4LIUA

Structure of ycfd, a ribosomal oxygenase from escherichia coli.
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
373
structure length
360
Chain Sequence
MEYQLTLNWPDFLERHWQKRPVVLKRGFNNFIDPISPDELAGLAMESEVDSRLVSHQDGKWQVSHGPFESYDHLGETNWSLLVQAVNHWHEPTAALMRPFRELPDWRIDDLMISFSVPGGGVGPHLDQYDVFIIQGTGRRRWRVGEKLVDPFEAIIDEELEPGDILYIPPGFPHEGYALENAMNYSVGFRAPNTRELISGFADYVLQRELGGNYYSDPDVPPRAHPADVLPQEMDKLREMMLELINQPEHFKQWFGEFISQSRHELDIAPPEPPYQPDEIYDALKQGEVLVRLGGLRVLRIGDDVYANGEKIDSPHRPALDALASNIALTAENFGDALEDPSFLAMLAALVNSGYWFFEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L16 arginine hydroxylase
publication title Ribosomal oxygenases are structurally conserved from prokaryotes to humans.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 84
structure length 360
sequence length 373
ec nomenclature ec 1.14.11.47: [50S ribosomal protein L16]-arginine 3-hydroxylase.
pdb deposition date 2013-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08007 Cupin_4 Cupin superfamily protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2510 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4liuA02
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 4liuA01
4Y3OA 4LITA 5A7WB 5F2WA 4D6SA 4V2VA 2YBSA 4QXHA 3PDQA 4Y4RA 5IVEA 5FYYA 5F3EA 5FP9A 5FYHA 4QX8A 5FPUA 4CCNA 5LW9A 2XMLA 5FZIA 5FZKA 4GAZA 3OPWA 5FY0A 5IVCA 4D6RA 3KV4A 5FZ9A 5LY1A 2PXJA 5F39A 5FZMA 2Q8CA 2Q8DA 5F37A 5KR7A 2WWUA 4IGQA 4QWNA 5FZ7A 4XDOA 5A7NA 5A3NA 4QXCA 3ZPOA 3DXUA 4AAPA 5IVYA 5A3TA 2YBKA 5FZ8A 5FZHA 5FYVA 4HOOA 5FZ0A 3KV6A 5FYZA 3LD8A 4CCMA 5FY8A 5FP8A 5FUNA 4BU2A 5FZ6A 4UF0A 2XUEA 5A3WA 5K4LA 3U4SA 5FYSA 2VD7A 5F3CA 5A7OA 5FZAA 4CCLA 5IVVA 5ISLA 3PUAA 5FY7A 4UF0B 5FPLA 2OQ6A 5A7SA 4EZ4A 3K3NA 5FP3A 2XXZA 5F5CA 5FYCA 3AVSA 4QU1A 4AI9A 5FZEA 2YU2A 3PUQA 3KV9A 4BXFA 3RVHA 4ASKA 4LIUA 5F32A 5FPBA 2OS2A 5A80A 4CCJA 5IVFA 5FJHA 2GP3A 2XDVA 3DXTA 5FYTA 3N9QA 3KVBA 4EYUA 5A1FA 5A1LA 4URAA 5IW0A 3PU3A 5IVBA 4NUBA 3PU8A 4CSWA 3PURA 3ZLIA 5FYIA 2Q8EA 3N9PA 5FWEA 2GP5A 5FZ4A 3N9OA 2OT7A 4LXLA 5E6HA 5FPAA 5IVJA 5FP7A 5FWJA 2OQ7A 4DO0A 5F5IA 4V2WA 5FP4A 3U78A 5FYUA 5FUPA 5A3PA 5FY5A 4EZHA 5FZCA 5FYBA 4CCOA 5FPVA 5FXVA 3KV5A 3NJYA 5F3GA 2OX0A 5F5AA 1VRBA 3AL5A 4QXBA 5FYMA 5ANQA 5FY9A 4D6QA 3LDBA 3AVRA 3AL6A 4Y33A 4BISA 3N9LA 5FXWA 4GJZA 5FZBA 4CUGA 4TN7A 2YU1A 5FZFA 5FZDA 5FZGA 3UYJA 3N9NA 3KVAA 4C8DA 4LIVA 3OPTA 5IWFA 4E4HA 5FZ1A 5A7PA 2YPDA 4CCKA 4XDPA 4GD4A 3N9MA 3K3OA 4QX7A 5F3IA 5FY4A 5A7QA 5FXZA 5LY2A 3K2OA 3PTRB 3PUSA 5F2SA 2P5BA 2WWJA 4IGOA 5FZLA 2YBPA 5FZOA 4GJYA 5FZ3A 5FBJA 5FJKA 2W2IA 5FXXA 5A7WA 5CEHA 4DIQA 5LWBA 5FV3A 4IGPA 4HONA 5FZOB 5FY1A
chains in the Genus database with same CATH superfamily
3L00A 1SQ4A 5FP9A 5GZCA 1K4SA 4JDMA 1QJFA 5DUXA 2GOMA 5F39A 3X29B 1GOFA 3CBNA 5JFRA 2XH6A 5A7NA 4HOBA 2F4LA 5T55A 4HOOA 5LASA 1YUDA 5K4LA 5DG1A 1FZPB 5JR3A 1AHSA 1P92A 1G7YA 4PJ0C 4A69C 1VQ7I 3O12A 5C5TA 3OD4A 5GLTA 5HDKA 5M0TA 2CUZA 1AXKA 2KR2A 4Y1YA 3P6BA 1KJLA 2VT3A 2HR3A 4CEYC 3FM3A 2UWAA 1W7PD 1JUHA 1RI7A 3BCWA 2ZO4A 5CU1A 3HOVJ 4WM7A 4MH0E 3MF9A 4LO5B 5C44J 3I7DA 1Z77A 1WCQA 5CNAA 3HN3A 3SXWA 5AFEA 3R4SA 2P5BA 1FTTA 1VQKI 2OZUA 1WPKA 3C8XA 1O8SA 5FO7B 5E17F 2P1BA 2XLFA 4Z07A 3KB5A 4B1MA 4QTRA 2KXLA 1KQ9A 1UY2A 2A70A 4YGDA 4GAZA 4DPNA 1VFCA 5M5WJ 1F15A 4S0HB 4LKDA 1R5ID 1LJ7A 1QJX2 3GFIA 1ZZ9A 3P3PA 4YM1A 3M70A 3KZ4C 4FFIA 1U8RA 2GU9A 1D1AA 3ZMTA 2J1VA 1DGWA 3UGFA 1KS4A 2LW8A 1LHVA 1HF0A 5L19A 4XQ4A 3BPVA 2ZFWA 2OCCH 4XLHA 3LSHA 1EPWA 2DWRA 1X9TA 1GWLA 1F4AA 3RIRA 5E1WA 1EAH2 2YS9A 1IKPA 4M9SA 2A6TA 4RR3C 3HUGB 1XB4A 2VQCA 5LBCA 1LKXA 4RR3B 3AKRA 3F8FA 4ZTFA 4Z2WA 2XGCA 2DTWA 3E0JB 3M8FA 1LB2A 3KQRA 1RUNA 2ERFA 4WCGA 3POBA 2R061 3QYFA 3N05A 4BHBA 1UAIA 1W8UA 2X05A 4RGSA 2P5LC 2QJVA 1MBGA 2LP0A 2HDCA 3PIJA 2D1VA 2Q0AA 2OPWA 4PT6A 2MHFA 2OA2A 3CJTB 1GWMA 1GOGA 5E8AA 4W6YA 2F4OB 2DW4A 4NHLA 4A12A 2HJIA 2AH2A 2JECA 3O6BB 4NIIA 1LHNA 1STMA 3ILNA 3PQKA 2VI6A 3NV4A 3VHRA 2RMU1 4BNCA 5GP9A 1POGA 3LFKA 4DZGA 1OC1A 3CUOA 3VDAA 4P9IA 1Z7S3 4BLJA 2TBVA 4GKXA 2BNNA 3T8TA 5FZ6A 1POQA 4AEDB 4JX0A 2R92J 2UWBA 3OYIA 2HWB2 1GHCA 1QQP3 5K7ZA 3ZYRA 3CCRI 2F6BA 4PQ9A 3M8EA 4ZYDA 2JKXA 1GR3A 2XDVA 1W6NB 2IPQX 5KCMA 3BJAA 3O0WA 3RRDA 3PU8A 1UZCA 1IO2A 3WT3A 3BR0A 3V56A 1R36A 1MDMB 5I8SA 1B1BA 4LBKA 2HXIA 1CF7B 5C9AA 3CMMA 5IP9J 4U87A 2HWF3 1TZLA 2BVVA 1GNYA 4A3IJ 1XN7A 5KHKA 4CUAA 4JRAA 4K3UA 5ILVA 1BXHA 3V8LA 2KZVA 4KIBA 4IHYA 2GALA 5BNOA 2ZHLA 2W2IA 5GTHC 4IGPA 2W84A 1OPCA 2BY1A 5HOOA 5F3EA 5CVRA 2BVMA 1YLLA 3JRDA 3ZXAC 3SZPA 2GN3A 4B4QA 5C71A 2G9WA 1Q5OA 4XKCA 4HN0A 4AIHA 4DYCA 4MHGA 4KG0A 3ZQCA 3EYYA 4II3A 4RFT0 2QFEA 2AEYA 3N97A 1BR2A 1TNFA 4YLZA 1AA7A 2YROA 2EA2A 5JOZA 3U4SA 5FYSA 3KIOA 3KP6A 1NK3P 5IT9K 2E5ZA 2VCMA 4OI0A 2W4SA 2VCBA 2DTYA 3BUCA 3HQUA 2Y34A 2F48A 2MC3A 2VZOA 4XHXA 2WZ8A 3S6PA 2VE9A 1PUEE 1X1AA 4URAA 1NLRA 4CVUA 4UW4A 2LF7A 1OCRH 2ZMNA 2VW0A 2ET1A 3ERED 1BN5A 2K40A 4EJUA 4PIYA 3SFIA 1V5FA 3MCZA 5K0UA 3S93A 3JQXA 4H0EA 1XMXA 1COV1 4KWLA 5D8AA 2CYFA 2XR4A 4I98B 5J4YA 1U5TA 4P1WA 1AR62 3PO3J 1ZVFA 2J5OA 5CZKA 4CXYA 2ADUA 1IKQA 2A7AA 3SEQA 4XJAA 1ZK8A 2DYRH 3HBKA 1LOEA 2QKDA 2EV6A 4COWA 4JK1X 1VI0A 2QBYA 1V9U2 3AG3H 1NE6A 3BT9A 4GD4A 3HZJA 4G94A 3VBRC 4Q4W3 1Z78A 2L4AA 1P7JA 5BS6A 1LOCA 3T0YA 4DY3A 2COBA 3L7WA 1YWKA 3E97A 3AP5A 2UV1A 4HNUA 1S1AA 4QKNA 5F0CA 2BNOA 5BUVA 2XJRA 2EJRA 3C18A 2ZMLA 3PIOF 4LBOA 4CDQB 1IC8A 4OI4A 2X10A 4WXHA 1BBT1 2B42B 3KM5A 1S0GA 3FK7A 1GSLA 1UHWA 3GHNA 4CICA 1XSXA 3IV5A 1DIWA 4O9GA 1ND2A 5F0HA 5FLJA 1HJGA 1UYPA 4RGGA 4D5FA 3MZYA 3SFZA 2E32A 5G05L 4FOQA 4WV8A 4AGVA 1XDSA 3VFZA 3ZXFA 2AQEA 5IT6A 1IHMA 4XTMA 3CCMI 1C5HA 1E0EA 3NRUA 3QP6A 2E7AA 2HZTA 1ZM1A 4XOPA 3BALA 4YM2A 3DEMA 1UY4A 3JCIA 1HC8A 1SVLA 2Q1FA 1ERDA 4L0PA 1DZTA 3BOWA 5M3FJ 3M3IA 1DUXC 1OYIA 2Z5UA 1TE1B 1HN1A 2TRTA 5CVIA 4FO9A 2AEZA 4BMEA 4CUGA 1YX5A 1VMJA 4YW5A 5LGUA 3CDLA 4XETA 3WQ7A 3R61A 2A1XA 4CCDA 3C3WA 1W0TA 1MGTA 3HQRA 3FXMA 2IP2A 3GALA 1K83J 3SLIA 4KG8A 3DPLC 3EMRA 4M4PA 5DXDA 4DXSA 3LIGA 1F31A 1YQ5A 1ZNPA 5LW9A 1ASJ3 4AQ6A 3VDXA 1PK6B 4ZXKA 1HA8A 1VBC3 2PYTA 2UY9A 2AUYA 3DPTA 3BI3A 2Y0MA 5M3MJ 5FCCA 2A68F 1RR7A 4I76A 1VQPI 3FFQA 1JU4A 1PZ7A 2LY9A 2EIDA 1OISA 5CA6A 3ZMZA 1WJ5A 3ZN1A 3CHXA 2VOKA 3F6VA 3EYIA 3WUCA 1UOJA 2K3PA 3WG9A 2D7FA 5DCMA 1UY3A 2XAUA 3L9JT 3TEDA 4LR4A 4N53C 3O8HA 1FJLA 4K8RB 4N53B 4AE2A 1OSGA 3VSLA 3NKGA 4FPGA 4QX5A 1EY2A 1YJKA 4XLFA 3JRAA 2NVXJ 1E5IA 3H9JA 3FJSA 4E2QA 4AWXB 3FMGA 4C0HA 4X6RB 1AF9A 1K6OA 1FYLA 4XLCA 4L0ZB 1TP4A 1WZXA 3S2DJ 3WTSC 2WY8Q 1EKEA 4YWAA 1YCIA 1HN0A 1I39A 4GFBA 3VN4A 2RS53 2PLV3 4G8XA 4MG2A 4IQ4A 3HMYA 3KVAA 4MLOA 4S05A 2YPDA 1MBJA 3PVEA 2X6OA 1WBFA 3CO6C 1FOXA 2QCOA 5LA0A 1M1EB 3DPRC 2NAZA 1K12A 2EIBA 3PL8A 3B6CA 4OMZA 5LBFA 3OUIA 3E5XA 4JHTA 5D21A 2MGQA 4WWCA 2RNJA 3S14J 3DPRB 4HT1T 1JZ8A 2PHDA 1RINA 5FLXK 4CDXC 1RIRA 1SAUA 2RC4A 5HNHA 2RR13 5KXDA 5B66C 1QEXA 1V6JA 1STZA 2NVTJ 3EXUA 4XBNA 3T08A 3U37A 2DDAA 2ID3A 4B47A 1JH5A 5BY5A 1ZARA 5JOWA 2BXZA 1G3YA 2EZKA 4EJOA 2ARAA 5ISLA 1VF9A 1S0CA 5BXXA 2HS5A 3AVSA 4FFFA 2XJSA 4E2GA 2O03A 2Y6JA 3POSA 5J37A 1VPHA 1UF2C 3MF6A 2W08A 3V8JA 5F08A 4QX2A 4N9IA 1XX5A 4UUSB 2O8KA 2QZ3A 3HHGA 4MXVA 2OQ7A 3NRVA 4LD5A 1WW6A 3CCQI 4N7IA 3BR3A 1JT0A 2C1FA 2WA4A 4R9BA 1AR82 3JD71 1B4AA 1TMF2 2DUQA 2WNUB 4IEPA 1NXD1 4NC7A 1HB3A 1T0FC 5F2SA 3INAA 4QKFA 3M3CA 3IAM2 4DUWA 4HZFA 5F1JA 2XJQA 4JQTA 4AZZA 5FPUA 1RHI1 3J7NA 1CIWA 2GXAA 3THCA 2IWGB 2BUKA 2X51A 2A75A 2OZJA 3IWZA 3PLQA 3CJIC 4AFBA 4PQQA 5E1XA 5JLXA 2VQAA 1TWFJ 2DPDA 5FKMA 3ABZA 4CDGA 1Q1HA 1ZRCA 5FY8A 3WTZA 3RQIA 2DVGA 3OBRA 3JR9A 1U0AA 5LA1A 4YFKF 2EWNA 2B5HA 1E17A 1RUE1 4OHXA 3MO4A 3DP7A 5CVUA 5C5UA 4NRMA 4LBNA 5IK5A 4B1LA 1YO5C 3PQJA 5FMOL 1QDOA 1EPZA 1R5HA 2RJKA 2V5YA 5A1FA 2GM4A 1ZHFA 4UB8C 3GFMA 4N9HA 1GV9A 3R4DB 3HUGA 3SCFA 5JR7B 4OIOF 1PM4A 4RR3A 1Z3YA 2MEV2 5BPXA 4HG6B 2M87A 4Q0UA 4HW0A 5EWSA 3K46A 1AR71 4M4RA 3MAJA 1N3PA 4NVPA 1AR92 3J26N 1T6BX 1XNKA 5B4NA 1S29A 2DQLA 2JA7J 1SCSA 2R4GA 4Y33A 1H4GA 3LPGA 4L9VA 3T8RA 2PHLA 5HCHA 2C26A 4AR2A 1Q8PA 1JTYA 1OCPA 1G8WA 4AG4A 3Q8EA 2WS93 3AYDA 1CVNA 1ACCA 4EE2A 1LUJB 2VOOA 3VPRA 5FKKA 1VLNA 3PTRB 5CLSA 4YIRX 1LJ9A 2YBPA 3GTPJ 4IHVA 1RUH1 3IPVB 2GIVA 2R063 2XIGA 4AEJA 1WLWA 3WCSA 2VULA 2FMYA 2AS5F 2WWUA 1RUI2 5BMZA 5EIYB 1IXCA 2MSYA 3ZYPA 4XN0A 1SG3A 3UL2A 4AEDA 2XLAA 5A6YA 1F5FA 4IPAA 1U2WA 1R58A 3OBZA 4GALA 3JRFA 3OL3A 1XS9A 1UJ8A 3ZFEC 4IO9F 2XBO2 1B35C 2RMU3 3ZSLA 1S0DA 2OPKA 5FLHA 1V5EA 1W6NA 1FPN1 3BDDA 3RNSA 2E1MB 2R7VA 3CTAA 4E70A 1ACIA 3QYBA 3R4UA 4XICA 2QQ9A 4RQPB 3IUOA 1MDMA 4QPGB 4L5EA 5TJJA 3LSMA 2VM9A 1LOGA 3O0VA 1CF7A 4V2WA 3LIHA 2DK8A 3B02A 4M71A 4P9UA 2QQIA 3FBIB 2GNMA 2WTEA 1BMV2 2G4IA 3OYJA 4NIDA 3GTGJ 2WJSA 5FZGA 3BPSA 3VD3A 5JLVA 3D4KA 3M7AA 3MMYB 2VMIA 3CEWA 2YY1A 4DB5A 4MXWB 2EIGA 4F3JA 4XAAA 3UNGC 2BBAA 2MD5A 3ORJA 3VKMA 3GZNB 3MKZA 3X2QH 3A03A 4QIWN 1SACA 1KONA 5FY0A 4LK0F 1XCBA 1QO0D 4QXCA 1W4MA 2CV1A 3PO2J 2WV0A 4NIHA 2E1NA 4RLFA 4AWDA 2PMHA 3VODA 3WODF 2XL9A 3KHCA 1FWZA 2Y0SN 3RKWA 2JA2A 3B9IA 4CCCA 2DAOA 3WTTC 3MKYB 3OJBA 2MABA 2WNVB 4I02A 2QSHX 2J1AA 3SITA 2OS2A 4LBMA 1NE4A 1Z67A 2YG0A 3KT1A 1ZZ6A 3HHHA 1O3TA 3M8LA 4Q1PA 2R5YB 3FMSA 4XAEA 3VSKA 3K48A 2VR4A 4PLOA 3KS7A 2NNNA 2Y8KA 1QHHD 1IGNA 2A5WA 2ORXA 5FMBA 2F2EA 3DU5A 3KZIC 2CJJA 2VC1A 2K9QA 2PHRA 1MS4A 4DMIA 1KDKA 2HQAA 2FJ1A 3GZUC 1WJDA 1COV3 4ZU4A 5TSWA 4M72A 4QX0A 2R16A 2VL8A 4IESA 3CJXA 2GXGA 1Z1DA 1BEV2 5L9BA 1PMHX 1ETKA 3TL4X 5CAZA 2VVFA 1EAH1 2P3JA 5KR7A 3WNNA 5FFOC 4UVBA 4AAXA 4CDQA 3K51A 2NM1A 4RYDA 1NZCA 2XB5A 4ES8A 1OKRA 2TDXA 3U0ZA 5FUNA 4BU2A 5F3CA 1D0YA 1ETQA 1WHUA 4Y26A 5LZ6A 1DYOA 5FTTC 4MGRA 5A3UA 2YFUA 3RJPA 1RUJ2 4R4ZA 1ZRRA 1CR7A 1UYYA 1OLRA 1EYBA 3C2HA 1OKQA 4IV3B 2DYSH 1BBT3 3KSCA 2RGVA 2IC1A 3HKZN 3H1WA 4CU7A 2OPTA 3LNQA 5FROA 4M3CB 3EJKA 2CQKA 2Y38A 4XJWA 1NG6A 5A6XA 4NRPA 1BC8C 2Y60A 1FIAA 3Q8AA 3FZVA 4ARYA 1VBB1 2WBMA 2V79A 1A6QA 5J47A 5FYMA 3AL6A 3A23A 2R071 1OFNA 4LO8A 4LOSA 2JG8C 2A3WA 5JIAA 5FMDA 3CMAI 3D0SA 2HWB1 3N7JA 3GZTB 3VD5A 4DNCA 1QRYA 3ACHA 4MOAA 2NYYA 4YFWA 4B3AA 1PK6A 5GZGA 3V7RA 3VZKA 3LSEA 4LUKA 3WNOA 1XPXA 3H1CA 1QGPA 1RB8G 2LNBA 4YZ1A 3TP3A 5FYVA 1I1EA 2KM2A 2W1UA 3OPZA 2QQBA 3CF2A 2W92A 4L97A 5A1AA 4GWNA 2UWCA 1X3UA 2RE9A 1SFUA 5CG8A 2RDQA 5F32A 3ZN6B 4KWUA 3FXJA 5FAXA 3JREA 1RITA 4N53A 5E3MA 1UELB 3VDCA 1PVC2 3VBHB 3VKNA 3GZ5A 1AJKA 1FATA 5H9RA 1SHWB 1VJ2A 2L5QA 4MTDA 1FI2A 1XG1A 1L7RA 2TEPA 5DDGA 2OTLI 3JU9A 2QQOA 5FZBA 1MQTB 3OSFA 4NHXA 1T08B 1XE8A 4PJYA 1R081 4L9BA 1XNDA 2IAIA 4C3HJ 1CGPA 1D1CA 2DT6A 2HOTA 2JVHA 4MQVA 1YC61 5IYYA 4URTA 1IXRC 5KC6A 3EPZA 1YHFA 3DBLB 5AC92 4Y3OA 2VCCA 2D43A 3DPRA 4L5JA 2PI0A 1OQDA 5B1BH 5D5XB 4Q26A 2CSOA 2AC1A 4P9WA 4QPQA 1A8MA 4CDXA 3EUKL 4G9YA 2R7DA 3VL8A 4QM8A 2VPLA 4CCMA 1IG0A 1RYYA 2DFFA 1AR61 3S16J 5JXIA 1W28A 1OVSA 5FMCA 3FXOA 4BE2A 1PNFA 2QTWB 2K2SA 3TBIA 2VBYA 2LROA 1I3AA 1GNZA 4CCJA 3H42B 1HJFA 2UURA 4NUBA 5IYBJ 1K79A 4WM8B 4HN1A 3OGSA 4UUSA 1P4AA 3WTUC 1H0MA 2KA3A 4OQ8A 4HAMA 3BODA 3NL1A 3JRGA 3IT8A 2VODA 1RMU1 3I53A 3PIPF 1POV1 3IB3A 1ZA4A 2OA4A 1J75A 4RL7A 2WNUA 2JWPA 5L9VA 2X4HA 5ERLA 4XVHA 3DGTA 2W94A 5FK7A 5A7PA 5LGNA 5DAWA 4ZPIA 3AXEA 3BTAA 5A7QA 5L3EA 1TWGJ 4COZA 1V6IA 5IK8A 1T0FA 2IS4A 4HPKB 4BIOA 4QDRA 3KLNA 3WCRA 2ZMKA 1JKQC 2XRNA 4IEJA 3CMGA 3IMNA 2WFF2 1ULCA 3HBLA 3JD73 1S6LA 2ZMEB 3ROUA 1O5UA 5HLTA 2DA7A 2ZXHA 1Z6RA 1HKDA 1ULYA 1V3FA 3ZYFA 1MW7A 1YW7A 3IZOA 1NA1B 4B43A 1XDUA 4XHBA 4YSFA 2PHFA 4YG3A 1H2MA 3BJOA 1X2NA 1RHI3 3U10A 2BEOA 2Z33A 1TQMA 1CPMA 3OSGA 5FP3A 1OLME 5EJ1B 2WRAA 3WV6A 2DA1A 1LCLA 4AC0A 4TZDA 2VKDA 3L2QA 4Y4YA 1HQCA 3K6GA 3VB2A 1QH6A 1RC6A 4BQAA 2HVRA 3RGBA 4GGGA 4IKFA 4YZ4A 3Q8CA 3BG3A 3PM1A 3ZQ7A 3CD6I 4FVVA 5DEQA 9ANTA 2JJ6A 1RUE3 3GF2A 2VE1A 4IV1C 5IYDJ 1GWKA 2X85A 1CWPA 5JI6A 1OMIA 3AL0C 2I07B 4Y1XA 5FYUA 3MFCA 1HLCA 3U75A 4FI9A 2V4AA 5FD5A 4NDLA 1DQUA 4O61A 3LWCA 4DBRA 2PN6A 5K8SA 5C6CA 1AR73 3AMHA 1O4TA 1IG3A 2C6YA 3WHUA 4KMFA 1FSHA 3IPVA 2WY7Q 2RS32 3I2GA 5J1YA 1ODNA 2K7LA 1YITI 4ANJA 1HIXA 5IVEA 4YIFA 4HKOA 2FOKA 4IL6C 5FZ9A 2XQRA 4XM3A 3H1YA 4AI0A 1W8FA 1YIJI 1LOBA 2V9VA 1W0PA 1CPNA 3ALQA 4AHXA 1YFYA 4S04A 1RUH3 1JU3A 2B46X 1FIPA 4J1WA 2ZJQF 4LJHA 1FNYA 2CO5A 2KJBA 2LKXA 2XGXA 1W2TA 4E4DX 4UVCA 1W36D 2FQPA 2DCYA 1A34A 2RDSA 2DMQA 2JD4A 3LAGA 2Y9YA 4G4FA 2WO3A 4BXUA 4Y52J 1ODDA 3GTKJ 4YRDA 1OLTA 3DFGA 4RQPA 4LFUA 4QPGA 3SEPA 3OV8A 2Q4SA 4F8AA 3AX4A 3T4HB 3I5UA 3GZ6A 2O9LA 1X50A 2KJCA 5JSOA 2QQMA 3RZGA 5D4RA 1LODA 2CV2A 1FPN3 1JHHA 2NVQJ 3ACLA 3S0MA 2VZTA 3ENRA 2CGPA 4AFAA 1VZ0A 5SV8A 1G2HA 5FZFA 3HSFA 3WZ1A 5FZ1A 4MXWA 4RN5A 4UFIA 1ZX5A 3HOUJ 1HKSA 1UCRA 3TP0A 3JW4A 2WBKA 4L18B 4IGOA 1W9FA 1ENHA 1WMFA 1Q56A 2ZKNA 5FJKA 4G6QA 1BQPA 3A21A 4IF4A 2VQGA 2P6HA 5FYYA 4Y20B 1UXZA 3ONQA 4CPBD 2E7WA 5D5WB 1WCSA 3A2KA 5I0RA 2QWWA 3PJRA 5A3NA 2FQ3A 1ETWA 2XJVA 1Y4WA 3F6OA 1VQ9I 2KDOA 4A5MA 3AYCA 2E53A 2A3YA 2EQRA 2Y75A 1SFNA 2IS1A 4I2OA 1PUFB 2MH2A 4LE3A 1FMWA 2D5HA 4P9YA 2OCEA 2Y6KA 5DV5A 3POWA 5IOYA 4L2NA 3I4PA 2VAUA 2WNVA 3J7AY 2HBTA 1AR81 3A0KA 3GDBA 3OUJA 1MMGA 2QQWA 4V2GA 4AQ2A 1TMF1 2IBDA 3USUB 3BR1A 2VC0A 2D6NA 3MVPA 3N4MA 2X48A 3QPSA 2R5YA 4QWQA 3T5XA 5JSPA 3FX3A 2QSGX 2CG4A 2V73A 2VXDA 2XHNA 4DNYA 3RQ0A 4MTEA 3DYMA 4FTEA 3FBNB 1U12A 4Q0PA 1XU2A 1T56A 1XPWA 3WHTA 4A3GJ 1U5IA 2JXAA 3PTYA 3N7KA 5FO8B 5FK8A 3UJQA 4PBPA 4L0YB 2K9SA 3CCSI 3MICA 3Q8BA 4XURA 1XNBA 1HV0A 1LHUA 2FDFA 1HXS1 1J3PA 3ZSMA 1ULOA 4OU0A 5IAVA 3I54A 4IL7A 5FYHA 3CCJI 2MG4A 3G73A 3SQOA 1I3QJ 4YW2A 3SZTA 2HNHA 1DHKB 3HRUA 3JCUC 2ZX2A 2WZR2 3OMYA 4HYEA 1NQJA 4XFAA 4Q29A 3OYLA 1RC9A 2MEV1 3MUY1 3N35A 1BJZA 3WHBA 3LOBA 3HNMA 4EGYA 4XRSG 1REEA 5BNNB 1EAH3 4LULA 5FPLA 1AR91 1UNBA 2E19A 3D5SC 4OYUA 2WQ8A 2XAJA 3OBAA 2MPFA 4IV3A 4PLNA 1CX1A 3QPTA 5A1LA 3A4CA 2JZYA 4UW3A 1N25A 2HQNA 1LGNA 3B01A 2A6VA 1HX6A 1VB4A 2F4PA 1XNCA 1XSQA 2D6KA 2KPMA 4M3CA 3EUAA 2A71A 4YG0A 3BR6A 5FZ4A 4P00B 2EF6A 2EFWA 1IAWA 2L9NA 1BIAA 1BIBA 2F5FA 4IHTA 1RUI1 1W5SA 1WCMJ 4KWJA 4CZCA 3NQHA 1R71A 4AVTA 3J7AO 3LAJA 4QX7A 5IFTA 3QU6A 2QM3A 2LY1A 2FQ4A 3GUDA 2XF5A 4DYRA 3LCPA 1VBB3 4XRFA 4CYDA 2K9NA 3TN91 4DRRA 2R073 2FRHA 3NW4A 3VV1A 5C7GA 2RQPA 1W8HA 4OIRF 3BGAA 2NMOA 2IGNA 2VXJA 2HWB3 1WKYA 4AXOA 3ZQLA 2Y6LA 4JDOA 1GVDA 5FZHA 4XDQA 2XL7A 2H94A 1B9MA 3BG5A 5DM7F 3A7QA 1HKQA 3I3QA 3O2PE 3V7SA 1S55A 1BMV1 2EA7A 1N1TA 1URXA 2VQLA 2HH9A 3ZN6A 1UMZA 2DMPA 2J1RA 1ETXA 2HTSA 1PO22 3V8KA 2EK5A 3VBHA 3OYWB 4AGGA 1GQHA 3TMOA 1DGWX 2IVJA 1OF4A 1SFOJ 1NCQB 2JB4A 3FBMA 3V42A 1R5GA 1DQ1A 2X1DA 2P0WA 4XUPA 4TTGA 2PQSA 5CFCC 3KT4A 3QCWA 2COMA 5FPAA 1GP6A 1DYKA 2P2KA 2VZRA 2MC4A 3U78A 5JMCA 1D7PM 5K1YA 1YI9A 3CJNA 1NOVA 2QQLA 3C7OA 3S30A 4AVCA 2E2IJ 4DEVA 3BPXA 3DTIA 2G0EA 4QKDA 1S72I 1MQTA 1WMDA 3M1EA 3WDVA 5FKBA 3BQZA 2DO7A 1HQWA 3F2ZA 4TYSA 4ISRA 1ZRDA 2ZACA 1PIV2 1QOOA 1IGOA 1DDLA 3ZPYA 2HEYF 3HT1A 2P17A 2OYZA 4BYYA 4W1UA 1R083 2OC6A 1USTA 1OA4A 1ZA7A 4IQPA 1AHDP 5GLUA 3B00A 4BQ2A 5A3TA 4Y24A 2CGNA 2YC4A 3WW4A 5DUWA 3TNPB 1C5IA 4K6BA 5C3OA 3K3NA 3F8BA 4FPOB 2DCTA 2CU5A 4AI9A 4BIFA 2DTZA 1OD3A 2R0FA 5LATA 3ETQA 1QVUA 3IH2A 5FJHA 2QVOA 3WNKA 2EIEA 5JVGF 4WM8A 1AR63 4G9SB 3U11A 4LA3A 2FBEA 2YYOA 4CZSA 1BEV1 4ZC3A 2HYFA 2P3YA 4FPJA 2DFHA 4HNTA 4LXLA 1H1MA 5JHFA 4QPYA 1EH7A 3WDTA 1UU4A 5FP4A 3KP7A 2MLGA 3AYEA 5FR3A 2QF7A 2ZJPF 5FIXA 5JZGC 4HQMA 1QDCA 2XB6C 1B59A 1OPMA 4DUXA 2WINB 4PGHA 1LE8B 5JZGB 3EO6A 3HL2A 3WE2A 5LLQA 1QH7A 3ST7A 4HPKA 3HPNA 1VQLI 1RMU3 2QLZA 4N43C 4BDYA 3OYGA 4A3LJ 1LEMA 3DN7A 1POV3 2VQ0A 4W50A 2ZMEA 5J6XA 4C3JJ 1Y56A 3CQOA 1OYYA 2EXHA 3OF1A 3RZMA 1U5YA 4FASD 5FKOA 1NA1A 3HOYJ 4RGUA 3ZMVA 1R9TJ 4NQWB 1V00A 1MNEA 3F8NA 2LSOA 3BZ6A 3HEFA 1XC5A 4E7JA 2L02A 1APNA 1K5MC 4AQTA 5EFUA 4ASNA 5D6EA 3ETPA 1PX3A 2BPA2 2AYHA 1ENSA 1AX0A 5D4SA 3DEWA 2VW2A 3OS2A 4ASMB 3RQ4A 1SMYF 3LDKA 2O14A 5M5YJ 2BWCA 4ASLA 1YFHA 1FMVA 1SD4A 2WNOA 3BQYA 2QQ8A 3ZLIA 1CZVA 3HOBA 3CUQC 1O4YA 5LHGA 4N90A 5H9SA 1WMEA 4JTOA 4BJ5C 1BVVA 4LB5A 2WO2A 3M3QA 2ZNYA 4M74A 3QWLA 4YVSB 5F5IA 3FHAA 3ZMOA 2ZC2A 3ZYJB 1N78A 2KT0A 1GZCA 1X9PA 5F9TA 2RV9A 4DRVA 4Q27A 5FY9A 3VKLA 4KWKA 2W5FA 3OOXA 2WB1A 3QLQA 2GNTA 3LA7A 4GWJA 5GJ6A 3O1MA 1FNNA 1SVMA 3WTYC 3OB8A 1H9TA 2DMTA 5LY2A 1P6RA 3NEUA 3UKTA 5KXEA 2FE3A 3QACA 3AC0A 5LWBA 2J1UA 2DK5A 3NJZA 2ELJA 4A41A 1OURA 3WR0A 1JUIA 2GC0A 1TEIA 4WF2A 4PZJA 4XKBA 4EM0B 3QH6A 3ZXGA 5KWRA 1JN2P 1PVC1 2VZVA 2Q8DA 5FZMA 4Q48A 3I2HA 4NPMA 4D0PA 5SV5A 4HQEA 2CV0A 5ACA2 3BTYA 3NNGA 1PMJX 4P96A 4K20A 3GVAA 3LD8A 3R0JA 2PMWB 5FREA 1MZEA 1MD0A 4B29A 1D3YA 3PUAA 5B2GB 2IXSA 4OVEA 2V9PA 5EEAA 2OIIA 5F5CA 2OJED 2W48A 4QU1A 3NWKA 1J59A 3HTSB 2XPWA 1VP6A 4LO4B 5IFPA 3QPLA 2ZFUA 1H9GA 1ZRIA 3QPHA 2I5UA 3ZFFC 3GLXA 1QHGA 4JZRA 3AZXA 2QZ8A 1JGGA 5AC91 1OCZH 2RN7A 3G71I 3CJQB 2JE9A 1MSEC 3J7HA 4OIPF 1B9NA 4AI2A 3RYKA 3DKQA 2A6HF 2W57A 4RB0A 4WVMB 1H1IA 2DVFA 2B4KA 1ZN2A 2YFZA 3SHFA 4UI9L 1VQOI 3AFGA 1J84A 4E4HA 2JDPA 3FHIB 3PVNA 4PSWA 4A0ZA 2F4IA 2ELHA 1MMDA 1KYZA 2BY0A 5A6ZA 5EEHA 1NQDA 1ND3C 5EQUA 2ZJ2A 3C1DA 3CJRB 3SXYA 4Y20A 4CA9A 5ED4A 4D6SA 1ND3B 2BOIA 4BZ4A 4M3DA 4CCNA 2WADA 2M4GA 1RKWA 1HDPA 3KPHA 2BW3B 4OULA 5E1ZB 1GV5A 5FKCA 3WQ0A 1MS8A 5JXHA 3WF2A 2CNAA 1PUFA 1AU7A 4GMP1 4AYBA 4BAYA 1BZWA 5KHDA 1Y8QB 1VBE1 2JSPA 4KFCA 3C2BA 2F17A 2VQUA 1XU1A 2PHUA 2ZEYA 5A6QA 3USUA 2EIMH 1HB2A 4DUVA 3KEQA 2KLOA 2MH9A 1GQGA 3Q8FA 4AVBA 4FXGB 3A22A 1W0UA 3SH5A 1TWHJ 1NX9A 5F1RA 2Y48A 3R60A 1F43A 3PVOA 1I27A 5KHHA 1NAEA 4CO8A 1XE0A 1AR83 4KITB 2WFF1 3L1PA 1VB2A 1TMF3 1FC3A 5HCBA 2QQJA 5GZEA 1BHGA 2WC2A 2D98A 1XNAA 4GJZA 1IPSA 2BJSA 1SBEA 2CFXA 1JUSA 4IOAF 3G2BA 2AZ5A 1U8BA 1YYVA 4JKMA 4Y22B 2EILH 1S2KA 2ZHKA 1B8IB 4MGKE 3HRTA 3L9FA 2YGLA 5FRNA 1G86A 5HLHA 4XABA 4Y4RA 2XF6A 3PFYA 3VWBA 3BIWE 5B4XA 5FFZA 1IN6A 1SLBA 1HXS3 3FUOA 4LMFA 4XLNF 3ZIXA 3M4FA 4Q8KA 4META 1UFMA 5CQEA 1TQPA 3OEAA 4UOJA 1WKMA 4XC9A 2J1SA 5BNNA 2XG3A 1UL9A 4UB6C 2LG4A 1YJNI 3V0BB 3KETA 4BEHB 4XMAA 5CFDB 4L9NA 1AKHB 1JI6A 1GLHA 1MIJA 3S5AA 4XN3A 1OBNA 4HL0A 2BXYA 3VBFB 1AZDA 2BNMA 2MEV3 1FP2A 1C3HA 1ULDA 3O7OA 3GJAA 1RGSA 3K10A 1H0BA 1GV2A 2KRCA 4F52A 3L2UA 1AR93 3J9SA 3ELKA 1OJLA 4YGEA 3HOSA 5L36A 4LK1F 2HEOA 1IQDC 1UCXA 2O8QA 5KXBA 2CS3A 3WQBA 3I64A 2VBZA 4ZYHA 4DZJA 1TLHB 4HF2A 5CQGA 5JCTA 4EN9B 1MKMA 4TV7A 2R93J 2ORZA 5DZGA 4F55A 3KT7A 5F3IA 3AG4H 1SBDA 4PHZA 3VOEA 2M8GX 3MBWA 3SC7X 3PJYA 1JZ4A 3ISPA 3U4XA 1RUI3 5FZOB 1ZGAA 4HLXA 4Z8BA 1DLCA 4RFRB 3A0BC 2AO9A 3S3MA 2PXJA 2M7AA 1T2KA 3G1MA 1ZBA2 3THDA 3U1DA 1D4M2 2NRAC 4JGZC 4MFDA 1RL3A 2D5VA 4UFLA 3TN93 4KGQA 3CO7C 5FUIA 2DXIA 3CNAA 4ITCA 4R9DA 2VJXA 2B9UA 1O4ZA 3T1MA 4LHKA 2GDFA 1PM7A 4PDWC 3ZSJA 4HXCA 1N3OA 3OYWA 2RDPA 4EQQA 2W47A 1BVP1 1NCQA 4PDWB 2JVGA 4RLQA 1NYWA 3LFUA 4PJLA 4CUCA 1DQ6A 2OV7A 5KXCA 2WAQN 4XXAA 4K8FA 3VDDB 2Z4FA 3I4IA 3GMEA 3A0HC 4LBQD 4ZKTB 4HK8A 3AZVA 2R5ZB 4UUVA 3WNLA 1BM9A 4FPYA 2OW4A 4V1PA 5HCAA 3C7JA 1SPPB 3AL5A 4Y1ZA 4IEUA 1NY72 1JHFA 1I5ZA 5C8CC 1LESA 1BL0A 3UK9A 2NZ9A 3RZOJ 2RREA 4C0BA 4Q4Y2 1OQ1A 4C91A 2XGDA 2QBXA 2K3FA 2L54A 3E1SA 5KHIA 2HOAA 4ZDPA 2DCEA 4OWRB 1JZ7A 3OY9A 1YJLA 3HPHA 1R1A2 4QPIC 4DBQA 3HJRA 2DA4A 5C4WB 1IXSB 1QNYA 5HODA 4Q0QA 2K46A 1F9NA 1HRV1 4AIDA 1DGRA 2Y0SA 1WW7A 3VBSC 3PUIA 1ONVA 4HKWA 1OOPC 2PBIA 2G9GA 2XROA 4CHUA 2YU2A 4U0VA 4YVWB 3A1YA 3VBUC 1K3IA 1MBKA 1A04A 4R52A 3DLAA 2RVAA 1O57A 5J4VA 3RJ2X 3J81Z 2XVLA 2DVAA 1V6NA 2ENRA 3LL7A 4FQ4A 4AVAA 3WG2A 3AP4A 1EF4A 2DBBA 4GXOA 4FPKA 2G9ZA 2R7QA 3ZMDA 4OUSA 4AK3A 3RZKA 4JX4A 2FOWA 3WEZA 4CDUB 1DQ0A 3SCHA 2DODA 4LK6A 3RKQA 1XGSA 5FPVA 5F04A 3ESWB 1HLVA 3UT0A 2UU8A 2XPVA 1BEV3 1LE8A 5JZGA 1MVQA 4MGIE 4Y5TA 4AHZA 4XSZF 1HKTA 2CU7A 3WOGA 3ZYHA 4E7IA 1N1SA 2LFBA 4EEFG 5FZLA 1K42A 3H3UA 2STWA 2J42A 1GZTA 2L9RA 3K4DA 4LHLA 3BWGA 5FZKA 3HSRA 2CH0A 4F93B 1T2XA 4RMNA 3P5BA 2HWC2 4HRIA 3NAPB 2ZBKA 2HWF2 4EWAA 2LD5A 2L2OA 3WG4A 3VYUB 5DAPA 4NQWA 1YTYA 1RUJ3 1A35A 1WLTA 2YBKA 4RGXA 2PX9A 2GN7A 4MVTA 2HVSA 3MIHA 4UUTA 3K4KA 3LSJA 1ETYA 3RWNA 4H2AA 3WSOA 1ZBE2 1XB9A 1A6CA 4DXRA 4PF1A 2ZKZA 2K5CA 2VKVA 4XRMA 4IDZA 1NCRC 3THPA 2QZ2A 1QPMA 1JYNA 1GLNA 1UHSA 1UZWA 2XB0X 3MHZA 2CQXA 3JRBA 2Q30A 3HKZA 3ZPLA 3IRQA 1O8PA 4QQPA 3KYCB 4RGKA 4A3XA 3UNPA 4DQAA 3I3MA 2E1OA 1S5LC 4LBQB 2KP6A 1EUUA 3JBG2 4XLAA 3WQ1A 4CDWC 4M9ZA 2Q8OA 1F2NA 1HXDA 4Z2AA 3IH3A 3O8GA 3P3NA 4YVSA 3GCWA 3NNFA 3OYMA 4XLPF 3TDUC 3K1NA 1FT9A 2HZDA 2GAUA 4Y15A 5T50A 5FXVA 1L3JA 1RESA 4FT8A 2XVKA 2FA5A 4F92B 4CA0A 4D7MA 5T5PA 5IOZA 5FXWA 3OPTA 4CXFA 2QYOA 3S2HJ 5C3PA 3H1MA 2X1CA 4NO4A 2D3PA 4KIFA 5I0DA 4AGRA 4JCKA 4B4CA 3DKWA 4BQ4A 3ZO0B 5K5OA 1R49A 3RMYA 1P9QC 1PO21 4XK4A 2X0LA 1NH3A 3LF7A 2ZJRF 3RI8A 4NPRA 1SLTA 1W0NA 1TT5B 2JDMA 2SLIA 2WSUA 1V6LA 3OIOA 4BK5A 5FZ0A 4D69A 3I49A 2LKSA 5JXGA 2JEMA 4HLYA 2A05A 2BHYA 1W5TA 3Q0UA 1ZELA 2ARCA 2VZ1A 5A7SA 1NT0A 1YEWA 3C2GA 1PVC3 5JI9A 4M6XA 1Y9GA 3OOUA 4IHWA 4LIUA 3K7AJ 1CJPA 3AMNA 2B9VA 2IGKA 1KU3A 4AI3A 3W6VA 1AUYA 3JSOA 1S0IA 1PIV1 2PHWA 1SFKA 2O8OA 5LRSA 1UOFA 4BQOA 1OH4A 4A0YA 2XUBA 3KX2A 3B3QE 5EJCA 2W24A 1XC6A 2ADDA 3MLJA 1W36C 1OLMA 2PAMA 1PYVA 2HQRA 3GCXA 4WVMA 3MD2A 3ZX7A 4EM1A 1G3TA 3NAUA 3WNXA 4P08A 2OBPA 3LMMA 2IXKA 4CRQA 1IUFA 1ITYA 5AC93 2V1XA 4CCKA 2P3KA 4KMQA 4ZS3A 3W21A 3K3OA 4QGMA 2O6GE 2BQPA 4LO6B 1KYWA 1E3OC 3EDPA 4R9CA 1FBUA 4WZCA 2XAGA 5BNQA 1ND3A 3NSTA 2XJTA 5L73A 2L9LA 4QX8A 1W9SA 3OPWA 2BW3A 1REDA 1U0JA 5EXOA 1LRHA 3LDRA 2Z1DA 1KEXA 2JB8A 3MUZ1 4COVA 1K78B 3AZYA 4KYWA 3OY8B 2B8MA 2GC3A 3G3ZA 4EROA 3CQZJ 3BZKA 5FO9B 3LSGA 2WQ4A 2W1WA 2BFUS 1UW8A 4BE1A 1A36A 4LGWA 3KV9A 2VUAA 4CEYB 2CFOA 4ZYGA 4MGZE 2IGOA 2WT1A 2VMFA 3U9GA 1NLQA 4GMP3 4K2EA 4LORA 1TME2 4MYEA 4Y1UA 5HV0A 1VBE3 3BCAA 3D1NI 1HB1A 4JC1A 2D44A 3AKQA 3W5MA 1LTEA 3CLPA 2M3AA 2HVQA 2DVBA 1CZSA 1JS9A 4FFHA 2CQNA 4P9GA 2O7OA 4X8NA 1UYZA 3BIEA 2VPVA 3KLOA 3PMSA 2TNFA 1C8NA 2YX4A 4E7SA 4QQ2A 3LEGA 1PDNC 2VMHA 4E7KA 4XJ9A 2VU9A 4H55A 1GICA 3T0BA 2F4MB 2Z3YA 4CUBA 2WFF3 4Y22A 3T1BA 1R7JA 4QGNA 1B8IA 1W6QB 4BBRJ 4A6EA 3BB6A 3PNYA 2CMPA 3K4AA 1L7LA 1LULA 2VZPA 4Q4ZF 4Q0SA 1XYPA 3O1PA 2H6CA 4DS0A 1QNWA 2A69F 4GXLA 2ZCWA 4BHPA 1KQRA 5IK4A 2BRTA 2JDNA 5DABA 2P37A 1VNDA 3JAMZ 2FUG2 4WX9A 1JXSA 1YS7A 1LFUP 4D94A 3GTMJ 2VASA 4DEQA 3V0BA 1FP1D 4BEHA 2FX0A 2C9KA 5CFDA 2VVDA 1AKHA 4DINB 1AX2A 4M3GA 4EZ4A 3MPBA 2WS91 3VBFA 2VBPA 2ID4A 1REFA 2K9LA 3H5RA 3GJBA 2M2EA 1ENRA 3FKIJ 4FOVA 3R05A 2WLQA 3IMMA 4OQ9A 1XMAA 4UYBA 2BGCA 3WF3A 1SZBA 1YG2A 4LA2A 4L99A 2VE8A 3S15J 3OOPA 3V4GA 2VUMJ 1F1ZA 1X4PA 2KIUA 4PJMA 3THTA 3ABKH 3HXLA 1X8EA 5FYBA 3L2HA 5ACA1 2JJ7A 2JRTA 4D6QA 1WZ2A 2UY8A 4Q1RA 1VQ5I 1T39A 1W1WE 1C4RA 2WNEA 5KHGA 3ZN4A 4NC6A 1UMIA 1IS6A 1ZLKA 4BDZA 3CU7A 2E31A 4S2FA 5ABJC 1Y39A 3T4VA 2BU9A 5FXZA 3FN9A 4PCRA 3E3VA 5FZOA 1O4XA 4D7YA 4GYIA 4YFXF 4IE6A 4KNCA 5IAXA 2K27A 2D6OX 5FB2A 3QD6A 2VIXA 5A2QZ 2CW8A 3U21A 2FDKA 3BTCA 2NXNB 1VIWB 1OI6A 4QHZA 5FO5A 5CBLA 4QHBA 1W90A 3OCPA 5DMYA 2DFCA 1S0FA 5EDNA 4AI8A 3TWIA 2OF7A 5EGOB 4LG3A 5J98B 4IX7A 5T5OA 4M3CF 1UXXX 3ZXEA 2XJPA 2FEZA 2R7EB 4K1ZA 3DU6A 2DA6A 5A33B 3OYHA 4PDWA 2ZGNA 3C7EA 4IE5A 2ARBA 1PZ8A 3BCBA 2W7NA 4DXTA 1E57A 1Y6IA 4Z82A 1SMVA 2HU9A 3VDDA 2QQPA 2BBVA 4ZTJA 3WNPA 1GQPA 1SD5A 2W9XA 5FFXA 3PSIA 4B1RA 2R5ZA 4GWIA 3AZZA 4ZZ5A 4JQRA 3OGJA 5FUPA 1QU3A 1SPPA 3H3VK 4W65A 4JGYC 3ZR8X 4RAFA 5LHHA 1GUUA 1EUTA 2D93A 4JGYB 2R7WA 4KT5C 4HVQA 3URFA 4Q4V2 1M4WA 1JBCA 1XGNA 4AL9A 4MEXF 4NR1A 1B09A 3JB4C 3QRFF 3V65A 3VD4A 3CDHA 2R6QA 3S1RJ 2WA3A 4M3CE 4XYXA 1H8TC 4Y5Z0 4YFZA 4PIXA 1F8VA 1W04A 4RHV2 3WXPA 3B7MA 2I10A 1UAAA 5C4WA 5GAHJ 1PGSA 2RJLA 3OYCA 3DXUA 4XFGA 3FHNA 3POIA 1CX4A 3BY6A 1J0RA 1X3ZB 1O6UA 2Y0OA 3K77A 4HKLA 3AKPA 4ENJA 4FX0A 3CDIA 3TEYA 1UPSA 1C28A 2RNGA 2XPUA 2NPIA 4YVWA 3AKTA 4LO7A 4AVSA 2R32A 5DS9A 4LHNA 3FE5A 1HRV3 5JIUA 2LUWA 3FC0A 5EV7A 2IXJA 4M3BA 4FOWA 4YZ2A 4NJ4A 1JKRC 1FLIA 1W99A 2VL4A 2WN2A 4YW7A 3PHMA 4PI0A 4AHYA 4CDUA 2XRLA 4XMYA 1S7OA 4HANA 1GP4A 2BV6A 3EB7A 3H9GA 1O3RA 4KN4X 3VBRB 4BBSJ 3GO5A 1W9TA 3N9LA 2XSDC 5LK5A 4NRQA 3VBOC 5C70A 1H30A 2P4WA 3OYDA 1YQAA 1XBFA 1S2EA 4O6JA 3U2RA 2WAEA 5L7OC 2P3IA 2OUMA 3FFZA 2UUZA 1BR1A 1VRH2 3TGNA 3AG1H 2Y9ZA 1LOFC 4AD9A 4V2VA 4Z6YA 4F3QA 4OMCA 4CH7A 5K7HA 4AF9A 3CCYA 3NAPA 2ZNZA 2VY0A 1PGW1 3MIFA 5LEJA 2EPFA 2W00A 5FQ0B 4BJ0A 4GIQA 4EATA 5I0TA 4S2GA 2VECA 2B7EA 4L5IA 5J3LA 3HOZJ 2ZXWH 3F3XA 3DPUA 1YI7A 4BJTA 4YEJA 5FLIA 1LKNA 3DCQA 1QWRA 4UT5A 2JA8J 1MVEA 1JJ6C 3GHMA 3I2OA 3BKZA 4U0WA 2H0VA 1PX4A 3DXTA 3K69A 1IS3A 5GAEJ 4LBQA 4X6AJ 1PNGA 4Q2FA 3OYKA 2DV9A 4A45A 4NB5A 4K7JA 3KFWX 4LLOA 3ZYBA 1OFSA 2ZGKA 1VQ6I 5FBZA 1C8M2 1OA3A 4GB31 2EZLA 1R4NB 2MLKA 3KD4A 3BTIA 5FWJA 2EFQA 3GYHX 1ZKGA 1AWCA 1BK1A 3RJRA 3CDZB 3HEIA 3HT2A 2DT5A 1JTXA 3WGHA 1UO9A 1ZBA1 5J1XA 1J09A 4ZZDA 1D4M1 2WAOA 4QB2A 1JODA 5CKMA 3K70C 5CKQA 1MEC2 1ON2A 2D1HA 1J9IA 3LKJA 5FZ3A 1N1VA 2E51A 3WNMA 4WM7C 2CV6A 4LITA 4F7ZA 3I55I 1UMHA 3MLLA 3Q3SA 4I0AA 2R0QC 5L3FA 5K7FA 1YQ8A 1Q8QA 2HDDA 3FXKA 3IIAA 3IBMA 1BJQA 3KEOA 1RUC2 2M0CA 3PMEA 5FZ8A 1AXYA 1H1AA 3WGGA 3KV6A 3C7GA 4LUMA 2GMPA 2VO5A 4LKEA 5A3WA 1X19A 1PO23 3O1UA 1COV2 5K5RA 2EFNA 4E7HA 4AEMA 4ONUA 1WLDA 4Z1VA 2VJIA 5CG9A 1NY71 3HB9A 4M3FA 2XASA 3VZMA 1FBSA 2N8GA 3TYJA 2Z9OA 5JDBA 2D6MA 6PAXA 4NOTA 4A0XA 2Y33A 4ZYAA 1BKZA 2BOJA 4Q4Y1 1XXNA 3P9CA 1CJDA 4AU7A 2B9SA 1J3QA 1IZ3A 3H7YA 1J5YA 1ZH5A 3B94A 4ENKA 1R1A1 1W03A 5DZEA 2FDHA 4I3GA 1TWCJ 2CYYA 2VNRA 2F5CA 1WRJA 2FZ2A 1GT0C 5JOYA 1WJFA 5LBEA 4JDNA 5GPCA 2Q0OA 1IRFA 1PIV3 2X29A 2ZAHA 4UV8A 2Y2ZA 4LKSA 3S32A 4RAYA 1Y0UA 4HEA2 3DECA 2HQ5A 2QQAA 2W46A 4ESBA 3CCUI 4S2HA 1QOSA 2JICA 4CDXB 2ZX4A 2ZHNA 1UIKA 5DQ0A 2ET7A 4KU7A 5F2WA 4BXSV 2GZWA 3HPGA 4HA8A 1TNRA 3NV1A 4ZONA 2I74A 2R7FA 5HVQC 1VE0A 1JTZX 2IXLA 5EG0B 1K78A 3I71A 3O1OA 2YSRA 3EUHC 2WO1A 2OVUA 2GIZA 5LEKA 3W6KB 3OY8A 1NLSA 3ES1A 3NV3A 3KQ4B 4OLLA 5DCFA 4XPVA 1FBQA 1NKGA 4CEYA 2DFIA 3O1VA 2K0GA 5FJ8J 3HSEA 5FRAA 2STTA 2ZJCA 1OR7C 1WI3A 4UXNA 3FBYA 4SBVA 2IS2A 2FMLA 3GGLA 1A6IA 2LS6A 5JAXA 2EZIA 2XWBB 2D3RA 5GLWA 3FHQA 3IDEA 4KL1A 2HYJA 4J6GA 4NBQA 1U78A 2EINH 1HW5A 4K9SA 4G7HF 2HWC1 4BHCA 1YW9A 3TQNA 2WSVA 2YDEA 3P9IA 3DL3A 5D5UB 3J7MA 1OXCA 3TO7A 1D5YA 1ZBE1 1W6QA 4R4XA 1KA8A 5C9AC 2NMNA 3CJIB 3VZOA 3BVCA 2EAAA 3JB8A 1H2LA 3BZCA 4B3NA 4GULA 2HWD2 3ITQA 2V6CA 3S1MJ 3POFA 2PN5A 3VB9A 1SLIA 3JBG1 4IRHA 4JX6A 1CIYA 5IPAA 1ENQA 5BNOC 4XJ8A 5HLIA 1I1GA 1MNDA 4HV5A 4XIDA 3J7LA 4FE7A 1V54H 1PZ9A 2VUCA 3CESA 2JENA 2DFBA 4HMZA 1IV8A 2FDGA 1DPRA 2JG9C 2PMZA 5ILSA 1FMD2 5D2AA 2H27A 2J7MA 1UHMA 3CCVI 4LOCA 2JG9B 5TGTA 3O0XA 3I9V2 4MGQA 1XYOA 3TNQA 4N0BA 1IDYA 4KICA 4PJNA 4XONA 3U07A 4Z92B 1DGLA 4B8XA 4XKWA 4IRGA 4ATFA 4ARXA 1TNSA 4E2SA 2RV8A 1BA5A 1ZZCA 4XF1A 4KI5M 2ZA9A 1VBD2 5K0UC 2YU1A 2CWEA 3RPQA 4QHOA 5E8GA 1U5TC 4XZPA 3HAGA 3IAPA 1OHFA 4HVRA 3W6JB 4NIAA 5ACA3 4BQ1A 4PK4A 3BC8A 2JUGA 4Q47A 1XGMA 5IYCJ 1ENXA 4BPZA 5HCFA 4I7HA 4UW6A 3MIEA 2JPCA 2JRMA 2P6CA 1LFPA 1FOD2 1UOGA 3ZFEB 1B35B 2VXZA 3A02A 1D4VB 3EHKA 2Y64A 2HYKA 2PFBA 1RZ4A 3I2FA 5EGOA 1W6PB 4YG6A 1D8JA 1J83A 4EVIA 3OR1C 5A7OA 2L9VA 5GPAA 4BLIA 5D8KB 3RI4A 1FOYA 1DP3A 1R092 4BQ3A 3VKOA 2RKHA 2WZEA 5A33A 5BPDA 1KRIA 3S3NA 2E34A 2R7ZJ 1F4KA 5C33A 2L4MA 3OYBA 5IW0A 5B1AH 2L0KA 4L92A 2VUDA 3DUIA 3W59A 4D7NA 3RPUD 1JW6A 1A3KA 4ISQA 1W05A 3H3LA 3MW3A 4FP2A 5GTIC 2BP6A 2WKKA 5DPNA 2EXJA 4LTAA 1FOKA 3D5LA 3LB9A 2YB7A 4BQ5A 2HDWA 1OT5A 4LMYA 2BBYA 2V26A 4KNYA 4QXBA 4JGYA 2D5FA 4N8MA 3IM0A 4D5CA 4JV4A 4L8QA 5BV6A 4G12A 4GZ9A 1W2NA 2VW1A 1YQCA 2RDRA 3E6CC 3LSIA 4LBLA 3BG7A 3RDIA 1PJRA 4AFCA 4B3XA 2VN2A 1W0OA 3OYAA 1USSA 4XQFA 2E60A 2LALA 3SQNA 2B45X 4U36A 1Z7LA 4OAZA 4FQGA 3Q9SA 2M9HA 1ZRFA 1TME1 3MEXA 5F37A 3IP4B 1JUPA 1CZTA 2Z69A 3NNJA 5I0UA 1YQ6A 3H9AA 1LVKA 1XRUA 3KF5A 1TNTA 2DOAA 2EXKA 2LBFB 4QLCU 2E2HJ 2IA2A 3I56I 4B4PA 1LGBA 2LR8A 1NG0A 1LEAA 4TSVA 2ID6A 2QQKA 3NNLA 2PJRB 3VZJA 3ZXDA 4MGTA 2GWRA 3MFAA 1QJX1 1G59A 3UR3C 3ZXJA 3HQXA 3PU3A 3IH4A 2HWE2 1VMHA 5LHIA 1K7AA 4EMSA 3FISA 4MIMA 2A61A 1EH8A 2I45A 4ZZLA 1YIPA 1AYN2 1SDDB 1WVRA 2K9ZA 4XXPA 3VBRA 1IJWC 1UZ0A 1VBA2 2ME0A 5C4JJ 2VMEA 4FTSA 1ULGA 4I01A 4KISA 2RS12 4DY5A 3K4MA 1BLZA 3ELNA 3TO6A 3JAMK 3L2VA 1SVOA 3QU3A 1IQAA 1X1BA 1YIFA 4NAMA 4II2A 3OS0A 1LOFA 5JUVA 2CDPA 2F6CA 2DA3A 1RETA 1Z91A 2BZTA 3H0GJ 2DU1A 5EZHA 2HOEA 5FQ0A 2R1DA 1QGLA 2PTMA 3M8JA 4EJRA 3PFIA 1R1VA 2CDOA 4HDVA 1HBXG 4KBBA 4BUPA 3E6DA 3WG3A 2WDBA 2ZX3A 3HR9A 5FY7A 1CQ9A 1YQ2A 4KBZA 3A4UA 1JE8A 2VKEA 4XF9A 1EH6A 1T8IA 4TXWA 4Z2YA 5L3GA 2ZGQA 3W3CA 1MJAA 2OXBA 2LYCA 3QQAA 3OD0A 4Q4X2 2IVMA 1Z7UA 2PMUA 1P2FA 2MW8A 2Q8EA 4CU8A 3LAPA 5EYRA 2KHMA 1VAVA 3MIBA 1O3SA 2JG8B 1XSVA 4MFEA 3HOWJ 2LK2A 4FPFA 1R1TA 2UXNA 2ILMA 2PQQA 3S1NJ 3ZDVA 4KH9A 4B09A 3WP6A 4GB33 2DPUA 3I2IA 1P4WA 1LR5A 1PP7U 3WP4A 5A2QK 1EA3A 4E9KA 3ES4A 3BU7A 2X6WA 3LSRA 3SH3A 1JYTA 4FAHA 5G04L 2IA1A 2DOEA 4GJYA 2KDZA 4DIQA 4RB1A 2WIIB 3NO8A 1XQNA 2ECBA 1RIOH 2AQFA 1ZBA3 1SFXA 2OTJI 1B6AA 3RYRA 4XUNA 4AVVA 1D4M3 5KAIC 2IUWA 1DP7P 5LY1A 1XSDA 3T3YA 3DBRB 1PHMA 2FCTA 3FLPA 1YRZA 1LEBA 1P7IA 2D3SA 4UVAA 5FYZA 1HB4A 2XUEA 4Y1VA 3LA2A 3BLYA 3B6AA 3JTHA 1LQ1A 2BOLA 2OD5A 3ZYGA 5CVVA 4E7ZA 1FV2A 4FBFA 4C9YA 4Q4V1 3CC7I 4PUSA 2WAQA 2ZABA 3BN6A 4J25A 4GYGA 4O3MA 1Z21A 1X7NA 3AM2A 3KZZA 3LA3A 2IJLA 3CO2A 4NHYA 1IN5A 5LD2C 3I97A 4RHV1 4IE7A 4XZUG 3J7ZI 1TQIA 4GA9A 5AVAA 2P4EA 3AZWA 5HPOA 4XFBA 4OHWA 2XSJC 3OYEA 1IPJA 4Q4Y3 3Q0WA 3BOPA 3RKXA 4OFGA 4KN7X 1DZRA 3PUBA 3MW4A 4IE0A 1RUOA 4ETSA 1R1A3 3IDAA 1ZZ8A 4LB6B 4DYQA 2HTJA 4RSUA 1K61A 1VTNC 2ETHA 1JOPA 1JI8A 4E6KG 3HDDA 3VGIA 2AACA 3ZCOA 5I91A 1LGCA 2JDUA 2XMLA 2W52A 2ZGMA 3POJA 5EG0A 5CIRA 1V9U1 1G6NA 3RZHA 3U1KA 3EUHA 2AHQA 4XSXF 1HDDC 2WYSA 1U5ZA 3H0OA 4M0HA 2K4BA 2VOTA 2YU9J 4QGLA 4LK7A 2ZAAA 3PNAA 1TC3C 5IVVA 3H50A 2CRGA 3CLQA 1T6SA 3VD9A 1FY7A 1LDDA 3M3YJ 1QJU2 2DQRA 2DOFA 3P1IA 3R6SA 3APBA 4ZHNA 1E2XA 1VBB2 5BQTA 1S8NA 4KMUX 3SDBA 5DD8A 5IY5H 2R072 4AEDC 3PNVA 2Y6HA 2LY2A 1AVBA 1OR7A 4FFGA 2GBYA 2BGOA 3ASOH 1ZR2A 1VRH1 3HIFA 1ODMA 4XBQA 3MYXA 2LRPA 3HG9A 3J7YJ 2WWSA 1VR3A 1VQ4I 3VL9A 2HYXA 1WUVA 3OG2A 1GDTA 5DTDA 1DZQA 1UIJA 1ZG5A 2KQRA 3NJYA 4QQHA 4QSHA 5GLZA 3KF3A 1ONAA 3SKJE 1W7PB 4INDA 3G1LA 2GNBA 3AJYA 4JAAA 4PIZA 4XDPA 1YNAA 3H3ZA 4HSRA 3CJIA 1X58A 2DN0A 2IXHA 3S2WA 1QJY2 3MEPA 3SH4A 1KZHA 2HWC3 5C3QA 1Y1WJ 1KGYA 1WGPA 3F72A 3CMYA 2BY3A 3PSFA 5DDJ2 1XTAA 4H3WA 2G9FA 1ZBE3 4NROA 4QX3A 1C8M1 4QQOA 1AL22 4A5NA 3M1HA 1CESA 5CB7A 5C4XJ 3GNEA 4UFMA 1H6YA 3ECQA 1FTZA 2NQYA 1LHOA 4COYA 3WTWC 2QSFX 1HRI2 4AI1A 2J1EA 5FZEA 3JBG3 1XYNA 4FPCA 4A2UA 1RVF2 3K4CA 1POV0 2JG9A 4IV1B 5J1RA 4LKFA 4CXWA 5EJZB 1MEC1 4QXKA 3HJEA 3AL0B 1R082 2FDJA 2ICWG 4YYOA 4ON0A 3WF1A 1EP0A 1WSUA 2OT7A 4HV6A 4XOGA 5JSRA 4RBOA 2DCJA 3CMEI 1PP8F 2A73B 4MV2A 1RUF2 4XFCA 4EZHA 4RDUA 4UY8I 4OOIA 1DQ5A 3LDBA 1RUC1 2ZZQA 5AVPA 4MQ9F 4YM3A 1QY4A 1QXJA 4A6OA 2Z5WA 2D6PA 3OL4A 1I5PA 4BQYA 1AL0G 1SEUA 1MZ6A 2JDYA 3O5SA 2OU2A 1BJAA 4P5YA 1SD6A 2R042 2IW5A 5DAVA 1WJAA 3ZSKA 3CZ6A 2NN8A 5D8LB 3EQEA 3HGGA 2FZ1A 2GNDA 2DUPA 1T38A 1KFXL 3RKYA 3RSNA 4RS8A 1S7EA 3WF4A 3ZFEA 4U88A 1G9CA 1B35A 2E35A 1FOWA 1W6PA 2GLOA 5IP6A 2Q1ZB 3SHRA 4A6SA 5K5QA 1QQIA 3LSTA 2RVCA 4E4SA 2PG4A 5D5VB 1JZ6A 3ZMSA 2VZQA 1RMU2 3LOIA 4EGZA 2PAEA 2EIKH 2WLPA 4CDQC 2VOWA 2AREA 4CP2A 4CZZA 3RTRA 5EF6A 4BY1J 3DYPA 2CW7A 4A3KJ 3M3EA 4UFKA 1DU6A 2WQZC 3WP5A 1HOMA 4A93J 5M5XJ 1VMFA 2CL2A 3BTZA 4HF0A 3IHUA 3M7GA 2VBBA 1PO12 4YIIA 3H8XA 3LGRA 5E18F 4NWVA 2MBFA 4NHJA 2E9QA 1MACA 5ANQA 5F6KA 2CGOA 3ME2A 2BV4A 3WG1A 1ULPA 2P81A 1R6RA 3D5OA 4P9XA 1JYIA 4XUTA 1XGOA 4UWDA 3POYA 3GW2A 1N47A 1CAXB 4RM3A 2V1DA 2VPRA 2HKXA 2PHTA 4UV9A 1IN8A 2J5PA 1I9RA 2LOOA 1OF3A 2H6BA 1MMAA 4P5OA 2CSGA 5A32B 2FCVA 2Y6FA 3AKZA 4A44A 1WH5A 4BXXJ 4CP9B 2LBFA 2KFDA 2XVCA 1DQ4A 4CE8A 2LM3A 2WB1N 2ZEWA 2BFUL 1RR8C 2LVSA 1PK6C 4BMBA 4RAZA 5L9RA 3M9AA 2PJRA 1TME3 4DGWB 3QOEA 1UU6A 3MPPG 2BHZA 4AIKA 5A70A 5A80A 2DCKA 2IXIA 4XFFA 1S0EA 3GZAA 4QD2A 1QMJA 4AHWA 2BDRA 1QIQA 2VVEA 4UBGA 3MN2A 4YZ3A 3AAFA 4FSJA 2HWD1 1BI1A 3PUFA 1HSTA 1MBHA 4BJ6C 3K2AA 5C8WA 1QJX3 4XUOA 5A3PA 5EP9A 4Q5SF 5F3GA 4PFOA 2R0HA 2JDKA 2JMWA 4W6WA 2GH8A 2RM22 4GQ7A 5FZDA 4LPLA 1RNLA 4IEVA 1Q1VA 2QDRA 5F5QA 3N9MA 3FMRA 3MV11 2Y26A 1DGRM 2K86A 3NMBA 2EH3A 1K4TA 4QPWA 4LOTA 4FTBA 1FMD1 5E1RA 3W20A 1GBGA 3MFKA 1XE7A 5B3SH 5APAA 2W1OA 1GNHA 4YARA 2JQ7A 1DGWY 3H92A 2ZSHB 1WCUA 3GX4X 4QU2A 2V09A 1RPWA 3HOTA 1M06G 3UKVA 3IAS2 1UYXA 4O5VA 1EV12 1Q43A 4EV0A 2XVGA 3QBQA 3WF0A 3C2UA 3ASIA 4NHMA 2OQGA 4Y7NJ 3H0DA 1R23A 4D0QA 4ZDLA 1HW2A 1SFPA 3RPUA 3I2KA 4YPJA 4M73A 4AFMA 5K9YA 1VBD1 5BNPC 4BS9A 2K02A 1HQLA 5BNPB 1SFYA 1K5JA 1W6OB 4HSLA 5F0FA 4CSWA 2DTRA 3TOJA 5I8TA 4LLNA 2JG8A 4AYBN 3ZN0A 2ZEXA 3PIGA 3CZJA 4RGRA 1D2SA 5E6HA 2Z16A 1G9AA 1X33A 2ZGTA 4NHKA 3D5RC 3O1RA 1G9FA 1H9PA 2XBO1 2HEVF 4F91B 5AFBA 2OX0A 1YO8A 2QDNA 3J80Z 1FOD1 1T33A 5JLWA 1V0AA 4MGSA 4U2AA 3CP2A 3GTQJ 2VJJA 2V1UA 1MS5A 2ETEA 4RAGA 2V9KA 3C7HA 4XQDA 1XCVA 1R091 1NHAA 3ZVXA 4HONA 1LENA 1Y43B 2DCZA 4KQ7A 2P5KA 4G7ZF 2WNUC 2ACJA 3LFMA 4BQNA 2PLYA 1C1FA 4DXZA 1MJ9A 1E3HA 1YFUA 2UZKA 3NJVA 3FIWA 4K21A 2E7TA 2L7FP 1MS3A 1SDWA 2DVDA 4NN0A 1B72B 4RB2C 4XACA 2VD7A 3UJOA 3T2OA 4U7DA 1FX7A 2HPMA 3UKGA 5LB6A 1W9WA 1ORKA 5CFCB 1FNZA 3UKNA 1W8OA 5CPRB 5IVBA 2DURA 2VOPA 1CAVB 3IDCB 4HX8A 1HXS2 4H7MA 1Y3TA 3ZDSA 1BI2A 1Z0HA 2DJNA 3OEBA 3ZP5A 3KGLA 4XFIA 4EJWA 2W1SA 4Q4V3 2DF7A 1WLCA 1YRNB 3LSDA 3MQ0A 1W9YA 3SDGA 2O61A 3JRIA 3RI9A 3NJXA 4E8CA 2H1KA 1O59A 1D1BA 5F6FA 3LZZA 3MIGA 1ZG3A 1YJWI 1E5SA 4RHV3 1X2MA 3KGZA 2C4XA 1O3QA 4DOZA 2QE3A 2DMNA 2E7XA 3FHZA 1UZZA 2DU0A 3I0TA 4PFPA 3UV9A 3SNMA 3B93A 4HVOA 5ICCA 3DTEA 1YFXA 2HWE1 4GDFA 3QYEA 4I09A 2EALA 3OGGA 4X6QB 2HFHA 2MD0A 3N7MA 1IRXA 3MDPA 1AYN1 5I93A 3ERMA 3RCOA 1T95A 2FDIA 3FLRA 4HG2A 3T2TA 1APLC 1VBA1 2QKMB 3QODA 3SISA 1LFBA 5T52A 4NC8A 4BQXA 2W3JA 1DPUA 3TKYA 1KFUL 4ZH4F 3SKVA 5F7UA 2IRFG 1V9U3 3F95A 3EYPA 3H35A 2GP3A 4HPQA 4XKVA 2RS11 2K9MA 4JKLA 4LG0B 4X8PA 4XJZA 3GFLA 5EZGA 3S57A 1YOVB 5CJ9A 1R1ZA 1JT6A 5DUVA 2DMUA 3N36A 2W1QA 2VGDA 2R7RA 2HEWF 2E1MC 5J3UA 3LQRA 1RUJ1 3TN92 1BW5A 5HS7A 1OKOA 4CCOA 1WBLA 4RQPC 3DXJF 1GZ9A 1J1TA 1DYPA 4QPGC 4N43B 5GALA 1W7PA 2C9AA 1RUG2 2QQUA 3I3LA 4CTEA 1VRH3 1K6YA 2XWJB 3N9NA 3N3HA 4DZPA 4I30A 3K1MA 2EB7A 3DQVC 1GMMA 1AXZA 2GC2A 4RGAA 4G6DA 4KJZA 2G19A 1YS6A 4EWEA 3TAYA 5CEHA 1Q8VA 4JRLA 4L9JA 2NS8A 1YXWA 1ALYA 2YMZA 5CYVA 1YFWA 3ZQQA 2ZGRA 4Q4X1 1X1DA 1Y9QA 4QAWA 2RDNA 2RJ2A 1K5MB 1IS5A 2DDUA 1OUXA 3F8MA 4WVWA 3WGIA 3AKSA 2XV4S 3CLOA 2CWMA 2VMDA 4XILA 1EJ9A 4HX4A 3GEZA 1GKBA 2WAAA 2XXZA 1Y9MA 2DI3A 5J40A 3CUQB 3K4LA 4O9EA 4ES9A 4IV1A 4S2DA 1C8M3 5E3LA 1S2BA 2CUEA 4C2MJ 1LDJA 3SEEA 1XOYA 3LFIA 2C5DA 2M8EA 2ZHMA 2P6TA 3DCFA 3I3BA 3ZFGC 2E71A 2WNVC 3EQLF 2LMDA 1DGRN 1AYM2 3HGYA 4ZS2A 4J01A 2OUHA 3ZFGB 3VYRB 3DWLE 2DJIA 3IWFA 3CF6E 2O3FA 2L7KA 5DG2A 1ZYRF 1MEC3 3O14A 4V2FA 3ZOIA 4E4ZA 3S5QA 4A7ZA 1UB9A 4M6YA 4A7KA 1G9BA 3Q5FA 2MNGA 2LKPA 4COUA 3VEPA 2ZGUA 4X0GA 4W97A 4A3EJ 3ACFA 3Q9VA 1SEFA 4FAGA 3P5JA 4EM2A 1JKPC 1XJAA 5I8YA 2O0OA 2QUOA 1KU7A 2WYFA 1F5TA 2ZX1A 2JDAA 1O91A 5JMOA 2YUEA 1RUC3 1IF1A 3QOPA 2IGMA 1S3JA 2FD5A 5J7MA 4FETA 3IRRA 1XNTA 3JTGA 2Z2SB 1C57A 4J00A 3PVBB 4NMIA 1S7AA 5KK1A 4WK8F 2X5IC 2PEXA 1VQMI 5HI0A 2J22A 3M1CA 4B48A 4LLLA 1JJ8C 2X5IB 3ZFFB 5C3RA 3JRHA 2WR9A 5HXMA 1N3QA 2R49A 2JK3A 4IEOA 3M2MA 1PGL2 4NPLA 3E5QA 5DUKA 4PSXA 3COAC 3TOBA 1N77A 1FYMA 3VZLA 5HDNA 3CL1A 2KMUA 3WDYA 4PDKA 1DQ2A 3AFHA 1LVAA 3TDZC 1F5JA 1SFEA 1W8TA 2QENA 2PA7A 4EN0A 4MHUA 3KEYA 2Y30A 4MO3M 3DF8A 1V6OA 3EBRA 4IV3C 2DBIA 1YW8A 2L3DA 3MI8A 3K9TA 2R7TA 2JIJA 3D6EA 4TLGA 5FD6A 2H8WA 2L9SA 2A5ZA 2KRHA 1Z3XA 1A31A 3OYNA 4CYCB 1JZ2A 2LC2A 3ZQFA 3LOCA 2X1EA 3KHBA 4IOCF 5EEGA 2C6SA 4C2UA 2VNVA 1HW1A 3G6EI 3VYSB 4ZDOA 1RXFA 2YPJA 1CAXA 2FF4A 1UN1A 2VCAA 5FPXA 5FXXA 1QJU1 1QA6A 4OINF 1MH4A 1X4OA 5IUQA 3GTJJ 2WO7A 5A32A 2YXSA 5JPNB 1ZG1A 2CHHA 2ISYA 4CP9A 3J8F2 3VHOA 2TCTA 4BDVB 4L11A 2SBAA 4YGBA 1L3LA 4QB6A 5FLVA 3ZMUA 3OWTA 1F36A 2M7BA 1H88C 1MZFA 3GTOJ 1IS4A 2LF8A 2GMMA 2R3SA 3ATGA 3DV8A 2H0BA 4OZXA 2VBWA 4UF0B 4L9TA 1YIOA 2NS0A 1W5CC 2GA2A 2M5WA 3IKVA 1V6MA 4W6XA 5FYCA 1N75A 2D40A 4YW3A 4ASKA 2PAKA 3I58A 1CD3G 1CQTA 4J19A 1CAWB 1QJY1 4CXXA 2WWYA 4OMDA 2L7ZA 1RUD2 4OIQF 3F21A 2EIJH 3M07A 3NWSA 5DDJ1 3VBHC 5KC5A 2QA4I 1Z9CA 2QKLB 1FAYA 3KV5A 2WABA 4YELA 1MMSA 4BQQA 1AL21 2Y69H 2UWMA 2RHPA 2YZ4A 1TL8A 5CKNA 3ILFA 4P9FA 4NIGA 2HWD3 4RD7A 3BYWA 4LLGF 1HRI1 2NLRA 4GMP0 4A3MJ 3G4SI 3GBWA 2BE5F 1QOTA 2XGEA 3UGHA 1JOBA 1MQTC 1RVF1 2XLGA 3WINE 3D0JA 5IVCA 1BBYA 1TWAJ 1HDKA 1HV1A 4XDOA 2PELA 1JZ5A 4J1XA 2VNGA 4LEJA 4EN7B 3FXQA 5FP8A 4EJVA 1FMD3 1OCCH 4Q8LA 2Q2EB 2FSWA 3WTVC 4I0WB 1RUF1 2RS31 3ZKUA 2YV8A 1XSRA 1LU2A 2P34A 2OQ6A 5D1IA 4V19K 2B63J 3V7CA 1GXQA 2EFPA 2WN3A 5LCWL 3CIHA 2XC7A 4BACA 3TO9A 1SC7A 1U3EM 5BNPA 1YLFA 2WV1A 4ZYEA 4E7LA 2JE8A 1W6OA 3GYDA 2BWAA 1YJ9I 2L01A 3FMQA 2W25A 2RG4A 2R041 2EFOA 2UYBA 3NKTA 4UNOA 4P14A 4M0NA 3D3AA 1VBD3 4LQRA 2XONA 1RKTA 1G9DA 3POEA 2P7VB 2Q5TA 2W39A 3RZDJ 1UX7A 4WM8C 4CGZA 5LA9A 3V0AB 5L3BA 3WTXC 3O1TA 3BP8A 4ENNA 2W68A 2CW0F 2IFWA 5E16A 2BVBA 1AX1A 4YFNF 1A78A 4X1EA 3TRSB 5FY4A 3RZLA 5E3OA 1W2UA 4M9XA 5DYMA 1VBE2 2XBO3 2M0MA 3PDQA 3PL0A 1FOD3 1QF3A 1US2A 1TTYA 4JGZB 1BR4A 3ZXLA 3JXSA 3KV4A 2I2SA 4IHSA 1DCSA 1SANA 3S3OA 2P6SA 1A8DA 1B72A 1R093 3MIDA 2A6XA 1PO11 1O5LA 3VD7A 2ZMEC 3S7IA 3OYFA 2OQRA 2BERA 1EV7A 3V64A 2WFPA 2TUNA 2JSCA 3T30A 3A01B 2ARXA 3L2RA 5CFCA 4BB3A 2NYXA 2CUFA 1GP5A 1NA1C 2HKOA 3K4BA 4F83A 1CONA 1PVEA 5E8IA 1CAVA 1ZZ7A 4ESFA 3T0AA 2QEXI 3AXDA 4JTNA 1MPXA 5T5LA 5LBBA 5FYIA 4A42A 5C8CB 2OZ6A 3BG9A 4UHTA 2ZXIA 5ANNA 4XL9A 4XFHA 4N4NB 2ES3A 4BQWA 4D1QA 1WCDJ 1YRNA 2OKXA 3ECHA 2ZXQA 4R1HA 5GKAC 2O0YA 3KCCA 1WJCA 1BI3A 5BPIA 3WU1B 3R0RA 4GWMA 2JWTA 4LHSA 5IWFA 4XBFA 5E89A 3H9QA 1SBFA 5FKLA 2YU3A 2ZTNA 4QPIB 3B5LB 1FYUA 2BGPA 5DM6F 5HNFA 5FBJA 1DU0A 4A3BJ 5C3EJ 2C24A 1F35A 4P9JA 4FTHA 2KIQA 2YBSA 4B7KA 2E1CA 2X53S 4QT6A 3UESA 3U1XA 3VBSB 2VTXA 2ZGOA 4YNIA 2AGSA 2DT7B 3I59B 1OOPB 3HVDA 4AUXA 1R22A 3VBUB 3I4MJ 2DLLA 2LTPA 2C0ZA 3AJZA 1OQEA 1QXRA 2HWE3 2XAFA 3WHCA 1Z7S2 4I3PA 4P9LA 2RM21 3WU2C 1UU5A 1GYKA 1BOAA 2WZR1 3NNMA 3RWKX 3ZIWA 4CCEA 1JYWA 2VMCA 3KP3A 5DN2A 3KVBA 4LG0A 5JVVA 4OUEA 1QQP2 3ZN5A 1AYN3 3P7NA 3UGGA 1QKQA 4Y5SA 3SMHA 4OI1A 1VBA3 3SCGA 4C90A 3NVCA 3PUHA 5HLGA 3FLTA 1GUIA 4CEWC 3LPFA 2X6YA 4D8MA 1NXMA 2JX9A 4W8JA 4IEYA 4AQSA 1V6KA 4CEWB 4N43A 2RS13 3I3EA 1VRBA 5CADA 1BC7C 4JX5A 5T54A 1GZWB 4QKBA 1EV11 4MEYF 4AVZA 1H2KA 3J4UH 1MS0A 3E5UA 3KP5A 1PMIA 3LSPA 4KA4A 5FV3A 3W5NA 2DA5A 4DW6A 1IG7A 3K0LA 3OBTA 5BYNA 5FOBB 2R7OA 2W85A 1TBXA 3F22A 2AR6A 2IVIB 4EN8B 1BI0A 1K5MA 4IVNA 3L2WA 1IDZA 1BYHA 3USSA 2FNAA 1NCRB 4YW6A 2W91A 2Y31A 4AAPA 3IIIA 3JRCA 1JYVA 3MWMA 4BM8A 3GLLA 5J8CA 5EYXA 3CUQA 2A5YB 5IP7J 1S0BA 4CDWB 4Q4X3 4PBOA 4ET7A 4ITVA 3H5AA 2EAKA 2XAHA 2E6VA 4EYUA 4RS5C 4NWWA 1IZ1A 4KT6A 3CF5F 1DDNA 3FL7A 4G7OF 1E3PA 1UKRA 4QDQA 2P8TA 4IZZA 1MBEA 4RS5B 1LDKB 3J80K 5IHRA 3TOAA 3Q0VA 2PHXA 4KDPA 4FCYA 3N9PA 1ULEA 2LDUA 3ZFGA 3AP7A 4BK4A 3FKJA 1TVGA 1U9NA 4RM2A 4DO0A 1ZZBA 2KD7A 1UG0A 4UFHA 3G7DA 1DP0A 5JWPA 2ZKLA 1KU2A 1C0WA 4OHVA 5E3NA 1UY1A 2XJUA 5FDBA 4CP1A 4GH4C 3DKXA 2D45A 1HRV2 5BOXA 4FISA 4TLFA 3K2OA 4OUMA 1QZZA 4GH4B 4XF4A 5DZFA 1KQ8A 5ICEA 1OA2A 1V5GA 4XR6A 3ZSEA 2FBKA 2BZDA 2ELKA 3F0CA 1ZYBA 3DEUA 5FZIA 3OS1A 2IS6A 1H9WA 3ACIA 4Q4W2 1FXZA 5H6RA 4IEZA 5A3LA 4A3ZA 5JVTA 2VC9A 2E63A 2F5VA 5H2FC 3ABUA 3KP2A 2VUJA 2JKBA 2R7UA 3A0NA 1J3RA 2NOJB 2X5IA 1J7KA 3ZFFA 4B44A 3IKTA 1RTVA 1D0ZA 2VTFA 2ECCA 3GF6A 2V6EA 4WBBA 2W82A 3ZQIA 2DFEA 3VHPA 1UX6A 3SJMA 4BXFA 1Y0NA 3QP5A 1U9OA 4IXAA 2ZGPA 1TW3A 4XRSA 1JXNA 5BNNC 5J1UA 2ZZJA 4EJTA 1CN1A 4KGGA 2GQQA 1MBFA 4XTPA 1JGSA 1SLLA 1RJ7A 2EZHA 3AK0A 4C1XA 2BVLA 3RG0A 4BL0B 3AP6A 5E88A 1H8AC 3OSDA 3E6MA 4IRIA 2XAQA 2R1BA 2LREA 4CYCA 2E36A 1WW4A 2Y6GA 3AVRA 1L0OC 1OH3A 3AFKA 4HK9A 2CUJA 2MA3A 2O1QA 3OGRA 4PCQA 4GO1A 1U6GA 3D8CA 5F6LB 1JOJA 2R7SA 2IA0A 5DD4A 4HDUA 4B4RA 3JQWA 4R79A 1D0HA 3I3DA 1ST8A 2HPIA 1Y1VJ 3CC2I 3BR2A 4MZUA 3B9CA 1UZYA 5KNLA 3VYTB 5AIQA 4Y17A 1UMQA 3IL2A 1S4CA 1QPIA 3RS6A 1QJU3 1ASJ2 4XF0A 1V55H 1VAKA 1W2AX 4XEZA 1QJEA 4XIKA 4I6ZA 1VBC2 4QPOA 2YC0A 4UF0A 1VQNI 1I6XA 2JDZA 2QGUA 1U5XA 1RUG1 4GRIA 1IV6A 1KJRA 3GXOA 1R00A 4CU6A 1D5VA 4LBJA 5EYYA 5IVFA 3DTKA 3K4NA 4QMAA 2XQXA 1OCTC 1CAWA 2XUMA 2QVSB 3LEMA 3FK6A 3ZQGA 1UOBA 2ZXJA 3AG2H 5LA2A 2F5EA 1TW2A 1IOAA 3B69A 4C2TA 3FF5A 4HBLA 1QZEA 1NK2P 3GZEA 3N9OA 2ME6A 1SCRA 1HCRA 1N1YA 4A3JJ 4OI2A 3MW2A 2WA0A 4WXDA 3UETA 1MR5A 3H8RA 1NCQC 3POGA 4UW5A 3ZM8A 1Z6TA 4AM3A 1F9KA 3REOA 1QJY3 1WA6X 2GC1A 2A3SA 3NWTA 2OAZA 4IE4A 1J2XA 2GSYA 4EN6B 2RQQA 1I6HJ 4UAPA 5DDJ3 3PUSA 5EJ3A 4W4ZA 2RS52 3I2DA 2PLV2 2ZX0A 4H7LA 2A6WA 2H8RA 2CAVA 3WE3A 4H14A 1GVJA 3FXUA 4UBHA 1G8XA 1AL23 1FSEA 3JZVA 2VJ4A 1WH7A 1SLCA 2JT1A 4GCVA 3WX5A 5A3MA 4OMYA 3HRSA 1HRI3 3SZGA 3BTJA 5JPMB 1AYM1 3PNTA 2M1BA 3LEKA 3WP3A 2VQTA 2Q2EA 4QDSA 1UY0A 4N4OB 1WJEA 2XKPA 2GH2A 1E5RA 4Q5OA 1RVF3 3H36A 1OPOA 3RSJA 1REPC 4XE9A 3MZHA 2ESNA 2RR12 4WXCA 4MO7A 2BYVE 3WLUA 4ZU7A 4OAYA 4YZ5A 1LHWA 3RZZA 2ZGLA 3KP4A 4A6DA 5JI7A 1W6MB 3N9QA 4I0BA 3ZXSA 1FPQA 3DBHB 3EETA 1RUF3 2WUHA 2RS33 1PVXA 5FRMA 5FWEA 2VQHA 1LEDA 1ZQ3P 1OQYA 1L7QA 2EA4A 2H09A 3JSPA 5ABJB 2PQ8A 4LT5A 5FY5A 5KVRA 3V0AA 2JE7A 2B39A 5IK7A 4A4AA 5F5AA