1SFYA

Crystal structure of recombinant erythrina corallodandron lectin
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
239
structure length
239
Chain Sequence
VETISFSFSEFEPGNDNLTLQGASLITQSGVLQLTKINQNGMPAWDSTGRTLYAKPVHIWDMTTGTVASFETRFSFSIEQPYTRPLPADGLVFFMGPTKSKPAQGYGYLGIFNNSKQDNSYQTLGVEFDTFSNQWDPPQVPHIGIDVNSIRSIKTQPFQLDNGQVANVVIKYDASSKLLHAVLVYPSSGAIYTIAEIVDVKQVLPEWVDVGLSGATGAQRDAAETHDVYSWSFQASLPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lectin
publication title Effect of glycosylation on the structure of Erythrina corallodendron lectin.
pubmed doi rcsb
source organism Erythrina corallodendron
molecule tags Sugar binding protein
total genus 52
structure length 239
sequence length 239
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2004-02-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1sfyA00
4LBMA 1JUIA 3QCWA 3RSJA 1GICA 4YM1A 4AVTA 4ITCA 4U36A 1BXHA 4FP2A 1N1VA 3NV3A 5HCFA 2JJ6A 2XB6C 3NV4A 3OGGA 1LECA 3BIWE 3AK0A 2DVGA 5GLUA 4XIOA 2FHRA 3SISA 1SLBA 2PHWA 3T1LA 1U0AA 2JD4A 1JN2P 3ILFA 1S0EA 1H30A 1VIWB 1LTEA 3B3QE 4OZXA 2AH2A 4XMIA 2PHUA 1Q8OA 1WCSA 4I30A 2ARBA 5IUQA 1N1SA 2A6ZA 3N7KA 5IT6A 3ZVXA 2BQPA 3JUUA 1S0CA 1LEDA 1S0IA 2C5DA 3AJYA 4XBLA 1APNA 1DQ5A 4XILA 4FPCA 3IPVB 1JYCA 2VY0A 5T5OA 1ULFA 1GV9A 1GZCA 3MEPA 1F31A 4K20A 2A3WA 3POYA 1UZYA 1YO8A 1SBFA 3B01A 4LBQD 2JECA 2ZGTA 1SCSA 2D6LX 4K21A 1CR7A 3B00A 1CN1A 4XBQA 4YGCA 3AP5A 5JOXA 4FPJA 2YV8A 1I3HA 3WG2A 3WDWA 2VUAA 1LHNA 2VXRA 3AYEA 3RMXA 1WW7A 3PVNA 2ZAAA 5JDBA 3M3QA 4TYSA 2P3IA 5HCAA 1LOEA 3POSA 3N36A 5JOYA 3I8TA 2OW4A 3WDTA 4H55A 1D0HA 2FMDA 1IS6A 5E89A 3CNAA 1CQ9A 1JXNA 4YG0A 4YZ2A 5F5QA 3Q9OA 1AVBA 1AF9A 3IPVA 4YFZA 1AXKA 4LBQB 4CZSA 3ASIA 4U2AA 1OKQA 3AZVA 1DGLA 1BKZA 1GBGA 1YRZA 1WW4A 5L73A 3RQ0A 3B9CA 3PMEA 1SLIA 2DVBA 4XJ8A 3HN1A 4XJAA 2JE7A 2WNEA 3AP7A 4XTPA 1S1AA 1FV2A 4XJ9A 2UURA 4FOVA 3KM5A 4XZPA 2PHTA 5EYYA 2W08A 2EAKA 4XMAA 4DFSA 4DS0A 2ZGMA 4Q8KA 4FOYA 2WT0A 5GZDA 1LOAA 4JC1A 1OQ1A 4WVVA 5GLZA 1N1YA 1QGLA 2P3KA 5T5PA 3KQRA 3AYAA 3WHTA 5T52A 2EIGA 1GYKA 2EXJA 2AREA 1GLHA 4M01A 1HKDA 3FFZA 2YZ4A 4Q8LA 4YLZA 3OY8A 3N7LA 4PCRA 5T5JA 3UL2A 1PZ9A 4XXPA 3BTAA 4L8QA 5FREA 1BYHA 2WT1A 3WDXA 1FX5A 1AX0A 3AYCA 2CWMA 3A0NA 3D4KA 4YW1A 3ZSKA 4D69A 1WUVA 2A70A 3FLTA 2ZA9A 3C2UA 1LGCA 2ZHNA 1SLAA 2P34A 5EWSA 1W6QB 1BQPA 5T54A 2OVUA 3O0WA 4XYXA 2DU0A 1YI7A 2H0BA 2R0HA 1H9WA 3SH4A 1I1EA 3AFKA 4GWMA 4YW5A 3PVOA 2D3RA 2ZACA 1SBEA 4Q1RA 4YZ4A 3ILRA 2EF6A 2VW2A 4AGGA 2V73A 3A0KA 3POWA 1DFQA 1LOCA 4XHBA 2LTNA 1LEMA 1HQLA 4K1ZA 5CAZA 1QKQA 3HR9A 4UW5A 1NXD1 2HYKA 2P3JA 2GMEA 3OYWA 4Y24A 3TB0A 2AGSA 1LOFA 2GNTA 4UW3A 4BMEA 1KDKA 3M3EA 4P9WA 3USUB 3ZSJA 1S0FA 5JMCA 1W6MB 4HANA 1C57A 1QDCA 3SNMA 4YZ3A 2ZABA 1W6QA 4YGDA 2ZGLA 1C4RA 2PHRA 3V0AA 2DTWA 4AVVA 1F5FA 5DXDA 2ZGNA 2CY6A 3WHUA 3ZSLA 2D6KA 2R1BA 4AGVA 5DZFA 5IK8A 2DUQA 5H9SA 5GZCA 2JKBA 2NMNA 5GJ6A 1A8DA 2NZ9A 1O4ZA 4XTMA 2PHXA 1GNZA 1VALA 2EXIA 2PELA 1QOTA 1C1LA 2XG3A 5EYXA 1BJQA 1S0BA 2GNDA 3W59A 2AUYA 5KXEA 1DQ6A 1Z78A 2JE9A 3V64A 2YMZA 3B69A 3ZYRA 5CBLA 3AZYA 2D43A 2A3YA 3WUCA 3BODA 4FPYA 3IMNA 4FOQA 1B09A 2W68A 4BLJA 1G9CA 3FLRA 4JCKA 2ZHMA 1GANA 4CRQA 3L2YA 5DZGA 2ZGPA 1N3PA 1LGBA 4P14A 1KDMA 5H9QA 2GN3A 1ENRA 4Q26A 3WG4A 1W6PA 2E7QA 2ES3A 1FV3A 1CIWA 2GNBA 4Q27A 5H9PA 3WLUA 3WG1A 1YYNA 1RIRA 2ZHLA 1SFYA 3DUIA 2DVAA 4RL7A 3LCPA 2P2KA 3AXDA 4PQ9A 2GALA 4UW6A 1CPNA 2DURA 1V00A 3AP9A 3OPZA 1VAMA 3V65A 4PBOA 1DZQA 1F9KA 2DWRA 4BMBA 2DV9A 3T2TA 3NV2A 4P9XA 1AZDA 1DQ4A 1JBCA 1G86A 1MS9A 1DHKB 1QDOA 3AXEA 2NN8A 1S0GA 2RHPA 1FNYA 2D7FA 2NMOA 4MYEA 1KRIA 2NYYA 3BOPA 1GNHA 1CONA 4YGEA 4WVWA 5JLVA 1G9DA 3QLQA 3O5SA 3NV1A 3AYDA 2P37A 1QOOA 2WSVA 3WVJA 4ZXKA 1IS3A 3JU9A 4R9BA 1LHOA 3RMYA 3ZYPA 1LOBA 5KXCA 1UPSA 2I2SA 1ZA4A 3N7MA 4R9AA 2W52A 3MW2A 3M2MA 4XJUA 1HQWA 3D5OA 3O0VA 3RRDA 4W65A 4YG6A 3RG0A 2A6WA 4GXLA 1MS0A 4BQ1A 3IM0A 2KM2A 5JOZA 3N7JA 4ASMB 1W0OA 4FPEA 1JHNA 1V6OA 5DZEA 3OBRA 2PHFA 5FRAA 2UWBA 2SLIA 1JW6A 1QNWA 2G4IA 1IKQA 2D6NA 1G9FA 1IS4A 3AX4A 4M3CF 2D44A 4LBKA 5JVVA 1AX1A 4ISQA 5GLVA 4LBQA 1CESA 1ONAA 2A75A 4FPHA 5GZGA 4HL0A 2AYHA 1QU0A 3O12A 4FPFA 4Q2FA 5IK7A 2EXHA 1R1ZA 4FOWA 1NLSA 1LHUA 2E7TA 3VKLA 3ZXFA 1Q8VA 4LBNA 1IOAA 2WQZC 1SBDA 2ZMNA 1LU2A 3WZ1A 2AENA 1DQ0A 4YZ5A 4NOTA 2C9AA 1MACA 4YW4A 1LULA 1CPMA 1D2SA 1MZ6A 1GKBA 3N3HA 4FQZA 4YG3A 1ULEA 1W6OB 4Y1YA 3WV6A 4YW2A 1MS4A 3V0BB 5DUUA 3ZXKA 3ZXLA 2DVFA 1Q8QA 3U4XA 1AXYA 2WSUA 1A78A 1WD4A 1Y7BA 4Y26A 4YM2A 1DLLA 3AJZA 3INAA 5GZEA 3VKNA 4SLIA 5DG1A 1PZ7A 1N3QA 1H9PA 1WLWA 2A6XA 2DTYA 1LOGA 4NO4A 3SLIA 2UU8A 1O4YA 5GM0A 3FBYA 2ZMLA 1CVNA 1C1FA 4F83A 2D3SA 4K1YA 5GALA 3T1MA 1LHVA 1WW5A 2GMMA 4PBPA 1RINA 1AX2A 3ZSMA 4YM0A 1DQ2A 4AWDA 1S0JA 2CL2A 1V6LA 2NP0A 1MVQA 1UZZA 1W6NB 1ZM1A 3HMYA 2GDFA 5GLTA 3VV1A 1PZ8A 3D6EA 1DYKA 4LBOA 1HDKA 4WZFA 5KXBA 1URXA 5IK4A 4GKXA 1A3KA 2EALA 1Q56A 1WBLA 4XE9A 4FP3A 4GKYA 2E6VA 1V6MA 4M00A 3V0BA 2DU1A 4ISRA 5T5LA 2R1DA 4BM8A 1AJKA 2CYFA 4FPGA 5SV8A 1LOFC 1VAVA 2A71A 3GNEA 4Y22B 4XJWA 1KJRA 4XIKA 2GNMA 1Z0HA 3UJOA 3ATGA 2WJSA 3ENRA 3SITA 3WUDA 1SLLA 2DUOA 1YIFA 1FAYA 4YM3A 5LK5A 3WG3A 3USUA 3WCSA 1W6MA 2DYCA 2EXKA 3NWKA 4FPOB 1UMZA 3WNXA 5F9TA 5IK5A 3WDYA 1MS8A 1ULDA 1W6NA 2JDZA 4BLIA 5JOWA 1CJPA 5KXDA 4XBNA 3AP6A 1N47A 1WW6A 2E51A 2UWCA 1UN1A 4C1WA 4TZDA 1LENA 3FUOA 3OBTA 1ULGA 1UL9A 2A6VA 5HCBA 2GMPA 2ZGSA 1MS5A 4Y1ZA 1JYIA 4Y22A 4XJZA 1ULCA 3SH3A 4XDQA 2NM1A 1N3OA 2ZBJA 5CNAA 1LGNA 1J1TA 1BZWA 4KBBA 2CWSA 3PJQA 1UX6A 1WLDA 2WLQA 5DUXA 3M3CA 5CA6A 4UW4A 4Y1XA 1JOJA 4ATFA 1IS5A 5DG2A 1FATA 1MS3A 3M1HA 4AYUA 4CTEA 1X50A 2ERFA 3R4SA 2D6OX 4ZKTB 1Q8SA 4YGBA 3VKMA 2E53A 4Q1PA 5AVAA 2OUJA 1V6KA 1DYPA 2R49A 2YY1A 5E88A 1DQ1A 1SLTA 4PF5A 4M3CB 1GZ9A 2VH9A 1ENQA 2Z42A 1MS1A 2DVDA 2ZGRA 1VLNA 1OFSA 1KJLA 4LBLA 4JRAA 5T50A 2YROA 2A7AA 3MW4A 2CTVA 3UJQA 3UK9A 5BYNA 1MR5A 1YXWA 3IN9A 2D6MA 3WCRA 1DIWA 1WLCA 4R9DA 3MW3A 1UAIA 1GSLA 5DUWA 3OY8B 2ZGOA 1SACA 4IQPA 1LCLA 5GZFA 1QMJA 2CNAA 1KITA 4FQ4A 1SCRA 1MZ5A 1QNYA 4RA0A 2R16A 3MPPG 4AVSA 4C1XA 1TEIA 2B7YA 2ARXA 4XXAA 4YFWA 4FVVA 1W0PA 1LJ7A 4M3CA 4XHXA 3ILNA 1LU1A 2ZKNA 2Q5TA 3WDVA 4Y1UA 4Y1VA 3IKWA 2A6YA 2OUHA 4FPKA 2UWAA 2D3PA 1LESA 3ZXEA 1MVEA 3ZXJA 2LALA 2VW0A 3AP4A 4XOGA 1ENSA 1RITA 1EPWA 2AR6A 5GLWA 1V6JA 2ENRA 1FNZA 4FPLA 3W58A 2R0FA 2WT2A 3O0XA 1G9BA 2D6PA 3AZXA 5T55A 4DQAA 3I4IA 2DUPA 3OYWB 4DPNA 1IKPA 4Y20B 2A3XA 2ZMKA 5DUVA 3SH5A 3AZZA 2WKKA 1AXZA 3RS6A 1WBFA 3WOGA 5EXOA 1GZWB 3PVEA 3R05A 4BPZA 1QOSA 3ZPYA 3H0OA 1HLCA 3N35A 4M3CE 4LBJA 4R9CA 3V0AB 4YZ1A 3TAYA 1LODA 1G8WA 4WV8A 4AGRA 1DBNA 1KQRA 4Z8BA 1N1TA 3FUQA 1SLCA 1V6IA 2V5YA 4YW3A 1AJOA 3APBA 2ZGUA 5H9RA 3GALA 1LHWA 1W6OA 3R4UA 5E8AA 3VKFC 4P9YA 3VUOA 2ZGKA 4GWNA 3LSDA 1G7YA 4BOWA 2GN7A 4GALA 3VKOA 3FLPA 2W39A 4DRVA 4ATEA 3WDUA 2SBAA 3OJBA 1Q8PA 2VU9A 2VW1A 2ZGQA 2ZHKA 3DGTA 4Y20A 1G9AA 1UKGA 3M3OA 4DRRA 1FYUA 1GZWA 3LSEA 2A5ZA 1WD3A 2YXSA 2TEPA 1QF3A 2ZZJA 3AZWA 5CB7A 1S0DA 1V6NA 3A4UA 1XQNA 4GA9A 1W6PB
chains in the Genus database with same CATH superfamily
4AVTA 4YM1A 5A6YA 5A7WA 4FP2A 3URFA 2JJ6A 3I7DA 1XNCA 1ZX5A 4HOOA 3BIWE 3AK0A 1FMD1 4FTEA 2CAVA 5FXWA 2R071 1YNAA 4DUWA 1AR61 4LK7A 1UOJA 4NROA 4EWEA 5CU1A 3LFMA 1W8WA 1VBE1 2JD4A 1FXZA 1JZ7A 4DO0A 5BNNB 3TNPB 1JN2P 3ZFGC 1Y43B 3AFGA 2VQAA 3B3QE 2AH2A 2JDKA 4ZPIA 1OC1A 1Q8OA 2ARBA 1N1SA 3JXSA 3N7KA 5C4WB 1ZZ7A 1SDDB 2BJSA 4EE2A 5C8CA 4CDXB 1LEDA 3H8RA 4QX2A 1APNA 5IVYA 1AR93 4WM8A 5T5OA 2ET7A 1RMU2 2GZWA 4O65A 1GV9A 3RJ2X 5JSRA 1F31A 4LTAA 4CPBA 4K20A 4NUBA 1TE1B 1JI6A 2A3WA 5C3OA 4K21A 2WNVC 3OG2A 4GWJA 5L9VA 1UY2A 3KV9A 3RGBA 2XJVA 1CN1A 3HOBA 3I2KA 3AP5A 4Y3OA 3RWKX 3FZ3A 3MV01 3ZX7A 3WDWA 1RMU1 2VUAA 4RYDA 4CUCA 1K5JA 4WZCA 5EQUA 4BH9A 2Q4SA 3M3QA 4TYSA 3VD7A 1RUI3 1RGSA 1JH5A 3PJYA 3POSA 3VDCA 4DXZA 1CAXB 2OW4A 4UI9L 4Y33A 1FT9A 2RDQA 4OVEA 4YG0A 1XNBA 5L7OA 5F5QA 2XL7A 3CEWA 3L9JT 1AF9A 3IDEA 4KBZA 4GIQA 1YCIA 5F32A 3THDA 2JDYA 4YVSB 2VTXA 4ARYA 3MDPA 3BN6A 1SG3A 4HSLA 4ASKA 2QQLA 2XH6A 3RQ0A 1NLRA 3N4MA 4QM9A 5K0UB 4AI9A 5LEKA 1ODNA 2WNEA 2FDKA 3AP7A 1S1AA 2TNFA 2YFUA 2UURA 4XJ9A 3WP3A 1VMFA 4FO9A 3RZHA 4N53C 2PHTA 4XZPA 2W08A 4W8JA 2EAKA 2JDAA 1ZZ9A 4XMAA 4DFSA 4DS0A 4XABA 1QJX3 2RDNA 3ZFFA 4Q8KA 4KGGA 4RQPC 1JS9A 3ABZA 4N9IA 1OF3A 1S2EA 1N1YA 1Y3TA 3NJZA 4O7XA 3GBWA 5FZLA 2EIGA 4KU7A 2AREA 1DDLA 5EV7A 3H50A 1UOGA 3PMSA 4M01A 4CDUC 1X36A 1UU6A 4PF1A 3IB3A 1PGL2 5T5JA 2VXJA 2CU5A 2W2IA 2X5IB 3J7LA 3TEWA 3BYWA 1W03A 2JDNA 3WDXA 3WF2A 3D4KA 3K51A 4E8DA 1DF0A 1H8TC 1WUVA 4XZUG 2A70A 1OA2A 2ZX3A 4PJYA 1OD5A 3ROUA 3IDAA 5EWSA 1PGL1 3BKZA 2FZ1A 1W6QB 4AI0A 3KHBA 3O0WA 4LO7A 4XYXA 2DU0A 1YI7A 4UBHA 4WM7B 5FYYA 4CCKA 4Q4V3 1H9WA 4QXKA 2YBSA 5I8TA 2CGNA 1RXFA 3ITQA 1IQDC 4HT1T 4A4AA 3RZLA 5E1RA 3AB0A 1BVVA 4YW5A 2BZDA 5ANQA 4JV4A 4HG6B 5FQ0B 4NHYA 5A3NA 2V73A 3A0KA 1GNYA 1KXGA 2DDUA 3POWA 3T3YA 4IV3B 4K1ZA 5F5IA 1R64A 4OUSA 4Z2WA 4BMEA 1RUC2 1LOFA 4UW3A 3ZYGA 1WCDJ 1F8VA 1H1MA 1S0FA 1W6MB 2JG8C 1SZBA 2OXBA 1RC6A 2NQYA 1PK6A 1QEXA 4K8FA 4AEMA 4DINB 1ZZ6A 1UZWA 2ZABA 5B4XA 3HPNA 2NLRA 4LNVA 4HN0A 4MGIE 2DTWA 4AVVA 4LOTA 2ZGNA 3O1PA 1UQXA 2DUQA 4HLTA 5GZCA 4Z2AA 2PHXA 5FYVA 5J09A 1VR3A 1AR83 4E4DX 2GU9A 3BTXA 1HB3A 5KXEA 3U1XA 2JE9A 4QKFA 3V64A 3VBHA 5K9YA 4A6OA 5IFTA 3AZYA 4QPGA 4QQ2A 1O59A 2PYTA 3IMNA 2C26A 1RUE3 1MQTC 1E57A 1RUH2 1BK0A 1OPMA 3L2YA 1TNFA 4LKEA 4Y4RA 5ANNA 4XURA 3VN4A 2HBTA 1LAJA 2HLEA 2ZEWA 4Q26A 3WG4A 1W6PA 2ES3A 4YVWC 5JR2A 3TBDA 1FV3A 2GNBA 3LIGA 1YYNA 5ABJB 1RIRA 1EP0A 1RUH1 4H3WA 2P2KA 4PIYA 5F3IA 2GALA 5I0RA 3CJIC 4UW6A 4H7MA 4XF1A 5LB6A 2XQXA 4AHWA 4CU9A 2BRTA 4C0BA 3OPTA 1O8PA 3FWEA 1AZDA 1DQ4A 1DU3D 1JBCA 1MS9A 3AXEA 3U78A 1ZRIA 1S0GA 2OZ6A 4WBBA 5BNNA 3HJRA 4QB1A 5FPUA 1CAWB 4PDWC 5BY5A 4W4ZA 1PM7A 3GHNA 4N7IA 3KLSA 1W90A 3O5SA 3QH6A 3QLQA 4IEWA 4IV1A 4NMIA 4PIXA 4PT6A 1U5ZA 4CDXA 1BMV2 3MV11 2WSVA 2V4VA 3WVJA 4BZ4A 4E4SA 1RL3A 4Q29A 1HJGA 4ZXKA 1LHOA 4I0WB 1H2MA 1OVSA 4IEVA 3T2PA 4OZOA 1LOBA 2Y6LA 1NT0A 4D94A 5IJRA 3WXPA 1YQ2A 4R9AA 2W52A 4AL9A 5A3TA 1BMV1 4XJUA 4LLFA 4W65A 2WQ4A 2WZR2 1L7RA 5CKNA 1F5JA 1NQJA 3BI3A 4GXLA 4BCUA 1MS0A 3VBSB 4BQ1A 3OD0A 4GMP1 4CCJA 2KM2A 4ASMB 4MO3M 1W0OA 4QDSA 3ON7A 3K3OA 1PO23 3LA2A 1XBFA 5JI9A 2BWCA 2WZR1 4CDWB 1Q43A 4LIVA 4RGKA 4HVRA 3VDDC 2HWD3 4C0HA 2C24A 1O3SA 2JENA 5FZ7A 3CL1A 2YU1A 1G9FA 3L2HA 4A7KA 4FSJA 3AX4A 3FMGA 4M3CF 2D44A 5JVVA 4D7SA 5TSWA 2JB8A 5IVVA 1RUJ2 3ACHA 5GZGA 5KHIA 1RUF3 4Z07A 1O6UA 1QU0A 2QQKA 3O12A 4FPFA 4QT6A 4FFGA 3HT2A 5K0UA 3ZIWA 5JXGA 2VZVA 2IXJA 4HSJA 2YC2A 1SPPA 4AF9A 2QE3A 3KT1A 2DCYA 1PO12 2WNUC 1Q8VA 1RUJ1 5JR7B 3ZXFA 1YLLA 2XKPA 3WZ1A 1OSGA 2C9AA 3A22A 2WRAA 4IGPA 1KFUL 1D2SA 1GP4A 3N3HA 4FQZA 3W20A 3X29B 4C91A 4Q0UA 1JZ8A 1H1IA 1W6OB 3BTYA 2FQPA 1PO11 2XVLA 4EYUA 2F4LA 3H8UA 5DDJ3 2FBEA 3V0BB 1E5HA 1VMJA 2C9KA 4O9GA 3BIEA 4DXRA 4OQ8A 2JX9A 5FY8A 1WD4A 2MEV3 3UNPA 2VNGA 2WO7A 3ACFA 2W1UA 3RVHA 4F8AA 1K5MC 2A6XA 5JSOA 1LOGA 1RUI2 4UFMA 3FBYA 3NNGA 1CVNA 4AR2A 3W21A 4N43C 4WVMA 1RTVA 1VP6A 2QTWB 2RJ2A 5CYYA 2ZKLA 1R093 2W92A 1RINA 4YM0A 1DQ2A 1PGSA 1S0JA 2DBNA 1HB4A 1V6LA 2NP0A 4AK3A 1MVQA 3LQCA 1W2AX 1W6NB 4MZUA 1RUI1 3D6EA 2WC2A 4WM7A 3NAPC 3EMRA 5FZ6A 1A3KA 1QQP1 4MGTA 2E33A 1Q56A 4IXLA 2EVXA 4FP3A 4GKYA 2RR13 4NIDA 5K4LA 4UFJA 5FQ0A 5T5LA 2R1DA 4BM8A 5F3CA 3VD4A 1WA4A 4FPGA 5SV8A 2BFUS 1K45A 3EO6A 1DG6A 4HVOA 3QD6A 4MGSA 2WL1A 4A6SA 4LORA 2P17A 1VBA2 5IVJA 2WJSA 5F3EA 3WUDA 2E26A 1QJX2 3AMQA 1OD3A 2A1XA 3HT1A 4JGYA 4S2GA 4CDQB 3LWCA 3WX5A 2VECA 4TWTA 3WCSA 1W6MA 4RR3B 5FZOB 1QJY3 1VBA1 2FDHA 1BLZA 1MS8A 3B7MA 1PNGA 1QJX1 1JU4A 1XNAA 3SEEA 3E6DA 5LA0A 3PU8A 5KXDA 4FT8A 1GQPA 4I0AA 2J7MA 1UN1A 4I09A 4PI0A 4J25A 4AEDC 2VPVA 4X8PA 1UL9A 2JDHA 5FMOS 1MS5A 2VUCA 3T0BA 2E31A 3HNMA 3PDQA 2X05A 5J48A 5JXJA 1JZ4A 1ULCA 1WCUA 3SH3A 4UFLA 4DEQA 4XDQA 3O1RA 2J22A 4JTNA 5CNAA 4KBBA 1J1TA 2MNGA 1PX4A 3JB4C 3PLQA 4Q4V2 1CAUB 1D4M3 1J83A 5A7NA 2WFPA 4NIHA 4AYUA 5DG2A 4CTEA 2QUOA 3ZKYA 1FOD3 5FZDA 1BHGA 1JHJA 5G05L 4UT5A 2EICA 2FD8A 2YDEA 3O1OA 3NNFA 4AZZA 1V6KA 4CCMA 1XU1A 4KMQA 5DPNA 3SQOA 3J9SA 3CKHA 4CUAA 4EJRA 1DQ1A 1BBT1 4PF5A 4K40A 1JYTA 2Y33A 2VOTA 1GZ9A 2VH9A 4LO4B 3S30A 5EIYB 1ZBA3 5FZHA 1BK1A 3U37A 4EN0A 3VBUB 1W8OA 1VLNA 1KJLA 2WAAA 5BYNA 3QH7A 3RZMA 2Q1FA 3WCRA 1YHFA 3VBOC 5FXXA 4AI2A 2BTVC 3MW3A 1UAIA 3M70A 1CAWA 1HRI1 5FZ9A 5C33A 3EJKA 2ZGOA 4BQYA 3IIIA 4IQPA 1VBE3 4LOSA 4EROA 2CNAA 1KITA 1HIXA 1SCRA 4OHVA 1QNYA 3LKJA 1JYVA 3OF1A 4NHXA 3GM8A 5B4NA 1SFPA 2B7YA 1AR82 1W2UA 4DOUA 3H3LA 3P6BA 5FYZA 3S5AA 4LO6B 5BNPB 3PURA 2OS2A 2EAAA 1ZBE2 3DN7A 5F3GA 3ILNA 5D1IA 5FBJA 5FK8A 4MOAA 1C3HA 2Q5TA 4Y1UA 3WP5A 1ND2C 3D8CA 4FPKA 2UWAA 4LA3A 2D3PA 4BQ2A 4KWKA 3VBSA 1MVEA 2W1WA 2VOXA 1RUE2 3ZFEB 3ZXEA 2LALA 4CU7A 3VBFA 2VMEA 2K0GA 3JQWA 2DCTA 1ZBE1 5GLWA 4OLLA 1GP5A 1RMU3 4XFFA 1FNZA 5EPAA 4CDWA 4FPLA 4LR4A 1KD7A 5HXVA 1SFNA 3W58A 3PIGA 1ULOA 1RUE1 4FBFA 2D6PA 4QX5A 1HN0A 3WF0A 4CUGA 1US2A 5LASA 3ACIA 3K75B 2VBDA 3OYWB 1VBD3 5FY0A 5L9RA 4CEWA 5ACA2 3ZN6B 2WN3A 2WKKA 3SHRA 1WBFA 3LDBA 3I2HA 2K46A 3LIHA 1GZWB 4KQ7A 4XACA 2PAEA 2RDRA 3K4ZA 3LPGA 1C8NA 2XWJB 1D2QA 2OPWA 4R9CA 4YZ1A 1CD3G 1LODA 4IL7A 1DBNA 1EUTA 5ACA1 2BYVE 2V72A 1JMUB 5A7WB 3VGIA 1ZZCA 4MG2A 3IAPA 1V6IA 3KS7A 3P1IA 2R6QA 3EB7A 3E6CC 5H9RA 4FFFA 1LHWA 1W6OA 5E8AA 3RJRA 4JTOA 1UF2C 3VUOA 1X9TA 1NAEA 4DRVA 2WO2A 2VGDA 4FTBA 3J7MA 3OJBA 4BE3A 4XDPA 4AVBA 4XUQA 1Q8PA 4Y20A 1OOPA 3DV8A 3G6JB 4K6BA 4NHMA 4QD2A 1L7QA 3LSEA 3LAGA 2A5ZA 4AFAA 1RB8G 2YXSA 4WM8B 5I8SA 1W2TA 1X8EA 4P00B 2TBVA 5CB7A 4FAGA 3MO4A 1AHSA 2JG9A 5HPOA 4YYOA 1YFYA 2HWD2 3AXDA 4NIAA 1W28A 1JUIA 3RSJA 1DP0A 1UIKA 4ITCA 3VDBA 4D6QA 1UX7A 2AEYA 4QX1A 3T0DA 2GC2A 2HKXA 1QH7A 3I2GA 3OGGA 1LECA 2UYAA 5CFCC 4ZU7A 4B1MA 2O14A 2BBAA 3KD4A 2FHRA 2HWD1 4P02B 1RUF2 2RV9A 3LEGA 2QNKA 4NN0A 1SLBA 1ZVFA 3I3BA 1U0AA 5LBBA 3CDZB 1FPN1 3FX3A 1MZEA 1QJU2 1G9AA 1VIWB 5JIAA 4CA9A 1J3QA 4R8HA 3WSOA 4I30A 4NRPA 2K2SA 5IT6A 1S0CA 1RUF1 2C5DA 2WS93 3AJYA 1X82A 4KU8A 3MLKA 4QDQA 4CDQA 1ODMA 4CEYB 3BGAA 3TEXA 1QJU1 2XGXA 2OQ7A 1J3PA 2CV6A 3E5UA 1SBFA 4RR3A 5LBCA 5FZOA 5DDJ2 1CR7A 4YGCA 3M7AA 4HONA 5EFUA 2YV8A 5JOXA 3NNMA 3WG2A 2PTMA 1ASJ3 2QKDA 4AVAA 2MEV2 3BU0A 2VVEA 3S7IA 4ASLA 1UWWA 2ZAAA 2BBVA 2JDMA 1NE4A 2R7EB 5DDJ1 2XJUA 5FKCA 3U11A 5C8CC 5FUPA 3ZFFB 2PHLA 5JOYA 2IXIA 3DF0A 3D0JA 1D0HA 1R092 4HMZA 2MEV1 1IS6A 1ZRRA 3CNAA 4YZ2A 5F7UA 3NL1A 2KA3A 3Q9OA 3H8XA 2FDGA 1AVBA 1R081 4P9GA 4N7UA 4QPWA 3IPVA 3UGFA 1LNSA 1XYNA 1AXKA 3HNYM 4CZSA 3AZVA 4OFGA 1WMXA 5DQ0A 5L73A 1B35A 1R091 2VCCA 3ZR6A 2RR12 3FJSA 5AFBA 3I49A 4NPMA 1MEC2 2Y6KA 5B2GB 2RVAA 2XVGA 2VMIA 4XTPA 2VD7A 1FV2A 4BQ5A 1OLQA 4FOVA 3SEPA 5JMOA 1MZFA 1IG0A 4DY3A 4QPIA 1XSRA 1X9PA 4CU6A 3WY6A 2RR11 2ET1A 5L7OC 5KR7A 3H1MA 1MEC1 4CCOA 5GZDA 4EN9B 3VBUA 4JC1A 2AEZA 4MSVA 1OQ1A 4XPVA 4CE8A 5JXHA 2VMGA 1TVGA 1QJY2 1HB1A 3AYAA 2Y64A 3KQRA 3KT7A 3OSDA 3HN3A 5T52A 1GYKA 3I97A 1XOYA 1A8MA 5T3NA 4B7KA 3W5MA 3FFZA 4RS5C 2IXCA 3FHIB 5BUVA 4FTSA 1DGWX 3B93A 3UL2A 1O3TA 1PZ9A 2YG0A 2LRPA 3GZEA 1CWPA 1QJY1 3IMMA 2ZX0A 3POEA 4BIOA 5F8PA 1XNTA 1FX5A 3S5QA 5ERLA 1AX0A 3WF1A 5F1RA 5JUVA 3PHMA 2B8MA 4YW1A 1ND3C 3SXWA 4D6RA 1D7PM 1PK6B 5BNPA 5FPXA 1Y4WA 5EP9A 2J1SA 1BQPA 1W0NA 2FDIA 3POGA 4HZFA 2W1SA 1D4M2 2H0BA 2BU9A 5FP7A 2R0HA 3LB9A 1PNFA 1I1EA 4UYBA 4BB3A 1FOD2 4RGAA 3PVOA 4WVZA 4XETA 4YPJA 5A3MA 1SBEA 3BALA 4Q1RA 5FUNA 4AGGA 1DFQA 3WEZA 5M0TA 2LTNA 1NYWA 3HWJA 3N9OA 1D4M1 1LEMA 4GD4A 4LHSA 3UV9A 2CGPA 2Y34A 4P5YA 3VD3A 1VBB1 4E8CA 1OURA 1EPZA 2GP5A 1O5LA 2G9GA 1QKQA 1FOD1 3I3DA 5CAZA 4LEJA 1OKOA 4UW5A 3BOWA 1NXD1 4K9SA 1ZBA2 2HYKA 1UY3A 2P3JA 3GBFA 3OYWA 2WQ8A 2AGSA 4QPGB 2GNTA 3RNSA 1KDKA 1XE8A 3USUB 4HANA 5FLHA 3MUY1 5EZWA 4I2OA 4YZ3A 4GH4A 2OQ6A 1HV0A 1ZBA1 1OI6A 3HQXA 2WA4A 4DEVA 5FYUA 3MYXA 2FMYA 1NCRA 4AHZA 4AGRA 3ZSLA 2D6KA 1VBE2 5IK8A 5DZFA 2JWPA 5H9SA 2F4PA 2NMNA 5GJ6A 5EJZB 4ZY9A 5BXXA 2NZ9A 1PMIA 3AKSA 1GR3A 1RUJ3 1VALA 2X53S 2PELA 1SMVA 3PUSA 1QJFA 4I3PA 4LMFA 4CCCA 5KHKA 3WW3A 1NA1A 2XG3A 5EYXA 5CVRA 5J98B 1Y9QA 4AVCA 1DQ6A 1I6XA 1O5UA 1Z78A 3TN93 1JZ2A 4UWDA 3ZYRA 4JDOA 2D43A 2A3YA 2D98A 2QQWA 4IEUA 2DFBA 2ARAA 4FPYA 1PO13 3R6SA 5LEJA 2VZTA 1B09A 1K12A 2W68A 2XUEA 4XC9A 4IV1B 5F6KA 5F39A 1RYYA 1NCQB 4IEQA 1AL21 5DZGA 2BV4A 2ZGPA 3NQHA 1R1A2 2PA7A 1O3QA 3CMGA 3OUHA 3EHKA 3WNNA 2G9FA 4L92A 4UBGA 3WG1A 1SFYA 5I0DA 1VBD2 5J1XA 4PQ9A 1R1A1 2WZ8A 2JIGA 2DCZA 2VBBA 2OKXA 1DZQA 5DABA 5JZGC 1RHI2 2DV9A 3CIHA 4XAEA 4ONUA 1G86A 1H8VA 1QDOA 2HEYF 2ZX1A 2NN8A 3DPRC 2D7FA 4QAWA 3KV4A 2NYYA 1VBD1 3BOPA 1QQP3 1GNHA 2VTXJ 3K48A 4YGEA 4HETA 4WVWA 4RN5A 4B3NA 4NE9A 4B1LA 3RZZA 1DLCA 1RHI1 5KHJA 1COV3 1V9U1 2P37A 1S55A 4N90A 4CEYA 1YJKA 1IS3A 3UETA 2XHKA 3RMYA 3A23A 1WA6X 4HFSA 4KWLA 1FI2A 5KXCA 1UPSA 2VZSA 4L0PA 2Y6FA 3MW2A 3C7HA 2JDUA 1HQWA 3RRDA 4EWAA 4MXVA 4QDRA 5JIUA 5FMCA 1SPPB 2XBO3 4JQTA 3RG0A 1S4CA 4BK4A 5BNNC 1YJLA 2B5HA 3D82A 5FZBA 2VMDA 3WF4A 1U5XA 1UY0A 3JBG3 2B9VA 1VBA3 2VUDA 1JHNA 4FPEA 5C4WC 2LUWA 1V6OA 4G3YC 4CDXC 2HWB3 3NO8A 2PHFA 4KG8A 2RM23 5C5TA 1JW6A 2G4IA 4QQHA 4JZRA 1DZTA 2FZ2A 4UFKA 1W39A 2V4AA 5LY2A 4LBKA 1UYZA 1OLMA 3ZO0B 5GLVA 2P5BA 3KCYA 4B29A 4PHZA 1ONAA 2A75A 4SBVA 4CP0A 4HL0A 5BNOA 5HV4A 5I0SA 5LRSA 3CO2A 1GMMA 2O1QA 2H6CA 1KGYA 3ORJA 4Q2FA 5IK7A 2J1AA 1R1ZA 3IT8A 4D8MA 4FOWA 2IZWA 4QX3A 4WVMB 2BP6A 2JG8B 2E7TA 4IEZA 4LBNA 5IAVA 2ILMA 1SBDA 2WS92 3UKNA 4YZ5A 2CDOA 2D40A 4Q0QA 1MACA 4AI8A 2WYFA 1RJ8A 3UGHA 1LULA 4J1XA 1UKRA 5FZIA 1GKBA 4OUMA 4YG3A 3TEYA 4YVSC 1BBT3 4FXKB 4M4RA 3WV6A 4BIFA 4YW2A 2UY8A 1UZVA 4JAAA 2WS91 3ZXKA 1JYXA 1IGOA 1ACCA 1YI9A 2DVFA 3OGRA 1AXYA 2BW8A 1ASJ2 2WSUA 1KEXA 2EA7A 2TUNA 2XXZA 3J4UH 4Y26A 4YM2A 1EAH2 1OF4A 5FMDA 1K42A 2QCSB 4SLIA 4EQVA 1N3QA 2XLFA 5FO7B 4E4HA 3SLIA 1TME3 3KZ4C 4NO4A 3KV5A 4JGYB 3AMMA 1M06G 4UFIA 5IFPA 2WLPA 3U0ZA 1HRI3 2D3SA 2X8KA 5LATA 1ASJ1 4K1YA 2IC1A 2PXJA 3KSCA 4PBPA 2OT7A 1EAH1 4AWDA 2W94A 5KBFA 1HRV3 3ACLA 1Y9MA 5GLTA 3P5BA 2CHHA 3AKRA 3ZXDA 2WYSA 4E2GA 4H14A 2YPJA 3E1F1 4FFHA 4PLNA 1EY2A 2QZ3A 2JE8A 2P3YA 1PVXA 2V09A 2DU1A 4XF3A 2R041 1AJKA 2X5IC 5FYBA 1W2OA 2CYFA 1QH6A 1W8NA 4ORFA 1VAVA 2YBPA 1KJRA 3KB5A 4XIKA 1UY4A 1Z0HA 3K3NA 2BOJA 3NJYA 1ZBE3 1ZRDA 1Z7S3 2RS51 3WR0A 3ELNA 1SLLA 1UYPA 2VVFA 2XLGA 1YIFA 2R30A 1FAYA 2IXKA 1US3A 4WM7C 3USUA 3DXTA 3AVRA 4N9HA 4OHWA 3K46A 3M3IA 3WDYA 4QXHA 5FMBA 4A7ZA 1YFWA 2JDZA 2Y0OA 2Q1MA 5F2WA 3AP6A 1N47A 1WW6A 3BCWA 2UWCA 3OGJA 4IV3C 5FXZA 4TZDA 3OBTA 3FUOA 4IW3A 5EJ1B 1ULGA 2BDRA 3ZMOA 4MUVA 4MGKE 2ZGSA 1Y9GA 5ACA3 2Z79A 4P9JA 4Y22A 1F15A 2PLV3 1WCKA 5DN2A 2VQTA 3WNMA 5LWBA 4FAHA 2ZBJA 3S0MA 1LGNA 4G9SB 3NMBA 4JHZA 3VB9A 3AC0A 3GGLA 1UX6A 2WLQA 3H1WA 3M3CA 3VZNA 1O91A 4ATFA 4BK5A 1IS5A 1FATA 3WW4A 5FO9B 5F5AA 2D6OX 1NCQA 5JPMB 1PMHX 2HBUA 4YGBA 3VKMA 2Q8DA 4EZ4A 4XFBA 2OUJA 4DXSA 5K8SA 4G4FA 1DGRN 2R49A 4XEZA 5IW0A 2XUMA 1XE0A 4CXXA 4J1WA 1O8SA 4NHKA 4JKKA 1L7LA 4DB5A 3ZXGA 1UMIA 5BPXA 1VB2A 3T2OA 3U75A 2VZPA 2Z42A 3UYJA 5C3SA 1JZ5A 1PGW2 1QIQA 4N53A 1CGPA 3ZR5A 1JUHA 4PIZA 3VBFB 2VMHA 5T50A 2A7AA 4YSFA 4DXTA 2V5DA 1QJEA 1YXWA 4TXWA 3IN9A 2D6MA 1DIWA 2E7AA 1PGW1 2VMCA 2XQRA 3OY8B 4KL1A 5FZ8A 5GZFA 1FPN3 3S6PA 5ABJC 4OHZA 4CEWB 3MPPG 4NPLA 2GSYA 1W9TA 1NG0A 3SC7X 1TEIA 3VL9A 4C1XA 3FN9A 3PTYA 2GP3A 3SCFA 1W0PA 3VBHB 5G04L 4AQ2A 3TN92 1RUOA 5LA9A 3R0RA 4I0BA 2ZKNA 1QJU3 4E2QA 1H8TA 2A6YA 1UCXA 3WT3A 3ZYBA 4CP1A 1LESA 1F4HA 4D0QA 5C8WA 3ZXJA 3AP4A 5LW9A 3NSTA 4AXOA 1ENSA 5CFDC 1AUYA 2AR6A 5FPVA 3TN91 1W8TA 4JHTA 1XNDA 4COWA 2VAUA 4HPKB 3ME2A 3H8OA 2QQNA 5FIXA 1BCXA 2H6BA 3AZXA 2YC0A 3MF9A 1W2NA 5D8AB 1NE6A 4DPNA 4A3ZA 1IKPA 3LE0A 4Y20B 4A42A 1OOPB 2A3XA 2ZMKA 3WOGA 2BPA2 3RS6A 2J1UA 1W8ZA 1A34A 5EXOA 2R062 4XF0A 3VBSC 1R083 4OULA 1UOFA 1C8M3 3VZJA 1QOSA 4NR1A 3ZPYA 5FYTA 3H0OA 2HWF3 2JB4A 4I3GA 1AYM3 1QQP2 2JG9B 4M0HA 4W6WA 2JG8A 1WKYA 4WV8A 4XDOA 3WP4A 4CDWC 1N1TA 4AOCA 2WR9A 4HN1A 3RI9A 3FUQA 3ZXAC 1COV2 2R061 4DUXA 4MHRA 5FJHA 4BJ0A 2ZGUA 4XAAA 2VUJA 3GALA 1D4VB 1S2KA 5HV0A 2NPIA 4AQSA 1XB9A 4D3WA 5FZFA 3LSDA 4F3JA 2GN7A 1MEC3 1COV1 2E9QA 3FLPA 4ATEA 3QACA 4COVA 4CP2A 2IFRA 1W9WA 2PHDA 2XBO2 3BUCA 2VU9A 3CBNA 2VW1A 3THTA 1UKGA 4Y5Z0 2HYXA 3JBG2 3FE5A 2VNOA 4NJ4A 5LRRA 1FYUA 5FOBB 3VD5A 2PQSA 2HWB2 5EHDA 2QQOA 3NJXA 4OQ9A 2RM22 4XUTA 1S0DA 4GA9A 2XBO1 1XQNA 1I9RA 3A4UA 2B9UA 3Q8CA 4TSVA 2JKXA 2EXKA 2WNOA 5HI0A 1MQTA 3LEMA 4M4PA 3WW2A 1VE0A 4QHBA 1BXHA 3JBG1 4U36A 2ID4A 1ZZBA 2XB6C 4Q4W3 4BXFA 2XKOA 2HWB1 1TMF3 3J7HA 3ZOIA 4AEKA 4URAA 1BEV3 4NIIA 1X33A 5FZCA 4YVWA 2RM21 4AAPA 4OUEA 5GLUA 4D7YA 4JDNA 2HWC1 5F37A 3T1LA 2W95A 3F2ZA 3TNQA 1YQ6A 2ZEXA 5FYHA 4B8EA 3CJIA 3ILFA 1S0EA 2J1VA 1AYN2 2PHUA 4XMIA 1WCSA 5FV3A 4QB2A 5IUQA 3WQ1A 3HEIA 3ZVXA 2HEVF 1DQ5A 3D0SA 4QWNA 4FPCA 3IPVB 1JYCA 4JKLA 4XILA 2BOIA 4PI2A 1F2NA 1OQEA 1ULFA 4IE5A 4RGGA 5FP3A 2K9ZA 1BBT2 1VBB3 1AYN1 1B35B 1UZYA 3POYA 3MHZA 4LBQD 3B00A 5CG8A 4XBQA 4XUOA 4LHKA 5LA2A 3O1TA 1ZRFA 4FPJA 4ZXEA 4ZS3A 4QPIB 2VZ3A 3KVAA 1IPSA 3VHOA 1WW7A 3DXUA 3PVNA 2ZAHA 2VOKA 1TME2 2XLAA 1X7NA 2JIJA 3FFQA 3U14A 3N36A 1HRI2 4CDQC 1NZCA 1NZIA 3HD8B 2QDNA 5FZ0A 3WF3A 1ENXA 2WUHA 2FMDA 1W99A 2Y26A 2MHFA 1JXNA 4Z82A 1HRV2 1XPWA 4RR3C 1STMA 1TME1 4DNYA 1UW8A 3B9IA 4YFZA 1RUG3 1CAVB 3ASIA 3JD71 1OKQA 5A7SA 3VDDA 3WINE 1GBGA 1TZOA 2D93A 4DIQA 3B9CA 5IYYA 1SLIA 3AL6A 2DVBA 1HRV1 5A7PA 5A3OA 1PIV3 5A33B 2FDJA 2JE7A 4EN8B 2YGMA 3POFA 4IE4A 2F17A 4LKFA 3LDRA 4KWUA 5EYYA 4NRMA 1AL23 1GZTA 4F7ZA 2DBIA 1Z7S2 1OXCA 4ES8A 2ZGMA 2WN2A 1VRBA 4IERA 3Q8FA 4FOYA 4LA2A 4A7YA 1LOAA 2WNUA 3PUQA 5GLZA 2VCAA 2YYOA 3I54A 1WMDA 5T5PA 1KS4A 5CFDB 3GJBA 1L3JA 1Z7S1 3WHTA 2AACA 1R1A3 2Y6HA 2EXJA 3SKVA 4BWOA 1GLHA 1HB2A 2P6HA 4Z1VA 1HKDA 1K3IA 4B4QA 3OY8A 4W6YA 5KC5A 3N7LA 4PCRA 3DYOA 3POBA 4M0NA 1WLTA 4IESA 2D97A 5J96B 2BGPA 3DCQA 5FREA 4HK8A 1BYHA 2WT1A 3FL7A 3AYCA 2CWMA 3A0NA 5FZEA 2KXLA 2OPKA 3ZSKA 5FDBA 3PTRB 3PIJA 2ZA9A 2PLV2 3C2UA 1K5MA 1RHI3 2QQVA 3VBUC 1V9U3 1LGCA 1XYOA 1SLAA 2ZHNA 4GH4B 3VBRB 5T54A 3VDAA 3GCWA 4PLOA 4N43A 2PMWB 3HBZA 5K7PA 3KVBA 4YARA 1H6XA 2OA2A 1NCRB 1AR62 2ADDA 2IXHA 4GWMA 2RS31 1VMHA 2Q0AA 2PLV1 2WINB 2ZACA 3A21A 2Y0IA 3ILRA 4JKMA 4YZ4A 1D0GA 2G1MA 3AVSA 3P3PA 4HPKA 5DAWA 4S2DA 5A7QA 1GOFA 4A45A 2B46X 1NA1B 1QWRA 1OVPA 1YQ8A 1YIPA 5FKBA 5BNPC 4Z92B 4JGZB 4R4ZA 5D8AA 5I0TA 2GMEA 4NRQA 3IAQA 5FO8B 4P9WA 3ZSJA 2EIBA 3C7OA 2Y38A 3ETPA 4I02A 1C57A 1QDCA 2Q8CA 3SNMA 1F4AA 1W9FA 3ZFEC 4D6SA 5C9AB 1J59A 1OBNA 2QBXA 4XFIA 1EUUA 4ARXA 4MGYE 5FBZA 2Q30A 4P9LA 1VAKA 1C4RA 2ZGLA 2HWE2 4OHXA 4QMAA 5FYSA 4NVPA 4B4RA 1F5FA 2B4KA 5DMYA 2CY6A 3WHUA 1CZSA 2R1BA 1FPN2 4PQQA 1QXJA 1O4ZA 4XTMA 2BNNA 4UF0B 2VG9A 1GNZA 3DL3A 2HWE1 2EXIA 1HXS3 1C1LA 2H0VA 1CZVA 3SKJE 4AEDA 1SQ4A 1S0BA 3W59A 1JZ6A 2AUYA 3LDKA 3KMHA 3CZJA 1V70A 2YMZA 5CBLA 4GZ9A 2RG4A 3HIFA 3I2IA 4QGMA 3WUCA 3S7EA 3BODA 1OUXA 2JXAA 4FOQA 5A80A 1G9CA 1UU5A 4ZONA 3FLRA 4XW3A 2ZHMA 2ZEYA 2JICA 2PQQA 1POV0 3MLLA 4HKOA 2IVIB 4L2NA 3WNLA 4RFRB 4P14A 3USSA 1XSQA 5H9QA 3D3AA 2E7QA 3RDIA 5H9PA 3WLUA 4CYDA 4IEPA 5I8YA 3HQUA 2VZUA 1H4HA 5FWJA 1W05A 5CIRA 4EWDA 3EQEA 2BWAA 3CF6E 4GMP0 4LHLA 1REEA 3PL0A 2A73B 2BFUL 2DURA 1V00A 4AHYA 1EAH3 1VAMA 1X8MA 3OPZA 4PBOA 3RYPA 2DWRA 1R082 3V65A 4CCNA 1C8M2 1H6YA 2XJTA 3M8LA 1OUSA 1IPJA 4MV2A 2HWF2 4YM3A 4MYEA 5CADA 1KRIA 4BXSV 1FNYA 4GAZA 1AYM2 2B45X 4WM8C 5FJKA 1QJZA 4AFCA 3AMPA 3GZAA 4J6GA 3FC0A 3KF5A 4OI4A 3NV1A 1IZ3A 3AYDA 1C8M1 2R043 1QOOA 1HW5A 2Y8KA 3VBOA 4Q4Y2 2HWF1 1C28A 3MIBA 1I5PA 4QQOA 4E4ZA 1AYM1 3ZYPA 5BNOB 1YC61 2RS53 3GJAA 4BA6A 3D5OA 1DGWA 4IE7A 5J37A 4YG6A 4KG0A 1W06A 4X6QB 5FMOL 5KC6A 4Q4Y1 5F5CA 1Q5OA 2VQUA 2RDSA 4LLOA 3IM0A 5JOZA 4DY5A 3RZKA 4BDVB 4KWJA 1UU4A 3MIGA 1ND2A 2VM9A 3HBKA 4AFDA 5FRAA 5LBEA 5JI7A 4CEYC 2SLIA 1J3RA 2WFF3 5HXMA 1QNWA 3LA7A 1IKQA 5FCCA 1SEFA 2Q8OA 1IS4A 2LW8A 4Q4W2 3RFRA 1TMF2 4CVUA 3BB6A 2KD7A 1BEV2 4ISQA 1CAVA 1REFA 1U5YA 3U10A 1CESA 4EN7B 5BV6A 4XF9A 5DAXA 5JSPA 4Q4W1 3WD5A 5A33A 1W3VA 1TMF1 2Y60A 3KV6A 3BU7A 3KCXA 1BEV1 2W5FA 3ZFFC 5C3RA 5F6LB 2VZ1A 1XJAA 3VKLA 5IVBA 3VZMA 5IVCA 4K8RB 2YGLA 2ZX2A 4BYYA 5A6XA 1LU2A 1YUDA 2AENA 1DQ0A 2CAUA 3OEAA 5FTTC 3ACGA 4YW4A 3W5NA 1CPMA 1VBB2 4UFHA 1ULEA 2BGOA 4Y1YA 1ULPA 1MS4A 1WCQA 2BUKA 2RMU3 1PMJX 3ZXLA 1ZYBA 4URTA 1NY72 3U4XA 1OLME 2XONA 2C1FA 2ZX4A 1H2NA 3C7EA 1Y7BA 1DLLA 3INAA 3VKNA 3THCA 4Q4X3 3ZFGB 4CCLA 1LR5A 2UU8A 1SDWA 4BQ4A 3KT4A 1JYWA 1C1FA 4QGNA 4ZZ5A 1NY71 3T2QA 5GALA 4LULA 3ZSMA 2ZS6B 3AMNA 1VBC3 2CL2A 4AI3A 4IGQA 3I3QA 3VBRA 2C6SA 3VV1A 1RUG2 2GDFA 1PZ8A 4BQXA 2CGOA 1URXA 3I2OA 2WNVB 4GKXA 1ALYA 1A6CA 1E5SA 1JOBA 2QQUA 4KGQA 4XE9A 4AG4A 4M00A 1V6MA 1LKNA 2WIIB 2XWBB 1PIV2 2Z69A 3O14A 4CXWA 4XCAA 2YB7A 1RUG1 4B4PA 1LOFC 3AL5A 2A71A 3BPZA 4Y22B 4XJWA 2GNMA 1AL22 2WWSA 2XJQA 3ATGA 4QXBA 2ZEZA 3UJOA 4W6XA 1PK6C 3H3ZA 1QXRA 2P4EA 1JU3A 3DPRB 3GBGA 4JGZA 1PIV1 4MADA 2DUOA 4YRDA 3U4SA 2XHNA 5FZ3A 3ZKUA 3G7DA 3IDBB 5LK5A 3WG3A 4ZS2A 5DAQA 2OYZA 3NWKA 4FPOB 4LE4A 5F9TA 5A6ZA 5C9AA 4Y4YA 5IK5A 1W8FA 4LPLA 5KHHA 1ZNPA 3OB8A 3EXUA 5A7OA 1IG3A 4CCEA 1CJPA 4XBNA 2Z2SB 4C1WA 5IAXA 4XCBA 3K4AA 2N7GA 4P08A 3SCHA 3HNBM 3AMHA 5D21A 3P3NA 4UF0A 3ZLIA 2GMPA 4Y1ZA 4BISA 4NIGA 2VCBA 4N53B 5FAXA 2DFCA 3VHNA 4BU2A 1UYYA 4QPGC 4CUBA 2BGCA 2ORXA 1V9U2 2R063 4CP9B 2W1QA 4RQPB 1BZWA 3CZUA 2CWSA 3PJQA 1WLDA 5DUXA 4UW4A 4Y1XA 1JOJA 4E2SA 4MXWA 3M1HA 1E5IA 3NKGA 1X50A 4QU2A 4Y5TA 4HKLA 1YQ5A 2VR4A 1PM4A 2ZTNA 4META 4V1PA 1KS5A 1H4GA 2E53A 4Q1PA 4CDUB 5FR3A 2XJSA 1DYPA 1NUKA 2YY1A 3EBRA 1SLTA 2DCJA 4QKNA 1W8UA 4L99A 5HBAA 3ALQA 3IWZA 5FZKA 3O1MA 1H8TB 1I5ZA 1P8JA 1G6NA 1RJ7A 1MS1A 2ZGRA 5FPBA 4LBLA 1ZZ8A 5FLJA 4JRAA 3MW4A 2CTVA 3UJQA 3FBMA 4JX0A 3W9AA 1OA4A 1MR5A 1T2XA 2Z4FA 4IV1C 3DECA 3RPQA 3VZOA 1NCQC 2P1BA 4R9DA 1EYBA 2XPJA 3QOPA 4YWAA 3H7YA 3ZSEA 4ZHNA 3PU3A 2HWC3 4S2HA 5FPAA 5FY7A 1LCLA 4RD7A 1QMJA 1ZREA 3KCCA 4FQ4A 3CJXA 3OEBA 4NAMA 1H2LA 3CHXA 3OUIA 4RS5A 2ARXA 4XXAA 1OFNA 4YFWA 1HXS2 2CSGA 3B94A 3LA3A 1LJ7A 3Q8AA 4XQWA 5AC93 4M3CA 1MPXA 1YFXA 5FPLA 5IWFA 1LU1A 3ZYHA 3C7FA 3TWIA 4B7EA 3GZUC 4AQ6A 1ND3A 2OUHA 1AYN3 2W9XA 2VW0A 1RUD3 1HXS1 2ZXQA 4GB33 1EPWA 2O8OA 2QFEA 4OCTA 3JB8A 4R52A 3MI8A 2WA3A 2R0FA 3MFCA 3O0XA 2X10A 1G9BA 2VC9A 3OTFA 1WGPA 2QZ2A 2AC1A 4JVAA 2XJPA 4CU8A 3HVDA 4DQAA 3GYDA 5C5UA 4KNCA 5K0UC 1UMHA 3ZYFA 2ZPXA 4GQ7A 4NWVA 4LO5B 3SH5A 5DUVA 3AZZA 1AXZA 1WZXA 2RS13 2B42B 3PVEA 4IEYA 3OBAA 5FZ1A 3R05A 4BPZA 1XYPA 2VVDA 3N35A 5FZGA 4LBJA 3V0AB 2O8QA 3JD73 1G8WA 1GP6A 1KQRA 3MLJA 3OGVA 1MQTB 3QBQA 3WNPA 4Z8BA 3U07A 3UKVA 1SLCA 3DYMA 2EIDA 2R042 3N9QA 3NW4A 3K4DA 2V5YA 3AM2A 4C8DA 5J36A 4YVWB 1AJOA 3APBA 2C0ZA 3V56A 3R4UA 2R32A 3R4DB 4P9YA 3VLBB 2RS52 1DZRA 4GWNA 5FZMA 1G7YA 4GALA 3VKOA 5GKAC 3CJIB 4QKBA 2SBAA 1LRHA 3DGTA 1GFF2 1HV1A 3LGRA 2ZHKA 5IVEA 1REDA 4QB6A 4UXAA 1EV13 1AL0G 3MF6A 2IFWA 1POQA 1W8HA 3ZFGA 1WD3A 3J26N 4PDWB 2QDRA 1V6NA 2WFF2 4QHZA 1HQNA 1RUC1 3LFIA 4LBMA 3QCWA 1GICA 3VZKA 5HCFA 1N1VA 3NV3A 4LUMA 3NV4A 4N8MA 4XQDA 4OI1A 3WQ0A 4QQPA 2DVGA 2YU2A 5JAXA 2VQ0A 2WNVA 4XIOA 2VMFA 2WFF1 2B39A 4GULA 4HKWA 4Q0PA 4RSUA 4W50A 1CJDA 2G9ZA 2PHWA 4YW6A 3SISA 4XF4A 3RZGA 1J1LA 4CSWA 1H30A 4JGYC 1LTEA 4OI2A 4OZXA 5A3LA 5JZGA 3POJA 2RS33 2ZCWA 2A6ZA 5FYIA 2BQPA 4MX3A 3JUUA 4UAPA 3RZJA 1S0IA 4XBLA 4JRLA 4L11A 3DPRA 3O1SA 2VY0A 5FUIA 4TTGA 2HEWF 3MEPA 1GZCA 4RHV3 3VDDB 1OQDA 5CEHA 3KQ4B 1YWKA 4LKDA 1GQGA 1YO8A 5LBFA 4AI1A 3B01A 2JECA 2XL9A 1SCSA 2D6LX 2RMU2 2ZGTA 4EV0A 3PUHA 4A44A 3O1VA 2E63A 2WAOA 2WO1A 1DCSA 2F6BA 1E5RA 1I3HA 2XMLA 1LHNA 2VXRA 3AYEA 3RMXA 4GJZA 5JDBA 4Q4X2 3ETQA 2ARCA 2VCMA 5A3WA 2RMU1 2P3IA 5HCAA 1LOEA 2WNUB 3I8TA 5C3PA 3WDTA 4H55A 2Z5WA 5DAVA 4LITA 3T0AA 2O0OA 5E89A 1CQ9A 3ES4A 5C4WA 1VBC2 2I07B 4CP9A 2E32A 1OLRA 2VNRA 2VL4A 3LOIA 1NKGA 2W0XA 3MFAA 3OUJA 4Q4X1 4LJHA 4RQPA 4E9KA 5A1LA 3LPFA 1H1AA 2W47A 3LOBA 2HWE3 2LS6A 4LBQB 1VB4A 1POV1 4U2AA 2FCTA 2VJXA 1DGLA 1BKZA 5L36A 1YRZA 1WW4A 2IVJA 4IDZA 4NAOA 3PMEA 1VBC1 4XJ8A 5KHGA 4QPYA 3KHCA 1PVC3 3HN1A 4XJAA 2AZ5A 5I93A 3V0AA 4LK6A 4AHXA 1VRH2 4CDUA 1DGRA 2FCUA 2OX0A 3KM5A 4UOJA 2QQPA 1K5MB 3JQXA 5C3QA 2Y6JA 3NRUA 1JOPA 4TN7A 3MIHA 4Q5OA 3H42B 5FFOC 3BVCA 4N43B 1RUNA 2WT0A 4COYA 3AKQA 1CAXA 1VRH1 3NNJA 4WVVA 3ECQA 1QGLA 3A7QA 4EN6B 2P3KA 3OOXA 3NAPB 1YFUA 1IQAA 2OZJA 4LHNA 4YVSA 2YZ4A 4Q8LA 5CG9A 4YLZA 1JZ3A 4XXPA 3S57A 3BTAA 1UPIA 2IWGB 4L8QA 3TEZA 2VO5A 2XJRA 1UXZA 2YC4A 4OMDA 4DUVA 2L9LA 5AVPA 4D69A 3FLTA 1HX6A 3I3MA 2WBKA 2HJIA 1F35A 2P34A 3VBFC 2YPDA 3ES1A 1GWKA 1AR92 3VZLA 3MPBA 2OVUA 3ZYJB 3RWNA 2DF7A 3E5QA 4XFHA 2Q1ZB 3ZDVA 3WP6A 4BQWA 3SH4A 4QGLA 1H2KA 4MGQA 5FY1A 5L19A 3AFKA 2QQIA 3ZIXA 4PLMA 2D3RA 1S2BA 2WWJA 5A32B 4FXGB 4A41A 4C90A 2EF6A 2GC0A 2GH8A 2VW2A 4Q4Y3 1AR91 1LOCA 3GCXA 2BNMA 4XHBA 4CEWC 3J8F3 3I2DA 4H7LA 1HQLA 1J58A 3VD9A 1M4WA 4AEDB 5FZ4A 3H7JA 3HR9A 2GC3A 5AFEA 3VBHC 1UOBA 2BERA 2X5IA 5IVFA 5CKQA 4YW7A 2DCKA 4OYUA 4Y24A 3TB0A 5A1FA 2WABA 3M3EA 3N9PA 3N9MA 4OMCA 3T4VA 5JMCA 3KGLA 1GQHA 3NVCA 5LK7B 3KWVA 3WNKA 4NWWA 1QY4A 1W6QA 3O7OA 1GWMA 1VPHA 2PHRA 4YGDA 1TG7A 5FY5A 3N9LA 5FOJB 4XVHA 3CQOA 1UY1A 5FLIA 2HWC2 5DXDA 4QKDA 3VHPA 4O61A 4AGVA 4HVQA 2RJLA 2JKBA 2WDBA 1A8DA 4DMIA 3B02A 3E6BA 3DYPA 5D8AC 4AFMA 1OT5A 2W3JA 3UT0A 3AKTA 1OOPC 1QOTA 4IV3A 5CISA 2FDFA 1BJQA 2W46A 2GNDA 1UIJA 5AC92 4I01A 2X29A 1O3RA 2WZEA 1HJFA 3B69A 3ZN4A 4FCAA 4K7JA 2PN5A 4RFT0 1WMEA 4AQTA 4BHPA 2ORZA 4BLJA 2JG9C 4XUNA 1RUD2 5A3PA 5C6CA 4GB32 3LZZA 3DKWA 3DKQA 1GANA 4JCKA 3WQBA 4CRQA 4D7TA 5IATA 3VBOB 5AC91 1N3PA 1NQDA 1LGBA 2BVVA 2EIEA 1KDMA 3C3VA 1XE7A 4PDWA 2ZZQA 1TQ5A 2GN3A 5F2SA 1ENRA 3VHRA 5A3UA 1LB2A 4Q27A 1CIWA 1UYXA 1RUD1 3ZN5A 3IDCB 2ZHLA 3H1YA 3DUIA 4GB31 4NHLA 2DVAA 4RL7A 1XNKA 3LCPA 5SV5A 4X8NA 5JCTA 1CPNA 2RS12 4ET7A 3AP9A 3N9NA 1F9KA 1W9SA 2XOMA 1WMFA 4BMBA 3T2TA 3NV2A 4P9XA 2JD9A 1ND2B 1NOVA 1DHKB 2WWUA 2Q8EA 2KR2A 2RHPA 2NMOA 3JD72 3EYPA 4S2FA 1W3XA 2C4XA 3MUZ1 1CONA 3MIFA 5JLVA 2RS11 1G9DA 4COZA 3GF6A 3MIEA 1XC6A 4R4XA 4DZGA 1IHMA 2ETEA 3JU9A 4R9BA 1RVF3 1AR73 3T4HB 3GDBA 1UO9A 4Q4V1 4FFIA 2I2SA 1QHDA 1ZA4A 3N7MA 5DAPA 5ISLA 5ABJA 3M2MA 3LF7A 2I74A 3J7NA 3O0VA 4P9IA 3VL8A 4OI0A 4INDA 5I0UA 2A6WA 3OCPA 1O7FA 3IBMA 4Y5SA 1EV12 3N7JA 3TRSB 1OHFA 5DZEA 4LKSA 3OBRA 3FHQA 2PAKA 2UWBA 1FMD3 2QJVA 2R073 2ATFA 2J42A 1AR63 1DYOA 1B35C 1YEWA 1EV11 2D6NA 1H0BA 4P5HA 4YNIA 5CFDA 3ZMNA 1J84A 2YUEA 4HK9A 1CX4A 5FYCA 4QX0A 1AX1A 2LM3A 4LBQA 4FPHA 4IETA 3ZM8A 4Q0VA 2XVKA 2Y6GA 1ST8A 3F95A 3MBWA 4QPIC 2AYHA 3UGGA 5FY9A 1W9YA 2EXHA 1Q3EA 5FP4A 2ZOEB 4K3UA 1NLSA 1LHUA 2RS32 3HAGA 3I59B 3OD4A 1U12A 3I3EA 1IOAA 2WQZC 1AR81 2FCVA 2ZMNA 2D5HA 1CIYA 5J7MA 2GAUA 4NOTA 4RHV2 2LROA 4MH0E 1MZ6A 3MGUA 1UXXX 4LXLA 1GWLA 4ZU4A 3ZDSA 1YQCA 4EZHA 5DUUA 5CFCB 4LUKA 1JTZX 3GZTB 3NAPA 3KF3A 3MZHA 4IE6A 1Q8QA 4TLFA 2ZJCA 4RHV1 5I91A 1A78A 3LD8A 2QQJA 3AJZA 3MIDA 5GZEA 1NLQA 1XU2A 5DG1A 1PZ7A 3O1UA 1H9PA 1WLWA 2DTYA 1O4YA 3JZVA 5GM0A 1GOHA 1SHWB 2ZMLA 4F83A 4LQRA 3FHAA 4ZZ8A 2YHJA 3T1MA 1LHVA 4KH9A 1WW5A 2GMMA 4MHUA 1CX1A 3SMHA 1AX2A 1BVP1 4ES9A 2PAMA 2VOVA 3OPWA 3K77A 1UZZA 1WWYA 2VULA 1ZM1A 5FY4A 3HMYA 3K2OA 5LY1A 2ADEA 1DYKA 4LBOA 1HDKA 2OIIA 1T6GC 4WZFA 5KXBA 5IK4A 5HCHA 2EALA 4XUPA 1WBLA 3LEKA 5D2AA 2E6VA 4AFBA 5A32A 1PVC2 3V0BA 4ISRA 3GXUA 4XFAA 2X09A 4JQRA 3B5LB 5FYMA 3GNEA 1VJ2A 3RYKA 5C8CB 3IIAA 1OA3A 5L9BA 2PFWA 5JPNB 2VBPA 3ENRA 3SITA 5JXIA 4QM8A 1PO22 1PVC1 3SCGA 3THPA 2VOWA 4GH4C 3VBRC 5KWRA 4MXWB 2DYCA 4IUGA 4LO8A 1UMZA 3WNXA 1NCRC 2CDPA 4QHOA 4CXYA 2BNOA 1ULDA 1W6NA 4TLGA 1PO21 4BLIA 3CU7A 4QXCA 4IEOA 5JOWA 2IXLA 2QQMA 2MPFA 2E51A 5CZKA 5LCWL 1LENA 1NA1C 4OHYA 4NPRA 1U5IA 3UKTA 2A6VA 4V2WA 5HCBA 4JGZC 1JYIA 2HH9A 5A1AA 2IUWA 4XJZA 4H2AA 4COUA 5L7OB 4IE0A 5BNQA 2NM1A 1N3OA 3KGZA 5FWEA 5C9AC 1UZ0A 2WO3A 3LEIA 3POIA 3WNOA 4KI5M 1W04A 1NXMA 3H9AA 3T30A 5CA6A 1C5HA 1MS3A 4XFGA 2P6CA 2ERFA 5JWPA 3R4SA 1JODA 5FXVA 3NJVA 1PX3A 5E16A 4ZKTB 4A2UA 1Q8SA 1GU3A 4AEJA 5AVAA 3J8F2 1UNBA 4RS5B 3MICA 2GH2A 5E88A 4V2VA 3JCIA 4M3CB 5C7GA 2J1TA 3TYJA 2BEOA 1ENQA 1ND3B 5FPZA 2DVDA 4MGZE 1RUC3 2RE9A 1ZRCA 3J8F1 1OFSA 3Q8EA 2YROA 3UK9A 4GJYA 3M4FA 2VE1A 2XR4A 2WZPP 5EJ3A 1KFXL 2J1EA 5FP9A 1O4TA 1WLCA 4LE3A 4L97A 4GWIA 1CAUA 1GUIA 1GSLA 5DUWA 1CZTA 1SACA 2YFZA 3NNLA 4MLOA 1MZ5A 4RA0A 2R16A 4BQ3A 1OH4A 4AVSA 1C5IA 2GC1A 5E6HA 4QU1A 4AE2A 2VNVA 3CLPA 5IHRA 1QXPA 5C71A 4FVVA 3E5XA 4O9EA 4L9BA 4XHXA 5APAA 4CCDA 4IEXA 4QX8A 3WDVA 4Y1VA 2QVSB 3IKWA 4AAXA 4IGOA 2J1RA 2W91A 3NKTA 4AW7A 2G19A 2VTFA 3C8XA 4XOGA 1RUH3 1RITA 3RI8A 3PUAA 1V6JA 2XDVA 3PNAA 2ENRA 1T6BX 1UD1A 1V0AA 2WT2A 1NX9A 5BNOC 4LT5A 5T55A 4XFCA 4X6RB 2VZQA 3I4IA 2D5FA 2DUPA 5FZAA 4Q0SA 3ST7A 1PHMA 3H3UA 3RYRA 1JYNA 2VZRA 5J3UA 4QX7A 4A3XA 4FI9A 1HLCA 1OMIA 2W87A 4JDMA 4M3CE 1ZA7A 1OPOA 1POV3 3TAYA 4ZU5A 3I2JA 5FP8A 1RXGA 3C7GA 5LA1A 3I59A 2UYBA 3WQ7A 3AKPA 3DEMA 3ZFEA 4CPBD 5C70A 1OH3A 5LZ6A 3E97A 1TNRA 4XQ4A 3IZOA 3ZPOA 3PVBB 4YW3A 5A70A 1RVF2 1AR72 2JDPA 1XXNA 4QQLA 1GOGA 2JEMA 3T08A 4GMP3 1IPKA 1XRUA 2I45A 5FK7A 2VZOA 3TOJA 3T09A 3VKFC 3WW1A 2ZGKA 3BTZA 2RJKA 3PUIA 4BOWA 4HBNA 5CFCA 3ZYIB 2W39A 3I2FA 2WZR3 3WDUA 1VRH3 4LIUA 1RVF1 1AR71 2YBKA 3Q8BA 2ZGQA 5JZGB 3ZN6A 4HXCA 3M3OA 3BPSA 3OBZA 1GZWA 4DRRA 3HQRA 4MVTA 4E27A 2BVBA 2TEPA 1QF3A 2ZZJA 3AZWA 1FMD2 3GHMA 3UESA 2R072 5A6QA 1HN1A 3OGSA 2UY9A 1W6PB 5CKMA
chains in the Genus database with same CATH topology
4AVTA 4YM1A 4FP2A 3URFA 2JJ6A 3I7DA 1XNCA 1ZX5A 3BIWE 3AK0A 1FMD1 4FTEA 2CAVA 2R071 1YNAA 1AR61 4EWEA 5CU1A 1VBE1 2JD4A 1FXZA 5BNNB 3TNPB 1JN2P 3ZFGC 1Y43B 3AFGA 2VQAA 3B3QE 2AH2A 1Q8OA 2ARBA 1N1SA 3N7KA 5C4WB 1ZZ7A 5C8CA 4CDXB 1LEDA 1APNA 1AR93 4WM8A 5T5OA 2ET7A 1RMU2 2GZWA 5JSRA 1GV9A 3RJ2X 1F31A 4LTAA 4K20A 1TE1B 2A3WA 4K21A 2WNVC 2XJVA 1CN1A 3AP5A 3FZ3A 3ZX7A 3WDWA 1RMU1 2VUAA 4WZCA 4BH9A 2Q4SA 3M3QA 4TYSA 1RUI3 1RGSA 1JH5A 3PJYA 3POSA 4DXZA 1CAXB 2OW4A 1FT9A 4OVEA 4YG0A 1XNBA 5L7OA 5F5QA 2XL7A 3CEWA 3L9JT 1AF9A 3IDEA 4GIQA 1YCIA 4YVSB 3MDPA 4HSLA 2XH6A 3RQ0A 1NLRA 3N4MA 4QM9A 5K0UB 5LEKA 2WNEA 3AP7A 1S1AA 2TNFA 4XJ9A 2UURA 3WP3A 4FO9A 4N53C 2PHTA 4XZPA 2W08A 2EAKA 1ZZ9A 4XMAA 4DFSA 4DS0A 1QJX3 3ZFFA 4Q8KA 4KGGA 4RQPC 4N9IA 1N1YA 1Y3TA 3NJZA 3GBWA 2EIGA 4KU7A 2AREA 1DDLA 5EV7A 3H50A 4M01A 3PMSA 4CDUC 1X36A 1UU6A 1PGL2 5T5JA 2X5IB 3WDXA 3D4KA 3K51A 1DF0A 1H8TC 1WUVA 2A70A 1OA2A 2ZX3A 4PJYA 1OD5A 3ROUA 5EWSA 1PGL1 2FZ1A 1W6QB 4AI0A 3O0WA 4LO7A 4XYXA 2DU0A 1YI7A 4UBHA 4WM7B 4Q4V3 1H9WA 4QXKA 5I8TA 2CGNA 4HT1T 5E1RA 3AB0A 1BVVA 4YW5A 4JV4A 5FQ0B 2V73A 3A0KA 3POWA 1KXGA 4IV3B 4K1ZA 4OUSA 4Z2WA 4BMEA 1RUC2 1LOFA 4UW3A 3ZYGA 1WCDJ 1F8VA 1H1MA 1S0FA 1W6MB 2JG8C 1RC6A 2NQYA 1PK6A 4K8FA 4DINB 4AEMA 1ZZ6A 2ZABA 2NLRA 4LNVA 4HN0A 4MGIE 2DTWA 4AVVA 2ZGNA 2DUQA 4HLTA 5GZCA 2PHXA 5J09A 1VR3A 1AR83 4E4DX 2GU9A 5KXEA 2JE9A 3V64A 5K9YA 3AZYA 4QPGA 4QQ2A 3IMNA 2PYTA 1RUE3 1MQTC 1E57A 1RUH2 1OPMA 3L2YA 1TNFA 3VN4A 4Q26A 3WG4A 1W6PA 2ES3A 4YVWC 3TBDA 1FV3A 2GNBA 1YYNA 5ABJB 1RIRA 1EP0A 1RUH1 4H3WA 2P2KA 4PIYA 2GALA 5I0RA 3CJIC 4UW6A 4H7MA 4XF1A 4AHWA 4C0BA 3FWEA 1AZDA 1DQ4A 1DU3D 1JBCA 1MS9A 3AXEA 5BNNA 4WBBA 1S0GA 2OZ6A 1CAWB 4PDWC 5BY5A 1PM7A 3GHNA 4N7IA 3KLSA 3QH6A 3O5SA 3QLQA 4IEWA 4IV1A 4PIXA 4CDXA 5CFDB 1BMV2 1U5ZA 2WSVA 3WVJA 4BZ4A 4E4SA 1RL3A 4Q29A 4ZXKA 1LHOA 4I0WB 1H2MA 4IEVA 1LOBA 4D94A 3WXPA 4R9AA 2W52A 1BMV1 4XJUA 4LLFA 4W65A 2WQ4A 2WZR2 1F5JA 1NQJA 4GXLA 4BCUA 1MS0A 3VBSB 4BQ1A 3OD0A 4GMP1 2KM2A 4ASMB 1W0OA 3LA2A 1PO23 5JI9A 2BWCA 2WZR1 4CDWB 1Q43A 4HVRA 3VDDC 2HWD3 4C0HA 1O3SA 2JENA 3CL1A 3L2HA 1G9FA 4A7KA 4FSJA 3AX4A 3FMGA 4M3CF 2D44A 5JVVA 4D7SA 5TSWA 1RUJ2 5GZGA 5KHIA 1RUF3 4Z07A 1QU0A 3O12A 4FPFA 4QT6A 3HT2A 5K0UA 2IXJA 4HSJA 4AF9A 2QE3A 3KT1A 2WNUC 2DCYA 1PO12 1Q8VA 1RUJ1 5JR7B 3ZXFA 1YLLA 2XKPA 3WZ1A 1OSGA 2C9AA 1KFUL 1D2SA 3N3HA 4FQZA 3X29B 4C91A 4Q0UA 1H1IA 1W6OB 2FQPA 1PO11 2XVLA 3H8UA 5DDJ3 2FBEA 3V0BB 4O9GA 2JX9A 1WD4A 2MEV3 2VNGA 4F8AA 1K5MC 2A6XA 5JSOA 1LOGA 1RUI2 3FBYA 1CVNA 4N43C 4WVMA 1RTVA 1VP6A 2ZKLA 1R093 1RINA 4YM0A 1DQ2A 1PGSA 1S0JA 1V6LA 2NP0A 4AK3A 1MVQA 4MZUA 1W6NB 1RUI1 3D6EA 2WC2A 4WM7A 3NAPC 1A3KA 1QQP1 1Q56A 4IXLA 2EVXA 4FP3A 4GKYA 2RR13 5FQ0A 5T5LA 2R1DA 4BM8A 1WA4A 4FPGA 5SV8A 2BFUS 3EO6A 1DG6A 4HVOA 3QD6A 2WL1A 2P17A 1VBA2 2WJSA 3WUDA 1QJX2 3AMQA 4CDQB 4S2GA 3HT1A 4JGYA 3LWCA 3WX5A 2VECA 4TWTA 3WCSA 1W6MA 4RR3B 1QJY3 1VBA1 1MS8A 3B7MA 1PNGA 1QJX1 3E6DA 5KXDA 4FT8A 4I0AA 4I09A 1UN1A 4AEDC 2VPVA 4X8PA 1UL9A 5FMOS 1MS5A 5J48A 1ULCA 3SH3A 4XDQA 4JTNA 5CNAA 4KBBA 1J1TA 2MNGA 3JB4C 3PLQA 4Q4V2 1CAUB 1D4M3 2WFPA 4AYUA 5DG2A 4CTEA 2QUOA 1FOD3 2YDEA 1V6KA 1XU1A 3J9SA 4EJRA 1DQ1A 1BBT1 4PF5A 4K40A 1GZ9A 2VH9A 4LO4B 3S30A 1ZBA3 1BK1A 4EN0A 3VBUB 1VLNA 1KJLA 5BYNA 3QH7A 3WCRA 1YHFA 3VBOC 4AI2A 2BTVC 3MW3A 1UAIA 3M70A 1CAWA 1HRI1 5C33A 3EJKA 2ZGOA 4IQPA 4EROA 1VBE3 2CNAA 1KITA 1HIXA 1SCRA 4OHVA 1QNYA 3LKJA 3OF1A 2B7YA 1AR82 1W2UA 4DOUA 4LO6B 5BNPB 2EAAA 1ZBE2 3DN7A 3ILNA 5D1IA 1C3HA 2Q5TA 4Y1UA 3WP5A 1ND2C 3D8CA 4FPKA 2UWAA 4LA3A 2D3PA 4KWKA 3VBSA 1MVEA 3ZXEA 2VOXA 1RUE2 3ZFEB 2LALA 3VBFA 2K0GA 3JQWA 2DCTA 1ZBE1 5GLWA 4OLLA 1RMU3 4XFFA 4CDWA 1FNZA 4FPLA 4LR4A 1KD7A 5HXVA 1SFNA 3W58A 1RUE1 4FBFA 2D6PA 4QX5A 3OYWB 1VBD3 4CEWA 5ACA2 3ZN6B 2WKKA 3SHRA 1WBFA 4KQ7A 1GZWB 2PAEA 1C8NA 2XWJB 1D2QA 4R9CA 4YZ1A 1CD3G 1LODA 4IL7A 1DBNA 5ACA1 2BYVE 3VGIA 1ZZCA 1V6IA 3KS7A 3E6CC 2R6QA 5H9RA 1LHWA 1W6OA 5E8AA 3RJRA 4JTOA 1UF2C 3VUOA 4DRVA 2VGDA 4FTBA 3OJBA 4BE3A 4AVBA 1Q8PA 4Y20A 1OOPA 3DV8A 3G6JB 4K6BA 4NHMA 4QD2A 3LSEA 3LAGA 2A5ZA 4AFAA 1RB8G 2YXSA 4WM8B 5I8SA 1X8EA 2TBVA 5CB7A 4FAGA 1AHSA 2JG9A 4YYOA 1YFYA 2HWD2 3AXDA 1JUIA 3RSJA 1UIKA 4ITCA 2GC2A 2HKXA 1QH7A 3OGGA 1LECA 2UYAA 5CFCC 4ZU7A 3KD4A 2FHRA 2HWD1 3ZIWA 1RUF2 2QNKA 4NN0A 1SLBA 1ZVFA 1U0AA 1FPN1 3FX3A 1MZEA 1QJU2 1G9AA 1VIWB 5JIAA 1J3QA 4R8HA 4I30A 2K2SA 5IT6A 1S0CA 1RUF1 2C5DA 2WS93 3AJYA 1X82A 4KU8A 3MLKA 4CDQA 4CEYB 1QJU1 2XGXA 1J3PA 2CV6A 3E5UA 1SBFA 4RR3A 5DDJ2 1CR7A 4YGCA 3M7AA 5EFUA 5JOXA 2YV8A 3WG2A 2PTMA 1ASJ3 2QKDA 4AVAA 2MEV2 2VVEA 3S7IA 4ASLA 2ZAAA 2BBVA 1NE4A 5DDJ1 5C8CC 2XJUA 3U11A 3ZFFB 2PHLA 5JOYA 2IXIA 3DF0A 3D0JA 1D0HA 1R092 4HMZA 2MEV1 1IS6A 1ZRRA 3CNAA 4YZ2A 3NL1A 2KA3A 3Q9OA 1AVBA 1R081 4P9GA 4N7UA 3IPVA 1XYNA 1AXKA 4CZSA 3AZVA 4OFGA 5L73A 1B35A 1R091 2RR12 3FJSA 5AFBA 1MEC2 5B2GB 2XVGA 2VMIA 4XTPA 1FV2A 1OLQA 4FOVA 1MZFA 4DY3A 4QPIA 3WY6A 2RR11 2ET1A 5L7OC 3H1MA 1MEC1 5GZDA 4EN9B 3VBUA 4JC1A 4MSVA 1OQ1A 4XPVA 2VMGA 1QJY2 3KQRA 3AYAA 3KT7A 5T52A 1GYKA 5T3NA 1A8MA 4B7KA 3FFZA 4RS5C 2IXCA 3FHIB 5BUVA 4FTSA 1DGWX 3B93A 3UL2A 1O3TA 1PZ9A 1QJY1 2ZX0A 4BIOA 5F1RA 1FX5A 1AX0A 3PHMA 2B8MA 4YW1A 1ND3C 3SXWA 1PK6B 5BNPA 5FPXA 1BQPA 4HZFA 1D4M2 2H0BA 2R0HA 3LB9A 1PNFA 1I1EA 1FOD2 4RGAA 3PVOA 4WVZA 4XETA 5A3MA 1SBEA 3BALA 4Q1RA 4AGGA 1DFQA 2LTNA 1NYWA 3HWJA 1D4M1 1LEMA 3UV9A 2CGPA 1VBB1 1EPZA 1O5LA 2G9GA 5CAZA 1QKQA 1FOD1 4LEJA 4UW5A 3BOWA 1NXD1 4K9SA 1ZBA2 2HYKA 2P3JA 3GBFA 3OYWA 2AGSA 4QPGB 2GNTA 3RNSA 1KDKA 1XE8A 3USUB 4HANA 5FLHA 5EZWA 4I2OA 4YZ3A 4GH4A 1HV0A 1ZBA1 1OI6A 3HQXA 2WA4A 3MYXA 2FMYA 1NCRA 4AHZA 3ZSLA 2D6KA 1VBE2 5IK8A 5DZFA 5H9SA 2F4PA 2NMNA 5GJ6A 5BXXA 2NZ9A 1PMIA 3AKSA 1GR3A 1RUJ3 1VALA 2X53S 2PELA 1SMVA 4I3PA 5KHKA 3WW3A 1NA1A 2XG3A 5EYXA 5CVRA 5J98B 1Y9QA 4AVCA 1DQ6A 1I6XA 1O5UA 1Z78A 3TN93 3ZYRA 4JDOA 2D43A 2A3YA 2D98A 5LEJA 4IEUA 2DFBA 4FPYA 1PO13 3R6SA 1B09A 2W68A 4IV1B 5F6KA 1NCQB 4IEQA 1AL21 5DZGA 2ZGPA 1R1A2 2PA7A 1O3QA 3EHKA 2G9FA 4L92A 4UBGA 3WG1A 1SFYA 1VBD2 4PQ9A 1R1A1 2DCZA 1DZQA 5JZGC 1RHI2 2DV9A 4ONUA 1G86A 1H8VA 1QDOA 2HEYF 2ZX1A 2NN8A 3DPRC 2D7FA 2NYYA 1VBD1 3BOPA 1QQP3 1GNHA 3K48A 4YGEA 4HETA 4WVWA 4B3NA 3RZZA 1RHI1 5KHJA 1COV3 1V9U1 2P37A 1S55A 4N90A 4CEYA 1YJKA 1IS3A 2XHKA 3RMYA 4HFSA 4KWLA 5KXCA 1FI2A 1UPSA 3MW2A 4EWAA 1HQWA 3RRDA 4MXVA 5JIUA 2XBO3 3RG0A 5BNNC 1YJLA 2B5HA 3D82A 1U5XA 3JBG3 1VBA3 4FPEA 1JHNA 5C4WC 2LUWA 1V6OA 4G3YC 4CDXC 2HWB3 3NO8A 2PHFA 4KG8A 2RM23 1JW6A 2G4IA 4QQHA 1DZTA 2FZ2A 1W39A 4LBKA 3ZO0B 5GLVA 3KCYA 4B29A 1ONAA 2A75A 4SBVA 4CP0A 4HL0A 5BNOA 5I0SA 5LRSA 3CO2A 2O1QA 2H6CA 4Q2FA 5IK7A 3IT8A 1R1ZA 4FOWA 2IZWA 4WVMB 2JG8B 2E7TA 4IEZA 4LBNA 2ILMA 1SBDA 2WS92 3UKNA 4YZ5A 2D40A 4Q0QA 1MACA 4AI8A 1RJ8A 1LULA 4J1XA 1UKRA 1GKBA 4OUMA 4YG3A 4YVSC 1BBT3 4FXKB 3WV6A 4BIFA 4YW2A 2UY8A 4JAAA 2WS91 3ZXKA 1IGOA 1YI9A 2DVFA 1AXYA 2BW8A 1ASJ2 2WSUA 2EA7A 2TUNA 3J4UH 4Y26A 4YM2A 1EAH2 2QCSB 4SLIA 1N3QA 2XLFA 5FO7B 3SLIA 1TME3 3KZ4C 4NO4A 4JGYB 3AMMA 1M06G 2WLPA 3U0ZA 1HRI3 2D3SA 2X8KA 1ASJ1 4K1YA 2IC1A 3KSCA 4PBPA 4AWDA 1EAH1 5KBFA 1HRV3 3ACLA 5GLTA 3AKRA 3ZXDA 4E2GA 4H14A 2YPJA 4PLNA 1EY2A 2QZ3A 2V09A 1PVXA 2DU1A 4XF3A 2R041 1AJKA 2X5IC 2CYFA 1QH6A 4ORFA 1VAVA 1KJRA 3KB5A 4XIKA 1Z0HA 1ZBE3 1ZRDA 1Z7S3 2RS51 3WR0A 3ELNA 1SLLA 2VVFA 2XLGA 1YIFA 2R30A 1FAYA 2IXKA 4WM7C 3USUA 4N9HA 4OHWA 3WDYA 3M3IA 4A7ZA 1YFWA 2JDZA 2Y0OA 2Q1MA 3AP6A 1N47A 1WW6A 3BCWA 2UWCA 3OGJA 4IV3C 4TZDA 3OBTA 3FUOA 1ULGA 3ZMOA 4MUVA 4MGKE 2ZGSA 5ACA3 2Z79A 4P9JA 4Y22A 2PLV3 1WCKA 4FAHA 2ZBJA 3S0MA 1LGNA 4G9SB 1UX6A 2WLQA 3H1WA 3M3CA 3VZNA 1O91A 4ATFA 1IS5A 1FATA 3WW4A 5FO9B 2D6OX 1NCQA 5JPMB 4YGBA 3VKMA 4XFBA