4LIUA

Structure of ycfd, a ribosomal oxygenase from escherichia coli.
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
373
structure length
360
Chain Sequence
b'MEYQLTLNWPDFLERHWQKRPVVLKRGFNNFIDPISPDELAGLAMESEVDSRLVSHQDGKWQVSHGPFESYDHLGETNWSLLVQAVNHWHEPTAALMRPFRELPDWRIDDLMISFSVPGGGVGPHLDQYDVFIIQGTGRRRWRVGEKLVDPFEAIIDEELEPGDILYIPPGFPHEGYALENAMNYSVGFRAPNTRELISGFADYVLQRELGGNYYSDPDVPPRAHPADVLPQEMDKLREMMLELINQPEHFKQWFGEFISQSRHELDIAPPEPPYQPDEIYDALKQGEVLVRLGGLRVLRIGDDVYANGEKIDSPHRPALDALASNIALTAENFGDALEDPSFLAMLAALVNSGYWFFEG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L16 arginine hydroxylase
publication title Ribosomal oxygenases are structurally conserved from prokaryotes to humans.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 84
structure length 360
sequence length 373
ec nomenclature ec 1.14.11.47: [50S ribosomal protein L16]-arginine 3-hydroxylase.
pdb deposition date 2013-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08007 Cupin_4 Cupin superfamily protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2510 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4liuA02
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 4liuA01
3KVAA 3DXTA 3N9PA 4CCKA 4EYUA 3PDQA 5F3EA 3K3OA 5FY1A 4QX7A 5FP4A 4Y4RA 2OX0A 4Y33A 5FZOA 4UF0B 5FPAA 5ANQA 2Q8EA 4DO0A 5F3IA 3DXUA 3PUSA 3OPWA 4QWNA 5IVFA 5A80A 5IVEA 2PXJA 2OQ7A 5F37A 3N9QA 3N9OA 4BXFA 5LW9A 5FZ7A 4GAZA 5A7WA 5FY4A 4D6RA 3ZLIA 5FP7A 4GD4A 5FUPA 3AVSA 3PUQA 5A3WA 5FZ3A 5FYYA 3LDBA 2YU1A 3N9LA 3PTRB 4V2VA 5A7OA 5FZ0A 5FZDA 3OPTA 3LD8A 4AAPA 4C8DA 2P5BA 5FP8A 4D6QA 4LXLA 5FPBA 2GP3A 3KV4A 3PU3A 4QXHA 3U78A 4BU2A 5F3GA 3ZPOA 5A3NA 4LIVA 5LWBA 3PURA 3RVHA 4NUBA 4LITA 4EZ4A 5FBJA 4CCJA 2OT7A 4IGQA 5FZOB 2YBSA 4V2WA 2XXZA 4HONA 3N9NA 2XDVA 5FYMA 4LIUA 4TN7A 2GP5A 2WWJA 2W2IA 3K3NA 5IVCA 4CCNA 5FYCA 4DIQA 5KR7A 4CCLA 5FUNA 5FXVA 2VD7A 5ISLA 5FZ6A 4HOOA 5FY0A 5FZHA 4D6SA 5IW0A 4QX8A 5A1LA 5F32A 4Y3OA 5FZCA 5FXWA 4CUGA 4XDOA 5FYBA 5LY2A 4XDPA 5F5CA 3KV6A 3NJYA 5LY1A 3N9MA 5FPVA 5FZ8A 4IGOA 5A7PA 3PUAA 4CSWA 5FZLA 5E6HA 4EZHA 2OS2A 5FZFA 5FY7A 3KV9A 3AVRA 4QXCA 4AI9A 3AL5A 5A3PA 5FXXA 4QU1A 4BISA 5FPLA 5K4LA 2WWUA 5FZ4A 5FWJA 4CCMA 5IVJA 5FYVA 5FYZA 2Q8CA 5FWEA 5A1FA 5IWFA 5FZGA 5F3CA 5IVBA 2XMLA 5FYSA 3U4SA 5F5IA 5FYTA 5FZIA 5FYIA 1VRBA 3AL6A 5A7WB 5A7NA 2YPDA 4GJYA 4E4HA 3UYJA 3KVBA 5F2SA 5FJHA 5F2WA 4CCOA 3K2OA 5FY8A 2XUEA 5IVYA 2OQ6A 5FZ9A 4ASKA 4UF0A 2YU2A 2YBPA 5FP3A 5FP9A 5FJKA 5FYHA 5A3TA 5FY9A 4QXBA 5FZMA 5IVVA 5FV3A 5FY5A 5FZBA 3KV5A 5F5AA 4URAA 5CEHA 5FZAA 5F39A 5A7SA 5FZEA 4GJZA 5FPUA 2YBKA 5FZ1A 5FXZA 3PU8A 5FYUA 2Q8DA 5FZKA 5A7QA 4IGPA
chains in the Genus database with same CATH superfamily
4AM3A 4PSWA 4XC9A 2E26A 2AXLA 4WM7C 3KT1A 3H3ZA 4EM0B 1QJU2 5J8CA 4BDVB 3NKTA 3AL0C 3D8CA 4BXFA 3T09A 1GOHA 3DEMA 5E1ZB 2JB4A 5KHKA 4K6BA 1ZBE1 5K1YA 2EXIA 2EB7A 1RYYA 4LO5B 1WH5A 5FRAA 4TWTA 4Z6YA 4XICA 3RI4A 4FCYA 2ZGTA 5FMCA 4DBRA 5J40A 2P6HA 3WF1A 5GADJ 2W47A 4IHWA 2JVGA 4G6DA 5FFXA 3O14A 3NSTA 4CCLA 5JFRA 2DOAA 3WW1A 1HXS2 3K75B 3PJQA 3C2BA 2RG4A 2VJ4A 4BXXJ 2EIJH 4XABA 2W25A 3IIIA 1LULA 4A12A 3RDIA 1F36A 3QODA 4BBRJ 4B3AA 1ALYA 4D5FA 2YPDA 3AP7A 4WM8A 1OCRH 3TEWA 4YFZA 5E1XA 2ZGRA 2PA7A 3ZM8A 2HDCA 2ET1A 3OS0A 5GKAC 1QJZA 1XJAA 4CUCA 1BC8C 1GP5A 4BDYA 2M7AA 1X19A 2DU1A 2C5DA 1IS6A 1RR7A 3LSTA 3OYWB 1GV5A 4NIGA 4Y52J 3HNYM 1AKHA 3BG6A 3B93A 2P0WA 2ZB9A 3OY9A 5I0DA 3K1PA 3VZLA 4YVSB 4F3QA 2IA0A 4ZU5A 1C1LA 1O8PA 1VE0A 2E33A 3VZOA 1QXJA 3OF1A 4NC8A 3OJBA 2IPQX 3JBG1 5G05L 3FHZA 4HOOA 1D1CA 2X9DA 3ASNH 5IK7A 4KIFA 2R5YA 4IXAA 1SLLA 5L19A 1POV1 3GEZA 1ENRA 2O03A 4QXCA 5K7HA 1GWLA 5L7OA 1VMHA 1W8HA 2IJLA 3FXOA 3LOCA 1SFUA 3F8MA 1AX1A 5FZIA 2LSOA 3ZSMA 3ZXEA 4XBFA 3DPLC 3GTJJ 1WBLA 3AP4A 4BWOA 3IBMA 3E6CC 2D98A 3OG2A 4KI5M 1Q8VA 1UCRA 2V9PA 4XUPA 1X1DA 1O4YA 4CCDA 1PGW1 3HOBA 5CYYA 1QVUA 1O3SA 2H1KA 1OPOA 5JHFA 1LGCA 1TTYA 1WQ2A 1H30A 2AEZA 1T08B 1XG1A 3OOPA 4RD7A 3JRGA 5IVFA 3SITA 4JKMA 4AU7A 2LKSA 4HX8A 1JJ8C 4DXTA 5GZCA 1RMU3 3G71I 4IEQA 1ZHFA 3GJAA 2LG4A 1SMVA 4WV8A 4MXWB 3JSPA 2CUFA 2YPJA 4M9XA 5E3NA 3Q9SA 2BVLA 1QU0A 3M7GA 2G9FA 3ELNA 4PIXA 3OMYA 2L02A 5FJ8J 2L9RA 2ECBA 4A0ZA 1ACCA 2L3DA 5TGTA 4QHZA 4PI0A 1FY7A 1TME1 2IS2A 2CO5A 2XG3A 3WF2A 4B1RA 4U2AA 4B29A 4XZUG 1FMVA 3DYMA 3HTSB 1G3YA 3DPRB 1NZCA 3FLRA 2WDBA 4Q4X2 4OAYA 1XDSA 1VQLI 5FMOL 3VDCA 2EV0A 4Q4W3 4XIOA 4ATFA 4AVCA 3WCSA 5E3MA 1RUG1 1WJEA 2GQQA 2QNKA 3MBWA 2X6YA 3IIAA 3T0DA 3S6PA 1BI0A 4PQQA 3TN93 5DAPA 5B5EC 5DMYA 1UO9A 1TQMA 1TMF1 2NM1A 2QUOA 4N9HA 2XQRA 1FTTA 2CJJA 2M3AA 3HBZA 4RAYA 3HNBM 1RNLA 4L9JA 2ZXJA 1HQWA 4CDXC 1HB2A 1X82A 3PFIA 4UXNA 3M8JA 3GXOA 4E7JA 2V1DA 1WH7A 2P6TA 3C7FA 3HPGA 1A35A 4QQPA 3IL2A 2FZ2A 3CJQB 2BNOA 2VQGA 2FQ4A 1UZCA 2W2IA 1QWRA 2WFF2 1JT0A 3GTLJ 1W6NA 4CUAA 3WNPA 2VQHA 5C3PA 2VQAA 1R091 3VBHB 2H09A 4N4OB 2X4HA 1BK1A 3LFIA 3OS2A 1FOD3 2EXHA 3KT7A 4HX7A 3PUFA 4I0BA 1KONA 1R1VA 4LJZF 2GLOA 5E8GA 3PIGA 5FYTA 3S5AA 3F8CA 2R7EB 4AVZA 5CQGA 3IP4B 1TG7A 3H5RA 4ASKA 1U5IA 2DLLA 2ZOEB 2XB5A 5KVRA 5FLVA 5FLXK 1QIQA 4A0YA 4EN9B 2D6NA 3MW2A 2L4MA 4LB6B 3RQ4A 1IN8A 2Q2EB 3OY8A 1GZWB 4EYUA 2R043 3MI8A 1YTYA 4OOIA 5HS8A 2CQKA 1R22A 1WJFA 3VHPA 3I2DA 5EEAA 1CD3G 2BPA2 2WY7Q 2KFDA 2Q8KA 1X9PA 1GUIA 1PJRA 4MADA 2TDXA 3ZQGA 4HZFA 3C7JA 1MJ9A 2PMZA 2JK3A 2AEYA 2VZPA 1MZFA 3MIEA 4NRQA 4OHXA 2IXJA 3GALA 3FWEA 5F3GA 1GR3A 3L2UA 1EV13 3PHMA 3TEYA 3RMXA 5C4WC 3OYMA 1O5UA 4LULA 5BMZA 1JZ6A 4CCNA 1DZQA 3ZR8X 4KISA 3PL0A 4BJ0A 1RIRA 2DF7A 1S0GA 1MQTC 1RUC2 1SBEA 1E5HA 2ZGUA 1KRIA 1D4M2 3KP5A 3SCHA 1HV1A 2Y0OA 1CZTA 1W04A 2G9WA 4AI3A 1LECA 3QAHA 4CEYB 1IZ1A 3U1KA 5FFOC 4CUBA 3U14A 3ELKA 1FT9A 3DU5A 4EE2A 3G2BA 1FV3A 1ZX5A 2ZJPF 5M3FJ 4QQOA 4C0HA 4A42A 2VNGA 1JOJA 1DIWA 2GALA 3NV4A 2Q0AA 4LUMA 1XYOA 2HWF3 2E9QA 1BM9A 3ABMH 4C9YA 1XRUA 2GIZA 3HQXA 5KAFC 5C70A 3CJIB 3ILRA 2VZUA 1ONAA 2ECCA 5LHHA 3K0LA 1FLIA 2ESNA 5L73A 3VBUA 1PO12 3MDPA 4XEZA 3OYDA 1FAYA 2DCJA 1OH4A 3N7MA 3OEBA 1C8M3 3HKZA 4Q48A 5GZEA 1DDNA 1BR4A 5A7WA 4ZZLA 4XF4A 1J9IA 4FPOB 2JKXA 1DQ5A 2R7UA 2NVUB 3OSGA 2BGCA 1YLLA 5BPXA 4XR6A 2W0XA 2OZJA 3FL7A 2VUCA 4A5MA 1GKBA 1BEV2 2R072 2XB0X 3PNYA 4DOUA 1Z7S3 1GUUA 3P5BA 2AENA 2HYXA 5C5UA 1H9PA 5KWRA 3RZOJ 4KFCA 5A7PA 4P9XA 1MS3A 2HYJA 1D0XA 3OL4A 4PJ0C 3WDTA 4LBOA 5IVBA 1UY0A 3I2GA 4Y1YA 5CKTA 2XSDC 2X5IB 4O9GA 1PZ9A 3UT0A 5LASA 5BNGA 3IMMA 4HF0A 1SG3A 1N25A 3WLUA 4Q29A 3OPZA 3ZYPA 2PFWA 3FXRA 3RJPA 3HRUA 1ZZBA 3WVJA 4XUOA 1AF9A 4BEHB 3TDZC 4RQPA 2P4EA 2RMU2 3MVPA 4URAA 2L7FP 4IJAA 1WSUA 2FMYA 1UY3A 4LT5A 1S29A 2HVSA 4A3LJ 2WAQN 4MTDA 5L3CA 4HRIA 5CVJA 4IV1B 1LQ1A 2QCOA 4QWNA 1NG0A 1ZK8A 4BIFA 5F37A 3PMSA 2WBKA 1E57A 3VDDC 4QIWN 4Q0SA 5DV5A 1IDYA 5A33B 2X29A 5EWSA 4WXHA 1OFNA 1G3SA 2WB1N 1ZZCA 4BQXA 3OBRA 1MS8A 2ATFA 2V26A 2QYOA 3TP0A 4PJNA 2TEPA 1AYN1 2Y6GA 3ABZA 4DIQA 5DZFA 5IK4A 3VKFC 3EPZA 3CDLA 3J7AY 3SKVA 3E5UA 5A1LA 1AR73 2V1XA 1S7EA 4RS5C 1UXXX 4HEA2 2IVIB 3I2KA 5FPVA 1K4SA 4CSWA 5FLHA 5E6HA 5B4NA 3RFRA 3HWJA 3I7DA 3VBRB 4HNUA 3ECHA 4HNVA 2ZX3A 4NWVA 3GLLA 1IS4A 2VL8A 4LLNA 3UL2A 4C91A 2PLV2 3KCXA 5BS6A 1ZG1A 2J1EA 5I91A 3BR0A 5IOYA 3J8F3 3CO7C 2JG8B 3J7AO 1LHVA 2Q0OA 2KJBA 3MPPG 4IPAA 1E5SA 5LK5A 5I0TA 1DQ6A 4DPNA 3P9KA 4FPHA 1Q8SA 5JXIA 2JA8J 5EPAA 1H1MA 1DU3D 2X6XA 4HKOA 4WVMB 1HN1A 3WW2A 5C9AA 1VBC2 5FPUA 3KYDB 5L9RA 1AR83 1TLHB 1MS1A 1XNCA 2R7RA 1HA8A 3J81K 1VQOI 3LFUA 3H1MA 1WMXA 3LFMA 3ZOIA 2W82A 4L9NA 1GP6A 2Y34A 4HQMA 1J09A 1PK6C 2QDNA 3AKTA 4FAHA 2M2EA 1PX3A 4D9JA 1EH6A 4FFFA 3U4XA 3IDBB 3JCUC 2WO2A 2GP3A 2VBBA 3ETPA 1LEAA 4AHWA 3WU0A 4QKNA 3VKOA 1MKMA 1JTXA 3I3DA 5KK1A 3Q8AA 3A01B 2J1AA 4AFBA 2NAZA 4OMYA 1LU2A 2FNAA 1LOCA 3DYOA 4ET7A 4C2TA 4RR3C 4BQYA 4LHSA 2K02A 2RKHA 2A6EF 4XLFA 3LKJA 4FP2A 5GALA 3CQZJ 2Z2SB 4AWDA 3JRBA 2QZ8A 3O7OA 2HYKA 1WGPA 2Y2ZA 1WRJA 4MEYF 2DCEA 3BZKA 4LMYA 2QZ3A 2J1RA 3GBGA 2DT5A 4BUPA 3VZKA 3MD2A 2DQLA 1MMDA 1QZYA 1NK2P 1AL22 4ZYEA 2QUFA 5IYYA 5F5QA 4GDFA 3KD4A 5DAWA 1DYKA 2VXZA 1YITI 2EAAA 3JD71 4QX3A 3DP7A 3CLQA 1WMEA 2JDNA 1CAWB 3ZPLA 1ZVFA 4JHTA 2KJCA 3L09A 1RR8C 4KNYA 4Z2WA 2HOSA 4KITB 1NX9A 3F8FA 3HSEA 2YHJA 2A6ZA 1HB1A 2R7ZJ 4GH4C 1JU3A 5DUVA 1CF7B 2B39A 1X58A 2W08A 3T8RA 1YCIA 4DY5A 2JDMA 3T08A 1RUOA 4CU9A 4QGLA 4RGKA 3HRSA 2J1SA 1Z1DA 5DZEA 5FKKA 3F6OA 1Z21A 3R4KA 3ZFFC 5FQ0A 3EJKA 3VBOB 3V0BB 1J2XA 2R063 2VC0A 1UWWA 4LBLA 4XJ8A 4A69C 5DD8A 1ITYA 2ZGLA 3W58A 2IGOA 4FE7A 3HB9A 3O1OA 4AHXA 3ABKH 2E51A 2GH8A 2K86A 1ENXA 4F83A 4KU7A 1RKWA 1D7PM 4AI8A 5AIQA 1O7FA 3D0SA 4K1YA 5D8AB 3T2OA 4AF9A 4AOCA 1OYIA 1NXD1 5J7MA 2GOMA 1WMFA 4CU7A 1FYUA 4ITCA 3B7MA 3GTQJ 4W4ZA 1MR5A 4G7ZF 2D6LX 4J00A 4AWXB 4Z8BA 3LAGA 4GB32 2JKBA 3BR3A 4IRHA 3QU6A 2RC4A 2M4KA 3O3KA 1XNBA 2GC0A 2PHFA 4J01A 3S7EA 1XU2A 3MHZA 1R5GA 4LLOA 4E70A 3GMEA 4CDUA 3ZYRA 4BA6A 5AONA 2RHPA 3I5UA 4HFSA 4OULA 1W0NA 3SXWA 4EWDA 4ZYGA 4UXAA 4QQ2A 3LEGA 3COAC 4NIDA 1KQRA 2E32A 3HRMA 2FSWA 3WG9A 5JPNB 1QHHD 1EAH2 2WNUB 1R1A1 3HYIA 3VGIA 3TBDA 5C6CA 2HTJA 2HWVA 1IS3A 3ACLA 3AZWA 5C3RA 2ADEA 3D82A 1MNEA 1ERDA 3J7YJ 3A2KA 3OCPA 2BE5F 4LUKA 2GXAA 1MVQA 3CMGA 3S8PA 4BE2A 3VKLA 2DFBA 1UZZA 2HWB2 4IEZA 2K27A 3KB5A 4KDPA 3F95A 4AW7A 4D7YA 4LR4A 4WM7A 5HV0A 2FMLA 1RXGA 5T3NA 4FBFA 3ZQ7A 5BPIA 1LR5A 5DZGA 1T2KA 1YIJI 4MQ9F 5GAEJ 1U6GA 4CDWC 4NRMA 2PHUA 1U12A 1YE9A 4B4CA 2BGOA 4KYWA 1F2NA 4W6WA 1ZA7A 3AZXA 1PZ8A 2NN8A 2CFOA 1N3PA 2JDUA 2QQVA 3S14J 4QB2A 2LMDA 3TO6A 1LRHA 3OTFA 2WV1A 2RJKA 1FX5A 2DI3A 4QX7A 1HRV2 2QQMA 4XJ9A 2H0BA 4BE0A 4OLLA 3C7EA 1JN2P 3DPUA 1B35B 4JRAA 1QH7A 3IMNA 5C3SA 5H6QA 4JGYB 3FISA 4U88A 1MDMA 1RUH1 2SBAA 1ZGAA 3LSEA 2ZKZA 1RESA 2XJSA 4FISA 3UNGC 5FOJB 3WP5A 2WZR2 3N7JA 4LOCA 3KFWX 2VMEA 3DGTA 5I93A 3H8UA 4COWA 3V7RA 2J42A 2WNVB 1XC6A 5FXVA 4TYSA 3O6BB 1QQP3 2VR4A 4ZJZA 5B1BH 1ZR2A 4B1MA 4RAZA 2BGPA 3S32A 2EALA 4JK1X 4CTEA 3B69A 3PUIA 1D5YA 3SHRA 1K42A 5DG2A 4N43A 1YJKA 2UY8A 1WZXA 4HLXA 4A3CJ 5F1JA 3JRCA 2JVHA 4Q4Y1 1DP3A 4UUSA 3JXSA 3RG0A 4J25A 1D1BA 1UHWA 3I64A 1BLZA 3EMRA 1AR62 4AYBN 2VGDA 4CGZA 3D5SC 3MKWB 4HXCA 5C44J 1NCRC 3CZ6A 4DYRA 2Y6HA 4E7IA 1W8FA 4YM2A 5ABJC 1ENQA 4NROA 1XMXA 1IRFA 3OS1A 4COYA 5KXDA 2IP2A 2LREA 1I1EA 4JGZB 3NNJA 2GZWA 1BMV1 4GFBA 2HBTA 2XL7A 3DXUA 4LJHA 3B6AA 3RKXA 4NVPA 4M73A 1FATA 1ZZ6A 5DCMB 2WABA 1W0PA 1PVC2 1GXPA 3GLXA 3GFJA 2BV4A 1JYXA 1UOGA 1RUE2 4L8QA 2FOWA 2LKPA 3ZMZA 3H92A 3ZO0B 4M6XA 1S8NA 4Q27A 1CX1A 1JKPC 2QQUA 1DFQA 2BXYA 4ZZ8A 1UHSA 5IHRA 1GVDA 4LE4A 4F91B 1G8XA 3GWZA 3O1RA 3BKZA 3NKGA 1FI2A 4FT8A 1R9TJ 4PF5A 2D3RA 1NLQA 3SZPA 4GQ7A 3IV5A 4AGRA 2RS33 4IOCF 4OMDA 1V6MA 1PIV1 2G19A 3GUDA 2NRAC 1XSDA 3KHCA 1J3RA 2FUG2 3CJNA 1RPWA 1OVSA 2DFEA 2YV8A 3OD4A 3HEIA 4HDUA 1RUJ1 2CYYA 3CP8A 4ZZDA 1FYLA 1TQPA 1R081 3MKLA 1EJ9A 2DDUA 2JJ6A 4GCVA 2CUEA 3LSJA 1JXSA 1T6BX 4Y1VA 5K7FA 5BNOC 3EYYA 2ZS6B 1FYMA 4BOWA 1SCSA 3V65A 4FPKA 1QMJA 3MFAA 2YGLA 3FMQA 1JMUB 3CQOA 3BZCA 3NJVA 4XQ4A 5FZ7A 3K1NA 2VZOA 2Z69A 1Y1VJ 5GP9A 5IP7J 3J7LA 3ATGA 3I4NJ 4EATA 1Z3XA 2DJNA 2WC2A 3MF9A 1EA3A 5A3NA 5FO5A 2ZMNA 2NMOA 4YIFA 1PYVA 1JYTA 3VD5A 1IXCA 1NCQB 4XRSG 3PTYA 4BK4A 2XAHA 5JSPA 3LAPA 5C7GA 2L9NA 1APLC 1FPN2 3CESA 3F8BA 1VBE2 3SKJE 4J19A 4CDGA 3P7NA 1NY72 4G9SB 5JR7B 4DYQA 4ZDOA 2VMDA 1SZBA 1DGLA 1UMZA 1V6OA 1HF0A 5FB2A 2VBWA 2IS6A 2WA0A 4DXSA 2RDRA 2Z5UA 4XETA 4YLZA 4A4AA 3WZ1A 3PUHA 4W97A 1VBA3 4LA3A 2XC7A 1FMD3 4CDXA 2R49A 3DEWA 4XAEA 2ILMA 1LHOA 3ERMA 2ZJRF 2ERFA 3H42B 3P5JA 3CCJI 1OLME 1VBB2 5FZBA 3ZDVA 4A93J 4IQ4A 4JDOA 3SISA 5A7SA 5L3BA 4A3XA 3AMHA 2OV7A 1QOOA 2RM22 5JAXA 4FTSA 3S2WA 3UJQA 1NT0A 4YG6A 1BHGA 4QB1A 2M30A 1K61A 4XFAA 4YELA 1XSXA 2R5ZB 1OUSA 4MUVA 1OQEA 2WAQA 1AXKA 2JENA 2A7AA 4HNTA 4IL7A 2MEV3 3A0KA 1BBT2 1ONVA 3VBSC 1OCPA 2VW2A 3DTKA 2V1NA 1LNSA 1B8IB 4M3CF 2VJXA 1W03A 1MW7A 1FOYA 5BYNA 5EJCA 2BFUL 3K3NA 4XN3A 3BN6A 3OUIA 1WCSA 4LBJA 2J7MA 4D1QA 2KKOA 1QJU1 1DP7P 4AVTA 4R9BA 4M9SA 3MIBA 3KP4A 1PP8F 1PGSA 1WW4A 1Q5OA 1NTCA 2ENRA 4MX3A 4AI9A 2WN3A 1QVTA 2E36A 1MBEA 1AJKA 2P3IA 3L7WA 3USSA 3BTXA 1YYVA 1O4TA 5FYZA 4ZXKA 1XNKA 2F4LA 1JZ7A 4Y17A 4XTPA 4BMEA 1JI8A 5EG0B 1RVF3 4OQ8A 2L7ZA 2FEZA 2XLFA 3C2UA 2W9XA 5LD2C 4GWNA 3HBLA 1RB8G 1HXS1 1LESA 1RHI1 2PX9A 4DQ2A 4IE6A 5C4WA 5F0HA 2LY9A 3WG4A 5DUXA 3K51A 2WSUA 3CDZB 3OR1C 1W9YA 5E1WA 1ZLJA 1A34A 4RSUA 1O3QA 3GTKJ 3H8XA 2QJVA 1YQ8A 1MMSA 1MQTA 4DO0A 4DNYA 3H9AA 5J98B 5IYBJ 2QQWA 1N77A 4L5EA 3IPVB 2CFXA 1UY4A 1W1WE 2YC2A 4IE7A 3CLPA 2BQPA 3KV4A 4BL0B 5H9QA 2X8KA 4O9EA 1R6RA 5BY5A 2E7AA 2CV1A 4XTMA 5E3LA 2WWJA 4XJAA 5BNPA 4N53C 4RA0A 2XRLA 5FZHA 4GZ9A 1XB4A 1FNNA 4BQ4A 1RJ7A 3DKQA 2VZQA 2LROA 4U0YA 3VKMA 2CW0F 1MMNA 2WADA 2DODA 5H20A 3CP2A 1POV0 4KICA 1H2NA 2W1QA 3RZMA 1D2QA 3S7IA 2V73A 2KZVA 5LBBA 2PHXA 3SMHA 1WCKA 4XK4A 1H1AA 5ACA3 1JUHA 1UU6A 2ADDA 1WBFA 3PQJA 4OVEA 1X8EA 1LKXA 3BJ6A 1T6GC 3HUGB 4QXBA 4LBQA 2HU9A 2GH2A 1DPUA 1YS6A 3R4DB 4AEDC 1R5ID 1T56A 2KXLA 2VBXA 3GX4X 2RDNA 1ASJ3 3Q0UA 1JTZX 4B4PA 1WKYA 2DT6A 2VMIA 5FROA 5GJ6A 5IOZA 3W59A 2E1MC 4YW1A 4UY8I 2QTWB 2Z3YA 4XQWA 4ES9A 5F3IA 4NRPA 3VLBB 4CXYA 3W2VA 4J1XA 4OHYA 1NA1B 4HA8A 3M3YJ 2P3JA 1Z91A 3VSLA 5M5WJ 1ZZ8A 2X0LA 4A3KJ 1IPJA 4YFNF 3KEQA 4LIVA 1AX0A 4MO7A 3FBIB 4EM1A 2VQUA 1QH6A 4JP0A 1UG2A 5D4RA 2A3SA 3ON7A 1S2BA 2CWSA 2LNBA 4AZZA 4SBVA 3ACFA 3CUQB 2D6PA 2GSYA 4JX0A 5FZ8A 2X6WA 4PDWC 1ETXA 2UYBA 4M4PA 4Y22A 2DA2A 4BXUA 5CVRA 3BPVA 4CICA 3CU7A 1Q8PA 1JZ3A 3MQ0A 3K2AA 1JW6A 2WYSA 3VDDA 3ZR5A 1X36A 5FAXA 3M8EA 1YRNA 1H8VA 5FOBB 1ACIA 2KZGA 4E7SA 1LB2A 5IK5A 4CDQC 2P17A 5FJKA 4OYUA 3PVEA 2K4BA 4LBNA 5KXBA 2DWRA 3SJMA 3L2CA 4E4ZA 2RDSA 2F5EA 3VBFC 2BNNA 2KDOA 2ZEYA 5DCFA 4ISQA 2RN7A 1UQXA 4RS5A 1MH4A 2GXBA 2ARCA 1U5TC 2HFHA 4Q4X1 1HIXA 2X10A 5KXCA 1RMU2 2WZ8A 3LFKA 2J1UA 3AMNA 4A7YA 4WM8B 4GYIA 3J9SA 3ZFEC 5LHGA 2X09A 3OGJA 4UWDA 3H7JA 5SV8A 5JUVA 3BG7A 3O1PA 1S2KA 2FF4A 3ZN6A 1QNTA 3C7HA 1SD7A 1ULYA 3PIPF 1N1TA 3CMYA 4XQFA 1N1VA 3G7DA 1GVJA 1JE8A 3AKSA 4C3JJ 3J4UH 3E5XA 1Y39A 4FQ4A 1PO23 1R23A 4MHGA 3K7AJ 2A6TA 2WQZC 2E19A 2JDAA 1PK6A 2A71A 1H9GA 2WAOA 4OHZA 2R7QA 3AKZA 3GYDA 3LCPA 5FZ9A 1IRZA 5C3QA 3G1MA 4LD5A 1VI0A 3WODF 1R092 2WFF1 2RJLA 4NR1A 4UW6A 1XNDA 1OOPC 1LHNA 2Z5WA 4XW3A 5CEHA 4QGMA 4IEVA 2VI6A 2LTNA 3VB9A 1VMJA 3LA7A 4ZH4F 5HPOA 2P2KA 1UCXA 3TN92 2R5YB 2K46A 2QSHX 1W99A 1WD4A 4ZTFA 4UF0B 5FZOA 2VCMA 4IE4A 4RR3A 3B02A 4I3PA 5L7OB 3CZJA 1Q3EA 4XFHA 2WAAA 2YU1A 4V2VA 2P34A 1PO21 5FRMA 4AGVA 2ARAA 2QWWA 4UBGA 1Q8QA 4HPKA 4OIRF 1K3IA 1F4KA 2JRMA 1ZARA 4FTBA 2C4XA 3B9IA 3GF2A 3HOWJ 3BOPA 5IVCA 5ANNA 5FYCA 3RJRA 1IDZA 3UKNA 3GCMA 3P9CA 2FDHA 1LFPA 2A3XA 2EIMH 4YG2F 5IT3A 4L0ZB 4UVBA 1ZKGA 1GBGA 3WNMA 2JWPA 2JE9A 3L9FA 4JQTA 1CGPA 4GH4A 3U4SA 1LTEA 3ZX7A 2OZUA 4C2UA 2QBXA 2ZKLA 3GFIA 3NAPA 1Q1HA 1XXNA 2XGEA 1PX4A 4BAYA 2A6VA 4V19K 4PCRA 4W8JA 3AMQA 4GULA 2YR2A 2X5IC 1JHNA 1MS9A 1IJWC 4K1ZA 1HXDA 3N3HA 3ZXKA 4E4DX 2O8KA 1W5SA 3DTEA 1D4M1 3LF7A 1YFHA 2Y60A 4AYBA 1USSA 2VW0A 1UW8A 1S0DA 4FPLA 3JRAA 3CEWA 2I5UA 4ANJA 5C4JJ 2R042 2DDAA 3LMMA 1GOGA 3W20A 5LB6A 1HW2A 1TWCJ 5DABA 1GLHA 2WS93 3R4UA 4AGGA 2J22A 3ZQFA 2C9KA 2COMA 3UGGA 1LDJA 3TMOA 3H5AA 4V1PA 3BROA 4Y1ZA 3LSGA 3OGVA 1ZBA3 1LCLA 3AYCA 1ZQ3P 1MJAA 5HBAA 4UNOA 1S7OA 1EV12 3RI9A 4U7DA 2GC2A 4P55A 4X6AJ 3ZFGC 1HKTA 1TT0A 2XHNA 3VV1A 5EDNA 2ELJA 2CDOA 2GNBA 3PJRA 2GM4A 2GA1A 2NLRA 2WKKA 3KV6A 1SFEA 1UX6A 2K9ZA 4Y5TA 2WWYA 3PUAA 4QHBA 1MBJA 4L97A 3T2QA 1YOVB 1OMIA 3PMEA 3K70C 2Q8CA 1XNAA 2O5RA 1ULFA 5DAQA 5EV7A 2CL2A 1WHUA 5CVIA 5LRRA 5IAVA 3VBRC 3ZDSA 2ZCWA 5FY8A 1ZRCA 2YUSA 1V4RA 1CAVA 2ZEWA 4OQ9A 3HL2A 3JUUA 1BEV1 4HSRA 3L9JT 2HWF2 3K70D 1U78A 2JG8C 2ZX1A 5KCMA 4WVZA 4O65A 5AFBA 3C3WA 4M4RA 2OQRA 2DURA 3HAGA 1YFWA 4META 4GJZA 2LS6A 5CLSA 3WDVA 5KBFA 1Q56A 4F55A 2PHTA 4M72A 4NBQA 4BGDA 2OU2A 4MGZE 1D2SA 1U9NA 4CH7A 1C8M2 1Z05A 3OPWA 2ID3A 3G1LA 5C3OA 2A73B 1W90A 2A6HF 1U0JA 3T1BA 3FFZA 3ZQCA 3WR0A 4GD4A 2B46X 1IV6A 1MBFA 4UUTA 1MZBA 4Y26A 4YFWA 3WW3A 1FBQA 1SHWB 1MSFC 2RMU1 1D5VA 4M3CE 2A5WA 2JDKA 2UWBA 1Y7BA 4QPYA 1OYYA 3M1CA 3IN9A 1NQDA 1RUD3 2LLKA 4CDWA 4D7MA 1ND3C 3RI8A 1RUI3 3HOUJ 3G3ZA 4XRFA 4YNIA 1JHHA 2V7FA 2JEMA 1V5FA 4DY3A 3OY8B 1X33A 3TNQA 3FHIB 1IGOA 2EIEA 3VODA 1SLCA 2BWCA 3ZYJB 3PNVA 1X50A 5F3CA 1ETOA 4YZ5A 2BY2A 3KF3A 1AYN2 2HWD3 1LOFC 2IT0A 3I49A 1FC3A 1FWZA 5FP3A 3OYLA 4ZXEA 3O0VA 1DF0A 2HVRA 3WSOA 4PJMA 3U75A 1FNZA 3MZHA 1ULCA 1AL0G 1Y0NA 3MN2A 3I59A 3O1TA 2EIKH 3VZMA 1ND2A 1Y9MA 1TZOA 1UZ0A 2ET7A 3WNXA 1UOBA 1W6QA 3HQUA 1JHJA 1W0UA 5CFDC 1T6SA 4ZYHA 1FYKA 3KLSA 5LGTA 3J7MA 4NPLA 2A6YA 3ZXLA 4A3EJ 1OJLA 3KX2A 2FD5A 2LFBA 3ZN1A 5FP7A 2Q30A 1W7PD 4FTEA 4HLTA 3FKJA 5E18F 5H9SA 4O61A 4LITA 3ZMNA 2JD4A 2TRTA 3I71A 2FBHA 4Q4V1 5J1RA 4AK3A 4L9VA 2XGCA 1NCRA 3VBOC 3NW4A 1AR72 3I3BA 4QXKA 3HM5A 3DLAA 3R6SA 1R1UA 1I3AA 2Z42A 1MNDA 1V70A 3VBUB 5HLIA 2G1MA 2NXNB 1YWKA 3ZYHA 2CQ7A 3JZVA 1FTZA 1IXSB 3R60A 4XKVA 2EIGA 5T55A 4TZDA 4AUXA 4M3FA 5EF6A 5A7WB 1I3QJ 4IDZA 5DDGA 2VMCA 1T98A 3VOEA 4XFIA 1MGTA 1K4TA 1I27A 2OZ6A 4F7ZA 1D0YA 3CKHA 1AXYA 4YRDA 3NRUA 2Y0MA 2YBKA 3E1F1 2AH2A 4UW5A 3B6CA 4HF1A 1AR82 3K4KA 2GC1A 2VKDA 4P14A 3WHBA 5CAZA 3WGIA 2JA5J 3L2YA 4G3YC 2PXJA 2OCCH 3KMHA 1JKOC 2XVKA 1YXWA 3BCBA 5DD4A 3DFGA 3CMAI 1JZ5A 1UYYA 2JX9A 4HN0A 3S0MA 2E7WA 3W3CA 3NNLA 2M7BA 2VTXJ 2ZXHA 3GGLA 4RQPB 2N7GA 2VE8A 1NE6A 4QX8A 4F3JA 5HCFA 3OR2C 4UFHA 1YI2I 1OT5A 5A70A 2OYZA 1VP6A 3VZNA 2HR3A 3A0BC 1W2UA 5BNOA 4JVAA 4DS0A 1ETYA 3WEZA 3WP3A 4DB5A 1T33A 4HV6A 1CZVA 2R30A 4ZDPA 3JREA 4RHV3 3FMSA 3LE0A 2DA6A 3WHUA 5HVQC 3J7HA 4Q4ZF 4CVUA 1N75A 3ZP5A 3ZXJA 5JHUA 3SQNA 3QOEA 3C2HA 1YRZA 5IK8A 5E1RA 3WTYC 3SH5A 3BCAA 1NHAA 3OYKA 1V9U3 1MH3A 1POGA 2Q5TA 3WQ0A 4AIDA 2BBVA 3HSRA 4MNUA 3GZ6A 5I8TA 2VT3A 2BTVC 3O1UA 1QZZA 4AG4A 3WTTC 3HJRA 1H0BA 2NNYA 1H6XA 2DVAA 1RI7A 3B5LB 5JOZA 4HBNA 3WNOA 3ST7A 2YC0A 1S0BA 4SLIA 1QKQA 3K6GA 3WTZA 1SPPA 2ZFWA 4NIAA 1ZZ7A 4IERA 2JA2A 4PBPA 2XJPA 1BBYA 2R062 2ZGQA 5FYMA 4UI9L 4IHSA 4N0BA 1QY4A 2XAQA 4A3JJ 2MSYA 5K0UB 4IV3C 5C9AB 5LEKA 4BZ4A 1GV9A 1LEDA 2D40A 4IEUA 3TDUC 4ATEA 5LA9A 4DZJA 3FLPA 3LQCA 4G6QA 2KISA 4Y13A 3NO8A 4P5HA 2R0FA 3QRFF 5JXJA 5IFPA 1DYPA 3OYWA 5A7NA 2F2EA 2ID6A 4RL7A 1VALA 2ZKNA 3D5OA 4U7BA 2BBYA 3POIA 2P5VA 2VT2A 1Y8QB 1MMGA 5FP9A 2TBVA 5GTIC 3MIFA 3VBSA 5IPAA 2PQSA 2YB7A 3S16J 5IT9K 2CYFA 5FD5A 2AR6A 3RKWA 2PMHA 3MIDA 2JT1A 2A5ZA 5KAIC 1U5XA 3PU8A 2QQAA 3DECA 3OYAA 1YQCA 1Q1VA 3E97A 1RJ8A 5A3MA 2G7HA 4BJTA 2FCVA 2VC9A 4PDKA 5KC5A 4C3IJ 5ICFA 1QJY3 2PBIA 5M3MJ 3K1MA 3G6JB 4KG0A 3ZXGA 4Y4YA 1E5IA 2A05A 3OYGA 5J37A 4I02A 3OOUA 3I54A 3WE2A 2O7OA 4OU0A 2W91A 4BH9A 4NQWA 4DBQA 4UAPA 3KHBA 3A4CA 4LEJA 5GTHC 2K9LA 2VPRA 1HRV1 2Z1DA 1CAXB 3MW4A 4E7LA 2XROA 4Z2YA 5F5CA 1KU3A 2KPMA 2R7WA 5HDKA 3WNKA 3K4AA 4ZU7A 2CUJA 2WYFA 1ULDA 3RZHA 4Q0QA 3BG5A 3CBNA 1KZHA 2Y0SN 1SMTA 4IUGA 2BYVE 3KPHA 5JVVA 1V00A 4Q47A 4MFEA 1NLSA 4CP1A 4CEWC 4NNJA 1GP4A 5M0TA 4BHCA 3ZXDA 2HVQA 1VQKI 4EROA 2DVFA 3LSKA 1VMFA 1O91A 4MZUA 2BY3A 3JB8A 1XGMA 3TEZA 5FQ0B 2VN2A 1UZVA 2JJ7A 5ERLA 4GKYA 1LHUA 4HSLA 1KU9A 1J3QA 3TYJA 4AHZA 1X9TA 4QWQA 4ARYA 4JKLA 1S5LC 2A6WA 2ZA9A 4M6YA 1PGL2 5J6XA 4YW3A 4N53A 3EQEA 4UW4A 1FBSA 3CNAA 2EXJA 3FKIJ 4E7ZA 1LE8A 1V3FA 4YFXF 4QMAA 2DTWA 1IXRC 2DK8A 4IE5A 1O8SA 3F23A 1AR61 4NWWA 4FVVA 4UT5A 5DDJ3 1K78A 1MEC1 1HC8A 3Q8CA 2LY2A 5CFCC 1N3QA 3Q3SA 3UK9A 2G4IA 3PU3A 1CZSA 4BU2A 1D0ZA 1I50J 1DGRA 5BOXA 4I09A 2JECA 5F8PA 2F17A 5IP9J 3RPUA 5CBLA 3GZ5A 2ZX2A 2BZTA 4B3XA 1BMV2 4CDUB 2C6SA 3LEIA 2CQNA 1XC5A 2OUHA 1QQP2 1OXCA 4AEDA 4LK1F 4XDPA 1RRJA 3FZVA 5A2QZ 2QE3A 4XKBA 2HKOA 2XJQA 4RB3C 2HPIA 1PVC1 2VQTA 4IEYA 3H1YA 1AHDP 4YVWC 1X3WB 3T4VA 4GALA 5LHIA 1ON1A 2RS53 3NJXA 1QGPA 5LGNA 3F3XA 3ACHA 6PAXA 4K7JA 5A32A 4XFCA 4A3GJ 3KVBA 2BHZA 5IVYA 1UYPA 3MICA 1XNTA 4M3CA 3AX4A 4OI2A 4XIDA 5DDJ1 2A68F 3TO7A 1J1TA 1UYXA 1ON2A 4K40A 2RAEA 1W3XA 3RZGA 3HSFA 5CKNA 2COBA 2ZJCA 2KIMA 1XPWA 2Y31A 2GWRA 3WXPA 3R05A 1DZRA 1TEIA 4D5CA 3BALA 4TSVA 2OAZA 1W28A 1PVXA 2H0VA 2BV6A 2ZSHB 1IW7F 2K3FA 2VZVA 2LK2A 3BR2A 3ZMSA 4QDRA 4PDWA 2CAVA 4RAGA 3KF5A 1RUJ2 2XJRA 4WM7B 2PHWA 1HLCA 4J6GA 4I99C 4YM0A 3DEUA 1LODA 1MZ5A 2R0HA 3LGRA 3K4CA 3AL0B 4YGDA 1XSQA 4ZC3A 1HX6A 3IDEA 1XB9A 1RETA 2DU0A 3INAA 4IHTA 3H9GA 4GRIA 2CGNA 4CDQA 2R16A 5KR7A 5FUNA 1U0AA 1OURA 2KMUA 1D8KA 4RLFA 3ZN4A 5F32A 3WW4A 2W95A 4OUEA 4KMUX 5FO7B 3RYKA 1ETWA 3VBFA 1JYIA 5JMOA 5JI9A 4LORA 2RS32 1VTNC 5JWPA 1BW5A 2GN3A 2D1HA 2HWC3 3GHNA 1P9QC 1QEXA 3ZSKA 3C18A 1UG0A 1U5TA 4AIJA 3UKTA 3DKXA 1WPKA 4YG3A 3M3EA 4FHTA 1G59A 1K5MC 4QDQA 4CP9A 3PIJA 5F1RA 1GZCA 3FXLA 1FPN1 3IWFA 2H6BA 2V1UA 1VBE1 3G4SI 1U3EM 2BP6A 2XPJA 2ZBJA 4NHYA 4QB6A 3ZFEA 4DINB 1NY71 2DUPA 5F39A 2ZXWH 1YFXA 4LG0A 4K2EA 1VRH3 5B1AH 3D4KA 3OGRA 1YW7A 4BQ2A 2OQ7A 1F9NA 4LA2A 3SEQA 2L2OA 3JRIA 2CY6A 4BQ1A 2F5DA 2CU7A 4ITVA 2FCTA 4UFIA 1VBB1 3KGZA 1O6UA 2XPUA 2XHKA 3VYRB 1B9NA 1RC9A 3V7SA 2X1EA 4EV0A 2OC6A 2VJJA 4RB2C 2RM21 3LSMA 1Y0UA 2HEOA 3S2DJ 2R7OA 1OOPA 2BERA 2HZDA 5I0SA 2MHFA 4KIBA 4R79A 4K8RB 3ZSEA 2EH3A 4U87A 5L3DA 4LHLA 2NVYJ 3TKYA 1YX3A 3ZN5A 4OIOF 1LAJA 4BXSV 2ZMEC 2G9GA 2A6XA 1BBT1 5H9PA 2LC2A 2VONA 5DM7F 1VRH1 1A8MA 4XDQA 4RLQA 4MH0E 2JICA 2FX0A 1VBA2 1J5YA 5J1XA 5B3SH 1MIJA 1H2MA 2VOPA 2DW4A 1S0CA 4C90A 2HGCA 3Q0WA 4LKFA 2PJRA 5LEJA 4UVCA 2G9ZA 2ELKA 2FNPA 1Z7LA 4FPCA 5D6EA 2VNRA 4F93B 4OHVA 2HBUA 2JZYA 3CF2A 4GWMA 5EFUA 2WN2A 1ZELA 4EGYA 2E2IJ 4GIQA 4BLJA 4G7HF 1GV2A 3WINE 3WU2C 1U8RA 2BHYA 4X6RB 1OBNA 2Z4FA 2IXLA 1IG0A 4QKBA 1DGWX 4JHZA 4XJUA 1RHI2 4FX0A 2MEV2 2WO7A 2VNOA 1HOMA 2QQ9A 1UELB 5DAVA 4HLYA 2XH6A 2IXKA 3S57A 5J48A 4M3GA 1G7YA 1H8AC 1FBUA 3EQLF 3LDRA 3AG2H 2E34A 2XQXA 1YO5C 3I3EA 2DVGA 3K69A 1ZTRA 4RGGA 2X5IA 1Z7UA 2WRAA 1O4XA 5J1UA 2LTPA 3HRTA 1ZYRF 2VM9A 2CV6A 3AP9A 4NC7A 3AYDA 1K5JA 1YQ2A 5FXXA 2BEOA 2BVVA 4NAOA 2B9SA 3RWKX 2W4SA 2BRTA 4A3BJ 3KGLA 2PN6A 1SLIA 1B4AA 3BCWA 3ENRA 1TNRA 4Y1UA 3UGHA 4RFT0 1LDDA 5T5JA 1ETQA 4N43C 4P9IA 1RUC3 1SLAA 2OQ6A 4W6XA 1RVF2 2K3PA 5EQUA 4AC0A 1XX5A 2WV0A 1EYBA 2G0EA 4IV1A 3AFKA 3CD6I 2XUBA 3LEKA 1H0MA 1KQ0A 2K2SA 2DQRA 2CGPA 5GZDA 2K85A 3LA2A 1MNMC 1SFNA 3ZFGA 3UV9A 2R1BA 2VH9A 3DV8A 4AAXA 1LFUP 5L36A 5EZHA 1ZLKA 4RGAA 3BTYA 1BOBA 2JIJA 1A6CA 2R7VA 2QQJA 2HI3A 3S1RJ 2QF7A 2F4IA 3RNSA 1SD6A 1JOPA 4NAMA 1PO13 4CDXB 3VBRA 4X0GA 2R0QC 1W8ZA 1X1PA 1SAUA 4QPGC 1TC3C 2GP5A 2C0ZA 2VZ3A 3RZJA 2O6GE 1IOAA 2JG8A 3V0AA 3H1CA 2HTSA 5HLHA 4L99A 2PMWB 5J8FA 4FQZA 1MMAA 2LYCA 1RUNA 2YDEA 2IVJA 1TBXA 1DGRM 3RPQA 3LQRA 3QP6A 3OYNA 4XVHA 1RXFA 3MFCA 4FX4A 2BOJA 1JH5A 2RV9A 3RIRA 1VPHA 1LGNA 4II3A 5AC93 3WF4A 1F9KA 5FYHA 3GCWA 4PIZA 1KS4A 3GFMA 4OHWA 5A6ZA 2VL4A 2IVMA 4Y7NJ 3A7QA 3W5MA 2B0LA 1SCRA 1ASJ2 5FKCA 2VG9A 5H6RA 3ZN0A 2GAUA 3PDQA 1ND3A 1XGNA 3T0BA 5GM0A 5I8YA 5LCWL 4ZPIA 4I2OA 1TWHJ 2E31A 2K4JA 4QX2A 3MLLA 2F5VA 3CMMA 1BI2A 4YWAA 5CVUA 5C8CC 3T1LA 3J26N 3BU0A 3DEEA 3A01A 4K9SA 3RQ0A 4WVWA 1U9OA 3OBTA 1GZTA 5JZGC 2NPIA 3BTZA 2LR8A 1V6IA 3ZXFA 2KA3A 5CKQA 1DGWY 2BU9A 3PURA 4BACA 2E71A 4LG3A 1LOFA 1EUTA 2EA2A 2BUKA 4XRSA 2ZACA 2H6CA 3S3OA 1YC61 4FOVA 3WTXC 2JG9C 3VEPA 3THPA 1QDOA 5FZ6A 1C3HA 2WAEA 3FN9A 4CE8A 1R36A 2XB6C 4FPEA 4DXRA 1REDA 2YXSA 5C4WB 4GMP0 3OYHA 4QPWA 1SVMA 3OYFA 1VLNA 3M3IA 4DEVA 3PVNA 4ENMA 1W7PA 1RMU1 1MQTB 3FJSA 4R4XA 4H4KC 4MGQA 5CFDA 4AEJA 2VIXA 3CHXA 1BL0A 1QPMA 1CAWA 3JRHA 3QPHA 3UNPA 1X1BA 4G7OF 1PUFA 3CO2A 3GCXA 4CU8A 1RZ4A 5JI7A 1MS4A 3D6EA 1QOSA 3I8TA 3O5SA 2P5LC 4BPZA 2EINH 5E3OA 5GPCA 1ZNPA 3O1SA 2XL9A 1G2HA 1MBHA 3J80Z 1XDUA 1LDKB 1JI6A 4LPLA 2J5OA 3VBOA 3KZIC 1WUVA 2RR13 4FFHA 5AFEA 4ZU4A 3G1OA 4D7NA 2NOGA 3IDCB 4JTNA 5B4XA 1E3OC 1VBC3 2O0OA 2CRGA 1YO8A 4EN6B 3THDA 4Q4W1 5L9BA 1FMWA 4C8DA 3CCUI 5DEQA 4G8XA 2D5HA 1PDNC 2OUJA 2F5CA 4BE1A 3TN91 1D0GA 2HOEA 5JR3A 5A3UA 1VB2A 3NJYA 4E8DA 2IFRA 4GYGA 1KEXA 2Y33A 4HVOA 1S3JA 3OBAA 1UFMA 1PO22 1BI1A 4QU1A 2CTVA 2ACJA 4LKSA 3ACGA 3Q9VA 3IKTA 4D0QA 5CU1A 3ULQB 1GICA 5C3EJ 2W39A 2W1UA 1ZGJA 1J3PA 3WOGA 1S1AA 4DXZA 4NHMA 2FMDA 2RVCA 3GYHX 2E60A 3ZQLA 2IA1A 3NAUA 4D94A 3ZYGA 1CIWA 2QSGX 3BTLA 5IFTA 1U8BA 3DYPA 4QSHA 3JW4A 3R0AA 2O9LA 2VB6A 3AFGA 4OINF 4BY1J 2B4KA 2VXJA 4XMYA 2QQBA 1FOD1 3ZMVA 5L3FA 2V72A 3I2HA 1R4MB 4I0WB 2W87A 2OA2A 4YM3A 4LO6B 1GMMA 2B63J 5LW9A 3N7KA 5D4SA 3FK6A 2VKVA 3PUQA 2CV2A 1TZLA 3TAYA 3NWTA 2CSOA 1ZGWA 4L5IA 3AP6A 3CUOA 5EGOA 1S2EA 4YYOA 3VDDB 5FPBA 2I07B 4RAFA 2UZKA 1YRNB 2HWE3 3SH3A 1X8MA 1YI7A 2PAMA 4XFGA 1GQPA 5JR2A 4IZZA 4ZZ5A 1LOAA 2BOIA 4YW4A 5GLZA 5BNNC 1HDDC 1T39A 2R041 3WHTA 5K9YA 1TL8A 4JAAA 3OYEA 4A45A 1MS5A 4XF9A 5LFAA 2WY8Q 2QSFX 5BNPC 4LGWA 1XSVA 1Z78A 2XONA 2DYCA 3KV9A 3I2OA 4ON0A 2ME0A 2M8EA 2DFFA 4RS5B 1M4WA 3RGBA 3U21A 3MLKA 1FIPA 4RM2A 5D1IA 5FO9B 2DFHA 4OMCA 5FYIA 3D5RC 3OL3A 1VIWB 1WA4A 4GA9A 3QD6A 1EV11 3H35A 2F6CA 1W6PB 4Y20B 4ASLA 2RS13 2WWSA 3S93A 4H7MA 3AZVA 3SNMA 1HRI3 2DPDA 4DUWA 2VOWA 4I01A 5JI6A 1VFCA 4M3EA 1YQAA 3U9GA 3QACA 5F9TA 1JYNA 5B2GB 1ODDA 4FOYA 3TW6A 1JYCA 4XL9A 3R0RA 4PI2A 1DLCA 4GB33 5EHDA 2OVUA 4BK5A 5FKNA 3IAM2 4IV3A 3GHMA 3OB8A 5EJ1B 1W8TA 1HV0A 2LRDA 3RZDJ 2WS92 4YEJA 4PCQA 3WNNA 4AVBA 3O1VA 4IEXA 4NMIA 4ESJA 1S9HA 4EN8B 4LBQD 4AQTA 1J84A 1ENSA 4HV5A 2VCCA 2RNJA 1PK6B 2HWF1 3M8LA 4YW7A 2A1XA 1V6JA 1ZBA2 2F6BA 3NV2A 2J1VA 4B3NA 1EPZA 1YJLA 2DBBA 4EN0A 3WQ7A 4HONA 2XDVA 3FK7A 1K6YA 3MUZ1 1KU7A 3OGSA 2V9VA 4RA2A 3F0CA 2PLYA 3CC7I 1EAH3 4LK7A 1C8M1 5I0RA 2W46A 3FHQA 1BR2A 1AOYA 1PM7A 1WJCA 1AX2A 2AACA 1X2NA 2L9SA 3OYBA 2K40A 2OS2A 2Y6KA 4DJAA 3CDIA 4Q0PA 1R49A 3AAFA 4CCMA 4XM3A 4RR3B 4P9JA 3V4GA 4BNCA 5EP9A 2BWAA 1OVPA 4LKEA 2XOMA 3AL6A 1S0IA 4W65A 5HDGA 3UYJA 2MD5A 2MYSA 2PJPA 5L9VA 2DCTA 1QOTA 2MPFA 4YZ1A 4KGGA 4DNCA 3ZQIA 1OH3A 1Z7S1 4Q1RA 3WNLA 2V79A 4U36A 3NNGA 5LBEA 3EUKL 1UL9A 3BT9A 1WJBA 1XCVA 4YARA 1MACA 3MIGA 2ICWG 5ICGA 4YRVA 4KNCA 4IW3A 1REPC 5ED4A 4Q2FA 3K4NA 5FLMJ 1S0JA 1R64A 3BG3A 2JA7J 1ETVA 4GAZA 2GMEA 4G6TB 4UUVA 2BVMA 4GH4B 5J47A 3TEXA 4CEWA 2PHLA 3RSNA 4YFKF 5FR3A 4PLMA 5HV4A 2XWJB 3PNTA 2XBO3 4Z82A 3EB7A 2XKPA 3K4ZA 1DLLA 4MO3M 1XQNA 5GLWA 5JIAA 1RUD2 2DVBA 2ZGMA 4A3MJ 2ZGOA 1HCRA 5KHGA 3ZRGA 3JR9A 2KR2A 3LPGA 3ZFFB 4LBMA 4KN7X 3SYTA 1RUI2 2V4VA 1TQ5A 5BNQA 4Q26A 1ZZ9A 4Y3OA 5K7PA 3UESA 2DPUA 2BOLA 2KIQA 4LMFA 2FBIA 2UXXA 3NQOA 2LP0A 3LQQA 3L2VA 2W3JA 4XUTA 4IXLA 5J3UA 1DG6A 3TOBA 2YMZA 4COUA 2STWA 4Q4V2 4PQ9A 2CNAA 2E53A 4OAZA 2HWD2 5CB7A 3A02A 4XIKA 1G9FA 5LGUA 1HBXG 3LWFA 1YJWI 5FZMA 5CFCA 2IW5A 1NK3P 1AR71 2MA3A 4R4ZA 3EUHC 4UW3A 2YSRA 2XVGA 4KT5C 3MWMA 1IKQA 1W6MB 3VKNA 5I8SA 3JSOA 4ZTJA 3MCZA 2VVFA 5ANQA 3J8F1 3FLTA 3F9KA 4HMZA 3L00A 5EZGA 3IAS2 3U1XA 4IF4A 3ISPA 5A3WA 1YHFA 4QDSA 2VZTA 4M00A 1WLWA 3NL1A 4YVWA 2FHRA 4P9LA 4LQRA 2DA3A 1W3VA 4IETA 2ZZJA 5E89A 2E1NA 2PMZN 1CAVB 1KYZA 3IAPA 4L18B 3RVHA 1I6XA 5LK7B 1Y4WA 2JSPA 1AR81 2RVAA 3W5NA 3WDYA 1I5PA 1SD4A 4XN0A 3W6KB 1AYM3 5FXWA 4BIOA 2HH9A 1H2LA 4QGNA 3BWGA 1Y43B 5FZFA 1P4XA 2HDWA 1BW6A 3N05A 4PJJA 4TV7A 1H6YA 2X1DA 5EJ3A 3S1QJ 3OSFA 4QAWA 1SFXA 4Q0VA 4JTOA 2GXGA 3I3QA 2DTYA 1USTA 1IG7A 3G6EI 2WR9A 2R93J 5HNFA 2ZAHA 3E6BA 2EIBA 3USUA 5IVVA 3ZYFA 3NAPC 1ST8A 5FV3A 2R5ZA 1QJX3 3ZCOA 4RDUA 4CDWB 2XLAA 4ORFA 3MZ8A 4JX4A 1W2NA 3H1WA 1IV8A 2ORZA 4EJOA 3MW3A 5F04A 2V5YA 3DPTA 1RTVA 2AYHA 4QHOA 2LDUA 1GQHA 2Y6FA 3ABLH 1F31A 1SDWA 4D7SA 2ZHNA 3S1MJ 3KP7A 4E2GA 2I45A 1VF9A 5HI0A 2E5ZA 4JDMA 3ZMTA 1LJ9A 3HKZN 5CNAA 3FBNB 4RB1A 5GLTA 1SVLA 5CYVA 4CYDA 4HK9A 2W24A 3WG3A 3HDDA 1MZEA 3FE5A 4C1WA 2VNVA 1US3A 5LWBA 3EUAA 1OKQA 1UPIA 4TN7A 4HG6B 1SDDB 1K5MA 4EGZA 1N1SA 3ILFA 4LOSA 5ISLA 2OJED 1HDKA 4AYUA 4WXCA 2LKXA 2ES3A 2DMNA 2M0CA 1HQNA 3R4SA 3WG1A 3I59B 3M1EA 3N7LA 5LBCA 3FFQA 3WTUC 5CJ9A 1QJX1 1W6QB 3X29B 2FA5A 2JTVA 2CG4A 1RITA 2KM2A 3SDGA 2M5WA 4INDA 3TP3A 2R7XA 3WTWC 3OD0A 4L2NA 3BQYA 1REEA 2DYSH 2LM3A 1UIJA 2R061 4RHV2 3JAMZ 1B72A 3VL8A 4PT6A 3VZJA 2EFOA 4CO8A 3KCCA 2DFCA 3IAQA 3VFZA 3U37A 1DQUA 1BQPA 2XSJC 1V9U2 2R6QA 2GDFA 2ELHA 4MHRA 5LRSA 1F43A 1V6KA 1PMIA 1C57A 1KQ9A 4RBOA 5ABJB 2ISZA 2X6OA 1BJAA 5E20A 5IVEA 2LRPA 1JT6A 1Q8OA 2YPRA 3OOXA 3EYIA 5JIUA 1MJBA 5JLWA 4PSXA 2HXIA 2ZMEA 1EUUA 4LXLA 2ZGNA 4BYYA 3BTJA 1YIOA 2OQGA 1I6HJ 3BJOA 5IAXA 2ZBKA 3HHHA 3H8OA 2QQLA 1B1BA 2FDJA 1GOFA 3F21A 4UFMA 2IGMA 1XMKA 1RIOH 4RGSA 1D4VB 3DL3A 3KT4A 2I8DA 2QM3A 1BKZA 3I2IA 5LY2A 2NMNA 2C9AA 3GM8A 4MV2A 1R1TA 2XV4S 4KIGA 2GIVA 4RGUA 4XLPF 4HF2A 3GFLA 1COV3 3HUGA 1GHCA 1H8TC 1PM4A 3HOYJ 1LVAA 5FWJA 1BXHA 1X1AA 3WD5A 1E5RA 3ZYBA 3ZSJA 2G7UA 2JDHA 5EXOA 1VQ9I 2P3KA 4A41A 5T52A 3ZMUA 2YROA 4LB5A 1OR7A 2NP0A 1G4DA 2DJIA 4UB6C 1ZBE3 1JZ4A 2Z16A 3KQ4B 2CW7A 5A3TA 3IH4A 3F6VA 1W6OA 2ZEZA 1HJFA 1GDTA 4KWUA 1NA1A 3BG9A 1UX7A 2OPTA 1UN1A 3AKRA 1WWYA 3H3LA 3HZJA 3CCLI 1CESA 3HOZJ 3PJYA 1X3ZB 2Q8OA 1GT0C 1WGXA 1QJY2 4FPGA 4AQ6A 2ZMLA 5BNOB 5A80A 2CH0A 1ND2C 3HTUA 2W94A 4AVAA 3REOA 4EQQA 2PEXA 3U11A 4CZSA 1COV1 3TBIA 1QDCA 4AAPA 3LD8A 1IHMA 1HKSA 4B4RA 3IUOA 3M4FA 3E6MA 3U78A 3HOVJ 4IX7A 3TQNA 1NYWA 3POBA 3J7ZI 1PGL1 5KC6A 3IRQA 1EPWA 1SC7A 5LATA 2P81A 2EPFA 3L1PA 3ZXAC 1T0FC 4P9GA 2Y48A 2Z33A 3H36A 4BM8A 5BXXA 1MEC2 3RZKA 4LFUA 3SCGA 2D3PA 3CCQI 3TO9A 2XJTA 5E8AA 1E3PA 3WF0A 4XFBA 5FWEA 2A3YA 4MGKE 2VXDA 1Z0XA 5HODA 2QBYA 5D2AA 3AKQA 1W39A 2EQRA 1I3HA 1ULEA 1SEUA 2VE9A 1CONA 2HXOA 3HEFA 3GJBA 1L7LA 3OEAA 4KJZA 1SPPB 5C8WA 1XU1A 1QQP1 5JXHA 2W1SA 2VCAA 3JBG3 1OKRA 3K4JA 2EILH 2VQLA 1ZA4A 2FZ1A 4A44A 1KA8A 4QPGA 2JRTA 2JDZA 4PK4A 2HPMA 5KHJA 1BK0A 5AVAA 3HPHA 4QPIC 3P3PA 3DUIA 3NV3A 1POV3 2ZSIB 3OYJA 1FX7A 4IHXA 2H1LA 1NXMA 5DDJ2 4D6RA 4ZONA 2MGQA 2L54A 1OPCA 2IA2A 2CAUA 4HG2A 3BTIA 1QBJA 3OPTA 2VECA 2OPWA 1XE8A 1Z9CA 1G8WA 1MD0A 5B66C 1UMQA 3ZQHA 3W6VA 4O3MA 4R9CA 1W0TA 4ESFA 3O0XA 3VBSB 3NNMA 2IBDA 1QU3A 2QQ8A 2UURA 4GO1A 4JOMA 3VN4A 3IKVA 5IW0A 1EF4A 2LW8A 2AZ5A 4FFIA 5D21A 4HSJA 1RKTA 4CYCB 1L7RA 4B09A 1KD7A 4F8AA 4CXFA 4MHUA 1PHMA 5AIPA 2FU4A 2CU5A 2B5HA 3ESWB 2RS52 1LENA 2DUQA 2W1WA 1SFPA 5F2SA 5C8CA 3C2GA 2E2HJ 4DYCA 2HDDA 3VDXA 2KDZA 3CZUA 1OFCX 2HYFA 4UF0A 1SANA 5EIYB 5JZGA 3DXJF 4KL1A 4NQWB 3U2RA 2VMFA 1E2XA 1Z6RA 2EFQA 1N47A 2VO5A 5E79C 3DKYA 3T0YA 1R58A 2CMPA 4E2SA 2WT1A 1CPNA 2XGDA 3GZAA 3DCQA 2JG9A 2E7TA 3AMMA 2OPKA 1VQ7I 2RS31 5CADA 1YW8A 2D97A 2Y30A 1BI3A 1YG2A 2IAIA 1B9MA 2YS9A 3KZYA 3F22A 1TME3 2JUGA 1H9WA 2LUWA 4S2HA 2O8QA 4IHYA 2D6KA 2M34A 2VZ1A 4GWJA 3MV11 3JTHA 4P00B 2KIFA 4Q8LA 4RMNA 3FM5A 5CISA 4M74A 4BLIA 2VD7A 3DKWA 1KGSA 1G9DA 4LLFA 2HQ5A 3KYCB 3DWLE 5D8KB 4XDOA 3WCRA 1RUG3 5FKOA 1CIYA 4N53B 1LVKA 4NHJA 5C71A 2VULA 1LE8B 1SMYF 2BW3B 2NYXA 1TNTA 1NG6A 4MYEA 1KDMA 3NWKA 1TMF3 2I10A 4XXPA 4KWJA 2FDIA 5FZGA 2VMHA 4WXDA 2HWC2 4BHBA 2E1OA 2PQ8A 1K78B 4OI4A 4QX5A 5F7UA 3TW7A 2KHMA 3C1DA 4XLCA 2ZHKA 2OIIA 1NLRA 3GZEA 2LD5A 2V09A 3FC0A 4JC1A 1TE1B 4AR2A 4KBBA 3QH7A 1RC6A 2VTFA 5AVPA 4EJVA 4I30A 3I97A 1AHSA 3HNMA 4AEDB 3I4MJ 4MGYE 4YVSC 1VRH2 2MG4A 3AK0A 3ILNA 5FLIA 1RINA 1R093 1XE0A 3KIOA 1JUMA 4H2AA 2E1MB 3KEYA 1VBA1 2WB1A 1FMD1 1HB4A 4H3WA 2XVCA 5A32B 5CG9A 2UWMA 2CHHA 3RZZA 3V42A 1F4HA 1IO2A 1LOGA 4HVRA 1F4AA 4M3CB 2VZSA 4LIUA 1OF3A 1JUPA 4IL6C 2UWCA 2E35A 3AXDA 3M3QA 3FMGA 2FDFA 2QDRA 1CX4A 1LEBA 4DW6A 2MLGA 4NOTA 2MC4A 4MGIE 4BQQA 1HJGA 3S2HJ 2WL1A 3KLOA 4O7XA 5FY7A 1SEFA 3A0HC 2Z79A 4FCAA 5TJJA 2MEV1 4Y5SA 4PDWB 1UY2A 5F5IA 2YFZA 2D6OX 3K10A 3SXYA 3CCYA 4JQFA 5F6KA 4LE3A 2VOKA 4QLCU 4WWCA 4PFOA 1IG3A 1NZIA 2WFPA 1W5CC 2BY1A 3T0AA 1YI9A 4CDQB 2JN6A 1QPIA 2HLEA 4N90A 5T50A 2PTMA 3V8JA 3TL4X 1BVVA 2GC3A 5BNNA 2E63A 1S4CA 1G3TA 3K4MA 1VQPI 2EXKA 2O0YA 4R52A 3LIGA 5JLXA 1PMHX 3VBFB 1PMJX 1DZTA 2DA7A 2Y69H 1OA2A 3H7YA 4COVA 1RVF1 4ASMB 4AHYA 4HW0A 4PLNA 1U5TB 1NUKA 1P2FA 4QXHA 1JKQC 2LOOA 5EEHA 3WE3A 4CP9B 1W36C 1IN4A 4U0WA 3WHCA 4AQSA 1BC7C 4NHXA 4AIKA 3ZFEB 4NIIA 3IC7A 4Q5SF 3VUOA 1XE7A 5K7ZA 2BDRA 5K5RA 5C33A 5HS9A 4FXKB 4LG0B 4MGSA 1NKGA 4JV4A 4BB3A 3IM0A 3ZMOA 1W36D 2AS5F 3DPRC 1R71A 4MEXF 1UB9A 2XAGA 2DOEA 2M8GX 5DG1A 5A1FA 4AVVA 3CJTB 3AXEA 3I3MA 3RPUD 5CIRA 1OCZH 2K9NA 3OYCA 4RB0A 4XBLA 5A6QA 3IH2A 4EQVA 5F08A 1Z6TA 1UY1A 4PJYA 2ZX4A 5D6FA 1ODNA 4GWIA 4C2MJ 1FOKA 3H0DA 3LAJA 3RYPA 1YW9A 5FBZA 4AFDA 1J59A 3Q5FA 4PFPA 3K46A 1OOPB 3RYRA 3HOSA 1P4WA 2ZTNA 2ZX0A 3EXUA 1UZYA 1ZREA 3M07A 4DRVA 2Q1ZB 1YFYA 4LOTA 1VAMA 3N9QA 5ACA1 2VVEA 4BKXA 3NWSA 2VJ5A 3FHNA 5DUIA 1Y3TA 3M3OA 3BIEA 5EYXA 3HPNA 5FZDA 2WA4A 2IXCA 1G3WA 4IVNA 2Y8KA 2QLZA 1PUEE 3BLYA 3GXUA 4NO4A 3LPFA 5FKLA 2W52A 1SACA 2ZHMA 2IS4A 1LFBA 4V2WA 1KFUL 4G12A 2ZNZA 1ASJ1 4IEWA 3VBHC 1VBD3 1W9WA 2F4PA 4M9ZA 2PJRB 2EA4A 2UY9A 3RS6A 1IN5A 1S72I 5GPAA 3CCEI 1O7LA 3WTSC 2AO9A 1JZ8A 3CC2I 1W8UA 4HX4A 4XHXA 2DBIA 4C0BA 2PELA 4QTRA 1OCTC 3WY6A 2DT7B 2F5FA 5LZ6A 4ENNA 3ACIA 4CP0A 3BI3A 3RSJA 3KSCA 1QRYA 4LNVA 1AU7A 1WJ5A 1RL3A 2X05A 2LF7A 4LHKA 5AC92 1FXZA 2QQIA 2QKLB 3KZ4C 5DUWA 1VQ4I 3LZZA 5J96B 4DUXA 3FMRA 1UMIA 3SH4A 1KS5A 4ETSA 1PNGA 5FZAA 4IO9F 1JKRC 2VUAA 1U5ZA 1WLCA 4YZ2A 1GZ9A 5IT6A 5K8SA 5FLXZ 1ZRFA 5FYUA 1AYN3 2CWEA 1MVEA 1NE4A 4V2FA 2GNMA 3N9PA 3T2PA 3KYLA 5D5XB 1IN6A 4A2UA 1C5HA 2BJSA 3V7CA 1VBD1 1BZWA 3VPRA 1TNFA 3PUSA 4YPJA 1FZPB 3LSDA 2K9SA 2EJRA 3LSPA 4HPQA 2DU9A 3BR1A 1DGWA 3M70A 3MPBA 2JA6J 3RRDA 1T95A 4NHKA 5JVGF 1AKHB 1PZ7A 3RKYA 4Q8KA 2ZC2A 3PO2J 3GZUC 2ESHA 3NARA 3I2FA 2HNHA 5F6LB 2QA4I 2JWTA 2NVTJ 3W6JB 5DAXA 5FGMA 2D2WA 1RUF3 1XMAA 1HW1A 4CEYC 3ZFGB 1C4RA 1JZ2A 1X2MA 3EUHA 4Q4W2 1EP0A 2E7XA 1Y8RB 1UAIA 2WBMA 4ZYDA 4K8FA 3I53A 2FBKA 1YNAA 3VHNA 4EJTA 1H1IA 1STZA 5FDBA 1JHFA 3ABTA 1HW5A 1ZYBA 4N9IA 1G9AA 2ZJQF 3LDKA 3E5QA 3WV6A 4GGGA 3CJIC 4N8MA 3QPTA 1CWPA 2R7TA 2V6CA 1ZRIA 3PSFA 2UUZA 3RTRA 3LSRA 1FIAA 1POQA 2Q8DA 1WCDJ 5CVVA 3V64A 3MLJA 3V0AB 1VQ8I 1P8JA 3K4DA 3MZYA 5FD6A 2RR12 1IAWA 4ABZA 2K9MA 5IY5H 4C1XA 1KDKA 1HSTA 4XBQA 1RUF1 4M71A 4AFMA 5FY4A 5K0UA 4HL0A 1SQ4A 5HXVA 3N97A 4A3DJ 1W9FA 3AYAA 5DYMA 2VMGA 5IYDJ 1K45A 1FOD2 1XGSA 2VKEA 4W1UA 1YQ5A 5FBJA 4IGQA 3BOQA 5T5OA 3DF0A 3UKVA 2N8GA 1X4OA 1OLQA 3D3AA 3U0ZA 1CAUA 1IPSA 2FBEA 2XAJA 4M3BA 1VR3A 2GU9A 4CUGA 2EFWA 1LOEA 4WF2A 2ZXIA 1H89C 2YFUA 1TW2A 3ITQA 1OLRA 3JD73 3POYA 2XASA 1ND3B 3SHFA 2R4GA 4P96A 1W2TA 1ULPA 2MH2A 3IDAA 4D8MA 2L7KA 1UOFA 2XMLA 5FYSA 1CN1A 3PL8A 2JPBA 5IUQA 2VOXA 3DN7A 1R4NB 1C0WA 2WINB 5GAHJ 1J1LA 2D7FA 3SCFA 1U2WA 5A1AA 1TWAJ 3QQAA 2WQ4A 3WG7H 2VCBA 1Z77A 4EEFG 4IV1C 2D45A 1ZR4A 1XD7A 3EDPA 4E6KG 4XUNA 2A3WA 1H9TA 3FHAA 4Y33A 4OI1A 2A70A 4GXOA 2EZKA 1YYNA 1W7PB 3I9V2 1DDLA 4KMQA 5CFDB 4L9BA 4BY7J 5IATA 1AR93 1CAXA 3PNAA 4DZPA 4EWEA 3PFYA 3WF3A 4KN4X 1B09A 3SDBA 1W8OA 4D6QA 3MFKA 1PUFB 3ZPOA 2HWE2 3Q9OA 1JXNA 3P1IA 2ZAAA 3KS7A 5CG8A 5FIXA 1T2XA 1R7JA 3BTAA 3ERED 4LK0F 2MABA 2Y9YA 2BW8A 5GLUA 3PUBA 3M8FA 3GTGJ 2AREA 3WTVC 3GTMJ 2WS91 2KP6A 2OUMA 1QO0D 3EYPA 3AL5A 5A3PA 4R8HA 2OF7A 4HANA 3IB3A 1FSHA 5FZ4A 3UR3C 3SQOA 2WLPA 3CJXA 1ZBA1 1F35A 2JE7A 3K4BA 1W6NB 4HETA 4NPMA 2QFEA 3BPZA 1G9CA 2ZGKA 1F5JA 1TT5B 3CMEI 4S0HB 2NS8A 2V4JC 1R1A3 3VDBA 2RS12 2DUOA 4LTAA 5A3OA 4BQ5A 4PBOA 4MLOA 1YJ9I 4AEKA 3BPXA 3HHGA 5HCAA 1HRI2 3UETA 2QQPA 1AR91 3W2AA 1W2AX 2XPVA 1UU5A 1NG7A 4PGGA 1N78A 5F6FA 5HLTA 1WWXA 3KP3A 5FKMA 2VUJA 4AVPA 2JE8A 4A3ZA 4HDVA 1YUDA 2YGMA 2C1FA 2XWBB 3HOXJ 2DFIA 4FI9A 3J81Z 2D1VA 2P8TA 3IT8A 3Q8FA 4AIHA 1E17A 4B44A 1K12A 1YEWA 3HT2A 1H8TA 1Z7S2 1BVP1 3HN3A 2P6SA 5IP6A 4OZXA 1C5IA 3OIPA 5J1YA 3ASIA 3POFA 2K9QA 2AQFA 3N36A 2BBAA 2AHQA 4BQNA 3CTAA 1BJQA 5G04L 3ZIXA 1S6LA 2B8MA 1WCMJ 1IF1A 5FZCA 4AD9A 2WTEA 4UV9A 2IS1A 2RV8A 1Y9GA 4XLHA 4IOAF 3QCWA 2AXTC 1UJ8A 3VYUB 3SC7X 4XKCA 1LEMA 2LY1A 1V6NA 2Z99A 1DBNA 1DUXC 5IVJA 4IQJA 5FYVA 1QHDA 3IRRA 2O14A 1K6OA 4FOWA 2TCTA 5HCHA 5HS7A 3J7NA 2KIUA 1RUD1 4U0VA 2B42B 2M9HA 1RUH3 5EGOB 1LUJB 1E0EA 1DU0A 4OCTA 1RUI1 1D8JA 4MFDA 4M0HA 4S2DA 1OISA 2W85A 5KHHA 5A7QA 4DOZA 3JRDA 4FASD 4LLGF 2DBNA 3AZYA 3FXJA 4NJ4A 1K83J 4EN7B 2RDQA 4D7TA 5K5QA 3GVAA 1I9RA 4MOAA 4QQLA 1T0FA 2WIIB 2NS7A 4CXXA 1JYWA 2HWD1 3ALQA 3WDWA 2W57A 3KM5A 5FYYA 2XUMA 5A7OA 3BIWE 2BY0A 2ZMKA 4Y15A 1QXPA 3AB0A 2P5BA 2XPWA 4Q4Y3 1UNBA 3I0TA 2XBO2 4AVSA 5ILSA 1J83A 4DEQA 2LBFA 5D8LB 4YZ4A 4LK6A 2VUMJ 5FPXA 5M5XJ 3CC4I 1G6NA 1YLFA 3WP6A 3J8F2 1GNZA 4RGRA 1DYOA 5D8AC 5T5PA 4E9KA 4FAGA 3S1NJ 2F48A 2UU8A 4PLOA 3L2QA 3BJAA 1UIKA 4F52A 4IV3B 3CIHA 3S17J 5SV5A 2W00A 3JRFA 2O1QA 4LO4B 3G73A 4QX1A 4QPIA 3AP5A 4A6OA 4P1WA 3SEPA 3M1HA 4Y1XA 1RGSA 2B7YA 2FD8A 4HK8A 5DQ0A 2HEVF 3POJA 3C7GA 3QYBA 4XZPA 1WZ2A 2DV9A 2XIGA 3QLQA 5FZKA 2BZDA 4WZCA 3CL1A 3BZ6A 1QF3A 1VJ2A 4YW5A 1VAVA 2WNOA 3K3OA 1YIPA 1LOBA 3I2JA 5FY1A 4NDLA 2MW8A 1KJRA 3ZKUA 2WNUC 4BBSJ 3BC8A 2KD7A 4KBZA 2CQXA 5HDNA 1NQJA 1MPXA 2R7DA 3UGFA 5KHDA 3KETA 3Q8EA 4DUVA 4NN0A 1NH3A 2DCZA 4HAMA 1PIV3 5EZWA 1F15A 3D0JA 5JDBA 4B8EA 3BQZA 4XJWA 4NUBA 2VLAA 2PQQA 2Q1FA 4CPBD 3U1DA 2QZ2A 4K20A 2Q1MA 2QGUA 5DN2A 2ETEA 1GU3A 1RUJ3 4LO8A 3A4UA 5GLVA 4TTGA 3GZNB 5CQEA 2GMPA 2YG0A 1R083 4JKKA 1IQDC 4XMIA 1AYM2 1W5TA 1AJOA 4KA4A 4DGWB 5HXMA 5GZGA 4OWRB 1FP1D 1CPMA 1HKDA 2GOXB 1ORKA 2HJIA 3QBQA 1F5TA 4IQPA 4L11A 2VY0A 3TB0A 4IESA 1OCOH 2IGKA 3CCVI 2EICA 5DUUA 3VB2A 4EWAA 3FBYA 4BQWA 3WDXA 2KRHA 3PLQA 4W6YA 4CEWB 1P7JA 2X51A 4AFCA 3SFZA 3GBFA 4EM2A 1F8VA 1QJX2 3KV5A 1UD1A 2M45A 1A04A 5FZ1A 1W05A 1MZ6A 1UAAA 4B7EA 2DN0A 3SZGA 1B35C 3O8GA 4XKWA 3DF8A 2VU9A 2EV6A 4PZJA 4MXVA 3ZMDA 1WLDA 5HNHA 4JGYC 4CXWA 5FPAA 1YX5A 2MFZA 1J0RA 4GKXA 4EJWA 5FMOS 2KT0A 4BE3A 4RHV1 5JOWA 2IXIA 1ZRDA 3ZQQA 1S55A 2PFBA 2IXHA 2XVLA 1WFXA 3ZKYA 3R0JA 5JMCA 1OF4A 1X7NA 1IRXA 2VE1A 3VYSB 2M4GA 2DMPA 2WNVC 1ZH5A 2OT7A 1V9U1 4M3DA 1WW6A 5CFCB 3B3QE 1QQIA 3GW2A 2MNGA 5A2QK 4DZGA 4E27A 3HXLA 1BJZA 2DA1A 5D5UB 2RDPA 3IKWA 2Y6JA 1LJ7A 4IGOA 4IRGA 3H9QA 1UKRA 4JYKA 4F92B 1SBFA 4BISA 4YVSA 2LVSA 4G4FA 2VQ0A 4QX0A 5ICEA 3RQIA 5IWFA 3EETA 2DDBA 5FLJA 4H14A 3P3NA 5LA2A 1S0EA 3O8HA 4KUMA 1GWMA 1UYZA 3E3VA 4CCOA 2FOKA 3QPLA 4YVWB 3SEZA 3S3NA 1FSEA 3DBLB 4XOTA 4DMIA 3GBWA 1IS5A 3KE2A 4CA9A 2DXIA 2QVOA 1HSJA 5J3LA 4JGZC 4OUMA 1ENHA 3OYIA 2L01A 4IEPA 1AWCA 5FMBA 2IRFG 2L4AA 4KMFA 5FTTC 2VPLA 1QJU3 3EO6A 2O61A 1SLTA 3ZIWA 1SVOA 3TNPB 3A21A 5EYRA 4XSXF 2HOTA 1UKGA 2M1BA 3I55I 2V9KA 4XURA 1IUYA 1Z67A 3VHRA 2NQYA 2A07F 1VNDA 3T4HB 2EWNA 3AJZA 3ECQA 4ONUA 4BQ3A 4XLNF 2DTZA 2KRCA 3TEDA 3USUB 4RGXA 1W06A 4AI0A 4MTEA 1JYVA 3B00A 1QJY1 1XSRA 2ARBA 1HXS3 2WT0A 1RHI3 2HKXA 1N3OA 2PHDA 3OIOA 2X48A 5LA0A 1EH7A 1COV2 4UB8C 4ENJA 3FBMA 3E1SA 3FXMA 3V8LA 3AC0A 2VBZA 5LA1A 4QPQA 4NE9A 3GTOJ 2CQQA 5FPZA 4LLLA 2RE9A 2QQNA 2W84A 2RQQA 2VXRA 2GMMA 1VB4A 2IUWA 4MXWA 4BJ6C 3R61A 2B9UA 2JUCA 1ZBE2 3I56I 2VZRA 2WZEA 1WW7A 1V5GA 3NEUA 2P5KA 2X85A 1U5YA 1HQLA 4JX5A 1K5MB 1HB3A 2AGSA 4E4SA 5TSWA 3URFA 3WU1B 3KVAA 1DP0A 3BB6A 3MO4A 4B43A 3IWZA 4AI2A 4H55A 3THTA 1IPKA 2V5DA 4H7LA 4JBAA 4B8XA 2MLKA 1JJ6C 1CVNA 2R3SA 5KNLA 2XAUA 1BN5A 3P6BA 2QQKA 3U10A 3FZ3A 4XHBA 3AZZA 3DPRA 4COZA 2XLGA 1A5JA 5A3LA 2A75A 1NCQC 3K48A 1IZ3A 1B72B 4Y5Z0 2ORXA 3CO6C 2L0KA 2J5PA 1W9SA 5D5WB 3I58A 1OUXA 3WX5A 1GXQA 1UHMA 1EY2A 2L7MP 3SLIA 2W7NA 2VAUA 2VQCA 4AXOA 4R1HA 1Y1WJ 2JDPA 3QOPA 4IHVA 3A0NA 4Z92B 5EYYA 3LL7A 1GSLA 2DMUA 4FO9A 4N7UA 1WJAA 4BS9A 1DU6A 3GO5A 2VJIA 1KXGA 1CJPA 2QKMB 4AI1A 1LKNA 4E4HA 3IZOA 3S30A 1X3UA 3H8RA 3KP6A 2ZMEB 2V4AA 1DPRA 3HR9A 5J4VA 3K4LA 2JMWA 2EFNA 5DUKA 2QEXI 1D1AA 4HKLA 2NOJB 4KU8A 5DTDA 3JBG2 2DTRA 3VBHA 3K2ZA 1TW3A 4FSJA 2K7LA 3MEXA 3DXTA 4HN1A 3GF6A 1X1CA 2RS51 3A03A 3HC7A 2FQPA 2A69F 3QWLA 1VAKA 2KL4A 1KGYA 1L7QA 2IGNA 1TVGA 2H8WA 2XJVA 3H0OA 1NOVA 2YX4A 1XCBA 1LPQA 2IEKA 4A5NA 2KLOA 1T38A 3VHOA 4S05A 2B9VA 3AM2A 1W6OB 1C28A 3BUCA 1MDMB 4P9FA 1IUFA 2Q2EA 1GZWA 2PG4A 4TLFA 3POSA 1OFSA 3SFIA 1PGW2 2Y0IA 4P02B 4QM8A 5LY1A 5ILVA 3KLNA 2OA4A 3AG1H 2DVDA 1VZ0A 1J75A 3BU7A 4ES8A 4RM3A 4XBNA 2P7VB 2YY1A 3ML6A 2WO1A 4Q4X3 2RJ2A 2I2SA 1N1YA 1HKQA 3C7OA 1Y6IA 4YZ3A 5JOXA 2PI0A 2WO3A 2OD5A 1P7IA 3A22A 4N43B 3AKPA 3LSIA 4QM9A 1EV7A 1JBCA 4R9AA 3AG4H 4UUSB 3A23A 1T8IA 5J36A 1OQDA 2DCKA 5FREA 1WVRA 2DK5A 1EKEA 1KU2A 4ZDLA 4GMP3 5F3EA 3ZVXA 2ZPXA 1PNFA 4K3UA 5I0UA 2HWC1 3ES1A 3MMYB 4CEYA 4ESBA 1GWKA 2Y75A 1Y9QA 2UYAA 1P4AA 1TME2 3H50A 3RMYA 5FZ3A 4XJZA 2HQRA 4PGHA 3M4OJ 2QBYB 5GZFA 4W50A 5FP8A 3HIFA 2JDYA 4CRQA 2F4MB 3V56A 1AXZA 1H88C 4Q1PA 4FOQA 2NVQJ 2WFF3 1I39A 2EAKA 3CJIA 3DBRB 3WUDA 4Q0UA 1KQ8A 1JUSA 3POWA 2C24A 1W2OA 1W6PA 4Y20A 5EEGA 5JSOA 3OWTA 4QPGB 1BOAA 5E8IA 1FMD2 4B1LA 1RUG2 4CZZA 5F0FA 2D5VA 3HGGA 2BNMA 3C3VA 1OC1A 3AVRA 5ILUA 2AQEA 2DAOA 2HS5A 3O12A 1FPQA 3BR5A 4X1EA 1TWGJ 1TMF2 3TWIA 2MBFA 4J1WA 4GMP1 4ARXA 4P9UA 1O5LA 3NQHA 4KWKA 2PAKA 1ODMA 4XORA 2YBPA 2D43A 2C6YA 4RN5A 1V6LA 1OR7C 4PIYA 4XYXA 2CW8A 5HLGA 4FQGA 1QNWA 2O3FA 2ZABA 2R7FA 2OCEA 1NA1C 5APAA 1AUYA 4LHNA 1B6AA 3MKYB 4QPOA 2ETHA 1JGGA 5FUPA 1PP7U 2A5YB 4XCBA 4ZHNA 5FZ0A 1GANA 4QU2A 4HVQA 2STTA 5ICCA 2GNDA 5C8CB 1V54H 4E2QA 1BIAA 1HDPA 1Z3YA 2CV0A 2YBSA 1YS7A 4BEHA 3RKQA 3W9AA 3CUQC 4A3IJ 5JZGB 1MS0A 1DGRN 1DCSA 4YSFA 2Y6LA 3KZZA 1O59A 4P9YA 3GTPJ 4D6SA 3C8XA 5H9RA 3M7AA 4NPRA 1ULGA 3W21A 2JG9B 1D4M3 3MAJA 5F0CA 3N9MA 3QPSA 4MIMA 3LOBA 1W9TA 1ZAOA 3ASOH 1WMDA 2LH9A 1A6IA 5A33A 3VD7A 2IWGB 4NHLA 2E1CA 1WW5A 5BPDA 2H94A 1VRBA 3WDUA 3AG3H 3VD3A 1BR1A 5K5OA 2PHRA 4FP3A 4KGQA 4NB5A 4BJ5C 4URTA 5C4XJ 1C1FA 3O1MA 4QD2A 3LSHA 3J80K 1DQ0A 5FUIA 3RZLA 1CR7A 2OTJI 4FXGB 2CGOA 1WJDA 2WJSA 3GDBA 4KT6A 1QXRA 1IRGA 2VKHA 2WSVA 2FE3A 4HSTA 3RWNA 3E0JB 1JOBA 4WM8C 3ZFFA 1VQMI 1RUC1 2DCYA 3IH3A 3T30A 1QGLA 1IC8A 4XACA 1XPXA 1P6RA 3VWBA 1O57A 2R92J 3FXQA 1JODA 3BODA 5BQTA 4I6ZA 4BQAA 2D5FA 3LB9A 4B7KA 4WVMA 1WI3A 3OUHA 3