3NVCA

Crystal structure of salicylate 1,2-dioxygenase g106a mutant from pseudoaminobacter salicylatoxidans in complex with salicylate
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
353
structure length
349
Chain Sequence
MQPKDTPELRALYKSFEEESIIPLWTQLGDLMPIHPKSKAVPHVWKWSTLLRLARKSGELVPVGRGGERRALGLANPGLGGNAYISPTMWAAIQYLGPRETAPEHRHSQNAFRFVVEGEGVWTVVNGDPVRMSRGDLLLTPGWCFHGHMNDTDQPMAWIDGLDIPFSQQMDVGFFEFGSDYATPNFSRGERLWCHPGLRPLSGLQNTVASPIGAYRWEFTDRALTEQLLLEDEGQPATVAPGHAAIRYVNPTTGGDVMPTLRCEFHRLRAGTETATRNEVGSTVFQVFEGAGAVVMNGETTKLEKGDMFVVPSWVPWSLQAETQFDLFRFSDAPIMEALSFMRTKIEGQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Gentisate 1,2-Dioxygenase
publication title The salicylate 1,2-dioxygenase as a model for a conventional gentisate 1,2-dioxygenase: crystal structures of the G106A mutant and its adducts with gentisate and salicylate.
pubmed doi rcsb
source organism Pseudaminobacter salicylatoxidans
total genus 94
structure length 349
sequence length 353
ec nomenclature ec 1.13.11.4: Gentisate 1,2-dioxygenase.
pdb deposition date 2010-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07883 Cupin_2 Cupin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3nvcA01
5JSPA 5KHIA 2PTMA 3IDCB 4N9IA 3H7YA 3D82A 4IEQA 5BPXA 4I0AA 3S7IA 3UKNA 2MPFA 1FI2A 2F4PA 2UY9A 1YFWA 2Y0OA 4EWAA 4Q29A 1QWRA 5JR7B 4J1XA 2C0ZA 3H8UA 4FAHA 4LULA 3DKWA 4GULA 4FAGA 3KGLA 4QGNA 4I2OA 3M70A 2H0VA 2BNNA 4FT8A 1LB2A 1GQHA 1O3RA 2OA2A 5CADA 3E6DA 4O9GA 3I54A 2XKOA 1WLTA 1UIKA 3H3ZA 4FBFA 3E5UA 4X6RB 4IEWA 3FX3A 4YRDA 2QJVA 1Q43A 3RDIA 4EV0A 1CAUA 4ZU7A 4MV2A 1NZCA 4DINB 4IESA 3I59A 4HSJA 2VPVA 5KHGA 3HT2A 2VQAA 3KCCA 3S7EA 2FMYA 1PM7A 4A2UA 3RPQA 2ET7A 4HN0A 2H6CA 4YNIA 4Q0UA 1G6NA 3IDBB 4XF9A 1O4TA 2KXLA 3FZ3A 3FJSA 1RGSA 5FDBA 4WVZA 4L11A 3JZVA 1QXRA 4LUMA 2IXJA 4PJYA 1ZZ9A 3FE5A 3H3UA 3CLPA 5JSOA 5FPZA 2IXCA 4ONUA 4R52A 3IIAA 2K0GA 2PA7A 4HBNA 1L3JA 4Z07A 5J3UA 3ZDSA 4HVRA 1YFXA 3H9AA 4KWJA 1O7FA 4X6QB 4MH0E 5LRSA 4MGYE 3MPBA 3SCHA 2VECA 3SMHA 4QGLA 1CAXB 2GC1A 5BXXA 2IXKA 2O8QA 4HMZA 2B5HA 4H7LA 3SXWA 2GAUA 5I8SA 3DV8A 3LZZA 3UKVA 1ZZCA 4Q0PA 2PYTA 5FLIA 5JCTA 2ETEA 4XETA 5LEJA 4BYYA 2ET1A 4CYDA 2GC2A 2PHDA 2Z69A 4ORFA 2GU9A 4F7ZA 3FHIB 3FWEA 2MNGA 4KU7A 3KMHA 3RYPA 4LA3A 2Q30A 2CGPA 1DGRA 4MGIE 5FQ0A 3G7DA 2XLAA 1EPZA 5E1RA 4MX3A 3DL3A 4YYOA 1VR3A 3H50A 1CAVB 1J58A 1SEFA 3C3VA 3OD0A 3RYKA 3BPZA 2D5HA 1CX4A 1FXZA 2GH2A 1ZZ8A 3SCFA 1J1LA 1O3TA 4XFHA 3NW4A 2XL9A 5FCCA 4EWDA 3DN7A 4MUVA 2O1QA 5I91A 3WW1A 1CGPA 2XHKA 4HLTA 5K8SA 1ZZ6A 2IXLA 2BEOA 2CV6A 4LTAA 4D7SA 2QNKA 3MZHA 1RUNA 1DZRA 3NSTA 4HSLA 4XF3A 5CU1A 1YLLA 4Q0QA 3PLQA 4XFCA 3R6SA 5BY5A 4IEXA 3CJXA 2Q1ZB 2EVXA 4IEPA 4RD7A 3EHKA 4PIYA 4Q0SA 4PIZA 1CAUB 3E5XA 4IERA 4QMAA 3UKTA 1OD5A 4I02A 4BIFA 3I59B 5I8YA 2UY8A 5FLHA 4OFGA 1IPKA 1HW5A 2E9QA 3CL1A 2P17A 4XFAA 4MGKE 3H7JA 1UCXA 5EFUA 1VP6A 3NJZA 4N9HA 5CVRA 5KHHA 4EWEA 1PMIA 3E97A 4QGMA 2K9ZA 4XFGA 5JSRA 3H1YA 3M3IA 1EYBA 3CF6E 2WC2A 5LRRA 3HIFA 4LLOA 1QXJA 1EP0A 2PFWA 2HJIA 2PAMA 3H1MA 3ETQA 2BYVE 1IPJA 4KWLA 3SCGA 3O14A 4TLFA 4XFIA 3E5QA 3CO2A 3RZZA 1CAWB 4AVCA 1QY4A 5KHJA 1VJ2A 4AVAA 1OMIA 3GBFA 3D0SA 2ATFA 3TNQA 5I0SA 1H1IA 1Q3EA 1YFYA 2D5FA 4EROA 4ZU5A 5AVPA 3RYRA 3S0MA 1ZREA 2XKPA 4IEVA 4P9GA 1J3PA 4IEYA 4JV4A 1ZNPA 1U12A 2OPKA 1O3SA 3MDPA 1RL3A 3OGJA 2BGCA 1J3RA 2QVSB 2GC0A 1UW8A 1CAXA 1LR5A 1FT9A 3USSA 1NYWA 1RTVA 2B9UA 2XLFA 4BHPA 5BUVA 1NE6A 2D93A 3E6BA 2ZKLA 4JTOA 3SHRA 3ACLA 3LA7A 4AQ2A 2CAUA 1DZTA 2GZWA 3KSCA 1Y9QA 4I3PA 5I0UA 3CEWA 1Y3TA 3BALA 4LUKA 1GQGA 1X82A 5I0RA 2B8MA 1ZZBA 5J7MA 3L2HA 5FQ0B 3OTFA 1I6XA 5E16A 3HT1A 4AXOA 5JAXA 3WW4A 4L2NA 3NVCA 4IEUA 1Q5OA 3VHRA 1UIJA 2Z2SB 4YARA 1ZVFA 1CAVA 4AVBA 1I5ZA 1SFNA 3OF1A 4XF0A 2V09A 1X8EA 2PAEA 4IETA 4KU8A 4Z82A 2CAVA 3EBRA 3PVBB 2BNOA 3EO6A 2I45A 3BCWA 3RNSA 3GYDA 1UPIA 5D1IA 1YUDA 1UD1A 1WGPA 3FFQA 4OLLA 2OYZA 1ZRFA 1ZZ7A 3LA2A 3H1WA 1XRUA 4JVAA 2QCSB 4META 4NVPA 4MGZE 1ZRDA 1J3QA 4XF1A 4HZFA 1J59A 1SQ4A 3ST7A 4HN1A 1X8MA 4E2QA 1NXMA 4YSFA 3ES1A 2PHLA 3N4MA 5KHKA 3U11A 3WW2A 1NE4A 5FLJA 5BV6A 4IEZA 5F1RA 5I93A 2IC1A 4KL1A 2Q4SA 2QDRA 3B02A 1RC6A 4K8FA 3QOPA 3U0ZA 3HQXA 1X7NA 5EZWA 3OCPA 4PIXA 3NL1A 3KGZA 2PQQA 2IXHA 2IXIA 4QM8A 1ZRRA 4E2GA 5J48A 3LAGA 2BNMA 3ELNA 5C6CA 2XGXA 4QX5A 5I0TA 2MHFA 2UYBA 3WW3A 5C8WA 2GC3A 1YWKA 1O5UA 3EQEA 1OI6A 1XE8A 1JUHA 5LEKA 4XF4A 4AQ6A 4LEJA 4WZCA 4HVOA 3MYXA 3NKTA 3LWCA 4LA2A 3ROUA 4UXAA 5KBFA 1ZX5A 1DGWA 2DCTA 4Q0VA 4R8HA 4UBGA 3TNPB 4I0BA 4E2SA 2ZCWA 4HVQA 1RUOA 3IBMA 4I01A 2OZJA 1CAWA 4QXKA 4J1WA 4B29A 2XL7A 1O3QA 1YFUA 5HI0A 5T3NA 4D7TA 4WBBA 2XLGA 2OZ6A 1WA4A 2Q0AA 1V70A 4MZUA 2EAAA 4BH9A 2FQPA 5FPXA 4XEZA 2N7GA 3D0JA 4IEOA 2D40A 3PNAA 1YHFA 1OFNA 3ES4A 4UBHA 1ZRCA 1EY2A 4KWKA 4F8AA 4I09A 1O5LA 3QACA 1LRHA 2UYAA 3LOIA 3E6CC 2WFPA 1XE7A 1TQ5A 3EJKA 4QM9A 3U10A 3IWZA 1LKNA 2EA7A 2PAKA 4ZU4A 3BU7A 3BB6A 1H1MA 4XFFA 3LA3A 4O9EA 5I8TA 2H6BA 4JTNA 4XFBA 3I7DA 2HKXA
chains in the Genus database with same CATH superfamily
4JRAA 5EP9A 2ADDA 4JC1A 1U5XA 1C57A 2YZ4A 4K9SA 3SISA 2P37A 3D82A 2NQYA 4FCAA 1MS3A 1GFF2 1G7YA 1SZBA 3GZTB 4NWVA 1O4YA 2XB6C 1VE0A 2MPFA 2DVFA 2JDHA 2RS13 4IV3B 4XVHA 4CDQC 4XJ8A 5ERLA 4DXTA 1YRZA 4RHV2 5A6XA 1JYXA 2ZGUA 1FI2A 3EXUA 1GKBA 3RVHA 5TSWA 1YFWA 1PNFA 1HXS2 2F4LA 4EN7B 1AYN1 5A7OA 3GGLA 1DYKA 5FO9B 4P9WA 3DKWA 4GULA 3OGGA 3I2GA 4XC9A 3KQ4B 1W05A 4QGNA 3TEWA 2H0VA 4LKEA 4KBBA 1EAH3 1C1LA 1DQ0A 4NIAA 2HWC1 4CCMA 4FT8A 1UKRA 1TME1 1GQHA 2XMLA 2P3KA 2OA2A 4PT6A 5A7PA 2WSUA 4R9DA 4Z1VA 1S0CA 5SV8A 4WVWA 4BXSV 4Z2WA 1DHKB 1WW6A 5AFEA 4S2GA 1GICA 1AR62 4AL9A 4YM0A 3F95A 3O1UA 2BBVA 2QJVA 4K1YA 3P6BA 5LK5A 3OUHA 1UU5A 1HB1A 4BPZA 3HR9A 3UGHA 3LDBA 4Q4V1 4DOUA 4TTGA 1C28A 1AR92 2R042 2VQAA 3KCCA 3NO8A 2R16A 1POV3 3C7EA 4A2UA 1NT0A 1N1TA 5CBLA 4HN0A 2JG9B 3BTYA 3BTZA 2H6CA 2YYOA 3RMXA 1OF3A 4YNIA 4H3WA 5IJRA 1MZFA 1S0DA 4QB1A 1C1FA 2UU8A 4XF9A 2ZJCA 3PVEA 1HQLA 2KXLA 2NM1A 3ZN5A 2VOXA 3WQ0A 2SLIA 3NV3A 2TBVA 4WVZA 4L11A 4YW1A 5AFBA 4PJYA 1UU6A 2X5IC 4MHUA 5FZBA 2GP5A 5CKQA 2WS91 4YLZA 5EYXA 2ZAHA 2VAUA 2WLQA 2ZMNA 1R64A 2V5DA 4FPJA 4IGQA 3V65A 1ZBA2 5IVVA 4EZHA 4ONUA 1WBLA 1MZ6A 1XYOA 2K0GA 5ACA1 1NA1B 3MI8A 4HBNA 1RUH2 2WZ8A 4W6XA 3AJZA 4LBQA 4Y3OA 3M2MA 1O7FA 4IW3A 4A42A 5HBAA 3A0NA 3QH7A 2J1SA 1RUC2 3AZYA 2FDIA 3N7JA 4CDXC 5DMYA 5L9VA 2VBPA 3J7NA 2GNBA 4OCTA 1H8TC 5F5IA 3VBHA 3W5NA 3POWA 2ZACA 1W6NA 3KHCA 2IXKA 2O8QA 4LE4A 2RM22 1OURA 2R1DA 4PBOA 2ADEA 2B5HA 5FZOA 1V0AA 2GAUA 1QH6A 3IDAA 3LEGA 2PLV2 2BOIA 3LZZA 5C8CA 5L7OC 4R4XA 3UKVA 3RG0A 3UT0A 4Q0PA 1JOJA 4I30A 5GZEA 4UT5A 1PK6B 4Y26A 4ZKTB 5F39A 2GC2A 4CYDA 4ORFA 4XHBA 4FP2A 2GU9A 4RGGA 2YBKA 3PJQA 5GZDA 4QQOA 2J1VA 3PL0A 3FWEA 4XJUA 1IOAA 2JE7A 3MEPA 1AXKA 2Q30A 1RITA 1G9DA 3BODA 4MGIE 5LBCA 1VBB1 4XOGA 4Y1YA 5CA6A 2C9KA 2XLAA 3Q8BA 5E1RA 5GZGA 3JCIA 4AE2A 4QD2A 5APAA 1OUXA 2VUJA 3QBQA 3DL3A 1CPMA 1VR3A 1W8HA 1ULFA 4CCCA 4XUOA 1BZWA 1VBE1 2ZXQA 3OD0A 4RFRB 4C90A 1HV1A 2ZGKA 3ZFFC 3HMYA 3SH3A 1CX4A 4HK8A 4CP2A 4ET7A 4C91A 4H55A 5BNNC 1YI7A 4Q1PA 2WWUA 2GH2A 4BQYA 1RUF3 1J1LA 2GN7A 3GF6A 2JDKA 3AVSA 5FCCA 4Z8BA 3ZSKA 2VZUA 5A3NA 4DY5A 5ABJA 2O1QA 3AP9A 4CRQA 3RWKX 2W52A 2W87A 3MBWA 4CPBA 3VBSB 3HBZA 3WNKA 5FKBA 2JECA 3LSEA 4PDWB 1MACA 2XG3A 2IXLA 2VD7A 2BEOA 3F2ZA 2CV6A 4XMIA 3Q8AA 5L73A 3TEZA 2JE9A 4N43C 3HAGA 3NSTA 5IFPA 2FD8A 3FLTA 4K21A 5CU1A 1VBD1 1W6QA 4BA6A 2XR4A 4Q0QA 3ZYBA 5BY5A 1FNYA 2VOWA 1UZYA 2EVXA 3U14A 2VCBA 3AYAA 4PIYA 3N9QA 3JBG3 2D3SA 4LBLA 1OPMA 4Q0SA 1JYNA 4XQ4A 4UW6A 4PIZA 5IYYA 4GWNA 1S4CA 3SQOA 2VMIA 5FKCA 2YG0A 5FYHA 3PVOA 3C8XA 3KM5A 3ORJA 5T5JA 3THCA 4I02A 3V0BA 5FV3A 1VAVA 1KJLA 2P4EA 3IB3A 4PCRA 2E51A 5T50A 4BIFA 5I8YA 4BK5A 3ZN6B 1C8M2 1KQRA 3I3DA 1ND3B 2DBNA 4GQ7A 1HW5A 2WLPA 3RRDA 5EQUA 2E9QA 3VHNA 4AFDA 1Q8OA 2P17A 4FTEA 4XCAA 3VBRC 4D6SA 2YB7A 3KV9A 2PHWA 5KXDA 1QJY1 1VP6A 3K77A 3NJZA 5CVRA 3WX5A 1R091 4WM7B 5JDBA 2DU0A 2RR11 1UXZA 4BQ2A 4CSWA 5IVCA 5JSRA 3N9LA 1BLZA 4BMEA 1F9KA 1RUI1 2EALA 3HIFA 5FPVA 5LRRA 2VZ3A 5D2AA 3WV6A 3L2YA 3A21A 5SV5A 4ZONA 4E4ZA 3ASIA 1OOPA 3H1MA 1SBDA 1Y43B 1PO12 4N90A 4TZDA 4LR4A 2YY1A 3L9JT 3WUCA 5FZDA 5FZ7A 2KR2A 2P3YA 3HWJA 3ZFEC 5F3EA 3FMGA 3HOBA 4AVCA 1CAWB 2JIJA 3MW3A 5FJHA 1AL0G 4LBQB 4AVAA 5KHJA 2ATFA 1ULDA 3VDDA 4Z92B 1H1IA 4EROA 1HRI1 3K46A 1RUD1 2NLRA 3IPVA 5C3PA 1ZREA 2XKPA 4IEVA 4FOYA 4OYUA 3BIEA 4FXKB 1RVF3 3H8OA 3VBHB 5HPOA 1JS9A 4YFWA 4NHLA 3B01A 1A3KA 1W8NA 2KD7A 5GJ6A 1MS0A 2LALA 5FZOB 5HV0A 1PMHX 2E7TA 2GC0A 2DWRA 1C4RA 1UW8A 2OIIA 3GCWA 4YFZA 1IS5A 1TNRA 3S5QA 4FP3A 3USSA 2RG4A 4LBOA 1CZVA 1H9PA 2XLFA 1KFXL 4TXWA 4QPIB 5FPLA 5BUVA 1NE6A 2WR9A 5KXBA 2G9FA 4QXBA 1BJQA 1EV12 3O1MA 1Q8PA 2MEV2 2VTXJ 1GWMA 4AQ2A 3GM8A 1UX7A 3I49A 5FYSA 5JXHA 1XQNA 1ZBE1 4XHXA 4WM8B 4YM3A 1GSLA 3BALA 4LUKA 4AI1A 1GQGA 1U5IA 4GJZA 1RUE3 3SH4A 1F5JA 1AR91 2R041 1DZQA 2E7QA 1F15A 1POQA 1ZZBA 4LHNA 1HRV1 4MXWA 4WVVA 4XIOA 1UL9A 3NV2A 3ALQA 3OTFA 5FXXA 5J96B 1SLLA 1IGOA 1H0BA 2A6VA 1WLWA 4RN5A 4CXWA 5JAXA 4XCBA 4L2NA 1LOCA 1STMA 5IAXA 1ASJ2 1C8NA 4YGCA 1Q5OA 3VHRA 1S2KA 4RL7A 2DF7A 1FPN2 2FZ2A 4Y5TA 2BJSA 5F2SA 1GNZA 1F31A 1ZM1A 4JDNA 3ENRA 1GLHA 2J1TA 1CWPA 1RMU2 3Q9OA 1CAVA 4AVSA 1K12A 1SFNA 1Z0HA 1XSRA 3KWVA 1X36A 4LPLA 2GSYA 4YG3A 4YWAA 1N3OA 1MEC1 1OD3A 3P1IA 4XTPA 4ZY9A 5B4NA 2A6YA 3POIA 3ZSMA 1K42A 2QQMA 5A3LA 2BNOA 4UFJA 1LTEA 1LGCA 1QQP3 2I45A 2YXSA 2ZMLA 2WRAA 1DYPA 3AVRA 3KQRA 3OJBA 5FP3A 1FOD1 5D1IA 1SLCA 1ENQA 3BN6A 2W68A 2XJSA 1W39A 2OYZA 4WZFA 1WMFA 5JMCA 3UJOA 5DDJ1 2WDBA 5C4WC 4LT5A 1VBA3 1EUUA 2UWCA 3ECQA 2QCSB 1UOJA 5FZ4A 4META 1DLLA 3N3HA 3ZYJB 1AHSA 1S0JA 2J1UA 4ISQA 2XXZA 4XTMA 4NIHA 4HPKA 4FO9A 4XUNA 3PUSA 4QXHA 4HANA 5JOYA 4TN7A 1X8MA 2OQ7A 3JU9A 4E2QA 2HWB3 1GWLA 3CIHA 1R1A1 3ZIWA 4QHBA 2VQUA 2PHLA 3ITQA 3WW2A 2XQRA 3IN9A 3THPA 5F1RA 1LEMA 2LROA 3VBFC 3HNBM 1DDLA 1REFA 3VD3A 2YROA 3B02A 4Y1XA 3HBKA 1RC6A 3VBUB 1W6PA 4XJZA 3AZWA 2WFF3 3ZXKA 3I97A 3QLQA 3PHMA 3PTYA 1BK1A 3QOPA 3HQXA 4O65A 4AAPA 3K3OA 4JHTA 4JKLA 1AYM3 1Y9GA 2BW8A 2KA3A 2WT2A 3B00A 4LIUA 4QM8A 4BQXA 5FZKA 5CFCC 3LAGA 2IWGB 4EN6B 2B7YA 2VTXA 3AMPA 5C6CA 5A80A 3OPZA 5DZGA 1TEIA 4Y1UA 2B46X 3LEIA 1T6GC 2MHFA 2V4AA 1I3HA 2UYBA 4LK7A 4CEYA 4UW5A 4BQ4A 3IM0A 5BNPA 1JMUB 3WG4A 5C8WA 2R071 4NR1A 5FBJA 5FP4A 1MQTA 2GC3A 2JENA 2RDNA 4IV1C 1YWKA 4BOWA 3VDBA 3EQEA 1OI6A 2G19A 2KM2A 5CYYA 2VVEA 2F17A 1YIFA 5A32A 4HONA 4D7YA 1WA6X 1F5FA 4XF4A 3VL9A 3CZUA 4HVOA 3GJAA 4LA2A 4ZS2A 3AK0A 1AYN2 4UXAA 4AI0A 4Q4W1 3MW2A 4HKOA 2EAKA 3J8F3 4NAMA 5G05L 3VDDB 3WG2A 4EE2A 2FDGA 4G3YC 3VBOA 1YQ6A 2ZCWA 4HVQA 4GA9A 2LUWA 4BXFA 3ZR5A 4I01A 5IVJA 2EICA 1TME2 1VALA 1HV0A 4DS0A 4TYSA 3NJXA 5FYTA 4RR3B 2C5DA 5F3GA 2FDFA 5CEHA 4Y4YA 1YFUA 4EN8B 5HI0A 3BKZA 2YHJA 1IQAA 2VZSA 1LEDA 4E8DA 1BYHA 1FV3A 2WNUA 1AR73 3ABZA 4FFIA 4JKMA 4CU6A 1I1EA 4LK6A 4NPMA 3WR0A 2Q0AA 1CJDA 3AL5A 1FMD3 2OKXA 5L19A 3SITA 4Q4V2 5JXJA 1UYZA 3LEMA 3VB9A 4RGKA 3I3EA 4AEDA 5CISA 3JD73 1H4GA 2GNDA 2N7GA 4LITA 1W0PA 1SG3A 2DCZA 3D0JA 2QZ2A 4QKNA 1D4M3 4NPLA 1KXGA 3AMHA 2AZ5A 4KG8A 4QPGA 2HWD2 3PNAA 4CUAA 3BUCA 5FZ0A 4EJRA 2K46A 1SACA 4GMP0 3NJVA 1HJFA 3KB5A 3VZOA 5A1AA 3MF9A 3A23A 2ZX1A 2JD9A 3IKWA 4F8AA 4QX2A 4GWJA 3AYCA 3B94A 5CFDC 2A3YA 1GP4A 1HB3A 5LY1A 1WW5A 1LRHA 5JUVA 2ARAA 2CHHA 1AF9A 1RHI1 2ZTNA 2WS92 1A8DA 1COV1 5LA2A 2PAKA 1G9FA 1Z7S3 4CDWA 1IS3A 1ULOA 4PHZA 4MLOA 4DUVA 4DUXA 3BOWA 5ACA2 4XFBA 5F5QA 4I3GA 3N7LA 2E33A 5FYVA 1V6NA 3ZFGB 4AR2A 3LQCA 4QPGC 4OHWA 5KHIA 2PTMA 2JB8A 3IDCB 4N9IA 3H7YA 4RGAA 1NY71 4YVWB 4CDUC 3GZEA 4KMQA 3UNPA 3JQWA 5BPXA 2JDUA 2RJKA 4I0AA 4D3WA 1D2SA 2JDNA 4RYDA 1PO11 2AC1A 3O1TA 3USUA 4YZ3A 3LB9A 2PELA 3ZSJA 2JKBA 3NNJA 5IK4A 4FPEA 2X10A 4AWDA 2XBO2 5AC93 3OY8A 4HK9A 4DEVA 4EWAA 1OBNA 1QWRA 4M0HA 5JR7B 3POFA 5EJ1B 4J1XA 2C0ZA 2VJXA 2WNVC 3AP5A 3DPRA 2DUQA 2VCCA 2P2KA 1JZ2A 4GB31 3MGUA 1WWYA 3IDEA 4XUQA 2A6WA 3VHOA 1N3PA 1ULCA 2A7AA 4HPKB 1UOGA 4CDWC 4FAGA 4I2OA 1C5HA 1K5MC 2VNGA 5FZCA 3ZYGA 4IDZA 5C71A 1LB2A 5LWBA 4LO5B 3SEEA 4K20A 5JPNB 4JQRA 4CU7A 2JX9A 3I54A 2XKOA 4O9GA 1WLTA 3ZYFA 4FBFA 1OKQA 1ND2A 3E5UA 2QQNA 4X6RB 3J9SA 1NCQC 1Q43A 2OW4A 4YM2A 1W03A 5T5OA 4ZU7A 3FUQA 4MV2A 1VBB2 1H2KA 1W6PB 3M7AA 1DP0A 4LJHA 1PZ7A 2YC4A 2ZGPA 4L9BA 1HIXA 5LASA 2RS11 1LESA 1PM7A 3AFKA 2ET7A 3DUIA 1MR5A 1VBE2 3NRUA 4OUSA 5JZGA 5FOBB 2ZGTA 2VNOA 3IDBB 4Y22A 1VLNA 3CMGA 1O4TA 3WT3A 2XJPA 1W28A 4CEYB 1LOFA 3FZ3A 5C9AB 4WVMA 3FJSA 4NRPA 4LMFA 5D8AC 5DN2A 1XE0A 1RB8G 1G9AA 5IVBA 3LKJA 1IKQA 1OHFA 1BQPA 1MQTB 3SKJE 3RZJA 1EAH1 1V6MA 5HCBA 1ND2C 1POV0 4NMIA 4JGZB 4F3JA 1ZZ9A 2OS2A 4O7XA 1W3XA 3FE5A 3HQRA 4GXLA 4MYEA 4L0PA 3MV11 3PIJA 5C5UA 5A32B 4V1PA 1XU1A 3MIBA 4RS5A 5FPBA 5FPZA 1V6KA 2IXCA 4R52A 4JGYB 1S55A 5FY0A 1OH3A 3O7OA 3T0DA 2A1XA 1A34A 1L3JA 5J3UA 5JMOA 3FLPA 1JI6A 5KC5A 3K2OA 3JB4C 1VBD2 2ZGLA 4KWJA 4N53B 4ZXKA 1POV1 4X6QB 4YVSC 2Y6JA 1MS9A 3I3BA 4GMP3 3MPBA 4X8NA 2YUEA 1H2NA 4QX7A 2CTVA 3PJYA 3SCHA 4FOQA 4XJ9A 3U37A 1CAXB 2GC1A 2PQSA 4DPNA 3DGTA 4E4DX 1NCRB 1W8ZA 5AVAA 4PI0A 5ANNA 3WDWA 2D3PA 3P3NA 4GH4B 1VBC3 4JDMA 4JX0A 3DV8A 5FZLA 3WHTA 4RS5C 1ZZCA 3WDVA 3KZ4C 1Y9MA 3E1F1 3MLKA 2D6PA 3EMRA 1QKQA 1N1VA 2ZKNA 4X8PA 3ZYHA 4XETA 1RUJ2 4K3UA 4CDQA 1V00A 2Z69A 5EV7A 4Y20A 2Y26A 1QJY2 4P02B 1IS4A 4XZPA 1R092 5LY2A 1TNFA 1YQCA 2MNGA 4JZRA 4KU7A 2RR12 4AG4A 2BDRA 3PIGA 1UNBA 3I4IA 3LDKA 2D7FA 2E53A 1NA1C 1QJEA 2JE8A 3A7QA 1RUI2 2AUYA 4RQPB 4IL7A 4YZ2A 4YYOA 3NMBA 3H50A 1J58A 5K7PA 5C3QA 4LBJA 3WP5A 2BERA 1MS8A 4ATFA 3BPZA 3M3OA 3WF3A 2D5HA 4CEWB 5A33A 1DIWA 2WN3A 1UKGA 4LBQD 3SLIA 1V6JA 1FXZA 3W20A 3MPPG 1KRIA 5A7WA 3SCFA 2C1FA 2IVIB 1DYOA 1O3TA 4XFHA 2WIIB 2BUKA 4EWDA 1HRI2 2Y0IA 3W9AA 3GCXA 4M4RA 1JYWA 2PHXA 1RUD2 3LPFA 1SPPB 1S2EA 2ZZQA 4NIDA 3FUOA 1NLRA 4MUVA 4QDQA 2X8KA 5FY7A 2RV9A 3USUB 4DY3A 4W8JA 5I91A 2ORZA 1TG7A 3LFMA 4TSVA 4FPOB 4U2AA 4XYXA 1HDKA 1GZCA 1MZ5A 5DAXA 3PMEA 2XHKA 3GBWA 4XMAA 4HLTA 1P8JA 5LBEA 5K8SA 5M0TA 4AFAA 4D7SA 4JRLA 1TE1B 3DPRB 4FTBA 1DZRA 3ZMNA 3WINE 3AZXA 1WCSA 4YZ5A 4AF9A 4XF3A 1PVC3 4CP9A 3CNAA 2ZPXA 3M4FA 1YLLA 3OD4A 2Q1ZB 3AMNA 3C7FA 2X5IA 3EYPA 1BHGA 1DQ6A 4JDOA 5DAQA 1D0HA 1ZBE2 2WL1A 4RD7A 1IZ3A 1AXYA 4UFLA 5FZ9A 3OEAA 1RUF1 4XAEA 3ZPOA 5A7SA 4XE9A 3E5XA 1XNBA 5JIAA 4AVVA 1HRV2 4QMAA 3S6PA 5JR2A 1JYTA 1OD5A 1W8TA 4UF0A 4E4HA 1W6MA 3NV1A 4S2FA 1GYKA 2A73B 4QU2A 2VQTA 2HWD1 1W0OA 2RDSA 1O8PA 2AGSA 4QU1A 3WNLA 4HOOA 5JZGB 2QQUA 1NQJA 3BI3A 2AACA 3H3LA 2ZGOA 3LF7A 4KG0A 3JB8A 4Y22B 4CDXA 4OUEA 1H8TA 4MGKE 1HB2A 1UCXA 5EFUA 4B3NA 2W95A 3MIHA 3O0WA 4N9HA 3VBSC 5K0UB 4YZ1A 2HWE3 1AJOA 2DTYA 4A41A 1MEC2 4PDWC 4QGMA 1K5JA 5FREA 3POJA 2K9ZA 3I2JA 1U0AA 2VNVA 2WWSA 1W9YA 3H1YA 2WC2A 5L7OA 3LE0A 2E6VA 2Y6GA 2CNAA 1B35A 1JU3A 1FOD2 4AFMA 4BK4A 1AR83 3WUDA 4UFIA 3FC0A 4UWDA 4DB5A 2PAMA 1JXNA 3JBG1 4BISA 4V2VA 3WOGA 5DDJ2 4YW4A 2R7EB 3SCGA 3O14A 2EF6A 3VD9A 4FTSA 1LHWA 1DU3D 1REDA 1XBFA 2WINB 3NAPA 2UURA 2E31A 2V4VA 3DF0A 1UMZA 4W65A 4FPFA 2VZRA 1NX9A 1QIQA 3OPWA 3B9CA 5FWEA 1YFYA 5I0SA 4ZU5A 4XQDA 1BEV3 3ZYRA 5H9RA 2BGOA 3GBGA 3RYRA 1GV9A 2XBO1 1CIWA 3CKHA 1R1A2 4UW3A 1YCIA 3RZMA 2OPWA 4JV4A 1ND3C 4Q8KA 1ZNPA 2F6BA 4LOSA 1U12A 1G9BA 2OPKA 2B39A 3ZFFA 1OVPA 4MGQA 2BGCA 1J3RA 5F8PA 1B35C 2QVSB 2VMEA 2A71A 5BNNA 4FSJA 5T52A 2HBUA 1X9TA 2ZAAA 3C7OA 1EUTA 2D97A 1RTVA 2B9UA 4XXAA 1QJU3 4M3CE 4WM7C 5FZ1A 1YQ8A 5K4LA 2D93A 3E6BA 2ZKLA 2VZVA 4GD4A 3SHRA 2QDNA 3LA7A 1HKDA 2C6SA 3NAPC 4LBNA 4D6RA 3KT1A 3FBYA 3KSCA 1Y9QA 4N7UA 4D69A 1Y3TA 2ZEWA 5IT6A 1BVVA 4DNYA 3LEKA 4LIVA 4YW6A 5IW0A 5FYCA 5KXCA 1X82A 5FZ6A 5I0RA 2B8MA 1QJX3 1R083 1QXPA 1WW4A 3L2HA 3URFA 2R072 5FZAA 1DQ2A 2XVLA 3AXDA 4N43A 4OI2A 4BQ1A 1NG0A 1WUVA 5E16A 3I3MA 3CDZB 5FY9A 2A3XA 4TLGA 3WW4A 2QE3A 1HQWA 3NVCA 1N1YA 5DZEA 4IEUA 1N3QA 4MXVA 4QQPA 4A6SA 2VUAA 1GOFA 4E9KA 1CIYA 1ODMA 3T1LA 5B4XA 1AJKA 5IVEA 2VULA 4NAOA 3PMSA 1KS4A 1OC1A 1RUG3 2VGDA 5A7WB 4Q4W2 2D6LX 1X8EA 5IAVA 2DTWA 4CCNA 2O14A 1T6BX 3QCWA 2W1WA 5FYYA 3ZN4A 1BMV1 1JZ4A 4MSVA 4LHKA 1UPIA 4QPIC 2YU1A 3GHMA 4OLLA 1L7RA 2CWMA 3ZXEA 1RUE1 4BE3A 4HFSA 3VBRA 2HEVF 2QQKA 2YPJA 1JUIA 1XRUA 4WM8C 2Q5TA 1RJ8A 1GUIA 4NVPA 3MUY1 4MGZE 2VXRA 3AFGA 2WN2A 3UGGA 3KV5A 4F83A 1XOYA 2R32A 2ZX2A 3DECA 1IPSA 5CZKA 5HXMA 1BVP1 3ST7A 5H9SA 1GMMA 2BP6A 1OQEA 3IAPA 4HN1A 5FFOC 3T30A 2P6HA 3ZXDA 1ODNA 2WJSA 4A7KA 3WCSA 1LAJA 2R6QA 1BK0A 3H0OA 4GJYA 3LD8A 5KHKA 4PBPA 5I93A 2DVDA 1NZIA 1F2NA 3CJIA 1FV2A 2B9VA 2Q4SA 4AGGA 5IK7A 2QDRA 4UF0B 2OT7A 3ZFEA 2RS33 4EYUA 1XU2A 2HWF3 4K8FA 1RUJ1 3VZLA 4ARYA 3T2OA 1QQP1 2DVGA 5A3UA 1W90A 1XNAA 3ZPYA 1RHI2 2JDAA 3S57A 5EZWA 1T2XA 4PIXA 2LW8A 3KGZA 1COV2 1LJ7A 2UWAA 1RYYA 1ZRRA 2E63A 1VBA1 1H8TB 1QDCA 4HG6B 4GZ9A 1FX5A 2VZOA 2EXKA 2XGXA 1I5PA 2OVUA 4CP0A 5I0TA 5F3CA 5ANQA 4BLJA 4MGTA 1NY72 3WW3A 3MO4A 2ARCA 1TMF3 3ZIXA 5FOJB 4HETA 5JLVA 1Y4WA 2QTWB 2HWB1 1CESA 1K45A 3CJIC 1XE8A 1LU1A 1WCQA 4W6YA 5LCWL 1JUHA 3AP6A 4QKBA 5GLZA 2L9LA 2BZDA 3VUOA 5FBZA 3K4DA 4AQ6A 1N1SA 4WZCA 3WNMA 2VW2A 5A6YA 2FZ1A 3NKTA 5KBFA 1ZX5A 1DGWA 3KCYA 4CXXA 1AL23 4Q0VA 2AH2A 4QPYA 5CG8A 4GB32 4FPGA 1BBT3 4M3CF 5D21A 2XDVA 1F35A 2WFF1 2X29A 1CVNA 5FY8A 1W6NB 3MFAA 2D6MA 1AYM1 2VCAA 2AENA 3T0AA 3VBUC 2D3RA 4LBKA 4CTEA 1O3QA 3B5LB 1PO23 5C8CB 3HN1A 1A6CA 4DRRA 2WT0A 2Q8CA 3RWNA 2XLGA 5BNNB 3QD6A 1JZ3A 1WW7A 1WA4A 1V9U3 2D6KA 2FCUA 2EAAA 2WZR3 5IK8A 5A3OA 5DABA 2RS12 5FPXA 1CX1A 2RJLA 2DUPA 3WDXA 1W2OA 2W92A 4K7JA 4COYA 2X05A 3WD5A 4Q4Y3 1OT5A 5EJZB 2D40A 5GLVA 4EN9B 4DXSA 3ZKUA 4FQ4A 4FOVA 4Q26A 3OSDA 1KITA 3ME2A 2NP0A 3NNMA 4OZOA 2RE9A 2WKKA 3IMMA 3RSJA 3J8F1 1EY2A 5C4WA 5LBBA 1L7QA 5A7NA 4I09A 3O1SA 2PHFA 4JKKA 1PIV3 2XJRA 2CYFA 1EAH2 2RS53 1GBGA 2O8OA 3N9NA 1JU4A 4GWMA 4FPLA 4URTA 2VZQA 2J1RA 3GZUC 5J36A 3E6CC 1JHJA 2NMOA 3VDAA 1XE7A 1TQ5A 3EJKA 4QM9A 1J83A 2OUHA 2D6OX 1LKNA 4K40A 4DMIA 2I74A 5C3OA 2CWSA 4P9LA 1AR71 1MZEA 5FP9A 3VKFC 4HT1T 5I8TA 4JTNA 4RR3C 3O1OA 1FMD1 4CXYA 2GNMA 1O8SA 2YU2A 1LODA 3VBFA 5ABJB 5JSPA 4MGSA 5FMBA 3JD71 2WNOA 2Y60A 4NROA 3B93A 4IEQA 4QQLA 1D4M1 2GDFA 3S7IA 3TN93 2R1BA 3UKNA 3ZVXA 2YBPA 4Q4X3 2VE1A 4LQRA 2GMMA 3OGVA 3ACGA 3T2QA 2F4PA 2UY9A 1W8OA 2Y0OA 3GALA 4AYUA 1W6QB 4XBLA 5CFCA 4Y5SA 2VY0A 5FMOL 1PZ9A 4LULA 2QKDA 3R05A 2A6ZA 3HNMA 2R063 1V6IA 1C5IA 3KGLA 3M70A 4ASKA 2BNNA 1ENSA 1Z78A 1XYNA 2DCYA 2YFUA 4IV1A 1VRH3 1O3RA 2ZHNA 4MHRA 3BIWE 4DO0A 1Z7S1 5CADA 2EIEA 3V0BB 1JYIA 2Q8OA 2P1BA 2W39A 2W3JA 3AKRA 1OA4A 2B4KA 3T0BA 2QBXA 3T1MA 4AEKA 4IEWA 5KWRA 5A6ZA 4K6BA 2FHRA 1W9TA 4XDPA 4YRDA 4EV0A 1JH5A 3POGA 4IESA 5EWSA 3RI9A 2I2SA 3A4UA 4H7MA 2B45X 3I59A 2GALA 1KS5A 3HT2A 3I2HA 4HSJA 4OULA 1Q8QA 3ZFGC 1XJAA 2FMYA 2FCTA 5DUVA 1DBNA 4PLOA 3RPQA 4A44A 5DXDA 4YVWC 2BVBA 3K48A 4QB2A 5AC91 2FDJA 4Q0UA 4RHV3 4KWUA 5HCHA 5FYUA 3I2DA 3WG1A 1H6YA 2VOVA 3WP3A 4CCEA 3UK9A 1SMVA 2LM3A 1GU3A 1HXS3 1RGSA 3OYWA 4W50A 1AXZA 5FDBA 5HCAA 4L8QA 3D6EA 4XDOA 2Z79A 1OOPB 2AYHA 3JZVA 3AC0A 2W47A 3V56A 4AVTA 2IXJA 5F6KA 3AX4A 2P5BA 5CKNA 1W3VA 5A7QA 2ZX3A 3H3UA 1SLTA 3JXSA 2CL2A 5FZEA 2O0OA 1LGBA 3CLPA 1GQPA 2ZX0A 1JZ6A 5KR7A 2G1MA 2VXJA 1ZA4A 2R49A 4S2DA 2ZBJA 4NHXA 3IPVB 2VO5A 1AR63 2YC2A 4L97A 4PF1A 3ZDSA 5KHGA 1FNZA 3O12A 1YFXA 3H9AA 1QJX2 2YC0A 4DRVA 5CFDA 3KT7A 3EB7A 4YM1A 1UY0A 3FHQA 1EPWA 4XUTA 4YW2A 2ZMKA 5F7UA 4GWIA 1DFQA 2NPIA 2R043 2DV9A 2HYXA 1V6LA 1M06G 5LA1A 2VECA 5GLWA 3N7KA 4C8DA 1CONA 4QDSA 3I8TA 3ACHA 1GZ9A 1LGNA 3J7HA 3Q8FA 1RUF2 5GLUA 4HMZA 5CIRA 5EHDA 3WQ7A 1LCLA 3J7MA 4CVUA 2NZ9A 4H7LA 3RZKA 2YMZA 1YQ5A 4UFHA 5BNOA 4FFGA 2XQXA 4ES8A 1SDDB 2BTVC 4NIIA 4CCLA 5C9AC 5T5PA 4QWNA 5FWJA 2RDRA 1JN2P 4AHWA 4CDUA 2BVVA 2ETEA 3KT4A 3ACFA 3NJYA 5LEJA 4BYYA 2PHDA 4MXWB 1KDMA 1ZA7A 5JIUA 4ITCA 2B42B 2BFUL 5FY5A 4F7ZA 1WMDA 3GZAA 2V72A 4QQHA 1PX3A 5C4WB 1ZBA3 3ILRA 3KMHA 3RYPA 3TB0A 2I07B 4LA3A 4QB6A 1VAMA 4LO8A 1DGRA 1B09A 4JGYC 2CGPA 1RUH3 1E5SA 2WNVA 2ID4A 5FQ0A 3G7DA 3C7GA 1E57A 4UFMA 2W94A 1ONAA 4W6WA 2JICA 3MLJA 4GMP1 1QOSA 3VN4A 1K5MA 1CAVB 1JODA 1SEFA 2CSGA 1RUC3 3C3VA 4R9AA 5BNOC 2J42A 4QX8A 3RYKA 3JBG2 5FMCA 1JZ5A 3OB8A 2WO7A 3P3PA 4L92A 2XVKA 1GZWA 3QH6A 4FPKA 1VBC1 4G9SB 1X50A 4BCUA 5A1FA 5FK8A 5C70A 2RM23 1NCRC 3POSA 1NCQA 2JG8C 3NW4A 2XL9A 4B1LA 3HEIA 4GH4C 1GNYA 4Y4RA 5EJ3A 5FMOS 2JWPA 2WUHA 1YXWA 2PLV3 1LU2A 1MVEA 3K75B 1YYNA 3AP7A 4FXGB 3I7DA 4OHVA 1GR3A 2IFRA 2A75A 1OQDA 3I2OA 3LCPA 2ORXA 1LNSA 1WLDA 3KF3A 3FHAA 4UI9L 1ZZ6A 4ASMB 5CFCB 2V5YA 1JOBA 4LTAA 3RGBA 3T3YA 5IWFA 3VL8A 2DFCA 4B1MA 4HSLA 1JW6A 5LW9A 3PU8A 1RUNA 3R4SA 4D6QA 5D8AA 2A70A 2EIBA 4B4QA 3PVNA 4INDA 2VMHA 3ZR6A 2Y6LA 4XFCA 2JJ6A 2WA3A 1ULGA 2XOMA 4IEXA 3SKVA 4BZ4A 5FP7A 4LO6B 5GZCA 1K3IA 1WMXA 2VCMA 4RQPC 1F4AA 5JOXA 3RZLA 2PN5A 3EHKA 2A3WA 3WF2A 2TUNA 4Y33A 2QQWA 3O1RA 1QMJA 2OQ6A 4CEWC 2EXHA 1UZWA 4ASLA 4IERA 1RXGA 3MUZ1 1PVXA 1SFYA 5FZGA 2OX0A 3I59B 4JQTA 2UY8A 3PUIA 5F5AA 5FLHA 2VMFA 5A6QA 4OFGA 1IPKA 5BNQA 1RVF2 1QOTA 3KVAA 4IGPA 4IV3C 4YVSA 2J1AA 3VV1A 3C7HA 3UL2A 4XFAA 3UETA 2Y38A 4Y24A 3FFZA 4YW5A 5LA9A 4BB3A 5BNPB 3AMQA 2V73A 1QNWA 1VRBA 2CDOA 5KHHA 3RI8A 3OYWB 4COZA 3ZSEA 4FPCA 3WVJA 2WBKA 4OMDA 5LATA 4BLIA 3ZXLA 4SBVA 4XFGA 2VM9A 3I2FA 4R9BA 3M3IA 3CF6E 4QX0A 4PF5A 5C7GA 1BMV2 1ST8A 1QXJA 2JKXA 1EP0A 1G86A 3LIHA 1UOFA 2PFWA 2WNEA 3A22A 2ZEXA 4B8EA 2HJIA 5C33A 2WAAA 3ETQA 3K4ZA 4M4PA 3U4SA 1OSGA 3VGIA 1RUE2 2BYVE 1IPJA 4BM8A 3FL7A 3VBOB 4XFIA 4E4SA 3E5QA 2WABA 4LHLA 2BQPA 3CO2A 2TEPA 3RZZA 3KV6A 2ZGMA 1VJ2A 2W1UA 1OMIA 2QZ3A 3D0SA 5FZIA 2G9ZA 2BWAA 1Q3EA 2D5FA 1DG6A 1NA1A 1F4HA 5DUXA 2JG9C 2WNUB 1SBFA 1C8M3 3OG2A 3FLRA 2JEMA 1W2UA 4OI4A 3INAA 1AX1A 4IEYA 3H42B 1UMIA 3N9OA 2FMDA 3IAQA 1O3SA 3MDPA 1RL3A 3OGJA 5FAXA 1WD4A 4AEDB 2DURA 2HWE1 4JCKA 2H0BA 1GANA 4OHZA 3CZJA 1MPXA 4LE3A 2BPA2 4CUCA 1LR5A 4P9IA 4QPGB 3WQ1A 5K0UC 1NYWA 3VD4A 1IG0A 1QQP2 3AZVA 1WKYA 2Y8KA 1N47A 3PTRB 5FUNA 4FQZA 4CDUB 4A3ZA 1H30A 1M4WA 3SEPA 3P5BA 4P9JA 2CGOA 3D8CA 5EYYA 2ZHKA 2DCJA 3LSDA 3POEA 2GZWA 4OI0A 5I0UA 3RQ0A 1H4HA 1LHUA 1VBA2 3KD4A 1UAIA 3WNNA 2VBBA 5JOWA 5FTTC 3N9MA 2ZZJA 3AM2A 4WV8A 4OVEA 4YW3A 3B3QE 1O91A 3AXEA 2ZOEB 4XZUG 1LHNA 3WDUA 5J7MA 1O4ZA 5FQ0B 5JXGA 1ZRIA 2IUWA 2XUMA 1BEV1 2BBAA 2ZEYA 3N7MA 4IQPA 4LXLA 5FYIA 1OVSA 3HT1A 5LA0A 4CDWB 2HWB2 4PLMA 4AQTA 4XAAA 5J98B 2JDZA 1IKPA 2CGNA 3ETPA 3CU7A 3HPNA 4PQQA 1GZWB 1OA2A 1S0EA 2Z2SB 3AKTA 1SCRA 4H2AA 4YARA 1V6OA 3OBTA 5FIXA 1DGWX 1LHVA 1YJKA 2VU9A 3DYOA 2Y6HA 1DLCA 5CB7A 1H2MA 2RVAA 2GH8A 1JZ8A 1QJU1 1UZZA 1XB9A 2HLEA 2WFF2 2PAEA 5FY4A 3V64A 4CCOA 4KU8A 3H8RA 4Z82A 4BIOA 1W9FA 4Z2AA 1PK6C 2VMDA 2Z42A 5FXZA 1AYM2 3BVCA 3OY8B 2AR6A 1UPSA 2ZA9A 3BCWA 3RNSA 5A70A 1KGYA 1XNTA 1ULEA 5FUIA 1EV13 1UD1A 1NLQA 1YO8A 2ZS6B 2MEV3 5DPNA 3ZXFA 1YJLA 3T09A 3LA2A 1LENA 5F37A 4C0HA 3MIDA 1QJX1 1R081 5F2WA 5J37A 4JVAA 1W6OA 3VBSA 4W4ZA 5D8AB 4RA0A 1GP5A 4PDWA 2SBAA 1XXNA 3AYEA 3M3EA 3MLLA 3AP4A 3DXTA 4Q1RA 1SQ4A 4D0QA 1ND2B 2A6XA 2RMU3 4GKYA 4P9YA 3OBRA 4FPYA 4DFSA 1NXMA 4YSFA 3GDBA 3ES1A 3ILFA 2C24A 4GAZA 3N4MA 1ASJ3 1U5ZA 3AKPA 3U11A 1RUG1 5BV6A 4IEZA 1FPN3 2VBDA 2WAOA 2XH6A 4YGDA 4DIQA 3J8F2 3OGRA 1US3A 2ENRA 2J22A 3ZXAC 2QQJA 1G8WA 4RSUA 1RMU3 1QJFA 4Q2FA 1S1AA 1XNCA 1FAYA 1LULA 2K2SA 4URAA 2VZ1A 4LO4B 4LNVA 4LHSA 4CE8A 3HD8B 4YVSB 3ZYPA 1REEA 1D4VB 2HEWF 1X7NA 5FPAA 4AZZA 4Q8LA 4IE6A 3U0ZA 3WF0A 1CQ9A 2PQQA 4WVMB 2IXHA 1PGW1 1UN1A 3ACIA 2WSVA 4Y5Z0 4E2GA 5J48A 1H1AA 1UOBA 1AR72 1UZVA 2YV8A 3ZN6A 1ND3A 2BNMA 4CPBD 3ELNA 4LORA 4C0BA 1WMEA 1FMD2 2WZPP 3HVDA 2VUCA 3JD72 4N7IA 4PQ9A 5H9PA 3WY6A 1XNDA 3N9PA 4COUA 4XUPA 1R1ZA 3CHXA 2ZGSA 1D4M2 3KLSA 4RS5B 1GP6A 4H14A 4WM7A 1O5UA 1UXXX 1SLIA 5A3MA 1E5HA 1OH4A 2GN3A 3BGAA 4AI9A 5E6HA 2ERFA 4CCJA 2E32A 4XABA 3MYXA 3ROUA 2ZGNA 4Q27A 1NAEA 2RS31 4Y1VA 2DCTA 4A7YA 4XQWA 2HWF1 4R8HA 3TNPB 4I0BA 3U07A 1UYYA 4E2SA 3NNLA 5JI7A 3MFCA 1XNKA 1GZTA 1H8VA 3CBNA 1CAWA 1KFUL 5DZFA 1W8UA 4CCKA 1Z7S2 1MS1A 3UGFA 5L36A 3WP4A 4FFHA 2XJUA 5A3TA 2R30A 2VVDA 3M1HA 5T3NA 2CY6A 2BV4A 3R4UA 3T2PA 2E7AA 2J7MA 4A45A 3MICA 1V70A 3ZX7A 2VNRA 4AEJA 4YG6A 1TMF1 4MZUA 4CZSA 2FQPA 4CDQB 4AHXA 1UU4A 2PHRA 4Y20B 3WF1A 5A1LA 2EIDA 3KV4A 4KNCA 3W58A 5A3PA 1WCUA 3I2IA 4JHZA 4P5YA 3AYDA 5CAZA 5AC92 2W91A 1US2A 1YHFA 2D98A 3NKGA 1OFNA 4QPIA 2NMNA 1S0BA 4M0NA 2ARBA 1AL21 1X9PA 5FYMA 3U1XA 3ZO0B 1BBT1 4KWKA 3RJ2X 1RVF1 1AYN3 2BOJA 1O5LA 1D0GA 2DCKA 3IIIA 2RHPA 4WM8A 5FJKA 3B9IA 2ZGRA 5A33B 3RFRA 1VAKA 2D44A 2UYAA 3LOIA 3RS6A 2WFPA 3WNXA 2DYCA 3VBHC 2HWC3 1MVQA 1OA3A 2Q1FA 1TME3 1PO21 2TNFA 3IWZA 4BMBA 4ZU4A 1LOGA 2HH9A 5FYBA 4ZZ8A 1H1MA 5C3RA 3AMMA 3UESA 2Y6FA 4XFFA 4O9EA 5BYNA 3G6JB 3DYMA 3OUJA 2WO2A 3W5MA 1V9U1 2VW0A 4QT6A 3VD5A 1PZ8A 2QUOA 5C8CC 2WZR1 5LBFA 4IE7A 2XONA 2Q8DA 1S0GA 1WLCA 4Q4V3 4NRMA 4Q4Y1 3ZMOA 3ZXJA 3C2UA 4OZXA 3SC7X 2WZEA 5T55A 2HWD3 5GKAC 4CP9B 1IS6A 4G4FA 4Q29A 1W6OB 4XPVA 1PIV1 2FBEA 3H8UA 4I0WB 4YW7A 1GNHA 2RS51 4FAHA 2X5IB 2BU9A 4B4PA 3ZSLA 3M3CA 3U4XA 1S2BA 3WEZA 2GP3A 2QFEA 3K51A 1QOOA 5LB6A 4BQ5A 1LHOA 1ZYBA 2WQ8A 5DAVA 2VMCA 3E6DA 2WS93 4BU2A 1S0IA 1W8WA 1YEWA 4B7KA 2OXBA 1H6XA 1UIKA 3H3ZA 1W6MB 1IHMA 4AGRA 2JDPA 3FX3A 4QDRA 3GNEA 3RDIA 3WQBA 4AI2A 1CAUA 5ACA3 3VZJA 4AOCA 1NZCA 2YGMA 5G04L 4DINB 3BU0A 3KVBA 2CDPA 4COVA 3TN91 4CDXB 2VPVA 5CKMA 5ABJC 4Q4X1 4YG0A 2WT1A 2PMWB 4NHMA 3S7EA 5EXOA 2Z5WA 5FR3A 1H9WA 1OQ1A 3BOPA 1D7PM 1IQDC 5F3IA 2P3IA 1W9WA 2BGPA 1UF2C 5T54A 3VBUA 5CG9A 1G6NA 2RJ2A 3D4KA 1VBC2 5JXIA 4QX3A 5FK7A 1UQXA 3OGSA 2W5FA 5L7OB 1KD7A 4C1WA 2XBO3 4KBZA 3TBDA 1B35B 2LS6A 2R061 3NV4A 3Q8EA 5IHRA 4CA9A 1LOAA 1QXRA 4LUMA 3UJQA 3ZLIA 4E8CA 1ACCA 1GOHA 1NQDA 1QGLA 1VRH1 3VKNA 2DDUA 4CCDA 3VZMA 1QHDA 2LRPA 2ZHLA 4Q5OA 4FFFA 3NAPB 3LPGA 1PGL1 5JSOA 3ON7A 2FDKA 5J1XA 2DVAA 1HLCA 4NJ4A 4BDVB 1QEXA 1YQ2A 1PMJX 3IIAA 1LOBA 4HXCA 2PA7A 4J6GA 4KI5M 5GZFA 4Z07A 3ZYIB 4CU8A 4Y1ZA 4AI8A 2C26A 4HVRA 1O59A 3T4HB 2XVGA 4MH0E 1VBB3 2D6NA 3K4AA 5LRSA 4MGYE 3ZFFB 3KCXA 2GMEA 2VTFA 2CU5A 3FN9A 1SFPA 3DKQA 5HXVA 2Q8EA 1LOEA 2JB4A 3OUIA 2WO1A 4OUMA 3SMHA 3IT8A 4QGLA 2UWBA 4RHV1 1VBE3 5IUQA 2XPJA 4OI1A 5BXXA 3ILNA 3PU3A 4NRQA 4V2WA 4B4RA 3J26N 5FP8A 1HXS1 4ZZ5A 4OMCA 4DZGA 4EQVA 3SXWA 5I8SA 5LK7B 4RR3A 3PURA 5FXWA 1DGRN 2WO3A 5FO8B 1TVGA 2DFBA 3AZZA 5IK5A 5LZ6A 4QPWA 2PYTA 1J1TA 3POBA 2JIGA 3AL6A 4QKFA 5FLIA 2Y34A 5JCTA 4J25A 5IFTA 4M3CA 1HQNA 4BWOA 1OOPC 1GWKA 4EN0A 2ET1A 4OQ9A 4ES9A 1UY4A 2VUDA 2PHTA 3B69A 4UYBA 1XSQA 4N43B 4AFCA 2QQVA 2ES3A 3APBA 3FHIB 3SH5A 3LFIA 4QHZA 2G9GA 1AR61 5FO7B 3D5OA 1VB2A 2HEYF 3VDDC 1PVC2 4MADA 4P14A 4PI2A 1EPZA 4MG2A 3WNPA 3TEYA 3MIFA 5FPUA 1VBD3 2VZPA 4MX3A 5HCFA 1JYVA 1OUSA 3DYPA 3W21A 2RMU2 4AQSA 3NNGA 5JPMB 5K9YA 2NYYA 4IUGA 4OQ8A 3WHUA 3WCRA 2DUOA 3NWKA 4KGQA 1CZSA 4RFT0 1QU0A 2R0HA 1L7LA 5DUWA 4N8MA 1ZZ8A 5F32A 2EIGA 2Y6KA 3THDA 4M00A 3I2KA 5L9BA 3K3NA 2AREA 4FOWA 4XIKA 3DN7A 3WP6A 2VOKA 1UMHA 2WYFA 1NXD1 5C5TA 2LTNA 3ZFGA 3VBRB 3KS7A 4UOJA 1JBCA 2ZEZA 2ARXA 4XDQA 1YNAA 3WW1A 1OLQA 5H9QA 4YVWA 4R4ZA 1RUJ3 3X29B 1CGPA 4KH9A 5EIYB 2W1QA 2GNTA 2HWE2 2XWJB 1ZBA1 1Q8VA 2VVFA 4LOTA 4ZXEA 1A8MA 1UYPA 4AI3A 2QNKA 3MZHA 1QJY3 1W06A 1RUH1 4A3XA 5JI9A 3KHBA 1W99A 1JHNA 1R093 4CU9A 1RIRA 4XILA 2RR13 1JOPA 5DAWA 1G9CA 1OLRA 4GKXA 3R4DB 3PLQA 3TWIA 3R6SA 1AR82 4KGGA 3V0AA 1GOGA 1RUC1 1ALYA 1RUI3 2IZWA 3CJXA 3D3AA 3CJIB 2GMPA 4A7ZA 3DXUA 1SDWA 3A0KA 4IEPA 3ZFEB 2XHNA 1PX4A 2R0FA 3Q8CA 3ZKYA 2ILMA 2VL4A 4LBMA 2RM21 1BCXA 1CAUB 2WYSA 3UKTA 1DQ1A 1BEV2 2PLV1 4IE4A 1QDOA 4XW3A 2HYKA 1JTZX 4IGOA 2Z4FA 2D43A 1HRI3 2W46A 1HX6A 1RUD3 1HJGA 4MO3M 2PHUA 1U5YA 3CL1A 3WDTA 2VR4A 4FPHA 4NHYA 2DVBA 2JXAA 5DG1A 1DQ5A 5CNAA 4DEQA 4XJWA 1LECA 5C3SA 5JWPA 2WQ4A 5GLTA 3H7JA 3WXPA 1OKOA 2X53S 2XJQA 2ZABA 2C9AA 4EWEA 1PMIA 1QJU2 1UY1A 3E97A 4MVTA 2VH9A 4AW7A 4LKSA 4L99A 3GXUA 4MOAA 4PLNA 1WZXA 5A3WA 1QH7A 1EYBA 3RZHA 1WBFA 2YGLA 5C9AA 1RINA 1XPWA 4LLOA 1FATA 2Y33A 1D2QA 1XC6A 2W0XA 3JQXA 4IE5A 1OLME 1I9RA 3TEXA 1ENXA 4JGZA 1CD3G 4KWLA 1ZBE3 3ZOIA 1JZ7A 1R082 4QHOA 2RDQA 4TLFA 3ATGA 2W2IA 3VHPA 3CQOA 4NIGA 1DF0A 4QQ2A 1QY4A 2VW1A 4TWTA 1AR93 3GBFA 1AUYA 3TNQA 1URXA 1HRV3 3SNMA 3T4VA 4JGYA 1W2AX 1HN0A 3JUUA 2DU1A 5AVPA 4XJAA 3ZXGA 3S0MA 1AZDA 2JDMA 4YGBA 4P9GA 4ARXA 1J3PA 2HBTA 3VZKA 4N53A 1VMHA 3I3QA 4XURA 2XWBB 3W59A 5B2GB 2QQPA 1RUG2 2HWC2 3HQUA 4ISRA 4CP1A 3H8XA 3U78A 4CEYC 1YI9A 5BNPC 3S30A 1W2TA 5DAPA 2AEYA 2NN8A 1CAXA 1FT9A 1MQTC 1NCRA 1BKZA 4E27A 1KDKA 1MEC3 2JG8A 4AAXA 4JGZC 4DQAA 1MS5A 3LOBA 4BHPA 3OBZA 1PHMA 4XXPA 1MS4A 1SHWB 1VB4A 1WD3A 4GH4A 5J09A 4JTOA 4M3CB 1Y7BA 5KC6A 3ACLA 1OFSA 3UV9A 1AVBA 1QJZA 4DXZA 5IVFA 3VZNA 1PGW2 2CAUA 4KQ7A 1DZTA 1OF4A 1FOD3 3DCQA 4I3PA 4LKFA 4QKDA 3CEWA 4LO7A 3RMYA 5EPAA 4BQWA 5KXEA 2IVJA 2YFZA 3NNFA 5DDJ3 4BJ0A 5FUPA 2BRTA 1PGSA 2P34A 4COWA 3VBOC 4N53C 3MV01 2QQOA 2VQ0A 1I6XA 1RXFA 2WQZC 3HJRA 4P08A 4AXOA 5F5CA 1C8M1 1W04A 1KEXA 1RJ7A 4ZHNA 4HL0A 3VBFB 3O1PA 4M01A 1SLBA 3AKSA 4OHXA 3TOJA 1Q56A 1UIJA 2JDYA 1R1A3 1E5IA 4RQPA 5FZ3A 2WNUC 5FZ8A 5GM0A 3PUHA 3VLBB 1ZVFA 1PM4A 4AVBA 3PUQA 1I5ZA 2RS32 3OF1A 4XF0A 5GALA 3WNOA 2HWF2 4A4AA 2V09A 3S5AA 1OXCA 1E5RA 3N36A 4SLIA 1CPNA 4AEDC 2P3JA 4CEWA 1XYPA 4IETA 3R0RA 3VKMA 4P5HA 2CAVA 3EBRA 3PVBB 4IE0A 3EO6A 3ZDVA 4B7EA 3TYJA 2Y64A 3GYDA 4DXRA 4IV3A 1YUDA 4U36A 1HB4A 1WGPA 2XJTA 3FFQA 1AX2A 1SPPA 1IG3A 1ZRFA 1ZZ7A 1ENRA 2WWJA 3H1WA 3POYA 2XJVA 2W08A 1NOVA 4IV1B 5F6LB 5L9RA 1TMF2 1ZRDA 1J3QA 4GALA 4O61A 4XF1A 5ISLA 4HZFA 3RZGA 2P6CA 2R073 4AEMA 3V0AB 1VPHA 1UY3A 1VMJA 1J59A 3VKLA 4ATEA 4NOTA 4NE9A 3TAYA 1NUKA 1YC61 2FDHA 3LIGA 1NE4A 3LDRA 5FLJA 3VKOA 1PNGA 4IXLA 5FZMA 1AL22 2ZGQA 1BBT2 2IC1A 1QF3A 1WCKA 4UFKA 4KL1A 3UYJA 3OOXA 4UAPA 4AGVA 3MIGA 3WZ1A 3OBAA 4OHYA 5FXVA 3BPSA 4Q4W3 3BTAA 3M3QA 3AKQA 3AB0A 5FZHA 3J7LA 2ZHMA 1W0NA 3WF4A 1CN1A 1UZ0A 4CUBA 5HV4A 1WCDJ 5DG2A 3OCPA 3NL1A 1EV11 1F8VA 1SBEA 2JG9A 1PO22 2MEV1 1CR7A 2IXIA 3KF5A 4XBQA 4A6OA 2YBSA 1PVC1 4AHYA 2PXJA 5FY1A 3HNYM 2C4XA 4QX1A 3DPRC 1V9U2 4P9XA 4QX5A 3U75A 2AEZA 5T5LA 2WZR2 1VIWB 4NUBA 1JYCA 1AX0A 3O5SA 1W9SA 3RJRA 3OPTA 5JVVA 5FYZA 2RMU1 5K0UA 1H2LA 4Q4Y2 5F9TA 1UYXA 1A78A 1NLSA 4AK3A 4HKLA 2EXJA 1ASJ1 3ZM8A 5LEKA 3O0XA 3PUAA 4XBNA 1FPN1 1X33A 2QQLA 4LEJA 3B7MA 3VDCA 1NKGA 3WDYA 2W9XA 5CFDB 4XACA 1APNA 3LWCA 5JOZA 3GJBA 1RMU1 1SCSA 3J4UH 4NO4A 2YPDA 1PIV2 5E89A 2RS52 4LLFA 1Q8SA 4UBGA 4YGEA 4ZPIA 5IATA 5FRAA 4K8RB 1OLMA 2JD4A 2OUJA 3LGRA 3PDQA 4GIQA 2G4IA 4LKDA 4AFBA 4AHZA 1RUOA 3IBMA 2IFWA 3WG3A 5I0DA 2OZJA 4CUGA 5JZGC 4QXKA 2J1EA 2W1SA 1J84A 4J1WA 4B29A 1UWWA 1RHI3 2BFUS 2E26A 2QQIA 2XL7A 1DGLA 1UO9A 5BNOB 2FCVA 1VMFA 5FZFA 1UY2A 1COV3 2BWCA 4QAWA 3VD7A 1LOFC 4NN0A 4D7TA 3O0VA 4WBBA 2YDEA 4NPRA 4P00B 2OZ6A 5E8AA 2WA4A 1UX6A 2Q1MA 1AR81 5FMDA 4HKWA 2JG8B 3TN92 4BH9A 2EXIA 3DEMA 3WLUA 4Q4X2 3T08A 1TZOA 5DQ0A 4XEZA 3MF6A 1DQ4A 1C3HA 2XUEA 3M8LA 3THTA 1PK6A 3HN3A 1ULPA 4IEOA 3N35A 4FI9A 2X09A 1PO13 4R9CA 5E88A 1OPOA 4EZ4A 4DUWA 3GHNA 5DUUA 3ES4A 2WNVB 2A5ZA 4FVVA 4UBHA 4YZ4A 4ZS3A 1ZRCA 3IZOA 1FYUA 3MIEA 3FBMA 1SLAA 1BXHA 1CZTA 3NQHA 1DCSA 2VG9A 1K5MB 2R062 3BYWA 2VOTA 1O6UA 4S2HA 3TRSB 3QACA 4JAAA 3WSOA 1QNYA 4GB33 5IVYA 3T2TA 1VRH2 3MW4A 4D94A 1W2NA 4C1XA 4BQ3A 3AJYA 4D8MA 3OEBA 3U10A 2VMGA 4K1ZA 1PGL2 3MHZA 3BTXA 2EA7A 1W8FA 1NCQB 2VZTA 3O1VA 3BU7A 4YPJA 3BB6A 3IMNA 2DBIA 1CJPA 2ZX4A 1KJRA 3LA3A 2VC9A 4NHKA 4UW4A 2H6BA 4QXCA 4NWWA 1YIPA 1S0FA 2HKXA 1HN1A
chains in the Genus database with same CATH topology
4JRAA 4JC1A 1U5XA 1C57A 2YZ4A 4K9SA 3SISA 2P37A 3D82A 2NQYA 4FCAA 1MS3A 1GFF2 1G7YA 3GZTB 4NWVA 1O4YA 2XB6C 2MPFA 2DVFA 2RS13 4IV3B 4CDQC 4XJ8A 1YRZA 4RHV2 2ZGUA 1FI2A 3EXUA 1GKBA 5TSWA 1YFWA 1PNFA 1HXS2 4EN7B 1AYN1 1DYKA 5FO9B 4P9WA 3DKWA 4GULA 3OGGA 4QGNA 2H0VA 4KBBA 1EAH3 1C1LA 1DQ0A 2HWC1 4FT8A 1UKRA 1TME1 1GQHA 2P3KA 2OA2A 2WSUA 4R9DA 4Z1VA 1S0CA 5SV8A 4WVWA 4Z2WA 5AFEA 1DHKB 1WW6A 4S2GA 1GICA 1AR62 4YM0A 2BBVA 2QJVA 4K1YA 5LK5A 1UU5A 4BPZA 3HR9A 4Q4V1 4DOUA 1C28A 1AR92 2R042 2VQAA 3KCCA 3NO8A 2R16A 1POV3 4A2UA 1N1TA 5CBLA 4HN0A 2JG9B 2H6CA 2YYOA 3RMXA 4YNIA 4H3WA 1MZFA 1S0DA 1C1FA 2UU8A 4XF9A 2ZJCA 3PVEA 1HQLA 2KXLA 2NM1A 3ZN5A 2VOXA 3WQ0A 2SLIA 3NV3A 2TBVA 4WVZA 4L11A 4YW1A 5AFBA 4PJYA 1UU6A 2X5IC 2WS91 4YLZA 5EYXA 2ZAHA 2WLQA 2ZMNA 4FPJA 3V65A 1ZBA2 4ONUA 1WBLA 1MZ6A 1XYOA 2K0GA 5ACA1 1NA1B 3MI8A 4HBNA 1RUH2 4W6XA 3AJZA 4LBQA 3M2MA 1O7FA 5HBAA 3A0NA 3QH7A 1RUC2 3AZYA 3N7JA 4CDXC 2GNBA 1H8TC 3VBHA 3POWA 2ZACA 1W6NA 2IXKA 2O8QA 4LE4A 2RM22 4PBOA 2R1DA 2B5HA 2GAUA 1QH6A 2PLV2 3LZZA 5C8CA 5L7OC 4R4XA 3UKVA 3RG0A 4Q0PA 1JOJA 4I30A 5GZEA 1PK6B 4Y26A 4ZKTB 4CYDA 2GC2A 4ORFA 4XHBA 4FP2A 2GU9A 4RGGA 3PJQA 5GZDA 4QQOA 3FWEA 4XJUA 1IOAA 2JE7A 3MEPA 1AXKA 2Q30A 1RITA 1G9DA 3BODA 4MGIE 1VBB1 4XOGA 4Y1YA 5CA6A 2XLAA 5E1RA 5GZGA 3JCIA 4AE2A 4QD2A 2VUJA 3QBQA 3DL3A 1CPMA 1VR3A 1ULFA 1BZWA 1VBE1 3OD0A 4C90A 1HV1A 2ZGKA 3ZFFC 3HMYA 3SH3A 1CX4A 4HK8A 4CP2A 4C91A 4H55A 5BNNC 1YI7A 4Q1PA 2GH2A 1RUF3 1J1LA 2GN7A 3GF6A 5FCCA 4Z8BA 3ZSKA 4DY5A 5ABJA 2O1QA 3AP9A 4CRQA 2W52A 3VBSB 3HBZA 2JECA 3LSEA 4PDWB 1MACA 2XG3A 2IXLA 2BEOA 2CV6A 4XMIA 5L73A 2JE9A 4N43C 3HAGA 3NSTA 3FLTA 4K21A 5CU1A 1VBD1 1W6QA 4BA6A 4Q0QA 5BY5A 1FNYA 2VOWA 1UZYA 2EVXA 3AYAA 4PIYA 3JBG3 2D3SA 4LBLA 1OPMA 4Q0SA 4XQ4A 4UW6A 4PIZA 4GWNA 2VMIA 5T5JA 3V0BA 3PVOA 3KM5A 4I02A 1VAVA 1KJLA 5T50A 4BIFA 4PCRA 2E51A 5I8YA 3ZN6B 1C8M2 1KQRA 4GQ7A 1ND3B 1HW5A 2WLPA 3RRDA 3VHNA 2E9QA 4AFDA 1Q8OA 2P17A 4FTEA 3VBRC 2PHWA 5KXDA 1QJY1 1VP6A 3WX5A 3NJZA 5CVRA 1R091 4WM7B 5JDBA 2DU0A 2RR11 5JSRA 4BMEA 1F9KA 1RUI1 2EALA 3HIFA 5LRRA 3WV6A 3L2YA 5SV5A 4E4ZA 3ASIA 1OOPA 3H1MA 1SBDA 1Y43B 1PO12 4N90A 4TZDA 4LR4A 2YY1A 3L9JT 3WUCA 3HWJA 3ZFEC 3FMGA 4AVCA 1CAWB 3MW3A 5KHJA 1AL0G 4LBQB 4AVAA 2ATFA 1ULDA 3VDDA 4Z92B 1H1IA 4EROA 1HRI1 1RUD1 2NLRA 3IPVA 1ZREA 2XKPA 4IEVA 4FOYA 4FXKB 1RVF3 3VBHB 4YFWA 4NHLA 3B01A 1A3KA 5GJ6A 1MS0A 2LALA 2E7TA 2GC0A 2DWRA 1C4RA 1UW8A 2OIIA 4YFZA 1IS5A 1TNRA 3USSA 4FP3A 4LBOA 1H9PA 2XLFA 1KFXL 5KXBA 4QPIB 5BUVA 1NE6A 2G9FA 1BJQA 1EV12 1Q8PA 2MEV2 4AQ2A 1XQNA 1ZBE1 4XHXA 4WM8B 4YM3A 1GSLA 3BALA 4LUKA 4AI1A 1GQGA 1U5IA 1RUE3 3SH4A 1F5JA 1AR91 2R041 1DZQA 2E7QA 1ZZBA 4WVVA 4LHNA 1HRV1 4MXWA 4XIOA 1UL9A 3NV2A 3ALQA 3OTFA 5J96B 1SLLA 1IGOA 1H0BA 2A6VA 1WLWA 5JAXA 4L2NA 1LOCA 1ASJ2 1C8NA 4YGCA 1Q5OA 3VHRA 1S2KA 4RL7A 2DF7A 1FPN2 2FZ2A 1GNZA 1F31A 1ZM1A 4JDNA 3ENRA 1GLHA 1RMU2 3Q9OA 1CAVA 4AVSA 4YG3A 1SFNA 1Z0HA 5A3MA 1X36A 2GSYA 1N3OA 1MEC1 4XTPA 2A6YA 3ZSMA 5A3LA 2BNOA 1LTEA 1LGCA 1QQP3 2I45A 2YXSA 2ZMLA 3OJBA 1DYPA 3KQRA 4ZXKA 1FOD1 5D1IA 1SLCA 1ENQA 2W68A 2XJSA 1W39A 2OYZA 4WZFA 1WMFA 5JMCA 3UJOA 5DDJ1 5C4WC 4LT5A 1VBA3 2UWCA 3ECQA 2QCSB 4META 1DLLA 3N3HA 3ZYJB 1AHSA 1S0JA 4ISQA 4XTMA 4HPKA 4FO9A 4HANA 5JOYA 1X8MA 3JU9A 4E2QA 2HWB3 1R1A1 3ZIWA 4QHBA 2PHLA 3WW2A 3THPA 3IN9A 5F1RA 1LEMA 3VBFC 1DDLA 1REFA 2YROA 3B02A 4Y1XA 1RC6A 3VBUB 1W6PA 4XJZA 3AZWA 2WFF3 3ZXKA 3QLQA 3PHMA 3PTYA 1BK1A 3QOPA 3HQXA 1AYM3 2BW8A 2KA3A 2WT2A 3B00A 4QM8A 5CFCC 3LAGA 2IWGB 4EN6B 2B7YA 3AMPA 5C6CA 3OPZA 5DZGA 1TEIA 4Y1UA 2B46X 1T6GC 2MHFA 4CEYA 1I3HA 2UYBA 4UW5A 3IM0A 5BNPA 3WG4A 5C8WA 2R071 4NR1A 1MQTA 2GC3A 2JENA 4IV1C 1YWKA 4BOWA 3EQEA 1OI6A 2KM2A 2VVEA 1YIFA 5A32A 4D7YA 1F5FA 4XF4A 3VL9A 4HVOA 4LA2A 3AK0A 1AYN2 4UXAA 4AI0A 4Q4W1 3MW2A 4HKOA 2EAKA 3J8F3 3WG2A 3VDDB 4G3YC 3VBOA 2ZCWA 4HVQA 4GA9A 2LUWA 4I01A 1TME2 1VALA 1HV0A 4DS0A 4TYSA 4RR3B 2C5DA 4Y4YA 1YFUA 4EN8B 5HI0A 2YHJA 1IQAA 1LEDA 1BYHA 1FV3A 2WNUA 1AR73 1I1EA 3WR0A 2Q0AA 1CJDA 1FMD3 5L19A 3SITA 4Q4V2 4AEDA 3JD73 1H4GA 2GNDA 2N7GA 1W0PA 2DCZA 3D0JA 2QZ2A 1D4M3 1KXGA 3AMHA 2AZ5A 4KG8A 4QPGA 2HWD2 3PNAA 4EJRA 1SACA 4GMP0 3KB5A 3VZOA 3MF9A 2ZX1A 3IKWA 4F8AA 3AYCA 3B94A 5CFDC 2A3YA 1WW5A 1LRHA 1AF9A 1RHI1 2ZTNA 2WS92 1A8DA 1COV1 2PAKA 1G9FA 1Z7S3 4CDWA 1IS3A 4MLOA 3BOWA 5ACA2 4XFBA 5F5QA 4I3GA 3N7LA 3ZFGB 1V6NA 4QPGC 4OHWA 5KHIA 2PTMA 3IDCB 4N9IA 3H7YA 4RGAA 1NY71 4YVWB 4CDUC 3JQWA 5BPXA 2RJKA 4I0AA 4D3WA 1D2SA 1PO11 3USUA 4YZ3A 3LB9A 2PELA 3ZSJA 2JKBA 5IK4A 4FPEA 4AWDA 2XBO2 5AC93 3OY8A 4HK9A 4EWAA 1QWRA 4M0HA 5JR7B 4J1XA 2C0ZA 2WNVC 3AP5A 3DPRA 2DUQA 2P2KA 4GB31 3MGUA 3IDEA 3VHOA 2A6WA 1N3PA 1ULCA 2A7AA 4HPKB 4CDWC 4FAGA 4I2OA 1C5HA 1K5MC 2VNGA 3ZYGA 1LB2A 4LO5B 4K20A 5JPNB 4JQRA 2JX9A 3I54A 2XKOA 4O9GA 1WLTA 4FBFA 1OKQA 1ND2A 3E5UA 4X6RB 3J9SA 1NCQC 1Q43A 2OW4A 4YM2A 5T5OA 4ZU7A 3FUQA 4MV2A 1VBB2 1H2KA 1W6PB 3M7AA 5KHGA 1PZ7A 2ZGPA 4L9BA 1HIXA 2RS11 1LESA 1PM7A 3AFKA 2ET7A 3DUIA 1MR5A 1VBE2 4OUSA 5JZGA 5FOBB 2ZGTA 2VNOA 3IDBB 4Y22A 1VLNA 1O4TA 3WT3A 2XJPA 4CEYB 1LOFA 3FZ3A 5C9AB 4WVMA 3FJSA 5D8AC 1RB8G 1G9AA 3LKJA 1IKQA 1OHFA 1BQPA 1MQTB 1EAH1 1V6MA 5HCBA 1ND2C 1POV0 4F3JA 4JGZB 1ZZ9A 4GXLA 3FE5A 4MYEA 5A32B 4V1PA 1XU1A 3MIBA 4RS5A 5FPZA 1V6KA 2IXCA 4R52A 4JGYB 1S55A 3O7OA 1L3JA 5J3UA 3FLPA 5KC5A 3JB4C 1VBD2 2ZGLA 4KWJA 4N53B 1POV1 4X6QB 4YVSC 1MS9A 4GMP3 3MPBA 4X8NA 2YUEA 1H2NA 3SCHA 2CTVA 3PJYA 4FOQA 4XJ9A 1CAXB 2GC1A 4DPNA 3DGTA 4E4DX 1NCRB 5AVAA 3WDWA 2D3PA 3P3NA 4GH4B 1VBC3 4JDMA 3DV8A 3WHTA 4RS5C 1ZZCA 3WDVA 3KZ4C 3MLKA 2D6PA 1QKQA 1N1VA 2ZKNA 4X8PA 4XETA 1RUJ2 4K3UA 4CDQA 1V00A 2Z69A 5EV7A 4Y20A 2Y26A 1QJY2 1IS4A 4XZPA 1R092 1TNFA 2MNGA 4KU7A 2RR12 4AG4A 3I4IA 2D7FA 2E53A 1NA1C 4RQPB 1RUI2 2AUYA 4IL7A 4YZ2A 4YYOA 3H50A 1J58A 5K7PA 4LBJA 3WP5A 4ATFA 1MS8A 3BPZA 3M3OA 4CEWB 2D5HA 5A33A 1DIWA 3SLIA 1UKGA 4LBQD 1V6JA 1FXZA 3MPPG 1KRIA 3SCFA 2C1FA 1O3TA 4XFHA 2WIIB 2BUKA 4EWDA 1HRI2 2Y0IA 3W9AA 2PHXA 1RUD2 2ZZQA 3FUOA 1NLRA 4MUVA 3USUB 2X8KA 5I91A 4DY3A 4U2AA 4TSVA 4FPOB 4XYXA 1HDKA 1GZCA 1MZ5A 3PMEA 2XHKA 3GBWA 4XMAA 4HLTA 5K8SA 4AFAA 4D7SA 4JRLA 1TE1B 3DPRB 4FTBA 1DZRA 3ZMNA 3WINE 3AZXA 1WCSA 4YZ5A 4AF9A 4XF3A 1PVC3 3CNAA 2ZPXA 3M4FA 1YLLA 3OD4A 2Q1ZB 3AMNA 2X5IA 1DQ6A 4JDOA 1D0HA 1ZBE2 2WL1A 4RD7A 1IZ3A 1AXYA 1RUF1 4XE9A 3E5XA 1XNBA 5JIAA 4AVVA 1HRV2 4QMAA 3S6PA 1OD5A 1W6MA 3NV1A 4S2FA 1GYKA 2A73B 4QU2A 2HWD1 1W0OA 2AGSA 5JZGB 1NQJA 2ZGOA 4KG0A 4CDXA 3JB8A 4Y22B 1H8TA 4MGKE 1UCXA 5EFUA 4B3NA 3O0WA 3MIHA 4N9HA 3VBSC 5K0UB 4YZ1A 2HWE3 1AJOA 2DTYA 1MEC2 4PDWC 4QGMA 5FREA 2K9ZA 1U0AA 2WWSA 3H1YA 2WC2A 5L7OA 2E6VA 1B35A 2CNAA 4AFMA 1FOD2 1AR83 3WUDA 3FC0A 4DB5A 2PAMA 1JXNA 3JBG1 3WOGA 5DDJ2 4YW4A 3SCGA 3O14A 2EF6A 4FTSA 1LHWA 1DU3D 1REDA 2WINB 3NAPA 2UURA 3DF0A 1UMZA 4W65A 4FPFA 5I0SA 3B9CA 1YFYA 4ZU5A 4XQDA 1BEV3 3ZYRA 5H9RA 3GBGA 3RYRA 1GV9A 2XBO1 1CIWA 1R1A2 4UW3A 1YCIA 4JV4A 1ND3C 4Q8KA 1ZNPA 2F6BA 1G9BA 1U12A 2OPKA 2B39A 3ZFFA 2BGCA 1J3RA 1B35C 2QVSB 2A71A 5BNNA 4FSJA 5T52A 2ZAAA 2D97A 1RTVA 2B9UA 4XXAA 1QJU3 4M3CE 4WM7C 2D93A 3E6BA 2ZKLA 3SHRA 2QDNA 3LA7A 1HKDA 3NAPC 4LBNA 3KT1A 3FBYA 3KSCA 1Y9QA 4N7UA 4D69A 1Y3TA 5IT6A 1BVVA 4DNYA 5KXCA 1X82A 5I0RA 1QJX3 1R083 1QXPA 2B8MA 1WW4A 3L2HA 3URFA 2R072 1DQ2A 2XVLA 3AXDA 4N43A 4OI2A 4BQ1A 1NG0A 1WUVA 5E16A 2A3XA 3WW4A 2QE3A 1HQWA 3NVCA 1N1YA 5DZEA 4IEUA 1N3QA 4MXVA 4QQPA 2VUAA 4E9KA 3T1LA 1AJKA 2VULA 3PMSA 1KS4A 1RUG3 2VGDA 4Q4W2 2D6LX 1X8EA 2DTWA 3QCWA 3ZN4A 1BMV1 4MSVA 4LHKA 1UPIA 4QPIC 3GHMA 4OLLA 2CWMA 3ZXEA 1RUE1 4BE3A 4HFSA 3VBRA 2HEVF 2YPJA 1JUIA 1XRUA 4WM8C 2Q5TA 1RJ8A 4NVPA 4MGZE 2VXRA 3AFGA 4F83A 2R32A 2ZX2A 1BVP1 3ST7A 5H9SA 5FFOC 4HN1A 1OQEA 4A7KA 3ZXDA 2WJSA 3WCSA 2R6QA 3H0OA 5KHKA 4PBPA 5I93A 2DVDA 1F2NA 3CJIA 1FV2A 2Q4SA 4AGGA 5IK7A 2QDRA 3ZFEA 2RS33 1XU2A 2HWF3 4K8FA 1RUJ1 3VZLA 1QQP1 2DVGA 3ZPYA 1RHI2 5EZWA 4PIXA 3KGZA 1COV2 1LJ7A 2UWAA 1ZRRA 2E63A 1VBA1 1H8TB 1QDCA 1FX5A 2EXKA 2XGXA 2OVUA 4CP0A 5I0TA 4BLJA 1NY72 3WW3A 1TMF3 3ZIXA 5FOJB 4HETA 5JLVA 1CESA 2HWB1 3CJIC 4W6YA 1LU1A 1XE8A 1JUHA 3AP6A 5GLZA 3VUOA 5FBZA 4AQ6A 1N1SA 4WZCA 2VW2A 2FZ1A 3NKTA 5KBFA 1ZX5A 1DGWA 3KCYA 5CG8A 1AL23 4Q0VA 2AH2A 4QPYA 4GB32 4FPGA 1BBT3 4M3CF 2WFF1 2X29A 1CVNA 1W6NB 3MFAA 2D6MA 1AYM1 2AENA 3VBUC 2D3RA 4LBKA 4CTEA 1O3QA 3B5LB 1PO23 5C8CB 3HN1A 1A6CA 4DRRA 2WT0A 3RWNA 2XLGA 5BNNB 3QD6A 1WW7A 1WA4A 1V9U3 2D6KA 2EAAA 2WZR3 5IK8A 2RS12 5FPXA 2RJLA 2DUPA 4K7JA 4COYA 3WD5A 4Q4Y3 2D40A 5GLVA 4EN9B 4FQ4A 4FOVA 4Q26A 1KITA 3ME2A 2NP0A 2RE9A 2WKKA 3RSJA 3J8F1 1EY2A 5C4WA 4I09A 2PHFA 1PIV3 2XJRA 2CYFA 1EAH2 2RS53 1GBGA 2O8OA 4GWMA 4FPLA 4URTA 5J36A 3GZUC 3E6CC 2NMOA 1XE7A 1TQ5A 3EJKA 4QM9A 2OUHA 2D6OX 1LKNA 4K40A 4DMIA 2I74A 2CWSA 4P9LA 1AR71 1MZEA 3VKFC 4HT1T 5I8TA 4JTNA 4RR3C 1FMD1 2GNMA 3VBFA 1LODA 5ABJB 5JSPA 3JD71 3B93A 4IEQA 4QQLA 1D4M1 2GDFA 3S7IA 3TN93 2R1BA 3UKNA 3ZVXA 4Q4X3 2GMMA 2F4PA 2UY9A 3GALA 2Y0OA 4AYUA 1W6QB 4XBLA 5CFCA 2VY0A 5FMOL 1PZ9A 4LULA 2QKDA 3R05A 2A6ZA 2R063 1V6IA 1C5IA 3KGLA 3M70A 2BNNA 1ENSA 1Z78A 1XYNA 2DCYA 4IV1A 1VRH3 1O3RA 2ZHNA 3BIWE 1Z7S1 5CADA 3V0BB 1JYIA 2Q8OA 2W39A 3AKRA 1OA4A 3T1MA 4AEKA 5KWRA 4IEWA 4K6BA 2FHRA 4YRDA 4EV0A 1JH5A 4IESA 5EWSA 3RI9A 2I2SA 3A4UA 4H7MA 2B45X 3I59A 2GALA 1KS5A 3HT2A 4HSJA 4OULA 3ZFGC 1Q8QA 2FMYA 5DUVA 1DBNA 4PLOA 3RPQA 5DXDA 4YVWC 2BVBA 3K48A 5AC91 4Q0UA 4RHV3 3I2DA 3WG1A 2VOVA 3WP3A 3UK9A 1SMVA 2LM3A 1HXS3 1RGSA 3OYWA 1AXZA 5FDBA 5HCAA 4L8QA 3D6EA 2Z79A 1OOPB 2AYHA 3JZVA 3V56A 4AVTA 2IXJA 5F6KA 3AX4A 2ZX3A 3H3UA 1SLTA 2CL2A 2O0OA 1LGBA 3CLPA 2ZX0A 1ZA4A 2R49A 4S2DA 2ZBJA 3IPVB 1AR63 4L97A 3ZDSA 1FNZA 3O12A 1YFXA 3H9AA 1QJX2 2YC0A 4DRVA 5CFDA 3KT7A 4YM1A 1EPWA 4YW2A 2ZMKA 1DFQA 2NPIA 2R043 2DV9A 1V6LA 1M06G 2VECA 5GLWA 3N7KA 1CONA 3I8TA 1GZ9A 1LGNA 5GLUA 1RUF2 3WQ7A 4HMZA 5CIRA 1LCLA 2NZ9A 4H7LA 2YMZA 5BNOA 4ES8A 2BTVC 5C9AC 5T5PA 4AHWA 1JN2P 4CDUA 2BVVA 2ETEA 3KT4A 5LEJA 4BYYA 2PHDA 4MXWB 1KDMA 5JIUA 4ITCA 2B42B 2BFUL 4F7ZA 1WMDA 3GZAA 4QQHA 5C4WB 1ZBA3 3ILRA 3KMHA 3RYPA 3TB0A 2I07B 4LA3A 1VAMA 4LO8A 1DGRA