1POQA

Solution structure of a superantigen from yersinia pseudotuberculosis
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
118
structure length
118
Chain Sequence
b'RIPNIATYTGTIQGKGEVCIIGNKEGKTRGGELYAVLHSTNVNADMTLILLRNVGGNGWGEIKRNDIDKPLKYEDYYTSGLSWIWKIKNNSSETSNYSLDATVHDDKEDSDVLTKCPV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords YPM
publication title Crystal and Solution Structures of a Superantigen from Yersinia pseudotuberculosis Reveal a Jelly-Roll Fold.
pubmed doi rcsb
source organism Yersinia pseudotuberculosis
molecule tags Immune system
total genus 14
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2003-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09144 YpM Yersinia pseudo-tuberculosis mitogen
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.510 Mainly Beta Sandwich Jelly Rolls Mitogen Ypm 1poqA00
1POQA 1PM4A
chains in the Genus database with same CATH superfamily
3PURA 3VV1A 3MO4A 4CEWB 5FXVA 4P9JA 4NVPA 1GLHA 4UYBA 1OPMA 3H3LA 2QQJA 4ZHNA 4QPIB 1OVPA 1YIPA 4FPOB 4B4PA 3PUAA 5A1AA 1VBE2 2ES3A 1W8NA 4PDWB 5KHGA 4ES8A 1QJU3 1CN1A 1J84A 4XABA 3ZYPA 1GZWA 2BTVC 2UYBA 4AVCA 3M3OA 1UY0A 5FIXA 3RJRA 4Q26A 4MGSA 5CFDA 4BXSV 1FXZA 4F8AA 3U10A 2FCVA 2PELA 1EPWA 2MEV1 1AR71 3J8F2 1H1MA 1YQCA 4LUMA 5FTTC 4YW1A 4Q4V3 3MBWA 2ERFA 3Q8AA 1WZXA 5T55A 2DCJA 5F3IA 4WVMB 1WMDA 3KF5A 4QWNA 1VP6A 1I1EA 1PO12 3NSTA 3PTYA 1NE6A 3J7LA 3FLPA 1U0AA 1VRBA 3THTA 3VBUC 2IWGB 1NLSA 3D0SA 4Y5TA 4H55A 1E5HA 4K40A 5EZWA 4LBOA 2BVBA 4E4SA 2A70A 1XRUA 1YNAA 3Q8BA 5GLWA 3T2QA 2EXJA 1QU0A 2PHRA 5F8PA 1F9KA 4R9DA 5DAWA 4LBQB 3DECA 3VD9A 1PMHX 5K8SA 2EIDA 3FX3A 1T6BX 5CKQA 3TN92 1BYHA 4LPLA 3TEYA 1EV11 2X09A 3MUZ1 1UU4A 5GZCA 2EA7A 2C1FA 4I3GA 3WNOA 3K3NA 3POYA 4HFSA 4OFGA 3WW1A 5K4LA 4BCUA 3O5SA 4CCMA 1YQ6A 2HWB1 5JZGA 3AMQA 1ND3B 1L7LA 3ALQA 4LXLA 1W0OA 4NHXA 2HEYF 2LW8A 4Y33A 5KHKA 5ABJC 1S0GA 2H6BA 3OOXA 4IE6A 2Q0AA 5FUIA 2FCUA 4W6WA 3I54A 2E31A 2DBNA 4TXWA 4AE2A 4R9CA 4AYUA 2RS12 3ETPA 2RVAA 2WNVB 4BWOA 3ZXJA 4U36A 4KWUA 1SBDA 3WDTA 3MDPA 1NYWA 2DCKA 1RHI3 1NQJA 1OOPB 1ZZ6A 2RS31 1IS3A 4DZGA 5FZFA 4XJ9A 3WNLA 1TMF1 1ZRIA 1ZYBA 2O8OA 2P5BA 5A7PA 1LRHA 3THCA 5DMYA 4LO4B 4OI4A 2VTFA 4PI0A 3ZFGB 3ES4A 4INDA 5FZIA 4PLOA 3LOIA 5A6YA 4LQRA 2CGPA 4GQ7A 2RS51 3RWNA 3OYWB 5KHJA 5IVCA 3JCIA 3WQ0A 2R061 4CCLA 5AC91 5IT6A 5A6QA 1CAUB 3NV3A 3AMHA 1NOVA 3I2JA 4LIUA 4H3WA 3O0XA 4LORA 3W5MA 1O3QA 5FFOC 4YM0A 4RR3B 3MIDA 2ZZJA 1XU2A 4JX0A 1ALYA 2E26A 4YVWB 3KHCA 5JI9A 1S0EA 4FT8A 4HSLA 4XUQA 5L73A 3ZIWA 4QQLA 1REEA 3GF6A 4XDQA 1RIRA 2QUOA 4MADA 5FZOA 4KBBA 3MGUA 3BTXA 1Y43B 1K5JA 2A3YA 4XW3A 4AFCA 1XB9A 2BP6A 4Q0UA 4CP9B 3BOPA 2HWC1 4XIKA 3BGAA 1CZTA 2WZR2 2X53S 4P5YA 4YVSB 5BPXA 5C3SA 1R1ZA 1O91A 2R30A 2VC9A 5HXVA 2VNRA 1NXD1 3LDRA 1JYIA 5ACA2 1RUC3 1W9YA 1SBEA 2ARCA 2LALA 4P9IA 4G4FA 4P9WA 3W21A 4HKOA 5A6ZA 2VO5A 4FPKA 3E5UA 2WINB 3ON7A 4ES9A 2C6SA 3Q8EA 4Z92B 5C6CA 4KBZA 1T2XA 2QJVA 4PLNA 2WZEA 2A6WA 2LM3A 5SV8A 4JDMA 1QJY3 2QQPA 3USSA 3EYPA 1AJOA 2WJSA 1VBD3 4I2OA 3WNNA 4HK8A 4K20A 4FBFA 2Q8OA 1M06G 5FUNA 2ZX4A 4HPKB 5FMDA 4MGZE 3N7LA 5DN2A 5CADA 1D2SA 3N35A 3OD4A 3IKWA 4HG6B 3HNBM 1AXYA 3HAGA 4E8DA 4EN0A 4YNIA 4L2NA 1VRH1 3OTFA 3WF0A 1BMV1 1HB4A 1Z7S3 4DNYA 2ZMLA 1COV1 3LGRA 2RJLA 3GNEA 4BH9A 1KD7A 1SFNA 2D7FA 4ZU4A 5A7QA 5SV5A 1CR7A 1QJZA 1R081 2VMEA 2ZS6B 1V9U1 4YGEA 2VZRA 5FO7B 3WEZA 3NVCA 4MH0E 4MYEA 4FXGB 4XAEA 2W94A 3J9SA 4IERA 1MZ6A 1ZBE1 3RG0A 4RS5B 4I0AA 1JYNA 2PHWA 2UYAA 1W6PA 2WT2A 1W6NA 1IG3A 5A33B 1YO8A 2NLRA 1NCQA 4LKDA 3SCHA 2PYTA 2P1BA 2VW1A 1RUE2 3MV11 1UO9A 3H8OA 2XWBB 3VBSB 3W58A 4M4PA 2WWSA 2YFZA 2OZJA 3K4ZA 5F5IA 4BMEA 1H6YA 4NROA 5FPUA 2VH9A 2YDEA 3BU0A 4OI0A 2IC1A 2ZTNA 2RJ2A 5D1IA 4BQYA 1NA1A 2GC1A 4IEQA 5BNQA 1PMIA 1YHFA 3FJSA 3RRDA 4E4DX 1AX0A 2PA7A 4XETA 3OY8B 1GMMA 2CGNA 1BEV3 2WT0A 1AR72 1CAWB 3AJYA 3PVNA 1Y4WA 1WLDA 1FMD1 5FZ8A 2JE7A 4M3CE 2EALA 4CCOA 4HMZA 1AR83 1UZWA 4LEJA 3RYRA 5CEHA 1VBA2 1DQ4A 1V6OA 2JDUA 1X82A 4AFAA 4W50A 1HXS1 1RUI3 2O14A 1RXFA 3R4SA 4YZ3A 3BKZA 1UY3A 4YZ1A 2LS6A 2Q5TA 1C8M2 1SLIA 2ZKLA 2JG9B 2V73A 4NPMA 1J58A 3ATGA 1UNBA 2VOKA 3LDBA 3IDEA 3MI8A 3PNAA 1W8UA 4WM8B 5BNPA 4PQ9A 2R043 1H9WA 2ORXA 4PI2A 4IGOA 3R6SA 1AXKA 1SCRA 3C2UA 2VCAA 4DY5A 2ZEZA 4NHKA 4AW7A 3G7DA 4CCDA 5C5TA 3K2OA 2GNTA 2EXIA 2C5DA 1PX3A 2Y6KA 4HK9A 1DBNA 1K12A 2A71A 2DVBA 3BTAA 3E1F1 4Q0QA 2IFWA 4ZXEA 3SHRA 3ZR6A 5FWJA 2DTYA 4N9IA 4N43B 4LO5B 4XFAA 2ZHLA 2SLIA 3ST7A 4CSWA 1H8VA 1MEC1 4HL0A 3IWZA 3IMNA 4M01A 1IZ3A 3KCXA 2VUDA 2VMHA 3B7MA 1BHGA 3C7EA 1SBFA 3U14A 3VBFB 2WO1A 3VBOB 1GU3A 2JB4A 3O1VA 1POV1 1LOBA 3SITA 3ZDVA 1VJ2A 2BGPA 4NAMA 1HV0A 1W9TA 5A3PA 1DGWA 4MOAA 1D4M3 5GLUA 1YCIA 4DXTA 1F35A 5FZ0A 3S0MA 2JXAA 4QKFA 3H3ZA 3PHMA 1SFYA 1I3HA 2R0FA 2CGOA 4GB32 5H9PA 5FYSA 2CTVA 1U12A 5IK4A 2RDSA 4LUKA 1RVF1 1QOOA 1YEWA 2XHKA 2I45A 3BALA 4COZA 2CY6A 2VVFA 4JGYB 3SQOA 3T2PA 1KQRA 2ZEYA 5CISA 5FY0A 2XONA 2BQPA 3KCCA 4FTBA 1V6IA 3A7QA 5AC92 3TBDA 1UKRA 2WFPA 4IL7A 2H0BA 2P2KA 3JD72 5K0UB 1HB1A 5A32B 5C3PA 2KXLA 1LOAA 1AYN3 3ZKUA 4DRVA 4AHXA 1MZ5A 4FSJA 1S0DA 3KT7A 4HKWA 3IPVB 4L11A 1VBB2 2ET7A 2DURA 3VDDA 2VM9A 4Q8KA 3TAYA 1MZEA 1YQ2A 2FBEA 4XE9A 4MX3A 1ENQA 2D40A 5FOBB 4AEMA 3ACHA 3MF6A 3SEPA 2IXIA 2EIEA 3USUB 3VKOA 1V00A 1UMHA 1XU1A 2AREA 1MZFA 3ITQA 3RPQA 3WW2A 3MW3A 1GWKA 5IJRA 1NA1C 3ZXAC 3AFGA 3BYWA 4Y5SA 2QQVA 5C4WB 4GH4B 1CZVA 3I3EA 2ZPXA 4KGGA 1GUIA 3M8LA 3LPGA 3UGGA 2UWAA 1O5LA 1LU1A 1MR5A 2CDPA 4XOGA 5D8AC 3N9LA 4AG4A 2R071 4CCCA 4WZCA 3CO2A 1G9BA 4EWAA 2DBIA 2DFCA 4XFIA 3NNFA 5IYYA 4AQ6A 4P5HA 2RM22 5FBJA 2RR13 4CXWA 3LEMA 4PIXA 1GOFA 2P3KA 4BHPA 3R4UA 2W0XA 3FHAA 2YFUA 4R52A 4CXYA 2C9AA 3K4DA 4Q4X3 4LK6A 4XZPA 1NKGA 4D7SA 1RUJ3 1ZRDA 2B42B 1UOFA 2Y64A 4GJYA 2BU9A 4QXBA 1UZ0A 5BNPC 1COV2 1HRI1 1H8TC 3N9QA 3JB4C 1W6OA 3OPZA 2AEYA 1R082 3OBZA 1LKNA 2GC2A 3DGTA 1AR93 4COYA 1V9U2 3KF3A 1WGPA 1ENXA 3ZYFA 4KWKA 3KCYA 1RL3A 1C4RA 4AGRA 4DXRA 2XJVA 1DQ6A 5T3NA 3DXTA 1GZTA 4AEKA 1MS3A 3GZAA 2BNNA 3KV9A 1QF3A 4UFHA 3WUCA 2P3JA 5BNOC 3INAA 4UFKA 4AOCA 5FPVA 1URXA 5EYXA 4WBBA 1NQDA 2Y0IA 1QJU1 4UF0A 1REFA 1XBFA 2I74A 3D0JA 3KVAA 3ZFEA 3PIJA 4JGZB 2J22A 1O4TA 5FPAA 3U1XA 4AL9A 4URAA 1Q8QA 2KA3A 1JYWA 3AKPA 4AGVA 1AL0G 2HKXA 2W1WA 1OF4A 3JQWA 1W28A 1HRV2 4Q4V1 2X29A 5A3TA 4GWIA 4Y5Z0 2JE9A 1A78A 4FQZA 4QPGC 1LHUA 1APNA 2NN8A 1NZIA 3CNAA 4FOVA 4MHUA 1RMU3 2ZCWA 4BA6A 3T3YA 2A5ZA 5LEKA 4XQWA 1V70A 1SHWB 2R32A 5LATA 5H9SA 1QGLA 4LOTA 2W92A 4URTA 1UYPA 1LU2A 1MQTB 1SDWA 1X9PA 4D6RA 5LCWL 4YW6A 2FZ2A 2DDUA 1X33A 5FZDA 5FZ1A 3H1MA 1XE8A 5E1RA 2K46A 5F39A 1ST8A 2A7AA 3IAPA 2XOMA 3ZLIA 2JKBA 1NT0A 3PU3A 4OHYA 3ASIA 1W6MA 2FD8A 4KU7A 1A8MA 4MXWB 3T1MA 2BDRA 2WKKA 1RYYA 1W9FA 3VZKA 2E7TA 1G7YA 4RHV3 1KRIA 1IGOA 4ZPIA 1SMVA 4N53A 4DEVA 1H2MA 4WVZA 1FV2A 1NY72 1RUF2 2ZZQA 5DZEA 3CJIB 3ZR5A 5IFPA 3V0BA 1BJQA 3VDDC 3D6EA 5A1LA 2X5IA 3S6PA 4YM2A 2ZA9A 3UNPA 1LOGA 4RGGA 3ZYHA 1QH6A 2V4AA 1NLQA 4GWNA 4M3CF 4OLLA 4XXAA 5GM0A 2ZGPA 2ZGOA 1W9SA 1CONA 2VMGA 3O7OA 1KITA 4E2SA 4K3UA 3N7KA 1MEC2 1J3RA 4HONA 5FY1A 2EVXA 4H7LA 2YC4A 4BQWA 2Y33A 1JHNA 3KHBA 3NKGA 4GMP0 1RHI1 1UMIA 1XNKA 5CG8A 3FBYA 2VOVA 5DAPA 2W2IA 4UF0B 2WL1A 1S55A 4JVAA 4K8FA 2QQOA 5E88A 3O1SA 3EJKA 2CHHA 1PGL1 3PLQA 3K46A 4LMFA 5FZKA 1O4YA 4E8CA 2TBVA 3SCGA 1K5MB 1NCRA 4XURA 2YBSA 5A3UA 4CU6A 2WIIB 1GOHA 4CP0A 2WT1A 2XL9A 2D6LX 2O1QA 4DEQA 4NIAA 1PVC2 3P5BA 2Y38A 2GSYA 3L2YA 3CKHA 5AFBA 5HXMA 5FXZA 5IVVA 1YI7A 3AXEA 2O8QA 4QHZA 2ZGMA 3LDKA 5FMOS 2W1SA 1AR61 1BVP1 2D6PA 4CEYA 5DG1A 3WQBA 4LBLA 4QXKA 4Q27A 2WDBA 4CP2A 1A8DA 2VUCA 4FVVA 2ADEA 3AFKA 3H50A 1DZQA 4YM3A 1D2QA 1VBC3 1DLLA 4Q4Y3 2GC0A 1JMUB 1ZZCA 2WQ4A 1TE1B 3AKTA 3E97A 3OD0A 4PIZA 5EYYA 3WLUA 4CUCA 5FPXA 3TB0A 5JOWA 4TLFA 1UOBA 2IUWA 4LA2A 4I30A 4CDQA 4S2FA 4H7MA 3ZFEC 2DVDA 4XC9A 1RUC1 5CA6A 1H2LA 5CFCC 5J48A 5IAVA 1LGBA 4XXPA 3ZN6B 4CVUA 1DZTA 1FYUA 2OPKA 1B35B 4JRLA 2XBO1 3LAGA 3M1HA 2FMYA 4ISQA 1UY2A 1QJY1 1CIYA 1S4CA 5JUVA 1IPSA 4R9AA 2BBAA 4W6XA 5FRAA 5EPAA 3D8CA 3B69A 5GLTA 5F5QA 5A7WA 2R072 4LLFA 4MGTA 4NMIA 1FATA 1UL9A 2W95A 4HBNA 4CCKA 1OOPC 3SH3A 3SKVA 1G9CA 4OUMA 1UXZA 3P6BA 1CESA 1WA6X 3T30A 1K3IA 3UJOA 3H9AA 5KXEA 3PIGA 4BQ4A 4DUWA 1KFXL 1OQ1A 3ETQA 4XBQA 2RDQA 4Y1VA 4XAAA 4AFMA 3LFIA 1S0FA 4BPZA 2VU9A 3LSEA 4DIQA 5GLVA 4OHWA 3UETA 5C5UA 2PAMA 2Z4FA 2GN7A 4BQ1A 1LEMA 3A0KA 4CCJA 1UY1A 1W05A 3WUDA 4XHBA 4M3CB 4IEYA 1ND2B 4GWJA 3WQ1A 2X5IC 5L7OA 1OLMA 1SPPB 3DKWA 3U11A 3S5AA 1XNAA 4NIDA 2R6QA 5EJ1B 4YVWC 1QXRA 2OQ6A 2L9LA 4JRAA 4OZXA 4AEDB 2QQIA 4FPYA 2R0HA 3I2KA 3HIFA 3KB5A 4AAPA 4XUPA 4AHYA 2HLEA 1PO23 3V0AB 3MLKA 4V2VA 1HIXA 1NE4A 2K0GA 5ABJA 3B9CA 4XF9A 5FLIA 1BEV1 3U37A 2WO7A 4FAHA 1A3KA 2CAVA 3RZLA 1PZ9A 3I4IA 4HXCA 2J1SA 1AR81 3ACLA 5FJKA 3UESA 2WR9A 3S5QA 1RUI1 3NAPA 4UW6A 5FYVA 2B9VA 3ZX7A 2OXBA 2XUEA 1NCRC 1JHJA 1GR3A 1SQ4A 1GZCA 3AC0A 3AZWA 3POFA 4UW3A 2BFUL 5DDJ3 5FQ0B 1AL23 4AI8A 1JU3A 4NOTA 1JTZX 4FAGA 3ZIXA 1RJ7A 4IEUA 5F5AA 3I49A 1MVEA 1P8JA 2R041 1VLNA 2VBBA 4AVAA 1RC6A 4XFCA 2BV4A 3ZXFA 4CEYC 3O1OA 3EQEA 1O59A 2K9ZA 4XILA 1HDKA 4Q0VA 2ZMKA 4FFGA 1XNCA 4RN5A 5JIAA 3KV6A 1DHKB 5DAQA 4LHNA 2NZ9A 2F6BA 1BBT2 1ODNA 2WFF2 2RG4A 3B94A 3J7NA 1KDKA 3T08A 3WF1A 1D0HA 1WW6A 5BXXA 3UJQA 5IATA 1PM7A 2X05A 4AVSA 1OD5A 3J4UH 3NMBA 4UXAA 2Q8EA 2E6VA 2PLV3 1VB2A 1H2KA 2R16A 4XMAA 3WOGA 4CDQC 4ZKTB 4P9XA 2VECA 1ULFA 1UPIA 1W0NA 4CDXA 3MZHA 3M3EA 3I2GA 3M3IA 5DXDA 3KM5A 2WS93 1QIQA 2LTNA 1X50A 2BGOA 1MS4A 1TME3 4IXLA 2UY8A 1IS5A 3NNJA 5JSPA 4I0BA 3UGHA 4XPVA 2ARXA 2GP5A 2F4PA 1PNGA 2HWD2 4XIOA 2EIBA 4N7IA 5FYHA 4IW3A 1KJLA 3HOBA 3I2OA 4FO9A 4GKXA 3VZJA 3ZFEB 5F32A 4EWEA 2X10A 1ZBA3 3JUUA 5GALA 3MLLA 2W46A 5IK7A 4YG0A 2W3JA 1K45A 1UW8A 1YFYA 3TNPB 4B3NA 5C9AB 1Z0HA 2RMU3 1XC6A 5FYMA 5K7PA 4Z82A 3RQ0A 2DF7A 5IW0A 1VMJA 3WR0A 3VKLA 2XLAA 4JCKA 1DLCA 1H1IA 1LGCA 1XNDA 4GULA 5B4XA 1QQP2 2WRAA 1ZZ8A 2JG8B 3DPRA 1GNZA 1XSRA 3FC0A 4NN0A 1I6XA 2RE9A 3C8XA 1OHFA 1CAVA 2J1EA 1AYN1 2JDKA 5T5JA 4W65A 5I91A 5LY1A 2D6OX 1H0BA 1IKPA 3WHUA 4AEJA 3IN9A 5DZGA 4LO7A 1JUHA 2DVGA 5EQUA 1AR62 3THPA 4EV0A 2JWPA 1ULDA 2ZEXA 1G9FA 2D93A 1GKBA 1UU6A 4UFIA 1S2KA 3L9JT 4TWTA 5L7OC 4CU9A 3ES1A 4XACA 3GBGA 2XWJB 3OGRA 3TEZA 2Q1ZB 4QT6A 4AI2A 1OPOA 1UX7A 2DCZA 4JKLA 2OT7A 4FPLA 5JVVA 2WQZC 1YUDA 1WCDJ 4HN0A 3ZFFB 2J42A 5EIYB 3O1PA 4RGKA 4TN7A 2B5HA 2HEVF 1J3PA 1ULOA 2JENA 3T2TA 3OB8A 2GMMA 3I97A 3O1RA 5GZGA 4WM7A 3POIA 3PUQA 4MV2A 4AI3A 2QBXA 2XBO2 2R1DA 2IVIB 2XJQA 3ZPOA 1S0CA 4KG8A 3VBFC 3WVJA 4Y1XA 5B2GB 4IV3B 3VHRA 2RR11 2YHJA 3NAPC 3KGLA 3HQXA 2CV6A 1W2OA 5C7GA 2AC1A 4Q4X1 2HWF3 4MXVA 2YY1A 1DP0A 2GMEA 2E9QA 2HWE3 4IE4A 4BM8A 3I2FA 1ZM1A 1RUJ1 4ZS2A 3WINE 2B4KA 4NPRA 2XVGA 1E5RA 3W5NA 1OFNA 2JDHA 3S7IA 4CDUB 3WDVA 3I59B 4Y22B 4YWAA 1DF0A 5KBFA 4HZFA 4XFFA 4XJZA 4MO3M 4XDPA 4QX3A 1XYPA 5FBZA 2EICA 2VQ0A 1J83A 1AR91 3RZHA 1PK6A 1R092 2LRPA 4GJZA 3W59A 3B5LB 1JOBA 1VBE3 2VL4A 3NKTA 4IE5A 2A3WA 1FOD1 4JGYC 1US3A 2V4VA 1EPZA 4DQAA 5FZ9A 2V72A 4HVOA 2PHTA 2I2SA 1VAKA 2OIIA 3CZJA 4A7KA 1DU3D 1LGNA 2ZGUA 1W6MB 4YFWA 4QX5A 1FPN2 1BCXA 3LZZA 3APBA 4QGLA 4NPLA 5H9RA 4CDXC 1ASJ2 1T6GC 4A7YA 3UYJA 1IPJA 4KG0A 2BYVE 1XYNA 1GNHA 2B9UA 1CPNA 1PO13 5F1RA 1IPKA 3B01A 4MVTA 2ZX2A 1UY4A 1O3RA 5BV6A 3ILRA 5C8CA 1CVNA 5DAXA 4QAWA 3NJVA 5L9RA 3ILNA 4F7ZA 5I8YA 4COWA 4OUSA 3ZYGA 2ZGNA 3SISA 3A23A 1RMU1 3WT3A 2CU5A 4NRQA 1LNSA 5FY9A 3IIAA 3VBHB 2VY0A 1OFSA 2VQTA 5TSWA 2W1QA 1F5FA 5CB7A 2ORZA 3ZSLA 2ZOEB 2VNGA 3OBTA 4GH4C 4BJ0A 1RUOA 4JQTA 4R4XA 4WV8A 3N9NA 5ANNA 3DN7A 3TN93 3AZYA 1FT9A 4K1YA 4HANA 2D44A 1J1LA 1ONAA 2Q30A 3DPRC 4B1MA 4EZHA 4Z1VA 5BYNA 4YGDA 2D97A 1GANA 2QQKA 1RUH2 5FMBA 2OYZA 3VBRA 3ZM8A 3HPNA 5KWRA 4EN6B 1UN1A 4P00B 3NW4A 3GJBA 3KT4A 5FMCA 4JTNA 3OF1A 4AFDA 3C7HA 3FN9A 5A3NA 4DUXA 5A3OA 5I0TA 1ZRFA 1O3SA 1YWKA 3RZMA 1MS5A 1RUG2 1PZ8A 2FCTA 2WNUB 1LJ7A 1W6QB 3D82A 3IBMA 3LEKA 2RS13 3PVBB 3EHKA 4E4ZA 1Q8PA 2OA2A 1D0GA 3HEIA 4AQTA 4AZZA 3HNMA 4XFBA 3AMMA 1R1A2 1F2NA 4AQ2A 2D98A 1RXGA 4FQ4A 3KMHA 1OA3A 4QX7A 4M0HA 3TRSB 3U07A 4DB5A 3T4HB 1NXMA 4CP1A 3M3QA 5A7OA 3H1WA 3HMYA 2E32A 1JZ3A 3N36A 3LB9A 1H30A 2ZEWA 3N7MA 5CG9A 4NRPA 1YC61 3CU7A 1NUKA 1UXXX 1UPSA 2YMZA 3Q8CA 1R64A 4WM7C 4CDWB 2QVSB 3KV4A 4BLJA 2WABA 2BOJA 4UFJA 3AZZA 4NIHA 4KQ7A 5I8TA 4AR2A 4RQPA 4IEZA 2PHDA 3I3QA 3AMPA 5A80A 4CU7A 4XMIA 3HN1A 5FO9B 5FPZA 2ZHMA 3I2IA 3ZN5A 4LHKA 5LASA 1W9WA 2W1UA 1QJEA 3M2MA 1HJGA 1J3QA 1QJX3 5BNNA 1UF2C 5FDBA 2MEV2 4CA9A 2XJUA 2Y8KA 5D8AA 3FMGA 1N1YA 2PXJA 1UYZA 2JDPA 1QOSA 3PU8A 2DCTA 1C1FA 1F4AA 3RFRA 2A6XA 5F2WA 1LODA 1CAXB 5FP3A 2OUJA 3RI8A 3MW4A 3VD4A 1PIV3 3AP4A 5FKCA 4CUAA 1PK6C 3C3VA 1XQNA 4M00A 4LKSA 4YARA 2VW2A 2WA3A 2DUPA 4Q4Y1 2VCMA 1QXJA 3EBRA 3H1YA 1DIWA 5ACA3 1FV3A 4D6SA 3V65A 3WP5A 2W68A 4A3XA 1U5YA 1H8TA 4FP3A 3CQOA 4BQ2A 3OSDA 4IV1B 3POGA 3VDCA 4TTGA 3VBUB 4YW4A 2ARAA 4P08A 2AEZA 3NO8A 4PQQA 2GU9A 5LY2A 1EV12 3AMNA 3MIHA 4WZFA 2XL7A 1GV9A 5BNOA 4AAXA 4X6RB 4NIGA 1XPWA 5J36A 4J6GA 2YXSA 1I5PA 2Q4SA 4YGCA 5FZ3A 5LBCA 3CJIC 3D4KA 1HKDA 4FFHA 2HWB2 5C8CC 4Y20B 3ZYIB 2XGXA 3P3NA 5KXBA 1F31A 1LHOA 4NJ4A 2BWAA 1QHDA 1U5IA 4B7EA 2MPFA 4OHZA 2YZ4A 2VQUA 3K4AA 3W20A 4A4AA 2D6MA 4I3PA 1HQLA 3H42B 4RFT0 1JOPA 5IUQA 3U78A 2VZOA 1GZ9A 2RR12 4QPGA 4IETA 3I8TA 4FOYA 3RJ2X 4A41A 4CRQA 2QDNA 5ABJB 3MPPG 1PVXA 2WYSA 3CMGA 2RS32 4Q4X2 3H8UA 5F6LB 4AHZA 5F9TA 2F4LA 3LKJA 1SLTA 1TMF2 5KHIA 4OQ8A 3LA3A 5KXDA 3VBRC 4QHBA 3EB7A 1V6LA 3VHOA 5I8SA 1W8ZA 1HB3A 1BQPA 2WWJA 5IWFA 4DS0A 1GYKA 1RUE3 3GHMA 3O0WA 4IUGA 4QDRA 1IG0A 2JDMA 3ZYRA 2RS52 3GXUA 4JTOA 5IK5A 3WG1A 2FMDA 4FOQA 2R062 3DYPA 4E2QA 4Y1ZA 1SZBA 1FOD2 1IS4A 1LAJA 2VZTA 3JBG3 2A1XA 3D5OA 1QDOA 2D6KA 3RYKA 3IM0A 1KFUL 2A6YA 3GHNA 2X8KA 4COUA 4NO4A 3AB0A 4A3ZA 1PO21 1AR73 5JWPA 1X36A 2ZX3A 3OUHA 1Y9MA 4UFLA 1CIWA 4B4RA 2ZGKA 1DCSA 4NWWA 5EJZB 1VBA3 5LB6A 4ATFA 2WZ8A 2P4EA 4Q1PA 4FPFA 3UKVA 4XEZA 2XJPA 2HWC2 4Y24A 4FP2A 1AZDA 3WNXA 3TEXA 1V6KA 3WG2A 1C8M3 4CEWA 1WMEA 3ZN4A 3BVCA 4RQPC 2E53A 4XZUG 2PFWA 5GZFA 4W8JA 3ZOIA 4DXZA 2C26A 5L19A 1WMFA 3QOPA 1WUVA 3C7OA 4QPIA 3IAQA 4QU1A 3O1UA 2GZWA 1JYXA 2CWMA 5DDJ1 5H9QA 3ZXLA 4PDWA 5BNNC 4DUVA 1O3TA 2VMIA 3J26N 4NHLA 4OZOA 2PAEA 2AENA 1X8EA 4PHZA 4AF9A 1GZWB 4AQSA 5CYYA 1WLWA 1W2AX 5LK5A 3CLPA 1KEXA 5CFDB 1U5XA 1OXCA 3POBA 1HW5A 1W8WA 2QQWA 4QB1A 3J7HA 3MW2A 5GZEA 4ARYA 2OPWA 2OUHA 1WCKA 2V09A 2ZX1A 4MGQA 5FY4A 5C3QA 4CU8A 4WVMA 4YYOA 3WW3A 1VRH2 2VE1A 3ZVXA 4K6BA 4QMAA 5J37A 1BMV2 3AJZA 1KS5A 5FY5A 4LKFA 4XUOA 2HBTA 1MACA 4L97A 4OYUA 3BB6A 3I2DA 1JI6A 3WD5A 1WCQA 2YUEA 2GNDA 3RNSA 1K42A 2XVLA 3WNMA 2Z2SB 5T5PA 1VE0A 2WS91 4LJHA 4SLIA 3O0VA 4E2GA 1WMXA 1ZBE2 2Z42A 5L36A 1J59A 4HT1T 4EN8B 1S0IA 3ZXEA 4LBQA 1IS6A 5F2SA 4GB33 2WLPA 4MGYE 1O5UA 1BK1A 2C24A 5JCTA 5FZ7A 1TNRA 3I7DA 3TEWA 2W87A 2ZXQA 3NV4A 3WXPA 5CFCA 2ENRA 1MPXA 4YG3A 1GP5A 1LESA 1YRZA 2DV9A 4AEDC 2JE8A 3BUCA 2RMU1 4N9HA 1ND3A 2OS2A 5AC93 2XVKA 1CX4A 5JZGB 2C0ZA 4XBNA 4YW5A 1W0PA 3JD73 1CD3G 5DUUA 1JZ6A 2W91A 2GMPA 2VZPA 2J1VA 4PCRA 2DFBA 4UOJA 3WNKA 5A1FA 5HV4A 1DYKA 2EIGA 3SNMA 5JPNB 1QXPA 1FMD2 2WNVA 1VBB3 4LOSA 4HVRA 1POV0 1V6NA 4DO0A 2P6CA 4R4ZA 1V0AA 3PMSA 4LTAA 3WG3A 1OOPA 1HXS2 2VJXA 3OGGA 4IESA 4DRRA 5LA1A 1UWWA 4XQDA 4XHXA 1UQXA 4Y26A 2ZHNA 3JXSA 1LCLA 4FPJA 1O6UA 1RITA 4NAOA 3ZFGA 2P17A 2FDHA 2B45X 4N90A 2B39A 1ZVFA 5LBEA 4W6YA 1WA4A 4R9BA 1FNZA 4HKLA 5FYIA 2VMDA 3OYWA 1E57A 1OLRA 4M0NA 4L0PA 1STMA 4LE3A 4AI1A 5L9BA 4V1PA 2BBVA 4OVEA 2ZAHA 3VDAA 2OX0A 4QPYA 1RUNA 1POQA 1CAUA 4DXSA 5FV3A 1GP4A 3ZMNA 3DF0A 1WBFA 4Y4RA 1XNBA 2XUMA 3HJRA 3MF9A 3FUOA 5FLHA 3M4FA 3HVDA 2D5HA 4FI9A 4RR3A 2OW4A 2VZUA 2Z69A 3FFQA 2QTWB 3WY6A 3EMRA 2RM23 2ZJCA 3WDWA 4YVWA 3NV1A 5JMCA 5FP7A 2HBUA 4FOWA 1W2TA 4C91A 1TEIA 2ZHKA 1TVGA 4CEWC 1BVVA 1Q8SA 4LHLA 2YU2A 2NMNA 4QPWA 5FZOB 4QPIC 2IXCA 1ACCA 2NYYA 4M4RA 4CP9A 5IVFA 2OQ7A 4XBLA 4YVSA 3UKNA 2HWE1 2TEPA 2WWUA 4PDWC 4OQ9A 4NHYA 4XUTA 4EN9B 1RINA 2A75A 3OBAA 4JKMA 1V9U3 1H4HA 2BFUS 4META 1CWPA 3I3MA 4OMDA 1U5ZA 3H7YA 3A22A 3MFCA 2F17A 3POJA 5C9AC 1GNYA 2PHFA 4J1XA 1JYVA 5ISLA 3RZZA 1PX4A 4FFFA 3BTYA 4CPBD 2UWCA 1LHVA 2JX9A 1RVF2 3AL5A 3B00A 1HX6A 5F5CA 2ZMNA 1MS8A 1EP0A 2D3RA 1JZ7A 4BU2A 3HQUA 4HPKA 3LIHA 2DVAA 5FZ4A 2UWBA 1DG6A 2JECA 2XMLA 3MHZA 5G04L 4IE7A 4QX2A 3HNYM 1WCSA 2ZGTA 2FZ1A 1HRV3 3K75B 3HN3A 2QDRA 3FLRA 4XJUA 3IZOA 1QKQA 5EJ3A 2B46X 5LA2A 5KC5A 4XF1A 1ULGA 1PO11 5AVAA 2GC3A 5G05L 2KM2A 2SBAA 3NJZA 4L99A 2IXHA 1KS4A 2D3PA 2NMOA 1W2NA 4LBNA 1ENRA 2WC2A 2QQNA 2EAKA 5DABA 4O61A 3T4VA 4PT6A 1CJDA 2PHLA 3N9MA 4JV4A 4RS5A 1WCUA 1W39A 2WBKA 1UIKA 2DCYA 2DU0A 2VG9A 5A33A 2D6NA 4K8RB 1UIJA 1W6PB 1W6NB 1ND3C 5J3UA 1EAH3 4HETA 1X8MA 1NCQB 1O8SA 3TN91 2VXRA 1G6NA 3VBSA 1VBD1 4XJAA 2QZ3A 4FCAA 4XF3A 5DDJ2 3WF3A 3VL9A 3ZSMA 1DQ0A 2J1RA 3KGZA 4NE9A 2WNVC 4ZXKA 1RUF3 5FCCA 2HH9A 1NA1B 3HWJA 5JMOA 4UAPA 1Z7S1 5J7MA 4QGMA 4BOWA 3OY8A 1OF3A 1CAWA 4YRDA 3OUIA 1S1AA 2XDVA 4N8MA 3NNMA 3ZFGC 2RS11 2XH6A 1MEC3 2XJRA 2PTMA 2P3YA 2ZX0A 2CDOA 2VGDA 1OLME 3UV9A 2V5DA 3NV2A 1HRI2 4UBHA 1BK0A 1KXGA 3RVHA 3H8XA 1IKQA 5LZ6A 2JG9A 1NZCA 4Z8BA 2YV8A 1YQ5A 2RJKA 4K21A 3KQ4B 1PGSA 3O12A 3VKMA 2HEWF 2P6HA 3CBNA 5CKMA 3A21A 4WM8A 3GBFA 4LITA 4G9SB 3ACFA 3DEMA 4RR3C 1UCXA 3NWKA 3DYOA 4JDOA 5EXOA 5FP9A 5BNPB 2P3IA 1OA4A 1ZZ7A 3VZMA 3N4MA 2Y6LA 3LOBA 3PUIA 4QB6A 5FYYA 5JI7A 2VUAA 1QJU2 2PHUA 3OPTA 4ET7A 3WSOA 5IAXA 3ACGA 1PVC3 1QNYA 1PGW1 1RUD3 5HV0A 3ZMOA 3E5XA 4OI1A 1LECA 3FL7A 4N43A 2VZVA 1HN0A 1W8FA 1QJX1 2VTXA 2GH2A 3IT8A 4YVSC 1LTEA 5I0SA 2JJ6A 1YXWA 4Q4V2 5IHRA 2G9ZA 5J09A 1DQ5A 4UBGA 3VBFA 3RZJA 3VBOA 4EWDA 4BLIA 4OHXA 1PIV1 1I9RA 4Q0SA 3BIEA 2C9KA 1W3VA 3VGIA 2WAAA 2OZ6A 4GMP3 2DYCA 3B02A 3RSJA 2JB8A 4PBOA 1OD3A 1Y9QA 3RGBA 4XQ4A 4LE4A 2GALA 5ACA1 3ENRA 2CAUA 5JXGA 3TNQA 1MS0A 2YBKA 4B7KA 4QQHA 3OG2A 1SG3A 5GJ6A 4ISRA 4XFGA 1IOAA 3MYXA 1FX5A 1OSGA 4JGYA 3WQ7A 2YB7A 4XTPA 5HCFA 1DYPA 1WD4A 3PL0A 5I93A 1X7NA 3A4UA 3VB9A 3KVBA 1VAVA 3HQRA 5GZDA 3JB8A 5DUVA 1GWLA 2EAAA 2OVUA 2R073 2XKPA 2VXJA 1SCSA 5K0UA 4ASKA 5A32A 5JPMB 4Q4W3 4C1XA 3AVRA 1AJKA 4RS5C 2BPA2 1UU5A 4FFIA 3HD8B 3O1TA 1Q8VA 1ZNPA 2E7AA 3S57A 4CZSA 2VOTA 1C3HA 1F5JA 5APAA 1D4M1 5C3RA 3VD5A 1D7PM 4AXOA 4DPNA 2YYOA 3FUQA 1WW5A 1NLRA 2GNMA 5FMOL 3VDDB 3VBSC 1LR5A 3ZO0B 4RFRB 1A34A 1RHI2 2VBDA 4LULA 1EUTA 3OJBA 1ZX5A 3USUA 1LEDA 3PJYA 1N1VA 1AX2A 1Q8OA 2I07B 3ZSEA 3GBWA 3LPFA 1DGLA 5J96B 3FHIB 5C4WA 3U0ZA 4GH4A 4JDNA 4YG6A 4XJ8A 1PGL2 1RUE1 5JR2A 3EXUA 4P9GA 4B4QA 1O7FA 1Y3TA 4O9EA 5AVPA 4IQPA 4X6QB 1SLAA 3CIHA 4IEOA 4NUBA 3JBG1 4RA0A 3QH7A 5FY8A 1M4WA 1Y7BA 4MG2A 3Q9OA 3AX4A 3HR9A 1G86A 3IB3A 3VUOA 4KI5M 4LBQD 1JZ8A 2VNVA 1RB8G 2JG9C 1ZZBA 4A6SA 5D21A 2QQMA 3Q8FA 2Y6JA 5FZCA 5KHHA 3VZLA 5HBAA 3BTZA 3HBZA 1HLCA 1VBA1 2W52A 2VZ3A 4WM8C 4ZU5A 2VPVA 2NM1A 2HYXA 4OUEA 5A7SA 3WCSA 4EN7B 2GP3A 2VTXJ 3LSDA 3DV8A 4IV1C 1C8M1 2WQ8A 3WX5A 1W6OB 3BN6A 4BE3A 4IGQA 4UW5A 3ILFA 4YPJA 5FR3A 4QQPA 1YFXA 1RUC2 4BYYA 5LBFA 1AYM3 1OKQA 1SFPA 2GH8A 2P37A 2XQRA 1H2NA 1HV1A 2K2SA 3GZUC 4N43C 1AUYA 3ACIA 1C1LA 2ARBA 4FPCA 2P34A 3AYDA 2W9XA 4C8DA 1GP6A 4RSUA 5JSRA 2Z79A 4EROA 1XJAA 4JGZA 1QJY2 1SDDB 3HBKA 4LIVA 1UMZA 2Y6GA 4JZRA 2PHXA 4N7UA 2PAKA 3CF6E 5FZEA 1VBD2 5J98B 3VBOC 4Q2FA 5CFCB 5B4NA 4CUBA 1BBT3 2WFF3 1MS9A 2VCCA 3VZNA 5HPOA 5FZMA 4EZ4A 4KGQA 1ZA4A 1ULEA 2RDRA 5A6XA 1DQ2A 4CE8A 1HQWA 3LA2A 3NNLA 3AL6A 4BQXA 2IFRA 4PLMA 4LNVA 1Z7S2 4RYDA 4O65A 1UKGA 3GGLA 1S2EA 4X8PA 5FLJA 3T0BA 4P9LA 3TOJA 5I0RA 4GZ9A 1ULPA 4QU2A 1MQTA 3THDA 5K9YA 3CL1A 4Q29A 2D5FA 1C5HA 2J1TA 2HWD3 5LA0A 1JN2P 4ZZ5A 1KGYA 4LR4A 1DYOA 1Y9GA 1N3OA 4Q8LA 1N3PA 1ODMA 2CWSA 2Y60A 4GB31 2XB6C 3NJYA 4QD2A 4IDZA 4MXWA 1JXNA 3CZUA 1UZZA 5FYCA 4BXFA 3MIBA 2N7GA 2CYFA 3GDBA 4FXKB 4UI9L 5DZFA 5JXHA 3J8F3 5K0UC 3WNPA 2JIGA 3AYAA 4LLOA 1AX1A 2FDKA 2VCBA 4ATEA 5FZLA 3OCPA 5C3OA 1GSLA 5CU1A 4XFHA 3U4XA 4N53B 3OEAA 1QQP3 3CJIA 3POEA 3ZSJA 4A7ZA 2Y34A 1S0BA 4COVA 3WW4A 2AR6A 5FKBA 3WP3A 3JD71 3V0BB 2Y26A 1PGW2 4MUVA 2X5IB 2QQUA 4CUGA 4YSFA 1F4HA 3T09A 4NRMA 1LB2A 1YJLA 3B3QE 4FPGA 1QJX2 1OKOA 1BEV2 2VBPA 1AR63 3KT1A 5HI0A 1VBB1 2B7YA 4LHSA 4RL7A 1AR82 3BOWA 3DYMA 3PVOA 4GALA 5C4WC 5EFUA 1N1TA 1SLBA 1RUI2 1EYBA 2WSVA 5C8WA 5ANQA 3NNGA 3JU9A 4HOOA 3H0OA 2YU1A 1PIV2 2WN3A 1GBGA 3FZ3A 4D3WA 4ZU7A 1LOFA 1NG0A 5J1XA 1JYTA 4YM1A 3H3UA 2WNEA 1YI9A 5T5OA 1RJ8A 4Q0PA 3RMXA 1XXNA 5FYZA 3WCRA 3JQXA 3RZKA 4RHV1 1YLLA 3CJXA 2H0VA 2WSUA 3AKRA 2HYKA 2R042 1K5MA 5CFDC 2QNKA 3CDZB 4P9YA 1H9PA 4DOUA 4BK4A 3AZVA 1IQDC 2TNFA 1NCRB 3E6BA 2RV9A 4CPBA 3K77A 3AVSA 2XBO3 2IXLA 4WVWA 1W03A 3FHQA 1PM4A 2Z5WA 3C7GA 2CSGA 1X9TA 2GDFA 1WW4A 1E5SA 2RM21 2AUYA 1BZWA 2XKOA 3QBQA 3I3DA 4BB3A 1JS9A 4CEYB 1CZSA 2VOWA 3PUSA 2LUWA 1FAYA 3LCPA 3R05A 3ZXKA 4IEXA 2VNOA 3FE5A 1OC1A 1E5IA 1Q5OA 3MFAA 1LHNA 2BZDA 2VR4A 4OHVA 1J1TA 3O14A 4ITCA 5E6HA 3TWIA 3VKFC 2IVJA 5C33A 5LA9A 3GM8A 2Q8DA 3DL3A 1OA2A 1D4M2 1R093 4C0BA 3QD6A 4JGZC 4CDQB 5HCHA 2G9FA 2PQSA 4JKKA 4GKYA 3SH5A 3ZN6A 3VZOA 1H4GA 1B35A 3DKQA 3NQHA 5FUPA 2A3XA 1VMFA 3IIIA 4L8QA 5IVYA 1OI6A 1WLTA 4B1LA 4B8EA 5KC6A 3KS7A 5JZGC 3BI3A 2XG3A 4ZZ8A 1QY4A 4KU8A 3SKJE 1FPN3 3HT1A 1HJFA 1VALA 1JBCA 1ASJ3 4ONUA 1GQPA 3WG4A 2DU1A 4C0HA 5A70A 3O1MA 1W04A 3H7JA 1C8NA 4OULA 3G6JB 2Q8CA 4AWDA 1CPMA 2VUJA 2Y6FA 4LK7A 3U4SA 4PBPA 2E33A 1HRV1 2V5YA 2ZACA 1DFQA 1MQTC 1WD3A 2WZR3 5A7WB 5DAVA 2UY9A 2YG0A 1QH7A 3JBG2 3GJAA 1AYN2 3UL2A 3E6CC 1VBC1 1VIWB 2VZSA 2XXZA 5FZ6A 4YGBA 2VVDA 3DCQA 3QACA 5JOYA 4QXHA 1EY2A 3NRUA 2R49A 2BW8A 4J1WA 5ERLA 2ZGRA 1UYXA 3GALA 2RDNA 4Z2WA 4C90A 2DWRA 2TUNA 2VAUA 3IDBB 3GYDA 3QLQA 1TG7A 1WLCA 2AYHA 3OGVA 4BDVB 5LWBA 2R7EB 3ZPYA 1OQDA 1CJPA 5F3EA 4YZ2A 5HCAA 4P14A 1L3JA 3AYEA 3MIEA 2YROA 2NPIA 5E89A 4M3CA 1XNTA 4Z07A 3H8RA 1EAH1 1ND2A 5JDBA 3T1LA 1SPPA 4YZ5A 1RUH3 3JZVA 4QM8A 3FWEA 1VR3A 5L7OB 1AVBA 3BU7A 1YJKA 1SLLA 4JHZA 1XE0A 4YW3A 3OUJA 4AEDA 4AVVA 5FK7A 2J7MA 2QQLA 4XTMA 1RUF1 1NY71 3VD3A 1A6CA 1JODA 4IGPA 1L7RA 2D3SA 3VKNA 3V0AA 4UWDA 1OH3A 1RUG3 2ZGLA 5T54A 4LBMA 4BIFA 3WZ1A 3LWCA 5T50A 4S2GA 4IEVA 4SBVA 3OGJA 2PQQA 1QOTA 3VHPA 1F15A 5LBBA 1US2A 1LOFC 1R1A3 4S2HA 4KWJA 2HJIA 1VAMA 4XYXA 5LRRA 3BODA 1DGRA 3FFZA 1EUUA 1F8VA 1RUJ2 4P02B 5CKNA 2VVEA 3KV5A 1AHSA 3UGFA 1O8PA 1QDCA 4I0WB 4QHOA 4Y3OA 4FTEA 3ZKYA 4A2UA 1GOGA 3K3OA 1K5MC 3NAPB 2W08A 3OGSA 4XJWA 4PIYA 5FQ0A 3V64A 4BQ5A 3B9IA 4LT5A 1AR92 3RS6A 1G9AA 5CZKA 4FTSA 2ZAAA 1ZZ9A 4AVTA 2JDYA 4BZ4A 4YFZA 2RHPA 1WKYA 5E8AA 5C70A 2FDIA 1PHMA 1OUXA 4HVQA 4FPHA 2BJSA 2IXJA 2VULA 1SACA 4JQRA 2BVVA 2VQAA 4JHTA 5DUXA 2MEV3 3LEGA 3ZXGA 4AFBA 1PVC1 1RUD1 3AM2A 3ELNA 2MNGA 5T5LA 3WF2A 2WUHA 3N3HA 2DUOA 4PF1A 1RGSA 5F7UA 3SMHA 5FZBA 5LW9A 2JICA 2YGLA 3KLSA 1VMHA 3SXWA 1QEXA 2CL2A 3VD7A 5FZGA 3CEWA 3ZSKA 3A0NA 2Y6HA 3MEPA 4A6OA 4OCTA 4LO8A 4ASLA 4KNCA 4CDXB 4F83A 1ENSA 1RMU2 2ATFA 1OMIA 1B35C 4K7JA 1AL21 5FYUA 4GMP1 1UZYA 3ECQA 4ORFA 1JZ5A 1KDMA 1NCQC 5FP4A 1N47A 3R4DB 3MLJA 5IFTA 1FNYA 1W8OA 5FPBA 1OLQA 4IE0A 5C71A 5CNAA 4K9SA 5FPLA 1JZ2A 4KH9A 1EV13 2J1AA 2JD9A 3LF7A 5C9AA 3MPBA 1JOJA 4RGAA 5M0TA 1FI2A 4NR1A 2JDNA 1REDA 2VMFA 4IEWA 2HWB3 3RDIA 1H1AA 4RHV2 1YYNA 2XQXA 4LKEA 1Z78A 3SEEA 3K48A 2ZGQA 5FZAA 2JG8A 1NX9A 3OEBA 4PF5A 2ILMA 2PLV1 1WW7A 4QGNA 3DPRB 4OMCA 4YW7A 3GCWA 1S2BA 2QE3A 4Q4W1 3UK9A 3P3PA 1TNFA 2G1MA 1CAVB 4DINB 1JZ4A 5D2AA 3VLBB 4A44A 1TME1 3T0AA 2O0OA 1DGWX 4MLOA 5FYTA 1JYCA 1JU4A 1OVSA 2RS33 1UOJA 4AVBA 4CCEA 3UKTA 1ND2C 1TMF3 4ZY9A 3K51A 5AFEA 4L9BA 1ZBA1 3LE0A 3AP9A 4YZ4A 5I0UA 1UOGA 5T52A 1C5IA 4TSVA 5KR7A 2XJSA 1AF9A 3KSCA 3I3BA 3BCWA 3DXUA 5DG2A 2Q1MA 4MHRA 2RS53 1B09A 4XF0A 3NJXA 5BUVA 3ZFFA 4NWVA 2VD7A 2ADDA 2R063 4O7XA 5F3CA 4QX8A 4LA3A 3POSA 1YQ8A 3AP7A 3F95A 1FOD3 4QQOA 4FPEA 2R1BA 4DY3A 3RZGA 4OI2A 3X29B 1L7QA 5LRSA 1SLCA 3EO6A 2FDFA 5JOZA 1W3XA 3PDQA 1I5ZA 1UD1A 2BRTA 3D3AA 4WM7B 3WV6A 4J25A 3ROUA 5JIUA 5JSOA 1WBLA 4IV3A 2VW0A 3R0RA 4EE2A 1BKZA 1OH4A 4R8HA 3MUY1 2W47A 1HQNA 4O9GA 4XCAA 1W90A 3AP5A 1QWRA 2NQYA 4ZONA 3ZDSA 4G3YC 2G4IA 3AKQA 1LOEA 4U2AA 2HWC3 5EWSA 5A3WA 2BOIA 4CDUA 1CGPA 3I59A 1VBC2 1LULA 4Y22A 1SEFA 4I02A 1GQGA 4Q4Y2 4E9KA 1KJRA 2BNOA 2W5FA 4QM9A 3C7FA 3HT2A 5FREA 4BISA 4XF4A 4ASMB 4DMIA 1NAEA 1MS1A 3CHXA 2W39A 4MGKE 5DPNA 4UW4A 3I2HA 2FDGA 2PN5A 3WP6A 1PK6B 2DUQA 4AHWA 1AYM1 2ID4A 3E6DA 4B29A 5JOXA 2XPJA 2J1UA 2WA4A 3B93A 3M70A 3SLIA 2AH2A 1EAH2 1LHWA 3BPZA 3N9OA 3OPWA 5DQ0A 1DQ1A 3GZTB 1YIFA 2VMCA 1GFF2 4BK5A 2WN2A 3PJQA 3RI9A 1BBT1 2WFF1 1S0JA 1GQHA 1VRH3 1W8TA 4H14A 1COV3 2HWF1 2JIJA 2VZQA 1C28A 4QQ2A 2WZPP 4WVVA 5A3LA 1R083 2BEOA 5FXXA 3TYJA 4Z2AA 1XOYA 4D94A 5C8CB 3RMYA 1CQ9A 2ET1A 1YFUA 4XVHA 2AZ5A 4S2DA 4CCNA 2WO3A 2BWCA 3KD4A 4BMBA 2LROA 1ZBE3 1XE7A 1XYOA 5EP9A 3VBHA 3WDXA 1MVQA 2OKXA 2G19A 2JDZA 3IMMA 1VBE1 2JKXA 2HWD1 2Q1FA 3N7JA 1Q43A 3AKSA 4KMQA 2QCSB 2JEMA 3UT0A 2CNAA 4X8NA 3AYCA 5A7NA 4I01A 5DUWA 2WO2A 2DTWA 1D4VB 3M7AA 3W9AA 2ZKNA 2JG8C 4GXLA 3LEIA 3OBRA 3WF4A 5CAZA 3J8F1 4HLTA 4NHMA 5F37A 4EYUA 4TZDA 3VBRB 1JUIA 4W4ZA 2WAOA 5JAXA 4QKDA 2ZABA 2AACA 3DUIA 2VOXA 1QQP1 5FY7A 5HCBA 4TYSA 4XUNA 4Y1YA 3RWKX 1W8HA 2WNUA 3POWA 1PO22 1W6QA 1W2UA 1RUD2 1FMD3 3QH6A 4GAZA 4XDOA 4LBJA 1C57A 1G8WA 2EF6A 2FQPA 1GWMA 2GNBA 3ME2A 4D69A 3T0DA 1VPHA 4CTEA 3SC7X 1HXS3 3FLTA 4K1ZA 4Q1RA 3S30A 4QDQA 3M3CA 4D7YA 1BLZA 3AK0A 3ZFFC 3E5QA 4F3JA 2YGMA 3AZXA 2BNMA 3PTRB 5EV7A 3PMEA 4CYDA 3J7MA 1UYYA 3P1IA 4H2AA 5GKAC 4CDWA 5I0DA 1AL22 3NL1A 1DZRA 5IVBA 2VZ1A 5JXJA 4NIIA 2XR4A 4MGIE 1ZREA 1V6JA 3WP4A 5FJHA 4A42A 2WNOA 4IV3C 4KL1A 4D8MA 4EJRA 4PJYA 4RQPB 1H6XA 2MHFA 5CVRA 1Q56A 3IDAA 5LEJA 4TLGA 1HN1A 1PMJX 1QJFA 4JAAA 1W06A 3VDBA 3PVEA 3S7EA 3QCWA 3U75A 1OUSA 5BNNB 1ULCA 3KQRA 3MIGA 1RTVA 5D8AB 4CDUC 3SH4A 4BIOA 4E4HA 4QX1A 1Q3EA 2UURA 1CAXA 5CIRA 1OT5A 2Y0OA 4QKBA 1JH5A 1POV3 2UU8A 5E16A 1CX1A 2PLV2 4AI0A 2QFEA 4YLZA 5IVJA 2IZWA 4Q4W2 2FDJA 5FXWA 5FOJB 4ARXA 3MV01 2WS92 2A73B 4LBKA 1YFWA 3LQCA 2KD7A 1TME2 4ZS3A 2A6ZA 2H6CA 3GCXA 2JD4A 2EXHA 4IV1A 1TZOA 3LA7A 1H8TB 3VBUA 3ZXDA 1R091 2WYFA 2NP0A 5LK7B 4EQVA 5CBLA 5FYBA 4QKNA 1RVF3 1ZBA2 3AP6A 1AXZA 1N1SA 2YPDA 2ZBJA 4QB2A 3WDYA 2XHNA 5JXIA 1UAIA 4L92A 4QDSA 4N53C 4V2WA 2XLGA 3RYPA 4YW2A 3ZYBA 2XJTA 3VL8A 5BNOB 4QX0A 2C4XA 2RMU2 4AI9A 4GIQA 4HSJA 4Y20A 1LOCA 3URFA 1FPN1 5EHDA 3MIFA 1ASJ1 4Y1UA 2ZGSA 1WWYA 1O4ZA 3PUHA 4AK3A 3ABZA 1BXHA 3VBHC 1W99A 2GAUA 4LO6B 5IK8A 2WZR1 2D43A 3LD8A 4MZUA 4AGGA 4HN1A 1PNFA 5JLVA 2QZ2A 4BQ3A 1IQAA 1ZA7A 3KWVA 3SCFA 3GZEA 4QPGB 5L9VA 1V6MA 4D6QA 4C1WA 3KZ4C 4GA9A 4IEPA 1QNWA 1JW6A 2YC0A 2BERA 4I09A 5F3GA 3VHNA 2B8MA 5FO8B 4GWMA 2FHRA 3LIGA 4KWLA 1G9DA 5FZHA 4UT5A 1ZRCA 4D7TA 2GN3A 1DGRN 1XSQA 2XLFA 4MSVA 2ETEA 2YPJA 1OQEA 1OBNA 4QXCA 3BIWE 3N9PA 3T2OA 1ZRRA 3WHTA 2WLQA 2WNUC 4GD4A 4Q5OA 2DVFA 5JR7B 1DDLA 1RUH1 1AYM2 1TQ5A 5FP8A 3VN4A 2E51A 4RD7A 4XCBA 1GICA 1LENA 1N3QA 2PMWB 3IDCB 2G9GA 3IPVA 2IXKA 4A45A 5F6KA 3AXDA 2EXKA 1OURA 3LFMA 5FAXA 3WDUA 3ZYJB 1VB4A 2BUKA 1RUG1 4JC1A 3FBMA 5FWEA 1UX6A 2E7QA 3F2ZA 5KXCA 1PZ7A 2E63A 3BPSA 5FK8A 2JDAA 1HB2A 2AGSA 2QKDA 5A3MA 5GLZA 1QMJA 3ORJA 1R1A1 4D0QA 4DFSA 4E27A 4CDWC 2HWF2 2YBPA 3L2HA 5IVEA 5BY5A 1HRI3 3MICA 2HWE2 1UZVA 2KR2A 2YC2A 4UFMA 4CXXA 2BGCA 2A6VA 4Y4YA 1IHMA 3V56A
chains in the Genus database with same CATH topology
1POQA 1PM4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1POQ A;  1PM4 A; 
#chains in the Genus database with same CATH topology
 3PUR A;  3VV1 A;  3MO4 A;  4CEW B;  5FXV A;  4P9J A;  4NVP A;  1GLH A;  4UYB A;  1OPM A;  3H3L A;  2QQJ A;  4ZHN A;  4QPI B;  1OVP A;  1YIP A;  4FPO B;  4B4P A;  3PUA A;  5A1A A;  1VBE 2;  2ES3 A;  1W8N A;  4PDW B;  5KHG A;  4ES8 A;  1QJU 3;  1CN1 A;  1J84 A;  4XAB A;  3ZYP A;  1GZW A;  2BTV C;  2UYB A;  4AVC A;  3M3O A;  1UY0 A;  5FIX A;  3RJR A;  4Q26 A;  4MGS A;  5CFD A;  4BXS V;  1FXZ A;  4F8A A;  3U10 A;  2FCV A;  2PEL A;  1EPW A;  2MEV 1;  1AR7 1;  3J8F 2;  1H1M A;  1YQC A;  4LUM A;  5FTT C;  4YW1 A;  4Q4V 3;  3MBW A;  2ERF A;  3Q8A A;  1WZX A;  5T55 A;  2DCJ A;  5F3I A;  4WVM B;  1WMD A;  3KF5 A;  4QWN A;  1VP6 A;  1I1E A;  1PO1 2;  3NST A;  3PTY A;  1NE6 A;  3J7L A;  3FLP A;  1U0A A;  1VRB A;  3THT A;  3VBU C;  2IWG B;  1NLS A;  3D0S A;  4Y5T A;  4H55 A;  1E5H A;  4K40 A;  5EZW A;  4LBO A;  2BVB A;  4E4S A;  2A70 A;  1XRU A;  1YNA A;  3Q8B A;  5GLW A;  3T2Q A;  2EXJ A;  1QU0 A;  2PHR A;  5F8P A;  1F9K A;  4R9D A;  5DAW A;  4LBQ B;  3DEC A;  3VD9 A;  1PMH X;  5K8S A;  2EID A;  3FX3 A;  1T6B X;  5CKQ A;  3TN9 2;  1BYH A;  4LPL A;  3TEY A;  1EV1 1;  2X09 A;  3MUZ 1;  1UU4 A;  5GZC A;  2EA7 A;  2C1F A;  4I3G A;  3WNO A;  3K3N A;  3POY A;  4HFS A;  4OFG A;  3WW1 A;  5K4L A;  4BCU A;  3O5S A;  4CCM A;  1YQ6 A;  2HWB 1;  5JZG A;  3AMQ A;  1ND3 B;  1L7L A;  3ALQ A;  4LXL A;  1W0O A;  4NHX A;  2HEY F;  2LW8 A;  4Y33 A;  5KHK A;  5ABJ C;  1S0G A;  2H6B A;  3OOX A;  4IE6 A;  2Q0A A;  5FUI A;  2FCU A;  4W6W A;  3I54 A;  2E31 A;  2DBN A;  4TXW A;  4AE2 A;  4R9C A;  4AYU A;  2RS1 2;  3ETP A;  2RVA A;  2WNV B;  4BWO A;  3ZXJ A;  4U36 A;  4KWU A;  1SBD A;  3WDT A;  3MDP A;  1NYW A;  2DCK A;  1RHI 3;  1NQJ A;  1OOP B;  1ZZ6 A;  2RS3 1;  1IS3 A;  4DZG A;  5FZF A;  4XJ9 A;  3WNL A;  1TMF 1;  1ZRI A;  1ZYB A;  2O8O A;  2P5B A;  5A7P A;  1LRH A;  3THC A;  5DMY A;  4LO4 B;  4OI4 A;  2VTF A;  4PI0 A;  3ZFG B;  3ES4 A;  4IND A;  5FZI A;  4PLO A;  3LOI A;  5A6Y A;  4LQR A;  2CGP A;  4GQ7 A;  2RS5 1;  3RWN A;  3OYW B;  5KHJ A;  5IVC A;  3JCI A;  3WQ0 A;  2R06 1;  4CCL A;  5AC9 1;  5IT6 A;  5A6Q A;  1CAU B;  3NV3 A;  3AMH A;  1NOV A;  3I2J A;  4LIU A;  4H3W A;  3O0X A;  4LOR A;  3W5M A;  1O3Q A;  5FFO C;  4YM0 A;  4RR3 B;  3MID A;  2ZZJ A;  1XU2 A;  4JX0 A;  1ALY A;  2E26 A;  4YVW B;  3KHC A;  5JI9 A;  1S0E A;  4FT8 A;  4HSL A;  4XUQ A;  5L73 A;  3ZIW A;  4QQL A;  1REE A;  3GF6 A;  4XDQ A;  1RIR A;  2QUO A;  4MAD A;  5FZO A;  4KBB A;  3MGU A;  3BTX A;  1Y43 B;  1K5J A;  2A3Y A;  4XW3 A;  4AFC A;  1XB9 A;  2BP6 A;  4Q0U A;  4CP9 B;  3BOP A;  2HWC 1;  4XIK A;  3BGA A;  1CZT A;  2WZR 2;  2X53 S;  4P5Y A;  4YVS B;  5BPX A;  5C3S A;  1R1Z A;  1O91 A;  2R30 A;  2VC9 A;  5HXV A;  2VNR A;  1NXD 1;  3LDR A;  1JYI A;  5ACA 2;  1RUC 3;  1W9Y A;  1SBE A;  2ARC A;  2LAL A;  4P9I A;  4G4F A;  4P9W A;  3W21 A;  4HKO A;  5A6Z A;  2VO5 A;  4FPK A;  3E5U A;  2WIN B;  3ON7 A;  4ES9 A;  2C6S A;  3Q8E A;  4Z92 B;  5C6C A;  4KBZ A;  1T2X A;  2QJV A;  4PLN A;  2WZE A;  2A6W A;  2LM3 A;  5SV8 A;  4JDM A;  1QJY 3;  2QQP A;  3USS A;  3EYP A;  1AJO A;  2WJS A;  1VBD 3;  4I2O A;  3WNN A;  4HK8 A;  4K20 A;  4FBF A;  2Q8O A;  1M06 G;  5FUN A;  2ZX4 A;  4HPK B;  5FMD A;  4MGZ E;  3N7L A;  5DN2 A;  5CAD A;  1D2S A;  3N35 A;  3OD4 A;  3IKW A;  4HG6 B;  3HNB M;  1AXY A;  3HAG A;  4E8D A;  4EN0 A;  4YNI A;  4L2N A;  1VRH 1;  3OTF A;  3WF0 A;  1BMV 1;  1HB4 A;  1Z7S 3;  4DNY A;  2ZML A;  1COV 1;  3LGR A;  2RJL A;  3GNE A;  4BH9 A;  1KD7 A;  1SFN A;  2D7F A;  4ZU4 A;  5A7Q A;  5SV5 A;  1CR7 A;  1QJZ A;  1R08 1;  2VME A;  2ZS6 B;  1V9U 1;  4YGE A;  2VZR A;  5FO7 B;  3WEZ A;  3NVC A;  4MH0 E;  4MYE A;  4FXG B;  4XAE A;  2W94 A;  3J9S A;  4IER A;  1MZ6 A;  1ZBE 1;  3RG0 A;  4RS5 B;  4I0A A;  1JYN A;  2PHW A;  2UYA A;  1W6P A;  2WT2 A;  1W6N A;  1IG3 A;  5A33 B;  1YO8 A;  2NLR A;  1NCQ A;  4LKD A;  3SCH A;  2PYT A;  2P1B A;  2VW1 A;  1RUE 2;  3MV1 1;  1UO9 A;  3H8O A;  2XWB B;  3VBS B;  3W58 A;  4M4P A;  2WWS A;  2YFZ A;  2OZJ A;  3K4Z A;  5F5I A;  4BME A;  1H6Y A;  4NRO A;  5FPU A;  2VH9 A;  2YDE A;  3BU0 A;  4OI0 A;  2IC1 A;  2ZTN A;  2RJ2 A;  5D1I A;  4BQY A;  1NA1 A;  2GC1 A;  4IEQ A;  5BNQ A;  1PMI A;  1YHF A;  3FJS A;  3RRD A;  4E4D X;  1AX0 A;  2PA7 A;  4XET A;  3OY8 B;  1GMM A;  2CGN A;  1BEV 3;  2WT0 A;  1AR7 2;  1CAW B;  3AJY A;  3PVN A;  1Y4W A;  1WLD A;  1FMD 1;  5FZ8 A;  2JE7 A;  4M3C E;  2EAL A;  4CCO A;  4HMZ A;  1AR8 3;  1UZW A;  4LEJ A;  3RYR A;  5CEH A;  1VBA 2;  1DQ4 A;  1V6O A;  2JDU A;  1X82 A;  4AFA A;  4W50 A;  1HXS 1;  1RUI 3;  2O14 A;  1RXF A;  3R4S A;  4YZ3 A;  3BKZ A;  1UY3 A;  4YZ1 A;  2LS6 A;  2Q5T A;  1C8M 2;  1SLI A;  2ZKL A;  2JG9 B;  2V73 A;  4NPM A;  1J58 A;  3ATG A;  1UNB A;  2VOK A;  3LDB A;  3IDE A;  3MI8 A;  3PNA A;  1W8U A;  4WM8 B;  5BNP A;  4PQ9 A;  2R04 3;  1H9W A;  2ORX A;  4PI2 A;  4IGO A;  3R6S A;  1AXK A;  1SCR A;  3C2U A;  2VCA A;  4DY5 A;  2ZEZ A;  4NHK A;  4AW7 A;  3G7D A;  4CCD A;  5C5T A;  3K2O A;  2GNT A;  2EXI A;  2C5D A;  1PX3 A;  2Y6K A;  4HK9 A;  1DBN A;  1K12 A;  2A71 A;  2DVB A;  3BTA A;  3E1F 1;  4Q0Q A;  2IFW A;  4ZXE A;  3SHR A;  3ZR6 A;  5FWJ A;  2DTY A;  4N9I A;  4N43 B;  4LO5 B;  4XFA A;  2ZHL A;  2SLI A;  3ST7 A;  4CSW A;  1H8V A;  1MEC 1;  4HL0 A;  3IWZ A;  3IMN A;  4M01 A;  1IZ3 A;  3KCX A;  2VUD A;  2VMH A;  3B7M A;  1BHG A;  3C7E A;  1SBF A;  3U14 A;  3VBF B;  2WO1 A;  3VBO B;  1GU3 A;  2JB4 A;  3O1V A;  1POV 1;  1LOB A;  3SIT A;  3ZDV A;  1VJ2 A;  2BGP A;  4NAM A;  1HV0 A;  1W9T A;  5A3P A;  1DGW A;  4MOA A;  1D4M 3;  5GLU A;  1YCI A;  4DXT A;  1F35 A;  5FZ0 A;  3S0M A;  2JXA A;  4QKF A;  3H3Z A;  3PHM A;  1SFY A;  1I3H A;  2R0F A;  2CGO A;  4GB3 2;  5H9P A;  5FYS A;  2CTV A;  1U12 A;  5IK4 A;  2RDS A;  4LUK A;  1RVF 1;  1QOO A;  1YEW A;  2XHK A;  2I45 A;  3BAL A;  4COZ A;  2CY6 A;  2VVF A;  4JGY B;  3SQO A;  3T2P A;  1KQR A;  2ZEY A;  5CIS A;  5FY0 A;  2XON A;  2BQP A;  3KCC A;  4FTB A;  1V6I A;  3A7Q A;  5AC9 2;  3TBD A;  1UKR A;  2WFP A;  4IL7 A;  2H0B A;  2P2K A;  3JD7 2;  5K0U B;  1HB1 A;  5A32 B;  5C3P A;  2KXL A;  1LOA A;  1AYN 3;  3ZKU A;  4DRV A;  4AHX A;  1MZ5 A;  4FSJ A;  1S0D A;  3KT7 A;  4HKW A;  3IPV B;  4L11 A;  1VBB 2;  2ET7 A;  2DUR A;  3VDD A;  2VM9 A;  4Q8K A;  3TAY A;  1MZE A;  1YQ2 A;  2FBE A;  4XE9 A;  4MX3 A;  1ENQ A;  2D40 A;  5FOB B;  4AEM A;  3ACH A;  3MF6 A;  3SEP A;  2IXI A;  2EIE A;  3USU B;  3VKO A;  1V00 A;  1UMH A;  1XU1 A;  2ARE A;  1MZF A;  3ITQ A;  3RPQ A;  3WW2 A;  3MW3 A;  1GWK A;  5IJR A;  1NA1 C;  3ZXA C;  3AFG A;  3BYW A;  4Y5S A;  2QQV A;  5C4W B;  4GH4 B;  1CZV A;  3I3E A;  2ZPX A;  4KGG A;  1GUI A;  3M8L A;  3LPG A;  3UGG A;  2UWA A;  1O5L A;  1LU1 A;  1MR5 A;  2CDP A;  4XOG A;  5D8A C;  3N9L A;  4AG4 A;  2R07 1;  4CCC A;  4WZC A;  3CO2 A;  1G9B A;  4EWA A;  2DBI A;  2DFC A;  4XFI A;  3NNF A;  5IYY A;  4AQ6 A;  4P5H A;  2RM2 2;  5FBJ A;  2RR1 3;  4CXW A;  3LEM A;  4PIX A;  1GOF A;  2P3K A;  4BHP A;  3R4U A;  2W0X A;  3FHA A;  2YFU A;  4R52 A;  4CXY A;  2C9A A;  3K4D A;  4Q4X 3;  4LK6 A;  4XZP A;  1NKG A;  4D7S A;  1RUJ 3;  1ZRD A;  2B42 B;  1UOF A;  2Y64 A;  4GJY A;  2BU9 A;  4QXB A;  1UZ0 A;  5BNP C;  1COV 2;  1HRI 1;  1H8T C;  3N9Q A;  3JB4 C;  1W6O A;  3OPZ A;  2AEY A;  1R08 2;  3OBZ A;  1LKN A;  2GC2 A;  3DGT A;  1AR9 3;  4COY A;  1V9U 2;  3KF3 A;  1WGP A;  1ENX A;  3ZYF A;  4KWK A;  3KCY A;  1RL3 A;  1C4R A;  4AGR A;  4DXR A;  2XJV A;  1DQ6 A;  5T3N A;  3DXT A;  1GZT A;  4AEK A;  1MS3 A;  3GZA A;  2BNN A;  3KV9 A;  1QF3 A;  4UFH A;  3WUC A;  2P3J A;  5BNO C;  3INA A;  4UFK A;  4AOC A;  5FPV A;  1URX A;  5EYX A;  4WBB A;  1NQD A;  2Y0I A;  1QJU 1;  4UF0 A;  1REF A;  1XBF A;  2I74 A;  3D0J A;  3KVA A;  3ZFE A;  3PIJ A;  4JGZ B;  2J22 A;  1O4T A;  5FPA A;  3U1X A;  4AL9 A;  4URA A;  1Q8Q A;  2KA3 A;  1JYW A;  3AKP A;  4AGV A;  1AL0 G;  2HKX A;  2W1W A;  1OF4 A;  3JQW A;  1W28 A;  1HRV 2;  4Q4V 1;  2X29 A;  5A3T A;  4GWI A;  4Y5Z 0;  2JE9 A;  1A78 A;  4FQZ A;  4QPG C;  1LHU A;  1APN A;  2NN8 A;  1NZI A;  3CNA A;  4FOV A;  4MHU A;  1RMU 3;  2ZCW A;  4BA6 A;  3T3Y A;  2A5Z A;  5LEK A;  4XQW A;  1V70 A;  1SHW B;  2R32 A;  5LAT A;  5H9S A;  1QGL A;  4LOT A;  2W92 A;  4URT A;  1UYP A;  1LU2 A;  1MQT B;  1SDW A;  1X9P A;  4D6R A;  5LCW L;  4YW6 A;  2FZ2 A;  2DDU A;  1X33 A;  5FZD A;  5FZ1 A;  3H1M A;  1XE8 A;  5E1R A;  2K46 A;  5F39 A;  1ST8 A;  2A7A A;  3IAP A;  2XOM A;  3ZLI A;  2JKB A;  1NT0 A;  3PU3 A;  4OHY A;  3ASI A;  1W6M A;  2FD8 A;  4KU7 A;  1A8M A;  4MXW B;  3T1M A;  2BDR A;  2WKK A;  1RYY A;  1W9F A;  3VZK A;  2E7T A;  1G7Y A;  4RHV 3;  1KRI A;  1IGO A;  4ZPI A;  1SMV A;  4N53 A;  4DEV A;  1H2M A;  4WVZ A;  1FV2 A;  1NY7 2;  1RUF 2;  2ZZQ A;  5DZE A;  3CJI B;  3ZR5 A;  5IFP A;  3V0B A;  1BJQ A;  3VDD C;  3D6E A;  5A1L A;  2X5I A;  3S6P A;  4YM2 A;  2ZA9 A;  3UNP A;  1LOG A;  4RGG A;  3ZYH A;  1QH6 A;  2V4A A;  1NLQ A;  4GWN A;  4M3C F;  4OLL A;  4XXA A;  5GM0 A;  2ZGP A;  2ZGO A;  1W9S A;  1CON A;  2VMG A;  3O7O A;  1KIT A;  4E2S A;  4K3U A;  3N7K A;  1MEC 2;  1J3R A;  4HON A;  5FY1 A;  2EVX A;  4H7L A;  2YC4 A;  4BQW A;  2Y33 A;  1JHN A;  3KHB A;  3NKG A;  4GMP 0;  1RHI 1;  1UMI A;  1XNK A;  5CG8 A;  3FBY A;  2VOV A;  5DAP A;  2W2I A;  4UF0 B;  2WL1 A;  1S55 A;  4JVA A;  4K8F A;  2QQO A;  5E88 A;  3O1S A;  3EJK A;  2CHH A;  1PGL 1;  3PLQ A;  3K46 A;  4LMF A;  5FZK A;  1O4Y A;  4E8C A;  2TBV A;  3SCG A;  1K5M B;  1NCR A;  4XUR A;  2YBS A;  5A3U A;  4CU6 A;  2WII B;  1GOH A;  4CP0 A;  2WT1 A;  2XL9 A;  2D6L X;  2O1Q A;  4DEQ A;  4NIA A;  1PVC 2;  3P5B A;  2Y38 A;  2GSY A;  3L2Y A;  3CKH A;  5AFB A;  5HXM A;  5FXZ A;  5IVV A;  1YI7 A;  3AXE A;  2O8Q A;  4QHZ A;  2ZGM A;  3LDK A;  5FMO S;  2W1S A;  1AR6 1;  1BVP 1;  2D6P A;  4CEY A;  5DG1 A;  3WQB A;  4LBL A;  4QXK A;  4Q27 A;  2WDB A;  4CP2 A;  1A8D A;  2VUC A;  4FVV A;  2ADE A;  3AFK A;  3H50 A;  1DZQ A;  4YM3 A;  1D2Q A;  1VBC 3;  1DLL A;  4Q4Y 3;  2GC0 A;  1JMU B;  1ZZC A;  2WQ4 A;  1TE1 B;  3AKT A;  3E97 A;  3OD0 A;  4PIZ A;  5EYY A;  3WLU A;  4CUC A;  5FPX A;  3TB0 A;  5JOW A;  4TLF A;  1UOB A;  2IUW A;  4LA2 A;  4I30 A;  4CDQ A;  4S2F A;  4H7M A;  3ZFE C;  2DVD A;  4XC9 A;  1RUC 1;  5CA6 A;  1H2L A;  5CFC C;  5J48 A;  5IAV A;  1LGB A;  4XXP A;  3ZN6 B;  4CVU A;  1DZT A;  1FYU A;  2OPK A;  1B35 B;  4JRL A;  2XBO 1;  3LAG A;  3M1H A;  2FMY A;  4ISQ A;  1UY2 A;  1QJY 1;  1CIY A;  1S4C A;  5JUV A;  1IPS A;  4R9A A;  2BBA A;  4W6X A;  5FRA A;  5EPA A;  3D8C A;  3B69 A;  5GLT A;  5F5Q A;  5A7W A;  2R07 2;  4LLF A;  4MGT A;  4NMI A;  1FAT A;  1UL9 A;  2W95 A;  4HBN A;  4CCK A;  1OOP C;  3SH3 A;  3SKV A;  1G9C A;  4OUM A;  1UXZ A;  3P6B A;  1CES A;  1WA6 X;  3T30 A;  1K3I A;  3UJO A;  3H9A A;  5KXE A;  3PIG A;  4BQ4 A;  4DUW A;  1KFX L;  1OQ1 A;  3ETQ A;  4XBQ A;  2RDQ A;  4Y1V A;  4XAA A;  4AFM A;  3LFI A;  1S0F A;  4BPZ A;  2VU9 A;  3LSE A;  4DIQ A;  5GLV A;  4OHW A;  3UET A;  5C5U A;  2PAM A;  2Z4F A;  2GN7 A;  4BQ1 A;  1LEM A;  3A0K A;  4CCJ A;  1UY1 A;  1W05 A;  3WUD A;  4XHB A;  4M3C B;  4IEY A;  1ND2 B;  4GWJ A;  3WQ1 A;  2X5I C;  5L7O A;  1OLM A;  1SPP B;  3DKW A;  3U11 A;  3S5A A;  1XNA A;  4NID A;  2R6Q A;  5EJ1 B;  4YVW C;  1QXR A;  2OQ6 A;  2L9L A;  4JRA A;  4OZX A;  4AED B;  2QQI A;  4FPY A;  2R0H A;  3I2K A;  3HIF A;  3KB5 A;  4AAP A;  4XUP A;  4AHY A;  2HLE A;  1PO2 3;  3V0A B;  3MLK A;  4V2V A;  1HIX A;  1NE4 A;  2K0G A;  5ABJ A;  3B9C A;  4XF9 A;  5FLI A;  1BEV 1;  3U37 A;  2WO7 A;  4FAH A;  1A3K A;  2CAV A;  3RZL A;  1PZ9 A;  3I4I A;  4HXC A;  2J1S A;  1AR8 1;  3ACL A;  5FJK A;  3UES A;  2WR9 A;  3S5Q A;  1RUI 1;  3NAP A;  4UW6 A;  5FYV A;  2B9V A;  3ZX7 A;  2OXB A;  2XUE A;  1NCR C;  1JHJ A;  1GR3 A;  1SQ4 A;  1GZC A;  3AC0 A;  3AZW A;  3POF A;  4UW3 A;  2BFU L;  5DDJ 3;  5FQ0 B;  1AL2 3;  4AI8 A;  1JU3 A;  4NOT A;  1JTZ X;  4FAG A;  3ZIX A;  1RJ7 A;  4IEU A;  5F5A A;  3I49 A;  1MVE A;  1P8J A;  2R04 1;  1VLN A;  2VBB A;  4AVA A;  1RC6 A;  4XFC A;  2BV4 A;  3ZXF A;  4CEY C;  3O1O A;  3EQE A;  1O59 A;  2K9Z A;  4XIL A;  1HDK A;  4Q0V A;  2ZMK A;  4FFG A;  1XNC A;  4RN5 A;  5JIA A;  3KV6 A;  1DHK B;  5DAQ A;  4LHN A;  2NZ9 A;  2F6B A;  1BBT 2;  1ODN A;  2WFF 2;  2RG4 A;  3B94 A;  3J7N A;  1KDK A;  3T08 A;  3WF1 A;  1D0H A;  1WW6 A;  5BXX A;  3UJQ A;  5IAT A;  1PM7 A;  2X05 A;  4AVS A;  1OD5 A;  3J4U H;  3NMB A;  4UXA A;  2Q8E A;  2E6V A;  2PLV 3;  1VB2 A;  1H2K A;  2R16 A;  4XMA A;  3WOG A;  4CDQ C;  4ZKT B;  4P9X A;  2VEC A;  1ULF A;  1UPI A;  1W0N A;  4CDX A;  3MZH A;  3M3E A;  3I2G A;  3M3I A;  5DXD A;  3KM5 A;  2WS9 3;  1QIQ A;  2LTN A;  1X50 A;  2BGO A;  1MS4 A;  1TME 3;  4IXL A;  2UY8 A;  1IS5 A;  3NNJ A;  5JSP A;  4I0B A;  3UGH A;  4XPV A;  2ARX A;  2GP5 A;  2F4P A;  1PNG A;  2HWD 2;  4XIO A;  2EIB A;  4N7I A;  5FYH A;  4IW3 A;  1KJL A;  3HOB A;  3I2O A;  4FO9 A;  4GKX A;  3VZJ A;  3ZFE B;  5F32 A;  4EWE A;  2X10 A;  1ZBA 3;  3JUU A;  5GAL A;  3MLL A;  2W46 A;  5IK7 A;  4YG0 A;  2W3J A;  1K45 A;  1UW8 A;  1YFY A;  3TNP B;  4B3N A;  5C9A B;  1Z0H A;  2RMU 3;  1XC6 A;  5FYM A;  5K7P A;  4Z82 A;  3RQ0 A;  2DF7 A;  5IW0 A;  1VMJ A;  3WR0 A;  3VKL A;  2XLA A;  4JCK A;  1DLC A;  1H1I A;  1LGC A;  1XND A;  4GUL A;  5B4X A;  1QQP 2;  2WRA A;  1ZZ8 A;  2JG8 B;  3DPR A;  1GNZ A;  1XSR A;  3FC0 A;  4NN0 A;  1I6X A;  2RE9 A;  3C8X A;  1OHF A;  1CAV A;  2J1E A;  1AYN 1;  2JDK A;  5T5J A;  4W65 A;  5I91 A;  5LY1 A;  2D6O X;  1H0B A;  1IKP A;  3WHU A;  4AEJ A;  3IN9 A;  5DZG A;  4LO7 A;  1JUH A;  2DVG A;  5EQU A;  1AR6 2;  3THP A;  4EV0 A;  2JWP A;  1ULD A;  2ZEX A;  1G9F A;  2D93 A;  1GKB A;  1UU6 A;  4UFI A;  1S2K A;  3L9J T;  4TWT A;  5L7O C;  4CU9 A;  3ES1 A;  4XAC A;  3GBG A;  2XWJ B;  3OGR A;  3TEZ A;  2Q1Z B;  4QT6 A;  4AI2 A;  1OPO A;  1UX7 A;  2DCZ A;  4JKL A;  2OT7 A;  4FPL A;  5JVV A;  2WQZ C;  1YUD A;  1WCD J;  4HN0 A;  3ZFF B;  2J42 A;  5EIY B;  3O1P A;  4RGK A;  4TN7 A;  2B5H A;  2HEV F;  1J3P A;  1ULO A;  2JEN A;  3T2T A;  3OB8 A;  2GMM A;  3I97 A;  3O1R A;  5GZG A;  4WM7 A;  3POI A;  3PUQ A;  4MV2 A;  4AI3 A;  2QBX A;  2XBO 2;  2R1D A;  2IVI B;  2XJQ A;  3ZPO A;  1S0C A;  4KG8 A;  3VBF C;  3WVJ A;  4Y1X A;  5B2G B;  4IV3 B;  3VHR A;  2RR1 1;  2YHJ A;  3NAP C;  3KGL A;  3HQX A;  2CV6 A;  1W2O A;  5C7G A;  2AC1 A;  4Q4X 1;  2HWF 3;  4MXV A;  2YY1 A;  1DP0 A;  2GME A;  2E9Q A;  2HWE 3;  4IE4 A;  4BM8 A;  3I2F A;  1ZM1 A;  1RUJ 1;  4ZS2 A;  3WIN E;  2B4K A;  4NPR A;  2XVG A;  1E5R A;  3W5N A;  1OFN A;  2JDH A;  3S7I A;  4CDU B;  3WDV A;  3I59 B;  4Y22 B;  4YWA A;  1DF0 A;  5KBF A;  4HZF A;  4XFF A;  4XJZ A;  4MO3 M;  4XDP A;  4QX3 A;  1XYP A;  5FBZ A;  2EIC A;  2VQ0 A;  1J83 A;  1AR9 1;  3RZH A;  1PK6 A;  1R09 2;  2LRP A;  4GJZ A;  3W59 A;  3B5L B;  1JOB A;  1VBE 3;  2VL4 A;  3NKT A;  4IE5 A;  2A3W A;  1FOD 1;  4JGY C;  1US3 A;  2V4V A;  1EPZ A;  4DQA A;  5FZ9 A;  2V72 A;  4HVO A;  2PHT A;  2I2S A;  1VAK A;  2OII A;  3CZJ A;  4A7K A;  1DU3 D;  1LGN A;  2ZGU A;  1W6M B;  4YFW A;  4QX5 A;  1FPN 2;  1BCX A;  3LZZ A;  3APB A;  4QGL A;  4NPL A;  5H9R A;  4CDX C;  1ASJ 2;  1T6G C;  4A7Y A;  3UYJ A;  1IPJ A;  4KG0 A;  2BYV E;  1XYN A;  1GNH A;  2B9U A;  1CPN A;  1PO1 3;  5F1R A;  1IPK A;  3B01 A;  4MVT A;  2ZX2 A;  1UY4 A;  1O3R A;  5BV6 A;  3ILR A;  5C8C A;  1CVN A;  5DAX A;  4QAW A;  3NJV A;  5L9R A;  3ILN A;  4F7Z A;  5I8Y A;  4COW A;  4OUS A;  3ZYG A;  2ZGN A;  3SIS A;  3A23 A;  1RMU 1;  3WT3 A;  2CU5 A;  4NRQ A;  1LNS A;  5FY9 A;  3IIA A;  3VBH B;  2VY0 A;  1OFS A;  2VQT A;  5TSW A;  2W1Q A;  1F5F A;  5CB7 A;  2ORZ A;  3ZSL A;  2ZOE B;  2VNG A;  3OBT A;  4GH4 C;  4BJ0 A;  1RUO A;  4JQT A;  4R4X A;  4WV8 A;  3N9N A;  5ANN A;  3DN7 A;  3TN9 3;  3AZY A;  1FT9 A;  4K1Y A;  4HAN A;  2D44 A;  1J1L A;  1ONA A;  2Q30 A;  3DPR C;  4B1M A;  4EZH A;  4Z1V A;  5BYN A;  4YGD A;  2D97 A;  1GAN A;  2QQK A;  1RUH 2;  5FMB A;  2OYZ A;  3VBR A;  3ZM8 A;  3HPN A;  5KWR A;  4EN6 B;  1UN1 A;  4P00 B;  3NW4 A;  3GJB A;  3KT4 A;  5FMC A;  4JTN A;  3OF1 A;  4AFD A;  3C7H A;  3FN9 A;  5A3N A;  4DUX A;  5A3O A;  5I0T A;  1ZRF A;  1O3S A;  1YWK A;  3RZM A;  1MS5 A;  1RUG 2;  1PZ8 A;  2FCT A;  2WNU B;  1LJ7 A;  1W6Q B;  3D82 A;  3IBM A;  3LEK A;  2RS1 3;  3PVB B;  3EHK A;  4E4Z A;  1Q8P A;  2OA2 A;  1D0G A;  3HEI A;  4AQT A;  4AZZ A;  3HNM A;  4XFB A;  3AMM A;  1R1A 2;  1F2N A;  4AQ2 A;  2D98 A;  1RXG A;  4FQ4 A;  3KMH A;  1OA3 A;  4QX7 A;  4M0H A;  3TRS B;  3U07 A;  4DB5 A;  3T4H B;  1NXM A;  4CP1 A;  3M3Q A;  5A7O A;  3H1W A;  3HMY A;  2E32 A;  1JZ3 A;  3N36 A;  3LB9 A;  1H30 A;  2ZEW A;  3N7M A;  5CG9 A;  4NRP A;  1YC6 1;  3CU7 A;  1NUK A;  1UXX X;  1UPS A;  2YMZ A;  3Q8C A;  1R64 A;  4WM7 C;  4CDW B;  2QVS B;  3KV4 A;  4BLJ A;  2WAB A;  2BOJ A;  4UFJ A;  3AZZ A;  4NIH A;  4KQ7 A;  5I8T A;  4AR2 A;  4RQP A;  4IEZ A;  2PHD A;  3I3Q A;  3AMP A;  5A80 A;  4CU7 A;  4XMI A;  3HN1 A;  5FO9 B;  5FPZ A;  2ZHM A;  3I2I A;  3ZN5 A;  4LHK A;  5LAS A;  1W9W A;  2W1U A;  1QJE A;  3M2M A;  1HJG A;  1J3Q A;  1QJX 3;  5BNN A;  1UF2 C;  5FDB A;  2MEV 2;  4CA9 A;  2XJU A;  2Y8K A;  5D8A A;  3FMG A;  1N1Y A;  2PXJ A;  1UYZ A;  2JDP A;  1QOS A;  3PU8 A;  2DCT A;  1C1F A;  1F4A A;  3RFR A;  2A6X A;  5F2W A;  1LOD A;  1CAX B;  5FP3 A;  2OUJ A;  3RI8 A;  3MW4 A;  3VD4 A;  1PIV 3;  3AP4 A;  5FKC A;  4CUA A;  1PK6 C;  3C3V A;  1XQN A;  4M00 A;  4LKS A;  4YAR A;  2VW2 A;  2WA3 A;  2DUP A;  4Q4Y 1;  2VCM A;  1QXJ A;  3EBR A;  3H1Y A;  1DIW A;  5ACA 3;  1FV3 A;  4D6S A;  3V65 A;  3WP5 A;  2W68 A;  4A3X A;  1U5Y A;  1H8T A;  4FP3 A;  3CQO A;  4BQ2 A;  3OSD A;  4IV1 B;  3POG A;  3VDC A;  4TTG A;  3VBU B;  4YW4 A;  2ARA A;  4P08 A;  2AEZ A;  3NO8 A;  4PQQ A;  2GU9 A;  5LY2 A;  1EV1 2;  3AMN A;  3MIH A;  4WZF A;  2XL7 A;  1GV9 A;  5BNO A;  4AAX A;  4X6R B;  4NIG A;  1XPW A;  5J36 A;  4J6G A;  2YXS A;  1I5P A;  2Q4S A;  4YGC A;  5FZ3 A;  5LBC A;  3CJI C;  3D4K A;  1HKD A;  4FFH A;  2HWB 2;  5C8C C;  4Y20 B;  3ZYI B;  2XGX A;  3P3N A;  5KXB A;  1F31 A;  1LHO A;  4NJ4 A;  2BWA A;  1QHD A;  1U5I A;  4B7E A;  2MPF A;  4OHZ A;  2YZ4 A;  2VQU A;  3K4A A;  3W20 A;  4A4A A;  2D6M A;  4I3P A;  1HQL A;  3H42 B;  4RFT 0;  1JOP A;  5IUQ A;  3U78 A;  2VZO A;  1GZ9 A;  2RR1 2;  4QPG A;  4IET A;  3I8T A;  4FOY A;  3RJ2 X;  4A41 A;  4CRQ A;  2QDN A;  5ABJ B;  3MPP G;  1PVX A;  2WYS A;  3CMG A;  2RS3 2;  4Q4X 2;  3H8U A;  5F6L B;  4AHZ A;  5F9T A;  2F4L A;  3LKJ A;  1SLT A;  1TMF 2;  5KHI A;  4OQ8 A;  3LA3 A;  5KXD A;  3VBR C;  4QHB A;  3EB7 A;  1V6L A;  3VHO A;  5I8S A;  1W8Z A;  1HB3 A;  1BQP A;  2WWJ A;  5IWF A;  4DS0 A;  1GYK A;  1RUE 3;  3GHM A;  3O0W A;  4IUG A;  4QDR A;  1IG0 A;  2JDM A;  3ZYR A;  2RS5 2;  3GXU A;  4JTO A;  5IK5 A;  3WG1 A;  2FMD A;  4FOQ A;  2R06 2;  3DYP A;  4E2Q A;  4Y1Z A;  1SZB A;  1FOD 2;  1IS4 A;  1LAJ A;  2VZT A;  3JBG 3;  2A1X A;  3D5O A;  1QDO A;  2D6K A;  3RYK A;  3IM0 A;  1KFU L;  2A6Y A;  3GHN A;  2X8K A;  4COU A;  4NO4 A;  3AB0 A;  4A3Z A;  1PO2 1;  1AR7 3;  5JWP A;  1X36 A;  2ZX3 A;  3OUH A;  1Y9M A;  4UFL A;  1CIW A;  4B4R A;  2ZGK A;  1DCS A;  4NWW A;  5EJZ B;  1VBA 3;  5LB6 A;  4ATF A;  2WZ8 A;  2P4E A;  4Q1P A;  4FPF A;  3UKV A;  4XEZ A;  2XJP A;  2HWC 2;  4Y24 A;  4FP2 A;  1AZD A;  3WNX A;  3TEX A;  1V6K A;  3WG2 A;  1C8M 3;  4CEW A;  1WME A;  3ZN4 A;  3BVC A;  4RQP C;  2E53 A;  4XZU G;  2PFW A;  5GZF A;  4W8J A;  3ZOI A;  4DXZ A;  2C26 A;  5L19 A;  1WMF A;  3QOP A;  1WUV A;  3C7O A;  4QPI A;  3IAQ A;  4QU1 A;  3O1U A;  2GZW A;  1JYX A;  2CWM A;  5DDJ 1;  5H9Q A;  3ZXL A;  4PDW A;  5BNN C;  4DUV A;  1O3T A;  2VMI A;  3J26 N;  4NHL A;  4OZO A;  2PAE A;  2AEN A;  1X8E A;  4PHZ A;  4AF9 A;  1GZW B;  4AQS A;  5CYY A;  1WLW A;  1W2A X;  5LK5 A;  3CLP A;  1KEX A;  5CFD B;  1U5X A;  1OXC A;  3POB A;  1HW5 A;  1W8W A;  2QQW A;  4QB1 A;  3J7H A;  3MW2 A;  5GZE A;  4ARY A;  2OPW A;  2OUH A;  1WCK A;  2V09 A;  2ZX1 A;  4MGQ A;  5FY4 A;  5C3Q A;  4CU8 A;  4WVM A;  4YYO A;  3WW3 A;  1VRH 2;  2VE1 A;  3ZVX A;  4K6B A;  4QMA A;  5J37 A;  1BMV 2;  3AJZ A;  1KS5 A;  5FY5 A;  4LKF A;  4XUO A;  2HBT A;  1MAC A;  4L97 A;  4OYU A;  3BB6 A;  3I2D A;  1JI6 A;  3WD5 A;  1WCQ A;  2YUE A;  2GND A;  3RNS A;  1K42 A;  2XVL A;  3WNM A;  2Z2S B;  5T5P A;  1VE0 A;  2WS9 1;  4LJH A;  4SLI A;  3O0V A;  4E2G A;  1WMX A;  1ZBE 2;  2Z42 A;  5L36 A;  1J59 A;  4HT1 T;  4EN8 B;  1S0I A;  3ZXE A;  4LBQ A;  1IS6 A;  5F2S A;  4GB3 3;  2WLP A;  4MGY E;  1O5U A;  1BK1 A;  2C24 A;  5JCT A;  5FZ7 A;  1TNR A;  3I7D A;  3TEW A;  2W87 A;  2ZXQ A;  3NV4 A;  3WXP A;  5CFC A;  2ENR A;  1MPX A;  4YG3 A;  1GP5 A;  1LES A;  1YRZ A;  2DV9 A;  4AED C;  2JE8 A;  3BUC A;  2RMU 1;  4N9H A;  1ND3 A;  2OS2 A;  5AC9 3;  2XVK A;  1CX4 A;  5JZG B;  2C0Z A;  4XBN A;  4YW5 A;  1W0P A;  3JD7 3;  1CD3 G;  5DUU A;  1JZ6 A;  2W91 A;  2GMP A;  2VZP A;  2J1V A;  4PCR A;  2DFB A;  4UOJ A;  3WNK A;  5A1F A;  5HV4 A;  1DYK A;  2EIG A;  3SNM A;  5JPN B;  1QXP A;  1FMD 2;  2WNV A;  1VBB 3;  4LOS A;  4HVR A;  1POV 0;  1V6N A;  4DO0 A;  2P6C A;  4R4Z A;  1V0A A;  3PMS A;  4LTA A;  3WG3 A;  1OOP A;  1HXS 2;  2VJX A;  3OGG A;  4IES A;  4DRR A;  5LA1 A;  1UWW A;  4XQD A;  4XHX A;  1UQX A;  4Y26 A;  2ZHN A;  3JXS A;  1LCL A;  4FPJ A;  1O6U A;  1RIT A;  4NAO A;  3ZFG A;  2P17 A;  2FDH A;  2B45 X;  4N90 A;  2B39 A;  1ZVF A;  5LBE A;  4W6Y A;  1WA4 A;  4R9B A;  1FNZ A;  4HKL A;  5FYI A;  2VMD A;  3OYW A;  1E57 A;  1OLR A;  4M0N A;  4L0P A;  1STM A;  4LE3 A;  4AI1 A;  5L9B A;  4V1P A;  2BBV A;  4OVE A;  2ZAH A;  3VDA A;  2OX0 A;  4QPY A;  1RUN A;  1POQ A;  1CAU A;  4DXS A;  5FV3 A;  1GP4 A;  3ZMN A;  3DF0 A;  1WBF A;  4Y4R A;  1XNB A;  2XUM A;  3HJR A;  3MF9 A;  3FUO A;  5FLH A;  3M4F A;  3HVD A;  2D5H A;  4FI9 A;  4RR3 A;  2OW4 A;  2VZU A;  2Z69 A;  3FFQ A;  2QTW B;  3WY6 A;  3EMR A;  2RM2 3;  2ZJC A;  3WDW A;  4YVW A;  3NV1 A;  5JMC A;  5FP7 A;  2HBU A;  4FOW A;  1W2T A;  4C91 A;  1TEI A;  2ZHK A;  1TVG A;  4CEW C;  1BVV A;  1Q8S A;  4LHL A;  2YU2 A;  2NMN A;  4QPW A;  5FZO B;  4QPI C;  2IXC A;  1ACC A;  2NYY A;  4M4R A;  4CP9 A;  5IVF A;  2OQ7 A;  4XBL A;  4YVS A;  3UKN A;  2HWE 1;  2TEP A;  2WWU A;  4PDW C;  4OQ9 A;  4NHY A;  4XUT A;  4EN9 B;  1RIN A;  2A75 A;  3OBA A;  4JKM A;  1V9U 3;  1H4H A;  2BFU S;  4MET A;  1CWP A;  3I3M A;  4OMD A;  1U5Z A;  3H7Y A;  3A22 A;  3MFC A;  2F17 A;  3POJ A;  5C9A C;  1GNY A;  2PHF A;  4J1X A;  1JYV A;  5ISL A;  3RZZ A;  1PX4 A;  4FFF A;  3BTY A;  4CPB D;  2UWC A;  1LHV A;  2JX9 A;  1RVF 2;  3AL5 A;  3B00 A;  1HX6 A;  5F5C A;  2ZMN A;  1MS8 A;  1EP0 A;  2D3R A;  1JZ7 A;  4BU2 A;  3HQU A;  4HPK A;  3LIH A;  2DVA A;  5FZ4 A;  2UWB A;  1DG6 A;  2JEC A;  2XML A;  3MHZ A;  5G04 L;  4IE7 A;  4QX2 A;  3HNY M;  1WCS A;  2ZGT A;  2FZ1 A;  1HRV 3;  3K75 B;  3HN3 A;  2QDR A;  3FLR A;  4XJU A;  3IZO A;  1QKQ A;  5EJ3 A;  2B46 X;  5LA2 A;  5KC5 A;  4XF1 A;  1ULG A;  1PO1 1;  5AVA A;  2GC3 A;  5G05 L;  2KM2 A;  2SBA A;  3NJZ A;  4L99 A;  2IXH A;  1KS4 A;  2D3P A;  2NMO A;  1W2N A;  4LBN A;  1ENR A;  2WC2 A;  2QQN A;  2EAK A;  5DAB A;  4O61 A;  3T4V A;  4PT6 A;  1CJD A;  2PHL A;  3N9M A;  4JV4 A;  4RS5 A;  1WCU A;  1W39 A;  2WBK A;  1UIK A;  2DCY A;  2DU0 A;  2VG9 A;  5A33 A;  2D6N A;  4K8R B;  1UIJ A;  1W6P B;  1W6N B;  1ND3 C;  5J3U A;  1EAH 3;  4HET A;  1X8M A;  1NCQ B;  1O8S A;  3TN9 1;  2VXR A;  1G6N A;  3VBS A;  1VBD 1;  4XJA A;  2QZ3 A;  4FCA A;  4XF3 A;  5DDJ 2;  3WF3 A;  3VL9 A;  3ZSM A;  1DQ0 A;  2J1R A;  3KGZ A;  4NE9 A;  2WNV C;  4ZXK A;  1RUF 3;  5FCC A;  2HH9 A;  1NA1 B;  3HWJ A;  5JMO A;  4UAP A;  1Z7S 1;  5J7M A;  4QGM A;  4BOW A;  3OY8 A;  1OF3 A;  1CAW A;  4YRD A;  3OUI A;  1S1A A;  2XDV A;  4N8M A;  3NNM A;  3ZFG C;  2RS1 1;  2XH6 A;  1MEC 3;  2XJR A;  2PTM A;  2P3Y A;  2ZX0 A;  2CDO A;  2VGD A;  1OLM E;  3UV9 A;  2V5D A;  3NV2 A;  1HRI 2;  4UBH A;  1BK0 A;  1KXG A;  3RVH A;  3H8X A;  1IKQ A;  5LZ6 A;  2JG9 A;  1NZC A;  4Z8B A;  2YV8 A;  1YQ5 A;  2RJK A;  4K21 A;  3KQ4 B;  1PGS A;  3O12 A;  3VKM A;  2HEW F;  2P6H A;  3CBN A;  5CKM A;  3A21 A;  4WM8 A;  3GBF A;  4LIT A;  4G9S B;  3ACF A;  3DEM A;  4RR3 C;  1UCX A;  3NWK A;  3DYO A;  4JDO A;  5EXO A;  5FP9 A;  5BNP B;  2P3I A;  1OA4 A;  1ZZ7 A;  3VZM A;  3N4M A;  2Y6L A;  3LOB A;  3PUI A;  4QB6 A;  5FYY A;  5JI7 A;  2VUA A;  1QJU 2;  2PHU A;  3OPT A;  4ET7 A;  3WSO A;  5IAX A;  3ACG A;  1PVC 3;  1QNY A;  1PGW 1;  1RUD 3;  5HV0 A;  3ZMO A;  3E5X A;  4OI1 A;  1LEC A;  3FL7 A;  4N43 A;  2VZV A;  1HN0 A;  1W8F A;  1QJX 1;  2VTX A;  2GH2 A;  3IT8 A;  4YVS C;  1LTE A;  5I0S A;  2JJ6 A;  1YXW A;  4Q4V 2;  5IHR A;  2G9Z A;  5J09 A;  1DQ5 A;  4UBG A;  3VBF A;  3RZJ A;  3VBO A;  4EWD A;  4BLI A;  4OHX A;  1PIV 1;  1I9R A;  4Q0S A;  3BIE A;  2C9K A;  1W3V A;  3VGI A;  2WAA A;  2OZ6 A;  4GMP 3;  2DYC A;  3B02 A;  3RSJ A;  2JB8 A;  4PBO A;  1OD3 A;  1Y9Q A;  3RGB A;  4XQ4 A;  4LE4 A;  2GAL A;  5ACA 1;  3ENR A;  2CAU A;  5JXG A;  3TNQ A;  1MS0 A;  2YBK A;  4B7K A;  4QQH A;  3OG2 A;  1SG3 A;  5GJ6 A;  4ISR A;  4XFG A;  1IOA A;  3MYX A;  1FX5 A;  1OSG A;  4JGY A;  3WQ7 A;  2YB7 A;  4XTP A;  5HCF A;  1DYP A;  1WD4 A;  3PL0 A;  5I93 A;  1X7N A;  3A4U A;  3VB9 A;  3KVB A;  1VAV A;  3HQR A;  5GZD A;  3JB8 A;  5DUV A;  1GWL A;  2EAA A;  2OVU A;  2R07 3;  2XKP A;  2VXJ A;  1SCS A;  5K0U A;  4ASK A;  5A32 A;  5JPM B;  4Q4W 3;  4C1X A;  3AVR A;  1AJK A;  4RS5 C;  2BPA 2;  1UU5 A;  4FFI A;  3HD8 B;  3O1T A;  1Q8V A;  1ZNP A;  2E7A A;  3S57 A;  4CZS A;  2VOT A;  1C3H A;  1F5J A;  5APA A;  1D4M 1;  5C3R A;  3VD5 A;  1D7P M;  4AXO A;  4DPN A;  2YYO A;  3FUQ A;  1WW5 A;  1NLR A;  2GNM A;  5FMO L;  3VDD B;  3VBS C;  1LR5 A;  3ZO0 B;  4RFR B;  1A34 A;  1RHI 2;  2VBD A;  4LUL A;  1EUT A;  3OJB A;  1ZX5 A;  3USU A;  1LED A;  3PJY A;  1N1V A;  1AX2 A;  1Q8O A;  2I07 B;  3ZSE A;  3GBW A;  3LPF A;  1DGL A;  5J96 B;  3FHI B;  5C4W A;  3U0Z A;  4GH4 A;  4JDN A;  4YG6 A;  4XJ8 A;  1PGL 2;  1RUE 1;  5JR2 A;  3EXU A;  4P9G A;  4B4Q A;  1O7F A;  1Y3T A;  4O9E A;  5AVP A;  4IQP A;  4X6Q B;  1SLA A;  3CIH A;  4IEO A;  4NUB A;  3JBG 1;  4RA0 A;  3QH7 A;  5FY8 A;  1M4W A;  1Y7B A;  4MG2 A;  3Q9O A;  3AX4 A;  3HR9 A;  1G86 A;  3IB3 A;  3VUO A;  4KI5 M;  4LBQ D;  1JZ8 A;  2VNV A;  1RB8 G;  2JG9 C;  1ZZB A;  4A6S A;  5D21 A;  2QQM A;  3Q8F A;  2Y6J A;  5FZC A;  5KHH A;  3VZL A;  5HBA A;  3BTZ A;  3HBZ A;  1HLC A;  1VBA 1;  2W52 A;  2VZ3 A;  4WM8 C;  4ZU5 A;  2VPV A;  2NM1 A;  2HYX A;  4OUE A;  5A7S A;  3WCS A;  4EN7 B;  2GP3 A;  2VTX J;  3LSD A;  3DV8 A;  4IV1 C;  1C8M 1;  2WQ8 A;  3WX5 A;  1W6O B;  3BN6 A;  4BE3 A;  4IGQ A;  4UW5 A;  3ILF A;  4YPJ A;  5FR3 A;  4QQP A;  1YFX A;  1RUC 2;  4BYY A;  5LBF A;  1AYM 3;  1OKQ A;  1SFP A;  2GH8 A;  2P37 A;  2XQR A;  1H2N A;  1HV1 A;  2K2S A;  3GZU C;  4N43 C;  1AUY A;  3ACI A;  1C1L A;  2ARB A;  4FPC A;  2P34 A;  3AYD A;  2W9X A;  4C8D A;  1GP6 A;  4RSU A;  5JSR A;  2Z79 A;  4ERO A;  1XJA A;  4JGZ A;  1QJY 2;  1SDD B;  3HBK A;  4LIV A;  1UMZ A;  2Y6G A;  4JZR A;  2PHX A;  4N7U A;  2PAK A;  3CF6 E;  5FZE A;  1VBD 2;  5J98 B;  3VBO C;  4Q2F A;  5CFC B;  5B4N A;  4CUB A;  1BBT 3;  2WFF 3;  1MS9 A;  2VCC A;  3VZN A;  5HPO A;  5FZM A;  4EZ4 A;  4KGQ A;  1ZA4 A;  1ULE A;  2RDR A;  5A6X A;  1DQ2 A;  4CE8 A;  1HQW A;  3LA2 A;  3NNL A;  3AL6 A;  4BQX A;  2IFR A;  4PLM A;  4LNV A;  1Z7S 2;  4RYD A;  4O65 A;  1UKG A;  3GGL A;  1S2E A;  4X8P A;  5FLJ A;  3T0B A;  4P9L A;  3TOJ A;  5I0R A;  4GZ9 A;  1ULP A;  4QU2 A;  1MQT A;  3THD A;  5K9Y A;  3CL1 A;  4Q29 A;  2D5F A;  1C5H A;  2J1T A;  2HWD 3;  5LA0 A;  1JN2 P;  4ZZ5 A;  1KGY A;  4LR4 A;  1DYO A;  1Y9G A;  1N3O A;  4Q8L A;  1N3P A;  1ODM A;  2CWS A;  2Y60 A;  4GB3 1;  2XB6 C;  3NJY A;  4QD2 A;  4IDZ A;  4MXW A;  1JXN A;  3CZU A;  1UZZ A;  5FYC A;  4BXF A;  3MIB A;  2N7G A;  2CYF A;  3GDB A;  4FXK B;  4UI9 L;  5DZF A;  5JXH A;  3J8F 3;  5K0U C;  3WNP A;  2JIG A;  3AYA A;  4LLO A;  1AX1 A;  2FDK A;  2VCB A;  4ATE A;  5FZL A;  3OCP A;  5C3O A;  1GSL A;  5CU1 A;  4XFH A;  3U4X A;  4N53 B;  3OEA A;  1QQP 3;  3CJI A;  3POE A;  3ZSJ A;  4A7Z A;  2Y34 A;  1S0B A;  4COV A;  3WW4 A;  2AR6 A;  5FKB A;  3WP3 A;  3JD7 1;  3V0B B;  2Y26 A;  1PGW 2;  4MUV A;  2X5I B;  2QQU A;  4CUG A;  4YSF A;  1F4H A;  3T09 A;  4NRM A;  1LB2 A;  1YJL A;  3B3Q E;  4FPG A;  1QJX 2;  1OKO A;  1BEV 2;  2VBP A;  1AR6 3;  3KT1 A;  5HI0 A;  1VBB 1;  2B7Y A;  4LHS A;  4RL7 A;  1AR8 2;  3BOW A;  3DYM A;  3PVO A;  4GAL A;  5C4W C;  5EFU A;  1N1T A;  1SLB A;  1RUI 2;  1EYB A;  2WSV A;  5C8W A;  5ANQ A;  3NNG A;  3JU9 A;  4HOO A;  3H0O A;  2YU1 A;  1PIV 2;  2WN3 A;  1GBG A;  3FZ3 A;  4D3W A;  4ZU7 A;  1LOF A;  1NG0 A;  5J1X A;  1JYT A;  4YM1 A;  3H3U A;  2WNE A;  1YI9 A;  5T5O A;  1RJ8 A;  4Q0P A;  3RMX A;  1XXN A;  5FYZ A;  3WCR A;  3JQX A;  3RZK A;  4RHV 1;  1YLL A;  3CJX A;  2H0V A;  2WSU A;  3AKR A;  2HYK A;  2R04 2;  1K5M A;  5CFD C;  2QNK A;  3CDZ B;  4P9Y A;  1H9P A;  4DOU A;  4BK4 A;  3AZV A;  1IQD C;  2TNF A;  1NCR B;  3E6B A;  2RV9 A;  4CPB A;  3K77 A;  3AVS A;  2XBO 3;  2IXL A;  4WVW A;  1W03 A;  3FHQ A;  1PM4 A;  2Z5W A;  3C7G A;  2CSG A;  1X9T A;  2GDF A;  1WW4 A;  1E5S A;  2RM2 1;  2AUY A;  1BZW A;  2XKO A;  3QBQ A;  3I3D A;  4BB3 A;  1JS9 A;  4CEY B;  1CZS A;  2VOW A;  3PUS A;  2LUW A;  1FAY A;  3LCP A;  3R05 A;  3ZXK A;  4IEX A;  2VNO A;  3FE5 A;  1OC1 A;  1E5I A;  1Q5O A;  3MFA A;  1LHN A;  2BZD A;  2VR4 A;  4OHV A;  1J1T A;  3O14 A;  4ITC A;  5E6H A;  3TWI A;  3VKF C;  2IVJ A;  5C33 A;  5LA9 A;  3GM8 A;  2Q8D A;  3DL3 A;  1OA2 A;  1D4M 2;  1R09 3;  4C0B A;  3QD6 A;  4JGZ C;  4CDQ B;  5HCH A;  2G9F A;  2PQS A;  4JKK A;  4GKY A;  3SH5 A;  3ZN6 A;  3VZO A;  1H4G A;  1B35 A;  3DKQ A;  3NQH A;  5FUP A;  2A3X A;  1VMF A;  3III A;  4L8Q A;  5IVY A;  1OI6 A;  1WLT A;  4B1L A;  4B8E A;  5KC6 A;  3KS7 A;  5JZG C;  3BI3 A;  2XG3 A;  4ZZ8 A;  1QY4 A;  4KU8 A;  3SKJ E;  1FPN 3;  3HT1 A;  1HJF A;  1VAL A;  1JBC A;  1ASJ 3;  4ONU A;  1GQP A;  3WG4 A;  2DU1 A;  4C0H A;  5A70 A;  3O1M A;  1W04 A;  3H7J A;  1C8N A;  4OUL A;  3G6J B;  2Q8C A;  4AWD A;  1CPM A;  2VUJ A;  2Y6F A;  4LK7 A;  3U4S A;  4PBP A;  2E33 A;  1HRV 1;  2V5Y A;  2ZAC A;  1DFQ A;  1MQT C;  1WD3 A;  2WZR 3;  5A7W B;  5DAV A;  2UY9 A;  2YG0 A;  1QH7 A;  3JBG 2;  3GJA A;  1AYN 2;  3UL2 A;  3E6C C;  1VBC 1;  1VIW B;  2VZS A;  2XXZ A;  5FZ6 A;  4YGB A;  2VVD A;  3DCQ A;  3QAC A;  5JOY A;  4QXH A;  1EY2 A;  3NRU A;  2R49 A;  2BW8 A;  4J1W A;  5ERL A;  2ZGR A;  1UYX A;  3GAL A;  2RDN A;  4Z2W A;  4C90 A;  2DWR A;  2TUN A;  2VAU A;  3IDB B;  3GYD A;  3QLQ A;  1TG7 A;  1WLC A;  2AYH A;  3OGV A;  4BDV B;  5LWB A;  2R7E B;  3ZPY A;  1OQD A;  1CJP A;  5F3E A;  4YZ2 A;  5HCA A;  4P14 A;  1L3J A;  3AYE A;  3MIE A;  2YRO A;  2NPI A;  5E89 A;  4M3C A;  1XNT A;  4Z07 A;  3H8R A;  1EAH 1;  1ND2 A;  5JDB A;  3T1L A;  1SPP A;  4YZ5 A;  1RUH 3;  3JZV A;  4QM8 A;  3FWE A;  1VR3 A;  5L7O B;  1AVB A;  3BU7 A;  1YJK A;  1SLL A;  4JHZ A;  1XE0 A;  4YW3 A;  3OUJ A;  4AED A;  4AVV A;  5FK7 A;  2J7M A;  2QQL A;  4XTM A;  1RUF 1;  1NY7 1;  3VD3 A;  1A6C A;  1JOD A;  4IGP A;  1L7R A;  2D3S A;  3VKN A;  3V0A A;  4UWD A;  1OH3 A;  1RUG 3;  2ZGL A;  5T54 A;  4LBM A;  4BIF A;  3WZ1 A;  3LWC A;  5T50 A;  4S2G A;  4IEV A;  4SBV A;  3OGJ A;  2PQQ A;  1QOT A;  3VHP A;  1F15 A;  5LBB A;  1US2 A;  1LOF C;  1R1A 3;  4S2H A;  4KWJ A;  2HJI A;  1VAM A;  4XYX A;  5LRR A;  3BOD A;  1DGR A;  3FFZ A;  1EUU A;  1F8V A;  1RUJ 2;  4P02 B;  5CKN A;  2VVE A;  3KV5 A;  1AHS A;  3UGF A;  1O8P A;  1QDC A;  4I0W B;  4QHO A;  4Y3O A;  4FTE A;  3ZKY A;  4A2U A;  1GOG A;  3K3O A;  1K5M C;  3NAP B;  2W08 A;  3OGS A;  4XJW A;  4PIY A;  5FQ0 A;  3V64 A;  4BQ5 A;  3B9I A;  4LT5 A;  1AR9 2;  3RS6 A;  1G9A A;  5CZK A;  4FTS A;  2ZAA A;  1ZZ9 A;  4AVT A;  2JDY A;  4BZ4 A;  4YFZ A;  2RHP A;  1WKY A;  5E8A A;  5C70 A;  2FDI A;  1PHM A;  1OUX A;  4HVQ A;  4FPH A;  2BJS A;  2IXJ A;  2VUL A;  1SAC A;  4JQR A;  2BVV A;  2VQA A;  4JHT A;  5DUX A;  2MEV 3;  3LEG A;  3ZXG A;  4AFB A;  1PVC 1;  1RUD 1;  3AM2 A;  3ELN A;  2MNG A;  5T5L A;  3WF2 A;  2WUH A;  3N3H A;  2DUO A;  4PF1 A;  1RGS A;  5F7U A;  3SMH A;  5FZB A;  5LW9 A;  2JIC A;  2YGL A;  3KLS A;  1VMH A;  3SXW A;  1QEX A;  2CL2 A;  3VD7 A;  5FZG A;  3CEW A;  3ZSK A;  3A0N A;  2Y6H A;  3MEP A;  4A6O A;  4OCT A;  4LO8 A;  4ASL A;  4KNC A;  4CDX B;  4F83 A;  1ENS A;  1RMU 2;  2ATF A;  1OMI A;  1B35 C;  4K7J A;  1AL2 1;  5FYU A;  4GMP 1;  1UZY A;  3ECQ A;  4ORF A;  1JZ5 A;  1KDM A;  1NCQ C;  5FP4 A;  1N47 A;  3R4D B;  3MLJ A;  5IFT A;  1FNY A;  1W8O A;  5FPB A;  1OLQ A;  4IE0 A;  5C71 A;  5CNA A;  4K9S A;  5FPL A;  1JZ2 A;  4KH9 A;  1EV1 3;  2J1A A;  2JD9 A;  3LF7 A;  5C9A A;  3MPB A;  1JOJ A;  4RGA A;  5M0T A;  1FI2 A;  4NR1 A;  2JDN A;  1RED A;  2VMF A;  4IEW A;  2HWB 3;  3RDI A;  1H1A A;  4RHV 2;  1YYN A;  2XQX A;  4LKE A;  1Z78 A;  3SEE A;  3K48 A;  2ZGQ A;  5FZA A;  2JG8 A;  1NX9 A;  3OEB A;  4PF5 A;  2ILM A;  2PLV 1;  1WW7 A;  4QGN A;  3DPR B;  4OMC A;  4YW7 A;  3GCW A;  1S2B A;  2QE3 A;  4Q4W 1;  3UK9 A;  3P3P A;  1TNF A;  2G1M A;  1CAV B;  4DIN B;  1JZ4 A;  5D2A A;  3VLB B;  4A44 A;  1TME 1;  3T0A A;  2O0O A;  1DGW X;  4MLO A;  5FYT A;  1JYC A;  1JU4 A;  1OVS A;  2RS3 3;  1UOJ A;  4AVB A;  4CCE A;  3UKT A;  1ND2 C;  1TMF 3;  4ZY9 A;  3K51 A;  5AFE A;  4L9B A;  1ZBA 1;  3LE0 A;  3AP9 A;  4YZ4 A;  5I0U A;  1UOG A;  5T52 A;  1C5I A;  4TSV A;  5KR7 A;  2XJS A;  1AF9 A;  3KSC A;  3I3B A;  3BCW A;  3DXU A;  5DG2 A;  2Q1M A;  4MHR A;  2RS5 3;  1B09 A;  4XF0 A;  3NJX A;  5BUV A;  3ZFF A;  4NWV A;  2VD7 A;  2ADD A;  2R06 3;  4O7X A;  5F3C A;  4QX8 A;  4LA3 A;  3POS A;  1YQ8 A;  3AP7 A;  3F95 A;  1FOD 3;  4QQO A;  4FPE A;  2R1B A;  4DY3 A;  3RZG A;  4OI2 A;  3X29 B;  1L7Q A;  5LRS A;  1SLC A;  3EO6 A;  2FDF A;  5JOZ A;  1W3X A;  3PDQ A;  1I5Z A;  1UD1 A;  2BRT A;  3D3A A;  4WM7 B;  3WV6 A;  4J25 A;  3ROU A;  5JIU A;  5JSO A;  1WBL A;  4IV3 A;  2VW0 A;  3R0R A;  4EE2 A;  1BKZ A;  1OH4 A;  4R8H A;  3MUY 1;  2W47 A;  1HQN A;  4O9G A;  4XCA A;  1W90 A;  3AP5 A;  1QWR A;  2NQY A;  4ZON A;  3ZDS A;  4G3Y C;  2G4I A;  3AKQ A;  1LOE A;  4U2A A;  2HWC 3;  5EWS A;  5A3W A;  2BOI A;  4CDU A;  1CGP A;  3I59 A;  1VBC 2;  1LUL A;  4Y22 A;  1SEF A;  4I02 A;  1GQG A;  4Q4Y 2;  4E9K A;  1KJR A;  2BNO A;  2W5F A;  4QM9 A;  3C7F A;  3HT2 A;  5FRE A;  4BIS A;  4XF4 A;  4ASM B;  4DMI A;  1NAE A;  1MS1 A;  3CHX A;  2W39 A;  4MGK E;  5DPN A;  4UW4 A;  3I2H A;  2FDG A;  2PN5 A;  3WP6 A;  1PK6 B;  2DUQ A;  4AHW A;  1AYM 1;  2ID4 A;  3E6D A;  4B29 A;  5JOX A;  2XPJ A;  2J1U A;  2WA4 A;  3B93 A;  3M70 A;  3SLI A;  2AH2 A;  1EAH 2;  1LHW A;  3BPZ A;  3N9O A;  3OPW A;  5DQ0 A;  1DQ1 A;  3GZT B;  1YIF A;  2VMC A;  1GFF 2;  4BK5 A;  2WN2 A;  3PJQ A;  3RI9 A;  1BBT 1;  2WFF 1;  1S0J A;  1GQH A;  1VRH 3;  1W8T A;  4H14 A;  1COV 3;  2HWF 1;  2JIJ A;  2VZQ A;  1C28 A;  4QQ2 A;  2WZP P;  4WVV A;  5A3L A;  1R08 3;  2BEO A;  5FXX A;  3TYJ A;  4Z2A A;  1XOY A;  4D94 A;  5C8C B;  3RMY A;  1CQ9 A;  2ET1 A;  1YFU A;  4XVH A;  2AZ5 A;  4S2D A;  4CCN A;  2WO3 A;  2BWC A;  3KD4 A;  4BMB A;  2LRO A;  1ZBE 3;  1XE7 A;  1XYO A;  5EP9 A;  3VBH A;  3WDX A;  1MVQ A;  2OKX A;  2G19 A;  2JDZ A;  3IMM A;  1VBE 1;  2JKX A;  2HWD 1;  2Q1F A;  3N7J A;  1Q43 A;  3AKS A;  4KMQ A;  2QCS B;  2JEM A;  3UT0 A;  2CNA A;  4X8N A;  3AYC A;  5A7N A;  4I01 A;  5DUW A;  2WO2 A;  2DTW A;  1D4V B;  3M7A A;  3W9A A;  2ZKN A;  2JG8 C;  4GXL A;  3LEI A;  3OBR A;  3WF4 A;  5CAZ A;  3J8F 1;  4HLT A;  4NHM A;  5F37 A;  4EYU A;  4TZD A;  3VBR B;  1JUI A;  4W4Z A;  2WAO A;  5JAX A;  4QKD A;  2ZAB A;  2AAC A;  3DUI A;  2VOX A;  1QQP 1;  5FY7 A;  5HCB A;  4TYS A;  4XUN A;  4Y1Y A;  3RWK X;  1W8H A;  2WNU A;  3POW A;  1PO2 2;  1W6Q A;  1W2U A;  1RUD 2;  1FMD 3;  3QH6 A;  4GAZ A;  4XDO A;  4LBJ A;  1C57 A;  1G8W A;  2EF6 A;  2FQP A;  1GWM A;  2GNB A;  3ME2 A;  4D69 A;  3T0D A;  1VPH A;  4CTE A;  3SC7 X;  1HXS 3;  3FLT A;  4K1Z A;  4Q1R A;  3S30 A;  4QDQ A;  3M3C A;  4D7Y A;  1BLZ A;  3AK0 A;  3ZFF C;  3E5Q A;  4F3J A;  2YGM A;  3AZX A;  2BNM A;  3PTR B;  5EV7 A;  3PME A;  4CYD A;  3J7M A;  1UYY A;  3P1I A;  4H2A A;  5GKA C;  4CDW A;  5I0D A;  1AL2 2;  3NL1 A;  1DZR A;  5IVB A;  2VZ1 A;  5JXJ A;  4NII A;  2XR4 A;  4MGI E;  1ZRE A;  1V6J A;  3WP4 A;  5FJH A;  4A42 A;  2WNO A;  4IV3 C;  4KL1 A;  4D8M A;  4EJR A;  4PJY A;  4RQP B;  1H6X A;  2MHF A;  5CVR A;  1Q56 A;  3IDA A;  5LEJ A;  4TLG A;  1HN1 A;  1PMJ X;  1QJF A;  4JAA A;  1W06 A;  3VDB A;  3PVE A;  3S7E A;  3QCW A;  3U75 A;  1OUS A;  5BNN B;  1ULC A;  3KQR A;  3MIG A;  1RTV A;  5D8A B;  4CDU C;  3SH4 A;  4BIO A;  4E4H A;  4QX1 A;  1Q3E A;  2UUR A;  1CAX A;  5CIR A;  1OT5 A;  2Y0O A;  4QKB A;  1JH5 A;  1POV 3;  2UU8 A;  5E16 A;  1CX1 A;  2PLV 2;  4AI0 A;  2QFE A;  4YLZ A;  5IVJ A;  2IZW A;  4Q4W 2;  2FDJ A;  5FXW A;  5FOJ B;  4ARX A;  3MV0 1;  2WS9 2;  2A73 B;  4LBK A;  1YFW A;  3LQC A;  2KD7 A;  1TME 2;  4ZS3 A;  2A6Z A;  2H6C A;  3GCX A;  2JD4 A;  2EXH A;  4IV1 A;  1TZO A;  3LA7 A;  1H8T B;  3VBU A;  3ZXD A;  1R09 1;  2WYF A;  2NP0 A;  5LK7 B;  4EQV A;  5CBL A;  5FYB A;  4QKN A;  1RVF 3;  1ZBA 2;  3AP6 A;  1AXZ A;  1N1S A;  2YPD A;  2ZBJ A;  4QB2 A;  3WDY A;  2XHN A;  5JXI A;  1UAI A;  4L92 A;  4QDS A;  4N53 C;  4V2W A;  2XLG A;  3RYP A;  4YW2 A;  3ZYB A;  2XJT A;  3VL8 A;  5BNO B;  4QX0 A;  2C4X A;  2RMU 2;  4AI9 A;  4GIQ A;  4HSJ A;  4Y20 A;  1LOC A;  3URF A;  1FPN 1;  5EHD A;  3MIF A;  1ASJ 1;  4Y1U A;  2ZGS A;  1WWY A;  1O4Z A;  3PUH A;  4AK3 A;  3ABZ A;  1BXH A;  3VBH C;  1W99 A;  2GAU A;  4LO6 B;  5IK8 A;  2WZR 1;  2D43 A;  3LD8 A;  4MZU A;  4AGG A;  4HN1 A;  1PNF A;  5JLV A;  2QZ2 A;  4BQ3 A;  1IQA A;  1ZA7 A;  3KWV A;  3SCF A;  3GZE A;  4QPG B;  5L9V A;  1V6M A;  4D6Q A;  4C1W A;  3KZ4 C;  4GA9 A;  4IEP A;  1QNW A;  1JW6 A;  2YC0 A;  2BER A;  4I09 A;  5F3G A;  3VHN A;  2B8M A;  5FO8 B;  4GWM A;  2FHR A;  3LIG A;  4KWL A;  1G9D A;  5FZH A;  4UT5 A;  1ZRC A;  4D7T A;  2GN3 A;  1DGR N;  1XSQ A;  2XLF A;  4MSV A;  2ETE A;  2YPJ A;  1OQE A;  1OBN A;  4QXC A;  3BIW E;  3N9P A;  3T2O A;  1ZRR A;  3WHT A;  2WLQ A;  2WNU C;  4GD4 A;  4Q5O A;  2DVF A;  5JR7 B;  1DDL A;  1RUH 1;  1AYM 2;  1TQ5 A;  5FP8 A;  3VN4 A;  2E51 A;  4RD7 A;  4XCB A;  1GIC A;  1LEN A;  1N3Q A;  2PMW B;  3IDC B;  2G9G A;  3IPV A;  2IXK A;  4A45 A;  5F6K A;  3AXD A;  2EXK A;  1OUR A;  3LFM A;  5FAX A;  3WDU A;  3ZYJ B;  1VB4 A;  2BUK A;  1RUG 1;  4JC1 A;  3FBM A;  5FWE A;  1UX6 A;  2E7Q A;  3F2Z A;  5KXC A;  1PZ7 A;  2E63 A;  3BPS A;  5FK8 A;  2JDA A;  1HB2 A;  2AGS A;  2QKD A;  5A3M A;  5GLZ A;  1QMJ A;  3ORJ A;  1R1A 1;  4D0Q A;  4DFS A;  4E27 A;  4CDW C;  2HWF 2;  2YBP A;  3L2H A;  5IVE A;  5BY5 A;  1HRI 3;  3MIC A;  2HWE 2;  1UZV A;  2KR2 A;  2YC2 A;  4UFM A;  4CXX A;  2BGC A;  2A6V A;  4Y4Y A;  1IHM A;  3V56 A; 
#chains in the Genus database with same CATH homology
 1POQ A;  1PM4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...