3NVCA

Crystal structure of salicylate 1,2-dioxygenase g106a mutant from pseudoaminobacter salicylatoxidans in complex with salicylate
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
353
structure length
349
Chain Sequence
b'MQPKDTPELRALYKSFEEESIIPLWTQLGDLMPIHPKSKAVPHVWKWSTLLRLARKSGELVPVGRGGERRALGLANPGLGGNAYISPTMWAAIQYLGPRETAPEHRHSQNAFRFVVEGEGVWTVVNGDPVRMSRGDLLLTPGWCFHGHMNDTDQPMAWIDGLDIPFSQQMDVGFFEFGSDYATPNFSRGERLWCHPGLRPLSGLQNTVASPIGAYRWEFTDRALTEQLLLEDEGQPATVAPGHAAIRYVNPTTGGDVMPTLRCEFHRLRAGTETATRNEVGSTVFQVFEGAGAVVMNGETTKLEKGDMFVVPSWVPWSLQAETQFDLFRFSDAPIMEALSFMRTKIEGQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gentisate 1,2-Dioxygenase
publication title The salicylate 1,2-dioxygenase as a model for a conventional gentisate 1,2-dioxygenase: crystal structures of the G106A mutant and its adducts with gentisate and salicylate.
pubmed doi rcsb
source organism Pseudaminobacter salicylatoxidans
molecule tags Oxidoreductase
total genus 94
structure length 349
sequence length 353
ec nomenclature ec 1.13.11.4: Gentisate 1,2-dioxygenase.
pdb deposition date 2010-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07883 Cupin_2 Cupin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3nvcA01
1QXRA 3OCPA 1UD1A 5CADA 2XGXA 3E5XA 3I7DA 4P9GA 2GC3A 2QNKA 1O3QA 2Q30A 4KWLA 2XKOA 2CAUA 4IEXA 1ZRDA 2QCSB 3ELNA 3RYKA 1LR5A 3UKVA 3IDBB 1NXMA 5I8TA 4E2GA 1NZCA 3RZZA 1O5LA 4KWKA 4LTAA 4AQ2A 5KHJA 2Y0OA 3FFQA 4HBNA 1QWRA 3CL1A 3LZZA 2GZWA 1CAUA 2HJIA 3LA2A 2Q4SA 2FQPA 1WLTA 4EWAA 2PHDA 1LKNA 4E2SA 5I0TA 4MGZE 4QGMA 4YYOA 2MPFA 3FHIB 4XFCA 4B29A 3IIAA 4X6QB 1ZRCA 3USSA 5KBFA 1YFUA 1G6NA 2ET7A 2EVXA 5EFUA 2ET1A 2OPKA 2Z2SB 3KGLA 3ZDSA 4E2QA 3EJKA 5KHIA 2OZJA 1I6XA 4I02A 1OFNA 3NSTA 5LEJA 4KU7A 3OF1A 4I09A 4MZUA 1VJ2A 2ATFA 2ETEA 3TNQA 5FLJA 3RYPA 2QJVA 4L2NA 4XF9A 3E6DA 3PNAA 3ETQA 3LA7A 2WC2A 1SFNA 5FLIA 1YUDA 2XLFA 4HVRA 3EBRA 2VECA 4I0BA 4WBBA 2UY8A 3NVCA 4XFIA 4Q0SA 1ZRRA 4XF3A 3E6CC 3D0JA 2O8QA 4IEWA 4AVAA 3IWZA 5K8SA 4YARA 3IDCB 4HVQA 3H1YA 4EV0A 2QVSB 1U12A 3H1MA 5FQ0A 3D82A 5FCCA 1O4TA 3SCGA 1ZZCA 3U10A 2BEOA 2Q1ZB 4Q0QA 2PAEA 1L3JA 5BXXA 3E5QA 3U0ZA 4LUKA 4YNIA 4XF0A 2Q0AA 5E1RA 3VHRA 4EWEA 4YRDA 5FQ0B 5J48A 3O14A 2UY9A 3CEWA 4QM9A 3S0MA 2CV6A 4O9GA 1GQHA 5I8YA 2IXKA 1J3QA 3H50A 2K0GA 4EROA 4Q0PA 3KMHA 2PA7A 4Q0UA 5KHHA 3H3ZA 3BPZA 2P17A 1CAXA 3WW2A 2C0ZA 1YHFA 1H1MA 5BV6A 2VQAA 3EQEA 1J1LA 4N9IA 1ZZ9A 3I54A 5JSRA 4QX5A 4MGKE 1UPIA 3WW4A 3E6BA 2OYZA 4XFBA 2H6BA 1FXZA 4HSLA 3E5UA 1X82A 1ZX5A 4ORFA 2IXCA 4IEYA 4IESA 4OLLA 1ZNPA 2GC2A 1UIJA 1NE6A 2FMYA 4UBGA 4IEVA 1EYBA 2XKPA 1RGSA 1EP0A 3DKWA 1J58A 1XRUA 3OTFA 4QXKA 2D40A 1DZTA 3UKNA 1ZZ7A 4Q0VA 2CAVA 2GC1A 3RYRA 3SHRA 1ZRFA 1UCXA 2I45A 2XLGA 1O3RA 2B8MA 5CVRA 1I5ZA 3MDPA 2OA2A 5CU1A 3H7JA 5J7MA 4I0AA 2IXIA 1OI6A 5FPXA 3LWCA 2Z69A 3EO6A 5T3NA 1CGPA 3GYDA 2WFPA 5I8SA 4IEPA 1CAUB 2VPVA 1SEFA 4CYDA 1DGRA 2MNGA 3FX3A 5I0SA 4BYYA 2DCTA 4HLTA 4ZU5A 3RNSA 1JUHA 1LB2A 3ES4A 2PAKA 5LRRA 3WW3A 5I0RA 2UYAA 3S7EA 4META 1YFXA 2XL7A 4DINB 2QDRA 3R6SA 3KSCA 2KXLA 4XETA 5HI0A 2GC0A 1ZZ6A 5C6CA 4PJYA 3G7DA 4Z07A 3FE5A 4WZCA 5JSPA 4HSJA 1YWKA 4I2OA 4LA3A 2GAUA 1EPZA 4BHPA 1UW8A 4QGNA 4FT8A 3I59A 4QGLA 1EY2A 3FWEA 3LA3A 2B5HA 5JR7B 4D7SA 1YLLA 4L11A 3ROUA 4HMZA 5FLHA 4MX3A 1O3SA 4MV2A 2B9UA 1ZZ8A 3OGJA 2IXJA 4IEUA 2K9ZA 2H0VA 4WVZA 3S7IA 1CAWA 2ZCWA 5BPXA 4MUVA 2PFWA 3I59B 3CF6E 2CGPA 3CJXA 4F8AA 4AVCA 3RPQA 3IBMA 4BH9A 4LA2A 1Q5OA 1IPKA 4XEZA 4O9EA 4R52A 2IXHA 4QMAA 1LRHA 2E9QA 3NJZA 4MGIE 3WW1A 1CAWB 2EA7A 3H1WA 4R8HA 2D5FA 2UYBA 5KHGA 4HVOA 4UXAA 4ONUA 4D7TA 5I93A 1NE4A 4LUMA 3SCHA 2PHLA 3MPBA 2H6CA 1CAXB 1O5UA 1OD5A 5F1RA 3SCFA 4RD7A 3QACA 4BIFA 2OZ6A 4J1WA 3HT1A 3ST7A 2V09A 3DV8A 4IETA 3CLPA 4KWJA 5J3UA 1VR3A 4A2UA 2F4PA 1IPJA 4ZU7A 3H9AA 3H7YA 5C8WA 3DL3A 4I01A 3BALA 3NW4A 4MH0E 2XL9A 5EZWA 3HIFA 4IERA 4F7ZA 2PAMA 1ZZBA 3MYXA 4FAGA 1WA4A 1OMIA 3PLQA 5FPZA 1X8MA 1ZVFA 3ACLA 2D93A 1GQGA 3NL1A 3HT2A 1SQ4A 2BGCA 1ZREA 4NVPA 4XF1A 4XFAA 1RUNA 3E97A 5I0UA 3M3IA 4J1XA 5I91A 4LULA 2PYTA 1RUOA 4K8FA 4JTOA 4LLOA 1FT9A 2BYVE 1O7FA 3N4MA 5JSOA 4I3PA 1QY4A 3RDIA 3QOPA 1XE8A 1O3TA 1VP6A 3LOIA 4XF4A 5KHKA 1TQ5A 2PTMA 4MGYE 1H1IA 4ZU4A 5JCTA 4X6RB 1NYWA 2IC1A 5FDBA 3L2HA 4TLFA 2BNOA 5E16A 1Y9QA 3BCWA 2GU9A 4JTNA 2ZKLA 1RL3A 3CO2A 4AQ6A 1YFYA 2GH2A 3OD0A 4AXOA 4Z82A 4PIXA 1FI2A 5AVPA 2PQQA 5LEKA 3JZVA 4JVAA 4N9HA 4HZFA 3BB6A 4XFFA 4IEOA 3C3VA 3MZHA 1XE7A 4EWDA 4KL1A 2IXLA 1J3RA 1V70A 3TNPB 3KGZA 4FAHA 5BY5A 3DN7A 2N7GA 1X7NA 3KCCA 1QXJA 5LRSA 4XFHA 2BNNA 1J3PA 4AVBA 4HN0A 1Y3TA 1J59A 3U11A 1RC6A 3HQXA 3H3UA 1Q3EA 3EHKA 2HKXA 2MHFA 1HW5A 1PMIA 1DGWA 1CAVA 4QM8A 4LEJA 4Q29A 3LAGA 2O1QA 1CX4A 4OFGA 1DZRA 4H7LA 3H8UA 3SMHA 1WGPA 4YSFA 3NKTA 1RTVA 3M70A 2BNMA 3PVBB 4GULA 2XLAA 4PIYA 3BU7A 4XFGA 5BUVA 3FJSA 1YFWA 4KU8A 3B02A 5D1IA 4PIZA 4JV4A 3ES1A 4FBFA 2XHKA 3UKTA 3GBFA 1X8EA 1CAVB 4HN1A 3SXWA 2EAAA 1Q43A 4IEQA 1PM7A 3D0SA 3FZ3A 4UBHA 1UIKA 2D5HA 4IEZA 5JAXA
chains in the Genus database with same CATH superfamily
5JUVA 1W2AX 1W6MB 4B4RA 1UD1A 5CADA 1R1ZA 2XGXA 3MF6A 4OI1A 3OGVA 2ZMNA 3ZYHA 1AR92 4CP2A 2QZ2A 2B42B 1IZ3A 1W39A 4AEDC 2VVFA 2QNKA 1Y43B 4IE6A 2RS11 1O3QA 3R05A 4KWLA 2XKOA 2VL4A 2VULA 2P3IA 1BCXA 2CAUA 3BGAA 1YO8A 3LE0A 2FCUA 4IEXA 4YG3A 5FO9B 4TZDA 2RR11 3ELNA 2D6NA 2GP3A 3SITA 2IFWA 1GR3A 1NXMA 3O7OA 3WDXA 4QWNA 5FPAA 4CEYC 1UU5A 5T5LA 4DRRA 1S2KA 5FREA 1O5LA 2W47A 1RUF1 4KWKA 4LITA 5LZ6A 3T1LA 1RMU2 5A3UA 4AOCA 1ASJ3 1S0GA 2ZEZA 2QBXA 2HWB2 1GP5A 4Y26A 3VDDB 2Q8EA 3T2OA 1KD7A 1LOFC 3CL1A 1I5PA 5GJ6A 2Y6KA 3AFGA 2JDYA 2JJ6A 1CAUA 3VBOA 1ENXA 4FOWA 1XYPA 2HJIA 3K4DA 4OHYA 2ZGOA 3WSOA 2FQPA 5E8AA 1CJPA 3RZJA 4CCEA 1UXZA 4QQOA 4XURA 5A3LA 2VXJA 1POV1 3WP3A 3H8XA 5C3RA 1JU3A 4MGZE 4QGMA 2MPFA 1MS4A 3IIAA 1RUI1 1ZRCA 2V4VA 2FZ2A 1YFUA 1TNRA 2TUNA 1OURA 2FMDA 2ZXQA 4YVSA 2OPKA 1Q8SA 3ZSLA 4E2QA 1U5IA 2AGSA 3EJKA 4I02A 5L9RA 2XJSA 1GUIA 1SCRA 1WKYA 5LEJA 2FDJA 2KD7A 4FPKA 2WT1A 3OF1A 4I09A 3SH5A 3VBOB 3ZMNA 4BE3A 2AYHA 3K77A 4FTBA 3RYPA 4XJAA 4Q2FA 2L9LA 4XF9A 4DY3A 5A3OA 5FZ7A 3HNMA 2QQJA 4LR4A 2HWE3 3LA7A 1N1VA 1PVXA 2JDHA 2XLFA 3LEGA 4HVRA 1H2LA 2VECA 2MEV3 1L7RA 4WBBA 3ZOIA 4N90A 3GGLA 2HWD2 2WRAA 3NVCA 4YVSB 5DMYA 1PO12 3CMGA 4QKFA 4YM0A 1UYPA 2ARXA 5LBCA 1ZRRA 2A6VA 2WBKA 3Q8AA 4AVAA 1GWKA 1MEC1 2VQ0A 5IK4A 1AR61 2R49A 1YQ2A 2YB7A 1VMHA 4YARA 4ASKA 4YZ5A 4YW2A 5DZGA 1GP4A 2BFUL 2ZZJA 3MICA 4LKFA 4GAZA 4JGZC 4DS0A 4U36A 3H1MA 2ZX2A 1BLZA 1O6UA 1REEA 2VMGA 1S0JA 1XNKA 1W8FA 4UW5A 5LA0A 1ZZCA 2R30A 2BEOA 3DPRC 2Q1ZB 2DBIA 1EV13 4NHMA 5EJZB 4JGYC 2D3SA 2JDKA 5BXXA 1OVPA 4A3XA 1QNYA 2HWF2 5A6XA 1G8WA 1Y4WA 1W6PA 3ALQA 1P8JA 1B35C 1UY1A 3VBFA 3VHPA 3MUY1 2K2SA 3LFMA 1QJU3 2Q8DA 1US3A 2VNVA 1A3KA 2Q0AA 1IG0A 3VHRA 4EWEA 1PO22 4PBPA 4QX2A 4DIQA 4C1XA 4WV8A 5FKBA 1BYHA 4XDQA 5A7PA 2H0BA 1YI7A 1NLSA 1W8TA 3RJ2X 5DABA 5F9TA 5GZGA 3THDA 5G04L 1W6PB 2PQSA 2R0HA 4AFAA 3AZYA 4JHZA 2K0GA 4R9BA 3VBFB 3ACGA 1AL0G 2NZ9A 2YU1A 2XDVA 5FP9A 1ULOA 3JQWA 5FP7A 5BNPA 5ACA1 1JZ6A 2DYCA 1R1A1 4UI9L 4W6YA 2VO5A 5FY0A 3AB0A 3U1XA 3LFIA 2JKBA 1R091 1C8M3 2D98A 5CIRA 5D8AC 5C3SA 2ENRA 1YHFA 1H1MA 2DF7A 5BV6A 1DCSA 2DCYA 5GZDA 3EQEA 3I3DA 3K4AA 3WV6A 1BHGA 2JG8A 3I54A 4AW7A 1MR5A 4A6SA 1PM4A 3OUIA 4JKLA 2OYZA 4OULA 2WS93 3ZYFA 4F3JA 2H6BA 1BQPA 5KXBA 1JBCA 1XBFA 1VBC3 4NPMA 5FP3A 3X29B 4DUWA 1RXFA 4XBLA 1GANA 1AR73 2DVDA 4NAMA 4Q1PA 2HEVF 1UZWA 4ORFA 2J1SA 4GQ7A 1IGOA 5GALA 2VCMA 5FPVA 3UL2A 2GC2A 5J98B 2R073 2VY0A 1XC6A 2JG8B 1W6OA 2AEZA 2EF6A 2FMYA 4IEVA 2R042 1RGSA 1E5IA 1PVC3 1NT0A 4AI9A 2ZGPA 1COV3 1SFYA 2VZVA 2WUHA 3CJIA 2QQOA 3OTFA 4YM2A 4CSWA 3UKNA 3FLPA 1K5JA 1DQ2A 4IV3C 4NRPA 4Q27A 1BZWA 2CAVA 5FBZA 1ZBE2 4P9LA 5KXCA 3WDUA 4C8DA 1BVP1 1UCXA 4FQZA 4KMQA 3ACFA 4OHVA 3VBRA 5FOBB 5CVRA 3V56A 4FFFA 5FYUA 4LORA 4CU8A 5H9SA 2A7AA 4K8RB 1K5MA 2D97A 3AZZA 3PURA 2J1AA 5J7MA 5KC6A 4M0NA 1JOPA 4IGPA 3AP6A 4CCCA 4NIHA 2Q5TA 3LWCA 1NLQA 2Z69A 3Q9OA 4XUOA 5ERLA 5T3NA 3VL8A 2YFZA 3OEAA 2VVDA 3U4SA 1Y7BA 1VBE1 1W8OA 2EIDA 5I8SA 2JDMA 2UU8A 1RYYA 3WF3A 4XXPA 1SLAA 2VUAA 3H3LA 1BEV2 4FFHA 1OQEA 2MNGA 3FX3A 3VBRB 4CUGA 3ZFGA 3C7EA 4ZZ8A 4FTEA 2VOWA 3QLQA 1WD4A 3B93A 4QPWA 4ATFA 4K21A 2WLQA 4CDXB 3V0AB 1JUHA 1K5MB 5L19A 1SBEA 3C7OA 3O1UA 2PAKA 2XXZA 3VZOA 1O8PA 2UYAA 3S7EA 4OCTA 3SEEA 4IGQA 4DINB 1O8SA 5LB6A 2UWAA 2P6CA 4GWJA 4M01A 1JZ2A 1CONA 5FZKA 4E27A 5CEHA 1RVF2 2WZEA 4XETA 4PDWC 5HI0A 5FY7A 3WF2A 4E8DA 3B3QE 4QX7A 5C6CA 1GNZA 4YM3A 5C3OA 3ZFGB 2JG9A 1S2EA 1W8ZA 3K48A 4QQHA 3KT1A 2Y6FA 5JSPA 2DVAA 1QJY2 4HSJA 4RFT0 1W2OA 2FHRA 1CZTA 1HB4A 3ITQA 3R4DB 4NAOA 5K0UA 2LALA 1HN1A 3KV4A 1CIWA 4A4AA 1UZVA 4GALA 1EPZA 3AC0A 3BODA 4QPGC 2ZGKA 4BHPA 4ISRA 1L7QA 3FHQA 3ACIA 3GZUC 3LEKA 5BNNA 1RUH2 2YV8A 3D4KA 5DPNA 4A44A 3FWEA 4GB31 4MO3M 4XIOA 1HRI2 3S30A 4B1LA 1BK1A 1R082 2A75A 2E7TA 4HMZA 1SG3A 1VBB2 5FMBA 3ASIA 5FLHA 3W5MA 2WZ8A 2RMU2 4S2HA 5K0UB 4L9BA 1ZZ8A 1MPXA 2W1UA 3AP5A 3MLKA 3WNXA 4M4RA 3POGA 4LK7A 1MS5A 1CAWA 5JLVA 1PO13 1Q8OA 5JWPA 5DG1A 1LHVA 5BPXA 3V0BA 2PFWA 5B4XA 5FMOS 4EN0A 2Y6JA 1TME3 5FPLA 4CEWB 4BQ5A 2VZPA 2WN2A 5BNNB 1W04A 3AX4A 2OQ7A 3KV6A 4WM8A 3VDDC 1S0FA 3CJXA 4F8AA 4QKDA 2Z79A 4KNCA 1Q5OA 3M3QA 2W1WA 2RJKA 4O9EA 4YZ4A 4R52A 3WLUA 2IXHA 1VBD3 4QMAA 4V2VA 1LRHA 1W2TA 3B9CA 1D2QA 3K2OA 4QX8A 5JR2A 2HH9A 1CAWB 2EA7A 1G9AA 1FV2A 4Q1RA 3ZYJB 1V6OA 3VZKA 5F5QA 2ARCA 3ZYPA 3PU3A 3T09A 3QH7A 3DKQA 3V0BB 4HOOA 5TSWA 3Q8FA 2XWJB 2HWF3 1IS4A 1XB9A 1OLRA 2FDIA 4AFCA 3M1HA 1O4YA 5HV0A 4N53C 1OQDA 1RITA 3QCWA 5A6YA 4UT5A 3GBWA 1A8DA 5DZFA 5F8PA 2EXHA 4DRVA 4GJZA 4CCLA 1APNA 3SCHA 2PHLA 1XPWA 1LOAA 1PO23 5DUWA 5EV7A 4M3CE 4RHV1 4MGQA 2XHNA 3IZOA 1OD5A 4NO4A 2VBPA 4DPNA 3SNMA 2RM22 1NA1C 4C91A 2YY1A 1LGNA 5FYBA 3N9NA 1RB8G 4NROA 4BIFA 3A0NA 2OZ6A 2Y26A 3HT1A 1UYZA 3KS7A 1BJQA 4IETA 4BCUA 3CLPA 2F4PA 3ZYBA 2Y34A 3F2ZA 2A5ZA 1VAKA 2HWE1 5FOJB 4Y5SA 5FYZA 5F3CA 3BN6A 3T4VA 3BUCA 1SBFA 1WD3A 3VD5A 3ZXLA 2MEV1 3KZ4C 4LIUA 4F7ZA 2FDKA 1CZSA 3CDZB 1UZZA 2ADDA 1UYXA 2WO3A 2PMWB 1ZZBA 4OMCA 4D0QA 1FMD1 4XMAA 1PK6A 1KXGA 1ZVFA 3HEIA 1RUC2 1LJ7A 1W8WA 1MS9A 1IS6A 3NV3A 4NVPA 1SBDA 2WZR2 2D43A 4XFAA 1W8UA 4Y3OA 3RI9A 3SQOA 2DVBA 2GN3A 3I2HA 5I91A 3FBYA 3NQHA 2BOIA 2O14A 4FFGA 1EV11 4ASLA 4CXWA 4E4ZA 4AGRA 2YFUA 1D4M3 2XQXA 4JTOA 4LLOA 4CA9A 1FT9A 4GWMA 1JYCA 3AXEA 5A3WA 2BYVE 3ZIWA 3QBQA 5J37A 3POFA 5A6ZA 4I3PA 5JSOA 4LOTA 3ZXAC 3N4MA 1QY4A 1XQNA 1ZM1A 2E53A 2R043 3M3EA 3T2PA 1OA3A 1QJU1 2RS32 5K9YA 3AKQA 3LOIA 2QQIA 5F39A 2LUWA 4P9JA 1H1IA 4XDPA 5FZ6A 4AAXA 1MQTA 5A32A 4ZU4A 3UJOA 1ALYA 1ZBE3 4FOVA 4HG6B 4QXHA 1JZ7A 1FYUA 3AZXA 2HBUA 4GWNA 5BNOA 3ACHA 4Y22B 4P00B 2LROA 2YC0A 4YVWC 5JOZA 3I2OA 5LBBA 2RDQA 4TSVA 2LRPA 2R6QA 2ZOEB 1XSRA 1RL3A 4EN6B 1YJKA 3HQRA 4HANA 4AQ6A 2GH2A 3EMRA 1H6YA 4UF0B 4OUSA 3RS6A 2IWGB 4AXOA 3RZKA 2Y38A 2YBKA 4KG8A 1FI2A 1RHI2 5AVPA 3ZYIB 5A32B 1MQTB 3SKJE 2CGNA 2IFRA 4FP2A 4HZFA 1C8M1 2PN5A 5FZ1A 1UMIA 4D94A 3GHNA 5BNOB 1AZDA 1BEV3 2XVGA 3DECA 4LBQA 4Q4Y2 1UY4A 2WKKA 1OF3A 4CP0A 4URTA 4CRQA 2NMOA 4NHLA 3KGZA 1XSQA 4D6RA 1JYIA 2N7GA 1X7NA 4W65A 1POV0 5LRSA 4XFHA 4Q8LA 4DY5A 4EN9B 5DUXA 1ST8A 1Y3TA 1VBC1 1RJ7A 4RGKA 4XTPA 1J59A 2YPJA 3U11A 4XXAA 1OPMA 1RVF3 1AR71 2RDRA 3O0XA 1OT5A 2XMLA 4OUEA 1H2KA 4O7XA 4LBQB 1Q3EA 1F4AA 1FOD2 2NYYA 5H9QA 1PMIA 1DGWA 2FDGA 1JU4A 2R071 4N43A 4ZXKA 3ZPOA 4Q29A 1Q8VA 3LAGA 2ORXA 4OFGA 2VTXA 1QJY3 3GDBA 3H8UA 4HK8A 5CB7A 1COV1 3J7LA 4XUPA 4OHWA 3TEWA 3INAA 2X5IC 1QH7A 2FBEA 3JB8A 4YFWA 2BBAA 4XFGA 2RHPA 3BU7A 5JI9A 3FJSA 3GF6A 3TAYA 4PLNA 3DYPA 4B1MA 4E4HA 3B02A 4QHOA 4YLZA 4TYSA 4K9SA 4PIZA 2ZS6B 4JV4A 3ES1A 3L9JT 4X8NA 4RR3C 2XHKA 3KV5A 3UKTA 1X8EA 2UWCA 4N43B 2EAAA 3T2TA 1Q43A 5A3TA 2FZ1A 5IVJA 1KFUL 1PM7A 1VBB3 2DU1A 3GZTB 1S55A 1U0AA 3HAGA 5HXVA 2IZWA 2OQ6A 4UBHA 4CDXC 4D69A 5FYMA 3SEPA 1UIKA 5FYSA 2G9ZA 4IEZA 5FZOB 5APAA 3B94A 3N3HA 4L97A 1W05A 3ZFEA 2DV9A 1V6NA 3AL6A 3WG4A 2WO7A 4Q4V2 5L9BA 3KCYA 2DCZA 5A33A 3BIEA 2VTFA 3OBTA 5AC93 5LK7B 1AUYA 1AXKA 3RYKA 2YGLA 2AEYA 2XJQA 2P6HA 1R1A3 1YI9A 2VR4A 4U2AA 3IDBB 3UKVA 3WVJA 4E2GA 5I8TA 5C33A 2HWB1 2JIJA 1ENSA 2PHWA 3CHXA 3Q8EA 4E4SA 1S0CA 5C4WA 5EJ1B 3AMQA 2BDRA 3ZFEB 4CCDA 1SLIA 5FUNA 4DUXA 4P14A 4HBNA 5GZEA 4R4XA 3I2DA 1VLNA 2WINB 3LEIA 5IAXA 4JC1A 1JOJA 2ID4A 3FBMA 2Q4SA 4EE2A 1FV3A 1F4HA 1WLTA 2XVLA 4FSJA 2CY6A 4YW3A 2VUCA 5DAWA 5JOYA 2PHDA 3AZVA 3JD72 4Q4W3 2DCKA 4YYOA 3BKZA 3FHIB 4B29A 4SBVA 1PMHX 1NCQA 1YQCA 1OA2A 1UZYA 2RM23 3OBAA 4XW3A 3KQ4B 3T0AA 5C4WB 4ZKTB 3I2KA 2EVXA 1JYVA 2Z2SB 4NMIA 2F17A 3MEPA 2YROA 1AR82 3ZN6A 1UQXA 4HXCA 1WCDJ 5FXVA 3NSTA 2W3JA 2YBSA 3VKOA 1VJ2A 2ETEA 4CEWC 5CFDC 3DXTA 1GZCA 1H8TA 1OUSA 3E6DA 3EXUA 2VMHA 3VB9A 2G19A 2VZUA 3MW3A 3ZIXA 4W8JA 1PO11 1I9RA 3J8F2 5FLIA 1NCQB 1KFXL 5IVFA 1OVSA 1D0HA 4BLJA 4QXBA 1N3PA 1TME1 5IK5A 4XFIA 5EQUA 3VDBA 5EPAA 4LBQD 4Q0SA 3GCWA 5A1LA 3ZN6B 1YXWA 2C26A 4MGSA 2OKXA 4XF3A 4A3ZA 2O8QA 3MV11 4AI8A 4BOWA 4Q4X2 3W58A 1FAYA 1LULA 1NXD1 2A6YA 3LCPA 3VDCA 1H8TB 2YMZA 3MBWA 3T30A 2QVSB 3O1MA 4QX3A 1J83A 1QIQA 1OBNA 3AMPA 2XBO2 4W50A 3WR0A 3D82A 2ZJCA 4XIKA 2HWF1 4YWAA 4OMDA 1F5FA 2J1RA 4PT6A 2PAEA 1W8NA 5T5OA 4CP1A 1TG7A 3PMEA 3BIWE 4LIVA 3PTYA 4IGOA 2E6VA 4O61A 3UGFA 2RS33 1ACCA 1X9TA 2ZMKA 1LAJA 1EPWA 2KA3A 1KITA 1PO21 3KT4A 2RDSA 4BXSV 1OKQA 1G7YA 2X29A 2DBNA 4P9WA 3O14A 3CEWA 3JCIA 3ZR5A 1LOEA 5HCAA 3HJRA 3N9MA 4QM9A 2O0OA 5HV4A 3WP6A 1QOTA 5I8YA 4GKYA 2C4XA 3H42B 3SH3A 2VW2A 5IK7A 2JB4A 3A4UA 4EN7B 3H50A 1PX3A 5EP9A 3AYAA 2BBVA 4NOTA 3FUQA 5AFBA 4IE4A 4IQPA 3WY6A 2OX0A 1WMDA 4COUA 2JICA 4QDRA 3K46A 5KHHA 3V0AA 4CDQA 5CZKA 3VD4A 2Q1FA 2GNMA 4RS5C 1UU6A 3U75A 4IUGA 2WR9A 2VXRA 1U5YA 1ND2A 2WQZC 1KGYA 3R0RA 1JW6A 4AHWA 5HPOA 2VQAA 4AF9A 4BQXA 1J1LA 4N9IA 4XCBA 5FBJA 1ZZ9A 4YW4A 1V6LA 3J7NA 4FXGB 4QX5A 4RGAA 4XBQA 4FVVA 1UPIA 3WW4A 5JSRA 3E6BA 2AREA 1FX5A 4KG0A 2VU9A 2QQVA 4LMFA 4GH4A 4QPIA 3THPA 4QDQA 4XJUA 1FXZA 1POQA 2WA3A 2WN3A 3OSDA 5FUIA 2QTWB 4YPJA 1GP6A 4CDQB 3E5UA 3THTA 1FOD3 1D4M1 4JDNA 1FPN3 1NUKA 4ZXEA 4JRAA 3VBSA 4YG6A 2GNDA 2IXCA 1ND2B 1ODMA 3AVSA 1ZNPA 2CYFA 2I2SA 2R041 4IESA 2G1MA 3W59A 3KF3A 4OI0A 2XKPA 1Y9GA 3ZXEA 5JMCA 2WJSA 1ZBE1 3A22A 2TEPA 3P5BA 4QPIB 1GU3A 3RYRA 2QQLA 3JBG2 4LO6B 1QJX3 4L0PA 4COWA 1HIXA 3VBSB 2VZRA 1ZRFA 2YGMA 3BYWA 3VHOA 3UJQA 5FP4A 3VV1A 2XLGA 1O3RA 3BTYA 3K4ZA 2VMIA 4ASMB 1Z7S2 3TRSB 2J7MA 5CU1A 4N7UA 3U37A 4Q8KA 5IW0A 1DQ4A 4I0AA 2P37A 3APBA 2W94A 1OI6A 5FPXA 4RHV3 5FPUA 1GWMA 1NCRC 2VMDA 3SLIA 1A78A 1TMF3 5SV5A 3MFCA 4LO5B 1BEV1 2QE3A 3I2IA 1G9DA 4Q4V3 3WDTA 1H4HA 1CAUB 1JXNA 2VMCA 2VPVA 3B7MA 4AR2A 3EB7A 4GA9A 4XAAA 4Z1VA 4P9XA 1KDMA 1O91A 5EYYA 4BYYA 3O1SA 4A7YA 2KR2A 4LQRA 1XNTA 5CFCC 2TNFA 1LB2A 5HXMA 1AL22 5JXHA 3AZWA 1JZ8A 2ZGRA 1OF4A 2VOVA 4UOJA 5JVVA 5EHDA 5I0RA 1VRH2 1RUJ2 1UL9A 2GSYA 1EAH2 4META 2QFEA 5GKAC 4AAPA 1YFXA 1RVF1 4BQ3A 1KS4A 1K45A 4GZ9A 2VZSA 1ULEA 5A7SA 1FMD3 4OHZA 3N7JA 4IDZA 3VBHC 4OQ9A 3VGIA 1C5IA 1LENA 4CTEA 4NUBA 1AX0A 1QJY1 2RE9A 1AHSA 5C71A 3NJXA 4H55A 3TOJA 5CG8A 1DP0A 4Z07A 3WDWA 2DTWA 4XHBA 2WWJA 4WM7C 3JD73 3ZR6A 5L73A 2WL1A 1RXGA 2GAUA 5C9AA 1W9SA 2ES3A 2XVKA 1UW8A 2JE7A 4QGNA 2BPA2 3KHBA 1S0IA 4XCAA 2QZ3A 1HRI1 3OBRA 4QGLA 4AEMA 1JYNA 1KRIA 1EY2A 4HETA 4NWWA 3MF9A 1ZYBA 4JQRA 1VBB1 1WW4A 5JI7A 2ZMLA 3C7GA 1LHNA 2RMU1 3RI8A 4X8PA 3QH6A 5IT6A 1JYTA 5FXXA 5B2GB 3IIIA 1SFPA 5C8CA 4KWUA 1RUG2 4JZRA 1W9FA 1HB3A 2HWC2 2IXJA 4AHZA 3RRDA 2WQ4A 4MYEA 1F2NA 4AEKA 2H0VA 3S7IA 2BTVC 5C9AB 3WCRA 1Z78A 2ZCWA 2CU5A 3TB0A 2J42A 3TEZA 3J26N 4J6GA 3NO8A 5LBFA 4B4PA 5AC91 2VNGA 4AFBA 3AJYA 4LO8A 5FMCA 2WYSA 5K4LA 3FC0A 3VBUC 1N1TA 4LO7A 3K51A 3RPQA 2DWRA 1UZ0A 3OBZA 2PLV2 1GWLA 1CQ9A 2V73A 4QB6A 3CIHA 1A8MA 2VG9A 4YM1A 5C8CB 5JPMB 2B39A 3ZKYA 3HN3A 4IE5A 1AYM2 2ARBA 1L7LA 3WW1A 1GLHA 1V9U3 2ZEXA 3ENRA 3NNMA 5SV8A 2NM1A 5DAVA 4HVOA 1NY72 4D7TA 5BNPB 4V1PA 5E6HA 4XPVA 5LWBA 1C8NA 4OVEA 4K7JA 5FZ0A 1SDWA 1GFF2 1NE4A 1WUVA 4XBNA 4Q4W1 1HN0A 4NPLA 2XOMA 3GZEA 3MPBA 1DQ0A 1XXNA 4V2WA 1GZTA 2RM21 1F15A 2DDUA 4UAPA 2RDNA 5FZLA 4C1WA 4JDOA 2W9XA 3C2UA 4B7KA 1H0BA 4XAEA 2W39A 3OPZA 5F1RA 1LGBA 2ERFA 2YU2A 4NHXA 1RUD3 3A7QA 2K46A 1ZBA2 3USUA 3WUCA 1OD3A 3AK0A 1WW5A 4COYA 1AJKA 1D7PM 3OY8A 5CKMA 3NAPC 1KEXA 4YGBA 1QKQA 4CVUA 3CU7A 2GH8A 5FY1A 3H9AA 2SLIA 3H7YA 4YGCA 3HWJA 3BALA 4CXYA 2RS12 2C5DA 1W9YA 1XNDA 5EZWA 3IAQA 3SISA 1VAMA 4EZHA 2CDPA 3POIA 1W6OB 2RR12 5T50A 4PCRA 2ZACA 5H9RA 3USUB 2CGOA 2LM3A 3IN9A 3LDKA 1QQP3 3VZMA 1AF9A 3CJIB 2PXJA 3PLQA 3OY8B 2WZR1 3ACLA 1HJFA 5IFTA 1AR93 1ZREA 1OLQA 4XF1A 2BRTA 3KCXA 1MZ6A 2DURA 3E97A 4FPCA 4AI3A 2W08A 2VM9A 3T1MA 4AQSA 3JQXA 5JPNB 4TTGA 3I2GA 4AE2A 4BK5A 5EIYB 4LK6A 5KXEA 3LIHA 3N9LA 4Y1UA 1AXYA 1QF3A 3OB8A 2RS31 4FI9A 3I2FA 5FKCA 3RWKX 1RMU3 4RQPC 4UFIA 4PBOA 1W06A 4RN5A 3RDIA 2HWB3 1XE8A 2QQNA 4AGVA 4AK3A 4XF4A 4K6BA 2PTMA 1UPSA 4BK4A 4GMP3 4MXWA 3OYWA 4FFIA 4MGYE 2QQPA 2VW1A 1CX1A 3JBG3 3ETPA 2YBPA 4INDA 2IC1A 1NKGA 2X8KA 3VD7A 1GICA 5L7OC 2R16A 2VCAA 1QH6A 5E16A 5E88A 1OOPA 5JIAA 3OUJA 3MFAA 2NMNA 4JTNA 4AQTA 5JZGA 2WAAA 2ZKLA 5FZAA 2R1BA 1MVQA 4HKLA 1XNBA 1YFYA 1TEIA 3TN92 2WNUA 3LGRA 5CNAA 3ZFFA 1C28A 2R062 4Z82A 1UNBA 4YW6A 1HQNA 1O59A 4MXWB 1NQDA 2J22A 3OYWB 5IUQA 2PQQA 2BFUS 5JDBA 5FTTC 1NX9A 3I3BA 5E89A 2BP6A 4G4FA 2VZ1A 2OIIA 3BB6A 5A7NA 5IATA 1UKGA 2JG9B 3C3VA 5FY4A 3MZHA 2I07B 1XE7A 1HXS2 1LOBA 1ULGA 4CDQC 2Z4FA 1OUXA 2Y64A 3CBNA 5FY9A 2EAKA 2EIBA 2P2KA 5FWEA 2E63A 4DMIA 5JZGB 3AMNA 2J1VA 1AL23 1J3RA 2ZHNA 1GMMA 4FAHA 3O1PA 2ZA9A 3HMYA 5EJ3A 5KXDA 1QXJA 3ORJA 1GZWA 1RUJ3 2HWD3 2BNNA 1LHOA 3MIGA 5IWFA 1KJLA 5ABJA 3DXUA 2QUOA 2RVAA 4NR1A 1FOD1 2JKXA 2YUEA 2B46X 1UXXX 1FPN1 3T2QA 1VRBA 4MGTA 2J1TA 3GNEA 2PHRA 1ZA4A 2JDAA 2Q8CA 3RSJA 2VNRA 1HW5A 2WNVA 2AH2A 4UW3A 4DEQA 5CYYA 1CAVA 4WVMA 3VHNA 2JDUA 3RZHA 3PTRB 1VPHA 1TE1B 5FZMA 4H7LA 5GLTA 4YSFA 4WVWA 1GZWB 3ZM8A 3M3CA 5ABJB 2XLAA 1QJX1 5J1XA 4KU8A 4URAA 4YGDA 5C7GA 3WP5A 3UK9A 3VDAA 5D1IA 5A6QA 1VMFA 2WA4A 4WM8B 4XUNA 2WZPP 1Q8QA 3GXUA 3M2MA 4A6OA 3NNLA 1BBT2 3IB3A 2UURA 2WNVB 2BVVA 1U5ZA 2D6OX 5LK5A 3SXWA 1CAVB 4HN1A 4WVMB 3T3YA 5C70A 3VBOC 1WLDA 2JD9A 1YYNA 2WO2A 3H8OA 5ACA2 2VQTA 1GV9A 1OC1A 3A21A 1H2NA 2C1FA 5HCBA 3B9IA 4BQ1A 1TMF1 5FO8B 4XUTA 2HWC3 2Q1MA 1G9FA 4LT5A 1PGSA 4Q4V1 3FHAA 1QXRA 1JN2P 2Y6LA 2PHUA 3LIGA 3OCPA 4DQAA 1G9BA 2FD8A 3E5XA 3I7DA 4YVSC 4P9GA 1ND3A 1JHJA 3HD8B 4EQVA 1QDCA 4CE8A 2CHHA 1H2MA 1R64A 4CDUA 1ZRDA 5FO7B 2A3WA 4E9KA 2PLV3 4LJHA 1HX6A 3PUAA 2EXKA 1U5XA 3B5LB 3LSDA 4IV1A 4HFSA 1SHWB 1NZCA 3IKWA 4XZPA 3RZZA 2X10A 3RWNA 1UOGA 4AFMA 1JI6A 1HRV2 1S1AA 3OEBA 3V65A 4M3CF 5LATA 4ARXA 4CDWA 1OQ1A 1PIV2 3OJBA 3WP4A 4H7MA 1ND3B 1QWRA 2ZX1A 2ZBJA 1I3HA 3IM0A 5EWSA 3M3OA 3UESA 2GZWA 2ZAHA 3AMMA 4CDUB 4XJ9A 1XU2A 4XABA 5JOWA 3LA2A 1SLCA 5FPBA 3JD71 4EWAA 3O1VA 3PVEA 2RJ2A 1LKNA 4IV1B 5GLUA 4E2SA 1H8VA 2SBAA 3MLLA 3ATGA 4XFCA 1MS0A 5T55A 2XJRA 3FLRA 1PNGA 1AR81 3MUZ1 3ZYRA 3USSA 4AL9A 1OH3A 1PK6B 1G6NA 4KI5M 2ET7A 1AYN2 4CDWB 1EUUA 2ET1A 3KGLA 4P9IA 4AEDA 4Y24A 4YZ3A 5DAQA 3ZXDA 5KHIA 4COZA 1I6XA 5A1FA 2D6LX 3OG2A 5A3NA 5F3IA 1D2SA 3WOGA 1VMJA 1UMZA 3VBFC 3O0VA 2ATFA 1VBE2 3F95A 5FLJA 3J8F1 3TBDA 5FYTA 3TNQA 4L2NA 4BMEA 4CXXA 3LSEA 5FZBA 4W6XA 3T0BA 4XACA 3PNAA 5L7OA 4CEYA 2EICA 3ETQA 3C7HA 2WC2A 2Y8KA 4FO9A 2PHTA 1NAEA 4ATEA 4NHKA 2ZX0A 1PGL1 2UY8A 2XONA 2ZPXA 4Q4X1 1WCSA 5GM0A 4AEDB 3ZPYA 5T5PA 2VD7A 2DVFA 4OHXA 5D21A 1W0OA 4IEWA 3NRUA 3IWZA 4HK9A 2PHFA 4PLOA 5K8SA 2XB6C 3Q8CA 4HVQA 5FK7A 4FPHA 4BU2A 2XBO1 5BNPC 1VAVA 1STMA 3NJVA 4CEYB 1OLME 1D0GA 3AKRA 3AKPA 4K20A 1U12A 1V9U1 1XYNA 5FQ0A 5KWRA 5FCCA 4UFHA 1O4TA 4CPBA 5FRAA 3SCGA 5JXIA 2HLEA 3P1IA 5T52A 4AGGA 4KGQA 3GCXA 1ULDA 3IMNA 2JG8C 1HQWA 2ORZA 4UFJA 1JHNA 3ZSKA 2E51A 2PELA 2VBBA 3RMYA 4YNIA 4XF0A 1IS5A 1HV1A 1V6MA 4R9AA 1PZ9A 4R4ZA 5CAZA 4YRDA 5FQ0B 4GB32 5J48A 3RZMA 1RUD1 1LCLA 3KM5A 3OPTA 3T08A 5F5AA 3MIEA 3S6PA 3S0MA 4R9DA 1MS1A 1GQHA 2VZQA 1URXA 3BVCA 1AX2A 3N36A 4FPEA 3HBZA 1QOOA 3TN93 3RFRA 2IXKA 2ZAAA 2R063 1W0PA 3AP7A 4DO0A 5JXGA 1UY0A 4QXCA 3CJIC 3PIGA 4JRLA 4Q0PA 1V6JA 2B7YA 3H0OA 3KMHA 1Z0HA 5LA9A 1RUH3 1BMV2 1KQRA 3GZAA 5C5UA 4JGZA 1JZ3A 2HYXA 3H3ZA 1JOBA 2VE1A 1HRI3 3KLSA 1R083 2AACA 3M4FA 2TBVA 5GLZA 1CAXA 3HNYM 3WW2A 5DZEA 3DPRA 3NWKA 3PMSA 1QQP1 2RMU3 3VBRC 1N3OA 4JGYA 1OFSA 4MHUA 4O65A 1AXZA 4A41A 1K5MC 1PMJX 1AR91 1ASJ2 3SH4A 2ADEA 4QDSA 2BGOA 1NOVA 4CP9A 1MACA 2JWPA 1N1SA 1W03A 2VC9A 2XUEA 1ZA7A 3ECQA 3J4UH 2VH9A 5A7WA 2ILMA 2J1EA 4AFDA 1V00A 1X82A 5F3GA 2BV4A 3K75B 3MIFA 1ENRA 1SLTA 3U4XA 3DPRB 4IEYA 2YG0A 4XTMA 3ZFGC 1MS3A 1RMU1 4JGYB 4OLLA 2GMMA 3OGGA 1M06G 4H3WA 4FPJA 1UIJA 3V64A 1UF2C 3RMXA 4CU9A 1NE6A 4UBGA 4GMP1 2WSUA 1LTEA 3DKWA 3JBG1 3POJA 4AVVA 1Y9MA 3LD8A 3R4SA 4QXKA 2D40A 4Y1XA 4ZPIA 2F6BA 4Q0VA 2GC1A 3SHRA 1IPSA 2JB8A 3OUHA 4CCNA 5A33B 5IVVA 1A6CA 3DEMA 5CA6A 2OS2A 5D8AA 2NQYA 2I45A 2ZEWA 2ZGUA 2B8MA 1LODA 4LBOA 2JG9C 2JX9A 2JDPA 3MDPA 1JS9A 4RGGA 2OA2A 4RSUA 3WDYA 3MIHA 5LW9A 4Z92B 2A3YA 2QQMA 2JIGA 1GBGA 1IHMA 4XDOA 5FY5A 5LA2A 4YW1A 3LDBA 4BJ0A 5FV3A 3IDEA 5C5TA 5K0UC 3AM2A 3VLBB 1SMVA 4AEJA 4MXVA 4C90A 2JDNA 1YRZA 4P5YA 2JE8A 1RUE2 2NP0A 4P5HA 3O1RA 1ULFA 1WW7A 1CGPA 1F31A 3GYDA 4MOAA 3AKTA 4IEPA 4COVA 1BK0A 1SEFA 4CYDA 3KQRA 5D8AB 5BNNC 1AL21 5I0SA 3WD5A 4HLTA 1VRH1 1RUJ1 2HWD1 3WX5A 5C3QA 3WW3A 5LRRA 4W4ZA 4I30A 1EV12 3LF7A 4Q26A 3AYEA 4YW5A 3GJAA 2W87A 3KSCA 4IV3A 4UW4A 4DEVA 1PIV3 1IKPA 2KXLA 1F8VA 4QD2A 5FZDA 1RUC3 4XJ8A 4ZZ5A 3T4HB 4TLGA 2WQ8A 1QJU2 4CPBD 2Y6GA 4UFLA 2WZR3 3ZDVA 5LBEA 3AXDA 4WM8C 4BZ4A 4BB3A 3HVDA 1WW6A 4UFKA 5FXWA 5M0TA 4PJYA 2A6WA 5IHRA 3G7DA 1C4RA 2ZTNA 4WZCA 2EALA 1OSGA 5FFOC 5KR7A 1N1YA 1QJFA 4UYBA 3WT3A 4I2OA 4LA3A 1W9TA 1AYN3 2WFF2 4IV3B 2D6MA 3AVRA 3KV9A 5BNQA 4AI1A 4FT8A 1CN1A 3I59A 4C0BA 2DVGA 1VBA2 4RA0A 2D7FA 3PL0A 4JKKA 1LESA 4A7ZA 2HWC1 2LS6A 4L11A 2PHXA 2VUJA 5F2WA 3WNLA 5GZCA 1O3SA 2VOXA 3HNBM 3OGJA 1QOSA 4MV2A 5IAVA 1UU4A 2A71A 2ZGTA 1V6IA 2K9ZA 5J96B 2EXJA 1UWWA 4CCKA 3CZJA 2E33A 3KVAA 4K1YA 4XOGA 5FZ9A 1JZ5A 3POWA 4MUVA 1UOFA 3OGRA 3AP9A 4P08A 3I59B 2WS92 4PDWA 2WT2A 1RHI3 1Q56A 2J1UA 1FNYA 3CF6E 3B01A 2CGPA 3TYJA 1SLBA 2PLV1 4DNYA 4OZOA 3BOPA 1SPPA 3WNOA 2X05A 4Q4Y3 4FPLA 4A45A 4AVCA 4BH9A 4LA2A 4FQ4A 2A3XA 2CDOA 3AFKA 1PGW2 1B09A 1VB2A 1H9WA 1W3XA 2JECA 2R072 4HPKA 2DU0A 1MZEA 3R4UA 1US2A 1UOBA 2W5FA 4QPGA 1NY71 1PVC2 1COV2 2D5FA 2UYBA 2VMEA 3IMMA 4PDWB 4GJYA 4UXAA 5J36A 5KHGA 1W6MA 1PK6C 3IAPA 5IVEA 4HL0A 3UGGA 2YC2A 2HEYF 5JIUA 4J25A 1XNAA 4LUMA 3KHCA 2W0XA 1CJDA 1JODA 2AC1A 1YC61 2WYFA 2IVIB 4HPKB 2CSGA 2VCCA 1AJOA 2FCVA 2WWSA 3K3OA 1JUIA 4XJWA 3SCFA 5IJRA 3QACA 2R1DA 2OT7A 1JMUB 2XR4A 2V09A 4GH4B 3VDDA 1AX1A 5J3UA 1VR3A 4A2UA 1IPJA 1YEWA 4ZU7A 3ILRA 5A3PA 3ZXKA 4NHYA 1NQJA 1MQTC 3VKLA 3BTAA 4ZS2A 5GLVA 1O4ZA 2ZHMA 3NW4A 4IE7A 3MO4A 5K7PA 5BNOC 1H1AA 1UMHA 1DHKB 2CNAA 2ZGLA 2XQRA 3ZSEA 3ZMOA 1GZ9A 5F6KA 1H4GA 1QDOA 3P3PA 2EXIA 4BISA 5F32A 4LHNA 2WT0A 3W21A 4FAGA 4G3YC 1DYOA 1OMIA 3M8LA 5EXOA 5FPZA 4N53A 3VD3A 1X8MA 4QT6A 2D93A 1QHDA 4Y20A 1GQGA 3NL1A 4FPFA 3UV9A 1SQ4A 1MZ5A 2VQUA 3HT2A 1ODNA 3MV01 4PI0A 4AZZA 1WCKA 3UGHA 3N7KA 2ZZQA 1XJAA 4L8QA 4LBNA 2A70A 4LHLA 2JENA 1KS5A 4QHBA 5I0UA 1RUNA 3M3IA 4J1XA 1V0AA 1DG6A 4W6WA 4QX0A 5F6LB 4LULA 1CIYA 1LEMA 2WDBA 3WG2A 4Y33A 1LNSA 2HBTA 1RUOA 1NA1A 4NRMA 3WDVA 1PZ7A 3NNFA 4K8FA 4BM8A 3DYOA 4D6SA 1SZBA 3VZLA 5CG9A 2DFBA 2NN8A 1X9PA 3RG0A 1F5JA 4N53B 2V4AA 4CCJA 4JDMA 2QQUA 2CTVA 4Y20B 4ZONA 2IVJA 3ZXGA 2R32A 2RJLA 2CWSA 2P1BA 3POEA 3ZO0B 3E1F1 3N7LA 5JCTA 3NMBA 4XYXA 1S2BA 4TWTA 5FR3A 4X6RB 5DDJ2 1HB2A 4I3GA 2VZOA 1H30A 2BNOA 2BZDA 1DLCA 3MW4A 4UFMA 1NA1B 1VE0A 1BXHA 3I4IA 4N43C 3N35A 2DTYA 4KBZA 3TN91 4BPZA 4PF1A 3VKNA 2JXAA 2R061 1YIPA 4NIDA 3CO2A 5F37A 1WBLA 1RJ8A 3D8CA 3ZXFA 2V5YA 1LECA 1DU3D 1PNFA 4Q5OA 5FXZA 1RUH1 5B4NA 1RUE3 1AR83 4UW6A 1TME2 3MPPG 3T0DA 1DYPA 3J9SA 3O5SA 2ZX3A 1DGWX 3JZVA 5GZFA 1R081 1HXS1 1QEXA 1WWYA 5T5JA 4XFFA 4IEOA 1K3IA 1CVNA 1HV0A 2VCBA 2BOJA 3BPSA 3PIJA 3SKVA 2W1QA 2YC4A 1TVGA 4EWDA 4KL1A 3P3NA 3O1OA 1N3QA 4EYUA 1VBD2 4HKOA 3J8F3 1UO9A 2IXLA 1V70A 3S57A 4S2GA 3I3EA 1DGRN 3DN7A 3KCCA 5FYHA 3BI3A 4LXLA 3O1TA 3WQ0A 4IE0A 4XC9A 3NNGA 1UKRA 4RFRB 3ZFEC 1RC6A 3KF5A 4LPLA 4YFZA 5I0DA 4Q4X3 1N47A 2WNEA 1IS3A 3NV1A 3PDQA 2FDHA 5FMOL 4IW3A 4QAWA 4BQ2A 3WINE 4YVWA 2BWCA 4LBLA 1CD3G 1X33A 2IUWA 3GBGA 4LEJA 4QM8A 2BQPA 2WWUA 4YG0A 5FZIA 4B4QA 4M0HA 1CX4A 1DZRA 2XBO3 3GALA 1WGPA 4TN7A 5H9PA 3S5QA 2YDEA 4RYDA 1RTVA 3M70A 4KGGA 4LLFA 4PHZA 2BNMA 3VKMA 1BVVA 5CISA 4PIYA 5BUVA 5DG2A 1UX7A 1JTZX 2DCJA 2WFF3 4FXKB 4B8EA 1YFWA 4CCOA 1BBT1 4FPOB 4Y4RA 5C4WC 5ISLA 1YQ8A 4JX0A 4DOUA 4BIOA 2LW8A 1REFA 3PU8A 4ISQA 4PI2A 2XJVA 3BTZA 4YVWB 1VBA3 1S0EA 3WG3A 1MVEA 2ZX4A 3PUIA 4IEQA 4Y1ZA 3WF0A 1H9PA 3WQBA 3RGBA 2RG4A 5IYYA 4FCAA 3C7FA 3CQOA 3FZ3A 4D8MA 2OXBA 4NJ4A 1EUTA 1CWPA 2RS52 3AMHA 3O12A 2D5HA 2A6ZA 1NCQC 2VW0A 3P6BA 3MW2A 3LPGA 1XNCA 3AYDA 5DAPA 2GC3A 4MSVA 1S0BA 4QQLA 5A70A 1E57A 3CNAA 2OUJA 1XE0A 2Q30A 2W52A 3QD6A 4LBKA 4MADA 4QKBA 4EJRA 2A6XA 1UY2A 4JHTA 3WNKA 3OD4A 2QCSB 2Z42A 1WLWA 3WHUA 4CCMA 1WLCA 1H8TC 4AVSA 1HRV1 1VALA 1LR5A 3I3QA 1D4M2 3U07A 2X5IA 4D3WA 1SACA 1PIV1 4BWOA 4PLMA 5FMDA 1RUC1 4LTAA 4WVVA 4AQ2A 4LOSA 4JAAA 4FPGA 3KB5A 2V5DA 2Y0OA 3FFQA 3DGTA 5KHJA 1RUF2 3POBA 2FCTA 2G9FA 3FUOA 4A7KA 2Y60A 2QDNA 1ONAA 4RR3A 3LZZA 3VKFC 4CZSA 1HQLA 2G9GA 4OYUA 4AG4A 4DXRA 3LQCA 2YYOA 4IXLA 4YW7A 2VGDA 5FAXA 1QMJA 1M4WA 4A42A 2W92A 3W5NA 5FZGA 2X5IB 5I0TA 4CDXA 1AYN1 2ARAA 4Y5Z0 4AWDA 1NG0A 4X6QB 3BTXA 2QQKA 3AL5A 5KBFA 3HQUA 3ZDSA 5EFUA 2EIGA 1SLLA 4Y1VA 4Z2AA 1DDLA 3VZJA 1RUI2 2OZJA 4TXWA 4RR3B 2OPWA 1OFNA 4P9YA 4QQ2A 4KU7A 2ZKNA 3JXSA 4K3UA 3N9PA 4MZUA 4KH9A 4NE9A 1W99A 1KJRA 4XUQA 2QJVA 3DF0A 4Y4YA 4DXZA 4CUBA 1HJGA 2VVEA 2NPIA 1Z7S3 5F3EA 5C3PA 1SFNA 2LTNA 3CZUA 1YUDA 1W3VA 3EBRA 3HPNA 4I0BA 3B69A 5A7OA 2ZHKA 1RHI1 3UNPA 1PX4A 1IG3A 2VOTA 1ENQA 3GM8A 1QU0A 1YQ6A 2P34A 3E6CC 3D0JA 4GMP0 4Q4Y1 4OUMA 2Y0IA 4XQ4A 2W1SA 3IDCB 1HLCA 3C8XA 3H1YA 4EV0A 1W6QA 3RJRA 1MEC2 4PQ9A 1PZ8A 1AR62 2WIIB 1OOPB 2P4EA 2R0FA 2W95A 4XVHA 4BQWA 3AP4A 3Q8BA 3U10A 1BKZA 4N8MA 4Q0QA 5FYCA 3MIBA 2WNUB 1LGCA 1ND2C 1VRH3 1GOGA 4M00A 1EAH3 3ZFFB 3B00A 2DUOA 1T6GC 1L3JA 1IQDC 3FFZA 1W2NA 4BQYA 3GHMA 3D6EA 3NNJA 1RIRA 5FY8A 4NIAA 3WF1A 3E5QA 4CEWA 4DXSA 3ON7A 5CFDA 5DAXA 3U0ZA 4BDVB 1DGLA 4GH4C 1W6QB 4LUKA 4QPIC 2YXSA 1K12A 2R7EB 5DDJ3 4LHKA 5CKNA 5E1RA 2WAOA 5DUVA 4EZ4A 2BGPA 3VBSC 2UY9A 3O0WA 4PF5A 4YZ2A 2QQWA 2CV6A 2C9AA 2W68A 4LBMA 4O9GA 5FYYA 3ZN4A 4DUVA 1SCSA 2BWAA 5FZHA 1J3QA 3WEZA 2VMFA 5FZ3A 1VIWB 2W46A 4AVTA 3G6JB 4XMIA 1BMV1 4EROA 5CFDB 2GNBA 1ZRIA 2PA7A 1DLLA 4Q0UA 2YHJA 2O8OA 3BOWA 1W0NA 3RVHA 5L36A 5DUUA 5AC92 2OVUA 1LHUA 2EIEA 4L99A 3WG1A 3BPZA 2GN7A 3HR9A 1LU1A 1HB1A 2P17A 4AI2A 1R1A2 3I3MA 4QB2A 1ASJ1 2V72A 1DZQA 1E5SA 1HKDA 2C0ZA 4OI4A 4BLIA 1RUG3 5IK8A 1C5HA 1R092 1XU1A 1WBFA 3PVNA 2JE9A 3OOXA 2B4KA 4G9SB 2VZ3A 3WZ1A 2C24A 4MGKE 2GMEA 4CUCA 3WNNA 4XFBA 2AR6A 2A73B 1W9WA 2NLRA 4HSLA 5LA1A 2VZTA 1ZX5A 4QKNA 3HN1A 1CZVA 5FP8A 5A3MA 3RZGA 1S4CA 1CR7A 4LNVA 1F35A 4Q4W2 1CPMA 5FZFA 5IVCA 4XHXA 3N9QA 1AYM3 3OGSA 1UY3A 2C9KA 3ME2A 2HYKA 3TWIA 3BU0A 4XZUG 2W2IA 1EYBA 1CPNA 4F83A 1EP0A 2XH6A 1J58A 2WABA 2P3KA 1XRUA 3LPFA 1W28A 1DZTA 1ZZ7A 2AUYA 3IPVA 1X36A 3J7MA 3OPWA 1C1FA 4RL7A 3IDAA 1W2UA 1GSLA 4RS5A 3DCQA 5J09A 1IOAA 1K42A 4MG2A 2XUMA 4ZS3A 3AKSA 4NWVA 2FDFA 4I0WB 1FATA 4IL7A 1I5ZA 4XE9A 2BUKA 1TNFA 1WMEA 4GD4A 3H7JA 3LEMA 3RQ0A 2C6SA 2AENA 1MZFA 2JD4A 1RUE1 2IXIA 2RS53 2ZGQA 3ZX7A 4ZHNA 1ZBA3 1WA6X 1E5HA 3EO6A 3H8RA 4FP3A 3FL7A 4LO4B 3IPVB 4QX1A 3VL9A 5C9AC 2WFPA 4FTSA 1MS8A 2GNTA 2OW4A 5FJKA 4E4DX 1W8HA 2X53S 2E31A 2ZGSA 4RS5B 3FLTA 4B7EA 1DGRA 3EYPA 5LCWL 2RS13 2DCTA 3WCSA 2RV9A 1UN1A 2XJTA 4Y22A 4ZU5A 4SLIA 3RNSA 1V6KA 4H14A 3ES4A 1OH4A 3UYJA 2RR13 5L9VA 2WNOA 3ZXJA 5C8CC 3WXPA 3URFA 1J84A 1G86A 2XL7A 1LOFA 2QDRA 4UF0A 3IT8A 4JQTA 1T2XA 1UAIA 3R6SA 3WHTA 1RUF3 3DUIA 4XJZA 1HDKA 2GC0A 5ANNA 1YCIA 1YIFA 1ZZ6A 5JAXA 1VB4A 1FNZA 3UETA 2WO1A 5LASA 5L7OB 1I1EA 2KM2A 4XILA 5HBAA 3JU9A 3FE5A 1GOFA 1X50A 4JCKA 1XYOA 1YWKA 2WFF1 2YPDA 3THCA 3ZLIA 4JKMA 1NCRA 4S2DA 1POV3 3W20A 2VTXJ 2Q8OA 4P02B 3PJYA 2P5BA 2DUPA 2E26A 4NRQA 1UYYA 2BERA 2B9VA 2XG3A 3U14A 1RUI3 1DQ1A 1VBA1 3MIDA 4UWDA 4ARYA 3PUHA 2ZGNA 3POYA 4GXLA 3LOBA 5FZEA 3LA3A 2B5HA 1YQ5A 4LE4A 5JR7B 3UT0A 4ES9A 3GJBA 4D7SA 5IVBA 5CFCA 1YLLA 4AHXA 3ROUA 5FK8A 4CUAA 3MI8A 5BYNA 3RZLA 1D4VB 1CESA 1ULPA 3PVOA 2VBDA 4MX3A 2B9UA 5D2AA 1NCRB 3HOBA 4IEUA 2WS91 4WVZA 1WCQA 1OA4A 3ILNA 3PHMA 5FZCA 5JMOA 3ZYGA 4R9CA 5FWJA 4M4PA 3VBHA 1WMXA 2VUDA 3M7AA 4MLOA 2BU9A 2VNOA 1OPOA 5F2SA 1QNWA 5IFPA 1PGW1 2P3JA 1FPN2 1DIWA 1UX6A 5CFCB 3IBMA 1MEC3 1QXPA 4AI0A 1IPKA 3PJQA 1AR63 1HXS3 4XEZA 1NLRA 4WM7A 4BMBA 2B45X 5ANQA 1PVC1 2E9QA 3NJZA 1JYWA 1F9KA 4MGIE 4K1ZA 3ZVXA 3H1WA 5F7UA 4R8HA 3I8TA 5FZOA 1IKQA 3VBHB 4WZFA 1B35A 1LHWA 4ONUA 3FMGA 3NV2A 1W6NA 4DB5A 1QJX2 1DBNA 2QKDA 5I93A 4JGZB 1KDKA 2A1XA 1XOYA 1C3HA 3WF4A 3JB4C 4K40A 3I97A 2JEMA 1DYKA 3N9OA 2H6CA 4WM7B 1LU2A 2I74A 1CAXB 4Y1YA 5AVAA 4PQQA 1O5UA 4XQWA 5CKQA 2E7AA 4GWIA 3VD9A 1ULCA 4CU6A 5AFEA 4LHSA 4RHV2 4RD7A 1H6XA 2OUHA 3HBKA 3ILFA 4BQ4A 4CP9B 1B35B 1G9CA 1C1LA 1TMF2 4J1WA 2XJUA 4ZY9A 3ST7A 2VAUA 1W6NB 1JYXA 3DV8A 4QU1A 4E8CA 4QQPA 3VBUA 4KWJA 5A7WB 1E5RA 2D6KA 4LE3A 2VOKA 4LKSA 5F5IA 4B3NA 4M3CA 1BBT3 4D7YA 4N7IA 1Z7S1 5C8WA 3DL3A 4LBJA 4I01A 4LKEA 5FIXA 4MH0E 5ACA3 2XL9A 1DF0A 2HWE2 3U78A 1UOJA 4FOYA 3HIFA 3LB9A 4IERA 1REDA 2MEV2 1OOPC 2PAMA 4ITCA 5FZ4A 1R093 3MYXA 3K3NA 5EYXA 5JZGC 4FOQA 1WA4A 2AZ5A 2E7QA 3L2YA 5FUPA 2WNUC 4ET7A 2GP5A 4GIQA 3VBUB 1FMD2 3ZFFC 2BGCA 5DQ0A 3PUSA 2Y6HA 4M3CB 5A80A 2Y33A 1J1TA 5LY2A 4DZGA 2XJPA 4Y5TA 3PUQA 1QGLA 3VN4A 1EAH1 2D3RA 2PYTA 1C57A 2VJXA 1DQ6A 5DXDA 3NJYA 1W90A 1O7FA 5FYIA 5HCFA 1HRV3 3J7HA 1LEDA 1AVBA 2BVBA 2G4IA 3N7MA 1TZOA 3QOPA 1WMFA 3NAPA 1VP6A 5F5CA 5A7QA 1O3TA 5KHKA 1TQ5A 5ABJC 3I2JA 5DDJ1 2D44A 4EN8B 2WSVA 4MVTA 3KD4A 3KT7A 1SDDB 5FZ8A 5JOXA 1NYWA 4ES8A 5FDBA 3L2HA 3WQ1A 4NN0A 4TLFA 1OXCA 2WNVC 2GDFA 3NKGA 4GKXA 1Y9QA 3BCWA 3ZSMA 1GNYA 2GU9A 2ZHLA 2D6PA 2XPJA 5FYVA 2HEWF 4QU2A 3ABZA 1QJEA 2GALA 4HKWA 4AYUA 3OD0A 1GQPA 3DYMA 3NAPB 1PGL2 2YZ4A 4PIXA 4YGEA 2UWBA 4NPRA 3D5OA 5GLWA 4D6QA 4BA6A 5FJHA 1OKOA 5LEKA 4JVAA 1YJLA 4N9HA 3JUUA 2BJSA 5IVYA 4NIGA 1VBD1 2ZGMA 3D3AA 1VBE3 4FPYA 1A34A 1GOHA 1RUG1 4HONA 1C8M2 1DQ5A 1S0DA 1YNAA 4OI2A 3W9AA 5HCHA 4NIIA 3TNPB 2DFCA 2P3YA 3CKHA 5BY5A 5LY1A 1DFQA 4RQPA 4S2FA 1V9U2 4MHRA 4QHZA 3SC7X 1J3PA 4HT1T 2BW8A 3KVBA 3WNPA 5JXJA 4AHYA 3WQ7A 4AVBA 4QPYA 4HN0A 2W91A 4YZ1A 1RINA 1QJZA 2DUQA 1OLMA 3HQXA 4OZXA 3H3UA 5DN2A 5CBLA 1ND3C 1VBC2 1WZXA 3A23A 3EHKA 4Z2WA 2HKXA 2MHFA 4Z8BA 1AR72 1LOGA 2ZABA 3A0KA 4LKDA 4C0HA 4CDUC 1AYM1 3WNMA 4DXTA 3S5AA 2O1QA 2ZEYA 3AJZA 3ZSJA 2WLPA 3MLJA 3SMHA 2X09A 1T6BX 2D3PA 3LKJA 4RQPB 3NKTA 4IV1C 1RUD2 3PVBB 4GULA 3POSA 4XQDA 4QB1A 2XWBB 2Z5WA 3I49A 4H2AA 4KBBA 3MGUA 3ZN5A 4CDWC 3LDRA 4OQ8A 5G05L 3KWVA 1GNHA 1SPPB 3NV4A 4KQ7A 4FBFA 4BXFA 4DFSA 3VUOA 1WCUA 2E32A 3GBFA 1LOCA 1Q8PA 4L92A 3TEXA 2RS51 3VZNA 1OHFA 1GKBA 1NZIA 2CWMA 4GB33 4CU7A 2F4LA 3MHZA 3TEYA 1PHMA 1ZBA1 1GYKA 3AYCA 3D0SA 3FN9A 1JZ4A 2GMPA 2JDZA 3ZKUA 5A1AA 5KC5A 4QPGB 1JH5A 1IQAA 2CL2A 3WUDA 5T54A 1QQP2
chains in the Genus database with same CATH topology
1W6MB 4B4RA 1UD1A 5CADA 1R1ZA 2XGXA 3MF6A 4OI1A 2ZMNA 1AR92 4CP2A 2QZ2A 2B42B 1IZ3A 1W39A 4AEDC 2VVFA 2QNKA 1Y43B 2RS11 1O3QA 3R05A 4KWLA 2XKOA 2VULA 2P3IA 1BCXA 2CAUA 4IEXA 1YO8A 5FO9B 4YG3A 4TZDA 2RR11 3ELNA 2D6NA 3SITA 2IFWA 1GR3A 1NXMA 3O7OA 3WDXA 4CEYC 4DRRA 5L7OC 1UU5A 5T5LA 1S2KA 5FREA 1O5LA 1RUF1 4KWKA 3T1LA 1RMU2 1ASJ3 1S0GA 2HWB2 4Y26A 3VDDB 1KD7A 1LOFC 3CL1A 5GJ6A 3AFGA 2JJ6A 1CAUA 3VBOA 1ENXA 4FOWA 1XYPA 2HJIA 4OHYA 2ZGOA 2FQPA 5E8AA 1CJPA 4QQOA 5A3LA 1POV1 3WP3A 4MGZE 4QGMA 2MPFA 1MS4A 3IIAA 1RUI1 1ZRCA 2FZ2A 1YFUA 1TNRA 2TUNA 2FMDA 4YVSA 2OPKA 1Q8SA 3ZSLA 4E2QA 1U5IA 2AGSA 3EJKA 4I02A 2XJSA 1SCRA 5LEJA 4FPKA 3VBOB 2WT1A 3OF1A 4I09A 3SH5A 3ZMNA 4BE3A 2AYHA 4FTBA 3RYPA 4XJAA 4Q2FA 4XF9A 4DY3A 4LR4A 2HWE3 3LA7A 1N1VA 1PVXA 2XLFA 4HVRA 1H2LA 2VECA 2MEV3 4WBBA 4N90A 2HWD2 3NVCA 4YVSB 1PO12 4YM0A 2ARXA 1ZRRA 2A6VA 4AVAA 1MEC1 2VQ0A 5IK4A 1AR61 2R49A 4YARA 4YZ5A 4YW2A 5DZGA 2BFUL 2ZZJA 3MICA 4JGZC 4DS0A 4U36A 3H1MA 2ZX2A 1REEA 2VMGA 1S0JA 1XNKA 4UW5A 1ZZCA 2R30A 2BEOA 3DPRC 2Q1ZB 4NHMA 1EV13 4JGYC 2D3SA 5BXXA 4A3XA 1QNYA 2HWF2 1G8WA 1W6PA 3ALQA 1B35C 3VBFA 3VHPA 2K2SA 1QJU3 1A3KA 2Q0AA 3VHRA 4EWEA 1PO22 4PBPA 4C1XA 4WV8A 1BYHA 4XDQA 2H0BA 1YI7A 1NLSA 3RJ2X 5F9TA 5GZGA 1W6PB 2R0HA 4AFAA 3AZYA 2K0GA 4R9BA 3VBFB 1AL0G 2NZ9A 3JQWA 5BNPA 5ACA1 2DYCA 1R1A1 4W6YA 3AB0A 2JKBA 1R091 1C8M3 2D98A 5CIRA 5D8AC 2ENRA 1YHFA 1H1MA 2DF7A 5BV6A 2DCYA 5GZDA 3EQEA 3WV6A 2JG8A 3I54A 4AW7A 1MR5A 2OYZA 4OULA 2WS93 4F3JA 2H6BA 1BQPA 5KXBA 1JBCA 1VBC3 3X29B 4XBLA 1GANA 1AR73 2DVDA 4Q1PA 2HEVF 4ORFA 4GQ7A 1IGOA 5GALA 3UL2A 2GC2A 5J98B 2R073 2VY0A 2JG8B 1W6OA 2EF6A 2FMYA 4IEVA 2R042 1RGSA 1PVC3 2ZGPA 1COV3 1SFYA 3CJIA 3OTFA 4YM2A 3UKNA 3FLPA 1DQ2A 4IV3C 4Q27A 1BZWA 2CAVA 5FBZA 1ZBE2 4P9LA 5KXCA 3WDUA 1BVP1 1UCXA 4FQZA 5FOBB 4OHVA 3VBRA 5CVRA 3V56A 5H9SA 2A7AA 1K5MA 2D97A 3AZZA 5J7MA 5KC6A 4M0NA 3AP6A 2Q5TA 3LWCA 2Z69A 3Q9OA 5T3NA 3VL8A 2VVDA 1Y7BA 1VBE1 5I8SA 2UU8A 4XXPA 1SLAA 2VUAA 1BEV2 1OQEA 2MNGA 3FX3A 3VBRB 4FTEA 3ZFGA 2VOWA 3QLQA 1WD4A 3B93A 4ATFA 4K21A 2WLQA 4CDXB 1JUHA 1K5MB 5L19A 1SBEA 2PAKA 3VZOA 2UYAA 3S7EA 4DINB 2UWAA 4M01A 1CONA 4E27A 1RVF2 4XETA 4PDWC 5HI0A 3B3QE 5C6CA 1GNZA 4YM3A 3ZFGB 2JG9A 3K48A 4QQHA 3KT1A 5JSPA 2DVAA 1QJY2 4HSJA 4RFT0 2FHRA 3R4DB 5K0UA 2LALA 1CIWA 4GALA 1EPZA 3BODA 4QPGC 2ZGKA 4BHPA 4ISRA 3GZUC 5BNNA 1RUH2 2YV8A 3D4KA 3FWEA 4GB31 4XIOA 1HRI2 3S30A 1BK1A 1R082 2A75A 2E7TA 4HMZA 1VBB2 3ASIA 5FLHA 4S2HA 2RMU2 5K0UB 4L9BA 1ZZ8A 3WNXA 3AP5A 3MLKA 1MS5A 1CAWA 5JLVA 1PO13 1Q8OA 5JWPA 5DG1A 1LHVA 5BPXA 3V0BA 2PFWA 5FMOS 4EN0A 1TME3 4CEWB 5BNNB 3AX4A 4WM8A 3VDDC 1S0FA 3CJXA 4F8AA 2Z79A 4KNCA 1Q5OA 3M3QA 2RJKA 4O9EA 4YZ4A 4R52A 3WLUA 2IXHA 1VBD3 4QMAA 1LRHA 3B9CA 1D2QA 1JYIA 1G9AA 1CAWB 2EA7A 1FV2A 4Q1RA 3ZYJB 1V6OA 3VZKA 5F5QA 3ZYPA 3V0BB 3QH7A 5TSWA 2XWJB 2HWF3 1IS4A 1OLRA 4AFCA 3M1HA 1O4YA 4N53C 1OQDA 1RITA 3QCWA 3GBWA 1A8DA 5DZFA 2EXHA 4DRVA 1APNA 3SCHA 2PHLA 1LOAA 1PO23 5DUWA 5EV7A 4M3CE 4RHV1 1OD5A 4NO4A 4DPNA 3SNMA 2RM22 1NA1C 4C91A 2YY1A 1LGNA 1RB8G 4BIFA 3A0NA 2OZ6A 2Y26A 3HT1A 3KS7A 1BJQA 4IETA 4BCUA 3CLPA 2F4PA 2A5ZA 1VAKA 2HWE1 5FOJB 1SBFA 1WD3A 3ZXLA 2MEV1 3KZ4C 4F7ZA 1UZZA 1ZZBA 1FMD1 4XMAA 1PK6A 1KXGA 1ZVFA 1RUC2 1LJ7A 1MS9A 1IS6A 3NV3A 4NVPA 1SBDA 2WZR2 2D43A 4XFAA 3RI9A 2DVBA 2GN3A 5I91A 3FBYA 1EV11 4ASLA 4E4ZA 4AGRA 1D4M3 4JTOA 4LLOA 1FT9A 4GWMA 1JYCA 3AXEA 2BYVE 3ZIWA 3QBQA 5J37A 5JSOA 3N4MA 4I3PA 3ZXAC 1QY4A 1XQNA 1ZM1A 2E53A 2R043 3M3EA 5K9YA 1OA3A 1QJU1 2RS32 3AKQA 3LOIA 2LUWA 4P9JA 1H1IA 5A32A 1MQTA 4ZU4A 3UJOA 1ALYA 1ZBE3 4FOVA 1FYUA 3AZXA 4GWNA 5BNOA 4Y22B 2YC0A 4YVWC 5JOZA 4TSVA 2R6QA 2ZOEB 4EN6B 1RL3A 1YJKA 4HANA 4AQ6A 2GH2A 3RS6A 4OUSA 2IWGB 4AXOA 2Y38A 4KG8A 1FI2A 1RHI2 5AVPA 3ZYIB 5A32B 1MQTB 2CGNA 2IFRA 4FP2A 4HZFA 1C8M1 2PN5A 4D94A 3GHNA 5BNOB 1AZDA 1BEV3 2XVGA 4LBQA 4Q4Y2 2WKKA 4CP0A 4URTA 4CRQA 2NMOA 4NHLA 3KGZA 2N7GA 1X7NA 4W65A 1POV0 5LRSA 4XFHA 4Q8LA 4DY5A 4EN9B 5DUXA 1Y3TA 1VBC1 1RJ7A 1J59A 4XTPA 2YPJA 3U11A 4XXAA 1OPMA 1RVF3 1AR71 3O0XA 1H2KA 4LBQB 1Q3EA 5H9QA 1FOD2 2NYYA 1PMIA 1DGWA 2R071 4N43A 4ZXKA 4Q29A 1Q8VA 3LAGA 4OFGA 4HK8A 1QJY3 3H8UA 5CB7A 1COV1 4OHWA 3INAA 2X5IC 1QH7A 2FBEA 3JB8A 4YFWA 4XFGA 2RHPA 3BU7A 5JI9A 3FJSA 3GF6A 3TAYA 4PLNA 3B02A 4YLZA 4TYSA 4K9SA 4PIZA 2ZS6B 4JV4A 3ES1A 3L9JT 4X8NA 4RR3C 2XHKA 3UKTA 1X8EA 2UWCA 4N43B 2EAAA 3T2TA 1Q43A 2FZ1A 1KFUL 1PM7A 1VBB3 2DU1A 3GZTB 1S55A 1U0AA 3HAGA 5HXVA 2IZWA 4UBHA 4CDXC 4D69A 1UIKA 4IEZA 3B94A 3N3HA 4L97A 3ZFEA 2DV9A 1V6NA 3WG4A 4Q4V2 3KCYA 2DCZA 5A33A 3OBTA 5AC93 5LK7B 1AUYA 1AXKA 3RYKA 2YGLA 2XJQA 4U2AA 1R1A3 1YI9A 3UKVA 3IDBB 3WVJA 5I8TA 4E2GA 5C33A 2HWB1 1ENSA 2PHWA 4E4SA 1S0CA 5C4WA 3AMQA 3ZFEB 1SLIA 4P14A 4HBNA 5GZEA 4R4XA 3I2DA 1VLNA 2WINB 4JC1A 1JOJA 3FBMA 2Q4SA 1FV3A 4FSJA 1WLTA 2XVLA 2CY6A 4YW3A 5JOYA 2PHDA 3AZVA 3JD72 4Q4W3 2DCKA 4YYOA 3FHIB 4B29A 4SBVA 1NCQA 2RM23 1OA2A 1UZYA 4XW3A 5C4WB 4ZKTB 2EVXA 2Z2SB 3MEPA 2YROA 1AR82 3ZN6A 1WCDJ 3NSTA 3VKOA 1VJ2A 2ETEA 4CEWC 5CFDC 1GZCA 1H8TA 3E6DA 3EXUA 2VMHA 3MW3A 3ZIXA 1PO11 1I9RA 3J8F2 5FLIA 1NCQB 1KFXL 1D0HA 4BLJA 1N3PA 1TME1 5IK5A 4XFIA 4LBQD 4Q0SA 3ZN6B 1YXWA 4XF3A 2O8QA 4AI8A 4BOWA 4Q4X2 3W58A 1FAYA 1LULA 1NXD1 2A6YA 3LCPA 1H8TB 2YMZA 2QVSB 3AMPA 2XBO2 3WR0A 3D82A 2ZJCA 4XIKA 2HWF1 1F5FA 5T5OA 2PAEA 4CP1A 3PMEA 3BIWE 3PTYA 2E6VA 2RS33 2ZMKA 1EPWA 2KA3A 1KITA 1PO21 3KT4A 1OKQA 1G7YA 2X29A 4P9WA 3O14A 3CEWA 3JCIA 1LOEA 5HCAA 4QM9A 2O0OA 3WP6A 1QOTA 5I8YA 4GKYA 5IK7A 3SH3A 2VW2A 3A4UA 4EN7B 3H50A 3AYAA 2BBVA 4NOTA 3FUQA 5AFBA 4IQPA 3WY6A 1WMDA 4COUA 2JICA 5KHHA 3V0AA 4CDQA 4RS5C 2GNMA 1UU6A 2VXRA 1U5YA 1ND2A 2WQZC 3R0RA 4AHWA 1JW6A 2VQAA 4AF9A 1J1LA 4N9IA 4YW4A 1ZZ9A 1V6LA 4FXGB 4QX5A 4RGAA 4XBQA 4FVVA 1UPIA 3WW4A 5JSRA 3E6BA 2AREA 1FX5A 4KG0A 2VU9A 4GH4A 4QPIA 3THPA 4XJUA 1FXZA 3WCRA 2WA3A 4CDQB 3V0AB 3E5UA 3THTA 1FOD3 1D4M1 4JDNA 1FPN3 3VBSA 4JRAA 4YG6A 2GNDA 2IXCA 1ND2B 4IESA 1ZNPA 2CYFA 2I2SA 2R041 3W59A 4OI0A 2XKPA 3ZXEA 5JMCA 2WJSA 1ZBE1 2TEPA 4QPIB 3RYRA 3JBG2 4LO6B 1QJX3 4COWA 1HIXA 3VBSB 1ZRFA 2YGMA 3VHOA 3UJQA 3VV1A 2XLGA 1O3RA 2VMIA 4ASMB 1Z7S2 3TRSB 5CU1A 4N7UA 4Q8KA 1DQ4A 4I0AA 2P37A 3APBA 1OI6A 5FPXA 4RHV3 3SLIA 1NCRC 1A78A 1TMF3 5SV5A 3MFCA 4LO5B 1BEV1 2QE3A 1G9DA 4Q4V3 3WDTA 1H4HA 1CAUB 1JXNA 2VPVA 3B7MA 4GA9A 4Z1VA 4P9XA 1KDMA 1O91A 5EYYA 4BYYA 4A7YA 5CFCC 2TNFA 1LB2A 1AL22 3AZWA 2ZGRA 2VOVA 5JVVA 5I0RA 1VRH2 1RUJ2 1UL9A 2GSYA 1EAH2 4META 2QFEA 5GKAC 1YFXA 1RVF1 1KS4A 1ULEA 1FMD3 4OHZA 3N7JA 3VBHC 3VGIA 1C5IA 1LENA 4CTEA 1AX0A 1QJY1 2RE9A 1AHSA 4H55A 3TOJA 5CG8A 4Z07A 3WDWA 2DTWA 4XHBA 4WM7C 3JD73 5L73A 2WL1A 2GAUA 5C9AA 2ES3A 2XVKA 1UW8A 2JE7A 4QGNA 2BPA2 1S0IA 2QZ3A 1HRI1 3OBRA 4QGLA 4AEMA 1KRIA 1EY2A 4HETA 4NWWA 3MF9A 1ZYBA 4JQRA 1VBB1 1WW4A 5JI7A 2ZMLA 5IT6A 1LHNA 2RMU1 3RI8A 4X8PA 3QH6A 5B2GB 5C8CA 4AHZA 1RUG2 2HWC2 2IXJA 3RRDA 2WQ4A 4MYEA 1F2NA 4AEKA 2H0VA 3S7IA 2BTVC 5C9AB 1Z78A 2ZCWA 3TB0A 3J26N 4J6GA 3NO8A 4B4PA 5AC91 2VNGA 4AFBA 3AJYA 4LO8A 3VBUC 3FC0A 1N1TA 4LO7A 3K51A 3RPQA 2DWRA 2PLV2 2V73A 1CQ9A 1A8MA 2VG9A 4YM1A 5C8CB 5JPMB 2B39A 1AYM2 2ARBA 3WW1A 1GLHA 1V9U3 3ENRA 5SV8A 2NM1A 4HVOA 1NY72 4D7TA 5BNPB 4V1PA 4XPVA 1C8NA 4OVEA 4K7JA 1SDWA 1GFF2 1NE4A 1WUVA 4XBNA 4Q4W1 3MPBA 1DQ0A 1XXNA 2RM21 4C1WA 4JDOA 3C2UA 4B7KA 1H0BA 2W39A 3OPZA 5F1RA 1LGBA 2ERFA 1RUD3 1ZBA2 3USUA 3WUCA 3AK0A 1WW5A 4COYA 1AJKA 3OY8A 3NAPC 4YGBA 1QKQA 3CU7A 2GH8A 3H9AA 2SLIA 3H7YA 4YGCA 3HWJA 3BALA 2RS12 2C5DA 1XNDA 5EZWA 3SISA 1VAMA 1W6OB 2RR12 5T50A 4PCRA 2ZACA 5H9RA 3USUB 2CGOA 2LM3A 3IN9A 1QQP3 3VZMA 1AF9A 3CJIB 3PLQA 3OY8B 2WZR1 3ACLA 1AR93 1ZREA 1OLQA 4XF1A 3KCXA 1MZ6A 2DURA 3E97A 4FPCA 4AI3A 2W08A 3T1MA 4AQSA 5JPNB 3JQXA 4AE2A 5KXEA 4Y1UA 1AXYA 1QF3A 2RS31 1RMU3 4RQPC 4PBOA 3RDIA 2HWB3 1XE8A 4AGVA 4AK3A 4XF4A 4K6BA 2PTMA 1UPSA 4GMP3 4MXWA 3OYWA 4MGYE 2QQPA 2VW1A 3JBG3 4INDA 2IC1A 2X8KA 1GICA 2R16A 5E16A 1QH6A 5E88A 1OOPA 5JIAA 3MFAA 2NMNA 4JTNA 4AQTA 5JZGA 2ZKLA 2R1BA 1MVQA 4HKLA 1XNBA 1YFYA 1TEIA 3TN92 2WNUA 3LGRA 5CNAA 3ZFFA 1C28A 2R062 4Z82A 1HQNA 4MXWB 1NQDA 3OYWB 5IUQA 2PQQA 2BFUS 5JDBA 5FTTC 5E89A 4G4FA 3BB6A 2OIIA 1UKGA 2JG9B 3C3VA 3MZHA 2I07B 1XE7A 1HXS2 1LOBA 1ULGA 4CDQC 2EAKA 2P2KA 2E63A 4DMIA 5JZGB 3AMNA 2ZHNA 1AL23 1J3RA 4FAHA 2ZA9A 3HMYA 5EJ3A 5KXDA 1QXJA 1GZWA 1RUJ3 2HWD3 2BNNA 1LHOA 3MIGA 1KJLA 5ABJA 2QUOA 4NR1A 2YUEA 1FOD1 2B46X 1FPN1 3GNEA 2PHRA 1ZA4A 3RSJA 2WNVA 2VNRA 1HW5A 2AH2A 4UW3A 1CAVA 4WVMA 3VHNA 1TE1B 4H7LA 5GLTA 4YSFA 4WVWA 1GZWB 3M3CA 5ABJB 2XLAA 1QJX1 4KU8A 4YGDA 3WP5A 3UK9A 5D1IA 4WM8B 2WA4A 2WZPP 1Q8QA 3M2MA 1BBT2 2UURA 2WNVB 2BVVA 1U5ZA 2D6OX 5LK5A 3SXWA 1CAVB 4HN1A 4WVMB 3VBOC 1WLDA 1YYNA 5ACA2 1GV9A 1H2NA 2C1FA 5HCBA 3B9IA 4BQ1A 1TMF1 5FO8B 2HWC3 2Q1MA 1G9FA 4LT5A 1PGSA 4Q4V1 1QXRA 1JN2P 3OCPA 2PHUA 4DQAA 1G9BA 3E5XA 3I7DA 4YVSC 4P9GA 1ND3A 3HD8B 1QDCA 1H2MA 4CDUA 1ZRDA 5FO7B 2A3WA 4E9KA 2PLV3 1HX6A 2EXKA 1U5XA 3B5LB 3LSDA 4IV1A 4HFSA 1NZCA 3IKWA 4XZPA 3RZZA 3RWNA 4AFMA 1HRV2 1S1AA 3V65A 4M3CF 4CDWA 1OQ1A 1PIV2 3OJBA 3WP4A 4H7MA 1ND3B 1QWRA 2ZX1A 2ZBJA 1I3HA 3IM0A 5EWSA 3M3OA 2GZWA 2ZAHA 3AMMA 4CDUB 4XJ9A 1XU2A 5JOWA 3LA2A 1SLCA 3JD71 4EWAA 3PVEA 4IV1B 1LKNA 5GLUA 4E2SA 1H8VA 2SBAA 3MLLA 3ATGA 4XFCA 1MS0A 5T55A 2XJRA 3FLRA 1PNGA 1AR81 3ZYRA 3USSA 1PK6B 1G6NA 4CDWB 2ET7A 1AYN2 2ET1A 3KGLA 4P9IA 4AEDA 4Y24A 4YZ3A 3ZXDA 5KHIA 4COZA 1I6XA 2D6LX 1D2SA 3WOGA 1UMZA 3VBFC 3O0VA 2ATFA 1VBE2 3TNQA 5FLJA 3J8F1 3TBDA 4BMEA 4L2NA 3LSEA 4W6XA 5L7OA 3PNAA 4CEYA 3ETQA 2WC2A 4FO9A 2PHTA 4ATEA 4NHKA 2ZX0A 1PGL1 2UY8A 2ZPXA 4Q4X1 1WCSA 5GM0A 4AEDB 3ZPYA 5T5PA 2DVFA 4OHXA 1W0OA 4IEWA 3IWZA 4HK9A 2PHFA 4PLOA 5K8SA 2XB6C 4HVQA 4FPHA 2XBO1 5BNPC 1VAVA 4CEYB 1D0GA 3AKRA 3AKPA 4K20A 1U12A 1V9U1 1XYNA 5FQ0A 5KWRA 5FCCA 1O4TA 5FRAA 3SCGA 5T52A 4AGGA 4KGQA 1ULDA 3IMNA 2JG8C 1HQWA 1JHNA 3ZSKA 2E51A 2PELA 3RMYA 4YNIA 4XF0A 1IS5A 1HV1A 1V6MA 4R9AA 1PZ9A 4R4ZA 5CAZA 4YRDA 5FQ0B 4GB32 5J48A 1RUD1 1LCLA 3KM5A 3MIEA 3S6PA 3S0MA 4R9DA 1MS1A 1GQHA 3N36A 1URXA 4FPEA 1AX2A 3HBZA 1QOOA 3TN93 2IXKA 2ZAAA 2R063 1W0PA 3AP7A 3CJIC 4JRLA