5C9AA

Crystal structure of empty coxsackievirus a16 particle
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
296
structure length
282
Chain Sequence
DPIADMISLTALQVLPTAANTEASSHRVVPALQAAETGASSNASDKNLIETRCVLNHHSTQETAIGNFFSRAGLVSIITMPTTGTQNTDGYVNWDIDLMGYAQLRRKCELFTYMRFDAEFTFVVAKPNGELVPQLLQYMYVPPGAPKPTSRDSFAWQTATNPSVFVKMTDPPAQVSVPFMSPASAYQWFYDGYPTFGEHLQANDLDYGQCPNNMMGTFSIRTVGIEKSPHSITLRVYMRIKHVRAWIPRPLRNQPYLFKTNPNYKGNDIKCTSTSRDKITTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Coxsackievirus A16 Capsids with Native Antigenicity: Implications for Particle Expansion, Receptor Binding, and Immunogenicity.
pubmed doi rcsb
molecule tags Virus
molecule keywords VP1
total genus 43
structure length 282
sequence length 296
ec nomenclature
pdb deposition date 2015-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5c9aA00
4Y5Z0 4Q4Y3 5AC93 5ACA2 3NAPC 4Z92B 4FTBA 1BBT1 1ZBA3 3VBOC 1K5MC 2RR13 1PGL1 2R061 3VDDA 1COV2 4Q4X1 3ZFGC 1R1A2 5CFDA 1NCRC 3ZXAC 1HRV2 1TMF1 1D4M1 4GB33 4JGZB 4RR3B 1ZBE3 2X5IB 4NWVA 5CFCA 2RS51 1HRI3 1RUD3 3TN91 4RR3C 1NCQB 5AC92 2BFUL 1R1A3 1NA1A 5AC91 1R081 1RUE2 1BBT3 1PIV2 2RS12 5K0UA 1AYN2 1AR81 1RHI1 2RR11 1ND3C 1POV1 4QPGB 2HWE3 4QPGA 1RUJ1 1OOPC 2RM21 4PDWC 1HRI2 4GMP1 4CEWA 3J8F1 2FZ2A 4GB32 3NAPB 1RUG3 3VBRA 1PIV3 5ABJB 4RS5A 4WM7C 2DF7A 4Q4V3 1VBA3 1ND2A 1QJX2 3S6PA 1BEV1 2Y26A 3TN93 4N43B 1H8TB 1R1A1 2HWD2 1OOPB 1R083 3ZFFA 3JD71 1NY71 4GMP0 1RUG2 1Z7S1 5BNOC 2BPA2 2RMU3 1CD3G 1RUJ3 1B35C 3VBHA 1DDLA 1EAH1 5C4WA 2WLPA 4CDQA 4CDUB 4PDWA 5D8AA 1COV1 4YVWA 1VBA1 1RUJ2 4NWWA 1X33A 2WFF3 2RM22 4WM7B 5CFDB 1QJU2 3ZFGB 1RMU2 3JD73 1AYN1 1AR73 1AR92 2RMU1 1VBC1 1W39A 5FMOL 2WWSA 2RS31 1WCDJ 1NCRA 2RR12 1NCQC 4JGYC 1COV3 1MEC2 2VQ0A 5DDJ2 4LLFA 1VRH3 4Q4X2 2QQPA 1TME3 1RVF3 4JGYB 5A32B 1RMU3 1R091 1PO11 1VBE1 1X36A 1R092 1HX6A 2R072 1MQTC 5BNNB 4BCUA 2X5IA 3HAGA 4JGZA 2HWF2 1RUI3 3VBOB 1D4M2 1RUC2 4CDWC 1PO21 4N43A 1PO22 1NCRB 2RS52 3VBHC 4Q4V2 1TME2 1VRH1 1TME1 1EAH2 4IV1A 5C8CA 1QJY3 1C8M2 1R093 2WS93 2HWD3 4WM8A 1RUC3 4Q4W2 4N53B 5C9AB 2WZR2 4YVWB 1VBA2 4CEYC 5JZGA 2WZR1 2GH8A 4CDUA 1RUI2 1B35A 4RS5B 3JB8A 3VBRC 1NG0A 1H8TA 2FZ1A 1VB4A 4WM8C 4N43C 1BMV1 1EV12 4RHV3 4Q4W3 2BBVA 2R041 1SMVA 1V9U1 2WS92 3LOBA 2HWF1 1RUE3 2RS13 1RUC1 4IV3B 4PDWB 1MQTB 5BNNC 4CEWC 2HWB3 4CDQB 1ND3B 4QPGC 2HWC1 3VBSA 4AEDC 1QQP1 4JGYA 1AL0G 1RUH2 3M8LA 4RHV1 1FMD3 4RQPA 3ZFEB 4RR3A 2GSYA 1QJU1 2ZAHA 5CFCC 1IHMA 1NCQA 1RUF1 2RS32 1NA1B 1VBD3 4FTEA 2IZWA 1AR91 2RMU2 1VBC2 1EV11 3JBG2 2XBO3 1VRH2 2TBVA 4Q4X3 3VBSC 5A32A 1D4M3 1VBB2 2MEV2 1ASJ2 4GB31 5L7OB 5JZGB 2RS53 2R062 2R042 1QJU3 3VBRB 5ABJA 1BEV2 4CDUC 1HRV3 1AL21 1AR63 4CDXC 1FOD3 1AL22 1VBD1 1AR83 1RHI3 3CJIC 1AR72 1AR93 1PGW2 3VBFA 3ZFFC 1Z7S2 4IV1C 5C8CC 4GMP3 5BNOB 1H8TC 5K0UB 5JZGC 1AUYA 1PIV1 1RUH1 4CDWA 2HWE2 4Q4V1 4RHV2 4CDWB 3JBG1 1RVF2 2HWC2 1BEV3 1ND2C 1PVC3 4Q4Y1 3VBSB 1AR62 5ABJC 1AL23 1C8NA 1HQNA 1AR61 4WM7A 1ND3A 1RUF2 4YVSA 1Z7S3 3ZFEA 1NA1C 4RFT0 4Y4YA 5BNPA 3ZFFB 1FPN3 3CJIB 1R082 1EAH3 3DPRA 1OHFA 2X5IC 1VBB1 2MEV1 1RUH3 1MQTA 1VB2A 1PVC2 5DDJ1 4AEDB 1RUD1 1PVC1 4GH4A 3VDDC 1POV0 4CEWB 4EJRA 2R071 1POV3 1AR71 1PGW1 5J96B 2BUKA 1VBC3 4RQPB 2HWE1 2RM23 2XBO2 1FPN2 1K5MB 3J8F3 4FSJA 5FOJB 1FPN1 2RS33 1HXS1 1K5MA 1HXS2 3VBOA 3DPRC 1VBB3 1RUG1 2MEV3 5CFCB 5FMOS 5BNPC 1QJX3 1QJZA 3TN92 5DDJ3 4YVSC 3FBMA 1RVF1 4QPIC 1C8M1 4IV1B 5C8CB 1A6CA 2R073 5D8AC 1F8VA 1MEC3 4CDQC 1VAKA 4CDXB 5L7OA 1M06G 1RUI1 1FOD2 1HXS3 1ASJ1 4CEYA 5L7OC 1ND2B 3VBFB 1QJX1 1V9U2 2WFF1 2WS91 1C8M3 5LK7B 5J98B 5K0UC 1AYN3 1MEC1 4IV3A 2WZR3 4SBVA 1QJY2 3VBUA 3JB4C 1ASJ3 3VBUB 4FTSA 5ACA3 1AYM3 1QQP2 4GH4B 1PGL2 4YVSB 4Q4W1 2R043 1V9U3 5A33B 1GFF2 3ZFGA 2HWF3 1RMU1 1PO13 1VBE3 3DPRB 5A33A 1E57A 1OPOA 1ZBE2 1F2NA 2HWB1 2PLV2 4RQPC 5CFDC 2HWC3 2XPJA 1RUD2 1AYM2 1QQP3 1PO23 5ACA1 4AEDA 1AYM1 1BBT2 3VDDB 1FMD1 4GH4C 3VBUC 5BNNA 4N53A 3ZFEC 3NAPA 2PLV3 5C9AA 1PO12 1VBE2 1CJDA 1QJY1 3IDEA 1B35B 1RUF3 2HWD1 1BMV2 1VBD2 4YVWC 1EV13 2XBO1 5C4WC 1NOVA 4IV3C 3VBHB 1NY72 5BNOA 2ZZQA 3VBFC 2HWB2 2PLV1 1RB8G 4WM8B 1HRV1 1TMF2 1RUE1 5C4WB 4Q4Y2 1FOD1 2RS11 4CDXA 1ZBA1 1ZBA2 5D8AB 4RS5C 2R063 4QPIA 1FMD2 4QPIB 3J8F2 4CEYB 4N53C 5C9AC 1TMF3 1OOPA 3CJIA 1AR82 1RHI2 5BNPB 3JD72 2BFUS 1ZBE1 5GKAC 4JGZC 1HRI1 3JBG3 2WFF2 2ZTNA
chains in the Genus database with same CATH superfamily
3PVOA 3VHNA 5GLUA 1S1AA 4A7ZA 4DZGA 4Q26A 3ACIA 2IXJA 1DU3D 4LBJA 3CKHA 2JD4A 1D4VB 3PMSA 3HMYA 3OUHA 2VD7A 1C28A 4A6OA 4A7YA 3LAGA 3MEPA 4C1WA 3BKZA 1K5MC 2RR13 5FO7B 1W03A 1JZ2A 2XG3A 3AP4A 4XJUA 1OUXA 3ZFGC 4QPYA 1GZWA 4M3CB 1D4M1 4HLTA 4PQQA 5J37A 1CAWB 4QGMA 2BGPA 1LULA 4DUXA 4FPOB 5IK4A 4HL0A 4OUSA 1GUIA 3VZKA 2YXSA 2X5IB 1DHKB 3FJSA 4NWVA 4P14A 3KCCA 3GXUA 4OQ9A 4KG8A 5H9PA 4TN7A 3WNPA 2MPFA 4O7XA 1NCQB 2OIIA 4IW3A 1R1A3 4LBNA 3ZN4A 1R081 3VL8A 3FLTA 4OI1A 2FDFA 2ZEXA 3RMXA 4XTPA 2RS12 1XNKA 5DUVA 1AR81 1RHI1 3V65A 4NRQA 1UOBA 4B4PA 5HI0A 2RR11 1ND3C 2JE7A 1K12A 3AZYA 4QPGB 5IK8A 3GBGA 4XF9A 3HT2A 2E63A 2VNGA 4PDWC 3WP6A 1MS8A 4HOOA 3AYDA 2FZ2A 1KRIA 4KWKA 4RGKA 4WV8A 3KSCA 4K20A 2BGOA 4Y3OA 2JG8B 2QQMA 3SNMA 3UGGA 4E9KA 4ET7A 3DKQA 1RUG3 1PZ9A 1U5IA 4LULA 3VL9A 4WM7C 3D0JA 4NOTA 1YFWA 4OZXA 2WAOA 3M7AA 1VBA3 1ND2A 1PNGA 1OA2A 1RYYA 1YFUA 3MPPG 1GNHA 5DG2A 2ZGKA 3P1IA 4ISQA 4QB2A 1DZQA 3O5SA 2W95A 5D21A 5F3EA 3ZFFA 2UURA 2QKDA 2WNVA 3EB7A 1DBNA 1NY71 1O4ZA 2R1DA 1RUG2 1OURA 2AYHA 1CX1A 3J4UH 4JVAA 4XJ9A 1DDLA 1RINA 2ZMKA 2K9ZA 5BPXA 4H14A 1EAH1 2UWBA 4L0PA 1DQ4A 4YM1A 2PAKA 3GCWA 1LOEA 4IGQA 4YG0A 2XHKA 5FXVA 5LA0A 4CUAA 1CESA 4CDUB 1N1TA 4HSLA 4PIZA 5D8AA 5FRAA 1YUDA 3OGJA 1HV1A 5FYBA 3N9MA 5T5OA 1VMHA 1FI2A 2WNEA 1OMIA 1JTZX 3BOWA 4MGKE 3UKTA 2UYBA 5FKCA 1UZWA 2YC0A 4F7ZA 3T0AA 3QBQA 4XUPA 3WW4A 2JG9A 1VMFA 2GZWA 4UAPA 4NIGA 4P9YA 4Y1VA 4LNVA 4PCRA 1MS9A 4QQHA 1LRHA 1CAXB 1JHJA 1W39A 5FMOL 3T0DA 1RXFA 3KT7A 1AJKA 1ULOA 2XH6A 4ARXA 3WG1A 4BZ4A 3T1LA 3ZN6B 1NCRA 2XHNA 4BE3A 1DZTA 2OT7A 4IGPA 2XONA 2Y34A 4IXLA 2PHUA 5FZ0A 2VQ0A 4A42A 5FPVA 1ONAA 2B5HA 2UWAA 3ACGA 3I59A 4RSUA 1VRH3 1UYPA 1W2NA 4IUGA 4XC9A 1SHWB 1V6IA 1R091 4AGVA 4N9HA 1R092 2R072 1MQTC 4HVRA 4URTA 1O8SA 2AREA 5BNNB 4N8MA 4BCUA 4PIXA 1R1ZA 2XL7A 1FV3A 5JOWA 2GH2A 4FP2A 2VW2A 3HAGA 1JZ4A 1QXJA 1JODA 4YLZA 5DZEA 2ZABA 3K75B 3ZVXA 3MIGA 3VBOB 1FATA 1SCSA 1PO21 4Q0SA 3MIHA 5JCTA 5A6QA 2W91A 1PO22 3KCYA 3X29B 4PI0A 4W8JA 5A1FA 3AJZA 1WLWA 3VBHC 4M01A 2D6LX 3M3CA 4Q4V2 1TME2 2A6XA 2VOKA 2JDNA 2JIGA 3GYDA 1ZREA 1EAH2 1UO9A 4A4AA 4EE2A 2HLEA 2XOMA 1LESA 2CWSA 3I8TA 5CU1A 5FK7A 4YARA 2P3IA 1QXPA 1JW6A 4FPCA 3LEIA 4X6QB 1ULCA 4N53B 3RI9A 3RVHA 1HQWA 4CEYC 1DG6A 4L11A 4YFWA 2ZMNA 4CDUA 5HCHA 2JB4A 4FO9A 4P08A 4TLGA 5F8PA 3H42B 1JZ7A 4RS5B 3B00A 4XUQA 1F9KA 5KHJA 2WSUA 3HNMA 2ZHMA 3P3NA 5AFEA 5CBLA 4QPWA 3THPA 4H2AA 3MO4A 4YW3A 3JXSA 1WLTA 1VB4A 2VAUA 3GM8A 1BMV1 1BVVA 3LPFA 1EV12 3POSA 4QX7A 3ZXEA 4XJZA 2YGMA 2YG0A 1NZIA 3A23A 2R041 2R7EB 3DCQA 4LMFA 3DYPA 3ES1A 2WN3A 2WS92 3GBWA 3LOBA 2W9XA 1QDCA 1TVGA 5FYCA 5LRSA 1CAUA 2GU9A 2RV9A 3VN4A 4IV3B 1GBGA 2WZPP 4LOTA 5DZGA 3FBYA 4PDWB 5FLIA 3DUIA 2HWB3 4NO4A 2VZUA 4CDQB 4HFSA 4AEDC 4BWOA 2VVEA 1QQP1 1S2KA 3A7QA 3OY8B 3SKJE 1KDMA 4LOSA 4PBPA 4Y4RA 5C33A 4KMQA 4RHV1 2W3JA 2KM2A 4PF5A 5A6ZA 3TEXA 3OD0A 4WBBA 1O4TA 1CAWA 1Z0HA 1HDKA 2RS32 3RS6A 2ETEA 1VBD3 2C9KA 2JDMA 1V6MA 1DGRA 4K9SA 1VBC2 3HVDA 5GJ6A 4IL7A 3VKFC 1EV11 3U75A 3JBG2 4I3GA 2QNKA 4Q4X3 2PHWA 3CDZB 5DPNA 1K45A 2KA3A 3MFAA 5KHGA 3VZLA 1TEIA 4JDMA 1N3QA 2BERA 2JJ6A 3T4VA 4HVQA 3EXUA 3ZYPA 1T6BX 1VBB2 5FY4A 1WKYA 3KM5A 1GV9A 3DXTA 2LS6A 2WZ8A 5GZFA 2BEOA 3UETA 5F9TA 2FD8A 3W59A 1RGSA 1FNZA 1DCSA 4QX0A 3LD8A 1JBCA 5C5UA 4JZRA 2D98A 5FP8A 1EPZA 2ZX2A 4CDXC 3VDCA 3OBRA 1GZ9A 1VBD1 2Q1ZB 4JCKA 2BBAA 1CWPA 3TWIA 5IFTA 3AP7A 3ZFFC 5APAA 4LQRA 1NQDA 1Z7S2 5HCBA 3ME2A 5LASA 5HPOA 1H8TC 3G7DA 1HW5A 1S0GA 1U5YA 5FK8A 1UF2C 3WDYA 2OYZA 4NIIA 2DCYA 2CV6A 3CBNA 3D3AA 4Q8LA 1RITA 2X10A 3MLKA 2ENRA 1GWKA 1IGOA 4NVPA 4D6QA 3IZOA 4CDWB 2QUOA 4QXBA 1YC61 4XF4A 1ND2C 5CB7A 4URAA 1C1FA 1VIWB 1AR62 2XJUA 5ABJC 1C8NA 2NPIA 1G9DA 4WM7A 3IDAA 4XETA 1Q8QA 1ND3A 4G9SB 2A3YA 5BXXA 1PM4A 4HN0A 4M3CA 3THDA 4OMDA 3FLRA 1JYWA 1RUOA 1QKQA 2EAAA 4UF0A 3IDBB 2HEWF 2FDJA 1GP6A 1UMHA 1X9TA 3PJQA 2VO5A 2W68A 4ORFA 4RFT0 4XFFA 3VKLA 1G9BA 5A7WB 3ZFFB 4YGEA 1HIXA 4LBQD 5FXWA 1EAH3 2IWGB 3RSJA 4YG3A 5C8WA 1HB3A 3KQ4B 1OHFA 3WNNA 4P9XA 3MFCA 1RUH3 1QNWA 3O0WA 3PDQA 3S30A 4K3UA 2C24A 4YPJA 2DUOA 2VZ3A 2XDVA 4DINB 4AQ6A 2WBKA 4FAHA 3OBTA 4HXCA 3DV8A 4GH4A 4HVOA 3WDXA 1POV0 1T2XA 4B7EA 2F4PA 2ORXA 1C1LA 1TE1B 1H8VA 2MNGA 2XVGA 2Y6HA 2FCTA 1POV3 1PGW1 4Z07A 5JXHA 4C0HA 4RQPB 4LE3A 2TUNA 4CPBA 2VOWA 3ELNA 4E2SA 4EQVA 2D97A 3J8F3 5FOJB 3VGIA 4A7KA 1HN1A 2QZ3A 1HXS1 4XZUG 1K5MA 4PF1A 4ZKTB 2IUWA 4I2OA 3AYCA 4L92A 2QQVA 4CUBA 1QJX3 4COVA 2PMWB 4MHRA 5F2SA 4R9BA 2W52A 5I91A 2VBDA 1QJZA 4KL1A 1XQNA 2ARCA 3NJVA 4JRLA 4PQ9A 4XACA 1XNCA 2QE3A 3WP3A 4COWA 1H6XA 1AXYA 1DYOA 3IPVB 4QPIC 5FMDA 3KVBA 3DYMA 2R073 2BWCA 2CWMA 1F8VA 4TLFA 4XJAA 1UZVA 4CDQC 2ZGMA 3LEMA 2E7QA 3LIHA 1CN1A 2WQ4A 3OPTA 1VAKA 4CDXB 5SV5A 1BQPA 1RUI1 4NR1A 5JXIA 4MX3A 4GAZA 1FOD2 3ZPOA 1C57A 2X29A 2WAAA 4QM9A 2HYXA 2LW8A 5DXDA 3V64A 4HZFA 1TNRA 2JDHA 4I01A 3POBA 3RG0A 4PT6A 1UZYA 2WSVA 4COYA 5JIAA 3NKGA 2VQTA 1OA4A 2BYVE 1NUKA 2WFF1 3ACLA 4QQ2A 1MS1A 1UU6A 4NMIA 5IATA 2A6YA 1PK6C 3EYPA 4WVWA 1JOBA 2W87A 1JZ3A 3LB9A 1J83A 4ZU4A 3W5MA 1AYN3 3PTRB 4OULA 4NPLA 1MEC1 2DDUA 3WDTA 4Q2FA 4XJ8A 1OH4A 4JQTA 5HBAA 1CAUB 1CR7A 1QJY2 1RC6A 1V6KA 1SG3A 4UW5A 3VBUA 1PMHX 4AGRA 3VHRA 2GNTA 1Q5OA 2VQAA 4XDPA 2I74A 4AHWA 4YGDA 5EJ1B 3POEA 4KGGA 4Q4W1 5EXOA 4X8NA 3OY8A 4BH9A 4EROA 2JIJA 5A33B 1GFF2 5FY5A 3RZZA 5A1LA 1JS9A 2WNUA 1UU4A 4E4DX 4LK7A 2JE9A 3AJYA 3HBZA 1DGWX 2P3KA 5FYVA 1LODA 2A73B 4L9BA 4FFFA 1C5HA 3CLPA 1KS4A 4O9EA 2AC1A 4E8CA 4CSWA 2W0XA 2VCCA 4GJZA 1ZVFA 2IC1A 4LIVA 3GNEA 3UV9A 5GLZA 3MIFA 3VD4A 1VLNA 5CFDC 2XPJA 5FYHA 1UYYA 1V6NA 4OLLA 1UN1A 4QB6A 5CA6A 1XSRA 4JAAA 3WHUA 1AYM2 4E2GA 4CA9A 2FMDA 1AYM1 2BOIA 2YU2A 4AEDA 3VDDB 3URFA 4D8MA 1IPKA 4XVHA 1F5FA 3CJXA 3RZKA 4LO4B 2ZGSA 3PHMA 2OUJA 2LALA 2JG8A 5C9AA 3ZFEC 1X82A 3HR9A 4AQSA 1W2TA 4OCTA 2EXHA 3LDBA 1PO12 1VBE2 3AFKA 3GF6A 4FFGA 4H55A 4UI9L 4Z1VA 3VD9A 3KQRA 4NRMA 1B35B 4AF9A 5JXGA 3CMGA 5T54A 2WO3A 1VBD2 3DL3A 4MGTA 3SCFA 2B9VA 1C3HA 3SH5A 1WD3A 3L2YA 4FI9A 2UWCA 5LEJA 5GALA 4LO7A 4R9DA 4NIAA 3BTZA 5HV4A 2WO2A 4BB3A 1H6YA 3LEGA 2XJTA 1F4AA 3NMBA 1BKZA 3HN1A 3JQWA 1Z78A 3VBHB 1BZWA 2ZGQA 4BLJA 2FDKA 3J9SA 3H8RA 1JYTA 3WV6A 4AVVA 4CE8A 5EYXA 2E32A 3IMMA 2DVFA 1EPWA 3ST7A 2ZZQA 5E88A 3VBFC 5FO9B 3BI3A 4FAGA 4ZHNA 4BM8A 4XAAA 4MZUA 1RUE1 5JR2A 1FOD1 3TEYA 4O9GA 1IZ3A 3RWKX 1XE0A 3O1SA 2GN7A 1S2BA 1W8FA 3DYOA 3VHOA 5D8AB 2O0OA 4BIOA 2QQIA 2Q8DA 4L2NA 3L9JT 1W6PB 4QPIB 3J8F2 3ZYFA 1OKOA 5EP9A 3RZLA 1I9RA 4BQ2A 3APBA 1BLZA 2J1TA 2QQJA 3AKPA 2DYCA 4DY5A 3CJIA 1AR82 1RHI2 2H0VA 5A3OA 1G9CA 1REEA 5FY7A 1QIQA 1G9AA 2AR6A 1W9FA 3N36A 1S0BA 2QBXA 4DNYA 3NV4A 3ILRA 4HT1T 4YGCA 3MGUA 4IGOA 5GLVA 3SH3A 1R64A 2WL1A 4N9IA 4IE7A 1PZ7A 1W2AX 3LKJA 3POJA 2JG8C 5EQUA 1BBT1 4Z92B 1ZBA3 2BQPA 3I59B 4GALA 4Q5OA 2VMGA 4D6RA 1RXGA 3WP4A 2PHTA 2R061 2WQ8A 3ON7A 4V2VA 5FY9A 2QQWA 3SH4A 3VDDA 5GZCA 4C90A 2GP5A 3K3OA 5FYMA 2VNVA 2VTXJ 2IFWA 5FZMA 2Q30A 1LTEA 5CFDA 3T09A 1NCRC 1J3RA 1GZWB 4LO6B 4R8HA 3O7OA 2BNMA 3O0VA 2QQOA 1OUSA 4AVBA 1UKRA 2J1SA 2PHFA 4MXWA 2D93A 4H7MA 5IVYA 3W9AA 3GGLA 1GMMA 2XGXA 4TSVA 4Y1YA 1RUD3 4FT8A 1A8MA 2BWAA 2NQYA 4RR3C 2BFUL 1ZRIA 3TN91 1NA1A 1AF9A 4YSFA 4GWJA 5AC91 2WWJA 4RD7A 1WD4A 2D40A 1AYN2 3ETQA 5FPAA 3EQEA 1US3A 5T5JA 1WCQA 4AK3A 1ZZBA 4OMCA 2HWE3 4QPGA 4GZ9A 3ZSEA 3O14A 4NN0A 3THCA 2RM21 5A6XA 4WVMB 1CAVA 1OFNA 5IVBA 3WCRA 2IXKA 2D6KA 3CHXA 3AMQA 4LA2A 5FZOB 3NSTA 5EIYB 3NAPB 3A0KA 5GZDA 1ALYA 3MIDA 4RS5A 4CP0A 1QNYA 4Q29A 2VU9A 4Q4V3 2XJVA 3O1UA 1QJX2 1GP5A 4PJYA 2H6CA 1H1IA 4W6WA 3RRDA 4N43B 3WCSA 1H8TB 1W6QB 4NUBA 1JYXA 4E27A 2D3RA 4OUMA 3NW4A 1AX2A 3UGFA 3WLUA 4CU8A 4META 5CVRA 2HEYF 2BPA2 2VR4A 1W8UA 2RMU3 2A70A 2JENA 4LBKA 1C4RA 1RUJ3 1B35C 1V6JA 1PGSA 4JDNA 4G4FA 4XDOA 5A80A 3ZO0B 1O3RA 1NLQA 5LBEA 2CY6A 4CDQA 4D7YA 1HJGA 1OQDA 1OQ1A 2V73A 1O5UA 2EIEA 1COV1 3K4DA 3M1HA 4PDWA 4YVWA 5FZKA 5FO8B 1VBA1 1W3VA 2A6VA 2YPJA 1RUJ2 1SLTA 2PFWA 2CAVA 4NWWA 2WFF3 2RM22 5FP4A 4XF0A 4AAXA 4D7SA 5CFDB 2DVDA 3ZFGB 3MW2A 3ZN5A 3NNJA 1UPIA 2E9QA 3U07A 1AR73 2PAMA 2GALA 1FXZA 4M4PA 1CPMA 1VBC1 1K5JA 4DXTA 3ABZA 1CZVA 3O1MA 2FCUA 3ZMNA 1WCDJ 3ACHA 5FZAA 3ENRA 1JUIA 1IS3A 1ZA7A 3EBRA 4FPHA 2W2IA 4I09A 2ORZA 4FQZA 3N35A 1GANA 5C3OA 1JYNA 1COV3 1H2KA 3E6BA 1UYZA 1CVNA 4NHMA 1MEC2 5DDJ2 2VZSA 4LLFA 3ZSJA 4PLOA 2RJ2A 1TME3 4LLOA 1UIKA 4JGYB 1ZZ7A 5A32B 1PO11 1VBE1 1X36A 1ULDA 1HX6A 2YC2A 2Y8KA 3POIA 1M4WA 3E1F1 4Q27A 4L8QA 5IVFA 4NPMA 4FOVA 1QOTA 4JGZA 4F8AA 1G86A 2CDPA 4XTMA 5H9SA 1I3HA 1W6QA 3NNGA 3PUAA 1RUC2 4N7IA 2GMPA 4EZ4A 1LOAA 1JN2P 2D6MA 4N43A 4DS0A 3CQOA 2RS52 2VTFA 1VPHA 4FQ4A 5BNQA 1GOFA 1YYNA 2RG4A 3KT4A 3NWKA 4KWUA 4XABA 4F3JA 1SFPA 2QFEA 3KS7A 5JR7B 3NVCA 1TME1 2W1UA 4IV1A 4BQWA 1PVXA 1C8M2 1R093 2FBEA 2WS93 3VD7A 3AB0A 4ZY9A 3WR0A 4WM8A 4BQXA 1LGBA 1RUC3 2YV8A 1SFNA 3OGRA 3WZ1A 5KHKA 4Q4W2 5C9AB 4QU1A 2WZR2 4YVWB 1VBA2 5EJZB 4YWAA 2Y0IA 2GH8A 3J7MA 3LIGA 2R32A 3UYJA 1YCIA 3AZZA 1B35A 4XBQA 1UOFA 1CQ9A 1N3PA 3JB8A 3VBRC 3FHIB 4XUOA 5FP9A 1NG0A 1H8TA 4XDQA 2FZ1A 2Y6FA 4LKFA 2B39A 2W5FA 3IMNA 3RFRA 5FZHA 4Q4W3 1YJKA 2VMDA 2ZXQA 2XWBB 1L7LA 3OCPA 4NHLA 1SMVA 3U4XA 1V9U1 3LOIA 1QJFA 5EJ3A 4A41A 2BBVA 3RJRA 5J09A 1GNYA 1RUC1 4HKLA 2VZ1A 1MVEA 3AM2A 5CZKA 3OF1A 4QGNA 5JSPA 4XW3A 1S0DA 2PHDA 3A21A 3J7NA 3GCXA 3GZEA 3RI8A 1ND3B 4QPGC 3AP9A 2HWC1 3QOPA 1QH7A 4BK5A 2R6QA 4MGSA 3VUOA 4MUVA 4JGYA 2UYAA 1AL0G 5KC6A 4IESA 1FMD3 1XNDA 4RQPA 3ZFEB 2FHRA 4RR3A 3ZSMA 3ZOIA 3K48A 2OW4A 4FPGA 2J1VA 2ZAHA 3ZM8A 1A78A 1RUF1 1CJPA 2Y33A 3LSEA 2IZWA 2E31A 2FCVA 4PIYA 1AR91 2A7AA 2AUYA 3PLQA 2RMU2 1A8DA 4XZPA 1F15A 2WO1A 4CXWA 4AW7A 1YRZA 3I3DA 2PHLA 1VJ2A 4M3CE 4YYOA 1JZ5A 1DIWA 5A32A 1L7RA 4LITA 5JWPA 1JMUB 2ZPXA 1GWLA 3FE5A 2FMYA 1D4M3 3MYXA 2MEV2 5JMOA 1JYIA 5IK7A 4BPZA 2VUCA 1JYVA 4CCJA 5JIUA 2EVXA 1UMZA 3FUQA 5FZCA 2R062 2RDSA 1DLCA 3ZYRA 5EV7A 1VMJA 1QJU3 1OD3A 2A1XA 4IQPA 1AL21 1N1YA 4GJYA 1AR63 2N7GA 1FOD3 4CYDA 1AL22 3OGSA 3SCGA 3CJIC 1AR72 2EXKA 3CIHA 1A34A 2VVFA 3AKQA 4Y5TA 5CKMA 1KITA 1LENA 4IV1C 2DUQA 2WUHA 2DCZA 3FHAA 4ZONA 1W6OB 2YC4A 2Z69A 3IPVA 5BNOB 2ARBA 2HH9A 1QU0A 5FMCA 1ENXA 2BU9A 2OVUA 4AI1A 1UIJA 4KWLA 3WSOA 2SBAA 4NIHA 4M00A 1NT0A 5I0TA 3RYRA 3RDIA 1RUH1 1DQ5A 3AP5A 4IEXA 4QD2A 1ZRRA 2HWE2 4QXKA 3N7LA 4OI4A 4S2HA 1RVF2 2HWC2 3U1XA 3VD3A 5K7PA 3QCWA 4YW7A 4Q4Y1 2ZX0A 4XUTA 1LOFC 2F17A 1N1SA 1ZM1A 1AR61 4RN5A 3POFA 1HB1A 1L3JA 3WW1A 3UL2A 1U12A 3SXWA 1YQ5A 2QCSB 4O61A 2A6WA 4UF0B 3LEKA 3R05A 3LPGA 5FY0A 3ZR6A 5A3UA 1GKBA 5BNPA 3HIFA 3T2PA 1LGNA 1FPN3 1ENSA 3R4UA 1CZSA 4FXKB 4LHNA 1IQAA 3H0OA 3B7MA 4P9LA 4BMEA 4LUMA 4FBFA 2J1EA 3QACA 3VZMA 4RGAA 2ZHNA 3I49A 2QDRA 1MQTA 4XFGA 3TNQA 1PVC2 4M4RA 2LUWA 5DDJ1 4AEDB 3BUCA 4UFLA 3WVJA 4LEJA 3O1TA 4YZ3A 5F32A 3PL0A 3NJZA 3ZIWA 3SCHA 4WVMA 1J84A 3BTAA 2TEPA 3KV6A 4EJRA 2R071 1MS4A 4XQWA 3VDAA 3I3QA 1LNSA 3KV9A 5A3LA 2C9AA 3HQRA 3AZVA 4UFKA 2HWE1 4X8PA 1XBFA 2AZ5A 1DQ0A 4UXAA 1YWKA 2RM23 3AMNA 3D0SA 4AE2A 4AVSA 1QJEA 4FSJA 3AXEA 2PYTA 2ZKNA 4M3CF 5A7SA 5IVVA 2WC2A 1HXS2 1GLHA 3A4UA 1Y3TA 4HN1A 3KGZA 5T50A 4QDSA 1LB2A 2I07B 5CFCB 4IEZA 5FMOS 4L97A 4W4ZA 1BHGA 1KGYA 5FQ0B 4RA0A 3WT3A 1LU1A 2V72A 3TRSB 3J26N 4B8EA 3FBMA 1J59A 2C4XA 2WO7A 3L2HA 5F5AA 4B3NA 5C3RA 5JLVA 1GP4A 1C8M1 1KD7A 2DVAA 3O0XA 4D3WA 5C8CB 4RL7A 5IWFA 4WVZA 5D8AC 1DYPA 3IDCB 1MEC3 3SMHA 4K21A 3ZLIA 2DVGA 1QH6A 4H7LA 5C5TA 5CAZA 5BY5A 5L7OA 5I93A 3GJAA 4XILA 4CTEA 1O6UA 1WCKA 3WOGA 4Q0QA 3MPBA 4IEOA 1OFSA 1ENRA 2W1WA 1GNZA 5L7OC 4XFCA 2SLIA 4QM8A 5FV3A 2WNVC 1NKGA 2WA3A 4MSVA 2GC3A 3ZSKA 4XCBA 2VNRA 5C3PA 3AKTA 1PM7A 4AVTA 3KB5A 2WS91 3I2JA 4W50A 3PIJA 1WCSA 2BGCA 2E7TA 4UBGA 5A7QA 5LK7B 1UNBA 2A5ZA 3TN93 1IPSA 1HB4A 4XQ4A 4YFZA 4COUA 1W9SA 2OQ7A 4UT5A 3ZXKA 2WZR3 2HJIA 1WMEA 4SBVA 2OA2A 4S2GA 1ODMA 3TOJA 1W2OA 3ZX7A 4DO0A 3E6CC 2NP0A 4AAPA 2WABA 3MV11 4KWJA 3W21A 5ISLA 3I3MA 2Y6GA 1X8MA 4MGQA 1Q8SA 2C5DA 1QQP2 2XXZA 2OXBA 3P3PA 5A7OA 1PGL2 5CG9A 1ULEA 3IBMA 4C91A 1D0GA 2VGDA 3MLJA 3ITQA 4YVSB 4DIQA 2B7YA 2XUEA 2Q8OA 3IAPA 2WT0A 4NROA 3M4FA 5A3MA 1RMU1 2JXAA 1WZXA 1PO13 1VBE3 3DPRB 4AHYA 5L9RA 5FZ8A 4COZA 5IFPA 4CCEA 4MLOA 4O65A 4NPRA 2X09A 4IE5A 3NQHA 3MIBA 4ISRA 1OPOA 2A6ZA 3IN9A 5FYYA 5F6KA 1F2NA 4FFIA 3ZDVA 4P9WA 4XMAA 3LFIA 4ZZ8A 5JSOA 3ZN6A 4DUVA 5IYYA 3B9CA 3NRUA 5KXBA 1BBT2 5E8AA 2YFUA 3PNAA 1OF3A 4GH4C 2D3PA 1XYOA 4A3XA 2JWPA 3DECA 4K8FA 3AZXA 2WIIB 3N7MA 1S0IA 1CJDA 4DB5A 3WNMA 5FJKA 2Q8CA 3LWCA 4UFIA 4ZU5A 3WY6A 4YZ5A 3I7DA 2J1UA 3MF9A 4QKFA 5FYSA 2XBO1 5G05L 1FX5A 2QQKA 5C4WC 5FUPA 1C5IA 3ECQA 1NOVA 3TYJA 4IV3C 3K2OA 3VZOA 5J48A 1DZRA 1PK6B 2E6VA 5KHIA 2E33A 2WWUA 2DCKA 1Q43A 4AR2A 5DAQA 3KV5A 5BNOA 3KZ4C 3FMGA 1SBDA 4J25A 5LBBA 5FYIA 2RVAA 2PXJA 5AFBA 3WNOA 2HWB2 2VZRA 2E7AA 5GZGA 3MF6A 4QKBA 1RB8G 1HN0A 1YFXA 4OI2A 5M0TA 5C4WB 4Q4Y2 2RS11 3V56A 3S0MA 5I0SA 1OH3A 2V4AA 2BJSA 4CP9B 1GOGA 4JHTA 5ANNA 2WA4A 2V5YA 3IAQA 2D6OX 3OB8A 4HPKB 4CEYB 3H1WA 5C9AC 5B4XA 1DGLA 2AH2A 1D7PM 1OOPA 3H8OA 4DUWA 4HK8A 2FDGA 5BNPB 3JD72 3LCPA 1ZBE1 1GQHA 1OPMA 3JZVA 3M70A 4NAOA 3T2TA 2WT2A 2XMLA 4TWTA 3WXPA 1E5RA 3ZSLA 4RGGA 1NCRB 3JBG3 1NYWA 2ZTNA 1QOOA 3EJKA 3M3IA 1W3XA 3B94A 3MZHA 5AC93 5ACA2 3HQUA 2X53S 2ES3A 4FTBA 1WLDA 3HD8B 4HETA 3SHRA 3VBOC 4Q0UA 2P6CA 3VD5A 3WW2A 1W8OA 4AI8A 4AZZA 4P9IA 1XNBA 1PGL1 4Z8BA 5D1IA 1COV2 1YQ6A 2WNUC 2IFRA 4J6GA 4Q4X1 1LU2A 3ILFA 5FREA 1UY0A 3RQ0A 4Q1PA 1IQDC 1R1A2 2PAEA 2XKPA 3HNYM 3C7EA 3MDPA 2Z5WA 3ZXLA 4QB1A 3ZXAC 1HRV2 1TMF1 1UKGA 1UX7A 1REDA 1WA6X 4JGZB 4QQPA 3PVEA 1ZBE3 3KGLA 3ZXDA 4AFAA 2B8MA 3K46A 3PUIA 3B01A 3IWZA 2ZX3A 4M0NA 1HRI3 5C70A 3BU0A 1LOGA 4AEJA 5EPAA 3LGRA 4E4SA 3ZYBA 4ASKA 1RUE2 2RJLA 2G9ZA 2O8QA 1FT9A 2CHHA 5F5CA 3V0AB 2B4KA 4S2DA 4F83A 3S57A 1XE8A 2W92A 4JTNA 1POV1 4IEVA 1WCUA 4UBHA 4ZS3A 2D6NA 1OI6A 4D7TA 1RUJ1 1OOPC 4N90A 1HRI2 4GMP1 4BJ0A 1QOSA 3KMHA 3C7FA 4QQLA 5FZLA 4IEWA 1Y9GA 3BGAA 4Y5SA 4D94A 5FZBA 1QEXA 3R4SA 4GB32 1X8EA 1W06A 4QX8A 5FP3A 5FY8A 2QQUA 2CGOA 4LHSA 4NHKA 5CKQA 2ZEYA 4YW1A 3VBRA 3WD5A 2DF7A 1SCRA 4IERA 1HKDA 1BK0A 4RYDA 2PA7A 3S6PA 2C1FA 4IEPA 1BEV1 1QGLA 1SBFA 5FZ9A 3WP5A 3KWVA 5T5PA 3RWNA 2E26A 1R1A1 1UXXX 2UY9A 3N9PA 1DYKA 3USUB 2CTVA 3Q8AA 4INDA 4C8DA 3JD71 4BDVB 5FYUA 5FOBB 3LDRA 2LTNA 4GMP0 3SISA 5BNOC 1CD3G 4P5HA 5HXMA 3M2MA 2GNBA 3PU3A 3DEMA 1W9YA 3HBKA 3AP6A 2VC9A 1F4HA 2B42B 2QZ2A 5IW0A 5C4WA 5FWJA 1LCLA 5T5LA 2ATFA 4MV2A 5E6HA 1T6GC 4XXAA 2BVBA 2H0BA 1XE7A 2VZOA 2JB8A 4LKDA 4XF1A 3UK9A 1S0JA 3WNLA 4A44A 3OBZA 4UOJA 1X33A 3AKSA 1KS5A 1OF4A 3WQ0A 4UW4A 2WNUB 4MGIE 4ATFA 4IEUA 5G04L 4AFBA 5D2AA 3FFQA 4EWAA 1NE6A 3POYA 2RMU1 1JOJA 4K8RB 2VUJA 4ES8A 2XWJB 2VCAA 2WWSA 3I3EA 3GBFA 5K8SA 2V09A 4CUGA 5FY1A 2B9UA 5DUXA 4ARYA 5FJHA 4B4RA 1NCQC 3R0RA 2IXCA 1WW6A 3OJBA 2Y6LA 1J1TA 1FAYA 3NKTA 2VECA 5B2GB 1DP0A 5JPNB 4LHKA 4Q1RA 4Y22B 1AZDA 3HT1A 1RMU3 4JV4A 3I2DA 2VVDA 1FNYA 2IVIB 4AGGA 2Q5TA 5DUWA 3I2FA 2YBSA 3WEZA 1LEMA 1PMIA 3NNFA 2ZHKA 2P5BA 5F3GA 1MR5A 5SV8A 4XHBA 1RUI3 3RZJA 2UY8A 2CAUA 2Z79A 1D4M2 5A1AA 3HWJA 2JG9C 2DU1A 2DV9A 3S5AA 2QVSB 4E8DA 5A7PA 1RJ7A 3B5LB 2YZ4A 5JDBA 5CKNA 2YDEA 2W1QA 3ZXFA 5IJRA 1JU3A 1NE4A 1SLIA 1ULPA 3CL1A 1QJY3 2NN8A 3S5QA 5FPZA 4KBBA 1XNAA 1S0EA 2HWD3 4OHWA 4Q8KA 4LT5A 3I2KA 2NM1A 4CPBD 3U78A 4WZCA 1U5ZA 2OZ6A 5LATA 3S7IA 1US2A 2WZR1 4OHVA 4LTAA 3AVSA 1BVP1 2WINB 4V1PA 2ZGRA 5JOYA 1YI7A 2BOJA 1S0FA 3H1MA 1WGPA 1W6PA 1NAEA 3KF5A 4MADA 5AC92 2NLRA 4QXCA 4CCCA 5IVEA 3UJQA 3ILNA 4CU6A 3H3LA 3JU9A 3RZHA 3ZMOA 3LFMA 5KXEA 2IXLA 3UNPA 3GHNA 5LEKA 2AEYA 1H2MA 1NLRA 4EN6B 4I3PA 1RUE3 2BZDA 1QY4A 5T3NA 3ACFA 2RS13 3FHQA 1D2QA 3LA3A 4MYEA 5HV0A 2WN2A 2VOTA 3WDVA 4BMBA 3KLSA 5JI9A 4LR4A 2QQLA 4HK9A 1OLRA 4HKWA 1DQ2A 1W0PA 1MQTB 1ULGA 1DGWA 4XAEA 4AEKA 4ZZ5A 5BNNC 5JOXA 3TEZA 3ZKYA 4XBLA 4XPVA 1SFYA 2R0FA 3BN6A 1O59A 3HQXA 2Y0OA 3AMPA 3INAA 2JE8A 2ZCWA 3ZYGA 3I2HA 3LE0A 4AYUA 4EZHA 5LRRA 1IG0A 1ZZCA 2EICA 3B69A 4HBNA 1LHOA 3I54A 3P5BA 4RFRB 3RMYA 3FC0A 1G7YA 2GSYA 1N3OA 3DN7A 1PHMA 4AFCA 1QJU1 5FZ7A 2W39A 5KR7A 1NCQA 3D4KA 1NA1B 1W8WA 4NE9A 2ZACA 4QMAA 1CAXA 2D43A 2X05A 3CNAA 4MGYE 5GZEA 3WW3A 4AHXA 5I0RA 5I0DA 4PBOA 3ZDSA 2QJVA 3PUQA 4J1WA 2JDUA 5K9YA 2D7FA 5IK5A 3MUZ1 4FPKA 3VBSC 1NXD1 3A0NA 4Y22A 1FYUA 2VH9A 2LROA 3H50A 4J1XA 3PUSA 5T55A 1BYHA 1GZTA 4GB31 5L7OB 5FKBA 1E5IA 1MS5A 2WKKA 1GSLA 3MV01 4GKXA 1OSGA 1DQ1A 2RS53 3PVNA 3ORJA 2NMNA 5A3NA 1N47A 1JYCA 2R042 3K3NA 1CPNA 2QTWB 2XLFA 3VBRB 1REFA 1WW5A 1O8PA 3H9AA 3K77A 1HRV3 4CDUC 3NNLA 5BYNA 5IAXA 1UCXA 1XYPA 2R1BA 2ZX4A 4B1LA 1AR83 1RHI3 2XR4A 4LJHA 1H4GA 3VBFA 3OEAA 2ZGUA 1LAJA 1H1AA 2GMEA 3DF0A 4LUKA 2DFCA 2G9FA 5J1XA 3SKVA 1O3QA 4A3ZA 4EN9B 1BJQA 4GMP3 1UY1A 1WLCA 5F5QA 5FPBA 2ZBJA 4JRAA 5FTTC 2XLAA 2P6HA 5KHHA 5JZGC 5FAXA 1AUYA 1PIV1 5LCWL 1HLCA 3I2GA 4GXLA 4EN7B 5F37A 1KEXA 4MVTA 4QX3A 5FZ3A 3BB6A 3POGA 4Q4V1 4RHV2 1YQ2A 1SLBA 4M0HA 5FP7A 3PJYA 1UU5A 2ZJCA 1BEV3 2RDQA 2VBPA 3PMEA 1PVC3 3AC0A 5LBCA 2VNOA 2XJQA 3WG3A 1AL23 4QQOA 5CEHA 1UAIA 3LZZA 1Q8VA 4Y20B 3N3HA 1RUF2 1WW7A 1W8ZA 3WQBA 4AQTA 3BOPA 2AGSA 3UKNA 4QKNA 2O1QA 1ODNA 4YVSA 1HQLA 3ZFEA 1OLME 1DLLA 4Y4YA 1K3IA 1UY3A 5FYZA 1XNTA 2W08A 4UFJA 1LHUA 3NO8A 1YEWA 4K1ZA 2EIGA 3LA2A 3CJIB 4AVCA 2KR2A 1TZOA 2DFBA 3DPRA 4LBLA 1OLMA 2XKOA 5H9QA 3NL1A 3QH6A 4C1XA 4XUNA 4CUCA 5FXXA 1ZYBA 1VBB1 2X5IC 2YHJA 4GQ7A 1SACA 4LORA 4DEVA 2GC0A 3FL7A 4FP3A 3OUIA 1H30A 4HONA 4YZ2A 1RUD1 1PVC1 5DAWA 2HBTA 4Y33A 3OG2A 5FUIA 4K40A 2XJSA 4OQ8A 4XFIA 2YFZA 1EYBA 2OPKA 1ZZ6A 3MIEA 3UJOA 4GD4A 4IE6A 4XJWA 2JDAA 1AR71 5J96B 1AX1A 2D5FA 5GLWA 3VKNA 3RZGA 2VY0A 4IETA 2XBO2 1FPN2 2RJKA 1K5MB 4GWMA 4DQAA 1FPN1 1ZRCA 2ADEA 1LGCA 2DURA 3VBOA 3DPRC 2MEV3 5FIXA 2EXIA 2D3SA 5DN2A 3E5UA 3BIEA 1MACA 1W05A 4EN8B 2CU5A 3LF7A 3ZYIB 2ZGNA 5FQ0A 1UMIA 4YVSC 1QHDA 1RVF1 2DCJA 2ZS6B 1PK6A 1W99A 1RIRA 2WQZC 1S2EA 5C6CA 4D6SA 3BU7A 5LA1A 3G6JB 2P3YA 3T4HB 4DY3A 3VZJA 4H3WA 4UW6A 3CO2A 4CRQA 3HNBM 1CGPA 2RDNA 3TNPB 2A71A 1M06G 1LKNA 3P6BA 5FZOA 2VULA 3I3BA 5I8SA 1HXS3 4LXLA 4AVAA 2OS2A 4YW6A 2A3XA 1ASJ1 2Q4SA 4LBQB 1TG7A 3MW3A 1H1MA 1KJRA 1ND2B 2I2SA 3VBFB 1Y9MA 5HCAA 5LZ6A 2ZGLA 4CXXA 5C71A 1JOPA 1W0OA 1CZTA 5T52A 1V9U2 3I2IA 4AI0A 5F6LB 4DMIA 1MS3A 2Q1MA 4LO8A 1CIWA 1GOHA 2VQUA 4WZFA 3WQ7A 2O14A 2ZGPA 1HB2A 2PHXA 3WNXA 3OGGA 4BLIA 5IT6A 1PX4A 1UY2A 2NMOA 4LE4A 2F6BA 4IV3A 4OZOA 4DRRA 1VALA 4ZXEA 2Q8EA 4CCKA 1TQ5A 4C0BA 3JQXA 2OX0A 3HJRA 5IVCA 1AVBA 1PMJX 1WWYA 1IPJA 1W6NB 3I97A 3JB4C 1EUUA 5JI7A 3VBUB 5ACA3 4YM3A 4FTSA 3LDKA 2V4VA 4BXFA 3RGBA 3E5XA 2WNOA 4FPFA 3MBWA 4OHXA 4XF3A 4XHXA 1SPPA 5LY2A 2R043 2K2SA 3TBDA 2YYOA 3PVBB 2GNMA 3QD6A 3F95A 3NJXA 4L99A 1UZ0A 5EZWA 3ZFGA 4W65A 2HWF3 4W6XA 3H7JA 5A33A 1MS0A 4JX0A 4DXZA 5A7WA 2V5DA 2JDZA 5FBJA 4DPNA 4FCAA 4U36A 3VKMA 2ZGTA 4BQYA 4GULA 1ZBE2 2EALA 5DUUA 1BCXA 3OBAA 1H2NA 2BDRA 2HWB1 2VL4A 5JXJA 3AKRA 2PTMA 2P4EA 4YW5A 3V0AA 5FLHA 3R6SA 3U14A 4AOCA 4LPLA 5CG8A 1XYNA 1VRBA 2BRTA 2ILMA 3TAYA 1SQ4A 1QQP3 3ZXGA 5KXDA 2ID4A 5ACA1 4KU7A 2P2KA 3AYAA 2Y38A 2YGLA 4IEYA 4MG2A 1FMD1 1YLLA 3C3VA 2DBNA 2IXHA 5BNNA 1XU1A 4V2WA 2VMCA 1DF0A 4FPJA 3JCIA 3NAPA 3OSDA 5FBZA 3GJBA 4PLMA 3B9IA 1Q56A 1JXNA 2O8OA 3OYWB 5J7MA 1MPXA 1RUF3 1CX4A 3D6EA 4JQRA 2X8KA 4Z82A 3AL5A 4YVWC 4AXOA 5IVJA 2BV4A 1I5PA 4YM2A 2VUAA 2CDOA 5E16A 2CGNA 2VMIA 4GWIA 1VR3A 3M3OA 2IVJA 1RTVA 5GM0A 1KQRA 3MICA 5I8YA 3WG4A 2P34A 4A2UA 3WHTA 2AEZA 1BK1A 1SZBA 1WBFA 1JUHA 4W6YA 5LA9A 1O5LA 3HN3A 1OKQA 2YU1A 4XIKA 3OTFA 2BTVC 3T0BA 1APNA 2PLV1 4OHZA 4UWDA 4WM8B 1HRV1 1TMF2 4I0BA 3KF3A 2BNNA 4CDXA 5LB6A 3GHMA 3V0BB 1LECA 2PQQA 2VCBA 1VE0A 2GC1A 2R16A 2CSGA 1SPPB 3EMRA 4RS5C 4CP9A 1ZZ8A 3PU8A 1FMD2 2ZMLA 5JSRA 3BTXA 4N53C 3AMHA 5LBFA 3DKWA 1TMF3 4YGBA 5FZ6A 4JC1A 2WR9A 1STMA 4PHZA 4A45A 1EY2A 2BFUS 1YIPA 5LWBA 4DFSA 3E97A 1XJAA 1JZ8A 2EIBA 1AX0A 3DGTA 1HRI1 2JKBA 3FZ3A 4LKEA 4Y5Z0 1SDDB 4Q4Y3 3BPZA 4AFMA 3M3QA 3NAPC 1AJOA 3D5OA 4CU9A 5IAVA 1UYXA 5C7GA 1XU2A 4LHLA 5A7NA 2Q0AA 4XE9A 4KI5M 5AVAA 3TEWA 2VW0A 1UW8A 2L9LA 4BYYA 5FFOC 1KXGA 1QMJA 4HANA 1Q8PA 3CU7A 2ZEZA 2IXIA 4ONUA 3OUJA 4ZXKA 4D0QA 3ASIA 1H4HA 2TNFA 3OGVA 3UESA 2XVKA 2R0HA 1LOBA 1G9FA 3B02A 1MZFA 1V6LA 4GB33 3RNSA 1J58A 4RR3B 1O3SA 4NHYA 5CFCA 2RS51 3ZR5A 3H1YA 2VXJA 2WFPA 4GA9A 5DG1A 1O7FA 1GYKA 1UL9A 4R9AA 5FCCA 2NYYA 5FZGA 4CXYA 1Y4WA 2I45A 1Y9QA 2VXRA 4PLNA 1RJ8A 1X7NA 5J36A 3BCWA 1JHNA 1BBT3 1D0HA 3GZTB 3WUDA 1PIV2 5K0UA 2ZA9A 4BQ1A 4B4QA 2JDYA 5K4LA 4CCMA 5LY1A 3AYEA 5F5IA 5H9RA 1POQA 2YB7A 1ZZ9A 4BHPA 3ZIXA 4CEWA 2ZX1A 3J8F1 3BPSA 4CVUA 2G19A 1W8TA 3OYWA 2XQXA 4P9GA 1NXMA 1ST8A 1O91A 2RDRA 1J1LA 5ABJB 1PIV3 2EIDA 1OBNA 2W46A 4I30A 1LHVA 3T3YA 1Y7BA 3V0BA 1SLAA 3UGHA 1WA4A 2G9GA 2W47A 3HOBA 4Y24A 3ES4A 3VLBB 5DAPA 2Y26A 1WW4A 3W58A 1YIFA 2HWD2 5TSWA 1OOPB 2DTWA 1R083 2XB6C 2Z2SB 5E1RA 1YXWA 3J7LA 1W9WA 4Q0PA 2WYSA 5FZIA 3T1MA 1NLSA 4EWDA 4CCLA 1ENQA 1Z7S1 3IKWA 3VB9A 5LW9A 3VBHA 3O1PA 3IIAA 1LHNA 1UQXA 1WBLA 4JTOA 4EYUA 3H3ZA 3AMMA 4Y1UA 2WLPA 1JH5A 2P37A 2J22A 2OPWA 2GN3A 2VOXA 1URXA 3GALA 1XOYA 1UOJA 2PHRA 2WLQA 2KD7A 1PZ8A 3OOXA 5EWSA 4XURA 2P3JA 3H8UA 1U5XA 1YJLA 4HMZA 4Y1ZA 4IDZA 4Z2AA 1SDWA 4WM7B 1QJU2 5JMCA 3QH7A 2BVVA 1RMU2 4R4XA 2F4LA 1W8HA 2GMMA 3JD73 4UYBA 5KXCA 1AYN1 2ARXA 4GWNA 1AR92 2C6SA 2ZHLA 1H9WA 5DMYA 1WMDA 2XVLA 2RS31 2JX9A 5L19A 4ATEA 3ROUA 1XB9A 4I0AA 3U10A 3GZUC 3ALQA 2RR12 4CU7A 4MHUA 4JGYC 4Q0VA 1IKPA 4QX2A 3O12A 3QLQA 1WMFA 1XSQA 2EA7A 3C8XA 5A3WA 2VJXA 4Q4X2 3FLPA 5FWEA 2QQPA 1RVF3 5FZEA 2CYFA 4CP2A 2VPVA 1W6MA 4XOGA 3WDWA 1UXZA 2YY1A 4QU2A 4MGZE 2BW8A 5L9VA 4AEMA 4BQ5A 3O1OA 4G3YC 1F31A 1DQ6A 4FOYA 4XYXA 1OQEA 3JUUA 3AZWA 1L7QA 2X5IA 5F39A 2W1SA 4D69A 4TTGA 4FPEA 2W94A 4P5YA 1D2SA 2VE1A 1IG3A 4BQ3A 2HWF2 1WUVA 2WZEA 1MVQA 2XQRA 3J7HA 3D82A 5EHDA 3USUA 1CIYA 2FQPA 3PUHA 3RYPA 5CNAA 4CDWC 2ZKLA 4YW4A 1W6OA 4ZU7A 2AENA 5JAXA 3MUY1 2PQSA 2ERFA 2Z42A 1QF3A 2VG9A 2HBUA 1OT5A 1N1VA 1WMXA 1VRH1 1YNAA 3MW4A 5DAVA 5C8CA 5IHRA 3O1RA 1LEDA 2RHPA 4BXSV 1KFXL 2DUPA 1Q3EA 1EP0A 2AACA 1G8WA 3WF0A 2YPDA 3KCXA 5F2WA 2P1BA 4TZDA 1LJ7A 4CCNA 5JZGA 4KQ7A 4KNCA 4GIQA 2K46A 2QDNA 1RUI2 2WRAA 3VDBA 2WJSA 5FDBA 2D44A 3WNKA 3WG2A 4QKDA 4FPYA 1GU3A 4QHOA 3BALA 4HPKA 4WM8C 4FOQA 4N43C 4RHV3 5DAXA 4P02B 1Y43B 3WF3A 2FDHA 2DBIA 5IUQA 1OXCA 1JU4A 2JG9B 2XUMA 2J1AA 4XFBA 3U4SA 4JHZA 1DFQA 1NQJA 2D6PA 2HWF1 3KHCA 1SLCA 4UFHA 4AI9A 2OQ6A 2ZAAA 3OEBA 3PIGA 4XIOA 1UX6A 2ADDA 3WF1A 3N9QA 4CEWC 2JECA 2DTYA 4U2AA 4Y20A 4E4ZA 4XXPA 4QWNA 3VBSA 3SEPA 2A75A 3TB0A 1RL3A 1BXHA 2NZ9A 2VZVA 4FFHA 1H0BA 1RUH2 1AXKA 1YI9A 2LM3A 2Z4FA 3BYWA 3M8LA 3N7KA 4MOAA 5E89A 1I6XA 4E2QA 1YHFA 1W90A 5FZFA 3LQCA 2G4IA 3OPZA 4YZ1A 1OA3A 4MH0E 1OVSA 2DWRA 2R49A 2VMEA 1PX3A 2G1MA 3Q8EA 2J7MA 4R4ZA 2DU0A 4QHBA 5CFCC 1IHMA 4A6SA 1HV0A 3VKOA 3WF2A 3K4ZA 4FTEA 1ZRDA 4YW2A 1KJLA 3ETPA 4JDOA 4R9CA 4QT6A 3IT8A 5J3UA 5FYTA 1MZ5A 1J3PA 1VRH2 2TBVA 2XBO3 4NJ4A 4QHZA 4IEQA 4HG6B 1UWWA 1IKQA 1LOCA 1CAVB 3NV2A 1UOGA 4NIDA 1A3KA 3SLIA 3GZAA 1ASJ2 2E51A 4QX1A 2HKXA 4Z2WA 3WUCA 5F3CA 5JUVA 5FPLA 5JZGB 4R52A 4XFAA 3CF6E 2VCMA 4TXWA 1H9PA 2A3WA 3ATGA 4XFHA 3SITA 5ABJA 1BEV2 1H2LA 2HYKA 3HEIA 3RJ2X 3AL6A 5EYYA 1P8JA 4PI2A 1OC1A 3HPNA 1AR93 1PGW2 1YQ8A 3AX4A 4BK4A 3RZMA 3FX3A 2LRPA 1XPWA 5C8CC 2VUDA 3N4MA 3N9LA 2BNOA 1MZ6A 1O4YA 3I4IA 4XEZA 5CYYA 5K0UB 3B93A 3ZYJB 2ET7A 4Y26A 3N9NA 1V6OA 5EFUA 3C7OA 1YFYA 5HXVA 5ANQA 4MXVA 5GLTA 4CDWA 3I2OA 1XXNA 3BODA 2C26A 3F2ZA 5C3SA 5KBFA 2YUEA 3JBG1 4AL9A 1UPSA 1XRUA 1F5JA 4QDRA 4ITCA 3VBSB 1HQNA 5DZFA 1W6NA 3C7GA 2HEVF 3SQOA 4EWEA 2C0ZA 2K0GA 2Y6JA 4K7JA 4FPLA 2WDBA 4YG6A 1Z7S3 2E53A 4K1YA 4LO5B 3K4AA 1NA1C 4UW3A 2DVBA 2VMFA 2JICA 3R4DB 1R082 2YBPA 2Y64A 4KBZA 4GKYA 5JOZA 3K51A 2D5HA 2MEV1 5I8TA 4OVEA 1YO8A 3CZUA 2Y60A 4QAWA 3POWA 2Y6KA 4HKOA 3LA7A 1VB2A 3WF4A 4TYSA 1X9PA 5CIRA 1RUNA 1E5HA 2EAKA 3T30A 3VDDC 5L73A 4E4HA 1IS4A 2XLGA 5A70A 4ASMB 4CEWB 5KC5A 4AI2A 1I5ZA 1S55A 4BA6A 4DXRA 5CISA 5JPMB 4BOWA 1O3TA 2EF6A 5L9BA 2BUKA 1VBC3 1HJFA 2BP6A 3N7JA 1UY4A 2DCTA 3BVCA 1B09A 3UKVA 2RS33 1QXRA 4NRPA 4DOUA 3C2UA 4ASLA 1IS5A 2Q1FA 1GZCA 4LBMA 1GWMA 2EXJA 1NZCA 1VBB3 1RUG1 3B3QE 5BV6A 3CEWA 1VP6A 3ZPYA 2P17A 5F1RA 5A6YA 2OZJA 5BNPC 3ZKUA 4YNIA 4CCDA 3TN92 5DDJ3 2WT1A 1LHWA 1S0CA 3NV1A 4BU2A 1ZRFA 5FZ4A 1ACCA 2VW1A 2ET1A 4FOWA 4FVVA 4IV1B 1FV2A 1LOFA 2MHFA 1A6CA 1W28A 1GQGA 1MZEA 3Q8FA 1VAVA 2GAUA 3KV4A 4LK6A 5FZ1A 4CZSA 3RPQA 4ZPIA 1GQPA 1W6MB 3C7HA 2B45X 3D8CA 4X6RB 4JKLA 4AI3A 1AHSA 1UD1A 4LIUA 5A3PA 3PTYA 5AVPA 1KFUL 2VBBA 2ZEWA 1EUTA 4CEYA 2VOVA 5LK5A 5DABA 3H8XA 1QJX1 3MI8A 2WNVB 4DEQA 4NHXA 4OI0A 1UZZA 1V70A 1V00A 3M3EA 4QX5A 4XMIA 1C8M3 3N9OA 4MO3M 4AG4A 2R30A 5J98B 5K0UC 4CP1A 1F35A 4KU8A 5FPXA 3EO6A 4LBOA 2JEMA 1K42A 2WYFA 3IIIA 5F3IA 4BIFA 3H3UA 5FXZA 4AWDA 1GICA 1J3QA 4DRVA 5B4NA 1ASJ3 3U0ZA 4QXHA 3IB3A 1AYM3 4GH4B 5I0UA 1G6NA 2JD9A 2J42A 4P9JA 3W20A 5KWRA 5A3TA 1NX9A 5C3QA 2JDKA 2VZQA 1YQCA 1I1EA 3USSA 1V9U3 1W8NA 4N7UA 1ZX5A 2XL9A 5FLJA 4B29A 1W04A 3FN9A 3GDBA 3KVAA 5JVVA 4JKMA 3W5NA 3U37A 1ULFA 2PN5A 3BIWE 4XCAA 5BUVA 1SEFA 3EHKA 1E57A 3KD4A 3KT1A 3OD4A 4KGQA 4LKSA 3OPWA 3Q8CA 2XJRA 3THTA 3S7EA 4EV0A 4OFGA 3Q9OA 2RE9A 1OLQA 5FPUA 4AFDA 4K6BA 2PLV2 4RQPC 4AHZA 3AXDA 3SEEA 5FZDA 5HCFA 1PNFA 2ZGOA 2OKXA 3T2QA 2HWC3 1RUD2 3ZYHA 2VMHA 4I02A 4OHYA 2VZPA 4WVVA 1PO23 4KH9A 2CGPA 4QDQA 4XQDA 3UT0A 1LR5A 3WINE 3WDUA 1AXZA 2VZTA 3VHPA 3IM0A 3FUOA 4YRDA 3DXUA 4SLIA 3VBUC 1QWRA 2XJPA 2J1RA 4N53A 3O1VA 2PLV3 2GC2A 4QGLA 4OYUA 1X50A 1QJY1 3IDEA 1JZ6A 4LBQA 3NV3A 2HWD1 1GR3A 1S4CA 1BMV2 3CZJA 2ARAA 2VM9A 3AVRA 2ZZJA 2UU8A 4YZ4A 5FR3A 3E5QA 2CL2A 1EV13 2KXLA 1V0AA 4ES9A 5L36A 1ZA4A 3NJYA 4MXWB 4XBNA 3T08A 4AQ2A 4HSJA 4YM0A 2CNAA 1W2UA 3H7YA 4B1MA 3A22A 1JI6A 4ZS2A 1NY72 4I0WB 3SC7X 1SLLA 2YROA 4Y1XA 3PURA 4LA3A 4P00B 4IE4A 2JDPA 1IS6A 3AFGA 3U11A 4CCOA 1Q8OA 4S2FA 1XC6A 3T2OA 1KDKA 4BQ4A 1VAMA 2OUHA 2YBKA 2YMZA 3LSDA 3NNMA 1W0NA 3MHZA 5LA2A 1CONA 5F7UA 3ZXJA 1ZBA1 3VZNA 1ZBA2 1U0AA 2GDFA 5FMBA 1DGRN 3Q8BA 3WX5A 2PELA 2R063 1OD5A 4QPIA 5DQ0A 2ZOEB 4FXGB 1E5SA 4IE0A 1SBEA 4NAMA 2JKXA 3E6DA 4BISA 3MLLA 4B7KA 5CADA 5ERLA 2VTXA 3AK0A 3WQ1A 2B46X 2FDIA 2QQNA 3KHBA 4JKKA 2GNDA 1W9TA 3FWEA 4DXSA 4UFMA 3BTYA 5FUNA 1TNFA 4OUEA 1IOAA 2H6BA 4JGZC 2GP3A 5GKAC 3VV1A 3RYKA 1OVPA 4KG0A 1QDOA 4EN0A 2WFF2 3FFZA 1ZNPA
chains in the Genus database with same CATH topology
3PVOA 3VHNA 5GLUA 1S1AA 4A7ZA 4DZGA 4Q26A 2IXJA 1DU3D 4LBJA 3PMSA 2JD4A 1D4VB 3HMYA 1C28A 4A7YA 3LAGA 3MEPA 4C1WA 1K5MC 2RR13 5FO7B 2XG3A 3AP4A 4XJUA 3ZFGC 4QPYA 1GZWA 4M3CB 1D4M1 4HLTA 5J37A 1CAWB 4QGMA 1LULA 4FPOB 5IK4A 4HL0A 4OUSA 3VZKA 2YXSA 2X5IB 1DHKB 3FJSA 4NWVA 4P14A 3KCCA 4KG8A 5H9PA 2MPFA 1NCQB 2OIIA 1R1A3 4LBNA 3ZN4A 1R081 3VL8A 3FLTA 4OI1A 3V65A 3RMXA 4XTPA 2RS12 1XNKA 5DUVA 1AR81 1RHI1 4B4PA 5HI0A 2RR11 1ND3C 2JE7A 3AZYA 4QPGB 5IK8A 3GBGA 4XF9A 3HT2A 2E63A 2VNGA 4PDWC 3WP6A 1MS8A 2FZ2A 3AYDA 1KRIA 4KWKA 4WV8A 3KSCA 4K20A 4E9KA 2JG8B 3SNMA 1RUG3 1PZ9A 1U5IA 4LULA 3VL9A 4WM7C 3D0JA 4NOTA 1YFWA 4OZXA 3M7AA 1VBA3 1ND2A 1PNGA 1OA2A 1YFUA 3TN93 3MPPG 1GNHA 5DG2A 2ZGKA 4ISQA 1DZQA 3O5SA 3ZFFA 2UURA 2QKDA 2WNVA 1DBNA 1NY71 1O4ZA 2R1DA 1RUG2 2AYHA 3J4UH 4JVAA 4XJ9A 1DDLA 1RINA 2ZMKA 2K9ZA 5BPXA 4H14A 1EAH1 2UWBA 4YM1A 1DQ4A 2PAKA 1LOEA 4YG0A 2XHKA 1CESA 4CDUB 1N1TA 4HSLA 4PIZA 5D8AA 5FRAA 1YUDA 3OGJA 1HV1A 5T5OA 1FI2A 2WNEA 1OMIA 1JTZX 3BOWA 4MGKE 3UKTA 2UYBA 2YC0A 4F7ZA 3QBQA 3WW4A 2JG9A 2GZWA 4P9YA 4Y1VA 4LNVA 4PCRA 1MS9A 4QQHA 1LRHA 1CAXB 1W39A 5FMOL 3KT7A 1AJKA 2XH6A 3WG1A 4BZ4A 3T1LA 3ZN6B 1NCRA 4BE3A 1DZTA 4IXLA 2PHUA 2VQ0A 1ONAA 2B5HA 2UWAA 3I59A 4RSUA 1VRH3 1V6IA 1R091 4AGVA 4N9HA 1R092 2R072 1MQTC 4HVRA 4URTA 5BNNB 2AREA 4BCUA 4PIXA 1R1ZA 2XL7A 1FV3A 5JOWA 2GH2A 4FP2A 2VW2A 3HAGA 1QXJA 4YLZA 5DZEA 2ZABA 3ZVXA 3MIGA 3VBOB 1FATA 1SCSA 1PO21 4Q0SA 3MIHA 5JCTA 1PO22 3KCYA 3X29B 3AJZA 1WLWA 3VBHC 4M01A 2D6LX 3M3CA 4Q4V2 1TME2 2A6XA 2VOKA 3GYDA 1ZREA 1EAH2 5CU1A 1LESA 2CWSA 3I8TA 4YARA 2P3IA 1QXPA 1JW6A 4FPCA 4X6QB 1ULCA 4N53B 3RI9A 4CEYC 1HQWA 1DG6A 4L11A 4YFWA 2ZMNA 4CDUA 4FO9A 4RS5B 3B00A 1F9KA 5KHJA 2WSUA 2ZHMA 3P3NA 5AFEA 5CBLA 3THPA 4YW3A 1WLTA 1VB4A 1BMV1 1BVVA 3POSA 1EV12 3ZXEA 4XJZA 2YGMA 2R041 3ES1A 2WS92 3GBWA 3LOBA 1QDCA 5LRSA 1CAUA 2GU9A 3VN4A 4IV3B 1GBGA 2WZPP 5DZGA 3FBYA 4PDWB 5FLIA 3DUIA 2HWB3 4NO4A 4CDQB 4HFSA 4AEDC 4BWOA 2VVEA 1QQP1 1S2KA 3OY8B 1KDMA 4PBPA 5C33A 4RHV1 2KM2A 4PF5A 3OD0A 4WBBA 1O4TA 1CAWA 1Z0HA 1HDKA 2RS32 3RS6A 2ETEA 1VBD3 1V6MA 1DGRA 4K9SA 1VBC2 5GJ6A 3VKFC 4IL7A 1EV11 3JBG2 4I3GA 2QNKA 4Q4X3 2PHWA 5KHGA 2KA3A 3MFAA 3VZLA 1TEIA 4JDMA 1N3QA 2JJ6A 4HVQA 3EXUA 3ZYPA 1VBB2 3KM5A 1GV9A 5GZFA 2BEOA 5F9TA 3W59A 1RGSA 1FNZA 1JBCA 2D98A 1EPZA 2ZX2A 4CDXC 3OBRA 1GZ9A 1VBD1 2Q1ZB 4JCKA 3TWIA 3AP7A 3ZFFC 1NQDA 1Z7S2 5HCBA 3ME2A 1H8TC 3G7DA 1HW5A 1S0GA 1U5YA 1UF2C 3WDYA 2OYZA 2DCYA 2CV6A 4Q8LA 1RITA 3MLKA 2ENRA 4NVPA 1IGOA 4CDWB 2QUOA 4XF4A 1ND2C 5CB7A 1C1FA 1VIWB 1AR62 2XJUA 5ABJC 1C8NA 2NPIA 1G9DA 4WM7A 5BXXA 4XETA 1Q8QA 1ND3A 4G9SB 2A3YA 4HN0A 4M3CA 1RUOA 3FLRA 1QKQA 2EAAA 3IDBB 2HEWF 3PJQA 4RFT0 2W68A 4ORFA 4XFFA 3VKLA 1G9BA 3ZFFB 4YGEA 1HIXA 4LBQD 1EAH3 2IWGB 3RSJA 4YG3A 5C8WA 1OHFA 4P9XA 3MFCA 1RUH3 1QNWA 3O0WA 3S30A 4K3UA 2DUOA 4DINB 4AQ6A 4FAHA 3OBTA 3DV8A 4GH4A 4HVOA 3WDXA 1POV0 4B7EA 2F4PA 1C1LA 1TE1B 1H8VA 2MNGA 2XVGA 1POV3 1PGW1 4Z07A 4C0HA 4RQPB 4LE3A 2TUNA 2VOWA 3ELNA 4E2SA 2D97A 3J8F3 5FOJB 3VGIA 4A7KA 2QZ3A 1HXS1 4ZKTB 1K5MA 4I2OA 3AYCA 4L92A 1QJX3 4COVA 4R9BA 2W52A 5I91A 1QJZA 4KL1A 1XQNA 4JRLA 4PQ9A 1XNCA 2QE3A 3WP3A 4COWA 1AXYA 3IPVB 4QPIC 2R073 2BWCA 2CWMA 1F8VA 4TLFA 4XJAA 4CDQC 2ZGMA 2E7QA 1CN1A 2WQ4A 1VAKA 4CDXB 5SV5A 1BQPA 1RUI1 4NR1A 4MX3A 1FOD2 1C57A 2X29A 4QM9A 5DXDA 3V64A 4HZFA 1TNRA 4I01A 3RG0A 1UZYA 2WSVA 4COYA 5JIAA 3NKGA 1OA4A 2BYVE 2WFF1 3ACLA 4QQ2A 1MS1A 1UU6A 2A6YA 1PK6C 4WVWA 3LB9A 4ZU4A 1AYN3 4OULA 1MEC1 3WDTA 4Q2FA 4XJ8A 5HBAA 1CAUB 1CR7A 1QJY2 1RC6A 1V6KA 4UW5A 3VBUA 4AGRA 3VHRA 2GNTA 1Q5OA 2VQAA 2I74A 4AHWA 4YGDA 4KGGA 4Q4W1 5EXOA 4X8NA 3OY8A 4BH9A 4EROA 5A33B 1GFF2 3RZZA 2WNUA 4E4DX 1UU4A 2JE9A 3AJYA 3HBZA 1DGWX 2P3KA 1LODA 2A73B 4L9BA 4O9EA 1C5HA 3CLPA 1KS4A 2W0XA 1ZVFA 2IC1A 3GNEA 3UV9A 5GLZA 3MIFA 1VLNA 5CFDC 2XPJA 1V6NA 4OLLA 1UN1A 5CA6A 4JAAA 3WHUA 1AYM2 4E2GA 2FMDA 1AYM1 4AEDA 3VDDB 3URFA 1IPKA 1F5FA 3CJXA 4LO4B 2ZGSA 3PHMA 2OUJA 2LALA 2JG8A 5C9AA 3ZFEC 1X82A 3HR9A 4AQSA 2EXHA 4H55A 1PO12 1VBE2 3AFKA 3GF6A 4Z1VA 3KQRA 1B35B 4AF9A 5T54A 1VBD2 3DL3A 3SCFA 1C3HA 3SH5A 1WD3A 3L2YA 2UWCA 5LEJA 5GALA 4LO7A 4R9DA 2XJTA 1BKZA 3HN1A 3JQWA 1Z78A 3VBHB 1BZWA 2ZGQA 4BLJA 3J9SA 3WV6A 4AVVA 5EYXA 2DVFA 1EPWA 3ST7A 2ZZQA 5E88A 3VBFC 5FO9B 4FAGA 4BM8A 4MZUA 1RUE1 1FOD1 4O9GA 1IZ3A 2GN7A 1S2BA 3VHOA 5D8AB 2O0OA 4BIOA 4L2NA 3L9JT 1W6PB 4QPIB 3J8F2 1I9RA 3APBA 3AKPA 4DY5A 2DYCA 3CJIA 1AR82 1RHI2 2H0VA 1G9CA 1REEA 1G9AA 2AR6A 3N36A 1S0BA 4DNYA 3NV4A 3ILRA 4HT1T 4YGCA 3MGUA 5GLVA 3SH3A 2WL1A 4N9IA 1PZ7A 3LKJA 4Z92B 2JG8C 1BBT1 1ZBA3 2BQPA 3I59B 4GALA 2VMGA 3WP4A 2PHTA 2R061 5GZCA 3SH4A 3VDDA 4C90A 2IFWA 2Q30A 1LTEA 5CFDA 1NCRC 1J3RA 1GZWB 4LO6B 4R8HA 3O7OA 2BNMA 3O0VA 4AVBA 1UKRA 2PHFA 4MXWA 2D93A 4H7MA 3W9AA 2XGXA 4TSVA 4Y1YA 1RUD3 4FT8A 1A8MA 2BWAA 2NQYA 4RR3C 2BFUL 3TN91 5AC92 1NA1A 1AF9A 4YSFA 5AC91 4RD7A 1WD4A 2D40A 1AYN2 3ETQA 3EQEA 5T5JA 4AK3A 1ZZBA 2HWE3 4QPGA 3ZSEA 3O14A 4NN0A 2RM21 4WVMB 1CAVA 1OFNA 3WCRA 2IXKA 2D6KA 3AMQA 4LA2A 3NSTA 3NAPB 3A0KA 5GZDA 1ALYA 3MIDA 4RS5A 4CP0A 1QNYA 4Q29A 2VU9A 4Q4V3 2XJVA 1QJX2 4PJYA 2H6CA 1H1IA 4W6WA 3RRDA 4N43B 3WCSA 1H8TB 1W6QB 4E27A 2D3RA 4OUMA 3NW4A 1AX2A 3WLUA 4META 5CVRA 2HEYF 2BPA2 2RMU3 2A70A 2JENA 4LBKA 1C4RA 1RUJ3 1B35C 1V6JA 1PGSA 4JDNA 4G4FA 3ZO0B 1O3RA 2CY6A 4CDQA 4D7YA 1OQDA 1OQ1A 2V73A 1O5UA 3M1HA 1COV1 4PDWA 4YVWA 5FO8B 1VBA1 2A6VA 2YPJA 1RUJ2 1SLTA 2PFWA 2CAVA 4NWWA 2WFF3 2RM22 4XF0A 4D7SA 5CFDB 2DVDA 3ZFGB 3MW2A 3ZN5A 1UPIA 2E9QA 3U07A 1AR73 2PAMA 2GALA 1FXZA 1CPMA 1VBC1 3ZMNA 1WCDJ 3ENRA 1JUIA 1IS3A 4FPHA 3EBRA 4I09A 4FQZA 3N35A 1GANA 1COV3 1H2KA 3E6BA 1CVNA 4NHMA 1MEC2 5DDJ2 4LLFA 3ZSJA 4PLOA 1TME3 4LLOA 1UIKA 4JGYB 1ZZ7A 5A32B 1PO11 1VBE1 1X36A 1ULDA 1HX6A 1M4WA 4Q27A 4L8QA 4FOVA 1QOTA 4JGZA 4F8AA 1G86A 4XTMA 5H9SA 1I3HA 1W6QA 1RUC2 4N7IA 2GMPA 1LOAA 1JN2P 2D6MA 4N43A 4DS0A 2RS52 4FQ4A 5BNQA 1YYNA 3NWKA 3KT4A 4F3JA 2QFEA 3KS7A 5JR7B 3NVCA 1TME1 4IV1A 1PVXA 1C8M2 1R093 2FBEA 2WS93 3AB0A 3WR0A 4WM8A 1LGBA 1RUC3 2YV8A 1SFNA 3WZ1A 5KHKA 4Q4W2 5C9AB 2WZR2 4YVWB 1VBA2 2Y0IA 2GH8A 2R32A 1YCIA 3AZZA 1B35A 4XBQA 1CQ9A 1N3PA 3JB8A 3VBRC 3FHIB 1NG0A 1H8TA 4XDQA 2FZ1A 2B39A 3IMNA 4Q4W3 1YJKA 2BBVA 2XWBB 3OCPA 4NHLA 3U4XA 1SMVA 1V9U1 3LOIA 5EJ3A 3RJRA 5J09A 1RUC1 4HKLA 1MVEA 3AM2A 3OF1A 4QGNA 5JSPA 4XW3A 1S0DA 2PHDA 3RI8A 1ND3B 4QPGC 3AP9A 2HWC1 3QOPA 1QH7A 2R6QA 3VUOA 4MUVA 4JGYA 2UYAA 1AL0G 5KC6A 4IESA 1FMD3 1XNDA 4RQPA 3ZFEB 2FHRA 4RR3A 3ZSMA 3K48A 2OW4A 4FPGA 2ZAHA 1A78A 1RUF1 1CJPA 3LSEA 2IZWA 4PIYA 1AR91 2A7AA 2AUYA 3PLQA 2RMU2 1A8DA 4XZPA 4AW7A 1YRZA 2PHLA 1VJ2A 4M3CE 4YYOA 1DIWA 5A32A 5JWPA 2ZPXA 3FE5A 2FMYA 1D4M3 3MYXA 2MEV2 1JYIA 5IK7A 4BPZA 5JIUA 2EVXA 1UMZA 3FUQA 2R062 3ZYRA 5EV7A 1QJU3 4IQPA 1AL21 1N1YA 1AR63 2N7GA 1FOD3 4CYDA 1AL22 3SCGA 3CJIC 1AR72 2EXKA 2VVFA 3AKQA 1KITA 1LENA 4IV1C 2DUQA 2DCZA 1W6OB 2Z69A 3IPVA 5BNOB 2ARBA 1QU0A 1ENXA 2OVUA 4AI1A 1UIJA 4KWLA 2SBAA 4M00A 5I0TA 3RYRA 3RDIA 1RUH1 1DQ5A 3AP5A 4IEXA 4QD2A 1ZRRA 2HWE2 4QXKA 3N7LA 4OI4A 4S2HA 1RVF2 2HWC2 5K7PA 3QCWA 4Q4Y1 2ZX0A 1LOFC 1N1SA 1ZM1A 1AR61 1L3JA 3WW1A 3UL2A 1U12A 3SXWA 2QCSB 2A6WA 3R05A 5BNPA 1GKBA 3HIFA 1LGNA 1FPN3 1ENSA 3R4UA 4FXKB 4LHNA 1IQAA 3H0OA 3B7MA 4P9LA 4BMEA 4LUMA 4FBFA 3QACA 3VZMA 4RGAA 2ZHNA 2QDRA 1MQTA 4XFGA 3TNQA 1PVC2 2LUWA 5DDJ1 4AEDB 3WVJA 4LEJA 4YZ3A 3NJZA 3ZIWA 3SCHA 4WVMA 3BTAA 2TEPA 4EJRA 2R071 1MS4A 4XQWA 5A3LA 2C9AA 3AZVA 2HWE1 4X8PA 2AZ5A 1DQ0A 4UXAA 1YWKA 2RM23 3D0SA 3AMNA 4AE2A 4AVSA 4FSJA 3AXEA 2PYTA 2ZKNA 4M3CF 2WC2A 1HXS2 1GLHA 3A4UA 1Y3TA 4HN1A 3KGZA 5T50A 1LB2A 2I07B 5CFCB 4IEZA 5FMOS 4L97A 5FQ0B 4RA0A 3WT3A 1LU1A 3TRSB 3J26N 4B8EA 3FBMA 1J59A 3L2HA 4B3NA 5JLVA 1C8M1 1KD7A 2DVAA 3O0XA 4D3WA 5C8CB 4RL7A 4WVZA 5D8AC 1DYPA 3IDCB 1MEC3 3SMHA 4K21A 2DVGA 1QH6A 4H7LA 5CAZA 5L7OA 5BY5A 5I93A 4XILA 4CTEA 1WCKA 3WOGA 4Q0QA 3MPBA 4IEOA 1OFSA 1ENRA 1GNZA 5L7OC 4XFCA 2SLIA 4QM8A 2WNVC 2WA3A 4MSVA 3ZSKA 2GC3A 2VNRA 3AKTA 1PM7A 4AVTA 3KB5A 2WS91 1WCSA 2BGCA 2E7TA 4UBGA 5LK7B 2A5ZA 4XQ4A 4YFZA 4COUA 3ZXKA 2WZR3 2HJIA 1WMEA 4SBVA 2OA2A 4S2GA 3TOJA 3ZX7A 3E6CC 2NP0A 4KWJA 1X8MA 1Q8SA 2C5DA 1QQP2 3P3PA 1PGL2 5CG9A 1ULEA 3IBMA 4C91A 1D0GA 2VGDA 3MLJA 4YVSB 2B7YA 2Q8OA 2WT0A 3M4FA 5A3MA 1RMU1 2JXAA 4AHYA 1PO13 1VBE3 3DPRB 4COZA 4MLOA 4NPRA 3MIBA 4ISRA 1OPOA 2A6ZA 3IN9A 5F6KA 1F2NA 4P9WA 4XMAA 5JSOA 3ZN6A 3B9CA 5KXBA 1BBT2 5E8AA 3PNAA 4GH4C 2D3PA 1XYOA 4A3XA 4K8FA 3AZXA 2WIIB 3N7MA 1S0IA 1CJDA 4DB5A 3LWCA 4ZU5A 3WY6A 4YZ5A 3I7DA 3MF9A 2XBO1 1FX5A 5C4WC 1C5IA 3ECQA 1NOVA 3TYJA 4IV3C 3VZOA 5J48A 1DZRA 1PK6B 2E6VA 5KHIA 2DCKA 1Q43A 5BNOA 3KZ4C 3FMGA 1SBDA 5AFBA 2HWB2 1RB8G 2E7AA 5GZGA 3MF6A 1YFXA 4OI2A 5C4WB 4Q4Y2 2RS11 3V56A 3S0MA 5I0SA 2WA4A 2V5YA 2D6OX 4HPKB 4CEYB 3H1WA 5C9AC 1DGLA 2AH2A 1OOPA 4HK8A 5BNPB 3JD72 3LCPA 1ZBE1 1GQHA 1OPMA 3JZVA 3M70A 3T2TA 3WXPA 2WT2A 4TWTA 3ZSLA 4RGGA 1NCRB 3JBG3 2ZTNA 1NYWA 1QOOA 3EJKA 3M3IA 3B94A 3MZHA 5AC93 5ACA2 2X53S 2ES3A 4FTBA 1WLDA 3HD8B 4HETA 3SHRA 3VBOC 4Q0UA 3WW2A 4AI8A 1PGL1 4P9IA 1XNBA 4Z8BA 5D1IA 1COV2 4J6GA 2WNUC 2IFRA 4Q4X1 5FREA 1LU2A 3ILFA 3RQ0A 4Q1PA 2XKPA 1R1A2 2PAEA 3MDPA 3ZXLA 2Z5WA 3ZXAC 1HRV2 1TMF1 1UKGA 1REDA 4JGZB 4QQPA 3PVEA 1ZBE3 3KGLA 3ZXDA 4AFAA 2B8MA 3B01A 3IWZA 2ZX3A 4M0NA 1HRI3 1LOGA 4AEJA 3LGRA 4E4SA 1RUE2 2RJLA 2O8QA 1FT9A 3V0AB 4S2DA 4F83A 1XE8A 4UBHA 4JTNA 1POV1 4IEVA 2D6NA 1OI6A 4D7TA 1RUJ1 1OOPC 4N90A 1HRI2 4GMP1 1QOSA 3KMHA 4QQLA 4IEWA 4D94A 3R4SA 4GB32 1X8EA 2CGOA 4NHKA 3VBRA 3WD5A 4YW1A 2DF7A 1SCRA 4IERA 1HKDA 2PA7A 3S6PA 2C1FA 4IEPA 1BEV1 1QGLA 1SBFA 3WP5A 3RWNA 5T5PA 1R1A1 2UY9A 3USUB 1DYKA 2CTVA 4INDA 3JD71 5FOBB 2LTNA 4GMP0 3SISA 5BNOC 1CD3G 4P5HA 3M2MA 2GNBA 3AP6A 2B42B 2QZ2A 5C4WA 1LCLA 5T5LA 2ATFA 4MV2A 1T6GC 4XXAA 2BVBA 2H0BA 1XE7A 3UK9A 4XF1A 1S0JA 1X33A 3AKSA 1KS5A 3WQ0A 4UW4A 2WNUB 4MGIE 4ATFA 4IEUA 4AFBA 3FFQA 4EWAA 1NE6A 3POYA 2RMU1 1JOJA 2VUJA 4ES8A 2XWJB 2WWSA 3GBFA 5K8SA 2V09A 2B9UA 5DUXA 4B4RA 1NCQC 3R0RA 2IXCA 1WW6A 3OJBA 1J1TA 1FAYA 3NKTA 2VECA 5B2GB 5JPNB 4LHKA 4Q1RA 4Y22B 1AZDA 3HT1A 1RMU3 4JV4A 3I2DA 2VVDA 1FNYA 4AGGA 2Q5TA 5DUWA 1LEMA 1PMIA 2ZHKA 1MR5A 5SV8A 4XHBA 1RUI3 2UY8A 2CAUA 2Z79A 1D4M2 3HWJA 2JG9C 2DU1A 2DV9A 2QVSB 1RJ7A 3B5LB 2YZ4A 5JDBA 2YDEA 3ZXFA 1NE4A 1SLIA 3CL1A 1QJY3 2NN8A 5FPZA 4KBBA 2HWD3 1S0EA 4OHWA 4Q8KA 4LT5A 2NM1A 4WZCA 1U5ZA 2OZ6A 3S7IA 2WZR1 4OHVA 4LTAA 1BVP1