3NVCA

Crystal structure of salicylate 1,2-dioxygenase g106a mutant from pseudoaminobacter salicylatoxidans in complex with salicylate
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
353
structure length
349
Chain Sequence
MQPKDTPELRALYKSFEEESIIPLWTQLGDLMPIHPKSKAVPHVWKWSTLLRLARKSGELVPVGRGGERRALGLANPGLGGNAYISPTMWAAIQYLGPRETAPEHRHSQNAFRFVVEGEGVWTVVNGDPVRMSRGDLLLTPGWCFHGHMNDTDQPMAWIDGLDIPFSQQMDVGFFEFGSDYATPNFSRGERLWCHPGLRPLSGLQNTVASPIGAYRWEFTDRALTEQLLLEDEGQPATVAPGHAAIRYVNPTTGGDVMPTLRCEFHRLRAGTETATRNEVGSTVFQVFEGAGAVVMNGETTKLEKGDMFVVPSWVPWSLQAETQFDLFRFSDAPIMEALSFMRTKIEGQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The salicylate 1,2-dioxygenase as a model for a conventional gentisate 1,2-dioxygenase: crystal structures of the G106A mutant and its adducts with gentisate and salicylate.
pubmed doi rcsb
source organism Pseudaminobacter salicylatoxidans
molecule tags Oxidoreductase
molecule keywords Gentisate 1,2-Dioxygenase
total genus 94
structure length 349
sequence length 353
ec nomenclature ec 1.13.11.4: Gentisate 1,2-dioxygenase.
pdb deposition date 2010-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07883 Cupin_2 Cupin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3nvcA01
4XEZA 4I0BA 4I02A 4X6QB 4XFAA 3M70A 4PJYA 2K0GA 2QJVA 3D0JA 4KL1A 4AVAA 4HSLA 2BYVE 5CVRA 4XFGA 3FFQA 1J59A 3USSA 1RL3A 2H6CA 2IXJA 1Y9QA 2VPVA 4HN0A 2B8MA 3CEWA 3GYDA 5I93A 1ZZ8A 4HBNA 4IESA 5I8TA 4MGYE 3RYRA 1DGRA 4HMZA 4O9GA 4XF3A 4HZFA 4AVCA 2MNGA 1YFWA 4IERA 3BPZA 3RNSA 3UKVA 1SEFA 2IC1A 3SCHA 2MPFA 3S7EA 1ZNPA 2D93A 5E16A 4HSJA 4IEXA 5I8SA 2Z69A 1CAUB 2CAUA 4FAHA 4QXKA 4XF1A 2OA2A 4EWEA 4GULA 1ZZ7A 3WW2A 2QCSB 4N9HA 1O7FA 3E97A 4LUMA 1UW8A 3EQEA 2HJIA 2PYTA 4Q0PA 2P17A 1NE4A 1UCXA 3R6SA 1EP0A 1GQHA 2EVXA 4IEUA 4AVBA 3UKNA 3H3ZA 3NL1A 1YWKA 3LOIA 2XKPA 4XFFA 3H9AA 4PIYA 2OYZA 1LRHA 4L2NA 1NZCA 4MGIE 4UXAA 4QX5A 5KHHA 3C3VA 4Q0QA 4F8AA 2D5HA 5LRSA 2BNOA 2HKXA 3E6BA 3QACA 5FLJA 4KWLA 3GBFA 4MUVA 1WGPA 3RZZA 4J1XA 5J3UA 4IEPA 3RPQA 3ROUA 4H7LA 1NXMA 4KWKA 1H1MA 2XL7A 3E5XA 1O5LA 1ZX5A 3MZHA 1O3RA 5F1RA 1IPKA 5JSRA 3DN7A 3FX3A 2EAAA 5T3NA 4E2GA 4UBGA 3NVCA 1CAUA 1JUHA 3IDBB 2B9UA 4Q0SA 3FE5A 3ES4A 3RYKA 4PIZA 1YFYA 1RUNA 2KXLA 3TNPB 5I0UA 2GC3A 3ACLA 5K8SA 2Y0OA 2ET7A 5FCCA 3H1YA 3LA2A 4UBHA 2O8QA 4IEWA 2GH2A 3LAGA 1Q5OA 1DZRA 4XF4A 1J58A 3NW4A 3HT1A 1RUOA 3HT2A 5D1IA 1RGSA 3KMHA 2Z2SB 2H0VA 4HVOA 3TNQA 5EZWA 4LA3A 4EWDA 5KHKA 1DZTA 1EPZA 1UD1A 4BIFA 4EWAA 3B02A 2WC2A 5CADA 3HQXA 1V70A 3DKWA 4MGZE 5LEJA 4ZU7A 4JV4A 4QM9A 1CGPA 4YYOA 3WW3A 1VP6A 2PHDA 1OMIA 2GC0A 4I09A 1DGWA 3EHKA 1OI6A 4XFBA 2PAMA 1Q43A 3LWCA 3DL3A 3SCGA 2GC1A 4IEZA 5FPZA 1QXJA 2PHLA 1ZREA 3SHRA 4QGLA 2BEOA 3U11A 4Z82A 3D0SA 5JR7B 4QM8A 1X7NA 1YHFA 5KBFA 3ZDSA 3S0MA 3ELNA 1O4TA 4IEQA 2QNKA 4R52A 3BU7A 3CJXA 3IBMA 5J48A 2CGPA 3L2HA 1IPJA 2XLFA 3CO2A 4MH0E 1LR5A 2IXIA 4I0AA 1CAWA 2XGXA 5FPXA 3LZZA 5CU1A 1ZRDA 3FJSA 4XFIA 1CX4A 3H1MA 4P9GA 1YFXA 4Q0VA 3E5QA 3I59B 3LA7A 1NYWA 2H6BA 1I5ZA 1X82A 4ZU4A 4E2QA 3M3IA 3FWEA 2MHFA 2EA7A 2XL9A 3WW1A 2UYBA 4D7SA 3RDIA 2ZKLA 3NSTA 4O9EA 2GZWA 1WA4A 1X8MA 3E5UA 4E2SA 4FAGA 5FLIA 5JCTA 4META 3LA3A 5E1RA 2UY9A 5JSOA 5FQ0B 2Q4SA 2QVSB 4LTAA 2XLGA 3H50A 1SQ4A 1GQGA 1OFNA 3KGLA 4WVZA 1O3SA 1UIJA 3IDCB 1EYBA 1ZRFA 4FBFA 3IIAA 3EJKA 3KSCA 2OPKA 3IWZA 3NKTA 3OCPA 4MX3A 3FHIB 2GAUA 4OLLA 4X6RB 2ATFA 2GU9A 5C8WA 1XRUA 4EV0A 5I8YA 4F7ZA 4BYYA 2VQAA 5FLHA 3WW4A 1HW5A 4K8FA 4HLTA 2V09A 3EBRA 2K9ZA 1CAVB 3KCCA 2XHKA 2B5HA 3I7DA 3VHRA 4J1WA 1UIKA 3SXWA 1ZZ6A 1SFNA 2E9QA 1EY2A 4OFGA 1CAVA 3DV8A 4LUKA 3N4MA 5JAXA 4FT8A 4LA2A 1O3TA 1FI2A 1J3PA 2BNNA 2QDRA 2Q0AA 1CAXA 4ORFA 3SCFA 3PVBB 3H1WA 1ZZCA 3ST7A 5BV6A 2WFPA 4WBBA 3PNAA 3H7YA 2VECA 1WLTA 3D82A 1X8EA 1ZZBA 1L3JA 4AQ6A 2BNMA 4IETA 5BUVA 4Q0UA 2Q1ZB 1LB2A 1ZRCA 5I0SA 1CAXB 4Q29A 4TLFA 4QGMA 1ZRRA 3OF1A 3OGJA 4CYDA 2FMYA 2XLAA 3BB6A 3HIFA 4WZCA 1H1IA 5FDBA 4IEVA 2CAVA 4ONUA 4I3PA 5HI0A 3S7IA 2OZ6A 2N7GA 2PQQA 1PM7A 1YUDA 4PIXA 1FXZA 3NJZA 2Q30A 3RYPA 4EROA 3ETQA 3BCWA 1I6XA 4YNIA 5LRRA 3G7DA 2CV6A 1VR3A 4DINB 1Y3TA 3I54A 3I59A 2GC2A 2ETEA 1PMIA 1ZVFA 1O5UA 2D5FA 1YLLA 4MGKE 4IEOA 3PLQA 3QOPA 1U12A 4ZU5A 3CLPA 5C6CA 1Q3EA 5LEKA 3E6CC 1TQ5A 2ZCWA 3MDPA 3MYXA 4KWJA 2PTMA 5JSPA 5KHJA 4QMAA 4BHPA 4JTOA 4D7TA 1XE7A 4XFHA 4LULA 1J3RA 1UPIA 4MV2A 4QGNA 2ET1A 2PAKA 1CAWB 3H8UA 2IXCA 3KGZA 5KHIA 1LKNA 4YARA 3SMHA 1QY4A 2IXHA 4JTNA 2OZJA 5AVPA 2C0ZA 2BGCA 5I0RA 5I91A 2PFWA 4MZUA 1QXRA 4Z07A 3EO6A 2FQPA 5EFUA 4LLOA 5J7MA 1VJ2A 1J1LA 5BXXA 2IXKA 2F4PA 1YFUA 1QWRA 1FT9A 5KHGA 3U0ZA 2I45A 2O1QA 2D40A 2PA7A 1G6NA 2DCTA 3OTFA 4R8HA 4XF9A 4XFCA 1XE8A 4NVPA 1O3QA 3CF6E 4YRDA 4KU8A 3UKTA 3E6DA 2IXLA 4AXOA 4I01A 3ES1A 3JZVA 4HN1A 5BY5A 3MPBA 5BPXA 1RC6A 3BALA 3O14A 1OD5A 4A2UA 4I2OA 5I0TA 4YSFA 4KU7A 2XKOA 3CL1A 4L11A 3OD0A 4HVQA 1NE6A 1RTVA 2PAEA 4JVAA 4XF0A 3H3UA 4N9IA 3U10A 4RD7A 4LEJA 3H7JA 4AQ2A 4B29A 4HVRA 5FQ0A 1J3QA 2UY8A 4BH9A 2UYAA 4IEYA 4XETA 1ZZ9A 3FZ3A
chains in the Genus database with same CATH superfamily
3BOPA 4XEZA 2R043 4I0BA 2EXHA 2ZKNA 2P1BA 4X6QB 1ZA4A 4RQPA 1KS5A 4ZS2A 1RHI3 3BGAA 1VAMA 2QJVA 3LKJA 3D0JA 4MOAA 5IVCA 4QPGC 4YG0A 1OVSA 3AKSA 1WA6X 3USSA 1VBD2 3N9PA 2QQKA 1GR3A 1HRI2 5JPNB 5JMOA 1VMJA 2BUKA 1XE0A 5GZCA 5B4XA 1KGYA 2YBSA 5B2GB 4FPHA 2ZGNA 5FO8B 5CKQA 3LSEA 2DVAA 4RQPB 1QEXA 2KA3A 5EPAA 1O91A 3AMPA 1PMHX 2VQTA 1ZZ8A 4HBNA 4LO5B 4IESA 5KC6A 1NQDA 3D8CA 5E89A 4OUMA 4CTEA 1BEV1 1BXHA 3RYRA 1DGRA 4HMZA 3V65A 4OHVA 5CNAA 2G19A 5K0UA 3SH3A 1WCKA 3C7EA 2QQUA 5F7UA 2BOIA 1BKZA 2ARAA 2CNAA 3VBOB 4CEYB 2TEPA 1SEFA 2IC1A 4YLZA 1FAYA 2MPFA 3S7EA 3OEBA 4WM7B 5DZFA 5E16A 4CUCA 4CU8A 5KWRA 1W8ZA 4K20A 5CB7A 3ZFFB 2CYFA 5FYHA 1E5HA 4YVSA 2Z69A 1CAUB 3VZNA 4FAHA 3EXUA 3ZXDA 1QU0A 4P9JA 5C5UA 4Z8BA 4N7IA 2DUPA 2BWAA 5D8AA 4GULA 3VBUA 3VHPA 5FOBB 1QMJA 2J1SA 3WD5A 5FTTC 4QPIB 2HWE2 1O7FA 2XJVA 3BOWA 3OBTA 3K4ZA 1JU3A 2AENA 1B35C 1D2SA 5JIAA 1H4HA 1VBB3 2P17A 1UCXA 4NWWA 1WCDJ 4Y1VA 1EP0A 3R6SA 1ODMA 2UU8A 3NKGA 4Q4W2 3LOIA 4XIKA 4CP0A 2B45X 3AL6A 3JXSA 3OUIA 4XFFA 2YGMA 1KJLA 4PIYA 4NJ4A 2W39A 5HXVA 1FYUA 4S2DA 2Y6GA 5GZDA 4P9YA 1UF2C 4DB5A 5IVBA 5IVFA 4MGIE 4UXAA 1LULA 4LK7A 5KHHA 5LBBA 3RJRA 4F8AA 2W9XA 1B35B 5T5LA 2BNOA 1W3XA 1UL9A 4GJZA 2WNEA 3I2FA 5FLJA 1YJKA 4CE8A 4KWLA 1ACCA 3NNMA 4YM1A 1R083 1ND2B 5GZEA 3WP5A 5FZ6A 5J3UA 2JG8A 1AYM3 4KQ7A 3JBG3 3ROUA 1R1A2 5FZBA 5C4WC 1HQWA 1RYYA 1TME3 4DQAA 2ZMLA 1JOPA 1HIXA 4KWKA 4XDPA 3WHTA 4JGYA 1WUVA 1GNHA 1S0EA 1TMF2 2WABA 4M4RA 3O1SA 1LOFC 2LM3A 4QPWA 3UYJA 4NPMA 3WQ7A 1OC1A 3CIHA 5FREA 2R062 2W1SA 3QLQA 1VAKA 1DIWA 3M3QA 4Z1VA 5F5QA 4R4XA 1CAUA 2ADDA 3WNLA 4B7EA 1JUHA 2RM23 2BOJA 1RUH1 1AR81 3KV5A 1PO11 4M4PA 4O7XA 4XUPA 4A41A 4Q0SA 4BISA 2XPJA 4LJHA 2A6WA 1UYPA 3ES4A 1UZVA 1VBA3 4AQSA 4PIZA 5LK5A 3VZMA 4ARXA 5I0UA 1PO21 1AVBA 2Y0OA 4LHSA 3N3HA 2DDUA 5FCCA 4YW4A 3BTZA 1PVC2 3KQ4B 4UBHA 2CSGA 2O8QA 3N9NA 4OUEA 5HCBA 3P5BA 3ZFEA 4E27A 4Q4X1 2DUQA 4QQPA 1Q5OA 2BTVC 1SLCA 2PELA 4XF4A 3VBHB 1R1A3 3OD4A 2NYYA 5E88A 1ZBA2 2LTNA 3R4SA 3NW4A 3Q9OA 3POYA 4K1ZA 2EIEA 4OI0A 3PU3A 3VV1A 3MIEA 4QWNA 5A3WA 4BMEA 1UKRA 2DWRA 4YGCA 1LGBA 5DUWA 4MADA 3VLBB 1Q8PA 1W9SA 2AR6A 1UXXX 2Z2SB 3VB9A 1N3QA 3TOJA 4LQRA 4W6WA 2FCUA 4HVOA 2FDFA 2R061 3ABZA 3N7MA 4Q27A 5FYMA 3ENRA 3KVAA 1OH3A 4N43C 1RUI2 1W06A 4CPBA 2R1DA 4MSVA 2V4VA 1XNDA 4LKDA 3T2PA 1I5PA 1TMF1 4YG6A 2B7YA 5L73A 1K12A 1FPN1 3HQXA 3LQCA 4CDXA 2VZ1A 3DKWA 3IAQA 3SKVA 2AREA 5A1FA 1CGPA 5GM0A 2WWSA 1AX2A 5A3TA 1VP6A 5IVVA 1OA4A 3W59A 2ADEA 5IVYA 1W6MA 5L7OC 5IK8A 2QZ3A 3U14A 2O0OA 3EHKA 4MGSA 4XFBA 2PAMA 5FAXA 3SKJE 3DXUA 1H2LA 2DTYA 2OXBA 3LWCA 5JR2A 3O1OA 4XTMA 3B01A 1VAVA 1OQEA 1GANA 5IHRA 4GMP1 2B42B 3RZJA 2F17A 3TN93 4IE4A 1E57A 3ZMOA 4DS0A 1E5RA 2RS33 3WXPA 4H3WA 4CCJA 1NY72 1NCQA 3S6PA 2OKXA 3S0MA 1RITA 1VIWB 3MFCA 4DEQA 2VTXA 4NHKA 3ZIXA 3VKOA 2VUAA 3L2HA 1IPJA 1T6GC 1AYM2 3NQHA 1Z0HA 5GLVA 1GWLA 1YQ8A 2XLFA 3B5LB 4BXSV 5GJ6A 2C5DA 2E32A 2FMDA 2WZR2 1CWPA 2UURA 2VW2A 4JHZA 1TG7A 3W5NA 2FCTA 5A3MA 5T5JA 2WO1A 5CEHA 1OLQA 1JYVA 3FLRA 2EXIA 1QJEA 5C3QA 1O4YA 2BP6A 2QTWB 2C1FA 1PZ8A 2VNOA 3HNYM 2WBKA 1ULPA 1S0DA 1D4M1 1QH7A 3LDRA 4CDQC 5C70A 5A1AA 4LBMA 2HYKA 2WO2A 3I59B 3KF5A 2V73A 3Q8EA 3ZR6A 4XQ4A 3LA7A 1LOCA 2H6BA 1GP6A 3JBG2 1I5ZA 4NHYA 3I2KA 5FR3A 4MYEA 4HKWA 4ZU4A 4E2QA 2JENA 3POSA 4I30A 4Y4RA 4XABA 3VHOA 1CD3G 3H8OA 3F2ZA 3WW1A 4UFJA 2UYBA 5F3CA 4YGBA 3NJVA 4IXLA 3ASIA 3NSTA 3RDIA 4EZHA 1H9PA 1OLME 5JXJA 3UV9A 1AR73 3SH5A 1AL23 1X8MA 1UU6A 4E2SA 4RFRB 5JCTA 1LECA 4FFHA 4FPCA 2IVJA 4CDQB 4FPYA 1SCRA 5DAXA 3AZYA 2WWJA 1DQ4A 5E1RA 1E5SA 3ZYGA 2QUOA 3HEIA 4LTAA 3MF6A 4NAMA 4LHLA 5H9PA 4HETA 2XLGA 1GQGA 2O14A 2NPIA 3BN6A 4CP9B 5CIRA 4CPBD 3NWKA 1LHWA 4JAAA 3VZKA 4DPNA 3IT8A 4QXHA 5DZGA 3S30A 3IIAA 3ZPOA 4V2WA 3I3BA 2W68A 1H8TC 1OQ1A 2KD7A 1QHDA 5BNOA 3OBZA 5I0DA 1WWYA 4QX7A 4D6SA 4KBBA 4UF0B 4YGDA 1C4RA 1G9DA 1GNZA 1V9U3 2Q1MA 1RMU3 4WM7A 1H30A 2DBIA 2Y0IA 5EJ3A 3K2OA 4O61A 2ZEZA 2RS51 2RS11 3GHMA 1KEXA 3MIGA 3I8TA 3W9AA 1LOGA 4XJUA 1SLAA 4H55A 5F2SA 1W2NA 3K3NA 3PIGA 2WINB 1NLSA 1NQJA 1Q8QA 2E33A 2XVLA 2WT1A 1W39A 1HW5A 1GP4A 4HLTA 1UKGA 5J37A 3EBRA 1Z7S2 1AXKA 1A3KA 1TME2 1VBE1 2WJSA 1TEIA 4XACA 3O1MA 4JZRA 3ZXGA 1I9RA 1CAVB 1QJU1 3O0XA 4RHV1 5FMOL 1QGLA 4QU1A 5LATA 4LT5A 1U0AA 2B5HA 3I7DA 4ES9A 4PT6A 1MR5A 1WZXA 5FIXA 1GZCA 3SXWA 2JB8A 2E9QA 2X5IC 3GNEA 5CZKA 1CAVA 2ZEXA 2VOVA 4X8NA 5IFTA 5CFDA 2MEV3 3BIWE 2XJTA 5FZHA 1CAXA 4ORFA 2EIGA 1Y7BA 1AR62 1GBGA 4TYSA 3SCFA 4B4QA 3WG2A 3H1WA 5DAWA 5FO9B 5T55A 3ST7A 2FDGA 2WFPA 1UOBA 3X29B 1RMU2 4QD2A 5A33A 1RJ8A 2RDQA 4AHYA 4OHYA 3ACHA 4XDOA 3H7YA 4XJAA 1Q8VA 2VECA 1X8EA 5CA6A 5LA2A 1C1LA 1OA2A 2BNMA 4IETA 1RVF3 5CBLA 2R042 5L9VA 3WP3A 1A6CA 2VMDA 3P3NA 4QB2A 3ZYJB 3LEKA 1I1EA 2Q1ZB 2QQJA 4OZXA 1ZRCA 3O0VA 3M4FA 1LEDA 3CBNA 1UOGA 2CU5A 1ZM1A 4XJ9A 3UL2A 4E4HA 4Q29A 4TLFA 3AXDA 2VCMA 5KC5A 3FHQA 3USUA 1ZRRA 2R30A 4FPKA 4SBVA 2NQYA 2D3SA 3HR9A 4CYDA 1W2UA 1HRI1 2ES3A 3NV3A 2XLAA 4UFHA 4RFT0 1H0BA 2W91A 3HIFA 2W47A 5FDBA 3ZFEC 2DU0A 3WNKA 2X53S 3S5AA 2OZ6A 5IVEA 2RDRA 2QQLA 2WWUA 4C8DA 4FTSA 1YIPA 4AGVA 1B09A 3WCRA 4R4ZA 1MS3A 3NJZA 4EROA 3BYWA 4XW3A 5A7OA 5EV7A 2HYXA 3MLKA 2IFWA 3U37A 3WNMA 5JWPA 4I0WB 5DXDA 4YNIA 1BYHA 4NUBA 1RUF2 2YHJA 2XVKA 2R6QA 1POQA 3MW3A 1AR91 4ZZ5A 3AKRA 4PLNA 3I54A 3I59A 2HWC2 3L2YA 3MI8A 3DECA 3LGRA 2JEMA 2HWC1 4FP3A 4C0BA 4CEWA 5J96B 4GD4A 1NCRA 1O5UA 1PGW2 1STMA 2IVIB 4OHXA 1OPMA 2QQOA 1IQAA 1CZVA 2WZR3 5DUVA 5FP7A 4DRRA 4URAA 5C5TA 2YB7A 1U12A 4ZU5A 3I2DA 5JXGA 2YGLA 2ZHLA 3VD7A 4B1MA 5LEKA 3MIHA 1QJY2 2VW1A 2B9VA 3GM8A 4KH9A 3ZIWA 3ZKYA 4DRVA 2XJUA 3VKNA 2BERA 5LASA 2YFUA 3C7GA 1JYXA 3KHCA 1OLMA 4BQ2A 3VDBA 3VDAA 4XFHA 1CVNA 2GNBA 2P37A 1BQPA 1UYYA 5C8CA 3P3PA 5DDJ2 3TBDA 2IXCA 3PMSA 3KCYA 1ZBE1 5T5PA 1LKNA 3QH7A 4GQ7A 5J36A 1QY4A 2W1WA 2IXHA 2XJPA 4K6BA 3VBUB 4GAZA 4XQDA 4EN8B 4E8DA 5I0RA 1SBEA 2PFWA 1HX6A 2R073 1BBT1 4QHOA 1QXRA 1JHJA 3JD73 4FOYA 1JU4A 4UFMA 3KT1A 1EV13 3BTYA 2WZPP 4Z07A 4AOCA 1JUIA 1H4GA 3EO6A 2ZGKA 2VR4A 2TUNA 4CCMA 1W2AX 1YFUA 1QWRA 1FT9A 2VMFA 1ZYBA 5KHGA 3U0ZA 2WIIB 1K5MC 4AL9A 2O1QA 2D40A 1X9PA 4XF9A 3TEZA 1OURA 1DLCA 4GWNA 5TSWA 3WUCA 1JZ4A 1JI6A 2JDHA 4HPKB 4DY3A 4QB1A 4Q4Y2 4OULA 4QPGB 1HV1A 3UKTA 3VDDA 1W6MB 4CU6A 2AEYA 4NWVA 1ZRIA 3K48A 4AXOA 1AL22 4Y5Z0 1F5JA 4QKFA 3RI9A 2OUJA 1MPXA 2XBO1 4GZ9A 1K5MB 1J1TA 2UWCA 3O14A 2BVVA 3VDDC 2GALA 2ZEYA 1VBE2 3ZN5A 4RS5A 3T30A 4HVQA 3N35A 4WZFA 2ORXA 3VKLA 2ID4A 1RTVA 1WD3A 3UESA 1W03A 3OGRA 3AFGA 4XF0A 5F39A 2XHNA 4OQ9A 1FV2A 1OD3A 1WW5A 2GN7A 5A6QA 4N9IA 5ISLA 1DGRN 3SISA 1UAIA 1QNYA 2RS12 5FZ4A 2RV9A 3TWIA 1WBFA 1FMD1 3RFRA 1W0OA 3MHZA 2LW8A 2VBPA 4QPGA 5FXVA 3VDDB 1OKOA 4IEYA 3POGA 3FZ3A 2RM22 2NM1A 4COYA 2JKBA 1KDMA 4UW6A 1YQCA 3PMEA 4RQPC 2VZPA 3GF6A 3VD5A 2NMOA 1YYNA 5IFPA 1R081 2ENRA 4A6SA 2VCBA 2Y34A 3J8F3 4CCOA 3AVSA 1MZFA 3AP7A 4CRQA 3DPRA 4PQQA 3K4AA 5ABJB 1ULEA 4E4ZA 4LKEA 2EALA 3FFQA 4XFGA 3CQOA 3H3LA 2AH2A 5F3GA 1QIQA 2BJSA 2DFCA 2LALA 4W65A 4EQVA 5HV4A 3BODA 4QX3A 1JN2P 2DBNA 4YW2A 3ZM8A 4Q8KA 5A6XA 1ND3B 3HNMA 3MIBA 4XUNA 1QJX2 4XDQA 2WNVC 4YZ4A 1NCQC 1R082 1OLRA 2DU1A 3T09A 2ZHKA 4E4SA 2O8OA 4P9IA 2VXRA 4JQTA 4MGQA 2YPDA 5C8CB 1R093 1NCRC 4WM8B 3NRUA 4CEWC 1N1VA 1PO13 5JPMB 2PHFA 5GZGA 4XF3A 4HZFA 4HKOA 2A6VA 3GZTB 1YXWA 2P4EA 1YFWA 2QQWA 2QQMA 1ND3C 5EQUA 1TZOA 2X09A 2HWD2 4WVWA 2BQPA 1VRH1 2D93A 2VMHA 3J7NA 4LORA 2OPWA 3MICA 3OBRA 4AK3A 5FP4A 4IEXA 5I8SA 4CUGA 5ACA3 2WNUA 3U1XA 5A1LA 1QKQA 1C5HA 4QXKA 1NCRB 4WM8C 4XF1A 3GXUA 4CEWB 5JZGB 1ZZ7A 3DKQA 2AGSA 3WW2A 2QCSB 1JYWA 3T0AA 5EP9A 2NN8A 5HV0A 1F9KA 1HDKA 2OW4A 5G04L 2GP3A 3EQEA 3UK9A 1IZ3A 4ZONA 5E6HA 4XYXA 3ITQA 1A8MA 3MIDA 3OJBA 4FPLA 1D7PM 3PUHA 3NL1A 1YWKA 2JX9A 2XKPA 5FXWA 3MV11 1NY71 2P6HA 1O8PA 3VBFC 1UO9A 3CKHA 3H9AA 5FYYA 3VBFA 1PVC3 5FZ0A 1NZCA 1VRH2 2A70A 5F3IA 4OMCA 4QX5A 1AZDA 3C3VA 4OZOA 4NIHA 2D5HA 3A23A 4NE9A 2YU1A 3E6BA 3PUIA 5FMOS 4U36A 3ZSEA 1GU3A 3H0OA 1XOYA 3WV6A 3ZN6B 1X33A 3RZZA 1RUC1 2JDPA 3O7OA 4IEPA 4J1XA 4PHZA 2G1MA 1MS4A 2VQUA 1LESA 2D6LX 2VULA 3LFMA 1AJKA 1NXMA 3VGIA 3ZXLA 1VBD3 2D44A 3MW2A 1UX6A 4XCAA 4AAXA 1ENSA 3TN91 2ORZA 4AFDA 5FXXA 2CY6A 3AMQA 1C8M3 3HQUA 4BWOA 5DDJ1 1PIV1 1JZ3A 2ARCA 4LR4A 5JSRA 4C90A 1IKQA 2HWD3 3DN7A 1H2KA 3I2JA 3K77A 2QKDA 4COUA 3T3YA 3NVCA 2ERFA 5BNNA 2RG4A 2W52A 4GB31 1VRBA 2GH8A 2YDEA 3J4UH 1LNSA 2DCYA 5C4WA 3JQXA 4G3YC 4OMDA 4K40A 1JYCA 4QQOA 2WNOA 5ANQA 4DUWA 2C6SA 3RYKA 3ALQA 2GC3A 1DGWX 1S2BA 2W2IA 2XUMA 3ACLA 2VMIA 2WN3A 2VW0A 3ZSLA 5KXEA 2I74A 3EMRA 4LBQB 5IAXA 2E26A 4WM7C 4DY5A 4A3ZA 3AP4A 2GH2A 4PF5A 2ZX0A 3J26N 4CVUA 4Y26A 3C7FA 2XB6C 1PO22 1DG6A 4S2HA 3ZSJA 2VG9A 1W9WA 2VZSA 3URFA 3POWA 1RUOA 3AJZA 2B39A 4M3CF 5D1IA 4FSJA 1PO12 1AYN3 2DVFA 2ZZQA 3DCQA 4MO3M 4P9XA 1QJZA 1SLTA 1NA1B 4XIOA 2BV4A 2JICA 1BMV1 4CZSA 4EWDA 2GN3A 3WNNA 1DZTA 1AL21 1PZ9A 2SBAA 2W5FA 4KG8A 2HWF3 2YC4A 1Y4WA 4BQ3A 1KDKA 1GV9A 1IHMA 2QQIA 4PI2A 4Z2AA 3BU0A 4FOVA 5A7WA 5LEJA 3VBFB 3LPGA 4ZU7A 4IV1C 1QXPA 5F37A 5LB6A 4HG6B 1US3A 3Q8FA 2ZHNA 2YFZA 3M3CA 5DUXA 3LEMA 1V6KA 4LKSA 5A3OA 5LA9A 4AR2A 1OMIA 1H8TB 1WCUA 5CKNA 1RINA 4CDQA 1SBFA 4AE2A 2ZGTA 1OI6A 3DYMA 4Y1ZA 1CQ9A 2XUEA 5K0UC 1RUJ2 3FLTA 4FI9A 2A71A 3DL3A 1SHWB 4CCNA 1V9U1 4GH4B 1RMU1 2CWMA 5EYXA 3THDA 4IDZA 4FPGA 4IEZA 5FPZA 2FZ2A 2VH9A 4QGLA 4YPJA 1L7QA 3U11A 4Z82A 3D0SA 2HWB1 3IN9A 3THTA 1YHFA 1SG3A 2XG3A 3OOXA 2BU9A 4Q4W1 3WDYA 4AEMA 5JIUA 4R52A 1O6UA 4IEQA 4EN7B 3ZYIB 1GUIA 4L97A 2VY0A 4JX0A 2AEZA 2BBAA 1U5XA 5J48A 4C0HA 2A1XA 1HQLA 1WD4A 4MH0E 2C9KA 2R1BA 4HT1T 3B94A 1QJY1 3PDQA 4IW3A 3GDBA 3NNJA 4LITA 4C1XA 2A3YA 5CU1A 1SFYA 3AP6A 3MLLA 1W8OA 1A8DA 2D6NA 4K21A 4CUBA 5FZLA 1D0HA 1CX4A 1YO8A 4M00A 1FATA 5D2AA 4DMIA 1PGW1 3OPZA 3ZSKA 5LW9A 2EF6A 4NO4A 1V6MA 2HBTA 2IFRA 2VO5A 4S2GA 3OYWB 4JKLA 5LA0A 2VCCA 1C8NA 1NYWA 4LBLA 1X82A 1HB2A 1N1TA 2MHFA 3BVCA 1DYPA 2VVEA 3FWEA 3M3IA 4YWAA 4LPLA 4DXTA 2EA7A 5A7QA 5L36A 2E6VA 3AYDA 3M2MA 3NNGA 1VMFA 4NRQA 2Q5TA 4RGGA 4WVVA 1F15A 5BNQA 5FZEA 4D7YA 4JGZC 4HL0A 4FAGA 4BM8A 1BHGA 3PJYA 2E7QA 4LBJA 5C7GA 1N3PA 1CONA 4WVMA 2D98A 1QQP2 1SMVA 3N7KA 4YW5A 5JSOA 1Q8OA 2RJKA 1QQP1 1POV1 1QH6A 4CP1A 3APBA 4WVZA 2OS2A 4GWJA 4QQLA 4HK9A 2ZAHA 4D8MA 3K3OA 3IDCB 2WL1A 1V6JA 4SLIA 4FBFA 5GLUA 4XILA 5D21A 3KSCA 4XUOA 1OQDA 1W6QB 3IWZA 3R4UA 1RHI2 2BDRA 3FHIB 1RUE3 4OLLA 4AFAA 4ZZ8A 3I2IA 5AC92 2GU9A 4Z2WA 1RXGA 3WP6A 3ZN4A 1FX5A 2HEWF 2PLV3 4EV0A 3T1LA 4TLGA 5JOXA 5H9QA 4F7ZA 2ZABA 2I2SA 1UZZA 3HN1A 2VQAA 5BNPB 2WFF1 1OOPB 2DV9A 1HJGA 5HBAA 1BJQA 1GOFA 4XZUG 4K8FA 3UETA 1REEA 4XQWA 1OUSA 1UU4A 2V09A 2D6MA 1RUD1 2K9ZA 2RJ2A 2XQRA 3OBAA 1CZTA 4LO7A 1XBFA 1K45A 1UZYA 4P5HA 1TNFA 1UIKA 4W8JA 1ZZ6A 1SFNA 2A3XA 4IV1B 1CPNA 2VZRA 1EY2A 4L99A 4OFGA 3HBZA 1TME1 4JGYC 5JAXA 4Q4V1 4ITCA 1GKBA 1FI2A 1OOPC 2BNNA 3KVBA 1YEWA 2Q0AA 3VDCA 4BMBA 5FJKA 3PVBB 4ZXEA 5HCAA 4YZ1A 1ZZCA 2FDHA 1POV0 1UU5A 5GALA 1ZBE3 3MFAA 3PJQA 5DAQA 3AZVA 2RS52 4NROA 4H2AA 2FHRA 4Q1RA 1RUJ1 1XNTA 4XCBA 2YMZA 2WYSA 1WLTA 4HFSA 4XURA 4ATFA 1AYN2 5FZOA 4AQ6A 3WVJA 5AC91 3S57A 3GALA 4YVWA 3WEZA 3AKTA 4BXFA 1NX9A 5FY0A 5I0SA 4LBOA 1PO23 1XSQA 1HXS3 3TYJA 1ND2A 1R64A 1UXZA 1F8VA 3WG1A 4DNYA 1Q56A 4DXSA 3KB5A 2JDUA 1B35A 5FBZA 2ZX1A 5FWEA 2CGNA 5HI0A 1RUI1 3S7IA 4LHKA 4L9BA 1XNCA 3T2TA 1SDWA 2W46A 5D8AC 3M8LA 4Q26A 4RYDA 4BA6A 1UMZA 3LB9A 4Y33A 2Q8DA 3THCA 2XBO3 2Q30A 2TBVA 4DO0A 2JG9B 1WMXA 4Y20A 1W2TA 4Y1XA 5FZ7A 3P6BA 4D0QA 1FOD3 3BCWA 3WQ1A 1I6XA 2RJLA 1PHMA 2CV6A 1SCSA 3AKPA 3W20A 3ZFGA 1JHNA 4DINB 2P3IA 5FV3A 4BQYA 5DQ0A 5FZ3A 3RZKA 2JD4A 5LK7B 4BQXA 4MGTA 4FOQA 2ETEA 4FCAA 1OPOA 1HB3A 2DCKA 1PMIA 4D6RA 2D5FA 2HH9A 2CDOA 3NV2A 4AVVA 2OUHA 1SLIA 4BQ4A 2Z4FA 4IEOA 1XU2A 2JIJA 1ULDA 3ZXEA 5FZMA 1W8WA 3CLPA 3ZDVA 5APAA 1PMJX 5C6CA 5L7OB 3BKZA 1Q8SA 1RUH2 2X05A 1PK6A 5JSPA 3ACFA 3ILFA 3VBOA 5A3LA 4QMAA 4JTOA 4JKMA 3WT3A 2FCVA 1Y43B 1W9YA 2W95A 1LENA 1VBC3 1J3RA 1UPIA 4IL7A 3UNPA 2VZTA 5L9RA 2GP5A 1JBCA 4CSWA 3ZXJA 1DZQA 3J8F1 1HKDA 3H8UA 2NP0A 2VOWA 3KGZA 3WF4A 1W9TA 2DVDA 1MS9A 2B4KA 4MVTA 4JTNA 3RMYA 4OYUA 4Y3OA 5LBFA 3CJIA 1V6LA 5K7PA 5IYYA 5I91A 1W6NA 5FP3A 4MZUA 5FYTA 3ZX7A 4ASKA 2AC1A 1CESA 4IE7A 1C5IA 4K8RB 4IE0A 3SNMA 2ZZJA 1T6BX 5C4WB 2D6KA 4V1PA 4NRPA 4XXAA 5EFUA 2FQPA 1J1LA 4A7ZA 2K2SA 4BK5A 2KM2A 4FFFA 4P00B 1GFF2 3OY8A 2I45A 3K75B 1XNKA 3ACGA 4ISRA 2C4XA 1G9AA 1G6NA 2DCTA 1LGCA 3NNLA 3OTFA 4R9DA 2W1UA 4TSVA 4XMIA 5DAPA 2GDFA 4D6QA 5JOWA 3VBHA 4NVPA 1NT0A 1FPN2 2QDNA 3GJAA 5C3OA 3AYCA 1YCIA 3QD6A 3OUHA 1KQRA 5FZFA 1JW6A 5ABJC 5BYNA 2JB4A 3CMGA 4I01A 3T2OA 3O1TA 1M06G 1CN1A 2ZMKA 4NIDA 4GJYA 5BPXA 4YZ5A 3RS6A 1TE1B 1WKYA 1EAH1 3VKMA 4NIAA 1IQDC 5B4NA 1GWKA 3AMNA 4YSFA 3O1PA 4QX1A 3MF9A 4BK4A 1J84A 4KU7A 5FPUA 5JMCA 3N9QA 4JGZA 4CXWA 3WCSA 4AW7A 4LBKA 4NHLA 3VBHC 3FBMA 1GZTA 1IS4A 4ISQA 4CDXC 2WNVA 3SEEA 4PDWA 4RN5A 4GMP3 5FBJA 1MZ6A 5DG1A 5FRAA 4D3WA 3ZFGB 5JOZA 5IK5A 3H7JA 1PVC1 3PL0A 4JGYB 4QXBA 1CJPA 4JRLA 2VZ3A 1ODNA 5FZIA 1IS5A 3R4DB 4PQ9A 2Q8OA 4CCDA 2UY8A 4XHBA 1UMIA 2AYHA 1F5FA 3IM0A 4NPLA 4XETA 4AI1A 5A6ZA 4EN6B 4NN0A 3LF7A 4N7UA 2V72A 3CJIC 1AR82 4CDWB 5JZGC 4AEDB 4BLJA 4DXRA 3M70A 3AL5A 3D4KA 1SDDB 1RUC3 5ANNA 3TAYA 1LAJA 5CFCA 3OGSA 2RS13 1WMFA 3AJYA 1X9TA 3OEAA 4R9BA 3HPNA 4HSLA 2BYVE 3MV01 5FY4A 4CP2A 1J59A 1UOJA 2VNVA 3EYPA 5C33A 2H6CA 1UPSA 3VBOC 3N9MA 1PK6C 2P3JA 1SBDA 1PIV3 4MXVA 5EXOA 1L7LA 1O59A 1UY2A 2J1AA 4AEDA 2B8MA 4LO6B 2D43A 2OX0A 3GYDA 4CDWA 1JZ5A 3IKWA 1IS3A 4AAPA 1HRV3 1RUC2 2CTVA 4ZXKA 3NAPA 2CL2A 1EV12 2DUOA 2RM21 4MGYE 1GSLA 3POBA 4O9GA 5T54A 3WG4A 3VKFC 1WLCA 3CNAA 4Y24A 2RMU1 2R072 5LY2A 3ZYBA 3B9CA 2WSUA 4AVCA 2MNGA 3U07A 3UKVA 3BPZA 1LOFA 2JD9A 3H42B 3B9IA 1ZNPA 4RL7A 2BW8A 3USUB 5A80A 1UQXA 1AXYA 2VU9A 3WDTA 5KXCA 2P34A 5A7NA 2QQVA 2UWBA 3NNFA 1QOTA 3IPVB 1FNZA 2OA2A 3LOBA 4EWEA 3WQ0A 2A6XA 1VBA2 2J1VA 2ZACA 4KWUA 5FZCA 1PNFA 1S2KA 1W2OA 5FP8A 4IV3C 5T50A 5LBCA 4XBQA 4MLOA 1COV1 1LOEA 2NLRA 1NA1C 2XJRA 2EIDA 4Q0PA 5LWBA 1VB2A 2EAKA 3FMGA 1GQHA 1V6NA 4IEUA 4A7YA 4AVBA 1W9FA 2WT0A 3H3ZA 2ZGMA 3JB4C 3RZGA 4TN7A 2OQ7A 3AZXA 5FUNA 1E5IA 2ILMA 2OYZA 4AZZA 2VOTA 3VBRB 1W8TA 1LRHA 4L2NA 1W8FA 4AI9A 2W08A 3F95A 3AYEA 4RR3C 4JC1A 4OUSA 3TEXA 4AQTA 5C8CC 4IGPA 5LRSA 1PZ7A 3QACA 4PI0A 2IWGB 1VBE3 3AX4A 2J7MA 3ZXFA 3GBFA 1RHI1 1T2XA 2WS93 3ILNA 3ORJA 4MUVA 1WGPA 4RHV3 1NUKA 1EUTA 3N36A 5CISA 1AHSA 3RPQA 4XJWA 1S1AA 4YVSC 4DZGA 3DEMA 4H7LA 3UGGA 1QJX1 1GOGA 1PGL2 1H1MA 2MEV1 3WZ1A 2YG0A 5BNNC 4INDA 4Y5SA 3LPFA 4M01A 2XL7A 3KV4A 2UWAA 5C3PA 1ZX5A 3MZHA 4LIUA 5F1RA 1JYNA 1RUF3 1IPKA 4RSUA 3AFKA 1MEC1 3D6EA 2F4LA 1DCSA 3KHBA 2HLEA 4Q4W3 1AF9A 1CX1A 3AB0A 4UF0A 4AI3A 3FX3A 1VBB2 4J6GA 5A32A 1JOJA 3TEWA 3WR0A 4FQ4A 4XJZA 1WLWA 1OXCA 4JHTA 2B9UA 4CCCA 2LUWA 1CPMA 4UW5A 1DLLA 1H2MA 4N90A 1YFYA 1RUNA 2FD8A 1UY3A 3SITA 1XJAA 2J1UA 2ET7A 2LROA 1ONAA 4L92A 5FZAA 5FY7A 2JDKA 4AHZA 2ZAAA 3ACIA 3LA2A 1AUYA 4HANA 1GZWA 4G9SB 1K5JA 4N43B 4CU7A 1J58A 1BLZA 3ATGA 1QDOA 1WW4A 2VBBA 3MBWA 4XOGA 1ASJ3 1N3OA 3KV6A 3HT1A 3WF1A 3FC0A 3WLUA 4CDUA 3HT2A 1OF4A 1US2A 4FXGB 4JDMA 1RGSA 3U75A 4AVTA 4BQWA 3JU9A 2ZGUA 4FPEA 1F4HA 1V0AA 3KT4A 2ZHMA 2RR11 2XBO2 4ZS3A 3UGHA 4TTGA 3TNQA 2JDYA 5EZWA 4LA3A 5KHKA 3HWJA 4LOSA 1EPZA 2R0FA 4TZDA 3DYPA 4YZ3A 4BIFA 3J7LA 4EWAA 4YZ2A 3LDBA 3I2GA 4AFMA 2FDKA 3VD9A 3B02A 1RUG1 4Q4Y1 5DG2A 2WC2A 2C9AA 4GH4A 5CADA 2MEV2 2WLQA 4ES8A 2HWC3 4MGZE 5FMCA 1REDA 2XOMA 4JV4A 1GZWB 1YRZA 2B46X 4QM9A 1NAEA 4EZ4A 4Q5OA 3FL7A 2H0BA 3MLJA 4YYOA 5A3NA 3VL8A 4FXKB 2PHDA 1HXS2 2GC0A 1ND3A 1UZWA 4I09A 1DGWA 4AHXA 1ENQA 3S5QA 2Y64A 2JKXA 3LEGA 4RA0A 1SPPB 1UY0A 2VOKA 1CIYA 3NV1A 3RSJA 1Q43A 4FTBA 1JODA 2ZJCA 1S0FA 4HXCA 5IW0A 1DYKA 4OCTA 1M4WA 5ABJA 1DHKB 4UT5A 3GCXA 2GC1A 3HBKA 2PLV1 1IS6A 2L9LA 4MHRA 5FPAA 1ZREA 2VUCA 1OFSA 2A75A 2HWF2 2BEOA 3WDVA 2ZTNA 1KXGA 1X7NA 5FXZA 1RUG2 3ZDSA 5HCHA 1KD7A 1BVVA 3A22A 5K4LA 3ZO0B 1O4TA 2QNKA 3M3OA 3U78A 4CXYA 3WUDA 1BMV2 4NHMA 1BBT3 1REFA 1COV2 2V4AA 2XJSA 5FY5A 3HMYA 3ECQA 1AX1A 3DPRC 4FPFA 5K0UB 1AXZA 1JMUB 1HV0A 2XR4A 4N53A 4Y5TA 3W21A 4GKXA 1BVP1 2P6CA 3T2QA 1YC61 4I0AA 1Z7S1 1CAWA 2BGOA 2XGXA 4AI8A 5FPXA 4FVVA 5J09A 1XYOA 1WCQA 5FYZA 5FZDA 5BNPA 1ZRDA 2YXSA 3A21A 2WN2A 3O0WA 4LNVA 2A6YA 4XFIA 3PVOA 4Q4X3 3CU7A 3H1MA 5IAVA 4P9GA 3RZHA 2OT7A 2WLPA 4BQ1A 5JXIA 1UY4A 3A0KA 4JQRA 4B1LA 2VQ0A 3B3QE 4BDVB 2J22A 5DAVA 1AR72 2RMU2 4BLIA 3UJOA 1XB9A 4AWDA 2OQ6A 1RUJ3 1W6NB 2WSVA 3AVRA 5F5IA 3WP4A 1RVF1 4LK6A 5CYYA 5AC93 2Z79A 4O9EA 4AF9A 2GZWA 5IVJA 1LJ7A 1D4VB 1LU1A 5EWSA 4BQ5A 2X8KA 4QDSA 3ZFEB 5F3EA 5FOJB 1QNWA 4UI9L 4NIGA 2UY9A 1S2EA 5FQ0B 2Q4SA 5FPLA 2QQPA 1W3VA 3H50A 1UX7A 4Y1YA 4BIOA 1BZWA 2VD7A 3TN92 1OFNA 1O3SA 5JDBA 1XYPA 3ZFGC 2GNMA 2D3RA 4MG2A 5FY1A 3ZXAC 1EYBA 3ZN6A 3PTRB 1G9BA 4OI4A 2QZ2A 3VBSA 3IPVA 4EN0A 3MUY1 3OCPA 4MX3A 2R041 1LHVA 2ZBJA 2JG9C 3IMNA 2WQZC 3WQBA 4A7KA 1JZ8A 3OGGA 1VMHA 2JWPA 4HONA 5C8WA 2TNFA 1XRUA 2WDBA 2BRTA 1SPPA 1BK1A 5IATA 3IAPA 5EIYB 3ZVXA 5IWFA 1RJ7A 4K1YA 2WZ8A 3MIFA 4GWMA 2ZX4A 4L0PA 4IE6A 4XHXA 4BYYA 4AFCA 1JZ2A 1W6PA 4P08A 5C9AA 3GGLA 3KM5A 3M3EA 3WF2A 1U5ZA 2VL4A 3WW4A 1LU2A 2PHRA 1DYOA 5FZ1A 2WZR1 1O8SA 4A45A 4YVWC 3AP5A 4Y22B 1VALA 1G9CA 3KCCA 2XHKA 5FYUA 1AYM1 2VNRA 2QQNA 4W4ZA 5IK7A 4RHV2 3LSDA 2VVFA 1BEV3 4Y22A 3NO8A 3B7MA 3DV8A 4LUKA 3V56A 4KG0A 2ZGLA 4FT8A 1TVGA 4LA2A 1O3TA 1W99A 3M1HA 4NR1A 3VUOA 4CCKA 3IMMA 1D4M3 1BCXA 2VBDA 4CCLA 3LD8A 5A3UA 4XJ8A 1NKGA 4WBBA 2Y6FA 3ZYPA 5FZOB 3PNAA 3GBWA 3HVDA 1V00A 4QB6A 4YG3A 3RWNA 4EYUA 4KBZA 2R071 2VMGA 3D82A 4N43A 1HN1A 5DABA 1ZZBA 4XAAA 1L3JA 3B00A 4MHUA 4XPVA 1EV11 4LMFA 5BUVA 4W6YA 1DFQA 4QPIC 3LIGA 1R1ZA 4DIQA 3RZLA 2P3KA 5FZ8A 4M0HA 4CDUC 3POEA 3HQRA 3ZFFA 1S0CA 4QGMA 2XONA 2YU2A 5FUIA 5FO7B 4MXWA 1NCQB 4H7MA 3RRDA 3I49A 1W6OB 2FMYA 2OIIA 1D0GA 1VE0A 2QFEA 1H1IA 3K51A 5A7SA 3J8F2 2BVBA 1GQPA 2CAVA 2G9ZA 3CDZB 5EJ1B 4AEKA 4E4DX 2N7GA 2V5YA 2PQQA 4FPJA 1PM7A 4QKNA 5C3SA 1MS0A 4PIXA 4NHXA 4PLMA 1UMHA 1FXZA 1DU3D 1OVPA 2F6BA 1F4AA 3WF3A 1OSGA 2VMCA 2ZX3A 5LBEA 3LDKA 3ETQA 5FKCA 2FZ1A 3A4UA 4QQHA 4CCEA 5LRRA 3L9JT 3U4XA 3FUOA 3JBG1 1ZBA1 1VR3A 3D3AA 1H8VA 2VVDA 3Q8BA 5FY9A 1Y3TA 1FMD2 1YNAA 2XWBB 1C1FA 4Q4X2 5CKMA 5CFDB 5JI9A 1D4M2 3WOGA 4OHZA 3PURA 2AUYA 2Y60A 2XWJB 3VN4A 3QBQA 3DGTA 1ZVFA 5JXHA 3LIHA 4JDNA 1YLLA 4M0NA 3VZOA 5FK7A 3WF0A 2PN5A 5FY8A 4KGGA 1MS5A 1YI7A 1H6XA 2VE1A 4R9AA 3E6CC 2ZGQA 1Y9MA 3MYXA 4EJRA 3MDPA 3INAA 1W6PB 3O1VA 4GB33 3QH6A 3WDUA 1RUH3 1AR83 3HOBA 4D7TA 1XE7A 4WVMB 4LULA 2J1TA 4MV2A 4QGNA 2RDSA 3N7LA 2ET1A 5F32A 3IDAA 4RGKA 1CAWB 3C2UA 4UW3A 2E51A 1DDLA 4BOWA 2ZPXA 2NZ9A 4YARA 3SQOA 4BZ4A 1LTEA 2OZJA 4LE4A 1WBLA 5AVPA 4YFZA 1YQ2A 2C0ZA 2BGCA 4QPYA 5JLVA 1LCLA 1XU1A 4GA9A 1R1A1 1W6OA 4D69A 1IKPA 3K4DA 3Q8CA 3T0BA 4DOUA 1QOOA 3OYWA 2GSYA 2WO3A 3WHUA 3NJYA 4LLOA 5J7MA 2YBPA 1HRV1 3HAGA 1APNA 5BXXA 2IXKA 2F4PA 3CZJA 3RVHA 4F83A 4IV3A 3FHAA 3H8XA 4I3GA 5EJZB 1UWWA 2JG9A 1MZEA 2QE3A 3DXTA 3PUSA 4M3CA 3VBUC 4XFCA 1HRI3 2BPA2 1J83A 1GYKA 1XE8A 5A3PA 3N9OA 5BNOC 2ZXQA 2WRAA 3CHXA 1O3QA 1DBNA 4LBQD 1TMF3 4QU2A 4PBOA 5JI7A 1FPN3 2BFUL 4GXLA 3KLSA 3PUAA 5DPNA 2RHPA 4KMQA 1I3HA 2WNUB 2P2KA 2JG8B 1OF3A 2X29A 3OPWA 2VAUA 2Z5WA 5E8AA 3KV9A 3WY6A 1RC6A 1W0PA 3BALA 1NLRA 2VTFA 2WO7A 4A2UA 4I2OA 5I0TA 4FTEA 1EUUA 3KCXA 3DYOA 3ZR5A 3O1RA 4L8QA 3GZEA 3CL1A 1ASJ2 4L11A 2D97A 1LOBA 5KR7A 3POFA 1AR93 4YGEA 1OH4A 1UN1A 4YVWB 1F31A 1YQ6A 2PAEA 4JVAA 4P02B 2CGOA 4XUTA 1HN0A 5FFOC 3H3UA 2YC2A 5FK8A 4UAPA 3U10A 4AHWA 3AM2A 3POJA 2AACA 2D6PA 1MS1A 2HWB3 3GZAA 3OG2A 4CDUB 2A6ZA 3JUUA 2ARXA 3JCIA 3W58A 4BH9A 2UYAA 3TEYA 2JE8A 4Q0UA 5CFCC 2W87A 1G86A 3RMXA 4A6OA 1RUE1 4I02A 2JE7A 5FYSA 3AMHA 1XYNA 3C7HA 4M3CB 3WX5A 2WNVB 1WCSA 3DPRB 4FO9A 1BK0A 4XFAA 2WS91 4M3CE 4KNCA 3ZXKA 4PJYA 2K0GA 2VUDA 2RS53 5F6KA 5F2WA 1F35A 2WT2A 4IGOA 4KL1A 4AVAA 5CVRA 1VBD1 5FYIA 1SFPA 1RL3A 2X10A 3ETPA 4DXZA 4B4RA 2IXJA 1Y9QA 2PQSA 2R0HA 4Y1UA 2NMNA 2YPJA 4QKDA 4YW6A 3RQ0A 4GMP0 4PDWC 1RUD3 2VPVA 2WS92 3CEWA 4HN0A 3ZOIA 1NOVA 1WMDA 1RVF2 1YQ5A 5I93A 2JDNA 4UW4A 5FZ9A 3ZYHA 4YW3A 1KFUL 2W1QA 5FPBA 5I8TA 2FDIA 4FPOB 3JB8A 4ATEA 2CWSA 3N9LA 4OHWA 5AVAA 3ZLIA 4LBQA 1OT5A 1AR71 5FYVA 1SZBA 5C3RA 4IERA 3RNSA 2JIGA 4G4FA 2R16A 2ZX2A 4K9SA 3IZOA 3SCHA 2Y8KA 1SACA 1AR63 2YUEA 5F6LB 4A3XA 2YZ4A 2RDNA 1AL0G 5J1XA 3SH4A 4HSJA 1QQP3 5BNNB 4KGQA 1W6QA 2EXJA 2WAAA 4O65A 4IUGA 1ASJ1 5KXDA 2R7EB 4GH4C 1MS8A 2VXJA 2WQ4A 1QOSA 2VM9A 5HCFA 2Q8CA 4N9HA 4URTA 3PUQA 3E97A 4LUMA 2HWE1 2E7AA 2JXAA 1UW8A 2HJIA 2PYTA 1U5IA 5IK4A 2SLIA 1JXNA 1NE4A 4K3UA 2ZS6B 3AZWA 3T08A 2EVXA 2JDZA 1LEMA 2R32A 3SC7X 3UKNA 5K9YA 4DEVA 4OI2A 3ZFFC 4PLOA 4UWDA 1UNBA 2VZUA 1K42A 1ZA7A 5FPVA 1DQ2A 1LHUA 2HWF1 3HD8B 3MEPA 4HOOA 2VUJA 5GKAC 2ARBA 1V9U2 3GBGA 2DF7A 4GKYA 4Q0QA 4BB3A 2WQ8A 3NJXA 3LEIA 3RWKX 3D5OA 2HKXA 2E7TA 4UOJA 4Y4YA 3J7MA 3LCPA 1HRV2 2WKKA 3ZKUA 4P9WA 1HB1A 1WW6A 4S2FA 1OKQA 3I2OA 4UFIA 1CIWA 4P5YA 2Q8EA 3V0BA 1H2NA 2V5DA 4AG4A 1H1AA 5EHDA 1C57A 5DZEA 1LHOA 4ZKTB 2WA3A 2WNUC 4AI2A 2GNTA 3R0RA 2ZOEB 4Q4V3 1CJDA 1XPWA 2DURA 4B8EA 4COVA 3KS7A 5FYBA 5AFEA 1RB8G 4NAOA 2Y6KA 3E5XA 1O5LA 1O3RA 1ST8A 4JDOA 1JOBA 4C91A 3POIA 1GWMA 3HJRA 2YBKA 3WSOA 1GOHA 2RR12 1MACA 2EAAA 5T3NA 4E2GA 3GZUC 1O4ZA 4QX2A 4UBGA 3V0AB 2G4IA 4D94A 1SLBA 2CHHA 4KI5M 1XXNA 3I3QA 4TWTA 2EIBA 5HPOA 5F8PA 5C9AC 3IDBB 1RUE2 1EPWA 2DVBA 2Q1FA 3FE5A 1ALYA 1H6YA 4QQ2A 2P5BA 2KXLA 3TNPB 1Z7S3 2JG8C 4PF1A 5A70A 1C8M2 3VBRC 5K8SA 1GP5A 1JYTA 1DQ1A 1X50A 1L7RA 4HK8A 4QHBA 3H1YA 4ET7A 2PMWB 3C8XA 4IEWA 1VPHA 3LAGA 3NV4A 1DZRA 4RR3A 3TB0A 3BTXA 1UZ0A 3MGUA 2Y38A 4XBNA 2FDJA 1JYIA 3VHNA 4LXLA 2VTXJ 1XNAA 3VBSC 5FZGA 5C9AB 1H8TA 5LZ6A 2GMMA 1ND2C 3AP9A 4IV3B 4RGAA 1IG3A 3KMHA 4JGZB 1DF0A 4IQPA 1CZSA 1NLQA 2BGPA 3GHNA 1YIFA 1YI9A 4XAEA 1HQNA 1JTZX 2E53A 2PHTA 5A6YA 1VBB1 2ZA9A 3O12A 5EYYA 2H0VA 4BCUA 3AKQA 4PDWB 1RXFA 1NA1A 4CA9A 2PHUA 2VJXA 1MEC2 1UD1A 1H9WA 3ZPYA 5JVVA 2W0XA 4COZA 3EB7A 5DUUA 3AMMA 4QKBA 5FP9A 3MUZ1 2G9FA 3GJBA 4QX0A 1DGLA 2HWB2 2Y6JA 3UJQA 3C7OA 3FBYA 1V70A 2ZGPA 3ME2A 4W6XA 1POV3 4DFSA 5FMBA 1WLDA 2HBUA 1ULGA 4RS5C 4V2VA 3R05A 2YV8A 2WUHA 1OOPA 4YW1A 3WDWA 3WW3A 5A33B 1KRIA 2W3JA 3OY8B 2DVGA 2WZEA 1FV3A 3I97A 5LA1A 1V6OA 2VZVA 3MPPG 4OQ8A 3E1F1 1URXA 3FN9A 4GIQA 3T0DA 1GZ9A 2ZGRA 3SCGA 1HLCA 2Z42A 4Q2FA 2ZEWA 5SV8A 5BNPC 2A73B 1QXJA 2PHLA 3PTYA 4K7JA 5DN2A 4RS5B 3SHRA 4ZY9A 3OUJA 2DCJA 5JR7B 4QM8A 1C28A 1FMD3 3T4HB 5KBFA 3KQRA 4N53C 2VMEA 1VBC2 3ELNA 1HJFA 1IG0A 1XC6A 1K5MA 3QCWA 3A7QA 4WV8A 2JDMA 1S0JA 1JZ6A 3BU7A 3CJXA 3IBMA 4QX8A 3KZ4C 1RIRA 2CGPA 4FOWA 3CJIB 3G6JB 3JD71 5F5CA 4C1WA 1G9FA 1CR7A 4N8MA 1KFXL 3CO2A 1DP0A 1W8HA 3FLPA 1LR5A 2C26A 1VBA1 2WA4A 5IUQA 2IXIA 2RVAA 4AGRA 1NZIA 1UOFA 1MVEA 3LZZA 1XQNA 1S0IA 1ENRA 2A3WA 2FBEA 2RE9A 4N53B 4OI1A 4B3NA 3FJSA 2ZMNA 5CG8A 1S0GA 2EICA 3PVNA 3KT7A 2DTWA 1X36A 2RS32 1YFXA 1PX4A 5GLWA 4H14A 4PCRA 4Q0VA 3E5QA 4MXWB 4UFLA 5FJHA 3VL9A 5L7OA 2AZ5A 1FOD2 5F5AA 1JZ7A 1W8NA 3KWVA 4CP9A 3VD4A 4U2AA 1N1SA 1R091 2BFUS 2XL9A 1OBNA 2E63A 5IJRA 3CZUA 1EAH3 4D7SA 2ZKLA 1OUXA 2R063 1N1YA 3P1IA 1F2NA 4GB32 4BE3A 1LOAA 1PX3A 1WA4A 3E5UA 4TXWA 5FLIA 3PHMA 4META 3ILRA 3FUQA 5J98B 4ASMB 3LA3A 2BBVA 2GMEA 3AC0A 1PIV2 4QDQA 5ACA2 1DQ6A 2QVSB 5KXBA 2IUWA 1KITA 4XXPA 1SQ4A 4IGQA 1SLLA 3ZMNA 1UYXA 4AI0A 1FNYA 4X8PA 5ACA1 3O1UA 3KGLA 5FZKA 1VLNA 3VZLA 1UIJA 4QXCA 1RUI3 1TNRA 1ZRFA 1P8JA 2VNGA 2WAOA 3EJKA 3NMBA 2YC0A 3A0NA 1G7YA 2OPKA 1R092 3NKTA 4X6RB 4AVSA 2GAUA 3OSDA 2J42A 2ATFA 3AK0A 4FP2A 4LE3A 1G8WA 4LHNA 4XMAA 3WINE 2GMPA 2P3YA 1S4CA 1FOD1 1GMMA 1W0NA 4Q8LA 3ZYFA 1ENXA 2DCZA 1QF3A 1ZBA3 3H8RA 5I8YA 3J7HA 2RS31 1ULFA 2VZQA 3T1MA 1A34A 1KJRA 4QDRA 5JUVA 3ON7A 1C3HA 2YY1A 3WDXA 5AFBA 5FLHA 3KD4A 3KF3A 4FFIA 4QPIA 2PXJA 1MQTC 1IOAA 1PVXA 3JQWA 3UGFA 5SV5A 1EAH2 3W5MA 3VHRA 3JD72 2G9GA 5H9RA 2WR9A 4J1WA 1UYZA 3VBSB 5LCWL 4CXXA 1QJX3 3BPSA 3N4MA 1GNYA 3BTAA 2PHXA 4A42A 1VBC1 4LIVA 4XE9A 1J3PA 2QDRA 4UFKA 4ASLA 4IV1A 1PNGA 1PM4A 2W92A 4DUXA 4ZPIA 4CEYA 2BZDA 2K46A 5DDJ3 4ZHNA 1MZ5A 5BV6A 5L19A 1VRH3 3BUCA 2XQXA 1MEC3 4YM0A 4OVEA 2HWD1 5CFDC 4NOTA 4YM2A 5LY1A 2X5IA 2VOXA 5CAZA 3M7AA 4Q1PA 4LKFA 2KR2A 3J9SA 4CDXB 5HXMA 1LODA 4LOTA 1AX0A 1W05A 1BEV2 1Z78A 4YFWA 4BU2A 1N47A 1K3IA 1OHFA 3O5SA 1LB2A 1MVQA 3PIJA 1UY1A 5A7PA 4DUVA 1ULOA 1CAXB 2J1RA 2VCAA 3VD3A 4Z92B 1HB4A 3PU8A 3OF1A 3OGJA 4HKLA 1S0BA 2D6OX 5T5OA 3RI8A 4JCKA 2D7FA 2JECA 2ZGOA 3BB6A 4YM3A 1QJFA 3OB8A 4WZCA 4IEVA 3K46A 4B4PA 4ONUA 4I3PA 1LGNA 4HPKA 3WNPA 3VBRA 5CG9A 2WYFA 1YUDA 1KS4A 3RJ2X 3AXEA 2JJ6A 2X5IB 5FKBA 1VB4A 3RYPA 2C24A 4GALA 4CUAA 4E9KA 2RR13 4NRMA 5IT6A 3AZZA 5G05L 5T52A 5JOYA 2XMLA 3G7DA 1PK6B 1W04A 4R9CA 5C71A 1LHNA 2YYOA 2LS6A 5FWJA 1IGOA 2W94A 3N7JA 4Q4Y3 3FFZA 4A4AA 1GLHA 4P14A 2GC2A 4NPRA 3I3MA 2EXKA 2XXZA 4LBNA 4A44A 2WFF3 4UYBA 3B69A 1PGSA 4PBPA 1QDCA 5GLTA 3NAPC 4MGKE 1C8M1 5BNOB 1RUF1 3PLQA 4COWA 3QOPA 3VZJA 4CDWC 3B93A 1QJU3 3I3EA 4GWIA 4AEDC 4CEYC 1Q3EA 2ZGSA 3IIIA 1TQ5A 2ZCWA 4KWJA 2GNDA 2PTMA 2A5ZA 2E31A 2XVGA 4IE5A 5KHJA 3BIEA 4BJ0A 3WNXA 3IB3A 4BHPA 4QT6A 2CDPA 4QAWA 4Y20B 5FMDA 3SLIA 1W90A 5L9BA 3WNOA 3I3DA 2R49A 3NAPB 2JDAA 1OA3A 2PAKA 1Y9GA 4RR3B 1V6IA 4JKKA 2VC9A 5FYCA 5KHIA 5F9TA 3IDEA 1XNBA 3SMHA 3MW4A 1MQTA 4P9LA 3RGBA 2HEVF 5JZGA 1PGL1 3I2HA 2HEYF 2PLV2 3U4SA 4EN9B 1IPSA 3RZMA 2QBXA 4XTPA 2LRPA 3V64A 4NIIA 4XVHA 4JRAA 4QHZA 1WW7A 1QJY3 1D2QA 2YROA 4FFGA 1VJ2A 1ULCA 1AYN1 3GCWA 5CFCB 3V0AA 1HXS1 4XUQA 3PVEA 3BI3A 3Q8AA 4YW7A 1DQ0A 1NG0A 4FQZA 4XBLA 4NMIA 1MQTB 2PA7A 1BBT2 2Y26A 2RMU3 4LO4B 1U5YA 4R8HA 3WG3A 4WM8A 4AGGA 4J25A 1WMEA 4XC9A 4XZPA 3ZSMA 2I07B 2Y6HA 4AEJA 3UT0A 2VGDA 3CF6E 4YRDA 1RUG3 4CU9A 1AR61 5M0TA 3LFIA 4KU8A 1ZBE2 2XDVA 2IZWA 3E6DA 3ZYRA 3DF0A 4B7KA 2IXLA 4Q4V2 2A7AA 4AFBA 4E8CA 1S55A 3OGVA 3ES1A 3JZVA 1XSRA 1YJLA 3MPBA 3MO4A 3HN3A 4HN1A 4YVSB 4LLFA 2Y33A 5BY5A 3V0BB 5A7WB 2XH6A 2D3PA 1OD5A 3DUIA 2XJQA 1QJU2 2OVUA 1GICA 5D8AB 1RUD2 1JS9A 2XKOA 2BWCA 2HWE3 5A32B 1COV3 1DQ5A 3OD0A 4AYUA 4F3JA 1NE6A 1W8UA 5H9SA 4BPZA 5DMYA 4W50A 2WFF2 1W28A 3OPTA 4ARYA 2DFBA 2DYCA 5ERLA 5GLZA 3TRSB 1A78A 3AYAA 4LEJA 4RD7A 2Y6LA 3SEPA 2PHWA 4EE2A 3THPA 1JH5A 4AQ2A 3HNBM 2J1EA 4B29A 5GZFA 4HVRA 3RG0A 1AR92 2VZOA 1J3QA 1AJOA 4LO8A 3LE0A 5FUPA 5FQ0A 3T4VA 2JE9A 3I4IA 1ZZ9A 2CAUA 1NXD1
chains in the Genus database with same CATH topology
3BOPA 4XEZA 2R043 4I0BA 2EXHA 2ZKNA 4X6QB 1ZA4A 4RQPA 1KS5A 1RHI3 1VAMA 2QJVA 3LKJA 3D0JA 4QPGC 4YG0A 3AKSA 3USSA 1VBD2 1GR3A 1HRI2 5JPNB 2BUKA 5GZCA 5B2GB 4FPHA 2ZGNA 5FO8B 3LSEA 2DVAA 4RQPB 2KA3A 1O91A 3AMPA 1ZZ8A 4HBNA 4LO5B 4IESA 5KC6A 1NQDA 3D8CA 5E89A 4OUMA 4CTEA 1BEV1 1BXHA 3RYRA 1DGRA 4HMZA 3V65A 4OHVA 5CNAA 5K0UA 3SH3A 1WCKA 1BKZA 2CNAA 3VBOB 4CEYB 2TEPA 1SEFA 2IC1A 4YLZA 1FAYA 2MPFA 3S7EA 4WM7B 5DZFA 5E16A 5KWRA 4K20A 5CB7A 3ZFFB 2CYFA 4YVSA 2Z69A 1CAUB 3VZNA 4FAHA 3EXUA 3ZXDA 1QU0A 4P9JA 4Z8BA 4N7IA 2DUPA 2BWAA 5D8AA 4GULA 3VBUA 3VHPA 5FOBB 1QMJA 3WD5A 5FTTC 4QPIB 2HWE2 1O7FA 2XJVA 3BOWA 3OBTA 2AENA 1B35C 1D2SA 5JIAA 1H4HA 1VBB3 2P17A 1UCXA 4NWWA 1WCDJ 4Y1VA 1EP0A 3R6SA 2UU8A 3NKGA 4Q4W2 3LOIA 4XIKA 4CP0A 2B45X 4XFFA 2YGMA 1KJLA 4PIYA 2W39A 5HXVA 1FYUA 4S2DA 5GZDA 4DB5A 4P9YA 1UF2C 4MGIE 4UXAA 1LULA 5KHHA 3RJRA 4F8AA 1B35B 5T5LA 2BNOA 1UL9A 2WNEA 5FLJA 1YJKA 4KWLA 4YM1A 1R083 1ND2B 5GZEA 3WP5A 5J3UA 2JG8A 1AYM3 4KQ7A 3JBG3 3ROUA 1R1A2 5C4WC 1HQWA 1TME3 4DQAA 2ZMLA 4KWKA 1HIXA 3WHTA 4JGYA 1WUVA 1GNHA 1S0EA 1TMF2 1LOFC 2LM3A 3WQ7A 5FREA 2R062 3QLQA 1VAKA 1DIWA 3M3QA 4Z1VA 5F5QA 4R4XA 1CAUA 4B7EA 1JUHA 2RM23 1RUH1 1AR81 1PO11 2XPJA 4Q0SA 2A6WA 3ES4A 1VBA3 4AQSA 4PIZA 5LK5A 3VZMA 5I0UA 1PO21 1AVBA 2Y0OA 3N3HA 5FCCA 4YW4A 1PVC2 4UBHA 2O8QA 5HCBA 4E27A 3ZFEA 4Q4X1 2DUQA 4QQPA 1Q5OA 2BTVC 1SLCA 2PELA 4XF4A 3VBHB 1R1A3 3OD4A 2NYYA 5E88A 1ZBA2 2LTNA 3R4SA 3NW4A 3Q9OA 3POYA 4K1ZA 4OI0A 3VV1A 3MIEA 4BMEA 1UKRA 2DWRA 4YGCA 1LGBA 5DUWA 3VLBB 1Q8PA 2AR6A 2Z2SB 1N3QA 3TOJA 4W6WA 4HVOA 2R061 3N7MA 4Q27A 3ENRA 4N43C 1RUI2 2R1DA 4MSVA 1XNDA 1TMF1 4YG6A 2B7YA 5L73A 1FPN1 3HQXA 4CDXA 3DKWA 2AREA 1CGPA 5GM0A 2WWSA 1AX2A 1VP6A 1OA4A 3W59A 1W6MA 5L7OC 5IK8A 2QZ3A 2O0OA 3EHKA 4XFBA 2PAMA 5FAXA 1H2LA 2DTYA 3LWCA 4XTMA 3B01A 1VAVA 1OQEA 1GANA 4GMP1 2B42B 3TN93 1E57A 3ZMOA 4DS0A 2RS33 3WXPA 4H3WA 1NY72 1NCQA 3S6PA 3S0MA 1RITA 1VIWB 3MFCA 4NHKA 3ZIXA 3VKOA 2VUAA 3L2HA 1IPJA 1T6GC 1AYM2 1Z0HA 5GLVA 2XLFA 3B5LB 5GJ6A 2C5DA 2FMDA 2WZR2 2UURA 2VW2A 5A3MA 5T5JA 1OLQA 3FLRA 2EXIA 1O4YA 2C1FA 1PZ8A 2VNOA 1S0DA 1D4M1 1QH7A 4CDQC 4LBMA 2HYKA 3I59B 2V73A 4XQ4A 3LA7A 1LOCA 2H6BA 3JBG2 1I5ZA 4MYEA 4HKWA 4ZU4A 4E2QA 2JENA 3POSA 4I30A 3VHOA 1CD3G 3WW1A 2UYBA 4YGBA 4IXLA 3ASIA 3NSTA 3RDIA 1H9PA 3UV9A 1AR73 3SH5A 1AL23 1X8MA 1UU6A 4E2SA 5JCTA 1LECA 4FPCA 4CDQB 4FPYA 1SCRA 3AZYA 5E1RA 1DQ4A 3ZYGA 2QUOA 4LTAA 5H9PA 3MF6A 4LHLA 4HETA 2XLGA 1GQGA 2NPIA 5CIRA 3NWKA 1LHWA 4JAAA 3VZKA 4DPNA 3IT8A 5DZGA 3S30A 3IIAA 2W68A 1H8TC 1OQ1A 5BNOA 1QHDA 4KBBA 4YGDA 1C4RA 1G9DA 1GNZA 1V9U3 2Q1MA 1RMU3 4WM7A 1H30A 2Y0IA 5EJ3A 2RS51 2RS11 3GHMA 3MIGA 3W9AA 3I8TA 1LOGA 4XJUA 1SLAA 4H55A 2WINB 1NLSA 1NQJA 1Q8QA 2XVLA 2WT1A 1W39A 1HW5A 5J37A 4HLTA 1UKGA 3EBRA 1AXKA 1VBE1 1A3KA 2WJSA 1TME2 1Z7S2 1TEIA 3ZXGA 1I9RA 1CAVB 1QJU1 3O0XA 4RHV1 5FMOL 1QGLA 4LT5A 1U0AA 2B5HA 3I7DA 4ES9A 1MR5A 1GZCA 3SXWA 2E9QA 2X5IC 3GNEA 1CAVA 2VOVA 4X8NA 5CFDA 2MEV3 3BIWE 2XJTA 1CAXA 4ORFA 2EIGA 1Y7BA 1AR62 1GBGA 4TYSA 3SCFA 4B4QA 3WG2A 3H1WA 5FO9B 5T55A 3ST7A 2WFPA 3X29B 1RMU2 4QD2A 5A33A 1RJ8A 4AHYA 4OHYA 3H7YA 4XJAA 1Q8VA 2VECA 1X8EA 5CA6A 1C1LA 1OA2A 2BNMA 4IETA 1RVF3 5CBLA 2R042 3WP3A 1A6CA 3P3NA 3ZYJB 1I1EA 2Q1ZB 4OZXA 1ZRCA 3O0VA 3M4FA 1LEDA 3UL2A 4XJ9A 1ZM1A 4Q29A 4TLFA 3AXDA 5KC5A 3USUA 1ZRRA 2R30A 4FPKA 4SBVA 2NQYA 2D3SA 3HR9A 4CYDA 1W2UA 1HRI1 2ES3A 3NV3A 2XLAA 4RFT0 1H0BA 3HIFA 5FDBA 3ZFEC 2DU0A 2X53S 2OZ6A 4FTSA 1YIPA 4AGVA 1B09A 3WCRA 4R4ZA 1MS3A 3NJZA 4EROA 4XW3A 5EV7A 3MLKA 2IFWA 5JWPA 4I0WB 5DXDA 4YNIA 1BYHA 1RUF2 2YHJA 2XVKA 2R6QA 3MW3A 1AR91 3AKRA 4PLNA 3I54A 3I59A 2HWC2 3L2YA 3MI8A 3LGRA 2JEMA 2HWC1 4FP3A 4C0BA 4CEWA 5J96B 4OHXA 1NCRA 1O5UA 1PGW2 1OPMA 1IQAA 2WZR3 5DUVA 4DRRA 1U12A 4ZU5A 3I2DA 2YGLA 2ZHLA 5LEKA 3MIHA 1QJY2 2VW1A 3ZIWA 4KH9A 4DRVA 2XJUA 3VKNA 4XFHA 1CVNA 2GNBA 2P37A 1BQPA 5C8CA 3P3PA 5DDJ2 3TBDA 2IXCA 3PMSA 3KCYA 1ZBE1 5T5PA 1LKNA 3QH7A 4GQ7A 5J36A 1QY4A 2IXHA 2XJPA 4K6BA 3VBUB 4XQDA 4EN8B 5I0RA 1SBEA 2PFWA 1HX6A 2R073 1BBT1 1QXRA 3JD73 4FOYA 3KT1A 1EV13 2WZPP 4Z07A 1JUIA 1H4GA 3EO6A 2ZGKA 2TUNA 1YFUA 1QWRA 1FT9A 5KHGA 1ZYBA 3U0ZA 2WIIB 1K5MC 2O1QA 2D40A 4XF9A 4GWNA 5TSWA 3WUCA 4HPKB 4DY3A 4Q4Y2 4OULA 4QPGB 1HV1A 3UKTA 3VDDA 1W6MB 4NWVA 3K48A 4AXOA 1AL22 4Y5Z0 1F5JA 3RI9A 2OUJA 2XBO1 1K5MB 1J1TA 2UWCA 3O14A 2BVVA 3VDDC 2GALA 1VBE2 3ZN5A 4RS5A 4HVQA 3N35A 4WZFA 3VKLA 1RTVA 1WD3A 3AFGA 4XF0A 1FV2A 1WW5A 2GN7A 4N9IA 1DGRN 3SISA 1UAIA 1QNYA 2RS12 3TWIA 1WBFA 1FMD1 1W0OA 4QPGA 3VDDB 4IEYA 3FZ3A 2RM22 2NM1A 4COYA 2JKBA 1KDMA 4UW6A 3PMEA 4RQPC 3GF6A 2NMOA 1YYNA 1R081 2ENRA 3J8F3 1MZFA 3AP7A 4CRQA 3DPRA 5ABJB 1ULEA 4E4ZA 4XFGA 2EALA 3FFQA 2AH2A 2DFCA 2LALA 4W65A 3BODA 4YW2A 1JN2P 4Q8KA 1ND3B 3MIBA 1QJX2 4XDQA 2WNVC 4YZ4A 1NCQC 1R082 1OLRA 2DU1A 2ZHKA 4E4SA 2O8OA 4P9IA 2VXRA 5C8CB 1R093 1NCRC 4WM8B 4CEWC 1N1VA 1PO13 5JPMB 2PHFA 5GZGA 4XF3A 4HZFA 4HKOA 2A6VA 3GZTB 1YXWA 1YFWA 1ND3C 4WVWA 2HWD2 2BQPA 1VRH1 2D93A 2VMHA 3MICA 3OBRA 4AK3A 4IEXA 5I8SA 5ACA3 2WNUA 1QKQA 1C5HA 4QXKA 1NCRB 4WM8C 4XF1A 4CEWB 5JZGB 1ZZ7A 3WW2A 2AGSA 2QCSB 2NN8A 1F9KA 1HDKA 2OW4A 3EQEA 3UK9A 1IZ3A 4XYXA 1A8MA 3MIDA 3OJBA 4FPLA 3NL1A 1YWKA 2JX9A 2XKPA 1NY71 3VBFC 3H9AA 3VBFA 1PVC3 1NZCA 1VRH2 2A70A 4QX5A 1AZDA 3C3VA 2D5HA 3E6BA 5FMOS 4U36A 3ZSEA 3H0OA 3WV6A 3ZN6B 1X33A 3RZZA 1RUC1 3O7OA 4J1XA 4IEPA 1MS4A 1LESA 2D6LX 2VULA 1AJKA 1NXMA 3VGIA 3ZXLA 1VBD3 2D44A 3MW2A 1UX6A 1ENSA 3TN91 4AFDA 2CY6A 3AMQA 1C8M3 4BWOA 5DDJ1 1PIV1 5JSRA 4LR4A 4C90A 1IKQA 2HWD3 3DN7A 1H2KA 2QKDA 4COUA 3NVCA 2ERFA 5BNNA 2W52A 4GB31 2GH8A 2YDEA 3J4UH 2DCYA 5C4WA 3JQXA 4G3YC 4K40A 1JYCA 4QQOA 3RYKA 3ALQA 2GC3A 1DGWX 1S2BA 2XUMA 3ACLA 2VMIA 3ZSLA 2VW0A 5KXEA 2I74A 4LBQB 4WM7C 4DY5A 3AP4A 2GH2A 4PF5A 2ZX0A 3J26N 4Y26A 2XB6C 1PO22 1DG6A 4S2HA 3ZSJA 2VG9A 3URFA 3POWA 1RUOA 3AJZA 2B39A 4M3CF 5D1IA 1PO12 1AYN3 2DVFA 2ZZQA 4P9XA 1QJZA 1SLTA 1NA1B 4XIOA 2JICA 1BMV1 4CZSA 4EWDA 2GN3A 1DZTA 1AL21 1PZ9A 2SBAA 4KG8A 2HWF3 1KDKA 1GV9A 1IHMA 4FOVA 5LEJA 3VBFB 4ZU7A 4IV1C 1QXPA 2ZHNA 3M3CA 5DUXA 1V6KA 1OMIA 1H8TB 1RINA 4CDQA 1SBFA 4AE2A 2ZGTA 1OI6A 4Y1ZA 1CQ9A 5K0UC 1RUJ2 3FLTA 2A71A 3DL3A 1V9U1 4GH4B 1RMU1 2CWMA 5EYXA 4FPGA 4IEZA 5FPZA 2FZ2A 2VH9A 4QGLA 3U11A 4Z82A 3D0SA 2HWB1 3IN9A 3THTA 1YHFA 2XG3A 4Q4W1 3WDYA 4AEMA 5JIUA 4R52A 4IEQA 4EN7B 3ZYIB 4L97A 2VY0A 1U5XA 5J48A 4C0HA 1HQLA 1WD4A 4MH0E 2R1BA 4HT1T 3B94A 1QJY1 4C1XA 2A3YA 5CU1A 1SFYA 3AP6A 3MLLA 1A8DA 2D6NA 4K21A 1D0HA 1CX4A 1YO8A 4M00A 1FATA 4DMIA 1PGW1 3OPZA 3ZSKA 2EF6A 4NO4A 1V6MA 2IFRA 4S2GA 3OYWB 1C8NA 1NYWA 4LBLA 1X82A 1N1TA 2MHFA 3FWEA 1DYPA 2VVEA 3M3IA 2EA7A 5L36A 2E6VA 3AYDA 3M2MA 2Q5TA 4RGGA 4WVVA 5BNQA 4D7YA 4JGZC 4HL0A 4FAGA 4BM8A 3PJYA 2E7QA 4LBJA 1N3PA 1CONA 4WVMA 2D98A 1QQP2 1SMVA 3N7KA 4YW5A 5JSOA 1Q8OA 2RJKA 1QQP1 1POV1 1QH6A 4CP1A 3APBA 4WVZA 4QQLA 4HK9A 2ZAHA 3IDCB 2WL1A 1V6JA 4SLIA 4FBFA 5GLUA 4XILA 3KSCA 1OQDA 1W6QB 3IWZA 3R4UA 1RHI2 3FHIB 4OLLA 1RUE3 4AFAA 5AC92 2GU9A 4Z2WA 3WP6A 3ZN4A 1FX5A 2HEWF 2PLV3 4EV0A 3T1LA 5JOXA 5H9QA 4F7ZA 2ZABA 2I2SA 1UZZA 3HN1A 2VQAA 5BNPB 2WFF1 1OOPB 2DV9A 5HBAA 1BJQA 4K8FA 1REEA 4XQWA 1UU4A 2V09A 2D6MA 1RUD1 2K9ZA 4LO7A 1UZYA 4P5HA 1TNFA 1UIKA 1ZZ6A 1SFNA 2A3XA 4IV1B 1CPNA 4L99A 1EY2A 4OFGA 3HBZA 1TME1 4JGYC 5JAXA 4Q4V1 4ITCA 1GKBA 1FI2A 1OOPC 2BNNA 2Q0AA 4BMBA 3PVBB 5HCAA 4YZ1A 1ZZCA 1POV0 1UU5A 5GALA 1ZBE3 3MFAA 3PJQA 3AZVA 2RS52 2FHRA 4Q1RA 1RUJ1 2YMZA 1WLTA 4HFSA 4ATFA 1AYN2 4AQ6A 3WVJA 5AC91 3GALA 4YVWA 3AKTA 5I0SA 4LBOA 1PO23 1HXS3 3TYJA 1ND2A 1F8VA 3WG1A 4DNYA 1Q56A 3KB5A 1B35A 5FBZA 2ZX1A 2CGNA 5HI0A 1RUI1 3S7IA 4LHKA 4L9BA 1XNCA 3T2TA 1SDWA 5D8AC 3M8LA 4Q26A 4BA6A 1UMZA 3LB9A 2XBO3 2Q30A 2TBVA 2JG9B 4Y20A 4Y1XA 1FOD3 3BCWA 3WQ1A 1I6XA 2RJLA 1PHMA 2CV6A 3AKPA 1SCSA 3ZFGA 1JHNA 4DINB 2P3IA 2JD4A 5LK7B 4FOQA 2ETEA 4FCAA 1OPOA 2DCKA 1PMIA 2D5FA 3NV2A 4AVVA 2OUHA 1SLIA 4IEOA 1XU2A 1ULDA 3ZXEA 3CLPA 5C6CA 5L7OB 1Q8SA 1RUH2 1PK6A 5JSPA 3ILFA 3VBOA 5A3LA 4QMAA 4JTOA 3WT3A 1Y43B 1LENA 1VBC3 1J3RA 1UPIA 4IL7A 1JBCA 3ZXJA 1DZQA 3J8F1 1HKDA 3H8UA 2NP0A 2VOWA 3KGZA 2DVDA 1MS9A 4MVTA 4JTNA 3RMYA 3CJIA 1V6LA 5K7PA 5I91A 1W6NA 4MZUA 3ZX7A 1CESA 1C5IA 3SNMA 2ZZJA 5C4WB 2D6KA 4V1PA 4XXAA 5EFUA 2FQPA 1J1LA 4A7ZA 2K2SA 2KM2A 1GFF2 3OY8A 2I45A 1XNKA 4ISRA 1G9AA 1G6NA 2DCTA 1LGCA 3OTFA 4R9DA 4TSVA 4XMIA 5JOWA 2GDFA 3VBHA 4NVPA 1FPN2 2QDNA 3AYCA 1YCIA 3QD6A 1KQRA 5ABJC 1JW6A 5BYNA 1M06G 4I01A 1CN1A 2ZMKA 5BPXA 4YZ5A 3RS6A 1TE1B 1EAH1 3VKMA 3AMNA 4YSFA 3MF9A 4KU7A 5JMCA 4JGZA 3WCSA 4AW7A 4LBKA 4NHLA 3VBHC 3FBMA 1IS4A 4ISQA 4CDXC 2WNVA 4PDWA 4GMP3 1MZ6A 5DG1A 5FRAA 4D3WA 3ZFGB 5JOZA 5IK5A 3H7JA 1PVC1 4JGYB 1CJPA 4JRLA 1IS5A 3R4DB 4PQ9A 2Q8OA 2UY8A 4XHBA 2AYHA 1F5FA 3IM0A 4AI1A 4XETA 4EN6B 4NN0A 4N7UA 3CJIC 1AR82 4CDWB 5JZGC 4AEDB 4BLJA 3M70A 3D4KA 1RUC3 3TAYA 5CFCA 2RS13 1WMFA 3AJYA 4R9BA 4HSLA 2BYVE 4CP2A 1J59A 5C33A 2H6CA 1UPSA 3VBOC 1PK6C 2P3JA 1SBDA 1PIV3 4MXVA 5EXOA 4AEDA 2B8MA 4LO6B 2D43A 3GYDA 4CDWA 3IKWA 1IS3A 1HRV3 1RUC2 2CTVA 4ZXKA 3NAPA 2CL2A 1EV12 2DUOA 2RM21 4MGYE 1GSLA 4O9GA 3WG4A 5T54A 3VKFC 1WLCA 3CNAA 4Y24A 2RMU1 2R072 3B9CA 2WSUA 4AVCA 2MNGA 3U07A 3UKVA 3BPZA 1LOFA 3B9IA 1ZNPA 4RL7A 2BW8A 3USUB 1AXYA 2VU9A 3WDTA 5KXCA 2P34A 2UWBA 1QOTA 3IPVB 1FNZA 2OA2A 3LOBA 4EWEA 3WQ0A 2A6XA 1VBA2 4FSJA 2ZACA 1PNFA 1S2KA 4IV3C 5T50A 4XBQA 4MLOA 1COV1 1LOEA 2NLRA 1NA1C 2XJRA 4Q0PA 1VB2A 2EAKA 3FMGA 1GQHA 1V6NA 4IEUA 4A7YA 4AVBA 3JB4C 2WT0A 3H3ZA 2ZGMA 3AZXA 2ILMA 2OYZA 3VBRB 1LRHA 4L2NA 2W08A 3AYEA 4RR3C 4JC1A 4OUSA 5C8CC 4AQTA 5LRSA 1PZ7A 3QACA 2IWGB 1VBE3 3AX4A 3ZXFA 3GBFA 1RHI1 3ILNA 2WS93 4MUVA 4RHV3 1WGPA 3N36A 1AHSA 3RPQA 4XJWA 1S1AA 4YVSC 4DZGA 4H7LA 1QJX1 1PGL2 1H1MA 2MEV1 3WZ1A 5BNNC 4INDA 4M01A 2XL7A 2UWAA 1ZX5A 3MZHA 5F1RA 1RUF3 1IPKA 4RSUA 3AFKA 1MEC1 3D6EA 4Q4W3 1AF9A 3AB0A 4AI3A 3FX3A 1VBB2 4J6GA 5A32A 1JOJA 3WR0A 4FQ4A 4XJZA 1WLWA 2B9UA 2LUWA 1CPMA 4UW5A 1DLLA 1H2MA 4N90A 1YFYA 1RUNA 3SITA 4AHZA 2ET7A 1ONAA 4L92A 2ZAAA 3LA2A 1AUYA 4HANA 1GZWA 4G9SB 4N43B 1J58A 3ATGA 1QDOA 1WW4A 4XOGA 1ASJ3 1N3OA 3HT1A 3FC0A