4LIUA

Structure of ycfd, a ribosomal oxygenase from escherichia coli.
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
373
structure length
360
Chain Sequence
MEYQLTLNWPDFLERHWQKRPVVLKRGFNNFIDPISPDELAGLAMESEVDSRLVSHQDGKWQVSHGPFESYDHLGETNWSLLVQAVNHWHEPTAALMRPFRELPDWRIDDLMISFSVPGGGVGPHLDQYDVFIIQGTGRRRWRVGEKLVDPFEAIIDEELEPGDILYIPPGFPHEGYALENAMNYSVGFRAPNTRELISGFADYVLQRELGGNYYSDPDVPPRAHPADVLPQEMDKLREMMLELINQPEHFKQWFGEFISQSRHELDIAPPEPPYQPDEIYDALKQGEVLVRLGGLRVLRIGDDVYANGEKIDSPHRPALDALASNIALTAENFGDALEDPSFLAMLAALVNSGYWFFEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ribosomal oxygenases are structurally conserved from prokaryotes to humans.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
molecule keywords 50S ribosomal protein L16 arginine hydroxylase
total genus 84
structure length 360
sequence length 373
ec nomenclature ec 1.14.11.47: [50S ribosomal protein L16]-arginine 3-hydroxylase.
pdb deposition date 2013-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08007 Cupin_4 Cupin superfamily protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2510 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4liuA02
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 4liuA01
1VRBA 4AAPA 4LXLA 4C8DA 5F5CA 4D6QA 5FWJA 5FY9A 2WWUA 4QXBA 4LIUA 4Y33A 5A7PA 3PUAA 5IVEA 5FYCA 5F3GA 4GJYA 5FYHA 5FZ3A 5FYIA 5A80A 3AVRA 3KV6A 2Q8DA 5A1LA 5IVCA 4NUBA 3LD8A 3KV5A 5FZGA 4QXHA 5FPLA 5FY5A 4DIQA 5FZCA 2XDVA 2WWJA 5F2WA 5FYBA 2XMLA 5FZDA 4CUGA 2XUEA 3ZLIA 5IVVA 5FYVA 3AVSA 5FZOA 5FY0A 4QU1A 2Q8CA 3UYJA 4CCOA 5FYUA 4GD4A 5FP3A 3KVAA 3RVHA 5FZ4A 5A3PA 5FXXA 4V2WA 5FZBA 3K3OA 5FP9A 3U78A 5FBJA 3PUQA 5FXZA 4AI9A 4CCKA 5F5AA 3K2OA 4D6RA 3KV9A 5FZIA 3AL5A 4V2VA 5K4LA 2GP3A 2P5BA 2Q8EA 4EZ4A 5FJKA 3PU3A 5FZAA 5A7WA 3DXUA 3PU8A 5A7WB 5FPAA 5FZHA 5FUPA 5FZFA 5E6HA 3ZPOA 4CCJA 4DO0A 5LW9A 2YPDA 5KR7A 2W2IA 2VD7A 2GP5A 4IGPA 5A7NA 4IGQA 5FP4A 4XDPA 5FZ9A 4CSWA 4ASKA 2OQ6A 3AL6A 5FZKA 4BU2A 3OPTA 4Y3OA 5IWFA 3N9LA 3U4SA 2YU2A 3DXTA 5FZ1A 2OQ7A 4Y4RA 4HOOA 5FUNA 5F3CA 2YU1A 5FPVA 4QWNA 5FYSA 5LY2A 4E4HA 4EYUA 3KVBA 3PURA 5FP8A 5FZ7A 5LWBA 5FZOB 5F37A 5IVFA 3KV4A 3NJYA 5FPBA 5LY1A 2OT7A 5CEHA 5A3NA 5F39A 3PUSA 3LDBA 5FJHA 5A7QA 5FV3A 4BXFA 5FZ8A 5FY7A 4IGOA 5A7OA 5F3IA 5F5IA 4QX8A 5FZ6A 5FXVA 5FYYA 4BISA 5ISLA 4LITA 4URAA 4UF0B 3N9OA 5IW0A 4HONA 2OX0A 2YBKA 3K3NA 4CCLA 3OPWA 4D6SA 5FPUA 3N9PA 4TN7A 5F32A 3N9QA 5FXWA 2YBSA 5FZEA 5ANQA 4EZHA 3N9NA 5F2SA 5A3WA 3PDQA 5FZ0A 3N9MA 4CCNA 5F3EA 5FZMA 5FZLA 4CCMA 3PTRB 5FYZA 5A7SA 5FP7A 5FY1A 5IVYA 5FWEA 2PXJA 5IVJA 2YBPA 4GJZA 5FYTA 5FY8A 2XXZA 5IVBA 5FY4A 4XDOA 2OS2A 4QX7A 4GAZA 4QXCA 4UF0A 4LIVA 5A1FA 5A3TA 5FYMA
chains in the Genus database with same CATH superfamily
1RUE1 3MUZ1 3GHMA 3LOBA 3EPZA 3GZ5A 1LULA 2QEXI 1H8TB 3ZFGA 5D8KB 3V7RA 1XNCA 4NPRA 3NV2A 2P4EA 1FAYA 2LM3A 1X2NA 2R062 2UV1A 2YFZA 1QBJA 5EFUA 2M30A 2GC0A 1O3TA 2C26A 2YMZA 1KYWA 2JENA 1POV1 3GZAA 2HFHA 1BMV1 1XNTA 3PU3A 5F6FA 1S2EA 2GZWA 3MEXA 5FPZA 3ZMNA 4ZC3A 1NLRA 3I2GA 2ZJRF 2PQ8A 1S6LA 4EEFG 1GP6A 2GMMA 5AC91 4BGDA 4HX4A 1VQPI 4UBGA 3IC7A 1Y0NA 3RTRA 2RVCA 2PQQA 2PAEA 2WYFA 2XB0X 3S2DJ 1OYIA 4MADA 2OTJI 1JTZX 5IW0A 4QM9A 1C57A 2FDKA 2NN8A 4N9HA 4D94A 2RJLA 5F32A 4JDMA 3AJZA 2CW7A 3HAGA 5E1XA 2VOTA 1IV8A 1G3TA 2XLAA 3AKSA 2P2KA 1YO5C 3A1YA 1J59A 1FPQA 1U0AA 3TEZA 1R64A 3WF3A 2KZGA 1FV3A 2CV6A 4BKXA 3BG5A 2VOWA 3RKQA 1FTTA 1DG6A 2E7TA 2VMFA 1QRYA 5IVCA 2QUFA 4YELA 4A6EA 1E5SA 1RETA 1PM7A 2VXDA 1FMD1 2ZACA 1VR3A 5JFRA 4CCOA 2VOOA 1LVAA 3ZKUA 4X8NA 2JVHA 4ZDOA 1PDNC 1QZZA 2ZGUA 2ISYA 3CLOA 1Q8VA 4M3CE 4LBOA 1NCQC 1MS5A 3ABMH 2YPDA 1LOFA 4XUOA 2R32A 2BXYA 2IA0A 3WHCA 4FCAA 4BEHA 4MEXF 1DYKA 2LDUA 4AC0A 2P1BA 4A3LJ 3I4MJ 1BIBA 3VBHB 2EIKH 4IW3A 1JJ6C 2YU1A 2MH2A 3K10A 2W95A 4E4SA 3AZVA 1R1VA 2YY1A 1SHWB 2RAEA 3GF2A 4F8AA 4NHJA 3RGBA 3LDBA 2V9VA 5L7OB 3RQ4A 1R092 3H5AA 3VBRC 4IRHA 4LITA 4LK1F 3JRBA 4IHTA 2HWE2 4J1WA 2XOMA 2VOPA 3MQ0A 2DFCA 3FBIB 1UIKA 3V8KA 4N43A 1TL8A 4RGKA 5D5WB 2LBFA 2P7VB 2M4GA 4PQ9A 4ZZ8A 4QQ2A 1B9NA 1OUXA 2X29A 3W5NA 1Z7UA 2CQXA 1T6SA 3FL7A 2RQPA 4B1MA 3GYHX 3I7DA 3AB0A 5F0CA 5L3DA 3ZXAC 5A32B 4GO1A 1TNSA 3WTVC 2LYCA 1RUNA 2G0EA 2AEZA 1ZLJA 4AG4A 1W2NA 2JWTA 5T5OA 2MABA 2VJIA 3T08A 1OCTC 3LSHA 2P34A 4W4ZA 4Y1VA 5C3EJ 2I45A 5FZIA 5GZCA 1ULOA 2JVGA 4AI0A 1Y1VJ 1ENSA 3JUUA 2HWC1 4PIYA 5A7NA 4M3FA 5CVVA 4OI0A 3BVCA 2RG4A 2GLOA 3ABZA 1X9TA 2ZGQA 1MEC3 4QKNA 1TC3C 1SFKA 2LTPA 1W6QA 1MVQA 3ZKYA 3IIAA 5DG2A 3VDBA 1ZAOA 1UU6A 1D4M1 1X1CA 2NLRA 3WNKA 1KFUL 4K6BA 5EWSA 5AONA 1ULFA 2OX0A 3BIEA 2XL9A 1YYNA 2LNBA 2O1QA 3LSDA 3N9QA 2LKPA 1YFHA 3E6MA 4HF0A 4LQRA 4AFMA 3MGUA 1MH4A 1C1FA 3IPVB 3GTPJ 4OHXA 2K4BA 3MWMA 3ZMZA 3ZOBA 3KS7A 2D43A 5FY8A 4Y24A 4MOAA 3MKZA 3DLAA 4BE3A 2PHXA 5DEQA 2F5DA 3IKVA 1SPPB 1Y9GA 3H9GA 4UAPA 3NMBA 3NV4A 4BY1J 2EINH 1VRH2 4IRGA 1RVF2 1QXRA 1QQP3 4X1EA 1V00A 1V6MA 2JPBA 1JE8A 4YFNF 4MGQA 1ZA4A 4AYUA 1W6NA 5FZ4A 3WP6A 4KFCA 4G6QA 2QQBA 3H0DA 4JDOA 1D0ZA 2Z3YA 3MI8A 4RQPC 1YITI 4AIJA 3K4ZA 3LPFA 1UW8A 4RFRB 1GUUA 3A0BC 1R9TJ 1V9U1 3BTXA 5D4SA 4GMP3 4YFZA 2PMZN 3CCVI 3N9LA 1XG1A 3K1MA 3NWTA 1LNSA 4PI2A 1BQPA 4A3ZA 1ETWA 1UPSA 4RM2A 4Z6YA 4LE4A 2V7FA 5A7QA 1BI1A 4FPFA 2VC1A 1QIQA 1R082 2VCAA 5IFTA 3U75A 5LHHA 1SBDA 1MSFC 3F8MA 5IAXA 3BPSA 2ELJA 1C8M1 3MCZA 4MGIE 4C3JJ 1XMXA 2DUQA 1RUG1 5C3QA 3LDRA 2PMHA 5D4RA 3NV1A 2CRGA 5DV5A 3A01B 2ME0A 4GQ7A 4I09A 1XB9A 1U9OA 1S2BA 4YW5A 3DUIA 3OS2A 1UZYA 2DF7A 1SMVA 4C8DA 1RKTA 4DYRA 3JRAA 2P6HA 3ZP5A 2M45A 1IRGA 3GYDA 4EE2A 4IHVA 2NM1A 4EMSA 5LCWL 2HOTA 1EV13 3HPGA 4GCVA 2DU0A 1CESA 4WZCA 2V1UA 3CQZJ 3FM3A 5GZDA 4V2WA 2JX9A 2GC1A 4Y1ZA 1V70A 4FPLA 1W6PA 3ZXDA 1MS3A 2RDRA 4JK1X 3B9IA 4IE7A 5BNGA 1R4MB 3THCA 2JG9B 2H09A 1QF3A 1AL0G 1VB2A 1PVEA 5GLWA 4KT5C 1QJX1 4BU2A 1ZBE2 5ABJC 1WCQA 2Z69A 2D44A 1X2MA 3J9SA 3ZXEA 1U3EM 3Q8BA 2R0FA 3BYWA 2AH2A 4FPGA 4LO4B 1AVBA 4MGKE 2ORZA 3H3UA 5JUVA 1N75A 1PP7U 3BN6A 1OOPB 1PP8F 2XRNA 1W7PD 3V8LA 4F3QA 1G86A 3GLXA 3OPWA 4OI4A 2Y0OA 1JZ4A 3X2QH 3QOPA 2WV0A 4G7OF 2ZGSA 2Y34A 3ABTA 2CFXA 4XUPA 1LENA 4CDUA 1O4ZA 1SACA 3BB6A 4NAMA 1JKPC 3ATGA 4OCTA 5L3FA 3BTIA 1RHI3 3SH5A 5AVAA 2CU7A 1BR1A 3PIOF 2YGMA 3VLBB 4HX8A 3P9IA 3ABUA 2ZX0A 1HKTA 2NS0A 2XASA 4Q29A 1SFNA 1LDJA 1FOD3 3UETA 1SLCA 2FXAA 1H2LA 4O9GA 4Q4V3 4CUGA 4Q0PA 4XFCA 1UAIA 3O1RA 2C5DA 3URFA 1ZLKA 2RGVA 4E4DX 1ALYA 4ABZA 2F4LA 4IV1B 1KGYA 4AGVA 1T39A 2DJIA 2CTVA 2HKOA 4YVSC 1REDA 3KZ4C 4QQHA 4M3CA 1QJU3 1LHOA 1OPOA 1AHDP 4GYIA 3VDXA 1W2AX 1BK0A 2A6ZA 5ACA3 2X1DA 3ZQQA 5EQUA 2A3SA 1OBNA 4DBRA 2E71A 2ZOEB 4ONUA 3WCSA 3K51A 5DAQA 3W2VA 1LKXA 1L7QA 3M07A 2E36A 5T5LA 3T2OA 3ZN5A 3BI3A 5IY5H 1P2FA 1DGWY 1FMWA 2E2HJ 2HVRA 2WABA 4OAZA 2F5VA 1H2KA 3O7OA 1FPN3 2W7NA 3CL1A 2WAEA 3ZCOA 5KVRA 4LHSA 4MX3A 1OXCA 1DQ2A 3WW1A 2XWBB 3OSDA 2DYCA 4BIOA 1DGRA 1WWXA 2BW3A 3AMQA 1MEC2 1U5ZA 1Z7LA 3ZMTA 2QE3A 2HR3A 2XPWA 3T0DA 3W2WA 3DPRA 2AXTC 3TMOA 1YLFA 2Q1FA 1N3PA 1NG0A 2ARCA 4L97A 4YNIA 5FCCA 4RHV2 2AUYA 2WN3A 2FDIA 4XILA 4XLCA 1G2HA 5FY0A 1VIWB 3OY8B 4WM8B 1ETVA 2JA5J 4NWVA 4PFPA 4KBBA 3SZGA 3B01A 4PT6A 4COUA 1O4YA 5D8AC 1PO11 2DOAA 1XXNA 2VNOA 4NB5A 2ZKNA 4OQ8A 4RHV1 2JD9A 5I0SA 5FZKA 2CSGA 4NE9A 2LTNA 2OQ7A 2MEV3 1JBCA 5C44J 3CCSI 5DZFA 3ZFGB 2ESNA 1QVTA 1NCQB 3K4MA 3WNLA 4FTBA 3W5MA 1MEC1 4XFHA 4Y1XA 1G6NA 1F35A 2ORXA 3RMYA 5FKKA 4ES8A 1LHNA 3BJOA 1SLAA 3K3NA 2ET1A 5FPUA 1YO8A 1OKQA 3P7NA 2LC2A 1OLQA 3OS1A 2HVQA 3NARA 1FIAA 1YLLA 3DV8A 2CSOA 3UESA 2E34A 2MFZA 2PJRA 4QX7A 4FPHA 1B35C 2HDWA 3OWTA 4AI8A 1SLBA 1LRHA 2X9DA 1RUE2 2MG4A 5I8YA 2Q8DA 1E5HA 1NXMA 5IJRA 2OF7A 2G9GA 5ILVA 1BOAA 4QPOA 2B9SA 3GCWA 4PFOA 5GAGJ 2AQFA 4C2TA 2ELKA 4N4OB 3AZXA 4AI3A 3WHUA 2WBMA 2ZXQA 1LU1A 4QPIB 3NKGA 3WNOA 5KHKA 3AG1H 1XS9A 4PJJA 4ASMB 1WMXA 2FNPA 2KIFA 1GBGA 2XROA 1CZSA 4IX7A 1Q8QA 1L3JA 1V6IA 3CO2A 5CYVA 2PAMA 2KXLA 1EV7A 1S72I 4YVWB 3OEBA 2VY0A 1OR7C 2R0QC 2A6YA 2RMU1 2GC2A 4R9CA 1V4RA 4HLTA 3TO9A 5GTIC 4NROA 4BLIA 3AFKA 4AVSA 2OT7A 2HU9A 2HTSA 1LE8A 1H9PA 2O0YA 3B93A 1LCLA 1JMUB 3ZSJA 2FE3A 3SFIA 5JXJA 5E89A 1XOYA 3ECQA 3AYDA 1SVMA 5HLHA 3PQKA 2CV2A 3EUAA 2PMUA 4S2FA 2QWWA 4AFBA 2W48A 4FQ4A 3FXRA 3BG6A 4OI1A 3WG3A 1U8BA 1X8EA 4K1YA 2Q2EA 4EM1A 2LR8A 2DYRH 5EEAA 2N7GA 2XR4A 4LLOA 1UELB 4CCCA 3J7YJ 3FHZA 2R7XA 2JE8A 1B8IA 4XM3A 4GDFA 5FYHA 4A41A 2BY1A 2R93J 3TRSB 2Q8CA 2HWF2 3KVAA 1PMHX 1UD1A 4SLIA 3VD4A 3GXUA 1GHCA 1B1BA 3CF6E 4DYCA 1JS9A 5H9RA 4DY3A 5FRMA 2M7BA 1W7PA 2JG8A 3BWGA 3KF3A 3WTSC 2N8GA 1ODMA 4ETSA 3ZN6A 2R042 5DCMB 1UNBA 2XGDA 2FOKA 1LOAA 3VBSB 2KRFA 1YJLA 1ZVFA 5LBBA 1HX6A 2EQRA 1H1MA 3CZJA 1WMDA 1ZBE3 5JI9A 2R7EB 4LMYA 2ZXHA 3CZUA 3HD8B 1RKWA 4PGHA 4A3BJ 4KMFA 4NHKA 5FZ6A 3PL0A 2EZLA 2BJSA 3POWA 1JHFA 3HL2A 2YBKA 1MZBA 1L7RA 3ZIXA 1BVVA 2ZBJA 3N9PA 2VBDA 1KGSA 2Y0SA 3BTJA 4XF4A 3S7EA 4XOPA 2VQLA 1AYN1 2XSJC 5A3WA 2CUFA 6PAXA 3ZXFA 1FXZA 1XCBA 1OJLA 2R7UA 2NRAC 2DMTA 4DOUA 4FX0A 3ZMDA 1RUF1 5JOZA 2EXKA 3BR0A 1LFUP 1ACCA 2DTWA 3R4SA 3U9GA 4H7MA 2C6YA 1PVC3 5KWRA 2YC2A 5F5CA 4A6DA 5GPCA 4IDZA 2MPFA 4Z82A 4HZFA 1ODNA 3N7MA 5HBAA 3WTWC 3KV5A 2Y31A 5H6QA 4ISRA 2RREA 2BOLA 1DUXC 2RS11 4Y13A 4WCGA 1ZZ6A 4GB33 3FXQA 1GQPA 4DRVA 5GZGA 4NMIA 4D0QA 5ILSA 1J09A 5FZBA 5FP9A 3U78A 3FDYA 2Z99A 4AL9A 3I97A 1KQRA 1UMIA 4U88A 4HPQA 2A5ZA 3B69A 1H88C 3DXUA 2HEOA 2M0MA 2EZIA 5DCMA 4JTOA 3CJIC 3HG9A 2ZJPF 2V4AA 1ZBA2 4IGQA 5FLXK 5ERIA 5JAXA 5JXIA 3U21A 3WG9A 4QT6A 1MPXA 4M4RA 3WTTC 3EETA 4B7EA 4HVQA 2ID3A 1QA6A 4Q4W1 3QYEA 4P5HA 2IS1A 3HTSB 3J4UH 1HIXA 3WTUC 3PUBA 4JX4A 2KDZA 2VR4A 4HL0A 4IEOA 3IMMA 1HB2A 3ZMSA 1H8VA 2BVVA 3J8F2 1B8IB 5FXVA 3AYAA 1QPIA 2RDQA 4BL0B 2OQRA 4HONA 3WTXC 1QGLA 3POYA 2A73B 2DU9A 4JX5A 2VQUA 4O7XA 1MMSA 3INAA 5IK4A 2WFF3 2WBKA 3WDVA 1RVF3 1EH7A 2FD8A 4CXXA 1TTYA 4QX0A 2ZMNA 2QQAA 3MW2A 1IXRC 3VZMA 2SBAA 2ZHKA 4ZTFA 1SLIA 2BVMA 1AF9A 1YNAA 3K4BA 3TL4X 1UCRA 5JZGB 2IGNA 3BJ6A 2BP6A 3HB9A 1J75A 1X3ZB 3E0JB 4XFFA 5KHDA 1K83J 1LESA 5JR3A 5F5AA 2PX9A 1ONAA 1UYPA 3DBHB 4YVWC 5IT9K 1P9QC 3N35A 2W0XA 4OIPF 2FBEA 2JKXA 2E60A 3K4CA 3QYFA 3FC0A 2E53A 3K70D 1R1A2 3AMHA 2Y69H 2JECA 2W1OA 1EY2A 1A8DA 3I3BA 1OQEA 1MMNA 2ZC2A 2VTXA 4A45A 5FKMA 2DWRA 3K2AA 4F7ZA 4XVHA 3ZSEA 2VULA 3AXEA 3LGRA 1KITA 4EQQA 3OYGA 1JTXA 5CFDC 3QP5A 4JCKA 1COV3 5C33A 3PUFA 4OULA 3KX2A 1ND2A 1O3QA 9ANTA 1DGWX 1GR3A 4HW0A 2WZR2 1OCOH 3MKYB 1IAWA 1IN4A 3TAYA 2KT0A 3QD6A 5FY4A 1YQCA 2ZFUA 3CJTB 3ZN1A 2RVAA 1AHSA 2W39A 4L92A 1G4DA 1QJY2 3CCQI 3VGIA 1VAVA 3K2ZA 3VBHC 4YW6A 1D2QA 5I8SA 3J7LA 4ZPIA 2RS32 3F23A 1XQNA 4QXHA 5KBFA 5JZGC 1AYM3 4I7HA 3AK0A 4Q0SA 4EN6B 4RAZA 1AKHA 3OUHA 4PLNA 4O5VA 5FBJA 3OBRA 1QJX3 5GAHJ 4A69C 4A5MA 2OBPA 4UW6A 3HNYM 2VBPA 3AG2H 1GWKA 2VZVA 2WN2A 2R30A 5CFCB 1QJX2 2WA0A 2ZMEC 4IF4A 1MDMB 3JRGA 4KNYA 1LOEA 2QBYB 3KZYA 4YSFA 4B8XA 3THTA 3ZQGA 4LHKA 3LSGA 3QPTA 3S14J 4OMCA 1ZTRA 3BOPA 2NVQJ 3DU5A 2AHQA 2FBIA 1MBJA 5K7HA 1KQ8A 4F92B 1HXS2 1IC8A 2AS5F 2GU9A 4EN7B 3OR2C 3WNMA 1QDOA 4CCEA 1IZ3A 2A3WA 2L01A 3BG3A 4LBLA 4COVA 2DMNA 4M3DA 3HBZA 1S1AA 4OQ9A 1TLHB 1WSUA 2DFEA 3IBMA 4KWJA 4Q5SF 2V73A 4N7IA 4XJWA 2IXSA 3PJQA 4UFKA 2JIJA 2MSYA 4PBOA 2YPJA 3PFIA 1DP7P 3NQOA 5GKAC 4L9BA 3COAC 1JUIA 4XIDA 4P9JA 4RBOA 1FOD1 2B7EA 1XGNA 4I99C 1J3RA 1B09A 3KEYA 3R0JA 5FY9A 1M06G 5I0TA 3AFGA 2XL7A 4ZYAA 4S04A 3RJPA 4ITCA 3O1PA 2D6NA 3EUHA 3UR3C 5FYBA 1FMVA 3AX4A 1IPKA 5FYVA 1RC6A 2V4JC 2OVUA 2VQGA 2H1KA 2EWNA 5DAPA 2P6CA 1RUH3 1QJU1 3W59A 5SV5A 2EFQA 5CFCC 4AM3A 1UG0A 4HLXA 2VZPA 4WK8F 3UKVA 3LEKA 1YWKA 1OA4A 4HANA 5F0HA 4KU7A 1V5FA 4ASKA 2IXLA 4Y4RA 2P5KA 5KXDA 1WA6X 3FF5A 5FBZA 1WRJA 4R8HA 4B3XA 2H0VA 4JQTA 1B6AA 3R61A 4XN3A 3AL0C 1PGW1 3C3VA 2OUHA 3QPSA 3KP3A 4GZ9A 4LHLA 2PI0A 1XD7A 4DINB 3H1YA 2FNAA 1STZA 2FOWA 2BRTA 1JGGA 2ZGLA 4L9VA 2PJRB 1DQ6A 1PGL1 3ZQ7A 3KP5A 4YIFA 2TBVA 2Y48A 5GALA 3KT7A 3K6GA 4MH0E 1LHVA 5JOXA 1DF0A 4YM2A 2P4WA 2DK8A 2ID6A 3VODA 5E1WA 5ICEA 4C91A 5ANNA 1SLTA 4CDXC 4CDUB 4Q47A 1QNWA 4M73A 4YW7A 3CTAA 2WNVC 3CP2A 4U2AA 4E8DA 4COZA 2BY2A 4PLOA 2H27A 5BS6A 1KDMA 1FP1D 2A6TA 2IC1A 1JUMA 3HVDA 1TME2 1Z0XA 4NVPA 2WWJA 4G4FA 4QGLA 1HQLA 3AP9A 2KD7A 3UYJA 5E8GA 3BJAA 5EJ3A 3WDYA 4AEMA 2X6OA 2KR2A 5ILUA 3LAGA 4D6RA 1UOGA 2K3FA 4BQ2A 4XETA 2DQLA 5EDNA 5FZAA 4A3CJ 3POSA 3ZQCA 1HJFA 1UX7A 2EXIA 4RN5A 1NA1B 4AYBN 2HOAA 4CZCA 5FMOL 3QYBA 3SFZA 1WBLA 2WADA 2XUMA 5C8CB 4HF1A 4JAAA 4WZFA 5J09A 1SVOA 3ZX7A 1YRZA 4E4HA 1N78A 1U2WA 3QCWA 4Y5TA 4IQ4A 5F6LB 1IGOA 2HYFA 1GV5A 3I2HA 3WODF 4CEYA 4IKFA 3MLKA 4MQVA 2NP0A 1QZEA 5FY7A 4Y26A 3NWKA 2A70A 5CYYA 5JLWA 1QU0A 4LD5A 3DN7A 1YIOA 4IXAA 1NUKA 1SVLA 4OHZA 2CJJA 3M7GA 1TG7A 4BQ1A 4OOIA 4GRIA 5GLUA 1REPC 2UWMA 4ZONA 2W82A 2ENRA 3POFA 3VKMA 4UY8I 1L0OC 1X1AA 1IG3A 2V5DA 4FP3A 3Q0UA 2CUZA 1IUFA 1WJAA 3M9AA 3WP4A 4OUSA 1UPIA 1QHHD 2F2EA 3I59A 4GMP0 2K86A 4Q4X2 4RGXA 1CVNA 5FYCA 2RR11 5K8SA 3MPBA 1U5XA 1RESA 1G9AA 4EGYA 3LFKA 4QDRA 5DUWA 5JOYA 5JSPA 3VYSB 4A6SA 2A6WA 5JI7A 1CJPA 3VBFB 4CCKA 3A21A 1VBC1 3WU0A 4KGQA 1JOJA 4M3CB 4MGTA 4RGGA 2XVCA 4W8JA 1CZTA 1BEV2 2GP5A 3ZMUA 3H36A 4RAFA 2HKXA 2X6XA 2CQ7A 2VE8A 2Z16A 3C7FA 3RWKX 1MJBA 2JMWA 4IPAA 1NCRC 1GZCA 3ULQB 2V4VA 1VRH3 4QIWN 1J1LA 2E32A 5HV0A 4UVAA 5HV4A 4WWCA 3NVCA 2HYGD 1GKBA 4CDQA 3K4NA 4S2GA 2WA3A 2K02A 1FMD3 2LS6A 1U5IA 5FIXA 1CZVA 2MW8A 4LJZF 1M4WA 3JRDA 1IHMA 2VW2A 1RJ8A 3POGA 4CP9B 1OA2A 4EN0A 3RZZA 2W92A 4PCQA 1UXZA 4CP1A 1SPPA 2ETEA 4XIKA 3EO6A 1S29A 4FPEA 4RLQA 4OWRB 3PTRB 3WF0A 3HT2A 1W1WE 2D45A 5CADA 1SAUA 3CZ6A 2BGCA 1F5JA 2Y26A 1MZ5A 1IRXA 3NAPA 2R071 1DQ5A 2QJVA 4U87A 5B2GB 3ONQA 1ULPA 3BPVA 1RUG2 4ZS3A 3VKNA 4XSXF 1ENXA 4AIDA 4B44A 3MFCA 2BV4A 1POQA 4PJYA 5J3UA 3J26N 5H2FC 1PGL2 4HNVA 3HEFA 2FSWA 3OIQA 1W05A 3HN3A 1Q1VA 5DTDA 1Y8RB 4JHTA 1W39A 2KMUA 3PLQA 2M3AA 3GUDA 3NO8A 2WT0A 3O1UA 4LO6B 1XC5A 3VYRB 4L9JA 1W6PB 4UWDA 2DT5A 4HNUA 1DHKB 1RL3A 2ZEWA 4OHYA 5F9TA 3A4UA 2XF6A 5GTHC 4J25A 5CB7A 2D6PA 1V3FA 3VBOC 2WNVA 5J37A 5FZOB 1VMFA 3T8TA 2QTWB 4FE7A 2L9VA 3L9JT 2OPTA 4WM7C 3S7IA 3AAFA 3WINE 3AZYA 2QSHX 2P3KA 2A6HF 4XLPF 3GEZA 1NK2P 3KT4A 5M5YJ 1S3JA 3RQ0A 5E3LA 1RUJ1 2KFDA 2J7MA 5EGOB 1F5TA 2DVDA 3RZGA 4CP0A 1VBE1 3MMYB 3HM5A 1GZWB 5FMBA 4CDQC 1XNBA 3VDDC 1JT6A 2LP0A 4YVSA 1HW2A 2QQPA 2YUSA 1V6JA 2QQUA 3M4FA 4L11A 5FYMA 1TQ5A 2JUGA 3RQIA 4NHYA 5JPNB 3EJKA 2FZ2A 4K40A 4IEZA 2W1QA 4PK4A 1UX6A 3M3OA 3WXPA 4OAYA 4LBQA 3OUIA 3UT0A 2WO1A 3U1XA 4E7IA 3DPUA 2Z9OA 2KJCA 4L5IA 3KLOA 1SMYF 4QPGB 3UKNA 3WCRA 3ZRGA 3MVPA 1IZ1A 1UYYA 5T52A 3ZFFC 3DKYA 5EIYB 1SBEA 3ZM8A 4Q4Y1 1IS6A 4CSWA 4OU0A 2UZKA 5BOXA 2KIMA 1LVKA 3PMSA 4QM8A 1PUFA 2QZ8A 1LHWA 4ZYGA 2WAQA 2ZGRA 4Q0VA 3A22A 3IIIA 2NVYJ 4Y20A 1TVGA 3PMEA 1I5ZA 1JN2P 3H5RA 4YRVA 1FOWA 5IT3A 4HMZA 4CGZA 5J47A 5BNNB 3ML6A 2IJLA 1COV1 1ASJ3 4TLGA 2CFOA 3S8PA 5JWPA 4AVZA 1MIJA 1JI8A 5CAZA 2TEPA 1IGNA 1WGPA 3ZPLA 4BHPA 2ZXJA 1W9WA 2RNJA 1T8IA 1K7AA 4D6QA 4CO8A 4FFFA 2OCCH 3RNSA 3LAPA 5FYIA 2WJSA 1DCSA 5EYYA 2FCVA 2K9ZA 3OMYA 1I3HA 4ZZ5A 1X1PA 2PA7A 2VPRA 3MZ8A 3AVSA 2DO7A 5FYUA 2YU3A 5A3PA 3L2QA 3CDZB 4C1XA 1H30A 1FTZA 4RB3C 1YOVB 3RSNA 1WUVA 2ZGNA 3AMPA 1UOJA 3VKLA 1NE4A 3KETA 1NK3P 2R063 3FBYA 3OEAA 3JTGA 4YW3A 2WO3A 4PI0A 1X19A 2GNTA 2JA6J 2ZBKA 2QQKA 1AZDA 3AYEA 2L3DA 3KCCA 3I2KA 3PURA 5LEJA 3H0GJ 2GA1A 2FBKA 3WQBA 2ZEXA 3HUGA 4XZPA 4XF1A 4KITB 5BNNC 1AR61 4GB31 1ZZ9A 4HETA 3KLNA 5EYXA 1YX5A 2M0CA 2NS8A 1Z77A 4P9LA 1LFBA 2UWBA 3W3CA 2JT1A 3BPZA 3M3QA 2D6OX 4DQ2A 3LA2A 5DDGA 5EV7A 3OIPA 2XAGA 3JRCA 1XE8A 5D6EA 5B5EC 5CU1A 4DNYA 1DP0A 3HOYJ 2XAQA 3V56A 2QDRA 5L7OA 3HUGB 1K5MA 3L2CA 1LOCA 1W90A 1OT5A 1JKOC 2I07B 3ZXSA 1GOFA 3VBHA 5LEKA 4MGRA 1KZHA 5BNOC 5BV6A 1ULEA 4NAOA 2GIZA 5B3SH 3JSOA 5FB2A 4ZJZA 1PIV1 1H0BA 2AR6A 2IBDA 3NSTA 5FMDA 5L73A 2XRLA 3PVEA 4YG3A 1WCDJ 2KM2A 1E5IA 5FP4A 3DKWA 4YFXF 1UOFA 4FPJA 5AFEA 1LPQA 1VAKA 3GZEA 2DUPA 4PCRA 4G12A 4RB2C 3SJMA 1PK6B 3R6SA 2BBAA 2H8WA 2IEKA 1LFPA 2JDMA 3OCPA 4JBAA 1VFCA 3PQJA 1N1SA 4BQYA 4IQJA 2Y0MA 5F27A 3P9CA 3IT8A 3AMMA 2DXIA 1BLZA 1WJ5A 2WNEA 2COMA 1WLDA 3LKJA 4RS8A 3N36A 1CJDA 3HOSA 4XONA 2FDFA 4J6GA 2LLKA 3FIWA 3ZYGA 5C8WA 4UFHA 1DGLA 1W9YA 2G19A 4JKKA 2WAQN 2Q1ZB 3WV6A 4RGSA 3T2TA 2C9AA 1BC7C 4BM8A 2QA4I 1QHDA 5JHUA 4G3YC 1ENHA 4LXLA 4M9SA 2O8QA 3KGZA 1BZWA 1WCMJ 4CP9A 1K4SA 4YYOA 3F3XA 3HRTA 1S0DA 2BHYA 2BY0A 3THDA 4M3BA 3HZJA 2Y6FA 1J3PA 2NNYA 4DXSA 3S1QJ 2HWF3 1G8WA 4ZU7A 3TEWA 3FXUA 4AI9A 2WQZC 3ZXKA 4CDXA 3HSRA 1T2KA 5J1YA 1O7FA 1QNTA 1FWZA 4AUXA 4Q0UA 2RM22 1JZ8A 3J7HA 1FYLA 4QPGA 3MIBA 1OA3A 3DQVC 2A6XA 3DECA 1YQAA 1BW6A 1D0YA 4HSJA 1OCRH 3AKRA 3R05A 2Z79A 1F5FA 3BG9A 4TTGA 4XBNA 3JU9A 3ZDSA 4E27A 2EALA 3MW4A 1XU1A 5JVVA 1OFCX 5A33B 1ZM1A 1H8TA 1R4NB 4XNFA 2DMUA 2DDBA 1RYYA 1YFXA 3JSPA 1V0AA 4H7LA 3GZUC 1ND3C 1NYWA 4BWOA 2HWD1 4I76A 2YUEA 5IPAA 2UYBA 2CHHA 3LIGA 1HC8A 2WQ4A 5CVRA 4BZ4A 2VKVA 4YVSB 1VALA 1W8UA 1UOBA 1ZZBA 3RZDJ 1YJ9I 2UXNA 4G7ZF 4HPKB 4ET7A 4CCMA 4II3A 1GZWA 3ILRA 2XF5A 3HOZJ 1O4TA 1LOFC 4RHV3 1T6BX 3ON7A 3OUJA 4G6DA 2ZHMA 2JDNA 3KP2A 3A0NA 2YV8A 5LGTA 4CDWA 3PL8A 4BNCA 4QMAA 1VRBA 1AR92 3FFZA 3QH6A 4Y33A 5A7PA 4HXCA 1ETXA 1IN5A 2B7YA 4YGCA 5HXMA 3E6BA 2R7QA 3RIRA 4QU1A 3M4OJ 3RVHA 1PM4A 3K3OA 3BR3A 1RUD2 3RJRA 1R7JA 4I02A 4ENMA 4NJ4A 5C8CA 1APLC 4AQSA 2GMEA 4MIMA 5DZGA 1JTYA 1MBFA 1OCCH 1AR73 3HOUJ 1RMU2 1X82A 1H89C 2O3FA 2V5YA 3NL1A 4LEJA 2XVGA 2GIVA 1JKRC 2BFUL 1WLCA 2WY7Q 1PUEE 3HGYA 5EJ1B 1BM9A 3GJAA 1NOVA 1RHI1 3H1CA 3OSFA 5A3MA 5FZ7A 2V09A 4RGAA 4QGNA 3V7CA 1CAXA 4XLFA 1TT0A 1R091 2FX0A 3WF2A 4AHYA 1BBYA 3GTMJ 4NC6A 4BBRJ 2CMPA 3OGRA 4XJAA 2LW8A 3IAM2 3Q8CA 4JKMA 4EZHA 2Q1MA 5A7SA 4XTMA 5HNHA 1SFYA 5GP9A 1ZR2A 4Q48A 5IVBA 3EYIA 4XDOA 2X1EA 4Q4ZF 2EXJA 2HWE3 2X05A 2DBIA 3E7LA 2RV8A 4AHWA 2XMLA 3GW2A 2XGEA 2BERA 4BJTA 5C9AB 5FXZA 1IS4A 4WM8C 1GVDA 3H8RA 4D7TA 5A7WB 4BMEA 1W5SA 3FISA 2BBYA 3O1VA 4CPBD 2FEZA 3QU6A 5KHIA 3OYAA 1H6YA 1J2XA 1ND2C 2PG4A 4YG6A 3HR9A 2JG9C 3USUA 1NE6A 3MV11 1W0NA 3WP5A 3BOWA 2PHDA 4XCBA 1T95A 2VZRA 3KVBA 5K7PA 1WW6A 1LHUA 3C2UA 3SZPA 3I59B 2JE7A 1K45A 1G59A 1X4PA 4I0WB 3HOWJ 3G7DA 4FQGA 4BXFA 5CVIA 5EZHA 3B5LB 4XF0A 1AOYA 4OIOF 1ZZ8A 4XORA 4L99A 5K5OA 5DAWA 2O61A 5BPIA 5M5WJ 3G1LA 2F6BA 3SZTA 3CMGA 3O8GA 3BY6A 3S5AA 4QDQA 2RS12 2CU5A 4IHYA 5TGTA 1R36A 5A1FA 5A3TA 1GUIA 1J84A 4HBNA 1K5JA 1X58A 3H35A 1DP3A 1SFPA 4QQOA 4GMP1 4NQWB 4QXBA 4X0GA 1Y1WJ 2VODA 2VASA 5JXGA 1CN1A 3UL2A 4B3NA 3RZHA 4TWTA 5C6CA 2BGOA 3I3DA 4YM0A 1W0UA 2DBNA 3RI4A 2E1OA 2GM4A 1UKGA 3SCHA 1DU0A 4BPZA 1WA4A 5LD2C 4IV1C 1OI6A 5DM7F 1W04A 1K3IA 3M1CA 4B1RA 2PN6A 1MDMA 1DIWA 4IL7A 4EZ4A 3P3NA 2DVGA 1P4AA 1BK1A 2RV9A 5C70A 4S0HB 5K5QA 2BW8A 5JDBA 3B6CA 1PZ7A 5FMCA 1MKMA 2Q0OA 4NBQA 1FC3A 3W58A 1UO9A 3U1KA 2CUEA 2R4GA 4MGYE 1P7IA 1IV6A 2Z4FA 5FPBA 4Z2WA 4KWKA 3A03A 3IWFA 5A3NA 3E6CC 2BNMA 2GSYA 2JICA 2YGLA 1IPSA 1S0FA 2VUAA 1VBB1 1B35B 3MIGA 3UGHA 4NIHA 4MFDA 2VBXA 1N47A 3N97A 1OOPC 5J1XA 3IH4A 3VWBA 1RRJA 2VUCA 2KQRA 5J7MA 4FFIA 4XJUA 1A04A 2BWAA 3FFQA 2L7KA 2GXBA 1F31A 3KCYA 4EWEA 3MV01 1YG2A 2GXAA 3QRFF 4OMYA 3ZYRA 1TME1 2VO5A 1IDZA 3ACHA 5TSWA 5HS8A 3BROA 4P9UA 4ESJA 3FLRA 5FQ0B 1BC8C 2IS6A 2DT6A 3WGGA 4YFWA 1HDKA 3FMRA 4PIZA 3BTCA 2WYSA 2VZ1A 2E33A 3I54A 1UMZA 2Y6LA 4HK9A 5E6HA 4KBZA 4UT5A 4O65A 3GXOA 3K4AA 3G71I 3VBRB 4R79A 2QNKA 2WFPA 2MLGA 1EPZA 3PSIA 5DAVA 3HPHA 2R061 3LNQA 5HODA 3K48A 1Y43B 4L0PA 2ZSHB 5AC93 1MS9A 5T55A 2MD0A 3J7MA 2P0WA 3TGNA 5JPMB 3VDDB 1JYVA 4BXXJ 4E4ZA 5C71A 3DBLB 2V1DA 4HEA2 3G6JB 1ZH5A 4BAYA 3R0AA 4HRIA 1ND3B 4UI9L 1GV9A 2JDZA 4HOBA 3P6BA 4DNCA 2L9RA 3VZKA 1JXNA 4O9EA 4WVMA 1FX5A 5FYZA 3Q8EA 5FP7A 2YBPA 3I0TA 1WGXA 4PDWC 1S0IA 4QXCA 1RITA 1W3XA 3L2RA 4LKEA 3WNPA 2K9SA 2IGKA 5FROA 1RHI2 2FMDA 3LA7A 3WG7H 4Y5Z0 2R7WA 1FEXA 2P8TA 3QLQA 2BVBA 2XPJA 1WWYA 4CEYC 4QKDA 1TW2A 3TKYA 2F4OB 4LLGF 1TNTA 4DIQA 3ZN4A 2Y30A 1LGBA 3FKIJ 5CFCA 4BE2A 1X4OA 5FKLA 2EPFA 4XFIA 1CGPA 1A6CA 5DQ0A 1VBE3 4CEWB 4G9YA 2NVTJ 4KIGA 2E1MC 3CKHA 4D69A 3BTYA 4F3JA 1VQ7I 2PMZA 3ZPOA 1T0FC 3KLSA 3D0SA 1MGTA 1WI3A 5J48A 3KE2A 2VQ0A 1AXKA 1K4TA 4DB5A 3L00A 3AFHA 5FTTC 1SD6A 1UB9A 1QEXA 1U6GA 3LDKA 1EAH2 4CDGA 3KPHA 2KRCA 1RMU3 3LF7A 2ZXWH 1YQ6A 5DPNA 1CAWA 2EFNA 5KAFC 5JVGF 1HLVA 4A3EJ 3LFMA 2CO5A 4A7YA 2H1LA 1FI2A 1VQ9I 3J7ZI 4Q1RA 4IRIA 2OJED 1NQJA 1D1CA 1K78A 3RI9A 1CAVA 4DQAA 2IPQX 2WS92 2HWB3 5K0UC 2W1UA 3D4KA 1FT9A 1E0EA 3FMSA 2OTLI 1VZ0A 3SH4A 5J36A 2HYKA 1GANA 5HDGA 2DOEA 4COYA 4JZRA 3TOBA 2M2EA 1VBB2 5A70A 4KUMA 3RDIA 3ASNH 1OCPA 3DEEA 1QH6A 2ZX1A 3UGFA 4U0VA 2GP3A 2YZ4A 1VBE2 3OL3A 2ZPXA 2W68A 1W0TA 2XPUA 4P55A 2Y6KA 1LDKB 4XIOA 4XDPA 4CUAA 5J3LA 1BJQA 3K1PA 2BZDA 2QCOA 4U0WA 3TNPB 5FRAA 2ISZA 2JTVA 1GNZA 4KQ7A 4INDA 5C9AA 1A35A 1RXGA 2K5CA 3PM1A 4AVBA 3VYTB 4GULA 2IRFG 2VMIA 2DPDA 3M70A 3LAJA 5F39A 2E7QA 2AEYA 1H1IA 2IS2A 2BQPA 1DYOA 1VQ4I 3WW4A 3PIPF 1AWCA 1AR91 4NWWA 5JLVA 2RDSA 5CFDA 4QB1A 3I2FA 3S30A 2Q2EB 4AGRA 2B46X 5K9YA 2V6EA 4B43A 1PNGA 2DCJA 4ENNA 3M3IA 4XLNF 3E97A 3M8JA 3PTYA 2W85A 5BNOB 4II2A 2KRHA 1WHUA 1IG7A 1REEA 3BIWE 3O1OA 2A71A 3DFGA 2XIGA 1C8M2 1X9PA 2VNGA 4I6ZA 5FWJA 4U0YA 5DS9A 4I98B 4JRAA 3C18A 4NHLA 1KRIA 1RUC2 2C4XA 4PSXA 2XGCA 1OD3A 2AYHA 2X8KA 2LUWA 4FISA 3PO2J 1K12A 1TNRA 3J7AY 3AC0A 4ZKTB 2VG9A 2R5YA 3V0BA 2WZEA 1CQTA 2B42B 3ROUA 1GMMA 3CJIB 3WLUA 5DCFA 4QXKA 4AI1A 2DCEA 3SNMA 4Y22B 3WF4A 2HWD2 4V19K 3SC7X 2C24A 2BBVA 2GOMA 2FHRA 4XOGA 5FK8A 1DZRA 4U7BA 5F3CA 3LEIA 3WVJA 4RDUA 3T5XA 3LPGA 1LEDA 1RUE3 2HEVF 3KFWX 3KV4A 2XVKA 4H14A 4BB3A 2L5QA 3GTOJ 3UV9A 2KIQA 1US3A 4XQWA 4I2OA 1IKQA 4EJTA 1LJ7A 1GZTA 1A78A 1A36A 3TNQA 2J42A 1KU7A 4MEYF 2W4SA 5JSRA 2UUZA 4LGWA 3DTIA 4TLFA 4QHBA 1R6RA 2HVSA 2IXCA 3AKZA 1H4GA 5IATA 3OD0A 3DF8A 2GN3A 2JEMA 3L2HA 3OOUA 3G73A 4ZYHA 4IEPA 1PHMA 5A80A 2DFIA 3MICA 2FU4A 1H8AC 1NCQA 1TBXA 4KH9A 4LLFA 4I0BA 1FYUA 1EAH3 2W08A 3ZSKA 2Z5WA 5FXXA 2AREA 3QOEA 1WD4A 3ZN6B 2QCSB 3B6AA 5CZKA 4YM3A 4FPCA 1W7PB 1Y6IA 3DYOA 2P3JA 4XTPA 2G7HA 3BQYA 1QY4A 4AEKA 5J4YA 3LSEA 5LW9A 4LUKA 3U07A 1H8TC 1C5IA 3J80K 5C8CC 1YC61 4UV8A 1KEXA 3WZ1A 1VMHA 4NIGA 4CDXB 3CLQA 4KU8A 2QVSB 4RAGA 4NOTA 3HDDA 4QWNA 4MZUA 1ULYA 5IYBJ 4E70A 2H94A 3ZQHA 3S1MJ 2D1HA 3IDCB 1O91A 4IGOA 4LLNA 3S16J 4URAA 5ABJA 2BDRA 4P9FA 3AYCA 3T0YA 1XGSA 2MA3A 1PZ8A 2JJ6A 4PF5A 3WDXA 2W5FA 1MS4A 4I01A 1PIV2 5E18F 1FYKA 3D5OA 2WUHA 2X09A 2OA4A 4YZ5A 2WZR3 2LD5A 4A42A 2VZTA 2PFWA 5F8PA 1SQ4A 1LE8B 3MBWA 4NR1A 3AKPA 5D8AB 1H4HA 1J7KA 4NN0A 1PO22 2W94A 2VKEA 5SV8A 1VBA3 5JOWA 2V1NA 2L9LA 5GZEA 1R23A 3I3EA 4YVWA 3RZJA 1O6UA 1H1AA 4IETA 4A5NA 4KN4X 1ZN2A 4XBLA 4IHXA 4Y22A 1PK6A 1MBHA 2K0GA 2WY8Q 2IW5A 1XSRA 1KD7A 3CJIA 4QX2A 4PJNA 4BJ0A 2MLKA 2M1BA 5T3NA 3WY6A 3Q8FA 3KHBA 1W3VA 5DUXA 3D0JA 1YFYA 4HV5A 3OJBA 5FFZA 1NZIA 5CVUA 1HF0A 3LSKA 1CQ9A 2RS53 4KA4A 3LZZA 2EAAA 1N1VA 3HHHA 2NNNA 3OOPA 1SFUA 1VQ5I 5LRSA 4AVVA 2O0OA 2FQ3A 1FPN1 1K5MB 1LR5A 3MDPA 4BQWA 4YIIA 5BNOA 5D6FA 1ZYBA 4M00A 4KMUX 3ZXGA 1ETOA 1JZ3A 5FXWA 1IN7A 4D5CA 4EJOA 2B39A 1W8ZA 5CA6A 1PGW2 5EZGA 5CFDB 4NPLA 3DCFA 5L7OC 2ATFA 3GHNA 1NCRB 3ACGA 4Q27A 4J19A 4Q26A 5K0UB 4B7KA 2KZVA 3KM5A 4DXTA 2CAUA 4M0NA 2MNGA 5DDJ2 4WVWA 2EVXA 2EICA 3QWLA 3G1MA 2IAIA 3Q0VA 3OYNA 4X6AJ 2HWB1 5EXOA 1MMGA 1S5LC 1JYWA 4XZUG 3HKZA 1QWRA 5M0TA 1ETYA 3VB9A 1OHFA 2JPCA 4A3IJ 1OPMA 5H9PA 3DL3A 4IEQA 2R1DA 1W99A 2XQRA 1J3QA 2D7FA 1GU3A 1MBKA 2PHRA 5E3NA 3HQRA 1YJKA 3ZMVA 2HOEA 1DYPA 2NZ9A 2VKDA 5FUIA 1N1TA 3BPXA 2LFBA 4XHBA 2CUJA 2WNUA 4EWDA 2MEV1 3QBQA 4LA3A 4BDYA 3O0VA 2G9ZA 2WWYA 2CW0F 2VM9A 1Z21A 5FOJB 3IP4B 1DQ1A 2K46A 4MSVA 1YHFA 4RS5C 2OD5A 3HHGA 2B4KA 1UMHA 1RC9A 4E7JA 4HDVA 4Q8LA 5CBLA 1XJAA 1UY4A 2DN0A 2VUDA 4XJ9A 4CU9A 5M5XJ 4FTEA 4LPLA 2KKOA 1NY72 1F15A 5FY1A 5CG8A 1VBA2 2Q4SA 4A3FJ 2HQAA 3HOTA 1FZPB 3A02A 1WVRA 3EXUA 2ET7A 3HOVJ 5CPRB 4K20A 3VBOB 4OIQF 4AAPA 5BNNA 5LA0A 3LFUA 4HVRA 1HJGA 1WLTA 2ZGPA 4HG2A 4BJ5C 1WH7A 2MC3A 4B47A 4XQDA 4JKLA 5F2WA 3JB4C 1Z78A 1VBC2 4X8PA 2XJRA 2J5PA 1X33A 3AZZA 2IXKA 2WT2A 2IXIA 3ZIWA 2L54A 3PNTA 3H9JA 2BFUS 3ECHA 5DDJ3 1O4XA 1J5YA 2LY2A 4ITVA 1HLCA 1P8JA 3MHZA 3CC7I 3THPA 4L9NA 3MN2A 3H92A 2R92J 1EP0A 2K9QA 2RDPA 1WFXA 4JHZA 3GDBA 2PTMA 3KP4A 2YROA 2ICWG 4M72A 2M5WA 3S2HJ 3DU6A 1ZX5A 3IH2A 4XLHA 5F6KA 2XV4S 3ZR8X 2MBFA 3CNAA 1HRI2 3ZYJB 1U78A 1TQPA 1HKSA 4AW7A 4EJRA 1QXJA 4RMNA 1OYWA 1POV0 1RUH1 3T4VA 2RS33 1RTVA 5C3SA 4YZ1A 5I8TA 2Y9ZA 1Y8QB 5EGOA 2V26A 2EH3A 3C7GA 1R5GA 2M8EA 3F6OA 1V6OA 5K1YA 2E7AA 3VDDA 3L2UA 3FHNA 5BPDA 1IN6A 5EZWA 1RUH2 3MFKA 4FFHA 3N7JA 1WKMA 2CQNA 3WQ7A 1Z3XA 2WNVB 5JSOA 1LNWA 1FLIA 5J8FA 2QQWA 4ISQA 3U11A 3OYWA 1UZVA 1FNNA 1X1BA 4XABA 1GICA 4XC9A 1EAH1 5EF6A 3DEUA 2L2OA 1FV2A 3JRIA 4FBFA 3WDUA 2STTA 1TMF3 3H0OA 1G3YA 5A1AA 4HG6B 1FOYA 2CDPA 2HWE1 5HLIA 2YFUA 4N9IA 3T30A 1W9TA 1UHWA 4M71A 4D7MA 5E3MA 1W06A 1IS3A 3QH7A 4A3XA 1XNKA 2XJQA 5C3PA 5FLJA 2Z5UA 3W6JB 1FIPA 2DA7A 1AJKA 1LODA 3A2KA 3HSEA 4IV3B 4HLYA 2O14A 3C2BA 1S7OA 4BISA 2EIGA 1HKQA 1HBXG 3NAPB 2O9LA 3VV1A 5C5UA 1WMFA 2UWCA 1UKRA 4DY5A 5JXHA 3ESWB 4GWIA 1RUC3 4LTAA 2J1TA 3RG0A 5IVJA 5LA2A 1KJLA 1AR81 2Z1DA 3GMEA 3LEMA 2K9LA 2JXAA 4N4NB 4F93B 1KS5A 4LO7A 4R9AA 3FJSA 4WM7A 4XKWA 4BK5A 5HCBA 5J1UA 3CEWA 2D1VA 2HWC2 3VL8A 2WFF2 3M3CA 4KN7X 4UYBA 2Y75A 1ETKA 4QD2A 1WJEA 4FT8A 1VBD3 1VB4A 2LK2A 3FXMA 3BGAA 1Z1DA 5JCTA 2IUWA 1BBT1 4RL7A 1OLME 2R0HA 1F8VA 2ZSIB 4V1PA 5GM0A 2K40A 4RS5B 3F21A 2DMQA 3FXJA 5FZ9A 2FJ1A 4XDQA 1TWCJ 4K3UA 3WW2A 4LB6B 3DPRC 4N7UA 5H9QA 4ASLA 2KIUA 1U9NA 3WQ1A 2I2SA 1WD3A 5IFPA 1LUJB 1F43A 3VBUB 4LULA 4W1UA 2R7VA 4NQWA 1L7LA 5F64A 4ENKA 1S0EA 1V5EA 5LBCA 1LJ9A 2HQRA 2VOVA 2ZMEB 1BJZA 3L7WA 1COV2 3ZYPA 1RUI2 1ZR4A 5FR3A 1OISA 4R4XA 2HZTA 4EWAA 3MKWB 1J1TA 3JZVA 2W1WA 4HSLA 1NZCA 4MYEA 2OYZA 5KXEA 1RVF1 1ASJ2 1RUC1 2CWSA 2M8GX 1UFMA 3JR9A 1IO2A 2QF7A 4MXVA 3OYCA 5F1JA 4M6YA 3OYIA 4XBFA 3A7QA 3I55I 1SDDB 4LK6A 5KK1A 4A7ZA 2Y38A 4XFAA 4RA0A 3A0HC 3BOQA 3K70C 1JYXA 4PHZA 5L9VA 1YJWI 1US2A 1RJ7A 4QHZA 4OYUA 2ETHA 2Y64A 3ENRA 2HQNA 4LT5A 3V8JA 5A6QA 1TP4A 2F6CA 2HI3A 3J81K 2OCEA 2P3IA 3ERED 4DXRA 1IQDC 1NA1A 2ECBA 3ETQA 2EV0A 4UVCA 2KPMA 2NYYA 2O7OA 1OVPA 4LUMA 3CIHA 1GXPA 4AEJA 4AI2A 3VD9A 3CMAI 5T5PA 2ELHA 1TME3 3O14A 1E3HA 3GTKJ 1UL9A 3ZXLA 4KI5M 4CPBA 3I58A 1B72B 2RDNA 2W84A 1W9SA 5D21A 5A32A 1IRZA 1SFEA 4DW6A 4YW4A 4DZGA 1MNEA 1VTNC 5D5UB 4CU6A 2ZHLA 4LK7A 2VL8A 3OYMA 1T98A 1ZKGA 2DMPA 2LBFB 2GH8A 4GA9A 1Z91A 1SEFA 2L7FP 2Y2ZA 2GNMA 3RKYA 1JU3A 3O1MA 3L9FA 2ZJQF 2DA2A 1BI2A 1XBFA 2NOGA 1QHGA 4IEJA 5DUVA 2W3JA 1UAAA 2AXLA 2FRHA 3PNYA 5FPXA 2NVUB 4E7KA 2Y60A 2R7FA 3IB3A 3LSIA 2FA5A 1CIWA 4CRQA 2A6VA 4XEZA 2VQAA 1WJBA 4BHBA 3L2YA 3TP0A 1DU6A 3HRMA 1R093 1OD5A 3WDTA 3BALA 4OIRF 2EV6A 1D0HA 1N1YA 5M3MJ 1MVEA 4M9XA 3D8CA 2KLOA 2YX7A 2VECA 3K2OA 5BNPA 2ZO4A 1GSLA 1PO12 3S2WA 2EJRA 1DGRM 4NDLA 2ZFWA 3SISA 4J00A 3N7KA 1TW3A 4JGZA 1YQ8A 3SEZA 1FX7A 3CF2A 2IXJA 1RUOA 4CU8A 5CQEA 2DA4A 4UFLA 1KFXL 2BGPA 1HDPA 5GJ6A 4M9ZA 1G9BA 3MYXA 2ARXA 2CG4A 2Q30A 3WE2A 3NQHA 1BW5A 3D3AA 2OUMA 2FZ1A 4EVIA 2PMWB 1XYNA 3KQ4B 3GNEA 4CDWB 3BTZA 2PHFA 1ZQ3P 2HWF1 3OR1C 3VDCA 2IFWA 2DFBA 1OURA 1NHAA 2HYJA 3EUHC 5HOOA 5FZ0A 1O8PA 3KYDB 5L9BA 1IOAA 1Q43A 3PHMA 2M34A 3GJBA 2X0LA 3BZKA 1V9U2 2XXZA 1HW5A 1C4RA 2CH0A 3DTKA 2VL4A 3I2IA 4XN0A 3FM5A 1NAEA 3ACIA 1QOTA 5ABJB 3Q9OA 3I64A 3BR5A 1K6OA 2R1BA 3TN93 2R7TA 4GH4A 3WD5A 4DMIA 2ERFA 1ZRDA 5IYCJ 1BVP1 1F1ZA 4EN9B 1R083 1J58A 4IE6A 3T2QA 4P14A 3BCWA 3OYFA 2WQ8A 3K1NA 3PVOA 1CF7B 3G3ZA 4FHTA 3RYRA 2R7SA 2QBYA 5FLMJ 3CD6I 2J22A 2VJ5A 4JTNA 2WL1A 2Y6JA 3FHQA 1YTYA 1FOD2 1BN5A 1RGSA 1AYN3 5FJKA 3CUOA 3DKQA 1ASJ1 5B4XA 3KCXA 4CXWA 3I9V2 1VI0A 2BYVE 2Z33A 4TSVA 2IVJA 1J0RA 5IP9J 4R52A 4WBBA 3TYJA 4FOQA 3LQRA 1MJ9A 1TMF1 4UUSB 2EILH 2ARBA 4IE0A 4XFGA 2AGSA 1AKHB 2JA7J 4C2UA 4GH4B 3OGSA 2D6KA 2DT7B 3VOEA 3WP3A 1ZBA3 2E51A 2LKSA 3H1MA 2X6WA 1RIRA 1AXYA 3MLLA 2CQKA 4R9BA 1OLTA 2ZAAA 3JBG2 5J98B 1UG2A 2PBIA 1S0CA 3ERMA 2YXSA 4YRDA 4DJAA 3SXYA 4QPWA 1WCKA 2BHZA 4CYCB 3V65A 4A2UA 2LY1A 2A75A 4DGWB 3VZOA 3S0MA 4Z07A 2W47A 5LB6A 5LLQA 2WS93 2QQOA 4Q4W2 1ND2B 1HV0A 3W21A 4BXSV 4LIUA 5A6YA 3TN91 4WX9A 1ZZCA 3J7NA 1XSDA 3I4IA 2G7UA 1GWMA 1F4AA 3ZYBA 5FZDA 3LSPA 5FRNA 4QX3A 4LOSA 2ZJ2A 4XJZA 2IP2A 3VZNA 3R4KA 1QU3A 1YW8A 4JGZB 4NIIA 4AHZA 4LFUA 1FP2A 4XRMA 1AR63 4XF9A 1KJRA 2BVLA 4FFGA 1AA7A 4CUCA 5BNPB 3RWNA 1FNZA 3BODA 4G6TB 1MD0A 1LEBA 4HOOA 2VNRA 1W9FA 2VOXA 4NHXA 5DD4A 1T56A 4AQTA 1VBA1 1Q1HA 3OSGA 1UYZA 1BEV1 1OYYA 1ZG3A 1VQ6I 4Z2AA 5KHGA 1KU9A 1BJAA 1DQ4A 4AE2A 4LA2A 5GLVA 1CIYA 5L3CA 3OTFA 2KA3A 5L9RA 5FZEA 2RMU2 1USTA 1G3SA 5DUIA 1F9NA 3OYBA 4D0PA 5IK8A 1ZELA 4IXLA 3B9CA 5JHFA 2O8OA 1SZBA 4EM2A 4W6XA 1BR2A 4IEUA 2R072 4ZU4A 2Y0IA 1MQTA 1APNA 4E2QA 1GNYA 2XJVA 3W6VA 5E1RA 3V0AB 4L9TA 1Z05A 1XMKA 1B72A 3BT9A 2CGNA 5TJJA 2WT1A 4AOCA 4HSTA 5ICCA 1FMD2 4LG0B 1RUF2 4C1WA 2M7AA 2VC9A 3POEA 1JZ2A 5AIQA 4BK4A 4YGDA 2E2JJ 1KQ0A 3ASOH 2EIEA 1JU4A 5EP9A 1SD4A 1FBSA 4LE3A 5C4WA 4BQ3A 1R1TA 5FZFA 2FDHA 2OZUA 4PJMA 3K0LA 1X3UA 1P4XA 4Y3OA 5K7ZA 3UKGA 2DVFA 4Z8BA 4AD9A 5IOYA 2ZNZA 3SCGA 1G9CA 3CUQB 5KNLA 3AM2A 1JYTA 5A3OA 3GFIA 5AVPA 2HWB2 3MIHA 4UFMA 1DBNA 4XUNA 3VZLA 3HSFA 4MUVA 2GC3A 4DPNA 1D0GA 4ES9A 1RUJ2 3GBWA 3R4UA 2ZABA 1MH3A 4BQNA 3PVBB 2VGDA 3ZMOA 2XC7A 2VNVA 4IL6C 1BIAA 1D1BA 2BXZA 1HXS3 5IYDJ 1I3QJ 3LQQA 4OUMA 1IKPA 1UY2A 1H2MA 3BZCA 3IWZA 4Y20B 4FI9A 4XRSG 2VT3A 3WG4A 1YYVA 1EJ9A 2WZPP 2E7XA 3C7JA 2G1MA 1T33A 1I39A 4CE8A 3SQOA 3TOJA 2Q8EA 5K4LA 5LGNA 4QPIC 3VBSA 3VDAA 3WW3A 4CTEA 2VT2A 1Z9CA 1YE9A 3IUOA 3H9QA 1LB2A 2OQ6A 4GXOA 2X85A 3GZ6A 2WLQA 4ZY9A 3FXKA 4ATFA 4BACA 3HC7A 2K9NA 4ASNA 2LMDA 4SBVA 1PZ9A 2VW1A 3SDGA 3UJQA 2EK5A 2QDNA 3PUSA 3Q9SA 3RJ2X 5F5IA 2XWJB 2NYXA 4Q1PA 2PYTA 3ELKA 3ELNA 3GFLA 5B4NA 2JN6A 1LOBA 2W46A 3FX3A 3KZZA 3TB0A 1BMV2 2ME6A 1AR83 2JDUA 2ZGKA 1LAJA 3QACA 3FWEA 4QU2A 1QQP2 1LU2A 1Z6TA 3GGLA 1BI3A 2DCTA 3CCJI 2GH2A 3FKJA 3RKWA 4A3GJ 3AP6A 1SCRA 1MMAA 4OZOA 3Q9VA 2F5EA 1FBUA 2EIBA 5AC92 1WKYA 4PIXA 1R1A3 1WCSA 2D5FA 2JSPA 1AL22 2HS5A 3NAUA 3WDWA 1O3SA 4ON0A 1KONA 1RUD3 4UVBA 1OQYA 1ITYA 4FPYA 1OC1A 1NG6A 3JBG1 3QODA 2VCCA 4M74A 4Y4YA 4JGYC 3RMXA 1TZOA 2JG8C 4U36A 2CWEA 5DM6F 2RS31 2VKHA 2DFFA 1AR93 1DGRN 4H4KC 4D9JA 2L4MA 5ACA1 3POJA 2DPUA 1WZXA 2X5IB 1OKRA 2VXZA 1XGMA 2O8XA 1UXXX 4YZ2A 2E1NA 5J96B 1NLSA 4OMDA 1WJCA 4EN8B 1AX1A 2VZQA 2HOSA 3S6PA 2HXOA 3VPRA 3SDBA 3IAPA 4UF0B 2B5HA 2JJ7A 1G3WA 2R6QA 1QOOA 4H2AA 2HZDA 2AC1A 2VTXJ 2DVBA 4IEXA 1RUF3 2OPWA 1YRNB 5K5RA 2NMNA 4AHXA 4BQAA 1WLWA 2J1SA 1TE1B 1Y4WA 3GZNB 4RFT0 1XX5A 2DU1A 2F5FA 3S3OA 2DOFA 1KU2A 2DTRA 2KL4A 1JZ7A 4RQPB 4DUXA 3MLJA 3POBA 4XQ4A 4PJ0C 5C4JJ 1PJRA 3G6EI 1OLRA 4ZYEA 3AG3H 1RXFA 4D5FA 4G9SB 2F17A 4JP0A 4A3DJ 4HKWA 5LA1A 1JYIA 4IERA 1K61A 4E7ZA 1UU5A 4LBQD 1GQGA 1GOGA 4NPMA 4Z92B 1ORKA 4JQRA 4BQQA 2CNAA 1IQAA 4CZZA 2E19A 4ZXKA 4OLLA 3RS6A 1MJAA 4XXAA 5DG1A 5L19A 2E5NA 3CJRB 5LZ6A 2HEYF 1OPCA 2ZCWA 2E9QA 4NC8A 3GTQJ 2WLPA 3GM8A 1V54H 1M1EB 4XSZF 3HPNA 1EH8A 3I71A 3SCFA 2VMHA 5FUNA 2LY9A 3AP4A 2WAAA 3EYYA 4LHNA 4I30A 4MXWB 1D8KA 4XF3A 4DS0A 1YUDA 3ZFFA 3V4GA 2D40A 4C9YA 4XLEA 2VXRA 2PN5A 3D1NI 3VBOA 2OC6A 4P1WA 3MAJA 4YIRX 1VBD1 2CY6A 3RCOA 1UJ8A 4Q4X3 2B8MA 1PYVA 2VZOA 3TW7A 3GX4X 3DPRB 5DDJ1 3WTYC 4WV8A 3BCBA 3I53A 5FLVA 3NNFA 2LF8A 4A3JJ 5FZLA 5I91A 1BR4A 1Y56A 2BW3B 4LBMA 1I50J 1O57A 2Q5TA 3K75B 1MS8A 2PHWA 2Z42A 5EPAA 2X10A 1YS7A 2RQQA 4LG3A 1DQUA 4RA2A 2DUOA 4A0XA 1E3PA 3OYDA 2FQPA 5IHRA 4ZHNA 2J1UA 2A6EF 5FY5A 3RZLA 1WI9A 2QVOA 3CMMA 2D5HA 1JZ6A 4AXOA 3NJXA 4U7DA 2H6CA 2GALA 1XE0A 4JRLA 5HS9A 2NOJB 2WC2A 3POIA 2IXHA 1RUG3 5D1IA 4BMBA 2CGPA 3QPLA 4I0AA 2P37A 2LRDA 5H9SA 3CDHA 2MHFA 4B3AA 5LHGA 4BQXA 3ZVXA 3DXJF 1GV2A 1F4HA 3T0BA 2P6TA 1HB4A 2EFOA 2QKDA 4XL9A 4K9SA 2VOKA 4PZJA 3ZGKA 3I4PA 5F1RA 3PJYA 3R0RA 4O61A 1D8JA 4QX8A 1U8RA 1Z7S3 5FGMA 3MKLA 2X6YA 1NCRA 1ZG5A 3WX5A 4XW3A 3B94A 1CAUB 2Q0AA 2WRAA 3H1WA 1MBEA 3HYIA 1YW7A 4RR3B 2PEXA 3PDQA 3IV5A 3HOBA 2KHMA 4P9YA 2NS7A 4URTA 5DABA 1R5HA 2DCYA 3NNGA 1MMDA 2VAUA 1HV1A 2MH9A 1W03A 2X1CA 1YHQI 1UQXA 3H3LA 4QAWA 4HBLA 1VQKI 4AF9A 3BDDA 1S0BA 5DD8A 3BU7A 1XPWA 5B1AH 3E1F1 1X3WB 5DN2A 2RS51 3JD71 4A0YA 4CP2A 1RR7A 3FXOA 4MQ9F 5ERLA 3M8LA 3D5RC 1RUI1 1JOPA 2WZ8A 3WG2A 1IJWC 2EF6A 2VMDA 3HJEA 1RR8C 1Y0UA 1KDKA 2Z2SB 4AIKA 3IKWA 2CV1A 5DAXA 2DAOA 2P17A 4BH9A 4QKBA 4YG2F 4IV3C 4D8MA 1YFUA 2AACA 1W36D 3RPUD 5CKTA 2XBO1 3IH3A 1CX4A 2A7AA 2UU8A 2FQ4A 4A44A 3PIGA 4EJWA 1W5CC 2JA2A 1OCZH 2M9HA 3ZR6A 1O5UA 4KISA 1W2TA 4Q4W3 5D8AA 4QX5A 2V1XA 2ZX3A 3K4KA 5FV3A 1VQ8I 2RJKA 4L18B 2QUOA 1U5TC 3WHTA 3I56I 3ZYFA 3WGHA 5E79C 3V7SA 3F8CA 4KWLA 2O6GE 1S7AA 3BU0A 3A01A 4B4QA 4W50A 5IVYA 5FWEA 4A4AA 2JIGA 1ZGWA 2EFWA 3P3PA 1EKEA 1QPMA 3HOXJ 3UK9A 1D0XA 1ZHFA 3MZYA 3S32A 3AP5A 3ZSLA 1QH7A 4E7LA 3BZ6A 2KDOA 4ESFA 1F36A 1PX3A 2G9FA 1YI9A 2HLEA 1K5MC 5FREA 2WDBA 4PLMA 1A6IA 5M3FJ 1TZLA 2RM23 4LR4A 4XUTA 4K8FA 2YX4A 1VJ2A 5L36A 5C5TA 2A1XA 3NW4A 2GOXB 2W00A 3LCPA 1ZRIA 1LEAA 3KHCA 2VD7A 5IYYA 4FETA 3PO3J 3C3WA 2VZ3A 3CDLA 2XBO3 2XJUA 4IHWA 3CCUI 3VHOA 5LK7B 3WE3A 2E63A 3TW6A 5E16A 1XPXA 3BG7A 2XPVA 1AX2A 3JQXA 5LHIA 4RQPA 3G1OA 1RB8G 3DGTA 3GLLA 2ESHA 3KSCA 4MTDA 4IQPA 1C3HA 1XRUA 5HNFA 2OIIA 1DZQA 2EIMH 1QKQA 4XAEA 4JGYB 3GO5A 5CKMA 1X50A 3T3YA 3N9NA 4C3IJ 1OUSA 5CKQA 3OB8A 1IN8A 4HV6A 1CD3G 2ID4A 2F4PA 1RUJ3 3F22A 3N7LA 4XBQA 3L09A 2OAZA 1RZ4A 2ZGTA 2BEOA 4UF0A 5E8AA 4N90A 1XU2A 2BE5F 3ABKH 3O0XA 1S55A 3BKZA 3L2VA 4I3PA 2UY9A 4YFKF 3CCYA 3CO6C 2ZMLA 3TO7A 1XYPA 5FK7A 3HQXA 4EM0B 4MTEA 5DZEA 2R041 5AFBA 4L8QA 1G8XA 3U4XA 5CJ9A 1FATA 2X5IA 3LIHA 3C2GA 3CUQA 3LSTA 5FP3A 3B3QE 3MIFA 1FY7A 4NO4A 4QQPA 3ETPA 2V79A 5IAVA 1OQ1A 3OF1A 5HI0A 1WPKA 1OLMA 2IT0A 2DYSH 4F55A 4HVOA 3CCRI 1W6MB 5CQGA 4XICA 2B9VA 3IZOA 3F0CA 4F83A 2ZZQA 1PNFA 1R49A 2ZJCA 3BQZA 2OZ6A 4AFCA 5T54A 4YGBA 3BC8A 4ZXEA 4LG0A 4JV4A 3RYPA 5JVTA 2XJTA 2PLV1 3OYHA 5J40A 5FZ8A 1ETQA 1YIPA 1D4M2 3JB8A 3V0AA 3WR0A 3TEXA 3U10A 3T1BA 4TN7A 3FMQA 1C8M3 4WVVA 4B4RA 3RPUA 2YC0A 3O5SA 2IFRA 3M8FA 3REOA 2VCBA 2JD4A 3H7YA 1PVC1 1ST8A 4IUGA 2UXXA 3R60A 2K27A 4UW3A 5B1BH 2ZX4A 4H0EA 4XKBA 1GFF2 2WIIB 4FXGB 3GBGA 4Q8KA 4G8XA 1ONVA 4KG0A 4GJYA 1W8NA 4XRFA 5CKNA 3E6DA 1AYM1 4ZS2A 1T38A 3NKTA 1EV11 3UNGC 4A0ZA 1SD7A 3RRDA 3SHRA 1WCUA 2D97A 1AR72 1TWFJ 2Q8KA 3VUOA 5F5QA 3A23A 4BEHB 1VQLI 5BQTA 3KGLA 1JZ5A 3RZOJ 1HQCA 3OG2A 3E1SA 1XNDA 1MW7A 3BTLA 2L7ZA 3PSFA 1NQDA 2QQ9A 1FYMA 5B66C 1H2NA 1EPWA 3HGGA 3DEMA 1IF1A 4LO5B 1E5RA 3MW3A 5J1RA 5FOBB 3TEDA 1CPMA 1GLHA 5KCMA 4ZU5A 1USSA 1AU7A 5LBEA 4BQOA 1CAVB 2CGOA 4AQ6A 3HTUA 2WO2A 1JJ8C 3PNAA 5FKCA 3DYPA 2XB5A 2XAHA 2EA7A 4IZZA 4MLOA 3FBNB 2JRMA 1PVXA 3VHNA 4W6WA 2TRTA 1H6XA 4TZDA 2EZHA 1MBGA 2YYOA 3LEGA 3I2OA 3N05A 4YG0A 1F2NA 3SMHA 3OPZA 3ZO0B 2E31A 2E2IJ 2QYOA 3B02A 2CYFA 3NV3A 3PUHA 1HSJA 5DUUA 3VKFC 1DFQA 3HRSA 4EV0A 5HCHA 5A3UA 4FOVA 1NY71 5GADJ 5KC5A 3SH3A 4Q4V1 4DUWA 1W0OA 1QJFA 3AP7A 4BY7J 3IDBB 5KC6A 2Y0SN 1PUFB 2L9NA 2C6SA 1AYN2 2JA8J 1FJLA 4OI2A 4DUVA 1UN1A 5C4WB 4WXDA 5KR7A 4UUTA 1VBD2 2WTEA 2BNNA 4AGGA 3EHKA 4QQLA 4Y15A 5FZ1A 2ZGMA 1EYBA 1WW4A 1TQIA 3HBLA 5CVJA 5JLXA 1RIOH 3HJRA 4WXHA 5L3BA 1ZGAA 4W97A 2WZR1 1DQ0A 1UCXA 2Y8KA 5GZFA 1I5PA 1DLCA 4MHUA 4LBQB 5EJCA 2J1VA 1MQTB 2JDHA 3I8TA 3KWVA 4CH7A 3FUOA 1QQIA 1GQHA 5IUQA 4CXFA 3SQNA 3SEPA 2A69F 3U37A 1HQNA 4BE1A 4YM1A 5F2SA 2WA4A 4UBHA 1UHSA 4WVMB 5F3EA 5EG0B 2BNOA 3L1PA 1V6KA 1EA3A 4CZSA 5H6RA 1W8OA 4LLLA 4JDNA 2EZKA 2OS2A 1GZ9A 2HQ5A 4META 1R58A 4A3KJ 2QQMA 4KJZA 4EGZA 4FXKB 4E7HA 4HAMA 1LDDA 1H9GA 1ULDA 1QVUA 1YIFA 4HK8A 3OYEA 3OGVA 4NNJA 1PX4A 2EA2A 5FZOA 1C5HA 3ZYHA 1YEWA 1TMF2 1ZZ7A 2NMOA 3IM0A 2VU9A 5HDNA 1PMJX 3VBRA 4KL1A 3AKQA 3TBDA 4M3EA 2MD5A 1W8FA 4LORA 2GQQA 4QPQA 1PO13 1ULGA 5FMOS 2RM21 4OHWA 2NAZA 4GFBA 3AL0B 3M2MA 2DA6A 3X29B 4BOWA 1KYZA 4R1HA 2OPKA 5FKNA 2KISA 5FQ0A 1EH6A 4P96A 2D3PA 1T6GC 1C28A 4IVNA 4CU7A 4HFSA 2J5OA 4S05A 5CISA 5KAIC 3CJXA 4UB8C 2DCZA 1EV12 5KXCA 2O03A 2IVMA 4AEDB 3TBIA 4OZXA 1KA8A 2B9UA 3ASIA 3NNLA 2TUNA 4AIHA 4CYCA 3QQAA 3KT1A 2BPA2 5FZMA 1OVSA 3C7EA 2YPRA 1ZG1A 3D5LA 1R5ID 3LSRA 2STWA 1WQ2A 3H8XA 5HLGA 1B35A 4AWXB 1Y9MA 3GZTB 3VN4A 4JX6A 3SXWA 2C0ZA 4CXYA 1W0PA 4ORFA 1D5YA 4E8CA 2QGUA 4RAYA 1JOBA 3WOGA 1MNDA 2AQEA 4OUEA 5D2AA 4QPYA 2PJPA 5GPAA 3F95A 4ZZLA 3WF1A 2DCKA 4YW1A 2XG3A 1QJZA 4LMFA 1RPWA 4IO9F 2A61A 3IN9A 4CCDA 3MEPA 3ILNA 5K7FA 3GWZA 3CO7C 1W5TA 1QMJA 1CF7A 4W6YA 3O0WA 2NPIA 3OY8A 2ZA9A 4WM8A 3IRRA 3U14A 1Q56A 3FLPA 3VBFA 2MYSA 2GBYA 2IGMA 4X6QB 2BWCA 3NJZA 5FAXA 1BBT2 5I0UA 1E3OC 2BZTA 4IEYA 3WTZA 2UYAA 1OF4A 3Q8AA 1R081 1UHMA 2XJPA 3GFJA 2Y33A 1YJNI 3O3KA 2R7RA 4FVVA 2OU2A 1UZZA 3KZIC 2FF4A 2YBSA 1IXSB 5J8CA 3W2AA 1BYHA 4HNTA 3ZFGC 5E20A 3OD4A 2ZKZA 2DA1A 1Q3EA 4N0BA 3EUKL 1OSGA 1W8WA 3BTAA 3I2JA 1ACIA 1EUUA 4AU7A 2FUG2 3VD7A 1JYCA 2E26A 2GNBA 5BUVA 1TWAJ 2W87A 2JDYA 3OV8A 1W28A 4CEYB 3ZFEA 1S4CA 1JH5A 3DPLC 3S3MA 2HWVA 1PIV3 2FDJA 1B59A 2NQYA 4JYKA 3BR2A 2VVFA 2YR2A 3BP8A 4ZTJA 3KV9A 2D2WA 4RSUA 2HH9A 1DU3D 2P5BA 1JUPA 2JK3A 5FZHA 2HBTA 1VAMA 2ADDA 3ZXJA 2QM3A 4DBQA 1SFOJ 4MGZE 1XN7A 2YU2A 1FBQA 3DLLF 1R1A1 2ZS6B 3AZWA 1XCVA 2XBO2 4YEJA 3I3LA 1XYOA 4N53A 5CNAA 1Y9QA 4BQ4A 5FP8A 1RUD1 3BCAA 1V5GA 3APBA 2VUMJ 2XAFA 1ODDA 4KIBA 2GDFA 1R71A 2BV6A 4G94A 1JT0A 4PBPA 3ZQIA 5JR7B 4B8EA 4BQ5A 3DKXA 5HDKA 3GCMA 2VLAA 4CA0A 4QKFA 5JI6A 1XGOA 1SD5A 2RR12 1A6QA 2ZGOA 5DUKA 4AEDC 4G7HF 3MZHA 4QGMA 4EJVA 2ZX2A 4AFDA 1PGSA 1LOGA 2ARAA 2R49A 3WUDA 2EXHA 1N25A 2RR13 2COBA 2QKMB 4FASD 3WG1A 1JGSA 3RPQA 2E35A 3DP7A 3PUIA 2HDCA 4HX7A 4IV3A 2ZEYA 2QQ8A 4IHSA 1YI2I 5IVVA 1P92A 4P00B 4NIDA 4FE4A 1IXCA 1SG3A 2JG9A 4E2GA 3EYPA 2HTJA 3EB7A 1VE0A 1YW9A 3GTGJ 2VMGA 5E8IA 1XE7A 5FUPA 1A8MA 1RNLA 4CUBA 3DCQA 1D4VB 3H9AA 2DBBA 4LJHA 3U4SA 1JODA 3DXTA 1HDDC 3FMGA 4M3CF 3E5QA 2A5YB 2ZMKA 1NH3A 2LVSA 4OHVA 4EATA 4L2NA 3K4DA 2HWD3 4E6KG 3SKJE 2JQ7A 1ON2A 3H8OA 3P5BA 2D6LX 1XDUA 2VVEA 1POV3 1OQDA 2VUJA 5A7OA 1O8SA 2A5WA 1Q5OA 3DF0A 1AX0A 4AWDA 5FO9B 1Y7BA 4EROA 3C1DA 3D82A 3LSJA 2VH9A 4P5OA 1HCRA 3F6VA 2QKLB 5GLZA 1FSEA 1VF9A 4P5YA 1Z3YA 4BJ6C 3JCUC 4B48A 4BBSJ 2ZHNA 3A0KA 2WFF1 2QBXA 4AVCA 3ZDVA 4GJZA 3Q5FA 4XKVA 3CC2I 5EYRA 1NLQA 2P5VA 4UNOA 4D7SA 2HXIA 4JX0A 2ZMEA 1MNMC 2XAUA 4C0HA 1U5TB 2K7LA 3WNXA 2R043 2DURA 1GP5A 2FBHA 3VBUA 4ZDPA 5A33A 5FZGA 3FXLA 1ZBA1 4RYDA 4B1LA 2E7WA 4ARXA 1G9FA 3W20A 3OBAA 1Z0HA 2C1FA 3JW4A 1HB1A 1JXSA 4RS5A 1ENRA 1KS4A 1HQWA 4RLFA 2HYXA 3T1LA 3VBUC 5BY5A 4MFEA 3M1HA 3O12A 3OPTA 5HVQC 3B00A 1P6RA 1VQNI 2VBYA 2JB4A 4XJ8A 2WS91 3KMHA 4EQVA 4A3MJ 4JOMA 3S1RJ 4A93J 4DEQA 3ZOIA 1KU3A 3VSLA 3T4HB 4WM7B 1QQP1 4WF2A 3H3ZA 1NXD1 2XLFA 1SMTA 4FTSA 4L0YB 5IP6A 4MV2A 3TP3A 4AZZA 3RI8A 3JAMZ 4M0HA 3IAQA 5ICFA 1IS5A 2EBIA 5ANQA 4KT6A 5EEHA 2VJXA 3IPVA 4P9WA 3O6BB 2JKBA 5KHHA 4XRSA 4IESA 1LTEA 1V9U3 5T5JA 4DOZA 3TO6A 1W4MA 3NNJA 2WNOA 1PVC2 5LA9A 2X5IC 3JXSA 5IT6A 1I3AA 5BYNA 5FO8B 2H0BA 4XR6A 1QJEA 2YG0A 4Q4Y2 4BYYA 3K69A 3P9KA 1LEMA 1DLLA 2L0KA 3DYMA 2XJSA 2ZNYA 1YS6A 3O8HA 3FK7A 2VTFA 1NX9A 4Q4Y3 4O6JA 1MS0A 4V2VA 1B9MA 3LOCA 3GF6A 1DPRA 3K9TA 1CONA 3JREA 1S8NA 2BU9A 3P5JA 3OYWB 3QAHA 3C2HA 1NT0A 4ZZDA 1I1EA 4D1QA 2EV5A 3RFRA 3FHAA 3SEEA 2RHPA 2DDUA 3CMYA 2ES3A 3TDZC 4HQEA 2CAVA 2QQNA 3JD73 2Y6GA 3ACFA 4IEVA 3ZFEC 5CG9A 2QQJA 3H3VK 1CWPA 2PHLA 4JQFA 2W52A 3V42A 1RINA 5FJHA 3DEWA 3GALA 2VZUA 1MSEC 2HBUA 1SBFA 5BNPC 4GGGA 2EA4A 1VQMI 2DTYA 3JBG3 1ZRRA 2WV1A 4KGGA 1XSXA 3CCLI 2CL2A 1U0JA 4N43B 1QOSA 4DZPA 5TISC 5FYTA 5C3OA 2C9KA 4K1ZA 3MFAA 2ACJA 2LOOA 3JRHA 4N53C 5IT9Z 3SYTA 3S15J 1D2SA 4NC7A 4LIVA 2XUBA 4D7NA 4LK0F 2GAUA 3AMNA 1D5VA 3HEIA 5LGUA 2W1SA 3KV6A 4M3GA 3I5UA 3ITQA 2M4KA 1IG0A 1CPNA 4QX1A 4N43C 2WAOA 3GCXA 4UUVA 2JB8A 1POGA 3BLYA 4XPVA 1E2XA 5C3RA 2YDEA 2RJ2A 3L2WA 2LRPA 3HXLA 5LBQA 2J1AA 3OBZA 4DRRA 1TT5B 2RN7A 1GYKA 2F4MB 5GAEJ 2GN7A 1W6MA 3J7AO 3PU8A 4LBJA 3ABLH 3TN92 3ISPA 2IA1A 3Q0WA 1C1LA 4GB32 1HXS1 3JD72 4JC1A 2JDAA 2XH6A 2XQXA 4E2SA 3NAPC 3O1TA 3AXDA 4S2DA 1VQOI 2VE1A 1ZNPA 4CEWC 2R5ZB 4WXCA 2XKPA 3WGIA 2YS9A 5HPOA 4PDKA 3DPTA 1HN1A 2PAKA 2HPMA 5FYYA 2HNHA 1AR62 1FPN2 3GTJJ 2F4IA 2VMEA 2VW0A 1W2UA 1JI6A 3QP6A 1ERDA 4FOYA 1JUHA 2PXJA 3AKTA 2QZ2A 3OGGA 2VMCA 3CESA 1S2KA 2PLYA 1DDNA 4JGYA 4GWMA 2RNGA 2DI3A 3FLTA 1FSHA 2QFEA 3LWCA 3LOIA 3AG4H 4AR2A 3GVAA 2XDVA 4LOCA 2JE9A 1RI7A 2VE9A 1AR82 5C9AC 2ZAHA 2KJBA 2WNUB 5FDBA 3VFZA 4AVTA 2VI6A 3NEUA 2EAKA 1BHGA 3PUQA 3TEYA 4AQ2A 2V6CA 3CC4I 1UZ0A 2CYYA 4KDPA 4LOTA 1NKGA 4Y1YA 1WH5A 4XACA 4TYSA 1U5YA 2AENA 1YXWA 4S2HA 2JG8B 3NJVA 2IWGB 5F08A 4Y17A 2X48A 1W6OA 2LSOA 4JVAA 5F7UA 1R1UA 2MEV2 2VBWA 1YQ5A 3SLIA 1I27A 1MS1A 3FHIB 5FKOA 4J01A 4GALA 2PHTA 5LWBA 5ED4A 5F37A 5IVFA 3HIFA 2P6SA 1PO21 5L3GA 1R1ZA 1N77A 2I10A 2XONA 1S0GA 4H3WA 5F3IA 1A5JA 3JAMK 5K0UA 1P7JA 1SC7A 4CCLA 1DPUA 1K6YA 4GXLA 4OVEA 1FNYA 4PQQA 4IE5A 3K7AJ 4MO3M 1BCXA 3TOAA 3BR1A 3T09A 4L5EA 2W24A 3N9MA 3VSKA 2HDDA 3DTEA 3FZVA 2BOIA 1GNHA 1HB3A 2GMPA 3CU7A 1IRFA 3J8F1 4QB2A 4UW4A 1JUSA 4IE4A 5FD6A 4XE9A 5HLTA 4DEVA 2A3YA 2G9WA 4P9XA 3KYLA 3CHXA 4NHMA 4HKOA 3CMEI 4LBNA 2A68F 1SLLA 5A1LA 3DWLE 3E5XA 5FZCA 3H7JA 4Q5OA 4HN0A 1QNYA 4LO8A 1LECA 1Z7S1 4ENJA 4Z1VA 3VBFC 4B29A 5I0DA 4FOWA 1UY3A 2VPVA 1URXA 4AVAA 3U0ZA 5IOZA 3SITA 4FPOB 2H8RA 3JCIA 2R7OA 4BDZA 4NRPA 5LBFA 1FOXA 2XF7A 3ST7A 3U2RA 3KEQA 4NIAA 1BOBA 2WSVA 4BUPA 2HPIA 5DXDA 2FD5A 4FCYA 4MHRA 2Y6HA 3ZPYA 3V0BB 4DYQA 1L3LA 1MQTC 5FYSA 3WHBA 3T2PA 1EF4A 3CDIA 5ICGA 3C8XA 4YZ4A 2NXNB 4K8RB 5J6XA 3F8BA 3H42B 1VNDA 1OFNA 3NJYA 3CJQB 4UHTA 2W9XA 1UZCA 3CBNA 1JHHA 3K4LA 1WW7A 1X7NA