2WNVC

Complex between c1q globular heads and deoxyribose
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
129
structure length
129
Chain Sequence
KFQSVFTVTRQTHQPPAPNSLIRFNAVLTNPQGDYDTSTGKFTCKVPGLYYFVYHASHTANLCVLLYRSGVKVVTFCGHTSKTNQVNSGGVLLRLQVGEEVWLAVNDYYDMVGIQGSDSVFSGFLLFPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords COMPLEMENT C1Q SUBCOMPONENT SUBUNIT A
publication title Cutting Edge: C1Q Binds Deoxyribose and Heparan Sulfate Through Neighboring Sites of its Recognition Domain.
pubmed doi rcsb
total genus 27
structure length 129
sequence length 129
chains with identical sequence F
ec nomenclature
pdb deposition date 2009-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00386 C1q C1q domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.40 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2wnvC00
3QBQA 1A8MA 2O0OA 4KGQA 5HBAA 3URFA 2AZ5A 2QDNA 1KXGA 1WCKA 2KA3A 1RJ8A 4E4DX 4MXWB 4TWTA 3B9IA 2WNUB 4G4FA 4KG8A 3FC0A 1TNFA 1DU3D 4QQOA 2Q8OA 3LKJA 2Q1MA 1JTZX 2E7AA 2OIIA 4OUSA 4RSUA 3K48A 4KGGA 1OQDA 5TSWA 1OQEA 2WNUC 1C3HA 1D4VB 1DG6A 1XU2A 2R30A 2RE9A 2ZJCA 4HT1T 3QD6A 1O91A 3IT8A 1TNRA 2JG9A 3AB0A 4MSVA 1JH5A 4OULA 1I9RA 1U5ZA 4QQPA 4QQLA 3L9JT 3TYJA 1U5XA 4J6GA 5L36A 3ME2A 2JG9B 2TUNA 4QQ2A 5KC5A 3ALQA 2JG8A 2HEWF 2RJKA 3K51A 5L19A 4OUMA 3B93A 4NN0A 1U5YA 4N90A 1XU1A 5BNQA 2HEVF 3TWIA 3WD5A 1C28A 2R32A 2X29A 4TSVA 1PK6A 2JG9C 4QPYA 4E4SA 3MI8A 4DB5A 2JG8B 1IQAA 4D7YA 2TNFA 5KC6A 4DOUA 4F3JA 4G3YC 1RJ7A 2WNVA 1PK6B 2JG8C 1S55A 2ZPXA 2WNVC 1ALYA 4EN0A 2RJLA 2Z5WA 1D2QA 3V56A 5CIRA 4MXVA 2HEYF 4MXWA 1OSGA 4GIQA 1PK6C 2WNVB 2QE3A 2R6QA 1D0GA 3B94A 1KD7A 4QQHA 5KWRA 1GR3A 2WNUA
chains in the Genus database with same CATH superfamily
4W50A 3OJBA 1RUG2 5DN2A 2HWC3 2J1SA 2GSYA 2I2SA 4KGQA 1G9DA 1RTVA 1SLIA 5CFCB 1SCRA 3POFA 4L11A 2WZ8A 3WR0A 2D5FA 3KV5A 4LMFA 4WZFA 2TEPA 1XYPA 3VKOA 4YGEA 4IEUA 1XQNA 1DQ0A 1M06G 1FYUA 1S0CA 5K9YA 1JS9A 3ILRA 4YZ4A 5LY1A 3FE5A 4WVMB 1JOBA 3M8LA 5F2SA 2B5HA 5JVVA 2ZAHA 3WW4A 1QXRA 4G4FA 2VXJA 2VVFA 2WNOA 4IV1B 3CQOA 4OMCA 1WCSA 4FT8A 4LITA 4XETA 5D2AA 1OLRA 4RYDA 4DO0A 2JE9A 2Q1MA 4CU9A 1HXS1 4HXCA 1Q3EA 2GU9A 3UKTA 1BHGA 1W9FA 3N7JA 1ULPA 1NXMA 3WF1A 4EWEA 4LHNA 4PI0A 3I2FA 4CTEA 3LQCA 2XMLA 4FPHA 2D6NA 3VDDC 1LOGA 2YGMA 5AC93 3DXUA 1VBB2 3WQBA 2VQAA 4FFFA 3IDAA 2W1WA 4GMP0 1POV3 3LEMA 1JOPA 4Y24A 1K5MA 1QJX3 2NQYA 1VBC1 3ENRA 3KLSA 2D6LX 3N9PA 3WUCA 1UIJA 5FRAA 1QQP1 5A33A 1IHMA 1PO13 4MADA 1EV12 1RUC1 1LNSA 2V4VA 4TXWA 5GZEA 1JZ5A 3I2JA 1T2XA 4XDPA 4YGBA 1QJU2 1Y9QA 4JTNA 4LLFA 5DUUA 3E97A 4AQ2A 1NQDA 2UY8A 5EWSA 3CZJA 3VD3A 4RL7A 5KBFA 3O12A 3VBHC 1W39A 2W46A 1ST8A 1Q8PA 1BBT3 2CU5A 1JZ4A 1VBE2 3T4VA 3RZHA 1GQPA 1NLRA 3SCHA 2HEWF 3V0AA 2Y64A 4QX8A 4CDWA 1UKRA 3GGLA 1W05A 3C7EA 3POYA 4CDQA 1W8WA 2A5ZA 4XDOA 3BODA 2IWGB 1W2UA 2EXJA 3NWKA 4M00A 1ZRRA 5GLVA 4Y5SA 2Q5TA 2VU9A 5FXWA 2ZTNA 4CCEA 3KB5A 3JCIA 4I3GA 3S7EA 2FCUA 3ZN6B 1V6NA 5J1XA 4XJAA 3I3EA 2HWF3 2B7YA 2VY0A 3LIGA 2WYFA 4JRAA 4TN7A 2X8KA 2YMZA 4W6WA 2EA7A 4LQRA 4YVSB 4MGQA 1OURA 1AR71 5D1IA 1S0DA 2A6XA 3PHMA 2N7GA 3ZFEA 1BKZA 1U5IA 1Y9GA 3G7DA 5FYBA 1T6BX 1RJ7A 4CDUC 1ND2B 4X8PA 2X5IC 1UYZA 2P3IA 2QBXA 2MPFA 3D4KA 1LODA 3MF9A 2R1BA 4HN0A 4D6QA 4E4ZA 3R4DB 5T5JA 2W52A 5LK5A 1RUJ1 2AEZA 1X82A 4XCBA 1NCRC 1NCQA 5FQ0B 4LKSA 2GN7A 3W59A 4DINB 3J8F3 1W6QA 4FOYA 2LRPA 1RHI2 4QXHA 4DY3A 3K77A 3VBRA 4AVTA 5AFEA 2W3JA 4A3XA 2OPKA 2LROA 3NV1A 4C0BA 1KD7A 4RGGA 1TVGA 2C6SA 4JHZA 3AYEA 4LKEA 4P08A 5JSRA 3QH6A 1WCUA 1ZBA2 2CGOA 3LEGA 5GZDA 4AI3A 1IG0A 3ABZA 2KXLA 2ZX0A 1OKOA 2XLAA 1TE1B 2AYHA 2A6ZA 2YXSA 3VUOA 1OH4A 1O3SA 1TEIA 2VUAA 2YC2A 1PMHX 2NLRA 3IIIA 3D82A 4FOWA 5BPXA 3ZPYA 3FLPA 3KVAA 1IS4A 3ZIXA 3T1MA 4K21A 4FPJA 4UYBA 1VP6A 4XQWA 3VD5A 3BIWE 4CCMA 5J36A 3AM2A 2RMU2 4EN6B 1DP0A 5C6CA 2ZX4A 2IUWA 2XG3A 1I5PA 2PFWA 3ZN5A 2HWE1 2CTVA 3LFMA 1S2KA 3VN4A 2VVEA 3H7YA 2AACA 5C4WA 1AR63 2R061 5DUVA 1VBA3 2WNUC 4HK8A 3WINE 1D4VB 2GMPA 2H0VA 4HK9A 2C5DA 3N9OA 3LCPA 2ZGNA 1XSQA 3MW4A 2G9GA 3ON7A 3T4HB 3W9AA 1V6JA 1AJOA 3AMPA 4COYA 4CUAA 1PO23 1WLWA 3SC7X 2R1DA 2ZKLA 4GH4C 4IV3A 3RJ2X 4QPGA 2QQNA 5FZ6A 1FV3A 1FV2A 4QQPA 5BUVA 3VBOB 4Q0VA 1ULOA 2ZX3A 3HJRA 3VDDB 3MHZA 3EHKA 4X6RB 3AP4A 4Q8LA 5I0DA 3RI8A 1CONA 3GBWA 2DCYA 1X8MA 2VMEA 5FZOA 2JJ6A 5A1AA 1CPMA 4BQWA 3MBWA 1RUD2 4PJYA 2V73A 5FLJA 3CHXA 4V2WA 1H6YA 3AVSA 5FZ8A 3E1F1 2WRAA 2ZBJA 3O1SA 1ASJ1 4DY5A 1QDOA 3F2ZA 3RRDA 2WFF2 4IQPA 1YQ5A 5T50A 5A3TA 3D8CA 3UJQA 4BISA 1YHFA 4NN0A 3VDAA 2ZHNA 5C9AA 5E89A 3N4MA 4R9AA 2B46X 1GZ9A 3VBHB 2R072 4QXBA 2QUOA 5EJ1B 1HV1A 2F6BA 4UT5A 2UWBA 3IMMA 3J7LA 4M01A 1OI6A 1Z7S2 2P3KA 5JPNB 2JDYA 1FT9A 1QOSA 3LF7A 4LOSA 5EYXA 3JQXA 4QX3A 2XOMA 1XRUA 4WVMA 3W5MA 2OQ6A 2BZDA 1CZSA 2PAEA 2WO2A 5IK7A 3NJZA 1XB9A 3LPGA 3NKGA 1D2SA 1N3OA 2HWB1 4J1WA 5I8SA 3USSA 5AFBA 3ILNA 3IN9A 3L2HA 1GNHA 1H4GA 2EALA 3ZYGA 2QQLA 5LW9A 1W6NA 4XW3A 4S2HA 2B45X 3I97A 3ZXLA 2XJRA 1OMIA 2WNVC 1PZ7A 3MFAA 4E4HA 1LAJA 1BCXA 2GALA 3DXTA 1CJDA 2IXKA 3ETPA 5H9PA 1AUYA 2J1TA 5FZ4A 1BEV2 1QOOA 5FZFA 2FMYA 2FQPA 4GWJA 2X5IB 4PLNA 1RUH2 1YJLA 2VOXA 5F7UA 5A32B 2E33A 1WKYA 1W8UA 2XKOA 5FO8B 3DECA 2BGCA 4N43C 1NCRB 1POV1 5CKMA 1MEC2 5FZLA 3KQRA 1PGL2 5LA9A 4M4RA 3ZFGC 4YARA 1GOHA 1YFWA 3VLBB 4YW5A 1Q56A 1KFXL 3LPFA 4N9HA 2ZGQA 2QQWA 3I3BA 2XWJB 3MLLA 3VBFC 2D44A 4RHV2 1GU3A 1AYN3 1WLTA 3TEWA 3BTYA 3HNMA 4Y22A 4YFWA 4IEZA 3ASIA 3KS7A 4S2DA 4WZCA 5DDJ3 4B7KA 5K0UC 5FYVA 2VBDA 2VJXA 4XZUG 2YYOA 3APBA 1UKGA 2QFEA 4WM8C 5FY1A 4ZU4A 3ZN6A 3A7QA 1PVXA 4MH0E 5JUVA 3CNAA 3PJYA 4OI0A 4XYXA 1HRI3 2D6KA 4LR4A 5GM0A 4NR1A 3S5AA 3MIBA 5GLUA 1HXS2 1RUI3 1CWPA 4AHYA 1X36A 3C2UA 3MZHA 2RE9A 5CG9A 1VMFA 1A3KA 1GLHA 1RYYA 4FAHA 2RR11 5A3LA 2VZ3A 5CU1A 3PJQA 4CCKA 3I3MA 1FOD1 4Y26A 1N1SA 3Q8BA 4OULA 1LB2A 4QQLA 4XUPA 1K42A 3JXSA 1ULEA 2JDMA 4ET7A 1VBC2 2BU9A 3J7HA 4UI9L 2XH6A 1DBNA 1QQP2 2GZWA 4LBQA 4JCKA 4IW3A 3ZN4A 1JODA 4UFIA 3HVDA 4AEDA 5L36A 2A70A 1UZZA 1RUC2 2JD9A 2VE1A 1BZWA 2RS52 1MZEA 2DUPA 3DPRC 3FWEA 5FMOL 4OUEA 2XL7A 3IPVA 4HANA 3BU7A 3K51A 3B93A 1W3VA 4UFKA 5FZ9A 4A6OA 4A7ZA 1WA6X 4N90A 5IT6A 4XZPA 4QM9A 5B4NA 1XNCA 4C91A 4F7ZA 4DXZA 3POJA 1LHOA 4GMP1 3VBUC 1XNDA 3RNSA 2OUHA 5C3RA 3MYXA 5IVBA 2PLV3 1G8WA 4QDSA 1PIV3 1IG3A 1IPKA 1HDKA 1UAIA 1UU5A 2VTFA 4A2UA 3O1TA 3OB8A 4AFBA 3H0OA 3LA2A 4WVVA 3CZUA 4CP2A 2C0ZA 1W8OA 1RUF2 2BOJA 4Q0UA 2UY9A 2WWJA 4AFDA 2DF7A 5JOYA 3SCGA 1C1LA 3LIHA 3WDUA 1CAWB 4LBQD 2ZPXA 2I07B 3FBMA 4MO3M 2HYKA 3ZYBA 4AI1A 2XUMA 3AZWA 1RUE2 4LUMA 2RJLA 1E5HA 1OA4A 5BNNC 2V5DA 1D2QA 1LOAA 2EIGA 2OZJA 2JDNA 4IEVA 1QH6A 3LWCA 1H8VA 3HAGA 1ZBE3 3RMXA 1RUJ2 1V0AA 1PX3A 2JB4A 2QTWB 2QE3A 2WNVB 4KBBA 2OA2A 3WDVA 4DZGA 1VRBA 4HETA 3VDDA 5HCAA 2BWCA 3FMGA 5FZ0A 1A8MA 5SV5A 4C90A 3GALA 2AZ5A 4B29A 1OD3A 3M70A 4JDMA 1VAMA 4ZZ8A 4LOTA 2FMDA 4NHXA 5LASA 4E4DX 1UPIA 1Y43B 3JUUA 4E2GA 3PUIA 1GP6A 4N43B 1QJY3 4FFHA 2R042 3KM5A 4Q27A 4A44A 4LHSA 4UFHA 3NAPC 1ENRA 2D6MA 4CU8A 5IVEA 2DWRA 4Z2AA 2HBUA 1AYM1 2GMEA 2Y8KA 4YW1A 4NIDA 3I4IA 1CAXA 1L7LA 3O14A 4BHPA 5JMCA 1RUG1 4XF1A 3ZYJB 2TBVA 2KM2A 4LO7A 3VZJA 1ULCA 3RMYA 5IUQA 3LA3A 2PHRA 3U10A 3H50A 4AI8A 1TZOA 1L7RA 3MEPA 5C8WA 3CKHA 3R0RA 1NY72 1YQ6A 4IE5A 4AI2A 3OUIA 3OOXA 1C3HA 3A0KA 3N3HA 4COZA 1NKGA 4XF4A 5KC5A 4KL1A 3K75B 5EPAA 4WM8B 5JDBA 1AVBA 4N7UA 2XLGA 1RMU2 3ZYRA 4C1XA 1FX5A 3JB8A 1DIWA 5FZGA 2R062 3P3PA 1JU3A 1GWKA 1O7FA 4MSVA 5A3NA 1MS5A 1LESA 2YG0A 3UL2A 4XTMA 4IE7A 4IXLA 2SLIA 1ZA7A 2ARXA 2VTXA 3H1YA 2WNEA 1RL3A 3QLQA 3FHQA 3O1OA 3L9JT 3C3VA 4CEYC 4YG0A 1REDA 4XJWA 5C8CB 1LECA 2VMIA 2VMDA 3FUQA 4CDUA 2K9ZA 2ZZJA 2B39A 5FPUA 2VW2A 1D4M2 1OA3A 2ENRA 3AZZA 4L0PA 4RFT0 3U4SA 3EXUA 4Q4X1 3VHRA 5AVAA 5HCHA 3K46A 4CEWB 2JKXA 1YEWA 2A7AA 1AR82 5L9RA 2BQPA 4GXLA 5FUPA 1S2EA 1ASJ2 3ZVXA 4AEMA 3INAA 5FK8A 3TWIA 4BQYA 4LBJA 4CXYA 5FMCA 3RQ0A 2ZZQA 2YBSA 3DPRB 1BMV2 1QJU1 3MLJA 5A3PA 5A6QA 3T2OA 3DL3A 3SQOA 2J1EA 1WCQA 4N7IA 3KGZA 5F3GA 1IQAA 2NN8A 4R9CA 4DRVA 1VBE1 4OMDA 4E9KA 2K46A 4XJ8A 5I8TA 3WF4A 1B35C 3RYRA 4H3WA 1W3XA 2HWC2 2JKBA 2G9FA 2C1FA 1DYOA 2W1SA 4WM7C 2HH9A 3THCA 3N9LA 3T08A 1F9KA 3VKFC 3X29B 5J3UA 1CPNA 4NMIA 3HQXA 2VO5A 3HBZA 2GNMA 2HWB2 1H1MA 3AZXA 5H9RA 4AVAA 1RUNA 3WQ7A 2VQ0A 4Y1UA 2ES3A 4EWDA 4L99A 4Z8BA 3ZSKA 3RPQA 2D3PA 4IEYA 4PF1A 5K4LA 2RG4A 4CP9B 1NA1A 2WSUA 3RG0A 5HV4A 3SEPA 3UGFA 2XJQA 1PK6C 1AL0G 2GDFA 1Q5OA 4UBGA 3K4ZA 1Q43A 1MQTB 2WNUA 1DLLA 1SBFA 1VBD1 5JIUA 4NHYA 5FMOS 3ZR6A 4QB6A 2YUEA 3JD73 4OHVA 5DAQA 2BVVA 2GNTA 4NRMA 3SHRA 2RS13 2WA3A 4LKDA 4AFAA 1N47A 3VHPA 5LRSA 4RQPC 4GH4A 4P02B 3LAGA 4YZ3A 1QJX2 2Z2SB 3EYPA 4H7LA 5FY9A 5FY8A 1REFA 5L7OC 1RHI1 4ZU5A 1QHDA 5FZ3A 5CNAA 4DXSA 1PO12 2NM1A 4OI2A 5KHKA 4Q4W3 4NHMA 1I3HA 2MHFA 2DVDA 5CB7A 1ZBA1 1RVF3 1V70A 1YFYA 2OIIA 2ZHMA 3TN93 4XABA 5IFTA 3SH3A 3FX3A 3J7NA 5FY5A 4OHYA 4NWVA 4JGYA 5AVPA 1SPPB 3RVHA 4AXOA 3NAPB 3RZMA 1BBT2 2PHUA 3KV9A 1JYIA 2VZRA 4KWUA 4YGCA 1SDDB 4SLIA 1DLCA 2BV4A 3UT0A 2P34A 2Y0OA 3H3LA 4QPIA 5FYYA 3IDCB 1LR5A 1QWRA 2CGNA 2ZMKA 4ARYA 5FTTC 4XHBA 1AXKA 3U07A 1PVC3 1U5ZA 1UY3A 4HL0A 1LEDA 4XIKA 1JZ2A 2B4KA 2ZOEB 3LE0A 3CBNA 2BTVC 4TLFA 3BTZA 1CAUA 1GFF2 3I2HA 3MFCA 4AHXA 3U75A 4Q1RA 3OGVA 3QOPA 1UCXA 1UO9A 2VNVA 4UF0B 4JAAA 3ME2A 4RGAA 2V72A 2XLFA 2JIGA 4EROA 3N9QA 4FPLA 1VB2A 1E5RA 3WDTA 4OHZA 1WWYA 2E26A 5LA2A 5T5OA 4DS0A 4E27A 1WMFA 4M3CB 5A3OA 1FAYA 4XIOA 4FVVA 2JDZA 3FHAA 3IWZA 4I3PA 4YM1A 5CVRA 3ZYHA 4ATFA 3VDCA 2IXHA 1W8NA 3WNMA 2HYXA 1TME1 1E57A 1UXZA 3S6PA 2WIIB 5FPAA 3WQ1A 4HVOA 1RUD1 2WABA 1S0IA 3EQEA 5DABA 2XBO3 3W58A 4E4SA 5I91A 4RR3A 4U2AA 4UBHA 4AE2A 1XYOA 1Y7BA 5I0RA 3B02A 2LM3A 4NHKA 3ZFGA 1NG0A 1VAVA 2WFF1 3C7HA 3ITQA 2A6WA 1GQGA 1NT0A 2WN2A 3O5SA 4IEWA 2KD7A 4NVPA 4XBLA 4XJZA 3ZSMA 5C5UA 4COVA 2BDRA 3VBFA 2ZEYA 4NPMA 2VZVA 5FOBB 2D98A 3KMHA 3LEIA 3NMBA 1JZ6A 4BOWA 4BWOA 4LO6B 4U36A 5FIXA 1ZRDA 1O5UA 2RM21 2WWSA 3VKLA 3PNAA 1UD1A 4CA9A 5A1LA 1Z7S1 3BPZA 1PZ8A 2E53A 1RIRA 4A3ZA 2WJSA 1B35B 5KXEA 5K0UA 4YVSC 4WM7B 2OZ6A 3S5QA 3RZJA 1YCIA 1NX9A 1MS3A 4IEOA 4JKMA 3HQUA 1JUIA 2LW8A 1BYHA 2E9QA 5FFOC 5JPMB 1POV0 1G9BA 1UWWA 1R1ZA 4XUQA 1D0GA 2QKDA 1YXWA 1CZVA 1O4ZA 3WP6A 1EUTA 1XSRA 2VCCA 1DQ5A 4DIQA 5BNPC 3PL0A 5CADA 2RVAA 3VGIA 2WZR3 5E6HA 5FYUA 1W28A 1VBA2 5CYYA 3RZGA 3B01A 1UMIA 3S7IA 3OGJA 4I0WB 3I2OA 1FMD1 3OBAA 1BEV1 1WA4A 3ZSJA 4COUA 1OLQA 3N9MA 1PO22 2OQ7A 2WL1A 1VALA 2I45A 1FPN3 5F9TA 1RUH1 3ZXEA 3DKWA 4FTBA 3ETQA 2W87A 4L9BA 5FP4A 1NQJA 4LO4B 3DV8A 1MR5A 3Q8FA 4AGVA 1MEC1 4P9GA 4XFCA 1YQ8A 1MACA 2ZX2A 3MPPG 3RYPA 3IIAA 5C71A 5IATA 4JGZB 1KRIA 5L7OB 3K48A 1IKQA 4AGRA 2Y0IA 1EYBA 1SACA 4RHV1 4CPBA 3UK9A 4MLOA 1VLNA 3ACLA 3AKSA 4IE4A 1UPSA 5ABJA 4D7TA 3A0NA 3NJVA 4MX3A 5C3OA 1OQ1A 1UZWA 1XU2A 3OY8B 3DF0A 2MNGA 1R64A 3HNYM 1GWMA 3PURA 3VBUA 5F5AA 3Q8AA 1PX4A 2F4PA 4EJRA 3ZOIA 5DUXA 2J1VA 2YBKA 1W03A 3VZOA 4CXWA 2BP6A 4PCRA 2CGPA 3WT3A 4AVCA 4PLMA 1JHNA 1CAVA 3G6JB 5GJ6A 1EUUA 2VZ1A 4EN8B 1US3A 1W6PA 1ZZCA 1IZ3A 2CWSA 3SCFA 1C8M3 1UL9A 2D6PA 3LFIA 3H3ZA 4OI4A 3N9NA 1F5JA 2DFBA 3J26N 4QQ2A 4S2GA 5JAXA 2C9AA 2BNNA 5A7WB 4FPFA 3VBOC 3ZR5A 4BIOA 1YC61 1YUDA 2J42A 5A6YA 1HN0A 1JZ8A 5F5CA 5BNNA 3M1HA 1LKNA 3U37A 2WS91 3QACA 3B69A 4Y1VA 2CAUA 4CE8A 1AF9A 4CPBD 4PF5A 4AZZA 4Q4X2 4CCDA 4YZ2A 4XEZA 2J22A 1N3QA 2JG8B 3I2DA 2RS51 1H2NA 1HB1A 1GZWA 4D7YA 4YVWC 2BBVA 1QGLA 4HG6B 5FPBA 3I3QA 4FOVA 1SMVA 3DKQA 2ZA9A 3PMSA 4BQ4A 1REEA 4GALA 4L97A 3DYOA 1ZA4A 3I59A 2GC3A 4Q4Y1 4F3JA 3VD9A 2DUQA 4Y5Z0 4QB1A 4JKLA 5CA6A 1GNZA 2MEV3 1DQ6A 3MW2A 2A3XA 1RGSA 2D5HA 1S55A 1GZCA 2XDVA 3LDRA 1UOGA 1D0HA 1ZZBA 5KHJA 4IEQA 2O14A 4AVVA 5IAVA 3TN91 5IFPA 1OVPA 5DDJ2 1C4RA 2ID4A 5LK7B 1VAKA 1OXCA 4M3CF 1LULA 4YSFA 1UMHA 4HOOA 1OSGA 3MW3A 1RUF1 2LS6A 3I2KA 3NW4A 3WP3A 2BGOA 2YBPA 3B94A 4RN5A 1ND3B 1U12A 5FXZA 5GZFA 3USUB 4BH9A 4IUGA 1UYYA 5IAXA 2CDPA 3I49A 1VRH3 2ARCA 2OVUA 2CDOA 4PLOA 5JSOA 3EBRA 5HBAA 3WV6A 1RUE1 3ZKUA 4Y1YA 2Y60A 2VAUA 4XUTA 5ACA3 4TLGA 1O3RA 3AX4A 1LOEA 4MXWB 2VCBA 1FNYA 1VBD2 3OG2A 1W8FA 2D3SA 4HPKA 2ZS6B 5F39A 4ZZ5A 1AXYA 1X8EA 2WT0A 5BNPB 3BIEA 5J37A 1LGNA 1LHUA 3SITA 4CEYA 1PGSA 1DU3D 3E6BA 3HT2A 2VD7A 4HONA 1MS8A 3PIGA 4I02A 4RSUA 4ZXKA 1JZ7A 2CYFA 3GBFA 4QDRA 3IAQA 1MZ5A 4P9LA 2BGPA 1SLLA 4XFBA 4Q4V1 1S1AA 2UYAA 2ZGLA 4OQ9A 5FJHA 4CCNA 4HLTA 4QX1A 2CNAA 2R041 4DUVA 3U0ZA 3QD6A 1BVVA 3IT8A 4H2AA 4R4XA 1RC6A 5JMOA 1CVNA 3RDIA 3VD7A 1UNBA 1R083 4K3UA 4HVQA 2W1QA 4CVUA 5K8SA 2PN5A 2XPJA 4M0HA 3ZYIB 1HKDA 4GB33 1PIV2 1W99A 1NY71 4ITCA 1OOPB 1COV3 4QM8A 3WG3A 4XMIA 5GALA 4PDWB 4YFZA 3ZXFA 4XXAA 1TG7A 1MZFA 3GCXA 4V1PA 3RS6A 3NSTA 1LHVA 1R093 1RITA 1RMU1 2DBIA 3FFQA 3JB4C 4FFIA 4CYDA 2ZGKA 3LB9A 4E2QA 3LOIA 5FY7A 1DZTA 1XC6A 1J84A 3BALA 1OUSA 3S30A 1WW5A 1XYNA 3WCSA 2A73B 1PK6A 3AKRA 2ZCWA 4X8NA 5FMDA 1QF3A 2WT2A 5ANNA 5C3SA 1WGPA 1HQWA 1DYKA 1ZBE2 1GWLA 1BLZA 3H8UA 5GLTA 1TME2 3WDWA 1D4M1 4AOCA 2PMWB 4CDXA 3RGBA 5D8AC 3NKTA 4FP3A 2ARAA 1J3RA 2J1RA 4QKFA 3WW3A 2ET1A 5JXHA 1W6OA 5FZAA 4RQPA 1AR81 3BPSA 4JZRA 4XOGA 2IFRA 3B3QE 2VOKA 4ORFA 1ONAA 1QDCA 1XNBA 3VB9A 1BMV1 4CZSA 4YVWB 4XURA 1O4YA 4FXKB 5J7MA 4W6XA 5APAA 4YW4A 1PMIA 1QJY2 2OPWA 2XUEA 2FDJA 2C4XA 4ZONA 1Y9MA 5FZMA 4QPWA 5IVCA 5CFCA 2RM22 4H14A 5CIRA 2DCJA 2WINB 1APNA 2HWC1 2ZX1A 4MVTA 4LHKA 4ZS3A 4JQTA 5F5QA 4GKXA 3E6CC 5J98B 1R1A3 2PAKA 4NAOA 3GJAA 3SH4A 4IV1A 2OX0A 4NWWA 2XQXA 4E2SA 2PHLA 2DVGA 4I2OA 5JXGA 4YZ1A 1KDKA 5JZGB 2PQQA 4BXFA 1WCKA 2OW4A 2WN3A 4AHWA 5CBLA 2VXRA 2K2SA 4CUCA 4ASKA 1DDLA 1F4AA 1PM7A 5IVYA 4R8HA 2JWPA 5FPXA 1UMZA 5A3MA 5IVJA 3WSOA 1MZ6A 2XR4A 3KGLA 3PLQA 4W8JA 2UU8A 1UXXX 1HB3A 5ERLA 4EZHA 1FMD2 3ACFA 3KF3A 3OGRA 3WNNA 2RS33 4GZ9A 3WW2A 2FZ2A 2DCKA 2BFUS 3S0MA 1JYNA 1WZXA 3ZXJA 4AR2A 1N1YA 3VV1A 2A75A 2DTWA 5I8YA 4XFIA 5AC91 3WEZA 3C7FA 2O1QA 1FNZA 2W68A 1M4WA 3PTRB 3VZKA 4BCUA 4BDVB 1F35A 1QJX1 3P6BA 4EYUA 2JDHA 3NNGA 4LEJA 4CP0A 1LOCA 2UURA 2YC4A 4FXGB 1NE4A 4Z82A 2X53S 2WA4A 3PTYA 1O8PA 1PO11 5FZIA 3WP4A 5FO9B 2FDFA 2JB8A 5DAXA 5AC92 1QEXA 1CR7A 3WNPA 1S2BA 4QKDA 3ST7A 1EV13 3O1MA 4D8MA 3WNLA 2QQMA 2BPA2 2ZEWA 5LBCA 4Q0PA 1BBT1 3H1MA 3ROUA 4TYSA 4Y1ZA 3TYJA 4BU2A 1XOYA 4W4ZA 2EF6A 1H30A 2WQZC 4KH9A 3ZMNA 4C8DA 4UW4A 5KXCA 2VQUA 3U1XA 5J96B 4H7MA 5A70A 2WUHA 4GQ7A 5FYTA 4LBOA 3RYKA 3VBSB 4XFHA 3ZM8A 3CF6E 1AR93 4BXSV 3UJOA 3ES4A 4D3WA 1W8TA 4DRRA 1BK0A 3KV4A 3ORJA 4AW7A 4YVSA 5LWBA 3KHCA 3KD4A 1H0BA 4WVWA 4ARXA 3RI9A 3OYWB 4A6SA 4XVHA 2HWF1 2W92A 3O7OA 4UWDA 3FLTA 4QX0A 5GLWA 4BA6A 5C8CC 4YRDA 2X29A 2Y6HA 4XTPA 1H2KA 1ND2A 1GP4A 1NZIA 1QMJA 2B9VA 2G19A 5A80A 4Z2WA 2ZGUA 4BJ0A 2YB7A 1H9PA 2QZ3A 3VZLA 3H3UA 2WS92 3JU9A 5BNPA 4R9DA 3V0BB 4BLJA 4CEWC 5FQ0A 3HMYA 4KNCA 5IYYA 4QHBA 4A7KA 3ZLIA 5CFDC 2PAMA 1ZRFA 3JD72 4P9YA 4XAEA 2K0GA 3NNFA 1KITA 2YHJA 4K1YA 3J8F1 1WBLA 1ZZ6A 3AYCA 5D8AB 4BK5A 5G05L 2WC2A 4Q4Y2 1TMF3 2CAVA 3CMGA 4QWNA 4ATEA 2DURA 3TEYA 5A3UA 3RWKX 4Q4W2 3I7DA 1V9U3 5CKNA 2YDEA 4MXVA 3VL8A 3MIEA 1UIKA 3H42B 3TN92 4BMBA 1W9WA 4JDNA 4XCAA 3WDYA 2G1MA 5HXMA 4HN1A 4QQHA 3D5OA 1QH7A 4NROA 1KQRA 2P5BA 3VKMA 2DCZA 4YM3A 3ZXAC 2QDRA 2EIBA 4I09A 3GNEA 2P4EA 1JMUB 3MIGA 1I6XA 1RJ8A 4MV2A 3ZYFA 4KI5M 4D94A 2ZGRA 4QHZA 4TWTA 1WUVA 3AZVA 3ZIWA 5DZGA 4EN7B 5A3WA 2GC2A 1MQTC 3SISA 1PVC2 3TAYA 3FC0A 1W6MB 2RMU3 2W0XA 4P5YA 2Q8OA 3SKJE 3WNOA 1GKBA 2Q1FA 4HFSA 3AKTA 5F3CA 1W06A 1DF0A 4FFGA 1AR61 4F83A 1IGOA 1VBA1 5FUIA 5JOWA 2ATFA 3N35A 3H8RA 4KU8A 1YWKA 3RZKA 4NRQA 4BK4A 3VBOA 3WNXA 1FI2A 4BQXA 3PIJA 2A3YA 1PO21 3IDEA 2BERA 4S2FA 4Y20B 3NNLA 1WCDJ 5LBFA 4K1ZA 4JRLA 1O5LA 1YI7A 1JUHA 4N53B 5F3IA 3O0XA 1O91A 5H9QA 3D6EA 3F95A 3OBRA 2BJSA 4Q4V2 4MHRA 3OBTA 2NPIA 1HRV3 4RS5B 1F15A 1K5MC 1SFPA 3M7AA 5C33A 1DQ2A 4LKFA 1IPSA 1SBDA 5C5TA 1JHJA 4YVWA 2XBO2 1WBFA 3CJIB 2RHPA 4XHXA 5T55A 4EQVA 2D93A 3BTXA 2VC9A 2DDUA 1KDMA 2C9KA 2PHFA 3T09A 5JR7B 1OH3A 1UZYA 4P9XA 4CU7A 3VBHA 2VZPA 1ZX5A 5LBBA 3VHOA 4AHZA 4AI9A 5BNOB 2FCTA 3GYDA 1KJRA 1ZZ9A 2JDUA 2JG9B 2QQVA 4NRPA 2VUJA 1E5SA 4GWNA 5FP3A 4XFFA 3RZZA 1UOFA 5EJZB 1O3QA 4ASMB 1UY1A 3D3AA 3POEA 3ZFFB 1YFXA 1U5YA 1W8ZA 5I0UA 3JBG3 3T2QA 4Z92B 2ADDA 2Y33A 1QOTA 5BNQA 5LEKA 3A4UA 3AMNA 4WV8A 1ZZ8A 3O0WA 3I54A 4Q29A 4ONUA 1OHFA 2VTXJ 3C8XA 2Q1ZB 3CJXA 4LO5B 5CAZA 4KU7A 5E16A 3IDBB 2H6CA 4MGKE 3B5LB 1HN1A 2BUKA 2JECA 1SEFA 1YNAA 4DQAA 2FDHA 1IOAA 1N1VA 1O3TA 3WLUA 1VMHA 3AL5A 1CQ9A 3NV3A 3ZX7A 3MF6A 3AYDA 4CCJA 1GBGA 3EJKA 4FTSA 1DQ4A 1S0GA 2X5IA 3OF1A 4YYOA 1JYVA 2VNRA 4IESA 3ELNA 4QU2A 2IVJA 5A32A 3NO8A 1HB2A 3HT1A 3T0DA 4XBQA 5FY4A 2GP5A 1NCRA 1ODNA 2EIEA 2ADEA 1FPN2 1QNYA 2NMOA 5CFDB 1SCSA 4EN9B 5J09A 2BW8A 4YM2A 1WMDA 4LBKA 1AL23 1DHKB 4QMAA 4YLZA 3W21A 4ES8A 5T3NA 2OT7A 2Y6KA 5IWFA 1W0OA 2JX9A 2Q0AA 4COWA 5E1RA 1AYN1 1HW5A 1OPMA 4B7EA 5F37A 1ACCA 1EAH3 2ZHLA 1J1LA 3LD8A 3POWA 3MIFA 5DDJ1 1JYWA 1SFNA 2Q8CA 1Q8VA 4LT5A 4XF0A 2XJUA 1JU4A 1LGCA 5GKAC 4O65A 3DUIA 2GH8A 4B1LA 4JDOA 5FYMA 2ZXQA 4FSJA 5DAPA 1GOGA 3M3EA 2GNDA 1HRI1 2C24A 4P14A 5JR2A 5DPNA 4OUSA 1PNGA 3AKPA 3HWJA 1RUI1 2YZ4A 4XXPA 5FP9A 1W9YA 2VOTA 1C8M2 4QKNA 4AWDA 1W2AX 3UESA 4INDA 4D0QA 1JXNA 1NAEA 4CU6A 5IK4A 3POGA 5DG1A 3TNQA 2JD4A 3K2OA 2VM9A 1HXS3 4A42A 5CG8A 5DZFA 3KCYA 4AAPA 3V0BA 2R30A 1ZREA 4IGQA 3UKVA 2E6VA 1QNWA 4Q0QA 2Q8EA 3WF0A 4JGZC 3ZSEA 4D7SA 1XNTA 2F17A 2Y6LA 3SEEA 3V64A 2Z4FA 3GCWA 1JH5A 1UY2A 5LRRA 3R4SA 4XBNA 1NUKA 2VUDA 4QGNA 1QQP3 3WG1A 1DGWX 1EPWA 3C7GA 4PBOA 2ERFA 1F2NA 1W90A 1RUC3 3WHTA 1ZRIA 1K5MB 4J25A 4NPRA 2ORZA 1JYTA 2TUNA 3RJRA 4L2NA 2VMHA 5A33B 3I2GA 3VZMA 3IB3A 4FTEA 4HMZA 2GMMA 3PDQA 4I01A 2MEV2 1LTEA 5LB6A 4B8EA 2FDKA 4HVRA 1O8SA 5KHGA 2PLV1 1W9SA 2IXJA 1PIV1 4FP2A 5C9AC 1QJEA 1C28A 4SBVA 1V6LA 3VZNA 5DQ0A 3BB6A 1CAWA 4Y4RA 2O8QA 2HWF2 3TBDA 3V0AB 4CDWB 4PQ9A 5LA0A 1Z78A 2VZQA 1G86A 3GZUC 1AHSA 5LCWL 1KS5A 4AAXA 4CDQB 4K9SA 3BOPA 1URXA 1UX6A 1W0PA 4ES9A 4RA0A 1NYWA 4DOUA 5F6KA 5M0TA 4G3YC 5FYZA 1PNFA 5BXXA 5ACA2 2WNVA 1AR73 3FBYA 1KS4A 4MGZE 2JG8C 2P6CA 2W47A 4XACA 4KWKA 1GZTA 2UYBA 2WLQA 4LK6A 4ASLA 4B1MA 1ZBE1 1HJGA 1OPOA 1SFYA 2F4LA 4LULA 4JQRA 2GNBA 3J8F2 4LTAA 1YIPA 2R0HA 2DCTA 3AZYA 3ZFEB 4XJUA 2PELA 4AEKA 2CHHA 4OFGA 1RUJ3 1LEMA 1CIYA 3PVOA 4N43A 5A7OA 3R6SA 2R6QA 4W6YA 5T5PA 4XF3A 1WD4A 3OD4A 4NUBA 3ZPOA 2XB6C 1WW6A 5E8AA 4KBZA 2Q8DA 3OEBA 4ZS2A 1OA2A 1NCQB 3ATGA 1QJY1 2I74A 3PUAA 1KXGA 5FZ7A 1W6QB 1HV0A 1YI9A 4ISQA 2WO3A 2HBTA 2E51A 2UWCA 2QVSB 3VBRB 4MHUA 3B9IA 1AX2A 1ND3C 2VMFA 5KR7A 1V6MA 1R082 2XJVA 2RDSA 1GP5A 5FLIA 3P3NA 1WD3A 3FLRA 5EFUA 2ET7A 4LO8A 3P5BA 4GB32 1ENQA 1G9FA 4WM8A 5FXVA 1COV2 3ZSLA 2R0FA 1AXZA 1UY0A 4JX0A 1UYXA 4BLIA 2A3WA 4PHZA 4KGGA 3LSDA 1ULDA 2XVLA 2ETEA 2O8OA 5FJKA 4FPOB 1KGYA 1C5IA 2AH2A 2ZMNA 1AR62 1HX6A 1C57A 1XJAA 1QIQA 2D97A 1LHWA 1W8HA 1XBFA 2RDRA 4XUNA 2HWE3 5LEJA 2ZGPA 3J7MA 2FBEA 2E63A 1VE0A 2RDQA 2ZKNA 5LY2A 3MUZ1 4D6RA 5C8CA 2R063 5FKBA 2VZTA 4LNVA 3BN6A 3AB0A 2L9LA 3HOBA 1GOFA 4NAMA 1NLSA 2DU1A 3FUOA 5C4WB 2OYZA 4CEWA 1F8VA 3I2IA 4X6QB 2W08A 3NJYA 4BM8A 4P9IA 5GZCA 4QHOA 2ILMA 4OVEA 1W9TA 1QKQA 1SBEA 2AUYA 1DZRA 2YU2A 3DPRA 3HNBM 4QX5A 1JYXA 5C70A 1I5ZA 5C7GA 4K40A 4IV3B 3ALQA 2XHNA 4OCTA 4QPGB 5CEHA 3MO4A 1BQPA 5JXIA 1CIWA 3LZZA 1DZQA 5FPZA 5FPLA 5JLVA 1ASJ3 1A78A 1OOPC 1XU1A 5FZOB 1UY4A 3OGGA 4KQ7A 4PDWC 2W39A 4OZOA 3NNJA 4L92A 2FDGA 3ACHA 1DGRN 4NIIA 1DQ1A 1G9CA 1ZRCA 3ILFA 5FYHA 4A45A 1RB8G 1NXD1 2EXKA 1R1A2 3A23A 3BTAA 5FBJA 3WZ1A 5FDBA 4CP9A 4KMQA 2VW1A 4FPKA 4EV0A 1U0AA 3OUJA 3PU8A 4GKYA 5C9AB 1S4CA 1A34A 5J48A 2J1AA 4CCOA 4PQQA 4BYYA 2HWB3 2WWUA 1X7NA 4I0BA 3JZVA 1MQTA 3E5QA 1YFUA 4P9JA 5FP7A 4CCCA 4ZKTB 1HB4A 4GAZA 1J1TA 3EO6A 3KWVA 5FZDA 2D40A 3J4UH 3M3CA 1HJFA 3V56A 3ZYPA 1RXGA 2IC1A 1XNAA 2RS32 4K8RB 4PI2A 1CX1A 2NYYA 1W6NB 2XJSA 1SLBA 1JBCA 2BFUL 3M3OA 1LHNA 3JD71 3AJZA 1CESA 2QQUA 2RS11 1OF4A 2WAOA 1CD3G 3T2TA 1W04A 3N7LA 4NJ4A 3NV4A 2QQPA 3AP7A 3J9SA 4MOAA 2B9UA 4AFMA 3VDBA 2JIJA 2QCSB 2KA3A 2XQRA 4Q4W1 2NP0A 3AXEA 1N1TA 2PQSA 2WDBA 1AYN2 1SPPA 3NAPA 1RVF1 1W2TA 4IEXA 2GH2A 3OEAA 4OYUA 4QGMA 4V2VA 2VCMA 3U78A 3MLKA 4LLOA 2XVGA 4KG8A 1UYPA 1TNFA 2H6BA 4YGDA 1F5FA 4GULA 5FOJB 5JZGC 5EP9A 3GDBA 2Z79A 2C26A 1JTZX 4GD4A 4I30A 2IXIA 4UFJA 3D0SA 1J59A 3AFGA 3Q9OA 3WP5A 3QH7A 4HSLA 1W2OA 5IJRA 4Y22B 2IZWA 4XUOA 5EV7A 1HRI2 3GXUA 3ZXKA 5JXJA 2A6YA 2Y6JA 1AR92 3S57A 2E7TA 1RUI2 3LDBA 4Q5OA 4XAAA 5DZEA 3O1UA 3BU0A 1DG6A 2GC0A 4HT1T 1PVC1 1WMEA 2DBNA 4NPLA 4UF0A 3OBZA 1SQ4A 4HBNA 5CISA 2XL9A 3ES1A 2P6HA 3UYJA 1UX7A 4K8FA 1F31A 4M3CA 2RR13 1PMJX 4UOJA 3RFRA 1OFNA 4A7YA 3RWNA 1ODMA 1DGLA 2Z69A 4HSJA 2VZOA 1BJQA 1FOD3 2AR6A 1SDWA 2LTNA 1IS6A 2VCAA 4NIHA 1HIXA 3BKZA 2ZGTA 3AL6A 2PHDA 1AX1A 1XXNA 2W9XA 3TOJA 3TRSB 3PUQA 1GANA 5HCFA 4OUMA 1H2LA 2P37A 2Y6FA 3U4XA 1IQDC 2W1UA 3T1LA 2OKXA 2DVFA 2XBO1 2BEOA 4LBQB 2VZUA 2B42B 3MDPA 3H8XA 1TMF2 1S0BA 5GZGA 3SXWA 2YU1A 5HXVA 2YC0A 1ZVFA 4AEDB 4P00B 4OLLA 4Z1VA 4TSVA 1V9U2 2G4IA 3HIFA 3ECQA 3VBSC 1S0EA 5FZKA 2D7FA 2PLV2 2RJ2A 2ZHKA 3MICA 4PIYA 5LZ6A 3IPVB 1UN1A 2VGDA 1EPZA 1YYNA 2FZ1A 1B35A 2JDKA 2PYTA 2ZAAA 4GMP3 4MGYE 3WHUA 1V6KA 3NL1A 3ZXGA 4WM7A 4B4RA 3KVBA 4FPEA 2PHTA 3BCWA 4Y4YA 1UOBA 2BVBA 4XQDA 5FV3A 4FPCA 4ZU7A 3DYMA 4MG2A 2Q30A 4WVZA 4ZPIA 4P5HA 2WLPA 1FXZA 2XKPA 2YPDA 4JTOA 4QX7A 5FBZA 3T30A 2VPVA 4FI9A 2R16A 3AKQA 4A41A 3NV2A 1XNKA 5HV0A 1Y4WA 4Q2FA 5HI0A 1OLMA 1IPJA 4AF9A 1SLAA 4AI0A 3UV9A 1NA1C 2XVKA 5EJ3A 1X33A 4GIQA 1XE0A 2DYCA 2WZR1 3HD8B 5KHIA 3OD0A 1N3PA 5KWRA 5EIYB 1GR3A 5DAWA 2WYSA 4DEVA 4OI1A 4UW3A 2Z42A 1LCLA 3QBQA 2O0OA 1MS4A 3URFA 1FPN1 3I3DA 5FYCA 3PVEA 3HBKA 4JGZA 1UW8A 5L7OA 2J1UA 3POSA 2AC1A 4O9EA 1HRV2 5FP8A 4CXXA 1YJKA 3H8OA 4AVBA 4BMEA 2WO1A 1H8TC 2HWD3 2KR2A 3GHNA 4N9IA 3TNPB 3BI3A 3OY8A 1XE8A 4Y33A 1LU1A 4YW3A 4LBMA 3T0BA 5ISLA 4K6BA 1Z0HA 3ZXDA 1UF2C 2IXLA 2YFZA 5F6LB 1K45A 1JN2P 2P3JA 1AYM3 1SZBA 3GZEA 4N8MA 1OQDA 3DCQA 4IGPA 3WY6A 3M3QA 5TSWA 1RUG3 3O1PA 1OQEA 4MYEA 3MUY1 4DPNA 1PGW2 4JGYC 3TEZA 5FPVA 4AQ6A 4LK7A 4XFAA 3IMNA 5FUNA 3THPA 1BK1A 4BQ2A 4UFLA 5JIAA 1CAXB 3HN1A 3ZMOA 3JBG2 4DFSA 5FO7B 1TNRA 5HPOA 1YQCA 4QPIC 2XWBB 1AJKA 5KXBA 4NOTA 2JICA 1LOFC 3KSCA 1DFQA 3FN9A 5A7WA 1LENA 3OUHA 1OC1A 3DN7A 3O0VA 1C8M1 1KEXA 1NLQA 2HJIA 4Y3OA 4ZY9A 3EB7A 4YPJA 1UOJA 4RGKA 4ISRA 4N53C 3ZKYA 3CLPA 4K20A 4LUKA 3WQ0A 3WCRA 4UW5A 1UU6A 3FFZA 3HPNA 4KWLA 2VQTA 4OHXA 4RS5C 5IHRA 1V6OA 1WLDA 1NOVA 2JG8A 3K4DA 4B3NA 2GAUA 4OHWA 1O59A 3B9CA 4CP1A 1Y3TA 2P3YA 3CJIC 1VBB3 3SNMA 1VMJA 2AGSA 2VH9A 2EVXA 3MV01 4PBPA 3ZO0B 5K7PA 3AP5A 5IK8A 4MUVA 2GC1A 5BNOC 2YROA 3POIA 5I0TA 4Q4X3 2R49A 2IVIB 2RDNA 2JG9C 4QPYA 4RFRB 4XJ9A 5FAXA 4CDUB 1AL22 4DB5A 3D0JA 2ZMLA 5DMYA 3M3IA 4C0HA 3DYPA 5A7PA 1QJU3 3NVCA 2DFCA 3GM8A 4RR3C 3ZFFC 1LJ7A 4QXCA 2MEV1 2TNFA 1NE6A 2W94A 2P17A 3ACGA 5IW0A 1SHWB 2WSVA 4PIZA 1JYCA 1VBE3 5E88A 3OGSA 2VZSA 4L8QA 2CSGA 4YW7A 1EAH2 3HN3A 4QAWA 2W95A 2W91A 3OSDA 5F2WA 1DYPA 1ND3A 3USUA 3WW1A 2PA7A 4NHLA 3T3YA 5FWJA 2LALA 4QXKA 4YM0A 4B4QA 2QQKA 5FZBA 1MVEA 5T5LA 1Q8QA 2VNGA 1LRHA 3WF3A 1NZCA 2CV6A 5BYNA 1VRH1 5DAVA 4CRQA 4MXWA 3RSJA 2WR9A 5ACA1 2JEMA 1J3QA 4LORA 2JENA 2VULA 4UAPA 3SH5A 5EQUA 1GQHA 4LIUA 1AZDA 3UKNA 3O1VA 4W65A 4UFMA 2QDNA 3MPBA 5FZ1A 3SLIA 1NA1B 2VBPA 2RS12 4GA9A 4R9BA 5DG2A 4IERA 1VBD3 1JI6A 1G9AA 4O7XA 3U11A 4I0AA 1BVP1 3U14A 3WX5A 4DNYA 1WW7A 2ZGSA 3GJBA 5KHHA 3TB0A 1MS0A 2WNUB 3PMEA 4ZHNA 4DUXA 1YIFA 3AC0A 4YG3A 1RHI3 2WT1A 1RVF2 3MIHA 1QY4A 4UXAA 5BY5A 4GH4B 3KHBA 3B00A 2WAAA 5JWPA 3NRUA 4XF9A 1T6GC 3GHMA 4KWJA 3IZOA 1ZBA3 4AL9A 1H8TB 1V00A 1OD5A 4META 5CZKA 3N36A 3CIHA 1H9WA 5H9SA 2X05A 4NIGA 3H9AA 1DGRA 3AMQA 4KG0A 4D6SA 3VKNA 1OOPA 1R081 3MV11 2YV8A 5ABJC 4PDWA 1Q8SA 3LDKA 1V6IA 3AYAA 4FOQA 3CDZB 4GB31 2WQ4A 2UWAA 4Q1PA 1OT5A 4B4PA 1DGWA 3UGHA 1COV1 3WVJA 1WW4A 4JGYB 2CY6A 1JOJA 3GZTB 4FPYA 4BZ4A 4DXTA 4LJHA 1W0NA 3AK0A 4PIXA 1L3JA 2GP3A 5DUWA 1VB4A 1R091 2H0BA 4BIFA 1ULFA 4AGGA 1MPXA 3PUSA 1U5XA 4QPIB 2EIDA 2R7EB 5F32A 2LUWA 3NNMA 2RV9A 5FZEA 2VMCA 4HZFA 5EXOA 3UETA 4D69A 5LA1A 1PGL1 5FWEA 4M4PA 2XONA 2RJKA 5L19A 1AR72 3BVCA 5JI7A 1H4HA 4XQ4A 3K3NA 1CAUB 1G6NA 2PXJA 3MGUA 3KCXA 1VIWB 1S0FA 2E31A 3WD5A 2WFPA 1H1IA 2BNMA 3IBMA 4QKBA 4Y1XA 1ENXA 4IGOA 2Y6GA 5FYSA 3RZLA 2A71A 1WMXA 1H2MA 1TME3 4IE0A 5FLHA 4Y5TA 4QU1A 4J1XA 2BYVE 3CU7A 1UZVA 1RUD3 5I93A 4HKLA 4EE2A 3BUCA 1J83A 3EMRA 5IVFA 1UU4A 2Q4SA 1GNYA 5F3EA 2WFF3 1O4TA 2HWD1 1GYKA 1IS5A 3KF5A 1JW6A 1K12A 4RR3B 1P8JA 4AEJA 5L9VA 3KZ4C 4CDWC 2QQOA 3KT4A 3E5UA 1SLCA 3ZFGB 2EAAA 2R073 2X09A 4FQ4A 5JZGA 4CDQC 2RM23 3T2PA 4OQ8A 1R1A1 1OBNA 2SBAA 1Z7S3 2DVBA 2VR4A 3VBFB 3IM0A 1QU0A 2HKXA 4LE3A 2FCVA 5EZWA 2HEYF 4EWAA 1KFUL 2J7MA 1ENSA 1KJLA 2WO7A 2VOVA 5GLZA 2DVAA 1EY2A 4GWIA 4A4AA 2PHWA 1O6UA 4AYUA 4R52A 2OXBA 1OFSA 2WKKA 4GJYA 1HQLA 3FJSA 3OPWA 3OPZA 3CL1A 3M4FA 2B8MA 5FK7A 5A6XA 1C5HA 5K0UB 3CO2A 2WZR2 4MGSA 3ZFEC 5IVVA 2HWE2 2ORXA 5EHDA 4DEQA 1GSLA 4XPVA 2ARBA 2RS31 3Q8CA 1QJZA 3CEWA 4FQZA 3VL9A 3WNKA 2Y34A 2PHXA 2QQJA 2EAKA 1FMD3 3AFKA 1BEV3 1PHMA 5L73A 4BQ3A 2VVDA 1A6CA 4BQ5A 1NCQC 5A7NA 3H1WA 5DXDA 3LKJA 4XDQA 5JSPA 2DTYA 3WOGA 1RUH3 2E7AA 3DGTA 5JOXA 4C1WA 2Y38A 4QGLA 3AMMA 1VBB1 3DEMA 5D21A 3VBRC 1MEC3 1VJ2A 3Q8EA 4HKWA 1QXPA 4JVAA 4CUGA 2IFWA 3THTA 4QD2A 3POBA 4XE9A 4Q0SA 4YW2A 1EV11 2FHRA 2ZJCA 3AP9A 4RHV3 2ZEXA 3MIDA 3ACIA 1X9TA 1C1FA 2ZEZA 1OF3A 3VBSA 4CUBA 2VW0A 2AREA 3WDXA 4JHTA 1I9RA 3THDA 4YG6A 1L7QA 1MS9A 3V65A 3KT1A 2QNKA 4LPLA 2HLEA 2JDAA 3PVBB 4JV4A 1EP0A 2BNOA 3GZAA 5ABJB 1OKQA 3OYWA 4YW6A 1AR91 5FREA 2D43A 3KV6A 4J6GA 1TQ5A 4M3CE 5F5IA 3P1IA 3VBUB 1B09A 1STMA 5FZHA 4E8DA 5ANQA 4RD7A 4YWAA 2WZPP 2EXIA 2OUJA 5A6ZA 4AVSA 5KXDA 4JKKA 3WUDA 4OZXA 4LA2A 4FPGA 3WXPA 3IKWA 5C4WC 1G7YA 1CAVB 3OPTA 1ULGA 2A6VA 4ZXEA 3WG2A 1F4HA 1C8NA 2HEVF 2XJTA 3LA7A 4LBLA 1W6PB 4XC9A 3AMHA 4O61A 3K4AA 4R4ZA 5FCCA 1I1EA 1S0JA 2E32A 4EZ4A 4FO9A 2JE7A 2VBBA 2YFUA 4XFGA 4IV3C 3ZDSA 3B7MA 2WQ8A 3MI8A 4QPGC 3A22A 4XILA 5G04L 1VBC3 1D7PM 2WS93 2DU0A 5D8AA 2JDPA 1CGPA 5LBEA 4CSWA 3FZ3A 1CX4A 5BNNB 4CDXC 1A8DA 1UQXA 5FKCA 3LOBA 2RS53 4FCAA 4AQSA 5C3QA 3VHNA 3AXDA 1POQA 3HEIA 1RXFA 4QX2A 1BXHA 4TTGA 1TMF1 5JOZA 4MGTA 3KQ4B 4F8AA 3M2MA 2X10A 4LXLA 2CWMA 4JC1A 4QDQA 2QQIA 1V9U1 4MGIE 1XPWA 1ALYA 1GZWB 1H8TA 4P9WA 3C7OA 1AX0A 2AEYA 1YRZA 3L2YA 4Q4Y3 4BPZA 4FAGA 4AFCA 5SV8A 2D3RA 3SKVA 1CN1A 5B2GB 1WLCA 4Q8KA 1GICA 2VUCA 4FBFA 3I59B 3T0AA 4YZ5A 5CFCC 2FDIA 5IK5A 2PTMA 4URAA 1RINA 2EXHA 1OLME 2NMNA 2W5FA 4K7JA 3UNPA 1X9PA 2XHKA 1H1AA 2BRTA 2YY1A 1VRH2 1VR3A 3GBGA 1RUF3 3IAPA 5A1FA 1W6MA 2DUOA 5C3PA 1PM4A 3NQHA 3W20A 4IV1C 4LBNA 1ZYBA 4LHLA 3A21A 5I0SA 1LOFA 3PUHA 1H6XA 2RMU1 2XJPA 1RUE3 4Y20A 1J3PA 1SG3A 3H7JA 5CKQA 1PZ9A 4G9SB 5FY0A 2P2KA 2GN3A 3AVRA 1GV9A 3OCPA 4N53A 5FZCA 4BQ1A 2RR12 4QQOA 3AJYA 4URTA 1Q8OA 4O9GA 5B4XA 1ZZ7A 3E5XA 4IETA 1FOD2 5LATA 1HQNA 4AG4A 4LA3A 4RS5A 2YPJA 5A7QA 3KCCA 4GWMA 2WZEA 4HPKB 4E8CA 4IEPA 3WG4A 2V4AA 3CJIA 3PVNA 5T54A 3LEKA 3HQRA 1HRV1 1HLCA 4NE9A 1X50A 1US2A 4XMAA 3N7MA 4CEYB 5BNOA 4DXRA 2XGXA 4Q4V3 5L9BA 2Y26A 3VD4A 2JG9A 1K5JA 2NZ9A 3ZDVA 5FXXA 2VNOA 3BOWA 2R043 5HCBA 5A7SA 4PT6A 4BB3A 2EICA 1XE7A 1YO8A 4BE3A 4WBBA 3NJXA 1ZNPA 2ZABA 2ZACA 1JZ3A 1OVSA 3ZFFA 2IXCA 1MS1A 5FMBA 2VECA 1PGW1 2QZ2A 1J58A 5F1RA 2JE8A 3E6DA 4IE6A 4QB2A 2A1XA 3JBG1 1R092 2R071 3LSEA 4IDZA 1W2NA 5JI9A 3K3OA 1CJPA 3GF6A 1RUOA 1K3IA 4TZDA 4LE4A 2BOIA 1ZM1A 1GUIA 1RMU3 1MVQA 1LGBA 2VG9A 3QCWA 3FL7A 2R32A 4Q26A 2AENA 3FHIB 1UZ0A 2ZGMA 2OS2A 4YNIA 1ND2C 5BV6A 3N7KA 4CCLA 2JXAA 3TEXA 2DV9A 2V09A 2W2IA 4HKOA 1DCSA 2E7QA 1SLTA 4GJZA 4IL7A 4MZUA 2BBAA 5CFDA 2VOWA 3UGGA 4Z07A 5T52A 2G9ZA 3PU3A 5KC6A 1GMMA 4NIAA 5FR3A 4AEDC 5JCTA 1D4M3 3BYWA 1PK6B 4H55A 4AQTA 2XXZA 1QXJA 2BWAA 3KT7A 2ZGOA 1QJFA 1OUXA 2VL4A 3R05A 4NO4A 1AR83 1IS3A 1AL21 1YLLA 3R4UA 4LIVA 3SMHA 1LU2A 2V5YA 4CDXB 3OTFA 4DUWA 4EN0A 3W5NA 2P1BA 4UW6A 1E5IA 2Z5WA 1FATA 2WBKA 3JQWA 3LGRA 2HWD2 2VMGA 1W6OB 1CZTA 4AK3A 4RQPB 5FYIA 4DMIA 2FD8A 3WF2A 2YGLA 3AP6A 3O1RA 3HR9A 2CL2A 4QT6A 1LOBA 1VPHA 3I8TA 3BGAA 1IKPA 1AYM2 5F8PA 5EYYA 2D6OX 1EAH1 4M0NA 1YQ2A 2QJVA
chains in the Genus database with same CATH topology
3OJBA 1RUG2 2HWC3 2GSYA 2I2SA 4KGQA 1G9DA 1RTVA 1SLIA 5CFCB 1SCRA 4L11A 3WR0A 2D5FA 4WZFA 2TEPA 1XYPA 3VKOA 4YGEA 4IEUA 1XQNA 1DQ0A 1M06G 1FYUA 1S0CA 5K9YA 3ILRA 4YZ4A 3FE5A 4WVMB 3M8LA 2B5HA 5JVVA 2ZAHA 3WW4A 1QXRA 4G4FA 2VVFA 4IV1B 4XETA 1WCSA 4FT8A 1OLRA 2JE9A 2Q1MA 1HXS1 1Q3EA 2GU9A 3UKTA 3N7JA 4EWEA 1NXMA 4LHNA 4CTEA 4FPHA 2D6NA 3VDDC 1LOGA 2YGMA 5AC93 1VBB2 2VQAA 4GMP0 1POV3 4Y24A 1K5MA 1QJX3 2NQYA 1VBC1 3ENRA 3KLSA 2D6LX 3WUCA 1UIJA 5FRAA 1QQP1 5A33A 1IHMA 1PO13 1EV12 1RUC1 5GZEA 4YGBA 1QJU2 1Y9QA 4JTNA 4LLFA 5DUUA 3E97A 4AQ2A 1NQDA 2UY8A 5EWSA 5KBFA 4RL7A 3O12A 3VBHC 1W39A 1Q8PA 1BBT3 1VBE2 3SCHA 1NLRA 2HEWF 3V0AA 4CDWA 1UKRA 3POYA 4CDQA 2A5ZA 3BODA 2IWGB 1W2UA 2EXJA 3NWKA 4M00A 1ZRRA 5GLVA 2Q5TA 2VU9A 2ZTNA 3KB5A 3JCIA 4I3GA 3S7EA 3ZN6B 1V6NA 4XJAA 2HWF3 2B7YA 2VY0A 4JRAA 4W6WA 2X8KA 2YMZA 2EA7A 4YVSB 5D1IA 1AR71 1S0DA 2A6XA 3PHMA 2N7GA 3ZFEA 1BKZA 1U5IA 3G7DA 1RJ7A 4CDUC 1ND2B 4X8PA 2X5IC 2P3IA 2MPFA 3D4KA 1LODA 3MF9A 2R1BA 4HN0A 4E4ZA 3R4DB 5T5JA 2W52A 5LK5A 1RUJ1 1X82A 1NCRC 1NCQA 5FQ0B 2GN7A 3W59A 4DINB 3J8F3 1W6QA 4FOYA 1RHI2 4DY3A 3VBRA 4AVTA 5AFEA 4A3XA 2OPKA 3NV1A 4C0BA 1KD7A 4RGGA 5JSRA 3AYEA 3QH6A 1ZBA2 2CGOA 5GZDA 4AI3A 2KXLA 2ZX0A 2XLAA 1TE1B 2AYHA 2A6ZA 2YXSA 3VUOA 1O3SA 1TEIA 2VUAA 2NLRA 3D82A 4FOWA 5BPXA 3ZPYA 3FLPA 1IS4A 3ZIXA 3T1MA 4K21A 4FPJA 1VP6A 4XQWA 5J36A 3BIWE 3AM2A 2RMU2 4EN6B 5C6CA 2ZX4A 2XG3A 2PFWA 3ZN5A 2HWE1 2CTVA 1S2KA 3VN4A 2VVEA 3H7YA 5C4WA 1AR63 2R061 5DUVA 1VBA3 2WNUC 4HK8A 3WINE 1D4VB 2GMPA 2H0VA 4HK9A 2C5DA 3LCPA 2ZGNA 3MW4A 2G9GA 3W9AA 1V6JA 1AJOA 3AMPA 4COYA 1PO23 1WLWA 2R1DA 2ZKLA 4GH4C 4IV3A 3RJ2X 4QPGA 1FV3A 1FV2A 4QQPA 5BUVA 3VBOB 4Q0VA 3VDDB 2ZX3A 3EHKA 4X6RB 3AP4A 4Q8LA 3RI8A 1CONA 3GBWA 2DCYA 1X8MA 2JJ6A 1CPMA 1RUD2 4PJYA 2V73A 5FLJA 2ZBJA 1ASJ1 4DY5A 1QDOA 3RRDA 2WFF2 4IQPA 5T50A 3D8CA 3UJQA 1YHFA 4NN0A 2ZHNA 5C9AA 5E89A 3N4MA 4R9AA 2B46X 1GZ9A 3VBHB 2R072 2QUOA 1HV1A 2F6BA 2UWBA 4M01A 1OI6A 1Z7S2 2P3KA 5JPNB 1FT9A 1QOSA 5EYXA 3JQXA 1XRUA 4WVMA 2PAEA 5IK7A 3NJZA 3NKGA 1D2SA 1N3OA 2HWB1 4J1WA 5I8SA 3USSA 5AFBA 3ILNA 3IN9A 3L2HA 1GNHA 1H4GA 2EALA 3ZYGA 1W6NA 4XW3A 4S2HA 2B45X 3ZXLA 2XJRA 1OMIA 2WNVC 1PZ7A 3MFAA 1BCXA 2GALA 1CJDA 2IXKA 5H9PA 1AUYA 1BEV2 1QOOA 2FMYA 2FQPA 2X5IB 4PLNA 1RUH2 1YJLA 2VOXA 5A32B 2XKOA 5FO8B 4N43C 2BGCA 1NCRB 1POV1 1MEC2 3KQRA 3ZFGC 4YARA 1YFWA 3VLBB 4YW5A 1Q56A 1KFXL 4N9HA 2ZGQA 3VBFC 2XWJB 3MLLA 2D44A 4RHV2 1AYN3 1WLTA 4Y22A 4YFWA 4IEZA 3ASIA 3KS7A 4S2DA 4WZCA 5DDJ3 4B7KA 5K0UC 2YYOA 3APBA 1UKGA 2QFEA 4WM8C 4ZU4A 3ZN6A 1PVXA 4MH0E 3CNAA 3PJYA 4OI0A 4XYXA 1HRI3 2D6KA 4LR4A 5GM0A 4NR1A 3MIBA 5GLUA 1HXS2 1RUI3 4AHYA 1X36A 3C2UA 3MZHA 2RE9A 5CG9A 1A3KA 1GLHA 4FAHA 2RR11 5A3LA 5CU1A 3PJQA 1FOD1 4Y26A 1N1SA 4OULA 1LB2A 4QQLA 1ULEA 1VBC2 2XH6A 1DBNA 1QQP2 2GZWA 4LBQA 4JCKA 3ZN4A 4AEDA 5L36A 2A70A 1UZZA 1RUC2 1BZWA 2RS52 1MZEA 2DUPA 3DPRC 3FWEA 5FMOL 2XL7A 3IPVA 4HANA 3BU7A 3K51A 3B93A 4A7ZA 4N90A 5IT6A 4XZPA 4QM9A 1XNCA 4C91A 4F7ZA 4DXZA 1LHOA 4GMP1 3VBUC 1XNDA 3RNSA 2OUHA 3MYXA 2PLV3 1G8WA 1PIV3 1IPKA 1HDKA 1UAIA 1UU5A 4A2UA 4AFBA 3H0OA 3LA2A 4WVVA 4CP2A 2C0ZA 1RUF2 4Q0UA 2UY9A 4AFDA 2DF7A 5JOYA 3SCGA 1C1LA 3WDUA 1CAWB 4LBQD 2ZPXA 2I07B 3FBMA 2HYKA 4AI1A 2XUMA 3AZWA 1RUE2 4LUMA 2RJLA 1OA4A 5BNNC 1D2QA 1LOAA 2EIGA 2OZJA 4IEVA 1QH6A 3LWCA 1H8VA 3HAGA 1ZBE3 3RMXA 1RUJ2 2WNVB 2QE3A 4KBBA 2OA2A 3WDVA 4DZGA 4HETA 3VDDA 5HCAA 2BWCA 3FMGA 1A8MA 5SV5A 4C90A 3GALA 2AZ5A 4B29A 3M70A 4JDMA 1VAMA 2FMDA 4E4DX 1UPIA 1Y43B 3JUUA 4E2GA 4N43B 1QJY3 2R042 3KM5A 4Q27A 3NAPC 1ENRA 2D6MA 2DWRA 1AYM1 2GMEA 4YW1A 3I4IA 1CAXA 3O14A 4BHPA 5JMCA 1RUG1 4XF1A 3ZYJB 2TBVA 2KM2A 4LO7A 3VZJA 1ULCA 3RMYA 5IUQA 3LA3A 2PHRA 3U10A 3H50A 4AI8A 3MEPA 5C8WA 3R0RA 1NY72 4AI2A 1C3HA 3A0KA 3N3HA 4COZA 4XF4A 4KL1A 4WM8B 5JDBA 1AVBA 4N7UA 2XLGA 1RMU2 3ZYRA 4C1XA 1FX5A 3JB8A 1DIWA 2R062 3P3PA 1O7FA 4MSVA 1MS5A 1LESA 3UL2A 4XTMA 4IXLA 2SLIA 2ARXA 3H1YA 2WNEA 1RL3A 3QLQA 3L9JT 3C3VA 4CEYC 4YG0A 1REDA 4XJWA 5C8CB 1LECA 2VMIA 3FUQA 4CDUA 2K9ZA 2ZZJA 2B39A 2VW2A 1D4M2 1OA3A 2ENRA 3AZZA 4RFT0 3EXUA 4Q4X1 3VHRA 5AVAA 4CEWB 2A7AA 1AR82 2BQPA 4GXLA 3ZVXA 1ASJ2 4AEMA 3INAA 3TWIA 4LBJA 3RQ0A 2ZZQA 3DPRB 1BMV2 1QJU1 3MLJA 3DL3A 4N7IA 3KGZA 1IQAA 2NN8A 4R9CA 4DRVA 1VBE1 4E9KA 4XJ8A 5I8TA 1B35C 3RYRA 4H3WA 2HWC2 2JKBA 2G9FA 2C1FA 4WM7C 1F9KA 3VKFC 3X29B 5J3UA 1CPNA 3HQXA 3HBZA 5H9RA 2GNMA 2HWB2 1H1MA 3AZXA 4AVAA 1RUNA 3WQ7A 2VQ0A 4Y1UA 2ES3A 4EWDA 4L99A 4Z8BA 3ZSKA 3RPQA 2D3PA 4IEYA 1NA1A 2WSUA 3RG0A 2XJQA 1PK6C 1AL0G 2GDFA 1Q5OA 4UBGA 1Q43A 2WNUA 1MQTB 1DLLA 1SBFA 1VBD1 5JIUA 5FMOS 2YUEA 3JD73 4OHVA 3SHRA 2BVVA 2GNTA 4AFAA 5AC92 2RS13 2WA3A 1N47A 3VHPA 5LRSA 4RQPC 4GH4A 3LAGA 4YZ3A 1QJX2 2Z2SB 4H7LA 5L7OC 1REFA 1RHI1 4ZU5A 1QHDA 5CNAA 1PO12 2NM1A 4OI2A 5KHKA 4Q4W3 4NHMA 1I3HA 2MHFA 2DVDA 5CB7A 1ZBA1 1RVF3 1V70A 1YFYA 2OIIA 2ZHMA 3TN93 3SH3A 3FX3A 4OHYA 4NWVA 4JGYA 5AVPA 4AXOA 3NAPB 1BBT2 2PHUA 1JYIA 4YGCA 4SLIA 2P34A 2Y0OA 4QPIA 3IDCB 1LR5A 1QWRA 2CGNA 2ZMKA 5FTTC 4XHBA 1AXKA 3U07A 1PVC3 1U5ZA 4HL0A 1LEDA 4XIKA 2ZOEB 2BTVC 4TLFA 1CAUA 1GFF2 3MFCA 4AHXA 4Q1RA 3QOPA 1UCXA 4JAAA 3ME2A 4RGAA 2XLFA 4EROA 4FPLA 1VB2A 3WDTA 4OHZA 4DS0A 5T5OA 4E27A 1WMFA 4M3CB 1FAYA 4XIOA 4FVVA 2JDZA 3IWZA 4I3PA 4YM1A 5CVRA 4ATFA 2IXHA 1TME1 1E57A 3S6PA 2WIIB 3WQ1A 4HVOA 1RUD1 1S0IA 3EQEA 4E4SA 2XBO3 3W58A 5I91A 4RR3A 4U2AA 4UBHA 4AE2A 1XYOA 1Y7BA 5I0RA 3B02A 2LM3A 4NHKA 3ZFGA 1NG0A 1VAVA 2WFF1 2A6WA 1GQGA 3O5SA 4NVPA 4XBLA 4IEWA 4XJZA 3ZSMA 4COVA 3VBFA 5FOBB 2D98A 3KMHA 4BOWA 4BWOA 4LO6B 4U36A 1ZRDA 1O5UA 2RM21 2WWSA 3VKLA 3PNAA 1UD1A 1Z7S1 3BPZA 1PZ8A 2E53A 1RIRA 2WJSA 1B35B 5KXEA 5K0UA 4YVSC 4WM7B 2OZ6A 1YCIA 1MS3A 4IEOA 1JUIA 1BYHA 2E9QA 5FFOC 5JPMB 1POV0 1G9BA 1R1ZA 1D0GA 2QKDA 1YXWA 1O4ZA 3WP6A 1DQ5A 5BNPC 5CADA 3VGIA 2WZR3 1VBA2 3B01A 3S7IA 3OGJA 4I0WB 1FMD1 1BEV1 1WA4A 3ZSJA 4COUA 1OLQA 1PO22 2WL1A 1VALA 2I45A 1FPN3 5F9TA 1RUH1 3ZXEA 3DKWA 4FTBA 3ETQA 4L9BA 1NQJA 4LO4B 3DV8A 1MR5A 4AGVA 1MEC1 4P9GA 4XFCA 3MPPG 1MACA 2ZX2A 3RYPA 3IIAA 4JGZB 1KRIA 5L7OB 3K48A 1IKQA 4AGRA 2Y0IA 1EYBA 1SACA 4RHV1 3UK9A 4MLOA 1VLNA 3ACLA 3AKSA 1UPSA 5ABJA 4D7TA 3A0NA 4MX3A 1OQ1A 1XU2A 3OY8B 3DF0A 2MNGA 3VBUA 2F4PA 4EJRA 5DUXA 3VZOA 4PCRA 2CGPA 3WT3A 4AVCA 4PLMA 1JHNA 1CAVA 3G6JB 5GJ6A 4EN8B 1W6PA 1ZZCA 1IZ3A 2CWSA 3SCFA 1C8M3 1UL9A 2D6PA 3H3ZA 4OI4A 1F5JA 2DFBA 3J26N 4QQ2A 4S2GA 5JAXA 2C9AA 2BNNA 4FPFA 3VBOC 4BIOA 1YUDA 5BNNA 3M1HA 1LKNA 2WS91 3QACA 3B69A 4Y1VA 2CAUA 1AF9A 4PF5A 4Q4X2 4YZ2A 4XEZA 1N3QA 2JG8B 3I2DA 2RS51 1H2NA 1GZWA 4D7YA 4YVWC 2BBVA 1QGLA 4FOVA 1SMVA 3PMSA 2ZA9A 1REEA 4GALA 4L97A 1ZA4A 3I59A 2GC3A 4Q4Y1 4F3JA 2DUQA 4Y5Z0 5CA6A 1GNZA 2MEV3 1DQ6A 3MW2A 2A3XA 1RGSA 2D5HA 1S55A 1GZCA 1ZZBA 1D0HA 5KHJA 4IEQA 4AVVA 3TN91 5DDJ2 1C4RA 5LK7B 1VAKA 4M3CF 1LULA 4YSFA 1OSGA 3MW3A 1RUF1 3NW4A 3WP3A 3B94A 4BH9A 1ND3B 1U12A 5GZFA 3USUB 1VRH3 2OVUA 4PLOA 5JSOA 3EBRA 5HBAA 3WV6A 1RUE1 5ACA3 4Y1YA 1O3RA 3AX4A 1LOEA 4MXWB 1FNYA 1VBD2 4HPKA 2D3SA 2ZS6B 1AXYA 1X8EA 2WT0A 5BNPB 5J37A 1LGNA 1LHUA 3SITA 4CEYA 1PGSA 1DU3D 3E6BA 3HT2A 1MS8A 4I02A 4RSUA 4ZXKA 2CYFA 3GBFA 1MZ5A 4P9LA 1SLLA 4XFBA 4Q4V1 1S1AA 2UYAA 2ZGLA 4HLTA 2CNAA 2R041 3U0ZA 3QD6A 1BVVA 3IT8A 4R4XA 1RC6A 1CVNA 3RDIA 1R083 4K3UA 4HVQA 5K8SA 2PN5A 2XPJA 4M0HA 3ZYIB 1HKDA 4GB33 1PIV2 1NY71 4ITCA 1OOPB 1COV3 4QM8A 3WG3A 4XMIA 5GALA 4PDWB 4YFZA 3ZXFA 4XXAA 1MZFA 4V1PA 3RS6A 3NSTA 1LHVA 1R093 1RITA 1RMU1 5KC5A 3FFQA 3JB4C 4CYDA 2ZGKA 3LB9A 4E2QA 3LOIA 1DZTA 3BALA 3S30A 1WW5A 1XYNA 3WCSA 2A73B 1PK6A 3AKRA 2ZCWA 4X8NA 1QF3A 2WT2A 1HQWA 1DYKA 1WGPA 1ZBE2 5GLTA 3H8UA 4CDXA 1TME2 3WDWA 1D4M1 5D8AC 3NKTA 4FP3A 1J3RA 3WW3A 2ET1A 1W6OA 4RQPA 1AR81 4XOGA 2IFRA 3B3QE 2VOKA 4ORFA 1ONAA 1QDCA 1XNBA 1BMV1 4CZSA 4YVWB 1O4YA 4FXKB 5J7MA 4W6XA 4YW4A 1PMIA 1QJY2 5CFCA 2RM22 4H14A 5CIRA 2DCJA 2WINB 1APNA 2HWC1 2ZX1A 4MVTA 4LHKA 5F5QA 3E6CC 4GKXA 5J98B 1R1A3 2PAKA 3SH4A 4IV1A 4NWWA 4I2OA 4E2SA 2PHLA 2DVGA 4YZ1A 1KDKA 5JZGB 2PQQA 1WCKA 2OW4A 4AHWA 5CBLA 2VXRA 2K2SA 1DDLA 1PM7A 4R8HA 5FPXA 1UMZA 5A3MA 1MZ6A 3KGLA 3PLQA 2UU8A 1FMD2 2RS33 3WW2A 2FZ2A 2DCKA 2BFUS 3S0MA 3ZXJA 1N1YA 3VV1A 2A75A 2DTWA 5I8YA 4XFIA 5AC91 2O1QA 1FNZA 2W68A 1M4WA 3VZKA 4BCUA 1QJX1 4LEJA 4CP0A 1LOCA 2UURA 4FXGB 4Z82A 1NE4A 2X53S 2WA4A 3PTYA 1PO11 3WP4A 5FO9B 1CR7A 1S2BA 3ST7A 1EV13 2BPA2 4Q0PA 1BBT1 3H1MA 3ROUA 4TYSA 4Y1ZA 3TYJA 5KXCA 2EF6A 1H30A 2WQZC 4KH9A 3ZMNA 4UW4A 5J96B 4H7MA 4GQ7A 3RYKA 4LBOA 3VBSB 4XFHA 3CF6E 1AR93 3UJOA 3ES4A 4D3WA 4DRRA 4AW7A 4YVSA 3KD4A 1H0BA 4WVWA 3RI9A 3OYWB 4BA6A 2HWF1 3O7OA 5GLWA 3FLTA 5C8CC 4YRDA 2X29A 4XTPA 1H2KA 1ND2A 1QMJA 4Z2WA 2ZGUA 1H9PA 2QZ3A 3VZLA 3H3UA 2WS92 3JU9A 5BNPA 4R9DA 3V0BB 4BLJA 4CEWC 5FQ0A 3HMYA 4KNCA 4QHBA 4A7KA 5CFDC 2PAMA 1ZRFA 3JD72 4P9YA 2K0GA 1KITA 2YHJA 4K1YA 3J8F1 1WBLA 1ZZ6A 3AYCA 5D8AB 2WC2A 4Q4Y2 1TMF3 2CAVA 4ATEA 2DURA 4Q4W2 3I7DA 1V9U3 2YDEA 4MXVA 3VL8A 3MIEA 1UIKA 3TN92 4BMBA 4JDNA 3WDYA 4HN1A 4QQHA 3D5OA 1QH7A 3VKMA 1KQRA 2DCZA 4YM3A 3ZXAC 2QDRA 4I09A 3GNEA 3MIGA 1I6XA 1RJ8A 4MV2A 4D94A 2ZGRA 4TWTA 1WUVA 3AZVA 3ZIWA 5DZGA 4EN7B 2GC2A 1MQTC 3SISA 1PVC2 3TAYA 3FC0A 1W6MB 2RMU3 2W0XA 2Q8OA 1GKBA 4HFSA 3AKTA 1DF0A 4F83A 1AR61 1IGOA 1VBA1 5JOWA 2ATFA 3N35A 4KU8A 1YWKA 3VBOA 3WNXA 1FI2A 2A3YA 1PO21 3IDEA 4S2FA 4Y20B 1WCDJ 4K1ZA 4JRLA 1O5LA 1YI7A 1JUHA 4N53B 3O0XA 1O91A 5H9QA 3D6EA 3OBRA 4Q4V2 3OBTA 2NPIA 1HRV3 4RS5B 1K5MC 3M7AA 5C33A 1DQ2A 1SBDA 4YVWA 2XBO2 1WBFA 3CJIB 2RHPA 4XHXA 5T55A 2D93A 2PHFA 1KDMA 5JR7B 1UZYA 4P9XA 3VBHA 3VHOA 1ZX5A 4AHZA 5BNOB 3GYDA 1KJRA 1ZZ9A 2JG9B 2VUJA 4GWNA 4XFFA 3RZZA 1O3QA 4ASMB 3ZFFB 1YFXA 1U5YA 4Z92B 5I0UA 3JBG3 5BNQA 5LEKA 1QOTA 3A4UA 3AMNA 4WV8A 1ZZ8A 3O0WA 3I54A 4Q29A 4ONUA 1OHFA 5CAZA 3CJXA 2Q1ZB 4LO5B 4KU7A 5E16A 3IDBB 2H6CA 4MGKE 3B5LB 2JECA 2BUKA 1SEFA 1YNAA 4DQAA 1IOAA 1N1VA 1O3TA 3WLUA 1CQ9A 3NV3A 3ZX7A 3MF6A 3AYDA 1GBGA 3EJKA 4FTSA 1DQ4A 1S0GA 2X5IA 3OF1A 4YYOA 2VNRA 4IESA 3ELNA 4QU2A 5A32A 3NO8A 3HT1A 4XBQA 1NCRA 1FPN2 1QNYA 2NMOA 5CFDB 1SCSA 4EN9B 5J09A 2BW8A 4YM2A 1WMDA 4LBKA 1AL23 1DHKB 4QMAA 4YLZA 4ES8A 5T3NA 1W0OA 2JX9A 2Q0AA 4COWA 5E1RA 1AYN1 1HW5A 1OPMA 4B7EA 1EAH3 2ZHLA 1J1LA 3POWA 5DDJ1 3MIFA 1SFNA 1Q8VA 4LT5A 4XF0A 2XJUA 1LGCA 5GKAC 3DUIA 2GH8A 4JDOA 4FSJA 3M3EA 2GNDA 1HRI1 4P14A 4OUSA 1PNGA 3AKPA 3HWJA 1RUI1 2YZ4A 4XXPA 1C8M2 4AWDA 4INDA 1JXNA 5IK4A 5DG1A 3TNQA 2JD4A 1HXS3 5CG8A 5DZFA 3KCYA 3V0BA 2R30A 1ZREA 3UKVA 2E6VA 1QNWA 4Q0QA 4JGZC 3ZSEA 4D7SA 3V64A 1JH5A 5LRRA 3R4SA 4XBNA 4QGNA 1QQP3 3WG1A 1DGWX 1EPWA 4PBOA 2ERFA 1F2NA 1RUC3 3WHTA 4NPRA 1K5MB 2TUNA 3RJRA 4L2NA 2VMHA 5A33B 3VZMA 4FTEA 4HMZA 2GMMA 4I01A 2MEV2 1LTEA 4B8EA 4HVRA 5KHGA 2PLV1 2IXJA 1PIV1 4FP2A 5C9AC 1C28A 4SBVA 1V6LA 3VZNA 3BB6A 1CAWA 2O8QA 2HWF2 3TBDA 3V0AB 4CDWB 4PQ9A 1Z78A 1G86A 3GZUC 1AHSA 1KS5A 4CDQB 4K9SA 3BOPA 1URXA 1UX6A 1W0PA 4ES9A 4RA0A 1NYWA 4DOUA 5F6KA 4G3YC 5BXXA 1PNFA 5ACA2 2WNVA 1AR73 3FBYA 1KS4A 4MGZE 2JG8C 4KWKA 2UYBA 2WLQA 4ASLA 1ZBE1 1OPOA 1SFYA 4LULA 4JQRA 2GNBA 3J8F2 4LTAA 1YIPA 2R0HA 2DCTA 3AZYA 3ZFEB 4XJUA 2PELA 4AEKA 4OFGA 1RUJ3 1LEMA 3PVOA 4N43A 3R6SA 2R6QA 4W6YA 5T5PA 4XF3A 1WD4A 3OD4A 2XB6C 1WW6A 5E8AA 1OA2A 1NCQB 3ATGA 1QJY1 2I74A 1KXGA 1W6QB 1HV0A 1YI9A 4ISQA 2E51A 2UWCA 2QVSB 3VBRB 3B9IA 1AX2A 1ND3C 1V6MA 1R082 2XJVA 5FLIA 3P3NA 1WD3A 3FLRA 5EFUA 2ET7A 4LO8A 4GB32 1ENQA 1G9FA 4WM8A 1COV2 3ZSLA 2R0FA 1AXZA 4BLIA 2A3WA 4KGGA 3LSDA 1ULDA 2XVLA 2ETEA 2O8OA 4FPOB 2AH2A 1C5IA 2ZMNA 1AR62 1HX6A 1C57A 2D97A 1LHWA 2HWE3 5LEJA 2ZGPA 1PGL2 2FBEA 2E63A 2ZKNA 5C8CA 2R063 4LNVA 3AB0A 1NLSA 2DU1A 3FUOA 5C4WB 2OYZA 4CEWA 1F8VA 4X6QB 2W08A 4BM8A 4P9IA 5GZCA 2ILMA 4OVEA 1QKQA 1SBEA 2AUYA 1DZRA 3DPRA 4QX5A 1I5ZA 4K40A 4IV3B 3ALQA 4QPGB 1BQPA 1CIWA 3LZZA 1DZQA 5FPZA 5JLVA 1ASJ3 1A78A 1OOPC 1XU1A 3OGGA 4KQ7A 4PDWC 2W39A 4L92A 1DGRN 1G9CA 1DQ1A 1ZRCA 3ILFA 1RB8G 1NXD1 2EXKA 1R1A2 3BTAA 3WZ1A 5FDBA 2VW1A 4FPKA 4EV0A 1U0AA 5C9AB 4GKYA 5J48A 4BYYA 2HWB3 1X7NA 4I0BA 3JZVA 1MQTA 3E5QA 1YFUA 4P9JA 4ZKTB 1J1TA 3EO6A 2D40A 3J4UH 3M3CA 3V56A 3ZYPA 2IC1A 2RS32 2NYYA 1W6NB 2XJSA 1SLBA 1JBCA 2BFUL 3M3OA 1LHNA 3JD71 3AJZA 1CESA 2RS11 1CD3G 3T2TA 3N7LA 3NV4A 2QQPA 3AP7A 3J9SA 2B9UA 4AFMA 2QCSB 2KA3A 4Q4W1 2NP0A 3AXEA 1N1TA 1AYN2 3NAPA 1RVF1 4IEXA 2GH2A 4QGMA 3MLKA 4LLOA 2XVGA 4KG8A 1TNFA 2H6BA 4YGDA 1F5FA 4GULA 5FOJB 5JZGC 2Z79A 1JTZX 4I30A 2IXIA 3D0SA 1J59A 3AFGA 3Q9OA 3WP5A 3QH7A 4HSLA 4Y22B 2IZWA 5EV7A 1HRI2 3ZXKA 2A6YA 1AR92 2E7TA 1RUI2 5DZEA 1DG6A 2GC0A 4HT1T 1PVC1 1WMEA 1SQ4A 4HBNA 2XL9A 3ES1A 4K8FA 1F31A 4M3CA 2RR13 1OFNA 4A7YA 3RWNA 1DGLA 2Z69A 4HSJA 1BJQA 1FOD3 2AR6A 1SDWA 2LTNA 1IS6A 1HIXA 2ZGTA 2PHDA 1AX1A 1XXNA 3TOJA 3TRSB 1GANA 5HCFA 4OUMA 1H2LA 2P37A 3U4XA 3T1LA 2DVFA 2XBO1 2BEOA 4LBQB 2B42B 3MDPA 1TMF2 1S0BA 5GZGA 3SXWA 5HXVA 2YC0A 1ZVFA 4AEDB 4OLLA 4Z1VA 4TSVA 1V9U2 2G4IA 3HIFA 3ECQA 3VBSC 1S0EA 2D7FA 2PLV2 2ZHKA 3MICA 4PIYA 3IPVB 1UN1A 2VGDA 1EPZA 1YYNA 2FZ1A 1B35A 2PYTA 2ZAAA 4GMP3 4MGYE 3WHUA 3ZXGA 1V6KA 3NL1A 4B4RA 4WM7A 4FPEA 2PHTA 3BCWA