2WZ8A

Family 35 carbohydrate binding module from clostridium thermocellum
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
142
structure length
135
Chain Sequence
b'TINVYEAEDPANTLGGAAVRQRDNAASGGQYVGWIGNGSNNYLQFNNVYVPQAGTYRMVVQFANAEVFNVVDRYCSISVNGGPEKGHYFFNTRGWNTYRTDIIDVYLNAGNNTIRFYNGTSGSYAPNIDKIAIAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CELLULOSOME PROTEIN DOCKERIN TYPE I
publication title Signature Active Site Architectures Illuminate the Molecular Basis for Ligand Specificity in Family 35 Carbohydrate Binding Module .
pubmed doi rcsb
source organism Clostridium thermocellum
molecule tags Sugar binding protein
total genus 32
structure length 135
sequence length 142
ec nomenclature
pdb deposition date 2009-11-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2wz8A00
2WN3A 4ZXEA 1JZ5A 3F2ZA 4XUOA 2VMFA 4XZUG 1ULPA 3I2GA 4E8DA 2W9XA 4A42A 4AAXA 4LKSA 3J7HA 4KMQA 2QQNA 3DYPA 4AG4A 2DDUA 4UOJA 3I2HA 1W9WA 3WEZA 1CZTA 2Y8KA 3I3BA 1NAEA 5DN2A 5J1XA 4GWJA 3IIIA 4CU7A 2VO5A 3A23A 1UMHA 1NX9A 3C7HA 3K75B 2VJXA 1UMIA 4CUAA 2VZOA 5JMOA 1JZ2A 3HEIA 1K42A 5LCWL 3NJXA 1W99A 4DUXA 3K46A 5JUVA 1UXZA 1YQ2A 1GUIA 1UWWA 3LEGA 1UY1A 5JR2A 3ABZA 2WABA 3WNKA 2VZVA 5A1AA 3BN6A 3WNLA 1KGYA 3ECQA 5LA2A 1O8PA 4OYUA 3OGVA 1CZSA 4PQQA 4BK4A 3D3AA 3SKJE 4JKMA 4QPWA 3CDZB 1GU3A 4DXTA 4L0PA 3T09A 4CU8A 4LQRA 1P8JA 3VDBA 1EUTA 2J1UA 2KD7A 1GQPA 5EIYB 2YG0A 1CZVA 3CZUA 4QAWA 2W1WA 1GOGA 2HYXA 3I97A 3DYMA 3NNGA 2VZ1A 4MOAA 5B4XA 5IFPA 2Y64A 1TG7A 3CMGA 3MO4A 3VD5A 3WNPA 2WAOA 4XUNA 2B9VA 3OGRA 1JYXA 1PMJX 3CKHA 4Z2AA 3VD9A 3HOBA 1O8SA 4LHSA 3LPGA 2VZRA 2W1QA 1UY0A 5IYYA 1T2XA 1JYVA 1JU4A 1W9TA 2ZEXA 2ID4A 2VCAA 3LEIA 2W87A 2QQOA 4P08A 1EUUA 5IJRA 2X09A 2VMCA 1JU3A 4CU9A 4ET7A 1ULOA 2QQKA 4TXWA 1K3IA 3K4AA 5I0DA 4BXSV 3K4ZA 2W1SA 3UETA 4A41A 3WF1A 1CX1A 4CVUA 4UI9L 3LE0A 3DYOA 1DLCA 2VZ3A 5JXGA 2Y6KA 3HNMA 2R7EB 5LA0A 1MPXA 3MUZ1 5C70A 4GZ9A 3WNMA 3GM8A 2J1EA 2J1VA 3HNYM 4M4PA 3UNPA 2YFUA 1OD3A 2CDOA 2W94A 4QX0A 3IAPA 2VZPA 4QX2A 3I2IA 1DP0A 2ZEZA 3WSOA 2VM9A 3JXSA 5G04L 4RN5A 3OEAA 1JYNA 2L9LA 3VD4A 2EIBA 4MGSA 2WZEA 2ZXQA 3UESA 5FUIA 2Y6LA 4ARYA 2ZEWA 2LS6A 1GOFA 3DECA 1SG3A 2J1RA 4W8JA 4DEVA 4D8MA 4XVHA 2XOMA 2RJ2A 2YC2A 2Z4FA 4QB6A 2WZ8A 2RVAA 1PX3A 4A3ZA 4LPLA 2VQUA 4W50A 3C7EA 4P00B 1US3A 1UXXX 4JKKA 2PQSA 1GOHA 4BJ0A 2VMEA 3T0BA 1OT5A 1RYYA 3T08A 4FI9A 3I2FA 1W8NA 1W8OA 2V4VA 1JHJA 3EB7A 3SKVA 3T2OA 3K77A 2J22A 2QQMA 2VZSA 3ZM8A 3CIHA 3OEBA 3VDCA 2WYSA 1GNYA 2OKXA 3OGSA 2VMDA 3NQHA 1JZ6A 3AC0A 3OBAA 1OH4A 2VC9A 1SDDB 3MBWA 3WNNA 4CU6A 2VL4A 1DYOA 3C8XA 3I3EA 2VR4A 2WBKA 4E8CA 4QB1A 4QX1A 3I2JA 2XQXA 2E32A 2J1TA 1NKGA 3BGAA 2ORXA 2W91A 4YPJA 2YFZA 2X10A 2V72A 1OF3A 2C9KA 3C7OA 4PF1A 3WF3A 5JXHA 2EIEA 5EJ1B 3A7QA 4JHZA 1L7RA 4DXRA 3ACHA 3SEPA 1H6YA 1W0NA 1H6XA 4QB2A 2WN2A 1L7QA 1F4AA 2QQLA 3ACGA 4JX0A 1D7PM 3P6BA 2E31A 2YB7A 2VZUA 3HJRA 5DQ0A 5HPOA 4TTGA 3MV11 5C7GA 4A45A 5B4NA 1PMHX 4GWIA 1UYZA 3EYPA 3ETPA 1US2A 3C7FA 2EIDA 2JE8A 4MADA 3CZJA 5C71A 2WAAA 5HXMA 2B4KA 2WUHA 3U37A 3WNOA 4M4RA 2BZDA 4A4AA 2X05A 3FHAA 1TVGA 4QDRA 3T2QA 4DXSA 2QBXA 1XNAA 1PX4A 2W92A 3IAQA 3GDBA 3HPNA 2WO3A 2VQTA 1JZ4A 2W1UA 2WO2A 3GXUA 2VZQA 2DCJA 1F4HA 1J84A 2Y6JA 4A6OA 3HNBM 4UAPA 1J83A 2DCKA 4QDQA 5LA1A 1JZ8A 4XUPA 2W5FA 4RYDA 2CDPA 1JI6A 3T0DA 1SHWB 2VOTA 3CQOA 1XC6A 2VZTA 2XONA 3W5MA 5JXJA 3NJVA 2WO1A 2LW8A 2J1AA 4QDSA 2QQIA 4XURA 4CUCA 3A21A 2Y6HA 4OMCA 4A44A 1BHGA 2XHNA 3THCA 4OUEA 2WDBA 3T2PA 4DUWA 2JKXA 3IB3A 2VCBA 1I5PA 3ACFA 2JDAA 1WKYA 1KEXA 3E1F1 3VD3A 5DMYA 3WQBA 4PT6A 5DPNA 1JZ7A 3HN3A 1XPWA 3OB8A 1XNTA 3I2KA 3I3DA 3WF0A 2Y6GA 4ZY9A 3WF2A 3WF4A 2W47A 1O59A 2C4XA 2BGOA 4XUTA 1JZ3A 1UY3A 3GGLA 3ACIA 5IHRA 4JKLA 4MO3M 4BDVB 3W5NA 4OZOA 3FN9A 1HN1A 5IFTA 4HG6B 5CYYA 4DEQA 5CZKA 3PUHA 1UX7A 3LPFA 4BK5A 2W46A 4DUVA 1W9SA 2VCCA 2W95A 1LNSA 1K45A 1OF4A 3LEKA 2E26A 2QQJA 2E33A 4IUGA 3T0AA 5G05L 4XUQA 1K12A 1UY2A 3VD7A 4OMDA 4P02B 2RV9A 1UY4A 2HLEA 1UYYA 2YC4A 1NUKA 3NRUA 5F7UA 4KI5M 2ZEYA 2C26A 2J1SA 1UYXA 2BBAA 2ORZA 2WQ8A 1IQDC 3SEEA 3VDAA 3C7GA 1GMMA 2BERA 1WCQA 4D0QA 3FL7A 3A22A 3MV01 2W3JA 3P1IA 2JD9A 4CUBA 3PUIA 4W4ZA 3IDAA 3THDA 5EJZB 4ZZ8A 5JXIA 4QX3A 2BGPA 4KWUA 4ZZ5A 1CIYA 2EICA 2VTFA 4MGQA 1JYWA 2V5DA 3OG2A 4P5YA 3FHQA 3LQCA 3K4DA 1R64A 1UZ0A 2J7MA 4ARXA 3MUY1
chains in the Genus database with same CATH superfamily
1QQP2 4LBMA 1DLLA 1LHOA 4PCRA 1MZFA 5HCHA 1RUE3 4XUOA 1OFSA 3H1MA 1VE0A 2VMFA 3LDKA 1MQTB 3M7AA 1ULPA 2CU5A 4BU2A 4OHZA 4QPGC 5C3SA 5T5OA 2VUDA 4AAXA 1G9FA 3B3QE 3KV5A 3AP9A 4LKSA 4P14A 3W9AA 3I2DA 1DQ0A 3N9QA 4KWKA 2QQNA 1D2QA 2NPIA 4YWAA 4AG4A 5DAVA 2Z5WA 4R9BA 1NLRA 1Q43A 4YW1A 4EN9B 3ZN5A 1AR71 4P5HA 2R49A 4FTBA 4CU7A 2VO5A 5A70A 3GF6A 1HXS3 1NX9A 3C7HA 2Q4SA 2P3YA 2BP6A 3K75B 2VJXA 2VQAA 5ANQA 4AEKA 4BE3A 4CUAA 2VZOA 3OD4A 2LALA 1W6QB 1FAYA 1WCSA 3X29B 1VBB1 3SH3A 1ODNA 3O1PA 1K42A 2PHLA 2Z42A 3VBUB 3SH5A 1CAWB 5FY5A 1UXZA 3ILFA 1YQ2A 4XJZA 1Q8SA 1DGWA 3LKJA 4RR3B 5L9BA 5A7WA 2WABA 2H6CA 3WNKA 1QOSA 2VZVA 1FV2A 5A33A 1JW6A 2F4LA 1OUXA 2Q8DA 4OI2A 2GNBA 3BN6A 1DZRA 4Q0SA 2Q5TA 1W0OA 1REEA 1RJ8A 4FPEA 1IS6A 2VVEA 1O8PA 3OUJA 4G9SB 2ES3A 4LHNA 5LRRA 2A3YA 4Q4X3 4QHZA 5FXZA 1AR62 5IVFA 4NAMA 3AZWA 3LFIA 1C5IA 3RZLA 1NCQB 1NQJA 1O7FA 1LOCA 4Q29A 3VZNA 1MEC1 2P6CA 3PNAA 3T09A 1S0IA 1DCSA 1VBA3 1Z7S3 2E9QA 2WQ4A 2J1UA 2KD7A 2WQZC 2YGMA 3WHUA 5FPXA 3AVSA 4A3XA 5EIYB 2YG0A 2EA7A 1CZVA 3CZUA 4FPFA 5E16A 1CQ9A 3FUOA 1K5JA 4LORA 5KHKA 4D6SA 3RYRA 3KQ4B 1H4HA 2VW1A 2JECA 2XB6C 2CNAA 4LE4A 1HJFA 2VZ1A 3WY6A 1QXJA 4AZZA 3LOBA 3AX4A 2Y0OA 2Y64A 1ND2B 1Q3EA 5BXXA 4XIOA 4Y4YA 1AXYA 4RS5C 2WAOA 3WNPA 1POQA 1UL9A 1YJLA 1VJ2A 4GKYA 4X8PA 3MFAA 1JYXA 1ZREA 1JH5A 2D40A 2ARCA 5IW0A 3ZPYA 4D6QA 2JDKA 1SLTA 3HOBA 4GWNA 4JAAA 3VD9A 2E7QA 1H9WA 2DUOA 3T1LA 2QTWB 2VZRA 3P3PA 4XBNA 2ZHLA 3I59A 2LROA 2W08A 2XBO3 4IL7A 2HWC1 4NMIA 5C8CC 5EJ3A 1RUF1 2F6BA 2JB8A 2VUCA 1FMD1 1YI9A 2IFWA 1W6NB 3GJBA 1ZZBA 1S2EA 2CSGA 1QJY1 3RJRA 3PMSA 1X8MA 2GC0A 4K40A 3JUUA 4Z07A 4A6SA 4AE2A 2W87A 4AOCA 1DQ6A 3DN7A 1LHWA 2QZ3A 4P08A 1EUUA 1UU4A 3KSCA 2X09A 5FP4A 4Y24A 1RB8G 1PVC1 3GCXA 1J58A 5FOJB 3KF3A 1B35A 3AYEA 5FO9B 3B7MA 2ZAAA 2ZX4A 2RS31 2QQKA 3C2UA 5I0DA 1UO9A 4KU8A 2ZGMA 3CL1A 3V56A 3ZYFA 2YPJA 4B1MA 1Q5OA 2IC1A 3GBWA 3IWZA 5FMOS 3K4ZA 1AR72 1A6CA 1QJU1 1ZRIA 1OOPC 2Y34A 3KV9A 4GULA 4BQ2A 1CX1A 3NJYA 4XMAA 5DDJ1 1W6OA 3LE0A 4HVOA 1V9U3 2AREA 4QT6A 4NIDA 4FSJA 3LIGA 4XHBA 4CCLA 1W03A 2VZ3A 4GB33 5CVRA 4UYBA 1D0HA 4AEMA 5FRAA 4EROA 1MZEA 4CA9A 4LO7A 4UT5A 1U5ZA 5LA9A 5I8YA 2YBSA 5C70A 2ET7A 3WV6A 3WNMA 3A0KA 1ALYA 1RHI1 1L7LA 1IQAA 1WA4A 1LGCA 3DF0A 4N7IA 3VN4A 2ZA9A 2YFUA 2RMU3 4FTSA 4AFAA 4IE4A 4N43A 5GZDA 4E4DX 2XJUA 4QX2A 5JOWA 2ZEZA 1HX6A 1RUI3 2VM9A 4FQZA 5G04L 1UD1A 1SLCA 4HVQA 4YW2A 2Y6FA 3OEAA 4X8NA 1XU2A 2L9LA 2BOJA 2O0OA 5AVAA 4LO8A 4NPLA 2O8QA 5GLZA 2BJSA 2XJTA 3ZMOA 4XJAA 3RZZA 1QH7A 3OPWA 2ARXA 4ARYA 2ZEWA 1TMF2 1GOFA 1MEC2 4LKDA 1ONAA 4AGVA 2QFEA 3PURA 3AZXA 4D69A 1KS5A 3DECA 4Q4Y1 1D4VB 1REFA 3KV4A 3OY8A 4CZSA 1R1A1 2J1RA 2WO7A 3QH6A 4DEVA 1PK6B 4W65A 4XVHA 4LLOA 4D8MA 1JOBA 1HJGA 2YC2A 2RR11 4LXLA 4EN8B 3TAYA 1PX3A 4XABA 3ZDSA 4H3WA 1G7YA 4W50A 4O61A 3ZSKA 3MGUA 3PVBB 1FPN3 4ISQA 4XILA 2X5IA 1ZRRA 1NA1A 1YFUA 4BPZA 4J25A 4RD7A 4JKKA 1WW4A 2K2SA 1HRI3 4NHYA 3RYKA 2A70A 3V0BB 1J1TA 4F8AA 1LESA 4V1PA 1OT5A 3RMXA 4LBKA 1OA2A 3IPVB 5LK7B 4WM7A 3QD6A 1CD3G 1W8NA 3DCQA 4WM8B 3TEZA 2NN8A 4CPBD 2OPWA 2HWC2 3FHIB 3HQXA 4ZU7A 2DTWA 5IUQA 1RUF2 4AEDA 1FMD2 3K77A 3IZOA 3ZKUA 1S0BA 2FMYA 1QJY2 3CIHA 1WW5A 3APBA 3NVCA 4IQPA 2WYSA 1GNYA 4LBLA 3VB9A 3OGSA 2VMDA 3RI9A 2ERFA 2CGNA 2IVJA 4TZDA 1RUG1 1OH4A 3MBWA 1SDDB 4MLOA 4CU6A 1DYOA 1PVC2 3ORJA 4KG8A 2I2SA 2ZMNA 1EV13 4QX7A 2RS32 4AK3A 1NKGA 1HV0A 3K3OA 2ORXA 2W91A 1CAXB 1LU1A 4IEOA 2PAMA 1HB1A 2JG8A 2OUHA 4B4PA 2X10A 3OF1A 3ATGA 3WW1A 2V72A 1QJZA 1QJU2 3ZR6A 3C7OA 5JDBA 3WF3A 2JIGA 1FT9A 5DDJ2 2VY0A 1L7RA 1OSGA 4LOSA 4Y22A 2R061 3IT8A 3SEPA 5BNOA 4CCNA 4AI9A 3RZKA 1H6YA 5FUPA 1C1LA 3KVAA 4XZPA 4XHXA 3USSA 5C4WC 1LGNA 2RS53 5KBFA 1OQEA 4CDXC 3ZFGA 4JGZB 1V6KA 1F15A 1PZ7A 1CPNA 4CCCA 2WZR3 5LASA 1ENRA 4JX0A 1O3RA 1QU0A 2B46X 4NJ4A 4QHOA 1BEV1 1ZVFA 2E31A 4OFGA 4NO4A 1RHI2 2ZX1A 3JBG1 5A32A 2HWE1 5K8SA 1NE6A 1H8TA 2VZUA 2YB7A 4FXGB 4NPRA 4SBVA 4R9AA 5FJKA 4M3CF 5JOYA 1GSLA 1RVF3 1QXPA 3TEWA 1WUVA 2IXCA 3MV11 1W06A 1YHFA 4I0BA 4A45A 1V6MA 2WLQA 3NV4A 4OUMA 1QJX1 2VOVA 1IG0A 1UYZA 2D98A 2JDZA 3OUIA 4JV4A 4Y1VA 4XF3A 4CDQC 1RUJ3 3C7FA 1EYBA 2HWB3 2WRAA 4H7LA 2BNNA 2DVDA 3AZVA 4LO4B 4DMIA 1CJPA 4MADA 1JYIA 1CVNA 3MEPA 3FE5A 4PLMA 2WAAA 1J3QA 2A6XA 3SXWA 3RI8A 4N8MA 5HXMA 4EYUA 2FHRA 5ABJA 1NLQA 2WUHA 4IEXA 5IVBA 1K5MC 4QKFA 1XE8A 2GAUA 1R1A2 2Y33A 1Q8VA 2Z69A 1TME1 4IV1C 4OCTA 4WBBA 1OUSA 3U78A 4CTEA 5GJ6A 3AMNA 1I6XA 2X05A 3AJZA 4LOTA 4ZPIA 4DS0A 3LAGA 1DZQA 1X7NA 2RR12 1AYM1 4KBBA 1EAH1 1XNAA 3G6JB 4IEPA 4K6BA 3GDBA 3B9IA 5K0UA 5JVVA 1IS3A 2WO3A 4UW6A 3ZIWA 2ZX0A 4IEWA 3DPRA 5H9QA 3FLPA 3LSEA 1JZ4A 3WDUA 1DZTA 2MPFA 3AP6A 3VBRC 2XQRA 2D93A 1YC61 3HN1A 1KITA 3HQUA 4XF4A 2DCJA 3BTYA 1S0GA 2G19A 1J84A 2OQ7A 5LEKA 1SLBA 1CONA 1J83A 4P9LA 3GCWA 2PLV3 3IN9A 4CEWA 3HAGA 5FYVA 3PVOA 4C0BA 3RZHA 4MXVA 5HCAA 1JZ8A 1XQNA 3CJIB 4QPIA 3EXUA 3NO8A 5A6QA 5JCTA 4PF5A 1YLLA 3T4VA 3LZZA 2VOTA 5BY5A 5CISA 5E88A 5F3CA 2IXJA 3OJBA 5DZGA 1REDA 5JXJA 3NJVA 3KD4A 3JD72 3WINE 5FO8B 2WO1A 4P9GA 5FLJA 5FYYA 1RUG2 2PQQA 2QQIA 4XQ4A 4ES9A 5J3UA 3RZMA 1OKQA 3RJ2X 1WMFA 5FK8A 1VRH1 5DAPA 5FV3A 1QNYA 5FCCA 3ZYPA 2PAKA 1VBC3 4OUEA 3MIGA 3UK9A 2B8MA 3KB5A 2ZABA 4IESA 2PHFA 1F2NA 4CEYA 1Y3TA 3HBKA 4U36A 2LM3A 3AMHA 4HL0A 3DXUA 3R6SA 4B4RA 4K1ZA 3AMQA 1AHSA 1XRUA 4CCJA 3IB3A 2FDIA 3VHPA 4KWJA 2VVFA 3ACFA 2B42B 3BTXA 3Q8AA 2JDAA 1RUH3 1D4M1 2VD7A 2XLAA 2Q8EA 5K7PA 4QGNA 1WMDA 2ZOEB 2BOIA 3E1F1 1SMVA 4EN0A 4OHXA 3TBDA 1W6MB 4YG3A 5I8SA 5C9AC 1JODA 1H8TC 1SACA 4RS5B 1BEV2 1JYCA 1ZNPA 1GLHA 2GH2A 2WA4A 2XL7A 4YG6A 2B5HA 1MR5A 3SCFA 3JBG2 1ZZ7A 3AKSA 4GD4A 2HWE2 4HMZA 4XDQA 1C57A 3WG1A 1ULEA 3LD8A 4AGRA 3PUAA 3H7JA 2RM21 1CJDA 3WCRA 1CWPA 4XUTA 3MICA 1CR7A 3JQXA 5C8CB 2DUPA 3VZOA 1QJX2 2WWUA 1RUD1 4Q8LA 3ZFEA 4LJHA 4BQ1A 4JKLA 1H2NA 3ZVXA 3W5NA 1VBE1 5FZKA 4FPHA 5HI0A 3FN9A 1E5IA 3O1OA 5IFTA 1APNA 3RG0A 3VBSC 3OYWB 4XQWA 1TNRA 3WDXA 3V65A 3ZXEA 3S57A 1S0EA 2VBPA 3KCCA 1ASJ2 4CDWA 2XJQA 4CRQA 5A7PA 2WNVC 4UWDA 2VCCA 2GMMA 4AHXA 5DUUA 3H0OA 3S6PA 1KDKA 1TME2 3RNSA 2ZAHA 1L3JA 1HRV3 2NM1A 5CFDB 2GSYA 5K0UC 3AXEA 3U14A 1OOPB 4IUGA 1F35A 3POFA 1AYM2 3DPRC 1EAH2 3WR0A 2RJKA 3WD5A 3AYCA 3U10A 1K12A 1UY2A 2NMNA 5EPAA 5FDBA 1ENQA 2VGDA 1RUC1 2G4IA 1XYOA 2HLEA 4XJ8A 4QKBA 3NV2A 1OURA 4XJ9A 2BW8A 2ZEYA 2R042 4HK8A 2J1SA 5CB7A 4CDUC 2ORZA 5A7WB 4XDPA 3H8RA 3VDAA 3TN93 1JMUB 5GKAC 2AENA 2C9AA 4GALA 4IE5A 4NN0A 4QQPA 4M3CE 1GKBA 4EJRA 1UYPA 4CSWA 5AFBA 3MPBA 4CP1A 2VTXA 1WCQA 5L9RA 4RA0A 4D0QA 1PGSA 4DRRA 3MV01 4BQXA 3O1MA 1VRBA 5KXBA 2MHFA 4S2GA 2VQ0A 2CHHA 4ZKTB 5F2WA 5E89A 3R05A 5EJZB 3VBHC 4ZZ8A 4LULA 4QX3A 5DABA 3IDBB 4TSVA 1CGPA 4JQTA 2WSUA 5JWPA 1VRH2 4AVCA 3ZXGA 4CEYC 1JYWA 5F6KA 4XE9A 1R64A 1UZ0A 3QACA 4CCDA 1ZRCA 2DVGA 4M0NA 4A7YA 2EXJA 1JZ5A 2GMEA 1F31A 2P3JA 3EO6A 3EHKA 4HPKB 5BNNC 3F2ZA 4IV3C 1RXFA 5F39A 3BODA 4Q0QA 3DKQA 3ES4A 5CFCA 3I2GA 1KXGA 1VBD1 1LRHA 1MZ5A 3J7HA 4INDA 5FPVA 1SEFA 4JGYC 4YVWA 1IS5A 4DXZA 3ZFFA 5GLTA 4Z92B 1RL3A 1UU6A 3DYPA 1QXRA 2DDUA 5I93A 3I49A 4COVA 3LDRA 3WEZA 1CZTA 2Y8KA 2DVFA 3U75A 3VZKA 3I59B 2Y26A 3ST7A 1NAEA 1WMEA 5DN2A 1A3KA 4RFT0 3IIIA 4UFKA 2DCZA 3O1RA 2RM22 2OW4A 4F7ZA 1GNZA 3PL0A 1YWKA 5D8AC 1BJQA 1RUD2 3PUQA 1OQDA 1UMIA 5T54A 4DOUA 4KL1A 4CP9A 1VBE2 1ZBA1 5H9PA 4E4HA 1ZRFA 3AYAA 3VBFA 2IFRA 2DTYA 2PHXA 2YBPA 1BYHA 1W99A 3NJXA 3WP5A 1GZWA 3K46A 5JUVA 5FO7B 1Q8QA 1NCRA 4ORFA 1W90A 2JG9B 1PMIA 2P5BA 2VOKA 5FYUA 3H8XA 1W0PA 4MGYE 5HV4A 2K9ZA 5IVJA 2FD8A 5IK5A 1LJ7A 1BXHA 1O4YA 1FOD3 3NAPB 1AR82 3NKGA 1KGYA 4R52A 1JTZX 2HKXA 2R071 3ILRA 1UW8A 1ND3A 4Q4V2 3USUA 3WDYA 3VBOA 4XF0A 1UIKA 2DCTA 2W68A 4XDOA 1CAUA 4FFHA 5GLUA 5KHHA 3OGVA 1LCLA 1QQP3 4Q1PA 3ZDVA 1CZSA 2BFUL 4PQQA 4BK4A 2WFF1 4D6RA 4Y20B 4JKMA 4CYDA 5C4WB 3CDZB 1GU3A 4NRQA 4CDXB 4EN6B 1AUYA 4O7XA 2QQWA 3UYJA 4XAAA 3QBQA 1QKQA 1QH6A 2AR6A 4HZFA 3AZZA 5FKCA 2DUQA 4I09A 2DVAA 3EMRA 1VPHA 3WQ0A 1RMU2 1PIV2 2XWJB 2RHPA 2BU9A 5FZCA 5L73A 2ZBJA 4E9KA 5B4XA 4L2NA 4FAGA 2VMHA 2DYCA 3CMGA 3LA7A 4IEUA 4LK7A 4RGGA 4XJWA 4QQ2A 2XVKA 4CDQB 2RS11 3BIEA 4XUNA 2XJRA 3OGRA 4FFGA 2XHKA 2WS91 3MIBA 3CBNA 5JIAA 1O8SA 1UPIA 2ZGLA 3POGA 4GJZA 2IWGB 4K8RB 3Q8CA 1WW7A 2FCVA 3U1XA 3B9CA 4QU1A 4Z82A 1N1SA 2VAUA 3KVBA 2PMWB 2OX0A 5CG9A 1OQ1A 1JU4A 1QEXA 1W9TA 5LWBA 2HEWF 4H2AA 1K5MB 2BGCA 2ZEXA 1LGBA 1RIRA 5CFCC 1C4RA 1YQ8A 1FYUA 2SBAA 4IV1B 1UQXA 3LEIA 4OLLA 1NT0A 4C1XA 1Q8PA 3S7EA 2JDYA 2R0HA 2OZ6A 1JOPA 2V09A 2W52A 4HONA 5IJRA 2QJVA 1SCRA 1DQ1A 1R091 1ZBE1 3WG4A 4CU9A 3AB0A 4HSLA 1ULGA 3VBRB 2Q8OA 4TXWA 1K3IA 2JE7A 3BI3A 4O9GA 5FK7A 1SCSA 4BA6A 1YFXA 4FP2A 3ON7A 3LOIA 4RHV1 4JVAA 4Q4W1 3WF1A 1YCIA 3OBZA 2OIIA 4UI9L 2SLIA 2ZHNA 3SH4A 2OPKA 2VXRA 4V2VA 1DLCA 2YZ4A 5JXGA 1FXZA 1NG0A 5KC6A 3SLIA 1KFUL 2RDSA 3Q9OA 2OS2A 1ZBA2 2Y6KA 5EXOA 3KHBA 3ZN6A 4L11A 4GH4C 4S2DA 2WIIB 2NMOA 1RUNA 2VU9A 2J1EA 2JE9A 2I07B 4HETA 5BNPC 2DFCA 3R4SA 4HOOA 1AL22 1UPSA 3UJOA 2CDOA 4XFHA 4XQDA 3VDDA 2BPA2 4QX0A 3IAPA 3K48A 4LHLA 3HT2A 2UYBA 1DP0A 4BWOA 1ND3C 3MF9A 3HVDA 4KWLA 1DGWX 1S2KA 4YLZA 5H9SA 4J1WA 3DUIA 4DY5A 1LR5A 2R072 1JOJA 2IUWA 1OVSA 1O6UA 1HXS1 2BNMA 5AFEA 2VTXJ 2A7AA 2EIBA 4AR2A 4NUBA 4MG2A 3I3MA 2WZEA 3Q8EA 3ZLIA 3THTA 2G9FA 2WFF2 2Y6LA 2LS6A 1O3QA 1SPPB 4K7JA 2YGLA 2R32A 5FY1A 2HH9A 4Q26A 5J37A 2E7AA 3AK0A 1W6PA 3M3OA 5C9AB 1SG3A 3OGGA 2TEPA 1A78A 3FFQA 4YZ1A 5A1LA 3AKQA 4MXWA 1WLTA 1BBT1 2RJ2A 2D5FA 4EN7B 2Z4FA 2VNVA 4QGLA 2Z2SB 5JSRA 3N7LA 4RGKA 5GZEA 1BK1A 4NOTA 2E53A 2UYAA 1IKQA 5F5IA 5KHGA 1ZYBA 4W6XA 5FBJA 1KRIA 3UGGA 1UXXX 3QLQA 2GALA 4HVRA 4LBQA 5A7SA 1GOHA 2RS12 3AP7A 4AFBA 1XSRA 4BJ0A 2EF6A 1DYPA 1UIJA 2WS92 5DZEA 4URAA 3BB6A 1DU3D 3T0BA 3T08A 2Q0AA 3VBSB 2D43A 4ZHNA 4FI9A 5CG8A 5JZGA 4KH9A 3KCYA 1UKRA 4QQLA 3WHTA 1VBB3 2V4VA 3EB7A 1Z7S1 1TMF1 3SKVA 3I4IA 4LUKA 2WNVB 3JQWA 3LWCA 5FAXA 5FPZA 5FY0A 1Z78A 2J22A 5FZOB 4LLFA 3NNMA 2Z79A 3OBTA 5FYSA 2VZSA 3MLJA 3ZPOA 4C91A 4DO0A 5KR7A 3VDCA 1UOBA 2JIJA 4Y33A 3IDCB 4ATFA 2A6YA 3DPRB 4NWVA 3NQHA 2A75A 2WA3A 1COV2 3WNNA 2VL4A 3I3EA 1U0AA 4Q2FA 1R092 1ZBE2 2WBKA 4E8CA 1GP6A 1QNWA 2MEV1 1DGRN 3LGRA 1VR3A 4QB1A 2A3WA 2R1BA 1OC1A 1OKOA 2A1XA 2J42A 4Y26A 4YPJA 2C1FA 4JCKA 4RHV2 5CKMA 2KXLA 4Q4W2 4QM9A 5JXHA 5EJ1B 1MEC3 2FBEA 5IK8A 3LA2A 4CDUB 5FOBB 4I3PA 3ACHA 4LBJA 1Y43B 2A6ZA 2YMZA 3UKNA 2HEYF 2WT2A 1QGLA 1SBFA 3KCXA 3CO2A 4L9BA 4XFFA 5BYNA 5I0UA 5T55A 1RUE2 1H4GA 3MYXA 4QB2A 4BOWA 4LTAA 1ENXA 1NOVA 2HWF1 4UBGA 4OQ9A 1LODA 2QQLA 3ACGA 5FQ0B 3N9PA 1XOYA 1JUHA 1MS4A 2XJPA 5A3OA 2YHJA 3K51A 1WLWA 3VBHB 5DAQA 4ZS3A 3HJRA 2E6VA 5DQ0A 5KHJA 5HPOA 2VECA 3M3CA 1WD3A 4RSUA 2WYFA 2ATFA 4TTGA 3ZYJB 2EVXA 1UAIA 4N9HA 3KS7A 1W2OA 1PO21 3NMBA 4OVEA 5FZDA 4DZGA 5FZ3A 4ES8A 3ZSEA 4UFIA 5EFUA 1GICA 5L9VA 4W6YA 5BNNB 5D1IA 1HXS2 3ETPA 1AL0G 2ZGRA 4IV3B 4LHKA 4M3CA 1DBNA 3F95A 1RUF3 2EIDA 3H9AA 4BIFA 1YXWA 3LSDA 5L7OA 1GP4A 1V70A 1AR93 2KM2A 2JE8A 3CZJA 2VVDA 4UF0A 2B4KA 4FPGA 2XJSA 1BKZA 3DXTA 4JGYB 1QOOA 2YPDA 5JIUA 2P2KA 1E5HA 1S55A 4EWAA 5J48A 4I2OA 3SMHA 5F6LB 3Q8FA 4L99A 4AEJA 5LB6A 4AYUA 1IKPA 1PVC3 3GZTB 3ZOIA 2BZDA 2JD4A 2GMPA 3FHAA 1WA6X 4WZFA 1BBT2 4Y1UA 2RS33 4URTA 3T2QA 5C3OA 2QBXA 4LIUA 1W2AX 2W92A 1PNFA 1QMJA 2AH2A 3HR9A 3IAQA 4QXKA 3W58A 1I5ZA 1M4WA 3HPNA 1LKNA 1YEWA 1QJU3 2VNGA 2W0XA 3CU7A 2TBVA 4JTOA 5D8AB 5DDJ3 4AF9A 2D6OX 2W1UA 2D6PA 3MIFA 2VZQA 4YM1A 4AVAA 1F4HA 3I7DA 4B8EA 3OD0A 1TZOA 2ZCWA 4PIZA 4KU7A 3E6CC 4D94A 4V2WA 5A3PA 2A6WA 2DCYA 3H3LA 2C24A 3QOPA 3PMEA 1G9DA 4RQPA 1Z7S2 4RYDA 3MI8A 2RG4A 1Y7BA 1JI6A 3B01A 1GWMA 4GWMA 2BFUS 3BYWA 4HANA 4PI2A 4QHBA 5AVPA 2OYZA 1XC6A 3BPSA 4RFRB 3O1VA 2QQUA 4AAPA 2FDFA 5FP9A 1VAVA 3M70A 3MLLA 4QDSA 2VNOA 4Q8KA 4XURA 4XCAA 5C3QA 1W39A 4XBLA 2MEV2 5IAXA 4YW5A 2JENA 2XHNA 3W21A 4COWA 3L2YA 4LK6A 1YJKA 4J1XA 3T2PA 4DUWA 2ZKLA 1LHVA 5FYTA 4Q4Y3 1LEDA 3POYA 2UWAA 3RZJA 3HD8B 1H8VA 1I5PA 1DIWA 2JX9A 3KF5A 3MW2A 4GIQA 3T30A 1B09A 1WKYA 3RVHA 2HWF2 1KEXA 3VD3A 1VMHA 3ROUA 4P9IA 2JDNA 4WVVA 2XVGA 5HBAA 2PHRA 3JD71 3U07A 3HN3A 1B35C 3MLKA 3OB8A 3I3DA 1C1FA 3ZSMA 2ENRA 3WF0A 1A34A 4ZY9A 3B00A 3V0AB 3WF2A 1O59A 2YDEA 2C4XA 2ZZJA 5T5LA 3HWJA 3IM0A 2GH8A 2Q30A 2N7GA 1UY3A 1HW5A 1PO22 2XLGA 4ONUA 4XFBA 3O0WA 3POWA 1J1LA 5F37A 5C5TA 1V9U2 1R081 4AWDA 4AFMA 5L7OC 1H2MA 4OZOA 3B69A 1V6OA 4GB32 1TNFA 3FFZA 3N4MA 5CYYA 3BIWE 5LY2A 4PLNA 5CZKA 3ZXKA 1QJFA 4BIOA 3PUHA 1ST8A 1GZCA 4AQSA 4EZ4A 1UX7A 2WZR1 4BK5A 2DURA 3UGHA 1MQTA 4DUVA 1X8EA 1LOFA 1RUG3 1LNSA 2W95A 1OF4A 5CAZA 4IE7A 4Z8BA 2E33A 2ZZQA 1AX0A 2R1DA 1N3PA 2ZGNA 5JR7B 4GMP1 4N43C 4OULA 1YI7A 4GXLA 3URFA 4YFZA 3O5SA 4XOGA 2R16A 5F32A 3OUHA 1RUI2 5FPLA 2ZX2A 4PDWA 4CCEA 1HV1A 1UN1A 3U11A 1XXNA 1H1IA 3VD7A 2VMIA 4OMDA 1RUJ1 1PNGA 2R063 4NIHA 2HWB1 3NRUA 5F7UA 1LENA 4GH4B 1GWKA 4YZ3A 4RQPC 4AFCA 4QPGB 3O7OA 1UNBA 3TB0A 5BNPB 1PO13 1W6QA 3H3UA 3C7GA 5LBBA 1ASJ1 2JKBA 1BEV3 3VBUA 2H0BA 2CYFA 2CL2A 1BK0A 3JBG3 1CAWA 2HWE3 1ND3B 2WJSA 1W3XA 1SLIA 3M3EA 3FL7A 4L97A 2YXSA 1IS4A 4YVSA 5IVEA 3P1IA 1LHUA 4RR3A 4PI0A 3PUIA 1V6IA 1KQRA 4W4ZA 3MW3A 1FPN2 3IDAA 2GN3A 2VBBA 4FVVA 3THDA 2X5IC 1QJX3 2ZGPA 1NA1C 4JC1A 3T2TA 4ZZ5A 1N3QA 1F8VA 2EICA 3M8LA 3E5UA 2A5ZA 3M1HA 1G8WA 1I1EA 4LNVA 4ARXA 4MSVA 3BKZA 1MS8A 3P3NA 1PM7A 2QUOA 4HKLA 2HYKA 2WN3A 2CAUA 4QX5A 4WM7C 4K20A 4ZXEA 2FDJA 2AACA 2R041 1NCQA 5JOXA 4BZ4A 1STMA 4AEDC 5IT6A 5HCFA 1FNYA 1RXGA 1TME3 1ZZ6A 2OXBA 1PGW1 5FYZA 2DU0A 4KMQA 2FCUA 3HBZA 1YIPA 3POIA 1AYM3 1EAH3 1X33A 1AX2A 3R4UA 1XE7A 3ME2A 3HQRA 2WNEA 1CAVB 4EQVA 3SITA 3I2HA 1DGRA 1HQWA 1SBDA 3H50A 3N7JA 5CIRA 3AL6A 1ACCA 1YYNA 2CGOA 3I3BA 4AI0A 5J1XA 1KDMA 3HIFA 3N35A 1QWRA 3E5QA 3IIAA 1W8WA 1ND2A 1VBC1 2JG8C 2ZKNA 5T5JA 1W8ZA 4JDMA 4WVMB 4BB3A 4MYEA 5GZGA 1W28A 5KHIA 2X53S 4K8FA 1R082 5BNOC 4S2HA 5JMOA 1WLCA 4XFCA 4C90A 5I91A 1N1TA 3HEIA 1UZYA 4YGBA 3LEMA 1GANA 5DG1A 1O5LA 5LCWL 5LRSA 5F5AA 3DGTA 1DFQA 1GWLA 1GYKA 5CNAA 3ZXDA 4XXAA 2W2IA 2XXZA 3ZFGC 4FPLA 1W6NA 2DFBA 5A6ZA 5BNQA 2YROA 1KS4A 4JHTA 4BISA 1UWWA 2WZR2 4Y5Z0 5T50A 4WV8A 4DINB 1UY1A 5BUVA 3B94A 4E2QA 1CX4A 5FR3A 5L19A 3L2HA 1ZZ8A 4LT5A 2WNOA 4QXCA 3CEWA 3OPTA 1VRH3 4PDWC 1LTEA 1BLZA 4FXKB 2DBNA 3WQ7A 4EZHA 1S4CA 2KA3A 5IVYA 1W8FA 1WLDA 4PIYA 1RITA 4R8HA 1NYWA 1ZM1A 1G9CA 1H1MA 1NZIA 1RUJ2 3RWKX 1W05A 3LCPA 4AVSA 2D44A 2HWB2 1KFXL 2BYVE 4CU8A 2XL9A 3KT7A 4AQTA 2PN5A 3RGBA 2HWD3 3H7YA 4FPYA 4NIGA 3VDBA 1EUTA 4WZCA 3CF6E 2RDNA 1D4M3 3B93A 3CJXA 3ZSLA 5ABJC 3AZYA 3H8UA 5C3PA 3KT4A 1IG3A 5J36A 2C5DA 3O0VA 5F2SA 4QAWA 2W1WA 1GOGA 2HYXA 4Q27A 1QY4A 1T6BX 4YVSC 5KXCA 1X50A 4QQOA 3DYMA 1RJ7A 4IEZA 1SFYA 5T5PA 2YYOA 5IFPA 1X9TA 3AKTA 4HXCA 4XACA 1AR81 4Q5OA 1AXZA 1YO8A 4MZUA 5DUXA 5FZ8A 5LBEA 3VD5A 1AYN1 4P9WA 4Y3OA 1YFYA 4YYOA 4CCOA 5IVCA 3VLBB 4I0WB 4Q4V1 1NXMA 3WG2A 1RUD3 1WCKA 4Z2AA 3O12A 4IEQA 1F5FA 1LOAA 5DUWA 1VBE3 3LPGA 1SBEA 2W1QA 1UY0A 1N1VA 4AQ6A 1OVPA 3WP6A 4Z2WA 1N1YA 1T2XA 4META 4I01A 3MHZA 5EWSA 5FZ1A 4CEWC 3POEA 3LA3A 2I45A 1AVBA 2ID4A 3WW2A 2E63A 1IPJA 1HB4A 1SLLA 2ETEA 2XR4A 4QPIC 3OOXA 5FZHA 1LULA 3DV8A 4LBOA 3D82A 3UJQA 4BQ3A 5ACA3 2FDGA 3ZXLA 5IVVA 4CCKA 2QQOA 4FOWA 2BVBA 5A33B 1EPZA 1W9FA 5GLVA 5A7OA 4R9DA 1PGW2 4HLTA 1RMU1 1PIV1 2VMCA 1JU3A 1PK6A 5FLHA 3AKRA 5JMCA 1SQ4A 3AJYA 4PBOA 3K4AA 3ZXFA 4F3JA 4LA3A 5FZGA 2JDUA 1C28A 4LO6B 4BLIA 4AQ2A 1URXA 2W1SA 3UETA 3QH7A 1RUC3 2WT0A 2LRPA 1C8M1 4COUA 1VBC2 3H8OA 3MIEA 3ZXAC 2VW0A 5FXWA 3DYOA 3FUQA 1BVP1 2D6KA 4RGAA 4XJUA 3AFGA 3V0BA 3J7LA 4IGQA 3ZYGA 2B9UA 3I54A 4YM0A 3HNMA 1H30A 3IPVA 4XFAA 2R7EB 3RMYA 3VL8A 4WM8A 4HKOA 1MS9A 2WINB 3MUZ1 3AP5A 4GZ9A 5FZ0A 2JDMA 3GM8A 3N3HA 2J1VA 5FY9A 1AZDA 5A80A 1HIXA 1KJLA 3EJKA 4I3GA 2A6VA 1V6JA 2GNMA 5DAWA 1OD3A 5FZLA 2PHTA 5FWJA 4AHZA 2VZPA 4GA9A 3GALA 2ADEA 4JZRA 3FWEA 3JXSA 4AI2A 1OXCA 4KGQA 5LW9A 1JYNA 1Z0HA 2BV4A 2VXJA 3VD4A 4XETA 1CAXA 4BQWA 2K0GA 5I0SA 3ZFEC 4BLJA 5E6HA 4C0HA 5IK4A 2ZXQA 1WW6A 3WP3A 5FREA 1C5HA 1U5XA 2ZS6B 1VBD3 1YNAA 3J7NA 4NAOA 4ITCA 3D8CA 3O1TA 1RC6A 3OBRA 3IDEA 3J8F1 4BCUA 4CDWC 5LATA 3VHNA 1B35B 3ZR5A 4Y5TA 1LOBA 3PHMA 1OLRA 2OQ6A 3CNAA 4JGZA 2VE1A 4QB6A 2WZ8A 1O3TA 2UY9A 1AL21 2P3KA 2RVAA 1OPOA 5J98B 4A3ZA 1XNBA 2PTMA 2CV6A 2F17A 5GZCA 4BMBA 4E4SA 1MS1A 1W6OB 3RZGA 1US3A 1OBNA 1S0CA 2GC3A 2A71A 4PBPA 1AYN2 5DXDA 2LTNA 2VNRA 4NHXA 4UFJA 1Y9QA 1BMV1 1POV1 2AC1A 3BU7A 1RYYA 5D2AA 1DDLA 1Q56A 5F5CA 5AC93 1DGLA 3KLSA 3AMPA 4OI0A 1JHJA 1UU5A 2XPJA 2QQMA 4M00A 2B7YA 4JRLA 2JDHA 1T6GC 3TN92 5FWEA 4LKEA 4MGTA 2CY6A 2OKXA 4D7YA 3JB8A 2VPVA 4K1YA 4N43B 5FMBA 4FOYA 4LMFA 1SZBA 2YU1A 3AC0A 4IGPA 3THPA 3S0MA 2VC9A 4TN7A 2VMGA 5FJHA 3ZMNA 2ZGTA 3P5BA 3QCWA 4LBQD 1Y4WA 4QX1A 5B4NA 4YFWA 2XQXA 2E32A 2ZGQA 2J1TA 4QKDA 5FZMA 3WW3A 1U5YA 3RQ0A 1AF9A 2YFZA 4Y1XA 3ILNA 5FZFA 2C9KA 4XFGA 1OLMA 3VKMA 2EIEA 3VKFC 1YQCA 1PVXA 3UKVA 1WCDJ 2BQPA 1W04A 1C8M2 3ES1A 4MUVA 2D3PA 3BU0A 5FYBA 4DXRA 2ZJCA 3OY8B 3VGIA 1E57A 1W0NA 2IXLA 4WM8C 5JAXA 1H6XA 2VW2A 2P4EA 5BPXA 2ZTNA 4FQ4A 1L7QA 3KT1A 4YM3A 1F4AA 1ODMA 1VB2A 3CJIA 5EZWA 1ZRDA 4GQ7A 1D7PM 3NNFA 3P6BA 5EYXA 1GNHA 4YVWC 1IZ3A 2X5IB 4YNIA 3VL9A 3ZFFC 1MS5A 1NA1B 1BCXA 1COV1 4YM2A 3DKWA 1I3HA 4RL7A 1PHMA 5APAA 5FMCA 4EV0A 2RS13 4XYXA 4YZ4A 2D5HA 3OTFA 2WS93 2GP3A 4P9JA 2NYYA 2PHWA 2VUAA 4XPVA 2OVUA 3MZHA 4WM7B 1AR63 1PZ9A 3NV1A 2GNTA 1C3HA 2BWAA 4HK9A 5IATA 2OT7A 3C3VA 1XYNA 3WXPA 4MX3A 5ANNA 3NW4A 4AEDB 5EQUA 3H42B 4JQRA 1A8DA 3KWVA 5C71A 5F3EA 2F4PA 3GHNA 3VBFC 1RUE1 1GFF2 2Q1ZB 1LEMA 2HBTA 4YSFA 2XG3A 4QX8A 3U37A 4TWTA 3KGZA 3WNOA 1NCRC 4JGZC 4M4RA 4B3NA 3J8F2 2EAAA 1R093 1ZBE3 2DV9A 3WCSA 4BQ4A 1H9PA 4MHRA 3POBA 2ILMA 4QDRA 4DFSA 4DXSA 3E5XA 1OA3A 1PX4A 4P9XA 5T52A 1WBLA 1W6MA 2JG8B 2P3IA 2WSVA 4RHV3 4RS5A 3TYJA 3ZO0B 2EIGA 1H2KA 5DZFA 1EPWA 2DBIA 4XFIA 3GXUA 2WO2A 4O9EA 4Y22B 3VBOC 5BNOB 5JSOA 2WC2A 2O8OA 4A6OA 3NL1A 1AJKA 1XE0A 4Q0VA 2ARBA 2PELA 4UAPA 1UMZA 1BMV2 1UKGA 3WUCA 3LDBA 4XTPA 5C8CA 3HMYA 1JN2P 2P6HA 2D6LX 3J9SA 3ZFGB 4QDQA 1ZZCA 3ZKYA 5C3RA 3Q8BA 5LA1A 3SCGA 1JS9A 4XUPA 2D3RA 3E6BA 1DG6A 2W5FA 1U5IA 2CAVA 2CDPA 4KBZA 4A7KA 1SHWB 1NE4A 3CQOA 1QJEA 3OYWA 4G4FA 5A32B 3FJSA 3WQ1A 4NWWA 1H8TB 3AP4A 3U4SA 3CHXA 3W5MA 4PDWB 3A4UA 1UZZA 3ZYRA 1S0DA 3GBGA 2J1AA 3OCPA 2UWBA 4DB5A 5KXEA 4YGCA 4QXHA 4CUCA 1EP0A 4CXYA 1CESA 3A21A 3KMHA 5CFDA 1AR73 3SHRA 3ETQA 2Y6HA 1DQ2A 1OOPA 2JJ6A 1HLCA 2JXAA 4ZXKA 3KZ4C 2ZGOA 4L92A 1VIWB 4FT8A 5FYCA 5IAVA 4Q4X1 2WDBA 4FAHA 1MS0A 2XGXA 1CN1A 5ABJB 3VZMA 4OZXA 1VBA1 2VCBA 2UU8A 4YVSB 3CJIC 1BBT3 3MIDA 1D0GA 4R4ZA 5DMYA 5K0UB 1W3VA 5J7MA 4NHLA 4JDOA 5DPNA 1JZ7A 2WLPA 2P1BA 2FZ2A 2VCMA 1X9PA 1XPWA 1QF3A 3I2KA 1EY2A 1X82A 2D7FA 2Y6GA 4IW3A 1G9BA 3WF4A 1Y9MA 3NKTA 1I9RA 5EV7A 4E2SA 3JB4C 5J96B 3NV3A 4AXOA 3V64A 1V6LA 2BGOA 1F5JA 1GQGA 2NLRA 3GGLA 4CEWB 4I0AA 4IERA 2LUWA 5IHRA 1VAMA 4PJYA 5I0TA 1GV9A 3DL3A 2AEYA 4N53A 4TLFA 4TLGA 4BDVB 3ZN4A 4QPIB 1C8NA 3A0NA 1TMF3 3M4FA 1HN1A 2XBO1 4HG6B 4HSJA 5DAXA 4DEQA 3OSDA 3RFRA 3LPFA 4HPKA 1VALA 2RJLA 4B4QA 4G3YC 4AI8A 1FI2A 4NROA 1K45A 3LEKA 3KQRA 3G7DA 3SNMA 2QQJA 1VMJA 1W9YA 2MEV3 4UBHA 3VDDC 2XUMA 2XKOA 4D7TA 3T0AA 1HKDA 2YC0A 2WFPA 4IETA 4XUQA 2QDNA 1N3OA 3K3NA 3U0ZA 1FV3A 1VLNA 4CEYB 2G9ZA 2QVSB 4MV2A 2G1MA 4YZ5A 3MFCA 5JI7A 4I30A 3GHMA 4P02B 4H55A 1IHMA 1V9U1 1NUKA 1QIQA 1FATA 5FP7A 4ZU4A 3WP4A 2UY8A 1AR91 2HWC3 3BUCA 4GB31 4EWDA 4AFDA 1QDOA 2C26A 4Y5SA 1FMD3 1UYXA 4H14A 4K3UA 1NY71 2BBAA 5FZ7A 2HWF3 1IQDC 2WQ8A 3SEEA 3AXDA 1QJY3 1XBFA 5SV5A 1YUDA 4IEYA 2V4AA 4KG0A 4Q1RA 1GMMA 5A6XA 1ZA7A 1W2TA 2BERA 2ZGSA 2DF7A 2BEOA 2AYHA 2ET1A 2CWMA 2JG9A 2VOWA 3A22A 2W3JA 3OGJA 2GNDA 1RUOA 2RMU1 4CUBA 2FDHA 5CFDC 3E97A 3M3QA 3VUOA 1PO23 1KD7A 5IWFA 3RRDA 4X6RB 4ZU5A 3ZFEB 2BGPA 4KWUA 4UFMA 1RUI1 1SLAA 1CIYA 2PYTA 3GYDA 3NAPA 5FZ4A 4GJYA 1LB2A 4MGQA 5FP3A 2V5DA 2VULA 3UV9A 1PGL1 3FHQA 3K4DA 3RSJA 2J7MA 4CUGA 2JICA 5LK5A 4QXBA 1DHKB 2E51A 3MUY1 3I2OA 3AMMA 5JZGC 4NVPA 4Q4X2 2WNUA 1VBB2 4CDWB 3ZYBA 3PUSA 4XCBA 4Y20A 4XZUG 5C4WA 1LHNA 5CKNA 4CDXA 2ARAA 4E8DA 2QQVA 1VBA2 4N90A 3WW4A 2W9XA 4A42A 3GZUC 4NPMA 1OH3A 1RHI3 2VBDA 1J3PA 1V00A 2IVIB 3JCIA 1DYKA 1DQ4A 4BHPA 1IGOA 5JPMB 4UOJA 5A7QA 4IGOA 1W9WA 3E6DA 3ALQA 4UFHA 5E8AA 1FPN1 2WT1A 4FTEA 2TUNA 4IDZA 4GWJA 4OQ8A 4YGDA 3FMGA 1G86A 3FLTA 3IKWA 1X36A 4MHUA 4R4XA 5I8TA 3A23A 1HRI1 1UMHA 2G9GA 4N53C 4CDQA 3RYPA 5FP8A 2V5YA 2NP0A 2X8KA 5JI9A 1XNDA 1NZCA 3TWIA 2JEMA 1JZ2A 3WNXA 3TRSB 4ZS2A 2XBO2 4DUXA 2UWCA 3AKPA 4BQYA 1JYTA 3UGFA 1OFNA 1K5MA 1R1ZA 1R1A3 4C8DA 3KV6A 3ZYHA 4IV1A 1GUIA 4HBNA 3LEGA 3PJQA 4HFSA 1BVVA 2XDVA 3PU8A 2QKDA 5TSWA 2RR13 5JR2A 3ABZA 2XMLA 3N9MA 4OHVA 3POJA 5C5UA 3LB9A 4WVWA 5A1AA 1OLQA 5FTTC 3WNLA 4H7MA 5F3IA 1EV11 1PM4A 1VP6A 4COZA 5KWRA 3VBRA 4FOQA 2XVLA 3ECQA 2QE3A 3AFKA 2FZ1A 3BOWA 5LA2A 2PXJA 3TOJA 4OYUA 2JDPA 4DNYA 1HDKA 1XSQA 3D3AA 2AGSA 4R9CA 3SKJE 4QPWA 2MNGA 1QDCA 1XB9A 2EXKA 2IXKA 4TYSA 4DXTA 1WMXA 4QD2A 5CFCB 2ZPXA 4L0PA 3WLUA 3FLRA 2XWBB 1AR92 4QPYA 4LQRA 1P8JA 1YIFA 5CKQA 2D3SA 5FLIA 1ZZ9A 1WCUA 4GMP0 1GQPA 1NY72 4YVWB 5FY8A 2RS51 3ZFFB 2XLFA 3IBMA 3SC7X 3SISA 4CCMA 5FZ6A 1W2UA 2QZ2A 3N7MA 5ISLA 1KJRA 1OLME 4NHKA 3I97A 3B02A 3JD73 2OA2A 2JG9C 3BTAA 5FZAA 2IZWA 3NNGA 4MOAA 1RGSA 4LKFA 3POSA 5F8PA 5ERLA 1TG7A 3MO4A 2R0FA 3WVJA 5A3LA 4GKXA 2GN7A 2GDFA 2RMU2 4COYA 3NAPC 1RVF1 2GC2A 2OZJA 5FZEA 2Y0IA 2B9VA 3O14A 4U2AA 2ADDA 2XJVA 4YG0A 1PMJX 2JWPA 2VOXA 1LU2A 3CKHA 4FP3A 1NLSA 3PIJA 3WT3A 3BTZA 1R083 1J3RA 4CP9B 4LHSA 3ZXJA 4QU2A 1PGL2 1O4TA 4PLOA 3VBFB 5IYYA 4UW5A 1QOTA 2GZWA 2I74A 2WNUC 4NRMA 1GZWB 3IMMA 4WVZA 5CEHA 5F1RA 1JYVA 4YW3A 4QMAA 4AI3A 2C6SA 5FPUA 1NCRB 5LZ6A 2R6QA 4L8QA 2WZPP 3ZIXA 1PO11 1V0AA 2VCAA 1Y9GA 4OHWA 1SPPA 5L36A 4LEJA 3SCHA 3ASIA 2NQYA 2WL1A 1S2BA 5C9AA 1IPSA 1A8MA 5FZIA 1H1AA 4MVTA 4HN0A 4IE0A 3T3YA 4ET7A 4GMP3 1ULOA 5E1RA 3USUB 3KGLA 3VBOB 1CAUB 4AVVA 1M06G 4MGIE 2B39A 4BXSV 3W59A 4OHYA 4LITA 5A3WA 4KNCA 1ULDA 2P17A 5FYIA 4A41A 4CVUA 2AUYA 2IXIA 3R4DB 3VKLA 4CXWA 1YQ6A 4Y1YA 3M2MA 4LUMA 1HRI2 4E2GA 1VMFA 5F9TA 3CLPA 1LOEA 4XBQA 5FY4A 1HB2A 1VB4A 1S0FA 3INAA 2D97A 3M3IA 2PLV1 2A3XA 3VBSA 4QGMA 1O4ZA 4D7SA 4JTNA 1O3SA 4DRVA 4FCAA 2DU1A 4Q4Y2 5A3MA 2VG9A 1S1AA 1ASJ3 5LA0A 2BDRA 1O5UA 1MPXA 3J26N 3VZJA 4AGGA 3RPQA 2C0ZA 2WNVA 4A2UA 4YRDA 1RTVA 1MS3A 3MPPG 5FZOA 3L9JT 2QCSB 4AHYA 3HNYM 4M4PA 1IOAA 3AL5A 3UNPA 1XNKA 2W94A 4F83A 3AM2A 4N9IA 2RDRA 3I2IA 4W6WA 4OI1A 2QQPA 2DWRA 3WSOA 3LF7A 3N9LA 1EV12 1GBGA 2X29A 4K9SA 4RN5A 1TQ5A 3I3QA 5T3NA 4MGSA 1JXNA 4ASKA 2WKKA 3TNQA 1ULCA 3FBMA 4FPJA 3UESA 3KM5A 5FUIA 2R043 4ISRA 1DF0A 4LA2A 2BBVA 4XXPA 1OA4A 5CU1A 3D0SA 3PVEA 4CDUA 3NSTA 2QNKA 3D0JA 5LEJA 2YU2A 3TNPB 4CPBA 1UCXA 2W39A 3ACLA 3MIHA 4W8JA 1GP5A 3PTYA 3WDVA 3BPZA 2XOMA 2ZHMA 5EP9A 2VUJA 4LBNA 4XF9A 1RUH1 2RS52 1MQTC 3WX5A 4FFIA 5C8WA 3KHCA 1LAJA 1LOFC 4FPCA 2XKPA 2ZGUA 5A3NA 5FQ0A 4LPLA 2VQUA 2XUEA 1GZ9A 1MVEA 3D4KA 5A7NA 1TE1B 3C7EA 3TEYA 4XF1A 5F5QA 3VBHA 1D2SA 4J6GA 3D6EA 4P00B 4ATEA 2YUEA 5C6CA 5JPNB 2PFWA 2PQSA 4NHMA 3PVNA 1RVF2 5H9RA 2VMEA 2BRTA 3PDQA 3EBRA 2DVBA 5KXDA 4N7UA 4EE2A 2R062 2H0VA 2A73B 3I2FA 1OI6A 3H1WA 2IXHA 5FZBA 1GQHA 2CTVA 2BTVC 1W8OA 4NIAA 3ZN6B 5BNNA 1WD4A 2HWD1 4IV3A 2ZMLA 3T2OA 3WUDA 1F9KA 1FNZA 1HN0A 4KQ7A 1PO12 5F3GA 3ZM8A 4DQAA 3OEBA 2PHUA 3PLQA 3VDDB 2UURA 2PA7A 4JGYA 3VBUC 2Y38A 1JZ6A 2O14A 3OBAA 3S30A 4BMEA 3C8XA 1Q8OA 3WG3A 2VR4A 3WZ1A 1HRV1 4MGZE 2V73A 4RR3C 3I2JA 1YFWA 4M0HA 5FYHA 3WOGA 4UXAA 4GAZA 3O1UA 3BGAA 1LECA 2YY1A 4XMIA 2AEZA 1OMIA 2RM23 1ZA4A 1S0JA 3H3ZA 1OF3A 2EALA 4PF1A 4XEZA 3T4HB 3VKOA 4BM8A 3A7QA 5D8AA 2PHDA 5FXXA 4AVTA 4JHZA 1W8HA 1MVQA 2ZGKA 1W6PB 5JOZA 4ZONA 4Q0PA 1MZ6A 5JSPA 1ZX5A 1NCQC 2PLV2 2HEVF 1RINA 1JUIA 4MXWB 2XH6A 2WN2A 1CPMA 1AXKA 2GP5A 5DG2A 5ACA1 4AW7A 2BNOA 1G6NA 4FPKA 4I02A 3RS6A 4YW7A 5FFOC 3SQOA 3TN91 3ZYIB 3N9NA 2EAKA 3J4UH 4O65A 1G9AA 4BXFA 2TNFA 2KR2A 1AR83 5I0RA 4LBQB 4B7KA 2JB4A 5DUVA 4B7EA 1AYN3 2ZMKA 1NXD1 2K46A 3LFMA 5C7GA 3FX3A 4Q4V3 4S2FA 5D21A 2ZX3A 3IMNA 1PMHX 5GZFA 4GWIA 4IEVA 3AVRA 5JZGB 1ND2C 2Q1FA 5K4LA 4YZ2A 2BVVA 4FFFA 2HJIA 4Z1VA 1WWYA 3VHOA 3EYPA 4E27A 2FQPA 1US2A 3BOPA 1XU1A 5J09A 4SLIA 3LIHA 3AYDA 3BCWA 1HB3A 3MW4A 2EXHA 4OUSA 3ZSJA 1ENSA 2CWSA 4HN1A 1RMU3 1PIV3 2NZ9A 3NJZA 2BWCA 3JU9A 4AI1A 4A4AA 1RUH2 3MDPA 1TVGA 3NWKA 2P37A 1OHFA 4NR1A 4FBFA 2O1QA 2Y60A 3GBFA 2RDQA 4N53B 5FKBA 4PIXA 2VQTA 4XIKA 4A7ZA 2HBUA 4FOVA 4X6QB 2FMDA 4CE8A 1C8M3 4EWEA 3V0AA 5EYYA 2Y6JA 4P9YA 3N9OA 1BQPA 3HNBM 4PHZA 5CBLA 5C33A 4KGGA 4UW4A 3BVCA 5FYMA 1PZ8A 2DCKA 1GR3A 1W8UA 4C1WA 1NQDA 2OUJA 4IE6A 4D3WA 1AX1A 1XYPA 2HWD2 3UT0A 1OPMA 4LO5B 3ZX7A 4CP2A 3T0DA 5FXVA 1D4M2 4QWNA 1IPKA 5LBFA 4CXXA 5FZ9A 5JLVA 5FMOL 2VZTA 1E5RA 3ENRA 5BV6A 1UX6A 2XONA 5GM0A 1POV0 3PIGA 4M01A 1J59A 2LW8A 1JHNA 4CP0A 2VH9A 3UL2A 4Y1ZA 3JZVA 4YW6A 3RWNA 1XNCA 1OD5A 4MH0E 1HRV2 1DQ5A 1FOD1 5FY7A 3VHRA 3PTRB 4OMCA 5FPBA 3J7MA 4LIVA 1BHGA 4A44A 4M3CB 4MGKE 3S5AA 3THCA 1YQ5A 4XTMA 5L7OB 1E5SA 4NIIA 5AC91 1QQP1 1CIWA 1O91A 4UF0B 4LE3A 5FBZA 4QQHA 4JRAA 2JKXA 4ASMB 4BH9A 3O1SA 1ZBA3 4UW3A 1VAKA 2P34A 3GZAA 3H1YA 1U12A 4GH4A 3U4XA 3J8F3 3VV1A 5FUNA 4XC9A 2Q8CA 3W20A 3NNLA 3B5LB 4QPGA 5ACA2 1UOFA 2AZ5A 2QDRA 5A3UA 1H2LA 3BALA 3TEXA 1AL23 3WQBA 5BNPA 4PT6A 3N36A 1PK6C 1UOJA 5A6YA 2D6NA 2WR9A 1XNTA 2GC1A 4FPOB 1H0BA 1W8TA 2W47A 3WDWA 3EQEA 3N7KA 5HCBA 2R073 4B1LA 4QM8A 3OPZA 2WNUB 1POV3 3RDIA 1JZ3A 1QHDA 3ACIA 4AL9A 4HT1T 1RUC2 5SV8A 4LR4A 3ELNA 4MO3M 3K2OA 2WFF3 1AJOA 4RQPB 1SDWA 5KC5A 5LY1A 4DIQA 2WWJA 3S5QA 2B45X 5GALA 2EXIA 3I8TA 2CGPA 4Q0UA 5FIXA 3VZLA 4IXLA 4JDNA 1UZVA 1WBFA 4YARA 1WGPA 2W46A 3O0XA 5CADA 1W9SA 5LBCA 2D6MA 3FZ3A 2E26A 3HT1A 2FDKA 4E4ZA 4UFLA 2FCTA 1HQLA 3FC0A 2ZACA 5FPAA 5G05L 5HV0A 5CA6A 5EHDA 1CAVA 1BZWA 1UOGA 2WWSA 1AR61 1UF2C 3GJAA 2PAEA 3ITQA 4AVBA 4K21A 5M0TA 2RV9A 1UY4A 4FO9A 1UYYA 2YC4A 1LOGA 1HQNA 3WDTA 4KI5M 4WVMA 1XJAA 3DEMA 4NE9A 1V6NA 1ULFA 1SFPA 2H6BA 4XW3A 2YV8A 4DY3A 3S7IA 1N47A 2R30A 5A1FA 1VBD2 1MACA 1W2NA 4QKNA 3MF6A 4NRPA 2GU9A 5IK7A 4DPNA 5A3TA 1GZTA 1COV3 4ASLA 4PQ9A 4YGEA 5B2GB 5FMDA 2BUKA 5K9YA 2JD9A 1FX5A 2E7TA 2RE9A 3R0RA 4XAEA 2ZHKA 4AHWA 2Q1MA 1UZWA 3PU3A 3NNJA 2YBKA 3D5OA 5JXIA 3GNEA 1YRZA 1SFNA 1FOD2 1JBCA 4B29A 4BYYA 1WZXA 4HKWA 4Q4W3 3GZEA 1TEIA 2VTFA 4Y4RA 3OG2A 4P5YA 4OI4A 3VKNA 3PJYA 3LQCA 3UKTA 3T1MA 4BQ5A 5GLWA 3FBYA 4YW4A 5AC92 5HXVA
chains in the Genus database with same CATH topology
2WN3A 4ZXEA 1JZ5A 3F2ZA 4XUOA 2VMFA 4XZUG 1ULPA 3I2GA 4E8DA 2W9XA 4A42A 4AAXA 4LKSA 3J7HA 4KMQA 2QQNA 3DYPA 4AG4A 2DDUA 4UOJA 3I2HA 1W9WA 3WEZA 1CZTA 2Y8KA 3I3BA 1NAEA 5DN2A 5J1XA 4GWJA 3IIIA 4CU7A 2VO5A 3A23A 1UMHA 1NX9A 3C7HA 3K75B 2VJXA 1UMIA 4CUAA 2VZOA 5JMOA 1JZ2A 3HEIA 1K42A 5LCWL 3NJXA 1W99A 4DUXA 3K46A 5JUVA 1UXZA 1YQ2A 1GUIA 1UWWA 3LEGA 1UY1A 5JR2A 3ABZA 2WABA 3WNKA 2VZVA 5A1AA 3BN6A 3WNLA 1KGYA 3ECQA 5LA2A 1O8PA 4OYUA 3OGVA 1CZSA 4PQQA 4BK4A 3D3AA 3SKJE 4JKMA 4QPWA 3CDZB 1GU3A 4DXTA 4L0PA 3T09A 4CU8A 4LQRA 1P8JA 3VDBA 1EUTA 2J1UA 2KD7A 1GQPA 5EIYB 2YG0A 1CZVA 3CZUA 4QAWA 2W1WA 1GOGA 2HYXA 3I97A 3DYMA 3NNGA 2VZ1A 4MOAA 5B4XA 5IFPA 2Y64A 1TG7A 3CMGA 3MO4A 3VD5A 3WNPA 2WAOA 4XUNA 2B9VA 3OGRA 1JYXA 1PMJX 3CKHA 4Z2AA 3VD9A 3HOBA 1O8SA 4LHSA 3LPGA 2VZRA 2W1QA 1UY0A 5IYYA 1T2XA 1JYVA 1JU4A 1W9TA 2ZEXA 2ID4A 2VCAA 3LEIA 2W87A 2QQOA 4P08A 1EUUA 5IJRA 2X09A 2VMCA 1JU3A 4CU9A 4ET7A 1ULOA 2QQKA 4TXWA 1K3IA 3K4AA 5I0DA 4BXSV 3K4ZA 2W1SA 3UETA 4A41A 3WF1A 1CX1A 4CVUA 4UI9L 3LE0A 3DYOA 1DLCA 2VZ3A 5JXGA 2Y6KA 3HNMA 2R7EB 5LA0A 1MPXA 3MUZ1 5C70A 4GZ9A 3WNMA 3GM8A 2J1EA 2J1VA 3HNYM 4M4PA 3UNPA 2YFUA 1OD3A 2CDOA 2W94A 4QX0A 3IAPA 2VZPA 4QX2A 3I2IA 1DP0A 2ZEZA 3WSOA 2VM9A 3JXSA 5G04L 4RN5A 3OEAA 1JYNA 2L9LA 3VD4A 2EIBA 4MGSA 2WZEA 2ZXQA 3UESA 5FUIA 2Y6LA 4ARYA 2ZEWA 2LS6A 1GOFA 3DECA 1SG3A 2J1RA 4W8JA 4DEVA 4D8MA 4XVHA 2XOMA 2RJ2A 2YC2A 2Z4FA 4QB6A 2WZ8A 2RVAA 1PX3A 4A3ZA 4LPLA 2VQUA 4W50A 3C7EA 4P00B 1US3A 1UXXX 4JKKA 2PQSA 1GOHA 4BJ0A 2VMEA 3T0BA 1OT5A 1RYYA 3T08A 4FI9A 3I2FA 1W8NA 1W8OA 2V4VA 1JHJA 3EB7A 3SKVA 3T2OA 3K77A 2J22A 2QQMA 2VZSA 3ZM8A 3CIHA 3OEBA 3VDCA 2WYSA 1GNYA 2OKXA 3OGSA 2VMDA 3NQHA 1JZ6A 3AC0A 3OBAA 1OH4A 2VC9A 1SDDB 3MBWA 3WNNA 4CU6A 2VL4A 1DYOA 3C8XA 3I3EA 2VR4A 2WBKA 4E8CA 4QB1A 4QX1A 3I2JA 2XQXA 2E32A 2J1TA 1NKGA 3BGAA 2ORXA 2W91A 4YPJA 2YFZA 2X10A 2V72A 1OF3A 2C9KA 3C7OA 4PF1A 3WF3A 5JXHA 2EIEA 5EJ1B 3A7QA 4JHZA 1L7RA 4DXRA 3ACHA 3SEPA 1H6YA 1W0NA 1H6XA 4QB2A 2WN2A 1L7QA 1F4AA 2QQLA 3ACGA 4JX0A 1D7PM 3P6BA 2E31A 2YB7A 2VZUA 3HJRA 5DQ0A 5HPOA 4TTGA 3MV11 5C7GA 4A45A 5B4NA 1PMHX 4GWIA 1UYZA 3EYPA 3ETPA 1US2A 3C7FA 2EIDA 2JE8A 4MADA 3CZJA 5C71A 2WAAA 5HXMA 2B4KA 2WUHA 3U37A 3WNOA 4M4RA 2BZDA 4A4AA 2X05A 3FHAA 1TVGA 4QDRA 3T2QA 4DXSA 2QBXA 1XNAA 1PX4A 2W92A 3IAQA 3GDBA 3HPNA 2WO3A 2VQTA 1JZ4A 2W1UA 2WO2A 3GXUA 2VZQA 2DCJA 1F4HA 1J84A 2Y6JA 4A6OA 3HNBM 4UAPA 1J83A 2DCKA 4QDQA 5LA1A 1JZ8A 4XUPA 2W5FA 4RYDA 2CDPA 1JI6A 3T0DA 1SHWB 2VOTA 3CQOA 1XC6A 2VZTA 2XONA 3W5MA 5JXJA 3NJVA 2WO1A 2LW8A 2J1AA 4QDSA 2QQIA 4XURA 4CUCA 3A21A 2Y6HA 4OMCA 4A44A 1BHGA 2XHNA 3THCA 4OUEA 2WDBA 3T2PA 4DUWA 2JKXA 3IB3A 2VCBA 1I5PA 3ACFA 2JDAA 1WKYA 1KEXA 3E1F1 3VD3A 5DMYA 3WQBA 4PT6A 5DPNA 1JZ7A 3HN3A 1XPWA 3OB8A 1XNTA 3I2KA 3I3DA 3WF0A 2Y6GA 4ZY9A 3WF2A 3WF4A 2W47A 1O59A 2C4XA 2BGOA 4XUTA 1JZ3A 1UY3A 3GGLA 3ACIA 5IHRA 4JKLA 4MO3M 4BDVB 3W5NA 4OZOA 3FN9A 1HN1A 5IFTA 4HG6B 5CYYA 4DEQA 5CZKA 3PUHA 1UX7A 3LPFA 4BK5A 2W46A 4DUVA 1W9SA 2VCCA 2W95A 1LNSA 1K45A 1OF4A 3LEKA 2E26A 2QQJA 2E33A 4IUGA 3T0AA 5G05L 4XUQA 1K12A 1UY2A 3VD7A 4OMDA 4P02B 2RV9A 1UY4A 2HLEA 1UYYA 2YC4A 1NUKA 3NRUA 5F7UA 4KI5M 2ZEYA 2C26A 2J1SA 1UYXA 2BBAA 2ORZA 2WQ8A 1IQDC 3SEEA 3VDAA 3C7GA 1GMMA 2BERA 1WCQA 4D0QA 3FL7A 3A22A 3MV01 2W3JA 3P1IA 2JD9A 4CUBA 3PUIA 4W4ZA 3IDAA 3THDA 5EJZB 4ZZ8A 5JXIA 4QX3A 2BGPA 4KWUA 4ZZ5A 1CIYA 2EICA 2VTFA 4MGQA 1JYWA 2V5DA 3OG2A 4P5YA 3FHQA 3LQCA 3K4DA 1R64A 1UZ0A 2J7MA 4ARXA 3MUY1
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WN3 A;  4ZXE A;  1JZ5 A;  3F2Z A;  4XUO A;  2VMF A;  4XZU G;  1ULP A;  3I2G A;  4E8D A;  2W9X A;  4A42 A;  4AAX A;  4LKS A;  3J7H A;  4KMQ A;  2QQN A;  3DYP A;  4AG4 A;  2DDU A;  4UOJ A;  3I2H A;  1W9W A;  3WEZ A;  1CZT A;  2Y8K A;  3I3B A;  1NAE A;  5DN2 A;  5J1X A;  4GWJ A;  3III A;  4CU7 A;  2VO5 A;  3A23 A;  1UMH A;  1NX9 A;  3C7H A;  3K75 B;  2VJX A;  1UMI A;  4CUA A;  2VZO A;  5JMO A;  1JZ2 A;  3HEI A;  1K42 A;  5LCW L;  3NJX A;  1W99 A;  4DUX A;  3K46 A;  5JUV A;  1UXZ A;  1YQ2 A;  1GUI A;  1UWW A;  3LEG A;  1UY1 A;  5JR2 A;  3ABZ A;  2WAB A;  3WNK A;  2VZV A;  5A1A A;  3BN6 A;  3WNL A;  1KGY A;  3ECQ A;  5LA2 A;  1O8P A;  4OYU A;  3OGV A;  1CZS A;  4PQQ A;  4BK4 A;  3D3A A;  3SKJ E;  4JKM A;  4QPW A;  3CDZ B;  1GU3 A;  4DXT A;  4L0P A;  3T09 A;  4CU8 A;  4LQR A;  1P8J A;  3VDB A;  1EUT A;  2J1U A;  2KD7 A;  1GQP A;  5EIY B;  2YG0 A;  1CZV A;  3CZU A;  4QAW A;  2W1W A;  1GOG A;  2HYX A;  3I97 A;  3DYM A;  3NNG A;  2VZ1 A;  4MOA A;  5B4X A;  5IFP A;  2Y64 A;  1TG7 A;  3CMG A;  3MO4 A;  3VD5 A;  3WNP A;  2WAO A;  4XUN A;  2B9V A;  3OGR A;  1JYX A;  1PMJ X;  3CKH A;  4Z2A A;  3VD9 A;  3HOB A;  1O8S A;  4LHS A;  3LPG A;  2VZR A;  2W1Q A;  1UY0 A;  5IYY A;  1T2X A;  1JYV A;  1JU4 A;  1W9T A;  2ZEX A;  2ID4 A;  2VCA A;  3LEI A;  2W87 A;  2QQO A;  4P08 A;  1EUU A;  5IJR A;  2X09 A;  2VMC A;  1JU3 A;  4CU9 A;  4ET7 A;  1ULO A;  2QQK A;  4TXW A;  1K3I A;  3K4A A;  5I0D A;  4BXS V;  3K4Z A;  2W1S A;  3UET A;  4A41 A;  3WF1 A;  1CX1 A;  4CVU A;  4UI9 L;  3LE0 A;  3DYO A;  1DLC A;  2VZ3 A;  5JXG A;  2Y6K A;  3HNM A;  2R7E B;  5LA0 A;  1MPX A;  3MUZ 1;  5C70 A;  4GZ9 A;  3WNM A;  3GM8 A;  2J1E A;  2J1V A;  3HNY M;  4M4P A;  3UNP A;  2YFU A;  1OD3 A;  2CDO A;  2W94 A;  4QX0 A;  3IAP A;  2VZP A;  4QX2 A;  3I2I A;  1DP0 A;  2ZEZ A;  3WSO A;  2VM9 A;  3JXS A;  5G04 L;  4RN5 A;  3OEA A;  1JYN A;  2L9L A;  3VD4 A;  2EIB A;  4MGS A;  2WZE A;  2ZXQ A;  3UES A;  5FUI A;  2Y6L A;  4ARY A;  2ZEW A;  2LS6 A;  1GOF A;  3DEC A;  1SG3 A;  2J1R A;  4W8J A;  4DEV A;  4D8M A;  4XVH A;  2XOM A;  2RJ2 A;  2YC2 A;  2Z4F A;  4QB6 A;  2WZ8 A;  2RVA A;  1PX3 A;  4A3Z A;  4LPL A;  2VQU A;  4W50 A;  3C7E A;  4P00 B;  1US3 A;  1UXX X;  4JKK A;  2PQS A;  1GOH A;  4BJ0 A;  2VME A;  3T0B A;  1OT5 A;  1RYY A;  3T08 A;  4FI9 A;  3I2F A;  1W8N A;  1W8O A;  2V4V A;  1JHJ A;  3EB7 A;  3SKV A;  3T2O A;  3K77 A;  2J22 A;  2QQM A;  2VZS A;  3ZM8 A;  3CIH A;  3OEB A;  3VDC A;  2WYS A;  1GNY A;  2OKX A;  3OGS A;  2VMD A;  3NQH A;  1JZ6 A;  3AC0 A;  3OBA A;  1OH4 A;  2VC9 A;  1SDD B;  3MBW A;  3WNN A;  4CU6 A;  2VL4 A;  1DYO A;  3C8X A;  3I3E A;  2VR4 A;  2WBK A;  4E8C A;  4QB1 A;  4QX1 A;  3I2J A;  2XQX A;  2E32 A;  2J1T A;  1NKG A;  3BGA A;  2ORX A;  2W91 A;  4YPJ A;  2YFZ A;  2X10 A;  2V72 A;  1OF3 A;  2C9K A;  3C7O A;  4PF1 A;  3WF3 A;  5JXH A;  2EIE A;  5EJ1 B;  3A7Q A;  4JHZ A;  1L7R A;  4DXR A;  3ACH A;  3SEP A;  1H6Y A;  1W0N A;  1H6X A;  4QB2 A;  2WN2 A;  1L7Q A;  1F4A A;  2QQL A;  3ACG A;  4JX0 A;  1D7P M;  3P6B A;  2E31 A;  2YB7 A;  2VZU A;  3HJR A;  5DQ0 A;  5HPO A;  4TTG A;  3MV1 1;  5C7G A;  4A45 A;  5B4N A;  1PMH X;  4GWI A;  1UYZ A;  3EYP A;  3ETP A;  1US2 A;  3C7F A;  2EID A;  2JE8 A;  4MAD A;  3CZJ A;  5C71 A;  2WAA A;  5HXM A;  2B4K A;  2WUH A;  3U37 A;  3WNO A;  4M4R A;  2BZD A;  4A4A A;  2X05 A;  3FHA A;  1TVG A;  4QDR A;  3T2Q A;  4DXS A;  2QBX A;  1XNA A;  1PX4 A;  2W92 A;  3IAQ A;  3GDB A;  3HPN A;  2WO3 A;  2VQT A;  1JZ4 A;  2W1U A;  2WO2 A;  3GXU A;  2VZQ A;  2DCJ A;  1F4H A;  1J84 A;  2Y6J A;  4A6O A;  3HNB M;  4UAP A;  1J83 A;  2DCK A;  4QDQ A;  5LA1 A;  1JZ8 A;  4XUP A;  2W5F A;  4RYD A;  2CDP A;  1JI6 A;  3T0D A;  1SHW B;  2VOT A;  3CQO A;  1XC6 A;  2VZT A;  2XON A;  3W5M A;  5JXJ A;  3NJV A;  2WO1 A;  2LW8 A;  2J1A A;  4QDS A;  2QQI A;  4XUR A;  4CUC A;  3A21 A;  2Y6H A;  4OMC A;  4A44 A;  1BHG A;  2XHN A;  3THC A;  4OUE A;  2WDB A;  3T2P A;  4DUW A;  2JKX A;  3IB3 A;  2VCB A;  1I5P A;  3ACF A;  2JDA A;  1WKY A;  1KEX A;  3E1F 1;  3VD3 A;  5DMY A;  3WQB A;  4PT6 A;  5DPN A;  1JZ7 A;  3HN3 A;  1XPW A;  3OB8 A;  1XNT A;  3I2K A;  3I3D A;  3WF0 A;  2Y6G A;  4ZY9 A;  3WF2 A;  3WF4 A;  2W47 A;  1O59 A;  2C4X A;  2BGO A;  4XUT A;  1JZ3 A;  1UY3 A;  3GGL A;  3ACI A;  5IHR A;  4JKL A;  4MO3 M;  4BDV B;  3W5N A;  4OZO A;  3FN9 A;  1HN1 A;  5IFT A;  4HG6 B;  5CYY A;  4DEQ A;  5CZK A;  3PUH A;  1UX7 A;  3LPF A;  4BK5 A;  2W46 A;  4DUV A;  1W9S A;  2VCC A;  2W95 A;  1LNS A;  1K45 A;  1OF4 A;  3LEK A;  2E26 A;  2QQJ A;  2E33 A;  4IUG A;  3T0A A;  5G05 L;  4XUQ A;  1K12 A;  1UY2 A;  3VD7 A;  4OMD A;  4P02 B;  2RV9 A;  1UY4 A;  2HLE A;  1UYY A;  2YC4 A;  1NUK A;  3NRU A;  5F7U A;  4KI5 M;  2ZEY A;  2C26 A;  2J1S A;  1UYX A;  2BBA A;  2ORZ A;  2WQ8 A;  1IQD C;  3SEE A;  3VDA A;  3C7G A;  1GMM A;  2BER A;  1WCQ A;  4D0Q A;  3FL7 A;  3A22 A;  3MV0 1;  2W3J A;  3P1I A;  2JD9 A;  4CUB A;  3PUI A;  4W4Z A;  3IDA A;  3THD A;  5EJZ B;  4ZZ8 A;  5JXI A;  4QX3 A;  2BGP A;  4KWU A;  4ZZ5 A;  1CIY A;  2EIC A;  2VTF A;  4MGQ A;  1JYW A;  2V5D A;  3OG2 A;  4P5Y A;  3FHQ A;  3LQC A;  3K4D A;  1R64 A;  1UZ0 A;  2J7M A;  4ARX A;  3MUY 1; 
#chains in the Genus database with same CATH topology
 1QQP 2;  4LBM A;  1DLL A;  1LHO A;  4PCR A;  1MZF A;  5HCH A;  1RUE 3;  4XUO A;  1OFS A;  3H1M A;  1VE0 A;  2VMF A;  3LDK A;  1MQT B;  3M7A A;  1ULP A;  2CU5 A;  4BU2 A;  4OHZ A;  4QPG C;  5C3S A;  5T5O A;  2VUD A;  4AAX A;  1G9F A;  3B3Q E;  3KV5 A;  3AP9 A;  4LKS A;  4P14 A;  3W9A A;  3I2D A;  1DQ0 A;  3N9Q A;  4KWK A;  2QQN A;  1D2Q A;  2NPI A;  4YWA A;  4AG4 A;  5DAV A;  2Z5W A;  4R9B A;  1NLR A;  1Q43 A;  4YW1 A;  4EN9 B;  3ZN5 A;  1AR7 1;  4P5H A;  2R49 A;  4FTB A;  4CU7 A;  2VO5 A;  5A70 A;  3GF6 A;  1HXS 3;  1NX9 A;  3C7H A;  2Q4S A;  2P3Y A;  2BP6 A;  3K75 B;  2VJX A;  2VQA A;  5ANQ A;  4AEK A;  4BE3 A;  4CUA A;  2VZO A;  3OD4 A;  2LAL A;  1W6Q B;  1FAY A;  1WCS A;  3X29 B;  1VBB 1;  3SH3 A;  1ODN A;  3O1P A;  1K42 A;  2PHL A;  2Z42 A;  3VBU B;  3SH5 A;  1CAW B;  5FY5 A;  1UXZ A;  3ILF A;  1YQ2 A;  4XJZ A;  1Q8S A;  1DGW A;  3LKJ A;  4RR3 B;  5L9B A;  5A7W A;  2WAB A;  2H6C A;  3WNK A;  1QOS A;  2VZV A;  1FV2 A;  5A33 A;  1JW6 A;  2F4L A;  1OUX A;  2Q8D A;  4OI2 A;  2GNB A;  3BN6 A;  1DZR A;  4Q0S A;  2Q5T A;  1W0O A;  1REE A;  1RJ8 A;  4FPE A;  1IS6 A;  2VVE A;  1O8P A;  3OUJ A;  4G9S B;  2ES3 A;  4LHN A;  5LRR A;  2A3Y A;  4Q4X 3;  4QHZ A;  5FXZ A;  1AR6 2;  5IVF A;  4NAM A;  3AZW A;  3LFI A;  1C5I A;  3RZL A;  1NCQ B;  1NQJ A;  1O7F A;  1LOC A;  4Q29 A;  3VZN A;  1MEC 1;  2P6C A;  3PNA A;  3T09 A;  1S0I A;  1DCS A;  1VBA 3;  1Z7S 3;  2E9Q A;  2WQ4 A;  2J1U A;  2KD7 A;  2WQZ C;  2YGM A;  3WHU A;  5FPX A;  3AVS A;  4A3X A;  5EIY B;  2YG0 A;  2EA7 A;  1CZV A;  3CZU A;  4FPF A;  5E16 A;  1CQ9 A;  3FUO A;  1K5J A;  4LOR A;  5KHK A;  4D6S A;  3RYR A;  3KQ4 B;  1H4H A;  2VW1 A;  2JEC A;  2XB6 C;  2CNA A;  4LE4 A;  1HJF A;  2VZ1 A;  3WY6 A;  1QXJ A;  4AZZ A;  3LOB A;  3AX4 A;  2Y0O A;  2Y64 A;  1ND2 B;  1Q3E A;  5BXX A;  4XIO A;  4Y4Y A;  1AXY A;  4RS5 C;  2WAO A;  3WNP A;  1POQ A;  1UL9 A;  1YJL A;  1VJ2 A;  4GKY A;  4X8P A;  3MFA A;  1JYX A;  1ZRE A;  1JH5 A;  2D40 A;  2ARC A;  5IW0 A;  3ZPY A;  4D6Q A;  2JDK A;  1SLT A;  3HOB A;  4GWN A;  4JAA A;  3VD9 A;  2E7Q A;  1H9W A;  2DUO A;  3T1L A;  2QTW B;  2VZR A;  3P3P A;  4XBN A;  2ZHL A;  3I59 A;  2LRO A;  2W08 A;  2XBO 3;  4IL7 A;  2HWC 1;  4NMI A;  5C8C C;  5EJ3 A;  1RUF 1;  2F6B A;  2JB8 A;  2VUC A;  1FMD 1;  1YI9 A;  2IFW A;  1W6N B;  3GJB A;  1ZZB A;  1S2E A;  2CSG A;  1QJY 1;  3RJR A;  3PMS A;  1X8M A;  2GC0 A;  4K40 A;  3JUU A;  4Z07 A;  4A6S A;  4AE2 A;  2W87 A;  4AOC A;  1DQ6 A;  3DN7 A;  1LHW A;  2QZ3 A;  4P08 A;  1EUU A;  1UU4 A;  3KSC A;  2X09 A;  5FP4 A;  4Y24 A;  1RB8 G;  1PVC 1;  3GCX A;  1J58 A;  5FOJ B;  3KF3 A;  1B35 A;  3AYE A;  5FO9 B;  3B7M A;  2ZAA A;  2ZX4 A;  2RS3 1;  2QQK A;  3C2U A;  5I0D A;  1UO9 A;  4KU8 A;  2ZGM A;  3CL1 A;  3V56 A;  3ZYF A;  2YPJ A;  4B1M A;  1Q5O A;  2IC1 A;  3GBW A;  3IWZ A;  5FMO S;  3K4Z A;  1AR7 2;  1A6C A;  1QJU 1;  1ZRI A;  1OOP C;  2Y34 A;  3KV9 A;  4GUL A;  4BQ2 A;  1CX1 A;  3NJY A;  4XMA A;  5DDJ 1;  1W6O A;  3LE0 A;  4HVO A;  1V9U 3;  2ARE A;  4QT6 A;  4NID A;  4FSJ A;  3LIG A;  4XHB A;  4CCL A;  1W03 A;  2VZ3 A;  4GB3 3;  5CVR A;  4UYB A;  1D0H A;  4AEM A;  5FRA A;  4ERO A;  1MZE A;  4CA9 A;  4LO7 A;  4UT5 A;  1U5Z A;  5LA9 A;  5I8Y A;  2YBS A;  5C70 A;  2ET7 A;  3WV6 A;  3WNM A;  3A0K A;  1ALY A;  1RHI 1;  1L7L A;  1IQA A;  1WA4 A;  1LGC A;  3DF0 A;  4N7I A;  3VN4 A;  2ZA9 A;  2YFU A;  2RMU 3;  4FTS A;  4AFA A;  4IE4 A;  4N43 A;  5GZD A;  4E4D X;  2XJU A;  4QX2 A;  5JOW A;  2ZEZ A;  1HX6 A;  1RUI 3;  2VM9 A;  4FQZ A;  5G04 L;  1UD1 A;  1SLC A;  4HVQ A;  4YW2 A;  2Y6F A;  3OEA A;  4X8N A;  1XU2 A;  2L9L A;  2BOJ A;  2O0O A;  5AVA A;  4LO8 A;  4NPL A;  2O8Q A;  5GLZ A;  2BJS A;  2XJT A;  3ZMO A;  4XJA A;  3RZZ A;  1QH7 A;  3OPW A;  2ARX A;  4ARY A;  2ZEW A;  1TMF 2;  1GOF A;  1MEC 2;  4LKD A;  1ONA A;  4AGV A;  2QFE A;  3PUR A;  3AZX A;  4D69 A;  1KS5 A;  3DEC A;  4Q4Y 1;  1D4V B;  1REF A;  3KV4 A;  3OY8 A;  4CZS A;  1R1A 1;  2J1R A;  2WO7 A;  3QH6 A;  4DEV A;  1PK6 B;  4W65 A;  4XVH A;  4LLO A;  4D8M A;  1JOB A;  1HJG A;  2YC2 A;  2RR1 1;  4LXL A;  4EN8 B;  3TAY A;  1PX3 A;  4XAB A;  3ZDS A;  4H3W A;  1G7Y A;  4W50 A;  4O61 A;  3ZSK A;  3MGU A;  3PVB B;  1FPN 3;  4ISQ A;  4XIL A;  2X5I A;  1ZRR A;  1NA1 A;  1YFU A;  4BPZ A;  4J25 A;  4RD7 A;  4JKK A;  1WW4 A;  2K2S A;  1HRI 3;  4NHY A;  3RYK A;  2A70 A;  3V0B B;  1J1T A;  4F8A A;  1LES A;  4V1P A;  1OT5 A;  3RMX A;  4LBK A;  1OA2 A;  3IPV B;  5LK7 B;  4WM7 A;  3QD6 A;  1CD3 G;  1W8N A;  3DCQ A;  4WM8 B;  3TEZ A;  2NN8 A;  4CPB D;  2OPW A;  2HWC 2;  3FHI B;  3HQX A;  4ZU7 A;  2DTW A;  5IUQ A;  1RUF 2;  4AED A;  1FMD 2;  3K77 A;  3IZO A;  3ZKU A;  1S0B A;  2FMY A;  1QJY 2;  3CIH A;  1WW5 A;  3APB A;  3NVC A;  4IQP A;  2WYS A;  1GNY A;  4LBL A;  3VB9 A;  3OGS A;  2VMD A;  3RI9 A;  2ERF A;  2CGN A;  2IVJ A;  4TZD A;  1RUG 1;  1OH4 A;  3MBW A;  1SDD B;  4MLO A;  4CU6 A;  1DYO A;  1PVC 2;  3ORJ A;  4KG8 A;  2I2S A;  2ZMN A;  1EV1 3;  4QX7 A;  2RS3 2;  4AK3 A;  1NKG A;  1HV0 A;  3K3O A;  2ORX A;  2W91 A;  1CAX B;  1LU1 A;  4IEO A;  2PAM A;  1HB1 A;  2JG8 A;  2OUH A;  4B4P A;  2X10 A;  3OF1 A;  3ATG A;  3WW1 A;  2V72 A;  1QJZ A;  1QJU 2;  3ZR6 A;  3C7O A;  5JDB A;  3WF3 A;  2JIG A;  1FT9 A;  5DDJ 2;  2VY0 A;  1L7R A;  1OSG A;  4LOS A;  4Y22 A;  2R06 1;  3IT8 A;  3SEP A;  5BNO A;  4CCN A;  4AI9 A;  3RZK A;  1H6Y A;  5FUP A;  1C1L A;  3KVA A;  4XZP A;  4XHX A;  3USS A;  5C4W C;  1LGN A;  2RS5 3;  5KBF A;  1OQE A;  4CDX C;  3ZFG A;  4JGZ B;  1V6K A;  1F15 A;  1PZ7 A;  1CPN A;  4CCC A;  2WZR 3;  5LAS A;  1ENR A;  4JX0 A;  1O3R A;  1QU0 A;  2B46 X;  4NJ4 A;  4QHO A;  1BEV 1;  1ZVF A;  2E31 A;  4OFG A;  4NO4 A;  1RHI 2;  2ZX1 A;  3JBG 1;  5A32 A;  2HWE 1;  5K8S A;  1NE6 A;  1H8T A;  2VZU A;  2YB7 A;  4FXG B;  4NPR A;  4SBV A;  4R9A A;  5FJK A;  4M3C F;  5JOY A;  1GSL A;  1RVF 3;  1QXP A;  3TEW A;  1WUV A;  2IXC A;  3MV1 1;  1W06 A;  1YHF A;  4I0B A;  4A45 A;  1V6M A;  2WLQ A;  3NV4 A;  4OUM A;  1QJX 1;  2VOV A;  1IG0 A;  1UYZ A;  2D98 A;  2JDZ A;  3OUI A;  4JV4 A;  4Y1V A;  4XF3 A;  4CDQ C;  1RUJ 3;  3C7F A;  1EYB A;  2HWB 3;  2WRA A;  4H7L A;  2BNN A;  2DVD A;  3AZV A;  4LO4 B;  4DMI A;  1CJP A;  4MAD A;  1JYI A;  1CVN A;  3MEP A;  3FE5 A;  4PLM A;  2WAA A;  1J3Q A;  2A6X A;  3SXW A;  3RI8 A;  4N8M A;  5HXM A;  4EYU A;  2FHR A;  5ABJ A;  1NLQ A;  2WUH A;  4IEX A;  5IVB A;  1K5M C;  4QKF A;  1XE8 A;  2GAU A;  1R1A 2;  2Y33 A;  1Q8V A;  2Z69 A;  1TME 1;  4IV1 C;  4OCT A;  4WBB A;  1OUS A;  3U78 A;  4CTE A;  5GJ6 A;  3AMN A;  1I6X A;  2X05 A;  3AJZ A;  4LOT A;  4ZPI A;  4DS0 A;  3LAG A;  1DZQ A;  1X7N A;  2RR1 2;  1AYM 1;  4KBB A;  1EAH 1;  1XNA A;  3G6J B;  4IEP A;  4K6B A;  3GDB A;  3B9I A;  5K0U A;  5JVV A;  1IS3 A;  2WO3 A;  4UW6 A;  3ZIW A;  2ZX0 A;  4IEW A;  3DPR A;  5H9Q A;  3FLP A;  3LSE A;  1JZ4 A;  3WDU A;  1DZT A;  2MPF A;  3AP6 A;  3VBR C;  2XQR A;  2D93 A;  1YC6 1;  3HN1 A;  1KIT A;  3HQU A;  4XF4 A;  2DCJ A;  3BTY A;  1S0G A;  2G19 A;  1J84 A;  2OQ7 A;  5LEK A;  1SLB A;  1CON A;  1J83 A;  4P9L A;  3GCW A;  2PLV 3;  3IN9 A;  4CEW A;  3HAG A;  5FYV A;  3PVO A;  4C0B A;  3RZH A;  4MXV A;  5HCA A;  1JZ8 A;  1XQN A;  3CJI B;  4QPI A;  3EXU A;  3NO8 A;  5A6Q A;  5JCT A;  4PF5 A;  1YLL A;  3T4V A;  3LZZ A;  2VOT A;  5BY5 A;  5CIS A;  5E88 A;  5F3C A;  2IXJ A;  3OJB A;  5DZG A;  1RED A;  5JXJ A;  3NJV A;  3KD4 A;  3JD7 2;  3WIN E;  5FO8 B;  2WO1 A;  4P9G A;  5FLJ A;  5FYY A;  1RUG 2;  2PQQ A;  2QQI A;  4XQ4 A;  4ES9 A;  5J3U A;  3RZM A;  1OKQ A;  3RJ2 X;  1WMF A;  5FK8 A;  1VRH 1;  5DAP A;  5FV3 A;  1QNY A;  5FCC A;  3ZYP A;  2PAK A;  1VBC 3;  4OUE A;  3MIG A;  3UK9 A;  2B8M A;  3KB5 A;  2ZAB A;  4IES A;  2PHF A;  1F2N A;  4CEY A;  1Y3T A;  3HBK A;  4U36 A;  2LM3 A;  3AMH A;  4HL0 A;  3DXU A;  3R6S A;  4B4R A;  4K1Z A;  3AMQ A;  1AHS A;  1XRU A;  4CCJ A;  3IB3 A;  2FDI A;  3VHP A;  4KWJ A;  2VVF A;  3ACF A;  2B42 B;  3BTX A;  3Q8A A;  2JDA A;  1RUH 3;  1D4M 1;  2VD7 A;  2XLA A;  2Q8E A;  5K7P A;  4QGN A;  1WMD A;  2ZOE B;  2BOI A;  3E1F 1;  1SMV A;  4EN0 A;  4OHX A;  3TBD A;  1W6M B;  4YG3 A;  5I8S A;  5C9A C;  1JOD A;  1H8T C;  1SAC A;  4RS5 B;  1BEV 2;  1JYC A;  1ZNP A;  1GLH A;  2GH2 A;  2WA4 A;  2XL7 A;  4YG6 A;  2B5H A;  1MR5 A;  3SCF A;  3JBG 2;  1ZZ7 A;  3AKS A;  4GD4 A;  2HWE 2;  4HMZ A;  4XDQ A;  1C57 A;  3WG1 A;  1ULE A;  3LD8 A;  4AGR A;  3PUA A;  3H7J A;  2RM2 1;  1CJD A;  3WCR A;  1CWP A;  4XUT A;  3MIC A;  1CR7 A;  3JQX A;  5C8C B;  2DUP A;  3VZO A;  1QJX 2;  2WWU A;  1RUD 1;  4Q8L A;  3ZFE A;  4LJH A;  4BQ1 A;  4JKL A;  1H2N A;  3ZVX A;  3W5N A;  1VBE 1;  5FZK A;  4FPH A;  5HI0 A;  3FN9 A;  1E5I A;  3O1O A;  5IFT A;  1APN A;  3RG0 A;  3VBS C;  3OYW B;  4XQW A;  1TNR A;  3WDX A;  3V65 A;  3ZXE A;  3S57 A;  1S0E A;  2VBP A;  3KCC A;  1ASJ 2;  4CDW A;  2XJQ A;  4CRQ A;  5A7P A;  2WNV C;  4UWD A;  2VCC A;  2GMM A;  4AHX A;  5DUU A;  3H0O A;  3S6P A;  1KDK A;  1TME 2;  3RNS A;  2ZAH A;  1L3J A;  1HRV 3;  2NM1 A;  5CFD B;  2GSY A;  5K0U C;  3AXE A;  3U14 A;  1OOP B;  4IUG A;  1F35 A;  3POF A;  1AYM 2;  3DPR C;  1EAH 2;  3WR0 A;  2RJK A;  3WD5 A;  3AYC A;  3U10 A;  1K12 A;  1UY2 A;  2NMN A;  5EPA A;  5FDB A;  1ENQ A;  2VGD A;  1RUC 1;  2G4I A;  1XYO A;  2HLE A;  4XJ8 A;  4QKB A;  3NV2 A;  1OUR A;  4XJ9 A;  2BW8 A;  2ZEY A;  2R04 2;  4HK8 A;  2J1S A;  5CB7 A;  4CDU C;  2ORZ A;  5A7W B;  4XDP A;  3H8R A;  3VDA A;  3TN9 3;  1JMU B;  5GKA C;  2AEN A;  2C9A A;  4GAL A;  4IE5 A;  4NN0 A;  4QQP A;  4M3C E;  1GKB A;  4EJR A;  1UYP A;  4CSW A;  5AFB A;  3MPB A;  4CP1 A;  2VTX A;  1WCQ A;  5L9R A;  4RA0 A;  4D0Q A;  1PGS A;  4DRR A;  3MV0 1;  4BQX A;  3O1M A;  1VRB A;  5KXB A;  2MHF A;  4S2G A;  2VQ0 A;  2CHH A;  4ZKT B;  5F2W A;  5E89 A;  3R05 A;  5EJZ B;  3VBH C;  4ZZ8 A;  4LUL A;  4QX3 A;  5DAB A;  3IDB B;  4TSV A;  1CGP A;  4JQT A;  2WSU A;  5JWP A;  1VRH 2;  4AVC A;  3ZXG A;  4CEY C;  1JYW A;  5F6K A;  4XE9 A;  1R64 A;  1UZ0 A;  3QAC A;  4CCD A;  1ZRC A;  2DVG A;  4M0N A;  4A7Y A;  2EXJ A;  1JZ5 A;  2GME A;  1F31 A;  2P3J A;  3EO6 A;  3EHK A;  4HPK B;  5BNN C;  3F2Z A;  4IV3 C;  1RXF A;  5F39 A;  3BOD A;  4Q0Q A;  3DKQ A;  3ES4 A;  5CFC A;  3I2G A;  1KXG A;  1VBD 1;  1LRH A;  1MZ5 A;  3J7H A;  4IND A;  5FPV A;  1SEF A;  4JGY C;  4YVW A;  1IS5 A;  4DXZ A;  3ZFF A;  5GLT A;  4Z92 B;  1RL3 A;  1UU6 A;  3DYP A;  1QXR A;  2DDU A;  5I93 A;  3I49 A;  4COV A;  3LDR A;  3WEZ A;  1CZT A;  2Y8K A;  2DVF A;  3U75 A;  3VZK A;  3I59 B;  2Y26 A;  3ST7 A;  1NAE A;  1WME A;  5DN2 A;  1A3K A;  4RFT 0;  3III A;  4UFK A;  2DCZ A;  3O1R A;  2RM2 2;  2OW4 A;  4F7Z A;  1GNZ A;  3PL0 A;  1YWK A;  5D8A C;  1BJQ A;  1RUD 2;  3PUQ A;  1OQD A;  1UMI A;  5T54 A;  4DOU A;  4KL1 A;  4CP9 A;  1VBE 2;  1ZBA 1;  5H9P A;  4E4H A;  1ZRF A;  3AYA A;  3VBF A;  2IFR A;  2DTY A;  2PHX A;  2YBP A;  1BYH A;  1W99 A;  3NJX A;  3WP5 A;  1GZW A;  3K46 A;  5JUV A;  5FO7 B;  1Q8Q A;  1NCR A;  4ORF A;  1W90 A;  2JG9 B;  1PMI A;  2P5B A;  2VOK A;  5FYU A;  3H8X A;  1W0P A;  4MGY E;  5HV4 A;  2K9Z A;  5IVJ A;  2FD8 A;  5IK5 A;  1LJ7 A;  1BXH A;  1O4Y A;  1FOD 3;  3NAP B;  1AR8 2;  3NKG A;  1KGY A;  4R52 A;  1JTZ X;  2HKX A;  2R07 1;  3ILR A;  1UW8 A;  1ND3 A;  4Q4V 2;  3USU A;  3WDY A;  3VBO A;  4XF0 A;  1UIK A;  2DCT A;  2W68 A;  4XDO A;  1CAU A;  4FFH A;  5GLU A;  5KHH A;  3OGV A;  1LCL A;  1QQP 3;  4Q1P A;  3ZDV A;  1CZS A;  2BFU L;  4PQQ A;  4BK4 A;  2WFF 1;  4D6R A;  4Y20 B;  4JKM A;  4CYD A;  5C4W B;  3CDZ B;  1GU3 A;  4NRQ A;  4CDX B;  4EN6 B;  1AUY A;  4O7X A;  2QQW A;  3UYJ A;  4XAA A;  3QBQ A;  1QKQ A;  1QH6 A;  2AR6 A;  4HZF A;  3AZZ A;  5FKC A;  2DUQ A;  4I09 A;  2DVA A;  3EMR A;  1VPH A;  3WQ0 A;  1RMU 2;  1PIV 2;  2XWJ B;  2RHP A;  2BU9 A;  5FZC A;  5L73 A;  2ZBJ A;  4E9K A;  5B4X A;  4L2N A;  4FAG A;  2VMH A;  2DYC A;  3CMG A;  3LA7 A;  4IEU A;  4LK7 A;  4RGG A;  4XJW A;  4QQ2 A;  2XVK A;  4CDQ B;  2RS1 1;  3BIE A;  4XUN A;  2XJR A;  3OGR A;  4FFG A;  2XHK A;  2WS9 1;  3MIB A;  3CBN A;  5JIA A;  1O8S A;  1UPI A;  2ZGL A;  3POG A;  4GJZ A;  2IWG B;  4K8R B;  3Q8C A;  1WW7 A;  2FCV A;  3U1X A;  3B9C A;  4QU1 A;  4Z82 A;  1N1S A;  2VAU A;  3KVB A;  2PMW B;  2OX0 A;  5CG9 A;  1OQ1 A;  1JU4 A;  1QEX A;  1W9T A;  5LWB A;  2HEW F;  4H2A A;  1K5M B;  2BGC A;  2ZEX A;  1LGB A;  1RIR A;  5CFC C;  1C4R A;  1YQ8 A;  1FYU A;  2SBA A;  4IV1 B;  1UQX A;  3LEI A;  4OLL A;  1NT0 A;  4C1X A;  1Q8P A;  3S7E A;  2JDY A;  2R0H A;  2OZ6 A;  1JOP A;  2V09 A;  2W52 A;  4HON A;  5IJR A;  2QJV A;  1SCR A;  1DQ1 A;  1R09 1;  1ZBE 1;  3WG4 A;  4CU9 A;  3AB0 A;  4HSL A;  1ULG A;  3VBR B;  2Q8O A;  4TXW A;  1K3I A;  2JE7 A;  3BI3 A;  4O9G A;  5FK7 A;  1SCS A;  4BA6 A;  1YFX A;  4FP2 A;  3ON7 A;  3LOI A;  4RHV 1;  4JVA A;  4Q4W 1;  3WF1 A;  1YCI A;  3OBZ A;  2OII A;  4UI9 L;  2SLI A;  2ZHN A;  3SH4 A;  2OPK A;  2VXR A;  4V2V A;  1DLC A;  2YZ4 A;  5JXG A;  1FXZ A;  1NG0 A;  5KC6 A;  3SLI A;  1KFU L;  2RDS A;  3Q9O A;  2OS2 A;  1ZBA 2;  2Y6K A;  5EXO A;  3KHB A;  3ZN6 A;  4L11 A;  4GH4 C;  4S2D A;  2WII B;  2NMO A;  1RUN A;  2VU9 A;  2J1E A;  2JE9 A;  2I07 B;  4HET A;  5BNP C;  2DFC A;  3R4S A;  4HOO A;  1AL2 2;  1UPS A;  3UJO A;  2CDO A;  4XFH A;  4XQD A;  3VDD A;  2BPA 2;  4QX0 A;  3IAP A;  3K48 A;  4LHL A;  3HT2 A;  2UYB A;  1DP0 A;  4BWO A;  1ND3 C;  3MF9 A;  3HVD A;  4KWL A;  1DGW X;  1S2K A;  4YLZ A;  5H9S A;  4J1W A;  3DUI A;  4DY5 A;  1LR5 A;  2R07 2;  1JOJ A;  2IUW A;  1OVS A;  1O6U A;  1HXS 1;  2BNM A;  5AFE A;  2VTX J;  2A7A A;  2EIB A;  4AR2 A;  4NUB A;  4MG2 A;  3I3M A;  2WZE A;  3Q8E A;  3ZLI A;  3THT A;  2G9F A;  2WFF 2;  2Y6L A;  2LS6 A;  1O3Q A;  1SPP B;  4K7J A;  2YGL A;  2R32 A;  5FY1 A;  2HH9 A;  4Q26 A;  5J37 A;  2E7A A;  3AK0 A;  1W6P A;  3M3O A;  5C9A B;  1SG3 A;  3OGG A;  2TEP A;  1A78 A;  3FFQ A;  4YZ1 A;  5A1L A;  3AKQ A;  4MXW A;  1WLT A;  1BBT 1;  2RJ2 A;  2D5F A;  4EN7 B;  2Z4F A;  2VNV A;  4QGL A;  2Z2S B;  5JSR A;  3N7L A;  4RGK A;  5GZE A;  1BK1 A;  4NOT A;  2E53 A;  2UYA A;  1IKQ A;  5F5I A;  5KHG A;  1ZYB A;  4W6X A;  5FBJ A;  1KRI A;  3UGG A;  1UXX X;  3QLQ A;  2GAL A;  4HVR A;  4LBQ A;  5A7S A;  1GOH A;  2RS1 2;  3AP7 A;  4AFB A;  1XSR A;  4BJ0 A;  2EF6 A;  1DYP A;  1UIJ A;  2WS9 2;  5DZE A;  4URA A;  3BB6 A;  1DU3 D;  3T0B A;  3T08 A;  2Q0A A;  3VBS B;  2D43 A;  4ZHN A;  4FI9 A;  5CG8 A;  5JZG A;  4KH9 A;  3KCY A;  1UKR A;  4QQL A;  3WHT A;  1VBB 3;  2V4V A;  3EB7 A;  1Z7S 1;  1TMF 1;  3SKV A;  3I4I A;  4LUK A;  2WNV B;  3JQW A;  3LWC A;  5FAX A;  5FPZ A;  5FY0 A;  1Z78 A;  2J22 A;  5FZO B;  4LLF A;  3NNM A;  2Z79 A;  3OBT A;  5FYS A;  2VZS A;  3MLJ A;  3ZPO A;  4C91 A;  4DO0 A;  5KR7 A;  3VDC A;  1UOB A;  2JIJ A;  4Y33 A;  3IDC B;  4ATF A;  2A6Y A;  3DPR B;  4NWV A;  3NQH A;  2A75 A;  2WA3 A;  1COV 2;  3WNN A;  2VL4 A;  3I3E A;  1U0A A;  4Q2F A;  1R09 2;  1ZBE 2;  2WBK A;  4E8C A;  1GP6 A;  1QNW A;  2MEV 1;  1DGR N;  3LGR A;  1VR3 A;  4QB1 A;  2A3W A;  2R1B A;  1OC1 A;  1OKO A;  2A1X A;  2J42 A;  4Y26 A;  4YPJ A;  2C1F A;  4JCK A;  4RHV 2;  5CKM A;  2KXL A;  4Q4W 2;  4QM9 A;  5JXH A;  5EJ1 B;  1MEC 3;  2FBE A;  5IK8 A;  3LA2 A;  4CDU B;  5FOB B;  4I3P A;  3ACH A;  4LBJ A;  1Y43 B;  2A6Z A;  2YMZ A;  3UKN A;  2HEY F;  2WT2 A;  1QGL A;  1SBF A;  3KCX A;  3CO2 A;  4L9B A;  4XFF A;  5BYN A;  5I0U A;  5T55 A;  1RUE 2;  1H4G A;  3MYX A;  4QB2 A;  4BOW A;  4LTA A;  1ENX A;  1NOV A;  2HWF 1;  4UBG A;  4OQ9 A;  1LOD A;  2QQL A;  3ACG A;  5FQ0 B;  3N9P A;  1XOY A;  1JUH A;  1MS4 A;  2XJP A;  5A3O A;  2YHJ A;  3K51 A;  1WLW A;  3VBH B;  5DAQ A;  4ZS3 A;  3HJR A;  2E6V A;  5DQ0 A;  5KHJ A;  5HPO A;  2VEC A;  3M3C A;  1WD3 A;  4RSU A;  2WYF A;  2ATF A;  4TTG A;  3ZYJ B;  2EVX A;  1UAI A;  4N9H A;  3KS7 A;  1W2O A;  1PO2 1;  3NMB A;  4OVE A;  5FZD A;  4DZG A;  5FZ3 A;  4ES8 A;  3ZSE A;  4UFI A;  5EFU A;  1GIC A;  5L9V A;  4W6Y A;  5BNN B;  5D1I A;  1HXS 2;  3ETP A;  1AL0 G;  2ZGR A;  4IV3 B;  4LHK A;  4M3C A;  1DBN A;  3F95 A;  1RUF 3;  2EID A;  3H9A A;  4BIF A;  1YXW A;  3LSD A;  5L7O A;  1GP4 A;  1V70 A;  1AR9 3;  2KM2 A;  2JE8 A;  3CZJ A;  2VVD A;  4UF0 A;  2B4K A;  4FPG A;  2XJS A;  1BKZ A;  3DXT A;  4JGY B;  1QOO A;  2YPD A;  5JIU A;  2P2K A;  1E5H A;  1S55 A;  4EWA A;  5J48 A;  4I2O A;  3SMH A;  5F6L B;  3Q8F A;  4L99 A;  4AEJ A;  5LB6 A;  4AYU A;  1IKP A;  1PVC 3;  3GZT B;  3ZOI A;  2BZD A;  2JD4 A;  2GMP A;  3FHA A;  1WA6 X;  4WZF A;  1BBT 2;  4Y1U A;  2RS3 3;  4URT A;  3T2Q A;  5C3O A;  2QBX A;  4LIU A;  1W2A X;  2W92 A;  1PNF A;  1QMJ A;  2AH2 A;  3HR9 A;  3IAQ A;  4QXK A;  3W58 A;  1I5Z A;  1M4W A;  3HPN A;  1LKN A;  1YEW A;  1QJU 3;  2VNG A;  2W0X A;  3CU7 A;  2TBV A;  4JTO A;  5D8A B;  5DDJ 3;  4AF9 A;  2D6O X;  2W1U A;  2D6P A;  3MIF A;  2VZQ A;  4YM1 A;  4AVA A;  1F4H A;  3I7D A;  4B8E A;  3OD0 A;  1TZO A;  2ZCW A;  4PIZ A;  4KU7 A;  3E6C C;  4D94 A;  4V2W A;  5A3P A;  2A6W A;  2DCY A;  3H3L A;  2C24 A;  3QOP A;  3PME A;  1G9D A;  4RQP A;  1Z7S 2;  4RYD A;  3MI8 A;  2RG4 A;  1Y7B A;  1JI6 A;  3B01 A;  1GWM A;  4GWM A;  2BFU S;  3BYW A;  4HAN A;  4PI2 A;  4QHB A;  5AVP A;  2OYZ A;  1XC6 A;  3BPS A;  4RFR B;  3O1V A;  2QQU A;  4AAP A;  2FDF A;  5FP9 A;  1VAV A;  3M70 A;  3MLL A;  4QDS A;  2VNO A;  4Q8K A;  4XUR A;  4XCA A;  5C3Q A;  1W39 A;  4XBL A;  2MEV 2;  5IAX A;  4YW5 A;  2JEN A;  2XHN A;  3W21 A;  4COW A;  3L2Y A;  4LK6 A;  1YJK A;  4J1X A;  3T2P A;  4DUW A;  2ZKL A;  1LHV A;  5FYT A;  4Q4Y 3;  1LED A;  3POY A;  2UWA A;  3RZJ A;  3HD8 B;  1H8V A;  1I5P A;  1DIW A;  2JX9 A;  3KF5 A;  3MW2 A;  4GIQ A;  3T30 A;  1B09 A;  1WKY A;  3RVH A;  2HWF 2;  1KEX A;  3VD3 A;  1VMH A;  3ROU A;  4P9I A;  2JDN A;  4WVV A;  2XVG A;  5HBA A;  2PHR A;  3JD7 1;  3U07 A;  3HN3 A;  1B35 C;  3MLK A;  3OB8 A;  3I3D A;  1C1F A;  3ZSM A;  2ENR A;  3WF0 A;  1A34 A;  4ZY9 A;  3B00 A;  3V0A B;  3WF2 A;  1O59 A;  2YDE A;  2C4X A;  2ZZJ A;  5T5L A;  3HWJ A;  3IM0 A;  2GH8 A;  2Q30 A;  2N7G A;  1UY3 A;  1HW5 A;  1PO2 2;  2XLG A;  4ONU A;  4XFB A;  3O0W A;  3POW A;  1J1L A;  5F37 A;  5C5T A;  1V9U 2;  1R08 1;  4AWD A;  4AFM A;  5L7O C;  1H2M A;  4OZO A;  3B69 A;  1V6O A;  4GB3 2;  1TNF A;  3FFZ A;  3N4M A;  5CYY A;  3BIW E;  5LY2 A;  4PLN A;  5CZK A;  3ZXK A;  1QJF A;  4BIO A;  3PUH A;  1ST8 A;  1GZC A;  4AQS A;  4EZ4 A;  1UX7 A;  2WZR 1;  4BK5 A;  2DUR A;  3UGH A;  1MQT A;  4DUV A;  1X8E A;  1LOF A;  1RUG 3;  1LNS A;  2W95 A;  1OF4 A;  5CAZ A;  4IE7 A;  4Z8B A;  2E33 A;  2ZZQ A;  1AX0 A;  2R1D A;  1N3P A;  2ZGN A;  5JR7 B;  4GMP 1;  4N43 C;  4OUL A;  1YI7 A;  4GXL A;  3URF A;  4YFZ A;  3O5S A;  4XOG A;  2R16 A;  5F32 A;  3OUH A;  1RUI 2;  5FPL A;  2ZX2 A;  4PDW A;  4CCE A;  1HV1 A;  1UN1 A;  3U11 A;  1XXN A;  1H1I A;  3VD7 A;  2VMI A;  4OMD A;  1RUJ 1;  1PNG A;  2R06 3;  4NIH A;  2HWB 1;  3NRU A;  5F7U A;  1LEN A;  4GH4 B;  1GWK A;  4YZ3 A;  4RQP C;  4AFC A;  4QPG B;  3O7O A;  1UNB A;  3TB0 A;  5BNP B;  1PO1 3;  1W6Q A;  3H3U A;  3C7G A;  5LBB A;  1ASJ 1;  2JKB A;  1BEV 3;  3VBU A;  2H0B A;  2CYF A;  2CL2 A;  1BK0 A;  3JBG 3;  1CAW A;  2HWE 3;  1ND3 B;  2WJS A;  1W3X A;  1SLI A;  3M3E A;  3FL7 A;  4L97 A;  2YXS A;  1IS4 A;  4YVS A;  5IVE A;  3P1I A;  1LHU A;  4RR3 A;  4PI0 A;  3PUI A;  1V6I A;  1KQR A;  4W4Z A;  3MW3 A;  1FPN 2;  3IDA A;  2GN3 A;  2VBB A;  4FVV A;  3THD A;  2X5I C;  1QJX 3;  2ZGP A;  1NA1 C;  4JC1 A;  3T2T A;  4ZZ5 A;  1N3Q A;  1F8V A;  2EIC A;  3M8L A;  3E5U A;  2A5Z A;  3M1H A;  1G8W A;  1I1E A;  4LNV A;  4ARX A;  4MSV A;  3BKZ A;  1MS8 A;  3P3N A;  1PM7 A;  2QUO A;  4HKL A;  2HYK A;  2WN3 A;  2CAU A;  4QX5 A;  4WM7 C;  4K20 A;  4ZXE A;  2FDJ A;  2AAC A;  2R04 1;  1NCQ A;  5JOX A;  4BZ4 A;  1STM A;  4AED C;  5IT6 A;  5HCF A;  1FNY A;  1RXG A;  1TME 3;  1ZZ6 A;  2OXB A;  1PGW 1;  5FYZ A;  2DU0 A;  4KMQ A;  2FCU A;  3HBZ A;  1YIP A;  3POI A;  1AYM 3;  1EAH 3;  1X33 A;  1AX2 A;  3R4U A;  1XE7 A;  3ME2 A;  3HQR A;  2WNE A;  1CAV B;  4EQV A;  3SIT A;  3I2H A;  1DGR A;  1HQW A;  1SBD A;  3H50 A;  3N7J A;  5CIR A;  3AL6 A;  1ACC A;  1YYN A;  2CGO A;  3I3B A;  4AI0 A;  5J1X A;  1KDM A;  3HIF A;  3N35 A;  1QWR A;  3E5Q A;  3IIA A;  1W8W A;  1ND2 A;  1VBC 1;  2JG8 C;  2ZKN A;  5T5J A;  1W8Z A;  4JDM A;  4WVM B;  4BB3 A;  4MYE A;  5GZG A;  1W28 A;  5KHI A;  2X53 S;  4K8F A;  1R08 2;  5BNO C;  4S2H A;  5JMO A;  1WLC A;  4XFC A;  4C90 A;  5I91 A;  1N1T A;  3HEI A;  1UZY A;  4YGB A;  3LEM A;  1GAN A;  5DG1 A;  1O5L A;  5LCW L;  5LRS A;  5F5A A;  3DGT A;  1DFQ A;  1GWL A;  1GYK A;  5CNA A;  3ZXD A;  4XXA A;  2W2I A;  2XXZ A;  3ZFG C;  4FPL A;  1W6N A;  2DFB A;  5A6Z A;  5BNQ A;  2YRO A;  1KS4 A;  4JHT A;  4BIS A;  1UWW A;  2WZR 2;  4Y5Z 0;  5T50 A;  4WV8 A;  4DIN B;  1UY1 A;  5BUV A;  3B94 A;  4E2Q A;  1CX4 A;  5FR3 A;  5L19 A;  3L2H A;  1ZZ8 A;  4LT5 A;  2WNO A;  4QXC A;  3CEW A;  3OPT A;  1VRH 3;  4PDW C;  1LTE A;  1BLZ A;  4FXK B;  2DBN A;  3WQ7 A;  4EZH A;  1S4C A;  2KA3 A;  5IVY A;  1W8F A;  1WLD A;  4PIY A;  1RIT A;  4R8H A;  1NYW A;  1ZM1 A;  1G9C A;  1H1M A;  1NZI A;  1RUJ 2;  3RWK X;  1W05 A;  3LCP A;  4AVS A;  2D44 A;  2HWB 2;  1KFX L;  2BYV E;  4CU8 A;  2XL9 A;  3KT7 A;  4AQT A;  2PN5 A;  3RGB A;  2HWD 3;  3H7Y A;  4FPY A;  4NIG A;  3VDB A;  1EUT A;  4WZC A;  3CF6 E;  2RDN A;  1D4M 3;  3B93 A;  3CJX A;  3ZSL A;  5ABJ C;  3AZY A;  3H8U A;  5C3P A;  3KT4 A;  1IG3 A;  5J36 A;  2C5D A;  3O0V A;  5F2S A;  4QAW A;  2W1W A;  1GOG A;  2HYX A;  4Q27 A;  1QY4 A;  1T6B X;  4YVS C;  5KXC A;  1X50 A;  4QQO A;  3DYM A;  1RJ7 A;  4IEZ A;  1SFY A;  5T5P A;  2YYO A;  5IFP A;  1X9T A;  3AKT A;  4HXC A;  4XAC A;  1AR8 1;  4Q5O A;  1AXZ A;  1YO8 A;  4MZU A;  5DUX A;  5FZ8 A;  5LBE A;  3VD5 A;  1AYN 1;  4P9W A;  4Y3O A;  1YFY A;  4YYO A;  4CCO A;  5IVC A;  3VLB B;  4I0W B;  4Q4V 1;  1NXM A;  3WG2 A;  1RUD 3;  1WCK A;  4Z2A A;  3O12 A;  4IEQ A;  1F5F A;  1LOA A;  5DUW A;  1VBE 3;  3LPG A;  1SBE A;  2W1Q A;  1UY0 A;  1N1V A;  4AQ6 A;  1OVP A;  3WP6 A;  4Z2W A;  1N1Y A;  1T2X A;  4MET A;  4I01 A;  3MHZ A;  5EWS A;  5FZ1 A;  4CEW C;  3POE A;  3LA3 A;  2I45 A;  1AVB A;  2ID4 A;  3WW2 A;  2E63 A;  1IPJ A;  1HB4 A;  1SLL A;  2ETE A;  2XR4 A;  4QPI C;  3OOX A;  5FZH A;  1LUL A;  3DV8 A;  4LBO A;  3D82 A;  3UJQ A;  4BQ3 A;  5ACA 3;  2FDG A;  3ZXL A;  5IVV A;  4CCK A;  2QQO A;  4FOW A;  2BVB A;  5A33 B;  1EPZ A;  1W9F A;  5GLV A;  5A7O A;  4R9D A;  1PGW 2;  4HLT A;  1RMU 1;  1PIV 1;  2VMC A;  1JU3 A;  1PK6 A;  5FLH A;  3AKR A;  5JMC A;  1SQ4 A;  3AJY A;  4PBO A;  3K4A A;  3ZXF A;  4F3J A;  4LA3 A;  5FZG A;  2JDU A;  1C28 A;  4LO6 B;  4BLI A;  4AQ2 A;  1URX A;  2W1S A;  3UET A;  3QH7 A;  1RUC 3;  2WT0 A;  2LRP A;  1C8M 1;  4COU A;  1VBC 2;  3H8O A;  3MIE A;  3ZXA C;  2VW0 A;  5FXW A;  3DYO A;  3FUQ A;  1BVP 1;  2D6K A;  4RGA A;  4XJU A;  3AFG A;  3V0B A;  3J7L A;  4IGQ A;  3ZYG A;  2B9U A;  3I54 A;  4YM0 A;  3HNM A;  1H30 A;  3IPV A;  4XFA A;  2R7E B;  3RMY A;  3VL8 A;  4WM8 A;  4HKO A;  1MS9 A;  2WIN B;  3MUZ 1;  3AP5 A;  4GZ9 A;  5FZ0 A;  2JDM A;  3GM8 A;  3N3H A;  2J1V A;  5FY9 A;  1AZD A;  5A80 A;  1HIX A;  1KJL A;  3EJK A;  4I3G A;  2A6V A;  1V6J A;  2GNM A;  5DAW A;  1OD3 A;  5FZL A;  2PHT A;  5FWJ A;  4AHZ A;  2VZP A;  4GA9 A;  3GAL A;  2ADE A;  4JZR A;  3FWE A;  3JXS A;  4AI2 A;  1OXC A;  4KGQ A;  5LW9 A;  1JYN A;  1Z0H A;  2BV4 A;  2VXJ A;  3VD4 A;  4XET A;  1CAX A;  4BQW A;  2K0G A;  5I0S A;  3ZFE C;  4BLJ A;  5E6H A;  4C0H A;  5IK4 A;  2ZXQ A;  1WW6 A;  3WP3 A;  5FRE A;  1C5H A;  1U5X A;  2ZS6 B;  1VBD 3;  1YNA A;  3J7N A;  4NAO A;  4ITC A;  3D8C A;  3O1T A;  1RC6 A;  3OBR A;  3IDE A;  3J8F 1;  4BCU A;  4CDW C;  5LAT A;  3VHN A;  1B35 B;  3ZR5 A;  4Y5T A;  1LOB A;  3PHM A;  1OLR A;  2OQ6 A;  3CNA A;  4JGZ A;  2VE1 A;  4QB6 A;  2WZ8 A;  1O3T A;  2UY9 A;  1AL2 1;  2P3K A;  2RVA A;  1OPO A;  5J98 B;  4A3Z A;  1XNB A;  2PTM A;  2CV6 A;  2F17 A;  5GZC A;  4BMB A;  4E4S A;  1MS1 A;  1W6O B;  3RZG A;  1US3 A;  1OBN A;  1S0C A;  2GC3 A;  2A71 A;  4PBP A;  1AYN 2;  5DXD A;  2LTN A;  2VNR A;  4NHX A;  4UFJ A;  1Y9Q A;  1BMV 1;  1POV 1;  2AC1 A;  3BU7 A;  1RYY A;  5D2A A;  1DDL A;  1Q56 A;  5F5C A;  5AC9 3;  1DGL A;  3KLS A;  3AMP A;  4OI0 A;  1JHJ A;  1UU5 A;  2XPJ A;  2QQM A;  4M00 A;  2B7Y A;  4JRL A;  2JDH A;  1T6G C;  3TN9 2;  5FWE A;  4LKE A;  4MGT A;  2CY6 A;  2OKX A;  4D7Y A;  3JB8 A;  2VPV A;  4K1Y A;  4N43 B;  5FMB A;  4FOY A;  4LMF A;  1SZB A;  2YU1 A;  3AC0 A;  4IGP A;  3THP A;  3S0M A;  2VC9 A;  4TN7 A;  2VMG A;  5FJH A;  3ZMN A;  2ZGT A;  3P5B A;  3QCW A;  4LBQ D;  1Y4W A;  4QX1 A;  5B4N A;  4YFW A;  2XQX A;  2E32 A;  2ZGQ A;  2J1T A;  4QKD A;  5FZM A;  3WW3 A;  1U5Y A;  3RQ0 A;  1AF9 A;  2YFZ A;  4Y1X A;  3ILN A;  5FZF A;  2C9K A;  4XFG A;  1OLM A;  3VKM A;  2EIE A;  3VKF C;  1YQC A;  1PVX A;  3UKV A;  1WCD J;  2BQP A;  1W04 A;  1C8M 2;  3ES1 A;  4MUV A;  2D3P A;  3BU0 A;  5FYB A;  4DXR A;  2ZJC A;  3OY8 B;  3VGI A;  1E57 A;  1W0N A;  2IXL A;  4WM8 C;  5JAX A;  1H6X A;  2VW2 A;  2P4E A;  5BPX A;  2ZTN A;  4FQ4 A;  1L7Q A;  3KT1 A;  4YM3 A;  1F4A A;  1ODM A;  1VB2 A;  3CJI A;  5EZW A;  1ZRD A;  4GQ7 A;  1D7P M;  3NNF A;  3P6B A;  5EYX A;  1GNH A;  4YVW C;  1IZ3 A;  2X5I B;  4YNI A;  3VL9 A;  3ZFF C;  1MS5 A;  1NA1 B;  1BCX A;  1COV 1;  4YM2 A;  3DKW A;  1I3H A;  4RL7 A;  1PHM A;  5APA A;  5FMC A;  4EV0 A;  2RS1 3;  4XYX A;  4YZ4 A;  2D5H A;  3OTF A;  2WS9 3;  2GP3 A;  4P9J A;  2NYY A;  2PHW A;  2VUA A;  4XPV A;  2OVU A;  3MZH A;  4WM7 B;  1AR6 3;  1PZ9 A;  3NV1 A;  2GNT A;  1C3H A;  2BWA A;  4HK9 A;  5IAT A;  2OT7 A;  3C3V A;  1XYN A;  3WXP A;  4MX3 A;  5ANN A;  3NW4 A;  4AED B;  5EQU A;  3H42 B;  4JQR A;  1A8D A;  3KWV A;  5C71 A;  5F3E A;  2F4P A;  3GHN A;  3VBF C;  1RUE 1;  1GFF 2;  2Q1Z B;  1LEM A;  2HBT A;  4YSF A;  2XG3 A;  4QX8 A;  3U37 A;  4TWT A;  3KGZ A;  3WNO A;  1NCR C;  4JGZ C;  4M4R A;  4B3N A;  3J8F 2;  2EAA A;  1R09 3;  1ZBE 3;  2DV9 A;  3WCS A;  4BQ4 A;  1H9P A;  4MHR A;  3POB A;  2ILM A;  4QDR A;  4DFS A;  4DXS A;  3E5X A;  1OA3 A;  1PX4 A;  4P9X A;  5T52 A;  1WBL A;  1W6M A;  2JG8 B;  2P3I A;  2WSV A;  4RHV 3;  4RS5 A;  3TYJ A;  3ZO0 B;  2EIG A;  1H2K A;  5DZF A;  1EPW A;  2DBI A;  4XFI A;  3GXU A;  2WO2 A;  4O9E A;  4Y22 B;  3VBO C;  5BNO B;  5JSO A;  2WC2 A;  2O8O A;  4A6O A;  3NL1 A;  1AJK A;  1XE0 A;  4Q0V A;  2ARB A;  2PEL A;  4UAP A;  1UMZ A;  1BMV 2;  1UKG A;  3WUC A;  3LDB A;  4XTP A;  5C8C A;  3HMY A;  1JN2 P;  2P6H A;  2D6L X;  3J9S A;  3ZFG B;  4QDQ A;  1ZZC A;  3ZKY A;  5C3R A;  3Q8B A;  5LA1 A;  3SCG A;  1JS9 A;  4XUP A;  2D3R A;  3E6B A;  1DG6 A;  2W5F A;  1U5I A;  2CAV A;  2CDP A;  4KBZ A;  4A7K A;  1SHW B;  1NE4 A;  3CQO A;  1QJE A;  3OYW A;  4G4F A;  5A32 B;  3FJS A;  3WQ1 A;  4NWW A;  1H8T B;  3AP4 A;  3U4S A;  3CHX A;  3W5M A;  4PDW B;  3A4U A;  1UZZ A;  3ZYR A;  1S0D A;  3GBG A;  2J1A A;  3OCP A;  2UWB A;  4DB5 A;  5KXE A;  4YGC A;  4QXH A;  4CUC A;  1EP0 A;  4CXY A;  1CES A;  3A21 A;  3KMH A;  5CFD A;  1AR7 3;  3SHR A;  3ETQ A;  2Y6H A;  1DQ2 A;  1OOP A;  2JJ6 A;  1HLC A;  2JXA A;  4ZXK A;  3KZ4 C;  2ZGO A;  4L92 A;  1VIW B;  4FT8 A;  5FYC A;  5IAV A;  4Q4X 1;  2WDB A;  4FAH A;  1MS0 A;  2XGX A;  1CN1 A;  5ABJ B;  3VZM A;  4OZX A;  1VBA 1;  2VCB A;  2UU8 A;  4YVS B;  3CJI C;  1BBT 3;  3MID A;  1D0G A;  4R4Z A;  5DMY A;  5K0U B;  1W3V A;  5J7M A;  4NHL A;  4JDO A;  5DPN A;  1JZ7 A;  2WLP A;  2P1B A;  2FZ2 A;  2VCM A;  1X9P A;  1XPW A;  1QF3 A;  3I2K A;  1EY2 A;  1X82 A;  2D7F A;  2Y6G A;  4IW3 A;  1G9B A;  3WF4 A;  1Y9M A;  3NKT A;  1I9R A;  5EV7 A;  4E2S A;  3JB4 C;  5J96 B;  3NV3 A;  4AXO A;  3V64 A;  1V6L A;  2BGO A;  1F5J A;  1GQG A;  2NLR A;  3GGL A;  4CEW B;  4I0A A;  4IER A;  2LUW A;  5IHR A;  1VAM A;  4PJY A;  5I0T A;  1GV9 A;  3DL3 A;  2AEY A;  4N53 A;  4TLF A;  4TLG A;  4BDV B;  3ZN4 A;  4QPI B;  1C8N A;  3A0N A;  1TMF 3;  3M4F A;  1HN1 A;  2XBO 1;  4HG6 B;  4HSJ A;  5DAX A;  4DEQ A;  3OSD A;  3RFR A;  3LPF A;  4HPK A;  1VAL A;  2RJL A;  4B4Q A;  4G3Y C;  4AI8 A;  1FI2 A;  4NRO A;  1K45 A;  3LEK A;  3KQR A;  3G7D A;  3SNM A;  2QQJ A;  1VMJ A;  1W9Y A;  2MEV 3;  4UBH A;  3VDD C;  2XUM A;  2XKO A;  4D7T A;  3T0A A;  1HKD A;  2YC0 A;  2WFP A;  4IET A;  4XUQ A;  2QDN A;  1N3O A;  3K3N A;  3U0Z A;  1FV3 A;  1VLN A;  4CEY B;  2G9Z A;  2QVS B;  4MV2 A;  2G1M A;  4YZ5 A;  3MFC A;  5JI7 A;  4I30 A;  3GHM A;  4P02 B;  4H55 A;  1IHM A;  1V9U 1;  1NUK A;  1QIQ A;  1FAT A;  5FP7 A;  4ZU4 A;  3WP4 A;  2UY8 A;  1AR9 1;  2HWC 3;  3BUC A;  4GB3 1;  4EWD A;  4AFD A;  1QDO A;  2C26 A;  4Y5S A;  1FMD 3;  1UYX A;  4H14 A;  4K3U A;  1NY7 1;  2BBA A;  5FZ7 A;  2HWF 3;  1IQD C;  2WQ8 A;  3SEE A;  3AXD A;  1QJY 3;  1XBF A;  5SV5 A;  1YUD A;  4IEY A;  2V4A A;  4KG0 A;  4Q1R A;  1GMM A;  5A6X A;  1ZA7 A;  1W2T A;  2BER A;  2ZGS A;  2DF7 A;  2BEO A;  2AYH A;  2ET1 A;  2CWM A;  2JG9 A;  2VOW A;  3A22 A;  2W3J A;  3OGJ A;  2GND A;  1RUO A;  2RMU 1;  4CUB A;  2FDH A;  5CFD C;  3E97 A;  3M3Q A;  3VUO A;  1PO2 3;  1KD7 A;  5IWF A;  3RRD A;  4X6R B;  4ZU5 A;  3ZFE B;  2BGP A;  4KWU A;  4UFM A;  1RUI 1;  1SLA A;  1CIY A;  2PYT A;  3GYD A;  3NAP A;  5FZ4 A;  4GJY A;  1LB2 A;  4MGQ A;  5FP3 A;  2V5D A;  2VUL A;  3UV9 A;  1PGL 1;  3FHQ A;  3K4D A;  3RSJ A;  2J7M A;  4CUG A;  2JIC A;  5LK5 A;  4QXB A;  1DHK B;  2E51 A;  3MUY 1;  3I2O A;  3AMM A;  5JZG C;  4NVP A;  4Q4X 2;  2WNU A;  1VBB 2;  4CDW B;  3ZYB A;  3PUS A;  4XCB A;  4Y20 A;  4XZU G;  5C4W A;  1LHN A;  5CKN A;  4CDX A;  2ARA A;  4E8D A;  2QQV A;  1VBA 2;  4N90 A;  3WW4 A;  2W9X A;  4A42 A;  3GZU C;  4NPM A;  1OH3 A;  1RHI 3;  2VBD A;  1J3P A;  1V00 A;  2IVI B;  3JCI A;  1DYK A;  1DQ4 A;  4BHP A;  1IGO A;  5JPM B;  4UOJ A;  5A7Q A;  4IGO A;  1W9W A;  3E6D A;  3ALQ A;  4UFH A;  5E8A A;  1FPN 1;  2WT1 A;  4FTE A;  2TUN A;  4IDZ A;  4GWJ A;  4OQ8 A;  4YGD A;  3FMG A;  1G86 A;  3FLT A;  3IKW A;  1X36 A;  4MHU A;  4R4X A;  5I8T A;  3A23 A;  1HRI 1;  1UMH A;  2G9G A;  4N53 C;  4CDQ A;  3RYP A;  5FP8 A;  2V5Y A;  2NP0 A;  2X8K A;  5JI9 A;  1XND A;  1NZC A;  3TWI A;  2JEM A;  1JZ2 A;  3WNX A;  3TRS B;  4ZS2 A;  2XBO 2;  4DUX A;  2UWC A;  3AKP A;  4BQY A;  1JYT A;  3UGF A;  1OFN A;  1K5M A;  1R1Z A;  1R1A 3;  4C8D A;  3KV6 A;  3ZYH A;  4IV1 A;  1GUI A;  4HBN A;  3LEG A;  3PJQ A;  4HFS A;  1BVV A;  2XDV A;  3PU8 A;  2QKD A;  5TSW A;  2RR1 3;  5JR2 A;  3ABZ A;  2XML A;  3N9M A;  4OHV A;  3POJ A;  5C5U A;  3LB9 A;  4WVW A;  5A1A A;  1OLQ A;  5FTT C;  3WNL A;  4H7M A;  5F3I A;  1EV1 1;  1PM4 A;  1VP6 A;  4COZ A;  5KWR A;  3VBR A;  4FOQ A;  2XVL A;  3ECQ A;  2QE3 A;  3AFK A;  2FZ1 A;  3BOW A;  5LA2 A;  2PXJ A;  3TOJ A;  4OYU A;  2JDP A;  4DNY A;  1HDK A;  1XSQ A;  3D3A A;  2AGS A;  4R9C A;  3SKJ E;  4QPW A;  2MNG A;  1QDC A;  1XB9 A;  2EXK A;  2IXK A;  4TYS A;  4DXT A;  1WMX A;  4QD2 A;  5CFC B;  2ZPX A;  4L0P A;  3WLU A;  3FLR A;  2XWB B;  1AR9 2;  4QPY A;  4LQR A;  1P8J A;  1YIF A;  5CKQ A;  2D3S A;  5FLI A;  1ZZ9 A;  1WCU A;  4GMP 0;  1GQP A;  1NY7 2;  4YVW B;  5FY8 A;  2RS5 1;  3ZFF B;  2XLF A;  3IBM A;  3SC7 X;  3SIS A;  4CCM A;  5FZ6 A;  1W2U A;  2QZ2 A;  3N7M A;  5ISL A;  1KJR A;  1OLM E;  4NHK A;  3I97 A;  3B02 A;  3JD7 3;  2OA2 A;  2JG9 C;  3BTA A;  5FZA A;  2IZW A;  3NNG A;  4MOA A;  1RGS A;  4LKF A;  3POS A;  5F8P A;  5ERL A;  1TG7 A;  3MO4 A;  2R0F A;  3WVJ A;  5A3L A;  4GKX A;  2GN7 A;  2GDF A;  2RMU 2;  4COY A;  3NAP C;  1RVF 1;  2GC2 A;  2OZJ A;  5FZE A;  2Y0I A;  2B9V A;  3O14 A;  4U2A A;  2ADD A;  2XJV A;  4YG0 A;  1PMJ X;  2JWP A;  2VOX A;  1LU2 A;  3CKH A;  4FP3 A;  1NLS A;  3PIJ A;  3WT3 A;  3BTZ A;  1R08 3;  1J3R A;  4CP9 B;  4LHS A;  3ZXJ A;  4QU2 A;  1PGL 2;  1O4T A;  4PLO A;  3VBF B;  5IYY A;  4UW5 A;  1QOT A;  2GZW A;  2I74 A;  2WNU C;  4NRM A;  1GZW B;  3IMM A;  4WVZ A;  5CEH A;  5F1R A;  1JYV A;  4YW3 A;  4QMA A;  4AI3 A;  2C6S A;  5FPU A;  1NCR B;  5LZ6 A;  2R6Q A;  4L8Q A;  2WZP P;  3ZIX A;  1PO1 1;  1V0A A;  2VCA A;  1Y9G A;  4OHW A;  1SPP A;  5L36 A;  4LEJ A;  3SCH A;  3ASI A;  2NQY A;  2WL1 A;  1S2B A;  5C9A A;  1IPS A;  1A8M A;  5FZI A;  1H1A A;  4MVT A;  4HN0 A;  4IE0 A;  3T3Y A;  4ET7 A;  4GMP 3;  1ULO A;  5E1R A;  3USU B;  3KGL A;  3VBO B;  1CAU B;  4AVV A;  1M06 G;  4MGI E;  2B39 A;  4BXS V;  3W59 A;  4OHY A;  4LIT A;  5A3W A;  4KNC A;  1ULD A;  2P17 A;  5FYI A;  4A41 A;  4CVU A;  2AUY A;  2IXI A;  3R4D B;  3VKL A;  4CXW A;  1YQ6 A;  4Y1Y A;  3M2M A;  4LUM A;  1HRI 2;  4E2G A;  1VMF A;  5F9T A;  3CLP A;  1LOE A;  4XBQ A;  5FY4 A;  1HB2 A;  1VB4 A;  1S0F A;  3INA A;  2D97 A;  3M3I A;  2PLV 1;  2A3X A;  3VBS A;  4QGM A;  1O4Z A;  4D7S A;  4JTN A;  1O3S A;  4DRV A;  4FCA A;  2DU1 A;  4Q4Y 2;  5A3M A;  2VG9 A;  1S1A A;  1ASJ 3;  5LA0 A;  2BDR A;  1O5U A;  1MPX A;  3J26 N;  3VZJ A;  4AGG A;  3RPQ A;  2C0Z A;  2WNV A;  4A2U A;  4YRD A;  1RTV A;  1MS3 A;  3MPP G;  5FZO A;  3L9J T;  2QCS B;  4AHY A;  3HNY M;  4M4P A;  1IOA A;  3AL5 A;  3UNP A;  1XNK A;  2W94 A;  4F83 A;  3AM2 A;  4N9I A;  2RDR A;  3I2I A;  4W6W A;  4OI1 A;  2QQP A;  2DWR A;  3WSO A;  3LF7 A;  3N9L A;  1EV1 2;  1GBG A;  2X29 A;  4K9S A;  4RN5 A;  1TQ5 A;  3I3Q A;  5T3N A;  4MGS A;  1JXN A;  4ASK A;  2WKK A;  3TNQ A;  1ULC A;  3FBM A;  4FPJ A;  3UES A;  3KM5 A;  5FUI A;  2R04 3;  4ISR A;  1DF0 A;  4LA2 A;  2BBV A;  4XXP A;  1OA4 A;  5CU1 A;  3D0S A;  3PVE A;  4CDU A;  3NST A;  2QNK A;  3D0J A;  5LEJ A;  2YU2 A;  3TNP B;  4CPB A;  1UCX A;  2W39 A;  3ACL A;  3MIH A;  4W8J A;  1GP5 A;  3PTY A;  3WDV A;  3BPZ A;  2XOM A;  2ZHM A;  5EP9 A;  2VUJ A;  4LBN A;  4XF9 A;  1RUH 1;  2RS5 2;  1MQT C;  3WX5 A;  4FFI A;  5C8W A;  3KHC A;  1LAJ A;  1LOF C;  4FPC A;  2XKP A;  2ZGU A;  5A3N A;  5FQ0 A;  4LPL A;  2VQU A;  2XUE A;  1GZ9 A;  1MVE A;  3D4K A;  5A7N A;  1TE1 B;  3C7E A;  3TEY A;  4XF1 A;  5F5Q A;  3VBH A;  1D2S A;  4J6G A;  3D6E A;  4P00 B;  4ATE A;  2YUE A;  5C6C A;  5JPN B;  2PFW A;  2PQS A;  4NHM A;  3PVN A;  1RVF 2;  5H9R A;  2VME A;  2BRT A;  3PDQ A;  3EBR A;  2DVB A;  5KXD A;  4N7U A;  4EE2 A;  2R06 2;  2H0V A;  2A73 B;  3I2F A;  1OI6 A;  3H1W A;  2IXH A;  5FZB A;  1GQH A;  2CTV A;  2BTV C;  1W8O A;  4NIA A;  3ZN6 B;  5BNN A;  1WD4 A;  2HWD 1;  4IV3 A;  2ZML A;  3T2O A;  3WUD A;  1F9K A;  1FNZ A;  1HN0 A;  4KQ7 A;  1PO1 2;  5F3G A;  3ZM8 A;  4DQA A;  3OEB A;  2PHU A;  3PLQ A;  3VDD B;  2UUR A;  2PA7 A;  4JGY A;  3VBU C;  2Y38 A;  1JZ6 A;  2O14 A;  3OBA A;  3S30 A;  4BME A;  3C8X A;  1Q8O A;  3WG3 A;  2VR4 A;  3WZ1 A;  1HRV 1;  4MGZ E;  2V73 A;  4RR3 C;  3I2J A;  1YFW A;  4M0H A;  5FYH A;  3WOG A;  4UXA A;  4GAZ A;  3O1U A;  3BGA A;  1LEC A;  2YY1 A;  4XMI A;  2AEZ A;  1OMI A;  2RM2 3;  1ZA4 A;  1S0J A;  3H3Z A;  1OF3 A;  2EAL A;  4PF1 A;  4XEZ A;  3T4H B;  3VKO A;  4BM8 A;  3A7Q A;  5D8A A;  2PHD A;  5FXX A;  4AVT A;  4JHZ A;  1W8H A;  1MVQ A;  2ZGK A;  1W6P B;  5JOZ A;  4ZON A;  4Q0P A;  1MZ6 A;  5JSP A;  1ZX5 A;  1NCQ C;  2PLV 2;  2HEV F;  1RIN A;  1JUI A;  4MXW B;  2XH6 A;  2WN2 A;  1CPM A;  1AXK A;  2GP5 A;  5DG2 A;  5ACA 1;  4AW7 A;  2BNO A;  1G6N A;  4FPK A;  4I02 A;  3RS6 A;  4YW7 A;  5FFO C;  3SQO A;  3TN9 1;  3ZYI B;  3N9N A;  2EAK A;  3J4U H;  4O65 A;  1G9A A;  4BXF A;  2TNF A;  2KR2 A;  1AR8 3;  5I0R A;  4LBQ B;  4B7K A;  2JB4 A;  5DUV A;  4B7E A;  1AYN 3;  2ZMK A;  1NXD 1;  2K46 A;  3LFM A;  5C7G A;  3FX3 A;  4Q4V 3;  4S2F A;  5D21 A;  2ZX3 A;  3IMN A;  1PMH X;  5GZF A;  4GWI A;  4IEV A;  3AVR A;  5JZG B;  1ND2 C;  2Q1F A;  5K4L A;  4YZ2 A;  2BVV A;  4FFF A;  2HJI A;  4Z1V A;  1WWY A;  3VHO A;  3EYP A;  4E27 A;  2FQP A;  1US2 A;  3BOP A;  1XU1 A;  5J09 A;  4SLI A;  3LIH A;  3AYD A;  3BCW A;  1HB3 A;  3MW4 A;  2EXH A;  4OUS A;  3ZSJ A;  1ENS A;  2CWS A;  4HN1 A;  1RMU 3;  1PIV 3;  2NZ9 A;  3NJZ A;  2BWC A;  3JU9 A;  4AI1 A;  4A4A A;  1RUH 2;  3MDP A;  1TVG A;  3NWK A;  2P37 A;  1OHF A;  4NR1 A;  4FBF A;  2O1Q A;  2Y60 A;  3GBF A;  2RDQ A;  4N53 B;  5FKB A;  4PIX A;  2VQT A;  4XIK A;  4A7Z A;  2HBU A;  4FOV A;  4X6Q B;  2FMD A;  4CE8 A;  1C8M 3;  4EWE A;  3V0A A;  5EYY A;  2Y6J A;  4P9Y A;  3N9O A;  1BQP A;  3HNB M;  4PHZ A;  5CBL A;  5C33 A;  4KGG A;  4UW4 A;  3BVC A;  5FYM A;  1PZ8 A;  2DCK A;  1GR3 A;  1W8U A;  4C1W A;  1NQD A;  2OUJ A;  4IE6 A;  4D3W A;  1AX1 A;  1XYP A;  2HWD 2;  3UT0 A;  1OPM A;  4LO5 B;  3ZX7 A;  4CP2 A;  3T0D A;  5FXV A;  1D4M 2;  4QWN A;  1IPK A;  5LBF A;  4CXX A;  5FZ9 A;  5JLV A;  5FMO L;  2VZT A;  1E5R A;  3ENR A;  5BV6 A;  1UX6 A;  2XON A;  5GM0 A;  1POV 0;  3PIG A;  4M01 A;  1J59 A;  2LW8 A;  1JHN A;  4CP0 A;  2VH9 A;  3UL2 A;  4Y1Z A;  3JZV A;  4YW6 A;  3RWN A;  1XNC A;  1OD5 A;  4MH0 E;  1HRV 2;  1DQ5 A;  1FOD 1;  5FY7 A;  3VHR A;  3PTR B;  4OMC A;  5FPB A;  3J7M A;  4LIV A;  1BHG A;  4A44 A;  4M3C B;  4MGK E;  3S5A A;  3THC A;  1YQ5 A;  4XTM A;  5L7O B;  1E5S A;  4NII A;  5AC9 1;  1QQP 1;  1CIW A;  1O91 A;  4UF0 B;  4LE3 A;  5FBZ A;  4QQH A;  4JRA A;  2JKX A;  4ASM B;  4BH9 A;  3O1S A;  1ZBA 3;  4UW3 A;  1VAK A;  2P34 A;  3GZA A;  3H1Y A;  1U12 A;  4GH4 A;  3U4X A;  3J8F 3;  3VV1 A;  5FUN A;  4XC9 A;  2Q8C A;  3W20 A;  3NNL A;  3B5L B;  4QPG A;  5ACA 2;  1UOF A;  2AZ5 A;  2QDR A;  5A3U A;  1H2L A;  3BAL A;  3TEX A;  1AL2 3;  3WQB A;  5BNP A;  4PT6 A;  3N36 A;  1PK6 C;  1UOJ A;  5A6Y A;  2D6N A;  2WR9 A;  1XNT A;  2GC1 A;  4FPO B;  1H0B A;  1W8T A;  2W47 A;  3WDW A;  3EQE A;  3N7K A;  5HCB A;  2R07 3;  4B1L A;  4QM8 A;  3OPZ A;  2WNU B;  1POV 3;  3RDI A;  1JZ3 A;  1QHD A;  3ACI A;  4AL9 A;  4HT1 T;  1RUC 2;  5SV8 A;  4LR4 A;  3ELN A;  4MO3 M;  3K2O A;  2WFF 3;  1AJO A;  4RQP B;  1SDW A;  5KC5 A;  5LY1 A;  4DIQ A;  2WWJ A;  3S5Q A;  2B45 X;  5GAL A;  2EXI A;  3I8T A;  2CGP A;  4Q0U A;  5FIX A;  3VZL A;  4IXL A;  4JDN A;  1UZV A;  1WBF A;  4YAR A;  1WGP A;  2W46 A;  3O0X A;  5CAD A;  1W9S A;  5LBC A;  2D6M A;  3FZ3 A;  2E26 A;  3HT1 A;  2FDK A;  4E4Z A;  4UFL A;  2FCT A;  1HQL A;  3FC0 A;  2ZAC A;  5FPA A;  5G05 L;  5HV0 A;  5CA6 A;  5EHD A;  1CAV A;  1BZW A;  1UOG A;  2WWS A;  1AR6 1;  1UF2 C;  3GJA A;  2PAE A;  3ITQ A;  4AVB A;  4K21 A;  5M0T A;  2RV9 A;  1UY4 A;  4FO9 A;  1UYY A;  2YC4 A;  1LOG A;  1HQN A;  3WDT A;  4KI5 M;  4WVM A;  1XJA A;  3DEM A;  4NE9 A;  1V6N A;  1ULF A;  1SFP A;  2H6B A;  4XW3 A;  2YV8 A;  4DY3 A;  3S7I A;  1N47 A;  2R30 A;  5A1F A;  1VBD 2;  1MAC A;  1W2N A;  4QKN A;  3MF6 A;  4NRP A;  2GU9 A;  5IK7 A;  4DPN A;  5A3T A;  1GZT A;  1COV 3;  4ASL A;  4PQ9 A;  4YGE A;  5B2G B;  5FMD A;  2BUK A;  5K9Y A;  2JD9 A;  1FX5 A;  2E7T A;  2RE9 A;  3R0R A;  4XAE A;  2ZHK A;  4AHW A;  2Q1M A;  1UZW A;  3PU3 A;  3NNJ A;  2YBK A;  3D5O A;  5JXI A;  3GNE A;  1YRZ A;  1SFN A;  1FOD 2;  1JBC A;  4B29 A;  4BYY A;  1WZX A;  4HKW A;  4Q4W 3;  3GZE A;  1TEI A;  2VTF A;  4Y4R A;  3OG2 A;  4P5Y A;  4OI4 A;  3VKN A;  3PJY A;  3LQC A;  3UKT A;  3T1M A;  4BQ5 A;  5GLW A;  3FBY A;  4YW4 A;  5AC9 2;  5HXV A; 
#chains in the Genus database with same CATH homology
 2WN3 A;  4ZXE A;  1JZ5 A;  3F2Z A;  4XUO A;  2VMF A;  4XZU G;  1ULP A;  3I2G A;  4E8D A;  2W9X A;  4A42 A;  4AAX A;  4LKS A;  3J7H A;  4KMQ A;  2QQN A;  3DYP A;  4AG4 A;  2DDU A;  4UOJ A;  3I2H A;  1W9W A;  3WEZ A;  1CZT A;  2Y8K A;  3I3B A;  1NAE A;  5DN2 A;  5J1X A;  4GWJ A;  3III A;  4CU7 A;  2VO5 A;  3A23 A;  1UMH A;  1NX9 A;  3C7H A;  3K75 B;  2VJX A;  1UMI A;  4CUA A;  2VZO A;  5JMO A;  1JZ2 A;  3HEI A;  1K42 A;  5LCW L;  3NJX A;  1W99 A;  4DUX A;  3K46 A;  5JUV A;  1UXZ A;  1YQ2 A;  1GUI A;  1UWW A;  3LEG A;  1UY1 A;  5JR2 A;  3ABZ A;  2WAB A;  3WNK A;  2VZV A;  5A1A A;  3BN6 A;  3WNL A;  1KGY A;  3ECQ A;  5LA2 A;  1O8P A;  4OYU A;  3OGV A;  1CZS A;  4PQQ A;  4BK4 A;  3D3A A;  3SKJ E;  4JKM A;  4QPW A;  3CDZ B;  1GU3 A;  4DXT A;  4L0P A;  3T09 A;  4CU8 A;  4LQR A;  1P8J A;  3VDB A;  1EUT A;  2J1U A;  2KD7 A;  1GQP A;  5EIY B;  2YG0 A;  1CZV A;  3CZU A;  4QAW A;  2W1W A;  1GOG A;  2HYX A;  3I97 A;  3DYM A;  3NNG A;  2VZ1 A;  4MOA A;  5B4X A;  5IFP A;  2Y64 A;  1TG7 A;  3CMG A;  3MO4 A;  3VD5 A;  3WNP A;  2WAO A;  4XUN A;  2B9V A;  3OGR A;  1JYX A;  1PMJ X;  3CKH A;  4Z2A A;  3VD9 A;  3HOB A;  1O8S A;  4LHS A;  3LPG A;  2VZR A;  2W1Q A;  1UY0 A;  5IYY A;  1T2X A;  1JYV A;  1JU4 A;  1W9T A;  2ZEX A;  2ID4 A;  2VCA A;  3LEI A;  2W87 A;  2QQO A;  4P08 A;  1EUU A;  5IJR A;  2X09 A;  2VMC A;  1JU3 A;  4CU9 A;  4ET7 A;  1ULO A;  2QQK A;  4TXW A;  1K3I A;  3K4A A;  5I0D A;  4BXS V;  3K4Z A;  2W1S A;  3UET A;  4A41 A;  3WF1 A;  1CX1 A;  4CVU A;  4UI9 L;  3LE0 A;  3DYO A;  1DLC A;  2VZ3 A;  5JXG A;  2Y6K A;  3HNM A;  2R7E B;  5LA0 A;  1MPX A;  3MUZ 1;  5C70 A;  4GZ9 A;  3WNM A;  3GM8 A;  2J1E A;  2J1V A;  3HNY M;  4M4P A;  3UNP A;  2YFU A;  1OD3 A;  2CDO A;  2W94 A;  4QX0 A;  3IAP A;  2VZP A;  4QX2 A;  3I2I A;  1DP0 A;  2ZEZ A;  3WSO A;  2VM9 A;  3JXS A;  5G04 L;  4RN5 A;  3OEA A;  1JYN A;  2L9L A;  3VD4 A;  2EIB A;  4MGS A;  2WZE A;  2ZXQ A;  3UES A;  5FUI A;  2Y6L A;  4ARY A;  2ZEW A;  2LS6 A;  1GOF A;  3DEC A;  1SG3 A;  2J1R A;  4W8J A;  4DEV A;  4D8M A;  4XVH A;  2XOM A;  2RJ2 A;  2YC2 A;  2Z4F A;  4QB6 A;  2WZ8 A;  2RVA A;  1PX3 A;  4A3Z A;  4LPL A;  2VQU A;  4W50 A;  3C7E A;  4P00 B;  1US3 A;  1UXX X;  4JKK A;  2PQS A;  1GOH A;  4BJ0 A;  2VME A;  3T0B A;  1OT5 A;  1RYY A;  3T08 A;  4FI9 A;  3I2F A;  1W8N A;  1W8O A;  2V4V A;  1JHJ A;  3EB7 A;  3SKV A;  3T2O A;  3K77 A;  2J22 A;  2QQM A;  2VZS A;  3ZM8 A;  3CIH A;  3OEB A;  3VDC A;  2WYS A;  1GNY A;  2OKX A;  3OGS A;  2VMD A;  3NQH A;  1JZ6 A;  3AC0 A;  3OBA A;  1OH4 A;  2VC9 A;  1SDD B;  3MBW A;  3WNN A;  4CU6 A;  2VL4 A;  1DYO A;  3C8X A;  3I3E A;  2VR4 A;  2WBK A;  4E8C A;  4QB1 A;  4QX1 A;  3I2J A;  2XQX A;  2E32 A;  2J1T A;  1NKG A;  3BGA A;  2ORX A;  2W91 A;  4YPJ A;  2YFZ A;  2X10 A;  2V72 A;  1OF3 A;  2C9K A;  3C7O A;  4PF1 A;  3WF3 A;  5JXH A;  2EIE A;  5EJ1 B;  3A7Q A;  4JHZ A;  1L7R A;  4DXR A;  3ACH A;  3SEP A;  1H6Y A;  1W0N A;  1H6X A;  4QB2 A;  2WN2 A;  1L7Q A;  1F4A A;  2QQL A;  3ACG A;  4JX0 A;  1D7P M;  3P6B A;  2E31 A;  2YB7 A;  2VZU A;  3HJR A;  5DQ0 A;  5HPO A;  4TTG A;  3MV1 1;  5C7G A;  4A45 A;  5B4N A;  1PMH X;  4GWI A;  1UYZ A;  3EYP A;  3ETP A;  1US2 A;  3C7F A;  2EID A;  2JE8 A;  4MAD A;  3CZJ A;  5C71 A;  2WAA A;  5HXM A;  2B4K A;  2WUH A;  3U37 A;  3WNO A;  4M4R A;  2BZD A;  4A4A A;  2X05 A;  3FHA A;  1TVG A;  4QDR A;  3T2Q A;  4DXS A;  2QBX A;  1XNA A;  1PX4 A;  2W92 A;  3IAQ A;  3GDB A;  3HPN A;  2WO3 A;  2VQT A;  1JZ4 A;  2W1U A;  2WO2 A;  3GXU A;  2VZQ A;  2DCJ A;  1F4H A;  1J84 A;  2Y6J A;  4A6O A;  3HNB M;  4UAP A;  1J83 A;  2DCK A;  4QDQ A;  5LA1 A;  1JZ8 A;  4XUP A;  2W5F A;  4RYD A;  2CDP A;  1JI6 A;  3T0D A;  1SHW B;  2VOT A;  3CQO A;  1XC6 A;  2VZT A;  2XON A;  3W5M A;  5JXJ A;  3NJV A;  2WO1 A;  2LW8 A;  2J1A A;  4QDS A;  2QQI A;  4XUR A;  4CUC A;  3A21 A;  2Y6H A;  4OMC A;  4A44 A;  1BHG A;  2XHN A;  3THC A;  4OUE A;  2WDB A;  3T2P A;  4DUW A;  2JKX A;  3IB3 A;  2VCB A;  1I5P A;  3ACF A;  2JDA A;  1WKY A;  1KEX A;  3E1F 1;  3VD3 A;  5DMY A;  3WQB A;  4PT6 A;  5DPN A;  1JZ7 A;  3HN3 A;  1XPW A;  3OB8 A;  1XNT A;  3I2K A;  3I3D A;  3WF0 A;  2Y6G A;  4ZY9 A;  3WF2 A;  3WF4 A;  2W47 A;  1O59 A;  2C4X A;  2BGO A;  4XUT A;  1JZ3 A;  1UY3 A;  3GGL A;  3ACI A;  5IHR A;  4JKL A;  4MO3 M;  4BDV B;  3W5N A;  4OZO A;  3FN9 A;  1HN1 A;  5IFT A;  4HG6 B;  5CYY A;  4DEQ A;  5CZK A;  3PUH A;  1UX7 A;  3LPF A;  4BK5 A;  2W46 A;  4DUV A;  1W9S A;  2VCC A;  2W95 A;  1LNS A;  1K45 A;  1OF4 A;  3LEK A;  2E26 A;  2QQJ A;  2E33 A;  4IUG A;  3T0A A;  5G05 L;  4XUQ A;  1K12 A;  1UY2 A;  3VD7 A;  4OMD A;  4P02 B;  2RV9 A;  1UY4 A;  2HLE A;  1UYY A;  2YC4 A;  1NUK A;  3NRU A;  5F7U A;  4KI5 M;  2ZEY A;  2C26 A;  2J1S A;  1UYX A;  2BBA A;  2ORZ A;  2WQ8 A;  1IQD C;  3SEE A;  3VDA A;  3C7G A;  1GMM A;  2BER A;  1WCQ A;  4D0Q A;  3FL7 A;  3A22 A;  3MV0 1;  2W3J A;  3P1I A;  2JD9 A;  4CUB A;  3PUI A;  4W4Z A;  3IDA A;  3THD A;  5EJZ B;  4ZZ8 A;  5JXI A;  4QX3 A;  2BGP A;  4KWU A;  4ZZ5 A;  1CIY A;  2EIC A;  2VTF A;  4MGQ A;  1JYW A;  2V5D A;  3OG2 A;  4P5Y A;  3FHQ A;  3LQC A;  3K4D A;  1R64 A;  1UZ0 A;  2J7M A;  4ARX A;  3MUY 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...