CDP A;  2DCK A;  4JKM A;  2YB7 A;  5EJ1 B;  2VZU A;  1O8P A;  2ZXQ A;  3GDB A;  4OYU A;  1XNA A;  3K77 A;  4OMD A;  2DDU A;  3T0D A;  3C7G A;  4OZO A;  3MO4 A;  2QQN A;  1UY3 A;  3OBA A;  2WN3 A;  2OKX A;  3T0B A;  4CUA A;  4DEQ A;  2ORZ A;  3MV1 1;  3NRU A;  3OEA A;  1NAE A;  1WKY A;  3P6B A;  3OGV A;  2QQM A;  4BDV B;  4W8J A;  1CIY A;  4L0P A;  4ARY A;  1K12 A;  2W3J A;  1MPX A;  4P5Y A;  1UZ0 A;  3LPF A;  2WN2 A;  3C8X A;  3CZU A;  2BZD A;  4A45 A;  1XNT A;  3C7O A;  5C71 A;  4DUX A;  5CYY A;  2J1S A;  1GOH A;  2E33 A;  4AG4 A;  4E8D A;  3HPN A;  1EUT A;  3I2K A;  1GNY A;  4LQR A;  2W94 A;  3UET A;  2Y6K A;  1US2 A;  3LE0 A;  4DUW A;  1W9T A;  2XOM A;  2V4V A;  2J7M A;  2C26 A;  1UY2 A;  4IUG A;  3F2Z A;  2J22 A;  3I3B A;  4JKK A;  3WQB A;  1PX4 A;  4MOA A;  2WO2 A;  2DCJ A;  2RV9 A;  1D7P M;  1JYX A;  4FI9 A;  1NUK A;  1UMH A;  3ECQ A;  4D0Q A;  2ZEY A;  2W92 A;  1UXZ A;  2W87 A;  1OF3 A;  2VZV A;  4LPL A;  4A6O A;  3OB8 A;  2Y6H A;  1UY0 A;  2W47 A;  2J1V A;  3JXS A;  3GGL A;  5DPN A;  2VZ3 A;  3FHA A;  2Y6J A;  4RYD A;  5JXH A;  3EYP A;  1J83 A;  1SHW B;  3EB7 A;  3NNG A;  1UXX X;  3I2J A;  4A41 A;  4XVH A;  4BK4 A;  2HYX A;  2JE8 A;  2YC4 A;  1GUI A;  4A3Z A;  1KEX A;  4ZZ5 A;  4QAW A;  1JZ3 A;  3HOB A;  3WNM A;  4GZ9 A;  3OG2 A;  4CU7 A;  3WF4 A;  2VCC A;  1GU3 A;  1WCQ A;  1F4A A;  1JZ5 A;  5DMY A;  3BN6 A;  4MGQ A;  3MBW A;  3C7H A;  1JZ4 A;  4DXS A;  2VZT A;  3A21 A;  4OUE A;  5JXG A;  3LEG A;  3CKH A;  1K42 A;  1ULO A;  2VZR A;  2W1W A;  3VDB A;  2W9X A;  4MGS A;  5G04 L;  3SKV A;  2BBA A;  2ZEX A;  3C7E A;  5C70 A;  2JDA A;  3HNY M;  5FUI A;  2V5D A;  2C4X A;  5F7U A;  2VR4 A;  4UAP A;  2RVA A;  3WEZ A;  1ULP A;  1PX3 A;  3I2F A;  2XQX A;  1GQP A;  1CZS A;  3ACH A;  1US3 A;  4PT6 A;  2VMD A;  3WF0 A;  2B9V A;  4ZY9 A;  3NJX A;  2JD9 A;  3K4Z A;  4P00 B;  4QPW A;  2Z4F A;  5J1X A;  1UY4 A;  4OMC A;  4CU8 A;  2V72 A;  3MV0 1;  3WSO A;  3A7Q A;  4UOJ A;  3WF1 A;  3MUZ 1;  3SEP A;  4PF1 A;  5C7G A;  4XUQ A;  1OF4 A;  3III A;  3T08 A;  4UI9 L;  2X05 A;  3LQC A;  2VTF A;  3CQO A;  3UES A;  3ABZ A;  3DYP A;  2W1U A;  2WAO A;  2BGP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...