2WNVC

Complex between c1q globular heads and deoxyribose
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
129
structure length
129
Chain Sequence
b'KFQSVFTVTRQTHQPPAPNSLIRFNAVLTNPQGDYDTSTGKFTCKVPGLYYFVYHASHTANLCVLLYRSGVKVVTFCGHTSKTNQVNSGGVLLRLQVGEEVWLAVNDYYDMVGIQGSDSVFSGFLLFPD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COMPLEMENT C1Q SUBCOMPONENT SUBUNIT A
molecule tags Immune system
publication title Cutting Edge: C1Q Binds Deoxyribose and Heparan Sulfate Through Neighboring Sites of its Recognition Domain.
pubmed doi rcsb
total genus 27
structure length 129
sequence length 129
chains with identical sequence F
ec nomenclature
pdb deposition date 2009-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00386 C1q C1q domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.40 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2wnvC00
4E4SA 2HEYF 4QPYA 3L9JT 4TSVA 2JG8B 4E4DX 1KXGA 4N90A 2WNUA 3V56A 4QQ2A 3B94A 1TNFA 1OQEA 4OUMA 5KC5A 2X29A 1IQAA 4KGQA 4NN0A 3URFA 1U5XA 2HEVF 1D4VB 1S55A 2QDNA 2E7AA 1GR3A 1DU3D 4DB5A 2TUNA 2WNUC 3LKJA 1JH5A 2WNUB 2Q8OA 1JTZX 3K48A 4MXWB 4J6GA 3TWIA 4GIQA 1OSGA 1U5YA 3QBQA 4KGGA 1C28A 3QD6A 5KC6A 4TWTA 3B9IA 2RJLA 4QQOA 5TSWA 1U5ZA 5CIRA 1O91A 5L36A 1KD7A 3AB0A 1XU2A 1WCKA 1RJ7A 2Q1MA 1DG6A 5HBAA 3ME2A 4MSVA 2WNVB 4MXWA 2JG9A 4G4FA 2WNVC 3IT8A 4QQHA 1D2QA 4RSUA 4F3JA 2ZJCA 1XU1A 2JG9C 1D0GA 2KA3A 2WNVA 2JG9B 4D7YA 4HT1T 1A8MA 2ZPXA 1PK6B 3MI8A 3TYJA 4MXVA 2R6QA 3ALQA 4OUSA 3FC0A 5KWRA 2AZ5A 4G3YC 2HEWF 4QQLA 5BNQA 1PK6C 2O0OA 3K51A 4EN0A 2JG8A 2RJKA 4KG8A 1I9RA 2R30A 5L19A 4DOUA 2OIIA 1OQDA 2QE3A 3B93A 4QQPA 3WD5A 2TNFA 2R32A 1PK6A 1C3HA 1TNRA 2JG8C 1RJ8A 1ALYA 2RE9A 4OULA 2Z5WA
chains in the Genus database with same CATH superfamily
2IXCA 2ZX1A 5DMYA 3AFGA 1JOJA 5FPZA 2ZGTA 1RMU1 2OQ6A 3MLJA 4GMP3 5JR7B 3VBFB 5FYBA 4LQRA 5FUIA 5C9AA 1DHKB 1RUF2 2XOMA 3AJYA 2WO1A 4DRVA 2VTXA 2Y6JA 1Y9QA 2V73A 1Z0HA 1W2AX 2WNEA 3KGLA 4IV1C 1AR62 1Q8OA 4ZS2A 1HQLA 1GNYA 1Y4WA 2Y33A 4XETA 1QY4A 1YFXA 5D8AC 3S30A 1LHOA 2J1EA 4COVA 3WP4A 5CADA 5JXIA 1RVF1 3DN7A 1O8PA 5GLWA 2ZAHA 2QDNA 4P9WA 2ET1A 2W87A 4JVAA 2PXJA 4XJAA 1VPHA 1OLME 1R093 3HNBM 5HI0A 1RUC3 2B8MA 3NQHA 1KS5A 2CDPA 3I2OA 2WZR3 3WOGA 4S2FA 1ZRFA 1T6BX 1B35C 5A7WA 5JIUA 3OGJA 3PTYA 4Y1VA 1BEV1 2VW1A 2W94A 4UF0B 4Q4W2 4RN5A 1JHNA 1J83A 1QQP2 1QJY1 1QJZA 2XHKA 3ACHA 4HK8A 1XJAA 5DPNA 5LCWL 3WQBA 2PAKA 4YZ2A 3VDDB 1AXZA 5AC93 2YV8A 4FPKA 2RJLA 2VZRA 5A6XA 4AI3A 1HW5A 3K2OA 4P9LA 1G7YA 3GF6A 2WWSA 1HB2A 4UFMA 4YWAA 3W5NA 1PNGA 1Z7S2 4MSVA 3WW4A 3AK0A 4IE5A 1POQA 3SH5A 1GOGA 2XL7A 5CFCA 1YQCA 4Q8LA 4XW3A 5H9SA 2K0GA 4Y26A 3ZXFA 5LATA 1GQHA 3BPSA 1MVEA 1DYOA 5DAVA 1DGRN 2DU1A 2HWE3 3PJYA 3N9LA 2JG9C 4Z92B 5F6LB 5FY9A 2YBSA 2ZMNA 1BVP1 1ZREA 1BEV2 1ASJ2 3WW2A 2W95A 4QPIA 1VBA1 4COZA 4QB6A 3NV3A 2CSGA 1PO22 2XHNA 3WNXA 1ZRRA 2G19A 4A6OA 1AZDA 2WLPA 5J98B 4BH9A 4YW5A 1YCIA 4LITA 4QT6A 1I6XA 2EICA 4ZXKA 4AF9A 4YVSA 1PVC1 4CU9A 4MHRA 4R52A 5FV3A 3D6EA 3FBMA 3KCYA 2R49A 1KQRA 4BLJA 2CY6A 1BHGA 3ZYPA 1JUHA 4EJRA 3UETA 4NIDA 2GZWA 4UOJA 2B9VA 2BJSA 1XNAA 2WSUA 1X8MA 4YVSC 4HZFA 1L7LA 2QE3A 3U75A 3SKVA 5FJHA 3LEIA 2ARAA 5DZGA 5FTTC 3BUCA 3O1PA 2JG8C 3Q9OA 1RXFA 4YM0A 3THPA 3OUIA 1REEA 2NN8A 1J3RA 4QD2A 2Z5WA 1CD3G 4HBNA 2DVDA 3OY8B 2NYYA 4XDOA 5D2AA 5FXZA 4GH4A 5FYMA 2CWSA 4LR4A 2VJXA 4MUVA 3OYWA 3I59A 1UY1A 3JUUA 4N90A 4FPHA 3RJ2X 4MH0E 2CGOA 1L7QA 4Q0PA 3LGRA 4QQ2A 1IKPA 3K4ZA 3IDBB 1HB4A 4FVVA 4LOSA 3PUIA 4GH4C 2MEV1 1PGSA 4KGQA 4OUEA 3USSA 4CEYB 5K0UB 3O7OA 4YGCA 1VBC3 4BMEA 3LPGA 2AYHA 4N9HA 1VR3A 4AI8A 4WVMA 1VIWB 2WNUC 3DXUA 2WJSA 4AWDA 4IEWA 5BXXA 4CDXA 1HRV1 2Y38A 5FLHA 4XFGA 5J37A 3JD73 3CJXA 4LHLA 3FFQA 3AJZA 2HYKA 3DEMA 5FZAA 4K20A 1RUOA 1V0AA 2DWRA 2EA7A 4HG6B 1XRUA 1R083 2JDAA 3A0NA 3QBQA 4QPWA 4QHBA 1C28A 3H7JA 1RUI2 1UKRA 1W9TA 5B4NA 3KQ4B 1Q8SA 3U11A 5FYSA 1F5JA 1V70A 3O1RA 2XONA 1IPJA 2DCZA 1VB4A 1V6LA 1PO13 1TME2 4M3CE 4CEYA 5JXJA 3JB4C 3VD3A 4PIYA 3RZGA 4U36A 1U0AA 5FWEA 4JKMA 1XU2A 4XXAA 4WVMB 2Y0OA 4XJ8A 1WW4A 2J7MA 2ZCWA 4IGOA 3PVNA 3NJYA 4P9JA 3ITQA 1CGPA 4ORFA 1QJU3 2ZACA 1AYN1 3AZYA 1DIWA 4MXWA 3SKJE 5C70A 4AEKA 1RL3A 4CPBA 1NCRC 2A6XA 5FZ3A 3B02A 4ZHNA 4BXFA 3HIFA 4NRMA 3RSJA 5E1RA 4I09A 4U2AA 1YIPA 5FZIA 3TN93 1LOGA 1OA2A 1AYN3 3MFCA 1UKGA 1E5SA 4LK7A 1PZ8A 4NVPA 4XJZA 1FYUA 2XLAA 3WDTA 3UNPA 4AFCA 5EYYA 3V0AA 5J96B 5GALA 2ILMA 3VHOA 1J59A 1COV2 3AKPA 3KV4A 3FX3A 1JZ3A 1QJX1 5F6KA 1JZ7A 2VZTA 3PHMA 4QX5A 4FBFA 1BMV1 3HBKA 4N9IA 2AC1A 5T50A 3GZUC 1OLQA 2R043 3WF0A 4PT6A 1K12A 1UF2C 1S2BA 3A7QA 3KCXA 4V2VA 5FYVA 5FLJA 1GYKA 5BV6A 4YGDA 3VV1A 4BCUA 3T1MA 4WVVA 5J3UA 2GALA 5A3LA 3RYKA 2XBO3 3LDKA 4EN9B 3V0AB 1Y9MA 4QX8A 3J7LA 4YFZA 1ZYBA 4X6QB 5IFPA 1JYVA 1PGW1 2FCUA 2NQYA 4LTAA 5HCHA 1UZ0A 1YYNA 3AX4A 3FMGA 3EO6A 4MV2A 1J3QA 1GWMA 1R1A3 2XDVA 4XUTA 4YW1A 4YGBA 1W8NA 4LBQB 3T2PA 1XNKA 3KT1A 3LD8A 3Q8FA 3ROUA 5IK4A 5KBFA 2R1DA 4A7YA 4BLIA 3BTYA 3P3PA 1DFQA 2RS13 4IEPA 2HEYF 2IZWA 2BWAA 4XZUG 5DAPA 5A33A 1H8VA 3ORJA 1WA4A 3N7JA 4RQPC 1WCUA 1W6NA 3L2YA 1UW8A 1A3KA 2DCTA 1PGL2 1AR83 3N36A 3C2UA 4HETA 2DVAA 3ZFEB 4BA6A 5T54A 1M06G 1H9PA 3DPRA 2ID4A 5J48A 1OA4A 3ZPYA 4BQ1A 5CFDA 3I3MA 4LO7A 4MADA 1AR71 3TEYA 4CXXA 1X33A 2RMU3 1PIV2 3OPTA 4OHWA 1LAJA 1NCQB 2ES3A 5CBLA 2LTNA 5DZEA 1JZ8A 3POSA 2P3IA 1RUC1 2MEV3 3AKSA 4KWKA 4LBNA 1DLLA 5FZOB 4A41A 1C1LA 3TEZA 1TQ5A 1O3RA 1C1FA 4HONA 1RVF2 2OA2A 4PI0A 3DYPA 2B5HA 1YWKA 4AGGA 2H0VA 4H7MA 1QOOA 3WG3A 4KG0A 1OBNA 1X8EA 4YM2A 4XHBA 4COYA 1YNAA 1VE0A 2WFPA 5CFDB 4LBOA 1CIYA 1LGCA 4CCNA 4KWJA 1H4HA 3G7DA 4ZKTB 3MYXA 4ARXA 1UOFA 2W46A 2ERFA 2PAEA 3F95A 1GP4A 4A2UA 2F4LA 1NG0A 3K77A 4G9SB 1ZM1A 4NWWA 3VBRA 4FO9A 5A1FA 4NAMA 5A32A 2XJSA 4L97A 2FQPA 4M00A 2JDHA 2IC1A 2QDRA 3TRSB 1V9U3 1K3IA 3QH6A 1PX4A 3R4SA 3QLQA 1O59A 1RUC2 2XGXA 2V4VA 5FZDA 2RDRA 3WCRA 2CGPA 1G8WA 4MGIE 2VOWA 5A3OA 5I0UA 3UL2A 1PO21 2TBVA 3OGVA 5A3UA 3DV8A 2JG9B 1GQGA 2XG3A 4M0NA 1W6MB 5EYXA 4NIGA 3ZN5A 4JCKA 3RZHA 1ZZ9A 1CAVA 1YQ8A 2KM2A 1IPKA 1OOPB 5IHRA 3BIEA 1YFWA 2VZPA 2RM22 3HNYM 1UZZA 2AH2A 2R6QA 2QQUA 2XVGA 3O5SA 1VMFA 1YIFA 4MOAA 3FC0A 2DTWA 3EBRA 5FPUA 1ULCA 1UYPA 1BYHA 1AR73 2VH9A 3W59A 3ZFFA 2GH8A 1HRI1 4BMBA 2G9FA 1S0GA 2EAAA 3B7MA 3FHAA 3LA3A 1I9RA 5FP8A 1IZ3A 4B29A 4CDQA 5L19A 1SBEA 1VBC2 2WAOA 3CKHA 1JYCA 1R092 4B1LA 2E26A 4N43B 5LBEA 1GP6A 4LBKA 2OYZA 2HWD2 4L2NA 3WG4A 2BV4A 3JB8A 4L11A 3VBSC 3ECQA 5FYTA 2G9GA 1WUVA 1UOGA 3BOWA 1NZCA 3AKTA 4JQTA 2E9QA 1ALYA 3OD0A 5CEHA 3KVAA 1JXNA 1DDLA 4IV1A 4QGLA 1RHI1 2V72A 5DXDA 3H3UA 3LA2A 1QDOA 1Q8PA 4QWNA 1J1LA 2VOVA 5D8AA 2VOXA 2WO7A 5CKMA 3VBSA 2JEMA 4YSFA 1SLCA 4TSVA 4BQ5A 4NIAA 5H9PA 2EIBA 2BVBA 2EALA 4EZHA 3KHBA 2VG9A 5T5LA 4DEVA 4QB1A 3LWCA 1KRIA 1DGRA 2UWBA 4FP2A 2R062 3SEEA 3I3EA 4CE8A 1B35A 3DL3A 3ZSKA 3ZR5A 3HT2A 4QKBA 3WNOA 3ACIA 4AW7A 3WLUA 4XEZA 1W0OA 2VBBA 2YB7A 3KHCA 3AL6A 3J8F1 2FDIA 4AVBA 4K3UA 4FPLA 5F7UA 1O6UA 3D8CA 3HN3A 4RYDA 3DYMA 3I2IA 2D7FA 3E6DA 5EJ3A 3VBFA 4XIKA 1B09A 2WSVA 1FPN3 2WS93 4NPMA 1DBNA 4KNCA 4KU7A 3H8RA 3BCWA 3WR0A 1XC6A 4XACA 1ACCA 1IS4A 4PF1A 4BYYA 1W8WA 4JRAA 1GZTA 3TBDA 1REFA 1V6OA 4JTNA 5C8CA 1W8HA 4LKSA 3RS6A 4CCOA 1MZFA 3MIHA 5JSPA 2D5HA 2HWD1 1TEIA 5DZFA 5AVPA 1R64A 3AKRA 3H8OA 4GXLA 1WCKA 3I97A 4E4HA 5LA2A 3TN91 3NJXA 1TZOA 3ZXAC 2EXIA 1QJU1 2DBNA 2G9ZA 1YUDA 2BNOA 4ATEA 1LENA 4QB2A 1XXNA 4I02A 3POEA 2Q8DA 4OZXA 3ZXLA 4O9EA 5GZDA 2WZ8A 1RUJ2 4CZSA 5AFBA 4LEJA 3NW4A 2CU5A 3LOIA 1AX0A 1BBT3 3VZNA 1Z7S1 3AYDA 5A3WA 5L73A 4CU6A 4GKYA 2WR9A 2ZJCA 4E9KA 3DF0A 2P4EA 1ND2B 1VBB1 3KD4A 2NM1A 1DQ1A 1QOTA 3C8XA 1ST8A 4IEOA 5ISLA 2MEV2 1DLCA 4CP9A 2HLEA 5GZFA 3IDCB 2ATFA 2CV6A 5KHHA 1DQ4A 5K7PA 3WHTA 2JECA 4JC1A 1AXKA 1NE4A 1TMF3 4FI9A 4JKLA 1TVGA 1VBA3 2W0XA 4AZZA 5IFTA 3N4MA 3OGRA 4JHTA 5C3SA 1HRV3 5FOBB 4MX3A 4XQ4A 5BYNA 3MBWA 2BFUS 5A6ZA 2YG0A 3KMHA 3ATGA 2WZR2 4M3CF 5CB7A 5FK7A 3ZYGA 2VUJA 1BMV2 3AP5A 3GZEA 3VD7A 1GMMA 3N7KA 3OBRA 4XFIA 4AVAA 5T3NA 1LULA 5I0TA 1MZ6A 3T09A 1V9U1 2XMLA 1UY3A 4L8QA 1RJ8A 3ZR6A 1PMHX 2VR4A 5GLUA 4NHLA 2XXZA 4YPJA 4OULA 5IVFA 3H50A 4BHPA 2X5IC 1UOJA 5L9RA 3AYAA 2A1XA 2A6WA 4PQQA 4PDWA 3N9QA 1SACA 2B45X 4AVSA 2BOJA 4K8RB 5J1XA 1L3JA 1MACA 3VKMA 2Y26A 1QWRA 2WNUA 5C4WA 2E63A 3MF6A 3Q8CA 4NE9A 3LFMA 1LU2A 3SXWA 1H2MA 5C71A 1STMA 4Y20B 2ZGNA 2HBUA 2D3SA 1ND3C 4I30A 1W6PA 4LIVA 3CJIA 5FZ0A 2VGDA 1PZ7A 3UGGA 1LGNA 4C90A 4GMP0 1W2TA 3ZO0B 4A7KA 5CVRA 5HPOA 4CEYC 3SISA 3KF3A 3PDQA 4K7JA 5L9VA 3OF1A 4QM9A 2ZZJA 1OSGA 3GBFA 4TLFA 5DDJ1 1W03A 1HB1A 3NAPA 5C7GA 2N7GA 1OOPC 4CEWA 4NHKA 5DAWA 4XURA 3HOBA 2WUHA 2WFF1 4YFWA 4AGRA 5KR7A 2RS33 2VBPA 2GDFA 2JE9A 4FPJA 3R05A 5IW0A 2XVKA 3ZX7A 2EXJA 5BNNA 3CF6E 1NCRA 2ZGQA 1OMIA 1PNFA 3B69A 5EP9A 1T6GC 2ZHNA 5TSWA 4IEYA 2GAUA 2LW8A 1O91A 4SBVA 3H42B 4EE2A 3BKZA 4TTGA 4ES9A 2P5BA 2ET7A 5FMDA 1SHWB 5T5OA 5FDBA 2X53S 4NWVA 3VBUA 4YZ3A 1AF9A 2D44A 2QQPA 2JWPA 5DG1A 4NHXA 4A7ZA 3M3QA 4J1XA 5HV0A 3MW2A 3RZKA 3APBA 3ILRA 5GLVA 4QDQA 4KL1A 1GKBA 4YLZA 3HPNA 1DZRA 2E7QA 5EHDA 2A3XA 3VL9A 3ETQA 5FMOL 3QACA 2IVIB 1QGLA 3TOJA 4AI1A 4AE2A 4Y22B 1KITA 3NNFA 2V5YA 1QOSA 2DVGA 5KXEA 4FFFA 4BIOA 4MO3M 2GNBA 4LE3A 4WZFA 3ACGA 3LSEA 3AMNA 1I5ZA 5ERLA 4BK4A 4TZDA 2VQ0A 3KT7A 4YG0A 1ULPA 1LU1A 2VMGA 1W6QB 2VQAA 4C8DA 3NNMA 2XPJA 1AR92 4XFCA 4YGEA 4DFSA 4Q4X2 5FZFA 1YJLA 4QQLA 3OPWA 3VBOA 2P2KA 3VBHB 2VZQA 2EIDA 2BEOA 3JZVA 4EN0A 4FOQA 4TYSA 1R081 5FY5A 3SH4A 4I01A 3U78A 1OKOA 4XXPA 2PA7A 2VNVA 5JI7A 3IMNA 4X6RB 4LKEA 4JDOA 1JZ5A 2R0FA 1ASJ1 4Q1PA 3AVSA 4N53B 3KSCA 5GZCA 4M3CB 1NX9A 1FMD2 5DDJ3 5CISA 2VZ1A 4CP1A 1FNYA 2V5DA 3M2MA 3B9CA 3MV11 4UBGA 2WL1A 4Y5SA 3DPRC 1BBT2 3E1F1 1W05A 4Y33A 2X05A 1OT5A 2IWGB 4LJHA 1E5RA 3T08A 1JUIA 1ODMA 3L9JT 4MZUA 4QHZA 1LEMA 1VBD2 1KDMA 1WMDA 3WQ7A 2JJ6A 4FP3A 4HVRA 4AVVA 3USUA 3V64A 3POGA 2PELA 3I49A 4FPOB 3IM0A 2ZX2A 2PLV1 3EXUA 3TAYA 4N53A 2X29A 5AC92 4M3CA 3P5BA 4Z2AA 4QX1A 3URFA 2SBAA 5LWBA 2O8OA 2ADEA 2CL2A 3FUOA 3S7IA 1GZWA 1NQJA 5BNPB 1CWPA 1DGWX 1WMXA 3LKJA 4OFGA 4B8EA 3ZXEA 5F5IA 1IOAA 4RGKA 2P17A 1V6NA 4W4ZA 4Q0QA 4Q26A 2XJUA 4YYOA 4AEMA 4XBQA 4AQ2A 1S0JA 4ZY9A 1GWLA 4Y4YA 1WGPA 2D93A 1W8UA 1WLTA 3KWVA 4RGGA 2ZZQA 1APNA 1QJX2 4F8AA 4A6SA 4DEQA 4AK3A 1GZCA 3LPFA 4Q4Y3 5ABJA 4ARYA 1AL21 1UIJA 1FMD3 2BGOA 5DDJ2 5IVEA 5FY0A 4FPGA 5FCCA 1NCQA 1F5FA 4GB32 2A3YA 1YLLA 3I3BA 3ZSMA 1NYWA 3VD5A 1Y7BA 3ZXJA 2CAVA 1WZXA 4AQTA 5IVJA 4UT5A 3MPBA 4CDWB 4QQHA 1KEXA 3JBG2 3I4IA 2YXSA 2WNOA 5FZMA 3E6CC 3UGHA 1W2NA 1AR82 5FR3A 3LIHA 2RS12 3H3LA 4KBZA 2XJPA 3JQWA 5FYYA 1CPMA 2OW4A 2HWB1 4D6QA 2BDRA 5D1IA 5EJ1B 1AR81 1XQNA 1WLWA 4D7YA 2VUCA 3FLRA 2YPDA 2TEPA 3DXTA 3PUSA 4R9BA 1RHI2 2HWC2 3FJSA 3ACLA 1EV13 2VMIA 2ZKNA 4JGYB 4DNYA 4HLTA 1PIV1 1FPN1 2RMU2 1WKYA 4IERA 4OUSA 4GB31 4P02B 5C5UA 1XE0A 1LNSA 3WNMA 1O8SA 3A0KA 3K51A 3ZDVA 4WM8A 4BQYA 3M7AA 2WT0A 3SEPA 2R30A 5JLVA 3VD9A 4S2HA 3ZSLA 2A6ZA 2YC4A 3QCWA 4YW4A 3AFKA 1NT0A 2O8QA 5JDBA 4QQPA 4C1WA 2XVLA 2TNFA 4DO0A 3NSTA 1TNRA 1GP5A 2MNGA 4HKLA 4YW7A 3WUCA 4DZGA 2VW0A 2JDKA 2Q5TA 2XKOA 4K21A 2RHPA 1OQ1A 1WWYA 1MR5A 2DVFA 3HVDA 4RA0A 2QUOA 4E4SA 1JZ2A 2JDYA 1GV9A 4E8CA 2OPWA 2WQZC 1AR72 4KQ7A 1VAKA 4WM8B 4KWUA 3LA7A 3EJKA 4V1PA 2E33A 3OCPA 1JU3A 5FQ0A 3FFZA 2VY0A 2ADDA 3J8F2 3X29B 4P9IA 5FZOA 1SCRA 2NZ9A 1TNFA 3B94A 1CR7A 4GWIA 1VMHA 1ND3B 3OY8A 4RFT0 3VN4A 4XUPA 3IPVB 1F35A 2R042 1GOHA 1S55A 4OYUA 3CHXA 1XB9A 4L99A 3WCSA 3VZOA 3WINE 5C5TA 5LY2A 1AX2A 1VRH3 2W47A 1ZBA3 2WQ8A 1CAXB 5F3GA 4CDUC 2WC2A 3BU0A 1HV1A 3VB9A 4B7KA 4CP0A 2GMPA 2GSYA 1C5HA 4LKFA 5K0UA 2WS91 2PHFA 1PVC3 4LBMA 1ENSA 1OLMA 2Z69A 1E5HA 3WDXA 2WZR1 3SCHA 3N3HA 5A32B 5FZHA 5FKBA 4GWNA 4K8FA 2UYAA 3LEMA 1QNWA 4AEDC 1YFYA 2W1QA 1L7RA 4UI9L 5FP3A 4CDUA 4CUAA 4LPLA 2JICA 3D4KA 4GJZA 1VBA2 2NMOA 2JKBA 4RS5A 1US2A 5AFEA 2R072 2XJTA 5HCBA 3VKOA 4O65A 2J1TA 2QZ2A 4NUBA 2A70A 2Z4FA 4YW6A 1HIXA 1NLQA 2PHLA 1G6NA 3MHZA 4QU2A 4YM3A 1GZ9A 1EYBA 1Y9GA 2JG9A 2QQKA 1POV0 3IT8A 1W6MA 2LROA 2D6LX 5A80A 5IJRA 3I2FA 1QXJA 1P8JA 2YZ4A 1PHMA 1BZWA 1F2NA 4RS5C 5FUPA 3U1XA 1CAUB 1XBFA 4XE9A 1OA3A 3BN6A 4M4PA 4AVTA 3D3AA 2YU2A 3FL7A 5CZKA 2OZJA 1DQ6A 4IV3B 4JKKA 4MGQA 5I8SA 4AHYA 4NIHA 4OCTA 2YY1A 4ET7A 1UX6A 2OUHA 5KXCA 2JDMA 2PN5A 4QM8A 4XDQA 5J36A 3BVCA 1MPXA 3ES4A 1WCDJ 5FZ8A 5F32A 3Q8AA 2QQWA 2WFF3 4C91A 1FV2A 5L7OB 3PU8A 1RITA 2CNAA 4H55A 1QH7A 5KHIA 1ENRA 2BW8A 1VMJA 2AZ5A 5KWRA 4YNIA 1H2KA 4ISRA 2BFUL 2A73B 3THCA 3MIBA 1PK6C 4HKOA 2V09A 4LK6A 4LNVA 2WO3A 4AFDA 4CYDA 2VUAA 2C0ZA 4CP2A 4PIXA 5K9YA 4XUNA 1DQ0A 2VXJA 3M4FA 2GU9A 1WBLA 4XUOA 5A6YA 1I5PA 2W1SA 3MLKA 1TG7A 1MQTA 4FXGB 5HXMA 2HWF1 4MGSA 1Y43B 3CO2A 3WD5A 4P9GA 3MW3A 3I8TA 4B3NA 4P9YA 2RS32 2PQQA 3ZOIA 5A1LA 2HJIA 1GBGA 3UKVA 2GMMA 5KHGA 5DN2A 1UU6A 4XHXA 4A3XA 2RVAA 1VBD1 3H7YA 5DABA 2JIGA 3OUJA 4D94A 3OUHA 1QHDA 1PM7A 3VDCA 4WVWA 2L9LA 4BPZA 4M0HA 3T4HB 4P08A 2YGMA 2Z2SB 5EPAA 4JX0A 3HBZA 3PIJA 4OHYA 5FMOS 3I2DA 3GJAA 3WNLA 1X50A 4OI0A 3AZXA 2BZDA 3PVBB 4CDXC 1H1IA 1S0FA 1MQTB 4FFIA 4PQ9A 4Q4Y2 4IESA 3MLLA 4QX0A 1MS9A 5A1AA 1U5XA 2EIGA 3PMEA 3DYOA 4UF0A 4AG4A 2H6CA 3QH7A 5A3PA 4IV1B 5LW9A 3C7GA 2VMFA 1YC61 5D8AB 5IK7A 1SFPA 5FZBA 2DFBA 2QQOA 1D4M1 4CCJA 2R041 5I91A 2RDSA 4Q4X1 4OHXA 5GKAC 2Y6LA 1SBDA 2GNDA 4BQ2A 2WO2A 2AENA 3MDPA 3P1IA 3NMBA 4C1XA 1CAWB 2PHXA 3UKTA 4BISA 1W90A 3U0ZA 2XWBB 2ZHLA 2AEYA 4V2WA 2RS31 3ZFEC 4TWTA 2XBO1 2JDZA 3LDBA 5FZ1A 3QOPA 4JGZA 3IMMA 4QQOA 4NIIA 2YYOA 1JOBA 5CU1A 4H14A 1FT9A 2HWF2 1AXYA 1VP6A 2UURA 1OF4A 2Q1ZB 2ZGUA 5A70A 1PGW2 2P3JA 2QKDA 3H9AA 2XB6C 5A7SA 2B7YA 5B2GB 1G9AA 1CJDA 2D3RA 2XH6A 3BIWE 2D6OX 2XR4A 4BM8A 1POV1 2WNVB 1BXHA 2UU8A 2BBAA 3J9SA 4LO8A 2P6HA 2W5FA 2ZHKA 4LXLA 1LR5A 3H1YA 4C0BA 1Y3TA 4EWEA 5C8WA 1AHSA 2CTVA 2Q1FA 3NAPB 1U5IA 5GLZA 5LBFA 5LBBA 1HLCA 1F4HA 1SPPB 3ETPA 1K5JA 1XSQA 1F8VA 1HJFA 5F39A 5FZ9A 3FHIB 4KU8A 5A7QA 4XIOA 3OOXA 1VRH1 5C8CB 3R4DB 4YVSB 3TEWA 2KXLA 1XU1A 2VCBA 2Y0IA 2BOIA 4AXOA 1YO8A 4QDSA 3HQXA 5LB6A 1O3SA 1NUKA 1XOYA 3VZMA 3LB9A 4FFGA 1S0CA 1Q56A 5DAXA 3EYPA 1VLNA 4NRQA 1JODA 2J42A 1CQ9A 3N9PA 4RR3A 2E51A 2DFCA 5BUVA 5HV4A 3KV9A 2WWUA 5LEJA 3J26N 2QNKA 1JW6A 1D4M2 2FDJA 1UAIA 2W1UA 4BOWA 5BNQA 3WNKA 1QJY3 5F37A 3AXEA 1H1AA 2DCJA 1ZRIA 1VBE2 3D0SA 2BU9A 2D5FA 3KZ4C 5T55A 3RI9A 2X10A 5K4LA 1DP0A 1H6XA 5DUUA 5FY4A 4EYUA 4GKXA 2WT1A 4P00B 1LTEA 2OIIA 3T4VA 1JN2P 4XABA 3RRDA 4QPIB 1UY4A 4DUXA 2ZA9A 1ZA7A 3SCFA 4BZ4A 3KF5A 4Q27A 1A6CA 3I59B 3DCQA 1WW7A 5B4XA 1EV12 5BNOA 1UY2A 3WF1A 4IGPA 4YG6A 2FDHA 3NVCA 1IS3A 4XBNA 2JDNA 2YROA 1BK1A 2Y60A 3IN9A 5IYYA 4SLIA 3VBHA 3WHUA 1CX4A 4CUCA 1I1EA 2YC0A 3JBG1 1AR91 3CJIB 3J7NA 4S2DA 5FMBA 3ZMNA 4CU7A 3SCGA 5FXXA 3KCCA 3NNGA 1XYOA 3PURA 2ZEWA 1UZYA 2A6VA 4JDMA 4QPGA 3WY6A 4INDA 5J09A 4HN1A 5FYHA 1SFYA 4EV0A 1LHVA 1OQEA 4PBPA 1OLRA 3OPZA 2D40A 3IDAA 1LOFC 1PO23 3BU7A 3VBSB 3M3CA 3VZKA 4AI0A 2RDQA 5FZKA 1OVPA 3E5XA 3OJBA 4AFMA 1DU3D 4JHZA 4D6SA 4DB5A 1ULFA 4QPGC 4BB3A 1ENXA 3GZTB 1NCRB 2AGSA 2K2SA 4NRPA 4ONUA 3BTZA 4GJYA 3ZYFA 3OBTA 1H1MA 3UJQA 1RUG1 1QU0A 4QXKA 5IVCA 4RD7A 1W28A 2VO5A 3B5LB 2HWD3 3KB5A 2VZOA 3LE0A 3VBUB 5KHKA 3GZAA 4B4QA 3RNSA 2K46A 3N9NA 3VBRC 3TB0A 3BODA 2EF6A 1ULEA 1EY2A 1U5ZA 2OQ7A 1OVSA 2YBPA 4UBHA 2D98A 2VQUA 1IGOA 3D0JA 5CG8A 5HBAA 4Q2FA 4MYEA 3ZFGA 3ZYHA 1W9SA 2PHDA 5FYZA 3WDWA 1BQPA 2QZ3A 1CVNA 4I3GA 5CYYA 3ZYJB 2ORZA 2OUJA 3K4AA 1SG3A 1UY0A 4D3WA 2J1AA 3WG2A 3DGTA 5GZGA 5C3QA 4EWDA 3CL1A 1BBT1 5FYCA 3GM8A 3T0AA 3RDIA 4IEVA 1UIKA 4XILA 1QJX3 4W6YA 2A5ZA 2B9UA 1D0GA 3H1MA 3NJZA 1VBB3 4K1ZA 1PVC2 2GMEA 3VBOB 2D43A 5G05L 1W3VA 2EXKA 1BK0A 2X8KA 3D82A 4HL0A 1O5LA 1TME1 4W50A 5FO7B 5LRRA 2DCYA 2HWB3 4FPFA 3ZFGB 3WV6A 4KWLA 3ZYBA 1OPOA 2PAMA 3KV6A 1PX3A 3A22A 4RHV3 3MEPA 3BALA 3D5OA 3H0OA 5LA9A 5CG9A 1GOFA 1UWWA 4HPKA 4MGZE 4OLLA 4Q4W3 4QAWA 5CKQA 1GQPA 5EFUA 2J1VA 2RV9A 4FOVA 1FV3A 1Z78A 1F31A 1MS3A 2B39A 2GP3A 4E2GA 3ES1A 1KJRA 3MIDA 2ZMLA 3U4SA 3JD72 1LCLA 2VNOA 3NV1A 2W52A 1JBCA 3U4XA 3V0BB 5J7MA 4FSJA 4X8NA 1JZ4A 2A6YA 5FZCA 1A8DA 4MGKE 5FZ6A 5C9AC 2YU1A 2JXAA 5T5PA 3ABZA 4GZ9A 3ZXDA 1M4WA 1PO12 4EZ4A 4JGYA 5I0SA 4H3WA 3BYWA 1PMIA 3MPPG 3AXDA 1GLHA 1FI2A 4MG2A 2ZABA 3AVRA 5LBCA 1GANA 3MIEA 1US3A 1BVVA 4XZPA 5A7WB 3IWZA 1F15A 1ONAA 4E4DX 3NL1A 1W99A 1KXGA 4AFAA 1EPWA 5F8PA 1I3HA 1DQ2A 4YVWA 1UPSA 1VBC1 2FCVA 3A21A 2UYBA 5FXWA 3W21A 2PTMA 4IUGA 1GICA 3AZZA 2WA3A 2DDUA 1AJKA 4GH4B 5K0UC 2HEVF 3LFIA 3IIAA 4RHV2 5FLIA 3OYWB 4Q4X3 5LK7B 4OHZA 2Y6KA 4LBQA 4KH9A 5LK5A 3O0XA 3VDAA 1LOCA 2WIIB 4CPBD 4D0QA 1O3QA 1OH4A 2W9XA 2VZUA 1MVQA 1QIQA 2QQIA 2WN2A 3P3NA 4RHV1 2FMYA 3SC7X 3WW1A 4EN6B 1VB2A 2BNNA 5DQ0A 4J6GA 5CFDC 4FQZA 1SLIA 1OFSA 3NV4A 1UD1A 4Z82A 3PVEA 4XAEA 4BQ4A 1LB2A 4XQDA 1E57A 5CNAA 2I07B 2Y6HA 3JD71 2WYSA 2VOKA 1X9TA 5CFCC 3O1VA 4CDWA 1O7FA 2HWC1 3ZYRA 2XKPA 1YEWA 1BEV3 1NXD1 2QBXA 4J25A 5CIRA 1MS1A 4KI5M 1RUE2 4E2SA 4WM7B 4LT5A 1DG6A 1HX6A 2J1SA 3ME2A 1W9YA 2RJ2A 4XF4A 4DPNA 4GA9A 1SLBA 4QKDA 1TE1B 4CDWC 1HJGA 4PI2A 1AYM2 1GWKA 1EAH2 4ISQA 4LO5B 2ZGOA 3V65A 4CA9A 3T0BA 4IV3C 2QVSB 3DKWA 3R0RA 3VDDA 4CCLA 3IAPA 1VAVA 2VBDA 3VZJA 2FZ2A 1NE6A 4ZPIA 1W9WA 4XTMA 3AP7A 4X8PA 4K1YA 4B1MA 2J1RA 2R061 4DMIA 4CU8A 5FIXA 1UMZA 2RG4A 4YW2A 2W3JA 4GD4A 3UV9A 1KJLA 4D8MA 4Y1ZA 1VALA 3WDUA 3HMYA 5F5QA 4GAZA 4HT1T 3VDDC 2XJVA 5E6HA 3LDRA 4HVQA 4NOTA 2XLFA 4H2AA 1X9PA 1JYTA 1RINA 3JCIA 2BQPA 4R9CA 1SLTA 2IVJA 4YG3A 2W92A 5JPMB 2MHFA 1QF3A 4IQPA 4DXRA 1C8M2 3WUDA 1V6MA 1RUE1 5C3RA 4ASLA 3AMPA 3CMGA 3IDEA 4AHZA 5JPNB 4WVZA 4NPLA 3ZXGA 2JG8A 2ZGRA 1QH6A 1VJ2A 3KS7A 1ZRDA 2P3YA 3MO4A 3BGAA 4I0BA 3I3QA 2ZS6B 2ZXQA 2LRPA 4IE0A 3NO8A 3AMQA 4FPEA 4L9BA 5EWSA 5FY7A 3RPQA 1W6NB 3CBNA 3W9AA 4PDWC 4BIFA 5FOJB 2A75A 2P1BA 5FFOC 1ULGA 5APAA 3CQOA 1BJQA 2VZSA 2RE9A 3WDYA 4MLOA 1JU4A 2FZ1A 4XTPA 2RM23 5JXHA 2HWF3 3TN92 4UFKA 3CZJA 4AEJA 2QQLA 2YPJA 2PHUA 3UYJA 3AP9A 4ZXEA 2JG8B 4MVTA 1RUH3 3CJIC 1JS9A 2P6CA 2FBEA 3MGUA 3DECA 3BB6A 4JQRA 1HDKA 3VKLA 5EIYB 1WA6X 5IT6A 5KC5A 3WF3A 3GBWA 1XE8A 2VE1A 4A45A 3GALA 1N47A 2ARXA 4JV4A 2WABA 2R7EB 5FPBA 2OVUA 4FOYA 3TNPB 4DIQA 2E7AA 2IXIA 2XUEA 1C8M1 3O12A 4Q29A 4N7UA 3L2HA 3NKTA 4Y1XA 3WNPA 1DGWA 2Q8OA 1V6IA 1CZTA 2QQNA 2VMDA 3ZFEA 4AAXA 1MS8A 2VUDA 2ZX4A 1NKGA 5FZ7A 4XCBA 1C8M3 1IS6A 2GC1A 1HXS1 1VRBA 5HCAA 3UGFA 3HJRA 2JDPA 3CNAA 3WQ0A 3RZLA 1RXGA 3VBUC 3WF2A 2YMZA 4FPCA 4R4XA 3VKFC 4CDXB 1COV1 2FMDA 1LOEA 5FRAA 3VBFC 1AL23 4IE7A 3ZSJA 2EXHA 5I0DA 1AR93 1OD3A 2DYCA 2ZGMA 5IUQA 2VXRA 3I3DA 5DG2A 3CIHA 3GCXA 1SQ4A 4IEQA 2HWC3 2ZHMA 5A7OA 2CYFA 1H2LA 5BNPC 1NAEA 5G04L 3HNMA 1IKQA 1CAXA 4Y1YA 5A7PA 1W2OA 5C8CC 3LQCA 3O1SA 2FDKA 2RS53 5KXDA 2RS51 2WA4A 5ABJB 4E27A 5IVBA 3KVBA 3A23A 3ELNA 4DS0A 3SNMA 4XPVA 1CAWA 3CU7A 2AR6A 5FREA 1RMU3 3MIFA 2JENA 4QXHA 3ZDSA 4RSUA 1YQ5A 2C9KA 2JDUA 4QXCA 5F1RA 5JXGA 4BU2A 2GC0A 2GC2A 1C5IA 2A7AA 5K8SA 1C8NA 3MF9A 5FP7A 3EMRA 5JR2A 2OZ6A 5FZGA 3T2QA 5IWFA 4QHOA 4FCAA 2MPFA 1EUTA 2RR13 3VHPA 2VC9A 4HANA 4UAPA 3ASIA 2DUOA 5JZGB 1GNZA 2VMHA 4CVUA 2KD7A 2J1UA 4OI4A 2IFWA 2K9ZA 4K40A 3EQEA 2W1WA 4N43A 1ND2C 4YZ4A 3THDA 4Z8BA 2C6SA 1MS5A 1W8ZA 2QJVA 5A33B 4QPIC 3WF4A 3C7OA 4XVHA 4LHSA 1SPPA 3IKWA 3M3EA 5EQUA 5C3PA 1N3OA 1XE7A 1HRI3 3B3QE 3Q8EA 1RB8G 5BNOC 3SLIA 5FPXA 4ITCA 1OHFA 2WAAA 2ZBJA 2BERA 2R073 1FMD1 1ND2A 1QNYA 1YJKA 5JOZA 2IFRA 1OQDA 2W68A 1ASJ3 4Y24A 5LRSA 4HFSA 4D7TA 2X5IB 1F4AA 3BI3A 2YFZA 4RQPA 5E16A 1LHWA 2VZ3A 1C3HA 2DCKA 3N7MA 5LA0A 1W04A 4Y5Z0 2DURA 3ZFFB 1RYYA 1ULOA 3AZWA 5F2SA 4AYUA 1R082 1XYPA 4XF0A 2JD4A 4LUKA 4CCCA 4W65A 1QQP3 3AM2A 1RUG2 3ILNA 2NLRA 1FOD1 4Q4Y1 3BTXA 1QXPA 2RS52 5JAXA 4GMP1 4QX2A 4FAGA 3MUZ1 2BP6A 5C6CA 4OZOA 2HWE1 1HV0A 3LF7A 1RUI1 4DUVA 3S5QA 3EHKA 4I2OA 4L92A 3ZN6B 2Y34A 1RUJ3 4HOOA 4ZU7A 2FHRA 3FHQA 2WYFA 2D6NA 4XF9A 2X5IA 1TME3 1AL22 3A4UA 4URAA 3FBYA 3NJVA 4NN0A 3ZPOA 3RG0A 2B42B 4UYBA 2AUYA 3KM5A 4W6WA 3WP5A 1WD3A 2XQXA 1D4VB 3OEAA 4H7LA 3LSDA 2Q8EA 5KHJA 1CIWA 5C33A 3O1MA 3BTAA 1AYN2 1DGLA 4OQ9A 1G9DA 4R4ZA 1EV11 3R6SA 1OC1A 4J1WA 3RYRA 4JGZB 2CDOA 2QFEA 5FXVA 2ZTNA 1VBE3 1A34A 1ND3A 1OD5A 2JE8A 4GIQA 4IL7A 4UXAA 1NCQC 1JYWA 3WQ1A 1PVXA 4R9DA 3OBZA 5FZEA 3C7FA 1YHFA 4LA2A 2BWCA 2HWB2 1NLRA 4URTA 4O9GA 1MEC3 3ACFA 2ZX3A 5FBZA 5FMCA 4ZU5A 3GHNA 1N1SA 1KS4A 5AC91 1S0BA 1A78A 2ZMKA 4FXKB 3KQRA 3DKQA 5A3TA 4EWAA 1SLAA 3BOPA 2PLV2 1YQ6A 1W06A 2H6BA 4UFLA 4E4ZA 3R4UA 2VCCA 2HYXA 3MW4A 3INAA 1RUH2 4IDZA 3THTA 1N3QA 2ZGKA 1UOBA 1DCSA 5JMOA 4UW6A 4CDUB 1CZSA 5JMCA 5SV5A 3RQ0A 3PUQA 4M4RA 4ZU4A 4Z1VA 4P9XA 1JMUB 2ARBA 3S57A 1OFNA 3J7MA 3WX5A 5ANNA 4LLOA 2Y6FA 5L9BA 3PUHA 4CEWB 4NHMA 1J58A 1YRZA 5CAZA 2OX0A 1NQDA 3HR9A 4D7SA 1UZWA 2VZVA 2VU9A 1XPWA 4LHNA 3VDBA 1VAMA 4WZCA 2C24A 3C3VA 3GBGA 1RIRA 2BUKA 4MHUA 3VBRB 2GNTA 2VNGA 4PLMA 1TMF1 4XYXA 5I8TA 2WZEA 1H8TA 4ZONA 3NKGA 2Q8CA 3I2KA 1RUNA 2DU0A 2DTYA 2WZPP 2ZGLA 4CCMA 4XQWA 4PJYA 1W6OA 3PTRB 4CDQC 4PHZA 3FWEA 3ILFA 2BRTA 3POJA 4LBQD 1IQDC 4MXVA 3T30A 4QDRA 2UY8A 4WBBA 4Y1UA 4BQXA 3W5MA 3HWJA 1OUXA 5T5JA 1SCSA 1RUE3 4QMAA 1H8TC 1DZQA 1NA1A 1DYKA 4OQ8A 1IG3A 1K5MB 1LOBA 1FATA 3WSOA 1HQNA 2V4AA 2R1BA 1PO11 1AR61 1JYNA 1UPIA 4QX7A 3POBA 2A3WA 4LMFA 5T52A 3LIGA 2R32A 3VBOC 1RGSA 3E6BA 4BK5A 1WMEA 5HCFA 3PJQA 4NR1A 5E89A 3RI8A 1NLSA 4W6XA 5LASA 1HB3A 4XF3A 3FE5A 1QKQA 1XNCA 4CCEA 3DUIA 4AEDB 4YZ5A 4MGYE 5JSOA 2E32A 4ZZ5A 3S0MA 1Q3EA 1QQP1 3IBMA 3WVJA 5C3OA 3LZZA 3GXUA 5IAVA 4ATFA 4UFIA 1SMVA 4Q0UA 4A3ZA 4RFRB 1W0NA 1G9CA 1QMJA 2WDBA 5E8AA 5FP9A 3NRUA 4LE4A 3RZZA 2C4XA 5LY1A 2UY9A 1TMF2 3M8LA 3OB8A 1OXCA 5C9AB 1GSLA 1C4RA 1W9FA 1GR3A 4LUMA 1YI9A 1XNBA 2C5DA 2VPVA 2I74A 4AOCA 5ACA3 3CEWA 3RVHA 2QTWB 1AJOA 2YBKA 3AMHA 3S6PA 4AEDA 1D4M3 1UYYA 1XYNA 2Z42A 3HEIA 4Z07A 1NZIA 5EV7A 3TWIA 4B4RA 1B35B 2ENRA 4A4AA 4IE6A 2GN7A 2IXHA 3U14A 2NPIA 1X82A 3N9OA 4KGGA 1W6PB 3USUB 2H0BA 3NNLA 3QD6A 3O1UA 2YGLA 2OT7A 2GC3A 1HN1A 3E5UA 4HVOA 1UNBA 1UYXA 1S0DA 2SLIA 1U12A 3HT1A 5F3EA 3FUQA 1OURA 4CSWA 3GCWA 3K3OA 1LOAA 3M70A 4AFBA 4JZRA 4C0HA 2VAUA 5F3IA 4BXSV 5FZLA 2PHRA 2BGCA 3VL8A 4LBLA 1WMFA 1GNHA 5ABJC 2WINB 2LM3A 1JZ6A 1VBD3 2PHTA 4XJWA 5F5AA 1AX1A 1N1YA 1UN1A 2EIEA 2D6PA 2HH9A 2VL4A 1BLZA 4Q4V1 1X7NA 3HQUA 4AGVA 1YXWA 4Y5TA 3F2ZA 1V00A 2PMWB 4F3JA 4COWA 5JUVA 2WS92 5CFCB 2KA3A 2WKKA 2WNVA 4Q0VA 4JTOA 5ACA2 5LA1A 2I2SA 4BJ0A 2NP0A 3PMSA 4EROA 1RUG3 4UFJA 4OI1A 1YQ2A 2BTVC 3VUOA 3OBAA 4M01A 1LECA 3HD8B 4Y3OA 2HKXA 1HKDA 1QXRA 2VQTA 4QKFA 3C7EA 2IUWA 2J22A 4L0PA 3I7DA 1LODA 3ALQA 3MUY1 3OTFA 1S2EA 4EN8B 1RUF1 4FTSA 1AVBA 4FT8A 3CLPA 5EXOA 4PDWB 3H8XA 4TLGA 4NROA 3ZYIB 4KG8A 3LEGA 3RMYA 2FD8A 4W8JA 2JB8A 2R071 1OF3A 1S0IA 1W6QA 4KBBA 1W8TA 3ENRA 2R0HA 3PVOA 4N8MA 4UWDA 3UJOA 2DBIA 4NPRA 2GP5A 4DQAA 3RGBA 2VMCA 2RR12 4Q5OA 1LEDA 3ZFFC 4FOWA 4WM8C 4IEUA 4R8HA 5D21A 4YVWB 5FY8A 4PLNA 1FAYA 5C4WC 4YM1A 2WT2A 3MZHA 3JQXA 4Z2WA 3H8UA 2ZKLA 4HPKB 5JI9A 3RJRA 5ANQA 2PFWA 2NMNA 3UKNA 1W8FA 4YRDA 1RUJ1 2F6BA 1EAH3 2YUEA 4LULA 4FPYA 3ZIWA 4FAHA 2OS2A 2VOTA 2YFUA 1WLDA 1V6JA 3FZ3A 3JBG3 2WFF2 5A3NA 1UU4A 2RM21 1K42A 3VHNA 1O4YA 5BY5A 3H1WA 1JOPA 1W39A 3RWKX 4HKWA 1CJPA 2ZOEB 4NMIA 4Q1RA 2ZAAA 1RMU2 2W91A 3WNNA 3ZSEA 5GZEA 3FLPA 2VNRA 2BVVA 2FCTA 3B01A 3NNJA 4S2GA 3VHRA 1BKZA 5CA6A 4QGNA 2PLV3 2WBKA 5HXVA 4CUBA 2FDFA 5JOYA 2GH2A 4Q4W1 4CCDA 4ASMB 1QJY2 2WNUB 5FO8B 2JIJA 3KLSA 3G6JB 1JTZX 5BNNC 4BQ3A 3KV5A 3WP6A 1REDA 1UXZA 2C26A 4JGZC 1XSRA 2B4KA 2PHWA 5FYUA 1CESA 4XFAA 5FPVA 5A3MA 2ZGPA 3GYDA 2VW2A 2XBO2 3IZOA 3POYA 5DUWA 3ST7A 5GLTA 1GZWB 1RUD3 3JU9A 5BNPA 1KFXL 2ZGSA 1N3PA 2UWCA 1W8OA 2WN3A 2DUQA 1RUF3 4LO4B 4HSJA 3KT4A 1QDCA 4LA3A 1D0HA 3I2JA 1ZZ6A 1RUD1 1KD7A 1NY72 2XWJB 3AB0A 3ON7A 1SBFA 4XUQA 4DY3A 1RJ7A 1OPMA 2EAKA 1GU3A 1O3TA 4OVEA 4E8DA 4B4PA 3T1LA 4IE4A 1ZZBA 4AHXA 1AUYA 1O4TA 3I2GA 3OG2A 1FOD2 2C1FA 5FBJA 3TNQA 3U07A 4AAPA 2XJRA 3OD4A 5FP4A 1RC6A 1EPZA 1D2QA 1EAH1 3SQOA 3UK9A 4CRQA 3VKNA 4IXLA 1UXXX 5CKNA 4P5YA 3AZVA 4AL9A 2C9AA 4N43C 3PL0A 3MICA 4OHVA 5JSRA 2YDEA 1PIV3 4I3PA 4RS5B 5JOXA 1A8MA 3J8F3 2P34A 4HK9A 1PK6B 5F5CA 5M0TA 1URXA 2D3PA 1MEC2 4IEXA 1LHUA 1ZBA2 1G86A 3M1HA 4IEZA 2ZX0A 4XFFA 2JB4A 1VBE1 4AI2A 2B46X 2CGNA 1H9WA 2ETEA 3LCPA 1UMIA 4EN7B 1Q8VA 1HN0A 1H30A 4Y22A 5I93A 1LKNA 1JHJA 2OPKA 4NAOA 3T2OA 1V9U2 4LO6B 2Y8KA 5AVAA 3OGGA 3SITA 3WZ1A 3MIGA 4LOTA 5L7OC 1HXS3 3N7LA 3POIA 4DOUA 5FJKA 1AR63 3O1OA 1N1VA 1RUD2 2YHJA 5BPXA 3WEZA 4META 3VBHC 1SZBA 1PK6A 4UFHA 1OH3A 1ZVFA 4OI2A 5FQ0B 1QJFA 3PNAA 5L7OA 3IB3A 5IK8A 2XLGA 5JIAA 3NV2A 1J1TA 3V0BA 3ZM8A 3U10A 1E5IA 1OKQA 3B00A 4XCAA 1FOD3 1MZEA 4IW3A 3OSDA 4KMQA 1MQTC 1LOFA 4QPYA 4UW5A 1C57A 4GWJA 4TN7A 4AQSA 5IAXA 2A71A 2JE7A 4K6BA 3RYPA 3AC0A 1VBB2 4Y4RA 4IGQA 4QU1A 2BYVE 4AQ6A 4D69A 4RL7A 2W39A 3K75B 4A44A 4OMDA 4OUMA 2WLQA 3SHRA 4PF5A 2XL9A 1JI6A 3PIGA 1H0BA 5H9RA 3TEXA 1NXMA 3AYEA 1PM4A 2OKXA 1G9BA 1NOVA 2TUNA 1Q43A 5LZ6A 1GUIA 3E5QA 3T3YA 1ZBA1 3GGLA 2PYTA 3PLQA 3WDVA 3O1TA 3AMMA 3K48A 4MXWB 4XMIA 4R9AA 3DPRB 4IETA 4AVCA 4Q0SA 1CPNA 4XJUA 1U5YA 5FKCA 2W08A 1R1A1 3OGSA 1SFNA 4DINB 3ZFGC 2ORXA 1N1TA 2KR2A 3J4UH 5GJ6A 2HWE2 1CONA 2P37A 1HXS2 3WT3A 1ULDA 1GFF2 1O4ZA 1IS5A 2D6MA 1R1A2 2XJQA 5FUNA 4CTEA 2VTXJ 2CWMA 3B9IA 4D6RA 3VD4A 2WRAA 4NHYA 3W58A 3I2HA 1CAUA 1JYIA 5L36A 1FNZA 4F83A 2F17A 2JKXA 2QCSB 1D7PM 1S1AA 3NAPC 5IK5A 1WCQA 2UWAA 2LALA 5JVVA 3WG1A 2CAUA 1OOPA 1WBFA 1SEFA 3ZN4A 2RS11 2D6KA 4YZ1A 4CEWC 3EB7A 3OEBA 3N9MA 1UO9A 4P5HA 3T0DA 2DVBA 2I45A 4ZZ8A 2XQRA 2VECA 1V6KA 4I0AA 1ODNA 2BBVA 4TXWA 5FPAA 3S7EA 4PBOA 3GNEA 3J7HA 5JZGA 3PU3A 4B7EA 4JDNA 5ACA1 4DXTA 4WM7A 3GHMA 4FTBA 4CDQB 1ZBE3 2VCMA 4ES8A 2E7TA 2G4IA 2FDGA 4WV8A 1S4CA 1FX5A 1T2XA 4XBLA 1Q5OA 3O0VA 4PLOA 4QGMA 3H3ZA 1NA1C 2EVXA 1WCSA 4N7IA 3SMHA 1ZRCA 5JZGC 3UESA 3AYCA 3AL5A 4LKDA 2IXLA 4WM7C 1DYPA 1VRH2 4QX3A 1SLLA 3RWNA 2D97A 1UCXA 4F7ZA 4QXBA 3SH3A 3AP4A 1WW5A 5JWPA 5KXBA 1G9FA 1PMJX 2QQMA 2W2IA 4FFHA 4G3YC 1J84A 2YC2A 2VVDA 4COUA 5F9TA 1IG0A 2O0OA 4RGAA 1FXZA 2RJKA 1CAVB 4HXCA 1LHNA 4JGYC 5FZ4A 1ZNPA 2ARCA 1LGBA 3IIIA 1ZX5A 4RR3C 4XF1A 4XMAA 1QJEA 1UYZA 1LJ7A 1ZZ7A 3VGIA 1H2NA 3WXPA 4LORA 2ZEZA 1CZVA 2P3KA 1H8TB 3B93A 4O7XA 3CDZB 2JD9A 3M3IA 4I0WB 4YW3A 3VLBB 4ASKA 3S5AA 4MGTA 2E6VA 3AP6A 5FPLA 1W6OB 2ZEXA 4YARA 4O61A 2AEZA 3I54A 3K46A 3ZN6A 1RUH1 4GULA 4XAAA 4YVWC 5DAQA 3RMXA 3RZMA 4XOGA 3P6BA 5H9QA 1NA1B 2DV9A 4BE3A 4HN0A 2RR11 1W2UA 1EUUA 1S2KA 1WLCA 4XDPA 3LEKA 1RTVA 3K3NA 3K4DA 4ZS3A 2Q4SA 4HMZA 1KGYA 2R16A 2VD7A 2XUMA 4Q4V3 3ZLIA 3V56A 1XNDA 4JRLA 3JXSA 2BGPA 5GM0A 1Q8QA 2VTFA 3NWKA 3U37A 1IQAA 2BNMA 4RQPB 1AYM3 1AYM1 3ZVXA 2AACA 2HBTA 3MFAA 2IXJA 2WQ4A 5SV8A 4BDVB 1O5UA 4AI9A 5BNOB 1LESA 1DQ5A 1JYXA 5A6QA 1JH5A 1IHMA 2PQSA 5BNNB 4UW4A 1PZ9A 1HRI2 4UW3A 4XFBA 4P14A 1W3XA 4N53C 3FN9A 4NJ4A 1MS4A 3HQRA 4DRRA 2VM9A 3HN1A 4DXSA 3IPVA 1ZZCA 1D2SA 2LS6A 1HRV2 3GJBA 1H6YA 3C7HA 3PUAA 2RDNA 2Q30A 4LHKA 4NO4A 4QPGB 1RHI3 2G1MA 1MS0A 2Q0AA 5I0RA 1ZBE2 3O0WA 1NY71 1UQXA 5KC6A 1R1ZA 1UMHA 1ENQA 3ZIXA 4IV3A 4JAAA 3M3OA 4DUWA 5FY1A 2AREA 2QQJA 1UZVA 1DF0A 2VVFA 4BWOA 5I8YA 2ZEYA 1YFUA 2Y6GA 3BPZA 3POFA 3POWA 4CP9B 2Q1MA 5FK8A 1AL0G 3UT0A 3WP3A 4AHWA 4FQ4A 1UU5A 5A7NA 3HAGA 4AR2A 5E88A 2VMEA 4G4FA 2GN3A 2WNVC 3W20A 5EZWA 3RFRA 1WD4A 1W0PA 1MZ5A 1YI7A 2CHHA 2DF7A 1ZA4A 3AKQA 2F4PA 1HQWA 3KGZA 4DY5A 3VZLA 1POV3 5JCTA 3IAQA 4CUGA 1R091 1BCXA 4GWMA 4RR3B 2O14A 3FLTA 1OI6A 4PCRA 1S0EA 1J3PA 1WW6A 2E53A 4XC9A 4HSLA 2QQVA 3ZMOA 3LAGA 2Z79A 5IVYA 1RVF3 4OMCA 4QKNA 4Q8KA 4LBJA 1CX1A 5FO9B 1KDKA 2O1QA 1CN1A 2R063 4LLFA 5IATA 3LOBA 2VULA 1K5MA 1UL9A 4EQVA 4A42A 5F3CA 2ZPXA 4PIZA 1ZBE1 3MI8A 5LEKA 2IXKA 3E97A 2LUWA 2BPA2 5IVVA 3TYJA 4CXYA 3CZUA 4LIUA 3ZKYA 2DUPA 2Y64A 4GB33 5FYIA 2VCAA 3T2TA 2HEWF 1ZZ8A 3WW3A 1K5MC 2GNMA 3GDBA 1FPN2 2RMU1 1QJU2 4E2QA 4FTEA 1MEC1 5DUVA 1UX7A 2WWJA 2OXBA 4Q4V2 1H4GA 3ZKUA 1IPSA 5F2WA 5C4WB 4GALA 3ZXKA 3RZJA 3N35A 4CXWA 1DZTA 5DUXA 1OUSA 4DXZA 2JX9A 5EJZB 1K45A 1COV3 3Q8BA 1KFUL 1F9KA 4XFHA 4Y20A 5FWJA 1SDDB 4XJ9A 1X36A 1QEXA 5FAXA 1Z7S3 2E31A 5JOWA 1SDWA 2VVEA 1EP0A 1PGL1 1XNTA 4BQWA 4GQ7A 4CCKA 2X09A 1LRHA 1RUI3 4K9SA 3MV01 3O14A
chains in the Genus database with same CATH topology
2IXCA 2ZX1A 3AFGA 1JOJA 5FPZA 2ZGTA 1RMU1 3VBFB 3MLJA 4GMP3 5JR7B 5C9AA 1DHKB 1RUF2 3AJYA 4DRVA 1Y9QA 2V73A 1Z0HA 3KGLA 2WNEA 4IV1C 1AR62 1Q8OA 1HQLA 4XETA 1QY4A 1YFXA 5D8AC 3S30A 1LHOA 4COVA 3WP4A 5CADA 1RVF1 3DN7A 5GLWA 2ZAHA 2QDNA 4P9WA 2ET1A 4JVAA 4XJAA 1R093 5HI0A 1RUC3 2B8MA 1KS5A 2WZR3 3WOGA 4S2FA 1ZRFA 1B35C 5JIUA 3OGJA 3PTYA 4Y1VA 1BEV1 2VW1A 4Q4W2 1JHNA 1QQP2 2XHKA 1QJY1 1QJZA 4HK8A 2PAKA 4YZ2A 3VDDB 1AXZA 5AC93 2YV8A 4FPKA 2RJLA 4AI3A 1HW5A 4P9LA 1G7YA 3GF6A 2WWSA 1PNGA 1Z7S2 4MSVA 3WW4A 3AK0A 3SH5A 5CFCA 2XL7A 4Q8LA 4XW3A 5H9SA 2K0GA 4Y26A 3ZXFA 1GQHA 1MVEA 1DGRN 2DU1A 2HWE3 3PJYA 2JG9C 4Z92B 5F6LB 2ZMNA 1BVP1 1ZREA 1BEV2 1ASJ2 3WW2A 4QPIA 1VBA1 4COZA 3NV3A 1PO22 3WNXA 1ZRRA 1AZDA 2WLPA 5J98B 4BH9A 4YW5A 1YCIA 4QT6A 1I6XA 4ZXKA 4AF9A 4YVSA 1PVC1 4R52A 3D6EA 3FBMA 3KCYA 2R49A 1KQRA 4BLJA 2CY6A 3ZYPA 1JUHA 4EJRA 2GZWA 2WSUA 1X8MA 4YVSC 4HZFA 2QE3A 5DZGA 5FTTC 2JG8C 3Q9OA 4YM0A 3THPA 1REEA 2NN8A 1J3RA 4QD2A 2Z5WA 1CD3G 4HBNA 2DVDA 3OY8B 2NYYA 4GH4A 2CWSA 4LR4A 4MUVA 3OYWA 3I59A 3JUUA 4N90A 4FPHA 3RJ2X 4MH0E 2CGOA 4Q0PA 3LGRA 4QQ2A 1IKPA 3IDBB 4FVVA 4GH4C 3USSA 2MEV1 1PGSA 4KGQA 4CEYB 5K0UB 3O7OA 4YGCA 1VBC3 4BMEA 4N9HA 2AYHA 1VR3A 4AI8A 4WVMA 1VIWB 2WNUC 4AWDA 2WJSA 4IEWA 5BXXA 4CDXA 1HRV1 2Y38A 5FLHA 4XFGA 5J37A 3JD73 3CJXA 4LHLA 3FFQA 3AJZA 2HYKA 1RUOA 4K20A 2DWRA 2EA7A 1XRUA 1R083 3A0NA 3QBQA 4QHBA 1C28A 3H7JA 1RUI2 1UKRA 1Q8SA 3U11A 1F5JA 1V70A 1IPJA 2DCZA 1VB4A 1V6LA 1PO13 1TME2 4M3CE 4CEYA 3JB4C 4PIYA 4U36A 1U0AA 1XU2A 4XXAA 4WVMB 2Y0OA 4XJ8A 1WW4A 2ZCWA 4P9JA 4XMIA 3PVNA 1O3RA 1CGPA 4ORFA 1QJU3 2ZACA 1AYN1 3AZYA 1DIWA 4MXWA 4AEKA 1RL3A 1NCRC 2A6XA 3B02A 3HIFA 3RSJA 5E1RA 4I09A 4U2AA 1YIPA 3TN93 1LOGA 1OA2A 1AYN3 3MFCA 1UKGA 4NVPA 1PZ8A 3WDTA 4XJZA 1FYUA 2XLAA 4AFCA 5EYYA 3V0AA 5J96B 5GALA 2ILMA 3VHOA 1J59A 1COV2 3AKPA 3FX3A 1QJX1 5F6KA 3PHMA 4QX5A 4FBFA 1BMV1 4N9IA 5T50A 3GZUC 1OLQA 2R043 1UF2C 1S2BA 3KCXA 5FLJA 1GYKA 5BV6A 4YGDA 3VV1A 4BCUA 3T1MA 4WVVA 5J3UA 2GALA 5A3LA 3RYKA 2XBO3 3V0AB 4EN9B 4YFZA 1ZYBA 4X6QB 1PGW1 2NQYA 4LTAA 1YYNA 3AX4A 3FMGA 3EO6A 4MV2A 1J3QA 1R1A3 4YW1A 4YGBA 4LBQB 5IK4A 1XNKA 3KT1A 3ROUA 5KBFA 2R1DA 4A7YA 4BLIA 3P3PA 1DFQA 2RS13 4IEPA 2HEYF 2IZWA 2BWAA 5A33A 1H8VA 1WA4A 3N7JA 4RQPC 1W6NA 3L2YA 1UW8A 1A3KA 2DCTA 1PGL2 1AR83 3N36A 3C2UA 4HETA 2DVAA 3ZFEB 4BA6A 5T54A 1M06G 1H9PA 3DPRA 5J48A 1OA4A 3ZPYA 4BQ1A 5CFDA 4LO7A 1AR71 1X33A 2RMU3 1PIV2 4OHWA 1NCQB 2ES3A 5CBLA 2LTNA 5DZEA 3POSA 2P3IA 1RUC1 2MEV3 3AKSA 4KWKA 4LBNA 1DLLA 1C1LA 1TQ5A 1C1FA 1RVF2 2OA2A 2B5HA 1YWKA 4AGGA 2H0VA 4H7MA 1QOOA 3WG3A 4KG0A 1X8EA 4YM2A 4XHBA 4COYA 1YNAA 2WFPA 5CFDB 4LBOA 1LGCA 4KWJA 1H4HA 3G7DA 4ZKTB 3MYXA 2ERFA 2PAEA 4A2UA 1NG0A 4G9SB 1ZM1A 4NWWA 3VBRA 4FO9A 5A32A 2XJSA 4L97A 2FQPA 4M00A 2IC1A 2QDRA 3TRSB 1V9U3 3QH6A 3R4SA 3QLQA 1RUC2 2XGXA 2CGPA 3WCRA 1G8WA 4MGIE 2VOWA 5I0UA 3UL2A 1PO21 2TBVA 3DV8A 2JG9B 1GQGA 2XG3A 4M0NA 1W6MB 5EYXA 3ZN5A 4JCKA 1ZZ9A 1CAVA 2KM2A 1IPKA 1OOPB 1YFWA 2RM22 1UZZA 2AH2A 2R6QA 2XVGA 3O5SA 1YIFA 3FC0A 2DTWA 3EBRA 1ULCA 1BYHA 1AR73 2VH9A 3W59A 3ZFFA 2GH8A 1HRI1 4BMBA 2G9FA 1S0GA 2EAAA 3B7MA 3LA3A 4B29A 1I9RA 4CDQA 1IZ3A 5L19A 1SBEA 1VBC2 1JYCA 1R092 4N43B 4LBKA 2OYZA 2HWD2 4L2NA 3WG4A 3JB8A 4L11A 3VBSC 3ECQA 2G9GA 1WUVA 3BOWA 1NZCA 3AKTA 2E9QA 1ALYA 3OD0A 1DDLA 1JXNA 4IV1A 4QGLA 1RHI1 5DXDA 3H3UA 3LA2A 1QDOA 1Q8PA 1J1LA 2VOVA 5D8AA 2VOXA 3VBSA 2JEMA 4YSFA 1SLCA 4TSVA 5H9PA 2BVBA 2EALA 2VG9A 5T5LA 3LWCA 1KRIA 1DGRA 2UWBA 4FP2A 2R062 1B35A 3DL3A 3ZSKA 3HT2A 4AW7A 3WLUA 4XEZA 1W0OA 3J8F1 4AVBA 4K3UA 4FPLA 3D8CA 2D7FA 3E6DA 5EJ3A 3VBFA 4XIKA 1B09A 2WSVA 1FPN3 2WS93 1DBNA 4KNCA 4KU7A 3BCWA 3WR0A 1IS4A 4BYYA 4JRAA 3TBDA 1REFA 1V6OA 4JTNA 5C8CA 3RS6A 1MZFA 3MIHA 5JSPA 2D5HA 2HWD1 1TEIA 5DZFA 3AKRA 4GXLA 1WCKA 3TN91 3ZXAC 2EXIA 1QJU1 1YUDA 2BNOA 4ATEA 1LENA 1XXNA 4I02A 4OZXA 3ZXLA 4O9EA 5GZDA 4CZSA 1RUJ2 5AFBA 4LEJA 3NW4A 3LOIA 1AX0A 1BBT3 3VZNA 1Z7S1 3AYDA 5L73A 4GKYA 4E9KA 2ZJCA 3DF0A 1ND2B 1VBB1 3KD4A 2NM1A 1DQ1A 1QOTA 4IEOA 2MEV2 5GZFA 3IDCB 2ATFA 2CV6A 5KHHA 1DQ4A 5K7PA 3WHTA 2JECA 4JC1A 1AXKA 1NE4A 1TMF3 1VBA3 2W0XA 3N4MA 5FOBB 1HRV3 4MX3A 4XQ4A 5BYNA 2BFUS 3KMHA 3ATGA 2WZR2 4M3CF 5CB7A 3ZYGA 2VUJA 1BMV2 3AP5A 3N7KA 3OBRA 4XFIA 4AVAA 5T3NA 1LULA 5I0TA 1MZ6A 1V9U1 4L8QA 1RJ8A 5GLUA 4NHLA 4OULA 3H50A 4BHPA 2X5IC 3AYAA 2A6WA 4PDWA 1SACA 2B45X 4AVSA 1L3JA 1MACA 3VKMA 2Y26A 1QWRA 2WNUA 5C4WA 2E63A 3MF6A 1LU2A 3SXWA 1H2MA 4Y20B 2ZGNA 2D3SA 1ND3C 4I30A 1W6PA 3CJIA 2VGDA 1PZ7A 1LGNA 4C90A 4GMP0 3ZO0B 4A7KA 5CVRA 4CEYC 3SISA 4K7JA 3OF1A 4QM9A 2ZZJA 1OSGA 3GBFA 4TLFA 5DDJ1 3NAPA 2N7GA 1OOPC 4CEWA 4NHKA 4AGRA 2WFF1 4YFWA 2RS33 2GDFA 2JE9A 4FPJA 3R05A 3ZX7A 2XVKA 5BNNA 2EXJA 3CF6E 1NCRA 2ZGQA 1OMIA 1PNFA 3B69A 1T6GC 2ZHNA 5TSWA 4IEYA 2GAUA 1O91A 4SBVA 4ES9A 5FDBA 2ET7A 5T5OA 2X53S 4NWVA 3VBUA 4YZ3A 1AF9A 2D44A 2QQPA 5DG1A 4A7ZA 3M3QA 4J1XA 3MW2A 3APBA 3ILRA 5GLVA 4KL1A 1GKBA 4YLZA 1DZRA 2E7QA 3VL9A 2A3XA 3ETQA 5FMOL 3QACA 3TOJA 1QGLA 4AI1A 4AE2A 4Y22B 1KITA 2V5YA 1QOSA 2DVGA 5KXEA 4BIOA 2GNBA 4LE3A 4WZFA 3LSEA 3AMNA 1I5ZA 4TZDA 2VQ0A 3KT7A 4YG0A 1LU1A 2VMGA 1W6QB 2VQAA 2XPJA 1AR92 4XFCA 4YGEA 4DFSA 4Q4X2 1YJLA 4QQLA 3VBOA 2P2KA 3VBHB 3JZVA 2BEOA 4EN0A 4FOQA 4TYSA 1R081 3SH4A 4I01A 4XXPA 5JI7A 2PA7A 3IMNA 4X6RB 4JDOA 2R0FA 1ASJ1 4Q1PA 4N53B 3KSCA 5GZCA 4M3CB 1FMD2 5DDJ3 4CP1A 1FNYA 3M2MA 3B9CA 4UBGA 2WL1A 3DPRC 1BBT2 2IWGB 1JUIA 3L9JT 4MZUA 1LEMA 1VBD2 1KDMA 1WMDA 3WQ7A 2JJ6A 4FP3A 4HVRA 4AVVA 3USUA 3V64A 2PELA 4FPOB 3IM0A 2ZX2A 2PLV1 3EXUA 3TAYA 4N53A 2X29A 5AC92 4M3CA 3URFA 2SBAA 2O8OA 2CL2A 3FUOA 3S7IA 1GZWA 1NQJA 5BNPB 1DGWX 3LKJA 4OFGA 4B8EA 3ZXEA 1IOAA 2P17A 1V6NA 4Q0QA 4Q26A 2XJUA 4YYOA 4AEMA 4XBQA 4AQ2A 1S0JA 4Y4YA 1WGPA 2D93A 1WLTA 4RGGA 2ZZQA 1APNA 1QJX2 4F8AA 4AK3A 1GZCA 4Q4Y3 5ABJA 1AL21 1UIJA 1FMD3 5DDJ2 4FPGA 5FCCA 1NCQA 1F5FA 4GB32 2A3YA 1YLLA 3ZSMA 1NYWA 1Y7BA 3ZXJA 2CAVA 4AQTA 3MPBA 4CDWB 4QQHA 3JBG2 3I4IA 2YXSA 3E6CC 1AR82 2RS12 2XJPA 3JQWA 1CPMA 2OW4A 2HWB1 5D1IA 1AR81 1XQNA 1WLWA 4D7YA 3FLRA 2TEPA 4R9BA 1RHI2 2HWC2 3FJSA 3ACLA 1EV13 2VMIA 2ZKNA 4JGYB 4DNYA 4HLTA 1PIV1 1FPN1 2RMU2 4IERA 4OUSA 4GB31 3A0KA 3K51A 4WM8A 3M7AA 2WT0A 5JLVA 2R30A 4S2HA 3ZSLA 2A6ZA 3QCWA 4YW4A 3AFKA 5JDBA 2O8QA 4QQPA 4C1WA 2XVLA 2TNFA 3NSTA 1TNRA 2MNGA 4HKLA 3WUCA 4DZGA 2VW0A 2Q5TA 2XKOA 4K21A 2RHPA 1OQ1A 1MR5A 2DVFA 4RA0A 2QUOA 4E4SA 1GV9A 2WQZC 1AR72 4KQ7A 1VAKA 4WM8B 3LA7A 3EJKA 4V1PA 3OCPA 5FQ0A 3FFZA 2VY0A 3J8F2 3X29B 4P9IA 1SCRA 2NZ9A 1TNFA 3B94A 1CR7A 1ND3B 3OY8A 4RFT0 3VN4A 3IPVB 2R042 1S55A 4L99A 3WCSA 3VZOA 3WINE 1AX2A 1VRH3 1ZBA3 4CDUC 1CAXB 2WC2A 1HV1A 4B7KA 4CP0A 2GMPA 2GSYA 1C5HA 5K0UA 2WS91 2PHFA 1PVC3 4LBMA 1ENSA 2Z69A 3WDXA 2WZR1 3SCHA 3N3HA 5A32B 4GWNA 4K8FA 2UYAA 4AEDC 1QNWA 4CDUA 1YFYA 2JICA 3D4KA 1VBA2 2NMOA 2JKBA 4RS5A 5AFEA 2R072 2XJTA 5HCBA 3VKOA 2QZ2A 5AVPA 2A70A 1HIXA 2PHLA 4QU2A 1G6NA 4YM3A 1GZ9A 1EYBA 2JG9A 1POV0 3IT8A 1W6MA 2D6LX 1QXJA 2YZ4A 1PHMA 1BZWA 1F2NA 4RS5C 1CAUB 4XE9A 1OA3A 4AVTA 2OZJA 1DQ6A 4IV3B 5I8SA 4AHYA 2YY1A 5KXCA 1UX6A 2OUHA 2PN5A 4QM8A 4XDQA 5J36A 3ES4A 1WCDJ 4C91A 2WFF3 1FV2A 5L7OB 1RITA 2CNAA 4H55A 1QH7A 5KHIA 1ENRA 2BW8A 5KWRA 2AZ5A 4YNIA 1H2KA 4ISRA 2BFUL 2A73B 3MIBA 1PK6C 4HKOA 2V09A 4LNVA 4AFDA 4CYDA 2VUAA 2C0ZA 4CP2A 4PIXA 5K9YA 1DQ0A 3M4FA 1WBLA 2GU9A 3MLKA 4FXGB 1MQTA 2HWF1 1Y43B 3CO2A 3WD5A 4P9GA 3MW3A 3I8TA 4B3NA 4P9YA 2RS32 2PQQA 2HJIA 1GBGA 3UKVA 2GMMA 5KHGA 4A3XA 1UU6A 4XHXA 1VBD1 3H7YA 4D94A 1QHDA 1PM7A 4WVWA 4BPZA 4M0HA 2YGMA 2Z2SB 3HBZA 5FMOS 3I2DA 1X50A 4OI0A 3AZXA 3PVBB 4CDXC 1H1IA 1S0FA 1MQTB 4PQ9A 4Q4Y2 4IESA 3MLLA 1MS9A 1U5XA 2EIGA 3PMEA 4AG4A 2H6CA 3QH7A 4IV1B 5D8AB 5IK7A 2DFBA 1D4M1 2R041 5I91A 4Q4X1 4OHXA 5GKAC 1SBDA 2GNDA 2AENA 3MDPA 4C1XA 1CAWB 2PHXA 3UKTA 3U0ZA 2XWBB 2ZHLA 2RS31 3ZFEC 4TWTA 2XBO1 2JDZA 3QOPA 4JGZA 4QQOA 2YYOA 5CU1A 4H14A 1FT9A 2HWF2 1AXYA 1VP6A 2UURA 2ZGUA 2Q1ZB 1PGW2 2P3JA 2QKDA 3H9AA 2XB6C 2B7YA 5B2GB 1G9AA 1CJDA 2D3RA 2XH6A 3BIWE 2D6OX 4BM8A 1POV1 2WNVB 1BXHA 2UU8A 4LO8A 3J9SA 2ZHKA 4C0BA 4EWEA 1LR5A 3H1YA 5C8WA 1Y3TA 1AHSA 2CTVA 3NAPB 1U5IA 5GLZA 1HLCA 1F8VA 3FHIB 4KU8A 4XIOA 1VRH1 5C8CB 3R4DB 4YVSB 2KXLA 1XU1A 2Y0IA 4AXOA 1YO8A 3HQXA 1O3SA 3VZMA 3LB9A 1S0CA 1Q56A 1VLNA 1CQ9A 4RR3A 2E51A 2DFCA 5BUVA 5LEJA 3J26N 2QNKA 1JW6A 1D4M2 4BOWA 1UAIA 5BNQA 1QJY3 3AXEA 3D0SA 1H1AA 1VBE2 2DCJA 3KZ4C 2D5FA 5T55A 3RI9A 5DUUA 4GKXA 2WT1A 1LTEA 2OIIA 1JN2P 3RRDA 4QPIB 2ZA9A 3SCFA 4BZ4A 4Q27A 1A6CA 3I59B 1WW7A 1EV12 5BNOA 4YG6A 3NVCA 1IS3A 4XBNA 2YROA 1BK1A 3IN9A 4SLIA 3VBHA 3WHUA 1CX4A 1I1EA 2YC0A 3JBG1 1AR91 3CJIB 4S2DA 3ZMNA 3SCGA 3KCCA 1XYOA 1UZYA 2A6VA 4JDMA 4QPGA 3WY6A 4INDA 5J09A 4HN1A 1SFYA 4EV0A 1LHVA 1OQEA 4PBPA 1OLRA 3OPZA 2D40A 1LOFC 1PO23 3BU7A 3VBSB 3M3CA 3VZKA 4AI0A 3OJBA 3E5XA 4AFMA 1DU3D 4DB5A 1ULFA 4QPGC 1ENXA 3GZTB 1NCRB 2AGSA 2K2SA 4ONUA 3OBTA 1H1MA 3UJQA 1RUG1 1QU0A 4QXKA 4RD7A 3B5LB 2HWD3 3KB5A 3VBUB 5KHKA 3GZAA 4B4QA 3RNSA 3VBRC 3TB0A 3BODA 2EF6A 1ULEA 1EY2A 1U5ZA 4UBHA 2D98A 1IGOA 3D0JA 5CG8A 5HBAA 4Q2FA 4MYEA 3ZFGA 2PHDA 3WDWA 1BQPA 2QZ3A 1CVNA 4I3GA 3ZYJB 2OUJA 4D3WA 3WG2A 3DGTA 5GZGA 4EWDA 3CL1A 1BBT1 3RDIA 4IEVA 1UIKA 4XILA 1QJX3 4W6YA 2A5ZA 2B9UA 1D0GA 3H1MA 3NJZA 1VBB3 4K1ZA 1PVC2 2GMEA 3VBOB 2D43A 2EXKA 2X8KA 3D82A 4HL0A 1O5LA 1TME1 5LRRA 5FO7B 2DCYA 2HWB3 4FPFA 3ZFGB 3WV6A 4KWLA 1OPOA 2PAMA 4RHV3 3MEPA 3BALA 3D5OA 3H0OA 5CG9A 4HPKA 4MGZE 4OLLA 4Q4W3 5EFUA 4FOVA 1FV3A 1Z78A 1MS3A 1F31A 2B39A 4E2GA 3ES1A 1KJRA 3MIDA 2ZMLA 3JD72 1LCLA 2VNOA 3NV1A 2W52A 1JBCA 3U4XA 3V0BB 5J7MA 4FSJA 4X8NA 2A6YA 1A8DA 4MGKE 5C9AC 2JXAA 5T5PA 3ZXDA 1M4WA 1PO12 4JGYA 5I0SA 4H3WA 1PMIA 3MPPG 3AXDA 1GLHA 1FI2A 2ZABA 1GANA 3MIEA 4XZPA 1BVVA 3IWZA 1ONAA 4E4DX 3NL1A 1KXGA 4AFAA 1EPWA 1I3HA 1DQ2A 4YVWA 1UPSA 1VBC1 2UYBA 2PTMA 1GICA 3AZZA 2WA3A 4GH4B 1AJKA 5K0UC 2HEVF 3IIAA 4RHV2 5FLIA 3OYWB 4Q4X3 5LK7B 4OHZA 4LBQA 4KH9A 5LK5A 3O0XA 1O3QA 1LOCA 2WIIB 1MVQA 3P3NA 4RHV1 3WW1A 4EN6B 2FMYA 5CFDC 1VB2A 2BNNA 4J6GA 4FQZA 1SLIA 1OFSA 3NV4A 1UD1A 4Z82A 3PVEA 1LB2A 4XQDA 1E57A 5CNAA 2I07B 3JD71 2VOKA 5CFCC 4CDWA 1O7FA 2HWC1 3ZYRA 2XKPA 1BEV3 1NXD1 5CIRA 1MS1A 1RUE2 4E2SA 4WM7B 4LT5A 1DG6A 1HX6A 3ME2A 4XF4A 4DPNA 4GA9A 1SLBA 1TE1B 4CDWC 1AYM2 4ISQA 1EAH2 4LO5B 2ZGOA 3V65A 4IV3C 2QVSB 3DKWA 3R0RA 3VDDA 1VAVA 3VZJA 2FZ2A 1NE6A 4XTMA 3AP7A 4X8PA 4K1YA 4DMIA 2R061 1UMZA 4YW2A 3UV9A 1KJLA 4Y1ZA 1VALA 3WDUA 3HMYA 5F5QA 4HT1T 3VDDC 2XJVA 4HVQA 4NOTA 2XLFA 1RINA 3JCIA 2BQPA 4R9CA 1SLTA 4YG3A 5JPMB 2MHFA 1QF3A 4IQPA 1C8M2 3WUDA 1V6MA 1RUE1 4ASLA 3AMPA 3IDEA 4AHZA 5JPNB 4WVZA 3ZXGA 2JG8A 2ZGRA 1QH6A 1VJ2A 3KS7A 1ZRDA 4I0BA 2ZS6B 3NO8A 3AMQA 4FPEA 4L9BA 5EWSA 3RPQA 3W9AA 1W6NB 4BIFA 5FOJB 4PDWC 2A75A 5FFOC 1ULGA 1BJQA 2RE9A 3WDYA 4MLOA 2FZ1A 4XTPA 2RM23 2HWF3 3TN92 4AEJA 2YPJA 2PHUA 3AP9A 2JG8B 4MVTA 1RUH3 3CJIC 2FBEA 3MGUA 3BB6A 4JQRA 1HDKA 3VKLA 5IT6A 5KC5A 3GBWA 1XE8A 3GALA 1N47A 2ARXA 4JV4A 2OVUA 4FOYA 3TNPB 2E7AA 2IXIA 3O12A 1C8M1 4Q29A 4N7UA 3L2HA 3NKTA 4Y1XA 1DGWA 2Q8OA 1V6IA 3ZFEA 1MS8A 2ZX4A 1C8M3 1IS6A 2GC1A 1HXS1 5HCAA 3CNAA 3WQ0A 3VBUC 2YMZA 4FPCA 4R4XA 3VKFC 4CDXB 1COV1 2FMDA 1LOEA 5FRAA 3VBFC 1AL23 3ZSJA 2EXHA 1AR93 2DYCA 2ZGMA 5IUQA 2VXRA 5DG2A 1SQ4A 4IEQA 2HWC3 2ZHMA 2CYFA 1H2LA 5BNPC 4Y1YA 1IKQA 1CAXA 5C8CC 2RS53 5KXDA 2RS51 2WA4A 5ABJB 4E27A 3ELNA 4DS0A 3SNMA 4XPVA 1CAWA 3CU7A 2AR6A 5FREA 1RMU3 3MIFA 2JENA 3ZDSA 4RSUA 5F1RA 2GC0A 2GC2A 1C5IA 2A7AA 5K8SA 1C8NA 3MF9A 2OZ6A 4FCAA 2MPFA 2RR13 3VHPA 4HANA 3ASIA 2DUOA 5JZGB 1GNZA 2VMHA 4OI4A 2IFWA 2K9ZA 4K40A 3EQEA 4YZ4A 4N43A 1ND2C 4Z8BA 1MS5A 2QJVA 5A33B 4QPIC 3IKWA 3M3EA 1N3OA 1XE7A 1HRI3 3B3QE 1RB8G 5BNOC 3SLIA 5FPXA 4ITCA 1OHFA 2ZBJA 2R073 1FMD1 1ND2A 1QNYA 1YJKA 5JOZA 2IFRA 1OQDA 2W68A 1ASJ3 4Y24A 5LRSA 4HFSA 4D7TA 2X5IB 5E16A 4RQPA 1LHWA 1C3HA 2DCKA 3N7MA 4Y5Z0 2DURA 3ZFFB 3AZWA 4AYUA 1R082 1XYPA 2JD4A 4LUKA 4W65A 1QQP3 3AM2A 1RUG2 3ILNA 2NLRA 1FOD1 4Q4Y1 1QXPA 2RS52 5JAXA 4GMP1 4FAGA 5C6CA 2HWE1 1HV0A 1RUI1 3EHKA 4I2OA 4L92A 3ZN6B 1RUJ3 4ZU7A 2FHRA 2D6NA 4XF9A 2X5IA 1TME3 1AL22 3A4UA 3FBYA 4NN0A 3RG0A 2B42B 4W6WA 2AUYA 3KM5A 3WP5A 5JSRA 1WD3A 1D4VB 5KHJA 4H7LA 3LSDA 1CIWA 5C33A 3BTAA 1AYN2 1DGLA 1G9DA 4R4ZA 1EV11 3R6SA 3RYRA 4J1WA 4JGZB 2QFEA 2ZTNA 1VBE3 1ND3A 1OD5A 4IL7A 4GIQA 4UXAA 1NCQC 3WQ1A 1PVXA 4R9DA 1YHFA 4LA2A 2BWCA 1NLRA 2HWB2 4URTA 4O9GA 1MEC3 2ZX3A 5FBZA 4ZU5A 3GHNA 1N1SA 1KS4A 5AC91 1S0BA 1A78A 2ZMKA 4FXKB 3KQRA 4EWAA 3BOPA 1SLAA 2PLV2 2H6BA 4E4ZA 3R4UA 3MW4A 3INAA 1RUH2 3THTA 1N3QA 2ZGKA 4UW6A 4CDUB 5JMCA 5SV5A 3RQ0A 4ZU4A 4Z1VA 4P9XA 2ARBA 1OFNA 3WX5A 4LLOA 4CEWB 4NHMA 1J58A 1YRZA 5CAZA 3HR9A 1NQDA 4D7SA 2VU9A 4LHNA 1VAMA 4WZCA 3C3VA 3GBGA 1RIRA 2BUKA 3VBRB 2GNTA 2VNGA 4PLMA 1TMF1 4XYXA 5I8TA 1H8TA 3NKGA 1RUNA 2DU0A 2DTYA 2WZPP 2ZGLA 4XQWA 4PJYA 1W6OA 4CDQC 3FWEA 3ILFA 4LBQD 4MXVA 4WBBA 2UY8A 4Y1UA 3HWJA 5T5JA 1SCSA 1RUE3 4QMAA 1H8TC 1DZQA 1NA1A 1DYKA 1K5MB 1LOBA 1FATA 1HQNA 2R1BA 1PO11 1AR61 1UPIA 2A3WA 5T52A 2R32A 3VBOC 1RGSA 3E6BA 1WMEA 5HCFA 3PJQA