2WNVC

Complex between c1q globular heads and deoxyribose
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
129
structure length
129
Chain Sequence
KFQSVFTVTRQTHQPPAPNSLIRFNAVLTNPQGDYDTSTGKFTCKVPGLYYFVYHASHTANLCVLLYRSGVKVVTFCGHTSKTNQVNSGGVLLRLQVGEEVWLAVNDYYDMVGIQGSDSVFSGFLLFPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COMPLEMENT C1Q SUBCOMPONENT SUBUNIT A
publication title Cutting Edge: C1Q Binds Deoxyribose and Heparan Sulfate Through Neighboring Sites of its Recognition Domain.
pubmed doi rcsb
molecule tags Immune system
total genus 27
structure length 129
sequence length 129
chains with identical sequence F
ec nomenclature
pdb deposition date 2009-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00386 C1q C1q domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.40 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2wnvC00
1U5XA 5KC6A 5L19A 2JG9A 3TYJA 4J6GA 1D4VB 4QQLA 4F3JA 2KA3A 2JG8C 1O91A 1OQEA 2HEVF 4NN0A 1IQAA 2JG9C 4RSUA 2O0OA 2WNVA 2JG9B 4DB5A 5L36A 4OULA 4QQ2A 2QDNA 5BNQA 1U5YA 2AZ5A 3URFA 3AB0A 4GIQA 3B93A 1JTZX 3ALQA 3K48A 1KXGA 1TNFA 2R30A 2ZPXA 2QE3A 1TNRA 4MXWA 4KGQA 2R6QA 2RJKA 3LKJA 2RJLA 4N90A 4G4FA 2E7AA 4TWTA 1PK6A 2WNUA 1DU3D 3V56A 3TWIA 1S55A 4MXWB 3WD5A 3B94A 4OUSA 2RE9A 1RJ7A 4QPYA 1D2QA 1I9RA 3ME2A 5CIRA 2WNUC 1PK6B 1XU1A 2R32A 2WNUB 3IT8A 2WNVC 3K51A 5HBAA 5TSWA 2WNVB 1A8MA 2Q1MA 3QBQA 4OUMA 4EN0A 2HEYF 4MSVA 2Q8OA 1C3HA 1XU2A 5KC5A 2ZJCA 3L9JT 1RJ8A 1DG6A 3MI8A 4KGGA 2JG8A 4TSVA 3B9IA 4QQOA 4MXVA 4D7YA 1PK6C 4E4SA 1C28A 4KG8A 1OSGA 1GR3A 2TNFA 2X29A 4DOUA 2OIIA 1KD7A 4HT1T 2Z5WA 1OQDA 2JG8B 3FC0A 4QQHA 3QD6A 1JH5A 1U5ZA 2HEWF 1ALYA 4E4DX 4QQPA 1D0GA 1WCKA 2TUNA 4G3YC 5KWRA
chains in the Genus database with same CATH superfamily
3RI9A 2BNOA 3N9QA 3ZX7A 1OPMA 5ACA3 5F7UA 2JE8A 4YW7A 3D0JA 3VZJA 1KRIA 1HQLA 5E1RA 5A7QA 4Y1UA 3ZPOA 4ISRA 5HCAA 1ND3B 3ILNA 3OOXA 3SEPA 3CMGA 5KHJA 3VUOA 4MGQA 4FT8A 2Z79A 3I3EA 1L7QA 3BOWA 5FZ8A 1DBNA 2P17A 3KGZA 4E2GA 1SDWA 4CVUA 4S2FA 1JU3A 3H8UA 3O0WA 2QBXA 1GOFA 2XR4A 1YJKA 1R1ZA 1UU6A 1RUG2 3JZVA 2B9VA 2A3XA 3WNXA 1KJLA 1QJX2 1ULGA 4CDUC 3ZN6A 2P37A 3JUUA 2RDNA 1WUVA 3BGAA 4ZHNA 1MS0A 3FX3A 1IKPA 2BVBA 3ACGA 1DGRA 2VCCA 4WBBA 5HXVA 3SXWA 1W9SA 2Z42A 4QPGA 3U11A 3VGIA 4EN7B 3TOJA 2BGCA 1JS9A 5C5TA 4XTMA 5F3GA 3W9AA 2H6BA 1NCRC 2ZZJA 1BJQA 4J25A 4CCNA 4Q8LA 1BVP1 5FK7A 2W0XA 4DIQA 2NMOA 2JB4A 1R081 1ZYBA 3WDWA 4D7SA 3BOPA 1YXWA 2WSVA 3U10A 4CXWA 5C5UA 2R1BA 3CJIC 4D7TA 5J37A 4XDPA 4OUSA 1OA3A 1QXJA 2CGNA 1OLRA 2WINB 1O3QA 1W6QA 4L2NA 2VZVA 3OUJA 1GWKA 3J7NA 3K3NA 4Q8KA 3WDXA 1EUTA 1EV11 5T5OA 5F37A 1CZVA 1XBFA 3I59B 1TMF1 4CCKA 3E97A 4OQ8A 3I3MA 3VBUC 4CXYA 1NZIA 5F5QA 2ARXA 1LR5A 5CNAA 3H0OA 1MS3A 2E7QA 5CG9A 2VH9A 3TN92 1RGSA 4IEWA 5FZBA 3P5BA 2D5HA 1J3RA 5GZDA 5I0DA 3E5XA 2VU9A 3OUIA 4B4PA 1VBE3 1V6JA 1VMHA 3T0DA 2W1WA 3R4SA 4O61A 1FPN3 4NJ4A 2HWC1 1O5UA 4WVMA 2PLV3 3B01A 1BK1A 4E4ZA 4A6SA 1HRV1 1WLTA 1RVF3 1XNBA 2ARAA 5FPUA 2WR9A 2VUCA 3HWJA 3PLQA 1K42A 1J58A 3I2DA 4MH0E 1MZFA 5FZIA 1OQDA 2P3KA 3KCXA 5A3UA 2BJSA 5J98B 3EO6A 4FSJA 3WG3A 2A3WA 4N7UA 4D6SA 1CAUA 4Y22B 2D93A 2GP3A 5FO8B 4ET7A 1VP6A 5IVVA 5IK8A 4LHLA 2VNRA 4COUA 1VAVA 2TUNA 1VPHA 1VRH1 2CGOA 2N7GA 4MHRA 4AQSA 4MGZE 3O5SA 3RYPA 1G7YA 4CPBA 1IHMA 2SLIA 2FCTA 1V6OA 2C0ZA 4XVHA 1JZ4A 2B7YA 2EIGA 1HB4A 1PVC2 2VNVA 2VTXJ 4B1MA 1QH7A 2HWB1 4IE5A 1AL0G 2IVJA 4XHXA 5SV5A 1EV12 3NV1A 5C4WB 5JDBA 3HNYM 2BBVA 1WZXA 1HV1A 2BBAA 1PO11 5FZLA 2MHFA 1F4AA 2R071 3K75B 1TMF2 3A4UA 1W2OA 3KHBA 4XUNA 1V9U3 4K3UA 3U14A 5T5PA 5EZWA 5FJKA 1RUG3 2EXHA 4BE3A 4EWAA 5L36A 1CN1A 4F83A 3ZYIB 4QB6A 5EPAA 3ECQA 1Q3EA 4LPLA 4N53A 5GZEA 5BNNB 4YNIA 5ANQA 1SBEA 3IKWA 2V5DA 2QQPA 1U5YA 2K9ZA 1GP4A 1SPPA 3UNPA 4AHZA 3CO2A 4D94A 1NKGA 4JX0A 1E5IA 2OPWA 4UFIA 3AP5A 4EZHA 4GULA 4CDQB 2Y6HA 3K4DA 5E88A 4K6BA 2ZGKA 1W6PB 3DPRB 1KFUL 2G9ZA 5DDJ1 1HRV2 3LA3A 1NG0A 5C9AB 1UMHA 1UY0A 4RGGA 4FTEA 1S0EA 1HXS3 5JWPA 1ZRRA 2UURA 5DAXA 4FOVA 3VKOA 1MZ5A 5BNOB 2JDNA 2VVFA 4PLNA 3LOIA 1MS8A 2IXCA 4FPHA 1V0AA 4RFRB 2ZEWA 3GHNA 5GJ6A 4XIKA 3ZYBA 4FVVA 3UKNA 3ZFEA 3MBWA 1VRH2 2EA7A 1H6YA 1XNDA 3CDZB 4LO7A 4XJAA 3PU8A 4H7LA 5FBJA 4AHYA 4ASMB 4L9BA 3VBFC 1RXGA 4OHYA 2WZ8A 5A1LA 2TBVA 5A3NA 2RDRA 5LBBA 2GNTA 1GZWA 2VW2A 4NPRA 1QJY1 3MIHA 3ZSJA 1VIWB 2VBPA 2CDPA 1OMIA 2J42A 1QU0A 3N7KA 4IEZA 3KT4A 4PDWB 4XF3A 5FZMA 2AGSA 4RGKA 3MW2A 4D0QA 3ZXLA 1JOPA 3EYPA 1AXZA 3AP9A 1IG0A 3EQEA 3IM0A 1FMD1 1DGWX 1ZBA2 2XQRA 1W99A 5CB7A 2XWJB 1YC61 3H7YA 3I2GA 4HK9A 4S2DA 3H8OA 5A7OA 3PJYA 4BWOA 5FZ3A 1OFSA 3RZGA 5EYYA 4DXTA 3QLQA 1XPWA 1YFUA 2YG0A 4NHKA 5FXWA 4NIHA 4BB3A 4LHNA 1O8PA 1FAYA 5FMBA 3VDDB 2NZ9A 4J1XA 5FXVA 5HV4A 1GMMA 4XFAA 3ZSEA 4IE6A 3NAPC 1LEMA 1OD3A 3USUA 5C7GA 4HN1A 3SKVA 3IPVB 1C1FA 4NHYA 5L9RA 2Y6GA 4FFFA 5K7PA 4JDNA 4XIOA 2VUDA 1MVEA 4K1ZA 1O7FA 4NRQA 4FI9A 1WBFA 3HNBM 2HWE2 4RN5A 5LRRA 1OKQA 2IWGB 3LEMA 4XDOA 3VD4A 1JZ6A 4YVWB 1PVC3 2VQ0A 4YW6A 4FO9A 2DVAA 4AK3A 3R05A 4LBOA 4RQPC 4YARA 1I5PA 1YQ5A 2VTFA 3WNMA 4FPLA 3OGGA 5FYMA 3J26N 4IEPA 1JZ8A 3TYJA 1UOJA 4KBZA 5HI0A 1QHDA 5CADA 2X53S 1D4VB 2VD7A 4HPKA 3DV8A 4TN7A 4YVSC 4FAHA 4XYXA 1NT0A 3AX4A 4URAA 1QJY2 2WZR3 1TME3 3WF3A 1O3TA 5FZ0A 2WO7A 1W8UA 3T1LA 5FZGA 3PDQA 3POGA 5HCFA 2Y0OA 3LD8A 5FWEA 4R9AA 1IQAA 5JSOA 3ASIA 4YGCA 5HPOA 3LIHA 1WGPA 4XUPA 4DXRA 3VBSC 4B8EA 2DCYA 4P9JA 1FMD2 3HT2A 1GNZA 4Q0PA 5D8AC 4B7EA 1UZVA 4GB31 4XE9A 3O7OA 2D98A 4IERA 4AW7A 3K48A 2WA3A 1NCRA 1DGRN 3FE5A 3WF1A 2VMDA 3R0RA 5A6YA 4JGZC 2HYKA 2CV6A 2JB8A 4RHV2 5FJHA 4NROA 4CP1A 4FQZA 5C3RA 3WQ0A 2E9QA 1Y43B 3CJIA 1KDKA 5FUNA 2X5IB 4K21A 4E9KA 3GBGA 4ITCA 4IL7A 4L8QA 4RS5B 1UAIA 2R0HA 2JDMA 5J7MA 2D6MA 4LO4B 1LOEA 1FOD2 4AI0A 5A33B 2Y6FA 4N7IA 1C8NA 4JHZA 4UFKA 5C6CA 3NL1A 1EUUA 2HWD1 2ILMA 4QKDA 4AI2A 3SC7X 1UYYA 1XNCA 5F39A 3KWVA 3ME2A 3QACA 1NQJA 2ORXA 1I6XA 3MHZA 4NOTA 2YC0A 4XTPA 3SMHA 1RUE3 3VBUA 4BISA 1EAH2 1X7NA 1CQ9A 3X29B 4CUGA 3TAYA 3GBWA 4IEYA 1I5ZA 1ONAA 5ISLA 2YBSA 3OYWB 4XJ9A 4HONA 3IZOA 5JIAA 1OHFA 2VQAA 2CAVA 3VBOC 1UOBA 2OVUA 4GJYA 1OLQA 1JI6A 4P9LA 1E5HA 1QJEA 5KC5A 5IW0A 1QH6A 3EMRA 2PFWA 2JDZA 2GSYA 3TEXA 3HN1A 1MS5A 3O1PA 1IPSA 2Q4SA 1VBD1 5DUVA 4QT6A 3MV11 4GMP0 5AVPA 5BY5A 1MEC3 1WW6A 1JYNA 2GNMA 1GQHA 1U5IA 2KR2A 4JHTA 1GU3A 2IXHA 2WRAA 4M3CA 4WVVA 3U37A 4IEVA 5JIUA 4ATEA 1GSLA 1QJU1 1OSGA 2X10A 3D4KA 4JZRA 4CUBA 1ZRCA 5DAVA 4MHUA 2IC1A 1K3IA 4YGEA 3B02A 1W2AX 2W92A 4Y20A 4AI8A 1A78A 1O59A 3GCXA 3KQ4B 3MYXA 2HWE3 1AJKA 1F15A 4CPBD 2ZZQA 3E5UA 3GZTB 4QX5A 3IAPA 2AENA 2XL9A 4PJYA 1R092 1F9KA 2E53A 5LWBA 3R4UA 4LO5B 1RHI2 5FV3A 2DU0A 5AFEA 4FPGA 2VUJA 3W21A 4J1WA 2X09A 1M4WA 1UXZA 2FCVA 1N1VA 3VN4A 4D8MA 2O14A 1MQTB 2DVGA 4PBPA 5BNPB 1DDLA 2Q8EA 1G9FA 5T5JA 4BIFA 3SH5A 4PQ9A 2ZCWA 4LO8A 5GLUA 2QQMA 5L19A 1QXRA 5A70A 2DUPA 4OUEA 4Q4V2 1NA1C 5IJRA 5FYIA 1N1SA 1C1LA 2OUHA 4D69A 3FN9A 3ELNA 1HB3A 2J1UA 2XJQA 4PI0A 4DXSA 1H2KA 3IB3A 2A1XA 4GWMA 3WDYA 1H1IA 3NW4A 1HW5A 2JG9B 2D6NA 4MOAA 5JXHA 4NIIA 5LEJA 1XRUA 1BHGA 1APNA 3ON7A 4DNYA 1DYPA 1VJ2A 3WHUA 5IFPA 3S5QA 3PIGA 3V0BA 4QB1A 1GKBA 2PTMA 1IGOA 1PMIA 5JXJA 2VMFA 1DZRA 1MPXA 1MVQA 4KU7A 5LEKA 3OG2A 2R30A 4Q1RA 4YW3A 2I07B 3WDUA 1QJU2 4AVSA 1XE0A 1A3KA 3BCWA 5CU1A 2B8MA 1OKOA 3ZDSA 4BQ2A 4ZZ5A 1QJFA 4KGQA 4PIZA 1GP6A 2CTVA 3HNMA 3UJOA 4OZOA 1LECA 1UX6A 3PHMA 4GALA 4NR1A 1HRI2 2AEZA 3VBHA 4IW3A 4BJ0A 3LWCA 4Y5Z0 2R041 3QOPA 2MEV3 4IUGA 2DU1A 2A73B 1WCSA 4LEJA 5LASA 4UW4A 5GM0A 3WG1A 4QX3A 3NWKA 3PUAA 1VAMA 4JGYC 4HANA 1FYUA 4NHXA 1A6CA 3CBNA 4XJZA 4CCCA 5K0UC 3ZLIA 4M4PA 1W03A 4YW5A 2XG3A 4YGBA 1UX7A 5FPXA 2JDHA 3MW3A 4TXWA 1PMHX 1QKQA 1HN0A 4BLIA 2WO3A 1W0OA 4NIDA 1SHWB 3POIA 4LHSA 3VHOA 1W8ZA 1RUH2 1PVXA 2MPFA 4H14A 4GKYA 1XU2A 3FFQA 4QX8A 1NCQB 4YM3A 5DUWA 4HVOA 4LIUA 3LDRA 3UJQA 3VKNA 2FDKA 2E6VA 2WN3A 4Z8BA 3NAPA 1YFYA 1EY2A 2JG8A 4JCKA 5C3OA 4PHZA 4LBNA 1X82A 3DXUA 1US3A 4ZS3A 5FLHA 5FKBA 2OKXA 1QNYA 3RNSA 2X05A 4UOJA 5K4LA 3H42B 2RDSA 3DF0A 5J96B 1VBC1 2JIGA 2OIIA 1N3QA 5ACA1 2DBIA 1JUHA 5LK5A 2DCTA 3VBRC 1BZWA 2AYHA 2B42B 2E63A 2GMMA 2YXSA 3HT1A 3OGRA 3E6CC 1YJLA 2RS53 1ALYA 3IBMA 1AVBA 1UMZA 4FPYA 1DQ6A 1QOOA 4YVSA 2J7MA 5KWRA 1W6NA 5D21A 1W6MB 4IGOA 3ZMNA 3ZYJB 3VV1A 1X8EA 1OURA 2Q0AA 1OFNA 1YFXA 4LK7A 2IXKA 5FMCA 4FPEA 1H8TB 2ADEA 3CZJA 4QX1A 3WUDA 5FREA 4IEQA 2EALA 2NPIA 4CCDA 1OI6A 5I0UA 3VKFC 2VVDA 4DEQA 2RMU1 2ZGPA 4JV4A 4PLMA 2PA7A 4I01A 3WEZA 1JN2P 4AEDC 2C6SA 4NN0A 5L7OB 1BLZA 2VOVA 4JGZA 2VMIA 3BTXA 2FD8A 4XFIA 3IDEA 5HCHA 3A21A 1RUC3 2W1SA 4QKBA 4UF0B 5FDBA 2NP0A 4QQ2A 2Y8KA 2J22A 4JDOA 3ZYRA 4YM2A 2YPDA 1PGW1 5DQ0A 3CL1A 4KNCA 2LRPA 5I8SA 3DEMA 4X6QB 1K45A 4YZ4A 3D6EA 1LHUA 1SLAA 3VBFB 2XMLA 2DBNA 4Y5TA 1IPJA 4CP9A 4YM0A 1NE4A 2DV9A 3I97A 4NHMA 1HRI3 4QXKA 4P5YA 5ABJC 4LNVA 2BTVC 3T2TA 1URXA 3OSDA 4CDWC 5C33A 5ACA2 1CVNA 1NOVA 2G4IA 4X8PA 4BQXA 1E57A 2CU5A 5LBFA 1D4M3 4FP2A 4B4RA 3WY6A 4XACA 4PCRA 3LZZA 4Q0VA 1UXXX 3MIGA 2ZHLA 5A6QA 2EIDA 1XOYA 2WC2A 3TNPB 4XAEA 1H4HA 1S55A 1RXFA 4JQRA 5FYTA 4RL7A 3UETA 1VB4A 1QGLA 5T55A 4ZU7A 4QPYA 2WJSA 3W5NA 1W6OB 3AZZA 2BQPA 4WV8A 4Y1ZA 4XF0A 4ZPIA 3VBOA 1PGL2 1N47A 3BI3A 4EQVA 4B7KA 5C8CA 2WNUB 3UKTA 5DAWA 4DZGA 1RUH3 2DYCA 5FZ1A 3ZR6A 1VBE1 2WNVB 3UK9A 5A3LA 1A8MA 2Q1MA 4LITA 4E8DA 4L0PA 5A6ZA 5GZGA 1A34A 4MV2A 1FPN1 1GZCA 2PLV1 2NMNA 2QQJA 1DGWA 3PVOA 1SG3A 1OPOA 1RVF1 5BV6A 2W39A 1G6NA 1LOFC 2WWJA 3JQWA 3K3OA 4H3WA 4C8DA 5A6XA 2WYFA 5CVRA 3C7HA 4C0HA 4CCMA 4BPZA 3AKRA 4IQPA 4N8MA 2ZAAA 1LKNA 4CYDA 4I2OA 3AMMA 4TSVA 5T5LA 4LBKA 3SISA 5LY2A 1DZQA 3CNAA 1GANA 3MLJA 1V6KA 1VRBA 2TNFA 2VMEA 2YROA 5L73A 2OXBA 3I8TA 2WNEA 2UWCA 5FZEA 1ZREA 4HVQA 2GH8A 2O8QA 2F4PA 1AX2A 3MF9A 2PAKA 4IV1A 4COVA 3JXSA 3UL2A 1OA4A 4NUBA 1T2XA 3RYKA 3Q8AA 4HN0A 1D0GA 2E51A 2UY8A 3I4IA 1STMA 1OH3A 1AR73 1SBDA 1V9U1 4IV3C 1S0JA 1T6GC 3VBSB 3WQ1A 4IXLA 1CJPA 1RUG1 1XB9A 4BA6A 4O7XA 4AVBA 4N43C 1VB2A 3WOGA 1W8TA 2E7TA 1WD3A 4W6XA 3T30A 4DEVA 2ZXQA 1KS4A 2YBKA 3M2MA 1RMU2 2XB6C 2IXJA 3B9CA 5A7WB 3ZXGA 2CAUA 2ORZA 5FIXA 1W9FA 2YUEA 1WKYA 2C1FA 3POFA 5FZOA 1NZCA 4UT5A 4XZPA 1RUNA 1X33A 2PLV2 4JDMA 2UWAA 3KV6A 1RVF2 4ARYA 5JR2A 5CISA 4AVCA 1ULFA 1WCQA 1AYN3 4JTOA 1HXS1 2WIIB 3T2OA 5IAXA 2KD7A 3N9LA 4RR3B 2Q8DA 2EIEA 3L2HA 5I91A 3AKTA 2BWAA 1G9CA 1VBA3 3ZR5A 2DCKA 5JPNB 3OEBA 3SCFA 2VG9A 1W06A 5IVBA 2BFUS 3TEZA 5FYYA 5FLJA 3FMGA 2WKKA 4ZXKA 5IHRA 2ARCA 3K4AA 2WQZC 1X9TA 2QE3A 5A32B 4D6QA 1ZX5A 3MPBA 4C1WA 3OGVA 4KBBA 1QDCA 3BU0A 1GWLA 4GD4A 4JGYA 4YZ2A 1ENSA 1JZ3A 5K0UA 2BYVE 2E7AA 3DCQA 1PK6A 1HN1A 4M3CF 5IATA 4PIXA 3ETQA 4MGSA 1ENQA 5A1AA 1RUI3 3TN91 1G9DA 2IXIA 4BHPA 1Q56A 4QM8A 1V9U2 5LBCA 3WG4A 3OY8B 5H9QA 4P9YA 4CDXA 1OOPB 1HQNA 4CU6A 1CIYA 3WV6A 1V6IA 4Y22A 3WNNA 4BLJA 4FPCA 4TLGA 2XHNA 4LOSA 2XDVA 2D40A 4Y33A 4OQ9A 3J7LA 4TLFA 2VCAA 4LO6B 3THTA 1MR5A 1K5MC 1C8M2 2KM2A 2VNOA 4B29A 4OHZA 1W9TA 2D44A 4U36A 2Q8OA 1JYCA 4QPIB 3ETPA 1LHOA 3SITA 3NJYA 3MV01 2BNNA 5C4WA 3TNQA 2VMCA 2W68A 1HXS2 2VR4A 2Y38A 1WMFA 4AYUA 1XSRA 5DG2A 5CAZA 3ZKUA 5EJZB 3VBRA 4I09A 2ERFA 2JKBA 1UYXA 3GGLA 1BQPA 1F2NA 2D3PA 1UOFA 4D7YA 1PVC1 3ZPYA 4XOGA 1ODMA 4RYDA 3WP5A 4KG8A 1UKRA 4PBOA 4NAMA 1EP0A 2VZ3A 2YMZA 1GLHA 5GLWA 3TB0A 2GAUA 1W28A 5C3QA 3LPGA 3MLKA 2D3SA 2QTWB 4HG6B 1POV3 2BP6A 2I74A 3FHIB 2WZR1 1TME1 3B3QE 2GP5A 5E8AA 1M06G 3K2OA 3JD73 1XNAA 4K40A 1DQ1A 1UIJA 2IFWA 2ZA9A 1SLTA 3PJQA 1RMU3 3G6JB 3WNKA 3C7OA 1PZ8A 4AEDA 2ZX2A 4XCAA 1QMJA 5CFCB 3IDAA 2DCZA 4DS0A 4D6RA 4LTAA 1S0DA 3MFCA 2V4VA 1CD3G 2BUKA 2GMPA 3PVBB 1W8WA 2XQXA 3NSTA 2GNDA 3AZVA 2Y6JA 2IVIB 2ZABA 4CEYB 3RJRA 5FO9B 4DINB 2ZGQA 3IIIA 3UKVA 1CAWA 2XJPA 2RJ2A 1ULEA 4C91A 1YUDA 4DB5A 2Z4FA 1K5JA 1HLCA 4QDSA 3O1MA 5ABJA 2A6YA 3H1WA 4NPMA 1K12A 1AUYA 2WWUA 4E2SA 1COV2 4CDWA 1PMJX 2UYBA 4E2QA 1C57A 4WM8C 2A6WA 2ZHNA 4OMDA 4YW1A 1JXNA 1TNFA 5A3WA 3NNMA 2A6ZA 5FY7A 1CAXB 4MADA 2GZWA 1ND2C 2GMEA 5CFDA 4E27A 4QDQA 1AR63 4Q26A 2VQUA 1W39A 2E31A 2Y6LA 5FPZA 5FZKA 3LDBA 5FXXA 2HH9A 2MNGA 1QWRA 2XJSA 4BYYA 3RZLA 3N3HA 1RUE1 4MUVA 5LB6A 2LROA 1XE8A 2H6CA 1PZ9A 1QY4A 1FV2A 1HJFA 2I2SA 3ZN6B 3VDDA 1QJZA 4I3PA 4CEWC 3KT1A 2XWBB 4W65A 1ZBA1 4IEXA 2WZR2 1TME2 4OCTA 4ZXEA 3H3UA 2J1EA 1L7RA 4QPGB 4F7ZA 1RUJ3 3IPVA 4IEOA 1SLBA 4P02B 2VZSA 1JYWA 3LOBA 4P9GA 5FYBA 5JR7B 2WBKA 3ST7A 1C8M3 2WDBA 2DCJA 3ZKYA 4AVTA 3N9NA 3ITQA 1LOFA 1XU1A 4QPWA 2QFEA 3IDCB 1TVGA 1VALA 4UBHA 1UY4A 3KV5A 4GMP1 4YVWA 3AYCA 3LEKA 1C4RA 1FNZA 2FMYA 3OBRA 2NLRA 4COZA 2HWF2 3V64A 4MSVA 1W6QB 4Z82A 4AGGA 5A3MA 2YC4A 3AYEA 4BQ1A 2VZOA 3LQCA 4GAZA 2J1VA 1J3QA 4XF4A 2VZTA 3FLRA 1OH4A 2HWE1 3HQUA 4XAAA 1G86A 3AYAA 2H0BA 3BTAA 2OQ7A 3B00A 3WW4A 1OBNA 3RGBA 4FBFA 1JYVA 2CDOA 3T3YA 1GYKA 1ASJ2 4NAOA 3DKWA 4QQOA 4XCBA 3DYOA 4BCUA 2VECA 3VBHC 2B5HA 2A3YA 5FQ0A 1H6XA 5DAQA 2D7FA 2P1BA 1WMEA 2C9AA 4IV3A 1J1TA 3CZUA 1BEV3 1GNYA 1RUE2 5G04L 4LBMA 5A3PA 1LU1A 3FC0A 3MW4A 4N43A 2P6HA 1ZBE3 2PQSA 3O1TA 5HV0A 2BW8A 4YG6A 5JZGC 4AHWA 3FZ3A 4QQPA 4WVMB 4ZKTB 3O1RA 1UZWA 2J1AA 2CWMA 2ZX0A 2X5IA 4INDA 3MZHA 4LT5A 4Q2FA 5I0SA 2WS93 4W4ZA 1HDKA 1U5XA 4MGKE 1LESA 4RHV1 1LCLA 2R16A 1GICA 2W87A 5A33A 4AFMA 1Y9QA 4QX2A 1ZRIA 1PO23 4XBQA 1MEC2 4ZU4A 4Z92B 3IAQA 1EPWA 3S0MA 2EAKA 1TE1B 1Z7S2 1H9WA 2JG8C 4QHOA 1JZ2A 3TEYA 1COV3 1FOD1 2JJ6A 3NNFA 3I3BA 2DF7A 5FP7A 1S4CA 4I02A 4PQQA 4LKEA 3KHCA 4BQ4A 3ZFGB 5KBFA 4MGYE 3VD3A 1XSQA 4XEZA 4NE9A 3VZMA 1AXKA 3G7DA 3JU9A 1W2UA 5FLIA 4CU7A 3B5LB 5EHDA 3ZFFC 1BMV2 1KXGA 4UW6A 3AFKA 4GH4C 1EAH1 2VMGA 3B69A 1YI9A 1DYOA 1C5HA 3J8F3 4LKFA 3I2OA 3FLTA 3VD5A 2VZRA 4N53B 4QWNA 4BIOA 1LTEA 3BB6A 1GOHA 5J36A 1R083 2R6QA 3FUOA 5I8TA 5EJ1B 1SPPB 1SACA 1UMIA 2QKDA 3LDKA 5EXOA 3DECA 3WP3A 1Q8SA 3DUIA 2VXRA 3OEAA 3S7IA 1Q8PA 1UPSA 4UWDA 4XPVA 2XJRA 4PF1A 4Y24A 1J1LA 1UKGA 1K5MA 2RE9A 4DUWA 5M0TA 2FDHA 2D5FA 3CEWA 2A75A 1ZZBA 2PHWA 4XFHA 3VB9A 3KV9A 2BERA 2LALA 5CIRA 4KWLA 3UGHA 1ACCA 2V72A 2B45X 1WCDJ 3WX5A 4Q5OA 2D97A 2HWF3 2QQIA 3K51A 3S57A 4EE2A 4M01A 1SEFA 4CTEA 1LRHA 3I49A 1CX1A 1MQTA 4D3WA 1SCSA 4WM7A 5FO7B 1GZTA 5T54A 5FZDA 1O3RA 1HX6A 3ZFEB 4LE4A 1ZRFA 4LBQA 1R091 3BALA 5J3UA 1IKQA 1RJ8A 4DUVA 1RHI1 2VNGA 1Q8QA 3K4ZA 1DIWA 1YFWA 2XJUA 1ASJ3 1QQP2 1GZWB 3INAA 3VDBA 1S2EA 2G19A 1OUXA 1HB1A 1IS4A 2VW1A 1NXD1 4FFIA 1W05A 1MZEA 3UESA 5AC93 4FTBA 1AX0A 5K9YA 1YNAA 2MEV2 3POSA 5IK7A 4Q4V1 3BTYA 4W8JA 4IETA 1DHKB 3WW1A 4DOUA 2YU1A 1US2A 1RTVA 5F6LB 2W91A 4MO3M 4UFLA 4Y4YA 4BMBA 3T0AA 4A6OA 1RC6A 4A7KA 2OZJA 1AX1A 3POYA 4YG0A 1YRZA 5JAXA 5A1FA 1IOAA 4CUAA 1F5FA 1RL3A 3EHKA 5C8CC 4E4DX 1NLRA 2LUWA 4YPJA 2YV8A 2YC2A 3W58A 3BPSA 3T2QA 4H55A 2I45A 4PF5A 1S0CA 1H1AA 3ZSKA 3D82A 2WYSA 2XLFA 3DKQA 1SFNA 2GC1A 1R1A2 1RUC1 2ETEA 3BODA 3FHAA 4R8HA 3USUB 3HOBA 4AFCA 4BU2A 2ZX1A 5AVAA 4Z2WA 1H1MA 2FCUA 1Z7S3 1B35A 3T2PA 2R073 3AVRA 2ZBJA 4KWJA 4C90A 1ND3C 4ATFA 1JW6A 2DFCA 2XUEA 1VE0A 1TG7A 3E5QA 5FUPA 2ZEZA 1IG3A 4YWAA 4L99A 3TRSB 4ZZ8A 1BK0A 1W8OA 1OLME 4WM8A 1HRI1 2Q1ZB 1C5IA 3B7MA 2Y26A 3T0BA 4UFHA 1I3HA 2OUJA 1RUD2 1W3VA 3VHRA 1ND2A 3APBA 2DUOA 3N35A 1F31A 1D4M1 3N7JA 3BYWA 4AHXA 4AGRA 1PGSA 3KT7A 3HJRA 3I2IA 4XW3A 3NKTA 2PN5A 1KDMA 3KS7A 2RS52 3FJSA 2BRTA 5F3IA 4IV1C 3OPZA 2FQPA 1JMUB 1UY1A 2XLAA 4A41A 1NCQA 1W8FA 3OD4A 2G1MA 5A7PA 4L92A 2QJVA 4CDUB 1AHSA 5T3NA 4EZ4A 4CEWA 2YBPA 4AXOA 4DY3A 5LRSA 4FOYA 4MXWA 1PZ7A 1UYPA 5K8SA 2VBDA 3VZOA 2JDUA 3KV4A 2RJLA 4JQTA 4HBNA 1RUH1 3HEIA 3ES1A 3ACFA 2R063 3OTFA 1NCRB 2C9KA 4YZ5A 2A71A 5GLVA 2WLPA 4A45A 2YPJA 2YHJA 1Z0HA 1EPZA 4TTGA 4RGAA 1LAJA 2Q30A 2NYYA 1SQ4A 1L3JA 3CJIB 2XBO3 3WCRA 1I9RA 2QCSB 2QZ3A 2Y34A 1DGLA 2W9XA 5A7NA 4AI3A 5HXMA 1RUC2 4ASKA 4QD2A 2R32A 3EBRA 2UWBA 2VL4A 5FYVA 4AR2A 4BOWA 2Q1FA 1ZZ8A 4BK4A 3JBG3 1JHNA 5FXZA 1W0PA 2O1QA 2WAAA 4EN0A 2ET7A 3AXDA 3GJBA 1BKZA 1ZZ7A 1W6MA 5EFUA 5C3PA 1RYYA 2R49A 3ZXEA 3OD0A 1QQP3 4Y1VA 3VBUB 1RUF3 1H8TA 1HIXA 3M3QA 1Y4WA 4QX7A 4HK8A 1UZYA 4NWWA 3CQOA 4ARXA 3GM8A 4EYUA 1LHVA 2W2IA 3WVJA 1D4M2 4LK6A 2K0GA 5FZ7A 2XJVA 2DDUA 2VE1A 1KITA 1ST8A 1AR71 4OMCA 4R52A 1FXZA 3B9IA 3FWEA 2Z2SB 2RS13 1PK6C 2DVFA 1WWYA 3AKSA 4FFHA 4HSLA 1TEIA 5JZGA 1UY3A 2UY9A 3ACIA 3HAGA 1ZZ6A 2ZGRA 4FP3A 3EB7A 1AYM2 1Q8VA 1QF3A 3VDAA 1CX4A 3HBZA 4CDXC 4LMFA 1DZTA 3RG0A 4K8FA 3QD6A 5IFTA 5KXEA 1U5ZA 4M3CB 2HEWF 2K2SA 3RPQA 4BH9A 2YGLA 4AWDA 1R1A3 3P1IA 1UF2C 1UZ0A 4KWUA 2B46X 2V73A 4UYBA 2WQ8A 1QDOA 4NRPA 4Y20B 3ZXDA 4XABA 5IK5A 3SNMA 2QDRA 2Z69A 5FR3A 4DRRA 5KR7A 2XL7A 5KC6A 2YZ4A 2Y6KA 3N9PA 5F5IA 3M4FA 3FBMA 3MIEA 5F3CA 3ZYGA 4HOOA 3OCPA 1VBA1 1VLNA 5C4WC 4BQ3A 2JICA 2QQOA 3KF3A 3RI8A 2OT7A 2BOIA 1B09A 1RUD3 4RD7A 5FP4A 2DFBA 5HCBA 1IQDC 2XKPA 1J59A 3ZFFA 4XMAA 1CAVB 4LORA 4GB33 1S0BA 4GH4A 3UGFA 1N1YA 4K20A 3WQ7A 5JSRA 1CR7A 1PHMA 1LODA 2WNVA 2H0VA 1LNSA 4XQ4A 5E89A 5F9TA 4CXXA 5D1IA 1GBGA 2ZKLA 4OULA 3OB8A 5BNQA 2FDFA 1Y9GA 4LULA 4FFGA 2VQTA 2GN7A 1RUI1 4MG2A 5I0TA 5FZ9A 1PGL1 3MIDA 1UIKA 4MVTA 1XQNA 1AR72 4ZS2A 5FZ4A 4CDQC 1GFF2 3PVNA 2RDQA 4P5HA 4Y1XA 2VPVA 2BV4A 2ZPXA 3DPRC 5FPLA 1UD1A 4IE7A 3RQ0A 1WMXA 5C9AC 4HLTA 4XUQA 5FY5A 3AKQA 3CJXA 4XFFA 4A3ZA 3U0ZA 3OBZA 1SMVA 4G4FA 3GNEA 1EYBA 5FPBA 3VKMA 5BNOC 4CP0A 1TZOA 2GN3A 3ILRA 2W08A 4I0AA 5A3OA 1MS9A 4HXCA 4JKMA 2DWRA 4KWKA 2VCBA 2CYFA 3WNPA 3AVSA 4LBQD 2D6KA 1NX9A 1AYN2 3J7MA 4UW3A 4TYSA 5IUQA 2WWSA 5FYSA 1WW5A 3ACLA 3ZSMA 3KF5A 1SLIA 2BPA2 3OUHA 1VBA2 5TSWA 3UV9A 2R1DA 1ENRA 2VOTA 1WD4A 3VZKA 3POWA 1SDDB 3HD8B 1XXNA 4PDWC 5LK7B 3SHRA 3I3DA 2VGDA 1ENXA 1PX3A 1VBD3 5IK4A 3O1UA 1H30A 1CIWA 4I30A 5FP8A 5CFDC 1L7LA 4LA3A 1WW7A 2RS33 4KU8A 2J1TA 2ZGNA 4NIAA 1PM7A 1O4YA 4QGNA 2PHFA 3FL7A 2AREA 2ZX3A 4CA9A 4EWDA 1POV1 2OW4A 3PNAA 2QZ2A 1CONA 2VVEA 1FX5A 3NJZA 4HFSA 1D7PM 1NE6A 3ROUA 2RM23 1RUI2 1J84A 3LB9A 4META 4R4XA 1AYM3 1NLSA 4YW4A 1N1TA 3VDDC 4A7YA 2JWPA 4RR3A 3T4VA 1RMU1 4YSFA 3AXEA 3KCCA 2WA4A 2A6XA 3V0AA 2RR13 1YEWA 1W90A 5FUIA 3NAPB 2JG8B 2W95A 1HKDA 2A5ZA 4GQ7A 2FHRA 5E16A 2XVGA 2JIJA 4CP2A 2ATFA 3SH3A 3AL6A 3MEPA 4CCEA 1YQ6A 1ND3A 5FY0A 1O8SA 4YVWC 2VC9A 4XMIA 4YM1A 3LAGA 3IWZA 1NY72 1AR83 5FYUA 4A3XA 3Q9OA 1IS3A 1KJRA 4RQPB 3J7HA 3ZDVA 3PUSA 4IGPA 2JE7A 3FBYA 5B4XA 1LJ7A 4XF9A 4R9DA 4XXAA 4DO0A 1O3SA 3HMYA 1ZM1A 1AR61 4YVSB 3LA2A 2VULA 3SKJE 4DXZA 5FMOL 1W6NB 4AFAA 3RMYA 2JKXA 3RWNA 3WF0A 4YFZA 1Z78A 3LIGA 4K1YA 4Q4W2 2BGOA 2O0OA 1H9PA 5BYNA 3TEWA 4QKNA 3NNLA 2PAEA 5EQUA 5E6HA 5FZFA 4A44A 1GWMA 3GF6A 1UCXA 1XC6A 5D8AB 5DXDA 4GIQA 4C0BA 4Q0UA 4XFCA 3D0SA 4AQ6A 2RV9A 4BXFA 3BU7A 1O6UA 1RUJ1 3ZMOA 1ULCA 2UYAA 3JD72 4JGZB 1KGYA 3SCHA 5IVEA 3RMXA 2X5IC 3NVCA 1C8M1 4IEUA 4YG3A 4AOCA 4LJHA 1DLCA 1ODNA 4RS5C 1J83A 5B2GB 3W20A 4A4AA 2VCMA 1O4TA 3I3QA 3NO8A 3RZKA 2CNAA 2EF6A 3MICA 3N7LA 3J9SA 3ZXJA 5FY1A 2ZACA 3AP7A 3I59A 3ZN5A 1RUOA 2C26A 1OUSA 1OT5A 1RJ7A 5FP9A 1PIV2 2ZOEB 5EYXA 3RZMA 1CGPA 5IWFA 1GQPA 1OF4A 1LENA 1UPIA 2PMWB 2V4AA 4I0WB 2VXJA 2VZQA 5EWSA 3WDTA 5HBAA 3HQXA 4LKSA 1YQ2A 4QU1A 2V09A 2ZGMA 3OJBA 3DGTA 3SH4A 3OBAA 1GNHA 4AI1A 1AR62 1DCSA 2WFF2 3AK0A 4FPJA 4OFGA 1O5LA 3FUQA 5LBEA 2JECA 1OD5A 1WCUA 2F6BA 3QH7A 1VAKA 3VBOB 1BEV1 4NHLA 3ABZA 4AEJA 3HVDA 3RYRA 2XPJA 4UAPA 4AL9A 3UYJA 1ZBE1 3Q8FA 2FDGA 4QGLA 4XBNA 4AAXA 1U0AA 1VBB2 4KGGA 3LA7A 5FOJB 4XF1A 4DQAA 4Z07A 1VBC3 4MXVA 4QXBA 3HIFA 4BXSV 2OA2A 3SQOA 1KQRA 1UU5A 1OVPA 3CF6E 1RUJ2 4SBVA 4CSWA 1QEXA 4GKXA 2WS91 2VZUA 2OQ6A 3N4MA 2PELA 5BPXA 1KD7A 4IGQA 2CHHA 1OC1A 3GZEA 4HETA 2VJXA 3WP4A 1CAXA 2JEMA 3WQBA 1PO21 1BBT3 5DAPA 5DZEA 4YLZA 4YZ3A 5GZFA 4OLLA 3H7JA 4AAPA 2VZ1A 2GALA 5F2SA 4ORFA 1LEDA 4Q4Y3 5KXDA 1REDA 2LW8A 2C4XA 3PMEA 4XXPA 1JYIA 3A23A 3POBA 4FXKB 1MQTC 3IMMA 4Q0QA 1COV1 4Y3OA 2JE9A 3NV4A 5BNPC 4WM7C 2HLEA 3ZO0B 4CU8A 4AQTA 5IVFA 2VTXA 4IV1B 2VZPA 4R4ZA 1REEA 5C71A 1V6NA 5KXCA 3KSCA 1JHJA 2RMU3 4AGVA 2AACA 5BNNA 4J6GA 1T6BX 2Y33A 4P14A 4F3JA 3WDVA 5CEHA 1SBFA 3SCGA 3AMQA 4BZ4A 1NA1B 3AMPA 1IS5A 3AZXA 4Q4W3 3NV3A 4MX3A 2IZWA 4MLOA 1OQEA 3DL3A 2EIBA 3J8F1 1POV0 3H1MA 3LEGA 3T4HB 3ZOIA 2E26A 4OHWA 4HL0A 3USSA 2JG9C 1ZNPA 4CDQA 1OVSA 4CZSA 4DUXA 1BEV2 3R6SA 3H9AA 5F3EA 1W6PA 3DPRA 2AH2A 3LCPA 4CCJA 2FZ2A 4PT6A 5C9AA 3J4UH 1ZBE2 4YW2A 3URFA 3KQRA 5FZOB 5CBLA 4R9BA 3ZN4A 1UYZA 4JKKA 2P3IA 2YU2A 3ALQA 3O1SA 3VHNA 2FMDA 1JODA 1YWKA 1RITA 5FPVA 4RFT0 1LU2A 4P08A 5F32A 5BNOA 2RVAA 1QOSA 1GOGA 2GC3A 3I7DA 2CWSA 3DYMA 1AR93 4NVPA 2WS92 1S0GA 3WXPA 1G9AA 3LKJA 4NWVA 4LA2A 2HWF1 1UN1A 4RA0A 4COYA 2P5BA 3S30A 1PO22 5JPMB 2GC2A 4N9IA 4XJWA 1B35C 3H3ZA 3VL9A 3WG2A 1YIPA 1SLCA 1GUIA 4ASLA 1PIV3 3KM5A 4GWJA 3V56A 5JMCA 4Q4X3 5A3TA 3A0KA 3AJYA 3D5OA 5KHKA 4FXGB 2VOWA 2FDIA 4BQ5A 3EJKA 4PDWA 3FLPA 5IT6A 1D2QA 1H4GA 1YLLA 1X8MA 2JDPA 3AKPA 1OQ1A 1ASJ1 4JGYB 2W3JA 4AG4A 1JU4A 1AL23 4OHXA 5I93A 5K0UB 4JRLA 1PK6B 5FMDA 4E8CA 3H3LA 3M8LA 1DQ0A 2PHLA 3F2ZA 3ZYHA 4HZFA 2WFF3 4R9CA 5AC91 4FCAA 5JCTA 2ZGUA 1S1AA 4AFBA 4Y5SA 2P6CA 1LGCA 4U2AA 1RB8G 5C70A 2ZGSA 2QQNA 1N3PA 4CDXB 4FPFA 5FCCA 2JD4A 1NCQC 4QDRA 3J8F2 1VBB3 3ZIWA 3S6PA 2WT1A 1R082 4L11A 4W6WA 4AE2A 2FBEA 1JZ5A 1Q8OA 4MYEA 5FZAA 1W8NA 2WZEA 2XGXA 3MI8A 1DQ5A 2WNOA 5A80A 1WW4A 3GALA 3I2JA 3MO4A 3Q8BA 3WCSA 3ATGA 4CUCA 3KLSA 5F2WA 4YGDA 5GZCA 3LGRA 1LGNA 4AVAA 3KMHA 1ZVFA 3RS6A 5JOWA 3ZFGA 1MEC1 2FDJA 4Y4RA 5F5CA 1SFPA 3THPA 1Z7S1 3U4SA 5DZGA 5ERLA 4B3NA 4HT1T 4SLIA 2E33A 2W52A 4MZUA 5DUXA 2GC0A 3VBRB 2W1QA 4UXAA 2JDAA 3LE0A 1JH5A 5H9SA 1QNWA 2Y60A 5FPAA 1QJX3 3PU3A 5L9BA 3GBFA 4BMEA 4PLOA 2PHUA 1UY2A 4A2UA 3Q8CA 1XNTA 1O4ZA 1ZA7A 1LGBA 2VBBA 1BMV1 4QXHA 1CZTA 1F8VA 3NNGA 1YCIA 4ZONA 2JENA 1V6MA 1H8TC 1W9YA 3LPFA 1JOBA 1YYNA 2ARBA 2HWC2 2ZEYA 4LLFA 4O9GA 5EV7A 1I1EA 4K9SA 5DN2A 2C5DA 2WL1A 5AC92 1NUKA 1D2SA 1OLMA 4EN9B 2WAOA 4CCOA 2HEVF 2W46A 2YFZA 3H50A 5L7OC 1XYOA 4LUMA 1QIQA 4QXCA 4AEDB 1LULA 5JI9A 5DPNA 3AL5A 1PNGA 3N9OA 1OA2A 1VMFA 4CU9A 2P34A 3VD7A 2BNMA 2BDRA 2R061 3WW3A 5DMYA 3I54A 3KGLA 3I2KA 5EJ3A 3FHQA 1PNFA 3AB0A 4EROA 1E5RA 1OF3A 3H8XA 3RZJA 4RS5A 2G9GA 2P2KA 4QKFA 4V2VA 4KH9A 1CAWB 3IIAA 3KCYA 3UGGA 2XBO1 3MFAA 3PMSA 1E5SA 3NQHA 5CKQA 3T08A 2HWB2 5F8PA 1CAUB 1UWWA 3GZUC 3VZLA 4F8AA 2PHRA 5ABJB 1BXHA 5BXXA 3WSOA 2VOKA 3WNOA 3TN93 1PO12 3AMNA 3CIHA 4CDWB 1A8DA 2R072 2WT2A 3DXTA 4N90A 2ZX4A 3SLIA 3O1VA 3JBG1 2ENRA 1S2KA 4GZ9A 2EAAA 5A7SA 5CFDB 5GLZA 3ZXAC 2VY0A 4Y26A 3T1MA 1W3XA 2BFUL 4O65A 2AC1A 1QQP1 3TWIA 5IYYA 3OYWA 4FPKA 1RUF1 3NRUA 3T09A 3C3VA 2R0FA 5FTTC 3HN3A 4N9HA 2WNUC 2MEV1 4XURA 2PAMA 3IT8A 3JB8A 4FPOB 4GXLA 4DFSA 2WNVC 4AEMA 4WZFA 1JBCA 4KL1A 2RS11 1X36A 4AFDA 5DDJ2 2HEYF 5SV8A 2AEYA 3W59A 3MPPG 3M1HA 3BPZA 3VHPA 1PM4A 2ES3A 1GP5A 2WN2A 3QCWA 3WF2A 2OS2A 3AP6A 3ENRA 1XYNA 1FT9A 5FKCA 5C3SA 2ZJCA 1DG6A 1WA4A 2BEOA 3BTZA 3E1F1 2VAUA 3O0VA 4URTA 2R062 4V2WA 4IE4A 4QHBA 2YB7A 3PUHA 1R1A1 4W6YA 3WT3A 1EV13 3LF7A 4YFWA 3CLPA 4A42A 1UO9A 4IDZA 1NXMA 4O9EA 1C28A 3PL0A 3THCA 1TMF3 2ZMKA 2EXKA 1WA6X 2XBO2 1GR3A 2GH2A 5JSPA 2JX9A 5T50A 1HV0A 4Q0SA 3ILFA 1F5JA 1N3OA 1SFYA 4AVVA 2ZS6B 4LHKA 2VO5A 5BNPA 3NJVA 4BK5A 3I2FA 3C8XA 4YRDA 4QB2A 2GDFA 2BWCA 3MDPA 4X8NA 4CDUA 3AJZA 3M7AA 3JBG2 1RUD1 1AJOA 2RG4A 2XVKA 4OYUA 4XDQA 1FATA 2YGMA 1YO8A 5FRAA 2ZEXA 5CZKA 5FQ0B 1WCKA 2P3JA 2YY1A 3IN9A 4IV3B 1AZDA 5CA6A 2RS51 4G3YC 1RUF2 1JZ7A 4H7MA 2HWC3 5FZCA 4LXLA 4ZU5A 2VW0A 1HRV3 4LOTA 4N43B 4MGIE 1RIRA 2ZMNA 3ES4A 4XJ8A 3WP6A 4ES9A 4UBGA 2JG9A 1OXCA 2XVLA 1SZBA 5J48A 2KA3A 2YYOA 5DUUA 2RS12 3W5MA 4JAAA 5B4NA 4JC1A 1UOGA 3KVAA 2EVXA 4Q1PA 2Y64A 1ULPA 3KZ4C 1MS4A 1VRH3 1KEXA 2WSUA 2QQVA 2YDEA 3H1YA 4RR3C 2XJTA 1S0FA 3PVEA 1MACA 4QMAA 5LA9A 3KD4A 5LATA 2CSGA 5LA0A 2HWB3 4ES8A 1REFA 3HPNA 2XOMA 2VM9A 1FNYA 2ZKNA 5FWJA 5DABA 1PO13 2D6PA 4JTNA 5G05L 2VUAA 4EWEA 1UL9A 1TNRA 3P3NA 1FI2A 3BIWE 2RJKA 1ZBA3 1V6LA 1VR3A 5GALA 1BVVA 1S2BA 2X8KA 2DTWA 2DUQA 2K46A 5LA2A 4QM9A 4XQDA 1VMJA 4EN6B 3OF1A 4BDVB 4NRMA 2F17A 1W9WA 4HPKB 5F6KA 1D0HA 3RDIA 1OOPC 2HKXA 2RS31 4GB32 5IVYA 4YZ1A 5JUVA 1LOAA 3EXUA 4GMP3 4XETA 1JYXA 4LIVA 4Q29A 5LZ6A 5DDJ3 1NLQA 1U12A 1IPKA 4HKLA 4UW5A 1W0NA 3WF4A 3TBDA 4BM8A 1S0IA 3WHTA 2XLGA 1CPMA 2CY6A 2PQQA 2RM21 2ZHMA 3K77A 1BYHA 4HKWA 4NPLA 1AYM1 4OUMA 4FQ4A 1ZA4A 3HR9A 1R64A 4XUOA 5IAVA 5C8WA 1K5MB 3ZYFA 1ULOA 1XYPA 4QPIC 4XFBA 5I0RA 2SBAA 5KHGA 1C3HA 2RR11 2O8OA 5FBZA 3PUQA 4I0BA 1UQXA 3RJ2X 3SEEA 2WQ4A 3L9JT 4P9XA 2WUHA 1X9PA 3PURA 3PUIA 4XILA 4BQYA 3MGUA 4Y1YA 2IFRA 4JRAA 3O0XA 1XNKA 3M3EA 4Q27A 4XFGA 3R4DB 5F5AA 5FMOS 4AZZA 4TZDA 4M00A 2HWD2 5J09A 1CAVA 2ZAHA 4WM7B 4HSJA 3BIEA 3PTRB 1G8WA 2L9LA 3OGSA 4GWIA 5APAA 4LBQB 4KI5M 1QJY3 1AR81 1WLDA 2WZPP 1V00A 1YQCA 2X29A 1DFQA 3N7MA 1CPNA 2A7AA 2CL2A 3BUCA 1XE7A 3K46A 4CRQA 1FMD3 5I8YA 4Z1VA 2NQYA 5DZFA 4XZUG 2JDYA 4ZY9A 2EXJA 2QQKA 5ANNA 2WABA 2AR6A 3AYDA 3U78A 2QVSB 2ZMLA 4MGTA 1POQA 1VBD2 4RHV3 3RSJA 5H9RA 5JXGA 1UNBA 2RS32 4GA9A 5FY9A 5FZ6A 3RFRA 5CFCC 1LHWA 5L7OA 1WLCA 4P9WA 2Y0IA 3LSEA 1IZ3A 3M3CA 3H8RA 4UF0A 2B4KA 3P6BA 3U07A 5KHIA 3IDBB 2QQWA 4CCLA 2RM22 3VZNA 1ULDA 1FOD3 4CEYC 2ID4A 1Q43A 4IE0A 2P3YA 3NJXA 4ONUA 3RRDA 4UFMA 3VBFA 4Z2AA 3LEIA 1LOGA 2IXLA 2GNBA 2RR12 2LTNA 1B35B 2OX0A 5T52A 4B4QA 3Q8EA 2HBUA 3U75A 3LSDA 1EAH3 3L2YA 2HYXA 2QDNA 3U1XA 5EIYB 5FK8A 2XUMA 2BOJA 2KXLA 3MUZ1 3WLUA 1AYN1 3BVCA 3AM2A 3NKGA 2A6VA 4WM8B 1ZRDA 3WINE 1LHNA 1HQWA 2EICA 1W04A 1YHFA 5EP9A 1ND2B 2PHXA 1AR82 1DYKA 4H2AA 5FYZA 3MUY1 4K8RB 5KXBA 2ADDA 2G9FA 5H9PA 2PXJA 4ISQA 4M0HA 3LFIA 1W6OA 4LUKA 5FAXA 5DG1A 2R7EB 4XUTA 1IS6A 1NYWA 3JB4C 1WLWA 5JVVA 2WNUA 3N9MA 4NO4A 5GLTA 3VDCA 3CU7A 4QPGC 1J3PA 2QNKA 4CEWB 5BNNC 2DURA 4QAWA 3ZXFA 1GQGA 5JI7A 1NAEA 4MXWB 1HB2A 4WVZA 3WD5A 4QGMA 4DRVA 4OVEA 4PIYA 2ET1A 3ZM8A 4JKLA 3D3AA 2VMHA 2WT0A 3O1OA 2DTYA 1Y9MA 3RWKX 5JOYA 1QOTA 4G9SB 3QH6A 3WNLA 1F4HA 3CHXA 1TQ5A 2EXIA 1R093 3C7EA 2XXZA 3GHMA 2ZGLA 4L97A 2XHKA 2AUYA 1RHI3 3C7GA 4WVWA 4RQPA 3CKHA 1SLLA 2D43A 4JVAA 3C7FA 3LFMA 3V0BB 3BKZA 2B39A 2E32A 1LOCA 2JDKA 3GZAA 1W2NA 2HWD3 4PI2A 2W94A 1H2LA 1H2MA 1ZZCA 1BBT1 3AZYA 2R042 3JCIA 3V65A 4IESA 4LBLA 3ZXKA 4Q4V3 1NY71 5JLVA 4OI1A 3PIJA 2LS6A 2GU9A 3OPWA 4Q4Y1 3AZWA 3THDA 5FFOC 4EJRA 4C1XA 3S7EA 2D6OX 2FZ1A 3N36A 4M3CE 3ZVXA 4E4SA 5F1RA 1H0BA 3KVBA 3WZ1A 2BZDA 2IUWA 3AMHA 3MIFA 3NNJA 4FOWA 4YYOA 3VBHB 3VBSA 3F95A 5D8AA 4LE3A 5CKMA 2V5YA 2CGPA 3HBKA 2BVVA 3OPTA 3NMBA 2Z5WA 4K7JA 1AXYA 4QQHA 2RHPA 4LBJA 3ZSLA 3OBTA 2ZHKA 4LKDA 1DF0A 1H8VA 3A22A 4Q4W1 5FY4A 4COWA 2XKOA 5JZGB 4WZCA 2ZGTA 2JD9A 5A7WA 3GDBA 3UT0A 5JOXA 4GWNA 3A7QA 2DVBA 3U4XA 3HQRA 3DN7A 2PHDA 1QJU3 4AEKA 5JOZA 3VLBB 2WFPA 1WBLA 5LCWL 1UZZA 5KHHA 2NM1A 4NIGA 3GYDA 1PX4A 1H2NA 1YIFA 3JD71 3KB5A 3P3PA 4NMIA 3ZYPA 2W1UA 5L9VA 4QQLA 1VBC2 1NQDA 4W50A 1W2TA 1V70A 1KFXL 2B9UA 2J1RA 1JUIA 2BGPA 2HJIA 1O91A 3OGJA 1CZSA 4KG0A 4X6RB 2QQLA 1AR91 1Y7BA 3AFGA 3MLLA 4OI2A 4RSUA 5GKAC 3S5AA 1DLLA 4DPNA 3MF6A 5FYCA 1SCRA 2QUOA 5FYHA 3RVHA 3ZFGC 2BU9A 3AP4A 4OHVA 1WMDA 3MIBA 5A32A 1BBT2 4LQRA 5FZHA 1GZ9A 2AZ5A 2HBTA 1DQ4A 4B1LA 1HJGA 4EN8B 3GJAA 1PIV1 3B93A 1JTZX 5FY8A 4HKOA 4Q4X1 5JMOA 2PYTA 2LM3A 4Q4Y2 3ZFFB 2C24A 3PTYA 4HMZA 2XONA 4XJUA 3VL8A 4GH4B 4N53C 4FOQA 1AL21 4OI4A 3WR0A 4M4RA 2P4EA 3OY8A 2OYZA 4P9IA 3O12A 1OOPA 4OI0A 1UW8A 2RMU2 1MZ6A 2WFF1 2OPKA 2Q8CA 4TWTA 3FFZA 1JOJA 4XBLA 3D8CA 1KS5A 3RZHA 3ZIXA 1DU3D 3VD9A 1X50A 5D2AA 3M3IA 4UI9L 1CESA 4KQ7A 3IMNA 3POEA 1JYTA 5IVJA 1LOBA 1QXPA 1VBB1 2W5FA 3B94A 4UFJA 1F35A 2VOXA 4I3GA 5CG8A 4V1PA 1PGW2 4S2GA 4P00B 3E6BA 1CJDA 4CE8A 1Q5OA 4QPIA 5IVCA 2WO1A 4DMIA 1FV3A 2DVDA 4XC9A 3AC0A 4QU2A 3A0NA 2YFUA 2WO2A 2Q5TA 1RINA 5JXIA 4HVRA 3QBQA 4QX0A 1DQ2A 3BN6A 5J1XA 3VKLA 1BCXA 3C2UA 3ZFEC 2NN8A 4GJZA 4E4HA 2R043 4QHZA 3O14A 2A70A 5LW9A 4FAGA 1AR92 4DY5A 2OZ6A 1CWPA 3WW2A 1LB2A 3GCWA 1XJAA 2D6LX 1NA1A 4AF9A 4CP9B 1AF9A 2D3RA 3E6DA 4XHBA 1QJX1 3JQXA 4LR4A 3WUCA 1ZZ9A 5CKNA 1GV9A 3GXUA 4AQ2A 2ZGOA 4Q4X2 3I2HA 1G9BA 4XQWA 4S2HA 4A7ZA 1UU4A 1MS1A 1VBE2 4OZXA 1YQ8A 4AI9A 3POJA 3M3OA 3ORJA 4LLOA 1AL22 1W8HA 1FPN2 1DP0A 3ACHA 5BUVA 3M70A 5CYYA 2WLQA 5FP3A 4EV0A 5LA1A 2JXAA 5CFCA 2W47A 2TEPA 2XH6A 2PHTA 4M0NA 5AFBA 5C8CB 2UU8A 4KMQA 5LY1A 2ZTNA 3DYPA 2QQUA 2F4LA 3RZZA 4BQWA 3NV2A 5FOBB 3V0AB 4FTSA 2J1SA 4CEYA 1P8JA 1YI7A 1Y3TA
chains in the Genus database with same CATH topology
3RI9A 2BNOA 3ZX7A 1OPMA 5ACA3 3VZJA 1KRIA 3D0JA 1HQLA 5E1RA 4Y1UA 5HCAA 4ISRA 1ND3B 3ILNA 5KHJA 3VUOA 4FT8A 2Z79A 3BOWA 1DBNA 2P17A 3KGZA 4E2GA 1SDWA 4S2FA 3H8UA 3O0WA 1YJKA 1R1ZA 1UU6A 1RUG2 3JZVA 2A3XA 3WNXA 1KJLA 1QJX2 1ULGA 4CDUC 3ZN6A 2P37A 3JUUA 1WUVA 1MS0A 3FX3A 1IKPA 2BVBA 1DGRA 5HXVA 4WBBA 3VGIA 3SXWA 2Z42A 4QPGA 3U11A 4EN7B 3TOJA 2BGCA 4XTMA 3W9AA 2H6BA 1NCRC 2ZZJA 1BJQA 4Q8LA 1BVP1 2W0XA 2NMOA 1R081 1ZYBA 3WDWA 4D7SA 3BOPA 1YXWA 2WSVA 3U10A 2R1BA 3CJIC 4D7TA 5J37A 4OUSA 1OA3A 1QXJA 2CGNA 1OLRA 2WINB 1O3QA 1W6QA 4L2NA 4Q8KA 3WDXA 1EV11 5T5OA 3I59B 1TMF1 3E97A 3VBUC 5F5QA 2ARXA 1LR5A 5CNAA 3H0OA 1MS3A 2E7QA 5CG9A 2VH9A 3TN92 1RGSA 4IEWA 2D5HA 1J3RA 5GZDA 3E5XA 2VU9A 4B4PA 1VBE3 1V6JA 3R4SA 1FPN3 4WVMA 2HWC1 1O5UA 4E4ZA 2PLV3 3B01A 1BK1A 1HRV1 1WLTA 1RVF3 1XNBA 3HWJA 3PLQA 1J58A 3I2DA 4MH0E 1MZFA 1OQDA 2P3KA 3KCXA 4FSJA 5J98B 3EO6A 3WG3A 2A3WA 4N7UA 1CAUA 4Y22B 2D93A 5FO8B 1VP6A 5IK8A 4LHLA 2VNRA 4COUA 1VAVA 2TUNA 1VRH1 2CGOA 2N7GA 4AQSA 4MGZE 3O5SA 3RYPA 1G7YA 1IHMA 2SLIA 1V6OA 2C0ZA 2B7YA 2EIGA 1PVC2 1QH7A 2HWB1 1AL0G 4XHXA 5SV5A 1EV12 3NV1A 5C4WB 5JDBA 2BBVA 1HV1A 1PO11 2MHFA 2R071 1TMF2 3A4UA 1V9U3 4K3UA 5T5PA 5EZWA 1RUG3 2EXHA 4BE3A 4EWAA 5L36A 1CN1A 4F83A 3ZYIB 3ECQA 1Q3EA 4N53A 5GZEA 5BNNB 4YNIA 1SBEA 3IKWA 1U5YA 2K9ZA 4AHZA 3CO2A 4D94A 3AP5A 4GULA 4CDQB 5E88A 4K6BA 2ZGKA 1W6PB 3DPRB 1KFUL 5DDJ1 1HRV2 3LA3A 1NG0A 5C9AB 4RGGA 4FTEA 1S0EA 1HXS3 5JWPA 1ZRRA 2UURA 4FOVA 3VKOA 1MZ5A 5BNOB 2VVFA 4PLNA 3LOIA 1MS8A 2IXCA 4FPHA 3GHNA 5GJ6A 4XIKA 4FVVA 3UKNA 3ZFEA 1VRH2 2EA7A 1XNDA 4LO7A 4XJAA 4AHYA 4H7LA 4ASMB 4OHYA 4L9BA 3VBFC 2TBVA 2GNTA 1GZWA 2VW2A 4NPRA 1QJY1 3MIHA 3ZSJA 1VIWB 1OMIA 4IEZA 1QU0A 3N7KA 4PDWB 3KT4A 4XF3A 2AGSA 3MW2A 3ZXLA 1AXZA 3AP9A 3IM0A 3EQEA 5CB7A 1FMD1 1DGWX 1ZBA2 2XWJB 3H7YA 4HK9A 4S2DA 3PJYA 4BWOA 1OFSA 5EYYA 3QLQA 1YFUA 4NHKA 4LHNA 1FAYA 3VDDB 2NZ9A 4J1XA 4XFAA 3ZSEA 3NAPC 1LEMA 3USUA 4HN1A 3IPVB 1C1FA 5K7PA 4JDNA 4XIOA 1MVEA 4K1ZA 1O7FA 1WBFA 2HWE2 5LRRA 1OKQA 2IWGB 4YVWB 1PVC3 2VQ0A 4FO9A 2DVAA 4AK3A 3R05A 4LBOA 4RQPC 4YARA 4FPLA 3OGGA 3J26N 4IEPA 3TYJA 5HI0A 1QHDA 5CADA 2X53S 1D4VB 4HPKA 3DV8A 4YVSC 4FAHA 4XYXA 3AX4A 1QJY2 2WZR3 1TME3 1O3TA 3T1LA 5HCFA 2Y0OA 4R9AA 1IQAA 5JSOA 3ASIA 4YGCA 1WGPA 3VBSC 4B8EA 2DCYA 4P9JA 1FMD2 3HT2A 1GNZA 4Q0PA 5D8AC 4B7EA 4XE9A 4GB31 3O7OA 2D98A 4IERA 4AW7A 3K48A 2WA3A 1NCRA 1DGRN 3FE5A 3R0RA 4JGZC 2HYKA 2CV6A 4RHV2 4CP1A 4FQZA 3WQ0A 2E9QA 1Y43B 3CJIA 1KDKA 2X5IB 4K21A 4E9KA 3GBGA 4ITCA 4IL7A 4L8QA 4RS5B 1UAIA 2R0HA 5J7MA 2D6MA 4LO4B 1LOEA 1FOD2 4AI0A 5A33B 4N7IA 1C8NA 5C6CA 3NL1A 2HWD1 2ILMA 4AI2A 1XNCA 3ME2A 3QACA 1NQJA 4XTPA 1I6XA 3SMHA 4NOTA 2YC0A 3VBUA 1RUE3 1EAH2 1X7NA 1CQ9A 3X29B 3TAYA 3GBWA 4IEYA 1I5ZA 1ONAA 3OYWB 4XJ9A 5JIAA 1OHFA 2VQAA 2CAVA 3VBOC 2OVUA 1OLQA 4P9LA 5KC5A 1QH6A 2PFWA 2JDZA 2GSYA 3HN1A 1MS5A 2Q4SA 1VBD1 5DUVA 4QT6A 4GMP0 5AVPA 5BY5A 1MEC3 1WW6A 2GNMA 1GQHA 1U5IA 4M3CA 2IXHA 4WVVA 5JIUA 4IEVA 4ATEA 1GSLA 1QJU1 1OSGA 3D4KA 1ZRCA 2IC1A 4YGEA 3B02A 4Y20A 4AI8A 1A78A 3MYXA 2HWE3 1AJKA 2ZZQA 3E5UA 3GZTB 4QX5A 2AENA 2XL9A 4PJYA 1R092 1F9KA 2E53A 3R4UA 4LO5B 1RHI2 5AFEA 2DU0A 4FPGA 2VUJA 4J1WA 1M4WA 1N1VA 3VN4A 1MQTB 2DVGA 4PBPA 5BNPB 1DDLA 1G9FA 5T5JA 4BIFA 3SH5A 4PQ9A 2ZCWA 4LO8A 5GLUA 5L19A 1QXRA 2DUPA 4Q4V2 1NA1C 1N1SA 1C1LA 2OUHA 4D69A 3ELNA 2XJQA 1H2KA 4GWMA 3WDYA 1H1IA 3NW4A 1HW5A 2JG9B 2D6NA 5LEJA 1XRUA 1APNA 4DNYA 1DYPA 1VJ2A 3WHUA 3V0BA 1GKBA 2PTMA 1IGOA 1PMIA 1DZRA 1MVQA 4KU7A 5LEKA 2R30A 4Q1RA 4YW3A 2I07B 3WDUA 1QJU2 4AVSA 3BCWA 1A3KA 5CU1A 2B8MA 3ZDSA 4KGQA 4PIZA 2CTVA 3UJOA 1LECA 1UX6A 3PHMA 4GALA 4NR1A 1HRI2 3VBHA 3LWCA 4Y5Z0 2R041 3QOPA 2MEV3 2DU1A 2A73B 1WCSA 4LEJA 4UW4A 5GM0A 3WG1A 3NWKA 4JGYC 1VAMA 4HANA 1FYUA 5K0UC 1A6CA 4XJZA 4YW5A 2XG3A 4YGBA 5FPXA 3MW3A 1QKQA 4BLIA 1W0OA 3VHOA 1RUH2 1PVXA 2MPFA 4H14A 4GKYA 1XU2A 3FFQA 1NCQB 4YM3A 5DUWA 4HVOA 3UJQA 3VKNA 2E6VA 4Z8BA 3NAPA 1YFYA 1EY2A 2JG8A 4JCKA 4LBNA 1X82A 5FLHA 1QNYA 3RNSA 5J96B 3DF0A 1VBC1 2OIIA 1N3QA 5ACA1 1JUHA 5LK5A 2DCTA 3VBRC 1BZWA 2AYHA 2B42B 2E63A 2GMMA 2YXSA 3HT1A 3E6CC 1YJLA 2RS53 1ALYA 3IBMA 1AVBA 1UMZA 4FPYA 1DQ6A 1QOOA 4YVSA 5KWRA 1W6NA 1W6MB 3ZMNA 3ZYJB 3VV1A 1X8EA 2Q0AA 1OFNA 1YFXA 2IXKA 4FPEA 1H8TB 3WUDA 5FREA 4IEQA 2EALA 2NPIA 1OI6A 5I0UA 3VKFC 2VVDA 2RMU1 2ZGPA 4JV4A 4PLMA 2PA7A 4I01A 1JN2P 4AEDC 4NN0A 5L7OB 2VOVA 4JGZA 2VMIA 4XFIA 3IDEA 2NP0A 1RUC3 5FDBA 4QQ2A 4JDOA 3ZYRA 4YM2A 1PGW1 3CL1A 4KNCA 5I8SA 4X6QB 4YZ4A 3D6EA 1LHUA 1SLAA 3VBFB 1IPJA 4YM0A 1NE4A 2DV9A 5ABJC 4NHMA 1HRI3 4QXKA 4LNVA 2BTVC 3T2TA 1URXA 4CDWC 5C33A 5ACA2 1CVNA 1NOVA 2G4IA 4X8PA 1E57A 1D4M3 4FP2A 4B4RA 3WY6A 4PCRA 3LZZA 4Q0VA 3MIGA 2ZHLA 2WC2A 3TNPB 1H4HA 1S55A 4JQRA 4RL7A 1VB4A 1QGLA 5T55A 4ZU7A 4QPYA 2WJSA 1W6OB 3AZZA 2BQPA 4WV8A 4Y1ZA 4XF0A 3VBOA 1PGL2 1N47A 4B7KA 5C8CA 2WNUB 3UKTA 4DZGA 1RUH3 2DYCA 5A3LA 1VBE1 2WNVB 3UK9A 1A8MA 2Q1MA 5GZGA 4MV2A 1FPN1 1GZCA 2PLV1 2NMNA 3PVOA 1DGWA 1OPOA 1RVF1 5BV6A 2W39A 1G6NA 1LOFC 3JQWA 4H3WA 5CVRA 4C0HA 4BPZA 3AKRA 4IQPA 2ZAAA 1LKNA 4CYDA 4I2OA 3AMMA 4TSVA 5T5LA 4LBKA 3SISA 1DZQA 3CNAA 1GANA 3MLJA 1V6KA 5L73A 2TNFA 2YROA 3I8TA 2WNEA 2UWCA 1ZREA 4HVQA 2GH8A 2O8QA 2F4PA 1AX2A 3MF9A 2PAKA 4IV1A 4COVA 3UL2A 1OA4A 3RYKA 4HN0A 1D0GA 2E51A 2UY8A 3I4IA 1AR73 1SBDA 1V9U1 4IV3C 1S0JA 1T6GC 3VBSB 3WQ1A 4IXLA 1CJPA 1RUG1 4BA6A 4AVBA 4N43C 1VB2A 3WOGA 2E7TA 1WD3A 4W6XA 1KS4A 3M2MA 1RMU2 2XB6C 2IXJA 3B9CA 3ZXGA 2CAUA 2YUEA 2C1FA 1NZCA 4XZPA 1RUNA 1X33A 2PLV2 4JDMA 2UWAA 1RVF2 4AVCA 1ULFA 4JTOA 1AYN3 1HXS1 2WIIB 4RR3B 3L2HA 5I91A 3AKTA 2BWAA 1G9CA 1VBA3 2DCKA 5JPNB 3SCFA 2VG9A 2BFUS 5FLJA 3FMGA 2WKKA 4ZXKA 2WQZC 2QE3A 5A32B 1ZX5A 3MPBA 4C1WA 4KBBA 1QDCA 4JGYA 4YZ2A 1ENSA 5K0UA 2BYVE 2E7AA 1PK6A 4M3CF 4PIXA 3ETQA 1ENQA 1RUI3 3TN91 1G9DA 2IXIA 4BHPA 1Q56A 4QM8A 1V9U2 3WG4A 3OY8B 5H9QA 4P9YA 4CDXA 1OOPB 1HQNA 3WV6A 1V6IA 4Y22A 4BLJA 4FPCA 2D40A 4TLFA 4LO6B 3THTA 1MR5A 1K5MC 1C8M2 2KM2A 2VNOA 4B29A 4OHZA 2D44A 4U36A 2Q8OA 1JYCA 4QPIB 1LHOA 3SITA 2BNNA 5C4WA 3TNQA 2W68A 1HXS2 2Y38A 1WMFA 4AYUA 5DG2A 5CAZA 3VBRA 4I09A 2ERFA 2JKBA 1BQPA 1F2NA 2D3PA 4D7YA 1PVC1 3ZPYA 4XOGA 3WP5A 4KG8A 1UKRA 4PBOA 1EP0A 2YMZA 1GLHA 5GLWA 3TB0A 2GAUA 3MLKA 2D3SA 1POV3 2I74A 3FHIB 2WZR1 1TME1 3B3QE 5E8AA 1M06G 3JD73 4K40A 1DQ1A 1UIJA 2IFWA 2ZA9A 1SLTA 3PJQA 1RMU3 3G6JB 1PZ8A 4AEDA 2ZX2A 1QMJA 5CFCB 4DS0A 2DCZA 4LTAA 1S0DA 3MFCA 1CD3G 2BUKA 2GMPA 3PVBB 3NSTA 2GNDA 3AZVA 2ZABA 4CEYB 3RJRA 5FO9B 4DINB 2ZGQA 3UKVA 1CAWA 2XJPA 1ULEA 4C91A 1YUDA 4DB5A 1HLCA 5ABJA 2A6YA 3H1WA 1AUYA 4E2SA 1COV2 4CDWA 2UYBA 4E2QA 1C57A 4WM8C 2A6WA 2ZHNA 4YW1A 1JXNA 1TNFA 2A6ZA 1CAXB 5CFDA 2GMEA 1ND2C 2GZWA 4E27A 1AR63 4Q26A 1W39A 5FPZA 2MNGA 2XJSA 1QWRA 4BYYA 3N3HA 1RUE1 4MUVA 1XE8A 2H6CA 1PZ9A 1QY4A 1FV2A 2I2SA 3ZN6B 3VDDA 1QJZA 4I3PA 4CEWC 3KT1A 2XWBB 4W65A 1ZBA1 4IEXA 2WZR2 1TME2 3H3UA 4QPGB 4F7ZA 1RUJ3 3IPVA 4IEOA 1SLBA 3LOBA 4P9GA 5JR7B 3ST7A 1C8M3 2DCJA 4AVTA 1LOFA 1XU1A 2QFEA 3IDCB 1VALA 4UBHA 4GMP1 4YVWA 3AYCA 1C4RA 1FNZA 2FMYA 3OBRA 2NLRA 4COZA 2HWF2 3V64A 4MSVA 1W6QB 4Z82A 4AGGA 5A3MA 3AYEA 4BQ1A 4XF4A 1J3QA 3FLRA 2HWE1 1G86A 3AYAA 2H0BA 3BTAA 3B00A 3WW4A 4FBFA 1GYKA 1ASJ2 4BCUA 3DKWA 4QQOA 2VECA 3VBHC 2B5HA 2A3YA 5FQ0A 2D7FA 1WMEA 2C9AA 4IV3A 1J1TA 1BEV3 1RUE2 4LBMA 1LU1A 3FC0A 3MW4A 4N43A 1ZBE3 2BW8A 4YG6A 5JZGC 4AHWA 3FZ3A 4QQPA 4WVMB 4ZKTB 2CWMA 2ZX0A 2X5IA 4INDA 3MZHA 4LT5A 4Q2FA 5I0SA 2WS93 1HDKA 1U5XA 4MGKE 1LESA 4RHV1 1LCLA 2R16A 1GICA 5A33A 4AFMA 1Y9QA 1PO23 4XBQA 1MEC2 4ZU4A 4Z92B 1EPWA 3S0MA 1TE1B 1Z7S2 2EAKA 1H9WA 2JG8C 1COV3 1FOD1 2JJ6A 2DF7A 4I02A 3ZFGB 5KBFA 4MGYE 4XEZA 3VZMA 1AXKA 3G7DA 3JU9A 1W2UA 5FLIA 3B5LB 3ZFFC 1BMV2 1KXGA 4UW6A 3AFKA 4GH4C 1EAH1 2VMGA 3B69A 1YI9A 1C5HA 3J8F3 3FLTA 4N53B 4BIOA 1LTEA 3BB6A 5J36A 1R083 2R6QA 3FUOA 5I8TA 1SACA 2QKDA 5EXOA 3WP3A 1Q8SA 3DUIA 2VXRA 3S7IA 1Q8PA 1UPSA 4XPVA 4Y24A 2XJRA 1J1LA 1UKGA 1K5MA 2RE9A 2D5FA 3CEWA 2A75A 2PHWA 1ZZBA 4XFHA 2LALA 5CIRA 4KWLA 2B45X 1WCDJ 3WX5A 2D97A 2HWF3 3K51A 4M01A 1SEFA 4CTEA 1LRHA 1MQTA 4D3WA 1SCSA 4WM7A 5FO7B 5T54A 1O3RA 1HX6A 3ZFEB 4LE4A 1ZRFA 4LBQA 1R091 3BALA 5J3UA 1IKQA 1RJ8A 1RHI1 2VNGA 1Q8QA 1DIWA 1YFWA 2XJUA 1ASJ3 1QQP2 1GZWB 3INAA 2VW1A 1IS4A 1NXD1 1MZEA 5AC93 4FTBA 1AX0A 5K9YA 1YNAA 2MEV2 3POSA 5IK7A 4Q4V1 4IETA 1DHKB 3WW1A 4DOUA 5F6LB 1RTVA 4Y4YA 4BMBA 1RC6A 4A7KA 2OZJA 1AX1A 3POYA 4YG0A 1YRZA 5JAXA 1IOAA 1F5FA 1RL3A 3EHKA 5C8CC 4E4DX 1NLRA 2LUWA 3W58A 2YV8A 4H55A 2I45A 4PF5A 1S0CA 1H1AA 3ZSKA 3D82A 2XLFA 4R8HA 1SFNA 2GC1A 1R1A2 1RUC1 2ETEA 3BODA 3USUB 4AFCA 2ZX1A 5AVAA 4Z2WA 1H1MA 1Z7S3 1B35A 2R073 2ZBJA 4KWJA 4C90A 1ND3C 4ATFA 1JW6A 2DFCA 3E5QA 4L99A 3TRSB 4WM8A 1HRI1 2Q1ZB 1C5IA 3B7MA 2Y26A 1I3HA 2OUJA 1RUD2 3VHRA 1ND2A 3APBA 2DUOA 3N35A 1F31A 1D4M1 3N7JA 4AHXA 4AGRA 1PGSA 3KT7A 4XW3A 3NKTA 2PN5A 1KDMA 3KS7A 2RS52 3FJSA 4IV1C 3OPZA 2FQPA 2XLAA 1NCQA 3OD4A 4CDUB 4L92A 2QJVA 1AHSA 5T3NA 4CEWA 4AXOA 4DY3A 5LRSA 4FOYA 4MXWA 1PZ7A 5K8SA 3VZOA 2RJLA 4HBNA 1RUH1 3ES1A 2R063 3OTFA 1NCRB 4YZ5A 2A71A 5GLVA 2WLPA 2YPJA 2YHJA 1Z0HA 1EPZA 4RGAA 2Q30A 2NYYA 1SQ4A 1L3JA 3CJIB 2XBO3 3WCRA 1I9RA 2QCSB 2QZ3A 1DGLA 4AI3A 1RUC2 4QD2A 2R32A 3EBRA 2UWBA 4BOWA 1ZZ8A 3JBG3 1JHNA 1W0PA 2O1QA 4EN0A 2ET7A 3AXDA 1BKZA 1ZZ7A 1W6MA 5EFUA 3ZXEA 2R49A 3OD0A 1QQP3 4Y1VA 3VBUB 1RUF3 1H8TA 1HIXA 3M3QA 4HK8A 1UZYA 4NWWA 1LHVA 3WVJA 1D4M2 2K0GA 2XJVA 1KITA 1AR71 4R52A 1FXZA 3B9IA 3FWEA 2Z2SB 2RS13 1PK6C 2DVFA 3AKSA 4HSLA 1TEIA 5JZGA 2UY9A 3HAGA 1ZZ6A 2ZGRA 4FP3A 1AYM2 1Q8VA 1QF3A 1CX4A 3HBZA 4CDXC 1DZTA 3RG0A 4K8FA 3QD6A 5KXEA 1U5ZA 4M3CB 2HEWF 2K2SA 3RPQA 4BH9A 2YGLA 4AWDA 1R1A3 1UF2C 2B46X 2V73A 3ZXDA 1QDOA 4Y20B 5IK5A 3SNMA 2QDRA 2Z69A 4DRRA 2XL7A 5KC6A 2YZ4A 3M4FA 3FBMA 3MIEA 3ZYGA 3OCPA 1VBA1 1VLNA 5C4WC 2JICA 3RI8A 1B09A 1RUD3 4RD7A 2DFBA 5HCBA 2XKPA 1J59A 3ZFFA 4XMAA 1CAVB 4GB33 1S0BA 4GH4A 3WQ7A 1N1YA 4K20A 5JSRA 1CR7A 1PHMA 1LODA 2WNVA 2H0VA 4XQ4A 5E89A 5F9TA 5D1IA 1GBGA 2ZKLA 4OULA 5BNQA 4LULA 2GN7A 1RUI1 1PGL1 5I0TA 3MIDA 1UIKA 4MVTA 1XQNA 1AR72 4CDQC 1GFF2 3PVNA 4P5HA 4Y1XA 2VPVA 3DPRC 2ZPXA 3RQ0A 1UD1A 5C9AC 4HLTA 3AKQA 3CJXA 4XFFA 3U0ZA 1SMVA 4G4FA 3GNEA 1EYBA 3VKMA 5BNOC 4CP0A 2GN3A 3ILRA 2W08A 4I0AA 1MS9A 4KWKA 2DWRA 2CYFA 4LBQD 2D6KA 1AYN2 4UW3A 4TYSA 5IUQA 2WWSA 1WW5A 3ACLA 3ZSMA 1SLIA 2BPA2 1VBA2 5TSWA 3UV9A 2R1DA 1ENRA 1WD4A 3VZKA 3POWA 3HD8B 1XXNA 4PDWC 5LK7B 3SHRA 2VGDA 1ENXA 5IK4A 1VBD3 1H30A 1CIWA 4I30A 5CFDC 4LA3A 1WW7A 2RS33 4KU8A 2ZGNA 1PM7A 1O4YA 4QGNA 2PHFA 2AREA 2ZX3A 4EWDA 1POV1 2OW4A 3PNAA 2QZ2A 1CONA 2VVEA 1FX5A 3NJZA 4HFSA 1NE6A 3ROUA 2RM23 1RUI2 3LB9A 4META 4R4XA 1AYM3 1NLSA 4YW4A 1N1TA 3VDDC 4A7YA 4RR3A 1RMU1 4YSFA 3AXEA 3KCCA 2WA4A 2A6XA 3V0AA 2RR13 3NAPB 2JG8B 1HKDA 2A5ZA 4GQ7A 2FHRA 5E16A 2XVGA 4CP2A 2ATFA 3SH3A 3MEPA 1ND3A 4YVWC 4XMIA 4YM1A 3LAGA 3IWZA 1NY72 1AR83 4A3XA 3Q9OA 1IS3A 1KJRA 4RQPB 2JE7A 3FBYA 1LJ7A 4XF9A 4R9DA 4XXAA 3HMYA 1ZM1A 1AR61 4YVSB 3LA2A 2VULA 4DXZA 5FMOL 1W6NB 4AFAA 3RMYA 3RWNA 4YFZA 1Z78A 4K1YA 4Q4W2 2O0OA 1H9PA 5BYNA 2PAEA 3GF6A 5DXDA 1UCXA 5D8AB 4C0BA 4GIQA 4Q0UA 4XFCA 3D0SA 4AQ6A 3BU7A 1RUJ1 3ZMOA 1ULCA 2UYAA 3JD72 4JGZB 3SCHA 3RMXA 2X5IC 3NVCA 1C8M1 4IEUA 4YG3A 4RS5C 5B2GB 1O4TA 3NO8A 2CNAA 2EF6A 3MICA 3N7LA 3J9SA 3ZXJA 2ZACA 3AP7A 3I59A 3ZN5A 1RUOA 1RJ7A 1PIV2 2ZOEB 5EYXA 1CGPA 1LENA 1UPIA 4I0WB 3WDTA 5EWSA 5HBAA 3HQXA 3SH4A 2V09A 2ZGMA 3OJBA 3DGTA 1GNHA 4AI1A 1AR62 4OFGA 2WFF2 3AK0A 4FPJA 1O5LA 3FUQA 2JECA 1OD5A 2F6BA 3QH7A 3VBOB 1VAKA 1BEV1 4NHLA 4AEJA 3RYRA 2XPJA 1ZBE1 4QGLA 4XBNA 1U0AA 1VBB2 4KGGA 3LA7A 5FOJB 4XF1A 4DQAA 4Z07A 1VBC3 4MXVA 3HIFA 2OA2A 1KQRA 1UU5A 4SBVA 3CF6E 1RUJ2 4GKXA 2WS91 3N4MA 2PELA 5BPXA 1KD7A 3WP4A 4HETA 1CAXA 2JEMA 1PO21 1BBT3 5DZEA 4YLZA 4YZ3A 5GZFA 4OLLA 3H7JA 2GALA 4ORFA 1LEDA 4Q4Y3 5KXDA 1REDA 3PMEA 1JYIA 4XXPA 4FXKB 1MQTC 4Q0QA 5BNPC 1COV1 2JE9A 3NV4A 4WM7C 3ZO0B 4AQTA 4IV1B 4R4ZA 1REEA 1V6NA 5KXCA 3KSCA 2RMU3 4AGVA 5BNNA 4J6GA 4P14A 4F3JA 3WDVA 1SBFA 3SCGA 3AMQA 4BZ4A 1NA1B 3AMPA 1IS5A 3AZXA 4Q4W3 3NV3A 4MX3A 2IZWA 4MLOA 1OQEA 3DL3A 1O3SA 3J8F1 1POV0 3H1MA 4OHWA 4HL0A 3USSA 2JG9C 1ZNPA 4CDQA 4CZSA 1BEV2 3R6SA 3H9AA 1W6PA 3DPRA 2AH2A 3LCPA 2FZ2A 5C9AA 3J4UH 1ZBE2 4YW2A 3URFA 3KQRA 5CBLA 4R9BA 3ZN4A 2P3IA 3ALQA 3VHNA 2FMDA 1YWKA 1RITA 4RFT0 1LU2A 5BNOA 1QOSA 2GC3A 3I7DA 2CWSA 1AR93 4NVPA 2WS92 1S0GA 3WXPA 1G9AA 3LKJA 4NWVA 4LA2A 2HWF1 1UN1A 4RA0A 4COYA 3S30A 1PO22 5JPMB 2GC2A 4N9IA 4XJWA 1B35C 3H3ZA 3VL9A 3WG2A 1YIPA 1SLCA 4ASLA 5JMCA 1PIV3 3KM5A 3V56A 4Q4X3 3A0KA 3AJYA 3D5OA 5KHKA 4FXGB 2VOWA 3EJKA 4PDWA 3FLPA 5IT6A 1D2QA 1H4GA 1YLLA 1X8MA 3AKPA 4JGYB 1OQ1A 1ASJ1 4AG4A 5BUVA 5I93A 5K0UB 1AL23 4OHXA 4JRLA 1PK6B 3M8LA 1DQ0A 2PHLA 4HZFA 2WFF3 4R9CA 5AC91 4FCAA 5JCTA 2ZGUA 1S1AA 4AFBA 1LGCA 4U2AA 1RB8G 2ZGSA 1N3PA 4CDXB 4FPFA 5FCCA 2JD4A 1NCQC 3J8F2 1VBB3 3ZIWA 3S6PA 2WT1A 1R082 4L11A 4W6WA 4AE2A 2FBEA 1Q8OA 4MYEA 2XGXA 3MI8A 1DQ5A 1WW4A 3GALA 3WCSA 3ATGA 3KLSA 5GZCA 4YGDA 3LGRA 1LGNA 4AVAA 3KMHA 1ZVFA 3RS6A 5JOWA 3ZFGA 1MEC1 3THPA