4LIUA

Structure of ycfd, a ribosomal oxygenase from escherichia coli.
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
373
structure length
360
Chain Sequence
MEYQLTLNWPDFLERHWQKRPVVLKRGFNNFIDPISPDELAGLAMESEVDSRLVSHQDGKWQVSHGPFESYDHLGETNWSLLVQAVNHWHEPTAALMRPFRELPDWRIDDLMISFSVPGGGVGPHLDQYDVFIIQGTGRRRWRVGEKLVDPFEAIIDEELEPGDILYIPPGFPHEGYALENAMNYSVGFRAPNTRELISGFADYVLQRELGGNYYSDPDVPPRAHPADVLPQEMDKLREMMLELINQPEHFKQWFGEFISQSRHELDIAPPEPPYQPDEIYDALKQGEVLVRLGGLRVLRIGDDVYANGEKIDSPHRPALDALASNIALTAENFGDALEDPSFLAMLAALVNSGYWFFEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords 50S ribosomal protein L16 arginine hydroxylase
publication title Ribosomal oxygenases are structurally conserved from prokaryotes to humans.
pubmed doi rcsb
source organism Escherichia coli
total genus 84
structure length 360
sequence length 373
ec nomenclature ec 1.14.11.47: [50S ribosomal protein L16]-arginine 3-hydroxylase.
pdb deposition date 2013-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08007 Cupin_4 Cupin superfamily protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2510 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4liuA02
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 4liuA01
4Y3OA 3K3NA 5FYHA 5FZ0A 4GJZA 4QWNA 4Y4RA 4Y33A 5FZHA 3OPWA 2YU1A 3AL6A 5FJHA 5FUNA 5FWJA 2W2IA 5FYMA 4CCNA 2P5BA 5A1LA 3AL5A 5FZKA 3KV5A 3ZLIA 5FY4A 5FUPA 5FZEA 3PU3A 2VD7A 2OQ7A 5FZOA 2XUEA 5FXWA 5FYZA 3OPTA 2GP3A 3LD8A 5F5IA 5FP7A 4D6SA 4LITA 4V2VA 5A7WB 4GJYA 5K4LA 4UF0B 4BU2A 2OS2A 5F3IA 5F32A 5IVVA 5FZBA 3DXUA 5FZ1A 4QX8A 5LW9A 3PURA 5A7PA 5IVJA 4HONA 4BXFA 5FYYA 4LIUA 3U4SA 4CCKA 3KV4A 2WWJA 5F5AA 3KV6A 5FZMA 4EYUA 4GAZA 5FYIA 4EZ4A 5FZ7A 5A7NA 3K2OA 5FYTA 4HOOA 3N9OA 4D6RA 2YPDA 5FJKA 1VRBA 4QXBA 4IGOA 5FZIA 2WWUA 5LY1A 5A80A 3KV9A 2XDVA 4QX7A 5FYCA 3PUQA 5A3TA 5FY0A 4D6QA 4CSWA 5F5CA 3N9LA 4BISA 4E4HA 5KR7A 5A3WA 5ISLA 4CCJA 5FP8A 3PUSA 3AVRA 4CUGA 5IVFA 3N9PA 5A7OA 3ZPOA 5FWEA 5F37A 5IWFA 3U78A 5A3NA 5IVBA 4CCLA 4IGQA 4LXLA 5FY8A 5FZ8A 2YBPA 5FYVA 4DIQA 5FZ9A 4URAA 3NJYA 5FYBA 5FZDA 5FY9A 2GP5A 5LY2A 2XMLA 4NUBA 5FPUA 2PXJA 5ANQA 4C8DA 3KVAA 5FZCA 5IVEA 3DXTA 3RVHA 2YBSA 5FY7A 5FPVA 5FZ3A 4XDPA 3LDBA 3PU8A 5FYUA 5FY5A 3UYJA 5A7SA 5FP3A 5FPBA 5FZOB 4QXHA 5FP9A 5FYSA 5FPAA 5FV3A 5FZ6A 2Q8DA 4ASKA 5F2SA 4DO0A 4TN7A 4AAPA 2YU2A 5FXZA 4IGPA 3N9NA 3PTRB 2OX0A 4LIVA 5FZ4A 4CCMA 4QXCA 4AI9A 5IVYA 4CCOA 5A3PA 3AVSA 5CEHA 5FZLA 4EZHA 3N9MA 5FZAA 5FXVA 5F3GA 3K3OA 5FBJA 5A7WA 5FZGA 3KVBA 4UF0A 5IVCA 2XXZA 4GD4A 5LWBA 3N9QA 5FY1A 5IW0A 2Q8CA 5F39A 5FPLA 5E6HA 5FZFA 5A1FA 5A7QA 5FXXA 5FP4A 5F3EA 3PDQA 2OT7A 4QU1A 3PUAA 2Q8EA 5F3CA 2OQ6A 5F2WA 4V2WA 2YBKA 4XDOA
chains in the Genus database with same CATH superfamily
1YRNA 2WA4A 2QQPA 2W08A 1IXRC 3IAQA 2D1VA 4IHVA 4AYBN 4RB3C 1TNTA 1UIKA 3JB4C 1TWGJ 5EZHA 2XUEA 1RGSA 3MLLA 2QQ8A 3ETQA 3Q8AA 5JIUA 1T08B 1B9MA 1JZ4A 1SD4A 4AI0A 4NIDA 5F27A 2XJQA 2A68F 1HKQA 2VOVA 5FD5A 1AX0A 5CFCC 3QH6A 4M00A 4WBBA 4XRSG 1XDSA 4IEQA 1W36C 2JA2A 3AFGA 5LBEA 1GZCA 2XJSA 2E35A 1W6QB 2ATFA 3G73A 4BIFA 2JG9B 3POEA 5KHGA 3MYXA 3P9KA 4JRLA 2P37A 2EZLA 2ME0A 4ZC3A 1KDMA 3EQEA 4JDOA 4Y1VA 3LGRA 2ZGRA 5HV0A 1EJ9A 3CP8A 4FOQA 4IGPA 5D8KB 3HOVJ 3G7DA 2AQEA 3EYYA 4EZHA 1FV3A 3T4VA 4MGRA 2CQQA 2QGUA 5J3LA 3VOEA 2RS11 2M0MA 3INAA 2DBIA 4A41A 2CV0A 2H94A 1W6QA 5IPAA 4O9EA 4UYBA 2QQJA 3CJXA 3HRUA 4QMAA 3ACFA 2P5VA 1UO9A 1S0CA 2HKXA 2PHTA 4L0YB 3PJYA 2V26A 2WO3A 1GUUA 4MNUA 4NMIA 1XGOA 3POFA 4JX5A 1CAUB 2YMZA 5CFDB 1OOPC 3K2OA 3CJTB 4ZDPA 3R0RA 2DMTA 2VMFA 4RR3C 1OQ1A 1UFMA 4FP3A 2WZ8A 4K21A 3SISA 3OUHA 2AZ5A 3NRUA 2H6BA 4LFUA 3N9PA 2EK5A 5A7OA 1H2LA 3UNGC 1MMSA 4M3CE 3K1MA 4EWAA 3HRTA 2H09A 3CCEI 4CA9A 1YQAA 5BPXA 3Q0WA 2WDBA 1UWWA 1UD1A 1CAUA 5CKQA 3PO2J 2IGKA 2PLV3 1YWKA 5CFDA 2HEVF 2R92J 1RUC2 4CUAA 4Q2FA 4FETA 2GDFA 3NJZA 3SQNA 4LMYA 3D8CA 3AVSA 3H8UA 5IOYA 4GWMA 4P9XA 5ACA3 3F8FA 3BODA 3H8OA 2HYJA 4M3DA 3JBG3 4QD2A 2Z42A 3M7GA 1RUF2 4OI0A 4L18B 3U75A 2KMUA 4M0HA 4L5IA 1XNAA 1F4HA 1T98A 1WCKA 1C8NA 3TN91 3MLJA 2W92A 3EUAA 2JQ7A 4XDOA 2EH3A 4Q26A 2JDMA 1S8NA 2IPQX 3ZMUA 5FY4A 1K4SA 1UZVA 4HVRA 3LFUA 4PIZA 1IV8A 3CMGA 2AYHA 5J3UA 4A6SA 2VBPA 2ZA9A 2FOWA 3GBGA 5I0TA 3K10A 5HXVA 2QYOA 2ET7A 4PGGA 3Q8BA 4XF3A 5EJCA 3WDYA 1B9NA 4HA8A 5C33A 5GZDA 3ZR8X 4ARYA 1WW5A 4DXRA 3DTKA 2LTNA 2GNMA 2R063 2RVAA 3HEFA 3BOQA 1X9TA 3HHHA 4UFIA 1XS9A 3HC7A 3CCMI 4YIIA 3ITQA 1MJBA 2DCJA 3MIFA 5F37A 1V4RA 1ZAOA 2HWF2 2P3JA 4XK4A 3S5AA 3U10A 2DUQA 5FBZA 1UKRA 4XW3A 1MBGA 1HSJA 1R091 2W85A 3ERED 2JB8A 5CIRA 2A05A 2XV4S 1RNLA 2OW4A 4ZU7A 2IXLA 3WF4A 4JCKA 2JIGA 1YJ9I 1GV2A 3ZFGC 4HVOA 1QQP3 2OPWA 1X8EA 3IZOA 3JCIA 4FPYA 4ZXEA 2FA5A 2YX7A 2VZ1A 4LKDA 4B29A 3TYJA 3CUQB 1VBD1 3DKYA 3GALA 1RXGA 5IK7A 2Q2EB 4DBRA 3WCSA 1G3YA 4XSZF 4ENNA 5FYHA 1AL23 4HMZA 4RQPC 3HSEA 1RUI3 2P5BA 4NHYA 1PGL2 1WLDA 5AONA 3GZ5A 3U1KA 3SEPA 3ZQFA 5FPXA 4AI3A 2Y38A 3T1MA 3F23A 2KR2A 2XJVA 3AB0A 1UMQA 4I7HA 1D0GA 1XDUA 5JSPA 2KKOA 1QHDA 1D1AA 2ACJA 2MEV2 4AHXA 1OH3A 3TEYA 2QKLB 5B3SH 1LEMA 3LB9A 2CMPA 5CISA 2Q2EA 3BR2A 4RGXA 3ML6A 2MW8A 2Z4FA 3AZXA 3U37A 1UZCA 4FPOB 2L54A 2CS3A 5FK7A 1RYYA 4XMIA 4U88A 3FISA 1J84A 3J81K 4GH4A 4QGMA 1QH7A 2G9ZA 5GZEA 1QDCA 4EN9B 2ECBA 2ZGOA 4FP2A 4Z07A 2MGQA 1QJX1 3I2DA 1NY71 2H0VA 1I3AA 3PIGA 2VN2A 4ESBA 1HIXA 1F4KA 4XCBA 5ICEA 5CYVA 4LO8A 4Q4V1 2XG3A 2QZ3A 3IM0A 3BCBA 2QSHX 3MFKA 2ZKNA 1K6OA 2D2WA 5HI0A 1JYVA 4A3JJ 2LREA 4OAYA 2IFRA 4QWNA 1FJLA 2RJ2A 5E1WA 2OD5A 4HBNA 3SZTA 1OYWA 3CJNA 2XBO2 5DAWA 4M3BA 2KDZA 3U4XA 2FQPA 2Q0OA 1FOD1 1REFA 3T2OA 3H9GA 1G9FA 3UKTA 3ZMTA 1VMJA 2ZBJA 2LM3A 4C3JJ 4CP9B 5A1AA 2HTSA 2ZX4A 2VONA 2J1AA 4BQYA 4P08A 4XKCA 1BMV2 3Q9SA 2EFNA 2JWTA 4IVNA 4BISA 2XVKA 1UZYA 3BCWA 3G6JB 1VQKI 3B73A 1S6LA 1E57A 2EAKA 3ZFFC 2B9SA 2Y8KA 3PNVA 4AL9A 2FDFA 4QDSA 3BDDA 1GWKA 1HSTA 2OUJA 1DFQA 3FXOA 2DVFA 4KNCA 1A8MA 1IS6A 4BMBA 1UELB 3K75B 3I53A 2GNDA 1VBC2 2R7DA 3ECHA 2VC9A 4CP9A 2WLPA 4UBHA 5FPAA 4Z2AA 1XJAA 2HOEA 4TN7A 1DYKA 4JGYC 4DQAA 1YO5C 5FQ0A 1WMXA 3IKVA 3TOJA 1ZM1A 2RAEA 4RS8A 2E36A 2QUOA 1ND3B 2RMU1 2BXZA 3ECQA 3BZ6A 1LE8A 1SMYF 3TGNA 5F3EA 3DPUA 1MR5A 1MMNA 3VBUC 2DVDA 2BHZA 1Z7S1 3H92A 5FPZA 2R7EB 3GF2A 3LSKA 5AVAA 2VMEA 5FJHA 1U6GA 1EP0A 3CUOA 4XN0A 1YHFA 3G6EI 2DFIA 2ZGUA 1F9KA 3PJRA 4Q5OA 2W7NA 2MD5A 3SLIA 4XUOA 4KMQA 3ZN4A 3GTLJ 4BJ0A 1FIAA 2OPTA 3T8RA 3RYRA 4GMP0 3J9SA 1N1VA 4FASD 1DGRN 3ZQLA 2P7VB 2R5ZB 2AEZA 1YQ2A 4QGNA 1O3TA 1MH3A 3CHXA 5ABJB 3ZSKA 1WA6X 4HSTA 1G8WA 4IL7A 2FHRA 3ZPOA 1UHSA 3BOWA 1S5LC 5ANQA 2IXSA 3KQRA 1B1BA 2CAUA 5J09A 3O1PA 3RVHA 1O59A 1LHVA 2EIGA 2ISYA 3NAPC 1BEV2 3RKYA 4MIMA 3M3CA 3NEUA 4NHLA 3OSGA 3RZOJ 4HRIA 4Q0UA 5ABJA 2PTMA 5L36A 3QRFF 2NS8A 4NC8A 3N9QA 3JAMZ 2CRGA 2PLV2 1PDNC 4Q29A 5KXDA 4CUCA 2EIKH 3ZXFA 2Q8EA 2VI6A 5FKBA 1PGW2 5L3CA 1TMF1 2RS13 2HOSA 1AR81 1JT6A 4XAEA 3ZQGA 3VV1A 2Y0MA 1ZGJA 2A6YA 3AL0C 2OQ7A 4R9CA 4DOZA 5GPAA 1TNSA 1EUTA 3HKZN 4BHBA 3VDDC 3GEZA 2HEYF 2ZO4A 1A78A 4IEXA 1MBFA 1BI2A 4CDGA 4ZHNA 4LEJA 1ZA7A 2W1WA 1P7IA 3O5SA 4PLMA 1QDOA 2WA3A 1JKOC 5FYTA 2EIJH 3J7ZI 2GC0A 4P1WA 1RR8C 1JTZX 1XNDA 3R4DB 4QPGC 4JDMA 2X09A 2Z5UA 2P4EA 3CP2A 4PI2A 3EDPA 3TNQA 1ITYA 1WCDJ 1MNMC 3Q8CA 1HKDA 5IWFA 3ZYPA 1DGWA 2WRAA 4JX4A 1C1FA 1V70A 1HRV2 2DW4A 4H2AA 1FYLA 3IIIA 3WINE 2GAUA 3QYEA 1VAMA 1DU6A 1VB4A 4HNVA 2ZJQF 1QBJA 2X51A 1ZVFA 5DDJ1 1XBFA 2WNOA 2WV0A 4GFBA 2CUJA 2LFBA 3V7RA 1QH6A 2ZGMA 4HLTA 2A75A 5M0TA 1ASJ1 2C9AA 2X10A 3N4MA 2HYGD 5LEKA 4BKXA 4F52A 1O3SA 3PUHA 5C9AB 1VLNA 4Y4YA 1YJNI 3O8GA 1IRGA 4E7HA 1QQP2 5IAXA 3CCVI 2VKEA 4II2A 4GJZA 3VHOA 2XAUA 3A23A 1UYXA 2GH2A 2ZXJA 4CCNA 4P96A 3TN93 1W0UA 3CLOA 3LOBA 1XU2A 1JE8A 3GZEA 1LOFC 1PM7A 5E1ZB 1FSEA 4Y1ZA 2BOLA 2Y64A 4E6KG 5FKKA 1IQDC 3B93A 5A7NA 1QWRA 3ABTA 3LQQA 1UY2A 2IVJA 3I56I 4C1WA 1OUXA 3JRCA 2VPRA 1V54H 3WX5A 4AVVA 5A2QZ 3BQZA 2VUMJ 5FYVA 2G7UA 4IO9F 2ZMEB 2PI0A 3N7JA 1SFOJ 3FBIB 4BLJA 1Z21A 3PLQA 4XUTA 3JTGA 2FBEA 4UFHA 1MBKA 4WXCA 1OFNA 3S2HJ 5KCMA 2VZRA 2W57A 1G4DA 1R093 2M5WA 3LIGA 3KLOA 4HKOA 4ANJA 3KYCB 4IE0A 3LA7A 2M9HA 3UKGA 1SBEA 1OR7A 3NVCA 4CXXA 4I01A 1TWHJ 5HDGA 1S29A 4UV8A 3K77A 1OF3A 3WQBA 2R7ZJ 1VE0A 1DHKB 2G4IA 2ZMEA 4C90A 2PYTA 1MS5A 3P5BA 1VBD3 3S3OA 3E1F1 2L7FP 3BTAA 3JRDA 4WK8F 2P3IA 3JXSA 4YWAA 2DYCA 3J80K 2WO1A 5DUXA 1CGPA 4ES8A 4B7KA 1X1PA 4XF0A 1SMTA 4UUVA 2ZSIB 4UW4A 2E1MB 5FYIA 4B44A 3HMYA 4BS9A 3S3MA 1OPMA 2VQCA 2NVQJ 1MS3A 3D5LA 3RSNA 1JUMA 1RIOH 5FKLA 2R30A 5JZGC 3PUQA 3I3BA 3LOCA 2R073 5A3WA 3DU5A 3WODF 1K7AA 5DUWA 2VVEA 4OI4A 3VBRC 3LSTA 5C7GA 3TOAA 2KL4A 2CY6A 4ZYHA 1Q8VA 1R00A 3VDAA 2LS6A 1LFPA 5IFPA 3RZGA 4QT6A 1W8WA 1AHSA 1BJZA 3ZMDA 4LMFA 5LFAA 3H9AA 2R7FA 1LKXA 3NNGA 2E2JJ 3WHBA 4A3MJ 1U78A 3O7OA 4QHOA 4AE2A 2YXSA 1RITA 1CPMA 3H5AA 5DM6F 1D4M1 4DFSA 1X58A 2BY1A 1NE6A 1QJX3 2IS4A 1K3IA 2PHLA 1ONVA 1UG0A 3OGVA 5K7ZA 1HW2A 5F04A 2M34A 3HL2A 1YCIA 5FO7B 4Q4V3 3S1RJ 3EETA 4Y4RA 1FV2A 1LKNA 3AL6A 1IS5A 2ZHLA 1I5ZA 2ZNYA 5DUUA 2OBPA 4NVPA 4MUVA 1RL3A 5FLXK 1UYYA 1KA8A 3UJOA 2P6TA 2YPRA 1Y1VJ 1ETXA 3U4SA 4AXOA 4E70A 1FOD3 3I3LA 3DYOA 4TYSA 3ZOBA 4U0WA 1W0PA 3N35A 1ZQ3P 3WP4A 2WSVA 2W82A 3IPVA 4S05A 2VZ3A 1SEUA 3A7QA 2GMMA 1HV0A 1TBXA 5E1XA 1XMAA 4RDUA 1WLTA 1C5IA 4MGTA 3ZQHA 5KC6A 4LBNA 5IYDJ 4MGZE 2FDIA 2RS51 2R0FA 1K4TA 3MF6A 1R1UA 2KISA 1GDTA 1XE7A 1K45A 3OD4A 4QDQA 4K3UA 4NIAA 3OD0A 2PHWA 2ZXHA 5FOBB 5A32B 2HQ5A 5IT3A 2LD5A 1GP4A 3PU8A 4N43A 3GWZA 4FOVA 1OD5A 2M7AA 4FPFA 1I50J 2XAGA 3V7SA 4QXCA 4LO4B 3KP2A 4BQ3A 2A6EF 4DZPA 3MEXA 3R0JA 4DBQA 4WM7B 1YFHA 4Z82A 1JGSA 2XPWA 1PUEE 2GALA 3WE2A 4HETA 3HOZJ 4A3LJ 3NMBA 3VKMA 1CF7B 3KHCA 3CNAA 1B09A 3CC2I 1LU1A 2YB7A 2RMU3 4URTA 5CVVA 4P9UA 4R4ZA 1NG6A 1W8OA 5A32A 3LSDA 2CNAA 3AZVA 1Z7S3 4CXFA 4MQ9F 5C3QA 1AR61 3ASOH 4LITA 4P9FA 3NAUA 2VXZA 4R52A 3VBSC 1YS6A 2VE8A 2I8DA 2JK3A 4C3IJ 4EYUA 1H2NA 4AQSA 4MFDA 2D5HA 2BXYA 5EIYB 2QQIA 4U7BA 4L97A 5CKTA 4BXSV 3CD6I 1CF7A 1T33A 1H6YA 1OT5A 1MNDA 2BJSA 1ZKGA 5GAGJ 4Q0VA 2M0CA 2XLGA 4HX7A 5GALA 1D5YA 2IAIA 1U5YA 3NQOA 5DMYA 1OYIA 2N8GA 1PK6A 2VCMA 4JDNA 5GP9A 5ERIA 2IA1A 1RMU2 2LTPA 5IVEA 2RM22 1UU5A 2ADUA 3H1WA 2ORXA 1OLRA 5D21A 3AXDA 1NA1C 1H1AA 3ZXGA 5IVYA 3UGGA 1DDLA 3WU2C 2NOJB 2FBKA 5GZFA 3F8CA 1XB9A 2VL8A 4LLFA 5LWBA 4QQLA 2QUFA 3IL2A 4MGQA 1M4WA 3SKVA 3ABZA 3C7EA 1S2EA 1TW2A 3E0JB 1IG7A 3L7WA 2DURA 2JDAA 3U0ZA 1IG0A 1JZ3A 1TMF3 1RINA 3V4GA 1WW7A 5J1YA 3HOSA 1HRI1 1RXFA 3A2KA 4YVWB 3KYDB 4QPWA 4J6GA 3E6DA 1P7JA 3BC8A 2TRTA 1S0IA 1MNEA 3GTPJ 2QQLA 5JR3A 5I93A 3W6VA 3QU6A 3RI4A 3TN92 3K4BA 2VGDA 3LKJA 2CUEA 3LAPA 1FWZA 3TNPB 4OUSA 4DZJA 3M07A 1U5ZA 5EG0B 4E4HA 3AKRA 3VL9A 4QPIB 2VCCA 3NNLA 3NWSA 3FJSA 4AG4A 1K83J 5FK8A 1AR72 1XNBA 4CDUB 3IDCB 2WYSA 3ESWB 4YVWA 1MJ9A 4AQ2A 5LRRA 2CU7A 3CDHA 3ZSMA 4LTAA 1WA4A 4IF4A 4XFGA 2ZGTA 5A7SA 1AR91 3CZ6A 4I02A 4CYCB 3DYMA 2AC1A 4N7UA 3VHRA 3WG1A 2D6NA 3HTUA 4C1XA 1JYIA 3UKNA 4AF9A 1DPUA 3OYWB 1H1MA 5EG0A 5DDJ3 1UYPA 4QPIA 1TME2 3VKFC 2DOFA 1A35A 1ASJ3 1KEXA 5A6ZA 1R22A 2ZX1A 4CDUA 1CD3G 2R042 4FPKA 2J1TA 3KEQA 1VNDA 2OVUA 4JYKA 4PQ9A 2WZPP 1H89C 4NB5A 5FRMA 2P1BA 3HOUJ 5FZKA 3PSFA 2VUJA 4LKFA 4ZU4A 4CYCA 4P5YA 2YDEA 3W2WA 4YVSC 3L2VA 3W5NA 3PNAA 1R082 3CQOA 3H42B 1FX5A 2R7XA 4ZZLA 3OYWA 3BOPA 5A70A 1SANA 5E18F 2BYVE 2DCYA 3MN2A 1TEIA 2M45A 2B39A 2CSGA 2KZGA 3LEMA 2EIMH 3D5OA 4F7ZA 1O5LA 4Y26A 3I4IA 2QF7A 3WY6A 1AX2A 3H3ZA 4CDXB 1XOYA 2MLKA 3LEKA 2Q30A 1VQ6I 2FEZA 4K7JA 4OU0A 3ZPYA 1GNZA 1ZREA 3CDLA 4ESJA 4BHCA 1BA5A 4XEZA 3VZNA 2JE8A 5EV7A 5IYCJ 1I6HJ 1LCLA 3M4FA 4HT1T 1QY4A 1OBNA 1C28A 4BWOA 5ED4A 4RA2A 3OGGA 4XETA 3PUIA 2KJBA 4D8MA 3RTRA 3PIPF 4L11A 2WIIB 1WPKA 5CNAA 2F4IA 1SAXA 2EFOA 4CDXA 1GP5A 2XR4A 2SBAA 5K0UB 2PEXA 2F4OB 3SCFA 3JRAA 2R49A 5E3NA 4F91B 3ME2A 4FT8A 1OC1A 4E4ZA 5GLZA 3CO2A 5ANNA 3O0VA 1MEC1 2EV5A 4YZ4A 2OZ6A 1QJX2 1OPOA 3F2ZA 5M5XJ 4MOAA 3KT7A 3O14A 4O6JA 3S3NA 4YM0A 3WOGA 3M8FA 4ZU5A 2UWMA 2DYRH 4FFIA 1LQ1A 2CFOA 2XGEA 1GZ9A 1BJQA 2P7CB 5EPAA 4IEWA 1CQ9A 4M01A 3QP6A 4B7EA 4PGHA 1X2NA 1WBFA 4HOOA 2CQKA 4CP0A 5K0UA 4JX0A 1UQXA 4HDUA 4BQQA 1YFXA 3O1TA 3KGLA 3ZPLA 3OYMA 2XWJB 1IKPA 4AI2A 4Q1PA 5LY2A 4A5MA 2LY9A 2YUEA 3BLYA 1U5XA 2PXJA 4LLLA 3W21A 4AHYA 1WVRA 3KE2A 3L2CA 1QOTA 3P3PA 4MTEA 2IXHA 4U2AA 4ASKA 1A04A 4YG6A 4HXCA 4UNOA 4IE4A 5CFCB 2WNVA 2BU9A 3WG2A 4X8PA 2V6CA 1FBUA 2O8XA 1D4M3 4NOTA 3WF0A 4PF1A 2IFWA 4AU7A 5J98B 3ZN5A 5C8CC 2VUDA 2GNBA 1MBEA 4P9WA 5IUQA 1JUSA 4XILA 2QDNA 4FFFA 3HOYJ 4A7KA 1UZZA 4UVAA 4FTSA 2Z3YA 1IRXA 1X3WB 4S0HB 2O9LA 3W6KB 3LIHA 1LHNA 1YQ5A 1AYN1 4BACA 3OYAA 1JKQC 1QJZA 2BZDA 3J8F1 4UVCA 3TO6A 3AXEA 3H3UA 3F72A 2QKDA 3P1IA 5A33B 2ZX2A 5KR7A 2H0BA 2CV1A 2O0YA 4Y5Z0 1R1A2 3PMEA 1A6IA 3O8HA 3EXUA 3REOA 2MHFA 3OYCA 3GJBA 2P81A 3UT0A 2RS53 1H8VA 4XLNF 3IDEA 2D44A 4DQ2A 5FY5A 3OR1C 2VTXJ 4XOPA 3NWTA 5FB2A 2O14A 3QPLA 3WNOA 1T2KA 1WJDA 5A33A 1FPQA 1RUG1 3HOBA 4FCAA 3T2QA 4XAAA 4LHSA 4G6TB 4RR3B 1EH7A 1SFUA 1VTNC 2CGNA 3Q8EA 3AG4H 4P9IA 3AKQA 2HQRA 2BZTA 3CO6C 1PZ8A 2RS31 3OL4A 3M9AA 4XBFA 2HWC1 3BU7A 3RJRA 3TBDA 3KT1A 1ZH5A 1ZBA2 1QOOA 3WNNA 1PNGA 1VALA 3I5UA 3S7EA 4Q4W2 4N90A 2A6TA 2DAOA 3ISPA 3OYEA 3DXUA 4AYUA 3CCRI 1AR63 4IHTA 5T3NA 3FBYA 2R7VA 4HZFA 2ZMNA 2W94A 4WVVA 3GMEA 1IUFA 2OUHA 5HDNA 1URXA 3VEPA 5BNGA 1AR82 5A3TA 4UUTA 1FMD1 1AJKA 1QIQA 4LHLA 4AQ6A 4CCCA 3SDGA 1GKBA 3K4KA 2JUGA 3UGHA 2YX4A 1REPC 2J1VA 4KWJA 3VZOA 2IJLA 4I2OA 2XJPA 1H9TA 4CGZA 1TLHB 1JT0A 2GC2A 4OZOA 5HS9A 2B9UA 5A3UA 2ELJA 1UY1A 3ZX7A 3NV1A 4BIOA 2LVSA 2Q5TA 3SFZA 2FDHA 5C6CA 1PM4A 4FPJA 4G7OF 3JSPA 5CZKA 4RM2A 4E7KA 4N4OB 3S17J 2QQBA 4TV7A 4ABZA 1OVPA 5FPLA 3WV6A 4P9JA 1BR4A 3T0BA 2E9QA 2JKBA 3GHNA 2F5EA 4JKLA 1UHWA 1K78B 1E5HA 5JXGA 3LD8A 4PT6A 4NWWA 4KL1A 2XSDC 4A12A 3H5RA 1E5RA 1W6PA 1F4AA 4HF2A 3KT4A 4Q1RA 1Q3EA 3IWFA 3OSFA 3H3VK 4LBMA 5LZ6A 2ESHA 1D1BA 1X1CA 1HRI3 3BB6A 3KCXA 2ZFWA 3ZFGB 1GOHA 3F21A 3PVNA 5F08A 3KZ4C 5T55A 2ISZA 5BPDA 1GYKA 3JD71 3OF1A 1YITI 4GH4C 4LNVA 3VKNA 3WHUA 1K78A 1EH8A 4XBLA 5BNPB 4URAA 2WN3A 2GZWA 2OTLI 2BBVA 2PLYA 1U3EM 4TLFA 5HLTA 3CMEI 1XCVA 2QQAA 2XB0X 1HB1A 2JD9A 1POGA 4BCUA 4WVWA 2Y6FA 3PUFA 4TTGA 5FP3A 1AOYA 3ZFGA 1Q8QA 2ZXIA 3SZPA 1X19A 5CAZA 4CRQA 2BVBA 2GMEA 4CU6A 4FCYA 4ZONA 1AR93 3BPZA 1J09A 2P17A 5I0UA 3FKIJ 2R1BA 1IHMA 3M3OA 3I59B 3Q5FA 1PMJX 3BR6A 3M8LA 2HXOA 1XE0A 1DQ5A 5FMDA 5BNPA 3FFZA 2WL1A 4Q4ZF 3BR5A 3ZFEB 2IP2A 4LBOA 2YSRA 1QQIA 2Z1DA 4MO7A 1LOEA 3V0BB 5DCMB 2W68A 2CFXA 5EJZB 3QPTA 4B3XA 4BU2A 1P8JA 1HKSA 3K51A 2P6SA 3TWIA 1WCMJ 1ZRDA 1C57A 1UJ8A 5FIXA 3KV4A 2VNGA 2ZMLA 5J1XA 1W28A 1D1CA 3I59A 1W9SA 1R58A 5HNHA 3HPGA 5KHJA 5FZIA 1A34A 3QAHA 3IHUA 1PMIA 4H0EA 3OJBA 1JTYA 1COV1 2BW8A 3J26N 2GA1A 5CVIA 3ZFEA 4LBQB 2AREA 5C3EJ 2OA4A 2PHDA 3ECOA 2L9SA 4IE5A 3X29B 2XASA 5HV4A 5FTTC 1ZLJA 5KVRA 5DCMA 1OQEA 4NUBA 5IP9J 4W1UA 3KYLA 2VZVA 3OUIA 5ILSA 2MLGA 2CGPA 3O0WA 4OHVA 1J58A 2B63J 1EAH1 3M3YJ 1XGNA 1VP6A 3O3KA 2PJRB 2YC2A 3HBLA 1E5IA 4JOMA 3JU9A 3QD6A 2XHKA 4UI9L 1SD5A 4WCGA 5A7WA 4A2UA 4HPKB 1W7PB 1EV7A 2IGNA 4CEYC 3TEZA 2Q8CA 2W4SA 4LBQA 3GZAA 4Y1UA 5FXXA 2Y33A 4ZYGA 5E8GA 2YG0A 1TZOA 5H9PA 2JA7J 3QPSA 2DTYA 2YU1A 5DXDA 3T4HB 5E16A 1Z77A 1L3LA 1Y3TA 3MKZA 2HPMA 3ZYBA 4MVTA 1D4M2 1PUFB 1MEC3 3JUUA 2YS9A 2PJRA 5DG2A 3AMQA 3K48A 1O5UA 4Y7NJ 1N78A 2W1UA 5FO8B 3HSRA 2C6SA 1W7PA 4EM1A 3P9CA 4COUA 1V6IA 5CG8A 3E6MA 1I3HA 1A6CA 2AUYA 2QCOA 1OPCA 3HPHA 1MZBA 1N3QA 5D6EA 2WT1A 4NHMA 5FCCA 3A4CA 4LORA 2Q0AA 4PSWA 5H9RA 3DL3A 4LE4A 1ZBE1 3HIFA 3VBUB 4AK3A 3SDBA 1W05A 1XC6A 1S9HA 1YX5A 4LUKA 1ETWA 2HXIA 3WQ0A 2YBPA 5JI9A 1SPPB 1F36A 1Q8OA 4B48A 1PUFA 4OIOF 2MNGA 2WNUC 2DTRA 4KUMA 2FQ3A 1PO11 2DQRA 3DXTA 1B72B 3OBAA 4XIOA 2LBFB 2FCUA 3A0BC 4XLAA 1OF4A 3MZHA 2AXTC 3SJMA 2I07B 2DT5A 3D4KA 4LKEA 1F9NA 5F0FA 1C4RA 2X85A 3MZ8A 3JQXA 2DT6A 5C3SA 4KWLA 5HNFA 2KHMA 3ZYFA 5IJRA 4RHV1 1STZA 3ERMA 5GTIC 2O61A 1FOXA 4LT5A 4EJVA 4IX7A 1SPPA 1K5JA 5DEQA 4AW7A 1X33A 2OYZA 4R79A 1X1BA 2RN7A 3LA3A 3T0DA 3E5XA 2VE9A 1LOCA 1PHMA 1WLCA 2WWSA 1B72A 4BK5A 4CU8A 2LBFA 3VB2A 3VD5A 2Z79A 5F1RA 2E33A 1JUPA 2OCEA 1RUD1 2PQSA 1VRH2 1J3PA 3MIGA 4K8RB 5B5EC 2L02A 3IH4A 3NAPB 3OEBA 3RCOA 4BA6A 3LNQA 5BNQA 2YFZA 3HN1A 1WJ5A 2BVLA 2L5QA 3TO9A 4FO9A 2VW2A 5FD6A 1MH4A 1CR7A 2EFWA 4UV9A 1JZ6A 2XAFA 1AYN3 1TWAJ 2XUMA 2XL9A 2DA3A 3HBZA 4IERA 2RR12 5ISLA 3J8F3 4N7IA 2IVIB 2CDPA 1AXKA 1W90A 1EKEA 5ICFA 1VPHA 2VJIA 2RVCA 4MV2A 3ALQA 3N97A 4LOCA 1UOJA 2VNOA 2LF7A 1H8AC 2V1NA 2YUSA 1UOBA 2WB1A 1ODMA 4B47A 4FQGA 1MS8A 4YYOA 4IRIA 4LOSA 3VDDB 2HH9A 1YOVB 5B1BH 1MW7A 4AAXA 4EJTA 3JRIA 1VQ7I 4AEMA 1ODDA 3WLUA 1Y8RB 2ID3A 5K1YA 2WZR1 4M73A 4XYXA 1QGPA 4AFMA 1ENSA 2XHNA 5JR2A 4D9JA 1S0DA 4XABA 2Q8KA 1RUG3 3BP8A 1TL8A 3HOTA 2FF4A 2FDGA 3V8KA 2HZTA 2UXNA 4YM3A 2K4JA 4Z92B 4GQ7A 1PVXA 2IXIA 4XFIA 1DZTA 4XF4A 4AWDA 4NC7A 3CF2A 2RS33 4JQFA 5JPMB 2VB6A 3PNYA 3CCUI 3WR0A 5J4VA 4QPOA 3TBIA 4BDVB 1Q56A 2HWC3 1Y39A 4CCKA 3TEDA 1KU2A 4AVAA 1OMIA 4PUSA 2G7HA 2M4KA 3AMPA 2O6GE 3PMSA 5C4JJ 1UIJA 3MI8A 3MPPG 1YNAA 4PDKA 1GFF2 1HQWA 5FLMJ 3LL7A 5BS6A 1XNKA 1W03A 3A4UA 4DXTA 1WZ2A 2HQAA 4YFNF 3IT8A 2VT3A 4D5FA 3RQ0A 5FFOC 4LO7A 4PI0A 2J1EA 1QF3A 4XOTA 1FMD3 2Y0OA 2JDZA 5JLXA 3WP5A 2WFF2 3MW3A 3OYIA 3AYAA 3FXKA 1Z6TA 1MACA 4HAMA 1RIRA 3VB9A 4BDZA 1RJ8A 1Y8QB 5FPVA 5LA0A 2FQ4A 3U1XA 1RUJ3 2KDOA 2PAEA 2WBKA 5DG1A 4M3EA 3WGHA 3IWZA 3DBRB 4BGDA 2VZQA 5DYMA 4JTOA 5E17F 3KVBA 3ZQIA 3HGYA 1YI9A 2WBMA 1BXHA 1DQ2A 1ZK8A 2CJJA 2CGOA 3S8PA 4CHUA 1PO21 1NLRA 4TXWA 2KFDA 1LOFA 4BY7J 1O3RA 4UXAA 4QKDA 1XYOA 1KJRA 4YW6A 4XQFA 2E2IJ 3WTYC 2NYXA 1EPWA 3JREA 4HNUA 4X0GA 2E32A 4AM3A 2EF6A 4FPCA 4EWEA 3KZZA 1VRBA 2VOTA 3B01A 2ZZQA 4DMIA 4U0YA 4KITB 2UV1A 1UXZA 2EIBA 3GCMA 4GYIA 5FLJA 1DYPA 1W9WA 2E1MC 1VMFA 1ZGWA 4I76A 2P0WA 4AQTA 3FZ3A 1RETA 2E26A 1RVF2 3JD73 4Y1XA 1KQRA 3A21A 2IGOA 3HHGA 4N53C 2QDRA 3GTOJ 2KRCA 1R49A 3FHZA 3RDIA 3S2WA 1CAXB 5K9YA 3QYFA 1Q43A 1Z78A 5FYSA 2PBIA 3MIEA 4YZ5A 1AA7A 3MO4A 3JAMK 3MDPA 3C18A 1JZ5A 5JZGB 2LKSA 3FF5A 1LVKA 4O7XA 4EQQA 1EV11 5GLVA 4MX3A 2D98A 3R6SA 1HN0A 1GT0C 1GZWB 2EICA 5L73A 3LFKA 1X50A 1X3ZB 4YG3A 1UN1A 1CAXA 3DGTA 4ISRA 4KBBA 1ALYA 1E2XA 5K7PA 3S57A 3Q3SA 3BIWE 2WADA 3HUGB 3LQCA 1G9DA 3KMHA 1WWYA 4FTEA 5LW9A 1YLFA 3FLPA 4LIUA 4KNYA 4CP1A 1WJFA 4LR4A 3DKQA 1Y0UA 4HKWA 1F15A 1PIV2 3UKVA 1BQPA 2K9MA 1HDDC 3NNJA 2FSWA 1LJ9A 2ZHNA 2E5ZA 3SEQA 1QJU1 3ZP5A 2LSOA 3ACLA 4NJ4A 4O65A 4A0ZA 4A44A 4GWIA 1GZWA 3PQKA 2LK2A 1VBB1 2VU9A 2LRDA 1T6SA 4N43C 4BXUA 3L2WA 1COV3 1HXS2 4LLGF 3LSMA 1BR2A 1APLC 1WD3A 1WMDA 2YU3A 5ILVA 2JVHA 1ZR2A 2AXLA 3E97A 2I45A 4E7LA 3MV01 3OEAA 4LBKA 1YQ8A 3J4UH 4BBRJ 4CYDA 1QZYA 1W2AX 1S1AA 1EAH3 2WAQA 1JKRC 1N3PA 2EA4A 1HKTA 1MVEA 1D3YA 3NJXA 5CPRB 1S7OA 4D7TA 3CBNA 2GQQA 5FP4A 3PSIA 1SD6A 1Q1VA 2E1CA 3HNBM 3BPXA 1E17A 1SZBA 1ODNA 4C2UA 1ENRA 2RQQA 1BW5A 5B66C 5M3MJ 3BTCA 5IP6A 2F2EA 1F1ZA 1YHQI 4KMFA 2XLAA 1ON2A 3C7FA 3I2FA 5LBQA 1V5FA 1V3FA 4OUEA 5EEAA 2JKXA 4XACA 4Z1VA 3DEMA 4MQVA 5BQTA 1NOVA 2Y60A 1JUHA 1UL9A 4AWXB 1HXDA 2EWNA 1PK6C 5A2QK 2E71A 2K0GA 4IHSA 3CL1A 2VMGA 1LR5A 1DLLA 3QWLA 4J00A 1QA6A 5JOWA 4Q4X2 5T54A 4MGIE 3MVPA 1W9TA 2ARCA 2EA2A 1R23A 1ZBE3 3DYPA 1Z67A 3U21A 4D5CA 4J25A 3PQJA 3KF5A 4K9SA 5EP9A 4XFFA 3ZIXA 2ID6A 3JZVA 3VBSB 2CTVA 2R7TA 1DP7P 1TT0A 3KF3A 3BWGA 5FKCA 1QXRA 5D4RA 4KA4A 2LMDA 1DGWX 4PBPA 3PJQA 2GXBA 2JJ7A 1SLBA 3PUAA 3S15J 3BPSA 4RHV3 2Y6KA 4GB32 1IPKA 1CX4A 2XKPA 4AIJA 1V9U1 4CZSA 2GC1A 4EJUA 2F6CA 1FY7A 3PU3A 4YGBA 1RTVA 3POWA 4NRMA 2VIXA 4YW7A 1GWMA 1CZTA 5FZ1A 2YHJA 4E4SA 1R5GA 1NA1B 1RUD3 4E8CA 3FXLA 2WS91 3IUOA 3QQAA 1HX6A 1WMEA 2ID4A 1IRZA 1X36A 2WYFA 3F6OA 2VOOA 4OMDA 2WWUA 4JKMA 5FMOS 2VW1A 3OGJA 2E7WA 2ZJCA 2R7SA 1REEA 4P5HA 4QX3A 4YVWC 1AYM1 4JV4A 1I27A 2C4XA 1RESA 4KG8A 3UR3C 4C2MJ 4O61A 2DA2A 2WUHA 1BYHA 2W47A 3BJAA 1XU1A 3HM5A 4A93J 2JWPA 4QAWA 4BY1J 5GADJ 1BBT2 3IC7A 5KNLA 4A42A 2BV4A 3WVJA 3HQXA 5D4SA 4II3A 1DUXC 1NA1A 4QPIC 3L1PA 1HW1A 3WTZA 2EV0A 4ENJA 5FP9A 5HCHA 1W6NB 1BI3A 3RZMA 4XRFA 1LRHA 2ZAAA 4QB1A 2D6PA 1Q5OA 3FHNA 2A6VA 2LOOA 3OOPA 3H35A 1KXGA 3GLLA 2ZFUA 4E8DA 5IVCA 5FMOL 1T38A 3LSHA 2K4BA 1NLSA 3VL8A 2OT7A 1USTA 3S5QA 4V2WA 4OWRB 3K9TA 2K9QA 2A3SA 4MHGA 1IOAA 1NAEA 1BL0A 3OOUA 3GF6A 1W6NA 3GTJJ 2QVSB 1K12A 1H4HA 1CONA 4B4PA 1XE8A 2OS2A 4A3BJ 3PL8A 3K70C 1YIFA 2A61A 4ZPIA 1UZWA 4I0WB 2NZ9A 2GN3A 2ZAHA 3OS1A 4XURA 1XXNA 3GTGJ 5EEHA 1NT0A 3DCFA 3GHMA 1P6RA 4GO1A 3A03A 4D6QA 1IPSA 5BXXA 1A5JA 1U5TB 2L4AA 1WZXA 3CCSI 5FUIA 3KP3A 3CMMA 2GOMA 1C8M2 1UX7A 2OUMA 4JVAA 3OS0A 4F83A 5LA9A 1YLLA 4YVSB 1J2XA 3LSEA 2HDDA 2QQUA 4A3IJ 3ZXJA 2DT7B 4ORFA 2NP0A 1MPXA 3FUOA 3JD72 1QKQA 4XQWA 5DUKA 2EQRA 1YEWA 3DLLF 1YYVA 3WW2A 2KIQA 2YU9J 2X5IB 1U5TA 3CLQA 2PELA 4XM3A 2GLOA 1XCBA 4RAFA 2B8MA 4K6BA 3POIA 1ACIA 5DS9A 3V8LA 4ZZ5A 4C2TA 3K4LA 5JXHA 3VKLA 4HDVA 1EUUA 4B1RA 4OMYA 3BKZA 3B3QE 4FPEA 5EYRA 4X8NA 2VZUA 2BY2A 1OLQA 5A3MA 3WTXC 2HWB2 4YVSA 5LK7B 2Q1FA 2STWA 4WX9A 2FBHA 1PO23 2ZGPA 4YEJA 2OJED 1W6MA 2X29A 2QFEA 2JX9A 1FBQA 1YIPA 4OIQF 4QX8A 4HONA 2XQRA 4BXFA 3G1MA 4GAZA 2X5IA 1DCSA 2G1MA 2EAAA 1T0FA 2K27A 2Y6HA 2J1UA 2XROA 4NAOA 3OTFA 2QWWA 3VD9A 4IE7A 4RL7A 4OUMA 3I71A 4N0BA 2EA7A 2AENA 3HJEA 2D6KA 1DQ1A 2NNYA 2A69F 2E60A 4PLNA 1XGMA 1ZYBA 2OQRA 4XJUA 3E5QA 1SFYA 2QCSB 3DBHB 5ILUA 4YPJA 4XORA 3ZXSA 2WNVC 4BAYA 4PQQA 1NLQA 3O1OA 2DA6A 1F5JA 3M1HA 3AG3H 4S04A 1NXD1 3VHPA 2GWRA 5FZ6A 2DQLA 2A5ZA 4Q0PA 4E2GA 4NE9A 5T5PA 2K7LA 1Y6IA 2WT2A 1QNYA 3O1VA 1M1EB 4B8EA 1JOPA 1OVSA 4EM2A 5KXEA 4UHTA 2XXZA 5FY1A 4KJZA 3W6JB 2DODA 3LOIA 4XHBA 1WH5A 3H7JA 4BQ1A 1JKPC 1ZELA 2LG4A 1ST8A 4Y3OA 3VWBA 3K6GA 2RDSA 2DVAA 1W39A 5J40A 2WAOA 3NL1A 2PMZA 1EV13 2O3FA 2XOMA 2RQPA 4IEZA 2O8OA 2YZ4A 5FXWA 3LSGA 4E7SA 3FK7A 1OI6A 4Z8BA 1RKTA 3IB3A 3ZDSA 3LSIA 1OISA 3N7LA 2GIZA 3M70A 1YE9A 4A3GJ 3PIJA 2ZEYA 1W04A 5IATA 1PVC1 1BIAA 3IKTA 1UPIA 4EV0A 1KJLA 4FE4A 4KICA 2XJRA 2RKHA 6PAXA 1UMIA 5C8CB 4YW5A 1QJU3 1ETYA 3DF0A 2E34A 1LUJB 3MF9A 1FPN1 2PJPA 2D5VA 1Z05A 1WD4A 4E4DX 1LESA 1SMVA 3IN9A 1VBB3 1OLTA 1O8PA 1JYTA 5FFXA 3EUHA 4L9TA 1VBA3 2DDUA 1IKQA 1NZIA 4HLXA 4K20A 1Y9QA 3C2HA 5J48A 2M1BA 2VOPA 2NNNA 4BJ5C 3MKWB 2IXKA 2ZGSA 3WNPA 1J9IA 3VGIA 3LWFA 4ASMB 5LA1A 3BTXA 1ZBE2 3NQHA 4NPRA 2QBXA 1BHGA 3TMOA 3COAC 3FXQA 3A0HC 2HBUA 4PFOA 1N1TA 4QQOA 1JHFA 2HZDA 5C8CA 5JLWA 2ES3A 2V1UA 2X6OA 1PO12 2HWD2 1IF1A 4BL0B 2EFPA 1S0EA 1ZYRF 2J7MA 4XXPA 3LA2A 1D0HA 4RYDA 2RREA 3RNSA 1AVBA 3N05A 4ZS2A 3ABKH 4ENMA 2FE3A 4LE3A 5L3EA 3DTEA 4AVBA 4RBOA 3DQVC 2W46A 4XF1A 2PQQA 3HRSA 5L3BA 1BZWA 1MZFA 2A6ZA 1WI3A 5F32A 5FKOA 3A0NA 1GNHA 1QRYA 1JODA 2VW0A 3SKJE 5IT6A 2V73A 3GCXA 2HWE2 3U1DA 1BKZA 1AUYA 2ZJRF 2MABA 2P8TA 3MFCA 4D1QA 4NRQA 4B3AA 3I4NJ 4CE8A 1RUD2 4CUGA 1Z1DA 4XKWA 4DNYA 5IVFA 4UT5A 5F0HA 4FQ4A 1D7PM 3DKWA 4D0QA 2V09A 4JAAA 3AFKA 5FZ3A 1E5SA 5JWPA 4DGWB 1QJEA 3CTAA 2NS0A 1YUDA 3G1OA 1H9WA 2DK8A 3OBRA 1UMZA 1P2FA 2GSYA 2V72A 2JE7A 2ARAA 1YI2I 1SBDA 1FSHA 3K1PA 3V42A 2XPUA 4CZZA 3HB9A 1C1LA 3S16J 4UF0A 2LY1A 2DVGA 1H88C 1JTXA 2JDPA 5A7QA 2VMIA 3HR9A 3TO7A 4TSVA 3AZWA 1G86A 3ON7A 4BB3A 5CLSA 2BUKA 4XN3A 1C5HA 1FMVA 3LSRA 5FOJB 4MEYF 3BG7A 1NYWA 4AIHA 3I7DA 3IV5A 3TL4X 4CICA 5FUPA 4MADA 1NKGA 1JI8A 2LP0A 5CU1A 5IK5A 1V9U3 2WZR2 5AC92 1VB2A 3KS7A 2XVGA 3TP0A 3ABMH 4Q0SA 4XQ4A 4YRVA 2NVUB 1OKQA 1FNYA 1RUE3 4YW4A 1VFCA 1KD7A 4FAHA 2ZS6B 3P9IA 4KN4X 2PX9A 3CJIB 2HWVA 1P92A 5DAPA 2WS93 2RC4A 4ESFA 2VBWA 2JPCA 2QZ8A 3PUSA 5JCTA 2NVYJ 3KFWX 2WINB 4ES9A 4QQHA 1AYM3 5LCWL 3NJYA 2WAEA 1NK3P 2FXAA 1SCRA 3FLTA 3OV8A 1RUH2 2DV9A 2J1SA 5C3OA 4QLCU 1RUC1 1IG3A 5GKAC 3MIHA 4RS5C 1JJ6C 1HC8A 2D6LX 3QACA 1H0MA 3NKGA 4RM3A 3FN9A 2Q1ZB 2OX0A 5BNPC 4FVVA 1P9QC 1ZZ8A 3QPHA 4XOGA 4D7MA 3CJIA 3IIAA 2Q8OA 1FLIA 3ABLH 5A3PA 1GR3A 1RUF1 1S3JA 3M4OJ 1ULCA 3NRVA 3I8TA 1ZA4A 4E7JA 3I2JA 2VR4A 4GH4B 1WUVA 2VVFA 3B00A 1ONAA 5HLIA 4QU1A 4KISA 2R071 4MHRA 3I2IA 2DWRA 5A3LA 5FWJA 2JEMA 5E3LA 1B35C 4UFJA 2E19A 1XGSA 4M72A 3N36A 5CADA 1WHUA 2M2EA 3ABUA 2QTWB 3K4CA 5CJ9A 1BVP1 1RHI2 4EJRA 3ZFEC 2PN6A 4S2DA 2K40A 4HYEA 4XMYA 1Z3YA 4XUQA 4KGQA 2OPKA 4F92B 1LEBA 1RJ7A 3F6VA 4BE2A 2YGMA 2V4AA 1E3HA 3IBMA 1L7LA 4CXYA 2P34A 3QP5A 5JXJA 4EWDA 3MUY1 4HANA 3OSDA 3BG3A 4RAGA 5DTDA 3ZCOA 2CUFA 2A5WA 2JSPA 4F8AA 1WW6A 2HS5A 2FNAA 3S1MJ 1OCCH 2DFBA 1U2WA 2O8QA 1R5ID 4GXOA 3KLSA 4M3GA 3WTUC 1IQAA 2C9KA 2BW3B 2NM1A 1IO2A 4R1HA 3SMHA 1LOAA 3F9KA 4EQVA 2B0LA 2A6WA 2QQOA 1ETKA 3DPRB 1A36A 5D5WB 5KK1A 3OS2A 5D5XB 3FK6A 1VQNI 4GDFA 4P9YA 2CG4A 4B43A 1SFKA 5HOOA 3WW1A 4FPLA 3O2PE 4AD9A 1YFUA 1PGL1 3LEGA 2O0OA 1WKYA 5FQ0B 3K69A 3MHZA 4GMP1 5I0SA 4UFMA 2BW3A 4OLLA 5EWSA 4RGUA 5TISC 1HQLA 4ASLA 3BYWA 1E3OC 1RB8G 1LE8B 1VIWB 3IAS2 1G3SA 3O1RA 1EH6A 2UURA 3DPRA 3H5NA 2BVMA 1ENXA 1ENHA 4M9XA 3C8XA 1QU0A 4A3EJ 4CEYB 3I4PA 5K7FA 2R3SA 1WGPA 5EZWA 2YC0A 3QODA 3ZOIA 5LEJA 2WFPA 4LPLA 1N75A 1USSA 3G3ZA 1K42A 1AXYA 2L9LA 1S72I 4PHZA 4W50A 3WUCA 4WVMB 3VZJA 2E7QA 1PMHX 3WNXA 1SFNA 1T56A 2HTJA 1NCQB 2HVRA 3GFJA 2XSJC 5TJJA 2BNMA 5DD8A 2E7TA 3H9QA 4M3FA 2QM3A 4AZZA 1Z6RA 2VG9A 3BQYA 4QHZA 1UOGA 4L5JA 5L3GA 5JSRA 1YO8A 4CEYA 2CWMA 4LGWA 1BCXA 3BALA 3HNMA 5T50A 1X4OA 4UW6A 2EIEA 3D3AA 3TOBA 1OLMA 2WA0A 1OFCX 2BOJA 5JUVA 2AH2A 3BGAA 4FBFA 2KIFA 4K1YA 1YW8A 3I3EA 4B1LA 3BIEA 2OAZA 4WVMA 2XBO1 3B69A 1PJRA 3RKXA 5JVVA 1CAWA 1NCQA 1G3TA 1JS9A 2WNUB 3B9CA 4NC6A 4QKNA 2Y6GA 2F4MB 1D5VA 2NMNA 2R32A 2H8WA 3AP4A 2DO7A 4A7YA 2L0KA 1HB2A 5IAVA 3ILRA 4L92A 5E89A 4BE1A 1VF9A 1V0AA 2L7MP 2B7YA 5GPCA 2CQNA 4W97A 5FLHA 2V9KA 1BMV1 5I91A 4RB1A 1ENQA 3RYKA 4JK1X 5FMBA 3W3CA 4XZPA 2R93J 4UW5A 1IN4A 2MG4A 4ONUA 4B4QA 5E8IA 4MXWB 3NNMA 2XQXA 1PVC3 2WNUA 2HKOA 4YZ2A 1G2HA 1UW8A 2XMLA 4HF1A 1VBC1 3ZRGA 4WV8A 3KM5A 3OUJA 3WEZA 3WSOA 5FMCA 5J4YA 3ACHA 5KHKA 1FPN3 1YYNA 4N9HA 4ZYAA 1H8TB 1T39A 5FXZA 1FBSA 5ACA2 5KC5A 4BJTA 2YPJA 1X9PA 4PCRA 4MEXF 1TWCJ 3JBG2 3QCWA 4COVA 4PZJA 1CN1A 4ZJZA 5J47A 4MXWA 2FCTA 4D69A 2EB7A 4CO8A 4Y22B 1NQDA 4DUVA 1S2KA 4GYGA 5C5UA 1SACA 3OIOA 3WTWC 3KQ4B 5J6XA 2E7AA 5EZGA 2QKMB 3HSFA 2VBYA 4Q47A 2ETEA 1IN8A 4RGGA 1H8TA 1W1WE 2R0QC 2BGPA 4HSLA 3VFZA 1VAVA 2K3PA 3ZYIB 5F5AA 1O7LA 3KV6A 5FZMA 5GJ6A 1W4MA 2IBDA 4LD5A 4MSVA 2R062 4Y22A 2VKDA 4A0XA 5A80A 2Y0IA 4FX4A 3C2BA 3ACGA 1V9U2 3VDCA 2BVVA 3F0CA 2HFHA 2A3YA 2DTWA 3CDIA 4RAZA 2COBA 3IMNA 3FXJA 1QGLA 2CUZA 1IS4A 2Y6LA 4IJAA 1X8MA 4E2SA 2R7QA 3FHQA 4DYCA 3WG3A 2WT0A 1MZEA 3RPUA 1S4CA 1JU4A 1RC6A 5LBBA 1LB2A 1BEV1 3CDZB 2OKXA 4KIFA 2DYSH 3EMRA 1AU7A 5FV3A 4XICA 1ZR4A 1R1TA 1V6OA 1G6NA 2KIMA 1MGTA 1UZ0A 3MPBA 1TQ5A 2EFQA 2DU0A 1ND2C 2O8KA 1FOWA 2WSUA 4UOJA 2JUCA 2PN5A 5F39A 3W2AA 1PGW1 4W6WA 2GH8A 1LOGA 2JJ6A 2OZUA 5T5JA 3W5MA 4JQTA 1AL22 2XL7A 2HYKA 2VL4A 4G9SB 5BNNC 1SFEA 2DUOA 4DRRA 1RUI2 4XIKA 1MJAA 3W58A 1D8KA 1LNSA 1HBXG 1UMHA 2OC6A 5HDKA 3FDYA 2RNJA 4XLPF 4FPGA 1O4TA 4BQXA 3ZYRA 2WV1A 5DN2A 3WF1A 3GUDA 3KWVA 1HLCA 3HG9A 1W8FA 5GTHC 4KU8A 3S1QJ 4YIFA 1Y1WJ 1W8TA 1OKOA 1W99A 4OFGA 3K4ZA 2RG4A 3OB8A 4I6ZA 3ENRA 4IGOA 2VMDA 2G9WA 5EF6A 4RA0A 1FOKA 2X05A 3RJPA 2NMOA 2WWYA 1B8IB 1GHCA 5GAEJ 1DF0A 3OG2A 5FP8A 2YY1A 2AQFA 1LECA 4A3DJ 4QQPA 1HRV1 1H9PA 5FWEA 3F3XA 4LO6B 3BU0A 3AM2A 2EZIA 2CW8A 1LDDA 4GWJA 4YNIA 4QB6A 1Z0HA 4WXDA 4LOTA 1AX1A 3WNLA 4CVUA 2CDOA 3GBFA 3OWTA 4UVBA 1KS4A 1EPZA 4HFSA 1SLAA 1G3WA 1PP7U 1RUC3 3H8RA 3M8JA 1MSEC 4FHTA 4CCOA 2ZEZA 1B8IA 1XTAA 3RQIA 5DAXA 4YG2F 2Y0SA 1GVJA 3TQNA 1U0AA 4HN0A 1OUSA 1QJFA 1RUF3 2W52A 4HV5A 1WCQA 3BR1A 4XXAA 1JHHA 2RDRA 3Q9VA 5A1LA 2DMNA 4N53B 2TUNA 2BTVC 2WY7Q 5JSOA 5CG9A 4MYEA 3T2TA 5J1UA 4GALA 2ZABA 3VZKA 1V5EA 1IXCA 1XSRA 2DVBA 3VN4A 3DV8A 2GOXB 3ZR5A 1S0FA 1G9CA 1FI2A 3KCYA 4IXAA 5FJKA 4LHNA 4AVSA 5LBCA 2VXJA 1JYNA 2V9VA 2KIUA 1W5TA 4AEDB 2ZOEB 3KIOA 4A7ZA 4N53A 4PBOA 2IGMA 3G71I 3SH5A 3AMMA 2B42B 3G2BA 3LQRA 5I8YA 1D8JA 2OIIA 4ARXA 4XL9A 1YW9A 4M6VA 2QQMA 3IPVB 3WNMA 5FZOB 1DQ6A 5F6KA 5BY5A 3S93A 5J37A 2W00A 5H9SA 2RV9A 2ZPXA 2X6XA 5M5YJ 2A6HF 5LRSA 4CDWC 1V6MA 3BI3A 3N9MA 3BJ6A 2W1OA 4WM8C 4AEDA 1YC61 1UCXA 1T95A 1WJAA 2HYFA 4META 2DA7A 1NX9A 3B7MA 4GCVA 3RSJA 3WT3A 4N43B 3O0XA 4QX1A 1R9TJ 3H0GJ 4LG3A 2MYSA 2OA2A 3AJZA 3B9IA 1QHGA 3AP6A 2PHXA 1CWPA 5FZOA 4CU9A 5FGMA 2VQUA 3P7NA 1NG7A 4JGZB 2EBIA 1H9GA 1NH3A 1DIWA 4X6QB 4XUPA 3IRRA 2V5DA 3VZMA 3UV9A 4GMP3 4COYA 1GQPA 4S2GA 1IGOA 4OAZA 1QEXA 1L0OC 4D6RA 4LK7A 3ZO0B 3KHBA 4XVHA 1QOSA 3AYEA 2MEV3 2IWGB 2CWSA 1Z91A 4CXWA 2VNVA 1TP4A 1DQ0A 3WNKA 2AEYA 3K4JA 4IXLA 3MKLA 2DA1A 4PFPA 4EN6B 1W36D 2M8EA 4AI8A 2VQHA 2KM2A 2EXHA 4JGZA 3SYTA 3FM3A 3DXJF 5A3OA 3GX4X 1SC7A 2BWCA 4G7ZF 3FHIB 1RI7A 4UFLA 3MEPA 5F7UA 3MKYB 3GJAA 2WABA 3LCPA 4K2EA 1BJAA 3OYHA 3N9NA 4FFHA 5FKMA 2MH2A 2D6MA 1ZRFA 3MW2A 3ZGKA 4NIIA 2L9VA 4OMCA 4YGDA 1PK6B 1Z7LA 2VBBA 1UHMA 3C7OA 1X1AA 5F64A 5E88A 3VHNA 5ICGA 3U11A 2RS12 4V2FA 2M87A 1D2QA 3DBLB 3VUOA 1O91A 4COWA 1SLIA 1ZZBA 4HV6A 3WGGA 1CIYA 3K4AA 5C5TA 3T8TA 3C2GA 1DU0A 1OA2A 2XBO3 1W2TA 4RFT0 3HOWJ 2MH9A 3WGIA 2KXLA 4RLQA 2VNRA 1K6YA 3D0SA 1JYCA 2LH9A 3GCWA 4DY5A 4Q0QA 3KV9A 1O57A 3HNYM 2HR3A 1GOFA 4I3PA 3POBA 5DAQA 5BOXA 1D0ZA 1J7KA 2VPVA 2Z33A 2P2KA 1FP1D 3VD4A 3V64A 3LDRA 4IEOA 1LODA 2FBIA 4G9YA 2R6QA 4Q4Y1 3DEEA 5FRAA 4QU2A 3H1CA 4J1WA 3WG4A 2ZC2A 2JE9A 2Q8DA 4IRHA 1VBC3 3RZKA 1HV1A 2ZSHB 1DDNA 3VBOC 3VD3A 3IDAA 5F6LB 2PHUA 2BGOA 4PJJA 4KGGA 3ZXAC 3CC7I 1ZG3A 5BV6A 2QQVA 3RKQA 1IDZA 4A3FJ 2NQYA 1KZHA 3EBRA 5LHIA 3OCPA 5BPIA 4DOUA 2Y48A 5HCAA 2FOKA 3R60A 4CUBA 3KETA 1SLLA 4UB6C 1R4NB 1DQUA 2DK5A 2D45A 3A01B 1CESA 3J7AY 2VJ5A 2VVDA 5FO9B 2N7GA 4RGRA 1W0NA 1FTTA 4PJYA 5E79C 3LSPA 1HN1A 5FYZA 2Y6JA 2JA5J 4I99C 3V56A 3SQOA 3ZMOA 2BPA2 1X7NA 4IV1B 3SHFA 1NHAA 2JG9A 1GQGA 5EJ1B 1U9OA 3CMAI 3A22A 4IEYA 4LBJA 1JW6A 1XSVA 2O1QA 4F3QA 4CDQB 3WUDA 2R7RA 2X4HA 2ZNZA 5GLWA 4IESA 3RZDJ 4FAGA 2W1SA 1GXQA 2K9NA 4PDWC 1MMGA 1SLTA 5DZFA 2Z9OA 2DJIA 1XRUA 3A01A 3ILNA 1LENA 1ORKA 1TNFA 1RMU1 1MKMA 2RM21 3THTA 1I1EA 2X6WA 3KB5A 4IV1A 1U5TC 2W1QA 1R092 4XJ8A 4CDQA 3S2DJ 2XB5A 1O7FA 1BEV3 4RN5A 1YJLA 3PL0A 3BY6A 1HQNA 5D8LB 5IOZA 1H2MA 4G94A 5FZAA 2P4WA 5LD2C 5FXVA 2FMLA 4LK0F 4GKYA 4C91A 3JQWA 3K4MA 5D5VB 2M7BA 4KQ7A 2IEKA 5AVPA 5J8CA 4WXHA 4N8MA 1VBD2 3WDTA 3CCJI 2KRHA 1B59A 2WO2A 2DFFA 2X5IC 1SQ4A 1IZ3A 1T0FC 1FYUA 4EN8B 5K4LA 5LHGA 1WLWA 2XAHA 4JBAA 5AIPA 4HNTA 3BUCA 3WDVA 1ZNPA 3DN7A 1UU4A 3IP4B 4EZ4A 1CJDA 1IGNA 1EF4A 3UK9A 2XVLA 3CKHA 2YPDA 4XFAA 4MZUA 2R072 4EROA 2B7EA 1G9BA 4YFZA 2OV7A 3DKXA 4F3JA 2A6XA 1NZCA 1AR71 3WG7H 2B45X 3ZYJB 1BN5A 2PA7A 1AJOA 1WW4A 2R0HA 4PCQA 4U0VA 2ENRA 1LGBA 4YW2A 4OHYA 4G12A 4BK4A 5E3MA 1HRV3 4BQ5A 4L2NA 4P5OA 2MSYA 2LKXA 4NHJA 2ET1A 4XFHA 2HPIA 1NY72 4QXKA 2KQRA 1TME1 1RKWA 2WR9A 1VQPI 1A31A 2K85A 1R5HA 2JRTA 2ZXWH 4OULA 2EZHA 4G7HF 2R041 4OHXA 3K2AA 4Q4V2 1BLZA 2L7ZA 2M8GX 3H3LA 2ERFA 1FYMA 1SVMA 2H8RA 3S30A 4LBQD 2M4GA 1R081 1GZTA 3OPTA 2DCEA 2WNVB 4HPQA 1TE1B 2ZGNA 2B46X 4AHZA 1R64A 5JMOA 3MWMA 4O9GA 2W84A 1UB9A 1E3PA 4QX5A 2PFWA 1FOD2 4QM9A 2I2SA 3AZZA 1UYZA 3DPLC 3GNEA 4KBZA 1JYXA 4NQWB 4CU7A 1AZDA 3NSTA 4LJHA 3RGBA 5L7OB 4EJWA 4Q48A 3BG9A 4RLFA 2HYXA 4XDQA 1VQ8I 4BUPA 4QDRA 3AP7A 3DECA 3L2RA 1HB3A 1W7PD 1WJCA 3EUHC 2D97A 5C70A 3GO5A 3ONQA 2LLKA 4Y20B 3WP6A 2VODA 4RGKA 4Y52J 3RJ2X 5FPUA 1FX7A 4OQ8A 4NNJA 3CUQA 5I8TA 1BK0A 4LULA 3I2HA 2HI3A 1D2SA 5E20A 4L8QA 2FDKA 5FRNA 1W6OB 2R7OA 1BC7C 3WW3A 4I0AA 4NQWA 2AACA 4MGYE 3C7GA 5L7OA 3FXMA 3CIHA 2DTZA 2O5RA 3EUKL 1QHHD 4XPVA 2E53A 4IQ4A 4JZRA 1RR7A 3VLBB 1QXPA 2LF8A 2Z69A 4YW3A 3HZJA 3PM1A 5IHRA 2RMU2 1WH7A 4Y20A 3HN3A 1S2BA 3L09A 3R4UA 1PX4A 3LDKA 1IAWA 2D3RA 2W5FA 3RRDA 1Z7S2 1T8IA 1GP6A 2LW8A 1W6OA 4FTBA 2WZEA 2PHRA 2RE9A 3LMMA 1Z0XA 4KG0A 1YI7A 4I0BA 3SCHA 3MZYA 2Z99A 4GJYA 4J19A 2ZGLA 2FUG2 2VQAA 3NV2A 4UBGA 1UU6A 3MIBA 3UETA 4LA2A 3JB8A 4A3KJ 2VH9A 3BPVA 1OCPA 2YGLA 4JRAA 4IQPA 4IV3B 3PIOF 1OCZH 3DWLE 1V00A 2JDNA 3M3EA 5DZEA 1UPSA 5D2AA 5EHDA 3WG9A 3AKTA 2HLEA 1MMDA 2JN6A 4ZTJA 3SHRA 4XHXA 3ETPA 5EJ3A 5TSWA 4XR6A 4E2QA 1ZTRA 2UWAA 3CF6E 1XYPA 5L19A 2STTA 2JDUA 3ZSLA 2E6VA 2JICA 4AUXA 2MFZA 4AYBA 2RNGA 1OCTC 3HWJA 4IV3A 1NCRB 5IY5H 3K3OA 1W5SA 3ZDVA 1YTYA 1XSQA 4HX8A 2IS2A 1YS7A 2TNFA 4WF2A 3V0AB 5A6QA 2OXBA 5F2WA 2NVXJ 3HDDA 1US2A 2WB1N 1HDKA 1EYBA 5FZ0A 5J36A 2CHHA 4DEQA 1TMF2 4BYYA 2KLOA 5IP7J 4QKFA 1US3A 2NRAC 1TT5B 3USUB 5F3IA 1NCRA 2EPFA 4IW3A 2AO9A 3DUIA 3O6BB 2F5VA 1U9NA 4ZS3A 2CV2A 1RUJ1 2Y31A 3V0AA 4AFCA 4ET7A 1R1A1 2UZKA 2C26A 2ZMKA 3I2OA 2JSCA 4L9JA 4DPNA 2LALA 5IT9Z 3SXYA 5B2GB 1W6PB 2A71A 2A7AA 4M6XA 3BR3A 3CCQI 3VBHB 2JA6J 1ND3A 3CJIC 4XIDA 1JZ7A 4A69C 4ZYEA 3USUA 5T5LA 3I9V2 2XC7A 4XTMA 2DFEA 3VDXA 1ZZ9A 3VYUB 4XLEA 2W25A 5L3FA 4Q4Y3 2K9LA 4TLGA 2FU4A 2ZX0A 1SAUA 1ZN2A 2WQ8A 5DDJ2 4XSXF 1S7EA 2EVXA 3FMQA 5CEHA 2IRFG 4UY8I 3NJVA 2FZ2A 1ULPA 1JHNA 3I64A 1GANA 1D0YA 4CCDA 2HOTA 4GD4A 4UWDA 1ASJ2 4RGAA 4BQ2A 3HTSB 3I97A 4IKFA 3VBHA 3ZYGA 5EEGA 1XYNA 1N47A 3B6CA 4XQDA 3VYRB 2R5ZA 1UG2A 1G7YA 5JOXA 1ZBA1 4DYQA 1XQNA 4KI5M 2QA4I 4Q4W1 4RD7A 2F5DA 2M3AA 5GLUA 1JMUB 3WE3A 2HJIA 3JCUC 4RS5B 4Y5SA 1IN5A 2L2OA 1HF0A 1Q1HA 1FATA 3ZR6A 1VJ2A 4M4RA 1CQTA 3W59A 3ROUA 1LFUP 3I3QA 5BYNA 1WCSA 4PIYA 3CO7C 3TEXA 1H6XA 3FX3A 2V79A 1MIJA 2VZTA 3OYBA 3E3VA 1N3OA 5FY8A 2D93A 3ATGA 1UF2C 1WCUA 3A1YA 3WQ7A 1SVLA 4LG0B 4L99A 2D1HA 1B35B 4RS5A 3WU0A 5SV8A 4AFAA 3BTJA 1GUIA 2XJUA 1RMU3 5HPOA 4V19K 5FYUA 2JDHA 2RM23 2DU9A 2VXRA 2SLIA 3UJQA 2DOEA 4NR1A 4A0YA 2VMHA 3M3IA 1FYKA 4KFCA 2DA4A 2XWBB 3KLNA 2UY8A 2A5YB 3L2YA 4ZDOA 3JRBA 2AR6A 4KWKA 3MLKA 3NKTA 5HVQC 3VBFB 2VBDA 4XMAA 4V1PA 4LG0A 2JVGA 5TRDA 2EILH 1B35A 3FE5A 2NS7A 4DW6A 3ZIWA 4E27A 1HB4A 2CW7A 1RUNA 4XJWA 1OJLA 2F5CA 3DPRC 3BTLA 4Y15A 4H55A 3BVCA 4Q8LA 5GLTA 3U07A 4O3MA 4D6SA 5A7WB 2FJ1A 2JXAA 4M6YA 1R4MB 2WLQA 2IS1A 2J1RA 3VBFA 3UGFA 3DCQA 2G9FA 1X4PA 1KQ9A 4Y13A 2GIVA 1KRIA 3OBZA 4ON0A 3UESA 3CQZJ 2BEOA 2Z16A 3C7HA 3HEIA 2WQ4A 3W9AA 1QVTA 1AR73 2H6CA 1YQ6A 2VMCA 5C9AA 4XJAA 1I9RA 2BE5F 3H0DA 2P5KA 4P00B 2RDPA 1WFXA 2YBSA 3OY9A 2JG8C 4AIKA 4HX4A 1KGYA 3I4MJ 4A3ZA 3CLPA 1XX5A 2K02A 3POJA 4HK8A 1YJKA 4I09A 3PTRB 1DGWY 2ECCA 1IC8A 2LYCA 2VBXA 3JTHA 3FXUA 4HKLA 4S2HA 5FZGA 1LHOA 1TQIA 3H1YA 1NCQC 3T2PA 1GVDA 5DV5A 3E1SA 1TME3 4F55A 3OPZA 2GN7A 3OR2C 2QBYB 2R043 2QVOA 3ST7A 4KN7X 3UNPA 5FZEA 2E51A 3BCAA 5DD4A 3PFYA 5F5IA 4XE9A 2M30A 4XKVA 3K2ZA 2VQGA 2WAQN 5D6FA 1F8VA 3OYNA 1TG7A 1R083 3OY8B 2BDRA 1SCSA 3RZHA 1BR1A 1UKGA 2VZSA 3N9OA 3THPA 2JB4A 1OCRH 4KIBA 1QZZA 4IHXA 5LY1A 2X8KA 4P9LA 3GZUC 3SEZA 4BH9A 2BWAA 4IETA 3IH3A 2QBYA 2Q1MA 1JUIA 1LJ7A 1PYVA 2F17A 4KMUX 4DEVA 4LQRA 4K8FA 3VDBA 3JRHA 1DLCA 2RHPA 4QSHA 2RS52 1HQCA 2CSOA 5IYYA 3OY8A 3PHMA 1QJY1 3GZTB 5F2SA 4XTPA 1MQTC 1XNTA 3HT2A 3T09A 1H1IA 3B02A 4FXKB 3LWCA 5H9QA 4ATFA 1L7QA 1FZPB 4JX6A 5C8WA 5FBJA 3BTZA 2BOIA 2Y69H 3FLRA 1I39A 3E5UA 2OTJI 5K5OA 3EO6A 4EEFG 5A1FA 2VQLA 1Y43B 4LB5A 1JGGA 3H36A 5L9VA 5EXOA 1H8TC 2BBYA 2BRTA 2D43A 3GZNB 1VQOI 5HS7A 4Y33A 3KD4A 1R71A 4NBQA 4EVIA 4W6XA 3H50A 1XNCA 4BMEA 1AKHB 1LHUA 4HLYA 1ULEA 4RB2C 4F93B 2NLRA 3NWKA 2JTVA 5KHIA 1CAVB 3LAJA 1AR62 1HDPA 4PSXA 4UUSB 3RFRA 2ZKZA 2A07F 2VQTA 3VKOA 5JLVA 4GULA 2D7FA 3ELKA 5CVRA 3SCGA 1Y0NA 1KQ8A 5LATA 4M3CB 3USSA 2DUPA 3ZN6B 4GZ9A 1ZG1A 1W0OA 1GWLA 4AEJA 2CL2A 3T1BA 3S6PA 4UB8C 1DZQA 1SBFA 2QLZA 4BXXJ 3AX4A 5A3NA 1AWCA 4QGLA 1UX6A 4CEWB 1AKHA 2Y30A 9ANTA 2TBVA 5CVJA 3OYGA 3HXLA 2GC3A 1CAVA 5J7MA 3EYPA 3D82A 3T0AA 1SG3A 4UUSA 1IV6A 2EIDA 4ATEA 3O1UA 3HBKA 4GXLA 4LUMA 4HF0A 4M3CF 1WRJA 2VJJA 4AIDA 4LIVA 4CCMA 4M3CA 3ZN6A 3RIRA 2CW0F 4NO4A 3O1MA 4Q4Y2 1DGRA 4CEWA 4INDA 3SZGA 3J7AO 4WZFA 2JZYA 1VRH1 2D5FA 3ZSJA 3CZJA 3GFIA 1BW6A 3K1NA 5L3DA 4QB2A 3KZYA 1Q8PA 5A6XA 4CPBD 5FROA 3CMYA 1PZ9A 1HRI2 1GBGA 1N25A 4EN7B 3TP3A 4HQMA 1MDMB 1IS3A 5FZ7A 3ZYHA 3D5SC 3KSCA 1KU9A 3WTVC 5EYYA 3L2UA 1ND2B 2RR11 2DU1A 3GLXA 2FMYA 3BN6A 1LEDA 4BQ4A 1CZSA 4YGEA 3ULQB 3F22A 5KHDA 2R4GA 4AVCA 3GFLA 5BNNB 2BERA 4FPHA 4WM7A 1E0EA 2VZOA 4DS0A 3LF7A 4BHPA 1R1A3 4AVTA 2I10A 1JOJA 2F4LA 2E63A 1T6GC 2XJTA 5D8AB 4IL6C 5JHFA 3PVOA 4IHWA 1OHFA 1W06A 3SH3A 3ZXDA 3SXWA 4GGGA 1LHWA 4IOAF 3GYDA 3OGRA 1MDMA 4XZUG 4HG6B 3F8NA 3MAJA 1KGSA 4DYRA 1ND2A 1AR92 3HKZA 3QH7A 2QQKA 2JENA 2FZ1A 4NDLA 2F6BA 2RJKA 4CZCA 5ERLA 2DLLA 2V1XA 4QX2A 3ZMNA 1CJPA 5BNNA 4K1ZA 4TZDA 2L01A 1OA4A 3J7HA 3UL2A 2VECA 2VOWA 4L0PA 3P5JA 1S0JA 1X3UA 3CC4I 1J83A 3JSOA 2PHFA 5D8AA 5T5OA 2GBYA 4U7DA 1W8NA 2W2IA 2QQNA 3OIPA 1O8SA 2XUBA 1X1DA 5JAXA 5JDBA 3ZQ7A 1LDJA 3RI9A 3AAFA 1ZBA3 4FSJA 4NPMA 2CH0A 4FX0A 5KAIC 3C7JA 4Q4W3 3C3WA 1SFPA 3NW4A 4MFEA 4L9BA 4OYUA 2XIGA 2KP6A 3SC7X 3L9FA 4AEKA 4YFXF 1O4YA 4Q5SF 2ADDA 2QEXI 1W3XA 1KU3A 1RC9A 3OYDA 2NN8A 1AR83 3QLQA 2X0LA 4LK1F 3WHTA 5HBAA 1REDA 2WFF1 3GXUA 5HLGA 1JXNA 1EY2A 4DIQA 5CKNA 1HCRA 3S7IA 5G05L 3ES4A 1MD0A 1DPRA 2BY3A 4D0PA 3ZXLA 1S55A 4P9GA 2NPIA 2LY2A 4KU7A 2C5DA 4AEDC 4DXSA 4MLOA 3PTYA 1MS4A 1NTCA 5J96B 4KYWA 5BNOB 1Q8SA 1CIWA 4LLOA 3MUZ1 5J8FA 1LNWA 4BPZA 3AFHA 1JH5A 1AXZA 1Z7UA 4MGSA 1AF9A 4HQEA 1WBLA 2CWEA 4AOCA 3THCA 4QHBA 2XKOA 2VKHA 2D3SA 3TKYA 1LVAA 3S1NJ 4G8XA 1VZ0A 1MEC2 1TNRA 2XRLA 1T2XA 1MS0A 4OCTA 3W2VA 1Z3XA 1TW3A 3WCRA 5BNOA 1U8RA 3BR0A 1XB4A 5G04L 2VJ4A 5D1IA 1YX3A 1K5MB 4BZ4A 2HDWA 2VT2A 3OGSA 4RSUA 4CDWB 1VBA1 3KP6A 1OSGA 4G4FA 2BV6A 4HEA2 1V6NA 3C3VA 2EV6A 4W8JA 1V55H 2OU2A 4WM8B 4G3YC 1I3QJ 2H1KA 4JGZC 1KITA 5FO5A 2PMZN 1RVF1 3B94A 3M2MA 2E1NA 1Y7BA 2KRFA 1SHWB 2HNHA 4CCLA 3AG1H 4YFKF 4XC9A 4IE6A 5DQ0A 2IXCA 1Z9CA 5C44J 3RQ4A 4QPYA 1UAIA 3VODA 5LBFA 3KEOA 2JA8J 1K5MA 4OVEA 5FPBA 2DPUA 5C4WC 3ORJA 4CDWA 4G6DA 2D3PA 3K46A 4XLCA 2XGXA 3I2KA 5LGTA 4WM8A 2UYBA 1VQLI 4QX0A 4AGGA 1LGNA 2W48A 2DDAA 1Y9GA 2IA2A 4HG2A 3F8BA 1W8ZA 1OFSA 3BG5A 4IEVA 1AHDP 1MZ6A 3GYHX 4LBLA 2K46A 4QIWN 1YFWA 1O4XA 2YC4A 1SDWA 3H9JA 2MPFA 2VKVA 2K2SA 4BLIA 2PMWB 2XLFA 2JIJA 3DU6A 4M9ZA 1J1TA 2V6EA 3ZLIA 3F95A 2XH6A 2EXJA 5IFTA 4EMSA 4Y24A 4PF5A 5AFBA 3TDUC 2VTFA 4BE3A 1CVNA 4ZDLA 3RKWA 1PIV1 1S0BA 1KS5A 3DPTA 4YW1A 4XBQA 2X9DA 1AYN2 4CH7A 2HVQA 3VYSB 4QXBA 1N1YA 3MGUA 1IZ1A 2C0ZA 1VQ4I 3B5LB 3J8F2 1SVOA 4X6RB 4NN0A 1LDKB 4OINF 3J7MA 2QQWA 4M9SA 1HA8A 1HW5A 2EJRA 5EGOB 2JDYA 3FBNB 5A6YA 1HXS1 3U78A 2WO7A 1BK1A 1YRZA 1QMJA 4GKXA 2VC1A 3RZJA 3MMYB 3HT1A 4LJZF 2AHQA 1KU7A 5SV5A 5DUVA 1MBHA 1OLME 2VULA 2CAVA 2JDKA 5JVGF 3GDBA 2WKKA 3NV3A 3ZM8A 1FXZA 1JBCA 2LC2A 3BJOA 3GXOA 1PGSA 2ZEXA 5BUVA 1QJY3 1U12A 5F8PA 4UW3A 2YR2A 4JC1A 5EGOA 4N9IA 1P4WA 1RUE1 2EXIA 5AFEA 3KP7A 1RUG2 3WTSC 4A3CJ 1YJWI 2VXDA 4AI1A 4BDYA 4RAYA 2YBKA 1JU3A 1NQJA 2VTXA 3T08A 4NROA 2JG9C 4COZA 4IHYA 1IUYA 1OH4A 2X48A 4X1EA 2RS32 2VD7A 1WMFA 3VSLA 3ZMVA 5C3PA 2HWC2 1GICA 3HVDA 5M3FJ 1JZ2A 2EXKA 3PURA 2GA2A 2COMA 1TQMA 3VBOB 4WWCA 1MSFC 4ASNA 3SITA 4B09A 4Q27A 2O03A 4KIGA 3T1LA 4L5EA 3ES1A 3LZZA 5C71A 3U9GA 4Q4X1 4IV1C 4H7LA 2XF6A 2QSFX 3EQLF 1FMD2 4Y17A 5CFCA 2ZKLA 1F5TA 1ULFA 5FY9A 4CDQC 2CV6A 3FIWA 1U0JA 1D4VB 1I5PA 2Y34A 2HOAA 2XF5A 1R6RA 5FY7A 2IZWA 1RUJ2 4FISA 3J81Z 3LDBA 5CB7A 3ZQCA 3VBOA 3KP5A 1JYWA 5CYYA 2QSGX 1VAKA 5EYXA 2DCKA 3MCZA 4C9YA 4HSJA 2B4KA 5JR7B 5D5UB 2A70A 5CFDC 3RZZA 1X82A 4AI9A 5EDNA 3BTYA 4AR2A 2ME6A 5CBLA 3DFGA 2LDUA 1HJFA 3L2QA 2FMDA 3AC0A 3T5XA 4GB31 4CP2A 1ZLKA 1FNZA 4PDWB 1K79A 3PDQA 1X2MA 3ZXEA 3EJKA 2OQ6A 1J75A 3VZLA 2ORZA 2XONA 2VAUA 1OOPB 2VE1A 2J5PA 2L3DA 3W20A 2ZJ2A 3M1EA 1SEFA 4XFCA 1WJEA 2KZVA 1VRH3 3AYDA 4JKKA 2PG4A 4ZH4F 3LFIA 2ZB9A 1OURA 1UY4A 2ARXA 1VQMI 2KA3A 5DCFA 1CX1A 1GMMA 5TGTA 5EQUA 4ENKA 5DM7F 1VQ9I 4HK9A 2VCAA 4PDWA 2K5CA 3CEWA 4EM0B 1W6MB 1YXWA 2KT0A 2L7KA 2RR13 1OOPA 3HQUA 2VBZA 1BBT1 2C1FA 4LXLA 4OHZA 4RR3A 3GBWA 2HBTA 1ACCA 1J3RA 1Y9MA 4LA3A 1KYWA 5KXBA 4OIPF 3M3QA 3AKSA 2MBFA 2W87A 1ZRCA 3HJRA 3KPHA 2PQ8A 2XGDA 3TEWA 2DF7A 1STMA 4IDZA 2E5NA 2H1LA 3H7YA 2W0XA 2VLAA 1JZ8A 4V2GA 1ULDA 3V8JA 1UY0A 1O6UA 1LTEA 1A6QA 3JW4A 5CQEA 5ICCA 1DU3D 4BNCA 2V4JC 5F3CA 2ESNA 2VY0A 1ZG5A 2LROA 2Y2ZA 4L9VA 3WDWA 3GVAA 5FUNA 3KX2A 2VC0A 2DMUA 1A8DA 4J1XA 2LR8A 3OYFA 5LLQA 3OL3A 4C0BA 5I0DA 2ARBA 2DPDA 4DINB 2VZPA 3H0OA 1GLNA 5IVJA 1YQCA 3GTQJ 4AGRA 2B5HA 2WWJA 4B8XA 3AYCA 3ASNH 3VPRA 3L00A 4L9NA 2XAQA 3THDA 2GMPA 4CSWA 2LKPA 1WKMA 1JJ8C 3RMYA 3CUQC 4EATA 1KYZA 4J01A 1IN6A 1C8M1 2YFUA 4I30A 1COV2 4X6AJ 4UXNA 1ON1A 2XPJA 5L7OC 1K61A 4LK6A 3ZSEA 2WFF3 3P6BA 4JTNA 3KVAA 2DOAA 1LAJA 2QZ2A 1OQDA 4HSRA 1Y56A 2MA3A 2KPMA 5CA6A 5JFRA 1EAH2 2ZHMA 4BOWA 4C30A 1XSXA 4RQPB 3QOPA 1MS9A 4DRVA 4YRDA 3IMMA 2FDJA 1WQ2A 2DI3A 2MC4A 4CTEA 4D7NA 3WDUA 3CF5F 4DZGA 4SBVA 5L9RA 3FZVA 3D1NI 4RFRB 2BGCA 5E3OA 4FOYA 4R9BA 2HWB1 3VYTB 3GTKJ 1RRJA 3CU7A 1WI9A 3T0YA 1QNWA 4BQAA 2UY9A 2D6OX 5FP7A 2R5YB 3R4SA 4BBSJ 5LGNA 1VBE1 4GA9A 5IVVA 5A7PA 4YARA 4B3NA 2FD5A 3LPGA 4RQPA 1N1SA 2NVTJ 3U2RA 4QQ2A 5DAVA 2J22A 2BQPA 4IOCF 2RGVA 1W9YA 1P4XA 4CCJA 1APNA 3FUQA 1QU3A 3AVRA 1NK2P 1FMWA 3AG2H 2MD0A 1UAAA 3R61A 1NUKA 5FYBA 2PMHA 4P55A 3L2HA 1U8BA 1RVF3 2R5YA 4L0ZB 4IV3C 3WHCA 3IKWA 2XGCA 4Y1YA 1FC3A 4IEPA 2UYAA 3UYJA 2AS5F 1CZVA 3ZKYA 3BZCA 4LLNA 5B1AH 1SDDB 1TC3C 1QNTA 3V0BA 5FR3A 4ZY9A 5DABA 2DMPA 1HJGA 2F5FA 5IW0A 4M0NA 2XRNA 2QNKA 5GZGA 2OQGA 2LNBA 4A45A 1GU3A 4RHV2 3FFQA 3E6CC 4RGSA 1QJY2 5K8SA 1NCRC 5H6QA 4XKBA 5FZHA 3OPWA 5JMCA 2CO5A 4YELA 2UU8A 3E7LA 3EHKA 2VUCA 3AL5A 4ZKTB 2K9ZA 3MV11 4HL0A 1MS1A 2ZXQA 2ZEWA 1BBYA 1SFXA 2R7UA 1PVEA 1XMXA 1ZRRA 3X2QH 4UF0B 3G1LA 1YIOA 2IC1A 3CJRB 3ZFFB 3M8EA 1DBNA 2D40A 4OIRF 1KQ0A 2FD8A 1J59A 4QPQA 2Y9ZA 3LEIA 2Y9YA 1PIV3 5FYCA 1SLCA 1H2KA 1J5YA 1ND3C 2R7WA 2A3WA 5GM0A 1B4AA 3FMSA 1JI6A 3WF3A 3POSA 1G9AA 4XRSA 4XNFA 1IJWC 4ITCA 4JGYB 4HPKA