1SFYA

Crystal structure of recombinant erythrina corallodandron lectin
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
239
structure length
239
Chain Sequence
VETISFSFSEFEPGNDNLTLQGASLITQSGVLQLTKINQNGMPAWDSTGRTLYAKPVHIWDMTTGTVASFETRFSFSIEQPYTRPLPADGLVFFMGPTKSKPAQGYGYLGIFNNSKQDNSYQTLGVEFDTFSNQWDPPQVPHIGIDVNSIRSIKTQPFQLDNGQVANVVIKYDASSKLLHAVLVYPSSGAIYTIAEIVDVKQVLPEWVDVGLSGATGAQRDAAETHDVYSWSFQASLPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords Lectin
publication title Effect of glycosylation on the structure of Erythrina corallodendron lectin.
pubmed doi rcsb
source organism Erythrina corallodendron
total genus 52
structure length 239
sequence length 239
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2004-02-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1sfyA00
1G9FA 3PVEA 4YGBA 4U2AA 2TEPA 2BQPA 4XMIA 4P9WA 4ZXKA 1LHOA 1UL9A 5BYNA 5GLZA 4Q26A 3USUA 1BZWA 3FLTA 5IUQA 3FLPA 2R49A 1GSLA 3OBTA 1QMJA 2ARXA 1EPWA 4YM1A 1V6KA 1YI7A 2Q5TA 1GZCA 3WZ1A 4FVVA 1LOAA 1N3QA 1IS5A 2DURA 1GZ9A 2DU1A 1G9CA 1W0PA 4XYXA 1LOFA 2PHRA 1V6IA 3A4UA 5DZGA 2NN8A 4YW3A 3LSEA 2D6LX 3WG1A 1FX5A 3M3CA 4PBPA 2DVAA 1W6QB 4HL0A 4XDQA 4CRQA 1G86A 1Q8OA 5H9SA 1MVQA 1WCSA 1S0BA 4FPGA 3WUDA 1SCRA 3WVJA 1BJQA 2RHPA 4FPEA 1G8WA 4WVVA 5GZCA 3M2MA 3OY8B 4WVWA 2D43A 3ZXEA 2DV9A 5JOZA 3AP6A 2GALA 2D3SA 2PHXA 2ARBA 3ILNA 1HQLA 4XIKA 5GLWA 2NM1A 2G4IA 2A6WA 2WT2A 3ATGA 3ZSLA 2UWBA 1FYUA 3R05A 1JXNA 1MACA 3I4IA 5KXDA 1DQ0A 1Q8PA 1ULFA 1ULEA 2V73A 3OJBA 3AP4A 2GDFA 3LCPA 5GJ6A 2W52A 4YZ4A 3SH3A 4DQAA 4OZXA 4DRRA 3T2TA 2D44A 4UW6A 1A8DA 1N1YA 1QKQA 1VAMA 1YIFA 3OYWA 2VY0A 4XILA 1SBFA 1AX1A 1N1TA 2A75A 1JUIA 2PHFA 1OKQA 3N7MA 5JOWA 4FPCA 3M3QA 3I8TA 3MW3A 3WV6A 3WNXA 3ZXLA 1MS8A 1LOEA 5GALA 1GNHA 4LBOA 3IM0A 4FQ4A 3VKOA 1LOFC 4DS0A 1G9AA 4Y22A 2DVFA 4FPFA 4M01A 3QLQA 4XBLA 1HQWA 5JVVA 1APNA 3B00A 4YLZA 5GLTA 1LU2A 1WBFA 3PVNA 2R1DA 2AUYA 3AJYA 5LK5A 3ZVXA 1ENQA 1DIWA 4I30A 2ZKNA 4YFWA 4DRVA 1JOJA 1LU1A 4P9XA 3AK0A 2GNDA 4XJ9A 5E8AA 2JKBA 4AGVA 4GKXA 2ZHKA 1V6LA 4ATFA 2A3YA 3TB0A 3VKLA 2I2SA 4GA9A 1W6QA 1OFSA 5T5JA 2P37A 3APBA 3WDWA 3ZXKA 3WG2A 5IK4A 2A70A 5DZFA 4Y20B 3WHTA 4XBNA 2D6NA 1UZYA 3SNMA 1V6NA 3UJQA 2FMDA 4AVTA 1DLLA 2A6ZA 2ZMLA 1V6JA 3V64A 2YMZA 5EWSA 1BXHA 1WW5A 1LTEA 3NV1A 4Y26A 2YROA 3N36A 1ENRA 2ZA9A 2WJSA 3VV1A 2ENRA 4GALA 2ZGUA 3SISA 1FV2A 3KQRA 1N1SA 2E6VA 4BLIA 2PELA 4UW4A 4DFSA 1OQ1A 1KITA 4LBNA 4NO4A 1CVNA 3N35A 1FATA 4BMEA 1W0OA 3V0AA 4YM0A 2D3PA 4XJUA 3AFKA 1URXA 1WD3A 3Q9OA 1D0HA 1HLCA 1VIWB 1QU0A 4M00A 2JE7A 1BQPA 1FNYA 1R1ZA 2HYKA 2ZGPA 3FFZA 2AREA 5HCBA 1G9BA 2FHRA 4ATEA 1CPNA 5T55A 2WSUA 5H9PA 3WCRA 1IS4A 5IK8A 3IPVB 2NYYA 4M3CB 2WQZC 4M3CE 4Z8BA 3D6EA 3V0BA 3WOGA 2D6PA 2WKKA 2WNEA 1JW6A 1LGNA 2E7TA 1QDCA 3C2UA 2VH9A 1I3HA 4PF5A 3WUCA 2WLQA 4PBOA 3AZXA 2D3RA 3WHUA 3O0XA 1QF3A 4FOVA 3ZYRA 4Q8KA 4FPHA 3BIWE 2GMPA 2LALA 2VXRA 1GLHA 3O0WA 4R9BA 1YYNA 4XXPA 4YZ1A 1DQ2A 2EXKA 5DUWA 1DYKA 2UURA 2P3IA 3M3EA 4P14A 1CN1A 1UN1A 1KDMA 4FPLA 4Y24A 2PHUA 1N47A 4BOWA 3HMYA 2VUAA 1UPSA 1D2SA 3NV4A 4YG3A 5FREA 4Q8LA 3IMNA 4LBJA 5GM0A 3SH5A 1BYHA 2XG3A 5KXBA 2UWCA 1RITA 1ULDA 1C4RA 1JHNA 1MS0A 4R9DA 1S0CA 1WUVA 1Q8SA 5IK7A 1SLTA 1GICA 2R0FA 3A0KA 3AZVA 4GWNA 2DVDA 2OUHA 5CB7A 1CONA 1GZWA 1JYCA 1MR5A 2DTYA 4MYEA 5L73A 3AYDA 4FPKA 1NLSA 4ISRA 2A5ZA 1Y7BA 2SLIA 3TAYA 1CESA 1LECA 5T52A 2P3KA 5GZFA 1ZA4A 2YV8A 4YW1A 3GNEA 1DQ5A 1W6PB 4IQPA 4Q1PA 4K20A 1S0IA 1V6MA 5KXCA 5KXEA 4XHXA 2V5YA 1C57A 1JN2P 1O4YA 1W6OA 1WW4A 3O0VA 3VKFC 3W58A 4AYUA 3RS6A 4M3CA 4LBKA 1HKDA 1SLAA 1QNWA 3POWA 4GXLA 1U0AA 4LBQD 3POSA 1X50A 3WG4A 4BPZA 4YFZA 5H9RA 2H0BA 4BMBA 2GMEA 3ZSMA 1LENA 1W6MB 3D5OA 4KBBA 4AWDA 1I1EA 5DXDA 3T1LA 1AX0A 2EXJA 1WLCA 1V00A 2P2KA 1MVEA 3R4UA 4Y1VA 4SLIA 1DHKB 2W68A 1GBGA 1IKQA 3AZWA 1F31A 4AGGA 3W59A 3M3OA 3SLIA 3V65A 2E53A 2ZGSA 1UMZA 1DZQA 4FOQA 4CTEA 1S0FA 1DQ4A 2ZGOA 1HDKA 2AGSA 1LESA 4XJAA 2KM2A 4LBQB 3WDUA 1DGLA 3OY8A 1JBCA 1CQ9A 1CR7A 1Q8QA 2JJ6A 3WDTA 2W08A 2GN7A 3CNAA 1VLNA 1LEDA 1PZ7A 2CWMA 3RMYA 2EIGA 3AJZA 3NWKA 3RRDA 2ZBJA 3ZSKA 3D4KA 3POYA 2D6MA 2YXSA 4K21A 3USUB 1SLBA 5JMCA 1SBEA 2ZHMA 5CNAA 1DQ1A 5DUUA 2ZHNA 2OW4A 1QNYA 1AF9A 3N7KA 2XB6C 5GZDA 1W6PA 3FUQA 4UW3A 4YM2A 4YG6A 3B01A 3MW2A 4Y1ZA 3AX4A 2AR6A 4XIOA 2AH2A 1GYKA 1UAIA 2EAKA 4YGCA 5CBLA 1RIRA 3MPPG 4Y1XA 3ZSJA 1LOGA 3N3HA 1LGBA 1G9DA 2NMOA 3VUOA 4Y1UA 1MZ5A 3ILRA 2ZGQA 4W65A 1ULCA 1MZ6A 3B9CA 1O4ZA 2B7YA 2LTNA 1WLDA 1IS3A 5T50A 1MS4A 2R1BA 4XTMA 1LCLA 3ZYPA 4YGEA 1GANA 1IKPA 3PVOA 1B09A 2ZGRA 2A3XA 3AZYA 2ZGLA 3IKWA 5DUVA 4BQ1A 4DPNA 4YM3A 1GV9A 3ASIA 5H9QA 4AVVA 4WZFA 3NV2A 1UZZA 4XMAA 1VAVA 2ERFA 2D7FA 4GWMA 1AXKA 2ZZJA 1LODA 3AYCA 4LBLA 4WV8A 2W39A 4XJWA 5CAZA 5EYYA 5AVAA 1LEMA 4FOWA 3FBYA 1QGLA 2ZHLA 4XTPA 4YW4A 4FPOB 3BODA 4R9CA 1W6NB 1WW7A 2R16A 4YW5A 1KJLA 4Y20A 4M3CF 1DBNA 1WBLA 3O5SA 4LBQA 3IN9A 2CYFA 1TEIA 1C1LA 1SLIA 5T5OA 1J1TA 3AP9A 3L2YA 3N7JA 1IOAA 2CTVA 2D6KA 2A6VA 3AXDA 4XZPA 2ZGTA 1SLCA 3INAA 4FP2A 4FOYA 4Y22B 2PHWA 5FRAA 5T5LA 2DWRA 3DGTA 1AXZA 1A3KA 1MS1A 2ZGNA 4Y1YA 2CY6A 5EXOA 4FPJA 1DYPA 3PMEA 2EF6A 4F83A 4UW5A 1YO8A 4XBQA 2ZABA 4ITCA 1MS3A 2A3WA 1ENSA 5JOYA 1H30A 4JRAA 5HCFA 1FNZA 1SACA 4XXAA 2NP0A 3FLRA 1VALA 5IT6A 3WG3A 1XQNA 1N3OA 4LBMA 2DVBA 2EALA 3OBRA 2P3JA 2ZMNA 3FUOA 3VKNA 3OGGA 1NXD1 1SLLA 2PHTA 2D6OX 2GNTA 5GZGA 4ISQA 2WSVA 1QOSA 3T1MA 4BLJA 5T54A 5JLVA 2DVGA 1LULA 3ENRA 2ZACA 3BOPA 3MW4A 1AZDA 1AXYA 2E51A 1CPMA 5F9TA 4AVSA 1C1FA 3JUUA 2DTWA 1PZ8A 4RA0A 1JYIA 2A6XA 1DFQA 2ZMKA 3AP7A 3IPVA 1ULGA 3UK9A 4YG0A 3OPZA 1KDKA 4XOGA 5DZEA 5GLUA 5GLVA 1S1AA 4C1XA 2NZ9A 1WD4A 2EXIA 3R4SA 1Z78A 2CL2A 2OUJA 2GN3A 1F5FA 2JECA 1LOBA 1QOTA 1LHWA 4U36A 3WCSA 1UKGA 3LSDA 2ZGKA 1Q56A 1IS6A 3ZPYA 1SFYA 1KQRA 4JCKA 4Q1RA 3GALA 2C5DA 2WT1A 1LHNA 3QCWA 1W6NA 5CA6A 3B3QE 3V0AB 2CWSA 1MS5A 1S0EA 5SV8A 2AENA 5E89A 1BKZA 5EYXA 1LGCA 2SBAA 3U4XA 4YZ5A 4K1YA 2A6YA 2WT0A 5E88A 3UJOA 2YZ4A 4TZDA 1KRIA 1G7YA 1KJRA 1AX2A 4BM8A 2ES3A 4XHBA 2UWAA 2DU0A 3UL2A 3ZXFA 2R0HA 1WLWA 3ILFA 2ZGMA 3VKMA 4YZ2A 5GZEA 1FAYA 1FV3A 1RINA 4GKYA 4YW2A 3WDYA 4ZKTB 2EXHA 3V0BB 3O12A 2ZAAA 2DUQA 5JOXA 4HANA 1PZ9A 2Z42A 2C9AA 3RSJA 1S0DA 1LOCA 1DQ6A 2DYCA 1S0JA 2GNMA 2OVUA 3AP5A 3M1HA 4ASMB 5T5PA 1WW6A 2A71A 3SH4A 4RL7A 4XJZA 1GNZA 3RG0A 3WDXA 3KM5A 4NOTA 4AGRA 5DG2A 3AYAA 1AJOA 1Q8VA 1H9WA 1GKBA 3WDVA 2NMNA 2VW0A 1N1VA 2AYHA 2UU8A 2VW1A 3HR9A 3RQ0A 1SBDA 2E7QA 3AZZA 2A7AA 1AJKA 5IK5A 1UX6A 3BTAA 1S0GA 4Q27A 2DUPA 4L8QA 4Q2FA 1CJPA 1MS9A 2P34A 1H9PA 1F9KA 4R9AA 3AXEA 4P9YA 3H0OA 1LHUA 4YGDA 5DG1A 1QDOA 1W6MA 1ONAA 2VU9A 4JC1A 4PQ9A 1GZWB 5DUXA 2JE9A 1ZM1A 4FPYA 3NV3A 1Z0HA 2DUOA 1LHVA 2JD4A 1A78A 2JDZA 1CIWA 4C1WA 4XE9A 4CZSA 2GMMA 1QOOA 4H55A 1N3PA 1YXWA 3RMXA 5HCAA 1AVBA 4K1ZA 4FP3A 4TYSA 4XJ8A 3B69A 2VW2A 3AYEA 3OYWB 5F5QA 2YY1A 3HN1A 4YZ3A 4FQZA 4PCRA 1LJ7A 3N7LA 1YRZA 3WLUA 1W6OB 3DUIA 4D69A 1SCSA 2CNAA 3JU9A 3PJQA 3A0NA 3MEPA 3ZXJA 1V6OA 5JDBA 3SITA 2GNBA
chains in the Genus database with same CATH superfamily
1CAWB 1G9FA 5ABJA 3ORJA 3MV01 3NL1A 2QQKA 5DAXA 4YGBA 2QCSB 5LB6A 2TEPA 4FFHA 3VDDA 1Y9MA 4P9WA 1W28A 2IXKA 5GLZA 1WCQA 3FLTA 3PUSA 4K9SA 5A33A 3DL3A 4FAGA 1J59A 2ARXA 1EPWA 2IWGB 4ZPIA 1YI7A 3H3LA 5FJHA 3QACA 4IE5A 3SMHA 5ACA2 3BALA 2VR4A 2VZOA 2V5DA 4BE3A 4COUA 5BNOA 2JG8B 4XYXA 2VUJA 5K4LA 1XBFA 1V6IA 1ZBA3 3A4UA 3WG1A 2D6LX 3KV4A 1FX5A 2HJIA 3A22A 3N9LA 4HL0A 1W6QB 3NO8A 4EN0A 4QKBA 1IHMA 1WCSA 2WL1A 3JQXA 1RVF1 1Q3EA 1SCRA 3WVJA 1BJQA 2RHPA 4FPEA 2FCTA 4ZZ8A 1JHJA 4DEVA 5GZCA 4PLNA 2VOWA 5LA0A 3KVAA 4GJZA 2EIDA 5FY8A 3MDPA 1K5MC 4MUVA 3ILNA 5GLWA 2QJVA 2NM1A 3DYOA 1NCRB 2VVDA 4H14A 2PLV1 2UWBA 5J1XA 4M0NA 4NJ4A 1FYUA 3R05A 4N53A 3I4IA 3LE0A 3S7EA 1ULEA 2V73A 3AP4A 5A6YA 5DDJ3 1C8M3 4R4XA 5GJ6A 2HWD1 4HFSA 4YZ4A 5CIRA 5FZ0A 4NIIA 1ZVFA 3SH3A 4A6OA 1HV0A 4OZXA 3VDDC 4DRRA 4NRMA 4UFHA 1VBC2 1N1YA 1XNKA 1WCDJ 2XGXA 4XILA 1BBT2 1AX1A 2WDBA 3RNSA 1JUIA 1WLTA 4HG6B 2Z5WA 1QY4A 4LOTA 5AVPA 4XUOA 4YVSB 1RC6A 2JD9A 1AR81 4XCBA 4FPCA 5JOWA 1GWKA 4GJYA 3WNXA 1MS8A 1ZBE2 5BNOC 2Q8EA 3LFIA 4J1XA 4DS0A 4AVBA 3ACLA 3T4VA 4FAHA 3ME2A 4XBLA 3QLQA 1HQWA 4ZS2A 1YQCA 3B00A 3KWVA 4YLZA 5GLTA 2YC4A 4CYDA 4JAAA 4RYDA 1WBFA 3PVNA 5FXWA 3DPRB 1DIWA 1PGW1 5EFUA 3VLBB 4E9KA 3TEYA 5APAA 5L7OB 2FCUA 2JG8A 3DKQA 3AK0A 5FJKA 4MGTA 2GNDA 4XJ9A 2Y0IA 2JKBA 4NIHA 2DCYA 1PM7A 1V6LA 4IV1B 4HK8A 2VCBA 5CZKA 1FPN2 3U14A 1CX1A 4IV3B 1W6QA 1Y4WA 3KZ4C 2FD8A 3D82A 3JD73 1NCQB 2R043 4N53C 1X9PA 5F8PA 4CCCA 4CCMA 1RUH3 4LJHA 3WHTA 1POV0 2D6NA 3LEGA 3SNMA 4AI0A 2Y26A 3VZJA 5ISLA 3LOBA 1CX4A 1W0NA 3BGAA 4GB33 1AHSA 4AI8A 2O8OA 5A3WA 1V6JA 4I0BA 5EWSA 1SPPA 1BXHA 1DLCA 1UD1A 2EA7A 2YPJA 1L3JA 4AI1A 5F32A 1W8WA 3N36A 3F95A 2ZA9A 1O3TA 2H6CA 1WCKA 1AR91 3OD4A 2VC9A 1NA1B 4P02B 4GALA 2ZGUA 3SISA 1N1SA 2E6VA 1VBC3 4D7SA 3LKJA 1ZREA 4DFSA 2R6QA 3ZMOA 1DDLA 4CP9A 4O9EA 1CVNA 2ZX1A 4AK3A 3NQHA 3PVBB 5ERLA 4XJUA 2PXJA 1X8MA 3ZXAC 5LA1A 5J36A 4IEXA 4URAA 1YFUA 2IXCA 3GDBA 4YVSA 4R52A 1AUYA 1O4TA 2HYKA 2JG8C 3GZTB 4ZS3A 4NVPA 1HXS1 4FFIA 5FZDA 2FHRA 4A3ZA 3AM2A 3J7LA 5EV7A 3VZLA 1CPNA 1PIV2 1GU3A 1UY2A 2NLRA 3E5UA 3IPVB 2ZXQA 4K8RB 5FZ8A 4JVAA 3TEWA 3DYMA 4Q4X2 4IUGA 4OQ8A 2A73B 2VMFA 3VBUB 2WYFA 1VJ2A 4BYYA 5L7OA 2VH9A 3I2IA 4KWUA 4PF5A 4Z1VA 2FDFA 2B39A 4PI0A 3F2ZA 5LY2A 5BNNA 5KR7A 1W05A 3PLQA 3WHUA 1XE0A 1QF3A 3MUY1 4IV3A 4TWTA 5LBCA 1JZ3A 4OMCA 1NCQA 4JV4A 3BIWE 2V72A 2GMPA 4MLOA 5FUIA 4Q8KA 2VE1A 3O0WA 3UKNA 2YYOA 1COV3 1TNRA 3DEMA 4XXPA 4YZ1A 5DQ0A 1ZZCA 2HYXA 3BU7A 5IATA 4NHXA 2ILMA 3KCXA 4Y24A 4A4AA 3K75B 3BCWA 2PHUA 1N47A 1W8OA 3EBRA 4XACA 3WT3A 4BOWA 1SMVA 2VUDA 3ETPA 3IMNA 4LBJA 3SH5A 1RUD3 4D6RA 2UWCA 5D8AB 1ZRFA 5FXXA 1C4RA 1JHNA 4YVSC 1MS0A 3MIHA 4R9DA 1S0CA 3HN3A 5A3UA 3NW4A 3HNBM 3C3VA 1SLTA 4GWNA 2DBNA 4AFCA 2MNGA 1UOGA 1OOPB 2XLGA 5DMYA 1JYCA 1MR5A 2BWAA 5HXMA 1A34A 4S2FA 4FPKA 2JEMA 1OBNA 4QXHA 2BGPA 4HPKB 5CYYA 4OI1A 3B5LB 4NPMA 4AEKA 4JGZB 3RFRA 3CU7A 4MGYE 1ZA4A 4QPWA 4X6QB 3GNEA 1DQ5A 5FZ9A 1W6PB 5HCHA 1ZRCA 4HN1A 5L7OC 4OMDA 2RS11 3ZYBA 2AEZA 5KXCA 4DXSA 1PO12 4EWDA 4CPBD 4YNIA 4AYUA 1JN2P 1O4YA 1W6OA 4IV3C 3NJXA 5KHHA 4XFCA 5HV0A 1QHDA 1NCQC 4Q4X3 4LBKA 4NHKA 4DB5A 2LROA 4EN9B 2P6CA 3THDA 3POWA 4LBQD 2QZ2A 1WWYA 1DGWA 1UPIA 4YFZA 1C5IA 5H9RA 5F5CA 3CKHA 3PHMA 3URFA 2GMEA 2BGCA 3ZSMA 3WEZA 1OA2A 2XH6A 5A7WA 5DXDA 3SEPA 3LEKA 2IZWA 4COWA 4CXXA 5FZIA 4W8JA 4NIAA 1WLCA 1ZZ7A 4Y1VA 1MVEA 2WFF2 2XHKA 4K7JA 1GBGA 1RUF2 4HSLA 1F31A 2PAMA 1GP5A 3SLIA 3ZXGA 2E53A 5EIYB 4A44A 1DZQA 2W1UA 3PIGA 4Y3OA 5LRSA 2QQVA 1R092 1S0FA 1ZX5A 4QXBA 2E9QA 1HDKA 4ZONA 2ZZQA 2WC2A 1OI6A 4XJAA 5D8AA 5JWPA 1JBCA 1CQ9A 3ELNA 3LD8A 5A1FA 1Q8QA 4Q4W2 2O1QA 4D3WA 5C5UA 1FOD1 2W08A 1VLNA 4LNVA 4META 3NWKA 1HRI1 5FPBA 4A45A 3ZSKA 3D4KA 3VD9A 1JZ2A 2CGNA 2YXSA 5EJ1B 2WS92 3USUB 1W90A 4B3NA 4CDQA 5JMCA 3SHRA 5CNAA 3I3MA 4N90A 1ODNA 2V4AA 3KS7A 4BB3A 4YARA 1E57A 4DY3A 4KQ7A 4JGZA 4NPLA 3N7KA 1PVC1 2XB6C 1W6PA 1OT5A 2YHJA 3AKPA 1W8NA 2VZRA 3POIA 4YVWB 5FYUA 2E26A 1POV1 4Y1ZA 4XIOA 2AR6A 4HZFA 5LA9A 5CBLA 1GYKA 3W5NA 3MPPG 3ZSJA 5LEJA 4LHLA 1LOGA 5I8TA 3N3HA 4HKWA 4CP2A 1PK6B 2YGLA 4Y1UA 3ZFGB 3C7EA 4EN7B 2ZGQA 1ULCA 3OUIA 1MZ6A 2VTXJ 4L97A 2QQPA 2B7YA 4GKYA 3VD5A 4LE4A 3C7FA 5A32B 5T50A 4D6SA 1R082 2D5FA 1GANA 1SDWA 4CUGA 1UOJA 1AR61 2B45X 4WM7B 4F3JA 2ZGRA 3AZYA 3MLKA 4G9SB 4DPNA 5BNPB 5HPOA 3KHCA 4A41A 3U11A 5JAXA 2WFF3 3NV2A 1UZZA 4XMAA 3UESA 1MPXA 2YC0A 3J26N 1VAVA 2ERFA 1JTZX 1V70A 3B93A 4Q29A 3AYCA 5DUXA 5D8AC 5CAZA 4W6WA 4ORFA 5AVAA 1W9TA 2PAKA 1IPKA 2WNUA 4FFGA 2W0XA 5A3LA 3H42B 1JZ4A 3FBYA 1QGLA 4FXGB 2RJ2A 3KQ4B 4UFIA 1BMV2 4XTPA 4YW4A 2BTVC 2HBTA 5FZHA 4CDQC 2IVJA 2XQXA 2ZPXA 3AKSA 4TLGA 3V56A 4X6RB 3QH7A 2R16A 4YW5A 3HVDA 5FO8B 4M3CF 4EYUA 1DBNA 1OKOA 3O5SA 2R072 2X10A 4JGZC 2CYFA 1TEIA 4QHOA 2HWE2 3FFQA 1UIJA 3AP9A 3GHNA 1WCUA 2BVVA 3L2YA 3N7JA 4I0WB 2ARAA 2D6KA 3FE5A 2A6VA 3AXDA 4IERA 2WS93 1OVSA 4CUCA 3O1MA 4ZXEA 1A3KA 4KH9A 2ZGNA 3OEBA 4XC9A 4Y1YA 4CCOA 4C91A 4NIGA 1CZTA 3AKRA 2HWD2 2EF6A 3CLPA 4UW5A 4B4QA 2R062 2VAUA 4BQ3A 1GP6A 2ZABA 4ITCA 4WZCA 4K6BA 2PMWB 1H30A 5HCFA 1UIKA 4XXAA 1VALA 1XNAA 1XPWA 5CKNA 1F5JA 1H4GA 1J3PA 5FZ6A 4P5YA 5FOJB 2J1AA 2JICA 2DCTA 1NXD1 1SLLA 4BCUA 4BXSV 1AR82 1IGOA 4QX0A 4UT5A 3ZIXA 1O3QA 2WA4A 4ISQA 1QXRA 2OPWA 2X5IA 2PN5A 2W1QA 5ACA1 2WNVB 1LULA 2R32A 2WNUC 3S6PA 3ENRA 4NHYA 3BOPA 3MW4A 1UYZA 1RUI2 3G7DA 1HJGA 1DGRN 4A7KA 4QGNA 3T09A 4LKFA 5I93A 2I45A 1PZ8A 3KCCA 4E2GA 1JYIA 3H7YA 2WLPA 1DFQA 5FZ7A 2ZMKA 3AL6A 4M0HA 5BNPA 1PGW2 4RGGA 3OPZA 1PVXA 3IDBB 4QPIB 5DZEA 3SEEA 5GLUA 3S0MA 1S1AA 3LOIA 2GU9A 1FI2A 2CL2A 2W91A 4LEJA 3WCSA 4C0HA 1RVF3 3E6BA 1E5SA 1PO22 2XL9A 5FYZA 5FMOS 2I74A 1SFYA 1KQRA 4JCKA 4Q1RA 4ZU7A 5KC5A 4Q0PA 4I02A 3C8XA 5CA6A 4LO7A 1X9TA 2CWSA 2JDNA 1W39A 3KT7A 1JOBA 4CDUB 2VPVA 5G05L 1S0EA 5SV8A 3U4SA 1BKZA 1MQTA 4I01A 4YYOA 2PLV3 2Y6FA 4PJYA 4RS5B 4ARXA 4YZ5A 3U4XA 1UMIA 4AEJA 5FLHA 2WT0A 3UJOA 3ZR5A 2K2SA 1G7YA 1KJRA 2J1EA 2MEV1 4JGYA 1EY2A 5FZ1A 1ND3B 5C71A 3UL2A 3ZFEB 1KD7A 2R0HA 1REEA 1WLWA 2HH9A 2UYBA 3C7GA 2HWD3 3VKMA 2JB8A 5CVRA 3ZKUA 3ZOIA 1PK6C 4KBZA 4CCLA 2L9LA 4MGIE 1BBT1 1FAYA 4GIQA 2X5IC 3CZJA 4QKFA 4DNYA 4YW2A 1TME2 1XSQA 2XQRA 5AC92 1JOPA 1W8HA 2ZAAA 2DUQA 5FP8A 5KHKA 2RM22 1U5YA 1ZBE1 1PZ9A 3DKWA 2VNRA 5LBFA 5LBEA 2Z42A 2F6BA 1AR83 5BNPC 4XQDA 1DQ6A 2B42B 2QTWB 1S0JA 2OVUA 3CZUA 4QM9A 4ASMB 3VHNA 4OUMA 2WNVA 4RL7A 4Y5Z0 4HXCA 3FZ3A 4Q0QA 5FY7A 2HBUA 3RG0A 4E8DA 5F3GA 2Q0AA 5DG2A 3AYAA 3UETA 1AJOA 3VD4A 1H9WA 4Y33A 3WF2A 3HQRA 4AAPA 4ET7A 2VW0A 5F6LB 3C7HA 4IGPA 3ZMNA 1D0GA 1FPN1 1RB8G 3RQ0A 1UU4A 2E7QA 3PUHA 1AJKA 2OPKA 3W9AA 1PMJX 5FPZA 1MQTC 2TBVA 2DUPA 1UNBA 4I09A 2JE8A 4Q2FA 3UKTA 4JKKA 4EZHA 3AXEA 3BOWA 2OT7A 4J6GA 4XDPA 5JXJA 1W6MA 2WA3A 4JGYC 3GF6A 4FPYA 1EV11 3NV3A 3IZOA 5FZOA 1CIWA 1OURA 4CZSA 5J98B 1XNCA 1OFNA 4C8DA 5K7PA 5C70A 1UY0A 2WO3A 3B02A 4RS5A 1V9U2 4LUKA 4OVEA 5HI0A 5F5AA 5C3PA 2C1FA 3ZN6B 4TYSA 1XC6A 2VW2A 1AR93 4CEWB 4PCRA 1ND3A 3O1UA 3ZFEA 2BVBA 4EJRA 4B29A 4HKOA 2CNAA 3JU9A 2KXLA 3A0NA 3ZXJA 5JDBA 5A3TA 4NE9A 2WNVC 3PVEA 3RVHA 2CGOA 4JX0A 1AYM2 5IVYA 4JQRA 2Q8DA 4XMIA 1O5LA 4OLLA 4ZXKA 1LHOA 3B94A 1MEC1 4Q26A 3POJA 4NHMA 4L0PA 3QD6A 5FK8A 3WP5A 3KV9A 1NY72 1PIV1 3OGSA 1V6KA 5JIUA 2Q5TA 2V09A 3ZM8A 1OH4A 1BK0A 1GZCA 1HXS3 3WZ1A 4FVVA 2E33A 4EN6B 2KR2A 3NKGA 1G9CA 2PFWA 3SCFA 2PHRA 1I9RA 3LWCA 1W03A 3M3CA 4PBPA 4LA2A 1OF4A 4XDQA 4CRQA 4LIVA 1Q8OA 2W46A 2YBPA 5BXXA 3LA2A 2JKXA 2CSGA 3U1XA 4TN7A 1XU2A 1ASJ2 3MI8A 4WVWA 1UYXA 1HJFA 5FYMA 4RS5C 3ZXEA 5JOZA 2Q8CA 2GALA 3MO4A 4XIKA 3MIBA 4E2SA 3WNNA 1D4M1 4AFAA 5F2SA 1ND3C 3ZN4A 2VCCA 3ZFEC 5JZGB 3KT4A 4KG8A 1JXNA 4PLOA 5A7PA 1EAH2 3KMHA 5CKQA 1ZRDA 1Q8PA 1ULFA 5FUPA 4PF1A 4GWJA 2GDFA 5FQ0A 2W52A 3VDAA 1GFF2 3NMBA 4DQAA 1NQJA 4XFGA 3ZN6A 2D44A 4UW6A 5FIXA 4W4ZA 5JR7B 1NOVA 3GCXA 3I54A 4CEWA 5A3PA 2O8QA 4HN0A 1IZ3A 1SBFA 2GH8A 1N1TA 2UY8A 1W2UA 3U0ZA 2PHFA 4DXTA 4P9LA 3VHPA 2Y38A 1X36A 4Q0UA 4AHYA 3RPQA 3K4ZA 1VBE2 3RYPA 1CIYA 3ACGA 2D40A 3VKOA 3IM0A 5CU1A 2RG4A 1WMDA 4Y22A 3LA7A 4P9IA 1PO11 1YJKA 4G3YC 5JXGA 4HONA 1EUUA 2VOKA 2RS13 2BFUS 4M4RA 2R1DA 2AUYA 3AJYA 5LK5A 3ZVXA 1PNFA 2OZ6A 4FFFA 4YFWA 4HK9A 1XYNA 1M06G 4I2OA 1JOJA 1LU1A 1KS5A 3WF3A 1BCXA 3FWEA 3LDBA 1NKGA 4AAXA 4RFRB 3C7OA 3DCQA 2ZHKA 3PL0A 3FC0A 4BIFA 1RUG2 2P37A 4UYBA 3SQOA 3B9IA 4QU1A 3BTZA 1KEXA 1Y9QA 1L7QA 4N9IA 1XYPA 4BJ0A 3VDBA 5CG9A 1DZRA 4H7LA 5DZFA 1ASJ3 3K4DA 3T2OA 1XRUA 1UZYA 2WFF1 4BDVB 3H50A 4YSFA 3UJQA 4BQXA 1AR62 4X8PA 2VCMA 5F3CA 3K3NA 4XAAA 3KHBA 1RUF1 1NLQA 3BN6A 1ULPA 4IEWA 2P1BA 1F4HA 2VOVA 4MHUA 3O1SA 4CEWC 4OFGA 3NV1A 1R091 4LOSA 1ZRIA 4MSVA 3I2FA 4QM8A 2WJSA 1I5PA 2RE9A 4AVAA 5JSRA 5FMOL 2PA7A 2BZDA 4FSJA 1OUSA 4PT6A 4A3XA 4Q4W1 4NAMA 2PELA 2BP6A 1GQHA 2WAAA 1KITA 4YPJA 3T0AA 2OX0A 5HV4A 2CV6A 2RVAA 3LDRA 3N35A 1R64A 1W0OA 1FOD3 2RS31 3I2KA 2QQLA 4QX5A 1VE0A 2WZR2 1POQA 1YQ2A 3RWKX 3BYWA 1QU0A 5EZWA 2GAUA 3VBFB 3PUAA 2ZGPA 5I8SA 2QQOA 4JKLA 5HCBA 1G9BA 1XE8A 2UYAA 1SG3A 4Z92B 4XUPA 5FYCA 3TNQA 1UKRA 5BY5A 1PVC3 3WCRA 3D8CA 3RI8A 5IK8A 4JHZA 2QZ3A 3MUZ1 2RJLA 4BK4A 4Z8BA 1POV3 1T6BX 1D4VB 4NWVA 2D6PA 2WKKA 5I0DA 1LGNA 1QDCA 3C2UA 1I3HA 4CSWA 3AFGA 3HEIA 1R081 1RUG3 4H2AA 4IEYA 4RR3A 3LPFA 1CWPA 1C28A 3POFA 1GWLA 3ZYRA 1W8FA 3RWNA 2VL4A 1YCIA 3Q8BA 2WO7A 5K0UB 3HWJA 4E8CA 1K12A 3KV5A 3NNFA 3MIEA 1AR63 1QIQA 2EXKA 4GWIA 3LA3A 1DYKA 4O61A 2P3IA 5CFCA 3M3EA 1CN1A 5HBAA 1KDMA 3HNYM 3N9OA 3THTA 3K51A 1QJX2 5A7NA 4NIDA 2VUAA 1BMV1 4RSUA 1S55A 5DAWA 5KXBA 4UF0A 2IXLA 4QX1A 5FDBA 2R071 2HWE1 1AL0G 1UZ0A 3A0KA 1AR72 2R0FA 2OUHA 4IGOA 3RZJA 1J58A 2BERA 3HT1A 4LORA 1QJEA 3PNAA 4ISRA 2A5ZA 1Y7BA 5FXVA 1LECA 1VB2A 5T52A 4WBBA 1QQP2 4XURA 1OLMA 2A1XA 1EYBA 1UY3A 5EJ3A 4AF9A 5CISA 5IVFA 2R061 4K20A 2MEV2 3BTXA 3VBFA 3ZSEA 1I6XA 1ZZ6A 2LRPA 5KXEA 1A8MA 1DCSA 3OG2A 4RR3C 4XHXA 4DO0A 1C57A 1WW4A 4JDOA 4OZOA 1OA3A 5FK7A 2Y6HA 4CU8A 4UI9L 2Z2SB 3KGZA 4UBHA 4QDSA 1HKDA 1KFXL 4CUBA 1OQDA 1U0AA 3PMSA 1O8PA 3LGRA 4XFBA 3VL9A 1C8NA 1CAWA 3POSA 2FMYA 5B4NA 3QH6A 1U5ZA 4IGQA 5CFCC 3TN92 2XL7A 2J1RA 3EHKA 1OQEA 4AFBA 3D5OA 1RUI1 4AQ2A 1H6XA 1ZZ9A 3T1LA 5ACA3 2JENA 1H8TB 1SDDB 2E7AA 1H8VA 4GAZA 4OI2A 2GC1A 2P2KA 4SLIA 5K9YA 3NRUA 4BH9A 3G6JB 1IKQA 2WRAA 5JSPA 4I0AA 4QB6A 4TLFA 5SV5A 3AZWA 3WQ1A 4AFMA 3H3UA 3M3OA 2HWC2 2Y0OA 3V65A 1QJU2 2VZ3A 1PO21 2V4VA 3LEIA 4BQYA 4FOQA 2TUNA 5FY5A 5DAPA 4XFAA 1H2NA 1QXJA 1BK1A 1DQ4A 2ZGOA 3ZDVA 3H8XA 2AGSA 4QX3A 5DPNA 3TRSB 3WDUA 4D8MA 1DGLA 2IUWA 4QQLA 1J83A 1CR7A 4LE3A 2QUOA 2JJ6A 2BNNA 3ZLIA 3VBFC 3B7MA 3ZR6A 2CWMA 2WQ4A 1NCRA 1EV12 2ZBJA 1VRH2 2JDMA 3POYA 1HX6A 4B4RA 1H6YA 1SLBA 1PM4A 3JB4C 2BUKA 2Q1ZB 2BV4A 2K0GA 1QQP3 5DUUA 1LR5A 3H1MA 1PNGA 4COZA 4JDMA 3RJRA 5FP3A 2MEV3 4FT8A 2VBBA 5I91A 3R4DB 1ND2B 3ABZA 1TME1 4YG6A 5AC91 2QQIA 1BBT3 1FXZA 2RM21 1ZA7A 3ZYFA 4Y1XA 5AFEA 1LGBA 1QH6A 1MZ5A 1RJ8A 2YU2A 1ZBE3 3OEAA 3B9CA 3VZMA 2LTNA 5AFBA 1MEC2 1IS3A 1RMU2 2XJQA 1MS4A 4QX8A 2R1BA 4R8HA 1LCLA 4N43B 4XTMA 4YGEA 3M8LA 1IKPA 1KXGA 2YB7A 5DUVA 4YM3A 2BFUL 4HBNA 3E97A 1H8TA 3D3AA 3JBG1 4WZFA 1OVPA 3DPRA 3MIGA 1RUE2 2WYSA 1GZTA 2D7FA 4GWMA 1DP0A 4LBLA 4WV8A 3ZX7A 1X82A 5FPVA 5EYYA 5A1LA 3I2OA 1FPN3 1LEMA 3O1RA 2WFPA 1QJU3 3OUJA 3LB9A 1RUJ2 4IV1A 4QDQA 2BU9A 1NCRC 1M4WA 3IMMA 4V2VA 5KC6A 2YC2A 2XUEA 1NX9A 3BODA 4HSJA 2OS2A 1W6NB 1TMF2 1UQXA 1KJLA 4IEQA 1JZ7A 4KU8A 2G19A 3WW4A 3IN9A 4LO6B 4GH4B 4LIUA 2WNOA 5T5OA 1OLRA 4Q4Y2 5FV3A 1EV13 3FN9A 1D4M2 4IETA 1VP6A 5JPNB 1VRH3 2CTVA 1ZNPA 3JZVA 1V9U1 4XZPA 3U10A 2W87A 3INAA 3HPNA 4FOYA 3DGTA 2MPFA 3PJYA 4KWKA 3AVSA 1WA6X 4FPJA 2DCJA 1NA1A 1STMA 2J7MA 2Y64A 3CHXA 3I3DA 3OB8A 4CP1A 3AKTA 3CJXA 1FNZA 1SACA 5FLIA 3M3IA 4HOOA 4AZZA 1XQNA 1AYM1 2G9FA 4XF3A 1WA4A 2WINB 1YFYA 2QBXA 5CADA 1GQPA 1H8TC 4LO8A 4CUAA 1NY71 3VBSB 3DPRC 1P8JA 2CAVA 5F2WA 4LA3A 5FZCA 1MEC3 5T54A 3SC7X 2RMU2 5JLVA 5FY9A 1S2BA 1Z7S2 5D2AA 1PIV3 1LB2A 2ZACA 1BEV2 2ET7A 4IV1C 1AZDA 4N43A 5LCWL 4AW7A 4AVSA 1C1FA 3JUUA 4QT6A 2IXIA 1GOHA 3IPVA 3AP7A 4PDWB 5EJZB 3UK9A 3H1YA 1RUE3 1KDKA 1H2KA 3OF1A 3N9PA 2VZTA 4JTNA 2MHFA 2NZ9A 2EXIA 3VBUA 1Z78A 1E5HA 1IQDC 4HKLA 2DFCA 2VNVA 1LHWA 1TE1B 4J1WA 2CU5A 1ASJ1 4LITA 2ZGKA 1Q56A 2W3JA 2FDJA 2BOJA 4HVQA 4PI2A 5K8SA 1FT9A 3GALA 2VZ1A 2C5DA 4LR4A 3CJIB 3QCWA 3ROUA 1W6NA 3B3QE 4QMAA 3V0AB 1WMXA 1NA1C 4MXWB 1EAH1 4QPGB 3CBNA 1D4M3 1ODMA 5L19A 1ND2C 2P3YA 2A6YA 2JG9B 5J09A 3PU8A 5IWFA 4XABA 3J4UH 3ZFFB 2C6SA 1VBA1 4IE4A 3P5BA 2RDRA 3FMGA 2DU0A 2IFRA 3ILFA 3N4MA 2ZGMA 4XFHA 2XVKA 4CDXB 1WZXA 4HLTA 3VD3A 3WDYA 1XB9A 3V0BB 1RXFA 3H8RA 4FTBA 3O12A 1E5IA 1H4HA 2F17A 4LPLA 4E4DX 1VBE1 5LZ6A 1O3SA 4HANA 1OOPA 4N43C 1ST8A 3OUHA 1LNSA 4H3WA 2RS32 1UY4A 2WIIB 4B1MA 1LOCA 4HPKA 2WZ8A 3TWIA 1Y43B 1VMJA 2DYCA 5T3NA 3AP5A 3M1HA 3VBSA 4BXFA 3HQXA 4AQSA 1YQ5A 2Y6LA 5FKCA 3VBUC 3R0RA 1WW6A 1PO13 3SH4A 1S4CA 1GNZA 3KM5A 3AMQA 3I97A 1Q8VA 2LM3A 1GKBA 3GBGA 1N1VA 4PDWA 3VBOB 5KBFA 4BU2A 3HD8B 1RUG1 3AZZA 2A7AA 2WUHA 2Z79A 1UX6A 3ZYGA 1GQGA 2PHDA 4GH4C 4L8QA 4ES8A 2P34A 1VBB2 3MBWA 4YRDA 1LHUA 4KI5M 1QDOA 5DG1A 1NE4A 2XR4A 2ID4A 4PQ9A 1AL22 1GZWB 4AVCA 3O1OA 2PAEA 3O14A 5L36A 4NRQA 4XFIA 2DUOA 2JD4A 4B8EA 2VO5A 1UYPA 3LEMA 1RUF3 5FR3A 5I8YA 4N9HA 2J22A 4MXWA 1ZZBA 3E6DA 2O14A 3J9SA 4XFFA 4XZUG 5J7MA 5HCAA 2JG9A 1AVBA 1OOPC 1R093 4Z82A 4FP3A 2Z69A 3PTRB 2H0VA 3EO6A 1NZCA 2C0ZA 3HN1A 3OYWB 4IEVA 2YGMA 1GMMA 3RZGA 3E1F1 1QJY2 4Q4W3 3VBSC 1O8SA 3PJQA 5CEHA 3MEPA 4OHXA 1V6OA 2ZX2A 2GZWA 4AFDA 2WZR1 3KB5A 4RFT0 1JH5A 2RS33 3JCIA 2RDQA 5BYNA 4BISA 3USUA 2G9GA 1H1AA 2R49A 5L9BA 3OBTA 4KNCA 1SFPA 3RZZA 4PDWC 1NYWA 2WZPP 4PQQA 2VZSA 2XONA 2XJTA 4LQRA 5IVBA 4A6SA 1LOAA 2DURA 4MOAA 1HRV2 2GC2A 3ZXDA 1X7NA 5GKAC 4YVWA 5F6KA 4CDWB 3WY6A 1W0PA 4R4ZA 1H2LA 4UFLA 5LATA 4UFKA 1W8ZA 2YBSA 4YW3A 5ANQA 4JDNA 5FYVA 2C24A 5A70A 2FDHA 4MVTA 1G86A 1PK6A 1PGL2 1S0BA 2QE3A 3ZFGA 1F8VA 3D0SA 1G8WA 2YFUA 4WVVA 3IAQA 1R083 2R30A 3M2MA 5FZ4A 3OY8B 4QPGC 2D43A 3VZOA 2DV9A 5A32A 1HQNA 1WGPA 2Y60A 1UZWA 2JG9C 2HEVF 2D3SA 4HETA 2PHXA 4WM7A 1TQ5A 2G4IA 2A6WA 2WT2A 3ATGA 3OGJA 2BNMA 5A6QA 1CAVB 4AHWA 1E5RA 2VMHA 2YDEA 1QJX1 1UOBA 5KXDA 2G1MA 4CDXC 1RUNA 4ONUA 4QX2A 3OJBA 3U75A 4NRPA 3P3NA 5A7QA 2XVGA 4NHLA 5D21A 3IDCB 4IEOA 3T2TA 4E2QA 4JZRA 2RV9A 3SITA 1AR71 4XUTA 1YIFA 4BQ4A 1DG6A 3OYWA 3Q8CA 5IJRA 1C3HA 3WF1A 2VY0A 2R073 4D7TA 2JDYA 3GZAA 1CJDA 2A75A 2HWE3 1SFNA 2HWF1 3I2DA 3I59B 4L11A 4DXZA 5C3SA 3RGBA 3M3QA 1QQP1 4YVWC 4AEMA 1LOEA 1GNHA 4LBOA 1NXMA 1YLLA 5HXVA 2DVFA 3GXUA 4M01A 1F4AA 1APNA 3ACFA 1NE6A 2R063 3ZFGC 4KWJA 4LKDA 1EUTA 1JYTA 1RUC2 2P5BA 3EB7A 1ENQA 3OBZA 4I30A 2ZKNA 4KGQA 5JMOA 2ETEA 4DRVA 4UFJA 4P9XA 4O65A 1WMFA 5E8AA 4GKXA 4QDRA 4YW6A 4WM7C 3FHIB 5LRRA 2A3YA 3TB0A 3TN91 3VKLA 5T5JA 1OFSA 5EP9A 4RGKA 2AEYA 2XXZA 3APBA 3WDWA 3WP6A 2FDKA 3ZXKA 3WG2A 1YEWA 1SHWB 3J7NA 2VVEA 4LHSA 3K2OA 4Y20B 4YW7A 4TXWA 4XBNA 2F4PA 1RUI3 1V6NA 2ZEYA 1QEXA 3U78A 2BRTA 1DLLA 4GD4A 4MO3M 3T2QA 3VN4A 3WQBA 4F8AA 4LLFA 4TTGA 5CG8A 3V64A 3JBG2 3OBAA 5IVEA 4P5HA 1JYXA 2HWC1 1QJU1 4S2GA 4OHWA 1CAVA 1VB4A 5IHRA 4QPIA 5F3EA 4Y26A 3SXWA 2YROA 1ENRA 2GC3A 2IVIB 2QQNA 3LIHA 3M70A 5C3OA 1PO23 3VV1A 4LXLA 3NAPB 2VULA 2ENRA 4XF1A 4AOCA 3BI3A 4UXAA 3CO2A 3HAGA 4Y4YA 2XJRA 4UW4A 5IVCA 4LBNA 2VNGA 1FMD2 3H3ZA 5F1RA 1VRH1 1O3RA 4FTEA 1FATA 2VNOA 2VOTA 4CDUA 4YM0A 4ZZ5A 2IXJA 4QU2A 3BU0A 1URXA 3NNMA 2ZTNA 3Q9OA 2D98A 1OLME 1HLCA 4M00A 1BQPA 4NAOA 1R1ZA 3FFZA 1OPOA 2AREA 5CKMA 3VBRB 2BYVE 4AHXA 4CP0A 4QD2A 3DXTA 1UYYA 4L9BA 4ATEA 5T55A 1GUIA 2IXHA 2WSUA 3MLJA 1IS4A 4B1LA 4IEPA 4M3CB 1TME3 2WQZC 2ADDA 4NPRA 5AC93 5I0SA 3D6EA 2W1SA 4DINB 3NVCA 2RM23 1XU1A 2WNEA 3U07A 3GZEA 1JW6A 3BIEA 3RZKA 1J84A 1T2XA 5FLJA 3WUCA 3MF6A 1RMU1 4XDOA 3GHMA 4PBOA 5FZ3A 4BIOA 3AZXA 3QBQA 2WABA 5C4WB 4WVMB 3O0XA 4FOVA 1OD3A 2FDIA 4FPHA 4QPIC 1UF2C 2LALA 1SZBA 1GLHA 3GYDA 3ZIWA 2HEWF 1RUE1 2LUWA 5DUWA 4OULA 3H1WA 1JZ6A 3CQOA 1REFA 2FZ1A 3JBG3 1RHI2 4FPLA 5FAXA 1RUJ1 3LZZA 3PUQA 4B4PA 1ACCA 3HMYA 1ZRRA 1UPSA 1D2SA 2RDSA 4YG3A 2ZX0A 4QPYA 4CDUC 5A3OA 3FBMA 3WNMA 5GM0A 3CL1A 3LFMA 3PUIA 1TMF1 2ARCA 2RS52 3UKVA 2TNFA 2OXBA 1RGSA 3A7QA 3NKTA 2XBO1 2JX9A 5C9AB 4F7ZA 3AZVA 4Q4Y1 1NZIA 3J8F1 2DVDA 2VZVA 5FZFA 5CB7A 1CONA 2J1UA 4MYEA 5L73A 5FXZA 4B7KA 4OI4A 2H6BA 5LASA 2DF7A 1NLSA 1DGRA 3N9MA 5FPUA 3AMNA 2SLIA 1CESA 5C8WA 3UNPA 4DMIA 1R1A2 1V9U3 1GP4A 5GZFA 4YW1A 4IQPA 4HT1T 1VBA2 3VGIA 4WM8B 2GH2A 3MIDA 4L99A 3ZDSA 3VBRA 4K40A 4MGZE 3KCYA 2I07B 2KA3A 3O0VA 3VKFC 3W5MA 1VMFA 3HIFA 2JB4A 3PDQA 2W1WA 4M3CA 3RS6A 4EV0A 3GBFA 2YU1A 1SLAA 4D94A 1AYM3 2RMU1 2WQ8A 1SEFA 1Z7S1 2PTMA 4UWDA 5A80A 1BEV1 2JDKA 1I1EA 4IESA 4AWDA 2ADEA 2B5HA 2RR12 4NUBA 3RYRA 4WVMA 4MGKE 1CAUB 1AX0A 2EXJA 1GOFA 2JDPA 1V00A 5FKBA 5LWBA 3DF0A 2D5HA 3HJRA 3K4AA 4OUEA 4XQWA 5KHGA 2EICA 2XKPA 4LO4B 1K5MB 2DBIA 3PU3A 2VQTA 2ZGSA 4CU6A 1CAXB 1QJZA 3POEA 4OYUA 3MPBA 3ZYHA 4CTEA 4CXYA 2BOIA 2PQSA 3IDEA 4IW3A 2YG0A 3CIHA 1LESA 2CHHA 4LBQB 4OHZA 2JIGA 3WDTA 3FL7A 3CNAA 4XETA 5FZAA 2CGPA 4AI2A 1LEDA 3RMYA 2X05A 3VBRC 2EIGA 1OSGA 2D6MA 1EAH3 4QXCA 4K21A 5JXHA 4QHBA 4FO9A 5JZGA 3KF3A 4INDA 1XE7A 2ZHNA 1JYVA 1AF9A 1VBA3 2WAOA 5I0TA 3SCHA 3FUQA 4UW3A 1LAJA 2ATFA 4YM2A 3AX4A 2ZX4A 2AH2A 2EAKA 3ZYJB 1ZBA2 2XMLA 2VJXA 4O9GA 3TBDA 3MV11 5FPLA 1U5IA 1VBE3 2NMOA 3I2HA 3VUOA 4W65A 4LK7A 1O91A 1HV1A 1O4ZA 2N7GA 3Q8AA 1WLDA 3LPGA 4ZHNA 5DN2A 2WN3A 1O59A 3IIIA 5JCTA 5KHJA 3I2GA 5IFPA 1G6NA 4XPVA 3PVOA 5BV6A 1B09A 1VBD1 3IKWA 3KLSA 3O7OA 4UOJA 1GV9A 4AVVA 2W95A 4N53B 1XNTA 4DOUA 2ZZJA 1LODA 1XOYA 1AYN2 3P1IA 5CFDB 4PIYA 3ZYIB 4B7EA 3E6CC 1VBB1 3M7AA 1C8M2 5DDJ2 3LAGA 5BUVA 1CD3G 1CAXA 2Y6JA 4C0BA 5JZGC 4KMQA 5FYYA 1AL21 4W50A 4LK6A 2W2IA 2X8KA 3UGGA 1WBLA 4KG0A 2WR9A 5FTTC 4LBQA 5BNQA 3LQCA 1BVVA 1C1LA 1SLIA 4JTOA 4MXVA 1IOAA 1W06A 2ZGTA 1SLCA 2VZQA 5T5LA 2PHWA 1XSRA 2DWRA 4O7XA 1AXZA 3MFAA 3M4FA 3TEXA 1MS1A 5JPMB 3WXPA 5J48A 3RZLA 4CCDA 1DYPA 1HN1A 1HN0A 2DDUA 2X29A 1QJY1 2WZEA 1W8TA 4EZ4A 1JYWA 2W5FA 1MS3A 5JOYA 2OIIA 3OSDA 3GGLA 1K42A 4AI9A 1U5XA 3K46A 5IT6A 2JDHA 1LKNA 2HWF2 4LBMA 3OBRA 2EALA 2HWB1 2P3JA 3FUOA 2GC0A 3DYPA 2WZR3 5FP7A 5FY4A 2OQ6A 2PHTA 2QQMA 5DAVA 2OKXA 2WSVA 4CE8A 4CCEA 2Q1FA 3T1MA 3KV6A 3JD72 4HMZA 2R042 3LF7A 3PIJA 1B35B 4GMP0 4JHTA 4QQOA 2DVGA 1HRV1 4XUQA 1RUH2 3WD5A 2E51A 4AEDB 3WNLA 1CZSA 4DUXA 5IYYA 2WWUA 4OCTA 2DTWA 4RA0A 4GB32 1RTVA 3JB8A 1ULGA 1SPPB 2ZJCA 1PGL1 5B2GB 4XOGA 3MF9A 5GLVA 1AYN3 5L9VA 2XJUA 5FZBA 2OUJA 1F5FA 5FUNA 4Y5SA 1QOTA 5CFDA 4QXKA 4G4FA 2VQ0A 4QKDA 1W9WA 3WQ0A 1PX4A 4XAEA 1TZOA 2QDNA 2WT1A 4JRLA 4DY5A 1Y3TA 4CP9B 5A6XA 5K0UA 1UY1A 1YWKA 3SKJE 2VM9A 2XOMA 2J1TA 5J96B 5FZMA 1MS5A 4XF9A 2DCZA 4WVZA 2GSYA 3SCGA 1YC61 3BKZA 5JSOA 4K1YA 1QJX3 5FY0A 3TEZA 5JIAA 3WW3A 2BW8A 1KRIA 1AX2A 2ES3A 4XHBA 2UWAA 1PGSA 3ZXFA 2IC1A 3I7DA 1KS4A 2Y34A 5EQUA 1FV3A 1RINA 1AR73 1JODA 2FQPA 2QFEA 2EXHA 2VD7A 3DECA 3ES4A 4XVHA 1F2NA 2R7EB 2HWF3 2OA2A 2HKXA 3HQUA 4COYA 3HT2A 3J7MA 4NWWA 4ZU5A 1IPJA 2XWBB 1XXNA 1UW8A 4NROA 1F35A 5BNNB 1S0DA 1VRBA 2VXJA 4AR2A 4BWOA 2GNMA 2PHLA 5FFOC 4XEZA 3ACHA 3N9QA 1OD5A 1RUC1 4P08A 2FZ2A 3TYJA 1ULOA 4CCNA 5T5PA 4CCJA 2KD7A 1H1MA 1B35A 5CFDC 4LULA 4XJZA 1COV2 2VCAA 3VB9A 3WDXA 1UWWA 1V0AA 4AGRA 4AEDA 3WDVA 5FPAA 3UGHA 3FJSA 3T4HB 2CDOA 3P6BA 4PHZA 5J37A 2AYHA 3H8UA 4LO5B 2DFBA 4IEUA 3OCPA 4URTA 1SBDA 5K0UC 4L92A 1YQ8A 1YUDA 2O0OA 5FY1A 3DN7A 3TN93 4Q27A 2VMCA 4LHKA 1RUD2 2RJKA 1H9PA 1F9KA 4R9AA 5FZKA 3R6SA 2P6HA 3E5QA 5B4XA 1EPZA 2Y8KA 1HW5A 1TG7A 4LLOA 1W9YA 2C9KA 2RDNA 3THPA 1RJ7A 1ZM1A 1Z0HA 5EHDA 1LHVA 1YHFA 1XNDA 4C1WA 2GMMA 1QOOA 4H55A 4EQVA 1J1LA 2HWC3 1N3PA 3NJYA 3PTYA 3IAPA 4X8NA 5A1AA 1MZFA 2XLFA 1YXWA 2VVFA 4UFMA 4IE7A 3MIFA 3ON7A 2YY1A 4YZ3A 3Q8FA 1X33A 1LJ7A 2ZEXA 1YRZA 4FXKB 1FMD1 4NN0A 1W6OB 4D69A 1SCSA 3WINE 2YUEA 2XBO2 2VTFA 1JMUB 1GWMA 3J8F2 1OHFA 2GNBA 4FCAA 4XCAA 1B35C 1W8UA 5FCCA 4LHNA 4QQ2A 4K8FA 4U2AA 2FCVA 2BQPA 1RXGA 3T30A 2W47A 4CCKA 1TVGA 1UL9A 4AEDC 2BPA2 1W99A 1BZWA 5IUQA 3FLPA 4Q5OA 1GSLA 5A7WB 1QMJA 4YM1A 3NNGA 4LMFA 4HVRA 1W9FA 4W6YA 1N3QA 3WQ7A 1IS5A 4BK5A 1RL3A 4BQ2A 1ND2A 2OQ7A 1GZ9A 2DU1A 5E6HA 3P3PA 3HNMA 3RZHA 1LOFA 5JUVA 5DZGA 2NN8A 4IE6A 3LSEA 3ES1A 5F39A 3W20A 2DVAA 4AL9A 1BLZA 3KF5A 4I3PA 4AQTA 2D97A 1K3IA 1MVQA 5H9SA 4FPGA 5C3QA 3I49A 3WUDA 2B4KA 1RMU3 4IE0A 4BA6A 4AE2A 5TSWA 5F5IA 3AP6A 5FBJA 5C7GA 3MICA 1JZ8A 1Q43A 2ARBA 4QGLA 1HQLA 3U37A 2WO1A 1RHI1 1JUHA 2F4LA 3ZSLA 2E63A 5A3NA 4CDQB 1J3QA 1UZVA 5JR2A 1MACA 2XJPA 2FBEA 4H7MA 4AXOA 1DQ0A 2ZCWA 5FOBB 1RUJ3 3DXUA 2RS51 3LCPA 2PQQA 1UXZA 4N7UA 3VHRA 5E16A 3KD4A 3L9JT 4GMP1 3MLLA 3AKQA 5FZEA 1TMF3 4N8MA 1A8DA 4MGSA 1QKQA 1VAMA 3VZKA 4IL7A 1US3A 1S2KA 1OF3A 2VZPA 3IDAA 2XBO3 3VHOA 4EN8B 1NAEA 5BNNC 5IVVA 1K45A 1OKQA 4Q4V2 3J8F3 4Q4Y3 4GH4A 4GZ9A 3GJBA 4LKSA 5I0RA 3N7MA 1R1A1 3I8TA 3MW3A 3WV6A 3ZXLA 2ZEWA 2ZAHA 2XJVA 5GALA 2P17A 3ITQA 1BHGA 4FQ4A 5JI7A 1Y9GA 1LOFC 1G9AA 2QKDA 4CU7A 3IBMA 3DV8A 4P00B 4RHV1 4FPFA 4MX3A 1S2EA 5D1IA 5JVVA 4AQ6A 1US2A 5L9RA 2VUCA 1LU2A 3I2JA 5FWEA 2Y33A 4MHRA 3KGLA 3BTYA 3T0BA 4QQPA 5LA2A 1YJLA 2WNUB 2Q4SA 4AGVA 4K3UA 4D0QA 2B9VA 5M0TA 4KL1A 4ATFA 3OGRA 4E4HA 2I2SA 4GA9A 4GQ7A 4TSVA 2QNKA 2RR11 1UO9A 3NNJA 2RMU3 4QX7A 3J7HA 4AHZA 4DUWA 1Z7S3 5IK4A 1PHMA 1YNAA 2A70A 1O5UA 4QB1A 3AMPA 4MG2A 1BEV3 1UOFA 2JXAA 2FMDA 3K3OA 4AVTA 4OI0A 1VBD2 2A6ZA 2ZMLA 4PIZA 1YQ6A 4MH0E 2YMZA 3GCWA 3WNKA 2VG9A 3WNPA 2VBDA 3RZMA 1D7PM 4I3GA 1WW5A 1LTEA 3MZHA 5DABA 3WP4A 5JXIA 3KSCA 1H2MA 2EVXA 2YPDA 3BPSA 1HB4A 4XUNA 2HEYF 1DU3D 3RJ2X 4QHZA 1DGWX 1FV2A 3KQRA 3WSOA 4BLIA 1XNBA 3ALQA 1OQ1A 4E4ZA 1L7LA 1GR3A 3CJIA 4NO4A 4A42A 5KHIA 1JU4A 4BMEA 3V0AA 3EMRA 1DF0A 4Q4V3 2D3PA 3CMGA 5JI9A 3AFKA 4DUVA 1WD3A 1MZEA 3GZUC 4QPGA 4ZY9A 1D0HA 2X5IB 1L7RA 1VIWB 1W2NA 3VDCA 2JE7A 4W6XA 1FNYA 3JQWA 4OUSA 5BPXA 2ORZA 3X29B 3ZFFA 5FYSA 2Y6GA 3WF4A 5IW0A 5H9PA 5FPXA 1UU6A 2QQJA 2NYYA 5FMBA 1ZBA1 4CDXA 4S2DA 4M3CE 1OLQA 4MGQA 4RN5A 5C3RA 3V0BA 3WOGA 2EAAA 4Q0VA 4D7YA 2PYTA 1NLRA 3EYPA 2E7TA 4E4SA 2HWB2 1YIPA 3CDZB 2WLQA 4NR1A 2WN2A 3THCA 2D3RA 2P4EA 1RVF2 2WWJA 5FP9A 1JU3A 1C5HA 1JZ5A 2VXRA 4R9BA 4V1PA 1YYNA 1DQ2A 2DCKA 2IFWA 2VQUA 2JDUA 4OQ9A 1VBD3 2UURA 1MQTB 5A7OA 1AYN1 4P14A 4LKEA 1UN1A 2PLV2 3GM8A 3POBA 5DDJ1 1C8M1 3CJIC 3VBOA 4JGYB 2VECA 3MYXA 5FREA 3NV4A 2LS6A 2BBVA 1QWRA 4Q8LA 1I5ZA 1UU5A 1BYHA 2XG3A 1VBB3 1RITA 1ULDA 1OPMA 5EPAA 5FYTA 1PX3A 1XJAA 3I3EA 2XDVA 3MGUA 5FYBA 1WUVA 1Q8SA 1AL23 1DYOA 5IK7A 1F15A 1GICA 3ZFFC 4KGGA 3MFCA 4JKMA 1GZWA 1W2AX 2B46X 2DTYA 3AYDA 3WR0A 1REDA 4QB2A 4BHPA 2BDRA 3T08A 3TAYA 5FMCA 1NT0A 1PMHX 4QQHA 1H1IA 2P3KA 1JYNA 2YV8A 4BQWA 2OYZA 1HIXA 2BNOA 2C26A 3NSTA 4Q1PA 2VBPA 2VTXA 2W92A 3ZKYA 4CVUA 1XYOA 1S0IA 5ABJC 5IVJA 1V6MA 3HOBA 4E27A 3BVCA 3H7JA 1QJY3 2V5YA 2YFZA 3W58A 3K48A 2QQUA 5LEKA 3PURA 5F37A 1OA4A 4DEQA 4Z2WA 3A21A 4IXLA 1QNWA 3Q8EA 4GXLA 3AB0A 2XWJB 2HWB3 2D93A 1X50A 3JD71 3AMHA 2NQYA 2R041 3WG4A 3WX5A 4BPZA 2H0BA 1X8EA 2UY9A 2X09A 4BMBA 1RUH1 2AC1A 5FZGA 1LENA 1W6MB 1W2OA 2ORXA 4KBBA 4CEYB 4MADA 3VBOC 5IAXA 4GB31 1HRV3 3R4UA 2ZKLA 5FZOB 1DHKB 2VZUA 1OC1A 4CDWA 2W68A 2X53S 2BJSA 3NJZA 5ANNA 3EXUA 2Z4FA 4AGGA 3W59A 4EE2A 3H9AA 4J25A 2CAUA 5LW9A 1UMZA 3UV9A 5C8CB 4YWAA 3FX3A 5FYIA 4IEZA 5C33A 1LRHA 1VBC1 1AR92 5C6CA 2KM2A 3OY8A 2VMIA 4M4PA 2GN7A 1HB2A 2BGOA 1PZ7A 4PLMA 3AJZA 2AACA 3OTFA 3RRDA 5FWJA 2JWPA 5G04L 5I0UA 2XKOA 2QDRA 1SBEA 2ZHMA 4C90A 1DQ1A 1YFWA 1TNFA 4DIQA 1EP0A 2OW4A 2XPJA 1H0BA 2VMEA 1QNYA 3GBWA 4RQPB 4QAWA 5GZDA 3W21A 4JQTA 1HXS2 4OHVA 4V2WA 1WMEA 5A3MA 3B01A 3MW2A 3O1PA 4XF0A 4AI3A 1JI6A 1IQAA 1UAIA 4COVA 4YGCA 3BUCA 1RIRA 3A23A 2W94A 4QKNA 3ACIA 4XF4A 4L2NA 4UAPA 1G9DA 4P9GA 3I59A 1NQDA 2ZS6B 3ILRA 3POGA 4ASLA 3VZNA 2K9ZA 3EJKA 3S30A 3KVBA 3ECQA 4CDWC 2CDPA 1UXXX 2WWSA 3ZYPA 4Y5TA 4CU9A 2J1SA 1COV1 1A6CA 3I3QA 1RUC3 3RYKA 2A3XA 4BQ1A 1NUKA 2EIEA 2ZGLA 3EQEA 4CEYA 1SQ4A 3ASIA 5H9QA 3RI9A 1CGPA 2W9XA 1KFUL 1ZZ8A 1AXKA 3IB3A 3QOPA 4XJWA 5E1RA 3WW1A 2W39A 4RGAA 2VOXA 4A7YA 1J3RA 4KWLA 2C4XA 4FOWA 4Z07A 5FQ0B 1RUD1 2ZHLA 2ZOEB 2E32A 1U12A 3SKVA 5IFTA 1VAKA 4FPOB 5C8CA 4EROA 3ZN5A 4HVOA 5FYHA 3ST7A 4R9CA 1PMIA 1WW7A 3FHAA 4XQ4A 5IAVA 4Y20A 3I3BA 4EWAA 2XHNA 2B9UA 3N9NA 4D6QA 2Y6KA 5A7SA 1J1TA 2BEOA 5F3IA 2EIBA 3NJVA 1VR3A 1K5JA 4FP2A 4Y22B 4EWEA 4SBVA 3JXSA 1QH7A 5FRAA 3K77A 1ZYBA 3IWZA 2VMDA 2CY6A 5EXOA 1T6GC 3PMEA 3IIAA 4F83A 3S5QA 1YO8A 3NAPA 3VL8A 4XBQA 2E31A 2ET1A 4RQPA 3T0DA 2A3WA 1ENSA 2RS12 2XJSA 4IDZA 4JRAA 3VBHB 1FMD3 3HBZA 4Q4X1 1KGYA 3TNPB 2NP0A 3FLRA 2BBAA 3WG3A 1N3OA 1IPSA 4GULA 3T2PA 3IT8A 3UT0A 3S5AA 1W3XA 2DVBA 2AZ5A 2ZMNA 3ETQA 3VKNA 5J3UA 3OGGA 1IG0A 2ZEZA 4CEYC 4CXWA 4P9JA 2D6OX 2GNTA 5GZGA 2QQWA 4AG4A 1QOSA 1D2QA 2J1VA 1QJFA 4MV2A 4A7ZA 1NG0A 1UX7A 4RHV2 1RUOA 5FMDA 2ZX3A 1AXYA 1QXPA 1CPMA 2XUMA 4MZUA 2HLEA 5F9TA 5FP4A 1OXCA 2JDAA 5C8CC 2A6XA 4A2UA 3O1VA 2JIJA 3S7IA 4YG0A 3OGVA 2FDGA 2NPIA 3FHQA 4C1XA 1OMIA 1WD4A 3R4SA 3RDIA 1W04A 4U36A 2GN3A 2JECA 2J42A 1LOBA 1O6UA 2Q8OA 3TOJA 4BQ5A 1UKGA 3D0JA 2LW8A 3LSDA 3O1TA 4NMIA 4CA9A 3VD7A 1IS6A 3ZPYA 1HB3A 5C4WA 5A6ZA 5LK7B 1GOGA 1LHNA 1Q5OA 1W3VA 2Q1MA 1UCXA 1BVP1 1VPHA 4FI9A 3NAPC 2XVLA 1RHI3 2AENA 4Y4RA 5E89A 1FOD2 1LGCA 2SBAA 4RQPC 2B8MA 5EYXA 3UYJA 4PIXA 5LBBA 1HRI2 3WNOA 5E88A 3E5XA 3CF6E 2QVSB 1WKYA 2YBKA 2YZ4A 3UGFA 3WW2A 4BM8A 4TZDA 3L2HA 2RS53 4ARYA 4YZ2A 3MHZA 5C5TA 2VQAA 5DAQA 3OPTA 2VMGA 4OHYA 1PVC2 2GP5A 5GZEA 4GMP3 2XLAA 4Q4V1 3KT1A 4ZKTB 3GJAA 5C9AA 3LDKA 5ABJB 4LTAA 4S2HA 3VDDB 3HBKA 5FZLA 3VBHA 5JOXA 5KWRA 3S57A 1W2TA 2C9AA 1DZTA 1O7FA 5A33B 4RR3B 3RSJA 1R1A3 2WBKA 1OH3A 2OZJA 3OOXA 3NNLA 1VMHA 2K46A 4XW3A 4RHV3 4WM8A 4DZGA 4QGMA 2A71A 5BNOB 2BWCA 3WP3A 3USSA 5LY1A 1UMHA 4N7IA 5FBZA 4NOTA 5CFCB 3H8OA 5C4WC 4QWNA 3OPWA 1ALYA 2G9ZA 2NMNA 1OUXA 5F7UA 2UU8A 2VW1A 3HR9A 4DXRA 3AVRA 2GP3A 4Q0SA 5IK5A 3BTAA 1S0GA 4RD7A 4UF0B 3ZPOA 1CJPA 1MS9A 1YI9A 3AL5A 5FO9B 1HB1A 2RR13 4UBGA 4P9YA 3H0OA 4YGDA 2VGDA 3CEWA 4LUMA 1ONAA 2VU9A 4BZ4A 4JC1A 2Q30A 1CAUA 1CZVA 1RYYA 2JE9A 1JS9A 1A78A 2JDZA 1YFXA 4XE9A 2WS91 5FO7B 3T3YA 4FTSA 1HRI3 1ENXA 5C9AC 4Z2AA 3AMMA 4ZU4A 3BPZA 1IG3A 3VBHC 1K5MA 3RMXA 4K1ZA 3OD0A 4CPBA 4FBFA 4XJ8A 1W9SA 3B69A 1GNYA 3AYEA 2WO2A 5F5QA 3WLUA 4FQZA 3N7LA 3LIGA 3WF0A 3AC0A 3BB6A 3DUIA 4ASKA 4ES9A 4LT5A 4KU7A 3ZO0B 4WM8C 4BLJA
chains in the Genus database with same CATH topology
1CAWB 1G9FA 5ABJA 3NL1A 4YGBA 2QCSB 3VDDA 2TEPA 4P9WA 2IXKA 5GLZA 3FLTA 4K9SA 5A33A 3DL3A 4FAGA 1J59A 2ARXA 1EPWA 2IWGB 1YI7A 3QACA 3SMHA 5ACA2 3BALA 4BE3A 4COUA 5BNOA 2JG8B 4XYXA 2VUJA 1V6IA 1ZBA3 3A4UA 3WG1A 2D6LX 1FX5A 2HJIA 4HL0A 1W6QB 3NO8A 4EN0A 1IHMA 1WCSA 2WL1A 3JQXA 1RVF1 1Q3EA 1SCRA 3WVJA 1BJQA 2RHPA 4FPEA 5GZCA 4PLNA 2VOWA 3MDPA 1K5MC 4MUVA 3ILNA 5GLWA 2QJVA 2NM1A 4H14A 1NCRB 2VVDA 2PLV1 2UWBA 4M0NA 1FYUA 3R05A 4N53A 3I4IA 3S7EA 1ULEA 2V73A 3AP4A 5DDJ3 1C8M3 4R4XA 5GJ6A 2HWD1 4HFSA 4YZ4A 5CIRA 5ABJC 1ZVFA 3SH3A 1HV0A 4OZXA 3VDDC 4DRRA 1VBC2 1N1YA 1XNKA 2XGXA 1WCDJ 4XILA 1BBT2 1AX1A 3RNSA 1JUIA 1WLTA 2Z5WA 1QY4A 5AVPA 4YVSB 1RC6A 1AR81 5JOWA 4FPCA 3WNXA 1MS8A 1ZBE2 5BNOC 4J1XA 4DS0A 4AVBA 3ACLA 4FAHA 3ME2A 4XBLA 3QLQA 1HQWA 3B00A 4YLZA 5GLTA 4CYDA 4JAAA 1WBFA 3PVNA 3DPRB 1DIWA 1PGW1 5EFUA 3VLBB 4E9KA 5L7OB 2JG8A 3AK0A 2GNDA 4XJ9A 2Y0IA 2JKBA 2DCYA 1PM7A 1V6LA 4IV1B 4HK8A 1FPN2 4IV3B 1W6QA 3KZ4C 3D82A 3JD73 1NCQB 2R043 4N53C 1RUH3 3WHTA 1POV0 2D6NA 3SNMA 4AI0A 2Y26A 3VZJA 3LOBA 1CX4A 4GB33 1AHSA 4AI8A 2O8OA 1V6JA 4I0BA 5EWSA 1UD1A 1BXHA 2EA7A 2YPJA 1L3JA 4AI1A 3N36A 2ZA9A 1O3TA 2H6CA 1WCKA 1AR91 3OD4A 1NA1B 4GALA 2ZGUA 3SISA 1N1SA 2E6VA 1VBC3 4D7SA 3LKJA 1ZREA 4DFSA 2R6QA 3ZMOA 1DDLA 4O9EA 1CVNA 2ZX1A 4AK3A 3PVBB 4XJUA 1X8MA 3ZXAC 5J36A 4IEXA 1YFUA 2IXCA 4YVSA 4R52A 1AUYA 1O4TA 2HYKA 2JG8C 3GZTB 4NVPA 1HXS1 2FHRA 3AM2A 5EV7A 3VZLA 1CPNA 1PIV2 2NLRA 3E5UA 3IPVB 4JVAA 4Q4X2 2A73B 3VBUB 1VJ2A 4BYYA 5L7OA 2VH9A 4PF5A 4Z1VA 2B39A 5BNNA 3PLQA 3WHUA 1QF3A 4IV3A 4TWTA 1NCQA 4JV4A 3BIWE 4MLOA 2GMPA 4Q8KA 3O0WA 3UKNA 2YYOA 1COV3 1TNRA 4XXPA 4YZ1A 1ZZCA 3BU7A 2ILMA 3KCXA 4Y24A 3BCWA 2PHUA 1N47A 3EBRA 3WT3A 4BOWA 1SMVA 3IMNA 4LBJA 3SH5A 1RUD3 2UWCA 5D8AB 1ZRFA 1C4RA 1JHNA 4YVSC 1MS0A 3MIHA 4R9DA 1S0CA 3NW4A 3C3VA 1SLTA 4GWNA 4AFCA 2MNGA 1OOPB 2XLGA 1JYCA 1MR5A 2BWAA 4S2FA 4FPKA 2JEMA 4HPKB 4OI1A 3B5LB 4AEKA 4JGZB 3CU7A 4MGYE 1ZA4A 4X6QB 3GNEA 1DQ5A 1W6PB 1ZRCA 4HN1A 5L7OC 2RS11 5KXCA 1PO12 4EWDA 4YNIA 4AYUA 1JN2P 1O4YA 1W6OA 4IV3C 5KHHA 4XFCA 1QHDA 1NCQC 4Q4X3 4LBKA 4NHKA 4DB5A 4EN9B 3POWA 4LBQD 2QZ2A 1DGWA 1UPIA 4YFZA 1C5IA 5H9RA 3PHMA 3URFA 2GMEA 2BGCA 3ZSMA 1OA2A 2XH6A 5DXDA 2IZWA 4COWA 1WLCA 1ZZ7A 4Y1VA 1MVEA 2WFF2 2XHKA 4K7JA 1GBGA 1RUF2 4HSLA 1F31A 2PAMA 3SLIA 3ZXGA 2E53A 1DZQA 5LRSA 1R092 1S0FA 1ZX5A 2E9QA 1HDKA 2ZZQA 2WC2A 1OI6A 4XJAA 5D8AA 5JWPA 1JBCA 1CQ9A 3ELNA 1Q8QA 4Q4W2 2O1QA 4D3WA 1FOD1 2W08A 1VLNA 4LNVA 4META 3NWKA 1HRI1 3ZSKA 3D4KA 2CGNA 2YXSA 2WS92 3USUB 4CDQA 4B3NA 5JMCA 3SHRA 5CNAA 4N90A 3KS7A 4YARA 1E57A 4DY3A 4KQ7A 4JGZA 3N7KA 1PVC1 2XB6C 1W6PA 2YHJA 3AKPA 4YVWB 1POV1 4Y1ZA 4XIOA 2AR6A 4HZFA 5CBLA 1GYKA 3MPPG 3ZSJA 5LEJA 4LHLA 1LOGA 5I8TA 3N3HA 4HKWA 4CP2A 1PK6B 2YGLA 4Y1UA 3ZFGB 4EN7B 2ZGQA 1ULCA 1MZ6A 4L97A 2QQPA 2B7YA 4LE4A 5A32B 5T50A 1R082 2D5FA 1GANA 1SDWA 2B45X 1AR61 4WM7B 4F3JA 2ZGRA 3AZYA 3MLKA 4G9SB 4DPNA 5BNPB 3U11A 5JAXA 2WFF3 3NV2A 1UZZA 4XMAA 3J26N 2YC0A 1VAVA 2ERFA 1JTZX 1V70A 3B93A 4Q29A 3AYCA 5DUXA 5D8AC 5CAZA 4W6WA 4ORFA 5AVAA 2PAKA 1IPKA 2WNUA 5A3LA 2W0XA 3FBYA 1QGLA 4FXGB 1BMV2 4XTPA 4YW4A 2BTVC 4CDQC 2ZPXA 3AKSA 3V56A 4X6RB 3QH7A 2R16A 4YW5A 5FO8B 4M3CF 1DBNA 3O5SA 2R072 4JGZC 2CYFA 1TEIA 2HWE2 3FFQA 1UIJA 3AP9A 3GHNA 2BVVA 3L2YA 3N7JA 4I0WB 2D6KA 3FE5A 2A6VA 3AXDA 4IERA 2WS93 4C91A 1A3KA 4KH9A 2ZGNA 4Y1YA 3AKRA 2HWD2 2EF6A 3CLPA 4UW5A 4B4QA 2R062 2ZABA 4ITCA 4WZCA 4K6BA 1H30A 5HCFA 1UIKA 4XXAA 1VALA 1F5JA 1H4GA 1J3PA 5FOJB 2JICA 2DCTA 1NXD1 1SLLA 4BCUA 1AR82 1IGOA 3ZIXA 1O3QA 2WA4A 4ISQA 1QXRA 2X5IA 2PN5A 5ACA1 2WNVB 1LULA 2R32A 2WNUC 3S6PA 3ENRA 3BOPA 3MW4A 1RUI2 3G7DA 1DGRN 4A7KA 4QGNA 5I93A 2I45A 1PZ8A 3KCCA 4E2GA 1JYIA 3H7YA 2WLPA 1DFQA 5BNPA 2ZMKA 4M0HA 1PGW2 4RGGA 3OPZA 1PVXA 3IDBB 4QPIB 5DZEA 3S0MA 5GLUA 1S1AA 3LOIA 2GU9A 1FI2A 2CL2A 4LEJA 3WCSA 4C0HA 1RVF3 3E6BA 1PO22 2XL9A 5FMOS 2I74A 1SFYA 1KQRA 4JCKA 4Q1RA 4ZU7A 5KC5A 4Q0PA 4I02A 5CA6A 4LO7A 2CWSA 3KT7A 1W39A 4CDUB 2VPVA 1S0EA 5SV8A 1BKZA 1MQTA 4I01A 4YYOA 2PLV3 4PJYA 4RS5B 3U4XA 4YZ5A 4AEJA 5FLHA 2WT0A 3UJOA 2K2SA 1G7YA 1KJRA 2MEV1 4JGYA 1EY2A 1ND3B 3UL2A 3ZFEB 1KD7A 2R0HA 1REEA 1WLWA 2UYBA 3VKMA 2HWD3 5CVRA 1PK6C 4MGIE 1BBT1 1FAYA 4GIQA 2X5IC 4DNYA 4YW2A 1TME2 5AC92 5KHKA 2ZAAA 2DUQA 2RM22 1U5YA 1ZBE1 1PZ9A 3DKWA 2VNRA 2Z42A 2F6BA 1AR83 5BNPC 4XQDA 1DQ6A 2B42B 1S0JA 2OVUA 4QM9A 4ASMB 3VHNA 4OUMA 2WNVA 4RL7A 4Y5Z0 4Q0QA 3FZ3A 3RG0A 2Q0AA 5DG2A 3AYAA 1AJOA 1H9WA 2VW0A 5F6LB 3ZMNA 1D0GA 1FPN1 1RB8G 3RQ0A 1UU4A 2E7QA 1AJKA 2OPKA 3W9AA 5FPZA 3UKTA 1MQTC 2TBVA 2DUPA 4I09A 4Q2FA 3AXEA 3BOWA 4J6GA 1W6MA 2WA3A 4JGYC 3GF6A 4FPYA 1EV11 3NV3A 1CIWA 4CZSA 5J98B 1XNCA 1OFNA 5K7PA 3B02A 4RS5A 1V9U2 4LUKA 4OVEA 5HI0A 2C1FA 3ZN6B 4TYSA 2VW2A 1AR93 4CEWB 4PCRA 1ND3A 3ZFEA 2BVBA 4EJRA 4B29A 4HKOA 2CNAA 3JU9A 2KXLA 3A0NA 3ZXJA 5JDBA 2WNVC 3PVEA 2CGOA 1AYM2 4JQRA 4XMIA 1O5LA 4OLLA 4ZXKA 1LHOA 3B94A 1MEC1 4Q26A 4NHMA 3QD6A 3WP5A 1NY72 1PIV1 1V6KA 5JIUA 2Q5TA 2V09A 1HXS3 1GZCA 3WZ1A 4FVVA 4EN6B 3NKGA 1G9CA 2PFWA 3SCFA 2PHRA 1I9RA 3LWCA 3M3CA 4PBPA 4LA2A 4XDQA 4CRQA 1Q8OA 5BXXA 3LA2A 1XU2A 1ASJ2 3MI8A 4WVWA 3ZXEA 4RS5C 5JOZA 2GALA 4XIKA 3MIBA 4E2SA 1D4M1 4AFAA 1ND3C 3ZN4A 3ZFEC 5JZGB 3KT4A 4KG8A 1JXNA 4PLOA 1EAH2 3KMHA 1ZRDA 1Q8PA 1ULFA 2GDFA 5FQ0A 2W52A 1GFF2 4DQAA 1NQJA 4XFGA 3ZN6A 2D44A 4UW6A 5JR7B 1NOVA 3I54A 4CEWA 2O8QA 4HN0A 1IZ3A 1SBFA 2GH8A 1N1TA 2UY8A 1W2UA 3U0ZA 2PHFA 4P9LA 3VHPA 2Y38A 1X36A 4Q0UA 4AHYA 3RPQA 1VBE2 3RYPA 2D40A 3VKOA 3IM0A 5CU1A 1WMDA 4Y22A 3LA7A 4P9IA 1PO11 1YJKA 4G3YC 2VOKA 2RS13 2BFUS 2R1DA 2AUYA 3AJYA 5LK5A 3ZVXA 1PNFA 2OZ6A 4YFWA 4HK9A 1XYNA 1M06G 4I2OA 1JOJA 1LU1A 1KS5A 1BCXA 3FWEA 2ZHKA 3FC0A 4BIFA 1RUG2 2P37A 3B9IA 1Y9QA 4N9IA 1XYPA 5CG9A 1DZRA 4H7LA 5DZFA 1ASJ3 1XRUA 1UZYA 2WFF1 4YSFA 3H50A 3UJQA 1AR62 4X8PA 1RUF1 4IEWA 2VOVA 4CEWC 4OFGA 3NV1A 1R091 4MSVA 4QM8A 2WJSA 2RE9A 4AVAA 5JSRA 5FMOL 2PA7A 4FSJA 4A3XA 4Q4W1 2PELA 1GQHA 1KITA 2CV6A 3N35A 1W0OA 1FOD3 2RS31 4QX5A 2WZR2 1QU0A 5EZWA 2GAUA 3VBFB 5I8SA 2ZGPA 5HCBA 1G9BA 1XE8A 2UYAA 4Z92B 3TNQA 1UKRA 5BY5A 1PVC3 3WCRA 3D8CA 3RI8A 5IK8A 2QZ3A 2RJLA 4Z8BA 1POV3 4NWVA 1D4VB 2D6PA 2WKKA 1LGNA 1QDCA 3C2UA 1I3HA 3AFGA 1R081 1RUG3 4IEYA 4RR3A 1C28A 3ZYRA 3RWNA 1YCIA 5K0UB 3HWJA 3MIEA 1AR63 2EXKA 3LA3A 1DYKA 2P3IA 5CFCA 3M3EA 1CN1A 5HBAA 1KDMA 3THTA 3K51A 1QJX2 1BMV1 2VUAA 4RSUA 1S55A 5KXBA 2IXLA 5FDBA 2R071 2HWE1 1AL0G 3A0KA 1AR72 2R0FA 2OUHA 1J58A 3HT1A 3PNAA 4ISRA 2A5ZA 1Y7BA 1LECA 1VB2A 5T52A 4WBBA 1QQP2 1EYBA 5EJ3A 4AF9A 2R061 4K20A 2MEV2 3VBFA 3ZSEA 1I6XA 1ZZ6A 5KXEA 1A8MA 4XHXA 4RR3C 1C57A 1WW4A 4JDOA 1OA3A 2Z2SB 3KGZA 4UBHA 1HKDA 1KFXL 1OQDA 1U0AA 3PMSA 3LGRA 4XFBA 3VL9A 1C8NA 1CAWA 3POSA 2FMYA 3QH6A 1U5ZA 5CFCC 3TN92 2XL7A 3EHKA 1OQEA 4AFBA 3D5OA 1RUI1 4AQ2A 1ZZ9A 3T1LA 5ACA3 2JENA 1H8TB 2E7AA 1H8VA 4OI2A 2GC1A 2P2KA 4SLIA 5K9YA 4BH9A 3G6JB 1IKQA 5JSPA 4I0AA 4TLFA 5SV5A 3AZWA 3WQ1A 4AFMA 3H3UA 3M3OA 2HWC2 2Y0OA 3V65A 1QJU2 1PO21 4FOQA 2TUNA 4XFAA 1H2NA 1QXJA 1BK1A 1DQ4A 2ZGOA 2AGSA 3WDUA 3TRSB 1DGLA 4QQLA 4LE3A 1CR7A 2QUOA 2JJ6A 2BNNA 3VBFC 3B7MA 2CWMA 2WQ4A 1NCRA 1EV12 2ZBJA 1VRH2 3POYA 1HX6A 4B4RA 1SLBA 3JB4C 2BUKA 2Q1ZB 2K0GA 1QQP3 5DUUA 1LR5A 3H1MA 1PNGA 4COZA 4JDMA 3RJRA 2MEV3 4FT8A 5I91A 3R4DB 1ND2B 1TME1 4YG6A 5AC91 1BBT3 1FXZA 2RM21 4Y1XA 5AFEA 1LGBA 1QH6A 1MZ5A 1RJ8A 1ZBE3 3B9CA 3VZMA 2LTNA 5AFBA 1MEC2 1IS3A 1RMU2 2XJQA 1MS4A 2R1BA 4R8HA 1LCLA 4N43B 4XTMA 4YGEA 3M8LA 1IKPA 1KXGA 5DUVA 4YM3A 2BFUL 4HBNA 3E97A 1H8TA 3JBG1 4WZFA 3DPRA 3MIGA 1RUE2 4WV8A 2D7FA 4GWMA 4LBLA 3ZX7A 1X82A 5EYYA 1FPN3 1LEMA 2WFPA 1QJU3 4IV1A 3LB9A 1RUJ2 1NCRC 1M4WA 5KC6A 3BODA 4HSJA 1W6NB 1TMF2 1KJLA 4IEQA 4KU8A 3WW4A 3IN9A 4LO6B 4GH4B 5T5OA 1OLRA