4LIUA

Structure of ycfd, a ribosomal oxygenase from escherichia coli.
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
373
structure length
360
Chain Sequence
MEYQLTLNWPDFLERHWQKRPVVLKRGFNNFIDPISPDELAGLAMESEVDSRLVSHQDGKWQVSHGPFESYDHLGETNWSLLVQAVNHWHEPTAALMRPFRELPDWRIDDLMISFSVPGGGVGPHLDQYDVFIIQGTGRRRWRVGEKLVDPFEAIIDEELEPGDILYIPPGFPHEGYALENAMNYSVGFRAPNTRELISGFADYVLQRELGGNYYSDPDVPPRAHPADVLPQEMDKLREMMLELINQPEHFKQWFGEFISQSRHELDIAPPEPPYQPDEIYDALKQGEVLVRLGGLRVLRIGDDVYANGEKIDSPHRPALDALASNIALTAENFGDALEDPSFLAMLAALVNSGYWFFEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ribosomal oxygenases are structurally conserved from prokaryotes to humans.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
molecule keywords 50S ribosomal protein L16 arginine hydroxylase
total genus 84
structure length 360
sequence length 373
ec nomenclature ec 1.14.11.47: [50S ribosomal protein L16]-arginine 3-hydroxylase.
pdb deposition date 2013-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08007 Cupin_4 Cupin superfamily protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2510 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4liuA02
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 4liuA01
4DIQA 4Y4RA 5F2WA 4AI9A 4IGOA 5E6HA 4CCNA 3AVSA 3K3OA 5FUNA 5FYYA 5F5CA 5FP8A 5IVFA 4LIVA 5FYSA 5IVYA 5A3WA 5K4LA 3AL6A 5A7WA 3PUQA 5FPLA 2YU1A 3LDBA 4GAZA 2OQ7A 5FYUA 4EZHA 5IVBA 5A7WB 4EZ4A 5FZLA 5IVVA 5FYCA 4HOOA 3DXTA 4IGQA 5KR7A 5FYTA 3PUSA 4QX7A 4CCKA 4D6RA 2WWJA 5LWBA 5A7SA 2Q8DA 5FZFA 2YPDA 5FY9A 4UF0B 4CCOA 5FWJA 3LD8A 4QXHA 2VD7A 5FZKA 2GP3A 4XDPA 5A1FA 3KV6A 5FZ4A 4IGPA 5FZOB 5F2SA 5FUPA 5FZGA 4BU2A 4QXCA 4D6SA 3PTRB 5FWEA 2GP5A 5FP3A 5A1LA 3KV9A 5FY8A 3UYJA 5LY2A 5FJHA 3N9NA 2OQ6A 3DXUA 5FXVA 4QU1A 4LIUA 5FZHA 5FZAA 4BISA 2OX0A 5A7NA 3AL5A 5FP7A 3ZLIA 5FPBA 2XUEA 5F32A 3KVAA 3N9QA 5F39A 5CEHA 5FPAA 3N9LA 4CCMA 5FY5A 3KV4A 5FYHA 5FZ3A 3KV5A 3OPWA 3NJYA 5F3GA 5FXZA 4ASKA 3U78A 4GJZA 2YBKA 3N9PA 5FJKA 4Y33A 2WWUA 5FYMA 3PU8A 5FY4A 5FZEA 3U4SA 5IW0A 4CSWA 4EYUA 5FZ7A 5F5AA 2YBPA 5F3IA 5IVJA 2Q8EA 5A3TA 5A7PA 1VRBA 5A3PA 3PU3A 5FYIA 3K3NA 5F3CA 3N9MA 5FPVA 5FXXA 4QX8A 5ANQA 5FYVA 5FZ9A 5IVEA 5IWFA 5FZ8A 5FZBA 5A7OA 4LITA 2XDVA 2PXJA 4AAPA 4C8DA 4URAA 3K2OA 5IVCA 5ISLA 5A3NA 2YU2A 2XXZA 4HONA 4LXLA 4UF0A 4CCJA 3N9OA 4Y3OA 5FYBA 5FP9A 4XDOA 4CUGA 5F5IA 2OT7A 3PUAA 5FY7A 5FZMA 5FZ6A 3PDQA 5FXWA 5A80A 4D6QA 5FV3A 5FZCA 5F37A 5F3EA 4QXBA 5LW9A 4GD4A 5A7QA 3KVBA 4QWNA 5FZ1A 5FY1A 4V2WA 5FZIA 5FZDA 5FYZA 4CCLA 3ZPOA 5FZOA 5FBJA 4GJYA 3OPTA 2W2IA 5FP4A 2P5BA 4NUBA 2Q8CA 4E4HA 5FPUA 5LY1A 2XMLA 3AVRA 4DO0A 4TN7A 3PURA 4V2VA 4BXFA 2YBSA 5FZ0A 3RVHA 2OS2A 5FY0A
chains in the Genus database with same CATH superfamily
3K10A 3K1MA 3FJSA 1IJWC 1RUI1 3EUAA 5D21A 1DGWA 2O0YA 1Y1VJ 4LKEA 4JX0A 2ZAAA 1YYNA 3MIGA 1F4HA 4GIQA 5IY5H 3NAPC 3PJQA 1S0JA 3VSKA 3A03A 3DYPA 5C9AA 3K1PA 2Z69A 3ZRGA 2KLOA 4JC1A 1NYWA 3HOZJ 1HN0A 3SITA 2VW0A 1UIJA 4I99C 1ZRCA 5C4WA 2H09A 4GB32 3VB2A 3TNPB 2TUNA 3OS1A 1PK6A 3LZZA 2VMCA 2W0XA 4OIRF 4UW6A 5JHUA 1ODNA 4XLAA 2ZEYA 2BHYA 1TW2A 5HXMA 1PK6B 4MYEA 4QPIB 4RHV1 1REEA 5EZHA 4CCJA 3UKGA 2VB6A 1LOBA 3D5SC 3DCFA 3U21A 1G9BA 4N0BA 1C1FA 3JD71 3ZKYA 3CUOA 3CF5F 2D5VA 4W65A 3WW3A 3QODA 2Y9YA 3IDEA 3T09A 3BOPA 3OYJA 1DCSA 3E5XA 3W59A 5ACA2 3O2PE 4M3CB 1JYWA 5FYUA 1R4NB 3IP4B 5BY5A 1OSGA 3POWA 4D3WA 4FVVA 3DEEA 5FJ8J 3IZOA 4HVRA 3CF2A 3F6VA 1J7KA 3AL0C 1RVF1 3NL1A 3G73A 1FYMA 2P6HA 3VHRA 3VKNA 4CUBA 2CQQA 1N78A 4YM3A 4DXZA 4AR2A 2DA4A 3V0BA 1D4M3 1YFXA 3DFGA 4D9JA 2ZHNA 2DO7A 4XXPA 4RSUA 2CRGA 2FHRA 4BJ6C 3LGRA 3OSFA 2GNMA 4YPJA 5AC92 5CKNA 1UYXA 4BMEA 5CKTA 2QKMB 3ETQA 1ZZ7A 2D5FA 5CFCA 2L4AA 1X2MA 1FV2A 1JU3A 5BNNA 3H3UA 1HRV2 4K1ZA 5FYBA 1MVQA 4AEJA 3MHZA 2P4EA 4K7JA 2ID4A 3I3QA 2AEYA 4ZZ5A 3ECOA 3BUCA 2E36A 1UPIA 4K9SA 3TN93 4XIDA 3CCUI 1ND2B 2QLZA 3VUOA 3HM5A 4KMQA 2CUZA 2XVKA 2RHPA 3LA3A 1W9SA 1QZZA 3MV11 1AR61 4UBHA 4DEVA 2YZ4A 1OPMA 4M3CF 3BC8A 1JHNA 4NROA 4KFCA 4Q0SA 2OPKA 2H8RA 5CG9A 4QDRA 1H9WA 3WU2C 1V9U2 4UW5A 1WI9A 2C5DA 3L9FA 3J7AO 5FZ4A 2Y9ZA 5FZGA 2HGCA 4JHZA 1Z77A 2XPUA 1BC8C 4XLHA 4KITB 4JX6A 3GCXA 3AM2A 1OCOH 3EB7A 1WVRA 1VB4A 3MZ8A 5JOXA 1WWXA 2K3PA 5DS9A 2RVAA 4UFKA 1VTNC 4AVVA 5FY4A 2CFXA 2COMA 1UHWA 1Q5OA 2VBZA 3PQKA 1Q8PA 5JVGF 3G1OA 1U5ZA 5GM0A 1FNNA 4XMYA 3LPGA 5A33A 4MUVA 3K2OA 2B9UA 1W6NB 5FROA 1VQNI 2VQGA 3PNVA 2IZWA 4BBRJ 4Q5OA 5BYNA 4AZZA 1CAWA 2RGVA 2J1SA 1UZWA 4L0ZB 2JRMA 2XPJA 1Y8QB 3EUHA 1LR5A 2AQEA 1MS4A 5LFAA 2XBO2 1VBA3 4KG8A 5D4SA 5D6FA 4LHSA 2FD8A 1NE4A 2C9KA 4JQFA 4B29A 1PO23 5FZ0A 2HYJA 4QLCU 3GBFA 2JEMA 4QKNA 2A07F 2QQKA 5F9TA 3GTQJ 1E0EA 4HAMA 2CSGA 5HCBA 3CC7I 1DQ6A 3UGHA 1NG7A 4OQ9A 2AACA 3W6JB 4Q29A 2WT1A 1A5JA 3I4PA 4I3GA 2WQZC 2EXJA 2G7HA 3JAMK 4LO5B 1OOPB 4LTAA 1CD3G 3THTA 1JE8A 3ZX7A 3F8BA 1RKWA 2OQ6A 2ZA9A 2MGQA 1UL9A 1XX5A 4B1LA 2DOFA 3AKZA 2O9LA 2BZTA 3WNMA 1MIJA 1YJLA 1XJAA 4Y33A 3M3EA 4QAWA 1LAJA 4FOWA 2IAIA 2LD5A 5B5EC 1SFOJ 2HWE1 1ULCA 5FYVA 2BHZA 4YIFA 4O3MA 2LC2A 4AAPA 5E8IA 4MHUA 4CEYA 5HXVA 1XPWA 3B5LB 3HMYA 3OYDA 1U3EM 1ZZ6A 2P3YA 3SLIA 3SDBA 2DURA 2VCMA 3PO3J 3MIFA 4V2WA 4BY1J 4JDOA 1UZYA 4I76A 1SLIA 1D1BA 2MH2A 1WW6A 4E4HA 2P5BA 4NJ4A 2XASA 5J1XA 4G7ZF 5LRRA 5IK4A 2HWB3 3HNMA 1Z21A 4IRHA 3AKQA 3AFHA 4DGWB 1G3YA 1O4TA 1T2KA 2VPRA 5JCTA 3HR9A 3S93A 1X1PA 2PLV3 4MFDA 4JV4A 3ZQ7A 1SFEA 3SDGA 5JXGA 3OIOA 2ELKA 2WWJA 3PMSA 4PT6A 2M8GX 4A3GJ 3AB0A 4NAMA 4ZYGA 2VUMJ 1YTYA 1KYZA 1FEXA 2DOAA 5FUPA 2GXGA 1B35A 1W2OA 3VL9A 4W6XA 1EA3A 4KN7X 1V0AA 2FDIA 3U11A 4HSLA 4XN0A 1C8M1 2Z99A 5C7GA 5FYMA 3T08A 1N47A 1VQ8I 4M3FA 2CGNA 1EYBA 3W2WA 3IM0A 4IE6A 1ERDA 4BY7J 2DCYA 1ASJ3 4E7IA 3WHBA 1JXNA 3A7QA 4YG2F 3WF1A 2P3IA 3HT2A 5A3NA 4COVA 5T3NA 1SMVA 3TP3A 3J7YJ 4A3CJ 2ZMNA 1ZKGA 3OL4A 4IHWA 2WO3A 4BM8A 1CAUB 1TNRA 3K1NA 1H30A 2WINB 5KC6A 2ECCA 2PEXA 2MLGA 4HVQA 2HNHA 3OGVA 3AVRA 1A78A 5I0RA 3I53A 2PELA 4MGKE 1W3XA 3KFWX 1X58A 5A3WA 1FX5A 1ETYA 2V7FA 4NIIA 2HWD2 4PI2A 4ZYEA 2OXBA 2DMUA 3RRDA 1G9FA 1FOWA 1Y0NA 5B4NA 2R4GA 4EQQA 3FHNA 2XAUA 4AQ6A 5CVUA 4K8RB 2AYHA 2ZTNA 5A1FA 4ZZLA 5DAXA 4BHCA 1IKQA 1XNTA 2QCOA 4BNCA 1XGOA 4U2AA 2E7AA 1UAAA 3U37A 2STTA 1UXZA 3WHUA 2OVUA 4OHZA 1BBYA 1GT0C 2PQSA 5IP6A 3HUGB 2VZRA 5F3GA 4NQWA 4IJAA 1H9TA 1C1LA 1HX6A 4UT5A 3UT0A 5BQTA 4F55A 2E6VA 4DNCA 1U5TB 3RKWA 2ZJRF 3GHMA 3PJRA 2PQQA 4YM1A 2VLAA 1RUI3 4YW4A 2F6BA 5BNOA 4UF0A 1WJ5A 4KGQA 1GZCA 2CWEA 4D5CA 4YG3A 3T2OA 3T4VA 3WTTC 1HRV3 5GPAA 2W52A 2MH9A 1KFXL 1V5GA 3TNQA 4OUSA 5HLIA 4Z2YA 3CP2A 1SMTA 1VF9A 3O1OA 1YO8A 4MADA 3VYTB 2VNRA 2GWRA 3J7NA 3NJXA 4A3EJ 2WO1A 1ZR2A 3KP7A 2MABA 4CU8A 4P9GA 2JA7J 4CDWC 2PHXA 3O6BB 3BROA 4I98B 2K7LA 3HOTA 2VULA 5FYCA 5D6EA 1R9TJ 1KXGA 1WCQA 2QUFA 2HU9A 2GU9A 1Z6RA 3JSOA 1VMHA 3SZTA 5BPIA 3A1YA 3X2QH 3WF4A 2RG4A 2W48A 4A7ZA 1UU4A 4CYCB 2M1BA 2PQ8A 5K7FA 3KLSA 5EEGA 1XSVA 5H6QA 5K5RA 3H8XA 2FD5A 5BNOB 4XYXA 4IEQA 3CO2A 1K5MC 1ZRDA 4JKMA 4QPOA 1GXPA 1AYN3 5FLHA 3WOGA 4OIOF 2E51A 1ASJ2 2RDPA 2QNKA 1QF3A 3ME2A 2SBAA 1ULOA 3CLOA 3KZIC 4NDLA 2JXAA 4M4PA 2QQLA 3PNTA 1ENXA 3FN9A 1LEAA 5A2QZ 1PX3A 3U07A 4DRVA 2VKDA 3VEPA 3HSFA 3G71I 3ALQA 2PI0A 1QGLA 2ZGSA 2EB7A 5E3NA 2EIJH 3ES4A 2ME6A 4DXTA 3BZKA 5A3UA 3OB8A 4BH9A 3CESA 1TQ5A 4C1XA 3J7LA 4CO8A 2ZMLA 2BP6A 3W2VA 1T2XA 3DEMA 4IEVA 4ENNA 2BEOA 2C6SA 3L2RA 3DXJF 1CAVB 4J1WA 1WH7A 1N1SA 5FYSA 1KD7A 3EMRA 1V5EA 4Q4Y3 2EAKA 1QPIA 4D7NA 1HXS1 4HN1A 4EWDA 5KXEA 1R36A 4A4AA 2V9VA 1W0TA 1IV8A 2Q30A 4UHTA 4GRIA 5LZ6A 2VBBA 4O9GA 3DBHB 1G3WA 2ME0A 1LGCA 1YQ6A 4RLFA 3WG7H 4YW7A 3VBHA 5CQEA 2TBVA 3AJYA 5FLIA 1LOCA 4IOAF 2DVAA 4AAXA 1KDMA 4H7LA 1FIAA 1H9PA 4EEFG 2DVBA 1RUOA 4INDA 1YW7A 4B44A 3FLPA 5FIXA 4D7YA 2MHFA 2F48A 4A0YA 2UXNA 4YYOA 2C1FA 5F3IA 4XOTA 2EV6A 1SDWA 2R93J 2CWMA 1RYYA 4AI8A 2W92A 2OYZA 1QY4A 3SEZA 5ISLA 4YVSB 2XXZA 1W0UA 2JG9B 4Y20A 5A33B 1NQJA 1WPKA 3A22A 3BTCA 4KT5C 3EO6A 2A3XA 4E7LA 4XMAA 2BFUL 2IS2A 2QQ8A 2DVFA 2WLQA 1POV1 3VDDB 1U78A 3IAQA 3OYIA 1UY3A 2DOEA 5BPDA 4IRIA 4N7UA 4YG0A 3Q8BA 2J42A 2GLOA 5LHHA 2HEOA 3DLAA 1GR3A 4WVMA 5BMZA 2CYYA 3SHFA 5FUNA 5FYYA 2CQNA 4JGYB 1QXJA 2DVGA 5A3MA 3Q0WA 4LK6A 5D4RA 4KWKA 4CDWB 2OA2A 1GXQA 2MW8A 2JQ7A 4HDUA 4GO1A 2A1XA 2ZGTA 2DJNA 2EIBA 4CXYA 5JSRA 4XE9A 1QJX3 1VBB1 3KV6A 3UESA 4UYBA 4XRSA 1S55A 4IEPA 1ZRIA 1C5IA 4MGYE 3G6EI 1TMF3 1PNFA 4NE9A 1WGXA 2OUJA 5FKBA 3LOBA 3R0RA 3TWIA 4E27A 4CEYB 4U0YA 4HBLA 3PVBB 4AEDA 2KPMA 2A73B 5F0CA 2XPWA 1YO5C 1J3QA 2EXKA 2RJ2A 1CF7A 4ETSA 3AG3H 4PGHA 1J09A 1XYNA 5JWPA 1BEV3 2P17A 4C2UA 3SJMA 1R49A 1XMXA 3RI8A 2ZX4A 1US3A 1T08B 1B6AA 4QD2A 4NHLA 1GWMA 5F08A 2LK2A 1FMD1 4LBJA 1ETOA 4QKBA 5E1RA 2FOKA 4V2FA 1UX7A 2V73A 1JKQC 2VXRA 4LLFA 1R1UA 4J1XA 4CCLA 2IA1A 3BGAA 4YLZA 3WV6A 1IG7A 3B01A 2DQRA 4P9IA 3OJBA 1FNYA 2R061 3EUHC 1MPXA 5JIAA 4A6OA 4CCNA 1F5JA 1BMV1 2XKOA 3CLPA 1LHWA 4A6EA 3OYWB 4JGYA 5L36A 4PCRA 4B1MA 4PBPA 3B3QE 2L7MP 5LA0A 4BLIA 5LA1A 2QGUA 2CNAA 1GZWA 3DUIA 3T2QA 1XCBA 2MBFA 4ASLA 2Q2EB 3BVCA 3UYJA 2BOLA 4OQ8A 1DU6A 3AG1H 2LS6A 2ZCWA 1B9NA 4FTEA 3TEYA 2D3PA 2J22A 5FY5A 3DCQA 1QIQA 3I8TA 2QZ2A 2JDYA 2ZABA 3BCWA 4L9NA 4LJZF 2C24A 2BVMA 3I2HA 4JQTA 1NQDA 1MJBA 3H0GJ 4C90A 2D7FA 3IC7A 5FYIA 3OSDA 1SG3A 4QX8A 4XJ9A 2BW3B 2QQUA 1R092 3D6EA 3K70C 3WEZA 3BPVA 3DPRC 2VC0A 3CCEI 2ZGUA 4QMAA 3ELNA 1YJKA 4ES9A 3Q9SA 3SCFA 2D1VA 2LKXA 2VNGA 3SQOA 5KNLA 1A04A 1QVUA 5C33A 3K4JA 4LO6B 2VIXA 3AG2H 3TOJA 4NUBA 2CW7A 1T95A 4UFIA 4ATFA 2YU3A 3I2JA 3I4IA 5A7WA 3W20A 4EROA 1HXDA 5SV8A 5DDGA 3NNJA 2RS53 2OQ7A 2NQYA 4GWJA 2GC3A 2R042 4GMP0 1W36D 1GOFA 3CCMI 2E71A 4LO7A 2EH3A 3H36A 4JHTA 2KT0A 1JGSA 1V6OA 4NPLA 2NVQJ 3KP5A 2K02A 3OOUA 5ILSA 4BE3A 2JE8A 3HOXJ 3V8JA 3OYFA 3KETA 1MS5A 1JS9A 1XPXA 2DBNA 1Q1VA 1J3RA 1SC7A 4D69A 1BI3A 5FZ3A 2OTJI 1COV2 4LLOA 5A6XA 1EH6A 3PM1A 2KIFA 5FK7A 4TSVA 2VG9A 4IV3A 5EDNA 3ZMUA 1MMAA 4ZONA 1YEWA 3N9MA 1K78A 4KWJA 2EWNA 4RAFA 5DAWA 3JU9A 2CYFA 2VMDA 5IVCA 2IEKA 2JB4A 2A6XA 4HONA 3WSOA 2PTMA 5AIPA 1XRUA 2X6WA 1RETA 2D6KA 4RA2A 1MMSA 2P6TA 2FEZA 1MMNA 2MEV2 3KCYA 2F4PA 3JD72 2QSFX 1U0AA 2IS4A 2QZ8A 4UVCA 4WWCA 2R071 4DO0A 1K5MB 2JMWA 1MZFA 3S7EA 4LG3A 5C4XJ 4P55A 3M1EA 2MD0A 3K3OA 4ASMB 2DPUA 3COAC 2E19A 4IHTA 2JA6J 4MHGA 4R9CA 4E8CA 1ZGAA 2IGNA 3LFUA 2WA4A 3D5OA 4FPYA 5DEQA 3R0JA 4BA6A 5L3EA 3DL3A 4GH4C 1R00A 5B1BH 2BPA2 3LD8A 1X1DA 4CDQB 2XBO3 4R9DA 3TKYA 4R8HA 3T1LA 1DG6A 3M3YJ 1ETQA 2KQRA 3DXUA 4XOGA 3PTYA 5IJRA 5HDKA 4UVBA 3M9AA 5JZGA 3KYCB 5M0TA 4WM8C 2QM3A 5K0UC 3FBIB 3M8FA 4XUPA 2V9KA 5LD2C 1L7LA 3UKVA 5E79C 4CDGA 4XJ8A 2LTNA 3ZM8A 1GP5A 1SFKA 1BC7C 4MEYF 4NVPA 5LATA 5J3LA 4I30A 3UJQA 1JI6A 5KAFC 1LFBA 2LM3A 1HRI1 1GZTA 3Q0VA 3BR6A 3HQXA 4E4SA 2RAEA 3LFIA 4Q8LA 3FBMA 4ITCA 2VJXA 4GD4A 3BALA 3D1NI 1U9OA 1OYWA 4FPLA 2KISA 2RNJA 5E1ZB 4EJOA 2GH8A 3J8F2 1FOKA 5AIQA 1AU7A 4M0NA 2HYKA 4IGOA 1QVTA 1BKZA 3EJKA 3AL6A 2V79A 4R9AA 2VN2A 5FLXZ 1RTVA 5KXBA 4LK7A 4JGZB 4BE2A 4V2GA 2JWPA 4LLGF 2WZR1 3VZJA 1DDNA 2LF7A 1O7LA 3OBRA 4JDNA 2KDOA 4GZ9A 5FRMA 2ESHA 5J1RA 3L09A 5GAGJ 2EALA 4YW1A 3QCWA 1ONVA 4QQ2A 4RFRB 3ISPA 1B72B 2ZACA 1RUH1 4YFKF 2LMDA 2ZBKA 4UNOA 1LRHA 3FXQA 1JZ4A 1Z0HA 2HQNA 1JKPC 3DPUA 2RV9A 1COV1 3H50A 4UW3A 1XYOA 2KIUA 4HT1T 1RKTA 4JGZC 3H7YA 4FISA 1PGW2 3AK0A 3KLOA 3IAS2 3PMEA 4RS5C 1STZA 2BZDA 4ZY9A 2BWCA 1Z3YA 4L9JA 2WKKA 4XVHA 1RUH3 1EPWA 1ND3C 5I0UA 4Z8BA 4AQ2A 4AWDA 4A3FJ 3WW1A 4MGQA 2G9WA 4KH9A 1ZLKA 3WU0A 3UETA 3P1IA 5DG2A 1LHOA 1ORKA 3E97A 2LY2A 1FNZA 4YZ2A 2NNYA 1UHMA 2DMNA 3CTAA 1QZYA 4IEOA 4XMIA 4N4NB 1Q8OA 2ZHKA 2ZBJA 1PDNC 1GP4A 3B9CA 5BNNC 5FP4A 3VBOB 3E0JB 4CDXC 1UELB 4AYBA 1KGYA 1TME2 1TNFA 2VQHA 2V4VA 1W2TA 5F8PA 2KDZA 2L2OA 4Q4V1 2WLPA 1WH5A 3K77A 3GJAA 4W50A 2CW8A 2KHMA 1WUVA 4BYYA 3MW4A 1A3KA 4M0HA 5C5UA 4WXHA 3FFZA 3F95A 4PF1A 1C28A 3C7JA 4OHXA 3WQ0A 4HX7A 1WRJA 4RGKA 5KHDA 2W1WA 5JI9A 3QU6A 2WAFA 4H55A 3HOYJ 1NG0A 1QZEA 2O8XA 1W8ZA 4K1YA 1RMU1 1U5IA 5FO5A 4XF9A 4WVMB 1PVC2 3J9SA 4YZ5A 2ZXHA 3HL2A 3CIHA 1ZM1A 3ZN4A 2M4GA 3MAJA 5DPNA 2HWE2 1OYYA 3OYKA 3F6OA 1J1LA 4RR3A 1H4GA 1LGBA 3AJZA 1ZBE2 3HIFA 1MS0A 3T1BA 3BY6A 2WZPP 1EPZA 1APNA 4DQ2A 1OF3A 2WIIB 2V5YA 3F8NA 1ZBA1 3KGLA 2RR13 2JB8A 1VBC2 1AR81 2EIDA 1EV11 1PO11 4CICA 3MZHA 1PMJX 2ZEZA 2FQ4A 1V6JA 2XSJC 1XSDA 1QJX1 2EIEA 4B1RA 4HA8A 5FQ0A 3KZYA 5H9PA 5C4WC 5G04L 1JJ6C 4Q8KA 5EIYB 3S2DJ 3TEWA 4R1HA 4HW0A 2R7XA 4XTPA 2D6MA 4F52A 3VDCA 3ERED 5IK7A 1DPRA 1WLDA 2KXLA 2GQQA 4R4ZA 5J7MA 4CU9A 3CHXA 1PO13 4UB6C 5I0SA 2ETEA 3POGA 1J75A 5FZFA 1CAXB 3MIHA 3GX4X 4M73A 1MJ9A 1YJWI 5DZGA 1JUMA 3BI3A 2DI3A 1RIRA 1YITI 1FMWA 3VLBB 2FDJA 3GBGA 2ARAA 2SLIA 4AEKA 1LUJB 2BXZA 4ZU5A 2OPWA 4E2SA 2ADUA 2DUQA 2NN8A 5BPXA 2X6YA 3V7SA 1NXD1 4I09A 1IQAA 2VOKA 4JTOA 2K0GA 3MFCA 4QPGB 4ENKA 2QDRA 4N43A 2BTVC 1TWAJ 3NVCA 4AHWA 3BG5A 2VZOA 3W9AA 1MSFC 3WHCA 4A69C 4UI9L 4AGGA 1RITA 2JG8B 4ZXKA 1FT9A 3H3LA 4NBQA 3PSFA 1FPN1 2E1OA 3DF0A 5A80A 5JIUA 5FZCA 4BQNA 2WNUB 4DZGA 4DEQA 4C0HA 3FXLA 3CMMA 4QX0A 1LDDA 1D0YA 4BBSJ 2D40A 5DDJ2 3BQYA 3FKIJ 3KYLA 2GNDA 3FDYA 5FD6A 1UO9A 4OMDA 3WE2A 5DTDA 3ZXDA 1FBQA 1HQWA 4QPWA 1MDMB 4JKLA 2WNUC 4XCAA 5L3BA 4AVCA 3WDXA 1DQUA 5ACA1 4Q4V2 1HSTA 4XFHA 4DY5A 1LNWA 1DYPA 1YUDA 1H1MA 2LF8A 3HT1A 3DBLB 5AVPA 1ETWA 3BQZA 1RVF2 4XFBA 4QKDA 4BEHA 4NPMA 4FAGA 4Y5SA 1E5RA 3ZMDA 4UUSB 2E5NA 1VPHA 1UIKA 4PUSA 1J2XA 1RMU2 4B7KA 1FATA 2PG4A 1AYM2 1UG0A 4NIAA 2D6LX 2G9FA 3K7AJ 2RQPA 3M4FA 2VZUA 5DM7F 1XOYA 3HYIA 4ZH4F 1JI8A 2WADA 1JHHA 2YB7A 3K51A 3KMHA 1VQLI 1MS1A 4G4FA 1ZARA 2RNGA 2WFPA 3GO5A 3W21A 1AR82 1UAIA 1Y9MA 2PMZA 2VUAA 1R5GA 3FHIB 2E31A 4ESJA 2OA4A 5FZIA 2HWVA 2WY8Q 4XEZA 4TTGA 4G6DA 2HQ5A 2W2IA 1MS9A 5L9VA 3VODA 4XIOA 4GMP3 1PM4A 4D8MA 4E7JA 1IXSB 3CMGA 3AXEA 3ECHA 3FXRA 3N7JA 4L92A 3MKYB 3DP7A 1H88C 4E2QA 3H1MA 1GICA 3IB3A 4MTDA 3NNGA 4HLTA 3PNAA 2H0VA 5A7SA 2Q8DA 2ET7A 4B7EA 2Z33A 3OD0A 2LLKA 1V9U1 1FTZA 5TISC 4BXSV 3BLYA 1UX6A 5D5WB 5M5XJ 2JENA 3J4UH 2ZMEC 3RZGA 3MICA 5FGMA 4YRVA 1J0RA 2W1OA 1XG1A 3O8HA 1JYXA 3UNGC 5BOXA 2XHKA 2V5DA 3NEUA 3AL5A 4N90A 5FPBA 5FPAA 3MPBA 4S05A 1NLSA 2ID3A 1WJCA 3OMYA 5E18F 1WMEA 3U9GA 2YG0A 2Y0MA 3IBMA 3KEQA 1NCRC 1Q8SA 1STMA 1OR7C 3LOIA 2E1CA 2EAAA 1JUPA 2QSGX 1LU2A 2UWAA 4LBQD 1WCKA 5DQ0A 4AWXB 1XCVA 1NE6A 2K3FA 1SD4A 5GJ6A 2L0KA 4YNIA 4ESFA 4COWA 3K4KA 4K40A 1O4YA 2W1QA 3I9V2 4ARYA 1D4M2 2RKHA 2W87A 3QAHA 3WF3A 5JOWA 2XBO1 2JIGA 3BTIA 2HJIA 5DDJ1 2ISZA 4NHXA 5HLTA 4ZKTB 2IWGB 5FKNA 1AR92 4Q47A 2A71A 3QBQA 1LKXA 4LD5A 2AREA 3MBWA 3LAGA 3SMHA 5ILUA 1Y3TA 5ICFA 2BNMA 3VKFC 3ASNH 1R5ID 4F83A 1BOBA 1JU4A 5IYCJ 4QX7A 5M5WJ 5T5PA 3KP3A 2X9DA 2CWSA 2XLAA 5J36A 2JN6A 2K9ZA 4PFPA 3MFAA 3A0NA 3HHHA 3HPNA 2BU9A 1L0OC 2XGDA 3G1MA 4HX8A 1JBCA 3D8CA 3RMYA 1AYM3 4IUGA 1R5HA 4Q0PA 4HNTA 1QA6A 2DTWA 2L02A 1EAH1 3IMMA 1O8PA 2CU7A 5F1RA 3LMMA 2V6EA 2EICA 4II3A 1OT5A 5ICEA 4QHZA 1IS5A 1Z67A 3BOQA 4D7SA 1FYKA 2P34A 4KWLA 1WKMA 4NHJA 1SLBA 5EGOB 1Y9GA 4F91B 5LGTA 3KZZA 5M3MJ 3L9JT 2R7WA 2CSOA 1JMUB 4CTEA 3E5QA 2A7AA 3I3DA 1ACIA 3N9OA 2BY1A 3JW4A 1O91A 2YS9A 2PJRB 3TYJA 2NVUB 3H9QA 3PDQA 4C0BA 2F5DA 4XLNF 3JUUA 2WAQA 3AYEA 3ZFEC 3FK6A 3VZOA 1BBT3 4F3JA 3BU0A 4WVWA 3SC7X 2F4IA 4JGYC 2Y6LA 5FCCA 2R7FA 1RUE2 1OQDA 1SLAA 4MQVA 2XONA 1I5PA 5FQ0B 2VL8A 3SH4A 3Q9VA 4ITVA 2VY0A 1TWFJ 1S0FA 4XURA 3M3IA 1OPCA 2CQ7A 1W6QA 4CXXA 3ENRA 4RGUA 1MBEA 2AENA 3WNLA 2RS31 4NIHA 1VBE1 3AMQA 1RUF3 2DODA 3VHNA 1DU3D 4QWQA 2LUWA 1F35A 2JIJA 4E6KG 4XSXF 4M6XA 4XKBA 1ZR4A 3MN2A 2DBIA 3DTIA 2DK5A 2UWCA 3B94A 4GKXA 3K4NA 2XRLA 1KU7A 1YX3A 4CP0A 5GAEJ 4XFCA 2XF5A 3BDDA 4YIIA 5T54A 3OG2A 3GFLA 2UWMA 3T2TA 3AKPA 3M8JA 1Q8QA 1I6HJ 3CCVI 1FOD2 2UY8A 1KITA 3LSTA 4XQFA 1LCLA 4ZPIA 3PIOF 3PFIA 1ENSA 3S57A 1CWPA 3QP5A 1D5YA 5FZ7A 4G9YA 1CAWB 4LR4A 2JZYA 1A36A 2VXZA 1HQLA 1H8TB 3UR3C 2IBDA 2V6CA 2VOXA 2YGMA 1VIWB 1W03A 3CJNA 2XL9A 3ZFFA 1WMXA 2X85A 1XBFA 2A6VA 2W84A 4OHWA 5F27A 3RFRA 3FWEA 2WS91 3RJPA 1BI1A 4QTRA 3ESWB 1W90A 1SBEA 1VFCA 2CS3A 2FRHA 3CLQA 1GUUA 2WAAA 2P5VA 1TME1 2R5YB 2H0BA 1HF0A 4Y4RA 1Z05A 2WYFA 4QM8A 3WNNA 3VBOC 4N7IA 2CAVA 4YVWC 2WT0A 4ZXEA 4QB6A 4AI3A 4C2TA 4AFCA 5FFXA 1H9GA 2HWE3 1HW1A 1LJ9A 1WBFA 2IUWA 2GIVA 2VZQA 4XKVA 1PX4A 1O4ZA 4XDPA 1RVF3 4XQDA 1LHVA 3S15J 2DA2A 1G7YA 4NHMA 3MF6A 4JAAA 1M4WA 3QLQA 1U8RA 1EAH2 4HN0A 1X36A 3OPWA 3FBYA 5EFUA 3C3VA 1PZ7A 5IW0A 1PO22 2BY3A 4IERA 4KN4X 1BIAA 3ZQHA 5SV5A 2JA2A 1R091 5FOJB 4Y3OA 1ZBA2 2BBVA 2P2KA 5J96B 5CLSA 1CN1A 2XJVA 4AU7A 3QPSA 3J8F3 3FISA 2HDWA 2VASA 1QJX2 5D5VB 2VTXA 3HOWJ 5CPRB 2X5IA 3GWZA 3VPRA 5HCHA 1RUE1 1W6OA 1ZX5A 4B48A 2GA1A 3KSCA 2A05A 5CU1A 4AQSA 1GQHA 4QQOA 1XGNA 4S0HB 3WXPA 4B4PA 2X6XA 1LE8B 2V1UA 3LNQA 3JSPA 5JMOA 3KX2A 2YMZA 2QQWA 2ILMA 4FPEA 1W6PA 3MIBA 2K9NA 5HDGA 2VO5A 1C8NA 1MS8A 3BJ6A 1HKSA 3SYTA 1ULEA 1EH8A 3NSTA 3LA2A 1T38A 1U6GA 4AI0A 2WO2A 2LP0A 5FZHA 5HS8A 1RUE3 1LPQA 2XUEA 2KP6A 1HSJA 2WA3A 1PM7A 2VH9A 3ILRA 3POSA 4GJZA 3K4MA 4C3JJ 1D0GA 3PIGA 3RMXA 2F5CA 3CMYA 4OZOA 1RUD1 2XJUA 2WA0A 2RREA 4RLQA 2VNOA 4QPGA 2XJTA 4LULA 4UUVA 4FCAA 3KHCA 2I10A 3S16J 3QRFF 2M7BA 1OFCX 1YW9A 4CDQA 2WV0A 2G9GA 3DU5A 4YARA 4YELA 4LBLA 2FQ3A 4MGIE 1FPN2 4KG0A 2XV4S 2P4WA 4HK9A 4GB33 2VQLA 2LTPA 2KM2A 3POJA 1N3OA 5CZKA 1IZ1A 4AFAA 4FOVA 3BG9A 2XGEA 1XSQA 4P96A 3A0BC 3WTZA 1J83A 1WKYA 3CJIA 4CYCA 3ZIXA 1JXSA 1QQP2 3MW2A 3FHQA 5JUVA 4KQ7A 1ON2A 3T5XA 2B63J 3I5UA 2I45A 4PJYA 2HQAA 3A2KA 1HXS2 1HRI3 4RAZA 3HEIA 3LEMA 1DP0A 3VBSB 1JGGA 4KYWA 4DYRA 2Z79A 5J3UA 4LLLA 3BN6A 4I0BA 4BPZA 1DGWY 1AHSA 1H6YA 2W9XA 1F5FA 1UFMA 3OYMA 4XF1A 4A3LJ 3G3ZA 3WTVC 5FWEA 3H1CA 3TP0A 3MF9A 2GP5A 4YRDA 4XDQA 4XLEA 3JREA 3VB9A 2UWBA 1SLLA 3MEXA 3N35A 2L9LA 4FPCA 2DT5A 3HEFA 4P5HA 3N9QA 1BI0A 1QXPA 2B39A 3J7HA 1DYKA 1O3RA 4ASKA 1JZ5A 5CJ9A 2UXXA 3WNOA 4CDXB 3JBG3 3NNFA 2VM9A 1FIPA 2Z9OA 3HG9A 4UUSA 2L9VA 5ILVA 4KICA 3FM3A 4LBOA 4G6QA 4ASNA 4HG6B 2E63A 4AM3A 1D8JA 5K9YA 2VL4A 3BODA 3ZSLA 3I4MJ 1ZGJA 3GMEA 2W5FA 2EA2A 2P6SA 1OOPC 1QQIA 4A93J 2HS5A 1Z91A 5CVRA 2CV2A 5EF6A 1Y39A 5DUXA 3ZXSA 2EFWA 4HRIA 2C9AA 1I27A 3NRUA 2Q1MA 3ILNA 4FPHA 4I0WB 2NVTJ 3RQ4A 3QYBA 2DA7A 3R0AA 3L2CA 4XFGA 4XLCA 4FPJA 3BR3A 2RMU3 1L7RA 4CE8A 2BXYA 3AFKA 4FQ4A 4JTNA 5FZKA 1VBB2 1VBD1 2PHWA 4ABZA 4M9SA 2X29A 3ZLIA 4H0EA 4G6TB 5GAHJ 4NPRA 4HV6A 1BI2A 3KP2A 1C8M2 3N9PA 5A32A 4W97A 1RGSA 2W1SA 5JOZA 4EGYA 1AL0G 3ZQLA 3U4SA 5GKAC 1UZCA 4P14A 2YBPA 2NRAC 3ZSJA 5FMCA 2HQRA 3ZN6A 2F4OB 4XK4A 4FOQA 5IFPA 3U0ZA 4M3BA 1S7EA 4MLOA 1UMQA 1R58A 3POIA 3CJRB 5GZFA 3WE3A 2XWBB 4OVEA 5FY7A 2OCCH 1IPKA 1YIPA 4OZXA 2XJQA 4Q4W1 3RZDJ 3N3HA 5EWSA 1F9NA 5F5QA 3SFIA 2WNVA 2J5OA 1OR7A 3VD9A 3BWGA 4AI2A 2ZJ2A 1S6LA 2Y30A 2RN7A 3MLJA 4Z2WA 4V2VA 1MMGA 3RVHA 2R062 4IX7A 1R083 3PNYA 4JGZA 3F21A 4JX5A 1H8AC 4X6RB 4XLFA 1XE8A 2FSWA 3K4BA 1VR3A 3C7OA 3L2UA 3LAJA 1HIXA 3ZYGA 4ON0A 4LLNA 1QU3A 1W8UA 4BDVB 4M9ZA 4IGQA 2GXBA 2PN6A 2JA8J 3WG2A 4Z6YA 1GV2A 3RIRA 3ZDVA 3IDCB 2ZZQA 1V70A 2D44A 2DCEA 1W6MA 4RR3B 4QX2A 3SKJE 3ROUA 2OX0A 1NA1C 2LKPA 2AR6A 3F22A 2X6OA 5FB2A 3LB9A 3DV8A 5FMOS 2CV0A 2ZKZA 5DUIA 2ET1A 1NY71 1O57A 2PHUA 3JCIA 4U88A 1GFF2 1I1GA 3ZCOA 2R16A 4JKKA 4FO9A 4F7ZA 3WG4A 1W2UA 4JQRA 2E1MC 4RN5A 2VOPA 3T3YA 2ZNYA 1GVJA 1LESA 1ZYBA 1ZH5A 3LFMA 1DQ2A 1GV5A 5FXXA 4O9EA 3NKTA 1ZAOA 4YGDA 4XF3A 1ZG5A 3ZFEA 4LITA 4MGTA 3CKHA 3FXJA 2V09A 1MEC3 4QGMA 1VBC1 3KGZA 3HRTA 2KA3A 4CDWA 2L01A 1QH7A 3M3OA 2KJCA 4OIQF 5FZDA 1REDA 5KAIC 4U36A 5EYXA 3HBLA 3LQQA 2O7OA 1ZA7A 3S7IA 3POFA 4GJYA 2QQ9A 2RDQA 2DA1A 1B59A 4PLMA 3CMEI 2WTEA 1PIV3 3THDA 2JECA 2CG4A 4K20A 1C5HA 2HDCA 3JRFA 2VKVA 2VJJA 3Q3SA 4OWRB 1DPUA 1GSLA 2LRDA 1J5YA 3NWKA 4YGBA 5C44J 1VBE2 2VC9A 5IOYA 3S1NJ 3JR9A 3MIEA 2R5ZB 2X51A 4Y20B 5LBQA 2Z4FA 2BV6A 3C3WA 5DCMB 2A61A 3ULQB 3ML6A 4EJTA 2G7UA 2ZFWA 1QOOA 2W46A 4QSHA 1A35A 1OI6A 2XF6A 3BPZA 2V1DA 3WQ7A 2Z5WA 3ZYBA 4EE2A 5F39A 4DQAA 2VTXJ 3OF1A 3KV4A 3LAPA 2DFBA 1FI2A 1VMFA 4A6DA 2WO7A 1QJU1 2CTVA 2JDZA 3VDAA 5IVJA 5J6XA 4JCKA 4KGGA 4KI5M 1L7QA 4IRGA 3NQHA 5FPVA 3ZPYA 2DYSH 2BV4A 5DM6F 2WV1A 3IPVA 2DT6A 2XB6C 1AR71 3CCLI 5A1AA 4NIGA 2X09A 1W6NA 5CQGA 4C91A 4FAHA 3MZYA 1RUG3 2W00A 1FSEA 3WP3A 1X4OA 1IXRC 2XVGA 3HSRA 4QX5A 4AL9A 1AKHB 4JYKA 1CIWA 3E1F1 1HBXG 3SCHA 1DP3A 2Y34A 3RTRA 1NCRA 2YC4A 1YJ9I 3INAA 4LT5A 2RQQA 1G8WA 1E17A 3IT8A 1MQTC 1USTA 1FOD3 3WZ1A 3MYXA 4EN0A 4XF0A 3HJEA 3ZYHA 3AKRA 5DZFA 3K46A 2NAZA 2XLGA 1EKEA 3MV01 4AVBA 4WX9A 3Q8CA 4DMIA 3TO6A 5DD8A 5DUKA 2MG4A 3GF6A 1MGTA 2EFNA 3K48A 3R4DB 2LH9A 4Y5Z0 2PX9A 2IVJA 1DQ5A 3LSEA 1S0DA 1NZIA 2GAUA 3GUDA 1ZZ8A 3VBHC 1Y56A 1FYLA 4IHVA 3JQWA 3M1CA 3AYCA 1ZGWA 4COZA 3FF5A 3LSMA 1B35C 2LG4A 1R1A2 4CU6A 5FR3A 1OQEA 3RWNA 2VODA 4KJZA 4OYUA 2ACJA 4Q4X3 2CU5A 3SNMA 3QACA 5HI0A 2NM1A 1LHNA 4A6SA 4DYCA 4G3YC 2E60A 4XDOA 4XUNA 4V1PA 4U87A 3ZFGB 1FJLA 3G7DA 3ZN5A 5CYVA 2H94A 3GZTB 4O61A 1OQYA 2HPMA 5FZOA 2A69F 3M8EA 1X4PA 5HV4A 3DQVC 2VOTA 3VKLA 2VGDA 2VMGA 2ORXA 3RKYA 1LEDA 3ZSMA 4BHBA 3ZOIA 2CMPA 1WWYA 3NAPA 2EK5A 2A6EF 5JDBA 3V7CA 4OIPF 1P4AA 4PJJA 4J00A 2Q0AA 2AXTC 3WINE 4BZ4A 5KR7A 2VZVA 1KJRA 4UF0B 4AHXA 2BDRA 2IJLA 2LR8A 5EV7A 3EUKL 2Q0OA 3HC7A 4HLXA 3WTXC 3KQ4B 4EM0B 2VMHA 4DW6A 2KMUA 5FXVA 1R71A 1JZ3A 2YSRA 1K3IA 2VQCA 4IV3B 4BQQA 4GB31 1WW4A 2MC3A 3JRCA 1JN2P 1SPPA 1XMAA 3CJXA 1SD7A 2Y26A 3NV1A 1K83J 4BJ0A 1BR4A 4PJNA 4KT6A 1Q56A 2YROA 3FUQA 2IXLA 2VE9A 4RGGA 1S8NA 3VD4A 4XUTA 1HQNA 1E3PA 2Z42A 3WLUA 1SEFA 3PJYA 4D7TA 3DKYA 1VQ9I 1J59A 2ARBA 1FMD2 5F6LB 5E88A 3GZNB 3OUHA 5BNGA 1YYVA 1D4M1 3T0YA 5DAPA 1LGNA 3DPRB 1RHI2 2IP2A 2W3JA 3A4CA 1IC8A 3R05A 3CC2I 2XMLA 5JI6A 3FX3A 5FLJA 5DUWA 3JRBA 3ZXKA 4UWDA 3FMQA 3ZGKA 5T50A 4P9XA 1RHI3 2R0FA 5HNHA 1PYVA 1MBJA 2GMEA 5K4LA 5DUUA 3PL8A 1W0NA 4QB1A 4ZS2A 3KE2A 2C0ZA 2W7NA 4BK5A 1RB8G 4HG2A 3BTLA 1PUEE 1RUJ1 3URFA 4F8AA 4D0PA 3RGBA 4RMNA 1OLTA 1PZ8A 1W6OB 4BLJA 5E3LA 2F6CA 1W4MA 4EN6B 5F1JA 2AQFA 3BZ6A 3AP9A 5EJ3A 4BE1A 4DOZA 5JZGC 2XB0X 2PMWB 2HFHA 2GNBA 4G7OF 2JKXA 4IEWA 4YW6A 3E6BA 4BDZA 1V00A 3VGIA 1OCTC 5F32A 3RZLA 1OCPA 4WVVA 4A7YA 5FMDA 1UU5A 2NXNB 2MC4A 4L9TA 3AFGA 3J80K 3SEEA 5FZEA 1K6OA 1CF7B 2JDAA 2JPBA 1R082 4S2DA 3HKZN 1FPQA 2L7ZA 3IIIA 3ZQCA 2VBDA 4MXWB 3Q5FA 3DPTA 5GALA 4OMYA 2VZ1A 3R61A 4A44A 3AP6A 1LOFA 1BYHA 3AZYA 2R043 3U14A 5F5IA 1CIYA 2OT7A 3ZFEB 4L2NA 1KS4A 4QB2A 4D6QA 4XHXA 5E17F 1GNHA 4ZHNA 1UYZA 1DLCA 1OQ1A 2WQ4A 3H7JA 4FTSA 1IV6A 4GQ7A 1X2NA 1L3JA 3U10A 1CX4A 4MG2A 2DFEA 5GLVA 3S3OA 4LBQB 2W4SA 4R4XA 1R64A 1MBKA 3H3VK 4XSZF 5D5UB 1W6QB 4XN3A 2X53S 4HSJA 2ARCA 1COV3 3ZR6A 1HKQA 2PLYA 5J4YA 3O1SA 2QKLB 4ZYDA 2VPVA 2R041 1D7PM 1E3HA 3NV3A 3ASOH 3PUSA 2DU1A 5E3OA 2OKXA 3HNYM 1ZG1A 1GMMA 4Y1VA 2LOOA 5DUVA 3RZJA 2V26A 5J1YA 4A12A 1QHGA 5FKCA 2RS11 2V72A 4EWEA 4I6ZA 2P37A 5IK5A 1Z7S2 3VHPA 3TAYA 3FE5A 3D0SA 4L9VA 2B0LA 3P3PA 4OI2A 3BR2A 4ENMA 3OBZA 3F9KA 2KL4A 2K9MA 4AEDB 3A23A 3ON7A 3LSPA 3EHKA 4LBQA 5JI7A 1U0JA 2FUG2 1ST8A 4NRPA 4HLYA 1OCRH 2A3WA 2WL1A 1FAYA 2VE1A 4RM2A 2P1BA 2LFBA 4W1UA 1ASJ1 1UMZA 2Q8EA 1TTYA 1GWKA 2K40A 1OPOA 4BQ1A 1AL21 2H6BA 3AL0B 3APBA 2WNVC 1TT0A 2Y8KA 5D8LB 3NO8A 1WZXA 5JSPA 4NWWA 1RJ8A 4CCDA 1UG2A 3FL7A 5CFDA 2AO9A 2NS0A 2YR2A 3H42B 3LA7A 2PHLA 1GLNA 1P7IA 3O12A 1JZ8A 4HOBA 3SFZA 2FXAA 3UJOA 1PGL1 3A02A 4X0GA 1QQP3 3JBG2 4BKXA 2Z3YA 2Y6FA 5ABJB 5H2FC 5JSOA 3RI9A 2XH6A 2M9HA 2IFWA 1VQ7I 4ZU4A 3L2HA 5E6HA 4YW5A 1BJAA 5JMCA 3LDRA 4P9UA 1IF1A 5FRAA 3AP7A 4Z82A 2FE3A 3PVNA 5A2QK 5BV6A 1QJY2 2RE9A 1DDLA 4CVUA 2FOWA 2VBXA 3ZFFC 3OYBA 4LO4B 4GA9A 1UCRA 3C8XA 2DV9A 2VUDA 4BOWA 4PJMA 2VQTA 5EZWA 5FY8A 2L9NA 3TMOA 3GXOA 1UW8A 3VFZA 2L7FP 1T6GC 1TEIA 2D98A 2DVDA 4I3PA 2QZ3A 4KNCA 5LA9A 1HDKA 4WV8A 1YG2A 2ENRA 1BIBA 1VAVA 4LNVA 5CKQA 5FJKA 1POV3 5BNPA 3QP6A 2R3SA 2QFEA 3GZ5A 2XSDC 5JXIA 3GZAA 2O03A 1WLTA 1MNMC 4FSJA 4Q4X2 5A7PA 3WP4A 1YS6A 1W06A 2EZKA 4YM0A 3M7GA 4AYBN 5HDNA 1FOXA 2ZMKA 2XIGA 1ZN2A 4C3HJ 5IWFA 1VJ2A 2E26A 1JYIA 1OURA 1LJ7A 4HXCA 2ZXJA 4GWNA 1G59A 3T4HB 5FZ6A 5FV3A 1MBHA 1V6MA 5JLWA 2P3JA 1C8M3 2WRAA 2Y2ZA 3VZMA 4L0YB 2YUEA 1XB4A 3BB6A 2DCJA 2CGPA 1XGSA 2M45A 2BERA 3ITQA 2DDUA 2WAEA 4RQPB 4NIDA 2DLLA 2L9SA 1D3YA 1E5SA 2VVDA 2DQLA 3IL2A 4XQ4A 1Y6IA 2LVSA 2RMU2 3TW7A 3BYWA 1CZSA 3ACLA 4GH4A 2OW4A 3I3LA 5GZCA 1AXKA 1W6PB 3H5AA 2GMPA 2ZC2A 4A41A 1XYPA 4OCTA 4FE4A 3TEDA 2RS12 1REFA 1RUH2 4GWIA 2FMLA 1GBGA 4YW2A 1D1AA 4BQ3A 3ZMSA 2RM21 2BVBA 2YYOA 5FDBA 5FXZA 5C8CB 4IDZA 5G05L 2VW1A 1S4CA 2JE7A 1H2LA 2DMTA 4UXNA 5HBAA 1R7JA 3UKTA 3E1SA 2G0EA 1AYN1 3ZFGA 2EV5A 3MO4A 2ZGLA 3OBTA 4URAA 3UGGA 1F4AA 2Q8OA 1DZRA 2FCVA 2VVEA 4LBKA 1IG0A 3J7MA 3ZXJA 1S0EA 1USSA 1EP0A 1JOBA 2W47A 1CQTA 4IV3C 1OH3A 1PUFA 5KHIA 2D45A 3VBUC 1E5HA 2RDNA 2VBPA 4P00B 5IT9K 5B3SH 4QX3A 3JBG1 3ZQFA 2Y6KA 3H0OA 5HLHA 3VN4A 5A70A 4Y1UA 3V0AA 2QBYA 2FDHA 4WVZA 4FXGB 1I3HA 3OYLA 5EG0B 4A3IJ 3RWKX 2ZKNA 2KRCA 2QA4I 5GZDA 3KCCA 1QDOA 4CP9B 4Q26A 2R7SA 1V5FA 5DV5A 1Q8VA 1D0XA 1K79A 2W68A 4KUMA 2JD4A 1G4DA 3SISA 2IT0A 4XRSG 1NA1A 2ISYA 2WDBA 4PLNA 2ZKLA 4N9HA 4Y24A 4LHKA 5B4XA 5KC5A 2BW8A 4A5MA 1N77A 4K2EA 2K9SA 4YW3A 2CFOA 4HF0A 3KT1A 1UZZA 5FKKA 2HLEA 3C7EA 4PSXA 3QYFA 2D5HA 4G94A 4OMZA 1VALA 2YX4A 3POBA 5A7OA 3ZMVA 1P7JA 1WJBA 2K27A 2A3YA 1DLLA 4X8PA 5F6FA 3J81K 2RS51 2YV8A 3NV4A 1ONAA 4LA3A 1RR7A 5J09A 2QQMA 1PO12 4AVTA 1MSEC 3GZUC 3DN7A 2EZLA 2JICA 3LOCA 1YC61 2Q2EA 3JB4C 1I5ZA 4A0ZA 5LBEA 1DGRA 1QNTA 3ABZA 4GDFA 2X1EA 2KIMA 2HWC3 1BBT1 2PMZN 2FDGA 1UQXA 4ZJZA 3PUQA 1RINA 4K21A 5FPLA 2RJLA 2QTWB 3H35A 3VYSB 1E3OC 1TWCJ 1JHFA 5AC93 5BUVA 3OIQA 1LEBA 1X3UA 3JD73 3GCMA 1KQ8A 2FMYA 4XM3A 2MFZA 1VBB3 3BPXA 4TLFA 1OC1A 2EFOA 2HWC1 2CJJA 3HWJA 2EFPA 3PUIA 3BKZA 1IO2A 4IHSA 4F3QA 3H8RA 1FWZA 1YHFA 3VBOA 5H9SA 2ZJQF 2F2EA 3G4SI 2XC7A 1IN7A 2QYOA 5D5XB 4AC0A 2B8MA 2YPRA 1GOGA 3N7LA 2W85A 1MH3A 5J48A 2WBKA 4S2HA 4MQ9F 2JDMA 3GVAA 4EWAA 2YU2A 2X10A 2DCZA 3W6KB 3MW3A 5HS7A 4URTA 3ZSKA 3AC0A 2EBIA 4Y7NJ 5ERLA 1KA8A 5A7QA 3I54A 3WVJA 3S30A 1FLIA 3AYDA 2Y38A 3EQLF 4OINF 1LOAA 5GLZA 4E7ZA 1YI9A 2F4LA 4JOMA 3GXUA 2K2SA 4FETA 1V54H 2Y0SN 2R0HA 5IVYA 1LU1A 2R6QA 1OUXA 1X8EA 4QM9A 1URXA 1AUYA 3CP8A 3FLRA 1RNLA 3QH7A 2J1TA 3P9IA 2BGOA 4XILA 3CZJA 4RD7A 3JRGA 3KCXA 2K86A 1QOTA 3VDDA 4L5EA 1R6RA 1VB2A 2QF7A 2EV0A 3USUB 2ZB9A 2QENA 1DZTA 3GNEA 1E57A 2O3FA 4L11A 2F17A 4P1WA 3ZFFB 3N9LA 3DLLF 2DN0A 4JRAA 4LMYA 1HB4A 3T8TA 1IOAA 3K2AA 1OVSA 1SFYA 3FC0A 5C3QA 4Y17A 3PQJA 3V7RA 2QJVA 3OIPA 5FZ9A 3KD4A 5FZ8A 4Z07A 4EJUA 4SBVA 2L5QA 4H7MA 2RS52 2R7TA 2UYAA 2YU9J 5LHIA 3RSJA 2HYGD 3OGGA 2HEWF 4HF1A 5FZMA 3PLQA 1QPMA 3AP5A 3ZQGA 3ZN6B 1PVC3 3LF7A 2X48A 2B42B 3D5RC 1AR83 3VBHB 2G1MA 2R32A 5J98B 3CCYA 3HRUA 1S2EA 2E2IJ 2OBPA 1JOPA 4LG0A 5E20A 4X6QB 5FY0A 2IXJA 2M4KA 1PVXA 2NVXJ 1C3HA 2ELHA 2Y31A 2V4AA 4UW4A 1W8HA 2M87A 4QDSA 3RZMA 5K8SA 2E7QA 2NP0A 3ABMH 5IUQA 1R23A 4JX4A 3M3CA 2ETHA 3R4UA 3S14J 1DIWA 1W9YA 2OC6A 4LB6B 4EM2A 1O5LA 4QXCA 2PHDA 1CESA 5FP3A 1VBA1 1H89C 2COBA 3I2FA 4LIUA 1V6NA 4R79A 5C8WA 3QH6A 4P9JA 4OUEA 3TB0A 2GSYA 1GLHA 2WWUA 1BLZA 5JLXA 3KZ4C 1ITYA 1Z3XA 1PGW1 1YRZA 3WDWA 2GMMA 4FX4A 5F5AA 4S2FA 4MO7A 5EGOA 2BNOA 1W9FA 2A6ZA 3BU7A 1EUUA 3B69A 4M3EA 3CJQB 1LFUP 3RDIA 5IOZA 1W8WA 5ED4A 1YFHA 4XUOA 4CP9A 2DYRH 2F5EA 2FNPA 1DBNA 1QBJA 1Z78A 1ZZBA 2G19A 1LTEA 4K6BA 3NAPB 1R22A 2WB1A 3OR2C 2Y64A 1DGRN 4NNJA 1BJQA 3F8CA 2JJ6A 3BTYA 3NRVA 3VHOA 4XZPA 5FRNA 4QQPA 4AW7A 3QWLA 5K5OA 3UK9A 4LO8A 2OU2A 3M4OJ 4XLPF 1BMV2 4RM3A 5IVFA 5J47A 1VQ4I 2A5YB 2H27A 1IUFA 1UPSA 3O1RA 3OPZA 5ANNA 3DXTA 5KHGA 3W2AA 2KD7A 4DY3A 1SAUA 2X4HA 2B9SA 2GH2A 1Z0XA 2VQAA 3KF5A 4MO3M 3QU3A 1W39A 3GZ6A 2MA3A 1POV0 4UAPA 5HS9A 2TEPA 4MVTA 4K3UA 2JVHA 5A7NA 2CUEA 1L3LA 1ETVA 5C3PA 2M30A 1WCDJ 1NKGA 3NMBA 1W0OA 2DUOA 4CXWA 2JE9A 5C8CA 4A3KJ 3PU8A 2WFF3 3IDAA 4D1QA 3A21A 2A6YA 4F92B 2DMPA 4BQWA 1WJEA 1X1CA 3QOPA 1OLME 2WNUA 1HKDA 1ND3A 1U5TA 5I0DA 3RCOA 1ULPA 2FBIA 4ANJA 4XRMA 5C3OA 2EIMH 2R7VA 1BR2A 1V3FA 5JVTA 3WNXA 4RS5A 3WTYC 4NMIA 2HEYF 1TBXA 4C1WA 4AHYA 1GANA 3E5UA 2HOAA 1FX7A 4B4CA 1XE0A 4QXBA 3ABTA 4GXLA 4CXFA 1PIV2 1RUC1 4TLGA 1MMDA 3CDLA 3G1LA 4YZ4A 2BJSA 3HPHA 2J1RA 3IKWA 3TN92 1ND2C 1IRGA 2M34A 3D82A 4J25A 4PQQA 1WJFA 4Y4YA 3KLNA 1LECA 3CDHA 3VBSC 5GLWA 2V1NA 6PAXA 2OZUA 2VC1A 2ZHLA 4NO4A 4EGZA 1EJ9A 4ZU7A 1MR5A 4ZYHA 2QCSB 4QU2A 4RS5B 3POEA 4NC7A 1KZHA 4QPIA 4WM7C 2W24A 4CUCA 3TOAA 1UZ0A 3KB5A 3F2ZA 3KYDB 3BR0A 4FP2A 3MCZA 1N3QA 3P6BA 3C2UA 1ULDA 2VAUA 2ZGKA 3H0DA 2GZWA 4OAYA 1XQNA 2HXOA 4ORFA 2V4JC 1IS3A 5DCFA 5IP9J 2JTVA 1DQ0A 3WT3A 2V1XA 2FDKA 1WCUA 5L9RA 1LOEA 1K6YA 2PYTA 3LSIA 4YM2A 1S2KA 1T56A 1AYN2 1YX5A 3IRQA 2ZXQA 4QQLA 4QT6A 3IH2A 3KP4A 5K7PA 2PXJA 3CUQA 1S1AA 2JUGA 4YFZA 2VONA 1P4XA 1CJPA 2R5ZA 2DU9A 3GCWA 2JD9A 1C0WA 2HBTA 2EFQA 2ZX2A 3PUAA 4BQ5A 3JRDA 1MQTB 2MEV1 4Q4W2 2K9QA 2YX7A 4LKFA 3WG3A 5FBJA 2FZ2A 4A42A 2R072 4MGSA 4EN7B 1FP1D 3CCRI 1P4WA 4BXFA 1U8BA 3OYEA 1HW2A 1U5TC 3WUDA 4AG4A 4N53C 3L1PA 2FU4A 2LW8A 5B66C 1P2FA 4LORA 1JKRC 4E7KA 1W05A 4BAYA 3DKQA 4UXAA 4Y52J 4D7MA 2E7WA 2D2WA 3S6PA 5FWJA 3CU7A 5A3LA 4A3ZA 1QNYA 1POQA 3TBDA 1K42A 1O4XA 1XTAA 2H1LA 5GPCA 2I74A 4P02B 2XOMA 4E70A 4PDKA 1J1TA 1EH7A 2VQUA 3N9NA 1XNBA 4RFT0 2WZ8A 3RZOJ 4WXDA 3HN1A 5GZGA 4LMFA 3K0LA 2XJPA 3GTLJ 4M3GA 1PP7U 3QPHA 4AVPA 4HNVA 4IPAA 4GYGA 1VQPI 2B4KA 1DQ4A 3WODF 4KWUA 1MQTA 2HDDA 4E2GA 2X8KA 1UY1A 1OISA 1NUKA 4TWTA 1CVNA 2XQXA 4IQPA 2DMQA 1OKQA 2O8OA 2PA7A 1WQ2A 3CUQB 2VMFA 5FP9A 1O3TA 1H2KA 4CUGA 2D3RA 2NVYJ 1XSXA 3MWMA 1Y9QA 2BVLA 2HWF2 3NV2A 4BJTA 2Y60A 3W3CA 1O3QA 3ZN0A 1NCQA 5A6YA 5AVAA 4PDWA 2O0OA 1OOPA 1VP6A 1ULFA 1F5TA 2M2EA 3VOEA 5F0HA 2LBFB 3HKZA 2ZX3A 1SAXA 2ZEXA 4CZSA 2E7XA 5JXHA 1PJRA 1SDDB 4LIVA 2EA4A 4FCYA 1YLLA 3LEKA 4OFGA 4MOAA 4XTMA 3HDDA 1QXRA 2JKBA 3TOBA 4YFNF 3DGTA 5AFEA 4NHYA 1IS6A 4L99A 3S2HJ 4AIDA 1DFQA 1XDSA 4PIXA 2L4MA 4XOPA 3PTRB 4LPLA 2CDPA 2GALA 4LEJA 5FP7A 1U5YA 1JZ6A 4A3BJ 1TMF2 2GIZA 1AXYA 3U78A 4R9BA 3SCGA 3MFKA 3LIGA 1QJU2 3N4MA 3WG9A 3WCSA 3O14A 4HX4A 1RUD2 2KJBA 1NLQA 3S3NA 1CR7A 3GM8A 1LVAA 5T52A 1TZOA 3RQIA 4FX0A 3OEBA 4LOCA 2JRTA 4C8DA 4RHV2 1VQ6I 3I7DA 4FP3A 3AXDA 1YLFA 2A6HF 1W28A 3LPFA 1G6NA 1EY2A 3TGNA 1NOVA 4C30A 5ABJC 4EJVA 5H9RA 1PGL2 3KP6A 1O6UA 5CNAA 3ZXAC 1G3TA 1X9PA 4TN7A 2DDBA 2WBMA 3TO9A 4M4RA 2LYCA 2IXKA 4XORA 1O59A 4DIQA 5I0TA 5L7OB 2M7AA 3DTEA 3O0WA 2HWD1 3ZYPA 1BW6A 2Y0OA 1ND2A 1Z1DA 1LDKB 1B72A 1QJY1 3ST7A 1JT0A 4AVAA 3RG0A 3G6JB 1VMJA 3M8LA 5JR7B 4UOJA 3OYGA 2PAEA 1D0HA 3ES1A 4AVZA 1GZ9A 1QJEA 1B4AA 4IV1C 4FOYA 2VOVA 4FQGA 4L9BA 2JSPA 2HVSA 3I4NJ 4UVAA 3NJYA 5DZEA 3CO7C 2JWTA 2HEVF 3OY8B 5IYYA 4CYDA 4IL7A 4UB8C 4OUMA 5DABA 2CV6A 2NMNA 3ATGA 1RJ7A 3ZN1A 3SZPA 4NC6A 2X1CA 1LULA 1T6BX 3MI8A 5CA6A 4ESBA 1CGPA 1XMKA 1QJZA 3K69A 4ONUA 5CFCC 1IW7F 1EV12 3ETPA 1GYKA 3I2OA 3VBSA 1K78B 1R093 2QUOA 4NC8A 4IXAA 1NA1B 5HOOA 5KWRA 2QDNA 5J37A 5FKOA 5IT9Z 2HWB2 4YFXF 4Y1YA 1TZLA 1H2NA 2ZX1A 1YE9A 5FPUA 4RQPC 3OD4A 1TNTA 3HGYA 1QJU3 1OFNA 4FTBA 3FLTA 2VI6A 4GMP1 3KEYA 3HQRA 4H4KC 1YIJI 2PFWA 1XU1A 1MBGA 3Q8AA 5FZLA 3DU6A 1OXCA 1AR62 3I0TA 2RS32 4EATA 1CAVA 1W5TA 3H9AA 4ISQA 5GZEA 2KRHA 3IAPA 3BTZA 1TG7A 1RUG2 2DFIA 1K61A 2XAHA 4WF2A 1R1TA 2BRTA 1MZEA 2NS8A 5FPZA 1VBD3 3RPQA 1HN1A 4JP0A 4LA2A 5FMOL 1MKMA 5D1IA 4BQ4A 4YG6A 3R4SA 1R1ZA 1FOD1 4X6AJ 4A3MJ 1MZBA 4PF5A 1OHFA 2OQGA 3T0AA 5A3TA 3V8LA 1VRBA 2VKHA 2WQ8A 1JUSA 1UY2A 2EXHA 4N9IA 5DAQA 4AHZA 4ZDLA 1MZ6A 4PBOA 2XF7A 5FO7B 4CA0A 2W82A 2VMIA 1BK1A 4Q1PA 4YGCA 5FAXA 3ILFA 5C4WB 5IT6A 4S04A 2WWYA 2R1DA 2EPFA 1ENQA 5E3MA 2VJ4A 3MPPG 4PFOA 5IP7J 1SHWB 2E1NA 1GKBA 1X1BA 3L2YA 3GTOJ 3M7AA 1HXS3 2E32A 3MKLA 4RB0A 3RPUA 4CEYC 1JODA 2JG9C 4JBAA 3ASIA 4LK1F 3NJZA 5EJ1B 2OV7A 2WY7Q 4L18B 4WK8F 1QWRA 3HZJA 2RC4A 1JOJA 5FLXK 2YPDA 1BEV1 1OUSA 2HOSA 4QXHA 4MZUA 4IEZA 2R1BA 3IHUA 3VBFC 1VQOI 2ZFUA 2NZ9A 2HZTA 2IC1A 4XJZA 3FXMA 2EQRA 2QVOA 4KNYA 1AYM1 3WP6A 1CONA 2A70A 4I2OA 1OA3A 1VE0A 4BL0B 3O1VA 3LFKA 3S2WA 3POYA 4N53A 2EZIA 4UV9A 3WHTA 1VNDA 5DMYA 1Q43A 5EJCA 2HKXA 9ANTA 2MSYA 5L3GA 5ANQA 5IVEA 4O6JA 3SQNA 3WF0A 4M3DA 2QEXI 3ZMTA 1TE1B 1NG6A 3HB9A 2OIIA 3ACFA 2XG3A 5LBBA 3HXLA 1RL3A 3AMNA 1WLWA 3KEOA 2DXIA 1OMIA 1ON1A 2QSHX 3USUA 4AIHA 4J19A 4M3CA 4XAAA 1W6MB 2VNVA 3VZLA 3TN91 3DECA 3HTUA 2EA7A 2R5YA 1TVGA 1SANA 1MVEA 3ZXLA 4UY8I 3VYRB 2DDAA 1BCXA 4LBMA 1XNCA 4ZS3A 3Q8FA 4WM7A 4QPGC 3WGIA 1H0BA 3B6CA 2ARXA 1YI7A 1B9MA 1QJFA 2D6PA 2YU1A 3HRMA 1QNWA 3AMMA 1M06G 5CIRA 2DTRA 2KZVA 1QHHD 2I5UA 4WXCA 3F23A 3ZMOA 2EJRA 3VSLA 2VE8A 4MV2A 1Z7S3 4BQOA 2VD7A 2XJRA 2K4JA 2GC1A 1DYOA 3JB8A 1UKGA 5GADJ 3OYCA 3V64A 2ZGMA 4BISA 3GGLA 3TRSB 1UYPA 4HNUA 3M1HA 1IN4A 2VJ5A 2K46A 4AE2A 2IS1A 5IPAA 1OKRA 3VL8A 2QWWA 3C2HA 1BL0A 4L0PA 4ZDPA 1X7NA 3WU1B 2JJ7A 4BCUA 2VUCA 2VT2A 1HLCA 4A0XA 1VRH2 4AOCA 2MLKA 3IWZA 3OY8A 1IKPA 2WC2A 4G8XA 2VU9A 2LY1A 1DHKB 1HV1A 5L9BA 2A6TA 5CVIA 4B8XA 1AR93 5FYZA 1B35B 4M6YA 4N43C 1OA4A 4IF4A 5TGTA 4ENJA 4HFSA 4FE7A 3I97A 5IAVA 2FCUA 2OJED 3CD6I 1TME3 2XVCA 5C3RA 2TNFA 1W2NA 1YFWA 3NNLA 4EZHA 5BS6A 1YHQI 2WR9A 1ZA4A 4LKSA 2Q8KA 3CCSI 3LKJA 4RGXA 1NCQC 1V6LA 4Y13A 4IQJA 4UFHA 4CCOA 3WDVA 2GP3A 2W1UA 1UY4A 3ZP5A 2LNBA 5JPNB 3M3QA 1F36A 2AC1A 4HETA 1BR1A 1VZ0A 1PMIA 3ZDSA 3IDBB 1CJDA 1IGNA 3CDZB 4XXAA 1SLCA 4II2A 1UN1A 4EQVA 2BGPA 2Y0SA 3ACIA 3W58A 2RJKA 4DPNA 3BPSA 2Y6GA 5JXJA 2HVRA 1VBE3 3QYEA 3PHMA 4OU0A 1Z6TA 2B7EA 4LK0F 3IH3A 1ZBE1 3B93A 1V6IA 3RI4A 1FBSA 5LLQA 3AYAA 2JDNA 5K7HA 5BNNB 4ZC3A 3OR1C 4EM1A 4XACA 2LSOA 2ZMEB 2ID6A 4RR3C 2ZGNA 2RR12 2HWF1 2QQIA 3SKVA 2L54A 1G86A 2R7EB 1LB2A 4N53B 3I2GA 1HC8A 4HKWA 3RYKA 1UOFA 4ES8A 2JK3A 4Y1ZA 2VOWA 2YBSA 3RKQA 1S9HA 3BG3A 3AVSA 4EMSA 1ENRA 4ET7A 3NKGA 1QH6A 4WZFA 3S1QJ 5FP8A 4XF4A 1I9RA 3V4GA 5JVVA 3PIPF 5E8GA 1LOFC 2CGOA 4P9FA 3PO2J 3HGGA 4QKFA 3TO7A 3ONQA 2UU8A 3V56A 1PK6C 4DJAA 1AL23 2DA3A 3FUOA 5EJZB 1VBD2 2HVQA 2AXLA 4AFDA 4LHLA 2Y0IA 4BUPA 2G9ZA 3SH5A 1TLHB 5FO8B 2KKOA 3J7AY 3P9CA 1GQPA 4HANA 3Q8EA 2ZXWH 4RYDA 4QU1A 1OCZH 1WCMJ 2P6CA 1UKRA 3TEXA 3H3ZA 1OH4A 1TMF1 3USSA 3L7WA 5A32B 2VZPA 4GWMA 5DG1A 1T0FA 2JPCA 4PJ0C 4MSVA 4DB5A 2LDUA 1AJKA 3BZCA 4A2UA 3OOXA 3PU3A 3C2GA 1SMYF 3ABLH 3REOA 4KU7A 3O0XA 1YQCA 2WN2A 1RR8C 1UOJA 2R7OA 1ZVFA 3AAFA 3SXYA 1AR73 2HOTA 2R073 5JLVA 3HBKA 3AKTA 1FPN3 4BMBA 3CC4I 4EVIA 4PIZA 1X8MA 1SLTA 3JRAA 3O3KA 4NQWB 2GM4A 5CVJA 1B8IB 2VPLA 4HSTA 3SZGA 5HODA 3AZVA 1OBNA 4AI1A 3IUOA 4RBOA 1F43A 2WN3A 2W95A 2DF7A 4AXOA 1P6RA 1QKQA 5EG0A 5L3DA 4LGWA 3SXWA 4LUMA 2WT2A 2BOJA 1AOYA 4M9XA 3OEAA 2QE3A 4NRQA 4RAYA 2NYYA 3OTFA 1UMHA 2E2HJ 1T98A 4GALA 4E4DX 1MNDA 3AZXA 2FCTA 4BACA 4NHKA 2OUHA 1VQMI 4AVSA 4NAOA 4H14A 1W8OA 2D97A 5J8FA 5KVRA 1LDJA 4COYA 1UXXX 1XU2A 3BJAA 1D5VA 2OCEA 1CX1A 4A3DJ 2EIGA 1BZWA 1IRFA 4AUXA 1GHCA 3ACGA 4EYUA 5CAZA 3H9JA 1E5IA 2C6YA 1H2MA 2JA5J 1CAUA 2Y6JA 4P9WA 2IXIA 3VBFB 3VD3A 4Q4Y1 4PI0A 1YIOA 3FK7A 1U9NA 2BFUS 1J58A 5EP9A 4P5YA 4HL0A 3VBFA 3V0BB 1IPSA 3DKXA 1LE8A 4BQYA 4M00A 2LRPA 1QO0D 3I58A 1XC6A 3FZVA 1TQMA 3KHBA 2IGOA 1DGWX 5FFZA 3JTHA 4B3AA 3CF6E 1W9WA 4GH4B 2FMDA 2BUKA 3H1YA 1NX9A 5EHDA 5D2AA 4FPFA 1RUI2 2XJSA 2H1KA 4FPKA 1SBFA 2QKDA 4KL1A 1ZRRA 5FOBB 3RYRA 5FD5A 5LEKA 5ICGA 3ELKA 4DNYA 4LOSA 2BGCA 4Q48A 1W8NA 1A6IA 1W0PA 3EYYA 1F2NA 3DBRB 3PFYA 2HTSA 1HCRA 2YXSA 3U1XA 2Z1DA 4D6SA 3BG6A 1CPNA 4DZJA 1UOGA 2H6CA 4AYUA 2ZAHA 5BNPC 3GYDA 1S7AA 2DTYA 1KU9A 4XPVA 1O8SA 1I39A 3I59A 1WFXA 2YUSA 1G9CA 3RZHA 5LEJA 2E1MB 4LG0B 2VUJA 2YBKA 5C3SA 1GWLA 1WW5A 2VVFA 4XHBA 3K70D 5JR3A 1GP6A 1YS7A 4XZUG 5I8SA 1MJAA 4YSFA 3K3NA 3D5LA 2ZGRA 4FQZA 2IPQX 3A4UA 4A5NA 1X50A 3CQOA 1AR72 2FF4A 3BJOA 5D8AC 3WW2A 3GLXA 1CAXA 3OWTA 1ZG3A 4Q4W3 5FREA 1F4KA 3OUIA 1HA8A 1O7FA 1ZRFA 1K4SA 1Y1WJ 4BXXJ 4RB1A 2M0MA 1JH5A 2WAOA 1W1WE 1KU2A 2RVCA 4AFBA 3ZPOA 4I02A 3QOEA 5C6CA 1XE7A 1YWKA 3LE0A 1CPMA 4LOTA 1FV3A 4HV5A 1QU0A 1W7PB 1YQAA 3RZKA 3C18A 4A3JJ 2Q5TA 5CFDC 2VBWA 5J8CA 2W57A 2XWJB 2Z16A 1H8VA 1R1VA 3HOVJ 1YIFA 3ERMA 4YGEA 1W04A 4RGRA 1VRH3 1OLMA 5HCFA 3IPVB 3MMYB 5F2SA 3FXUA 4KA4A 4Q4ZF 2IS6A 1EAH3 1Z7LA 3CL1A 1QOSA 4CDUA 1US2A 1BHGA 3O1TA 3PVOA 3E6CC 5CFDB 4YVWB 1OCCH 3IKTA 2FZ1A 3K4ZA 5ICCA 1FMVA 2NPIA 2Y6HA 3DF8A 1P9QC 1NCQB 2NMOA 1X9TA 4KIGA 3J7ZI 1ZREA 5AC91 2CHHA 4Q5SF 1A8MA 5F3CA 3E6MA 1OVPA 1NXMA 2ZMEA 1IN5A 2ZOEB 3VKMA 1GDTA 3ZYRA 3I64A 1XS9A 5GLTA 2PBIA 2WWSA 3AMPA 1LNSA 2Z5UA 2CL2A 3W6VA 1PZ9A 1BA5A 3B00A 5EQUA 2YFUA 4HZFA 3S3MA 3ZKUA 1B1BA 3WNKA 1WMFA 3JXSA 4TV7A 3AP4A 1V55H 4BWOA 2PLV1 5A6QA 2YC0A 2FBKA 1T8IA 4Y22B 1QMJA 2R92J 2RS33 4BJ5C 2QQAA 5L3FA 1VAKA 4E7SA 1RC6A 1BN5A 4CCKA 4CH7A 1MZ5A 3JQXA 1JT6A 1CQ9A 2W08A 1ZQ3P 3FM5A 4D0QA 1X82A 2X05A 4HDVA 4OOIA 3DPRA 5LB6A 5HLGA 3ZXEA 1MNEA 2YDEA 5M5YJ 3ZVXA 2ZXIA 2WSUA 4CUAA 3I2KA 5DAVA 5DDJ3 3NW4A 3RJ2X 4SLIA 4L97A 4CEWC 4WCGA 5LRSA 2OF7A 5HPOA 1UZVA 3WTUC 2CDOA 1BM9A 3GYHX 3HN3A 5KBFA 1D2QA 3DTKA 2X5IC 3GBWA 2DYCA 3WGGA 2XAFA 3HSEA 3Q9OA 1MD0A 2HH9A 3MIDA 5F37A 1FY7A 3HNBM 5IYBJ 2DUPA 2CUJA 5H6RA 4RGSA 3IV5A 3C7HA 4HK8A 4X1EA 4XQWA 2QQVA 2ZGPA 4CDUC 1W7PA 5JHFA 2OS2A 2XUMA 3S32A 1WBLA 5A6ZA 2FNAA 2XKPA 5HNFA 1OFSA 1MEC1 3VBRA 5EYRA 4AEMA 3CZUA 5FY9A 5L3CA 3K6GA 4LQRA 4MHRA 1UF2C 1T33A 3O0VA 3MVPA 1H1IA 3LSRA 3A0HC 3ZMNA 5HCAA 2HXIA 4FI9A 3HJRA 4UUTA 3A01B 2VZ3A 4KU8A 3DWLE 3KWVA 5FZAA 3HOBA 3JCUC 3V0AB 1XDUA 1H4HA 1PNGA 1GUIA 2ERFA 3KV5A 4M3CE 3T8RA 2HBUA 3RQ0A 1VQ5I 2J5PA 4BK4A 1UMIA 2B9VA 2G4IA 4PSWA 1PUFB 1HJGA 4QX1A 2L9RA 4CZZA 1S5LC 2BWAA 3WP5A 1AX1A 4JZRA 2B45X 4D94A 4MGRA 3P7NA 2ES3A 2BNNA 3LEGA 1VI0A 1SPPB 2DTZA 5B1AH 1AXZA 2DPDA 4XONA 3LSGA 3NARA 4FFFA 2MYSA 4BDYA 1APLC 4DYQA 3I3EA 2P5KA 3I2IA 3RKXA 4HEA2 3KVBA 4BQAA 3GW2A 5J4VA 4L8QA 4EJRA 2HWB1 4R52A 2N8GA 4C2MJ 3I3BA 1GU3A 5LHGA 5I8YA 3GFJA 3MGUA 3J8F1 3K75B 4RGAA 4IQ4A 5IATA 1DZQA 4IV1B 3GTGJ 1RUC3 2PLV2 1BBT2 2VMEA 3S17J 1IGOA 2BBYA 2HPIA 3BCAA 1DU0A 4PCQA 4EZ4A 5IVVA 4BHPA 4LE3A 4J01A 4HQMA 4IE5A 4XABA 3ZYFA 1RUG1 5EZGA 2ZPXA 2I07B 2D1HA 4DUWA 1IZ3A 1IS4A 2VT3A 3LIHA 1GQGA 1RC9A 1KEXA 2WS93 2I8DA 1A34A 2XAGA 4CP1A 5HV0A 4OHVA 4QGLA 5LY2A 1AVBA 4IHYA 3P5JA 2W25A 1SZBA 1A6CA 4PJLA 1DGLA 5IYDJ 2A68F 4DBQA 1B09A 1YW8A 3OUJA 4XUQA 3S5QA 1MW7A 1H0MA 4FFIA 3S1MJ 3KPHA 1SVOA 4LFUA 3VDXA 3KF3A 3CNAA 3UL2A 1K12A 2A3SA 4PQ9A 3OYHA 1JUHA 4LXLA 2WZR3 3VDBA 1AHDP 1HB1A 2K85A 3O1UA 4X8NA 4QIWN 1RZ4A 2D93A 4W6WA 1ZYRF 4Y1XA 2E2JJ 3B6AA 1ETXA 5F6KA 4JK1X 1N1TA 1LKNA 4ARXA 5L7OA 3N05A 4IV1A 4QPQA 1OLQA 4YZ3A 2BBAA 4O7XA 2AUYA 2XRNA 1K4TA 3RSNA 1RUJ3 2ZX0A 1UY0A 1XSRA 4OI1A 4RQPA 2VOOA 4D6RA 3J26N 2GBYA 1WMDA 4IESA 5AFBA 3V8KA 3UGFA 2JG8A 1NCRB 2BOIA 3PUHA 5H20A 3P5BA 2UY9A 2AGSA 1ZNPA 2R7QA 2FBEA 2E5ZA 3V42A 5CYYA 1D1CA 1BW5A 1SFXA 4YIRX 3LSJA 2R063 1O3SA 2VR4A 1ZTRA 4MH0E 4HPKA 2VXDA 4LJHA 4G7HF 4IL6C 5IHRA 1Y7BA 2HTJA 1TWHJ 1RIOH 4EN9B 3MUY1 3TW6A 4G9SB 3TEZA 4OI0A 2J7MA 1JKOC 3L2WA 2BVVA 3HVDA 4ATEA 3Q0UA 2XUBA 3WDTA 5FFOC 2MD5A 2DFCA 2TDXA 4UV8A 4E7HA 4MNUA 1I50J 3IIAA 5GTHC 4Q4V3 2XDVA 2OUMA 2B7YA 1QDCA 1XC5A 3OV8A 3FHAA 1HRV1 1W8TA 3PUFA 1X19A 3BT9A 3LEIA 3VBRB 1S2BA 2QQNA 2IVIB 3VWBA 5K0UB 3GTJJ 4B47A 3TDZC 3OS2A 3M07A 1REPC 1XNAA 2IXSA 2Q8CA 4HMZA 5TJJA 1R4MB 4GYIA 1ENHA 4L5JA 3F0CA 4CU7A 1EF4A 1YOVB 1AR63 2R7DA 1IUYA 3ORJA 2M3AA 1P8JA 2M0CA 1FC3A 5HVQC 3F8MA 3O5SA 4XJUA 3FBNB 2J1EA 2DCTA 2RMU1 1SCSA 3H5NA 2FDFA 2BE5F 5FBZA 5ABJA 5BNQA 1ODMA 2XHNA 5FK8A 1JZ2A 2HKOA 3OSGA 3CCQI 3EPZA 1J9IA 2WNVB 3E7LA 4IXLA 4XCBA 2CW0F 3OYNA 3VV1A 3C1DA 4YFWA 3X29B 2PJRA 2NOGA 4CCMA 1UNBA 2QQOA 1WJAA 2MEV3 1IXCA 5F04A 2XLFA 3IH4A 2J1AA 5GP9A 1SD6A 1D8KA 3GHNA 1JZ7A 2BQPA 2Q1FA 2P8TA 2BYVE 3U4XA 3K4LA 3QQAA 1SEUA 2HYXA 4NOTA 1FMD3 5FO9B 1S72I 3KM5A 4XKWA 1D0ZA 2KZGA 4BQXA 2EXIA 4DRRA 4DUVA 1IN6A 2ZO4A 1KS5A 2XR4A 3CBNA 1FZPB 5D8AA 1WD4A 5F64A 1K45A 1V4RA 3DPLC 4YWAA 2OAZA 2XROA 2LALA 1YQ5A 4XL9A 3AZWA 3IN9A 2B46X 3VZNA 3TL4X 1G9DA 2XQRA 1W9TA 1YFYA 4BIFA 2DT7B 2DAOA 3WW4A 1WJDA 3OGSA 4YVSC 5IK8A 2F5FA 1HB3A 1EV7A 3C7GA 2XVLA 2HZDA 3J80Z 1KYWA 1YQ8A 1X3WB 1XXNA 2XB5A 3DEWA 2R7UA 1RUJ2 3RJRA 2FX0A 3MKWB 3PL0A 5DD4A 1ACCA 1KONA 3EXUA 3ABKH 1KU3A 1Y4WA 3GJBA 2VTFA 3FHZA 1G8XA 4M01A 1WGPA 1PP8F 3K4CA 3KV9A 1Z9CA 1Q3EA 3H9GA 2DU0A 3CJIB 1IQDC 1MACA 3L2VA 1U2WA 5CEHA 3UKNA 1XNKA 3NAUA 4S2GA 3M70A 4IEYA 3OS0A 5T5OA 1FBUA 4CSWA 3VD5A 3R4KA 4LB5A 4GFBA 2ZJCA 5LK7B 4ZDOA 1ODDA 2FJ1A 3L00A 1DGRM 4CCEA 1ULYA 4JVAA 4LHNA 3QPTA 4CDXA 2VBYA 2LREA 4ZZ8A 1UHSA 4DXSA 1KQRA 3NNMA 3OOPA 4KISA 3AKSA 3O1PA 4HPKB 3C2BA 1LQ1A 2V9PA 3E3VA 1ZBA3 2RR11 4UFLA 3FZ3A 4QGNA 2DA5A 3EDPA 3WF2A 4Y5TA 1ETKA 5A3OA 1HLVA 3GZEA 1R1A3 3LCPA 2WB1N 2CO5A 3K9TA 4H2AA 3WTSC 5F2WA 1Q1HA 2NYXA 2CQKA 4M6VA 2ECBA 3HOSA 4QPIC 4MGZE 3S8PA 2O8KA 1IRZA 5T55A 3LWFA 3T0BA 4TXWA 3I49A 1MH4A 5K5QA 3JTGA 2E7TA 3O8GA 4GULA 3HD8B 4W6YA 3VBUA 5LWBA 3HTSB 2EZHA 4Y26A 2CUFA 1HDDC 2CV1A 4IGPA 3U2RA 1TC3C 2VZTA 3GFIA 1UYYA 1H1AA 5FPXA 4AGVA 5FJHA 1JUIA 2RM23 2O61A 2VCBA 4COUA 1DUXC 2A75A 2ICWG 5K0UA 4IEJA 2HWC2 4I0AA 4RL7A 4B4QA 3BP8A 3SHRA 3U1KA 2AEZA 4CCCA 3QPLA 5FLMJ 2X1DA 3AMHA 5JR2A 1NHAA 4IE4A 3VDDC 4BQ2A 2PFBA 4OHYA 1GVDA 4CHUA 1ZLJA 4MEXF 1RUD3 3P3NA 2E35A 3WD5A 3FKJA 5FZBA 1F31A 5CKMA 1D2SA 1GOHA 2GDFA 2HWD3 1GNYA 3I55I 1W7PD 1XD7A 4M74A 1H6XA 1FSHA 2OQRA 1SACA 4P9LA 3DEUA 5TSWA 1IHMA 4RB3C 3ZQQA 4B3NA 4RB2C 5LY1A 4HF2A 2XGCA 1DP7P 3ZXGA 3H5RA 3ZYJB 4AQTA 2ZGOA 4WM8B 5EEHA 3LSHA 4CEWA 2UUZA 2JDPA 4KDPA 5IT3A 1UOBA 1PVEA 1YJNI 2CAUA 1SD5A 4Q27A 1W5SA 4JDMA 5A7WB 4IEXA 4CEWB 5KCMA 2E34A 5ACA3 1KQ9A 4WM8A 5JOYA 3OCPA 5EEAA 1OYIA 3ABUA 1I1EA 2ZSHB 2PHTA 3FMRA 2ADDA 3VBUB 4WBBA 5FZOB 3TDUC 1OKOA 2C4XA 2VW2A 3B7MA 4QDQA 1S0CA 2P3KA 1RI7A 3LDKA