2WZ8A

Family 35 carbohydrate binding module from clostridium thermocellum
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
142
structure length
135
Chain Sequence
TINVYEAEDPANTLGGAAVRQRDNAASGGQYVGWIGNGSNNYLQFNNVYVPQAGTYRMVVQFANAEVFNVVDRYCSISVNGGPEKGHYFFNTRGWNTYRTDIIDVYLNAGNNTIRFYNGTSGSYAPNIDKIAIAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords CELLULOSOME PROTEIN DOCKERIN TYPE I
publication title Signature Active Site Architectures Illuminate the Molecular Basis for Ligand Specificity in Family 35 Carbohydrate Binding Module .
pubmed doi rcsb
source organism Clostridium thermocellum
total genus 32
structure length 135
sequence length 142
ec nomenclature
pdb deposition date 2009-11-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2wz8A00
1GUIA 3LEKA 3A7QA 3VD4A 5EJ1B 2J1EA 4XUPA 5I0DA 1TVGA 4P08A 3IIIA 3ACFA 4XVHA 1EUTA 2YFUA 1UX7A 1NX9A 1H6YA 1UXZA 3K4AA 1XNAA 3OEAA 2Y6GA 2YG0A 4LHSA 3UNPA 5C70A 3CKHA 2ZEZA 3ECQA 4MGQA 1J84A 2WDBA 4E8CA 3W5MA 2J1AA 2WABA 3NQHA 5IFPA 3T2OA 2VMCA 3WNLA 2BERA 2W1UA 2W5FA 1GOGA 1UZ0A 4P5YA 2JD9A 2PQSA 1YQ2A 1SDDB 3NJVA 1W9TA 2RJ2A 3WNNA 4QPWA 3HNBM 1JZ7A 3I2HA 4A45A 1GOFA 1PX3A 3LPGA 5JUVA 2XQXA 4RN5A 3CQOA 1W9SA 3T2PA 1CX1A 2W9XA 4UAPA 3BN6A 4MOAA 3WF2A 3FN9A 3JXSA 4QB6A 2VR4A 2X05A 2J1VA 1K45A 1KEXA 1W8OA 3CMGA 5B4XA 2YC2A 3C7FA 5F7UA 4M4RA 3K4DA 3DYOA 2YFZA 1UY1A 3SEEA 3K46A 4A42A 1UY0A 3FL7A 3MV01 4QDQA 3OBAA 3T0AA 1US3A 5CYYA 1NUKA 2ORXA 5B4NA 2VCAA 5IFTA 4UOJA 1W8NA 1IQDC 2C26A 4QDSA 3UETA 1MPXA 4DXSA 4D0QA 2J22A 2HLEA 3GDBA 1CZTA 2E26A 1CIYA 2VC9A 1K3IA 1NKGA 4FI9A 3A22A 2W1WA 1L7RA 3WF1A 1NAEA 2DCJA 2VZOA 2VZPA 3K75B 2VZ1A 4GWJA 2Y6LA 3NNGA 5IHRA 3I2IA 1K42A 1SG3A 2R7EB 4BDVB 3T0DA 4DXTA 1JZ5A 2B9VA 3FHQA 2Y6JA 2V5DA 4QX3A 2VZUA 3C7HA 2B4KA 2QQKA 1JHJA 4ZY9A 5G04L 4ET7A 2J7MA 2VL4A 4DUWA 1UYZA 2QQIA 2E31A 2LW8A 3OGSA 5FUIA 3T09A 1O8PA 3WNOA 3HOBA 4A3ZA 3WQBA 4ZZ5A 5DMYA 4XUTA 2WYSA 3MBWA 5EJZB 1P8JA 1CZVA 3SKJE 4CU7A 4M4PA 3WNPA 4CVUA 3MV11 2JE8A 2VM9A 1XC6A 4QX2A 4ARYA 3ACHA 1KGYA 2W46A 4XURA 4YPJA 1GNYA 1JU4A 2VZSA 2WZEA 2VTFA 2ZEWA 1W9WA 3HPNA 4ARXA 2XONA 5JXJA 1PX4A 1UYXA 2WO3A 2OKXA 1OH4A 1JYVA 5JXIA 3MO4A 2Y64A 4AG4A 4OMDA 1JZ8A 3I3EA 3HN3A 4W4ZA 1OT5A 2ZEXA 3SEPA 2J1RA 4XZUG 4LQRA 3LE0A 3WSOA 2E33A 4OUEA 4HG6B 3VD9A 2VZVA 2VOTA 4A6OA 2C9KA 2E32A 1O59A 1W0NA 1US2A 4BXSV 1UY3A 3T0BA 4E8DA 1WKYA 1UY2A 3LPFA 1R64A 2VCBA 4QAWA 1I5PA 4QB2A 1GMMA 4CU9A 3UESA 1JYXA 2W94A 2YB7A 3VD3A 3W5NA 4KMQA 3DYMA 3C7GA 2XHNA 4DEQA 3OGRA 4LPLA 2VZQA 2W87A 4OYUA 4P02B 1J83A 4CUCA 3VDCA 3ZM8A 3C7EA 4JHZA 5CZKA 4CUBA 2QQMA 2VQUA 2W3JA 2BBAA 2RV9A 3WEZA 2VZ3A 2WO1A 3C7OA 1SHWB 4QB1A 4Z2AA 2ZEYA 5JR2A 2X09A 3I97A 4D8MA 3AC0A 3I2GA 4DEVA 2L9LA 1JZ6A 3F2ZA 3CDZB 2EIBA 1OF4A 1XPWA 4XUOA 1H6XA 2C4XA 2W92A 1F4HA 4KI5M 3NJXA 1GU3A 4MO3M 2VMEA 2WN3A 1K12A 1UYYA 5JXGA 5G05L 1W99A 2VJXA 3EYPA 2QQOA 3CZJA 4JKLA 3U37A 3LEIA 2BGOA 3ABZA 3DECA 3J7HA 4L0PA 3GM8A 2WO2A 5LA0A 3D3AA 2Y6KA 3ACIA 4MGSA 5LA1A 2QQNA 4TXWA 1D7PM 4TTGA 2VMDA 4JX0A 5A1AA 3GGLA 4GWIA 1O8SA 3THCA 4DUXA 3I3DA 2WAAA 3K4ZA 3P1IA 2YC4A 4OZOA 3WF0A 4QX0A 1GQPA 3IAPA 1JZ2A 1PMHX 4DUVA 2WUHA 3GXUA 1T2XA 3LEGA 5LCWL 3I2KA 3LQCA 3IDAA 2JKXA 4QDRA 1EUUA 2QQJA 2J1UA 3BGAA 4OMCA 3ACGA 1ULPA 3VDBA 2W91A 1UMHA 4PF1A 4W8JA 4A44A 1UY4A 2WN2A 4MADA 3OB8A 2LS6A 2XOMA 5LA2A 4JKMA 1WCQA 2QQLA 1OD3A 3HNMA 1JZ4A 1DP0A 1PMJX 4XUQA 1TG7A 2WBKA 5HPOA 2BGPA 3PUHA 4W50A 3OGVA 3OG2A 3IB3A 1JU3A 3IAQA 2CDOA 5IJRA 3VD5A 5IYYA 2X10A 3CIHA 3WF4A 5JXHA 3EB7A 2W47A 1RYYA 4ZZ8A 1LNSA 2DCKA 4CUAA 4CU6A 3VDAA 3DYPA 5C7GA 3T08A 5HXMA 2VZRA 2VQTA 2WQ8A 3HEIA 2VO5A 2J1SA 4PQQA 4BK5A 4BK4A 2ID4A 3I2JA 1XNTA 1L7QA 1UXXX 5DQ0A 1F4AA 3HJRA 3CZUA 2HYXA 1ULOA 2VCCA 1UMIA 1DYOA 5EIYB 2QBXA 3A21A 3VD7A 4QX1A 2KD7A 3OEBA 2VZTA 2V72A 4RYDA 3I2FA 5DPNA 1OF3A 2ORZA 5DN2A 4P00B 4GZ9A 3T2QA 3HNYM 3FHAA 5C71A 2W1SA 4BJ0A 1JI6A 2EIEA 1JYWA 1DLCA 4DXRA 2WZ8A 3E1F1 1UWWA 4ZXEA 4A41A 3C8XA 4IUGA 2J1TA 3K77A 1GOHA 3WNKA 1CZSA 2JDAA 3P6BA 3THDA 4KWUA 2Z4FA 4AAXA 4XUNA 3WNMA 2V4VA 3MUY1 3PUIA 4PT6A 2W95A 2DDUA 2BZDA 2EICA 3I3BA 2Y6HA 4JKKA 4CU8A 2Y8KA 2ZXQA 3WF3A 2RVAA 1JZ3A 4UI9L 3SKVA 4A4AA 5J1XA 5JMOA 1BHGA 3ETPA 2CDPA 2WAOA 2VMFA 2W1QA 3A23A 3MUZ1 1JYNA 1HN1A 2EIDA 3NRUA 4LKSA
chains in the Genus database with same CATH superfamily
2ZMNA 4MLOA 4ATFA 1KFUL 1YLLA 3WXPA 2Q1FA 4XUPA 3WDXA 5I0DA 3ZFEA 2ZX2A 1URXA 1W0OA 2YFUA 5A3WA 4E4ZA 5EQUA 5KXEA 2BVVA 1H2MA 2GMMA 3J7NA 4AZZA 5JSPA 1R081 4HPKA 1QXJA 2VMIA 3UNPA 3KGZA 2HBUA 4FBFA 3N9OA 1EV13 1NCQB 3NO8A 4NRMA 4E8CA 4Y20B 1W8FA 4XFCA 2QZ3A 2R0FA 1NA1C 2J1AA 2DUQA 3WW2A 3NQHA 4NN0A 4YGCA 3T2OA 5DUVA 2Q30A 2WFPA 4QQPA 4WVWA 2ZA9A 4XFGA 3OUIA 5FFOC 1R082 3WNLA 4A7KA 5K0UC 2WA3A 3GHNA 5KXBA 1JYNA 1HXS3 3U75A 1GOGA 2D6KA 3LDRA 5CG8A 2JD9A 1QJU3 2R1DA 3IWZA 3VZMA 1WW7A 3DXUA 5FCCA 5CEHA 4OULA 4LLOA 4XACA 3PU8A 3WNNA 1YYNA 3HNBM 1F15A 1PZ9A 3I4IA 3O1RA 1Y9MA 1CJPA 1K5JA 5D2AA 5C9AC 5CFDB 4OVEA 3CQOA 2JDYA 2R063 3NNFA 5GZFA 3R6SA 1CX1A 2OT7A 3B7MA 1RXGA 1AXZA 1RUJ1 4UAPA 3RFRA 4QPGB 4EROA 2JJ6A 3HQRA 4FO9A 4NPMA 2QDNA 2VXJA 1Z7S1 3J8F2 4G3YC 2VG9A 2VR4A 3W20A 2D93A 3J26N 2YU2A 3CMGA 1YUDA 3AJYA 4XFHA 4Z92B 1QJZA 2YBKA 3ACLA 4CP1A 2PQQA 2VAUA 1VBC3 1RUJ2 5F7UA 1PGW1 2PHLA 1C1LA 3CL1A 4QKBA 1UY0A 3LIHA 5A3TA 4GB33 4QDQA 2WFF1 4GAZA 2YYOA 5CYYA 1NUKA 3BU7A 2VCAA 5DAVA 4DRRA 1VAKA 2WS91 1NCQA 1HRI1 4OI0A 2ES3A 3KV5A 1IOAA 4QDSA 3UETA 4B4RA 2XBO1 2B45X 4FFIA 1LGBA 1N1SA 4P9JA 1EPZA 1QXRA 3PDQA 1PGW2 4Y20A 2C0ZA 1AR62 1CZTA 3MLJA 4DZGA 4WZCA 4FP3A 1OH3A 3M7AA 3HVDA 5SV5A 3MGUA 4D6RA 2WS92 2MNGA 3FLRA 3ZXEA 3V0AB 3KD4A 3G6JB 2XBO2 1W2TA 2ZGRA 3K75B 4NOTA 4FPYA 5FV3A 5IHRA 2VVFA 5TSWA 2BUKA 3LSEA 1UU6A 1AYM3 4DMIA 3O0XA 3ZXLA 3BIWE 4Q4W3 2B9VA 3N7KA 3AZYA 3FHQA 5CFDA 1GICA 2VOWA 1XSRA 5GM0A 1VRH3 5DAXA 1PGSA 4ET7A 4DUWA 2C24A 2NN8A 1CAVB 4IEXA 4QPGA 3BODA 4XQ4A 3WDWA 2GSYA 4Y1UA 3MF9A 1O8PA 3HOBA 3I8TA 1RITA 2HWF3 2PHWA 3VHOA 3WP3A 5DMYA 1ASJ1 1DZRA 1W03A 3IPVB 1HX6A 1SQ4A 2JG9C 1CX4A 5JOYA 2AYHA 3B69A 3N9QA 4IEYA 3RPQA 4FTSA 2JDNA 1W8UA 1W2OA 3MICA 5GKAC 2E7AA 4YG6A 5I0TA 1EYBA 3P5BA 1QJX1 4Z8BA 1LEDA 2B46X 1LOAA 1AL23 5CKMA 4CCJA 1UNBA 1QHDA 3ZSLA 3ON7A 5C3RA 4AEDB 2HWC1 1ASJ2 1FATA 1PIV1 4CDQC 5AFEA 3BTYA 4WM7A 5FPZA 3M70A 1JHNA 4K3UA 3POEA 4XURA 4QM8A 1LGCA 4XHXA 5CISA 4N53B 1QJX2 1JU4A 5A3NA 4QKNA 2G4IA 1YFWA 3IN9A 5H9QA 4FQZA 5L7OC 2HWC2 1CVNA 2OZJA 1PX4A 4XJ9A 4YW6A 2PLV3 2BFUS 4E4HA 5A80A 5FP7A 4Q2FA 5FZ9A 1N3QA 1JYIA 2XWJB 1HKDA 2Q4SA 4FOQA 1GP4A 2FDHA 4OMDA 4BCUA 1C57A 3I3EA 5A7WA 1JZ8A 1BVVA 1YQ5A 3W59A 2P3JA 5CFCB 4CRQA 1QEXA 4IXLA 4HONA 1OA2A 4F3JA 4DNYA 4NMIA 3S30A 1RUG2 3SMHA 1CAVA 1RUH1 4URAA 1K5MC 1QY4A 3DXTA 3USSA 4DB5A 4L97A 4P9WA 2F4LA 1U5ZA 3M8LA 3IPVA 4QXCA 1DGWA 4CDXB 1W0NA 3AVRA 4BXSV 2ZGMA 3WUDA 4KG8A 1RUH2 1WKYA 3ZFEC 1OOPC 2CL2A 3CBNA 2JX9A 1R64A 1VAVA 1Q3EA 2LUWA 1R083 1RVF3 1I5PA 2QE3A 1LB2A 1SFYA 2P3IA 2YPJA 1JYXA 2IWGB 4IGPA 4M0NA 4EJRA 3NV2A 4AI1A 1UOBA 3AVSA 3OGRA 3EO6A 4N53A 1SLCA 1Q8VA 2OZ6A 2W87A 1H9WA 4XJWA 5EYYA 3WR0A 2DYCA 3VKLA 1LULA 1ZRFA 5C5TA 3WHUA 3ZM8A 3C7EA 5JZGC 1PM7A 4GA9A 4BU2A 3FLTA 2B5HA 1PZ7A 1SMVA 3PIGA 4FQ4A 1GBGA 4EWDA 2C1FA 2VNOA 3WEZA 5F5IA 2VOXA 1U5IA 3B9CA 1RMU1 2DVFA 3A0NA 5APAA 1KQRA 1H4HA 3H3UA 5BNNB 1SHWB 2Q0AA 5GZGA 3RZJA 5GLUA 1SBFA 3J8F3 4BOWA 1A3KA 3HAGA 4IE4A 4LBQB 4Z2AA 5CFCA 3L2HA 1WD4A 3VBFA 1QH6A 4KG0A 3ZXJA 4OZXA 3S0MA 4XABA 5ANNA 5JSOA 5E88A 1RMU2 2ZHMA 4OHYA 4Y4YA 2E6VA 4B3NA 1SPPB 2EIBA 1JS9A 1OF4A 3G7DA 4XUOA 5JIUA 3POWA 2C4XA 3NWKA 4CDXA 4BM8A 1F4HA 4YZ4A 4TZDA 3OUJA 4IV3B 2WZPP 4CPBD 4H2AA 2VTXA 1QOTA 2OIIA 5FJKA 4BA6A 1AR63 3ORJA 5E8AA 2FCVA 4F7ZA 1VBE1 1REFA 4OLLA 4YNIA 4NWVA 4Q5OA 1F5JA 2HH9A 1WW4A 2BW8A 4LULA 4Y1VA 1L7LA 1X8MA 5E16A 3UL2A 4COYA 2QQOA 1CAWB 3LEIA 3OPTA 2WS93 1TME1 2BGOA 3ABZA 1G9DA 2W2IA 1WA6X 1WLDA 2XBO3 2ERFA 1QIQA 2K9ZA 3DECA 3GZTB 4QGLA 1NCQC 4XJAA 4YG3A 5IK4A 2WO2A 5LA0A 3INAA 1AXYA 5C33A 2XVGA 1VBE2 4H14A 4TXWA 2E63A 4I0AA 4IEPA 4TYSA 2V73A 2VMDA 4EN6B 5A1AA 1UD1A 4EZHA 4AVCA 2GH8A 1TME2 5A7QA 3THCA 3ZN4A 1PO11 1S0CA 2FDGA 5T5PA 3ZOIA 3KB5A 4ES8A 2WAAA 5BNQA 3LFMA 3NJYA 2HWD1 3P1IA 1VE0A 5BNNA 4OZOA 1JOBA 4GWMA 3WT3A 4LBQA 5FYMA 3RWNA 3N9NA 5FTTC 2ARAA 3ZDSA 4JDOA 3J9SA 1GQPA 1ZM1A 2EA7A 1PO12 1C8NA 1CIWA 3QCWA 4P9YA 4XF3A 3ZYPA 1FAYA 4IE5A 1GQGA 4S2FA 3S7EA 1MZEA 2HWD2 4FPEA 5C3OA 1NT0A 2OS2A 3OGGA 1W0PA 1T2XA 1SPPA 2WT2A 4QXBA 3RJRA 2IZWA 1YNAA 1MS3A 5EFUA 1G9AA 1HJGA 1V6MA 1RUI3 5DZEA 2H6CA 4J1WA 4ONUA 4IV3A 2E51A 1BLZA 2PHRA 4QDRA 4H7MA 4AXOA 1NCRA 3BGAA 4LBKA 1QJX3 1T6BX 4QGNA 3ZMNA 1X7NA 2VW0A 4A6SA 2QJVA 4FPFA 3SQOA 1YFUA 5T5LA 3D4KA 3ZVXA 1PO23 1TE1B 4AYUA 5A70A 1AR71 2JEMA 2HWC3 3AZWA 3VDBA 4Q4X2 1UY4A 1WBFA 1CAWA 2XKOA 3PVOA 4MADA 4XBNA 3OB8A 2Y60A 1CQ9A 3H8RA 4RS5B 1YFXA 1YC61 1ZZ6A 3ENRA 4LO4B 1W6NB 2XH6A 3U78A 4UBGA 5LA2A 4XE9A 4QWNA 4AAPA 1GFF2 3CJIB 4R4ZA 1MVQA 4CZSA 3QD6A 4J6GA 5J3UA 5E1RA 1CN1A 3HNMA 1JZ4A 2JWPA 2AEYA 1O3RA 2RG4A 2XJQA 4R9DA 5GZDA 1RUG3 1Z78A 1PMJX 5D8AB 3WG2A 1GYKA 5C3QA 1OLQA 1MS4A 1W2UA 2Q8EA 1RUC1 2BGPA 5IATA 2WNUB 1SLTA 1UIKA 3ZR5A 3OGVA 4UFLA 1DCSA 3W21A 4I0WB 1AHSA 4HKOA 4O9EA 1JU3A 4ES9A 3IAQA 3IDEA 2CDOA 3M1HA 1QXPA 2BWAA 2YUEA 4JRAA 4XZPA 4MX3A 2ZKLA 5IJRA 3VD5A 5IVEA 2WRAA 4UW6A 2X10A 4ZPIA 3CIHA 1R1A1 4QPIB 3PTYA 1CGPA 1ZZ7A 1APNA 1RUC2 3BUCA 1RYYA 3MI8A 3AKSA 4YFZA 5FOJB 3DYPA 2CU5A 3BOPA 3HQXA 4AE2A 2WQ8A 3HEIA 4FTBA 4BK5A 2J1SA 4JDNA 3KT1A 2QFEA 1R1A2 3NV4A 1TZOA 2QTWB 2MEV1 3FX3A 3UGGA 4B1LA 3V64A 1FI2A 2RR11 1W8HA 3J7LA 1YRZA 1F4AA 5F6KA 2ZMLA 3PJQA 5K0UB 1DBNA 3CZUA 1SLIA 4M01A 1ULOA 1YFYA 2Z5WA 2ZGQA 1DYOA 4AEDC 4AHZA 4MXVA 1WCSA 1UOFA 1EY2A 5FKCA 1YWKA 1QJY1 1V6LA 5JAXA 3VBRB 1JW6A 2G9FA 1H0BA 3D5OA 4RYDA 5JI7A 5LY1A 2ADDA 2BNOA 2BQPA 2NLRA 2ORZA 2R041 2F4PA 2ZTNA 1HRV1 1MEC1 1O3TA 3CJIA 2RS12 5C9AB 3AP9A 5GLZA 5FYSA 4XMIA 4OQ9A 4I09A 1O4TA 1V6OA 1QJY2 1I3HA 1BMV1 5D8AA 2GC1A 1RMU3 1TMF3 4MHUA 4AQ6A 4DXRA 3H50A 2ZHLA 2WNUA 5LBBA 4K7JA 1OLMA 1UWWA 1XU2A 3F95A 5L36A 1HRV2 2H0VA 2PTMA 3C8XA 5LA9A 2GN3A 3LGRA 4YM1A 2G1MA 4E27A 2P3YA 4QQOA 1UW8A 3CJXA 3HWJA 4QPIA 3EMRA 1JOPA 2JDAA 5I0UA 5KHJA 3P6BA 4O9GA 1WMXA 3AYDA 4AAXA 1HV0A 1UU4A 4BLJA 5HCHA 1GKBA 1UKGA 3ZYBA 3OTFA 4META 3ZYHA 1Q8OA 2VBBA 4YM0A 3OPZA 2EICA 1POV0 5FP4A 2Y6HA 2ZX0A 3KCYA 3NAPC 3WX5A 4AFAA 1MZFA 1WCDJ 4EV0A 1JZ3A 4UI9L 3SCFA 3KGLA 5FP8A 1VBE3 1XSQA 4H55A 4AEKA 4IEOA 5K0UA 4A4AA 2D3RA 5DDJ2 4DO0A 4KBZA 4FAHA 1H9PA 1TME3 1AYN1 3A23A 3MHZA 4IDZA 4XDPA 3ZXGA 3AX4A 1IPSA 2Y6FA 3POYA 5EZWA 4RL7A 1HN1A 4CDUC 2D44A 3M2MA 5FY8A 3T1MA 3ZYRA 3U0ZA 1W05A 2OW4A 5LEJA 2A7AA 2XLAA 5C9AA 4PIXA 2GAUA 3J7MA 4XVHA 5KHGA 4YVSC 1EUTA 1PO13 2GN7A 5FPXA 5LK7B 1KXGA 2F6BA 3AKPA 1IG3A 3ALQA 1UXZA 2BNNA 3WQ0A 4AVBA 1GNZA 1XNAA 2HWD3 3HMYA 3KZ4C 1V0AA 4XQDA 1ZRDA 3WZ1A 4W6WA 3JU9A 4O61A 1W9YA 4YW4A 2D40A 2WNEA 5C70A 1UOGA 2KR2A 3CKHA 1J84A 2JG9B 1VIWB 2VW2A 2AGSA 2O8OA 3VKNA 3AKTA 1GWLA 3D0JA 2WABA 3O0WA 5IFPA 1VR3A 3UGFA 4EN7B 3O1UA 4JTNA 4FPKA 4MH0E 1C4RA 2W5FA 4Q4X3 2XLFA 4DXZA 2XR4A 1W6MB 3JZVA 3QH6A 4F83A 3WW1A 3RZZA 1YQ2A 4M3CA 1R1ZA 1SDDB 3NJVA 4LBLA 2O8QA 4Y5Z0 4QPWA 2BP6A 1JZ7A 3I2HA 2R16A 1GOFA 1PX3A 5JUVA 4Y3OA 1F5FA 1UMZA 2UURA 3R4DB 4WM8B 1W9SA 4XFFA 3T2PA 2CAUA 4FXKB 3LF7A 1ULFA 3THPA 4E9KA 3BN6A 3M3CA 1AR91 2R49A 3FN9A 4OHZA 4FPCA 2CWSA 4CXWA 5ACA2 2WZR1 2XQRA 4IE6A 5FZ3A 2WNVC 3SITA 3ZIWA 1W8OA 5DN2A 1BBT1 1GZCA 3MPBA 1ZREA 2VD7A 5FY5A 4AHYA 5FXWA 3ZYIB 5CBLA 3Q8AA 4XW3A 2FD8A 1AR92 4GMP0 5I93A 2YFZA 5JDBA 5IK7A 1UY1A 3SEEA 3K46A 3FL7A 4NHLA 2WZR2 1VRBA 5J7MA 3MV01 2ZZJA 4Q4V1 5FY4A 3ME2A 4GIQA 5J37A 2Q8OA 1BBT2 5IFTA 1XNCA 4EN8B 1W8NA 2JG9A 2C26A 3GF6A 1MPXA 4GJZA 4DXSA 3Q9OA 4D0QA 4X6QB 2B7YA 3GDBA 4UFIA 2XJUA 1PM4A 3O1TA 3KT7A 4CCKA 1OOPB 4OUMA 2DURA 2E26A 3FFQA 3GBGA 4LE3A 4MUVA 1J59A 1H2KA 4IV1C 5CU1A 1DZQA 4Q4V2 5F5AA 2AEZA 2VNRA 3A22A 4QQ2A 2WINB 3KF3A 5F9TA 2VBDA 1HJFA 1NOVA 1W6MA 2P37A 2YGMA 4CDQA 4QXKA 2DCJA 3BU0A 2VZOA 5FZAA 2OPWA 5I91A 2VZPA 4GWJA 4Q8LA 1UL9A 1I5ZA 4Q4Y1 5JR7B 1K42A 1SG3A 2R7EB 3T4HB 2CWMA 3DGTA 1IKQA 3BTXA 1M06G 4CSWA 1W28A 4HLTA 5JZGB 1Q5OA 3KMHA 4WM8A 5JI9A 3O1PA 3ZKUA 2DU1A 2RS13 2VZUA 1VBD1 1MACA 4UWDA 1S2EA 4HBNA 1RUOA 2VL4A 2JICA 4CP9B 3RYKA 2ZPXA 4B29A 2LW8A 1WA4A 1WMEA 1REDA 4N8MA 5FUIA 3T09A 4NAOA 1H30A 4RS5C 4B4PA 5HV4A 3AMPA 1LENA 1HRV3 1MZ6A 3MBWA 4IETA 1P8JA 3KV6A 1VBD2 2ZGSA 3AMNA 2QQUA 3D8CA 4LKDA 1CR7A 3E5QA 3IBMA 3AP6A 3RNSA 3WNPA 1U0AA 2PHXA 4CVUA 4RHV2 1C8M1 1K5MA 1GZTA 3MV11 4QHOA 3NNMA 5FYIA 3H3LA 4A3XA 3PURA 1EAH3 4J25A 4PCRA 5D8AC 3W58A 5JCTA 1XC6A 5JPMB 3ILFA 5LRSA 4RD7A 2WNUC 3ACHA 4O65A 3E6CC 2IXCA 1LOEA 4C91A 2VW1A 1GNYA 3N9LA 1GV9A 1XNBA 1SLAA 3H7YA 4YZ1A 2C6SA 1VBA1 1OOPA 2BFUL 2VZSA 2WZEA 4FPJA 4I3PA 1W9WA 3HPNA 4QPIC 1ZZCA 2JDZA 2XONA 4ARXA 4B4QA 1GLHA 4BQ4A 5JXJA 4ZHNA 2NMNA 2UWCA 5DDJ3 3N4MA 4BQ3A 2O0OA 4WZFA 3L2YA 1FPN3 1OH4A 1JYVA 2DTYA 2HEYF 5JXIA 3MO4A 3GCXA 2B9UA 4Y22B 4JTOA 4FXGB 5DG2A 3TEZA 1VBA2 3NSTA 1E57A 4YSFA 2KXLA 1KD7A 1OT5A 3C3VA 3HD8B 5JZGA 2X8KA 1HB4A 3KT4A 2ARXA 3UJOA 1SLBA 2J1RA 4XZUG 2XMLA 1BCXA 2R32A 2R071 3LE0A 4ASMB 3O7OA 5F2SA 3RMXA 2VCMA 2DU0A 2O1QA 2JXAA 3KM5A 2ENRA 1IG0A 4CP9A 4ASKA 4K8RB 1ULCA 4PDWC 2VOTA 4B1MA 1SBEA 1X8EA 3VBRC 3M3EA 3OF1A 5A33B 2OQ7A 1ACCA 2W0XA 5GJ6A 2E32A 1FV3A 1N1YA 2C9KA 3EXUA 1KJLA 2VMGA 4A6OA 2VUAA 1RGSA 1T6GC 3JBG1 3POFA 3DF0A 3PVNA 2R072 1US2A 4HZFA 4LO5B 4N43C 1L3JA 2VOVA 3POGA 3N9MA 1VMJA 2CNAA 2X53S 5FQ0B 4XXAA 1R091 4I3GA 1S0EA 2PMWB 3C2UA 5IWFA 2HEVF 3MW4A 1FNYA 2DWRA 3RYPA 3RJ2X 1COV1 2VCBA 4QAWA 2RM21 5F5QA 5A3PA 2HWE1 2ZGTA 1Y43B 4SLIA 3QACA 4MVTA 5BPXA 4BIFA 3UESA 4D69A 1Q43A 1AZDA 1W04A 3W5NA 3JBG2 3RGBA 3ZN5A 3FLPA 4RFRB 3C7GA 4DEQA 1WZXA 3OJBA 1Y3TA 4KGGA 1OVPA 1OVSA 1ND3B 3PL0A 4OYUA 1YQ6A 4YYOA 1NXD1 2WLQA 3VDCA 5BYNA 4JHZA 4MGTA 2RM22 5CZKA 4XAAA 2HWE2 2RJKA 2AH2A 2RS51 3RG0A 1HB3A 4MHRA 1CPNA 1Z7S2 5F3IA 4Q0PA 2A71A 4Y22A 4LOSA 2TNFA 2DCTA 3C7OA 2VMHA 1CD3G 4BXFA 2BOJA 4LBOA 3OCPA 1PVC1 5GZCA 5ACA3 2WJSA 3AK0A 4MGKE 2HWB1 3E97A 1BJQA 2ET7A 1DGLA 2RMU3 2RS52 2ZEYA 1QNWA 2WO7A 3QOPA 2FHRA 2GP3A 3AC0A 5KXDA 5CIRA 1XYPA 2WFF2 3I2GA 5HCAA 1CONA 4LXLA 2QQVA 3LKJA 1AR93 2CYFA 1HRI2 3DN7A 4QU2A 1JZ6A 1O7FA 1PVC2 2PXJA 2FDIA 3BTZA 5A6XA 1ZBA1 2WZR3 5A33A 2HWB2 4GKYA 1Q8QA 1ULEA 1XPWA 4ISRA 2Q1MA 1H6XA 4QHZA 5FYUA 3U1XA 1D0GA 1BBT3 3GHMA 1U5YA 3KF5A 2Z42A 2ZX1A 1XYOA 4TLFA 1GU3A 4PBPA 1UZZA 1W8WA 2VMEA 5BNPB 5FQ0A 3MDPA 1XBFA 2WN3A 3RZMA 4CUGA 5JXGA 5G05L 1BZWA 3VBSB 5LZ6A 2FZ1A 3H42B 4GJYA 3EYPA 2YGLA 3DV8A 3B94A 4JKLA 4XJUA 5EXOA 3U10A 2QQPA 4BQWA 4NIHA 4NIIA 1KFXL 2QDRA 3AKQA 4P9IA 2OUJA 1H2NA 3GM8A 2AACA 5FMOS 4IESA 3VZNA 1UOJA 3GCWA 1C28A 2QQNA 5LW9A 4TTGA 1W8TA 4NJ4A 3AM2A 1QOSA 4JX0A 3NMBA 3R4SA 4GWIA 2Y34A 2P5BA 2D43A 5A32B 4O7XA 2VTXJ 3USUB 2D6MA 2A3XA 3DEMA 2BU9A 1AR81 1KITA 4YW5A 1E5RA 3K4ZA 4LA2A 4OCTA 4Q0SA 3WF0A 2ZABA 3WVJA 4DS0A 2TBVA 4UF0B 1N3OA 4LUKA 2CSGA 4BQ1A 3GJBA 4IEVA 3V56A 3S57A 1ENRA 1VBD3 5IVBA 1JZ2A 5JPNB 1YO8A 4WM8C 1AR82 3MFCA 1PIV2 5FXXA 3U07A 1V9U1 3V0AA 4RHV3 4UW5A 2WQ4A 4R8HA 4HOOA 3CHXA 4L9BA 3AZZA 3A0KA 2JIGA 2EXHA 3IDAA 4X8NA 2VXRA 3JD71 2GC2A 4Q29A 4XCAA 1TEIA 4NE9A 1EUUA 3PMEA 2P1BA 4FPLA 5BNPA 4OMCA 4XXPA 4NRPA 4XETA 5DAPA 1V9U2 5H9RA 3T4VA 1X9PA 3VZLA 4I30A 4D7SA 5J09A 1Y7BA 3TAYA 3TBDA 5A6QA 3VBSA 3ZXKA 4W8JA 4CEYC 4AR2A 3GZEA 2WN2A 3N35A 3JD72 4LA3A 2JB4A 1ULDA 2OXBA 3RYRA 2JENA 2YDEA 4FPGA 5FBJA 2C5DA 5FK8A 3WUCA 3WP4A 1FOD1 2JDHA 2XKPA 3AL5A 3NAPB 4CP2A 1W9FA 1O3SA 4UFJA 3CLPA 3AFKA 4JKMA 1RUF1 1WCQA 1I1EA 5T50A 2DVGA 2A3YA 5EP9A 2JIJA 3LB9A 2GNTA 5A32A 5IAXA 4FOWA 3USUA 1F35A 3E5XA 4AEDA 4QKFA 1DP0A 5FBZA 3HN1A 1FOD2 1MS1A 5FY9A 5T54A 3ZSJA 1MQTB 1ZYBA 2OPKA 1SEFA 1RC6A 1VBB1 4FCAA 4XUQA 4IGOA 4CDUB 4N7UA 2Z2SB 5HPOA 2NPIA 4W50A 1OUSA 3PTRB 4UF0A 2DUPA 3IB3A 1POQA 4LR4A 1EP0A 2GNDA 1LHOA 3N36A 4Q0QA 2RS31 2NYYA 1PZ8A 4L8QA 1BK0A 4DY5A 1OXCA 3N7LA 4AVAA 2RHPA 4YVSB 5FZOB 2R6QA 1OPMA 2OA2A 1DF0A 1VBB2 2D98A 3ZDVA 5LRRA 2Z69A 1B09A 2VH9A 4AEMA 2JD4A 4CU6A 5K4LA 1DYKA 1GWKA 5DUWA 2WWJA 4RGGA 3I2OA 4WVMB 5H9SA 1G9BA 1IZ3A 2A70A 2RS32 3JBG3 2VZRA 5FPBA 5HXMA 5FZGA 1GZWB 3ZXDA 2NMOA 5A7OA 4A7ZA 2XVLA 3DKQA 1L7QA 4JQTA 2IXHA 4LJHA 5IVYA 2RM23 2XG3A 1RUJ3 3HJRA 2HYXA 2YBSA 5FK7A 5EIYB 4PBOA 2QBXA 4UFHA 1OQDA 1Z7S3 3LZZA 3ZR6A 3A21A 4LBMA 2KD7A 2BV4A 3TYJA 5AVAA 3MZHA 3P3NA 5F3EA 4Q8KA 3NAPA 4WV8A 2D5HA 3U4SA 2EIGA 4AQTA 3QH7A 2A75A 3I49A 1POV1 2DVDA 2LM3A 4G4FA 2EXIA 3T2QA 3ZSKA 1I6XA 5C71A 3POBA 2W1SA 2EIEA 1S0IA 3LOBA 2WFF3 4AF9A 5DAWA 3DCQA 4BH9A 1MQTA 2YHJA 3VBUB 4CDUA 2WZ8A 1HRI3 2JDUA 3WCRA 3NKTA 2JDPA 5JOWA 4ZXEA 2HWB3 2WNVB 1NZIA 1PK6B 3AJZA 3GJAA 2UWAA 3IDBB 4IUGA 1OLME 3ZKYA 3POIA 2XJPA 3O0VA 4XBQA 1VLNA 4YVSA 1SDWA 5FZOA 1NQDA 2WWSA 1CZSA 1N47A 3AB0A 2ZOEB 5FZ4A 3THDA 4L2NA 2A6XA 4KWUA 3ZMOA 2PHDA 3RZLA 2WL1A 3WNMA 5KHKA 4WVMA 2V4VA 2QQWA 2ZGLA 3PUIA 1XYNA 2W95A 1QWRA 2A5ZA 2BZDA 3U14A 4AI8A 4JKKA 3QBQA 3WF3A 4UW3A 1NLSA 3Q8FA 4P5HA 5GLTA 3ZX7A 5HV0A 5JMCA 2VU9A 4JV4A 4IV1B 1LTEA 2FMDA 4S2HA 1BHGA 1DG6A 1QF3A 1QDCA 2WAOA 2EAAA 4MZUA 3B02A 4FPOB 3MUZ1 1TNRA 3HQUA 4KL1A 2PFWA 5I8TA 1CWPA 1ASJ3 4LNVA 2EIDA 2B42B 2BRTA 1ODMA 3GZUC 1GUIA 3A7QA 4YW2A 3SH5A 3ZPOA 4CEWC 2GH2A 1ND3C 1ONAA 1CPMA 5D1IA 1TVGA 4OHXA 3PIJA 3IIIA 5FIXA 1JYTA 3FMGA 1RIRA 4YGBA 4EWEA 2WIIB 3I54A 3K48A 4NWWA 2DTWA 1UX7A 2WR9A 4HK9A 4X8PA 1NX9A 1H6YA 1XJAA 5FYZA 1PIV3 4FVVA 3K4AA 4NHMA 1FX5A 4NVPA 2JG8C 2Y6GA 2W68A 4JC1A 4FOYA 5DZFA 4MGYE 2ZGUA 1LOBA 4XFBA 2WNVA 4MGQA 2WA4A 1YXWA 1UF2C 2GNBA 2WDBA 2ZAHA 4FOVA 3W5MA 3O1VA 1AR72 2IXLA 2BPA2 2AZ5A 3AL6A 5BNOC 5L19A 5GALA 5L9VA 2K2SA 3AMQA 4NAMA 4XILA 1V9U3 2VMCA 3VKOA 4E2SA 3UT0A 1HN0A 2ZGOA 1FYUA 2BERA 3GBFA 3CEWA 1UZ0A 3HBKA 4KQ7A 2FDJA 2VQAA 4PHZA 4GMP1 3JD73 2KM2A 2ZMKA 2BWCA 2RJLA 1J3RA 4Q0UA 4NHKA 5FZBA 4LIUA 4NPLA 2IFWA 4M3CE 2TEPA 5BNPC 3H8OA 3O14A 2XQXA 1RUH3 3FWEA 4IV1A 4K1ZA 4Q1PA 4RN5A 4YZ3A 3B93A 2VUCA 3TNPB 4UBHA 3DKWA 3VBSC 2W9XA 4LIVA 1DQ5A 3KSCA 4LEJA 3I59B 2FDKA 1FOD3 1NE4A 3J4UH 4RSUA 3R0RA 1LHVA 1LOCA 2NZ9A 2YV8A 4AVTA 1QQP1 4QB6A 1LODA 2X05A 3OPWA 1BEV1 2DV9A 2J1VA 4B8EA 1K45A 3FHIB 3IT8A 5AVPA 4XCBA 5B4XA 1RB8G 4GULA 4NUBA 2YC2A 4B7KA 3THTA 3ASIA 1DFQA 3OBZA 1LKNA 4QMAA 3B3QE 1OA3A 3DYOA 2A1XA 1VBB3 1OMIA 3TOJA 1ZBE1 1ZRRA 2Q8DA 1QQP2 3OBAA 4PDWB 3DPRB 1ND2B 1BEV2 1US3A 3T0AA 4NROA 4RS5A 4OHWA 2MEV2 4QXHA 2ORXA 4AEJA 5B4NA 3W9AA 2RR12 1QOOA 3O1MA 5FZFA 1W6NA 3LSDA 1IQDC 1RUD1 2RS33 4ZONA 3KHBA 2D6PA 3ITQA 2Q8CA 4QPYA 2HLEA 3WD5A 4N43B 3AMHA 3RMYA 5F6LB 3KQ4B 5KWRA 2QNKA 3EHKA 1ZBE2 2VC9A 1K3IA 1KDKA 2ZKNA 1NKGA 3H1YA 4AVVA 2EXJA 5FPUA 3B5LB 1JUHA 4GQ7A 1L7RA 4KBBA 1VB4A 1V6JA 1RUD2 1UYPA 4K21A 3VL9A 3AYEA 4CPBA 2R042 2VZ1A 4L99A 1MEC2 2GALA 2Y6LA 1LHWA 4LO6B 4YG0A 5F8PA 4ATEA 4XFAA 3PVBB 2HEWF 2ZHKA 4V1PA 3H8XA 4Q27A 2Y38A 1V6NA 1OQ1A 4DXTA 3T0DA 5CG9A 2IFRA 3NW4A 1MZ5A 3KVAA 3SH4A 5CAZA 4I01A 5T5JA 5FDBA 1BMV2 5FXZA 5FJHA 2V5DA 3E5UA 4Y1XA 4C90A 3MW2A 3C7HA 2B4KA 2QQKA 3KLSA 1JHJA 3CNAA 4IEWA 5I0SA 4ZY9A 2JB8A 4DFSA 3BKZA 2J7MA 3AP7A 3I2DA 2QQIA 3I59A 1FMD1 3AXDA 4UW4A 3OGSA 3FFZA 4LTAA 5LBEA 3VBHB 4AHWA 3WNOA 4A3ZA 3IZOA 4XUTA 2WYSA 2ETEA 2V09A 3WG4A 4LBJA 3K2OA 3VLBB 4E4DX 3VZOA 1YHFA 4AQ2A 4CCOA 1SCRA 3SKJE 4CU7A 4M4PA 4HSJA 2I45A 1OQEA 3JQWA 3FBYA 2ZBJA 4RFT0 2JE8A 4XF9A 4PDWA 1ND2A 1MQTC 2VM9A 4QX2A 3VBRA 4ARYA 1WMDA 4YZ2A 1B35B 2DF7A 5A7PA 1JUIA 2YPDA 1KGYA 3OBRA 4ITCA 5CNAA 4YM3A 4YPJA 5C4WB 4XTPA 4N43A 1LHNA 2YMZA 3IM0A 5FZ7A 5KXCA 1EV11 3H1WA 4CXYA 4BQXA 2BVBA 4COWA 2CHHA 2VTFA 2VQ0A 1AYN2 4KU7A 2BGCA 5HI0A 4LKEA 4HL0A 1GWMA 2I74A 1LOGA 3MW3A 1XNKA 2I07B 1UYXA 4S2DA 2VBPA 4ZU7A 5E89A 2OVUA 1VMFA 4HMZA 3ETQA 2Y64A 1XU1A 2WC2A 4AG4A 1GNHA 1OPOA 5F3CA 4XJZA 3HN3A 2YROA 3SXWA 4W4ZA 1SACA 2VECA 2ZEXA 1OI6A 5L9BA 3SEPA 5IW0A 3ES1A 1UKRA 4GH4B 1WMFA 2E7TA 2E33A 1O3QA 2W08A 3LOIA 2ZZQA 3SH3A 2N7GA 4HG6B 4FAGA 2JKBA 1C3HA 2ZX3A 4YVWB 3VD9A 4C0HA 3O1OA 2R061 2QUOA 1PGL1 1STMA 4IGQA 4AI2A 4ZU4A 3AYAA 5EV7A 2CV6A 1WD3A 1DGWX 4EQVA 5HBAA 4WVVA 2XB6C 4LO8A 3MIBA 1JN2P 1IHMA 1UY3A 2A6VA 1XE0A 4ISQA 1AR73 1D4VB 4RR3C 4BQYA 4XJ8A 5FP3A 2XPJA 1OFNA 4UFMA 5J36A 2WT1A 4PJYA 2XL9A 1PGL2 1VBC1 2XL7A 1G8WA 3RZHA 4Y1ZA 4RQPB 3VBUC 1CAUB 4CU9A 4MGZE 4DIQA 2VUDA 3LIGA 3AZVA 3VD3A 3DYMA 5FLJA 4GB31 5C4WA 2DBNA 4LPLA 1PK6C 2ILMA 2VZQA 4UFKA 5ANQA 4IEUA 2VUJA 4FP2A 4CUCA 4OFGA 2UY9A 2ZCWA 1IPJA 2P34A 1VBC2 4NHXA 4CUBA 2QQMA 3FC0A 2BYVE 5J96B 4LT5A 2PHUA 1VMHA 2BBAA 4CEYB 3WHTA 3MFAA 5FY0A 5A3LA 5I8YA 1RUC3 2VGDA 5FZIA 3V0BB 1O91A 4K6BA 3KHCA 2G9ZA 2VZ3A 2Y33A 2Y0OA 2WO1A 1ALYA 4DPNA 4KH9A 5FUPA 3AP5A 3KWVA 4G9SB 3N9PA 4HKLA 5FYYA 3FZ3A 1IQAA 4QB1A 3SISA 3WV6A 4Y24A 3ZN6B 4CCLA 1R1A3 3WNXA 3I97A 4D8MA 1LGNA 4Q26A 1A8MA 3ZFFB 3EJKA 4JVAA 5CB7A 1Y9QA 4YVWA 4BMEA 4DEVA 3QLQA 1W6QB 4MSVA 3F2ZA 4BWOA 4D3WA 5K7PA 1OBNA 2GMPA 3ZFGB 1BEV3 3NL1A 5T55A 2W92A 2MEV3 4JDMA 4LLFA 3H8UA 2RR13 1QNYA 4YZ5A 4KI5M 2PAKA 3NJXA 2WSVA 2E7QA 4GKXA 4MO3M 5FYHA 3T3YA 4Z1VA 3JB8A 1WLWA 2XUEA 1GQHA 1PNFA 1UYYA 3KCCA 1ZBE3 1ZZ9A 2VJXA 2MPFA 2BBVA 1RJ7A 1CAUA 1LU1A 1QJY3 1YIPA 3U11A 1HQLA 3CZJA 4Q4Y2 3U37A 5FMOL 2A6YA 1RUD3 3HT1A 5F5CA 4JGZC 4QX5A 4SBVA 2R043 4BPZA 1MEC3 1QDOA 1UZYA 2XUMA 3D3AA 2Y6KA 5FYCA 4MGSA 3VDDC 1HB1A 5AC91 1D7PM 2ZGPA 1LAJA 3JUUA 2CTVA 3MF6A 3GGLA 4QQHA 1O8SA 1OHFA 3OY8B 4CEYA 1H1AA 3CO2A 5KHHA 2OYZA 3V0BA 5CKQA 1YIFA 4DUXA 2A3WA 2PAMA 2P3KA 2RDRA 3OSDA 2IXJA 4JCKA 1J1LA 4M00A 5FZ6A 5AC92 1WW6A 1ZX5A 4KNCA 4DQAA 4I2OA 3ZN6A 2E9QA 2HYKA 2RDNA 4HFSA 5IAVA 1C8M2 4QX0A 5FMCA 2FMYA 2ZJCA 4AFBA 1QMJA 4OQ8A 1LHUA 2JDKA 2EXKA 3IAPA 3ZFFA 3ZO0B 2BOIA 3AZXA 1PMHX 1ZRIA 2YC0A 4DUVA 2WUHA 5C8CB 4L11A 3S7IA 3KV4A 3HR9A 4AI0A 2IVJA 1W6QA 4PI0A 5FO9B 3RI8A 1KS4A 1HV1A 3ZFGA 3S5QA 5LCWL 2ARCA 5FZMA 4IW3A 1NE6A 1S0BA 2PN5A 2GDFA 3ACGA 3ATGA 3B01A 3UJQA 3VHNA 2YBPA 1AYN3 4JRLA 1RL3A 3H1MA 5J48A 1MVEA 1LESA 1UMHA 4LHKA 3BYWA 3WG3A 5A3OA 3ZLIA 3DPRC 1ND2C 1RVF1 1XNDA 3PUQA 1IS6A 1OUXA 4MV2A 1FV2A 5K8SA 2JE7A 3BIEA 5BUVA 5LY2A 1G7YA 2DCYA 5ERLA 5FZ8A 1C5HA 4BLIA 3S5AA 3DUIA 4GALA 1OD3A 5FRAA 3OY8A 2PYTA 1MR5A 2BNMA 4MYEA 1RVF2 2FCUA 4Z82A 3I3MA 1DZTA 3ZSMA 4R9CA 3IMNA 5DUXA 3JB4C 3O12A 2AENA 4DOUA 4R4XA 5JLVA 3OG2A 1AJOA 3TB0A 4CEWB 1R092 2DVBA 1WW5A 1NZCA 5DXDA 4DINB 1DIWA 2PAEA 1COV2 1ZA4A 5IYYA 3J8F1 3WF4A 5C8CA 2D6LX 3EB7A 3MIFA 4COZA 1AXKA 1CJDA 5KC5A 2OUHA 5DG1A 3BB6A 3WDTA 1LNSA 3SCGA 4ZZ8A 3MPPG 4V2VA 4CUAA 2JG8B 3TN91 5K9YA 3VBHC 5ABJC 5C7GA 4CCCA 1VJ2A 2WT0A 1WCUA 3IDCB 4OI4A 4QT6A 4PQQA 1NG0A 5FZEA 1F9KA 5FWEA 3V65A 3WDVA 2ID4A 4A2UA 3E6DA 3LFIA 4GD4A 1VPHA 4BK4A 5CKNA 1XNTA 1UCXA 2VVEA 5BNOB 5FMBA 4R9BA 3KCXA 1UXXX 4JGYC 5DQ0A 1QGLA 2XGXA 3SCHA 4D7YA 1GP5A 1IS3A 3TN92 1AR61 1WCKA 1MS0A 2VCCA 3MIGA 5IK5A 5DZGA 4UT5A 4QX1A 1B35C 5LBFA 1E5HA 4K20A 5C4WC 4WM7B 2V72A 4YM2A 1YJKA 3RRDA 1LRHA 1OF3A 3OD0A 3DL3A 1D4M1 4GZ9A 2X5IB 2BEOA 1NXMA 3FHAA 4LKFA 4NRQA 1JYCA 5FO7B 1ZBA2 4XHBA 1JI6A 5SV8A 4Q4V3 3N3HA 2X29A 3WQ1A 1UU5A 2D97A 5FZHA 3UK9A 1D0HA 3BPZA 2HJIA 3MIHA 5ISLA 4CEWA 3ILRA 5C8WA 1ND3A 1D4M2 4A41A 2W52A 2CY6A 5A7WB 4FFGA 3K77A 1J1TA 1GOHA 1YQCA 2DVAA 3WNKA 1W06A 4I02A 4LORA 4LK7A 4GH4C 4WBBA 1D2SA 3WCSA 5FWJA 2Z4FA 4NO4A 2JG8A 3PUSA 3I3QA 4YVWC 5I0RA 1UPSA 2ET1A 4XUNA 3ZSEA 2EALA 4Q4Y3 4LHNA 4PT6A 3D82A 1S0GA 2DDUA 1W39A 3ZYJB 1O5LA 1XRUA 5HCFA 1PMIA 4XYXA 2GC3A 3OYWB 2Y8KA 1RUI1 2SBAA 2ZXQA 4U2AA 2B39A 2H0BA 1W3VA 2DFBA 2G9GA 3FBMA 5CVRA 5J98B 5BNOA 1KRIA 1AVBA 4LBQD 5FLIA 4ASLA 1H8TC 5J1XA 1HQNA 3WP5A 4IE0A 1W90A 1E5SA 2R0HA 3ETPA 4BE3A 2RDSA 3RZGA 3MLKA 1OA4A 2VMFA 1O6UA 4RQPC 4AGRA 5BY5A 1PO21 2FQPA 5F3GA 1S0JA 2HKXA 1AF9A 1UAIA 1RUI2 2NQYA 3VZKA 3POSA 4BQ5A 1AL0G 4W6XA 2LROA 3LEKA 3LAGA 3VD4A 5EJ1B 2PHFA 5AC93 1LECA 1ZZ8A 1DGRA 4LE4A 2J1EA 2WQZC 4ZU5A 4I0BA 3VB9A 1GSLA 4EE2A 4P08A 2X5IA 4GXLA 3UGHA 1C8M3 4K8FA 3ACFA 4XMAA 2QZ2A 4AOCA 4AVSA 3VBOB 1PO22 4WVZA 3NKGA 1DLLA 4QGMA 1S55A 4PIYA 4CDWB 2V4AA 1RJ8A 4YFWA 4HSLA 1W8ZA 1ZRCA 3OEAA 3BVCA 1XQNA 2YG0A 1RUG1 2LTNA 4H3WA 4LHSA 4HVOA 3CF6E 2WWUA 3ECQA 1VBA3 2ZEZA 2ZS6B 1YI7A 4P14A 5FYVA 1JH5A 4M3CF 2A6ZA 5FUNA 3O5SA 1KDMA 3ZFFC 3VBFB 4JQRA 2BJSA 2P2KA 2P6HA 5LWBA 4L92A 2OQ6A 2W1UA 3LEMA 5FY7A 4AK3A 3HBZA 2WYFA 5FREA 4P5YA 4Y33A 3AP4A 1H4GA 4XDOA 4PLNA 2GC0A 5AFBA 2PQSA 1MS8A 1PNGA 3UV9A 3ZFGC 1D2QA 1RUF2 1JTZX 3AKRA 1W9TA 3OYWA 2RJ2A 3WP6A 4C1XA 1HB2A 3NVCA 5FKBA 4AL9A 5EYXA 5FYTA 4A45A 2R073 4XQWA 3LPGA 3OBTA 4INDA 4CA9A 2GU9A 2WSUA 1H1IA 2YU1A 4KU8A 3PU3A 4IEZA 1VAMA 1V00A 3BCWA 3LA3A 4MOAA 3WF2A 4ZS3A 2XJVA 5T3NA 1S2KA 1YJLA 1UO9A 4COVA 4XFIA 2A73B 4U36A 1VB2A 3JXSA 5JIAA 5LEKA 1A78A 1RHI1 3IKWA 4M0HA 1KEXA 1R093 4XF0A 2WNOA 4BISA 4K40A 2QVSB 2R30A 4P9XA 3VBOA 4CCDA 3KS7A 1COV3 3C7FA 4AGVA 3LA2A 4M4RA 2HWE3 5FXVA 5LATA 3K4DA 1YI9A 3AFGA 4CDWA 1RUE1 3Q8CA 4A42A 1DDLA 2J42A 1UIJA 1FXZA 1RHI2 3T2TA 1DQ4A 3LD8A 1TMF1 5D21A 4UOJA 3ZXAC 3LCPA 4LUMA 1V70A 1F8VA 2VY0A 1XE8A 1DYPA 2J22A 1JMUB 3P3PA 4NPRA 3TRSB 5F1RA 2KA3A 5IK8A 2VOKA 1GANA 2RS53 2Q1ZB 1RUE2 1BYHA 4RR3B 4BMBA 1MS5A 2GP5A 1ODNA 2RE9A 1CIYA 1Q56A 3FJSA 1BXHA 3R4UA 4R9AA 4XF4A 3ZYFA 5C8CC 3BPSA 4FI9A 3TN93 1TMF2 2W1WA 4HKWA 3NV3A 4QKDA 1UZVA 4CCNA 3WF1A 1XE7A 1NAEA 1PVC3 3MEPA 1BK1A 3NNGA 4LHLA 3I2IA 5EHDA 3OUHA 4BDVB 2IC1A 5C6CA 1KS5A 3VN4A 1JZ5A 4HN1A 1OFSA 5DAQA 4RGKA 1NCRB 2Y6JA 4NIAA 4QX3A 2XDVA 2UYAA 4HT1T 5JWPA 2R1BA 4QD2A 2FCTA 5F2WA 5GLWA 5G04L 1ZBA3 2RDQA 1UYZA 5B2GB 2H6BA 3GYDA 2E31A 3PLQA 1ZNPA 2TUNA 3WDYA 5CA6A 1S2BA 4AI3A 4C1WA 4CE8A 1O4ZA 3TWIA 4CCEA 1ENXA 1QJFA 2D6NA 2XWBB 1IGOA 4ZZ5A 1GZWA 2VNGA 3WW4A 1RTVA 3WQBA 3RWKX 3UKTA 3WY6A 3SNMA 1D4M3 5EJZB 5KC6A 1XOYA 4NIGA 2YZ4A 1YEWA 3K3OA 3FE5A 3HIFA 1C1FA 5FPAA 2UYBA 1CZVA 4AFCA 4TLGA 3ROUA 3BOWA 4PLOA 1U12A 1G86A 1V6KA 4XIOA 1CAXB 4FFHA 4YW1A 1OD5A 1REEA 1H1MA 1AJKA 1VALA 5JVVA 1NLRA 1QH7A 2EF6A 3NNLA 4CYDA 2W46A 2ZAAA 1FNZA 1LJ7A 5C3PA 2NP0A 1EPWA 3KQRA 4K9SA 4RR3A 1I9RA 1HW5A 3AXEA 3LDBA 2ZEWA 1SFNA 4XTMA 5CFDC 4D6SA 3A4UA 1AR83 3AMMA 4Y5SA 3O1SA 3VBUA 1OURA 1ZZBA 2OKXA 2ATFA 2WO3A 3TEWA 4TSVA 4JAAA 3RVHA 2K0GA 3ILNA 2UY8A 1KJRA 4FT8A 1G6NA 2DFCA 4QPGC 4ZS2A 3UKVA 4D94A 1PK6A 4Q4X1 4JGZB 1S4CA 2AR6A 2P17A 3MLLA 4NR1A 4V2WA 5A6ZA 3T1LA 2Y26A 1QJEA 1ZVFA 5FYBA 1SCSA 3VDDB 2I2SA 4YGEA 5C5UA 5A3MA 5HXVA 4W65A 4LQRA 2WKKA 2Z79A 4Y4RA 5T5OA 3WSOA 1X33A 2ZHNA 3D0SA 4HK8A 4OUEA 4CTEA 1M4WA 1X36A 3ZIXA 4A7YA 2B8MA 2VZVA 2D3PA 2PELA 5IVVA 4EN9B 3VUOA 1XB9A 1DU3D 5A7SA 1UZWA 4NIDA 2VPVA 4WM7C 1IKPA 4Y26A 1O59A 2CAVA 1N3PA 3GALA 5JSRA 2CGPA 2EAKA 4EZ4A 1V6IA 4XBLA 3T0BA 3EQEA 4E8DA 2X5IC 1WWYA 4MGIE 5FR3A 2VE1A 1UY2A 3SHRA 4UYBA 4BHPA 4IERA 4CP0A 3LPFA 1CAXA 3NNJA 1QU0A 3HT2A 1AUYA 4QB2A 1F2NA 1GMMA 1OKQA 2W94A 2YB7A 4KMQA 2P6CA 2XXZA 4AGGA 2XHNA 2P4EA 4XIKA 1ENSA 1S0DA 4Q1RA 5DABA 4Z07A 3FUQA 3WOGA 1RUF3 1TQ5A 5F32A 4P02B 4C0BA 1J83A 4D6QA 4Y5TA 3RI9A 3VV1A 3JCIA 1GP6A 1WUVA 4BYYA 1UPIA 4OUSA 3RZKA 2VQUA 3IIAA 2W3JA 1JODA 1OSGA 2RV9A 2ZX4A 2XJSA 1XXNA 1HIXA 2VVDA 3N7MA 4JGZA 3MYXA 1O4YA 3ST7A 3BALA 3K51A 3VDDA 3SLIA 5JR2A 1LOFA 2X09A 2XHKA 1F31A 1NA1B 4TWTA 5CADA 4HN0A 4Q0VA 1HLCA 3M4FA 4ZKTB 1U5XA 1UN1A 2RS11 2L9LA 3ELNA 1PVXA 1UQXA 4Z2WA 5M0TA 4PQ9A 4P9LA 1IS5A 3CDZB 3VL8A 5FPLA 5LASA 4KWJA 4AI9A 1RHI3 5F37A 1CESA 4N53C 1G9CA 1S1AA 4IE7A 5FZ1A 2C9AA 4QX7A 3VBOC 3KV9A 4OHVA 1RUE3 2D7FA 3H7JA 5L9RA 1K12A 3KVBA 1ULGA 4QX8A 2D5FA 5T52A 4H7LA 2AUYA 1FT9A 1W99A 4HXCA 4CDWC 2FBEA 1BKZA 2PHTA 4YRDA 3VHPA 4J1XA 2O14A 5FZLA 3TNQA 5ABJB 4Y1YA 1EAH1 5H9PA 4N7IA 1SBDA 3ES4A 3T30A 4E2QA 3J7HA 3LWCA 3B9IA 4L0PA 4W6YA 5KHIA 5FY1A 5I8SA 5A3UA 1POV3 1W3XA 2D6OX 3ACIA 3H9AA 5LA1A 5CFCC 3VZJA 3VKFC 4JGYB 1YCIA 1Y4WA 1QKQA 1HQWA 2AC1A 1FMD2 2QCSB 3GZAA 4HVRA 3VBFC 4YGDA 1A34A 2GZWA 1EAH2 3PVEA 2VULA 3DPRA 3I3DA 1X50A 2DBIA 5DDJ1 4PF5A 4YLZA 4AFDA 4LK6A 3NJZA 4EWAA 5F39A 4D7TA 1FPN1 2YC4A 4XPVA 1AX1A 3APBA 4M3CB 4CDXC 4DY3A 1H2LA 4YARA 1NA1A 1X9TA 4AHXA 2A6WA 2Y0IA 2GNMA 3S6PA 1H8VA 1NQJA 4KWLA 5FOBB 2XJTA 1C5IA 5E6HA 2Q5TA 3X29B 3GXUA 4QM9A 3VGIA 1SZBA 5FZCA 3Q8BA 1DQ0A 1FPN2 1W6PB 2YY1A 2LRPA 1HXS1 3N7JA 4DRVA 3LEGA 3BTAA 2WLPA 3I2KA 4UXAA 1IPKA 3LQCA 3TEXA 1EV12 4LITA 4XOGA 1QJU1 3TEYA 2PA7A 3VHRA 2JKXA 1AX2A 5DUUA 2QQJA 3WQ7A 1Z0HA 4LOTA 2J1UA 4PI2A 5LK5A 1VP6A 5FPVA 4P9GA 1MS9A 3NV1A 1JXNA 4JZRA 2IVIB 1DHKB 1HXS2 1ULPA 2BDRA 2W91A 1W2NA 4XAEA 4PF1A 4A44A 1A8DA 3RDIA 5IT6A 1QJU2 5LB6A 4HVQA 3M3OA 3VBHA 5ABJA 1RUNA 1LCLA 3UKNA 3PUAA 4KGQA 4COUA 2IXIA 5HCBA 4YWAA 3H3ZA 5IVFA 4HETA 1N1VA 3VKMA 1HDKA 2E53A 5BNNC 2LS6A 5C3SA 4FSJA 2XOMA 2GMEA 4JGYA 3JQXA 4BQ2A 1H8TB 4YW7A 4EN0A 2QQLA 4EYUA 2R062 4XF1A 1IS4A 3POJA 4KWKA 3MIEA 1TNFA 1B35A 4RGAA 3B00A 4OI1A 5KBFA 1TG7A 2WBKA 4CDQB 3PUHA 5IVCA 3GBWA 2IUWA 4MXWB 4XC9A 3FUOA 4XDQA 2EVXA 1N1TA 2CGNA 2IXKA 2QKDA 2JECA 2HBTA 2ZACA 4IQPA 4IV3C 3SC7X 3WG1A 5ACA1 1NCRC 1G9FA 2MHFA 1BQPA 2RMU1 5L7OB 3AYCA 5FO8B 3WLUA 5JXHA 5FZ0A 2VNVA 2W47A 4K1YA 4MG2A 5EJ3A 4GB32 1W6PA 4GMP3 2DCKA 4YW3A 4CXXA 4QHBA 4R52A 1YQ8A 3RQ0A 4RA0A 1BVP1 4N9IA 2XLGA 3VDAA 4N90A 3T08A 3URFA 3WW3A 2VQTA 4IEQA 2VO5A 2G19A 1JOJA 4ZXKA 3RSJA 3CU7A 2RMU2 3I2JA 3OGJA 3D6EA 4TN7A 4C8DA 5KR7A 5BXXA 1ENQA 4AFMA 1J3QA 2UU8A 4GH4A 1AYM1 4PLMA 2ADEA 3OOXA 5JOZA 1OKOA 4Q4W1 4AWDA 1W6OB 5FP9A 2YXSA 4JHTA 4BB3A 3WDUA 1UX6A 1ST8A 1X82A 2XVKA 2ZGNA 1NLQA 5FZKA 4URTA 5L73A 2XJRA 1UMIA 1K5MB 4OI2A 4QU1A 1VRH1 1Y9GA 3PNAA 1SLLA 5FZDA 3ZXFA 1RXFA 4NHYA 5FAXA 1GZ9A 1QQP3 3VD7A 2FDFA 1DQ2A 1DQ6A 4BZ4A 3OEBA 1ZA7A 1WBLA 4LMFA 2VZTA 4GWNA 1AYM2 5JOXA 1OC1A 2NM1A 3I2FA 4Q4W2 2HWF1 1DQ1A 4XEZA 5DPNA 1J3PA 4QQLA 2DCZA 3WINE 4P00B 3OD4A 5EWSA 1H8TA 3ZYGA 3ZFEB 3HNYM 5IVJA 1NY71 1VRH2 3PJYA 4BJ0A 2AREA 4E2GA 4RQPA 2JDMA 2UWBA 4ORFA 4X6RB 1JYWA 1AL21 1E5IA 1DLCA 1O5UA 1GR3A 4F8AA 3BI3A 2FZ2A 4HPKB 3E1F1 3RS6A 4MXWA 2HWF2 4BIOA 4E4SA 2K46A 2SLIA 4FPHA 5A1FA 5FLHA 1NY72 3R05A 2J1TA 2CGOA 4FFFA 2BTVC 3L9JT 1LOFC 3MIDA 5EPAA 5A6YA 2ARBA 3K3NA 1AL22 5LBCA 5L7OA 1WLTA 5GZEA 2D3SA 2F17A 3Q8EA 5A7NA 1RINA 5FMDA 2W39A 3U4XA 5BV6A 2PLV1 3E6BA 1A6CA 1LU2A 3PMSA 4IL7A 3GNEA 3I7DA 1WGPA 3EBRA 4RHV1 1J58A 3MUY1 4S2GA 4LO7A 1PHMA 2LALA 3M3IA 3IMMA 3I3BA 4AW7A 2DUOA 4N9HA 4AQSA 4B7EA 5A1LA 4CU8A 1LEMA 2OX0A 2RVAA 2V5YA 5GLVA 3SKVA 4FTEA 4PIZA 1W6OA 4LBNA 5IUQA 1Q8PA 1OLRA 1NYWA 1WLCA 2PLV2 3CJIC 3LDKA 5JMOA 2ZGKA 1FMD3 1LR5A 3M3QA 2CDPA 1Q8SA 3PHMA 3ZPYA 1W2AX 4HANA 1AX0A 2W1QA 1JBCA 3H0OA 2JE9A 3UYJA 4CCMA 1SFPA 1S0FA 3LA7A 1DGRN 3NRUA 4LKSA
chains in the Genus database with same CATH topology
1GUIA 3LEKA 3A7QA 3VD4A 5EJ1B 2J1EA 4XUPA 5I0DA 1TVGA 4P08A 3IIIA 3ACFA 4XVHA 1EUTA 2YFUA 1UX7A 1NX9A 1H6YA 1UXZA 3K4AA 1XNAA 3OEAA 2Y6GA 2YG0A 4LHSA 3UNPA 5C70A 3CKHA 2ZEZA 3ECQA 4MGQA 1J84A 2WDBA 4E8CA 3W5MA 2J1AA 2WABA 3NQHA 5IFPA 3T2OA 2VMCA 3WNLA 2BERA 2W1UA 2W5FA 1GOGA 1UZ0A 4P5YA 2JD9A 2PQSA 1YQ2A 1SDDB 3NJVA 1W9TA 2RJ2A 3WNNA 4QPWA 3HNBM 1JZ7A 3I2HA 4A45A 1GOFA 1PX3A 3LPGA 5JUVA 2XQXA 4RN5A 3CQOA 1W9SA 3T2PA 1CX1A 2W9XA 4UAPA 3BN6A 4MOAA 3WF2A 3FN9A 3JXSA 4QB6A 2VR4A 2X05A 2J1VA 1K45A 1KEXA 1W8OA 3CMGA 5B4XA 2YC2A 3C7FA 5F7UA 4M4RA 3K4DA 3DYOA 2YFZA 1UY1A 3SEEA 3K46A 4A42A 1UY0A 3FL7A 3MV01 4QDQA 3OBAA 3T0AA 1US3A 5CYYA 1NUKA 2ORXA 5B4NA 2VCAA 5IFTA 4UOJA 1W8NA 1IQDC 2C26A 4QDSA 3UETA 1MPXA 4DXSA 4D0QA 2J22A 2HLEA 3GDBA 1CZTA 2E26A 1CIYA 2VC9A 1K3IA 1NKGA 4FI9A 3A22A 2W1WA 1L7RA 3WF1A 1NAEA 2DCJA 2VZOA 2VZPA 3K75B 2VZ1A 4GWJA 2Y6LA 3NNGA 5IHRA 3I2IA 1K42A 1SG3A 2R7EB 4BDVB 3T0DA 4DXTA 1JZ5A 2B9VA 3FHQA 2Y6JA 2V5DA 4QX3A 2VZUA 3C7HA 2B4KA 2QQKA 1JHJA 4ZY9A 5G04L 4ET7A 2J7MA 2VL4A 4DUWA 1UYZA 2QQIA 2E31A 2LW8A 3OGSA 5FUIA 3T09A 1O8PA 3WNOA 3HOBA 4A3ZA 3WQBA 4ZZ5A 5DMYA 4XUTA 2WYSA 3MBWA 5EJZB 1P8JA 1CZVA 3SKJE 4CU7A 4M4PA 3WNPA 4CVUA 3MV11 2JE8A 2VM9A 1XC6A 4QX2A 4ARYA 3ACHA 1KGYA 2W46A 4XURA 4YPJA 1GNYA 1JU4A 2VZSA 2WZEA 2VTFA 2ZEWA 1W9WA 3HPNA 4ARXA 2XONA 5JXJA 1PX4A 1UYXA 2WO3A 2OKXA 1OH4A 1JYVA 5JXIA 3MO4A 2Y64A 4AG4A 4OMDA 1JZ8A 3I3EA 3HN3A 4W4ZA 1OT5A 2ZEXA 3SEPA 2J1RA 4XZUG 4LQRA 3LE0A 3WSOA 2E33A 4OUEA 4HG6B 3VD9A 2VZVA 2VOTA 4A6OA 2C9KA 2E32A 1O59A 1W0NA 1US2A 4BXSV 1UY3A 3T0BA 4E8DA 1WKYA 1UY2A 3LPFA 1R64A 2VCBA 4QAWA 1I5PA 4QB2A 1GMMA 4CU9A 3UESA 1JYXA 2W94A 2YB7A 3VD3A 3W5NA 4KMQA 3DYMA 3C7GA 2XHNA 4DEQA 3OGRA 4LPLA 2VZQA 2W87A 4OYUA 4P02B 1J83A 4CUCA 3VDCA 3ZM8A 3C7EA 4JHZA 5CZKA 4CUBA 2QQMA 2VQUA 2W3JA 2BBAA 2RV9A 3WEZA 2VZ3A 2WO1A 3C7OA 1SHWB 4QB1A 4Z2AA 2ZEYA 5JR2A 2X09A 3I97A 4D8MA 3AC0A 3I2GA 4DEVA 2L9LA 1JZ6A 3F2ZA 3CDZB 2EIBA 1OF4A 1XPWA 4XUOA 1H6XA 2C4XA 2W92A 1F4HA 4KI5M 3NJXA 1GU3A 4MO3M 2VMEA 2WN3A 1K12A 1UYYA 5JXGA 5G05L 1W99A 2VJXA 3EYPA 2QQOA 3CZJA 4JKLA 3U37A 3LEIA 2BGOA 3ABZA 3DECA 3J7HA 4L0PA 3GM8A 2WO2A 5LA0A 3D3AA 2Y6KA 3ACIA 4MGSA 5LA1A 2QQNA 4TXWA 1D7PM 4TTGA 2VMDA 4JX0A 5A1AA 3GGLA 4GWIA 1O8SA 3THCA 4DUXA 3I3DA 2WAAA 3K4ZA 3P1IA 2YC4A 4OZOA 3WF0A 4QX0A 1GQPA 3IAPA 1JZ2A 1PMHX 4DUVA 2WUHA 3GXUA 1T2XA 3LEGA 5LCWL 3I2KA 3LQCA 3IDAA 2JKXA 4QDRA 1EUUA 2QQJA 2J1UA 3BGAA 4OMCA 3ACGA 1ULPA 3VDBA 2W91A 1UMHA 4PF1A 4W8JA 4A44A 1UY4A 2WN2A 4MADA 3OB8A 2LS6A 2XOMA 5LA2A 4JKMA 1WCQA 2QQLA 1OD3A 3HNMA 1JZ4A 1DP0A 1PMJX 4XUQA 1TG7A 2WBKA 5HPOA 2BGPA 3PUHA 4W50A 3OGVA 3OG2A 3IB3A 1JU3A 3IAQA 2CDOA 5IJRA 3VD5A 5IYYA 2X10A 3CIHA 3WF4A 5JXHA 3EB7A 2W47A 1RYYA 4ZZ8A 1LNSA 2DCKA 4CUAA 4CU6A 3VDAA 3DYPA 5C7GA 3T08A 5HXMA 2VZRA 2VQTA 2WQ8A 3HEIA 2VO5A 2J1SA 4PQQA 4BK5A 4BK4A 2ID4A 3I2JA 1XNTA 1L7QA 1UXXX 5DQ0A 1F4AA 3HJRA 3CZUA 2HYXA 1ULOA 2VCCA 1UMIA 1DYOA 5EIYB 2QBXA 3A21A 3VD7A 4QX1A 2KD7A 3OEBA 2VZTA 2V72A 4RYDA 3I2FA 5DPNA 1OF3A 2ORZA 5DN2A 4P00B 4GZ9A 3T2QA 3HNYM 3FHAA 5C71A 2W1SA 4BJ0A 1JI6A 2EIEA 1JYWA 1DLCA 4DXRA 2WZ8A 3E1F1 1UWWA 4ZXEA 4A41A 3C8XA 4IUGA 2J1TA 3K77A 1GOHA 3WNKA 1CZSA 2JDAA 3P6BA 3THDA 4KWUA 2Z4FA 4AAXA 4XUNA 3WNMA 2V4VA 3MUY1 3PUIA 4PT6A 2W95A 2DDUA 2BZDA 2EICA 3I3BA 2Y6HA 4JKKA 4CU8A 2Y8KA 2ZXQA 3WF3A 2RVAA 1JZ3A 4UI9L 3SKVA 4A4AA 5J1XA 5JMOA 1BHGA 3ETPA 2CDPA 2WAOA 2VMFA 2W1QA 3A23A 3MUZ1 1JYNA 1HN1A 2EIDA 3NRUA 4LKSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GUI A;  3LEK A;  3A7Q A;  3VD4 A;  5EJ1 B;  2J1E A;  4XUP A;  5I0D A;  1TVG A;  4P08 A;  3III A;  3ACF A;  4XVH A;  1EUT A;  2YFU A;  1UX7 A;  1NX9 A;  1H6Y A;  1UXZ A;  3K4A A;  1XNA A;  3OEA A;  2Y6G A;  2YG0 A;  4LHS A;  3UNP A;  5C70 A;  3CKH A;  2ZEZ A;  3ECQ A;  4MGQ A;  1J84 A;  2WDB A;  4E8C A;  3W5M A;  2J1A A;  2WAB A;  3NQH A;  5IFP A;  3T2O A;  2VMC A;  3WNL A;  2BER A;  2W1U A;  2W5F A;  1GOG A;  1UZ0 A;  4P5Y A;  2JD9 A;  2PQS A;  1YQ2 A;  1SDD B;  3NJV A;  1W9T A;  2RJ2 A;  3WNN A;  4QPW A;  3HNB M;  1JZ7 A;  3I2H A;  4A45 A;  1GOF A;  1PX3 A;  3LPG A;  5JUV A;  2XQX A;  4RN5 A;  3CQO A;  1W9S A;  3T2P A;  1CX1 A;  2W9X A;  4UAP A;  3BN6 A;  4MOA A;  3WF2 A;  3FN9 A;  3JXS A;  4QB6 A;  2VR4 A;  2X05 A;  2J1V A;  1K45 A;  1KEX A;  1W8O A;  3CMG A;  5B4X A;  2YC2 A;  3C7F A;  5F7U A;  4M4R A;  3K4D A;  3DYO A;  2YFZ A;  1UY1 A;  3SEE A;  3K46 A;  4A42 A;  1UY0 A;  3FL7 A;  3MV0 1;  4QDQ A;  3OBA A;  3T0A A;  1US3 A;  5CYY A;  1NUK A;  2ORX A;  5B4N A;  2VCA A;  5IFT A;  4UOJ A;  1W8N A;  1IQD C;  2C26 A;  4QDS A;  3UET A;  1MPX A;  4DXS A;  4D0Q A;  2J22 A;  2HLE A;  3GDB A;  1CZT A;  2E26 A;  1CIY A;  2VC9 A;  1K3I A;  1NKG A;  4FI9 A;  3A22 A;  2W1W A;  1L7R A;  3WF1 A;  1NAE A;  2DCJ A;  2VZO A;  2VZP A;  3K75 B;  2VZ1 A;  4GWJ A;  2Y6L A;  3NNG A;  5IHR A;  3I2I A;  1K42 A;  1SG3 A;  2R7E B;  4BDV B;  3T0D A;  4DXT A;  1JZ5 A;  2B9V A;  3FHQ A;  2Y6J A;  2V5D A;  4QX3 A;  2VZU A;  3C7H A;  2B4K A;  2QQK A;  1JHJ A;  4ZY9 A;  5G04 L;  4ET7 A;  2J7M A;  2VL4 A;  4DUW A;  1UYZ A;  2QQI A;  2E31 A;  2LW8 A;  3OGS A;  5FUI A;  3T09 A;  1O8P A;  3WNO A;  3HOB A;  4A3Z A;  3WQB A;  4ZZ5 A;  5DMY A;  4XUT A;  2WYS A;  3MBW A;  5EJZ B;  1P8J A;  1CZV A;  3SKJ E;  4CU7 A;  4M4P A;  3WNP A;  4CVU A;  3MV1 1;  2JE8 A;  2VM9 A;  1XC6 A;  4QX2 A;  4ARY A;  3ACH A;  1KGY A;  2W46 A;  4XUR A;  4YPJ A;  1GNY A;  1JU4 A;  2VZS A;  2WZE A;  2VTF A;  2ZEW A;  1W9W A;  3HPN A;  4ARX A;  2XON A;  5JXJ A;  1PX4 A;  1UYX A;  2WO3 A;  2OKX A;  1OH4 A;  1JYV A;  5JXI A;  3MO4 A;  2Y64 A;  4AG4 A;  4OMD A;  1JZ8 A;  3I3E A;  3HN3 A;  4W4Z A;  1OT5 A;  2ZEX A;  3SEP A;  2J1R A;  4XZU G;  4LQR A;  3LE0 A;  3WSO A;  2E33 A;  4OUE A;  4HG6 B;  3VD9 A;  2VZV A;  2VOT A;  4A6O A;  2C9K A;  2E32 A;  1O59 A;  1W0N A;  1US2 A;  4BXS V;  1UY3 A;  3T0B A;  4E8D A;  1WKY A;  1UY2 A;  3LPF A;  1R64 A;  2VCB A;  4QAW A;  1I5P A;  4QB2 A;  1GMM A;  4CU9 A;  3UES A;  1JYX A;  2W94 A;  2YB7 A;  3VD3 A;  3W5N A;  4KMQ A;  3DYM A;  3C7G A;  2XHN A;  4DEQ A;  3OGR A;  4LPL A;  2VZQ A;  2W87 A;  4OYU A;  4P02 B;  1J83 A;  4CUC A;  3VDC A;  3ZM8 A;  3C7E A;  4JHZ A;  5CZK A;  4CUB A;  2QQM A;  2VQU A;  2W3J A;  2BBA A;  2RV9 A;  3WEZ A;  2VZ3 A;  2WO1 A;  3C7O A;  1SHW B;  4QB1 A;  4Z2A A;  2ZEY A;  5JR2 A;  2X09 A;  3I97 A;  4D8M A;  3AC0 A;  3I2G A;  4DEV A;  2L9L A;  1JZ6 A;  3F2Z A;  3CDZ B;  2EIB A;  1OF4 A;  1XPW A;  4XUO A;  1H6X A;  2C4X A;  2W92 A;  1F4H A;  4KI5 M;  3NJX A;  1GU3 A;  4MO3 M;  2VME A;  2WN3 A;  1K12 A;  1UYY A;  5JXG A;  5G05 L;  1W99 A;  2VJX A;  3EYP A;  2QQO A;  3CZJ A;  4JKL A;  3U37 A;  3LEI A;  2BGO A;  3ABZ A;  3DEC A;  3J7H A;  4L0P A;  3GM8 A;  2WO2 A;  5LA0 A;  3D3A A;  2Y6K A;  3ACI A;  4MGS A;  5LA1 A;  2QQN A;  4TXW A;  1D7P M;  4TTG A;  2VMD A;  4JX0 A;  5A1A A;  3GGL A;  4GWI A;  1O8S A;  3THC A;  4DUX A;  3I3D A;  2WAA A;  3K4Z A;  3P1I A;  2YC4 A;  4OZO A;  3WF0 A;  4QX0 A;  1GQP A;  3IAP A;  1JZ2 A;  1PMH X;  4DUV A;  2WUH A;  3GXU A;  1T2X A;  3LEG A;  5LCW L;  3I2K A;  3LQC A;  3IDA A;  2JKX A;  4QDR A;  1EUU A;  2QQJ A;  2J1U A;  3BGA A;  4OMC A;  3ACG A;  1ULP A;  3VDB A;  2W91 A;  1UMH A;  4PF1 A;  4W8J A;  4A44 A;  1UY4 A;  2WN2 A;  4MAD A;  3OB8 A;  2LS6 A;  2XOM A;  5LA2 A;  4JKM A;  1WCQ A;  2QQL A;  1OD3 A;  3HNM A;  1JZ4 A;  1DP0 A;  1PMJ X;  4XUQ A;  1TG7 A;  2WBK A;  5HPO A;  2BGP A;  3PUH A;  4W50 A;  3OGV A;  3OG2 A;  3IB3 A;  1JU3 A;  3IAQ A;  2CDO A;  5IJR A;  3VD5 A;  5IYY A;  2X10 A;  3CIH A;  3WF4 A;  5JXH A;  3EB7 A;  2W47 A;  1RYY A;  4ZZ8 A;  1LNS A;  2DCK A;  4CUA A;  4CU6 A;  3VDA A;  3DYP A;  5C7G A;  3T08 A;  5HXM A;  2VZR A;  2VQT A;  2WQ8 A;  3HEI A;  2VO5 A;  2J1S A;  4PQQ A;  4BK5 A;  4BK4 A;  2ID4 A;  3I2J A;  1XNT A;  1L7Q A;  1UXX X;  5DQ0 A;  1F4A A;  3HJR A;  3CZU A;  2HYX A;  1ULO A;  2VCC A;  1UMI A;  1DYO A;  5EIY B;  2QBX A;  3A21 A;  3VD7 A;  4QX1 A;  2KD7 A;  3OEB A;  2VZT A;  2V72 A;  4RYD A;  3I2F A;  5DPN A;  1OF3 A;  2ORZ A;  5DN2 A;  4P00 B;  4GZ9 A;  3T2Q A;  3HNY M;  3FHA A;  5C71 A;  2W1S A;  4BJ0 A;  1JI6 A;  2EIE A;  1JYW A;  1DLC A;  4DXR A;  2WZ8 A;  3E1F 1;  1UWW A;  4ZXE A;  4A41 A;  3C8X A;  4IUG A;  2J1T A;  3K77 A;  1GOH A;  3WNK A;  1CZS A;  2JDA A;  3P6B A;  3THD A;  4KWU A;  2Z4F A;  4AAX A;  4XUN A;  3WNM A;  2V4V A;  3MUY 1;  3PUI A;  4PT6 A;  2W95 A;  2DDU A;  2BZD A;  2EIC A;  3I3B A;  2Y6H A;  4JKK A;  4CU8 A;  2Y8K A;  2ZXQ A;  3WF3 A;  2RVA A;  1JZ3 A;  4UI9 L;  3SKV A;  4A4A A;  5J1X A;  5JMO A;  1BHG A;  3ETP A;  2CDP A;  2WAO A;  2VMF A;  2W1Q A;  3A23 A;  3MUZ 1;  1JYN A;  1HN1 A;  2EID A;  3NRU A;  4LKS A; 
#chains in the Genus database with same CATH topology
 2ZMN A;  4MLO A;  4ATF A;  1KFU L;  1YLL A;  3WXP A;  2Q1F A;  4XUP A;  3WDX A;  5I0D A;  3ZFE A;  2ZX2 A;  1URX A;  1W0O A;  2YFU A;  5A3W A;  4E4Z A;  5EQU A;  5KXE A;  2BVV A;  1H2M A;  2GMM A;  3J7N A;  4AZZ A;  5JSP A;  1R08 1;  4HPK A;  1QXJ A;  2VMI A;  3UNP A;  3KGZ A;  2HBU A;  4FBF A;  3N9O A;  1EV1 3;  1NCQ B;  3NO8 A;  4NRM A;  4E8C A;  4Y20 B;  1W8F A;  4XFC A;  2QZ3 A;  2R0F A;  1NA1 C;  2J1A A;  2DUQ A;  3WW2 A;  3NQH A;  4NN0 A;  4YGC A;  3T2O A;  5DUV A;  2Q30 A;  2WFP A;  4QQP A;  4WVW A;  2ZA9 A;  4XFG A;  3OUI A;  5FFO C;  1R08 2;  3WNL A;  4A7K A;  5K0U C;  2WA3 A;  3GHN A;  5KXB A;  1JYN A;  1HXS 3;  3U75 A;  1GOG A;  2D6K A;  3LDR A;  5CG8 A;  2JD9 A;  1QJU 3;  2R1D A;  3IWZ A;  3VZM A;  1WW7 A;  3DXU A;  5FCC A;  5CEH A;  4OUL A;  4LLO A;  4XAC A;  3PU8 A;  3WNN A;  1YYN A;  3HNB M;  1F15 A;  1PZ9 A;  3I4I A;  3O1R A;  1Y9M A;  1CJP A;  1K5J A;  5D2A A;  5C9A C;  5CFD B;  4OVE A;  3CQO A;  2JDY A;  2R06 3;  3NNF A;  5GZF A;  3R6S A;  1CX1 A;  2OT7 A;  3B7M A;  1RXG A;  1AXZ A;  1RUJ 1;  4UAP A;  3RFR A;  4QPG B;  4ERO A;  2JJ6 A;  3HQR A;  4FO9 A;  4NPM A;  2QDN A;  2VXJ A;  1Z7S 1;  3J8F 2;  4G3Y C;  2VG9 A;  2VR4 A;  3W20 A;  2D93 A;  3J26 N;  2YU2 A;  3CMG A;  1YUD A;  3AJY A;  4XFH A;  4Z92 B;  1QJZ A;  2YBK A;  3ACL A;  4CP1 A;  2PQQ A;  2VAU A;  1VBC 3;  1RUJ 2;  5F7U A;  1PGW 1;  2PHL A;  1C1L A;  3CL1 A;  4QKB A;  1UY0 A;  3LIH A;  5A3T A;  4GB3 3;  4QDQ A;  2WFF 1;  4GAZ A;  2YYO A;  5CYY A;  1NUK A;  3BU7 A;  2VCA A;  5DAV A;  4DRR A;  1VAK A;  2WS9 1;  1NCQ A;  1HRI 1;  4OI0 A;  2ES3 A;  3KV5 A;  1IOA A;  4QDS A;  3UET A;  4B4R A;  2XBO 1;  2B45 X;  4FFI A;  1LGB A;  1N1S A;  4P9J A;  1EPZ A;  1QXR A;  3PDQ A;  1PGW 2;  4Y20 A;  2C0Z A;  1AR6 2;  1CZT A;  3MLJ A;  4DZG A;  4WZC A;  4FP3 A;  1OH3 A;  3M7A A;  3HVD A;  5SV5 A;  3MGU A;  4D6R A;  2WS9 2;  2MNG A;  3FLR A;  3ZXE A;  3V0A B;  3KD4 A;  3G6J B;  2XBO 2;  1W2T A;  2ZGR A;  3K75 B;  4NOT A;  4FPY A;  5FV3 A;  5IHR A;  2VVF A;  5TSW A;  2BUK A;  3LSE A;  1UU6 A;  1AYM 3;  4DMI A;  3O0X A;  3ZXL A;  3BIW E;  4Q4W 3;  2B9V A;  3N7K A;  3AZY A;  3FHQ A;  5CFD A;  1GIC A;  2VOW A;  1XSR A;  5GM0 A;  1VRH 3;  5DAX A;  1PGS A;  4ET7 A;  4DUW A;  2C24 A;  2NN8 A;  1CAV B;  4IEX A;  4QPG A;  3BOD A;  4XQ4 A;  3WDW A;  2GSY A;  4Y1U A;  3MF9 A;  1O8P A;  3HOB A;  3I8T A;  1RIT A;  2HWF 3;  2PHW A;  3VHO A;  3WP3 A;  5DMY A;  1ASJ 1;  1DZR A;  1W03 A;  3IPV B;  1HX6 A;  1SQ4 A;  2JG9 C;  1CX4 A;  5JOY A;  2AYH A;  3B69 A;  3N9Q A;  4IEY A;  3RPQ A;  4FTS A;  2JDN A;  1W8U A;  1W2O A;  3MIC A;  5GKA C;  2E7A A;  4YG6 A;  5I0T A;  1EYB A;  3P5B A;  1QJX 1;  4Z8B A;  1LED A;  2B46 X;  1LOA A;  1AL2 3;  5CKM A;  4CCJ A;  1UNB A;  1QHD A;  3ZSL A;  3ON7 A;  5C3R A;  4AED B;  2HWC 1;  1ASJ 2;  1FAT A;  1PIV 1;  4CDQ C;  5AFE A;  3BTY A;  4WM7 A;  5FPZ A;  3M70 A;  1JHN A;  4K3U A;  3POE A;  4XUR A;  4QM8 A;  1LGC A;  4XHX A;  5CIS A;  4N53 B;  1QJX 2;  1JU4 A;  5A3N A;  4QKN A;  2G4I A;  1YFW A;  3IN9 A;  5H9Q A;  4FQZ A;  5L7O C;  2HWC 2;  1CVN A;  2OZJ A;  1PX4 A;  4XJ9 A;  4YW6 A;  2PLV 3;  2BFU S;  4E4H A;  5A80 A;  5FP7 A;  4Q2F A;  5FZ9 A;  1N3Q A;  1JYI A;  2XWJ B;  1HKD A;  2Q4S A;  4FOQ A;  1GP4 A;  2FDH A;  4OMD A;  4BCU A;  1C57 A;  3I3E A;  5A7W A;  1JZ8 A;  1BVV A;  1YQ5 A;  3W59 A;  2P3J A;  5CFC B;  4CRQ A;  1QEX A;  4IXL A;  4HON A;  1OA2 A;  4F3J A;  4DNY A;  4NMI A;  3S30 A;  1RUG 2;  3SMH A;  1CAV A;  1RUH 1;  4URA A;  1K5M C;  1QY4 A;  3DXT A;  3USS A;  4DB5 A;  4L97 A;  4P9W A;  2F4L A;  1U5Z A;  3M8L A;  3IPV A;  4QXC A;  1DGW A;  4CDX B;  1W0N A;  3AVR A;  4BXS V;  2ZGM A;  3WUD A;  4KG8 A;  1RUH 2;  1WKY A;  3ZFE C;  1OOP C;  2CL2 A;  3CBN A;  2JX9 A;  1R64 A;  1VAV A;  1Q3E A;  2LUW A;  1R08 3;  1RVF 3;  1I5P A;  2QE3 A;  1LB2 A;  1SFY A;  2P3I A;  2YPJ A;  1JYX A;  2IWG B;  4IGP A;  4M0N A;  4EJR A;  3NV2 A;  4AI1 A;  1UOB A;  3AVS A;  3OGR A;  3EO6 A;  4N53 A;  1SLC A;  1Q8V A;  2OZ6 A;  2W87 A;  1H9W A;  4XJW A;  5EYY A;  3WR0 A;  2DYC A;  3VKL A;  1LUL A;  1ZRF A;  5C5T A;  3WHU A;  3ZM8 A;  3C7E A;  5JZG C;  1PM7 A;  4GA9 A;  4BU2 A;  3FLT A;  2B5H A;  1PZ7 A;  1SMV A;  3PIG A;  4FQ4 A;  1GBG A;  4EWD A;  2C1F A;  2VNO A;  3WEZ A;  5F5I A;  2VOX A;  1U5I A;  3B9C A;  1RMU 1;  2DVF A;  3A0N A;  5APA A;  1KQR A;  1H4H A;  3H3U A;  5BNN B;  1SHW B;  2Q0A A;  5GZG A;  3RZJ A;  5GLU A;  1SBF A;  3J8F 3;  4BOW A;  1A3K A;  3HAG A;  4IE4 A;  4LBQ B;  4Z2A A;  5CFC A;  3L2H A;  1WD4 A;  3VBF A;  1QH6 A;  4KG0 A;  3ZXJ A;  4OZX A;  3S0M A;  4XAB A;  5ANN A;  5JSO A;  5E88 A;  1RMU 2;  2ZHM A;  4OHY A;  4Y4Y A;  2E6V A;  4B3N A;  1SPP B;  2EIB A;  1JS9 A;  1OF4 A;  3G7D A;  4XUO A;  5JIU A;  3POW A;  2C4X A;  3NWK A;  4CDX A;  4BM8 A;  1F4H A;  4YZ4 A;  4TZD A;  3OUJ A;  4IV3 B;  2WZP P;  4CPB D;  4H2A A;  2VTX A;  1QOT A;  2OII A;  5FJK A;  4BA6 A;  1AR6 3;  3ORJ A;  5E8A A;  2FCV A;  4F7Z A;  1VBE 1;  1REF A;  4OLL A;  4YNI A;  4NWV A;  4Q5O A;  1F5J A;  2HH9 A;  1WW4 A;  2BW8 A;  4LUL A;  4Y1V A;  1L7L A;  1X8M A;  5E16 A;  3UL2 A;  4COY A;  2QQO A;  1CAW B;  3LEI A;  3OPT A;  2WS9 3;  1TME 1;  2BGO A;  3ABZ A;  1G9D A;  2W2I A;  1WA6 X;  1WLD A;  2XBO 3;  2ERF A;  1QIQ A;  2K9Z A;  3DEC A;  3GZT B;  4QGL A;  1NCQ C;  4XJA A;  4YG3 A;  5IK4 A;  2WO2 A;  5LA0 A;  3INA A;  1AXY A;  5C33 A;  2XVG A;  1VBE 2;  4H14 A;  4TXW A;  2E63 A;  4I0A A;  4IEP A;  4TYS A;  2V73 A;  2VMD A;  4EN6 B;  5A1A A;  1UD1 A;  4EZH A;  4AVC A;  2GH8 A;  1TME 2;  5A7Q A;  3THC A;  3ZN4 A;  1PO1 1;  1S0C A;  2FDG A;  5T5P A;  3ZOI A;  3KB5 A;  4ES8 A;  2WAA A;  5BNQ A;  3LFM A;  3NJY A;  2HWD 1;  3P1I A;  1VE0 A;  5BNN A;  4OZO A;  1JOB A;  4GWM A;  3WT3 A;  4LBQ A;  5FYM A;  3RWN A;  3N9N A;  5FTT C;  2ARA A;  3ZDS A;  4JDO A;  3J9S A;  1GQP A;  1ZM1 A;  2EA7 A;  1PO1 2;  1C8N A;  1CIW A;  3QCW A;  4P9Y A;  4XF3 A;  3ZYP A;  1FAY A;  4IE5 A;  1GQG A;  4S2F A;  3S7E A;  1MZE A;  2HWD 2;  4FPE A;  5C3O A;  1NT0 A;  2OS2 A;  3OGG A;  1W0P A;  1T2X A;  1SPP A;  2WT2 A;  4QXB A;  3RJR A;  2IZW A;  1YNA A;  1MS3 A;  5EFU A;  1G9A A;  1HJG A;  1V6M A;  1RUI 3;  5DZE A;  2H6C A;  4J1W A;  4ONU A;  4IV3 A;  2E51 A;  1BLZ A;  2PHR A;  4QDR A;  4H7M A;  4AXO A;  1NCR A;  3BGA A;  4LBK A;  1QJX 3;  1T6B X;  4QGN A;  3ZMN A;  1X7N A;  2VW0 A;  4A6S A;  2QJV A;  4FPF A;  3SQO A;  1YFU A;  5T5L A;  3D4K A;  3ZVX A;  1PO2 3;  1TE1 B;  4AYU A;  5A70 A;  1AR7 1;  2JEM A;  2HWC 3;  3AZW A;  3VDB A;  4Q4X 2;  1UY4 A;  1WBF A;  1CAW A;  2XKO A;  3PVO A;  4MAD A;  4XBN A;  3OB8 A;  2Y60 A;  1CQ9 A;  3H8R A;  4RS5 B;  1YFX A;  1YC6 1;  1ZZ6 A;  3ENR A;  4LO4 B;  1W6N B;  2XH6 A;  3U78 A;  4UBG A;  5LA2 A;  4XE9 A;  4QWN A;  4AAP A;  1GFF 2;  3CJI B;  4R4Z A;  1MVQ A;  4CZS A;  3QD6 A;  4J6G A;  5J3U A;  5E1R A;  1CN1 A;  3HNM A;  1JZ4 A;  2JWP A;  2AEY A;  1O3R A;  2RG4 A;  2XJQ A;  4R9D A;  5GZD A;  1RUG 3;  1Z78 A;  1PMJ X;  5D8A B;  3WG2 A;  1GYK A;  5C3Q A;  1OLQ A;  1MS4 A;  1W2U A;  2Q8E A;  1RUC 1;  2BGP A;  5IAT A;  2WNU B;  1SLT A;  1UIK A;  3ZR5 A;  3OGV A;  4UFL A;  1DCS A;  3W21 A;  4I0W B;  1AHS A;  4HKO A;  4O9E A;  1JU3 A;  4ES9 A;  3IAQ A;  3IDE A;  2CDO A;  3M1H A;  1QXP A;  2BWA A;  2YUE A;  4JRA A;  4XZP A;  4MX3 A;  2ZKL A;  5IJR A;  3VD5 A;  5IVE A;  2WRA A;  4UW6 A;  2X10 A;  4ZPI A;  3CIH A;  1R1A 1;  4QPI B;  3PTY A;  1CGP A;  1ZZ7 A;  1APN A;  1RUC 2;  3BUC A;  1RYY A;  3MI8 A;  3AKS A;  4YFZ A;  5FOJ B;  3DYP A;  2CU5 A;  3BOP A;  3HQX A;  4AE2 A;  2WQ8 A;  3HEI A;  4FTB A;  4BK5 A;  2J1S A;  4JDN A;  3KT1 A;  2QFE A;  1R1A 2;  3NV4 A;  1TZO A;  2QTW B;  2MEV 1;  3FX3 A;  3UGG A;  4B1L A;  3V64 A;  1FI2 A;  2RR1 1;  1W8H A;  3J7L A;  1YRZ A;  1F4A A;  5F6K A;  2ZML A;  3PJQ A;  5K0U B;  1DBN A;  3CZU A;  1SLI A;  4M01 A;  1ULO A;  1YFY A;  2Z5W A;  2ZGQ A;  1DYO A;  4AED C;  4AHZ A;  4MXV A;  1WCS A;  1UOF A;  1EY2 A;  5FKC A;  1YWK A;  1QJY 1;  1V6L A;  5JAX A;  3VBR B;  1JW6 A;  2G9F A;  1H0B A;  3D5O A;  4RYD A;  5JI7 A;  5LY1 A;  2ADD A;  2BNO A;  2BQP A;  2NLR A;  2ORZ A;  2R04 1;  2F4P A;  2ZTN A;  1HRV 1;  1MEC 1;  1O3T A;  3CJI A;  2RS1 2;  5C9A B;  3AP9 A;  5GLZ A;  5FYS A;  4XMI A;  4OQ9 A;  4I09 A;  1O4T A;  1V6O A;  1QJY 2;  1I3H A;  1BMV 1;  5D8A A;  2GC1 A;  1RMU 3;  1TMF 3;  4MHU A;  4AQ6 A;  4DXR A;  3H50 A;  2ZHL A;  2WNU A;  5LBB A;  4K7J A;  1OLM A;  1UWW A;  1XU2 A;  3F95 A;  5L36 A;  1HRV 2;  2H0V A;  2PTM A;  3C8X A;  5LA9 A;  2GN3 A;  3LGR A;  4YM1 A;  2G1M A;  4E27 A;  2P3Y A;  4QQO A;  1UW8 A;  3CJX A;  3HWJ A;  4QPI A;  3EMR A;  1JOP A;  2JDA A;  5I0U A;  5KHJ A;  3P6B A;  4O9G A;  1WMX A;  3AYD A;  4AAX A;  1HV0 A;  1UU4 A;  4BLJ A;  5HCH A;  1GKB A;  1UKG A;  3ZYB A;  3OTF A;  4MET A;  3ZYH A;  1Q8O A;  2VBB A;  4YM0 A;  3OPZ A;  2EIC A;  1POV 0;  5FP4 A;  2Y6H A;  2ZX0 A;  3KCY A;  3NAP C;  3WX5 A;  4AFA A;  1MZF A;  1WCD J;  4EV0 A;  1JZ3 A;  4UI9 L;  3SCF A;  3KGL A;  5FP8 A;  1VBE 3;  1XSQ A;  4H55 A;  4AEK A;  4IEO A;  5K0U A;  4A4A A;  2D3R A;  5DDJ 2;  4DO0 A;  4KBZ A;  4FAH A;  1H9P A;  1TME 3;  1AYN 1;  3A23 A;  3MHZ A;  4IDZ A;  4XDP A;  3ZXG A;  3AX4 A;  1IPS A;  2Y6F A;  3POY A;  5EZW A;  4RL7 A;  1HN1 A;  4CDU C;  2D44 A;  3M2M A;  5FY8 A;  3T1M A;  3ZYR A;  3U0Z A;  1W05 A;  2OW4 A;  5LEJ A;  2A7A A;  2XLA A;  5C9A A;  4PIX A;  2GAU A;  3J7M A;  4XVH A;  5KHG A;  4YVS C;  1EUT A;  1PO1 3;  2GN7 A;  5FPX A;  5LK7 B;  1KXG A;  2F6B A;  3AKP A;  1IG3 A;  3ALQ A;  1UXZ A;  2BNN A;  3WQ0 A;  4AVB A;  1GNZ A;  1XNA A;  2HWD 3;  3HMY A;  3KZ4 C;  1V0A A;  4XQD A;  1ZRD A;  3WZ1 A;  4W6W A;  3JU9 A;  4O61 A;  1W9Y A;  4YW4 A;  2D40 A;  2WNE A;  5C70 A;  1UOG A;  2KR2 A;  3CKH A;  1J84 A;  2JG9 B;  1VIW B;  2VW2 A;  2AGS A;  2O8O A;  3VKN A;  3AKT A;  1GWL A;  3D0J A;  2WAB A;  3O0W A;  5IFP A;  1VR3 A;  3UGF A;  4EN7 B;  3O1U A;  4JTN A;  4FPK A;  4MH0 E;  1C4R A;  2W5F A;  4Q4X 3;  2XLF A;  4DXZ A;  2XR4 A;  1W6M B;  3JZV A;  3QH6 A;  4F83 A;  3WW1 A;  3RZZ A;  1YQ2 A;  4M3C A;  1R1Z A;  1SDD B;  3NJV A;  4LBL A;  2O8Q A;  4Y5Z 0;  4QPW A;  2BP6 A;  1JZ7 A;  3I2H A;  2R16 A;  1GOF A;  1PX3 A;  5JUV A;  4Y3O A;  1F5F A;  1UMZ A;  2UUR A;  3R4D B;  4WM8 B;  1W9S A;  4XFF A;  3T2P A;  2CAU A;  4FXK B;  3LF7 A;  1ULF A;  3THP A;  4E9K A;  3BN6 A;  3M3C A;  1AR9 1;  2R49 A;  3FN9 A;  4OHZ A;  4FPC A;  2CWS A;  4CXW A;  5ACA 2;  2WZR 1;  2XQR A;  4IE6 A;  5FZ3 A;  2WNV C;  3SIT A;  3ZIW A;  1W8O A;  5DN2 A;  1BBT 1;  1GZC A;  3MPB A;  1ZRE A;  2VD7 A;  5FY5 A;  4AHY A;  5FXW A;  3ZYI B;  5CBL A;  3Q8A A;  4XW3 A;  2FD8 A;  1AR9 2;  4GMP 0;  5I93 A;  2YFZ A;  5JDB A;  5IK7 A;  1UY1 A;  3SEE A;  3K46 A;  3FL7 A;  4NHL A;  2WZR 2;  1VRB A;  5J7M A;  3MV0 1;  2ZZJ A;  4Q4V 1;  5FY4 A;  3ME2 A;  4GIQ A;  5J37 A;  2Q8O A;  1BBT 2;  5IFT A;  1XNC A;  4EN8 B;  1W8N A;  2JG9 A;  2C26 A;  3GF6 A;  1MPX A;  4GJZ A;  4DXS A;  3Q9O A;  4D0Q A;  4X6Q B;  2B7Y A;  3GDB A;  4UFI A;  2XJU A;  1PM4 A;  3O1T A;  3KT7 A;  4CCK A;  1OOP B;  4OUM A;  2DUR A;  2E26 A;  3FFQ A;  3GBG A;  4LE3 A;  4MUV A;  1J59 A;  1H2K A;  4IV1 C;  5CU1 A;  1DZQ A;  4Q4V 2;  5F5A A;  2AEZ A;  2VNR A;  3A22 A;  4QQ2 A;  2WIN B;  3KF3 A;  5F9T A;  2VBD A;  1HJF A;  1NOV A;  1W6M A;  2P37 A;  2YGM A;  4CDQ A;  4QXK A;  2DCJ A;  3BU0 A;  2VZO A;  5FZA A;  2OPW A;  5I91 A;  2VZP A;  4GWJ A;  4Q8L A;  1UL9 A;  1I5Z A;  4Q4Y 1;  5JR7 B;  1K42 A;  1SG3 A;  2R7E B;  3T4H B;  2CWM A;  3DGT A;  1IKQ A;  3BTX A;  1M06 G;  4CSW A;  1W28 A;  4HLT A;  5JZG B;  1Q5O A;  3KMH A;  4WM8 A;  5JI9 A;  3O1P A;  3ZKU A;  2DU1 A;  2RS1 3;  2VZU A;  1VBD 1;  1MAC A;  4UWD A;  1S2E A;  4HBN A;  1RUO A;  2VL4 A;  2JIC A;  4CP9 B;  3RYK A;  2ZPX A;  4B29 A;  2LW8 A;  1WA4 A;  1WME A;  1RED A;  4N8M A;  5FUI A;  3T09 A;  4NAO A;  1H30 A;  4RS5 C;  4B4P A;  5HV4 A;  3AMP A;  1LEN A;  1HRV 3;  1MZ6 A;  3MBW A;  4IET A;  1P8J A;  3KV6 A;  1VBD 2;  2ZGS A;  3AMN A;  2QQU A;  3D8C A;  4LKD A;  1CR7 A;  3E5Q A;  3IBM A;  3AP6 A;  3RNS A;  3WNP A;  1U0A A;  2PHX A;  4CVU A;  4RHV 2;  1C8M 1;  1K5M A;  1GZT A;  3MV1 1;  4QHO A;  3NNM A;  5FYI A;  3H3L A;  4A3X A;  3PUR A;  1EAH 3;  4J25 A;  4PCR A;  5D8A C;  3W58 A;  5JCT A;  1XC6 A;  5JPM B;  3ILF A;  5LRS A;  4RD7 A;  2WNU C;  3ACH A;  4O65 A;  3E6C C;  2IXC A;  1LOE A;  4C91 A;  2VW1 A;  1GNY A;  3N9L A;  1GV9 A;  1XNB A;  1SLA A;  3H7Y A;  4YZ1 A;  2C6S A;  1VBA 1;  1OOP A;  2BFU L;  2VZS A;  2WZE A;  4FPJ A;  4I3P A;  1W9W A;  3HPN A;  4QPI C;  1ZZC A;  2JDZ A;  2XON A;  4ARX A;  4B4Q A;  1GLH A;  4BQ4 A;  5JXJ A;  4ZHN A;  2NMN A;  2UWC A;  5DDJ 3;  3N4M A;  4BQ3 A;  2O0O A;  4WZF A;  3L2Y A;  1FPN 3;  1OH4 A;  1JYV A;  2DTY A;  2HEY F;  5JXI A;  3MO4 A;  3GCX A;  2B9U A;  4Y22 B;  4JTO A;  4FXG B;  5DG2 A;  3TEZ A;  1VBA 2;  3NST A;  1E57 A;  4YSF A;  2KXL A;  1KD7 A;  1OT5 A;  3C3V A;  3HD8 B;  5JZG A;  2X8K A;  1HB4 A;  3KT4 A;  2ARX A;  3UJO A;  1SLB A;  2J1R A;  4XZU G;  2XML A;  1BCX A;  2R32 A;  2R07 1;  3LE0 A;  4ASM B;  3O7O A;  5F2S A;  3RMX A;  2VCM A;  2DU0 A;  2O1Q A;  2JXA A;  3KM5 A;  2ENR A;  1IG0 A;  4CP9 A;  4ASK A;  4K8R B;  1ULC A;  4PDW C;  2VOT A;  4B1M A;  1SBE A;  1X8E A;  3VBR C;  3M3E A;  3OF1 A;  5A33 B;  2OQ7 A;  1ACC A;  2W0X A;  5GJ6 A;  2E32 A;  1FV3 A;  1N1Y A;  2C9K A;  3EXU A;  1KJL A;  2VMG A;  4A6O A;  2VUA A;  1RGS A;  1T6G C;  3JBG 1;  3POF A;  3DF0 A;  3PVN A;  2R07 2;  1US2 A;  4HZF A;  4LO5 B;  4N43 C;  1L3J A;  2VOV A;  3POG A;  3N9M A;  1VMJ A;  2CNA A;  2X53 S;  5FQ0 B;  4XXA A;  1R09 1;  4I3G A;  1S0E A;  2PMW B;  3C2U A;  5IWF A;  2HEV F;  3MW4 A;  1FNY A;  2DWR A;  3RYP A;  3RJ2 X;  1COV 1;  2VCB A;  4QAW A;  2RM2 1;  5F5Q A;  5A3P A;  2HWE 1;  2ZGT A;  1Y43 B;  4SLI A;  3QAC A;  4MVT A;  5BPX A;  4BIF A;  3UES A;  4D69 A;  1Q43 A;  1AZD A;  1W04 A;  3W5N A;  3JBG 2;  3RGB A;  3ZN5 A;  3FLP A;  4RFR B;  3C7G A;  4DEQ A;  1WZX A;  3OJB A;  1Y3T A;  4KGG A;  1OVP A;  1OVS A;  1ND3 B;  3PL0 A;  4OYU A;  1YQ6 A;  4YYO A;  1NXD 1;  2WLQ A;  3VDC A;  5BYN A;  4JHZ A;  4MGT A;  2RM2 2;  5CZK A;  4XAA A;  2HWE 2;  2RJK A;  2AH2 A;  2RS5 1;  3RG0 A;  1HB3 A;  4MHR A;  1CPN A;  1Z7S 2;  5F3I A;  4Q0P A;  2A71 A;  4Y22 A;  4LOS A;  2TNF A;  2DCT A;  3C7O A;  2VMH A;  1CD3 G;  4BXF A;  2BOJ A;  4LBO A;  3OCP A;  1PVC 1;  5GZC A;  5ACA 3;  2WJS A;  3AK0 A;  4MGK E;  2HWB 1;  3E97 A;  1BJQ A;  2ET7 A;  1DGL A;  2RMU 3;  2RS5 2;  2ZEY A;  1QNW A;  2WO7 A;  3QOP A;  2FHR A;  2GP3 A;  3AC0 A;  5KXD A;  5CIR A;  1XYP A;  2WFF 2;  3I2G A;  5HCA A;  1CON A;  4LXL A;  2QQV A;  3LKJ A;  1AR9 3;  2CYF A;  1HRI 2;  3DN7 A;  4QU2 A;  1JZ6 A;  1O7F A;  1PVC 2;  2PXJ A;  2FDI A;  3BTZ A;  5A6X A;  1ZBA 1;  2WZR 3;  5A33 A;  2HWB 2;  4GKY A;  1Q8Q A;  1ULE A;  1XPW A;  4ISR A;  2Q1M A;  1H6X A;  4QHZ A;  5FYU A;  3U1X A;  1D0G A;  1BBT 3;  3GHM A;  1U5Y A;  3KF5 A;  2Z42 A;  2ZX1 A;  1XYO A;  4TLF A;  1GU3 A;  4PBP A;  1UZZ A;  1W8W A;  2VME A;  5BNP B;  5FQ0 A;  3MDP A;  1XBF A;  2WN3 A;  3RZM A;  4CUG A;  5JXG A;  5G05 L;  1BZW A;  3VBS B;  5LZ6 A;  2FZ1 A;  3H42 B;  4GJY A;  3EYP A;  2YGL A;  3DV8 A;  3B94 A;  4JKL A;  4XJU A;  5EXO A;  3U10 A;  2QQP A;  4BQW A;  4NIH A;  4NII A;  1KFX L;  2QDR A;  3AKQ A;  4P9I A;  2OUJ A;  1H2N A;  3GM8 A;  2AAC A;  5FMO S;  4IES A;  3VZN A;  1UOJ A;  3GCW A;  1C28 A;  2QQN A;  5LW9 A;  4TTG A;  1W8T A;  4NJ4 A;  3AM2 A;  1QOS A;  4JX0 A;  3NMB A;  3R4S A;  4GWI A;  2Y34 A;  2P5B A;  2D43 A;  5A32 B;  4O7X A;  2VTX J;  3USU B;  2D6M A;  2A3X A;  3DEM A;  2BU9 A;  1AR8 1;  1KIT A;  4YW5 A;  1E5R A;  3K4Z A;  4LA2 A;  4OCT A;  4Q0S A;  3WF0 A;  2ZAB A;  3WVJ A;  4DS0 A;  2TBV A;  4UF0 B;  1N3O A;  4LUK A;  2CSG A;  4BQ1 A;  3GJB A;  4IEV A;  3V56 A;  3S57 A;  1ENR A;  1VBD 3;  5IVB A;  1JZ2 A;  5JPN B;  1YO8 A;  4WM8 C;  1AR8 2;  3MFC A;  1PIV 2;  5FXX A;  3U07 A;  1V9U 1;  3V0A A;  4RHV 3;  4UW5 A;  2WQ4 A;  4R8H A;  4HOO A;  3CHX A;  4L9B A;  3AZZ A;  3A0K A;  2JIG A;  2EXH A;  3IDA A;  4X8N A;  2VXR A;  3JD7 1;  2GC2 A;  4Q29 A;  4XCA A;  1TEI A;  4NE9 A;  1EUU A;  3PME A;  2P1B A;  4FPL A;  5BNP A;  4OMC A;  4XXP A;  4NRP A;  4XET A;  5DAP A;  1V9U 2;  5H9R A;  3T4V A;  1X9P A;  3VZL A;  4I30 A;  4D7S A;  5J09 A;  1Y7B A;  3TAY A;  3TBD A;  5A6Q A;  3VBS A;  3ZXK A;  4W8J A;  4CEY C;  4AR2 A;  3GZE A;  2WN2 A;  3N35 A;  3JD7 2;  4LA3 A;  2JB4 A;  1ULD A;  2OXB A;  3RYR A;  2JEN A;  2YDE A;  4FPG A;  5FBJ A;  2C5D A;  5FK8 A;  3WUC A;  3WP4 A;  1FOD 1;  2JDH A;  2XKP A;  3AL5 A;  3NAP B;  4CP2 A;  1W9F A;  1O3S A;  4UFJ A;  3CLP A;  3AFK A;  4JKM A;  1RUF 1;  1WCQ A;  1I1E A;  5T50 A;  2DVG A;  2A3Y A;  5EP9 A;  2JIJ A;  3LB9 A;  2GNT A;  5A32 A;  5IAX A;  4FOW A;  3USU A;  1F35 A;  3E5X A;  4AED A;  4QKF A;  1DP0 A;  5FBZ A;  3HN1 A;  1FOD 2;  1MS1 A;  5FY9 A;  5T54 A;  3ZSJ A;  1MQT B;  1ZYB A;  2OPK A;  1SEF A;  1RC6 A;  1VBB 1;  4FCA A;  4XUQ A;  4IGO A;  4CDU B;  4N7U A;  2Z2S B;  5HPO A;  2NPI A;  4W50 A;  1OUS A;  3PTR B;  4UF0 A;  2DUP A;  3IB3 A;  1POQ A;  4LR4 A;  1EP0 A;  2GND A;  1LHO A;  3N36 A;  4Q0Q A;  2RS3 1;  2NYY A;  1PZ8 A;  4L8Q A;  1BK0 A;  4DY5 A;  1OXC A;  3N7L A;  4AVA A;  2RHP A;  4YVS B;  5FZO B;  2R6Q A;  1OPM A;  2OA2 A;  1DF0 A;  1VBB 2;  2D98 A;  3ZDV A;  5LRR A;  2Z69 A;  1B09 A;  2VH9 A;  4AEM A;  2JD4 A;  4CU6 A;  5K4L A;  1DYK A;  1GWK A;  5DUW A;  2WWJ A;  4RGG A;  3I2O A;  4WVM B;  5H9S A;  1G9B A;  1IZ3 A;  2A70 A;  2RS3 2;  3JBG 3;  2VZR A;  5FPB A;  5HXM A;  5FZG A;  1GZW B;  3ZXD A;  2NMO A;  5A7O A;  4A7Z A;  2XVL A;  3DKQ A;  1L7Q A;  4JQT A;  2IXH A;  4LJH A;  5IVY A;  2RM2 3;  2XG3 A;  1RUJ 3;  3HJR A;  2HYX A;  2YBS A;  5FK7 A;  5EIY B;  4PBO A;  2QBX A;  4UFH A;  1OQD A;  1Z7S 3;  3LZZ A;  3ZR6 A;  3A21 A;  4LBM A;  2KD7 A;  2BV4 A;  3TYJ A;  5AVA A;  3MZH A;  3P3N A;  5F3E A;  4Q8K A;  3NAP A;  4WV8 A;  2D5H A;  3U4S A;  2EIG A;  4AQT A;  3QH7 A;  2A75 A;  3I49 A;  1POV 1;  2DVD A;  2LM3 A;  4G4F A;  2EXI A;  3T2Q A;  3ZSK A;  1I6X A;  5C71 A;  3POB A;  2W1S A;  2EIE A;  1S0I A;  3LOB A;  2WFF 3;  4AF9 A;  5DAW A;  3DCQ A;  4BH9 A;  1MQT A;  2YHJ A;  3VBU B;  4CDU A;  2WZ8 A;  1HRI 3;  2JDU A;  3WCR A;  3NKT A;  2JDP A;  5JOW A;  4ZXE A;  2HWB 3;  2WNV B;  1NZI A;  1PK6 B;  3AJZ A;  3GJA A;  2UWA A;  3IDB B;  4IUG A;  1OLM E;  3ZKY A;  3POI A;  2XJP A;  3O0V A;  4XBQ A;  1VLN A;  4YVS A;  1SDW A;  5FZO A;  1NQD A;  2WWS A;  1CZS A;  1N47 A;  3AB0 A;  2ZOE B;  5FZ4 A;  3THD A;  4L2N A;  2A6X A;  4KWU A;  3ZMO A;  2PHD A;  3RZL A;  2WL1 A;  3WNM A;  5KHK A;  4WVM A;  2V4V A;  2QQW A;  2ZGL A;  3PUI A;  1XYN A;  2W95 A;  1QWR A;  2A5Z A;  2BZD A;  3U14 A;  4AI8 A;  4JKK A;  3QBQ A;  3WF3 A;  4UW3 A;  1NLS A;  3Q8F A;  4P5H A;  5GLT A;  3ZX7 A;  5HV0 A;  5JMC A;  2VU9 A;  4JV4 A;  4IV1 B;  1LTE A;  2FMD A;  4S2H A;  1BHG A;  1DG6 A;  1QF3 A;  1QDC A;  2WAO A;  2EAA A;  4MZU A;  3B02 A;  4FPO B;  3MUZ 1;  1TNR A;  3HQU A;  4KL1 A;  2PFW A;  5I8T A;  1CWP A;  1ASJ 3;  4LNV A;  2EID A;  2B42 B;  2BRT A;  1ODM A;  3GZU C;  1GUI A;  3A7Q A;  4YW2 A;  3SH5 A;  3ZPO A;  4CEW C;  2GH2 A;  1ND3 C;  1ONA A;  1CPM A;  5D1I A;  1TVG A;  4OHX A;  3PIJ A;  3III A;  5FIX A;  1JYT A;  3FMG A;  1RIR A;  4YGB A;  4EWE A;  2WII B;  3I54 A;  3K48 A;  4NWW A;  2DTW A;  1UX7 A;  2WR9 A;  4HK9 A;  4X8P A;  1NX9 A;  1H6Y A;  1XJA A;  5FYZ A;  1PIV 3;  4FVV A;  3K4A A;  4NHM A;  1FX5 A;  4NVP A;  2JG8 C;  2Y6G A;  2W68 A;  4JC1 A;  4FOY A;  5DZF A;  4MGY E;  2ZGU A;  1LOB A;  4XFB A;  2WNV A;  4MGQ A;  2WA4 A;  1YXW A;  1UF2 C;  2GNB A;  2WDB A;  2ZAH A;  4FOV A;  3W5M A;  3O1V A;  1AR7 2;  2IXL A;  2BPA 2;  2AZ5 A;  3AL6 A;  5BNO C;  5L19 A;  5GAL A;  5L9V A;  2K2S A;  3AMQ A;  4NAM A;  4XIL A;  1V9U 3;  2VMC A;  3VKO A;  4E2S A;  3UT0 A;  1HN0 A;  2ZGO A;  1FYU A;  2BER A;  3GBF A;  3CEW A;  1UZ0 A;  3HBK A;  4KQ7 A;  2FDJ A;  2VQA A;  4PHZ A;  4GMP 1;  3JD7 3;  2KM2 A;  2ZMK A;  2BWC A;  2RJL A;  1J3R A;  4Q0U A;  4NHK A;  5FZB A;  4LIU A;  4NPL A;  2IFW A;  4M3C E;  2TEP A;  5BNP C;  3H8O A;  3O14 A;  2XQX A;  1RUH 3;  3FWE A;  4IV1 A;  4K1Z A;  4Q1P A;  4RN5 A;  4YZ3 A;  3B93 A;  2VUC A;  3TNP B;  4UBH A;  3DKW A;  3VBS C;  2W9X A;  4LIV A;  1DQ5 A;  3KSC A;  4LEJ A;  3I59 B;  2FDK A;  1FOD 3;  1NE4 A;  3J4U H;  4RSU A;  3R0R A;  1LHV A;  1LOC A;  2NZ9 A;  2YV8 A;  4AVT A;  1QQP 1;  4QB6 A;  1LOD A;  2X05 A;  3OPW A;  1BEV 1;  2DV9 A;  2J1V A;  4B8E A;  1K45 A;  3FHI B;  3IT8 A;  5AVP A;  4XCB A;  5B4X A;  1RB8 G;  4GUL A;  4NUB A;  2YC2 A;  4B7K A;  3THT A;  3ASI A;  1DFQ A;  3OBZ A;  1LKN A;  4QMA A;  3B3Q E;  1OA3 A;  3DYO A;  2A1X A;  1VBB 3;  1OMI A;  3TOJ A;  1ZBE 1;  1ZRR A;  2Q8D A;  1QQP 2;  3OBA A;  4PDW B;  3DPR B;  1ND2 B;  1BEV 2;  1US3 A;  3T0A A;  4NRO A;  4RS5 A;  4OHW A;  2MEV 2;  4QXH A;  2ORX A;  4AEJ A;  5B4N A;  3W9A A;  2RR1 2;  1QOO A;  3O1M A;  5FZF A;  1W6N A;  3LSD A;  1IQD C;  1RUD 1;  2RS3 3;  4ZON A;  3KHB A;  2D6P A;  3ITQ A;  2Q8C A;  4QPY A;  2HLE A;  3WD5 A;  4N43 B;  3AMH A;  3RMY A;  5F6L B;  3KQ4 B;  5KWR A;  2QNK A;  3EHK A;  1ZBE 2;  2VC9 A;  1K3I A;  1KDK A;  2ZKN A;  1NKG A;  3H1Y A;  4AVV A;  2EXJ A;  5FPU A;  3B5L B;  1JUH A;  4GQ7 A;  1L7R A;  4KBB A;  1VB4 A;  1V6J A;  1RUD 2;  1UYP A;  4K21 A;  3VL9 A;  3AYE A;  4CPB A;  2R04 2;  2VZ1 A;  4L99 A;  1MEC 2;  2GAL A;  2Y6L A;  1LHW A;  4LO6 B;  4YG0 A;  5F8P A;  4ATE A;  4XFA A;  3PVB B;  2HEW F;  2ZHK A;  4V1P A;  3H8X A;  4Q27 A;  2Y38 A;  1V6N A;  1OQ1 A;  4DXT A;  3T0D A;  5CG9 A;  2IFR A;  3NW4 A;  1MZ5 A;  3KVA A;  3SH4 A;  5CAZ A;  4I01 A;  5T5J A;  5FDB A;  1BMV 2;  5FXZ A;  5FJH A;  2V5D A;  3E5U A;  4Y1X A;  4C90 A;  3MW2 A;  3C7H A;  2B4K A;  2QQK A;  3KLS A;  1JHJ A;  3CNA A;  4IEW A;  5I0S A;  4ZY9 A;  2JB8 A;  4DFS A;  3BKZ A;  2J7M A;  3AP7 A;  3I2D A;  2QQI A;  3I59 A;  1FMD 1;  3AXD A;  4UW4 A;  3OGS A;  3FFZ A;  4LTA A;  5LBE A;  3VBH B;  4AHW A;  3WNO A;  4A3Z A;  3IZO A;  4XUT A;  2WYS A;  2ETE A;  2V09 A;  3WG4 A;  4LBJ A;  3K2O A;  3VLB B;  4E4D X;  3VZO A;  1YHF A;  4AQ2 A;  4CCO A;  1SCR A;  3SKJ E;  4CU7 A;  4M4P A;  4HSJ A;  2I45 A;  1OQE A;  3JQW A;  3FBY A;  2ZBJ A;  4RFT 0;  2JE8 A;  4XF9 A;  4PDW A;  1ND2 A;  1MQT C;  2VM9 A;  4QX2 A;  3VBR A;  4ARY A;  1WMD A;  4YZ2 A;  1B35 B;  2DF7 A;  5A7P A;  1JUI A;  2YPD A;  1KGY A;  3OBR A;  4ITC A;  5CNA A;  4YM3 A;  4YPJ A;  5C4W B;  4XTP A;  4N43 A;  1LHN A;  2YMZ A;  3IM0 A;  5FZ7 A;  5KXC A;  1EV1 1;  3H1W A;  4CXY A;  4BQX A;  2BVB A;  4COW A;  2CHH A;  2VTF A;  2VQ0 A;  1AYN 2;  4KU7 A;  2BGC A;  5HI0 A;  4LKE A;  4HL0 A;  1GWM A;  2I74 A;  1LOG A;  3MW3 A;  1XNK A;  2I07 B;  1UYX A;  4S2D A;  2VBP A;  4ZU7 A;  5E89 A;  2OVU A;  1VMF A;  4HMZ A;  3ETQ A;  2Y64 A;  1XU1 A;  2WC2 A;  4AG4 A;  1GNH A;  1OPO A;  5F3C A;  4XJZ A;  3HN3 A;  2YRO A;  3SXW A;  4W4Z A;  1SAC A;  2VEC A;  2ZEX A;  1OI6 A;  5L9B A;  3SEP A;  5IW0 A;  3ES1 A;  1UKR A;  4GH4 B;  1WMF A;  2E7T A;  2E33 A;  1O3Q A;  2W08 A;  3LOI A;  2ZZQ A;  3SH3 A;  2N7G A;  4HG6 B;  4FAG A;  2JKB A;  1C3H A;  2ZX3 A;  4YVW B;  3VD9 A;  4C0H A;  3O1O A;  2R06 1;  2QUO A;  1PGL 1;  1STM A;  4IGQ A;  4AI2 A;  4ZU4 A;  3AYA A;  5EV7 A;  2CV6 A;  1WD3 A;  1DGW X;  4EQV A;  5HBA A;  4WVV A;  2XB6 C;  4LO8 A;  3MIB A;  1JN2 P;  1IHM A;  1UY3 A;  2A6V A;  1XE0 A;  4ISQ A;  1AR7 3;  1D4V B;  4RR3 C;  4BQY A;  4XJ8 A;  5FP3 A;  2XPJ A;  1OFN A;  4UFM A;  5J36 A;  2WT1 A;  4PJY A;  2XL9 A;  1PGL 2;  1VBC 1;  2XL7 A;  1G8W A;  3RZH A;  4Y1Z A;  4RQP B;  3VBU C;  1CAU B;  4CU9 A;  4MGZ E;  4DIQ A;  2VUD A;  3LIG A;  3AZV A;  3VD3 A;  3DYM A;  5FLJ A;  4GB3 1;  5C4W A;  2DBN A;  4LPL A;  1PK6 C;  2ILM A;  2VZQ A;  4UFK A;  5ANQ A;  4IEU A;  2VUJ A;  4FP2 A;  4CUC A;  4OFG A;  2UY9 A;  2ZCW A;  1IPJ A;  2P34 A;  1VBC 2;  4NHX A;  4CUB A;  2QQM A;  3FC0 A;  2BYV E;  5J96 B;  4LT5 A;  2PHU A;  1VMH A;  2BBA A;  4CEY B;  3WHT A;  3MFA A;  5FY0 A;  5A3L A;  5I8Y A;  1RUC 3;  2VGD A;  5FZI A;  3V0B B;  1O91 A;  4K6B A;  3KHC A;  2G9Z A;  2VZ3 A;  2Y33 A;  2Y0O A;  2WO1 A;  1ALY A;  4DPN A;  4KH9 A;  5FUP A;  3AP5 A;  3KWV A;  4G9S B;  3N9P A;  4HKL A;  5FYY A;  3FZ3 A;  1IQA A;  4QB1 A;  3SIS A;  3WV6 A;  4Y24 A;  3ZN6 B;  4CCL A;  1R1A 3;  3WNX A;  3I97 A;  4D8M A;  1LGN A;  4Q26 A;  1A8M A;  3ZFF B;  3EJK A;  4JVA A;  5CB7 A;  1Y9Q A;  4YVW A;  4BME A;  4DEV A;  3QLQ A;  1W6Q B;  4MSV A;  3F2Z A;  4BWO A;  4D3W A;  5K7P A;  1OBN A;  2GMP A;  3ZFG B;  1BEV 3;  3NL1 A;  5T55 A;  2W92 A;  2MEV 3;  4JDM A;  4LLF A;  3H8U A;  2RR1 3;  1QNY A;  4YZ5 A;  4KI5 M;  2PAK A;  3NJX A;  2WSV A;  2E7Q A;  4GKX A;  4MO3 M;  5FYH A;  3T3Y A;  4Z1V A;  3JB8 A;  1WLW A;  2XUE A;  1GQH A;  1PNF A;  1UYY A;  3KCC A;  1ZBE 3;  1ZZ9 A;  2VJX A;  2MPF A;  2BBV A;  1RJ7 A;  1CAU A;  1LU1 A;  1QJY 3;  1YIP A;  3U11 A;  1HQL A;  3CZJ A;  4Q4Y 2;  3U37 A;  5FMO L;  2A6Y A;  1RUD 3;  3HT1 A;  5F5C A;  4JGZ C;  4QX5 A;  4SBV A;  2R04 3;  4BPZ A;  1MEC 3;  1QDO A;  1UZY A;  2XUM A;  3D3A A;  2Y6K A;  5FYC A;  4MGS A;  3VDD C;  1HB1 A;  5AC9 1;  1D7P M;  2ZGP A;  1LAJ A;  3JUU A;  2CTV A;  3MF6 A;  3GGL A;  4QQH A;  1O8S A;  1OHF A;  3OY8 B;  4CEY A;  1H1A A;  3CO2 A;  5KHH A;  2OYZ A;  3V0B A;  5CKQ A;  1YIF A;  4DUX A;  2A3W A;  2PAM A;  2P3K A;  2RDR A;  3OSD A;  2IXJ A;  4JCK A;  1J1L A;  4M00 A;  5FZ6 A;  5AC9 2;  1WW6 A;  1ZX5 A;  4KNC A;  4DQA A;  4I2O A;  3ZN6 A;  2E9Q A;  2HYK A;  2RDN A;  4HFS A;  5IAV A;  1C8M 2;  4QX0 A;  5FMC A;  2FMY A;  2ZJC A;  4AFB A;  1QMJ A;  4OQ8 A;  1LHU A;  2JDK A;  2EXK A;  3IAP A;  3ZFF A;  3ZO0 B;  2BOI A;  3AZX A;  1PMH X;  1ZRI A;  2YC0 A;  4DUV A;  2WUH A;  5C8C B;  4L11 A;  3S7I A;  3KV4 A;  3HR9 A;  4AI0 A;  2IVJ A;  1W6Q A;  4PI0 A;  5FO9 B;  3RI8 A;  1KS4 A;  1HV1 A;  3ZFG A;  3S5Q A;  5LCW L;  2ARC A;  5FZM A;  4IW3 A;  1NE6 A;  1S0B A;  2PN5 A;  2GDF A;  3ACG A;  3ATG A;  3B01 A;  3UJQ A;  3VHN A;  2YBP A;  1AYN 3;  4JRL A;  1RL3 A;  3H1M A;  5J48 A;  1MVE A;  1LES A;  1UMH A;  4LHK A;  3BYW A;  3WG3 A;  5A3O A;  3ZLI A;  3DPR C;  1ND2 C;  1RVF 1;  1XND A;  3PUQ A;  1IS6 A;  1OUX A;  4MV2 A;  1FV2 A;  5K8S A;  2JE7 A;  3BIE A;  5BUV A;  5LY2 A;  1G7Y A;  2DCY A;  5ERL A;  5FZ8 A;  1C5H A;  4BLI A;  3S5A A;  3DUI A;  4GAL A;  1OD3 A;  5FRA A;  3OY8 A;  2PYT A;  1MR5 A;  2BNM A;  4MYE A;  1RVF 2;  2FCU A;  4Z82 A;  3I3M A;  1DZT A;  3ZSM A;  4R9C A;  3IMN A;  5DUX A;  3JB4 C;  3O12 A;  2AEN A;  4DOU A;  4R4X A;  5JLV A;  3OG2 A;  1AJO A;  3TB0 A;  4CEW B;  1R09 2;  2DVB A;  1WW5 A;  1NZC A;  5DXD A;  4DIN B;  1DIW A;  2PAE A;  1COV 2;  1ZA4 A;  5IYY A;  3J8F 1;  3WF4 A;  5C8C A;  2D6L X;  3EB7 A;  3MIF A;  4COZ A;  1AXK A;  1CJD A;  5KC5 A;  2OUH A;  5DG1 A;  3BB6 A;  3WDT A;  1LNS A;  3SCG A;  4ZZ8 A;  3MPP G;  4V2V A;  4CUA A;  2JG8 B;  3TN9 1;  5K9Y A;  3VBH C;  5ABJ C;  5C7G A;  4CCC A;  1VJ2 A;  2WT0 A;  1WCU A;  3IDC B;  4OI4 A;  4QT6 A;  4PQQ A;  1NG0 A;  5FZE A;  1F9K A;  5FWE A;  3V65 A;  3WDV A;  2ID4 A;  4A2U A;  3E6D A;  3LFI A;  4GD4 A;  1VPH A;  4BK4 A;  5CKN A;  1XNT A;  1UCX A;  2VVE A;  5BNO B;  5FMB A;  4R9B A;  3KCX A;  1UXX X;  4JGY C;  5DQ0 A;  1QGL A;  2XGX A;  3SCH A;  4D7Y A;  1GP5 A;  1IS3 A;  3TN9 2;  1AR6 1;  1WCK A;  1MS0 A;  2VCC A;  3MIG A;  5IK5 A;  5DZG A;  4UT5 A;  4QX1 A;  1B35 C;  5LBF A;  1E5H A;  4K20 A;  5C4W C;  4WM7 B;  2V72 A;  4YM2 A;  1YJK A;  3RRD A;  1LRH A;  1OF3 A;  3OD0 A;  3DL3 A;  1D4M 1;  4GZ9 A;  2X5I B;  2BEO A;  1NXM A;  3FHA A;  4LKF A;  4NRQ A;  1JYC A;  5FO7 B;  1ZBA 2;  4XHB A;  1JI6 A;  5SV8 A;  4Q4V 3;  3N3H A;  2X29 A;  3WQ1 A;  1UU5 A;  2D97 A;  5FZH A;  3UK9 A;  1D0H A;  3BPZ A;  2HJI A;  3MIH A;  5ISL A;  4CEW A;  3ILR A;  5C8W A;  1ND3 A;  1D4M 2;  4A41 A;  2W52 A;  2CY6 A;  5A7W B;  4FFG A;  3K77 A;  1J1T A;  1GOH A;  1YQC A;  2DVA A;  3WNK A;  1W06 A;  4I02 A;  4LOR A;  4LK7 A;  4GH4 C;  4WBB A;  1D2S A;  3WCS A;  5FWJ A;  2Z4F A;  4NO4 A;  2JG8 A;  3PUS A;  3I3Q A;  4YVW C;  5I0R A;  1UPS A;  2ET1 A;  4XUN A;  3ZSE A;  2EAL A;  4Q4Y 3;  4LHN A;  4PT6 A;  3D82 A;  1S0G A;  2DDU A;  1W39 A;  3ZYJ B;  1O5L A;  1XRU A;  5HCF A;  1PMI A;  4XYX A;  2GC3 A;  3OYW B;  2Y8K A;  1RUI 1;  2SBA A;  2ZXQ A;  4U2A A;  2B39 A;  2H0B A;  1W3V A;  2DFB A;  2G9G A;  3FBM A;  5CVR A;  5J98 B;  5BNO A;  1KRI A;  1AVB A;  4LBQ D;  5FLI A;  4ASL A;  1H8T C;  5J1X A;  1HQN A;  3WP5 A;  4IE0 A;  1W90 A;  1E5S A;  2R0H A;  3ETP A;  4BE3 A;  2RDS A;  3RZG A;  3MLK A;  1OA4 A;  2VMF A;  1O6U A;  4RQP C;  4AGR A;  5BY5 A;  1PO2 1;  2FQP A;  5F3G A;  1S0J A;  2HKX A;  1AF9 A;  1UAI A;  1RUI 2;  2NQY A;  3VZK A;  3POS A;  4BQ5 A;  1AL0 G;  4W6X A;  2LRO A;  3LEK A;  3LAG A;  3VD4 A;  5EJ1 B;  2PHF A;  5AC9 3;  1LEC A;  1ZZ8 A;  1DGR A;  4LE4 A;  2J1E A;  2WQZ C;  4ZU5 A;  4I0B A;  3VB9 A;  1GSL A;  4EE2 A;  4P08 A;  2X5I A;  4GXL A;  3UGH A;  1C8M 3;  4K8F A;  3ACF A;  4XMA A;  2QZ2 A;  4AOC A;  4AVS A;  3VBO B;  1PO2 2;  4WVZ A;  3NKG A;  1DLL A;  4QGM A;  1S55 A;  4PIY A;  4CDW B;  2V4A A;  1RJ8 A;  4YFW A;  4HSL A;  1W8Z A;  1ZRC A;  3OEA A;  3BVC A;  1XQN A;  2YG0 A;  1RUG 1;  2LTN A;  4H3W A;  4LHS A;  4HVO A;  3CF6 E;  2WWU A;  3ECQ A;  1VBA 3;  2ZEZ A;  2ZS6 B;  1YI7 A;  4P14 A;  5FYV A;  1JH5 A;  4M3C F;  2A6Z A;  5FUN A;  3O5S A;  1KDM A;  3ZFF C;  3VBF B;  4JQR A;  2BJS A;  2P2K A;  2P6H A;  5LWB A;  4L92 A;  2OQ6 A;  2W1U A;  3LEM A;  5FY7 A;  4AK3 A;  3HBZ A;  2WYF A;  5FRE A;  4P5Y A;  4Y33 A;  3AP4 A;  1H4G A;  4XDO A;  4PLN A;  2GC0 A;  5AFB A;  2PQS A;  1MS8 A;  1PNG A;  3UV9 A;  3ZFG C;  1D2Q A;  1RUF 2;  1JTZ X;  3AKR A;  1W9T A;  3OYW A;  2RJ2 A;  3WP6 A;  4C1X A;  1HB2 A;  3NVC A;  5FKB A;  4AL9 A;  5EYX A;  5FYT A;  4A45 A;  2R07 3;  4XQW A;  3LPG A;  3OBT A;  4IND A;  4CA9 A;  2GU9 A;  2WSU A;  1H1I A;  2YU1 A;  4KU8 A;  3PU3 A;  4IEZ A;  1VAM A;  1V00 A;  3BCW A;  3LA3 A;  4MOA A;  3WF2 A;  4ZS3 A;  2XJV A;  5T3N A;  1S2K A;  1YJL A;  1UO9 A;  4COV A;  4XFI A;  2A73 B;  4U36 A;  1VB2 A;  3JXS A;  5JIA A;  5LEK A;  1A78 A;  1RHI 1;  3IKW A;  4M0H A;  1KEX A;  1R09 3;  4XF0 A;  2WNO A;  4BIS A;  4K40 A;  2QVS B;  2R30 A;  4P9X A;  3VBO A;  4CCD A;  3KS7 A;  1COV 3;  3C7F A;  4AGV A;  3LA2 A;  4M4R A;  2HWE 3;  5FXV A;  5LAT A;  3K4D A;  1YI9 A;  3AFG A;  4CDW A;  1RUE 1;  3Q8C A;  4A42 A;  1DDL A;  2J42 A;  1UIJ A;  1FXZ A;  1RHI 2;  3T2T A;  1DQ4 A;  3LD8 A;  1TMF 1;  5D21 A;  4UOJ A;  3ZXA C;  3LCP A;  4LUM A;  1V70 A;  1F8V A;  2VY0 A;  1XE8 A;  1DYP A;  2J22 A;  1JMU B;  3P3P A;  4NPR A;  3TRS B;  5F1R A;  2KA3 A;  5IK8 A;  2VOK A;  1GAN A;  2RS5 3;  2Q1Z B;  1RUE 2;  1BYH A;  4RR3 B;  4BMB A;  1MS5 A;  2GP5 A;  1ODN A;  2RE9 A;  1CIY A;  1Q56 A;  3FJS A;  1BXH A;  3R4U A;  4R9A A;  4XF4 A;  3ZYF A;  5C8C C;  3BPS A;  4FI9 A;  3TN9 3;  1TMF 2;  2W1W A;  4HKW A;  3NV3 A;  4QKD A;  1UZV A;  4CCN A;  3WF1 A;  1XE7 A;  1NAE A;  1PVC 3;  3MEP A;  1BK1 A;  3NNG A;  4LHL A;  3I2I A;  5EHD A;  3OUH A;  4BDV B;  2IC1 A;  5C6C A;  1KS5 A;  3VN4 A;  1JZ5 A;  4HN1 A;  1OFS A;  5DAQ A;  4RGK A;  1NCR B;  2Y6J A;  4NIA A;  4QX3 A;  2XDV A;  2UYA A;  4HT1 T;  5JWP A;  2R1B A;  4QD2 A;  2FCT A;  5F2W A;  5GLW A;  5G04 L;  1ZBA 3;  2RDQ A;  1UYZ A;  5B2G B;  2H6B A;  3GYD A;  2E31 A;  3PLQ A;  1ZNP A;  2TUN A;  3WDY A;  5CA6 A;  1S2B A;  4AI3 A;  4C1W A;  4CE8 A;  1O4Z A;  3TWI A;  4CCE A;  1ENX A;  1QJF A;  2D6N A;  2XWB B;  1IGO A;  4ZZ5 A;  1GZW A;  2VNG A;  3WW4 A;  1RTV A;  3WQB A;  3RWK X;  3UKT A;  3WY6 A;  3SNM A;  1D4M 3;  5EJZ B;  5KC6 A;  1XOY A;  4NIG A;  2YZ4 A;  1YEW A;  3K3O A;  3FE5 A;  3HIF A;  1C1F A;  5FPA A;  2UYB A;  1CZV A;  4AFC A;  4TLG A;  3ROU A;  3BOW A;  4PLO A;  1U12 A;  1G86 A;  1V6K A;  4XIO A;  1CAX B;  4FFH A;  4YW1 A;  1OD5 A;  1REE A;  1H1M A;  1AJK A;  1VAL A;  5JVV A;  1NLR A;  1QH7 A;  2EF6 A;  3NNL A;  4CYD A;  2W46 A;  2ZAA A;  1FNZ A;  1LJ7 A;  5C3P A;  2NP0 A;  1EPW A;  3KQR A;  4K9S A;  4RR3 A;  1I9R A;  1HW5 A;  3AXE A;  3LDB A;  2ZEW A;  1SFN A;  4XTM A;  5CFD C;  4D6S A;  3A4U A;  1AR8 3;  3AMM A;  4Y5S A;  3O1S A;  3VBU A;  1OUR A;  1ZZB A;  2OKX A;  2ATF A;  2WO3 A;  3TEW A;  4TSV A;  4JAA A;  3RVH A;  2K0G A;  3ILN A;  2UY8 A;  1KJR A;  4FT8 A;  1G6N A;  2DFC A;  4QPG C;  4ZS2 A;  3UKV A;  4D94 A;  1PK6 A;  4Q4X 1;  4JGZ B;  1S4C A;  2AR6 A;  2P17 A;  3MLL A;  4NR1 A;  4V2W A;  5A6Z A;  3T1L A;  2Y26 A;  1QJE A;  1ZVF A;  5FYB A;  1SCS A;  3VDD B;  2I2S A;  4YGE A;  5C5U A;  5A3M A;  5HXV A;  4W65 A;  4LQR A;  2WKK A;  2Z79 A;  4Y4R A;  5T5O A;  3WSO A;  1X33 A;  2ZHN A;  3D0S A;  4HK8 A;  4OUE A;  4CTE A;  1M4W A;  1X36 A;  3ZIX A;  4A7Y A;  2B8M A;  2VZV A;  2D3P A;  2PEL A;  5IVV A;  4EN9 B;  3VUO A;  1XB9 A;  1DU3 D;  5A7S A;  1UZW A;  4NID A;  2VPV A;  4WM7 C;  1IKP A;  4Y26 A;  1O59 A;  2CAV A;  1N3P A;  3GAL A;  5JSR A;  2CGP A;  2EAK A;  4EZ4 A;  1V6I A;  4XBL A;  3T0B A;  3EQE A;  4E8D A;  2X5I C;  1WWY A;  4MGI E;  5FR3 A;  2VE1 A;  1UY2 A;  3SHR A;  4UYB A;  4BHP A;  4IER A;  4CP0 A;  3LPF A;  1CAX A;  3NNJ A;  1QU0 A;  3HT2 A;  1AUY A;  4QB2 A;  1F2N A;  1GMM A;  1OKQ A;  2W94 A;  2YB7 A;  4KMQ A;  2P6C A;  2XXZ A;  4AGG A;  2XHN A;  2P4E A;  4XIK A;  1ENS A;  1S0D A;  4Q1R A;  5DAB A;  4Z07 A;  3FUQ A;  3WOG A;  1RUF 3;  1TQ5 A;  5F32 A;  4P02 B;  4C0B A;  1J83 A;  4D6Q A;  4Y5T A;  3RI9 A;  3VV1 A;  3JCI A;  1GP6 A;  1WUV A;  4BYY A;  1UPI A;  4OUS A;  3RZK A;  2VQU A;  3IIA A;  2W3J A;  1JOD A;  1OSG A;  2RV9 A;  2ZX4 A;  2XJS A;  1XXN A;  1HIX A;  2VVD A;  3N7M A;  4JGZ A;  3MYX A;  1O4Y A;  3ST7 A;  3BAL A;  3K51 A;  3VDD A;  3SLI A;  5JR2 A;  1LOF A;  2X09 A;  2XHK A;  1F31 A;  1NA1 B;  4TWT A;  5CAD A;  4HN0 A;  4Q0V A;  1HLC A;  3M4F A;  4ZKT B;  1U5X A;  1UN1 A;  2RS1 1;  2L9L A;  3ELN A;  1PVX A;  1UQX A;  4Z2W A;  5M0T A;  4PQ9 A;  4P9L A;  1IS5 A;  3CDZ B;  3VL8 A;  5FPL A;  5LAS A;  4KWJ A;  4AI9 A;  1RHI 3;  5F37 A;  1CES A;  4N53 C;  1G9C A;  1S1A A;  4IE7 A;  5FZ1 A;  2C9A A;  4QX7 A;  3VBO C;  3KV9 A;  4OHV A;  1RUE 3;  2D7F A;  3H7J A;  5L9R A;  1K12 A;  3KVB A;  1ULG A;  4QX8 A;  2D5F A;  5T52 A;  4H7L A;  2AUY A;  1FT9 A;  1W99 A;  4HXC A;  4CDW C;  2FBE A;  1BKZ A;  2PHT A;  4YRD A;  3VHP A;  4J1X A;  2O14 A;  5FZL A;  3TNQ A;  5ABJ B;  4Y1Y A;  1EAH 1;  5H9P A;  4N7I A;  1SBD A;  3ES4 A;  3T30 A;  4E2Q A;  3J7H A;  3LWC A;  3B9I A;  4L0P A;  4W6Y A;  5KHI A;  5FY1 A;  5I8S A;  5A3U A;  1POV 3;  1W3X A;  2D6O X;  3ACI A;  3H9A A;  5LA1 A;  5CFC C;  3VZJ A;  3VKF C;  4JGY B;  1YCI A;  1Y4W A;  1QKQ A;  1HQW A;  2AC1 A;  1FMD 2;  2QCS B;  3GZA A;  4HVR A;  3VBF C;  4YGD A;  1A34 A;  2GZW A;  1EAH 2;  3PVE A;  2VUL A;  3DPR A;  3I3D A;  1X50 A;  2DBI A;  5DDJ 1;  4PF5 A;  4YLZ A;  4AFD A;  4LK6 A;  3NJZ A;  4EWA A;  5F39 A;  4D7T A;  1FPN 1;  2YC4 A;  4XPV A;  1AX1 A;  3APB A;  4M3C B;  4CDX C;  4DY3 A;  1H2L A;  4YAR A;  1NA1 A;  1X9T A;  4AHX A;  2A6W A;  2Y0I A;  2GNM A;  3S6P A;  1H8V A;  1NQJ A;  4KWL A;  5FOB B;  2XJT A;  1C5I A;  5E6H A;  2Q5T A;  3X29 B;  3GXU A;  4QM9 A;  3VGI A;  1SZB A;  5FZC A;  3Q8B A;  1DQ0 A;  1FPN 2;  1W6P B;  2YY1 A;  2LRP A;  1HXS 1;  3N7J A;  4DRV A;  3LEG A;  3BTA A;  2WLP A;  3I2K A;  4UXA A;  1IPK A;  3LQC A;  3TEX A;  1EV1 2;  4LIT A;  4XOG A;  1QJU 1;  3TEY A;  2PA7 A;  3VHR A;  2JKX A;  1AX2 A;  5DUU A;  2QQJ A;  3WQ7 A;  1Z0H A;  4LOT A;  2J1U A;  4PI2 A;  5LK5 A;  1VP6 A;  5FPV A;  4P9G A;  1MS9 A;  3NV1 A;  1JXN A;  4JZR A;  2IVI B;  1DHK B;  1HXS 2;  1ULP A;  2BDR A;  2W91 A;  1W2N A;  4XAE A;  4PF1 A;  4A44 A;  1A8D A;  3RDI A;  5IT6 A;  1QJU 2;  5LB6 A;  4HVQ A;  3M3O A;  3VBH A;  5ABJ A;  1RUN A;  1LCL A;  3UKN A;  3PUA A;  4KGQ A;  4COU A;  2IXI A;  5HCB A;  4YWA A;  3H3Z A;  5IVF A;  4HET A;  1N1V A;  3VKM A;  1HDK A;  2E53 A;  5BNN C;  2LS6 A;  5C3S A;  4FSJ A;  2XOM A;  2GME A;  4JGY A;  3JQX A;  4BQ2 A;  1H8T B;  4YW7 A;  4EN0 A;  2QQL A;  4EYU A;  2R06 2;  4XF1 A;  1IS4 A;  3POJ A;  4KWK A;  3MIE A;  1TNF A;  1B35 A;  4RGA A;  3B00 A;  4OI1 A;  5KBF A;  1TG7 A;  2WBK A;  4CDQ B;  3PUH A;  5IVC A;  3GBW A;  2IUW A;  4MXW B;  4XC9 A;  3FUO A;  4XDQ A;  2EVX A;  1N1T A;  2CGN A;  2IXK A;  2QKD A;  2JEC A;  2HBT A;  2ZAC A;  4IQP A;  4IV3 C;  3SC7 X;  3WG1 A;  5ACA 1;  1NCR C;  1G9F A;  2MHF A;  1BQP A;  2RMU 1;  5L7O B;  3AYC A;  5FO8 B;  3WLU A;  5JXH A;  5FZ0 A;  2VNV A;  2W47 A;  4K1Y A;  4MG2 A;  5EJ3 A;  4GB3 2;  1W6P A;  4GMP 3;  2DCK A;  4YW3 A;  4CXX A;  4QHB A;  4R52 A;  1YQ8 A;  3RQ0 A;  4RA0 A;  1BVP 1;  4N9I A;  2XLG A;  3VDA A;  4N90 A;  3T08 A;  3URF A;  3WW3 A;  2VQT A;  4IEQ A;  2VO5 A;  2G19 A;  1JOJ A;  4ZXK A;  3RSJ A;  3CU7 A;  2RMU 2;  3I2J A;  3OGJ A;  3D6E A;  4TN7 A;  4C8D A;  5KR7 A;  5BXX A;  1ENQ A;  4AFM A;  1J3Q A;  2UU8 A;  4GH4 A;  1AYM 1;  4PLM A;  2ADE A;  3OOX A;  5JOZ A;  1OKO A;  4Q4W 1;  4AWD A;  1W6O B;  5FP9 A;  2YXS A;  4JHT A;  4BB3 A;  3WDU A;  1UX6 A;  1ST8 A;  1X82 A;  2XVK A;  2ZGN A;  1NLQ A;  5FZK A;  4URT A;  5L73 A;  2XJR A;  1UMI A;  1K5M B;  4OI2 A;  4QU1 A;  1VRH 1;  1Y9G A;  3PNA A;  1SLL A;  5FZD A;  3ZXF A;  1RXF A;  4NHY A;  5FAX A;  1GZ9 A;  1QQP 3;  3VD7 A;  2FDF A;  1DQ2 A;  1DQ6 A;  4BZ4 A;  3OEB A;  1ZA7 A;  1WBL A;  4LMF A;  2VZT A;  4GWN A;  1AYM 2;  5JOX A;  1OC1 A;  2NM1 A;  3I2F A;  4Q4W 2;  2HWF 1;  1DQ1 A;  4XEZ A;  5DPN A;  1J3P A;  4QQL A;  2DCZ A;  3WIN E;  4P00 B;  3OD4 A;  5EWS A;  1H8T A;  3ZYG A;  3ZFE B;  3HNY M;  5IVJ A;  1NY7 1;  1VRH 2;  3PJY A;  4BJ0 A;  2ARE A;  4E2G A;  4RQP A;  2JDM A;  2UWB A;  4ORF A;  4X6R B;  1JYW A;  1AL2 1;  1E5I A;  1DLC A;  1O5U A;  1GR3 A;  4F8A A;  3BI3 A;  2FZ2 A;  4HPK B;  3E1F 1;  3RS6 A;  4MXW A;  2HWF 2;  4BIO A;  4E4S A;  2K46 A;  2SLI A;  4FPH A;  5A1F A;  5FLH A;  1NY7 2;  3R05 A;  2J1T A;  2CGO A;  4FFF A;  2BTV C;  3L9J T;  1LOF C;  3MID A;  5EPA A;  5A6Y A;  2ARB A;  3K3N A;  1AL2 2;  5LBC A;  5L7O A;  1WLT A;  5GZE A;  2D3S A;  2F17 A;  3Q8E A;  5A7N A;  1RIN A;  5FMD A;  2W39 A;  3U4X A;  5BV6 A;  2PLV 1;  3E6B A;  1A6C A;  1LU2 A;  3PMS A;  4IL7 A;  3GNE A;  3I7D A;  1WGP A;  3EBR A;  4RHV 1;  1J58 A;  3MUY 1;  4S2G A;  4LO7 A;  1PHM A;  2LAL A;  3M3I A;  3IMM A;  3I3B A;  4AW7 A;  2DUO A;  4N9H A;  4AQS A;  4B7E A;  5A1L A;  4CU8 A;  1LEM A;  2OX0 A;  2RVA A;  2V5Y A;  5GLV A;  3SKV A;  4FTE A;  4PIZ A;  1W6O A;  4LBN A;  5IUQ A;  1Q8P A;  1OLR A;  1NYW A;  1WLC A;  2PLV 2;  3CJI C;  3LDK A;  5JMO A;  2ZGK A;  1FMD 3;  1LR5 A;  3M3Q A;  2CDP A;  1Q8S A;  3PHM A;  3ZPY A;  1W2A X;  4HAN A;  1AX0 A;  2W1Q A;  1JBC A;  3H0O A;  2JE9 A;  3UYJ A;  4CCM A;  1SFP A;  1S0F A;  3LA7 A;  1DGR N;  3NRU A;  4LKS A; 
#chains in the Genus database with same CATH homology
 1GUI A;  3LEK A;  3A7Q A;  3VD4 A;  5EJ1 B;  2J1E A;  4XUP A;  5I0D A;  1TVG A;  4P08 A;  3III A;  3ACF A;  4XVH A;  1EUT A;  2YFU A;  1UX7 A;  1NX9 A;  1H6Y A;  1UXZ A;  3K4A A;  1XNA A;  3OEA A;  2Y6G A;  2YG0 A;  4LHS A;  3UNP A;  5C70 A;  3CKH A;  2ZEZ A;  3ECQ A;  4MGQ A;  1J84 A;  2WDB A;  4E8C A;  3W5M A;  2J1A A;  2WAB A;  3NQH A;  5IFP A;  3T2O A;  2VMC A;  3WNL A;  2BER A;  2W1U A;  2W5F A;  1GOG A;  1UZ0 A;  4P5Y A;  2JD9 A;  2PQS A;  1YQ2 A;  1SDD B;  3NJV A;  1W9T A;  2RJ2 A;  3WNN A;  4QPW A;  3HNB M;  1JZ7 A;  3I2H A;  4A45 A;  1GOF A;  1PX3 A;  3LPG A;  5JUV A;  2XQX A;  4RN5 A;  3CQO A;  1W9S A;  3T2P A;  1CX1 A;  2W9X A;  4UAP A;  3BN6 A;  4MOA A;  3WF2 A;  3FN9 A;  3JXS A;  4QB6 A;  2VR4 A;  2X05 A;  2J1V A;  1K45 A;  1KEX A;  1W8O A;  3CMG A;  5B4X A;  2YC2 A;  3C7F A;  5F7U A;  4M4R A;  3K4D A;  3DYO A;  2YFZ A;  1UY1 A;  3SEE A;  3K46 A;  4A42 A;  1UY0 A;  3FL7 A;  3MV0 1;  4QDQ A;  3OBA A;  3T0A A;  1US3 A;  5CYY A;  1NUK A;  2ORX A;  5B4N A;  2VCA A;  5IFT A;  4UOJ A;  1W8N A;  1IQD C;  2C26 A;  4QDS A;  3UET A;  1MPX A;  4DXS A;  4D0Q A;  2J22 A;  2HLE A;  3GDB A;  1CZT A;  2E26 A;  1CIY A;  2VC9 A;  1K3I A;  1NKG A;  4FI9 A;  3A22 A;  2W1W A;  1L7R A;  3WF1 A;  1NAE A;  2DCJ A;  2VZO A;  2VZP A;  3K75 B;  2VZ1 A;  4GWJ A;  2Y6L A;  3NNG A;  5IHR A;  3I2I A;  1K42 A;  1SG3 A;  2R7E B;  4BDV B;  3T0D A;  4DXT A;  1JZ5 A;  2B9V A;  3FHQ A;  2Y6J A;  2V5D A;  4QX3 A;  2VZU A;  3C7H A;  2B4K A;  2QQK A;  1JHJ A;  4ZY9 A;  5G04 L;  4ET7 A;  2J7M A;  2VL4 A;  4DUW A;  1UYZ A;  2QQI A;  2E31 A;  2LW8 A;  3OGS A;  5FUI A;  3T09 A;  1O8P A;  3WNO A;  3HOB A;  4A3Z A;  3WQB A;  4ZZ5 A;  5DMY A;  4XUT A;  2WYS A;  3MBW A;  5EJZ B;  1P8J A;  1CZV A;  3SKJ E;  4CU7 A;  4M4P A;  3WNP A;  4CVU A;  3MV1 1;  2JE8 A;  2VM9 A;  1XC6 A;  4QX2 A;  4ARY A;  3ACH A;  1KGY A;  2W46 A;  4XUR A;  4YPJ A;  1GNY A;  1JU4 A;  2VZS A;  2WZE A;  2VTF A;  2ZEW A;  1W9W A;  3HPN A;  4ARX A;  2XON A;  5JXJ A;  1PX4 A;  1UYX A;  2WO3 A;  2OKX A;  1OH4 A;  1JYV A;  5JXI A;  3MO4 A;  2Y64 A;  4AG4 A;  4OMD A;  1JZ8 A;  3I3E A;  3HN3 A;  4W4Z A;  1OT5 A;  2ZEX A;  3SEP A;  2J1R A;  4XZU G;  4LQR A;  3LE0 A;  3WSO A;  2E33 A;  4OUE A;  4HG6 B;  3VD9 A;  2VZV A;  2VOT A;  4A6O A;  2C9K A;  2E32 A;  1O59 A;  1W0N A;  1US2 A;  4BXS V;  1UY3 A;  3T0B A;  4E8D A;  1WKY A;  1UY2 A;  3LPF A;  1R64 A;  2VCB A;  4QAW A;  1I5P A;  4QB2 A;  1GMM A;  4CU9 A;  3UES A;  1JYX A;  2W94 A;  2YB7 A;  3VD3 A;  3W5N A;  4KMQ A;  3DYM A;  3C7G A;  2XHN A;  4DEQ A;  3OGR A;  4LPL A;  2VZQ A;  2W87 A;  4OYU A;  4P02 B;  1J83 A;  4CUC A;  3VDC A;  3ZM8 A;  3C7E A;  4JHZ A;  5CZK A;  4CUB A;  2QQM A;  2VQU A;  2W3J A;  2BBA A;  2RV9 A;  3WEZ A;  2VZ3 A;  2WO1 A;  3C7O A;  1SHW B;  4QB1 A;  4Z2A A;  2ZEY A;  5JR2 A;  2X09 A;  3I97 A;  4D8M A;  3AC0 A;  3I2G A;  4DEV A;  2L9L A;  1JZ6 A;  3F2Z A;  3CDZ B;  2EIB A;  1OF4 A;  1XPW A;  4XUO A;  1H6X A;  2C4X A;  2W92 A;  1F4H A;  4KI5 M;  3NJX A;  1GU3 A;  4MO3 M;  2VME A;  2WN3 A;  1K12 A;  1UYY A;  5JXG A;  5G05 L;  1W99 A;  2VJX A;  3EYP A;  2QQO A;  3CZJ A;  4JKL A;  3U37 A;  3LEI A;  2BGO A;  3ABZ A;  3DEC A;  3J7H A;  4L0P A;  3GM8 A;  2WO2 A;  5LA0 A;  3D3A A;  2Y6K A;  3ACI A;  4MGS A;  5LA1 A;  2QQN A;  4TXW A;  1D7P M;  4TTG A;  2VMD A;  4JX0 A;  5A1A A;  3GGL A;  4GWI A;  1O8S A;  3THC A;  4DUX A;  3I3D A;  2WAA A;  3K4Z A;  3P1I A;  2YC4 A;  4OZO A;  3WF0 A;  4QX0 A;  1GQP A;  3IAP A;  1JZ2 A;  1PMH X;  4DUV A;  2WUH A;  3GXU A;  1T2X A;  3LEG A;  5LCW L;  3I2K A;  3LQC A;  3IDA A;  2JKX A;  4QDR A;  1EUU A;  2QQJ A;  2J1U A;  3BGA A;  4OMC A;  3ACG A;  1ULP A;  3VDB A;  2W91 A;  1UMH A;  4PF1 A;  4W8J A;  4A44 A;  1UY4 A;  2WN2 A;  4MAD A;  3OB8 A;  2LS6 A;  2XOM A;  5LA2 A;  4JKM A;  1WCQ A;  2QQL A;  1OD3 A;  3HNM A;  1JZ4 A;  1DP0 A;  1PMJ X;  4XUQ A;  1TG7 A;  2WBK A;  5HPO A;  2BGP A;  3PUH A;  4W50 A;  3OGV A;  3OG2 A;  3IB3 A;  1JU3 A;  3IAQ A;  2CDO A;  5IJR A;  3VD5 A;  5IYY A;  2X10 A;  3CIH A;  3WF4 A;  5JXH A;  3EB7 A;  2W47 A;  1RYY A;  4ZZ8 A;  1LNS A;  2DCK A;  4CUA A;  4CU6 A;  3VDA A;  3DYP A;  5C7G A;  3T08 A;  5HXM A;  2VZR A;  2VQT A;  2WQ8 A;  3HEI A;  2VO5 A;  2J1S A;  4PQQ A;  4BK5 A;  4BK4 A;  2ID4 A;  3I2J A;  1XNT A;  1L7Q A;  1UXX X;  5DQ0 A;  1F4A A;  3HJR A;  3CZU A;  2HYX A;  1ULO A;  2VCC A;  1UMI A;  1DYO A;  5EIY B;  2QBX A;  3A21 A;  3VD7 A;  4QX1 A;  2KD7 A;  3OEB A;  2VZT A;  2V72 A;  4RYD A;  3I2F A;  5DPN A;  1OF3 A;  2ORZ A;  5DN2 A;  4P00 B;  4GZ9 A;  3T2Q A;  3HNY M;  3FHA A;  5C71 A;  2W1S A;  4BJ0 A;  1JI6 A;  2EIE A;  1JYW A;  1DLC A;  4DXR A;  2WZ8 A;  3E1F 1;  1UWW A;  4ZXE A;  4A41 A;  3C8X A;  4IUG A;  2J1T A;  3K77 A;  1GOH A;  3WNK A;  1CZS A;  2JDA A;  3P6B A;  3THD A;  4KWU A;  2Z4F A;  4AAX A;  4XUN A;  3WNM A;  2V4V A;  3MUY 1;  3PUI A;  4PT6 A;  2W95 A;  2DDU A;  2BZD A;  2EIC A;  3I3B A;  2Y6H A;  4JKK A;  4CU8 A;  2Y8K A;  2ZXQ A;  3WF3 A;  2RVA A;  1JZ3 A;  4UI9 L;  3SKV A;  4A4A A;  5J1X A;  5JMO A;  1BHG A;  3ETP A;  2CDP A;  2WAO A;  2VMF A;  2W1Q A;  3A23 A;  3MUZ 1;  1JYN A;  1HN1 A;  2EID A;  3NRU A;  4LKS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...