1POQA

Solution structure of a superantigen from yersinia pseudotuberculosis
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
118
structure length
118
Chain Sequence
RIPNIATYTGTIQGKGEVCIIGNKEGKTRGGELYAVLHSTNVNADMTLILLRNVGGNGWGEIKRNDIDKPLKYEDYYTSGLSWIWKIKNNSSETSNYSLDATVHDDKEDSDVLTKCPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords YPM
publication title Crystal and Solution Structures of a Superantigen from Yersinia pseudotuberculosis Reveal a Jelly-Roll Fold.
pubmed doi rcsb
source organism Yersinia pseudotuberculosis
molecule tags Immune system
total genus 14
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2003-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09144 YpM Yersinia pseudo-tuberculosis mitogen
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.510 Mainly Beta Sandwich Jelly Rolls Mitogen Ypm 1poqA00
1POQA 1PM4A
chains in the Genus database with same CATH superfamily
5CNAA 4JGYA 4N7IA 4AI9A 3GJAA 3VL8A 3D82A 1K5MC 2JKXA 2XHKA 1UU5A 2I2SA 4FPCA 2GC3A 4IV3A 3SISA 3O1UA 4NIIA 2JWPA 3EQEA 2ZKLA 5FR3A 1NLQA 1WLWA 2ZPXA 2B39A 3TNPB 1FMD2 1PHMA 4Q4V1 2JB8A 5BNPB 2WL1A 2WC2A 2UWCA 4O7XA 1D2QA 1HQWA 2BFUL 4MLOA 2WFF1 5C4WC 3ZFFB 4C91A 4JGZB 5KBFA 3B3QE 3EJKA 1ZBE3 1AX2A 1CGPA 4DQAA 1NLRA 3WCRA 3RYKA 3ZXAC 1ASJ2 1W8ZA 4PQ9A 4B1LA 4RHV2 2UYBA 4DMIA 3RWNA 2WQ8A 3VBFB 3RZKA 1SPPA 1FX5A 4QDSA 1AX1A 5IFPA 1VRH1 2XVGA 3N36A 1N47A 2WYFA 2DCYA 5KHJA 5JSOA 3MPBA 4LA2A 4M4PA 4DEVA 5L7OC 1VBC1 2R16A 4QX8A 3OGSA 1ZRFA 4HK8A 2WQ4A 4KG8A 2JDNA 3JQWA 4MV2A 2W52A 1TME2 2VW2A 2JIGA 3FE5A 4EROA 3UV9A 4PJYA 4AG4A 2JJ6A 2YROA 1RVF1 3M7AA 1H9PA 4M0NA 2WS92 3ACFA 4UYBA 2WZPP 1DQ6A 4B4RA 4EWEA 2WNOA 1UY2A 2J1TA 1JYXA 2UU8A 4XHXA 4FPGA 4LUKA 1EY2A 4O9GA 5D8AC 4ZY9A 4B4QA 4DY5A 5JUVA 3QH6A 4GMP3 3AP4A 3PTYA 4K21A 3U4XA 4JGYC 4LK6A 1CAXB 4LO4B 4CSWA 3RZGA 3IDEA 5EV7A 3AKTA 4FOYA 2IC1A 4A42A 1DYOA 3OCPA 1UX7A 1W2UA 1QQP1 1TMF1 1IQDC 3IN9A 4M4RA 1YIFA 1S0FA 2RS51 4JCKA 3VD4A 2DWRA 4LHNA 1VPHA 4CRQA 1CN1A 1GP6A 4PIXA 4OULA 3AZWA 2D43A 3GZAA 1OLRA 3AL6A 3H1MA 1NOVA 5BUVA 3ACGA 1NA1A 1F35A 4MGTA 4Y1YA 1FPN2 1IPJA 2A7AA 3M3EA 3THDA 5JSRA 1UXXX 2E33A 2AREA 4HFSA 5HBAA 1VB2A 3RZLA 2ILMA 1FYUA 3H8RA 1DP0A 4LORA 4CU6A 4HKOA 2FMDA 1POQA 1APNA 1UXZA 2VUCA 3CDZB 3QOPA 4AF9A 1HV1A 2HEWF 4BXSV 1A6CA 1REEA 2VUJA 5IT6A 5JDBA 5L19A 4S2DA 2QQWA 3VGIA 3INAA 1ZRCA 2WO7A 1NCRA 4JV4A 1LJ7A 2XOMA 2FCUA 1H2LA 3OGVA 4V2VA 4DB5A 5FCCA 4YVSC 2R49A 4M3CA 2Y6LA 3ZYPA 4GH4A 4YW3A 5T50A 3AZVA 4LO5B 2A3YA 3KGZA 3M4FA 3BTZA 2P37A 4NJ4A 2MEV1 5E16A 4BQ1A 1BQPA 2GZWA 2VBBA 5HCHA 4LPLA 1JS9A 1AL22 1JYNA 3ITQA 5F2SA 4Q4X2 3NV3A 4RR3C 4Y5TA 5FZ4A 3MLKA 2BNMA 2VMEA 3KD4A 4MUVA 5FK7A 5A7PA 4KWUA 2HBTA 3WG3A 3NJXA 4X6RB 5BPXA 4D7TA 5F6LB 1WGPA 2VQTA 1YQ2A 3S7EA 3RQ0A 2LRPA 5GLUA 5JR2A 4AW7A 1NA1C 1R1A2 1LOGA 5C9AB 4NIHA 1O59A 3ZM8A 5FPVA 2XJVA 1ZREA 4LXLA 2B4KA 4Q8KA 2ZX0A 3VD5A 5FYHA 1UKGA 3M3QA 4HLTA 4RS5B 3THCA 3DN7A 5FWJA 3LWCA 4DUXA 2VNGA 2Y6GA 1URXA 1VIWB 1LOFC 3D8CA 1Y9MA 2GDFA 4XF9A 1H2NA 3O1SA 2VCCA 3LDRA 1T6BX 3T2PA 4IEOA 3TOJA 1OQ1A 3E1F1 1VBA2 1ENSA 1ASJ3 3GALA 4RHV3 4A4AA 2R1DA 1W2TA 5K7PA 3WW2A 4FFFA 1T2XA 3NNMA 4FSJA 1YC61 5I8SA 3RNSA 1NCRC 4CCNA 5C6CA 4XZUG 1GZWA 2VMCA 4QQHA 2EVXA 1CJPA 4XVHA 4Y22A 1W9YA 2EICA 5CKMA 3WNOA 3ZYRA 4DUWA 4ZZ5A 2JENA 4K3UA 3VZKA 4DXRA 1A8DA 5FO7B 4B4PA 4KMQA 2J1EA 2P6HA 2P5BA 2ARCA 4GA9A 2YY1A 1TME3 1Q8PA 2ARXA 1XNKA 2GMEA 3MGUA 4FTBA 4B7KA 1H8VA 3DF0A 4URTA 1MEC1 2WSVA 1D4M1 5DZEA 1ULFA 2Q1FA 1D7PM 2A6YA 2WS93 4QKNA 5FYYA 3RI8A 1GBGA 4CU7A 1V70A 2Z2SB 4FPEA 1YHFA 5JXJA 1CVNA 1R1ZA 2PAKA 4WM7B 4D6SA 5CU1A 3IWZA 3T0DA 1C1FA 2EXHA 4FOQA 2WWUA 1HDKA 1G9AA 2DVDA 4RL7A 4CCDA 5FDBA 1QOOA 3AVRA 3ZO0B 5IAXA 4FFHA 4W6WA 2EIBA 2ZOEB 4PLMA 2VCAA 4Q4V2 3OPWA 3A23A 3AJZA 2OQ7A 4H7MA 5I0TA 2WFF2 1ND2B 3VL9A 2ZCWA 2I07B 4CDXA 1ONAA 5FLIA 3E5XA 3VD7A 5BY5A 2DU0A 5SV8A 3T4HB 4W50A 2PHDA 5B4NA 3PUIA 1F31A 2C9AA 2ZBJA 4FP3A 1FPN3 3KCCA 4XQWA 3WQ7A 5A1AA 1SZBA 5CA6A 5CYYA 1VRH2 4GQ7A 3AYAA 3I59B 3KQRA 5IK8A 1V00A 2AENA 2ZTNA 1ND3A 1VBC2 3K3OA 5FZLA 4I30A 5F9TA 5DAXA 1MS8A 1SBEA 4XTMA 1RUOA 2Y6KA 4YARA 4XFHA 2QNKA 1NCQB 4A6OA 1QF3A 4ZZ8A 3CZJA 1UZYA 1BKZA 2JE7A 1RVF2 1S4CA 3AFKA 4Q4W1 1DZRA 4XILA 5H9QA 2OA2A 3ZFGA 4GWJA 1R091 1QIQA 2HEVF 3H0OA 4LBKA 1X33A 1XNTA 4K20A 4EN6B 2VZUA 1JMUB 1QJFA 2PMWB 3J26N 4XEZA 5A7SA 4C90A 2Q4SA 2VVDA 1HRI1 5BV6A 1POV3 2EF6A 3FC0A 5AFEA 1ZM1A 1QQP2 1TMF2 2IVIB 2D6PA 5FK8A 3VDDB 1C5HA 2EIEA 5EYYA 1X9TA 3LKJA 4OHXA 2RS52 1U5YA 1Y43B 2LTNA 4QDRA 1AL23 1YUDA 2PHUA 3SHRA 2VOKA 4Q4X3 1NAEA 3G7DA 3I2JA 1W6OB 1W0NA 1DBNA 1NE6A 2XDVA 4HKWA 4CDXC 4OHYA 5J36A 4Y1VA 5A7WA 3OUJA 3V56A 4CP0A 5GLWA 2AR6A 1R1A3 1I5ZA 4EZ4A 4E27A 2BVBA 2LS6A 3BU0A 1FT9A 1Q8SA 2OX0A 4B8EA 4Q2FA 3NNJA 2VMFA 3DPRB 4QXHA 3P6BA 4XFGA 3T0AA 5JXHA 4P9YA 3UKNA 3C7OA 4GWNA 2BOJA 4OZOA 4QDQA 2RJ2A 3NV4A 2UY8A 4IERA 3W5MA 2BWAA 2YHJA 3NAPA 2R6QA 5ERLA 2Y6JA 2NN8A 2A6VA 2IZWA 2PQQA 2QDRA 1VBA3 3ES1A 4NAOA 2B9UA 5JXIA 3R05A 1LOAA 3NWKA 4FXGB 1W6QA 4P9IA 2KD7A 4YZ1A 1H1AA 5FYCA 4DEQA 5LY1A 4J1XA 1CAWA 4HANA 5JVVA 2MNGA 4QKDA 2MEV2 3MI8A 2W08A 3KMHA 3DECA 1GNHA 4PLNA 2Y34A 2E26A 4FTSA 2R0HA 3POFA 3LF7A 4AQTA 1OH3A 3VBOA 2C1FA 3LSDA 2ZGTA 3L2YA 2E31A 1DGWX 2EXJA 4COZA 1MQTC 1JZ2A 1GQPA 1O8SA 2A71A 3CMGA 4LBLA 2JXAA 4LMFA 5FZKA 5EFUA 2XVKA 1ZZ9A 1RC6A 1AHSA 1AYN3 3PU8A 4YZ4A 5DN2A 5FZ1A 4Z8BA 4QX5A 5LW9A 4QMAA 4WVMA 4Q4V3 2CV6A 1UZVA 2RJKA 3BPSA 5SV5A 3EB7A 2DVGA 2VJXA 4L99A 4HVOA 1D0GA 3ZN5A 2ARBA 4G4FA 4MHUA 4AVTA 5ABJB 4AI1A 3IDBB 4IE0A 3U14A 3VBRC 1JYCA 3U4SA 4XMAA 5A6XA 1XU2A 3C7EA 1GOHA 2VOVA 3AP6A 1I9RA 2Q1MA 1JU3A 1OUSA 3KT4A 1LOEA 4YM0A 1Q8QA 3B94A 2WO1A 5FQ0B 1IPSA 4CA9A 2CNAA 5FZHA 4CDWB 1Q56A 3C2UA 4GB31 1SBFA 3MUZ1 4GD4A 1VBC3 1J83A 3IB3A 4Q0SA 5DMYA 3NKTA 3QBQA 3NJZA 4QKFA 4UF0B 2XJRA 5DABA 4DFSA 1O6UA 4UW4A 1MPXA 1RUI1 4HZFA 3RYRA 2V4VA 2RR11 3K2OA 3RMYA 2HH9A 3SCGA 4DXSA 3MHZA 4P5HA 3WF0A 1MEC2 2ZGPA 4UFHA 3ZFFA 1RVF3 1D4M2 4JGZA 1FV2A 4OQ8A 2EXKA 3VBOC 4GMP0 4LA3A 1UY3A 4ZONA 2ADEA 3RJRA 4EE2A 5JZGB 3AXEA 5CKQA 3KZ4C 5DQ0A 2HWD1 3VBFA 3DXUA 4HVRA 4CE8A 2DF7A 2ZGLA 3ZIWA 3OEBA 3VBSC 4Y1XA 1QNYA 4ZU5A 1CR7A 3PUAA 4XW3A 3QCWA 4AI8A 1AYM1 1QQP3 1TMF3 2RJLA 3AP9A 3RSJA 4OQ9A 2CTVA 4XC9A 2ZEWA 4HBNA 2RS53 2Y0OA 5C8CA 3NMBA 1GU3A 3ELNA 3N3HA 4O9EA 4AHXA 3M8LA 5J96B 1KDKA 2NLRA 1YQ8A 1F5JA 4YZ2A 4AEMA 2OT7A 4HN1A 1AJKA 5K0UB 2FZ2A 2DCTA 4AVVA 1GZ9A 5FMOS 3MZHA 1YYNA 4TLFA 2W39A 3PDQA 1CAXA 1AX0A 3H8UA 1W0PA 2VU9A 3Q8CA 2PLV3 3PNAA 4KWLA 5A3NA 3JU9A 3ZR6A 1KS4A 4YYOA 3FFZA 4TWTA 5LK5A 4QPIB 2D6LX 3IIIA 4COUA 1G9DA 1D2SA 1GSLA 4Q4W2 3QLQA 5FYZA 3ZDVA 3ZYFA 1DF0A 4J6GA 1R092 4IEWA 3ZFFC 4DRRA 4CYDA 3AKRA 4QPGB 4A45A 1AR81 4XHBA 2ORXA 1CIYA 1HRI2 2RMU1 2XB6C 4W65A 3KGLA 5EIYB 4Z07A 3VBFC 2ZABA 1QJEA 4JRAA 1RUC1 2FQPA 4KL1A 1OF3A 2XJSA 4TSVA 2WO2A 5F8PA 1EP0A 4XFAA 3H8OA 1LTEA 4QX3A 3MFAA 4YW4A 4Q0VA 4XPVA 3QD6A 3DXTA 2JE9A 1TZOA 1YRZA 2ATFA 5C8CC 2ES3A 2XL9A 4FBFA 1GYKA 2A6XA 3POWA 1LKNA 3U11A 1WMDA 4OI0A 2YGLA 1S2BA 1AXYA 3AP5A 4QU1A 3OBAA 4ZS2A 1WWYA 3WQ1A 1OD3A 1BVP1 5CZKA 5G04L 2YFUA 3W5NA 4YW6A 3VB9A 1SLTA 1GKBA 1JYWA 4O65A 1MZ6A 1LU1A 4JKKA 2CGOA 5C3SA 3A22A 3ZKUA 1STMA 2EIGA 2RDRA 4LR4A 2XG3A 3MF9A 3OPZA 1OKOA 1N1SA 2BNNA 4Q0UA 3B5LB 3WG4A 2C5DA 2VMGA 1LGBA 4D6QA 5I91A 5IVVA 3LA3A 2VW1A 5JR7B 2YPDA 5LBEA 4N90A 4I0AA 4P14A 4AVCA 5FY9A 3VDAA 5C9AA 2ZEXA 2RDSA 2V72A 3K48A 3RZHA 3CEWA 1AZDA 3ZMOA 2J1SA 1RJ7A 1XBFA 4P9WA 1H2MA 4JAAA 2IFRA 4RS5A 4LHLA 4WV8A 3T09A 2E63A 5I0UA 2P4EA 4DXTA 2E32A 5FREA 1UIKA 4GZ9A 1MEC3 5GM0A 4BQYA 5EWSA 1PX3A 2PQSA 1D4M3 3B69A 1B35B 5C5TA 4FPJA 2HWE1 5EJZB 2W1QA 4LE4A 1KDMA 3KV5A 4QHZA 2DCZA 5FPLA 1RIRA 4Q29A 3FHIB 3K4DA 3J7HA 1XNAA 3M3CA 4XFFA 2B5HA 4Y4YA 1AF9A 1DQ1A 4XABA 3G6JB 5T5LA 4BWOA 1SQ4A 1U12A 3N9LA 5FY0A 1UIJA 5H9RA 2TUNA 2Z79A 3KT1A 3WEZA 1LODA 1NKGA 4GALA 4D7SA 2PHRA 1WW4A 1XE8A 3DKQA 1QDOA 4H14A 3ZN4A 4BMEA 4LLOA 4EN0A 3GJBA 2XQRA 4CXYA 1KGYA 3FUOA 4XF1A 3KLSA 2EAAA 1HB1A 3ZXFA 4XIKA 4PCRA 2RS11 5LA9A 2BW8A 3OYWB 3WNXA 4WM7A 1PO21 1DLCA 1HIXA 1VAKA 4GJZA 4AEKA 1QXPA 4GB32 5DZFA 5JIAA 4IE4A 2Y38A 5JMCA 5C9AC 2PHFA 1RUI2 3LE0A 3PVBB 4JHZA 4LOTA 1NLSA 4QX0A 2RR12 4MYEA 4ZS3A 4CPBD 2FBEA 3LEIA 1XU1A 1YFYA 3CJIB 4RS5C 4YW7A 4AE2A 2VNVA 1ND2A 4OI1A 2NM1A 3H8XA 3OTFA 4Q4W3 4UI9L 4AGVA 1LHOA 3ZXEA 3RJ2X 1R093 2VO5A 3ACIA 4BLJA 2UURA 3IDCB 3MIDA 2VVFA 5CKNA 1YO8A 4QPYA 1GQHA 2HWD2 4YVWB 2QQJA 1S0GA 3WP6A 3A4UA 1POV0 1W39A 5CVRA 4IGOA 4HMZA 1HRI3 1E5HA 2RDNA 3I59A 2PHTA 2LUWA 2WUHA 4I3PA 1AYM2 4Q4Y1 1KRIA 3POBA 5HV0A 3GGLA 1OBNA 3ZFEB 3TBDA 4H7LA 3VHOA 1NCQA 1WCSA 3UETA 4F83A 2UWBA 1IHMA 4UOJA 1I5PA 4JTOA 5E6HA 5FXVA 2RHPA 4XYXA 4W8JA 5J48A 3HAGA 2Q8CA 2FCTA 4N53B 3TWIA 4AQ2A 1S2EA 2GSYA 1H4GA 2ZMNA 5E88A 3VKLA 4WM7C 4LKSA 4W4ZA 4JTNA 1OHFA 4QWNA 3VLBB 1BMV1 4AZZA 5FOJB 5AC91 2Y0IA 3VDDA 1ZZ8A 3HQUA 2WR9A 4KI5M 3ZYJB 3P3PA 1OC1A 1C3HA 3WP5A 5IATA 4BA6A 1GOFA 3AMNA 1C57A 4IV1B 2C9KA 3IMMA 4YGEA 1MZEA 2OYZA 2QFEA 1QGLA 1ND2C 1W6OA 3AMQA 4LULA 3M1HA 1KQRA 4EN8B 2GNTA 3HQRA 3OGJA 3F2ZA 4K40A 4LHSA 1OFNA 2GAUA 1AR82 4I02A 4NN0A 4D94A 1FATA 1N1VA 1UCXA 1WMFA 2RMU2 3AMPA 3T2OA 3WP3A 3NW4A 3WSOA 1DGRN 1F15A 4YG0A 5KHKA 5FMOL 1JUIA 2RDQA 1RUC2 2JICA 1YIPA 3I8TA 1PK6A 3N7MA 4WVVA 5FKBA 3T2TA 4X6QB 5JI9A 1IG0A 1S0EA 1ZZ6A 2E6VA 3DPRA 2GMPA 3LCPA 1BXHA 4IEXA 1XB9A 2VG9A 3HPNA 4CDUC 3O1RA 3WF4A 3ZPOA 4B7EA 3UKVA 4TYSA 3WDTA 2VTXJ 4RD7A 1PGW1 2UWAA 1VMHA 5FXXA 2P17A 1U0AA 2CDPA 2YBSA 4NE9A 1HB3A 3WDVA 1SFPA 1K3IA 2R061 3UYJA 5EXOA 5FZIA 4AI2A 4ARXA 2VZQA 3AB0A 3VBHB 1S0JA 2P1BA 2H6CA 4WZCA 2PAEA 4NIDA 4XBNA 2D6NA 1CJDA 1PZ8A 4CCMA 1W8FA 1EV11 3I2DA 4EN9B 1UY4A 4YFWA 3WQ0A 1AL0G 3KCYA 3L2HA 4DINB 5DG2A 1KFXL 5H9SA 3NKGA 1MS5A 1H1MA 4QX2A 3AMMA 3NQHA 4RYDA 4XIOA 3VDDC 4CP2A 3SXWA 1BJQA 2P3YA 3AYDA 4FOVA 1J1LA 4AGGA 1YQCA 1MS0A 3R0RA 1NXD1 4HPKB 4IQPA 4YLZA 1XSRA 2ZMLA 2C26A 4LBQD 5FIXA 5J3UA 5FY8A 2JDKA 5IUQA 1A78A 2E51A 3SH5A 1EAH1 2A73B 3T0BA 4HSJA 4AFDA 4FI9A 3CO2A 4FFGA 2ZHKA 3I2FA 4GB33 4PBOA 2VGDA 4XFIA 3I3QA 4P9JA 5F5IA 1OURA 4JZRA 1PK6C 5A3PA 1RUI3 4IW3A 1H6YA 4OI2A 2VL4A 3AM2A 3CKHA 3GBFA 3DPRC 4MX3A 1OA4A 5EYXA 2X05A 5K4LA 1RUG1 4OVEA 2HWE2 2ETEA 4IV3C 5D21A 4KG0A 4P08A 3EBRA 4FP2A 2ZGNA 4UFLA 5FYIA 3E6BA 5ABJA 5JMOA 2ZAHA 4EN7B 3LEMA 2HWD3 4CCJA 4FCAA 3WG2A 4UFJA 3ABZA 1NQDA 5FQ0A 4OMCA 4XACA 4CDWA 3CBNA 1G6NA 1AYM3 2OPWA 1W6MB 1DIWA 2DCJA 1H8TA 1OLME 3MW4A 2EXIA 3D0SA 4UF0A 4AOCA 3GDBA 1OFSA 4ORFA 5HI0A 1JZ3A 5J37A 2GN7A 4CDQB 1XNBA 4KBZA 3FJSA 3T4VA 2QQOA 3AFGA 1PVXA 3J7LA 5FFOC 2YU1A 4R52A 4K6BA 2RS12 2ZZJA 1WUVA 2D97A 2A3WA 2CHHA 1REDA 3I54A 1IKQA 4XBLA 4MVTA 1PO22 5IW0A 3W21A 5CG9A 3ZSLA 2AEZA 4DOUA 2PXJA 4XCAA 4C1WA 1KITA 4D69A 3UJQA 3MBWA 5FXZA 3SEEA 3ON7A 3O1MA 2YC4A 4B3NA 1L7QA 1RUF1 2V09A 2XXZA 1CZVA 2PAMA 4L9BA 4IDZA 2FCVA 4P9GA 5IJRA 1XRUA 3HMYA 4H55A 3ZYHA 1NX9A 4F7ZA 5A33B 3BI3A 5J98B 2B9VA 2BBVA 3S7IA 4ZXKA 4NWVA 4CP9A 5FZ7A 4I3GA 1HJFA 3B01A 1RB8G 4C0HA 3BPZA 3THPA 4Q1PA 2X8KA 1W6PB 4BIOA 3PUHA 2WT0A 4XOGA 5K0UA 3WY6A 1OPMA 1AR83 1LNSA 1WKYA 2IXJA 3DUIA 1S1AA 2HYXA 1DGWA 2OPKA 2RMU3 3M2MA 1DQ0A 3IZOA 4NHXA 4M0HA 4Q4Y2 4HVQA 4NPMA 2YC0A 2UYAA 5FOBB 3O1VA 1QXJA 2QQLA 4OMDA 3WVJA 1AJOA 3ZSJA 1ZBA1 4CDWC 3FMGA 3HR9A 3ACLA 5FLJA 1UQXA 4P9LA 1H8TC 2W3JA 5GZDA 3RVHA 1NUKA 3WP4A 5C5UA 1Y4WA 1RHI1 3CF6E 4OFGA 1JU4A 3AC0A 4YGBA 3E97A 3PHMA 3LDBA 3I2HA 1FMD3 1OVPA 3C3VA 3W59A 4DIQA 2ZGKA 4Z2AA 2VOXA 3PU3A 4QPGA 2BU9A 2BV4A 3KSCA 5FY4A 5F5AA 1D4VB 1YJKA 4Y3OA 3U07A 4YGDA 3WG1A 2B8MA 3NVCA 1BMV2 1C8M1 3KB5A 2ORZA 2QQKA 4SLIA 4AFAA 5AC92 3MIFA 3JB8A 1UMHA 2C24A 5TSWA 1OPOA 1SEFA 1UPIA 2YB7A 3VKMA 1VLNA 2DV9A 4AVBA 1Z7S1 2CYFA 1OUXA 2DVFA 1OT5A 4GH4C 1UMZA 2VNOA 1UX6A 3RI9A 4FQ4A 3I49A 3HNMA 3BVCA 5A32A 2DFBA 2JG9B 2J1AA 1V6OA 2JG8B 3IPVB 4I0BA 4QPWA 5K0UC 1WCQA 4QXCA 3VDBA 1OKQA 5KHGA 5FY5A 1X8EA 3D0JA 1Y9QA 2WNUB 5FZDA 3SC7X 3M3IA 3WW4A 4ET7A 4NRQA 4MGQA 4FPHA 4E2SA 2BGPA 3HD8B 1EPWA 5FYVA 3ZN6B 1PGW2 5JSPA 2ZJCA 4D8MA 4NAMA 4CXWA 2R062 4GWMA 1SFNA 1RMU1 2K2SA 4I09A 1NXMA 2HWF1 4CUGA 2QTWB 3FHQA 4QB6A 3WDYA 3ATGA 2I74A 1EV12 3FX3A 2GU9A 3WUCA 4BDVB 3POJA 2DTWA 4GKYA 2XQXA 3GF6A 3LIGA 1DGRA 3JD71 1UN1A 5HCFA 1WW5A 4BQ3A 3KHCA 1DG6A 2EIDA 2A70A 1REFA 5T5PA 5C3PA 2KA3A 2FDFA 1GQGA 1W8OA 4MH0E 1E5RA 3B7MA 1B35A 3RZMA 1CQ9A 2PHWA 1O5UA 4RA0A 1K45A 2RS13 2OUHA 4QQ2A 3U37A 1Z78A 2WA3A 5FLHA 1OMIA 1EAH2 1PO23 3JCIA 5IK7A 4BB3A 3ZSMA 2F17A 1SFYA 3VZMA 2XPJA 2R071 4Y20B 4CUAA 2B42B 4FT8A 3KVBA 4LBOA 3QH7A 3ORJA 4XJWA 4NHKA 3POIA 2XGXA 5FZMA 1RUG2 4NHMA 2VECA 3D5OA 1FNZA 1K5MB 3OBRA 5DZGA 2QQNA 3AMHA 4S2FA 1PZ7A 5FTTC 4NUBA 5K8SA 4OI4A 3OYWA 4D0QA 5C8WA 1EPZA 5A7OA 3E6CC 4EWDA 1NE4A 3NNLA 5C4WB 3ALQA 2DURA 1JHJA 2ZGQA 3TN91 1LCLA 5A6QA 2W92A 3OBTA 2D93A 4JC1A 2VQAA 3OF1A 4BQ5A 4L97A 5FMBA 3OOXA 3WOGA 4N8MA 4XFCA 4AWDA 2Y6FA 3K46A 2VMHA 2YV8A 5I0RA 2O8OA 1W2OA 1RUD1 2QJVA 3CJIA 2IWGB 5A3LA 2WLPA 4ONUA 3GBWA 2ZEZA 4Y26A 5CFDB 4XAEA 1GP5A 1ND3C 3N9QA 4CU8A 2VXRA 2VZVA 3ZR5A 1DQ5A 2DUQA 5IK4A 3O5SA 3GZUC 4OHVA 1O5LA 4N9IA 5BYNA 3MF6A 1FNYA 3APBA 5FZ9A 5FBJA 4CXXA 4EWAA 3IT8A 3MW3A 3PVOA 5DG1A 1GANA 1RUF2 3ZFGC 5JXGA 5AC93 2C0ZA 4HG6B 3VHNA 5FZFA 4UXAA 3ZFEA 3MICA 5GZFA 1ENQA 1FOD1 5D8AB 5F2WA 1LEMA 1ZA4A 3ZYBA 5FP9A 1RUE1 3HVDA 4BYYA 5IVCA 4FPYA 4OUSA 1ACCA 3AX4A 4K1ZA 1BEV1 2WAOA 2WKKA 4CCEA 1DYPA 1O91A 5FUNA 4N53A 5IAVA 5CISA 5LA1A 4XXAA 1SLBA 1V9U1 1QJX1 4M01A 1C8NA 2J1UA 3PVNA 4Y5Z0 3IM0A 2HWC1 2VC9A 1E57A 1X9PA 1PO11 1ULOA 2D3RA 1RXGA 3JBG1 5A6ZA 2FDIA 1ZYBA 4MSVA 5FAXA 3ZLIA 3LOBA 1XQNA 2KM2A 3MIGA 1ULDA 1JYVA 1WA6X 3MW2A 1DQ2A 4BU2A 3GXUA 5LBFA 1QWRA 1H0BA 2CDOA 3MIHA 4YRDA 4IV1A 1RHI2 1QOTA 2V73A 1JXNA 1JODA 3CJIC 5F3CA 3T3YA 1O3RA 1JOJA 1UOBA 3WQBA 3EYPA 1M4WA 2WFF3 1K12A 5L9VA 1ZZ7A 2BUKA 2VTXA 4E4DX 1GP4A 2DTYA 3NAPC 4ASLA 1EV13 1C8M2 5IK5A 5FKCA 2BVVA 3LAGA 1V6KA 4XE9A 3CNAA 3KWVA 4D7YA 3PL0A 2SLIA 3WT3A 1ZBE1 1VRH3 4J25A 3SNMA 4QAWA 4BZ4A 4AK3A 1Z7S2 2VZ1A 1AVBA 5CBLA 4YVSB 3IAPA 1RL3A 3WUDA 4CEWB 1EUTA 5FP7A 2D5FA 4QGNA 1W8TA 5GLZA 5JIUA 2TBVA 5BNPA 3ILNA 1EAH3 4G3YC 4QB2A 5E89A 3VBHA 4KH9A 2WWSA 4N53C 4S2GA 2Q8DA 5BXXA 3WDWA 2NYYA 3N4MA 1PGL1 4RR3B 4K7JA 4NRPA 2QQIA 4Q26A 3WX5A 3NRUA 2GH8A 1Q8OA 4CEYB 1I1EA 2WQZC 3MLJA 2JD4A 2WZ8A 4HT1T 4Q27A 4L11A 1PGSA 3ZXGA 5CFCB 1RUG3 3ZXDA 5FRAA 1IOAA 4IGQA 4AVAA 1JZ5A 1H6XA 1RMU2 2VXJA 3I7DA 4HPKA 4PBPA 4NMIA 2HWF2 5DAVA 2W2IA 4A7ZA 3POEA 3WHUA 3LPGA 3IIAA 1WLTA 2HEYF 1CD3G 3ZXJA 3MV01 2NMOA 2W94A 5F37A 2JEMA 5FZAA 4B1MA 2VW0A 4J1WA 4AVSA 3JD72 3F95A 4AEJA 1V6NA 4KGGA 1LAJA 4PIYA 3W20A 2KR2A 2ZX3A 2WSUA 1I6XA 1NT0A 2WLQA 3TRSB 3H50A 1J58A 3Q9OA 2GALA 2X10A 3AKQA 3P5BA 3WCSA 4EQVA 5T5JA 2W87A 2DCKA 1V0AA 4YGCA 5FUPA 4A2UA 1E5IA 4A7KA 1T6GC 3H3UA 2VE1A 1FXZA 1LR5A 1ZNPA 2BP6A 1NYWA 4H2AA 5IYYA 4GJYA 3ZSKA 2FDJA 4EZHA 1SMVA 5BNPC 3FLRA 2P3KA 3KM5A 4XJ8A 1AR71 5AFBA 5FP4A 3VBHC 1JZ4A 5AVPA 3N9PA 4JGZC 2R072 4V1PA 2HBUA 1RUF3 5F3GA 1X36A 2ZX2A 1W6MA 1FAYA 2CAUA 3KQ4B 2WBKA 2XJTA 3BIWE 1G9FA 3T2QA 1W04A 1WCKA 2XLAA 3R6SA 1D0HA 3SITA 4UBHA 1TVGA 1QMJA 1TEIA 1W8NA 3K3NA 2IXIA 4GULA 3C7GA 2OZ6A 4FPFA 3WW3A 4CDQA 2Q8OA 3T1MA 5JPNB 4FTEA 2A1XA 2MEV3 3LFIA 3EO6A 1WMXA 4Q1RA 5A80A 2YBKA 2VBPA 1BBT1 1EUUA 2DUOA 3AKPA 4HONA 3L9JT 4MG2A 1GV9A 2UY9A 1W8HA 3HEIA 3TN92 2ZGRA 4IEZA 2GC1A 3ZYIB 2VQUA 5L36A 1LULA 3BU7A 4LBNA 4LBQB 4UFIA 4TN7A 1VBD1 4BISA 4E4SA 5ISLA 3VZOA 5A33A 1RUD2 4Q8LA 4JDNA 4AAXA 4Z1VA 1YEWA 3V0BB 4KWJA 1OVSA 1SHWB 1SLAA 3ZOIA 3HN1A 1YI7A 5K9YA 3UESA 2CY6A 5EQUA 1MR5A 4UWDA 5F32A 2J22A 1QEXA 1YLLA 1W6PA 4ZKTB 3J7MA 1CX1A 5LK7B 4HKLA 2FDGA 3DV8A 3RZZA 2YXSA 2R7EB 5KC6A 2MPFA 1RUJ1 1UU4A 1S55A 2B7YA 5J09A 1C8M3 1J3PA 2WZEA 5FZ3A 5FPUA 4K9SA 5D2AA 4AXOA 2JKBA 1Q5OA 2RS31 1XSQA 2R041 1FOD2 3OD4A 1G7YA 5LCWL 3VKOA 2JDYA 1SCSA 1LHVA 1WLDA 2ERFA 4YM1A 5C3QA 1RUE2 1Z7S3 5FP3A 4LOSA 2W47A 1W3XA 4CTEA 3O7OA 1BEV2 4UW5A 2JDAA 3D6EA 1V9U2 1VBE1 2GC0A 1QJX2 2QZ3A 3S5QA 5APAA 1W6NB 2OS2A 4GWIA 2MHFA 1IPKA 2HWC2 2P6CA 5FWEA 3QACA 2XJUA 1PO12 2Z69A 3C8XA 5BNQA 3JBG2 3ZYGA 3AL5A 4C8DA 4KNCA 5DUWA 5LBBA 2EA7A 1TQ5A 5A70A 4JKLA 4KQ7A 4PF5A 3ECQA 3J9SA 3CU7A 4R9CA 5LEKA 1PMIA 2CAVA 3HOBA 3KV4A 1LOBA 1YWKA 1RUH1 1VMFA 4M3CF 1GWLA 4L92A 3VBUB 1UO9A 2BWCA 2JECA 3JZVA 4N9HA 3WF2A 5JAXA 3WD5A 4HOOA 4WBBA 3FFQA 1ZRIA 1SG3A 2JDZA 4XURA 2JG9A 4URAA 4QD2A 2JB4A 3FHAA 1YQ5A 4NHYA 1CESA 1H4HA 4C0BA 2JG8A 3IPVA 4OYUA 2V5DA 2NZ9A 3UT0A 2JDMA 4ZPIA 1IS4A 4ES8A 3EXUA 3C7FA 1SCRA 4YW2A 2GMMA 1QXRA 2WNUA 3JD73 1RINA 1ZBE2 4IE5A 4XJAA 1XXNA 3ZDSA 2Q8EA 3N7JA 4M3CE 4E2QA 3CHXA 2ID4A 1W06A 2VMDA 4K1YA 3ROUA 1QNWA 4MGKE 2Q1ZB 1TE1B 3ZN6A 3RRDA 1KFUL 4ZHNA 4BMBA 5EHDA 1PX4A 1MS3A 3AVSA 1N1TA 4I01A 1XYPA 1L7RA 3UK9A 4Z2WA 4TLGA 1DZQA 3H7YA 3TYJA 2ZACA 1O8PA 1WA4A 3PVEA 1QY4A 3W58A 3WV6A 4FPKA 4QHBA 4JHTA 4OZXA 1PGL2 2R073 5A1LA 2E7AA 2ZGOA 4LE3A 1CPNA 4QQLA 2W1UA 2E7TA 1HQLA 1G9BA 3ZX7A 1MQTB 3WXPA 5C3OA 4XBQA 2JX9A 3JUUA 4NHLA 2G9GA 2IXLA 2HLEA 1HB2A 2RE9A 2SBAA 1WD3A 3RPQA 1UPSA 3H9AA 5F3EA 4YZ5A 3UKTA 5L9BA 5FZCA 1POV1 3OGGA 4TZDA 4FQZA 2ET7A 2VULA 3ETQA 2ZA9A 1MVEA 4S2HA 3WZ1A 4G9SB 3TN93 2QQPA 3HQXA 2JG8C 1A34A 1ODMA 1W9SA 2X09A 4Y20A 1UL9A 4BLIA 2FHRA 3VBRB 2BEOA 4D6RA 1N3QA 2WNVB 2WNUC 2E9QA 4GKXA 1GUIA 1ZA7A 1H2KA 3BTXA 1VBB1 2D6OX 1K5MA 1ULPA 5FXWA 3LA7A 3ETPA 3N9OA 5LB6A 1QJU1 3GCXA 1AXZA 2ZKNA 4LKEA 3GHNA 5LWBA 2ZS6B 4XQ4A 1SACA 2XJQA 1PIV1 2J42A 5KXCA 3TEWA 1AR72 1XE0A 3DYOA 1Y9GA 4PIZA 5C4WA 3OGRA 4QGMA 2VZPA 2XLGA 5A7QA 4E9KA 3OD0A 4D3WA 4MGYE 1UKRA 3U10A 1JOPA 1VRBA 2P2KA 5FMDA 1GLHA 1GNYA 3FZ3A 3S30A 1GOGA 1ZVFA 2WA4A 3KVAA 3S5AA 1S0DA 1RUE3 3N9MA 1UNBA 5FZ0A 3V0AB 4BE3A 2BOIA 1PM7A 3A0KA 4IEUA 5CFDA 3U75A 3VBSB 1BEV3 3Q8FA 2TEPA 3P3NA 1VE0A 1BBT2 5B4XA 1O3SA 1V9U3 1OXCA 1L7LA 4LITA 1HXS1 3WHTA 1NCQC 3J7NA 2YG0A 1R64A 3OY8B 2JIJA 1RGSA 5JOWA 3SQOA 1QHDA 1WD4A 2F4PA 2XWJB 1PO13 3LSEA 5DUXA 5KHHA 4F3JA 3HIFA 1AR61 3DGTA 3JBG3 1ST8A 3MIEA 5FMCA 3TB0A 5C71A 5EPAA 1IZ3A 2FD8A 1VBD2 4XJZA 4YG3A 1UOGA 2VUAA 4IE7A 1JH5A 4UFMA 3URFA 3WNPA 2OUJA 5D8AA 1VAVA 2X29A 4LUMA 1VJ2A 2VZSA 1G86A 2ZHMA 4Y33A 5FZOB 3NV1A 2CL2A 3BTYA 3S57A 3B9IA 3GZEA 5EJ3A 4IE6A 4LKFA 2FMYA 2BYVE 2W91A 5I93A 2W9XA 2JDPA 2W5FA 4FFIA 2VH9A 4HL0A 1AYN1 2VOWA 3K4ZA 3ZXLA 1N1YA 5IVFA 3LA2A 5EJ1B 1RUJ2 2GH2A 4XDQA 4MXVA 5KXBA 4ES9A 2G9FA 1BCXA 4MGZE 4ISQA 2RS32 2VCMA 2R042 2YPJA 2XL7A 1IS5A 1O4TA 4KU8A 1OQDA 4R4ZA 4YW5A 1CAUB 1V6JA 3OEAA 4DPNA 3I2IA 4AR2A 5BNOB 3O0XA 4AFBA 3E6DA 1DHKB 3GM8A 3O0VA 2RM21 1VR3A 3NV2A 2F4LA 4AI0A 2V4AA 1IKPA 3N35A 2G9ZA 4F8AA 3TAYA 2XWBB 4DO0A 2XKPA 1NG0A 1VBE2 1MS9A 2RR13 1V6IA 2CU5A 1XNCA 2WNEA 4L0PA 4R4XA 3MV11 4WM8B 3AKSA 5T52A 3AJYA 3IDAA 2WN2A 4JKMA 4CPBA 5JOZA 2Q0AA 4HN0A 4A3ZA 5FBZA 3ZXKA 5C8CB 1X82A 3W9AA 1OLQA 1W2NA 3K77A 1GFF2 4YZ3A 1SDWA 5A3TA 2A6ZA 2Y6HA 3AP7A 5L9RA 2VM9A 3UGGA 2KXLA 1PNFA 1RUH2 4BXFA 4I2OA 2WRAA 2DYCA 4YVSA 1J1TA 2A6WA 3LGRA 1HB4A 1PZ9A 5IWFA 4CEWA 3UL2A 3RGBA 4XUQA 5LATA 3HWJA 2VD7A 4LHKA 3KCXA 4RGKA 4OLLA 2DU1A 3CLPA 2GP5A 2VPVA 4XUPA 1W8WA 2JDHA 2HYKA 4JRLA 3WINE 5HXMA 2IXKA 4CUBA 3UJOA 3BB6A 4BPZA 4YM3A 1UY0A 4Q0PA 4RR3A 4RQPB 3O1TA 3ST7A 1XYNA 2WAAA 5JZGA 1HN1A 4CEYA 2IXHA 5A3OA 5IHRA 2O8QA 3WW1A 1YCIA 1BHGA 2Y33A 4ISRA 4P5YA 5FPAA 4MHRA 4E2GA 2VQ0A 1JYIA 5JWPA 4A7YA 1F8VA 1BK1A 4AFMA 4XF4A 1XPWA 5FZ6A 4Y1UA 4RFRB 3OUHA 3MYXA 1HX6A 5BNNB 1UAIA 3HN3A 4Y1ZA 2WYSA 4E4HA 2PYTA 2QQUA 1LOFA 4LBMA 1AR73 1WBLA 2NMNA 2Z42A 2PLV1 4XXPA 2EALA 4AI3A 5DUUA 4BQWA 1J84A 3H1WA 2XMLA 1UYXA 4PDWB 5D1IA 2D3SA 2W46A 3Q8EA 3R4DB 4PI0A 4AEDB 5ABJC 1SBDA 4IGPA 4JQRA 4CCOA 5C3RA 1H30A 3NJVA 1RJ8A 3FWEA 5GALA 5L73A 4XJ9A 5FJKA 2LW8A 3SKVA 1WMEA 2YYOA 1M06G 5FYTA 2HWB1 1RUC3 3JQXA 4ZXEA 2H0BA 2C6SA 4GIQA 2J1RA 4LNVA 4CCLA 2WZR1 1BK0A 3I3BA 1Q8VA 3SCFA 4CEWC 1BBT3 5FZEA 2QZ2A 2BNOA 4QPIA 1NZIA 3PUQA 1NQJA 1TNRA 3C7HA 3ENRA 3N7KA 2PA7A 2DFCA 2GN3A 2LM3A 4IEYA 3BUCA 1YNAA 2GNMA 1PVC1 3RG0A 4IEPA 1W9FA 4QKBA 2VR4A 2BQPA 4QXBA 4AQ6A 4HXCA 3MO4A 2IFWA 1LU2A 1VBD3 3TEYA 2D7FA 4YWAA 2ADDA 1W99A 3HNYM 5JZGC 4CEYC 4XMIA 3K4AA 1VBB2 2D40A 5DPNA 4PLOA 4MADA 4PF1A 1QJU2 3FL7A 4YSFA 1XYOA 1PIV2 3GYDA 3IBMA 3VV1A 3PJYA 5LY2A 4LEJA 4P00B 2XUMA 4ZU7A 4QQPA 3PURA 4RN5A 4AQSA 1RUJ3 1YQ6A 2W0XA 1ALYA 1UYPA 1B09A 2DBNA 3RFRA 1WW7A 1A3KA 5F7UA 3FN9A 3CJXA 4JVAA 2RV9A 4NR1A 2RS33 2R043 1BYHA 2QKDA 4NIGA 4LBQA 3T1LA 5IVJA 4LLFA 3O1OA 3V0BA 3LEKA 1QH6A 1QKQA 1QU0A 1ZX5A 1UMIA 3MIBA 5CG8A 4BQ2A 3AYEA 2ZGUA 4IXLA 1S0IA 1WW6A 2QUOA 2GNDA 1COV1 2YU2A 3CIHA 4FPOB 4OUEA 2V5YA 1VBE3 5HV4A 4MXWB 2AZ5A 1HXS2 1HRV1 4PI2A 4N43B 3A0NA 1LHWA 2A3XA 1FI2A 1X50A 4E8CA 5JCTA 2HWE3 4NPRA 1YXWA 1PMHX 1CAVB 1OOPB 2LROA 4QPIC 3RWKX 4AHYA 1AR62 3RYPA 5JOXA 3DYPA 4HETA 2PHXA 1DYKA 2TNFA 1WCDJ 1UU6A 3GNEA 5F5QA 4M00A 4IEVA 2YC2A 1UY1A 5KWRA 4QPGC 3U1XA 1AR91 3SH4A 3UGHA 2AUYA 1RUH3 5FPZA 3RMXA 4CCCA 4FPLA 2P34A 3OUIA 3B93A 3PMEA 5GLVA 1LESA 2BGCA 2CSGA 2YBPA 4LO8A 4COYA 1ZRDA 1VAMA 4U2AA 2X5IB 1AYN2 2J1VA 3ILFA 1SDDB 3ACHA 4YPJA 4CUCA 3LOIA 1W6NA 4DRVA 3I2OA 3J8F1 5LRRA 2D5HA 5ACA1 5GZCA 5LRSA 1LGCA 3PIGA 1LB2A 4TXWA 3DEMA 1H9WA 1N3PA 3BALA 3HT2A 3GBGA 3DKWA 1CWPA 3USUB 3H3LA 2G4IA 1XNDA 2RM22 2ZHNA 3VBUA 1AUYA 4Q0QA 2QQVA 1QOSA 4IL7A 5C70A 4H3WA 1A8MA 1L3JA 4AGRA 1O3TA 2PTMA 3NNGA 1Q43A 2JD9A 1DGLA 4FXKB 1DDLA 2ZGMA 3N7LA 4R9AA 4CDUB 1O7FA 1RITA 4BIFA 3LPFA 1R081 1EYBA 2JDUA 4OUMA 4QX1A 3LD8A 1VMJA 5E1RA 1HJGA 2IVJA 2BBAA 3TNQA 2NPIA 1IG3A 4JQTA 4A44A 3MPPG 3WNNA 5DAQA 3VZLA 4BK5A 5LASA 1UZWA 5LBCA 3I2GA 4Q4Y3 1Z0HA 4NROA 1W90A 2K0GA 3BCWA 2QBXA 3H7JA 1JOBA 3HT1A 2OKXA 2XBO1 3SEPA 1G8WA 1LECA 1OSGA 1S0BA 4IEQA 4MGSA 5CAZA 2XUEA 4MZUA 4XETA 5I8YA 2VZRA 5GLTA 4Q5OA 1Y7BA 1HKDA 1JHNA 2AEYA 4YW1A 2GP3A 1YFUA 3BIEA 3LDKA 3AK0A 5L7OB 4KGQA 5GZEA 1LHUA 2WABA 3B02A 3K75B 1B35C 2YMZA 3ME2A 3O14A 1UYZA 2J7MA 2W68A 4O61A 2XVLA 1Y3TA 5KXEA 2YDEA 2ZEYA 4YVWA 5CIRA 1JI6A 1DLLA 2ZGSA 3HJRA 4LK7A 1MQTA 3I3DA 3SMHA 4QX7A 4QM9A 5FYSA 2E7QA 3P1IA 1VBB3 3ILRA 4QU2A 1J3RA 2O14A 4XDOA 3WNLA 3VBUC 5G05L 1QJU3 1WBFA 1GZCA 3SCHA 4DZGA 4Y4RA 2RVAA 3T08A 4XTPA 1PIV3 4NWWA 1PK6B 1ZZBA 4A6SA 4OCTA 1OA2A 4V2WA 1IS6A 3WF1A 4JGYB 1LGNA 3SKJE 3ZMNA 5A3MA 2PLV2 5CEHA 1UW8A 5FO8B 1OLMA 1PM4A 1ODNA 1VB4A 4IV3B 4AHZA 3WLUA 4ATFA 3MFCA 5DDJ1 2JE8A 3POYA 1JZ6A 1QJY1 3J4UH 4RGAA 1JBCA 3VBRA 1GZTA 1MACA 1WLCA 4XF3A 2WNVA 4IETA 4COWA 3I3MA 3NO8A 4AAPA 3VD9A 2HWB2 3VHPA 2WZR2 1ZBA2 3PLQA 1O3QA 3NJYA 3BOPA 4R8HA 2W1WA 2WINB 4QT6A 3SLIA 3DL3A 3IKWA 4BM8A 3S0MA 2AC1A 2B45X 1HXS3 2VCBA 4LKDA 1J59A 4A3XA 1DU3D 4JDOA 1SPPB 3R4SA 3B00A 5JOYA 1PVC2 1AR63 2R063 3O12A 2R32A 4QQOA 4UFKA 3DYMA 1GNZA 1LRHA 5T3NA 2BDRA 1LEDA 4DNYA 1JZ8A 3U0ZA 3LFMA 2IXCA 4BCUA 2W95A 4E8DA 3KT7A 2H6BA 2Y8KA 4YVWC 4DXZA 4LO7A 5KC5A 3V0AA 3UGFA 2F6BA 3MUY1 3VBSA 1MS1A 2D44A 5FY1A 2D3PA 1W9TA 4WVWA 1S2KA 1UZZA 1XJAA 3ZFEC 2ZX4A 4L2NA 3HBKA 2WO3A 3OY8A 3V64A 4QGLA 5LZ6A 3GCWA 3KHBA 4JDMA 3ZVXA 1RYYA 3LZZA 1UYYA 5CFCA 2NP0A 5HPOA 3OBZA 4MOAA 4WZFA 1BZWA 2K46A 2CGNA 3KF5A 1JZ7A 3DCQA 3A21A 3AZYA 1CPMA 2R30A 1UOFA 4KU7A 4CU9A 1ULGA 1LOCA 5FJHA 1MZFA 4MGIE 2ENRA 2RM23 4TTGA 2Y60A 2WNVC 2BGOA 5FZOA 1YFWA 1COV2 3IAQA 3H3ZA 2GC2A 4K8RB 4XQDA 5F39A 4DS0A 2YGMA 1ENXA 1HRV2 2FDKA 1X8MA 4NOTA 1NA1B 3HBZA 1OH4A 3CL1A 1H8TB 2FZ1A 4X8PA 4XUOA 3VZJA 3R4UA 4GMP1 4IV1C 5I0DA 3BYWA 3OJBA 2LALA 3NSTA 3M70A 4PHZA 4FVVA 4AYUA 2ARAA 5A6YA 1K5JA 1SLCA 2AGSA 1CONA 1CAUA 1AR92 3FUQA 2OVUA 3POGA 5A1FA 5BNOA 2X53S 2DVBA 4PQQA 4RSUA 1XE7A 2ZXQA 5IFTA 4YM2A 4SBVA 5CFDC 1JUHA 2P3IA 5KHIA 4OHZA 3BKZA 1P8JA 4FAGA 5LEJA 3A7QA 4CP1A 4BH9A 4WM8A 4K8FA 1YI9A 3U78A 3ZSEA 4AFCA 1ULEA 3OPTA 1NCRB 4UW6A 2QE3A 2IUWA 3J8F2 5HXVA 4R9DA 4UBGA 5ACA2 1W03A 4Y5SA 3VZNA 4UAPA 1VP6A 1N3OA 4M3CB 1SLLA 3H42B 4FO9A 4GH4B 4BOWA 1YFXA 1DQ4A 4BQ4A 1VALA 3AXDA 3NL1A 2AH2A 1E5SA 5T54A 4CP9B 5CFCC 3UNPA 3BODA 2Z5WA 3IMNA 1IQAA 2A5ZA 4DUVA 1HV0A 1UWWA 1W05A 4P9XA 1OF4A 1O4ZA 3TEZA 2EAKA 4BK4A 2Q5TA 1RXFA 2B46X 3PTRB 5IVYA 1JN2P 4YNIA 1NY71 1US2A 5AVAA 4PT6A 2OXBA 4EJRA 3JB4C 4YG6A 3ZPYA 1KS5A 3WR0A 2ET1A 5M0TA 1C5IA 1R082 4JX0A 2ZAAA 2I45A 5JI7A 2DVAA 4DY3A 4RQPA 5FYMA 4A41A 5FYBA 4IESA 4LIUA 1XC6A 4NPLA 3VN4A 4ASKA 5IVBA 2VZOA 1JW6A 1O4YA 2DDUA 2BFUS 2H0VA 1KJLA 3E5QA 5ANQA 4ZU4A 2HWB3 3VHRA 4XFBA 4ARYA 5BNOC 2O1QA 2VZTA 2ZMKA 2WIIB 1MVQA 2XJPA 3I4IA 2WZR3 1ZBA3 2QVSB 2K9ZA 5CADA 3VDCA 2XBO2 3H1YA 4UT5A 5EP9A 5T5OA 4CZSA 5A3WA 3OB8A 4Z92B 1IS3A 1V6MA 1RTVA 5BNNA 2XR4A 1RHI3 5ANNA 5KR7A 4WM8C 5F1RA 1UF2C 5A7NA 2OZJA 1V6LA 2VTFA 3D4KA 4ITCA 1GZWB 1PVC3 2N7GA 1W8UA 4PDWA 3AZXA 4Y22B 2WWJA 4AEDA 4EV0A 3LB9A 3POSA 4R9BA 1UZ0A 3MLLA 2D6MA 2GNBA 1FMD1 5A32B 4AHWA 2R0FA 3VD3A 2ZHLA 1DFQA 4LO6B 2VMIA 4XUTA 3I3EA 5DUVA 1DCSA 3AZZA 1JTZX 4QXKA 4KBBA 5DAPA 5FZGA 1HQNA 1LENA 3EMRA 3I2KA 3S6PA 2XH6A 2XKOA 1U5XA 1W9WA 3T30A 1SLIA 1ZRRA 4I0WB 1ASJ1 1QDCA 1U5IA 4RHV1 3WDUA 3EHKA 4CDQC 1GMMA 2CWMA 2FDHA 5FPXA 2Q30A 5DDJ2 2DUPA 2VNRA 3B9CA 3USSA 1OQEA 4CVUA 1QJY2 5C33A 1GICA 3MEPA 1C1LA 1C28A 4RQPC 4C1XA 1G9CA 1ULCA 2YUEA 3FLPA 1CZTA 1TME1 4XZPA 3CQOA 3HNBM 3BTAA 1COV3 4CDXB 4XUNA 2Y64A 1PMJX 2WS91 1HN0A 2VY0A 2AACA 4NRMA 1HRV3 2HJIA 4GXLA 4QM8A 4YFZA 5LA0A 1GR3A 1TNFA 1AXKA 2WFPA 5BNNC 1KD7A 2BZDA 5FO9B 3FBMA 1RMU3 3N9NA 2P3JA 5FZBA 2BJSA 2HWF3 5FY7A 1ND3B 4AL9A 1BVVA 1CIWA 4RGGA 4PDWC 5J1XA 1AR93 3O0WA 1CX4A 4AEDC 4INDA 2AYHA 4BQXA 2OIIA 2OW4A 4LBJA 3RDIA 4Y24A 4B29A 5IVEA 4GAZA 1F2NA 4P02B 5J7MA 1OD5A 1ENRA 3FBYA 3ZFGB 1S0CA 2G19A 1W3VA 2QQMA 5HCBA 3VKFC 1UD1A 5FV3A 4MXWA 5GJ6A 1FV3A 4NO4A 1KJRA 4BJ0A 2VOTA 4N43A 2YZ4A 3LQCA 3VUOA 3J8F3 2BPA2 4WVZA 4FAHA 4ASMB 5ACA3 4NIAA 1FPN1 2Y26A 1CAVA 1OOPA 5H9PA 1OA3A 3OSDA 5FUIA 4MO3M 1MZ5A 4LIVA 2QDNA 3WNMA 1IGOA 2VBDA 3RZJA 3WDXA 3PIJA 3O1PA 2HKXA 3E5UA 1JYTA 5F5CA 2BTVC 3I97A 4EYUA 1WZXA 1QJZA 1LHNA 5GKAC 2X5IA 4HK9A 3MDPA 1UOJA 3GZTB 1XOYA 3K51A 4XJUA 4NVPA 4W6YA 5A7WB 3V65A 1W2AX 3WNKA 4OHWA 1R083 3PUSA 5DXDA 1CZSA 1HW5A 2WJSA 2XONA 1W28A 3BOWA 2BERA 4LTAA 5E8AA 2G1MA 2QCSB 2XHNA 1F4HA 2NQYA 2WDBA 4QB1A 5T55A 4BHPA 1X7NA 4META 3USUA 2DBIA 2JG9C 2VUDA 4W6XA 1K42A 2O0OA 2ZZQA 3PJQA 1YJLA 4IUGA 5EZWA 2BRTA 3ES4A 3NAPB 1AL21 2XBO3 2XLFA 1KEXA 4Q4X1 5GZGA 1HLCA 2WT2A 4X8NA 4N7UA 1WCUA 1RUD3 3ASIA 4XF0A 3RS6A 3KS7A 1TG7A 3D3AA 3BN6A 1OI6A 3BGAA 4XAAA 2D6KA 4CDUA 1GWMA 1W6QB 2OQ6A 4N43C 2VVEA 3VKNA 1ZZCA 1H1IA 3PMSA 4HSLA 1R1A1 2WT1A 1QH7A 5FYUA 1KXGA 3JXSA 1OOPC 1DZTA 5JLVA 2ZX1A 5I0SA 5I8TA 1CAWB 1W0OA 1GWKA 5FP8A 5CB7A 5DAWA 3KV9A 3KV6A 3ZIXA 3X29B 3TEXA 5LA2A 2W1SA 3FLTA 2E53A 2C4XA 4QHOA 3VBOB 1NY72 1FOD3 1VBA1 5C7GA 3CZUA 3GHMA 2CGPA 2X5IC 4FOWA 3NNFA 3SH3A 2L9LA 3WF3A 4LT5A 5F3IA 5B2GB 3Q8BA 1US3A 2CWSA 3OG2A 2PN5A 3Q8AA 3KF3A 5L7OA 2D98A 1I3HA 2VAUA 2PHLA 4RFT0 2Z4FA 4L8QA 5DDJ3 1F5FA 4CCKA 5JPMB 2RG4A 4E4ZA 1QJX3 1QJY3 2VZ3A 4KWKA 4LQRA 1RUNA 4WVMB 3LIHA 5KXDA 4LJHA 1U5ZA 5FPBA 2A75A 2YFZA 5FZ8A 2HWC3 3M3OA 4U36A 4UW3A 1J3QA 1PNGA 5HCAA 3THTA 4XCBA 1F9KA 5A3UA 3ZKYA 4ATEA 3AYCA 1MS4A 2WN3A 4XDPA 2PFWA 1C4RA 3LEGA 4Z82A 5F6KA 1BLZA 1NZCA 2R1BA 1F4AA 4COVA 1Q3EA 2PELA
chains in the Genus database with same CATH topology
1POQA 1PM4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1POQ A;  1PM4 A; 
#chains in the Genus database with same CATH topology
 5CNA A;  4JGY A;  4N7I A;  4AI9 A;  3GJA A;  3VL8 A;  3D82 A;  1K5M C;  2JKX A;  2XHK A;  1UU5 A;  2I2S A;  4FPC A;  2GC3 A;  4IV3 A;  3SIS A;  3O1U A;  4NII A;  2JWP A;  3EQE A;  2ZKL A;  5FR3 A;  1NLQ A;  1WLW A;  2ZPX A;  2B39 A;  3TNP B;  1FMD 2;  1PHM A;  4Q4V 1;  2JB8 A;  5BNP B;  2WL1 A;  2WC2 A;  2UWC A;  4O7X A;  1D2Q A;  1HQW A;  2BFU L;  4MLO A;  2WFF 1;  5C4W C;  3ZFF B;  4C91 A;  4JGZ B;  5KBF A;  3B3Q E;  3EJK A;  1ZBE 3;  1AX2 A;  1CGP A;  4DQA A;  1NLR A;  3WCR A;  3RYK A;  3ZXA C;  1ASJ 2;  1W8Z A;  4PQ9 A;  4B1L A;  4RHV 2;  2UYB A;  4DMI A;  3RWN A;  2WQ8 A;  3VBF B;  3RZK A;  1SPP A;  1FX5 A;  4QDS A;  1AX1 A;  5IFP A;  1VRH 1;  2XVG A;  3N36 A;  1N47 A;  2WYF A;  2DCY A;  5KHJ A;  5JSO A;  3MPB A;  4LA2 A;  4M4P A;  4DEV A;  5L7O C;  1VBC 1;  2R16 A;  4QX8 A;  3OGS A;  1ZRF A;  4HK8 A;  2WQ4 A;  4KG8 A;  2JDN A;  3JQW A;  4MV2 A;  2W52 A;  1TME 2;  2VW2 A;  2JIG A;  3FE5 A;  4ERO A;  3UV9 A;  4PJY A;  4AG4 A;  2JJ6 A;  2YRO A;  1RVF 1;  3M7A A;  1H9P A;  4M0N A;  2WS9 2;  3ACF A;  4UYB A;  2WZP P;  1DQ6 A;  4B4R A;  4EWE A;  2WNO A;  1UY2 A;  2J1T A;  1JYX A;  2UU8 A;  4XHX A;  4FPG A;  4LUK A;  1EY2 A;  4O9G A;  5D8A C;  4ZY9 A;  4B4Q A;  4DY5 A;  5JUV A;  3QH6 A;  4GMP 3;  3AP4 A;  3PTY A;  4K21 A;  3U4X A;  4JGY C;  4LK6 A;  1CAX B;  4LO4 B;  4CSW A;  3RZG A;  3IDE A;  5EV7 A;  3AKT A;  4FOY A;  2IC1 A;  4A42 A;  1DYO A;  3OCP A;  1UX7 A;  1W2U A;  1QQP 1;  1TMF 1;  1IQD C;  3IN9 A;  4M4R A;  1YIF A;  1S0F A;  2RS5 1;  4JCK A;  3VD4 A;  2DWR A;  4LHN A;  1VPH A;  4CRQ A;  1CN1 A;  1GP6 A;  4PIX A;  4OUL A;  3AZW A;  2D43 A;  3GZA A;  1OLR A;  3AL6 A;  3H1M A;  1NOV A;  5BUV A;  3ACG A;  1NA1 A;  1F35 A;  4MGT A;  4Y1Y A;  1FPN 2;  1IPJ A;  2A7A A;  3M3E A;  3THD A;  5JSR A;  1UXX X;  2E33 A;  2ARE A;  4HFS A;  5HBA A;  1VB2 A;  3RZL A;  2ILM A;  1FYU A;  3H8R A;  1DP0 A;  4LOR A;  4CU6 A;  4HKO A;  2FMD A;  1POQ A;  1APN A;  1UXZ A;  2VUC A;  3CDZ B;  3QOP A;  4AF9 A;  1HV1 A;  2HEW F;  4BXS V;  1A6C A;  1REE A;  2VUJ A;  5IT6 A;  5JDB A;  5L19 A;  4S2D A;  2QQW A;  3VGI A;  3INA A;  1ZRC A;  2WO7 A;  1NCR A;  4JV4 A;  1LJ7 A;  2XOM A;  2FCU A;  1H2L A;  3OGV A;  4V2V A;  4DB5 A;  5FCC A;  4YVS C;  2R49 A;  4M3C A;  2Y6L A;  3ZYP A;  4GH4 A;  4YW3 A;  5T50 A;  3AZV A;  4LO5 B;  2A3Y A;  3KGZ A;  3M4F A;  3BTZ A;  2P37 A;  4NJ4 A;  2MEV 1;  5E16 A;  4BQ1 A;  1BQP A;  2GZW A;  2VBB A;  5HCH A;  4LPL A;  1JS9 A;  1AL2 2;  1JYN A;  3ITQ A;  5F2S A;  4Q4X 2;  3NV3 A;  4RR3 C;  4Y5T A;  5FZ4 A;  3MLK A;  2BNM A;  2VME A;  3KD4 A;  4MUV A;  5FK7 A;  5A7P A;  4KWU A;  2HBT A;  3WG3 A;  3NJX A;  4X6R B;  5BPX A;  4D7T A;  5F6L B;  1WGP A;  2VQT A;  1YQ2 A;  3S7E A;  3RQ0 A;  2LRP A;  5GLU A;  5JR2 A;  4AW7 A;  1NA1 C;  1R1A 2;  1LOG A;  5C9A B;  4NIH A;  1O59 A;  3ZM8 A;  5FPV A;  2XJV A;  1ZRE A;  4LXL A;  2B4K A;  4Q8K A;  2ZX0 A;  3VD5 A;  5FYH A;  1UKG A;  3M3Q A;  4HLT A;  4RS5 B;  3THC A;  3DN7 A;  5FWJ A;  3LWC A;  4DUX A;  2VNG A;  2Y6G A;  1URX A;  1VIW B;  1LOF C;  3D8C A;  1Y9M A;  2GDF A;  4XF9 A;  1H2N A;  3O1S A;  2VCC A;  3LDR A;  1T6B X;  3T2P A;  4IEO A;  3TOJ A;  1OQ1 A;  3E1F 1;  1VBA 2;  1ENS A;  1ASJ 3;  3GAL A;  4RHV 3;  4A4A A;  2R1D A;  1W2T A;  5K7P A;  3WW2 A;  4FFF A;  1T2X A;  3NNM A;  4FSJ A;  1YC6 1;  5I8S A;  3RNS A;  1NCR C;  4CCN A;  5C6C A;  4XZU G;  1GZW A;  2VMC A;  4QQH A;  2EVX A;  1CJP A;  4XVH A;  4Y22 A;  1W9Y A;  2EIC A;  5CKM A;  3WNO A;  3ZYR A;  4DUW A;  4ZZ5 A;  2JEN A;  4K3U A;  3VZK A;  4DXR A;  1A8D A;  5FO7 B;  4B4P A;  4KMQ A;  2J1E A;  2P6H A;  2P5B A;  2ARC A;  4GA9 A;  2YY1 A;  1TME 3;  1Q8P A;  2ARX A;  1XNK A;  2GME A;  3MGU A;  4FTB A;  4B7K A;  1H8V A;  3DF0 A;  4URT A;  1MEC 1;  2WSV A;  1D4M 1;  5DZE A;  1ULF A;  2Q1F A;  1D7P M;  2A6Y A;  2WS9 3;  4QKN A;  5FYY A;  3RI8 A;  1GBG A;  4CU7 A;  1V70 A;  2Z2S B;  4FPE A;  1YHF A;  5JXJ A;  1CVN A;  1R1Z A;  2PAK A;  4WM7 B;  4D6S A;  5CU1 A;  3IWZ A;  3T0D A;  1C1F A;  2EXH A;  4FOQ A;  2WWU A;  1HDK A;  1G9A A;  2DVD A;  4RL7 A;  4CCD A;  5FDB A;  1QOO A;  3AVR A;  3ZO0 B;  5IAX A;  4FFH A;  4W6W A;  2EIB A;  2ZOE B;  4PLM A;  2VCA A;  4Q4V 2;  3OPW A;  3A23 A;  3AJZ A;  2OQ7 A;  4H7M A;  5I0T A;  2WFF 2;  1ND2 B;  3VL9 A;  2ZCW A;  2I07 B;  4CDX A;  1ONA A;  5FLI A;  3E5X A;  3VD7 A;  5BY5 A;  2DU0 A;  5SV8 A;  3T4H B;  4W50 A;  2PHD A;  5B4N A;  3PUI A;  1F31 A;  2C9A A;  2ZBJ A;  4FP3 A;  1FPN 3;  3KCC A;  4XQW A;  3WQ7 A;  5A1A A;  1SZB A;  5CA6 A;  5CYY A;  1VRH 2;  4GQ7 A;  3AYA A;  3I59 B;  3KQR A;  5IK8 A;  1V00 A;  2AEN A;  2ZTN A;  1ND3 A;  1VBC 2;  3K3O A;  5FZL A;  4I30 A;  5F9T A;  5DAX A;  1MS8 A;  1SBE A;  4XTM A;  1RUO A;  2Y6K A;  4YAR A;  4XFH A;  2QNK A;  1NCQ B;  4A6O A;  1QF3 A;  4ZZ8 A;  3CZJ A;  1UZY A;  1BKZ A;  2JE7 A;  1RVF 2;  1S4C A;  3AFK A;  4Q4W 1;  1DZR A;  4XIL A;  5H9Q A;  2OA2 A;  3ZFG A;  4GWJ A;  1R09 1;  1QIQ A;  2HEV F;  3H0O A;  4LBK A;  1X33 A;  1XNT A;  4K20 A;  4EN6 B;  2VZU A;  1JMU B;  1QJF A;  2PMW B;  3J26 N;  4XEZ A;  5A7S A;  4C90 A;  2Q4S A;  2VVD A;  1HRI 1;  5BV6 A;  1POV 3;  2EF6 A;  3FC0 A;  5AFE A;  1ZM1 A;  1QQP 2;  1TMF 2;  2IVI B;  2D6P A;  5FK8 A;  3VDD B;  1C5H A;  2EIE A;  5EYY A;  1X9T A;  3LKJ A;  4OHX A;  2RS5 2;  1U5Y A;  1Y43 B;  2LTN A;  4QDR A;  1AL2 3;  1YUD A;  2PHU A;  3SHR A;  2VOK A;  4Q4X 3;  1NAE A;  3G7D A;  3I2J A;  1W6O B;  1W0N A;  1DBN A;  1NE6 A;  2XDV A;  4HKW A;  4CDX C;  4OHY A;  5J36 A;  4Y1V A;  5A7W A;  3OUJ A;  3V56 A;  4CP0 A;  5GLW A;  2AR6 A;  1R1A 3;  1I5Z A;  4EZ4 A;  4E27 A;  2BVB A;  2LS6 A;  3BU0 A;  1FT9 A;  1Q8S A;  2OX0 A;  4B8E A;  4Q2F A;  3NNJ A;  2VMF A;  3DPR B;  4QXH A;  3P6B A;  4XFG A;  3T0A A;  5JXH A;  4P9Y A;  3UKN A;  3C7O A;  4GWN A;  2BOJ A;  4OZO A;  4QDQ A;  2RJ2 A;  3NV4 A;  2UY8 A;  4IER A;  3W5M A;  2BWA A;  2YHJ A;  3NAP A;  2R6Q A;  5ERL A;  2Y6J A;  2NN8 A;  2A6V A;  2IZW A;  2PQQ A;  2QDR A;  1VBA 3;  3ES1 A;  4NAO A;  2B9U A;  5JXI A;  3R05 A;  1LOA A;  3NWK A;  4FXG B;  1W6Q A;  4P9I A;  2KD7 A;  4YZ1 A;  1H1A A;  5FYC A;  4DEQ A;  5LY1 A;  4J1X A;  1CAW A;  4HAN A;  5JVV A;  2MNG A;  4QKD A;  2MEV 2;  3MI8 A;  2W08 A;  3KMH A;  3DEC A;  1GNH A;  4PLN A;  2Y34 A;  2E26 A;  4FTS A;  2R0H A;  3POF A;  3LF7 A;  4AQT A;  1OH3 A;  3VBO A;  2C1F A;  3LSD A;  2ZGT A;  3L2Y A;  2E31 A;  1DGW X;  2EXJ A;  4COZ A;  1MQT C;  1JZ2 A;  1GQP A;  1O8S A;  2A71 A;  3CMG A;  4LBL A;  2JXA A;  4LMF A;  5FZK A;  5EFU A;  2XVK A;  1ZZ9 A;  1RC6 A;  1AHS A;  1AYN 3;  3PU8 A;  4YZ4 A;  5DN2 A;  5FZ1 A;  4Z8B A;  4QX5 A;  5LW9 A;  4QMA A;  4WVM A;  4Q4V 3;  2CV6 A;  1UZV A;  2RJK A;  3BPS A;  5SV5 A;  3EB7 A;  2DVG A;  2VJX A;  4L99 A;  4HVO A;  1D0G A;  3ZN5 A;  2ARB A;  4G4F A;  4MHU A;  4AVT A;  5ABJ B;  4AI1 A;  3IDB B;  4IE0 A;  3U14 A;  3VBR C;  1JYC A;  3U4S A;  4XMA A;  5A6X A;  1XU2 A;  3C7E A;  1GOH A;  2VOV A;  3AP6 A;  1I9R A;  2Q1M A;  1JU3 A;  1OUS A;  3KT4 A;  1LOE A;  4YM0 A;  1Q8Q A;  3B94 A;  2WO1 A;  5FQ0 B;  1IPS A;  4CA9 A;  2CNA A;  5FZH A;  4CDW B;  1Q56 A;  3C2U A;  4GB3 1;  1SBF A;  3MUZ 1;  4GD4 A;  1VBC 3;  1J83 A;  3IB3 A;  4Q0S A;  5DMY A;  3NKT A;  3QBQ A;  3NJZ A;  4QKF A;  4UF0 B;  2XJR A;  5DAB A;  4DFS A;  1O6U A;  4UW4 A;  1MPX A;  1RUI 1;  4HZF A;  3RYR A;  2V4V A;  2RR1 1;  3K2O A;  3RMY A;  2HH9 A;  3SCG A;  4DXS A;  3MHZ A;  4P5H A;  3WF0 A;  1MEC 2;  2ZGP A;  4UFH A;  3ZFF A;  1RVF 3;  1D4M 2;  4JGZ A;  1FV2 A;  4OQ8 A;  2EXK A;  3VBO C;  4GMP 0;  4LA3 A;  1UY3 A;  4ZON A;  2ADE A;  3RJR A;  4EE2 A;  5JZG B;  3AXE A;  5CKQ A;  3KZ4 C;  5DQ0 A;  2HWD 1;  3VBF A;  3DXU A;  4HVR A;  4CE8 A;  2DF7 A;  2ZGL A;  3ZIW A;  3OEB A;  3VBS C;  4Y1X A;  1QNY A;  4ZU5 A;  1CR7 A;  3PUA A;  4XW3 A;  3QCW A;  4AI8 A;  1AYM 1;  1QQP 3;  1TMF 3;  2RJL A;  3AP9 A;  3RSJ A;  4OQ9 A;  2CTV A;  4XC9 A;  2ZEW A;  4HBN A;  2RS5 3;  2Y0O A;  5C8C A;  3NMB A;  1GU3 A;  3ELN A;  3N3H A;  4O9E A;  4AHX A;  3M8L A;  5J96 B;  1KDK A;  2NLR A;  1YQ8 A;  1F5J A;  4YZ2 A;  4AEM A;  2OT7 A;  4HN1 A;  1AJK A;  5K0U B;  2FZ2 A;  2DCT A;  4AVV A;  1GZ9 A;  5FMO S;  3MZH A;  1YYN A;  4TLF A;  2W39 A;  3PDQ A;  1CAX A;  1AX0 A;  3H8U A;  1W0P A;  2VU9 A;  3Q8C A;  2PLV 3;  3PNA A;  4KWL A;  5A3N A;  3JU9 A;  3ZR6 A;  1KS4 A;  4YYO A;  3FFZ A;  4TWT A;  5LK5 A;  4QPI B;  2D6L X;  3III A;  4COU A;  1G9D A;  1D2S A;  1GSL A;  4Q4W 2;  3QLQ A;  5FYZ A;  3ZDV A;  3ZYF A;  1DF0 A;  4J6G A;  1R09 2;  4IEW A;  3ZFF C;  4DRR A;  4CYD A;  3AKR A;  4QPG B;  4A45 A;  1AR8 1;  4XHB A;  2ORX A;  1CIY A;  1HRI 2;  2RMU 1;  2XB6 C;  4W65 A;  3KGL A;  5EIY B;  4Z07 A;  3VBF C;  2ZAB A;  1QJE A;  4JRA A;  1RUC 1;  2FQP A;  4KL1 A;  1OF3 A;  2XJS A;  4TSV A;  2WO2 A;  5F8P A;  1EP0 A;  4XFA A;  3H8O A;  1LTE A;  4QX3 A;  3MFA A;  4YW4 A;  4Q0V A;  4XPV A;  3QD6 A;  3DXT A;  2JE9 A;  1TZO A;  1YRZ A;  2ATF A;  5C8C C;  2ES3 A;  2XL9 A;  4FBF A;  1GYK A;  2A6X A;  3POW A;  1LKN A;  3U11 A;  1WMD A;  4OI0 A;  2YGL A;  1S2B A;  1AXY A;  3AP5 A;  4QU1 A;  3OBA A;  4ZS2 A;  1WWY A;  3WQ1 A;  1OD3 A;  1BVP 1;  5CZK A;  5G04 L;  2YFU A;  3W5N A;  4YW6 A;  3VB9 A;  1SLT A;  1GKB A;  1JYW A;  4O65 A;  1MZ6 A;  1LU1 A;  4JKK A;  2CGO A;  5C3S A;  3A22 A;  3ZKU A;  1STM A;  2EIG A;  2RDR A;  4LR4 A;  2XG3 A;  3MF9 A;  3OPZ A;  1OKO A;  1N1S A;  2BNN A;  4Q0U A;  3B5L B;  3WG4 A;  2C5D A;  2VMG A;  1LGB A;  4D6Q A;  5I91 A;  5IVV A;  3LA3 A;  2VW1 A;  5JR7 B;  2YPD A;  5LBE A;  4N90 A;  4I0A A;  4P14 A;  4AVC A;  5FY9 A;  3VDA A;  5C9A A;  2ZEX A;  2RDS A;  2V72 A;  3K48 A;  3RZH A;  3CEW A;  1AZD A;  3ZMO A;  2J1S A;  1RJ7 A;  1XBF A;  4P9W A;  1H2M A;  4JAA A;  2IFR A;  4RS5 A;  4LHL A;  4WV8 A;  3T09 A;  2E63 A;  5I0U A;  2P4E A;  4DXT A;  2E32 A;  5FRE A;  1UIK A;  4GZ9 A;  1MEC 3;  5GM0 A;  4BQY A;  5EWS A;  1PX3 A;  2PQS A;  1D4M 3;  3B69 A;  1B35 B;  5C5T A;  4FPJ A;  2HWE 1;  5EJZ B;  2W1Q A;  4LE4 A;  1KDM A;  3KV5 A;  4QHZ A;  2DCZ A;  5FPL A;  1RIR A;  4Q29 A;  3FHI B;  3K4D A;  3J7H A;  1XNA A;  3M3C A;  4XFF A;  2B5H A;  4Y4Y A;  1AF9 A;  1DQ1 A;  4XAB A;  3G6J B;  5T5L A;  4BWO A;  1SQ4 A;  1U12 A;  3N9L A;  5FY0 A;  1UIJ A;  5H9R A;  2TUN A;  2Z79 A;  3KT1 A;  3WEZ A;  1LOD A;  1NKG A;  4GAL A;  4D7S A;  2PHR A;  1WW4 A;  1XE8 A;  3DKQ A;  1QDO A;  4H14 A;  3ZN4 A;  4BME A;  4LLO A;  4EN0 A;  3GJB A;  2XQR A;  4CXY A;  1KGY A;  3FUO A;  4XF1 A;  3KLS A;  2EAA A;  1HB1 A;  3ZXF A;  4XIK A;  4PCR A;  2RS1 1;  5LA9 A;  2BW8 A;  3OYW B;  3WNX A;  4WM7 A;  1PO2 1;  1DLC A;  1HIX A;  1VAK A;  4GJZ A;  4AEK A;  1QXP A;  4GB3 2;  5DZF A;  5JIA A;  4IE4 A;  2Y38 A;  5JMC A;  5C9A C;  2PHF A;  1RUI 2;  3LE0 A;  3PVB B;  4JHZ A;  4LOT A;  1NLS A;  4QX0 A;  2RR1 2;  4MYE A;  4ZS3 A;  4CPB D;  2FBE A;  3LEI A;  1XU1 A;  1YFY A;  3CJI B;  4RS5 C;  4YW7 A;  4AE2 A;  2VNV A;  1ND2 A;  4OI1 A;  2NM1 A;  3H8X A;  3OTF A;  4Q4W 3;  4UI9 L;  4AGV A;  1LHO A;  3ZXE A;  3RJ2 X;  1R09 3;  2VO5 A;  3ACI A;  4BLJ A;  2UUR A;  3IDC B;  3MID A;  2VVF A;  5CKN A;  1YO8 A;  4QPY A;  1GQH A;  2HWD 2;  4YVW B;  2QQJ A;  1S0G A;  3WP6 A;  3A4U A;  1POV 0;  1W39 A;  5CVR A;  4IGO A;  4HMZ A;  1HRI 3;  1E5H A;  2RDN A;  3I59 A;  2PHT A;  2LUW A;  2WUH A;  4I3P A;  1AYM 2;  4Q4Y 1;  1KRI A;  3POB A;  5HV0 A;  3GGL A;  1OBN A;  3ZFE B;  3TBD A;  4H7L A;  3VHO A;  1NCQ A;  1WCS A;  3UET A;  4F83 A;  2UWB A;  1IHM A;  4UOJ A;  1I5P A;  4JTO A;  5E6H A;  5FXV A;  2RHP A;  4XYX A;  4W8J A;  5J48 A;  3HAG A;  2Q8C A;  2FCT A;  4N53 B;  3TWI A;  4AQ2 A;  1S2E A;  2GSY A;  1H4G A;  2ZMN A;  5E88 A;  3VKL A;  4WM7 C;  4LKS A;  4W4Z A;  4JTN A;  1OHF A;  4QWN A;  3VLB B;  1BMV 1;  4AZZ A;  5FOJ B;  5AC9 1;  2Y0I A;  3VDD A;  1ZZ8 A;  3HQU A;  2WR9 A;  4KI5 M;  3ZYJ B;  3P3P A;  1OC1 A;  1C3H A;  3WP5 A;  5IAT A;  4BA6 A;  1GOF A;  3AMN A;  1C57 A;  4IV1 B;  2C9K A;  3IMM A;  4YGE A;  1MZE A;  2OYZ A;  2QFE A;  1QGL A;  1ND2 C;  1W6O A;  3AMQ A;  4LUL A;  3M1H A;  1KQR A;  4EN8 B;  2GNT A;  3HQR A;  3OGJ A;  3F2Z A;  4K40 A;  4LHS A;  1OFN A;  2GAU A;  1AR8 2;  4I02 A;  4NN0 A;  4D94 A;  1FAT A;  1N1V A;  1UCX A;  1WMF A;  2RMU 2;  3AMP A;  3T2O A;  3WP3 A;  3NW4 A;  3WSO A;  1DGR N;  1F15 A;  4YG0 A;  5KHK A;  5FMO L;  1JUI A;  2RDQ A;  1RUC 2;  2JIC A;  1YIP A;  3I8T A;  1PK6 A;  3N7M A;  4WVV A;  5FKB A;  3T2T A;  4X6Q B;  5JI9 A;  1IG0 A;  1S0E A;  1ZZ6 A;  2E6V A;  3DPR A;  2GMP A;  3LCP A;  1BXH A;  4IEX A;  1XB9 A;  2VG9 A;  3HPN A;  4CDU C;  3O1R A;  3WF4 A;  3ZPO A;  4B7E A;  3UKV A;  4TYS A;  3WDT A;  2VTX J;  4RD7 A;  1PGW 1;  2UWA A;  1VMH A;  5FXX A;  2P17 A;  1U0A A;  2CDP A;  2YBS A;  4NE9 A;  1HB3 A;  3WDV A;  1SFP A;  1K3I A;  2R06 1;  3UYJ A;  5EXO A;  5FZI A;  4AI2 A;  4ARX A;  2VZQ A;  3AB0 A;  3VBH B;  1S0J A;  2P1B A;  2H6C A;  4WZC A;  2PAE A;  4NID A;  4XBN A;  2D6N A;  1CJD A;  1PZ8 A;  4CCM A;  1W8F A;  1EV1 1;  3I2D A;  4EN9 B;  1UY4 A;  4YFW A;  3WQ0 A;  1AL0 G;  3KCY A;  3L2H A;  4DIN B;  5DG2 A;  1KFX L;  5H9S A;  3NKG A;  1MS5 A;  1H1M A;  4QX2 A;  3AMM A;  3NQH A;  4RYD A;  4XIO A;  3VDD C;  4CP2 A;  3SXW A;  1BJQ A;  2P3Y A;  3AYD A;  4FOV A;  1J1L A;  4AGG A;  1YQC A;  1MS0 A;  3R0R A;  1NXD 1;  4HPK B;  4IQP A;  4YLZ A;  1XSR A;  2ZML A;  2C26 A;  4LBQ D;  5FIX A;  5J3U A;  5FY8 A;  2JDK A;  5IUQ A;  1A78 A;  2E51 A;  3SH5 A;  1EAH 1;  2A73 B;  3T0B A;  4HSJ A;  4AFD A;  4FI9 A;  3CO2 A;  4FFG A;  2ZHK A;  3I2F A;  4GB3 3;  4PBO A;  2VGD A;  4XFI A;  3I3Q A;  4P9J A;  5F5I A;  1OUR A;  4JZR A;  1PK6 C;  5A3P A;  1RUI 3;  4IW3 A;  1H6Y A;  4OI2 A;  2VL4 A;  3AM2 A;  3CKH A;  3GBF A;  3DPR C;  4MX3 A;  1OA4 A;  5EYX A;  2X05 A;  5K4L A;  1RUG 1;  4OVE A;  2HWE 2;  2ETE A;  4IV3 C;  5D21 A;  4KG0 A;  4P08 A;  3EBR A;  4FP2 A;  2ZGN A;  4UFL A;  5FYI A;  3E6B A;  5ABJ A;  5JMO A;  2ZAH A;  4EN7 B;  3LEM A;  2HWD 3;  4CCJ A;  4FCA A;  3WG2 A;  4UFJ A;  3ABZ A;  1NQD A;  5FQ0 A;  4OMC A;  4XAC A;  4CDW A;  3CBN A;  1G6N A;  1AYM 3;  2OPW A;  1W6M B;  1DIW A;  2DCJ A;  1H8T A;  1OLM E;  3MW4 A;  2EXI A;  3D0S A;  4UF0 A;  4AOC A;  3GDB A;  1OFS A;  4ORF A;  5HI0 A;  1JZ3 A;  5J37 A;  2GN7 A;  4CDQ B;  1XNB A;  4KBZ A;  3FJS A;  3T4V A;  2QQO A;  3AFG A;  1PVX A;  3J7L A;  5FFO C;  2YU1 A;  4R52 A;  4K6B A;  2RS1 2;  2ZZJ A;  1WUV A;  2D97 A;  2A3W A;  2CHH A;  1RED A;  3I54 A;  1IKQ A;  4XBL A;  4MVT A;  1PO2 2;  5IW0 A;  3W21 A;  5CG9 A;  3ZSL A;  2AEZ A;  4DOU A;  2PXJ A;  4XCA A;  4C1W A;  1KIT A;  4D69 A;  3UJQ A;  3MBW A;  5FXZ A;  3SEE A;  3ON7 A;  3O1M A;  2YC4 A;  4B3N A;  1L7Q A;  1RUF 1;  2V09 A;  2XXZ A;  1CZV A;  2PAM A;  4L9B A;  4IDZ A;  2FCV A;  4P9G A;  5IJR A;  1XRU A;  3HMY A;  4H55 A;  3ZYH A;  1NX9 A;  4F7Z A;  5A33 B;  3BI3 A;  5J98 B;  2B9V A;  2BBV A;  3S7I A;  4ZXK A;  4NWV A;  4CP9 A;  5FZ7 A;  4I3G A;  1HJF A;  3B01 A;  1RB8 G;  4C0H A;  3BPZ A;  3THP A;  4Q1P A;  2X8K A;  1W6P B;  4BIO A;  3PUH A;  2WT0 A;  4XOG A;  5K0U A;  3WY6 A;  1OPM A;  1AR8 3;  1LNS A;  1WKY A;  2IXJ A;  3DUI A;  1S1A A;  2HYX A;  1DGW A;  2OPK A;  2RMU 3;  3M2M A;  1DQ0 A;  3IZO A;  4NHX A;  4M0H A;  4Q4Y 2;  4HVQ A;  4NPM A;  2YC0 A;  2UYA A;  5FOB B;  3O1V A;  1QXJ A;  2QQL A;  4OMD A;  3WVJ A;  1AJO A;  3ZSJ A;  1ZBA 1;  4CDW C;  3FMG A;  3HR9 A;  3ACL A;  5FLJ A;  1UQX A;  4P9L A;  1H8T C;  2W3J A;  5GZD A;  3RVH A;  1NUK A;  3WP4 A;  5C5U A;  1Y4W A;  1RHI 1;  3CF6 E;  4OFG A;  1JU4 A;  3AC0 A;  4YGB A;  3E97 A;  3PHM A;  3LDB A;  3I2H A;  1FMD 3;  1OVP A;  3C3V A;  3W59 A;  4DIQ A;  2ZGK A;  4Z2A A;  2VOX A;  3PU3 A;  4QPG A;  2BU9 A;  2BV4 A;  3KSC A;  5FY4 A;  5F5A A;  1D4V B;  1YJK A;  4Y3O A;  3U07 A;  4YGD A;  3WG1 A;  2B8M A;  3NVC A;  1BMV 2;  1C8M 1;  3KB5 A;  2ORZ A;  2QQK A;  4SLI A;  4AFA A;  5AC9 2;  3MIF A;  3JB8 A;  1UMH A;  2C24 A;  5TSW A;  1OPO A;  1SEF A;  1UPI A;  2YB7 A;  3VKM A;  1VLN A;  2DV9 A;  4AVB A;  1Z7S 1;  2CYF A;  1OUX A;  2DVF A;  1OT5 A;  4GH4 C;  1UMZ A;  2VNO A;  1UX6 A;  3RI9 A;  4FQ4 A;  3I49 A;  3HNM A;  3BVC A;  5A32 A;  2DFB A;  2JG9 B;  2J1A A;  1V6O A;  2JG8 B;  3IPV B;  4I0B A;  4QPW A;  5K0U C;  1WCQ A;  4QXC A;  3VDB A;  1OKQ A;  5KHG A;  5FY5 A;  1X8E A;  3D0J A;  1Y9Q A;  2WNU B;  5FZD A;  3SC7 X;  3M3I A;  3WW4 A;  4ET7 A;  4NRQ A;  4MGQ A;  4FPH A;  4E2S A;  2BGP A;  3HD8 B;  1EPW A;  5FYV A;  3ZN6 B;  1PGW 2;  5JSP A;  2ZJC A;  4D8M A;  4NAM A;  4CXW A;  2R06 2;  4GWM A;  1SFN A;  1RMU 1;  2K2S A;  4I09 A;  1NXM A;  2HWF 1;  4CUG A;  2QTW B;  3FHQ A;  4QB6 A;  3WDY A;  3ATG A;  2I74 A;  1EV1 2;  3FX3 A;  2GU9 A;  3WUC A;  4BDV B;  3POJ A;  2DTW A;  4GKY A;  2XQX A;  3GF6 A;  3LIG A;  1DGR A;  3JD7 1;  1UN1 A;  5HCF A;  1WW5 A;  4BQ3 A;  3KHC A;  1DG6 A;  2EID A;  2A70 A;  1REF A;  5T5P A;  5C3P A;  2KA3 A;  2FDF A;  1GQG A;  1W8O A;  4MH0 E;  1E5R A;  3B7M A;  1B35 A;  3RZM A;  1CQ9 A;  2PHW A;  1O5U A;  4RA0 A;  1K45 A;  2RS1 3;  2OUH A;  4QQ2 A;  3U37 A;  1Z78 A;  2WA3 A;  5FLH A;  1OMI A;  1EAH 2;  1PO2 3;  3JCI A;  5IK7 A;  4BB3 A;  3ZSM A;  2F17 A;  1SFY A;  3VZM A;  2XPJ A;  2R07 1;  4Y20 B;  4CUA A;  2B42 B;  4FT8 A;  3KVB A;  4LBO A;  3QH7 A;  3ORJ A;  4XJW A;  4NHK A;  3POI A;  2XGX A;  5FZM A;  1RUG 2;  4NHM A;  2VEC A;  3D5O A;  1FNZ A;  1K5M B;  3OBR A;  5DZG A;  2QQN A;  3AMH A;  4S2F A;  1PZ7 A;  5FTT C;  4NUB A;  5K8S A;  4OI4 A;  3OYW A;  4D0Q A;  5C8W A;  1EPZ A;  5A7O A;  3E6C C;  4EWD A;  1NE4 A;  3NNL A;  5C4W B;  3ALQ A;  2DUR A;  1JHJ A;  2ZGQ A;  3TN9 1;  1LCL A;  5A6Q A;  2W92 A;  3OBT A;  2D93 A;  4JC1 A;  2VQA A;  3OF1 A;  4BQ5 A;  4L97 A;  5FMB A;  3OOX A;  3WOG A;  4N8M A;  4XFC A;  4AWD A;  2Y6F A;  3K46 A;  2VMH A;  2YV8 A;  5I0R A;  2O8O A;  1W2O A;  1RUD 1;  2QJV A;  3CJI A;  2IWG B;  5A3L A;  2WLP A;  4ONU A;  3GBW A;  2ZEZ A;  4Y26 A;  5CFD B;  4XAE A;  1GP5 A;  1ND3 C;  3N9Q A;  4CU8 A;  2VXR A;  2VZV A;  3ZR5 A;  1DQ5 A;  2DUQ A;  5IK4 A;  3O5S A;  3GZU C;  4OHV A;  1O5L A;  4N9I A;  5BYN A;  3MF6 A;  1FNY A;  3APB A;  5FZ9 A;  5FBJ A;  4CXX A;  4EWA A;  3IT8 A;  3MW3 A;  3PVO A;  5DG1 A;  1GAN A;  1RUF 2;  3ZFG C;  5JXG A;  5AC9 3;  2C0Z A;  4HG6 B;  3VHN A;  5FZF A;  4UXA A;  3ZFE A;  3MIC A;  5GZF A;  1ENQ A;  1FOD 1;  5D8A B;  5F2W A;  1LEM A;  1ZA4 A;  3ZYB A;  5FP9 A;  1RUE 1;  3HVD A;  4BYY A;  5IVC A;  4FPY A;  4OUS A;  1ACC A;  3AX4 A;  4K1Z A;  1BEV 1;  2WAO A;  2WKK A;  4CCE A;  1DYP A;  1O91 A;  5FUN A;  4N53 A;  5IAV A;  5CIS A;  5LA1 A;  4XXA A;  1SLB A;  1V9U 1;  1QJX 1;  4M01 A;  1C8N A;  2J1U A;  3PVN A;  4Y5Z 0;  3IM0 A;  2HWC 1;  2VC9 A;  1E57 A;  1X9P A;  1PO1 1;  1ULO A;  2D3R A;  1RXG A;  3JBG 1;  5A6Z A;  2FDI A;  1ZYB A;  4MSV A;  5FAX A;  3ZLI A;  3LOB A;  1XQN A;  2KM2 A;  3MIG A;  1ULD A;  1JYV A;  1WA6 X;  3MW2 A;  1DQ2 A;  4BU2 A;  3GXU A;  5LBF A;  1QWR A;  1H0B A;  2CDO A;  3MIH A;  4YRD A;  4IV1 A;  1RHI 2;  1QOT A;  2V73 A;  1JXN A;  1JOD A;  3CJI C;  5F3C A;  3T3Y A;  1O3R A;  1JOJ A;  1UOB A;  3WQB A;  3EYP A;  1M4W A;  2WFF 3;  1K12 A;  5L9V A;  1ZZ7 A;  2BUK A;  2VTX A;  4E4D X;  1GP4 A;  2DTY A;  3NAP C;  4ASL A;  1EV1 3;  1C8M 2;  5IK5 A;  5FKC A;  2BVV A;  3LAG A;  1V6K A;  4XE9 A;  3CNA A;  3KWV A;  4D7Y A;  3PL0 A;  2SLI A;  3WT3 A;  1ZBE 1;  1VRH 3;  4J25 A;  3SNM A;  4QAW A;  4BZ4 A;  4AK3 A;  1Z7S 2;  2VZ1 A;  1AVB A;  5CBL A;  4YVS B;  3IAP A;  1RL3 A;  3WUD A;  4CEW B;  1EUT A;  5FP7 A;  2D5F A;  4QGN A;  1W8T A;  5GLZ A;  5JIU A;  2TBV A;  5BNP A;  3ILN A;  1EAH 3;  4G3Y C;  4QB2 A;  5E89 A;  3VBH A;  4KH9 A;  2WWS A;  4N53 C;  4S2G A;  2Q8D A;  5BXX A;  3WDW A;  2NYY A;  3N4M A;  1PGL 1;  4RR3 B;  4K7J A;  4NRP A;  2QQI A;  4Q26 A;  3WX5 A;  3NRU A;  2GH8 A;  1Q8O A;  4CEY B;  1I1E A;  2WQZ C;  3MLJ A;  2JD4 A;  2WZ8 A;  4HT1 T;  4Q27 A;  4L11 A;  1PGS A;  3ZXG A;  5CFC B;  1RUG 3;  3ZXD A;  5FRA A;  1IOA A;  4IGQ A;  4AVA A;  1JZ5 A;  1H6X A;  1RMU 2;  2VXJ A;  3I7D A;  4HPK A;  4PBP A;  4NMI A;  2HWF 2;  5DAV A;  2W2I A;  4A7Z A;  3POE A;  3WHU A;  3LPG A;  3IIA A;  1WLT A;  2HEY F;  1CD3 G;  3ZXJ A;  3MV0 1;  2NMO A;  2W94 A;  5F37 A;  2JEM A;  5FZA A;  4B1M A;  2VW0 A;  4J1W A;  4AVS A;  3JD7 2;  3F95 A;  4AEJ A;  1V6N A;  4KGG A;  1LAJ A;  4PIY A;  3W20 A;  2KR2 A;  2ZX3 A;  2WSU A;  1I6X A;  1NT0 A;  2WLQ A;  3TRS B;  3H50 A;  1J58 A;  3Q9O A;  2GAL A;  2X10 A;  3AKQ A;  3P5B A;  3WCS A;  4EQV A;  5T5J A;  2W87 A;  2DCK A;  1V0A A;  4YGC A;  5FUP A;  4A2U A;  1E5I A;  4A7K A;  1T6G C;  3H3U A;  2VE1 A;  1FXZ A;  1LR5 A;  1ZNP A;  2BP6 A;  1NYW A;  4H2A A;  5IYY A;  4GJY A;  3ZSK A;  2FDJ A;  4EZH A;  1SMV A;  5BNP C;  3FLR A;  2P3K A;  3KM5 A;  4XJ8 A;  1AR7 1;  5AFB A;  5FP4 A;  3VBH C;  1JZ4 A;  5AVP A;  3N9P A;  4JGZ C;  2R07 2;  4V1P A;  2HBU A;  1RUF 3;  5F3G A;  1X36 A;  2ZX2 A;  1W6M A;  1FAY A;  2CAU A;  3KQ4 B;  2WBK A;  2XJT A;  3BIW E;  1G9F A;  3T2Q A;  1W04 A;  1WCK A;  2XLA A;  3R6S A;  1D0H A;  3SIT A;  4UBH A;  1TVG A;  1QMJ A;  1TEI A;  1W8N A;  3K3N A;  2IXI A;  4GUL A;  3C7G A;  2OZ6 A;  4FPF A;  3WW3 A;  4CDQ A;  2Q8O A;  3T1M A;  5JPN B;  4FTE A;  2A1X A;  2MEV 3;  3LFI A;  3EO6 A;  1WMX A;  4Q1R A;  5A80 A;  2YBK A;  2VBP A;  1BBT 1;  1EUU A;  2DUO A;  3AKP A;  4HON A;  3L9J T;  4MG2 A;  1GV9 A;  2UY9 A;  1W8H A;  3HEI A;  3TN9 2;  2ZGR A;  4IEZ A;  2GC1 A;  3ZYI B;  2VQU A;  5L36 A;  1LUL A;  3BU7 A;  4LBN A;  4LBQ B;  4UFI A;  4TN7 A;  1VBD 1;  4BIS A;  4E4S A;  5ISL A;  3VZO A;  5A33 A;  1RUD 2;  4Q8L A;  4JDN A;  4AAX A;  4Z1V A;  1YEW A;  3V0B B;  4KWJ A;  1OVS A;  1SHW B;  1SLA A;  3ZOI A;  3HN1 A;  1YI7 A;  5K9Y A;  3UES A;  2CY6 A;  5EQU A;  1MR5 A;  4UWD A;  5F32 A;  2J22 A;  1QEX A;  1YLL A;  1W6P A;  4ZKT B;  3J7M A;  1CX1 A;  5LK7 B;  4HKL A;  2FDG A;  3DV8 A;  3RZZ A;  2YXS A;  2R7E B;  5KC6 A;  2MPF A;  1RUJ 1;  1UU4 A;  1S55 A;  2B7Y A;  5J09 A;  1C8M 3;  1J3P A;  2WZE A;  5FZ3 A;  5FPU A;  4K9S A;  5D2A A;  4AXO A;  2JKB A;  1Q5O A;  2RS3 1;  1XSQ A;  2R04 1;  1FOD 2;  3OD4 A;  1G7Y A;  5LCW L;  3VKO A;  2JDY A;  1SCS A;  1LHV A;  1WLD A;  2ERF A;  4YM1 A;  5C3Q A;  1RUE 2;  1Z7S 3;  5FP3 A;  4LOS A;  2W47 A;  1W3X A;  4CTE A;  3O7O A;  1BEV 2;  4UW5 A;  2JDA A;  3D6E A;  1V9U 2;  1VBE 1;  2GC0 A;  1QJX 2;  2QZ3 A;  3S5Q A;  5APA A;  1W6N B;  2OS2 A;  4GWI A;  2MHF A;  1IPK A;  2HWC 2;  2P6C A;  5FWE A;  3QAC A;  2XJU A;  1PO1 2;  2Z69 A;  3C8X A;  5BNQ A;  3JBG 2;  3ZYG A;  3AL5 A;  4C8D A;  4KNC A;  5DUW A;  5LBB A;  2EA7 A;  1TQ5 A;  5A70 A;  4JKL A;  4KQ7 A;  4PF5 A;  3ECQ A;  3J9S A;  3CU7 A;  4R9C A;  5LEK A;  1PMI A;  2CAV A;  3HOB A;  3KV4 A;  1LOB A;  1YWK A;  1RUH 1;  1VMF A;  4M3C F;  1GWL A;  4L92 A;  3VBU B;  1UO9 A;  2BWC A;  2JEC A;  3JZV A;  4N9H A;  3WF2 A;  5JAX A;  3WD5 A;  4HOO A;  4WBB A;  3FFQ A;  1ZRI A;  1SG3 A;  2JDZ A;  4XUR A;  2JG9 A;  4URA A;  4QD2 A;  2JB4 A;  3FHA A;  1YQ5 A;  4NHY A;  1CES A;  1H4H A;  4C0B A;  2JG8 A;  3IPV A;  4OYU A;  2V5D A;  2NZ9 A;  3UT0 A;  2JDM A;  4ZPI A;  1IS4 A;  4ES8 A;  3EXU A;  3C7F A;  1SCR A;  4YW2 A;  2GMM A;  1QXR A;  2WNU A;  3JD7 3;  1RIN A;  1ZBE 2;  4IE5 A;  4XJA A;  1XXN A;  3ZDS A;  2Q8E A;  3N7J A;  4M3C E;  4E2Q A;  3CHX A;  2ID4 A;  1W06 A;  2VMD A;  4K1Y A;  3ROU A;  1QNW A;  4MGK E;  2Q1Z B;  1TE1 B;  3ZN6 A;  3RRD A;  1KFU L;  4ZHN A;  4BMB A;  5EHD A;  1PX4 A;  1MS3 A;  3AVS A;  1N1T A;  4I01 A;  1XYP A;  1L7R A;  3UK9 A;  4Z2W A;  4TLG A;  1DZQ A;  3H7Y A;  3TYJ A;  2ZAC A;  1O8P A;  1WA4 A;  3PVE A;  1QY4 A;  3W58 A;  3WV6 A;  4FPK A;  4QHB A;  4JHT A;  4OZX A;  1PGL 2;  2R07 3;  5A1L A;  2E7A A;  2ZGO A;  4LE3 A;  1CPN A;  4QQL A;  2W1U A;  2E7T A;  1HQL A;  1G9B A;  3ZX7 A;  1MQT B;  3WXP A;  5C3O A;  4XBQ A;  2JX9 A;  3JUU A;  4NHL A;  2G9G A;  2IXL A;  2HLE A;  1HB2 A;  2RE9 A;  2SBA A;  1WD3 A;  3RPQ A;  1UPS A;  3H9A A;  5F3E A;  4YZ5 A;  3UKT A;  5L9B A;  5FZC A;  1POV 1;  3OGG A;  4TZD A;  4FQZ A;  2ET7 A;  2VUL A;  3ETQ A;  2ZA9 A;  1MVE A;  4S2H A;  3WZ1 A;  4G9S B;  3TN9 3;  2QQP A;  3HQX A;  2JG8 C;  1A34 A;  1ODM A;  1W9S A;  2X09 A;  4Y20 A;  1UL9 A;  4BLI A;  2FHR A;  3VBR B;  2BEO A;  4D6R A;  1N3Q A;  2WNV B;  2WNU C;  2E9Q A;  4GKX A;  1GUI A;  1ZA7 A;  1H2K A;  3BTX A;  1VBB 1;  2D6O X;  1K5M A;  1ULP A;  5FXW A;  3LA7 A;  3ETP A;  3N9O A;  5LB6 A;  1QJU 1;  3GCX A;  1AXZ A;  2ZKN A;  4LKE A;  3GHN A;  5LWB A;  2ZS6 B;  4XQ4 A;  1SAC A;  2XJQ A;  1PIV 1;  2J42 A;  5KXC A;  3TEW A;  1AR7 2;  1XE0 A;  3DYO A;  1Y9G A;  4PIZ A;  5C4W A;  3OGR A;  4QGM A;  2VZP A;  2XLG A;  5A7Q A;  4E9K A;  3OD0 A;  4D3W A;  4MGY E;  1UKR A;  3U10 A;  1JOP A;  1VRB A;  2P2K A;  5FMD A;  1GLH A;  1GNY A;  3FZ3 A;  3S30 A;  1GOG A;  1ZVF A;  2WA4 A;  3KVA A;  3S5A A;  1S0D A;  1RUE 3;  3N9M A;  1UNB A;  5FZ0 A;  3V0A B;  4BE3 A;  2BOI A;  1PM7 A;  3A0K A;  4IEU A;  5CFD A;  3U75 A;  3VBS B;  1BEV 3;  3Q8F A;  2TEP A;  3P3N A;  1VE0 A;  1BBT 2;  5B4X A;  1O3S A;  1V9U 3;  1OXC A;  1L7L A;  4LIT A;  1HXS 1;  3WHT A;  1NCQ C;  3J7N A;  2YG0 A;  1R64 A;  3OY8 B;  2JIJ A;  1RGS A;  5JOW A;  3SQO A;  1QHD A;  1WD4 A;  2F4P A;  2XWJ B;  1PO1 3;  3LSE A;  5DUX A;  5KHH A;  4F3J A;  3HIF A;  1AR6 1;  3DGT A;  3JBG 3;  1ST8 A;  3MIE A;  5FMC A;  3TB0 A;  5C71 A;  5EPA A;  1IZ3 A;  2FD8 A;  1VBD 2;  4XJZ A;  4YG3 A;  1UOG A;  2VUA A;  4IE7 A;  1JH5 A;  4UFM A;  3URF A;  3WNP A;  2OUJ A;  5D8A A;  1VAV A;  2X29 A;  4LUM A;  1VJ2 A;  2VZS A;  1G86 A;  2ZHM A;  4Y33 A;  5FZO B;  3NV1 A;  2CL2 A;  3BTY A;  3S57 A;  3B9I A;  3GZE A;  5EJ3 A;  4IE6 A;  4LKF A;  2FMY A;  2BYV E;  2W91 A;  5I93 A;  2W9X A;  2JDP A;  2W5F A;  4FFI A;  2VH9 A;  4HL0 A;  1AYN 1;  2VOW A;  3K4Z A;  3ZXL A;  1N1Y A;  5IVF A;  3LA2 A;  5EJ1 B;  1RUJ 2;  2GH2 A;  4XDQ A;  4MXV A;  5KXB A;  4ES9 A;  2G9F A;  1BCX A;  4MGZ E;  4ISQ A;  2RS3 2;  2VCM A;  2R04 2;  2YPJ A;  2XL7 A;  1IS5 A;  1O4T A;  4KU8 A;  1OQD A;  4R4Z A;  4YW5 A;  1CAU B;  1V6J A;  3OEA A;  4DPN A;  3I2I A;  4AR2 A;  5BNO B;  3O0X A;  4AFB A;  3E6D A;  1DHK B;  3GM8 A;  3O0V A;  2RM2 1;  1VR3 A;  3NV2 A;  2F4L A;  4AI0 A;  2V4A A;  1IKP A;  3N35 A;  2G9Z A;  4F8A A;  3TAY A;  2XWB B;  4DO0 A;  2XKP A;  1NG0 A;  1VBE 2;  1MS9 A;  2RR1 3;  1V6I A;  2CU5 A;  1XNC A;  2WNE A;  4L0P A;  4R4X A;  3MV1 1;  4WM8 B;  3AKS A;  5T52 A;  3AJY A;  3IDA A;  2WN2 A;  4JKM A;  4CPB A;  5JOZ A;  2Q0A A;  4HN0 A;  4A3Z A;  5FBZ A;  3ZXK A;  5C8C B;  1X82 A;  3W9A A;  1OLQ A;  1W2N A;  3K77 A;  1GFF 2;  4YZ3 A;  1SDW A;  5A3T A;  2A6Z A;  2Y6H A;  3AP7 A;  5L9R A;  2VM9 A;  3UGG A;  2KXL A;  1PNF A;  1RUH 2;  4BXF A;  4I2O A;  2WRA A;  2DYC A;  4YVS A;  1J1T A;  2A6W A;  3LGR A;  1HB4 A;  1PZ9 A;  5IWF A;  4CEW A;  3UL2 A;  3RGB A;  4XUQ A;  5LAT A;  3HWJ A;  2VD7 A;  4LHK A;  3KCX A;  4RGK A;  4OLL A;  2DU1 A;  3CLP A;  2GP5 A;  2VPV A;  4XUP A;  1W8W A;  2JDH A;  2HYK A;  4JRL A;  3WIN E;  5HXM A;  2IXK A;  4CUB A;  3UJO A;  3BB6 A;  4BPZ A;  4YM3 A;  1UY0 A;  4Q0P A;  4RR3 A;  4RQP B;  3O1T A;  3ST7 A;  1XYN A;  2WAA A;  5JZG A;  1HN1 A;  4CEY A;  2IXH A;  5A3O A;  5IHR A;  2O8Q A;  3WW1 A;  1YCI A;  1BHG A;  2Y33 A;  4ISR A;  4P5Y A;  5FPA A;  4MHR A;  4E2G A;  2VQ0 A;  1JYI A;  5JWP A;  4A7Y A;  1F8V A;  1BK1 A;  4AFM A;  4XF4 A;  1XPW A;  5FZ6 A;  4Y1U A;  4RFR B;  3OUH A;  3MYX A;  1HX6 A;  5BNN B;  1UAI A;  3HN3 A;  4Y1Z A;  2WYS A;  4E4H A;  2PYT A;  2QQU A;  1LOF A;  4LBM A;  1AR7 3;  1WBL A;  2NMN A;  2Z42 A;  2PLV 1;  4XXP A;  2EAL A;  4AI3 A;  5DUU A;  4BQW A;  1J84 A;  3H1W A;  2XML A;  1UYX A;  4PDW B;  5D1I A;  2D3S A;  2W46 A;  3Q8E A;  3R4D B;  4PI0 A;  4AED B;  5ABJ C;  1SBD A;  4IGP A;  4JQR A;  4CCO A;  5C3R A;  1H30 A;  3NJV A;  1RJ8 A;  3FWE A;  5GAL A;  5L73 A;  4XJ9 A;  5FJK A;  2LW8 A;  3SKV A;  1WME A;  2YYO A;  1M06 G;  5FYT A;  2HWB 1;  1RUC 3;  3JQX A;  4ZXE A;  2H0B A;  2C6S A;  4GIQ A;  2J1R A;  4LNV A;  4CCL A;  2WZR 1;  1BK0 A;  3I3B A;  1Q8V A;  3SCF A;  4CEW C;  1BBT 3;  5FZE A;  2QZ2 A;  2BNO A;  4QPI A;  1NZI A;  3PUQ A;  1NQJ A;  1TNR A;  3C7H A;  3ENR A;  3N7K A;  2PA7 A;  2DFC A;  2GN3 A;  2LM3 A;  4IEY A;  3BUC A;  1YNA A;  2GNM A;  1PVC 1;  3RG0 A;  4IEP A;  1W9F A;  4QKB A;  2VR4 A;  2BQP A;  4QXB A;  4AQ6 A;  4HXC A;  3MO4 A;  2IFW A;  1LU2 A;  1VBD 3;  3TEY A;  2D7F A;  4YWA A;  2ADD A;  1W99 A;  3HNY M;  5JZG C;  4CEY C;  4XMI A;  3K4A A;  1VBB 2;  2D40 A;  5DPN A;  4PLO A;  4MAD A;  4PF1 A;  1QJU 2;  3FL7 A;  4YSF A;  1XYO A;  1PIV 2;  3GYD A;  3IBM A;  3VV1 A;  3PJY A;  5LY2 A;  4LEJ A;  4P00 B;  2XUM A;  4ZU7 A;  4QQP A;  3PUR A;  4RN5 A;  4AQS A;  1RUJ 3;  1YQ6 A;  2W0X A;  1ALY A;  1UYP A;  1B09 A;  2DBN A;  3RFR A;  1WW7 A;  1A3K A;  5F7U A;  3FN9 A;  3CJX A;  4JVA A;  2RV9 A;  4NR1 A;  2RS3 3;  2R04 3;  1BYH A;  2QKD A;  4NIG A;  4LBQ A;  3T1L A;  5IVJ A;  4LLF A;  3O1O A;  3V0B A;  3LEK A;  1QH6 A;  1QKQ A;  1QU0 A;  1ZX5 A;  1UMI A;  3MIB A;  5CG8 A;  4BQ2 A;  3AYE A;  2ZGU A;  4IXL A;  1S0I A;  1WW6 A;  2QUO A;  2GND A;  1COV 1;  2YU2 A;  3CIH A;  4FPO B;  4OUE A;  2V5Y A;  1VBE 3;  5HV4 A;  4MXW B;  2AZ5 A;  1HXS 2;  1HRV 1;  4PI2 A;  4N43 B;  3A0N A;  1LHW A;  2A3X A;  1FI2 A;  1X50 A;  4E8C A;  5JCT A;  2HWE 3;  4NPR A;  1YXW A;  1PMH X;  1CAV B;  1OOP B;  2LRO A;  4QPI C;  3RWK X;  4AHY A;  1AR6 2;  3RYP A;  5JOX A;  3DYP A;  4HET A;  2PHX A;  1DYK A;  2TNF A;  1WCD J;  1UU6 A;  3GNE A;  5F5Q A;  4M00 A;  4IEV A;  2YC2 A;  1UY1 A;  5KWR A;  4QPG C;  3U1X A;  1AR9 1;  3SH4 A;  3UGH A;  2AUY A;  1RUH 3;  5FPZ A;  3RMX A;  4CCC A;  4FPL A;  2P34 A;  3OUI A;  3B93 A;  3PME A;  5GLV A;  1LES A;  2BGC A;  2CSG A;  2YBP A;  4LO8 A;  4COY A;  1ZRD A;  1VAM A;  4U2A A;  2X5I B;  1AYN 2;  2J1V A;  3ILF A;  1SDD B;  3ACH A;  4YPJ A;  4CUC A;  3LOI A;  1W6N A;  4DRV A;  3I2O A;  3J8F 1;  5LRR A;  2D5H A;  5ACA 1;  5GZC A;  5LRS A;  1LGC A;  3PIG A;  1LB2 A;  4TXW A;  3DEM A;  1H9W A;  1N3P A;  3BAL A;  3HT2 A;  3GBG A;  3DKW A;  1CWP A;  3USU B;  3H3L A;  2G4I A;  1XND A;  2RM2 2;  2ZHN A;  3VBU A;  1AUY A;  4Q0Q A;  2QQV A;  1QOS A;  4IL7 A;  5C70 A;  4H3W A;  1A8M A;  1L3J A;  4AGR A;  1O3T A;  2PTM A;  3NNG A;  1Q43 A;  2JD9 A;  1DGL A;  4FXK B;  1DDL A;  2ZGM A;  3N7L A;  4R9A A;  4CDU B;  1O7F A;  1RIT A;  4BIF A;  3LPF A;  1R08 1;  1EYB A;  2JDU A;  4OUM A;  4QX1 A;  3LD8 A;  1VMJ A;  5E1R A;  1HJG A;  2IVJ A;  2BBA A;  3TNQ A;  2NPI A;  1IG3 A;  4JQT A;  4A44 A;  3MPP G;  3WNN A;  5DAQ A;  3VZL A;  4BK5 A;  5LAS A;  1UZW A;  5LBC A;  3I2G A;  4Q4Y 3;  1Z0H A;  4NRO A;  1W90 A;  2K0G A;  3BCW A;  2QBX A;  3H7J A;  1JOB A;  3HT1 A;  2OKX A;  2XBO 1;  3SEP A;  1G8W A;  1LEC A;  1OSG A;  1S0B A;  4IEQ A;  4MGS A;  5CAZ A;  2XUE A;  4MZU A;  4XET A;  5I8Y A;  2VZR A;  5GLT A;  4Q5O A;  1Y7B A;  1HKD A;  1JHN A;  2AEY A;  4YW1 A;  2GP3 A;  1YFU A;  3BIE A;  3LDK A;  3AK0 A;  5L7O B;  4KGQ A;  5GZE A;  1LHU A;  2WAB A;  3B02 A;  3K75 B;  1B35 C;  2YMZ A;  3ME2 A;  3O14 A;  1UYZ A;  2J7M A;  2W68 A;  4O61 A;  2XVL A;  1Y3T A;  5KXE A;  2YDE A;  2ZEY A;  4YVW A;  5CIR A;  1JI6 A;  1DLL A;  2ZGS A;  3HJR A;  4LK7 A;  1MQT A;  3I3D A;  3SMH A;  4QX7 A;  4QM9 A;  5FYS A;  2E7Q A;  3P1I A;  1VBB 3;  3ILR A;  4QU2 A;  1J3R A;  2O14 A;  4XDO A;  3WNL A;  3VBU C;  5G05 L;  1QJU 3;  1WBF A;  1GZC A;  3SCH A;  4DZG A;  4Y4R A;  2RVA A;  3T08 A;  4XTP A;  1PIV 3;  4NWW A;  1PK6 B;  1ZZB A;  4A6S A;  4OCT A;  1OA2 A;  4V2W A;  1IS6 A;  3WF1 A;  4JGY B;  1LGN A;  3SKJ E;  3ZMN A;  5A3M A;  2PLV 2;  5CEH A;  1UW8 A;  5FO8 B;  1OLM A;  1PM4 A;  1ODN A;  1VB4 A;  4IV3 B;  4AHZ A;  3WLU A;  4ATF A;  3MFC A;  5DDJ 1;  2JE8 A;  3POY A;  1JZ6 A;  1QJY 1;  3J4U H;  4RGA A;  1JBC A;  3VBR A;  1GZT A;  1MAC A;  1WLC A;  4XF3 A;  2WNV A;  4IET A;  4COW A;  3I3M A;  3NO8 A;  4AAP A;  3VD9 A;  2HWB 2;  3VHP A;  2WZR 2;  1ZBA 2;  3PLQ A;  1O3Q A;  3NJY A;  3BOP A;  4R8H A;  2W1W A;  2WIN B;  4QT6 A;  3SLI A;  3DL3 A;  3IKW A;  4BM8 A;  3S0M A;  2AC1 A;  2B45 X;  1HXS 3;  2VCB A;  4LKD A;  1J59 A;  4A3X A;  1DU3 D;  4JDO A;  1SPP B;  3R4S A;  3B00 A;  5JOY A;  1PVC 2;  1AR6 3;  2R06 3;  3O12 A;  2R32 A;  4QQO A;  4UFK A;  3DYM A;  1GNZ A;  1LRH A;  5T3N A;  2BDR A;  1LED A;  4DNY A;  1JZ8 A;  3U0Z A;  3LFM A;  2IXC A;  4BCU A;  2W95 A;  4E8D A;  3KT7 A;  2H6B A;  2Y8K A;  4YVW C;  4DXZ A;  4LO7 A;  5KC5 A;  3V0A A;  3UGF A;  2F6B A;  3MUY 1;  3VBS A;  1MS1 A;  2D44 A;  5FY1 A;  2D3P A;  1W9T A;  4WVW A;  1S2K A;  1UZZ A;  1XJA A;  3ZFE C;  2ZX4 A;  4L2N A;  3HBK A;  2WO3 A;  3OY8 A;  3V64 A;  4QGL A;  5LZ6 A;  3GCW A;  3KHB A;  4JDM A;  3ZVX A;  1RYY A;  3LZZ A;  1UYY A;  5CFC A;  2NP0 A;  5HPO A;  3OBZ A;  4MOA A;  4WZF A;  1BZW A;  2K46 A;  2CGN A;  3KF5 A;  1JZ7 A;  3DCQ A;  3A21 A;  3AZY A;  1CPM A;  2R30 A;  1UOF A;  4KU7 A;  4CU9 A;  1ULG A;  1LOC A;  5FJH A;  1MZF A;  4MGI E;  2ENR A;  2RM2 3;  4TTG A;  2Y60 A;  2WNV C;  2BGO A;  5FZO A;  1YFW A;  1COV 2;  3IAQ A;  3H3Z A;  2GC2 A;  4K8R B;  4XQD A;  5F39 A;  4DS0 A;  2YGM A;  1ENX A;  1HRV 2;  2FDK A;  1X8M A;  4NOT A;  1NA1 B;  3HBZ A;  1OH4 A;  3CL1 A;  1H8T B;  2FZ1 A;  4X8P A;  4XUO A;  3VZJ A;  3R4U A;  4GMP 1;  4IV1 C;  5I0D A;  3BYW A;  3OJB A;  2LAL A;  3NST A;  3M70 A;  4PHZ A;  4FVV A;  4AYU A;  2ARA A;  5A6Y A;  1K5J A;  1SLC A;  2AGS A;  1CON A;  1CAU A;  1AR9 2;  3FUQ A;  2OVU A;  3POG A;  5A1F A;  5BNO A;  2X53 S;  2DVB A;  4PQQ A;  4RSU A;  1XE7 A;  2ZXQ A;  5IFT A;  4YM2 A;  4SBV A;  5CFD C;  1JUH A;  2P3I A;  5KHI A;  4OHZ A;  3BKZ A;  1P8J A;  4FAG A;  5LEJ A;  3A7Q A;  4CP1 A;  4BH9 A;  4WM8 A;  4K8F A;  1YI9 A;  3U78 A;  3ZSE A;  4AFC A;  1ULE A;  3OPT A;  1NCR B;  4UW6 A;  2QE3 A;  2IUW A;  3J8F 2;  5HXV A;  4R9D A;  4UBG A;  5ACA 2;  1W03 A;  4Y5S A;  3VZN A;  4UAP A;  1VP6 A;  1N3O A;  4M3C B;  1SLL A;  3H42 B;  4FO9 A;  4GH4 B;  4BOW A;  1YFX A;  1DQ4 A;  4BQ4 A;  1VAL A;  3AXD A;  3NL1 A;  2AH2 A;  1E5S A;  5T54 A;  4CP9 B;  5CFC C;  3UNP A;  3BOD A;  2Z5W A;  3IMN A;  1IQA A;  2A5Z A;  4DUV A;  1HV0 A;  1UWW A;  1W05 A;  4P9X A;  1OF4 A;  1O4Z A;  3TEZ A;  2EAK A;  4BK4 A;  2Q5T A;  1RXF A;  2B46 X;  3PTR B;  5IVY A;  1JN2 P;  4YNI A;  1NY7 1;  1US2 A;  5AVA A;  4PT6 A;  2OXB A;  4EJR A;  3JB4 C;  4YG6 A;  3ZPY A;  1KS5 A;  3WR0 A;  2ET1 A;  5M0T A;  1C5I A;  1R08 2;  4JX0 A;  2ZAA A;  2I45 A;  5JI7 A;  2DVA A;  4DY3 A;  4RQP A;  5FYM A;  4A41 A;  5FYB A;  4IES A;  4LIU A;  1XC6 A;  4NPL A;  3VN4 A;  4ASK A;  5IVB A;  2VZO A;  1JW6 A;  1O4Y A;  2DDU A;  2BFU S;  2H0V A;  1KJL A;  3E5Q A;  5ANQ A;  4ZU4 A;  2HWB 3;  3VHR A;  4XFB A;  4ARY A;  5BNO C;  2O1Q A;  2VZT A;  2ZMK A;  2WII B;  1MVQ A;  2XJP A;  3I4I A;  2WZR 3;  1ZBA 3;  2QVS B;  2K9Z A;  5CAD A;  3VDC A;  2XBO 2;  3H1Y A;  4UT5 A;  5EP9 A;  5T5O A;  4CZS A;  5A3W A;  3OB8 A;  4Z92 B;  1IS3 A;  1V6M A;  1RTV A;  5BNN A;  2XR4 A;  1RHI 3;  5ANN A;  5KR7 A;  4WM8 C;  5F1R A;  1UF2 C;  5A7N A;  2OZJ A;  1V6L A;  2VTF A;  3D4K A;  4ITC A;  1GZW B;  1PVC 3;  2N7G A;  1W8U A;  4PDW A;  3AZX A;  4Y22 B;  2WWJ A;  4AED A;  4EV0 A;  3LB9 A;  3POS A;  4R9B A;  1UZ0 A;  3MLL A;  2D6M A;  2GNB A;  1FMD 1;  5A32 B;  4AHW A;  2R0F A;  3VD3 A;  2ZHL A;  1DFQ A;  4LO6 B;  2VMI A;  4XUT A;  3I3E A;  5DUV A;  1DCS A;  3AZZ A;  1JTZ X;  4QXK A;  4KBB A;  5DAP A;  5FZG A;  1HQN A;  1LEN A;  3EMR A;  3I2K A;  3S6P A;  2XH6 A;  2XKO A;  1U5X A;  1W9W A;  3T30 A;  1SLI A;  1ZRR A;  4I0W B;  1ASJ 1;  1QDC A;  1U5I A;  4RHV 1;  3WDU A;  3EHK A;  4CDQ C;  1GMM A;  2CWM A;  2FDH A;  5FPX A;  2Q30 A;  5DDJ 2;  2DUP A;  2VNR A;  3B9C A;  3USS A;  1OQE A;  4CVU A;  1QJY 2;  5C33 A;  1GIC A;  3MEP A;  1C1L A;  1C28 A;  4RQP C;  4C1X A;  1G9C A;  1ULC A;  2YUE A;  3FLP A;  1CZT A;  1TME 1;  4XZP A;  3CQO A;  3HNB M;  3BTA A;  1COV 3;  4CDX B;  4XUN A;  2Y64 A;  1PMJ X;  2WS9 1;  1HN0 A;  2VY0 A;  2AAC A;  4NRM A;  1HRV 3;  2HJI A;  4GXL A;  4QM8 A;  4YFZ A;  5LA0 A;  1GR3 A;  1TNF A;  1AXK A;  2WFP A;  5BNN C;  1KD7 A;  2BZD A;  5FO9 B;  3FBM A;  1RMU 3;  3N9N A;  2P3J A;  5FZB A;  2BJS A;  2HWF 3;  5FY7 A;  1ND3 B;  4AL9 A;  1BVV A;  1CIW A;  4RGG A;  4PDW C;  5J1X A;  1AR9 3;  3O0W A;  1CX4 A;  4AED C;  4IND A;  2AYH A;  4BQX A;  2OII A;  2OW4 A;  4LBJ A;  3RDI A;  4Y24 A;  4B29 A;  5IVE A;  4GAZ A;  1F2N A;  4P02 B;  5J7M A;  1OD5 A;  1ENR A;  3FBY A;  3ZFG B;  1S0C A;  2G19 A;  1W3V A;  2QQM A;  5HCB A;  3VKF C;  1UD1 A;  5FV3 A;  4MXW A;  5GJ6 A;  1FV3 A;  4NO4 A;  1KJR A;  4BJ0 A;  2VOT A;  4N43 A;  2YZ4 A;  3LQC A;  3VUO A;  3J8F 3;  2BPA 2;  4WVZ A;  4FAH A;  4ASM B;  5ACA 3;  4NIA A;  1FPN 1;  2Y26 A;  1CAV A;  1OOP A;  5H9P A;  1OA3 A;  3OSD A;  5FUI A;  4MO3 M;  1MZ5 A;  4LIV A;  2QDN A;  3WNM A;  1IGO A;  2VBD A;  3RZJ A;  3WDX A;  3PIJ A;  3O1P A;  2HKX A;  3E5U A;  1JYT A;  5F5C A;  2BTV C;  3I97 A;  4EYU A;  1WZX A;  1QJZ A;  1LHN A;  5GKA C;  2X5I A;  4HK9 A;  3MDP A;  1UOJ A;  3GZT B;  1XOY A;  3K51 A;  4XJU A;  4NVP A;  4W6Y A;  5A7W B;  3V65 A;  1W2A X;  3WNK A;  4OHW A;  1R08 3;  3PUS A;  5DXD A;  1CZS A;  1HW5 A;  2WJS A;  2XON A;  1W28 A;  3BOW A;  2BER A;  4LTA A;  5E8A A;  2G1M A;  2QCS B;  2XHN A;  1F4H A;  2NQY A;  2WDB A;  4QB1 A;  5T55 A;  4BHP A;  1X7N A;  4MET A;  3USU A;  2DBI A;  2JG9 C;  2VUD A;  4W6X A;  1K42 A;  2O0O A;  2ZZQ A;  3PJQ A;  1YJL A;  4IUG A;  5EZW A;  2BRT A;  3ES4 A;  3NAP B;  1AL2 1;  2XBO 3;  2XLF A;  1KEX A;  4Q4X 1;  5GZG A;  1HLC A;  2WT2 A;  4X8N A;  4N7U A;  1WCU A;  1RUD 3;  3ASI A;  4XF0 A;  3RS6 A;  3KS7 A;  1TG7 A;  3D3A A;  3BN6 A;  1OI6 A;  3BGA A;  4XAA A;  2D6K A;  4CDU A;  1GWM A;  1W6Q B;  2OQ6 A;  4N43 C;  2VVE A;  3VKN A;  1ZZC A;  1H1I A;  3PMS A;  4HSL A;  1R1A 1;  2WT1 A;  1QH7 A;  5FYU A;  1KXG A;  3JXS A;  1OOP C;  1DZT A;  5JLV A;  2ZX1 A;  5I0S A;  5I8T A;  1CAW B;  1W0O A;  1GWK A;  5FP8 A;  5CB7 A;  5DAW A;  3KV9 A;  3KV6 A;  3ZIX A;  3X29 B;  3TEX A;  5LA2 A;  2W1S A;  3FLT A;  2E53 A;  2C4X A;  4QHO A;  3VBO B;  1NY7 2;  1FOD 3;  1VBA 1;  5C7G A;  3CZU A;  3GHM A;  2CGP A;  2X5I C;  4FOW A;  3NNF A;  3SH3 A;  2L9L A;  3WF3 A;  4LT5 A;  5F3I A;  5B2G B;  3Q8B A;  1US3 A;  2CWS A;  3OG2 A;  2PN5 A;  3Q8A A;  3KF3 A;  5L7O A;  2D98 A;  1I3H A;  2VAU A;  2PHL A;  4RFT 0;  2Z4F A;  4L8Q A;  5DDJ 3;  1F5F A;  4CCK A;  5JPM B;  2RG4 A;  4E4Z A;  1QJX 3;  1QJY 3;  2VZ3 A;  4KWK A;  4LQR A;  1RUN A;  4WVM B;  3LIH A;  5KXD A;  4LJH A;  1U5Z A;  5FPB A;  2A75 A;  2YFZ A;  5FZ8 A;  2HWC 3;  3M3O A;  4U36 A;  4UW3 A;  1J3Q A;  1PNG A;  5HCA A;  3THT A;  4XCB A;  1F9K A;  5A3U A;  3ZKY A;  4ATE A;  3AYC A;  1MS4 A;  2WN3 A;  4XDP A;  2PFW A;  1C4R A;  3LEG A;  4Z82 A;  5F6K A;  1BLZ A;  1NZC A;  2R1B A;  1F4A A;  4COV A;  1Q3E A;  2PEL A; 
#chains in the Genus database with same CATH homology
 1POQ A;  1PM4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...