1POQA

Solution structure of a superantigen from yersinia pseudotuberculosis
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
118
structure length
118
Chain Sequence
RIPNIATYTGTIQGKGEVCIIGNKEGKTRGGELYAVLHSTNVNADMTLILLRNVGGNGWGEIKRNDIDKPLKYEDYYTSGLSWIWKIKNNSSETSNYSLDATVHDDKEDSDVLTKCPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal and Solution Structures of a Superantigen from Yersinia pseudotuberculosis Reveal a Jelly-Roll Fold.
pubmed doi rcsb
source organism Yersinia pseudotuberculosis
molecule tags Immune system
molecule keywords YPM
total genus 14
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2003-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09144 YpM Yersinia pseudo-tuberculosis mitogen
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.510 Mainly Beta Sandwich Jelly Rolls Mitogen Ypm 1poqA00
1POQA 1PM4A
chains in the Genus database with same CATH superfamily
3Q8AA 5J98B 1H9PA 4LBLA 4XIOA 3W21A 5IFPA 3GZAA 3MIDA 5JDBA 5GZCA 3POIA 4NWVA 2EVXA 5JOZA 4OHVA 3MLLA 3ES4A 1A8DA 1BHGA 2VL4A 4MXWB 4B4QA 4NPRA 2WZPP 2YDEA 4AI8A 3TN93 4CDUC 5BNQA 2IC1A 3CL1A 3C7FA 5TSWA 2RS12 4CEYB 1EAH3 4L99A 1JZ7A 4RHV2 2AH2A 2NM1A 3U4SA 3KF5A 3DPRC 1UY0A 3I3QA 1AR63 4OUSA 4D6RA 4IE6A 4S2GA 5A3NA 1Q8VA 1UXXX 4P08A 5DZEA 4JGYB 4HOOA 1JZ3A 3O1RA 1W2TA 3HQXA 1YEWA 4NHLA 5CA6A 5I91A 3DN7A 1GYKA 1UZWA 2R061 3OGRA 1NCRC 1VPHA 2DU1A 4COUA 1AX2A 1QEXA 2VQ0A 4GKXA 4FAHA 4JGZB 1NUKA 4ZS3A 4NRMA 3GXUA 2YGMA 3HOBA 5LBCA 4ORFA 5K0UC 5FUNA 2QQJA 2ADEA 3JUUA 4IGOA 3LEGA 4O61A 5A32B 5JCTA 1OPOA 4W6WA 1PGW2 1W6OA 4DEVA 3MIHA 1Q8PA 4RQPC 4AEDC 2YC4A 4UT5A 1WLCA 5KBFA 5B4XA 2JG8C 1VBA1 3A4UA 1TNFA 1OC1A 2GMEA 3M3CA 5IK5A 1NA1C 1APNA 1AJOA 1BYHA 2ZKNA 3LEMA 1TQ5A 4N43C 3WCRA 1O5UA 1ZRDA 1PO22 1W8WA 1WUVA 4XEZA 2QTWB 2Y0OA 3B3QE 3NO8A 3V56A 1POV0 1VBC2 2BBVA 4UF0B 2WBKA 1GP6A 3HT1A 5I0RA 4XQWA 2F4PA 1MQTC 4Y1UA 4NAMA 3ZSLA 4Q0SA 4GXLA 4QM9A 4K8RB 4YW3A 5FYZA 5DG1A 2R1BA 3UJOA 1ENQA 3C3VA 4HONA 4PF5A 1UCXA 1G7YA 1VB4A 3F95A 4QPIB 2BNOA 3AFKA 3M7AA 1DGWA 1N1SA 2C9KA 1GICA 1OLRA 3LWCA 5G05L 4AGRA 1JW6A 1HRI2 2B46X 3DL3A 1KDKA 3PTYA 3MBWA 2E33A 2QCSB 3J4UH 1W8TA 4IV1C 1QJX3 3WNNA 1DQ4A 4EN7B 1YLLA 4XURA 3KGZA 5EIYB 4TLGA 3PLQA 4YPJA 4AGGA 5BNOB 2JG8A 4YVWA 1OI6A 2RR13 1OA4A 1VALA 2EAKA 2EXHA 3EB7A 4QX1A 4ARYA 1G86A 1GQGA 1NXMA 1U5YA 3WNKA 1TMF3 2ZMNA 3I59B 2QQNA 4UF0A 4EZ4A 4B29A 5A7WA 4YZ5A 2SBAA 3C8XA 4R9AA 5JMOA 2D6PA 4NRQA 1HW5A 1VR3A 1S0GA 2JWPA 3H0OA 1TZOA 4LO8A 4N43A 4B8EA 3N7MA 5JZGA 4DQAA 3MIFA 1VMHA 4LORA 4V2VA 3R0RA 4CDWC 2DF7A 3RZLA 4Y1YA 4EN0A 1JODA 2D7FA 3N7LA 3GJBA 4YNIA 3ZYIB 4AI9A 2DUQA 3THDA 5KHGA 2B42B 4UFKA 2XLAA 4MADA 1FV3A 2WFF3 1HXS1 3P6BA 3PU8A 4GMP1 4NOTA 2E6VA 4RL7A 4XJZA 5DDJ3 4F3JA 5AVPA 5CIRA 2J22A 3VD3A 4YFZA 5A1AA 4Q1PA 3ZIWA 4TLFA 3HNBM 2VMGA 3OTFA 2BU9A 5CBLA 5ACA2 2IWGB 1C8M1 3MLKA 2BJSA 2WLQA 1IS3A 1S4CA 1Y7BA 3EYPA 3X29B 4KBZA 5FZOB 4LKSA 4O65A 3GDBA 5A7PA 5LA0A 1UPIA 2JJ6A 4JQTA 2DU0A 3VHRA 3ACFA 5DABA 2GZWA 2VNVA 5FP4A 4CU9A 2NP0A 2FD8A 4EN8B 1VAKA 2PAEA 4FAGA 1HRI1 2F17A 4I09A 1BJQA 1PIV1 4IQPA 3T0AA 1BK0A 2P34A 4LHNA 4ZU4A 4BIFA 5JXJA 2R043 4N43B 4XJ9A 1NZIA 2VE1A 4ZZ8A 2DUOA 2MHFA 1URXA 3DUIA 3KMHA 2A6YA 3IMNA 3KCCA 1QJU1 2VOWA 3JD73 1Z7S1 3Q9OA 4IEXA 1F2NA 5FREA 3UGHA 3TEZA 5HXMA 2XQXA 3AZZA 4GULA 4I0AA 3WOGA 2E9QA 4XAEA 2UWBA 2K2SA 1O8SA 1RUG2 2E51A 2Z79A 4YVSC 3RVHA 2Y6FA 3M2MA 4J1XA 4XDQA 2AEYA 2PHUA 2Y38A 4IETA 4QGMA 3ATGA 1Q5OA 1YFWA 4BPZA 2PHLA 1LR5A 3DECA 3M4FA 5FZHA 4XZUG 4IL7A 3U10A 2OA2A 3W9AA 4AW7A 4KBBA 2QDNA 5B2GB 3MPPG 4PJYA 1R1A3 2WABA 2OUJA 1CPNA 4E4HA 3CJIA 1RUC3 1GZTA 4A44A 2BGPA 2FBEA 5J48A 1UYYA 3JXSA 1AR61 2WA3A 1CAXA 4LIVA 4QX2A 4XVHA 1R093 3V0BA 1LGBA 1DCSA 3E6DA 5FWEA 1LECA 2YBSA 4BQYA 2A5ZA 4YM1A 2JE8A 1RHI1 3B00A 2WUHA 1O59A 4PF1A 3AYCA 4QB1A 4X8PA 3HNMA 4K1ZA 5FXZA 2CGOA 1SQ4A 2PLV3 4AI0A 3WP6A 4LOTA 2XJSA 3CU7A 3S7EA 5C9AA 5I0SA 2EXIA 1O7FA 2FDKA 2Q30A 4LO7A 1FPN3 4XFIA 3VN4A 3DKWA 5LW9A 4D7TA 1ZZ6A 4AG4A 5EPAA 4KG0A 4CP1A 1HRV3 4MX3A 3EMRA 2RVAA 1MS4A 1YFXA 2AUYA 1AR91 1Q56A 3H3LA 1W8ZA 1OT5A 1RXGA 2W1WA 3NRUA 3OGGA 3T1LA 1EP0A 4E4SA 2OPWA 3CKHA 3KQRA 3VBHA 4ZY9A 1W99A 4FPYA 2DVGA 2FCVA 3ACLA 3LD8A 4K7JA 5FQ0B 3WD5A 2BW8A 3O0WA 4QX5A 1NXD1 1BCXA 5APAA 5KC6A 1IG3A 1OUXA 1N47A 2YV8A 5IHRA 2VD7A 1SLTA 5FBZA 5FKCA 1J1LA 1O4ZA 3OF1A 5A7QA 5LB6A 1N3PA 1AR73 4AE2A 1LNSA 1QDCA 5DAXA 2VOKA 1LHNA 1VBB3 2IXCA 1ZRIA 2V73A 1AYN3 4CTEA 2HJIA 5K7PA 3ZSKA 5K0UB 3H7JA 4J6GA 1XRUA 2GMPA 4N53C 2GP5A 2K0GA 3OBAA 5EXOA 1ZNPA 2OPKA 4BOWA 1R083 1BVVA 1O4YA 2DDUA 2WDBA 4YGBA 3PUIA 3A23A 4P9IA 2D93A 3CHXA 2X09A 1YNAA 3FBYA 3RZGA 2ORZA 2G9GA 2ZAAA 5FUPA 3RWNA 5A6QA 1HQNA 2ENRA 4JHZA 4BU2A 1VBB1 5A3MA 3RZMA 3QH7A 2GN3A 3BIEA 5HCBA 3BTZA 1LOAA 4Z2AA 4P02B 4ZU7A 1EV12 4XUTA 1MQTB 2JKXA 4P9GA 4QQOA 2HYKA 4NAOA 3WQ7A 1RUOA 3PHMA 2JDPA 1VBE2 3LSDA 3POFA 1W8HA 1VRH3 2XBO1 4QPIC 3QACA 2K46A 4KGQA 5EYXA 1MZFA 2QQWA 5A1LA 3LQCA 1KFXL 1YJLA 2ZZJA 2HWE2 4GIQA 1VAMA 3PVEA 3U37A 4OCTA 4KNCA 2XLGA 3H42B 5FYYA 3HR9A 3OYWA 1H0BA 3KT7A 3S5QA 4FSJA 1NE6A 3I3DA 3VKOA 2IZWA 1WLWA 2GC1A 3OSDA 5CKNA 3NKGA 2Y0IA 2VUCA 4IERA 3R05A 5CG9A 5FMBA 4DZGA 1HN0A 2YROA 3BTAA 1JUIA 4O9EA 4YM2A 4BQXA 2OXBA 2XBO3 4EV0A 1WZXA 5F3EA 1PK6A 2V4VA 3MICA 4XCBA 2IXKA 3B69A 1CONA 3WG4A 3UKVA 1MVQA 1HRV1 4LBKA 4YM3A 3FFQA 1DQ1A 1DGLA 4KH9A 4M0NA 4W65A 5FZAA 2WNUC 1VB2A 3OPWA 5IATA 4PDWB 5K8SA 3AZYA 1XYNA 3FBMA 1DF0A 1QNYA 3I2HA 3KHBA 2CGPA 1ODMA 1J59A 2P3YA 1W9TA 4RFT0 1OH4A 4A4AA 1H8VA 1LU1A 4YM0A 1AZDA 1LOGA 2OW4A 2CSGA 4TYSA 2J1RA 4JDOA 1NQJA 3BOPA 3ZN4A 4GA9A 4EQVA 3J8F3 3QBQA 2R0FA 4ES9A 2UY8A 3GGLA 5SV5A 4QKDA 2YU1A 3U14A 4COWA 1HXS3 4GMP3 1X50A 5DDJ1 4BLJA 1UY2A 4CDUB 4IEVA 1F4AA 2B5HA 2VZ3A 2X53S 4XILA 2WRAA 5AVAA 4DXTA 1MEC3 4EWEA 3N35A 4FP3A 4BDVB 4Z8BA 1WD3A 2E63A 2B4KA 5HCHA 1UYZA 1OURA 2BERA 2J1AA 3ZOIA 1Q8SA 3ITQA 1ULOA 4OULA 3MLJA 2R041 4OVEA 2GN7A 4HBNA 3SKVA 5FWJA 1QKQA 5F37A 3VDDA 4MGTA 3SH4A 2PFWA 4BQ5A 2VCBA 2ZMKA 1VIWB 4C8DA 2HWB2 1T6GC 5FLHA 2VW2A 2XPJA 1UXZA 3PUQA 5EQUA 2D6OX 2WS93 3VZMA 5ABJC 3H50A 1WWYA 3AZWA 1JU3A 3ZSJA 4EWDA 1LHUA 3VL9A 4CEYA 1S1AA 1OQEA 5LK7B 1MR5A 3J7LA 5EFUA 1HB3A 3RSJA 5CZKA 2UWAA 5E1RA 5FIXA 1BVP1 2EIBA 3C7HA 3PDQA 3O0XA 4QGLA 1SZBA 1T2XA 5A33B 1ODNA 1POV1 3WHUA 5FPLA 1UOBA 2PHTA 2XL9A 1YCIA 3Q8EA 3WF3A 4V2WA 4BQWA 3K4DA 5F6LB 3K4ZA 5F5AA 5F8PA 4Y5TA 3UGGA 3POWA 4R9DA 3HVDA 2D6LX 1UZ0A 4BLIA 1F31A 2JICA 1W06A 2BDRA 3CLPA 4XDOA 2GMMA 5JIAA 2AACA 3E1F1 3WV6A 1SCSA 4CCMA 2W5FA 1K5MC 3WINE 4HK8A 3ZFFB 1JXNA 1D4M1 1FYUA 2E53A 2ZGQA 5I0UA 1OF4A 4HG6B 1VBD2 1ASJ3 1Y9MA 3I2GA 3N9QA 4HSLA 3D8CA 4U36A 1ASJ2 1VBD3 4QB6A 4XBNA 3RGBA 3ZR5A 4AFBA 4BISA 4CRQA 2J1UA 3QLQA 3WDVA 1TME1 1MS3A 4IE4A 4YG0A 4D3WA 2GC0A 1G9CA 1SFYA 3BU0A 4KWLA 4OQ8A 2VNOA 1ACCA 1PVC3 3WDYA 4QMAA 4NVPA 4BYYA 3IAPA 3ST7A 1GWMA 2NLRA 2XMLA 3RMXA 5KXEA 4E4ZA 2A71A 5ANNA 2YBPA 1SLAA 1A8MA 5JOYA 1RUH2 5IVJA 1QJEA 3N9LA 5IVBA 5LEJA 1AXKA 1NCQA 1UWWA 2MPFA 2ZAHA 5DMYA 2DCYA 3WLUA 5LRSA 2R7EB 3O1SA 3A0KA 4R9BA 2P3KA 4QX0A 1GFF2 4AK3A 5C3PA 4A45A 2V09A 3TWIA 1CX4A 4CCNA 4MGSA 5E8AA 1W6QB 2VC9A 1OLME 4G3YC 4O9GA 3TEXA 3ZPOA 4GALA 1AUYA 3GJAA 4AR2A 3J7NA 1JHJA 2DTYA 5FBJA 1DQ6A 1NLSA 5A6ZA 1K3IA 1BBT3 3I2JA 5IJRA 5C3SA 5I8YA 4DFSA 3C7GA 5EZWA 4EJRA 5JZGC 1SLIA 1UKRA 2WKKA 4L92A 4TZDA 4ITCA 3WXPA 5IVEA 5C9AB 1GZCA 4EYUA 2O1QA 4A3ZA 2VU9A 4IGPA 4OHXA 4OHWA 1H4GA 2HBTA 3MW4A 4HPKB 2JDAA 3ZFGC 5J7MA 1Q3EA 1W05A 1AX1A 1U0AA 3I8TA 5JOWA 1RUF3 3ZSMA 1JYNA 2DBNA 1YI7A 3ZKUA 2Q8CA 3K3OA 5I0DA 5CFDB 4YLZA 5KHHA 1D0GA 2JD4A 5FLIA 1IKQA 2RM23 1XSRA 2JIGA 2ET7A 4QQ2A 3KD4A 2HH9A 3GZEA 4DY5A 3AYDA 3HN3A 4A7KA 2ZXQA 4R4XA 1FX5A 1K45A 2ADDA 2CGNA 4LBQA 3RNSA 4QHOA 2OQ7A 2PAKA 3CJIB 2IXHA 4BXSV 1W9WA 4CYDA 4E4DX 2FCUA 1GNYA 2UYAA 1EPWA 2JD9A 5DPNA 5IVYA 1GR3A 2PHFA 3ACHA 3NVCA 4AVAA 2XGXA 3K4AA 4DRVA 4AVBA 1C28A 1GKBA 1OD3A 5HCFA 4EE2A 4OFGA 4RQPB 4AEDB 4LMFA 2JDMA 2ZBJA 1ZZ7A 3B93A 2ZJCA 4QU2A 5JUVA 2UURA 3FC0A 1JZ5A 3NAPB 4XHXA 2HWD1 4Y26A 4Y3OA 1UU4A 2A70A 2SLIA 3T2OA 4AI2A 1DIWA 3AKRA 4XW3A 2VJXA 3LDBA 2DUPA 4DUVA 2ARCA 4LUMA 4D0QA 2CDOA 3MV01 2BGCA 3A7QA 1V6IA 3AX4A 1VRH2 2ORXA 2W08A 2ZEYA 3CBNA 1US3A 5EHDA 1Q8OA 3VD9A 3WW4A 1MEC1 4PQQA 1J58A 2KM2A 2YG0A 1HJFA 3OEBA 3K3NA 4GB33 3R4DB 2TNFA 4LE3A 2PXJA 4XUPA 5KXBA 4Y20B 1CX1A 2BOIA 1QJFA 5FLJA 1UOJA 4QKBA 4YW7A 1ZA7A 1Y3TA 2XWBB 3ZR6A 1XU2A 1PMHX 1LOFA 4WM7C 4GQ7A 3ZN6B 2VOVA 2DBIA 3NL1A 5LASA 2BQPA 5EV7A 2VMCA 2WT2A 2ZGNA 1X82A 1R082 2PN5A 1OLMA 1NCQB 2Y60A 1Z7S2 4MYEA 2VMEA 1ZM1A 3M8LA 2QJVA 1IPSA 4EN6B 3ENRA 1S0IA 2P37A 3LE0A 4HN1A 2HWF2 4IV3B 3U0ZA 3RRDA 1MPXA 1VBB2 2VY0A 3Q8BA 2VZOA 5GZFA 1UOFA 3WX5A 4Z07A 4CSWA 2HWC2 2ZGSA 3VKMA 5HV4A 2V72A 3RG0A 3Q8FA 1KD7A 5GLUA 2HWD2 4AFCA 1JI6A 3N9NA 4EROA 2YY1A 1BEV3 1NY72 3E5UA 3OUJA 1RUH1 2WC2A 2UWCA 4YW4A 3WZ1A 1F9KA 1O3SA 3NV1A 2NPIA 1KGYA 1LENA 4AYUA 1PGL2 4AEKA 1SEFA 4XDPA 5FZMA 2EIGA 1QQP2 2ZABA 4HFSA 2A6VA 2D5FA 2WINB 4XF3A 3GNEA 4Q4Y3 3J7MA 1DLLA 3WNPA 1HKDA 4DUXA 2XUEA 5C5UA 4GH4A 2OYZA 2VZTA 4NHXA 3BVCA 4QX7A 4ZXKA 4JKKA 3WW3A 5JSRA 2YZ4A 4ZZ5A 5AC92 4K20A 2RHPA 5E89A 1XYOA 2WQ4A 2WYSA 3D0SA 2D3PA 1E5SA 1FPN2 4Q0QA 1NYWA 2VW1A 2C0ZA 1QWRA 3SHRA 2PHXA 4OI2A 1N3QA 2W0XA 1MVEA 2PLV2 3DV8A 1FPN1 3VBSA 3ZYJB 2Y6HA 3RFRA 4LITA 4BIOA 4Z92B 2DCKA 3JQXA 3U78A 1QOSA 1QJZA 1W9SA 3DEMA 2I07B 4JRAA 3FZ3A 5F2WA 4JRLA 5LBEA 1LJ7A 4E2GA 2L9LA 2D6KA 1VMFA 3FLRA 4JGZC 4OUEA 4ASKA 4AFAA 3N4MA 2QZ3A 5FMCA 5KC5A 3VZLA 1RVF1 1YYNA 3NMBA 4DY3A 1JYTA 1R1A2 1UU5A 1A6CA 2EA7A 2FHRA 2AEZA 2H0BA 3H7YA 4Q5OA 4LO5B 1W6MB 2YMZA 4FFFA 3VKNA 4A7YA 3GZUC 4CP9A 3T2PA 2OX0A 2A7AA 4HVOA 1OKQA 2HEWF 4A6SA 1YHFA 2EXKA 3UETA 2C4XA 3PURA 1H8TA 3VKFC 5H9RA 4UFHA 3ZMNA 1SFNA 4KL1A 4DXSA 1RUG3 3K75B 1ENRA 1W6NB 4JGYA 1W0PA 2NQYA 1SDDB 1JU4A 4IGQA 3O1PA 1CAUB 4XCAA 1R081 3LDRA 4XUNA 3Q8CA 5C4WC 3T1MA 2VVEA 2BWCA 2J1VA 4IE7A 3JD72 1UKGA 5LA9A 4BZ4A 2VR4A 1WMDA 3WHTA 1H6XA 4AVCA 2VQUA 3KT1A 4IV1B 2UU8A 5GJ6A 5IUQA 1P8JA 1W2AX 3RYKA 1QU0A 1W8NA 3ZFFA 3VHOA 1O5LA 3INAA 1ZBA3 1CVNA 4YVWC 1PX3A 3M1HA 3UJQA 4ATFA 4DEQA 5FOBB 4BQ3A 5F6KA 4MHRA 4DO0A 2KXLA 1LEDA 1W9YA 1X7NA 1SPPB 4CCKA 3W20A 3ZFEA 3VHNA 3LA2A 5IK7A 4BK5A 4UW5A 2AC1A 1XNKA 4YGCA 4SLIA 2BNMA 3VD7A 1UQXA 3WDUA 4AWDA 5F9TA 5EJ3A 5DUUA 2QVSB 1C5IA 4UW6A 3MI8A 2W1UA 1SLCA 5ACA3 2ZHMA 1ND3C 2HLEA 1UIKA 1O91A 4CE8A 1VJ2A 2ARBA 5GLWA 4E27A 5JSOA 3FFZA 3P1IA 5DDJ2 2WFF2 4Q4Y1 1OSGA 1YRZA 4ZONA 3VLBB 4ZKTB 4JHTA 4GKYA 3I54A 4EZHA 2WN2A 1XB9A 2LS6A 4URAA 1RTVA 1YC61 1REDA 1RGSA 2V4AA 3ZXDA 3SEPA 3NSTA 3AJYA 3V65A 5E6HA 1JYXA 2ILMA 2XJPA 4RA0A 1BZWA 2ZGKA 1PO11 4FP2A 4IEQA 2XVGA 3AMQA 3WP4A 3C2UA 2JG9C 1RHI2 4IEWA 2ZHNA 1AXYA 1X8MA 1TNRA 1BQPA 4YWAA 4TTGA 5IFTA 1HX6A 2VNRA 2WT1A 2ZX0A 1KDMA 3NWKA 3ZVXA 5FO8B 1LRHA 3OBZA 2ET1A 4IDZA 1JOBA 3OGJA 4P9LA 1UIJA 3WF0A 4NIHA 2RR12 3NAPC 2LW8A 1ZBE1 1RVF3 1FNYA 2IVIB 4B4PA 1RMU2 5DZFA 2ZGLA 3WW1A 1EPZA 2A6ZA 2H6BA 3DPRB 3ZYGA 2VQTA 4A6OA 5CVRA 1HRI3 5DN2A 3HQRA 3O12A 2XJVA 4IESA 4HXCA 3T08A 1J3QA 1RUD3 2CV6A 4GWIA 1AF9A 3SLIA 1NT0A 5JXHA 2EF6A 5JSPA 1JTZX 3GF6A 4M01A 3U11A 3VBRC 5BNNC 1XOYA 4LK7A 4QU1A 4XHBA 4XTPA 4QQPA 1W3XA 2HWB1 1UZYA 1XBFA 2PMWB 1VBC3 4QD2A 2R071 1ND2A 1Z78A 2YGLA 1U5IA 3HBZA 4FFHA 3H3UA 2XJTA 5KHKA 1PO23 2GALA 2FMYA 3OJBA 3ZYPA 2B39A 4GD4A 3WQ0A 3AP5A 1COV3 5GZEA 1YQ2A 3G6JB 3T2TA 4XQDA 4D6QA 4DXRA 2ATFA 2PHRA 4XF0A 1H8TC 1J3RA 2LTNA 3ZXGA 3I2OA 4K40A 3WG3A 5FV3A 3PUSA 1LGNA 3NV3A 1CIWA 2WO2A 4DMIA 4QT6A 2YXSA 5EP9A 4AF9A 5L7OA 4QXHA 2WO7A 1WLTA 4AFDA 4QKFA 3AKQA 4QXKA 3AYEA 3RJ2X 3SCGA 4BXFA 4UFJA 2XJUA 1HQLA 5GLZA 1CJPA 4DINB 3CZUA 2JB4A 3CEWA 1R091 4GH4C 1OXCA 1SLBA 5C5TA 1OA2A 5L19A 3FHIB 1QH7A 2VBDA 4MVTA 2RS33 3KHCA 2GH2A 3IDEA 5ERLA 1A3KA 1M4WA 1QJU3 3JD71 1TME2 2GNDA 1AR62 3NJVA 4PLMA 4M3CA 4FPGA 3AKSA 3OEAA 2VZ1A 2QFEA 3NQHA 4LOSA 1U5ZA 4RHV3 2XKOA 3OGVA 4KQ7A 1NZCA 3WCSA 1W8UA 2JDNA 2RS13 5FZ0A 3S57A 4U2AA 1HN1A 4OHZA 5HBAA 4LNVA 1J83A 1S0CA 3TN92 4YYOA 4YG6A 3WDTA 3SH3A 2BUKA 3WVJA 1RXFA 4UW3A 2WWJA 1JN2P 1ASJ1 4PLOA 3RZHA 4Y1VA 2P2KA 3ZX7A 3NV2A 4YZ1A 3ZN6A 3USUA 1OVPA 5ABJB 3MV11 4CZSA 2WZ8A 1XNDA 5FZBA 3W5MA 5FYTA 1FMD3 3USSA 5A3LA 4FVVA 4KWUA 4M4PA 4HLTA 1W28A 4H7MA 2ARAA 1XU1A 4QPGC 5JR2A 3TBDA 3BN6A 3OB8A 2R16A 5GLTA 2WZR1 2WNVC 1WCDJ 4YSFA 4YW2A 4MOAA 1AL22 2BVVA 3VGIA 1YXWA 1LOEA 3PNAA 2R6QA 4XABA 3IZOA 4AGVA 1OOPB 3GCXA 1POQA 3BUCA 3POYA 1L7QA 1DGRN 1C1FA 3ACGA 2DWRA 5IVFA 3ZKYA 4I3PA 2Z2SB 5BYNA 1OMIA 4BQ1A 1RC6A 1RUE3 1H2MA 1C8M3 1W2NA 2FCTA 2RS53 4K6BA 4KGGA 4CEWB 4X6RB 5K0UA 1C4RA 1CZSA 4ZS2A 5F5IA 3KM5A 5T52A 2QZ2A 4CCOA 3WNLA 3K77A 2NZ9A 3HNYM 2JDKA 1HB4A 4KWJA 1KS5A 2QBXA 2JE7A 4FTSA 4PIXA 2WSVA 2ZEWA 1O3QA 3M70A 3GBGA 3VDDC 2CAUA 4AEJA 1C1LA 3FL7A 3MYXA 2NMNA 3E5QA 4OUMA 3ILNA 2W46A 4XUQA 5FY7A 3LIHA 2YHJA 2A3WA 3VDCA 2YBKA 1XE7A 4YG3A 1YIFA 1HDKA 4AHZA 2OUHA 1TE1B 1UU6A 1TMF1 2GAUA 1EV11 4BK4A 4XAAA 2RDNA 1RUF1 4AXOA 3OBTA 4MH0E 4LBQD 3O5SA 4MUVA 1W6NA 5FZ6A 1W6QA 1PGL1 1LULA 2VMIA 3NNLA 5JAXA 5KR7A 3O1TA 1SPPA 1UY1A 1H30A 1IHMA 5T5OA 5EJZB 4GWMA 4QGNA 5CFDA 5CEHA 1DU3D 1EYBA 1POV3 5DZGA 1DYPA 1O3TA 3KCXA 1QJY3 3DPRA 1H2NA 5BY5A 3VBOB 1N1TA 3AKPA 4WZCA 1AL0G 5FZEA 4UW4A 3KT4A 2XDVA 4HPKA 2XLFA 3O1OA 4PQ9A 2WT0A 5A7SA 3AMMA 5L9VA 1PX4A 1GV9A 5ANQA 3H8UA 1W6PB 5FK8A 4IEZA 2CWMA 4M00A 2WNVB 5I8SA 1OA3A 1QJY2 4CP0A 4COZA 5FZDA 4AI3A 2P3JA 4LA2A 2UY9A 4I30A 1WCQA 3D5OA 2V5DA 2XWJB 3NNMA 4LBOA 4Q4X1 4DS0A 1VBC1 3TAYA 5HI0A 3WF1A 2BP6A 1WGPA 5CFCC 4XFAA 3GBWA 2QQVA 3NW4A 3HMYA 2GDFA 5FKBA 2JEMA 4FOYA 3W5NA 4QPYA 1S0FA 4V1PA 1PK6B 4QX8A 3RJRA 4FPFA 4OYUA 3W58A 2WLPA 2XHNA 1GU3A 1PZ8A 3O7OA 1ENXA 3IBMA 3VBHB 1ALYA 1OKOA 2G9ZA 3AP7A 5KXCA 2WN3A 4JCKA 3I2KA 3K46A 1LAJA 4HN0A 4B1MA 3QOPA 1M06G 4AHXA 2X5IB 5FP8A 3CNAA 5LY2A 4W6YA 1OLQA 2WJSA 3TNPB 1HLCA 1E5RA 5HCAA 3ZXFA 2ZPXA 1IPJA 1QDOA 1STMA 2NN8A 4XC9A 2ZGUA 2QQLA 1COV1 3BPZA 4P00B 2A1XA 5C33A 4K8FA 1RIRA 1WBLA 5BNOA 4JQRA 3LPGA 4LTAA 2C24A 2R073 2QQKA 2PAMA 3PJQA 1LESA 1JZ2A 1IOAA 1AL23 4BQ2A 2VTXJ 4XJUA 3WDWA 5FMOL 1ULPA 1JOJA 2BWAA 5FZLA 5T5JA 3IPVA 4N7UA 5C6CA 1ZZCA 3ZYBA 1UYXA 1H8TB 4MHUA 2VCAA 2DURA 2F6BA 1AX0A 1HB1A 2VG9A 2ZGTA 1W3VA 3IN9A 5DUWA 4QQHA 4C0BA 1FMD2 2DYCA 4D7YA 4KWKA 3E5XA 1VLNA 5FPAA 4BQ4A 1VRH1 4Y24A 4B7KA 2ETEA 3ZDSA 2DTWA 4L97A 5LATA 2GU9A 1QXPA 2PQSA 4H55A 2QDRA 4XE9A 4BM8A 5C8WA 2ZOEB 5FXWA 5DAVA 3UNPA 1AYM3 4NUBA 1ZA4A 1W2UA 4IV3A 4OLLA 2AENA 1GP4A 3JB8A 3CZJA 1I3HA 2C5DA 2GC2A 2VZSA 3DXUA 2Z42A 4LJHA 1GZ9A 4E8CA 1D4M2 1WA4A 4AAPA 1TME3 3EBRA 1QJU2 1I5PA 3VBHC 1XNTA 3PJYA 2RS32 3VDDB 4HVQA 1JOPA 5FAXA 1PVXA 4BMBA 3LF7A 3M3QA 1W0OA 2LALA 3NKTA 1FOD1 4XUOA 4MGIE 1C8NA 3T0DA 5F39A 5IK8A 5A7OA 3HAGA 3SKJE 2E7TA 2VXRA 2ZGPA 3QCWA 2VM9A 4D6SA 3USUB 1FAYA 1MACA 2Q4SA 4J1WA 2ZX2A 4ZXEA 2VVDA 2AREA 1PM7A 4CDUA 4MXVA 1R1A1 2DFCA 3SC7X 2YPJA 1FOD3 2ZGRA 4FPEA 5FPVA 4CDXB 5JZGB 1GMMA 1HJGA 2X5IA 4JTOA 5L36A 4LHSA 3S7IA 1Y9QA 1H9WA 2WAOA 5FZ9A 1VAVA 3BOWA 4NPLA 2Y33A 2D44A 1AR82 4IW3A 2VUAA 1OVSA 4LKFA 2EIDA 4LE4A 4N9IA 1COV2 2ZMLA 3KLSA 1JHNA 4LO6B 1PNFA 5K4LA 4CPBD 4BJ0A 4N90A 4NIDA 4QWNA 2R0HA 4BWOA 1HB2A 4JKMA 1C3HA 2FDIA 1BEV1 1O6UA 1CR7A 4MGYE 5BV6A 1C57A 1W0NA 4NIAA 4BMEA 1AL21 3FJSA 1FV2A 3ROUA 3VBOC 3WG1A 1ZREA 1RUD2 3V0AA 4QXCA 5AFBA 2WFPA 4CDWB 1PO12 5J1XA 5C4WA 3VBRB 4D8MA 1CWPA 4PBPA 2MEV1 3CDZB 1OFNA 2YPDA 1X9PA 1GZWA 4JZRA 2AR6A 3JBG2 4WM8A 5FUIA 3ZM8A 3OYWB 1D2QA 1RMU3 3LGRA 1UL9A 1QMJA 1F4HA 3FX3A 2Z5WA 1YUDA 3R6SA 3SQOA 4CUBA 5CFCB 1RVF2 4MV2A 4FBFA 2B9UA 2WSUA 4QQLA 4FPCA 3HWJA 1V70A 4ZU5A 1WA6X 3QH6A 5KHIA 4BA6A 2IXIA 1KS4A 1OH3A 1LB2A 1ND3B 4MG2A 5FRAA 2PLV1 1JZ8A 4OZOA 3OY8A 3NNFA 5T3NA 1ULCA 1RHI3 1PHMA 2P3IA 5F2SA 1U12A 4LIUA 4X8NA 3KVAA 3ECQA 4LA3A 2P17A 1V6OA 2D40A 2I74A 1OUSA 3DF0A 4LT5A 4S2HA 2QUOA 5C4WB 2NMOA 3FUQA 3IPVB 4XF4A 2WAAA 4XFFA 5CKQA 1B09A 4XXAA 5FZ1A 1S0JA 4JGZA 4KMQA 1AR93 1GOGA 1KITA 3NJXA 3NNJA 1HV0A 3GCWA 2VOTA 3MPBA 3TOJA 5FPXA 2DV9A 1W6MA 5IVCA 2IXJA 3UYJA 3B5LB 5JPMB 5T55A 4H7LA 1MZ5A 1VE0A 4P9YA 4L2NA 2B45X 4YZ4A 2IFWA 2VMFA 3IMMA 4WVMA 3RZZA 4XFGA 1UYPA 1US2A 3ETQA 4UI9L 3O1UA 3LEKA 3PL0A 4NIGA 2CHHA 2XH6A 4Y5Z0 4XACA 1IS4A 1I5ZA 3LDKA 4O7XA 1SFPA 4FFIA 3VDBA 2TUNA 1WMXA 3DYOA 5IWFA 1ZBA2 3ZDVA 4EN9B 3NAPA 3LFIA 5DAWA 3GALA 2LRPA 3BKZA 1YFYA 2BTVC 2OVUA 4PDWA 3POGA 3DCQA 4XYXA 4AQ6A 5C3RA 2O14A 4XXPA 3VBSB 3BIWE 4DRRA 3VD5A 1OQ1A 1Y43B 4M3CB 2EALA 4FQ4A 3UKNA 3B02A 1PMJX 1BK1A 4N9HA 4A41A 5CNAA 2VGDA 4W4ZA 3ELNA 2RE9A 1XNCA 3L9JT 5LBFA 5C9AC 5C8CC 1WBFA 4I02A 3HN1A 5J96B 4QXBA 1I1EA 1AYM1 2ZHLA 1YWKA 4CEYC 5IW0A 5HXVA 4Q4X2 4D7SA 3G7DA 2VECA 2VVFA 4RS5C 5ABJA 5FP7A 2WWSA 4OMDA 1ULFA 1PGW1 1V9U2 2WA4A 3LCPA 4UBGA 4FI9A 5A80A 3HIFA 4Y33A 5FZCA 5T5PA 1ND3A 4XBLA 2R062 2D6NA 4MXWA 1OBNA 1DQ2A 3AL5A 2BZDA 3PU3A 1CAWA 4P9JA 2JIJA 5D2AA 5LA1A 1WW4A 5JXIA 2VMDA 4C1XA 5GLVA 3KWVA 1ENSA 1XNAA 2FZ1A 3IDCB 5KWRA 3ZXLA 3BI3A 1RJ7A 2ZGMA 2WZR2 2Q8DA 5A32A 1V6JA 2CAVA 4ASLA 2Q1FA 3SNMA 1RUJ2 5AC93 3GZTB 3UL2A 2VXJA 4NO4A 1ZX5A 4CDXA 1YFUA 4N8MA 3OOXA 2JB8A 5FR3A 4LBJA 1LU2A 2RJKA 3CJIC 4NHMA 3N7KA 1MZEA 2WFF1 4Q4Y2 5A6XA 1V6KA 4M4RA 5JPNB 1QQP3 4IE5A 4JDNA 1NOVA 4KI5M 2W1QA 2XB6C 2W52A 2KA3A 3IM0A 3TN91 5C70A 3I97A 2XJQA 2E7AA 4XTMA 2QNKA 1BEV2 4JGYC 1H1IA 2O0OA 5SV8A 5T5LA 3BTXA 3DYMA 3FE5A 2HWD3 2XOMA 4I3GA 4OI1A 3WG2A 3M3IA 3BU7A 3IDAA 3VDAA 3MDPA 2HWC3 3MIGA 4CCCA 2GH8A 1L3JA 3OY8B 3VZJA 4Z82A 1WLDA 4Y22B 5A3OA 1H2LA 3VZOA 2R32A 4M3CE 5E16A 4L0PA 4XFBA 2HWF3 1S0DA 1R1ZA 4PHZA 2KR2A 1DQ5A 2DVDA 4PT6A 3WW2A 1Z7S3 3LFMA 2WL1A 1ND2C 1CAXB 2IUWA 5FZIA 3WEZA 2XUMA 1YO8A 4Q29A 4TXWA 1XC6A 4AEMA 1LEMA 2J42A 1RUE1 2JG9B 2RS51 2OKXA 3AMHA 4X6QB 1E5IA 1NX9A 3VBFA 3BCWA 3POEA 2BFUL 3PUAA 4Q0VA 3K2OA 3LA7A 4YW5A 3HD8B 1RB8G 3PIJA 1H6YA 1VBD1 1ZYBA 2VO5A 2WIIB 3I4IA 3ILRA 3OD4A 4GB32 3ALQA 4HT1T 4XF9A 2A3XA 4QDRA 3VHPA 1VP6A 4PI0A 1DYOA 3O14A 3ZXAC 4XQ4A 1V6NA 3DYPA 4Q27A 5DAQA 3VUOA 1RINA 4Q0PA 1CAWB 3I2IA 4M3CF 3BGAA 3T30A 3ZYRA 1GNHA 4AQTA 4CDQC 2WNOA 5GALA 2E32A 3HEIA 1UW8A 5J3UA 1IQAA 5L7OC 2W2IA 4K1YA 4MLOA 2VZPA 3WR0A 5J37A 3RYRA 4FPHA 3NNGA 3IKWA 4H14A 4KU7A 3N36A 4QDQA 5T54A 5C8CA 3IIIA 1H4HA 5LK5A 3IT8A 2JDUA 2ZTNA 2Q8OA 4RS5A 5FY5A 3KF3A 4QAWA 5D21A 2DVFA 4Q26A 2ZGOA 3H9AA 4XIKA 4BH9A 5FYMA 5J09A 2DCJA 3ZFFC 4Q4V3 4EWAA 2CL2A 1V6MA 3EQEA 2RJ2A 3NJZA 4NHKA 2VPVA 3EO6A 3LOIA 4ARXA 3RPQA 1CZTA 4RGAA 2RMU2 4CUGA 4AHYA 3MUY1 1ZBE3 3E97A 1GBGA 1WW7A 2A6WA 2IVJA 3KB5A 4QHZA 4R8HA 1BLZA 1UMZA 4YW6A 2Q8EA 2WR9A 4RHV1 2WNVA 1YI9A 2RM22 3PMEA 2C9AA 4KU8A 1YJKA 2GC3A 4QPGA 1F5JA 3HPNA 4FOWA 1V0AA 4YFWA 2GNMA 3ZFEC 2XXZA 5BPXA 2XG3A 2X8KA 1DGRA 4YVSB 2NYYA 4S2FA 4BB3A 4K3UA 1RUF2 2VZQA 1EUUA 2HYXA 1UOGA 3MGUA 4HANA 4RGGA 1LODA 2IXLA 1SBDA 3M3OA 5CG8A 3AL6A 4TWTA 3VZKA 1RUI1 4GJYA 2VAUA 1D0HA 3VL8A 4E2QA 3C7EA 1F15A 4JTNA 1S55A 2HEYF 4PI2A 1PK6C 1SACA 3U75A 2A73B 1BBT2 1JBCA 5L9BA 1NCRB 4YGDA 5ACA1 3HBKA 3S0MA 1W8FA 5CISA 3VBUA 3JB4C 4BE3A 3ORJA 1VBE1 3ZIXA 4CU8A 1X8EA 3VZNA 4MGKE 4Q4W3 4B1LA 1DZQA 2Y64A 4FO9A 5A3WA 4ET7A 5FYSA 3KQ4B 2DFBA 2G4IA 1ZRRA 5JI7A 1WW6A 4WZFA 1GNZA 4XFHA 4A42A 4IXLA 5CYYA 5EWSA 5LEKA 1VBA3 4Q8LA 4F7ZA 2XONA 1NLRA 2ZACA 2JG8B 3AP6A 4RGKA 1RUH3 3MZHA 1WKYA 4CXWA 4M0HA 2RS31 4LQRA 1E57A 4L8QA 2OS2A 4I0WB 3UESA 3VBRA 2AZ5A 4JV4A 5LCWL 4CEWA 4ISRA 1GQPA 1UMIA 4NN0A 1PVC2 3EJKA 3MFAA 2RS11 4RYDA 3WF4A 4NE9A 5FPUA 1ZRFA 2KD7A 1UZZA 2CY6A 5GM0A 5FZ7A 4WVMB 1UMHA 2JKBA 2PYTA 3MO4A 3KVBA 1MS9A 1NG0A 2BRTA 4LPLA 3U1XA 3MW2A 4FCAA 4NJ4A 5CFDC 5KXDA 2Q1ZB 5FY9A 4HKWA 3CF6E 2B7YA 5H9QA 3O1VA 2GP3A 3KGLA 1SDWA 3CIHA 3HJRA 2HWF1 5A3TA 3KCYA 4H2AA 1CAVA 1A78A 1AYN1 1WCUA 2VZRA 1UN1A 3AXEA 4LBQB 4XZPA 3KV6A 5FZFA 1FATA 4B7EA 1RL3A 2ZEXA 3SISA 1V6LA 1UO9A 4CUCA 4LR4A 3H8XA 1CGPA 3J8F1 1PO21 3I2DA 4CXXA 2HWE1 1CQ9A 4W6XA 1Y4WA 3J26N 2JXAA 1ULGA 1RYYA 4QDSA 2B8MA 5KHJA 4QM8A 1J1TA 2PA7A 1IQDC 4D94A 3ZXEA 4Z1VA 5A70A 3LEIA 1VBA2 1QQP1 3U07A 4Q2FA 3ZO0B 2WYFA 3ZYHA 5LWBA 4G9SB 4CEWC 1WW5A 5FY8A 4YW1A 3FLTA 3K51A 4GJZA 4Y5SA 2YUEA 5DXDA 4Q4W2 3SCHA 1LKNA 4LLOA 1ZZ8A 4R9CA 4NROA 5FYUA 4ASMB 5HPOA 4CDQB 3PUHA 2WS92 2ZX1A 4W8JA 3P3PA 4HVRA 2HWB3 1CAVB 5BNPC 4WVVA 3MIBA 1N1VA 3PMSA 1HV1A 1W39A 3OPZA 2I2SA 3OUHA 1RUD1 4QPIA 1QXRA 1R64A 1ZBA1 5D1IA 3VBFC 1QNWA 2ZS6B 4COVA 1ZZBA 3AK0A 3C7OA 1IS6A 4OMCA 3UT0A 3VKLA 5FJKA 3RZKA 2JDHA 1GOHA 2P6CA 2P1BA 4WM7B 5FJHA 1MEC2 3I59A 3OCPA 4L9BA 2RMU1 2W9XA 4PBOA 2HKXA 1HXS2 1RJ8A 1UF2C 4JVAA 3WSOA 1GUIA 3N7JA 3GYDA 2G1MA 4ES8A 1DQ0A 3J8F2 5A33A 5JMCA 2WO1A 4ATEA 1Z0HA 4GH4B 4WM8B 3GBFA 2R30A 1ZBE2 3PVBB 2D97A 2RMU3 3U4XA 3J7HA 3KS7A 1OOPC 2JECA 1AVBA 1UNBA 3AMNA 1LCLA 4OHYA 5FY1A 3JCIA 3RYPA 1E5HA 4META 1ST8A 4G4FA 4RR3C 3TNQA 3ZYFA 4YRDA 3VV1A 2WNUA 4Q4V2 3OD0A 5LBBA 1LOFC 1G6NA 3AP4A 3B9IA 5EJ1B 1GOFA 2XBO2 3J9SA 2FDGA 2JDZA 5A3PA 3OBRA 3TRSB 4NWWA 1OQDA 4A7ZA 2Q1MA 3QD6A 1DLCA 1JMUB 2Y6KA 4JDMA 1W90A 5I0TA 5T50A 3AYAA 4IEUA 4CU7A 2P5BA 3OUIA 3I3BA 4QPWA 4UOJA 2FDFA 2YB7A 3F2ZA 2C26A 2O8OA 1U5XA 1XYPA 2HWE3 3LIGA 4UXAA 2JDYA 3K48A 4WVZA 5BNNB 2FQPA 1L7RA 4FPKA 2YFUA 2Q5TA 4HZFA 2R49A 4CU6A 2A6XA 5BNPB 5CAZA 1VBE3 2W47A 3CMGA 3SMHA 4AZZA 4FFGA 2ZCWA 4HETA 3GHMA 1OHFA 4L11A 3AMPA 4PIZA 1UZVA 4YARA 2W95A 1QY4A 4KG8A 1EV13 1W04A 1OOPA 4LHKA 4S2DA 2EAAA 5FZKA 3PIGA 3POJA 4PLNA 3AZVA 4FT8A 5FOJB 5JI9A 1G9BA 2QQPA 4CXYA 1LOBA 5F32A 5LZ6A 5M0TA 1JYIA 1KJLA 5A1FA 2RJLA 1K5MB 1UX7A 2E31A 2WQZC 4F83A 4N7IA 3ZFGB 1IPKA 2RR11 4HK9A 5BNNA 4OI4A 3JBG1 2PHDA 5JR7B 3LKJA 4BCUA 3BTYA 3VBOA 4AL9A 5FP9A 1XXNA 2X10A 3V0BB 3MUZ1 4Q0UA 5FZ4A 4WM8C 1AYN2 3JU9A 2WO3A 1B35C 4HMZA 2BFUS 2Y8KA 3L2YA 1S0BA 5H9SA 1AR72 4AVVA 2H0VA 4IV1A 1BMV2 5A7NA 1IZ3A 2RM21 4R52A 4ZPIA 5JLVA 4YZ2A 4AVSA 1PGSA 1FNZA 1GQHA 1ZVFA 4C0HA 3E6CC 1WCKA 2BYVE 5FMOS 1K5MA 1QF3A 5DUXA 4HKOA 4CVUA 1RUJ1 4Q4V1 3N9MA 4PCRA 1ND2B 2W1SA 2X05A 1XE0A 2OZJA 2W68A 5FXXA 4LLFA 5GZDA 3RQ0A 2JG9A 4CCJA 5CKMA 1DGWX 3UV9A 3D3AA 5DUVA 1HRV2 4UYBA 2ID4A 2JX9A 1D2SA 2XVLA 5F7UA 3MF9A 4UBHA 1RUJ3 2Y26A 4CP2A 5G04L 4Q8KA 5B4NA 1WCSA 5LA2A 1W2OA 2RDQA 2EXJA 4ISQA 5AC91 3LPFA 3I49A 3NV4A 5FMDA 2WZR3 1J3PA 2DVBA 1F35A 4AQSA 1Y9GA 5D8AB 1PMIA 4INDA 3CO2A 3TYJA 1Q43A 2FZ2A 1K12A 1W6PA 1GSLA 1A34A 2CWSA 3AB0A 5GKAC 2VMHA 1R092 3P5BA 1B35A 1GWKA 4LEJA 1HIXA 4IE0A 4I2OA 1CD3G 1FI2A 2R063 2VW0A 2X29A 1GP5A 3RZJA 1RUC2 4H3WA 2VUDA 4A2UA 3FLPA 3WP5A 1V9U3 2VOXA 5I93A 1O4TA 4RSUA 4FOVA 4QX3A 4WV8A 4Q4X3 3H8OA 2D3SA 2WWUA 4HKLA 2H6CA 4DPNA 5FPZA 2XHKA 2W91A 1D7PM 3A0NA 3THCA 1G9AA 2HWC1 2WNUB 2ZHKA 5BUVA 2D3RA 4I0BA 1QIQA 2P4EA 5EYYA 1PM4A 1OFSA 4E2SA 3PVNA 1QOTA 4FPOB 4IV3C 1SBFA 3B9CA 3ZLIA 3CQOA 5HV0A 2G9FA 1H1AA 4R4ZA 3H1YA 3KZ4C 1TEIA 3V64A 4PDWC 5L9RA 3ME2A 3MEPA 1S0EA 4WVWA 4BHPA 1G8WA 3VD4A 1AJKA 1QOOA 4I01A 3ZFEB 3O0VA 1CN1A 3ETPA 1GLHA 1JUHA 3UGFA 2PQQA 1DZRA 1AR81 2R042 1REFA 4Y4YA 1B35B 3NJYA 5FCCA 3ZPYA 1DZTA 1G9FA 1BBT1 2K9ZA 1MZ6A 2VNGA 2ZEZA 3B01A 3IDBB 3I3MA 1QXJA 2W39A 3ABZA 4JAAA 4QKNA 3T4HB 2XKPA 2RDSA 1W03A 1KEXA 4F8AA 3KV9A 1PZ9A 4MSVA 3OG2A 4UFMA 1H1MA 3KV4A 5FQ0A 1BKZA 4YZ3A 1SBEA 3WQ1A 4XBQA 1NQDA 2GNTA 2VULA 1N1YA 4CDWA 1X33A 4LKDA 4XMAA 3ACIA 5IT6A 2XR4A 1QH6A 3I3EA 3LB9A 4DIQA 3BODA 5L7OB 2DCTA 1XNBA 2PELA 1AR92 3KSCA 3PVOA 2HBUA 4CPBA 1KRIA 3AP9A 1KFUL 2J1EA 4RFRB 2C6SA 5FFOC 3RWKX 4CDXC 4D69A 4AQ2A 4E8DA 4CCDA 5C8CB 5CB7A 1GWLA 3VBUC 3THPA 4FPLA 4LK6A 3JZVA 1MS5A 4XETA 5IAXA 3BYWA 1PVC1 2QQUA 5AFEA 1NA1B 4FXGB 3IIAA 4CCEA 2C1FA 1XQNA 3D82A 2Y6LA 2V5YA 2O8QA 2MNGA 1JYCA 1IS5A 4P14A 1EAH1 4RN5A 1TMF2 2UYBA 2AGSA 5F3GA 1AXZA 1YQ5A 4LUKA 4NHYA 4UWDA 3WUCA 2EICA 4C90A 4FTBA 1V9U1 2N7GA 5FYIA 2BGOA 2VBBA 4GAZA 1WMEA 5A6YA 1OF3A 1AHSA 1MQTA 5FPBA 4ONUA 4URTA 1W6OB 2XL7A 4MGZE 2OT7A 3JBG3 1QJX2 2GSYA 3SH5A 1FMD1 2I45A 2FDHA 1CAUA 1CJDA 1KJRA 3BB6A 5FDBA 1BXHA 2ZX3A 4N53A 4XJAA 2J1TA 4DUWA 1W9FA 5JOXA 3D0JA 1PO13 3OGSA 2VTFA 1HQWA 2VTXA 1WMFA 2VCMA 2ZZQA 4DXZA 3IB3A 1CESA 1H2KA 2CYFA 4Z2WA 5LRRA 3T4VA 3R4SA 4XJWA 5F5QA 1XE8A 3A21A 1X9TA 2A75A 4NMIA 2BVBA 2ZX4A 4C1WA 3LAGA 2VCCA 3P3NA 1SLLA 3I2FA 4K21A 2PHWA 1NY71 2E7QA 3LSEA 4FPJA 3T09A 5H9PA 3H1WA 2W94A 2ERFA 2ZKLA 1XSQA 4B4RA 3LOBA 3APBA 5D8AA 4DOUA 1WD4A 1D4VB 4MO3M 5F1RA 5FY0A 3FWEA 1MS1A 2DCZA 1AR83 1IG0A 4GMP0 1ZRCA 2CTVA 2WS91 5I8TA 4TSVA 2LROA 3AC0A 1O8PA 3ZN5A 3HT2A 1F8VA 5A3UA 5C7GA 1DG6A 2ES3A 3FHAA 5L73A 4OI0A 2W3JA 1FOD2 5ISLA 5FZOA 3RDIA 3TEYA 2FDJA 2YC0A 2J1SA 2OIIA 3AZXA 3WP3A 2VZUA 1OD5A 5IYYA 5JWPA 5K9YA 2DVAA 3HQUA 4LBMA 1LHWA 4GWJA 2YFZA 1YQ6A 3ON7A 4LULA 2RG4A 4E9KA 1ULDA 3RI8A 3JQWA 3E6BA 4Y1ZA 3PTRB 3ZSEA 2LUWA 4AFMA 4FXKB 1KXGA 3CJXA 4CCLA 4CA9A 5FY4A 4XFCA 3VBFB 2TBVA 1VMJA 4P9XA 4RR3B 1PNGA 5DAPA 5FYVA 5FK7A 4DNYA 3VBUB 5FZ3A 1D4M3 5BNPA 2CDPA 4UAPA 4QHBA 1X36A 2EIEA 5FYCA 5C3QA 1C5HA 1F5FA 4SBVA 1S2EA 1SCRA 3T0BA 1NLQA 3WNOA 1EAH2 2XJRA 3ZMOA 5FO9B 2RDRA 1NE4A 4B3NA 4XPVA 1TVGA 1CIYA 1DP0A 4JX0A 1AYM2 1I6XA 1FT9A 1IGOA 5DG2A 1UY3A 4YGEA 3ES1A 3IAQA 2Y6GA 3FN9A 4XF1A 3SCFA 2VH9A 1DYKA 3W59A 3TEWA 4UFIA 1NKGA 2VZVA 4IUGA 2QE3A 3FHQA 2WQ8A 4P9WA 4AHWA 1JH5A 4YVSA 3BALA 2IFRA 3IWZA 3LA3A 1DBNA 4LO4B 4Y22A 2D98A 2VQAA 4N53B 3ZFGA 2YC2A 1UAIA 1V00A 2BPA2 5IVVA 3TB0A 3T2QA 4QB2A 3LZZA 1DHKB 2Y6JA 2XVKA 1AR71 3POSA 4P5HA 1UX6A 1UPSA 2Z69A 3D4KA 3MFCA 1UY4A 3B7MA 5F5CA 3UK9A 2R072 3WNXA 3DXTA 3WY6A 4CP9B 3RI9A 3R4UA 1JZ6A 3FMGA 1K5JA 1ZZ9A 1LHVA 4TN7A 3SXWA 5CU1A 4PIYA 4IEPA 3DGTA 1NA1A 2Y34A 1QHDA 1EY2A 4IEYA 4Q4W1 2BBAA 1REEA 3A22A 4XMIA 2BNNA 2VUJA 3AM2A 1K42A 1NCQC 1ONAA 1TG7A 2GNBA 1SHWB 5A7WB 3SEEA 3WT3A 4FQZA 3RMYA 4CUAA 1RUI2 1RMU1 3MW3A 1Q8QA 3ZXKA 2BOJA 3N3HA 1N3OA 2MEV3 4GWNA 2QKDA 4MZUA 2RV9A 4YVWB 5BXXA 4A3XA 1KQRA 2LM3A 5J36A 5JIUA 1UD1A 2D6MA 3UKTA 3N9OA 4NR1A 2P6HA 3MIEA 4GB31 1MS8A 5F3IA 2D5HA 1MS0A 5GZGA 4JC1A 2BEOA 1CZVA 4IEOA 4RS5B 1GANA 1RUC1 1RITA 3V0AB 2OZ6A 4NIIA 4OZXA 3SITA 3WNMA 5JXGA 1PIV2 4Y4RA 4AAXA 4HSJA 3FUOA 2WNEA 5FZGA 4FOQA 3L2HA 3AKTA 1LHOA 4J25A 4C91A 3MHZA 3AFGA 3AVRA 5C3OA 1NAEA 3AJZA 2ZA9A 4WBBA 3T3YA 2B9VA 1S2BA 4UFLA 4MGQA 2BV4A 1XJAA 2CU5A 3H3ZA 1SG3A 5CADA 4ZHNA 4LXLA 5LY1A 5IK4A 3S6PA 2Z4FA 2AYHA 5FO7B 4WM7A 4QPGB 2Q0AA 3I7DA 1SMVA 1RUNA 3WQBA 3POBA 3ASIA 5FP3A 4Y20A 4XJ8A 3B94A 2QQIA 1W8OA 3URFA 2X5IC 3O1MA 1J84A 1QJY1 1OPMA 1PIV3 2FMDA 1JS9A 4RR3A 2CNAA 1YQ8A 4RQPA 3WDXA 5IAVA 4AEDA 3ILFA 3OPTA 3WF2A 5BNOC 2E26A 4AOCA 3H8RA 2HEVF 3D6EA 1RUG1 2PTMA 3GM8A 4XOGA 4Y1XA 3THTA 4P5YA 4CDQA 5FTTC 3MF6A 2W87A 1LOCA 1DDLA 4NPMA 2MEV2 4OQ9A 3H1MA 4JKLA 1JYWA 1YQCA 3S5AA 1BMV1 3EHKA 2G19A 3VB9A 1YIPA 5DQ0A 1RUI3 5FYHA 1PZ7A 2YU2A 4AI1A 5F3CA 1ULEA 1LTEA 2JE9A 4W50A 1JYVA 2YYOA 3AVSA 1JZ4A 3VBSC 1VRBA 2TEPA 4FTEA 5JVVA 2R1DA 2W92A 4LBNA 1EUTA 2WZEA 5D8AC 1T6BX 2D43A 4Q1RA 4NRPA 3ZXJA 3KV5A 3M3EA 1LGCA 2J7MA 4RD7A 3DKQA 4LHLA 3WUDA 1C8M2 4LKEA 1RUE2 2RS52 5C71A 1CPMA 3EXUA 5CFCA 1G9DA 2F4LA 2ARXA 2VBPA 3N9PA 1GZWB 1FXZA 5FXVA 2A3YA 3RS6A 1XPWA 3S30A 2QQOA 2OQ6A 2XQRA 4K9SA 1NCRA 4GZ9A 4HL0A 5FZ8A 2QQMA 4DB5A 5FYBA 4AVTA 3BPSA 2JENA 3GHNA 1L7LA 1S2KA 1I9RA 1O3RA 1IKPA 1QJX1 4COYA 1DFQA 5E88A 1QGLA 3AXDA
chains in the Genus database with same CATH topology
1POQA 1PM4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1POQ A;  1PM4 A; 
#chains in the Genus database with same CATH topology
 3Q8A A;  5J98 B;  1H9P A;  4LBL A;  4XIO A;  3W21 A;  5IFP A;  3GZA A;  3MID A;  5JDB A;  5GZC A;  3POI A;  4NWV A;  2EVX A;  5JOZ A;  4OHV A;  3MLL A;  3ES4 A;  1A8D A;  1BHG A;  2VL4 A;  4MXW B;  4B4Q A;  4NPR A;  2WZP P;  2YDE A;  4AI8 A;  3TN9 3;  4CDU C;  5BNQ A;  2IC1 A;  3CL1 A;  3C7F A;  5TSW A;  2RS1 2;  4CEY B;  1EAH 3;  4L99 A;  1JZ7 A;  4RHV 2;  2AH2 A;  2NM1 A;  3U4S A;  3KF5 A;  3DPR C;  1UY0 A;  3I3Q A;  1AR6 3;  4OUS A;  4D6R A;  4IE6 A;  4S2G A;  5A3N A;  1Q8V A;  1UXX X;  4P08 A;  5DZE A;  4JGY B;  4HOO A;  1JZ3 A;  3O1R A;  1W2T A;  3HQX A;  1YEW A;  4NHL A;  5CA6 A;  5I91 A;  3DN7 A;  1GYK A;  1UZW A;  2R06 1;  3OGR A;  1NCR C;  1VPH A;  2DU1 A;  4COU A;  1AX2 A;  1QEX A;  2VQ0 A;  4GKX A;  4FAH A;  4JGZ B;  1NUK A;  4ZS3 A;  4NRM A;  3GXU A;  2YGM A;  3HOB A;  5LBC A;  4ORF A;  5K0U C;  5FUN A;  2QQJ A;  2ADE A;  3JUU A;  4IGO A;  3LEG A;  4O61 A;  5A32 B;  5JCT A;  1OPO A;  4W6W A;  1PGW 2;  1W6O A;  4DEV A;  3MIH A;  1Q8P A;  4RQP C;  4AED C;  2YC4 A;  4UT5 A;  1WLC A;  5KBF A;  5B4X A;  2JG8 C;  1VBA 1;  3A4U A;  1TNF A;  1OC1 A;  2GME A;  3M3C A;  5IK5 A;  1NA1 C;  1APN A;  1AJO A;  1BYH A;  2ZKN A;  3LEM A;  1TQ5 A;  4N43 C;  3WCR A;  1O5U A;  1ZRD A;  1PO2 2;  1W8W A;  1WUV A;  4XEZ A;  2QTW B;  2Y0O A;  3B3Q E;  3NO8 A;  3V56 A;  1POV 0;  1VBC 2;  2BBV A;  4UF0 B;  2WBK A;  1GP6 A;  3HT1 A;  5I0R A;  4XQW A;  2F4P A;  1MQT C;  4Y1U A;  4NAM A;  3ZSL A;  4Q0S A;  4GXL A;  4QM9 A;  4K8R B;  4YW3 A;  5FYZ A;  5DG1 A;  2R1B A;  3UJO A;  1ENQ A;  3C3V A;  4HON A;  4PF5 A;  1UCX A;  1G7Y A;  1VB4 A;  3F95 A;  4QPI B;  2BNO A;  3AFK A;  3M7A A;  1DGW A;  1N1S A;  2C9K A;  1GIC A;  1OLR A;  3LWC A;  5G05 L;  4AGR A;  1JW6 A;  1HRI 2;  2B46 X;  3DL3 A;  1KDK A;  3PTY A;  3MBW A;  2E33 A;  2QCS B;  3J4U H;  1W8T A;  4IV1 C;  1QJX 3;  3WNN A;  1DQ4 A;  4EN7 B;  1YLL A;  4XUR A;  3KGZ A;  5EIY B;  4TLG A;  3PLQ A;  4YPJ A;  4AGG A;  5BNO B;  2JG8 A;  4YVW A;  1OI6 A;  2RR1 3;  1OA4 A;  1VAL A;  2EAK A;  2EXH A;  3EB7 A;  4QX1 A;  4ARY A;  1G86 A;  1GQG A;  1NXM A;  1U5Y A;  3WNK A;  1TMF 3;  2ZMN A;  3I59 B;  2QQN A;  4UF0 A;  4EZ4 A;  4B29 A;  5A7W A;  4YZ5 A;  2SBA A;  3C8X A;  4R9A A;  5JMO A;  2D6P A;  4NRQ A;  1HW5 A;  1VR3 A;  1S0G A;  2JWP A;  3H0O A;  1TZO A;  4LO8 A;  4N43 A;  4B8E A;  3N7M A;  5JZG A;  4DQA A;  3MIF A;  1VMH A;  4LOR A;  4V2V A;  3R0R A;  4CDW C;  2DF7 A;  3RZL A;  4Y1Y A;  4EN0 A;  1JOD A;  2D7F A;  3N7L A;  3GJB A;  4YNI A;  3ZYI B;  4AI9 A;  2DUQ A;  3THD A;  5KHG A;  2B42 B;  4UFK A;  2XLA A;  4MAD A;  1FV3 A;  2WFF 3;  1HXS 1;  3P6B A;  3PU8 A;  4GMP 1;  4NOT A;  2E6V A;  4RL7 A;  4XJZ A;  5DDJ 3;  4F3J A;  5AVP A;  5CIR A;  2J22 A;  3VD3 A;  4YFZ A;  5A1A A;  4Q1P A;  3ZIW A;  4TLF A;  3HNB M;  2VMG A;  3OTF A;  2BU9 A;  5CBL A;  5ACA 2;  2IWG B;  1C8M 1;  3MLK A;  2BJS A;  2WLQ A;  1IS3 A;  1S4C A;  1Y7B A;  3EYP A;  3X29 B;  4KBZ A;  5FZO B;  4LKS A;  4O65 A;  3GDB A;  5A7P A;  5LA0 A;  1UPI A;  2JJ6 A;  4JQT A;  2DU0 A;  3VHR A;  3ACF A;  5DAB A;  2GZW A;  2VNV A;  5FP4 A;  4CU9 A;  2NP0 A;  2FD8 A;  4EN8 B;  1VAK A;  2PAE A;  4FAG A;  1HRI 1;  2F17 A;  4I09 A;  1BJQ A;  1PIV 1;  4IQP A;  3T0A A;  1BK0 A;  2P34 A;  4LHN A;  4ZU4 A;  4BIF A;  5JXJ A;  2R04 3;  4N43 B;  4XJ9 A;  1NZI A;  2VE1 A;  4ZZ8 A;  2DUO A;  2MHF A;  1URX A;  3DUI A;  3KMH A;  2A6Y A;  3IMN A;  3KCC A;  1QJU 1;  2VOW A;  3JD7 3;  1Z7S 1;  3Q9O A;  4IEX A;  1F2N A;  5FRE A;  3UGH A;  3TEZ A;  5HXM A;  2XQX A;  3AZZ A;  4GUL A;  4I0A A;  3WOG A;  2E9Q A;  4XAE A;  2UWB A;  2K2S A;  1O8S A;  1RUG 2;  2E51 A;  2Z79 A;  4YVS C;  3RVH A;  2Y6F A;  3M2M A;  4J1X A;  4XDQ A;  2AEY A;  2PHU A;  2Y38 A;  4IET A;  4QGM A;  3ATG A;  1Q5O A;  1YFW A;  4BPZ A;  2PHL A;  1LR5 A;  3DEC A;  3M4F A;  5FZH A;  4XZU G;  4IL7 A;  3U10 A;  2OA2 A;  3W9A A;  4AW7 A;  4KBB A;  2QDN A;  5B2G B;  3MPP G;  4PJY A;  1R1A 3;  2WAB A;  2OUJ A;  1CPN A;  4E4H A;  3CJI A;  1RUC 3;  1GZT A;  4A44 A;  2BGP A;  2FBE A;  5J48 A;  1UYY A;  3JXS A;  1AR6 1;  2WA3 A;  1CAX A;  4LIV A;  4QX2 A;  4XVH A;  1R09 3;  3V0B A;  1LGB A;  1DCS A;  3E6D A;  5FWE A;  1LEC A;  2YBS A;  4BQY A;  2A5Z A;  4YM1 A;  2JE8 A;  1RHI 1;  3B00 A;  2WUH A;  1O59 A;  4PF1 A;  3AYC A;  4QB1 A;  4X8P A;  3HNM A;  4K1Z A;  5FXZ A;  2CGO A;  1SQ4 A;  2PLV 3;  4AI0 A;  3WP6 A;  4LOT A;  2XJS A;  3CU7 A;  3S7E A;  5C9A A;  5I0S A;  2EXI A;  1O7F A;  2FDK A;  2Q30 A;  4LO7 A;  1FPN 3;  4XFI A;  3VN4 A;  3DKW A;  5LW9 A;  4D7T A;  1ZZ6 A;  4AG4 A;  5EPA A;  4KG0 A;  4CP1 A;  1HRV 3;  4MX3 A;  3EMR A;  2RVA A;  1MS4 A;  1YFX A;  2AUY A;  1AR9 1;  1Q56 A;  3H3L A;  1W8Z A;  1OT5 A;  1RXG A;  2W1W A;  3NRU A;  3OGG A;  3T1L A;  1EP0 A;  4E4S A;  2OPW A;  3CKH A;  3KQR A;  3VBH A;  4ZY9 A;  1W99 A;  4FPY A;  2DVG A;  2FCV A;  3ACL A;  3LD8 A;  4K7J A;  5FQ0 B;  3WD5 A;  2BW8 A;  3O0W A;  4QX5 A;  1NXD 1;  1BCX A;  5APA A;  5KC6 A;  1IG3 A;  1OUX A;  1N47 A;  2YV8 A;  5IHR A;  2VD7 A;  1SLT A;  5FBZ A;  5FKC A;  1J1L A;  1O4Z A;  3OF1 A;  5A7Q A;  5LB6 A;  1N3P A;  1AR7 3;  4AE2 A;  1LNS A;  1QDC A;  5DAX A;  2VOK A;  1LHN A;  1VBB 3;  2IXC A;  1ZRI A;  2V73 A;  1AYN 3;  4CTE A;  2HJI A;  5K7P A;  3ZSK A;  5K0U B;  3H7J A;  4J6G A;  1XRU A;  2GMP A;  4N53 C;  2GP5 A;  2K0G A;  3OBA A;  5EXO A;  1ZNP A;  2OPK A;  4BOW A;  1R08 3;  1BVV A;  1O4Y A;  2DDU A;  2WDB A;  4YGB A;  3PUI A;  3A23 A;  4P9I A;  2D93 A;  3CHX A;  2X09 A;  1YNA A;  3FBY A;  3RZG A;  2ORZ A;  2G9G A;  2ZAA A;  5FUP A;  3RWN A;  5A6Q A;  1HQN A;  2ENR A;  4JHZ A;  4BU2 A;  1VBB 1;  5A3M A;  3RZM A;  3QH7 A;  2GN3 A;  3BIE A;  5HCB A;  3BTZ A;  1LOA A;  4Z2A A;  4P02 B;  4ZU7 A;  1EV1 2;  4XUT A;  1MQT B;  2JKX A;  4P9G A;  4QQO A;  2HYK A;  4NAO A;  3WQ7 A;  1RUO A;  3PHM A;  2JDP A;  1VBE 2;  3LSD A;  3POF A;  1W8H A;  1VRH 3;  2XBO 1;  4QPI C;  3QAC A;  2K46 A;  4KGQ A;  5EYX A;  1MZF A;  2QQW A;  5A1L A;  3LQC A;  1KFX L;  1YJL A;  2ZZJ A;  2HWE 2;  4GIQ A;  1VAM A;  3PVE A;  3U37 A;  4OCT A;  4KNC A;  2XLG A;  3H42 B;  5FYY A;  3HR9 A;  3OYW A;  1H0B A;  3KT7 A;  3S5Q A;  4FSJ A;  1NE6 A;  3I3D A;  3VKO A;  2IZW A;  1WLW A;  2GC1 A;  3OSD A;  5CKN A;  3NKG A;  2Y0I A;  2VUC A;  4IER A;  3R05 A;  5CG9 A;  5FMB A;  4DZG A;  1HN0 A;  2YRO A;  3BTA A;  1JUI A;  4O9E A;  4YM2 A;  4BQX A;  2OXB A;  2XBO 3;  4EV0 A;  1WZX A;  5F3E A;  1PK6 A;  2V4V A;  3MIC A;  4XCB A;  2IXK A;  3B69 A;  1CON A;  3WG4 A;  3UKV A;  1MVQ A;  1HRV 1;  4LBK A;  4YM3 A;  3FFQ A;  1DQ1 A;  1DGL A;  4KH9 A;  4M0N A;  4W65 A;  5FZA A;  2WNU C;  1VB2 A;  3OPW A;  5IAT A;  4PDW B;  5K8S A;  3AZY A;  1XYN A;  3FBM A;  1DF0 A;  1QNY A;  3I2H A;  3KHB A;  2CGP A;  1ODM A;  1J59 A;  2P3Y A;  1W9T A;  4RFT 0;  1OH4 A;  4A4A A;  1H8V A;  1LU1 A;  4YM0 A;  1AZD A;  1LOG A;  2OW4 A;  2CSG A;  4TYS A;  2J1R A;  4JDO A;  1NQJ A;  3BOP A;  3ZN4 A;  4GA9 A;  4EQV A;  3J8F 3;  3QBQ A;  2R0F A;  4ES9 A;  2UY8 A;  3GGL A;  5SV5 A;  4QKD A;  2YU1 A;  3U14 A;  4COW A;  1HXS 3;  4GMP 3;  1X50 A;  5DDJ 1;  4BLJ A;  1UY2 A;  4CDU B;  4IEV A;  1F4A A;  2B5H A;  2VZ3 A;  2X53 S;  4XIL A;  2WRA A;  5AVA A;  4DXT A;  1MEC 3;  4EWE A;  3N35 A;  4FP3 A;  4BDV B;  4Z8B A;  1WD3 A;  2E63 A;  2B4K A;  5HCH A;  1UYZ A;  1OUR A;  2BER A;  2J1A A;  3ZOI A;  1Q8S A;  3ITQ A;  1ULO A;  4OUL A;  3MLJ A;  2R04 1;  4OVE A;  2GN7 A;  4HBN A;  3SKV A;  5FWJ A;  1QKQ A;  5F37 A;  3VDD A;  4MGT A;  3SH4 A;  2PFW A;  4BQ5 A;  2VCB A;  2ZMK A;  1VIW B;  4C8D A;  2HWB 2;  1T6G C;  5FLH A;  2VW2 A;  2XPJ A;  1UXZ A;  3PUQ A;  5EQU A;  2D6O X;  2WS9 3;  3VZM A;  5ABJ C;  3H50 A;  1WWY A;  3AZW A;  1JU3 A;  3ZSJ A;  4EWD A;  1LHU A;  3VL9 A;  4CEY A;  1S1A A;  1OQE A;  5LK7 B;  1MR5 A;  3J7L A;  5EFU A;  1HB3 A;  3RSJ A;  5CZK A;  2UWA A;  5E1R A;  5FIX A;  1BVP 1;  2EIB A;  3C7H A;  3PDQ A;  3O0X A;  4QGL A;  1SZB A;  1T2X A;  5A33 B;  1ODN A;  1POV 1;  3WHU A;  5FPL A;  1UOB A;  2PHT A;  2XL9 A;  1YCI A;  3Q8E A;  3WF3 A;  4V2W A;  4BQW A;  3K4D A;  5F6L B;  3K4Z A;  5F5A A;  5F8P A;  4Y5T A;  3UGG A;  3POW A;  4R9D A;  3HVD A;  2D6L X;  1UZ0 A;  4BLI A;  1F31 A;  2JIC A;  1W06 A;  2BDR A;  3CLP A;  4XDO A;  2GMM A;  5JIA A;  2AAC A;  3E1F 1;  3WV6 A;  1SCS A;  4CCM A;  2W5F A;  1K5M C;  3WIN E;  4HK8 A;  3ZFF B;  1JXN A;  1D4M 1;  1FYU A;  2E53 A;  2ZGQ A;  5I0U A;  1OF4 A;  4HG6 B;  1VBD 2;  1ASJ 3;  1Y9M A;  3I2G A;  3N9Q A;  4HSL A;  3D8C A;  4U36 A;  1ASJ 2;  1VBD 3;  4QB6 A;  4XBN A;  3RGB A;  3ZR5 A;  4AFB A;  4BIS A;  4CRQ A;  2J1U A;  3QLQ A;  3WDV A;  1TME 1;  1MS3 A;  4IE4 A;  4YG0 A;  4D3W A;  2GC0 A;  1G9C A;  1SFY A;  3BU0 A;  4KWL A;  4OQ8 A;  2VNO A;  1ACC A;  1PVC 3;  3WDY A;  4QMA A;  4NVP A;  4BYY A;  3IAP A;  3ST7 A;  1GWM A;  2NLR A;  2XML A;  3RMX A;  5KXE A;  4E4Z A;  2A71 A;  5ANN A;  2YBP A;  1SLA A;  1A8M A;  5JOY A;  1RUH 2;  5IVJ A;  1QJE A;  3N9L A;  5IVB A;  5LEJ A;  1AXK A;  1NCQ A;  1UWW A;  2MPF A;  2ZAH A;  5DMY A;  2DCY A;  3WLU A;  5LRS A;  2R7E B;  3O1S A;  3A0K A;  4R9B A;  2P3K A;  4QX0 A;  1GFF 2;  4AK3 A;  5C3P A;  4A45 A;  2V09 A;  3TWI A;  1CX4 A;  4CCN A;  4MGS A;  5E8A A;  1W6Q B;  2VC9 A;  1OLM E;  4G3Y C;  4O9G A;  3TEX A;  3ZPO A;  4GAL A;  1AUY A;  3GJA A;  4AR2 A;  3J7N A;  1JHJ A;  2DTY A;  5FBJ A;  1DQ6 A;  1NLS A;  5A6Z A;  1K3I A;  1BBT 3;  3I2J A;  5IJR A;  5C3S A;  5I8Y A;  4DFS A;  3C7G A;  5EZW A;  4EJR A;  5JZG C;  1SLI A;  1UKR A;  2WKK A;  4L92 A;  4TZD A;  4ITC A;  3WXP A;  5IVE A;  5C9A B;  1GZC A;  4EYU A;  2O1Q A;  4A3Z A;  2VU9 A;  4IGP A;  4OHX A;  4OHW A;  1H4G A;  2HBT A;  3MW4 A;  4HPK B;  2JDA A;  3ZFG C;  5J7M A;  1Q3E A;  1W05 A;  1AX1 A;  1U0A A;  3I8T A;  5JOW A;  1RUF 3;  3ZSM A;  1JYN A;  2DBN A;  1YI7 A;  3ZKU A;  2Q8C A;  3K3O A;  5I0D A;  5CFD B;  4YLZ A;  5KHH A;  1D0G A;  2JD4 A;  5FLI A;  1IKQ A;  2RM2 3;  1XSR A;  2JIG A;  2ET7 A;  4QQ2 A;  3KD4 A;  2HH9 A;  3GZE A;  4DY5 A;  3AYD A;  3HN3 A;  4A7K A;  2ZXQ A;  4R4X A;  1FX5 A;  1K45 A;  2ADD A;  2CGN A;  4LBQ A;  3RNS A;  4QHO A;  2OQ7 A;  2PAK A;  3CJI B;  2IXH A;  4BXS V;  1W9W A;  4CYD A;  4E4D X;  2FCU A;  1GNY A;  2UYA A;  1EPW A;  2JD9 A;  5DPN A;  5IVY A;  1GR3 A;  2PHF A;  3ACH A;  3NVC A;  4AVA A;  2XGX A;  3K4A A;  4DRV A;  4AVB A;  1C28 A;  1GKB A;  1OD3 A;  5HCF A;  4EE2 A;  4OFG A;  4RQP B;  4AED B;  4LMF A;  2JDM A;  2ZBJ A;  1ZZ7 A;  3B93 A;  2ZJC A;  4QU2 A;  5JUV A;  2UUR A;  3FC0 A;  1JZ5 A;  3NAP B;  4XHX A;  2HWD 1;  4Y26 A;  4Y3O A;  1UU4 A;  2A70 A;  2SLI A;  3T2O A;  4AI2 A;  1DIW A;  3AKR A;  4XW3 A;  2VJX A;  3LDB A;  2DUP A;  4DUV A;  2ARC A;  4LUM A;  4D0Q A;  2CDO A;  3MV0 1;  2BGC A;  3A7Q A;  1V6I A;  3AX4 A;  1VRH 2;  2ORX A;  2W08 A;  2ZEY A;  3CBN A;  1US3 A;  5EHD A;  1Q8O A;  3VD9 A;  3WW4 A;  1MEC 1;  4PQQ A;  1J58 A;  2KM2 A;  2YG0 A;  1HJF A;  3OEB A;  3K3N A;  4GB3 3;  3R4D B;  2TNF A;  4LE3 A;  2PXJ A;  4XUP A;  5KXB A;  4Y20 B;  1CX1 A;  2BOI A;  1QJF A;  5FLJ A;  1UOJ A;  4QKB A;  4YW7 A;  1ZA7 A;  1Y3T A;  2XWB B;  3ZR6 A;  1XU2 A;  1PMH X;  1LOF A;  4WM7 C;  4GQ7 A;  3ZN6 B;  2VOV A;  2DBI A;  3NL1 A;  5LAS A;  2BQP A;  5EV7 A;  2VMC A;  2WT2 A;  2ZGN A;  1X82 A;  1R08 2;  2PN5 A;  1OLM A;  1NCQ B;  2Y60 A;  1Z7S 2;  4MYE A;  2VME A;  1ZM1 A;  3M8L A;  2QJV A;  1IPS A;  4EN6 B;  3ENR A;  1S0I A;  2P37 A;  3LE0 A;  4HN1 A;  2HWF 2;  4IV3 B;  3U0Z A;  3RRD A;  1MPX A;  1VBB 2;  2VY0 A;  3Q8B A;  2VZO A;  5GZF A;  1UOF A;  3WX5 A;  4Z07 A;  4CSW A;  2HWC 2;  2ZGS A;  3VKM A;  5HV4 A;  2V72 A;  3RG0 A;  3Q8F A;  1KD7 A;  5GLU A;  2HWD 2;  4AFC A;  1JI6 A;  3N9N A;  4ERO A;  2YY1 A;  1BEV 3;  1NY7 2;  3E5U A;  3OUJ A;  1RUH 1;  2WC2 A;  2UWC A;  4YW4 A;  3WZ1 A;  1F9K A;  1O3S A;  3NV1 A;  2NPI A;  1KGY A;  1LEN A;  4AYU A;  1PGL 2;  4AEK A;  1SEF A;  4XDP A;  5FZM A;  2EIG A;  1QQP 2;  2ZAB A;  4HFS A;  2A6V A;  2D5F A;  2WIN B;  4XF3 A;  3GNE A;  4Q4Y 3;  3J7M A;  1DLL A;  3WNP A;  1HKD A;  4DUX A;  2XUE A;  5C5U A;  4GH4 A;  2OYZ A;  2VZT A;  4NHX A;  3BVC A;  4QX7 A;  4ZXK A;  4JKK A;  3WW3 A;  5JSR A;  2YZ4 A;  4ZZ5 A;  5AC9 2;  4K20 A;  2RHP A;  5E89 A;  1XYO A;  2WQ4 A;  2WYS A;  3D0S A;  2D3P A;  1E5S A;  1FPN 2;  4Q0Q A;  1NYW A;  2VW1 A;  2C0Z A;  1QWR A;  3SHR A;  2PHX A;  4OI2 A;  1N3Q A;  2W0X A;  1MVE A;  2PLV 2;  3DV8 A;  1FPN 1;  3VBS A;  3ZYJ B;  2Y6H A;  3RFR A;  4LIT A;  4BIO A;  4Z92 B;  2DCK A;  3JQX A;  3U78 A;  1QOS A;  1QJZ A;  1W9S A;  3DEM A;  2I07 B;  4JRA A;  3FZ3 A;  5F2W A;  4JRL A;  5LBE A;  1LJ7 A;  4E2G A;  2L9L A;  2D6K A;  1VMF A;  3FLR A;  4JGZ C;  4OUE A;  4ASK A;  4AFA A;  3N4M A;  2QZ3 A;  5FMC A;  5KC5 A;  3VZL A;  1RVF 1;  1YYN A;  3NMB A;  4DY3 A;  1JYT A;  1R1A 2;  1UU5 A;  1A6C A;  2EA7 A;  2FHR A;  2AEZ A;  2H0B A;  3H7Y A;  4Q5O A;  4LO5 B;  1W6M B;  2YMZ A;  4FFF A;  3VKN A;  4A7Y A;  3GZU C;  4CP9 A;  3T2P A;  2OX0 A;  2A7A A;  4HVO A;  1OKQ A;  2HEW F;  4A6S A;  1YHF A;  2EXK A;  3UET A;  2C4X A;  3PUR A;  1H8T A;  3VKF C;  5H9R A;  4UFH A;  3ZMN A;  1SFN A;  4KL1 A;  4DXS A;  1RUG 3;  3K75 B;  1ENR A;  1W6N B;  4JGY A;  1W0P A;  2NQY A;  1SDD B;  1JU4 A;  4IGQ A;  3O1P A;  1CAU B;  4XCA A;  1R08 1;  3LDR A;  4XUN A;  3Q8C A;  5C4W C;  3T1M A;  2VVE A;  2BWC A;  2J1V A;  4IE7 A;  3JD7 2;  1UKG A;  5LA9 A;  4BZ4 A;  2VR4 A;  1WMD A;  3WHT A;  1H6X A;  4AVC A;  2VQU A;  3KT1 A;  4IV1 B;  2UU8 A;  5GJ6 A;  5IUQ A;  1P8J A;  1W2A X;  3RYK A;  1QU0 A;  1W8N A;  3ZFF A;  3VHO A;  1O5L A;  3INA A;  1ZBA 3;  1CVN A;  4YVW C;  1PX3 A;  3M1H A;  3UJQ A;  4ATF A;  4DEQ A;  5FOB B;  4BQ3 A;  5F6K A;  4MHR A;  4DO0 A;  2KXL A;  1LED A;  1W9Y A;  1X7N A;  1SPP B;  4CCK A;  3W20 A;  3ZFE A;  3VHN A;  3LA2 A;  5IK7 A;  4BK5 A;  4UW5 A;  2AC1 A;  1XNK A;  4YGC A;  4SLI A;  2BNM A;  3VD7 A;  1UQX A;  3WDU A;  4AWD A;  5F9T A;  5EJ3 A;  5DUU A;  2QVS B;  1C5I A;  4UW6 A;  3MI8 A;  2W1U A;  1SLC A;  5ACA 3;  2ZHM A;  1ND3 C;  2HLE A;  1UIK A;  1O91 A;  4CE8 A;  1VJ2 A;  2ARB A;  5GLW A;  4E27 A;  5JSO A;  3FFZ A;  3P1I A;  5DDJ 2;  2WFF 2;  4Q4Y 1;  1OSG A;  1YRZ A;  4ZON A;  3VLB B;  4ZKT B;  4JHT A;  4GKY A;  3I54 A;  4EZH A;  2WN2 A;  1XB9 A;  2LS6 A;  4URA A;  1RTV A;  1YC6 1;  1RED A;  1RGS A;  2V4A A;  3ZXD A;  3SEP A;  3NST A;  3AJY A;  3V65 A;  5E6H A;  1JYX A;  2ILM A;  2XJP A;  4RA0 A;  1BZW A;  2ZGK A;  1PO1 1;  4FP2 A;  4IEQ A;  2XVG A;  3AMQ A;  3WP4 A;  3C2U A;  2JG9 C;  1RHI 2;  4IEW A;  2ZHN A;  1AXY A;  1X8M A;  1TNR A;  1BQP A;  4YWA A;  4TTG A;  5IFT A;  1HX6 A;  2VNR A;  2WT1 A;  2ZX0 A;  1KDM A;  3NWK A;  3ZVX A;  5FO8 B;  1LRH A;  3OBZ A;  2ET1 A;  4IDZ A;  1JOB A;  3OGJ A;  4P9L A;  1UIJ A;  3WF0 A;  4NIH A;  2RR1 2;  3NAP C;  2LW8 A;  1ZBE 1;  1RVF 3;  1FNY A;  2IVI B;  4B4P A;  1RMU 2;  5DZF A;  2ZGL A;  3WW1 A;  1EPZ A;  2A6Z A;  2H6B A;  3DPR B;  3ZYG A;  2VQT A;  4A6O A;  5CVR A;  1HRI 3;  5DN2 A;  3HQR A;  3O12 A;  2XJV A;  4IES A;  4HXC A;  3T08 A;  1J3Q A;  1RUD 3;  2CV6 A;  4GWI A;  1AF9 A;  3SLI A;  1NT0 A;  5JXH A;  2EF6 A;  5JSP A;  1JTZ X;  3GF6 A;  4M01 A;  3U11 A;  3VBR C;  5BNN C;  1XOY A;  4LK7 A;  4QU1 A;  4XHB A;  4XTP A;  4QQP A;  1W3X A;  2HWB 1;  1UZY A;  1XBF A;  2PMW B;  1VBC 3;  4QD2 A;  2R07 1;  1ND2 A;  1Z78 A;  2YGL A;  1U5I A;  3HBZ A;  4FFH A;  3H3U A;  2XJT A;  5KHK A;  1PO2 3;  2GAL A;  2FMY A;  3OJB A;  3ZYP A;  2B39 A;  4GD4 A;  3WQ0 A;  3AP5 A;  1COV 3;  5GZE A;  1YQ2 A;  3G6J B;  3T2T A;  4XQD A;  4D6Q A;  4DXR A;  2ATF A;  2PHR A;  4XF0 A;  1H8T C;  1J3R A;  2LTN A;  3ZXG A;  3I2O A;  4K40 A;  3WG3 A;  5FV3 A;  3PUS A;  1LGN A;  3NV3 A;  1CIW A;  2WO2 A;  4DMI A;  4QT6 A;  2YXS A;  5EP9 A;  4AF9 A;  5L7O A;  4QXH A;  2WO7 A;  1WLT A;  4AFD A;  4QKF A;  3AKQ A;  4QXK A;  3AYE A;  3RJ2 X;  3SCG A;  4BXF A;  4UFJ A;  2XJU A;  1HQL A;  5GLZ A;  1CJP A;  4DIN B;  3CZU A;  2JB4 A;  3CEW A;  1R09 1;  4GH4 C;  1OXC A;  1SLB A;  5C5T A;  1OA2 A;  5L19 A;  3FHI B;  1QH7 A;  2VBD A;  4MVT A;  2RS3 3;  3KHC A;  2GH2 A;  3IDE A;  5ERL A;  1A3K A;  1M4W A;  1QJU 3;  3JD7 1;  1TME 2;  2GND A;  1AR6 2;  3NJV A;  4PLM A;  4M3C A;  4FPG A;  3AKS A;  3OEA A;  2VZ1 A;  2QFE A;  3NQH A;  4LOS A;  1U5Z A;  4RHV 3;  2XKO A;  3OGV A;  4KQ7 A;  1NZC A;  3WCS A;  1W8U A;  2JDN A;  2RS1 3;  5FZ0 A;  3S57 A;  4U2A A;  1HN1 A;  4OHZ A;  5HBA A;  4LNV A;  1J83 A;  1S0C A;  3TN9 2;  4YYO A;  4YG6 A;  3WDT A;  3SH3 A;  2BUK A;  3WVJ A;  1RXF A;  4UW3 A;  2WWJ A;  1JN2 P;  1ASJ 1;  4PLO A;  3RZH A;  4Y1V A;  2P2K A;  3ZX7 A;  3NV2 A;  4YZ1 A;  3ZN6 A;  3USU A;  1OVP A;  5ABJ B;  3MV1 1;  4CZS A;  2WZ8 A;  1XND A;  5FZB A;  3W5M A;  5FYT A;  1FMD 3;  3USS A;  5A3L A;  4FVV A;  4KWU A;  4M4P A;  4HLT A;  1W28 A;  4H7M A;  2ARA A;  1XU1 A;  4QPG C;  5JR2 A;  3TBD A;  3BN6 A;  3OB8 A;  2R16 A;  5GLT A;  2WZR 1;  2WNV C;  1WCD J;  4YSF A;  4YW2 A;  4MOA A;  1AL2 2;  2BVV A;  3VGI A;  1YXW A;  1LOE A;  3PNA A;  2R6Q A;  4XAB A;  3IZO A;  4AGV A;  1OOP B;  3GCX A;  1POQ A;  3BUC A;  3POY A;  1L7Q A;  1DGR N;  1C1F A;  3ACG A;  2DWR A;  5IVF A;  3ZKY A;  4I3P A;  2Z2S B;  5BYN A;  1OMI A;  4BQ1 A;  1RC6 A;  1RUE 3;  1H2M A;  1C8M 3;  1W2N A;  2FCT A;  2RS5 3;  4K6B A;  4KGG A;  4CEW B;  4X6R B;  5K0U A;  1C4R A;  1CZS A;  4ZS2 A;  5F5I A;  3KM5 A;  5T52 A;  2QZ2 A;  4CCO A;  3WNL A;  3K77 A;  2NZ9 A;  3HNY M;  2JDK A;  1HB4 A;  4KWJ A;  1KS5 A;  2QBX A;  2JE7 A;  4FTS A;  4PIX A;  2WSV A;  2ZEW A;  1O3Q A;  3M70 A;  3GBG A;  3VDD C;  2CAU A;  4AEJ A;  1C1L A;  3FL7 A;  3MYX A;  2NMN A;  3E5Q A;  4OUM A;  3ILN A;  2W46 A;  4XUQ A;  5FY7 A;  3LIH A;  2YHJ A;  2A3W A;  3VDC A;  2YBK A;  1XE7 A;  4YG3 A;  1YIF A;  1HDK A;  4AHZ A;  2OUH A;  1TE1 B;  1UU6 A;  1TMF 1;  2GAU A;  1EV1 1;  4BK4 A;  4XAA A;  2RDN A;  1RUF 1;  4AXO A;  3OBT A;  4MH0 E;  4LBQ D;  3O5S A;  4MUV A;  1W6N A;  5FZ6 A;  1W6Q A;  1PGL 1;  1LUL A;  2VMI A;  3NNL A;  5JAX A;  5KR7 A;  3O1T A;  1SPP A;  1UY1 A;  1H30 A;  1IHM A;  5T5O A;  5EJZ B;  4GWM A;  4QGN A;  5CFD A;  5CEH A;  1DU3 D;  1EYB A;  1POV 3;  5DZG A;  1DYP A;  1O3T A;  3KCX A;  1QJY 3;  3DPR A;  1H2N A;  5BY5 A;  3VBO B;  1N1T A;  3AKP A;  4WZC A;  1AL0 G;  5FZE A;  4UW4 A;  3KT4 A;  2XDV A;  4HPK A;  2XLF A;  3O1O A;  4PQ9 A;  2WT0 A;  5A7S A;  3AMM A;  5L9V A;  1PX4 A;  1GV9 A;  5ANQ A;  3H8U A;  1W6P B;  5FK8 A;  4IEZ A;  2CWM A;  4M00 A;  2WNV B;  5I8S A;  1OA3 A;  1QJY 2;  4CP0 A;  4COZ A;  5FZD A;  4AI3 A;  2P3J A;  4LA2 A;  2UY9 A;  4I30 A;  1WCQ A;  3D5O A;  2V5D A;  2XWJ B;  3NNM A;  4LBO A;  4Q4X 1;  4DS0 A;  1VBC 1;  3TAY A;  5HI0 A;  3WF1 A;  2BP6 A;  1WGP A;  5CFC C;  4XFA A;  3GBW A;  2QQV A;  3NW4 A;  3HMY A;  2GDF A;  5FKB A;  2JEM A;  4FOY A;  3W5N A;  4QPY A;  1S0F A;  4V1P A;  1PK6 B;  4QX8 A;  3RJR A;  4FPF A;  4OYU A;  3W58 A;  2WLP A;  2XHN A;  1GU3 A;  1PZ8 A;  3O7O A;  1ENX A;  3IBM A;  3VBH B;  1ALY A;  1OKO A;  2G9Z A;  3AP7 A;  5KXC A;  2WN3 A;  4JCK A;  3I2K A;  3K46 A;  1LAJ A;  4HN0 A;  4B1M A;  3QOP A;  1M06 G;  4AHX A;  2X5I B;  5FP8 A;  3CNA A;  5LY2 A;  4W6Y A;  1OLQ A;  2WJS A;  3TNP B;  1HLC A;  1E5R A;  5HCA A;  3ZXF A;  2ZPX A;  1IPJ A;  1QDO A;  1STM A;  2NN8 A;  4XC9 A;  2ZGU A;  2QQL A;  1COV 1;  3BPZ A;  4P00 B;  2A1X A;  5C33 A;  4K8F A;  1RIR A;  1WBL A;  5BNO A;  4JQR A;  3LPG A;  4LTA A;  2C24 A;  2R07 3;  2QQK A;  2PAM A;  3PJQ A;  1LES A;  1JZ2 A;  1IOA A;  1AL2 3;  4BQ2 A;  2VTX J;  4XJU A;  3WDW A;  5FMO L;  1ULP A;  1JOJ A;  2BWA A;  5FZL A;  5T5J A;  3IPV A;  4N7U A;  5C6C A;  1ZZC A;  3ZYB A;  1UYX A;  1H8T B;  4MHU A;  2VCA A;  2DUR A;  2F6B A;  1AX0 A;  1HB1 A;  2VG9 A;  2ZGT A;  1W3V A;  3IN9 A;  5DUW A;  4QQH A;  4C0B A;  1FMD 2;  2DYC A;  4D7Y A;  4KWK A;  3E5X A;  1VLN A;  5FPA A;  4BQ4 A;  1VRH 1;  4Y24 A;  4B7K A;  2ETE A;  3ZDS A;  2DTW A;  4L97 A;  5LAT A;  2GU9 A;  1QXP A;  2PQS A;  4H55 A;  2QDR A;  4XE9 A;  4BM8 A;  5C8W A;  2ZOE B;  5FXW A;  5DAV A;  3UNP A;  1AYM 3;  4NUB A;  1ZA4 A;  1W2U A;  4IV3 A;  4OLL A;  2AEN A;  1GP4 A;  3JB8 A;  3CZJ A;  1I3H A;  2C5D A;  2GC2 A;  2VZS A;  3DXU A;  2Z42 A;  4LJH A;  1GZ9 A;  4E8C A;  1D4M 2;  1WA4 A;  4AAP A;  1TME 3;  3EBR A;  1QJU 2;  1I5P A;  3VBH C;  1XNT A;  3PJY A;  2RS3 2;  3VDD B;  4HVQ A;  1JOP A;  5FAX A;  1PVX A;  4BMB A;  3LF7 A;  3M3Q A;  1W0O A;  2LAL A;  3NKT A;  1FOD 1;  4XUO A;  4MGI E;  1C8N A;  3T0D A;  5F39 A;  5IK8 A;  5A7O A;  3HAG A;  3SKJ E;  2E7T A;  2VXR A;  2ZGP A;  3QCW A;  2VM9 A;  4D6S A;  3USU B;  1FAY A;  1MAC A;  2Q4S A;  4J1W A;  2ZX2 A;  4ZXE A;  2VVD A;  2ARE A;  1PM7 A;  4CDU A;  4MXV A;  1R1A 1;  2DFC A;  3SC7 X;  2YPJ A;  1FOD 3;  2ZGR A;  4FPE A;  5FPV A;  4CDX B;  5JZG B;  1GMM A;  1HJG A;  2X5I A;  4JTO A;  5L36 A;  4LHS A;  3S7I A;  1Y9Q A;  1H9W A;  2WAO A;  5FZ9 A;  1VAV A;  3BOW A;  4NPL A;  2Y33 A;  2D44 A;  1AR8 2;  4IW3 A;  2VUA A;  1OVS A;  4LKF A;  2EID A;  4LE4 A;  4N9I A;  1COV 2;  2ZML A;  3KLS A;  1JHN A;  4LO6 B;  1PNF A;  5K4L A;  4CPB D;  4BJ0 A;  4N90 A;  4NID A;  4QWN A;  2R0H A;  4BWO A;  1HB2 A;  4JKM A;  1C3H A;  2FDI A;  1BEV 1;  1O6U A;  1CR7 A;  4MGY E;  5BV6 A;  1C57 A;  1W0N A;  4NIA A;  4BME A;  1AL2 1;  3FJS A;  1FV2 A;  3ROU A;  3VBO C;  3WG1 A;  1ZRE A;  1RUD 2;  3V0A A;  4QXC A;  5AFB A;  2WFP A;  4CDW B;  1PO1 2;  5J1X A;  5C4W A;  3VBR B;  4D8M A;  1CWP A;  4PBP A;  2MEV 1;  3CDZ B;  1OFN A;  2YPD A;  1X9P A;  1GZW A;  4JZR A;  2AR6 A;  3JBG 2;  4WM8 A;  5FUI A;  3ZM8 A;  3OYW B;  1D2Q A;  1RMU 3;  3LGR A;  1UL9 A;  1QMJ A;  1F4H A;  3FX3 A;  2Z5W A;  1YUD A;  3R6S A;  3SQO A;  4CUB A;  5CFC B;  1RVF 2;  4MV2 A;  4FBF A;  2B9U A;  2WSU A;  4QQL A;  4FPC A;  3HWJ A;  1V70 A;  4ZU5 A;  1WA6 X;  3QH6 A;  5KHI A;  4BA6 A;  2IXI A;  1KS4 A;  1OH3 A;  1LB2 A;  1ND3 B;  4MG2 A;  5FRA A;  2PLV 1;  1JZ8 A;  4OZO A;  3OY8 A;  3NNF A;  5T3N A;  1ULC A;  1RHI 3;  1PHM A;  2P3I A;  5F2S A;  1U12 A;  4LIU A;  4X8N A;  3KVA A;  3ECQ A;  4LA3 A;  2P17 A;  1V6O A;  2D40 A;  2I74 A;  1OUS A;  3DF0 A;  4LT5 A;  4S2H A;  2QUO A;  5C4W B;  2NMO A;  3FUQ A;  3IPV B;  4XF4 A;  2WAA A;  4XFF A;  5CKQ A;  1B09 A;  4XXA A;  5FZ1 A;  1S0J A;  4JGZ A;  4KMQ A;  1AR9 3;  1GOG A;  1KIT A;  3NJX A;  3NNJ A;  1HV0 A;  3GCW A;  2VOT A;  3MPB A;  3TOJ A;  5FPX A;  2DV9 A;  1W6M A;  5IVC A;  2IXJ A;  3UYJ A;  3B5L B;  5JPM B;  5T55 A;  4H7L A;  1MZ5 A;  1VE0 A;  4P9Y A;  4L2N A;  2B45 X;  4YZ4 A;  2IFW A;  2VMF A;  3IMM A;  4WVM A;  3RZZ A;  4XFG A;  1UYP A;  1US2 A;  3ETQ A;  4UI9 L;  3O1U A;  3LEK A;  3PL0 A;  4NIG A;  2CHH A;  2XH6 A;  4Y5Z 0;  4XAC A;  1IS4 A;  1I5Z A;  3LDK A;  4O7X A;  1SFP A;  4FFI A;  3VDB A;  2TUN A;  1WMX A;  3DYO A;  5IWF A;  1ZBA 2;  3ZDV A;  4EN9 B;  3NAP A;  3LFI A;  5DAW A;  3GAL A;  2LRP A;  3BKZ A;  1YFY A;  2BTV C;  2OVU A;  4PDW A;  3POG A;  3DCQ A;  4XYX A;  4AQ6 A;  5C3R A;  2O14 A;  4XXP A;  3VBS B;  3BIW E;  4DRR A;  3VD5 A;  1OQ1 A;  1Y43 B;  4M3C B;  2EAL A;  4FQ4 A;  3UKN A;  3B02 A;  1PMJ X;  1BK1 A;  4N9H A;  4A41 A;  5CNA A;  2VGD A;  4W4Z A;  3ELN A;  2RE9 A;  1XNC A;  3L9J T;  5LBF A;  5C9A C;  5C8C C;  1WBF A;  4I02 A;  3HN1 A;  5J96 B;  4QXB A;  1I1E A;  1AYM 1;  2ZHL A;  1YWK A;  4CEY C;  5IW0 A;  5HXV A;  4Q4X 2;  4D7S A;  3G7D A;  2VEC A;  2VVF A;  4RS5 C;  5ABJ A;  5FP7 A;  2WWS A;  4OMD A;  1ULF A;  1PGW 1;  1V9U 2;  2WA4 A;  3LCP A;  4UBG A;  4FI9 A;  5A80 A;  3HIF A;  4Y33 A;  5FZC A;  5T5P A;  1ND3 A;  4XBL A;  2R06 2;  2D6N A;  4MXW A;  1OBN A;  1DQ2 A;  3AL5 A;  2BZD A;  3PU3 A;  1CAW A;  4P9J A;  2JIJ A;  5D2A A;  5LA1 A;  1WW4 A;  5JXI A;  2VMD A;  4C1X A;  5GLV A;  3KWV A;  1ENS A;  1XNA A;  2FZ1 A;  3IDC B;  5KWR A;  3ZXL A;  3BI3 A;  1RJ7 A;  2ZGM A;  2WZR 2;  2Q8D A;  5A32 A;  1V6J A;  2CAV A;  4ASL A;  2Q1F A;  3SNM A;  1RUJ 2;  5AC9 3;  3GZT B;  3UL2 A;  2VXJ A;  4NO4 A;  1ZX5 A;  4CDX A;  1YFU A;  4N8M A;  3OOX A;  2JB8 A;  5FR3 A;  4LBJ A;  1LU2 A;  2RJK A;  3CJI C;  4NHM A;  3N7K A;  1MZE A;  2WFF 1;  4Q4Y 2;  5A6X A;  1V6K A;  4M4R A;  5JPN B;  1QQP 3;  4IE5 A;  4JDN A;  1NOV A;  4KI5 M;  2W1Q A;  2XB6 C;  2W52 A;  2KA3 A;  3IM0 A;  3TN9 1;  5C70 A;  3I97 A;  2XJQ A;  2E7A A;  4XTM A;  2QNK A;  1BEV 2;  4JGY C;  1H1I A;  2O0O A;  5SV8 A;  5T5L A;  3BTX A;  3DYM A;  3FE5 A;  2HWD 3;  2XOM A;  4I3G A;  4OI1 A;  3WG2 A;  3M3I A;  3BU7 A;  3IDA A;  3VDA A;  3MDP A;  2HWC 3;  3MIG A;  4CCC A;  2GH8 A;  1L3J A;  3OY8 B;  3VZJ A;  4Z82 A;  1WLD A;  4Y22 B;  5A3O A;  1H2L A;  3VZO A;  2R32 A;  4M3C E;  5E16 A;  4L0P A;  4XFB A;  2HWF 3;  1S0D A;  1R1Z A;  4PHZ A;  2KR2 A;  1DQ5 A;  2DVD A;  4PT6 A;  3WW2 A;  1Z7S 3;  3LFM A;  2WL1 A;  1ND2 C;  1CAX B;  2IUW A;  5FZI A;  3WEZ A;  2XUM A;  1YO8 A;  4Q29 A;  4TXW A;  1XC6 A;  4AEM A;  1LEM A;  2J42 A;  1RUE 1;  2JG9 B;  2RS5 1;  2OKX A;  3AMH A;  4X6Q B;  1E5I A;  1NX9 A;  3VBF A;  3BCW A;  3POE A;  2BFU L;  3PUA A;  4Q0V A;  3K2O A;  3LA7 A;  4YW5 A;  3HD8 B;  1RB8 G;  3PIJ A;  1H6Y A;  1VBD 1;  1ZYB A;  2VO5 A;  2WII B;  3I4I A;  3ILR A;  3OD4 A;  4GB3 2;  3ALQ A;  4HT1 T;  4XF9 A;  2A3X A;  4QDR A;  3VHP A;  1VP6 A;  4PI0 A;  1DYO A;  3O14 A;  3ZXA C;  4XQ4 A;  1V6N A;  3DYP A;  4Q27 A;  5DAQ A;  3VUO A;  1RIN A;  4Q0P A;  1CAW B;  3I2I A;  4M3C F;  3BGA A;  3T30 A;  3ZYR A;  1GNH A;  4AQT A;  4CDQ C;  2WNO A;  5GAL A;  2E32 A;  3HEI A;  1UW8 A;  5J3U A;  1IQA A;  5L7O C;  2W2I A;  4K1Y A;  4MLO A;  2VZP A;  3WR0 A;  5J37 A;  3RYR A;  4FPH A;  3NNG A;  3IKW A;  4H14 A;  4KU7 A;  3N36 A;  4QDQ A;  5T54 A;  5C8C A;  3III A;  1H4H A;  5LK5 A;  3IT8 A;  2JDU A;  2ZTN A;  2Q8O A;  4RS5 A;  5FY5 A;  3KF3 A;  4QAW A;  5D21 A;  2DVF A;  4Q26 A;  2ZGO A;  3H9A A;  4XIK A;  4BH9 A;  5FYM A;  5J09 A;  2DCJ A;  3ZFF C;  4Q4V 3;  4EWA A;  2CL2 A;  1V6M A;  3EQE A;  2RJ2 A;  3NJZ A;  4NHK A;  2VPV A;  3EO6 A;  3LOI A;  4ARX A;  3RPQ A;  1CZT A;  4RGA A;  2RMU 2;  4CUG A;  4AHY A;  3MUY 1;  1ZBE 3;  3E97 A;  1GBG A;  1WW7 A;  2A6W A;  2IVJ A;  3KB5 A;  4QHZ A;  4R8H A;  1BLZ A;  1UMZ A;  4YW6 A;  2Q8E A;  2WR9 A;  4RHV 1;  2WNV A;  1YI9 A;  2RM2 2;  3PME A;  2C9A A;  4KU8 A;  1YJK A;  2GC3 A;  4QPG A;  1F5J A;  3HPN A;  4FOW A;  1V0A A;  4YFW A;  2GNM A;  3ZFE C;  2XXZ A;  5BPX A;  2XG3 A;  2X8K A;  1DGR A;  4YVS B;  2NYY A;  4S2F A;  4BB3 A;  4K3U A;  1RUF 2;  2VZQ A;  1EUU A;  2HYX A;  1UOG A;  3MGU A;  4HAN A;  4RGG A;  1LOD A;  2IXL A;  1SBD A;  3M3O A;  5CG8 A;  3AL6 A;  4TWT A;  3VZK A;  1RUI 1;  4GJY A;  2VAU A;  1D0H A;  3VL8 A;  4E2Q A;  3C7E A;  1F15 A;  4JTN A;  1S55 A;  2HEY F;  4PI2 A;  1PK6 C;  1SAC A;  3U75 A;  2A73 B;  1BBT 2;  1JBC A;  5L9B A;  1NCR B;  4YGD A;  5ACA 1;  3HBK A;  3S0M A;  1W8F A;  5CIS A;  3VBU A;  3JB4 C;  4BE3 A;  3ORJ A;  1VBE 1;  3ZIX A;  4CU8 A;  1X8E A;  3VZN A;  4MGK E;  4Q4W 3;  4B1L A;  1DZQ A;  2Y64 A;  4FO9 A;  5A3W A;  4ET7 A;  5FYS A;  3KQ4 B;  2DFB A;  2G4I A;  1ZRR A;  5JI7 A;  1WW6 A;  4WZF A;  1GNZ A;  4XFH A;  4A42 A;  4IXL A;  5CYY A;  5EWS A;  5LEK A;  1VBA 3;  4Q8L A;  4F7Z A;  2XON A;  1NLR A;  2ZAC A;  2JG8 B;  3AP6 A;  4RGK A;  1RUH 3;  3MZH A;  1WKY A;  4CXW A;  4M0H A;  2RS3 1;  4LQR A;  1E57 A;  4L8Q A;  2OS2 A;  4I0W B;  3UES A;  3VBR A;  2AZ5 A;  4JV4 A;  5LCW L;  4CEW A;  4ISR A;  1GQP A;  1UMI A;  4NN0 A;  1PVC 2;  3EJK A;  3MFA A;  2RS1 1;  4RYD A;  3WF4 A;  4NE9 A;  5FPU A;  1ZRF A;  2KD7 A;  1UZZ A;  2CY6 A;  5GM0 A;  5FZ7 A;  4WVM B;  1UMH A;  2JKB A;  2PYT A;  3MO4 A;  3KVB A;  1MS9 A;  1NG0 A;  2BRT A;  4LPL A;  3U1X A;  3MW2 A;  4FCA A;  4NJ4 A;  5CFD C;  5KXD A;  2Q1Z B;  5FY9 A;  4HKW A;  3CF6 E;  2B7Y A;  5H9Q A;  3O1V A;  2GP3 A;  3KGL A;  1SDW A;  3CIH A;  3HJR A;  2HWF 1;  5A3T A;  3KCY A;  4H2A A;  1CAV A;  1A78 A;  1AYN 1;  1WCU A;  2VZR A;  1UN1 A;  3AXE A;  4LBQ B;  4XZP A;  3KV6 A;  5FZF A;  1FAT A;  4B7E A;  1RL3 A;  2ZEX A;  3SIS A;  1V6L A;  1UO9 A;  4CUC A;  4LR4 A;  3H8X A;  1CGP A;  3J8F 1;  1PO2 1;  3I2D A;  4CXX A;  2HWE 1;  1CQ9 A;  4W6X A;  1Y4W A;  3J26 N;  2JXA A;  1ULG A;  1RYY A;  4QDS A;  2B8M A;  5KHJ A;  4QM8 A;  1J1T A;  2PA7 A;  1IQD C;  4D94 A;  3ZXE A;  4Z1V A;  5A70 A;  3LEI A;  1VBA 2;  1QQP 1;  3U07 A;  4Q2F A;  3ZO0 B;  2WYF A;  3ZYH A;  5LWB A;  4G9S B;  4CEW C;  1WW5 A;  5FY8 A;  4YW1 A;  3FLT A;  3K51 A;  4GJZ A;  4Y5S A;  2YUE A;  5DXD A;  4Q4W 2;  3SCH A;  1LKN A;  4LLO A;  1ZZ8 A;  4R9C A;  4NRO A;  5FYU A;  4ASM B;  5HPO A;  4CDQ B;  3PUH A;  2WS9 2;  2ZX1 A;  4W8J A;  3P3P A;  4HVR A;  2HWB 3;  1CAV B;  5BNP C;  4WVV A;  3MIB A;  1N1V A;  3PMS A;  1HV1 A;  1W39 A;  3OPZ A;  2I2S A;  3OUH A;  1RUD 1;  4QPI A;  1QXR A;  1R64 A;  1ZBA 1;  5D1I A;  3VBF C;  1QNW A;  2ZS6 B;  4COV A;  1ZZB A;  3AK0 A;  3C7O A;  1IS6 A;  4OMC A;  3UT0 A;  3VKL A;  5FJK A;  3RZK A;  2JDH A;  1GOH A;  2P6C A;  2P1B A;  4WM7 B;  5FJH A;  1MEC 2;  3I59 A;  3OCP A;  4L9B A;  2RMU 1;  2W9X A;  4PBO A;  2HKX A;  1HXS 2;  1RJ8 A;  1UF2 C;  4JVA A;  3WSO A;  1GUI A;  3N7J A;  3GYD A;  2G1M A;  4ES8 A;  1DQ0 A;  3J8F 2;  5A33 A;  5JMC A;  2WO1 A;  4ATE A;  1Z0H A;  4GH4 B;  4WM8 B;  3GBF A;  2R30 A;  1ZBE 2;  3PVB B;  2D97 A;  2RMU 3;  3U4X A;  3J7H A;  3KS7 A;  1OOP C;  2JEC A;  1AVB A;  1UNB A;  3AMN A;  1LCL A;  4OHY A;  5FY1 A;  3JCI A;  3RYP A;  1E5H A;  4MET A;  1ST8 A;  4G4F A;  4RR3 C;  3TNQ A;  3ZYF A;  4YRD A;  3VV1 A;  2WNU A;  4Q4V 2;  3OD0 A;  5LBB A;  1LOF C;  1G6N A;  3AP4 A;  3B9I A;  5EJ1 B;  1GOF A;  2XBO 2;  3J9S A;  2FDG A;  2JDZ A;  5A3P A;  3OBR A;  3TRS B;  4NWW A;  1OQD A;  4A7Z A;  2Q1M A;  3QD6 A;  1DLC A;  1JMU B;  2Y6K A;  4JDM A;  1W90 A;  5I0T A;  5T50 A;  3AYA A;  4IEU A;  4CU7 A;  2P5B A;  3OUI A;  3I3B A;  4QPW A;  4UOJ A;  2FDF A;  2YB7 A;  3F2Z A;  2C26 A;  2O8O A;  1U5X A;  1XYP A;  2HWE 3;  3LIG A;  4UXA A;  2JDY A;  3K48 A;  4WVZ A;  5BNN B;  2FQP A;  1L7R A;  4FPK A;  2YFU A;  2Q5T A;  4HZF A;  2R49 A;  4CU6 A;  2A6X A;  5BNP B;  5CAZ A;  1VBE 3;  2W47 A;  3CMG A;  3SMH A;  4AZZ A;  4FFG A;  2ZCW A;  4HET A;  3GHM A;  1OHF A;  4L11 A;  3AMP A;  4PIZ A;  1UZV A;  4YAR A;  2W95 A;  1QY4 A;  4KG8 A;  1EV1 3;  1W04 A;  1OOP A;  4LHK A;  4S2D A;  2EAA A;  5FZK A;  3PIG A;  3POJ A;  4PLN A;  3AZV A;  4FT8 A;  5FOJ B;  5JI9 A;  1G9B A;  2QQP A;  4CXY A;  1LOB A;  5F32 A;  5LZ6 A;  5M0T A;  1JYI A;  1KJL A;  5A1F A;  2RJL A;  1K5M B;  1UX7 A;  2E31 A;  2WQZ C;  4F83 A;  4N7I A;  3ZFG B;  1IPK A;  2RR1 1;  4HK9 A;  5BNN A;  4OI4 A;  3JBG 1;  2PHD A;  5JR7 B;  3LKJ A;  4BCU A;  3BTY A;  3VBO A;  4AL9 A;  5FP9 A;  1XXN A;  2X10 A;  3V0B B;  3MUZ 1;  4Q0U A;  5FZ4 A;  4WM8 C;  1AYN 2;  3JU9 A;  2WO3 A;  1B35 C;  4HMZ A;  2BFU S;  2Y8K A;  3L2Y A;  1S0B A;  5H9S A;  1AR7 2;  4AVV A;  2H0V A;  4IV1 A;  1BMV 2;  5A7N A;  1IZ3 A;  2RM2 1;  4R52 A;  4ZPI A;  5JLV A;  4YZ2 A;  4AVS A;  1PGS A;  1FNZ A;  1GQH A;  1ZVF A;  4C0H A;  3E6C C;  1WCK A;  2BYV E;  5FMO S;  1K5M A;  1QF3 A;  5DUX A;  4HKO A;  4CVU A;  1RUJ 1;  4Q4V 1;  3N9M A;  4PCR A;  1ND2 B;  2W1S A;  2X05 A;  1XE0 A;  2OZJ A;  2W68 A;  5FXX A;  4LLF A;  5GZD A;  3RQ0 A;  2JG9 A;  4CCJ A;  5CKM A;  1DGW X;  3UV9 A;  3D3A A;  5DUV A;  1HRV 2;  4UYB A;  2ID4 A;  2JX9 A;  1D2S A;  2XVL A;  5F7U A;  3MF9 A;  4UBH A;  1RUJ 3;  2Y26 A;  4CP2 A;  5G04 L;  4Q8K A;  5B4N A;  1WCS A;  5LA2 A;  1W2O A;  2RDQ A;  2EXJ A;  4ISQ A;  5AC9 1;  3LPF A;  3I49 A;  3NV4 A;  5FMD A;  2WZR 3;  1J3P A;  2DVB A;  1F35 A;  4AQS A;  1Y9G A;  5D8A B;  1PMI A;  4IND A;  3CO2 A;  3TYJ A;  1Q43 A;  2FZ2 A;  1K12 A;  1W6P A;  1GSL A;  1A34 A;  2CWS A;  3AB0 A;  5GKA C;  2VMH A;  1R09 2;  3P5B A;  1B35 A;  1GWK A;  4LEJ A;  1HIX A;  4IE0 A;  4I2O A;  1CD3 G;  1FI2 A;  2R06 3;  2VW0 A;  2X29 A;  1GP5 A;  3RZJ A;  1RUC 2;  4H3W A;  2VUD A;  4A2U A;  3FLP A;  3WP5 A;  1V9U 3;  2VOX A;  5I93 A;  1O4T A;  4RSU A;  4FOV A;  4QX3 A;  4WV8 A;  4Q4X 3;  3H8O A;  2D3S A;  2WWU A;  4HKL A;  2H6C A;  4DPN A;  5FPZ A;  2XHK A;  2W91 A;  1D7P M;  3A0N A;  3THC A;  1G9A A;  2HWC 1;  2WNU B;  2ZHK A;  5BUV A;  2D3R A;  4I0B A;  1QIQ A;  2P4E A;  5EYY A;  1PM4 A;  1OFS A;  4E2S A;  3PVN A;  1QOT A;  4FPO B;  4IV3 C;  1SBF A;  3B9C A;  3ZLI A;  3CQO A;  5HV0 A;  2G9F A;  1H1A A;  4R4Z A;  3H1Y A;  3KZ4 C;  1TEI A;  3V64 A;  4PDW C;  5L9R A;  3ME2 A;  3MEP A;  1S0E A;  4WVW A;  4BHP A;  1G8W A;  3VD4 A;  1AJK A;  1QOO A;  4I01 A;  3ZFE B;  3O0V A;  1CN1 A;  3ETP A;  1GLH A;  1JUH A;  3UGF A;  2PQQ A;  1DZR A;  1AR8 1;  2R04 2;  1REF A;  4Y4Y A;  1B35 B;  3NJY A;  5FCC A;  3ZPY A;  1DZT A;  1G9F A;  1BBT 1;  2K9Z A;  1MZ6 A;  2VNG A;  2ZEZ A;  3B01 A;  3IDB B;  3I3M A;  1QXJ A;  2W39 A;  3ABZ A;  4JAA A;  4QKN A;  3T4H B;  2XKP A;  2RDS A;  1W03 A;  1KEX A;  4F8A A;  3KV9 A;  1PZ9 A;  4MSV A;  3OG2 A;  4UFM A;  1H1M A;  3KV4 A;  5FQ0 A;  1BKZ A;  4YZ3 A;  1SBE A;  3WQ1 A;  4XBQ A;  1NQD A;  2GNT A;  2VUL A;  1N1Y A;  4CDW A;  1X33 A;  4LKD A;  4XMA A;  3ACI A;  5IT6 A;  2XR4 A;  1QH6 A;  3I3E A;  3LB9 A;  4DIQ A;  3BOD A;  5L7O B;  2DCT A;  1XNB A;  2PEL A;  1AR9 2;  3KSC A;  3PVO A;  2HBU A;  4CPB A;  1KRI A;  3AP9 A;  1KFU L;  2J1E A;  4RFR B;  2C6S A;  5FFO C;  3RWK X;  4CDX C;  4D69 A;  4AQ2 A;  4E8D A;  4CCD A;  5C8C B;  5CB7 A;  1GWL A;  3VBU C;  3THP A;  4FPL A;  4LK6 A;  3JZV A;  1MS5 A;  4XET A;  5IAX A;  3BYW A;  1PVC 1;  2QQU A;  5AFE A;  1NA1 B;  4FXG B;  3IIA A;  4CCE A;  2C1F A;  1XQN A;  3D82 A;  2Y6L A;  2V5Y A;  2O8Q A;  2MNG A;  1JYC A;  1IS5 A;  4P14 A;  1EAH 1;  4RN5 A;  1TMF 2;  2UYB A;  2AGS A;  5F3G A;  1AXZ A;  1YQ5 A;  4LUK A;  4NHY A;  4UWD A;  3WUC A;  2EIC A;  4C90 A;  4FTB A;  1V9U 1;  2N7G A;  5FYI A;  2BGO A;  2VBB A;  4GAZ A;  1WME A;  5A6Y A;  1OF3 A;  1AHS A;  1MQT A;  5FPB A;  4ONU A;  4URT A;  1W6O B;  2XL7 A;  4MGZ E;  2OT7 A;  3JBG 3;  1QJX 2;  2GSY A;  3SH5 A;  1FMD 1;  2I45 A;  2FDH A;  1CAU A;  1CJD A;  1KJR A;  3BB6 A;  5FDB A;  1BXH A;  2ZX3 A;  4N53 A;  4XJA A;  2J1T A;  4DUW A;  1W9F A;  5JOX A;  3D0J A;  1PO1 3;  3OGS A;  2VTF A;  1HQW A;  2VTX A;  1WMF A;  2VCM A;  2ZZQ A;  4DXZ A;  3IB3 A;  1CES A;  1H2K A;  2CYF A;  4Z2W A;  5LRR A;  3T4V A;  3R4S A;  4XJW A;  5F5Q A;  1XE8 A;  3A21 A;  1X9T A;  2A75 A;  4NMI A;  2BVB A;  2ZX4 A;  4C1W A;  3LAG A;  2VCC A;  3P3N A;  1SLL A;  3I2F A;  4K21 A;  2PHW A;  1NY7 1;  2E7Q A;  3LSE A;  4FPJ A;  3T09 A;  5H9P A;  3H1W A;  2W94 A;  2ERF A;  2ZKL A;  1XSQ A;  4B4R A;  3LOB A;  3APB A;  5D8A A;  4DOU A;  1WD4 A;  1D4V B;  4MO3 M;  5F1R A;  5FY0 A;  3FWE A;  1MS1 A;  2DCZ A;  1AR8 3;  1IG0 A;  4GMP 0;  1ZRC A;  2CTV A;  2WS9 1;  5I8T A;  4TSV A;  2LRO A;  3AC0 A;  1O8P A;  3ZN5 A;  3HT2 A;  1F8V A;  5A3U A;  5C7G A;  1DG6 A;  2ES3 A;  3FHA A;  5L73 A;  4OI0 A;  2W3J A;  1FOD 2;  5ISL A;  5FZO A;  3RDI A;  3TEY A;  2FDJ A;  2YC0 A;  2J1S A;  2OII A;  3AZX A;  3WP3 A;  2VZU A;  1OD5 A;  5IYY A;  5JWP A;  5K9Y A;  2DVA A;  3HQU A;  4LBM A;  1LHW A;  4GWJ A;  2YFZ A;  1YQ6 A;  3ON7 A;  4LUL A;  2RG4 A;  4E9K A;  1ULD A;  3RI8 A;  3JQW A;  3E6B A;  4Y1Z A;  3PTR B;  3ZSE A;  2LUW A;  4AFM A;  4FXK B;  1KXG A;  3CJX A;  4CCL A;  4CA9 A;  5FY4 A;  4XFC A;  3VBF B;  2TBV A;  1VMJ A;  4P9X A;  4RR3 B;  1PNG A;  5DAP A;  5FYV A;  5FK7 A;  4DNY A;  3VBU B;  5FZ3 A;  1D4M 3;  5BNP A;  2CDP A;  4UAP A;  4QHB A;  1X36 A;  2EIE A;  5FYC A;  5C3Q A;  1C5H A;  1F5F A;  4SBV A;  1S2E A;  1SCR A;  3T0B A;  1NLQ A;  3WNO A;  1EAH 2;  2XJR A;  3ZMO A;  5FO9 B;  2RDR A;  1NE4 A;  4B3N A;  4XPV A;  1TVG A;  1CIY A;  1DP0 A;  4JX0 A;  1AYM 2;  1I6X A;  1FT9 A;  1IGO A;  5DG2 A;  1UY3 A;  4YGE A;  3ES1 A;  3IAQ A;  2Y6G A;  3FN9 A;  4XF1 A;  3SCF A;  2VH9 A;  1DYK A;  3W59 A;  3TEW A;  4UFI A;  1NKG A;  2VZV A;  4IUG A;  2QE3 A;  3FHQ A;  2WQ8 A;  4P9W A;  4AHW A;  1JH5 A;  4YVS A;  3BAL A;  2IFR A;  3IWZ A;  3LA3 A;  1DBN A;  4LO4 B;  4Y22 A;  2D98 A;  2VQA A;  4N53 B;  3ZFG A;  2YC2 A;  1UAI A;  1V00 A;  2BPA 2;  5IVV A;  3TB0 A;  3T2Q A;  4QB2 A;  3LZZ A;  1DHK B;  2Y6J A;  2XVK A;  1AR7 1;  3POS A;  4P5H A;  1UX6 A;  1UPS A;  2Z69 A;  3D4K A;  3MFC A;  1UY4 A;  3B7M A;  5F5C A;  3UK9 A;  2R07 2;  3WNX A;  3DXT A;  3WY6 A;  4CP9 B;  3RI9 A;  3R4U A;  1JZ6 A;  3FMG A;  1K5J A;  1ZZ9 A;  1LHV A;  4TN7 A;  3SXW A;  5CU1 A;  4PIY A;  4IEP A;  3DGT A;  1NA1 A;  2Y34 A;  1QHD A;  1EY2 A;  4IEY A;  4Q4W 1;  2BBA A;  1REE A;  3A22 A;  4XMI A;  2BNN A;  2VUJ A;  3AM2 A;  1K42 A;  1NCQ C;  1ONA A;  1TG7 A;  2GNB A;  1SHW B;  5A7W B;  3SEE A;  3WT3 A;  4FQZ A;  3RMY A;  4CUA A;  1RUI 2;  1RMU 1;  3MW3 A;  1Q8Q A;  3ZXK A;  2BOJ A;  3N3H A;  1N3O A;  2MEV 3;  4GWN A;  2QKD A;  4MZU A;  2RV9 A;  4YVW B;  5BXX A;  4A3X A;  1KQR A;  2LM3 A;  5J36 A;  5JIU A;  1UD1 A;  2D6M A;  3UKT A;  3N9O A;  4NR1 A;  2P6H A;  3MIE A;  4GB3 1;  1MS8 A;  5F3I A;  2D5H A;  1MS0 A;  5GZG A;  4JC1 A;  2BEO A;  1CZV A;  4IEO A;  4RS5 B;  1GAN A;  1RUC 1;  1RIT A;  3V0A B;  2OZ6 A;  4NII A;  4OZX A;  3SIT A;  3WNM A;  5JXG A;  1PIV 2;  4Y4R A;  4AAX A;  4HSJ A;  3FUO A;  2WNE A;  5FZG A;  4FOQ A;  3L2H A;  3AKT A;  1LHO A;  4J25 A;  4C91 A;  3MHZ A;  3AFG A;  3AVR A;  5C3O A;  1NAE A;  3AJZ A;  2ZA9 A;  4WBB A;  3T3Y A;  2B9V A;  1S2B A;  4UFL A;  4MGQ A;  2BV4 A;  1XJA A;  2CU5 A;  3H3Z A;  1SG3 A;  5CAD A;  4ZHN A;  4LXL A;  5LY1 A;  5IK4 A;  3S6P A;  2Z4F A;  2AYH A;  5FO7 B;  4WM7 A;  4QPG B;  2Q0A A;  3I7D A;  1SMV A;  1RUN A;  3WQB A;  3POB A;  3ASI A;  5FP3 A;  4Y20 A;  4XJ8 A;  3B94 A;  2QQI A;  1W8O A;  3URF A;  2X5I C;  3O1M A;  1J84 A;  1QJY 1;  1OPM A;  1PIV 3;  2FMD A;  1JS9 A;  4RR3 A;  2CNA A;  1YQ8 A;  4RQP A;  3WDX A;  5IAV A;  4AED A;  3ILF A;  3OPT A;  3WF2 A;  5BNO C;  2E26 A;  4AOC A;  3H8R A;  2HEV F;  3D6E A;  1RUG 1;  2PTM A;  3GM8 A;  4XOG A;  4Y1X A;  3THT A;  4P5Y A;  4CDQ A;  5FTT C;  3MF6 A;  2W87 A;  1LOC A;  1DDL A;  4NPM A;  2MEV 2;  4OQ9 A;  3H1M A;  4JKL A;  1JYW A;  1YQC A;  3S5A A;  1BMV 1;  3EHK A;  2G19 A;  3VB9 A;  1YIP A;  5DQ0 A;  1RUI 3;  5FYH A;  1PZ7 A;  2YU2 A;  4AI1 A;  5F3C A;  1ULE A;  1LTE A;  2JE9 A;  4W50 A;  1JYV A;  2YYO A;  3AVS A;  1JZ4 A;  3VBS C;  1VRB A;  2TEP A;  4FTE A;  5JVV A;  2R1D A;  2W92 A;  4LBN A;  1EUT A;  2WZE A;  5D8A C;  1T6B X;  2D43 A;  4Q1R A;  4NRP A;  3ZXJ A;  3KV5 A;  3M3E A;  1LGC A;  2J7M A;  4RD7 A;  3DKQ A;  4LHL A;  3WUD A;  1C8M 2;  4LKE A;  1RUE 2;  2RS5 2;  5C71 A;  1CPM A;  3EXU A;  5CFC A;  1G9D A;  2F4L A;  2ARX A;  2VBP A;  3N9P A;  1GZW B;  1FXZ A;  5FXV A;  2A3Y A;  3RS6 A;  1XPW A;  3S30 A;  2QQO A;  2OQ6 A;  2XQR A;  4K9S A;  1NCR A;  4GZ9 A;  4HL0 A;  5FZ8 A;  2QQM A;  4DB5 A;  5FYB A;  4AVT A;  3BPS A;  2JEN A;  3GHN A;  1L7L A;  1S2K A;  1I9R A;  1O3R A;  1IKP A;  1QJX 1;  4COY A;  1DFQ A;  5E88 A;  1QGL A;  3AXD A; 
#chains in the Genus database with same CATH homology
 1POQ A;  1PM4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...