3MF6A

Computationally designed endo-1,4-beta-xylanase
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
193
structure length
193
Chain Sequence
GSDTTITQNQTGYDNGYFYSFRTDAPGTVSMTLHSGGSYSTSWRNTGLFLAGKGWSTGGRRTVTYNASFNPSGNARLTLYGWTRNPLVSYHIVESWGTYRPTGTYKGTVTTDGGTYDIYETWRYNAPSIEGTRTYQQFWSVRQQKRTSGTITIGNHFDAWARAGMNLGSHDYQIMATEGYQSSGSSTVSISEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Endo-1,4-beta-xylanase
publication title Computational design of an endo-1,4-{beta}-xylanase ligand binding site.
pubmed doi rcsb
source organism Thermopolyspora flexuosa
molecule tags Hydrolase
total genus 60
structure length 193
sequence length 193
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2010-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00457 Glyco_hydro_11 Glycosyl hydrolases family 11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3mf6A00
3B5LB 4H7MA 1REDA 2C1FA 1YNAA 4XQDA 1H1AA 4XQWA 3WQ7A 1NLRA 5K9YA 2B46X 3AKQA 1UU5A 4S2FA 1T6GC 2DCYA 1XNKA 2QZ3A 1KS4A 3WY6A 3RI8A 3VZLA 1AXKA 1M4WA 2BWCA 3HD8B 4S2DA 1ENXA 3LGRA 2QZ2A 4HKLA 2VULA 4HKWA 3MF9A 1BVVA 1BCXA 2VUJA 3WT3A 1QH6A 1UU6A 2VG9A 1OLQA 1UKRA 1REEA 5K7PA 3VZKA 3M4FA 2B45X 3AMHA 4NPRA 2BWAA 3WP4A 3AMNA 3VL9A 1REFA 3VHOA 1XXNA 3WP6A 1XNCA 2NLRA 1H0BA 1XYOA 3WR0A 2BVVA 3MFAA 3B7MA 3EXUA 3VZNA 3VZJA 2NQYA 4HKOA 1H4GA 3RI9A 1H8VA 3VLBB 3AKPA 3WP5A 3O7OA 2DCJA 1QH7A 1XYNA 1UU4A 1KS5A 3AKSA 1C5HA 1TE1B 2DCKA 4HK9A 3WQ0A 3AMPA 2B42B 1OLRA 5HXVA 1XYPA 3VHNA 1OA3A 3VL8A 2BW8A 3VGIA 1HV1A 2D98A 1PVXA 3AMQA 2DCZA 3WP3A 4IXLA 2DFBA 2JENA 3WX5A 1H4HA 1OA4A 3ZSEA 1XNBA 3AMMA 1HV0A 3VHPA 1BK1A 1IGOA 3VZOA 4XPVA 1HIXA 2DFCA 1XNDA 2JEMA 1OA2A 1F5JA 3AKTA 3LB9A 1W2UA 2D97A 4S2GA 1C5IA 4HK8A 2Z79A 3WQ1A 2VGDA 3VZMA 3MF6A 3AKRA 2JICA 3MFCA 3WXPA 2F6BA 5EJ3A 4XQ4A 4S2HA
chains in the Genus database with same CATH superfamily
1EV13 2CDPA 2KM2A 3AYCA 3AZWA 1GZWB 4XABA 2RHPA 4CEYB 1C1LA 3L2HA 4OMCA 4YZ3A 5EQUA 2G19A 3HJRA 2V4AA 3NW4A 4Q4Y3 1JI6A 4XQWA 2RJKA 4B29A 1W8WA 4PLNA 3VHRA 1QOOA 2OYZA 4C1XA 2ZGTA 1TNFA 4NAMA 4XTPA 1BBT3 4O9EA 5FV3A 3Q8BA 1XNKA 3SHRA 2QJVA 2LUWA 2DVDA 4XJWA 1COV2 3B9IA 1XE8A 2E33A 2XXZA 5CFDA 4Y22A 3WF4A 1LHWA 1PVC2 2Z42A 2J42A 2WNOA 2UWAA 4L11A 3AYDA 4AG4A 4CCJA 2V73A 1KEXA 1IQAA 1LOEA 3ZYIB 2C5DA 2WQZC 3CF6E 1VRH3 4FP2A 4M3CA 5FO9B 5AVAA 2BERA 1F4AA 5FY8A 4PBOA 2PHXA 1XSRA 2G9ZA 3UK9A 1STMA 4EWAA 1VBC3 3GNEA 1GOGA 4CCCA 4XBNA 5EIYB 2WO3A 1SBFA 3IPVB 3LPFA 4BIFA 1W0OA 4COUA 1AYM1 3QD6A 4M4RA 3AC0A 1B35B 4BM8A 3ILRA 2XUEA 4XDPA 2YBKA 1HXS2 1PMHX 2OZ6A 4Q29A 4YPJA 2VZVA 3DKWA 3BTAA 3M3QA 4RQPC 1SG3A 3RPQA 2CHHA 4QHZA 4IGPA 5HCAA 4TLGA 4BJ0A 2YPDA 5GLVA 1IOAA 3UJOA 1SLAA 2WFPA 2HWF1 3POYA 4R9CA 3BCWA 3WP5A 2OUHA 4IEUA 1W39A 2KD7A 1CIYA 3FLRA 5TSWA 4I01A 4QDSA 5ACA2 4Y5SA 4EYUA 4PLMA 3ZXAC 2E53A 3USUA 1KS5A 4IEQA 5DZEA 1C5HA 1C1FA 2DCKA 2D3PA 4GKXA 5JIAA 1CZVA 4QQPA 4DUVA 3SLIA 1PK6C 2BW8A 3BVCA 3RJRA 2D98A 1K5MC 1OQDA 2N7GA 1UY2A 5A3UA 3RQ0A 3I49A 2PTMA 2RS12 4XFBA 3NNFA 3WDXA 4URAA 3JB8A 3Q8FA 2VZ3A 1ENRA 1WLDA 1PGW2 1UYZA 2GNTA 2WO2A 1WD4A 4KGQA 5GJ6A 2YU1A 3POIA 1MZ5A 2CY6A 1DGRN 5KHKA 1CQ9A 4Y5Z0 4Y20A 1CR7A 1FOD1 4H55A 4XCAA 3H3ZA 3R4DB 4ZXEA 4Y24A 1EUTA 1WW5A 3OEAA 2GC0A 5F32A 4N53A 4CDWB 2WLQA 1UOJA 1F35A 1CJPA 3OCPA 2DU1A 4LXLA 3VD5A 4QKFA 1HKDA 1CPNA 3RDIA 4A44A 1T6BX 3ABZA 1GUIA 2F6BA 4RGAA 4A6SA 4CUBA 1CN1A 1W6OB 1MQTB 4RR3A 3LEIA 4A42A 4AOCA 5JOXA 4LBJA 4ZU4A 2E6VA 5EP9A 1QHDA 2IXCA 4M3CF 4FPEA 1KJRA 4LHNA 5A6YA 5AC93 2ARAA 4BE3A 1YNAA 2VTXJ 4BCUA 4MGTA 2ZX2A 3L2YA 4B4RA 5FXXA 1GWKA 2ZS6B 3C7FA 3WQBA 3GHNA 1UU5A 2WZ8A 1CAWA 1K12A 3J8F3 1H1IA 2WS93 2YUEA 4GWNA 3N9LA 3U11A 2GN3A 4XYXA 3PU8A 3L9JT 1RUOA 4QQ2A 4OLLA 3DF0A 5A7WA 3K2OA 2VMHA 1SMVA 2XL9A 1UY3A 1YCIA 3GCWA 1R081 4PI0A 4AEKA 5FY0A 2EA7A 2VULA 5HI0A 4K1ZA 3DPRB 5C8WA 5FP7A 4Q4W2 4WM7C 1AR63 1PMIA 5C33A 1SPPB 3SNMA 1VBD1 2KXLA 4Q27A 1F9KA 1I5PA 4WM8C 1CGPA 4BA6A 2OPWA 1ZM1A 3H3LA 2JDHA 2PLV1 1MEC2 3H42B 2X53S 2VMCA 2VZQA 4XFGA 3WW4A 4LIVA 4QWNA 3SH5A 1RHI2 1JZ4A 1UY1A 1G9CA 4NPRA 1AJKA 1UYYA 1GP6A 3QLQA 4CDXA 1REFA 2JDNA 1RVF1 5A32A 5IHRA 5I0UA 5E89A 3B94A 3VHOA 5HXMA 1RUJ3 4PDWC 4NIHA 3OB8A 2VPVA 3V0AB 4UXAA 3VBSC 1JN2P 2BGCA 4UBGA 5FK8A 1BZWA 4ZS2A 4ZZ5A 4RGGA 5F5AA 3JQXA 4YW3A 5BNOC 1GQGA 2XUMA 1FV2A 2ENRA 3AKPA 3MO4A 3IKWA 5D8AC 3O14A 1UPSA 5IK8A 2PAEA 1AX0A 1RUI3 3UT0A 1CZTA 2X09A 5KXDA 2WL1A 3T2QA 3V0BA 4CYDA 4QGLA 2RMU3 1FMD3 1KDKA 4PQQA 5I8SA 2ZHLA 3DL3A 5A1LA 3MUZ1 2F4PA 1XYPA 1VP6A 3LQCA 1RXFA 5F3GA 3T2PA 2WNVA 1W2NA 3AMQA 3ZPOA 4A6OA 3Q8EA 4XFHA 5F9TA 1LU2A 2AUYA 5JUVA 3ZR5A 1TQ5A 2OXBA 3HR9A 1O91A 1S0DA 1AL22 1ODNA 2E26A 4O7XA 5C5TA 3TYJA 4JC1A 4BQ5A 5E6HA 4YYOA 3B02A 1UCXA 2BUKA 3CDZB 4ZU7A 2VMDA 1T2XA 3ZYRA 3PIGA 5FPBA 1VAMA 1SCSA 3JB4C 4OUMA 1EY2A 4BMBA 2AGSA 1Y3TA 1S0GA 1F5JA 4FPGA 4XJ8A 1QOTA 1KFUL 4CEWB 1OPOA 5F5QA 2W1QA 3WLUA 3OGGA 5FDBA 1O3QA 2R071 1BEV1 3IAPA 1UKGA 3ORJA 4UW4A 4A45A 2JICA 3WNXA 2W94A 4LO6B 5T5OA 5T5JA 1SBEA 4AYUA 1S0CA 2CSGA 3I3DA 5DDJ1 2B8MA 4AFMA 4GJZA 3UV9A 2VZPA 3MICA 2CGNA 4XHBA 3H50A 3S7EA 2W95A 1V6NA 3T4VA 3LDKA 1PGL1 5A7OA 1AUYA 4IE0A 4D94A 3WQ7A 1ND3A 2EF6A 3M3EA 5FQ0A 1F15A 4GMP1 2YDEA 2QCSB 3POBA 4C90A 4GB32 1EAH2 2WT1A 2JXAA 2ATFA 2HWD2 2XLGA 5F7UA 1PGSA 5C3OA 4CUAA 3ES4A 4RN5A 4AZZA 1OUXA 1ZBA3 1YRZA 3GBFA 4AHZA 4DFSA 1DG6A 2G1MA 2O14A 1PM4A 2WZEA 4R9DA 2AYHA 1JZ6A 3GGLA 5A80A 2RG4A 5DPNA 2RDSA 3TEXA 1VBE3 4CP9A 3DYMA 5LY1A 3WZ1A 1UN1A 4NVPA 2P4EA 4F3JA 1OOPA 2RS51 1ULPA 4GXLA 2I74A 4UFKA 4L92A 2ZEXA 2QTWB 1S2EA 1JW6A 1WLCA 5CFCA 2ZEZA 2VQ0A 3H1MA 4AQ6A 2XHNA 3WP4A 4DXZA 2BOIA 2ZOEB 1GNZA 2GH2A 1UZVA 1H1MA 4NMIA 1BMV1 3SCFA 1EV12 2OQ6A 1Z7S1 1W9FA 2FDGA 2HWC3 4Q4Y2 2ZGLA 3VZJA 2EIEA 5ABJC 1CONA 1PIV3 2MPFA 2X5IB 5K0UC 4A7KA 4LR4A 4IV1B 3HPNA 4BQYA 1BBT2 4QM8A 3HNMA 1UZZA 4DS0A 4P9XA 2BGPA 3ECQA 2VU9A 3H9AA 2W1UA 3K77A 4HONA 1NG0A 4LE4A 4D6QA 4R4ZA 2HWB3 3OOXA 3IWZA 3ZDVA 2BYVE 2Q0AA 4MX3A 3ZXGA 5KC6A 3K4ZA 3LEMA 3A23A 4XVHA 3ZPYA 1FI2A 2WZR3 5FAXA 3WW2A 3BI3A 4YGEA 2W3JA 5T52A 1O3SA 2ZX1A 1HRV3 3VBRA 3ZYFA 1VRH2 5JAXA 4H14A 2SLIA 3ZMNA 2GC3A 2LTNA 2OW4A 4OYUA 4XBLA 2JENA 3P3PA 4HSJA 2K9ZA 2MEV1 2ARXA 4P00B 4QU2A 4TSVA 4XDOA 2R063 4YVSA 5F3CA 4JGYC 5F5IA 1VBC2 4INDA 1DGWX 2HKXA 4KG0A 1IGOA 2PHLA 1ZBE1 3C3VA 5B4XA 1C57A 1PO23 4B4QA 4OZOA 4XC9A 3LCPA 4AGGA 3EB7A 1CAVA 5AVPA 1O8PA 3FX3A 3OSDA 3HOBA 3IDAA 1LGBA 4MOAA 4FT8A 5FYZA 2Q8OA 2D44A 2WABA 4PHZA 4TZDA 1QJX3 4D6SA 2DVFA 1RJ7A 3ZXFA 5FZBA 3OYWB 5IK5A 1DF0A 3ZM8A 2PAKA 1CAXA 4IEYA 4CU7A 4IERA 1JZ3A 2JX9A 4CU6A 2OT7A 5J48A 4HL0A 5EXOA 1D4M1 3P1IA 2EIGA 3T4HB 1V6JA 1KITA 2TEPA 4LA3A 3I2KA 5BNQA 3RJ2X 1OC1A 1S0JA 4RQPB 2EVXA 5A7NA 3VKLA 4YZ4A 2ZX0A 1QY4A 2WSVA 2QZ3A 3WUCA 4C0BA 2YGLA 2Z2SB 3K3OA 1C8M3 2XG3A 3LEKA 1FXZA 2BWCA 3OF1A 1TG7A 5IVFA 1MVQA 3HQUA 3O0WA 4HMZA 2DBNA 4AHWA 3T0AA 2IVJA 4KBZA 4QDRA 5HCFA 3KT7A 2R0HA 2Y34A 4HKLA 1YIPA 4HN1A 4QX1A 1W6QA 4XZUG 5J36A 3V56A 3VDCA 4LO7A 3FBMA 1W05A 3SEEA 1KGYA 5F2WA 1QMJA 3CBNA 5ANNA 3GZEA 1YFXA 2XKOA 5JXGA 2X10A 1Q5OA 3K48A 5C8CA 4NUBA 4K3UA 4CDUA 1SLIA 4QPIA 2WNUA 1DGRA 4CCNA 2XWJB 1REEA 2Q1MA 4O9GA 2P34A 4X8PA 5C4WA 4C0HA 4CXWA 1K5MB 1WLWA 2XH6A 2DV9A 3BN6A 4QPYA 1H2KA 4LLFA 3A0KA 5ACA3 3WOGA 4LKDA 1HRI1 3LEGA 1XNCA 5ANQA 2VUDA 2WN2A 2X05A 1W8NA 1A78A 5AFBA 4CDWC 4E2SA 5FMDA 4N53C 4FAGA 1UYXA 3WHTA 5AC92 2E7AA 3ACGA 5EFUA 3CZUA 4IE4A 3VZNA 4CCDA 3U4XA 4FPHA 4Q0SA 5GLTA 3ZSLA 5LEJA 1WKYA 4IEXA 5FZLA 3SISA 2CDOA 3J8F2 4RD7A 5FBJA 2WS92 4GA9A 4YGCA 4KU7A 2VO5A 5IK7A 1QU0A 3JXSA 4NHXA 1HW5A 2VVEA 4RR3C 3BU7A 1X8MA 1J1TA 1JOBA 1GWLA 2ZJCA 1W6NA 3POWA 5JSPA 2P3JA 5KR7A 4JTNA 4O65A 2XHKA 3ZMOA 1OLMA 3G6JB 2HBTA 2RS33 4W6WA 5I0RA 1RC6A 4CCLA 2YGMA 1HV1A 3S5QA 4FFGA 1DCSA 2JKBA 4FFFA 1AR62 1BLZA 2BBAA 3LSEA 1JZ5A 2FDHA 1RMU1 2XB6C 4AI1A 2WSUA 3THDA 1AX2A 2ZGNA 1OA4A 4AI3A 4Q8KA 3BIEA 1G9AA 2GC2A 2A7AA 3KS7A 4XPVA 4LKEA 1QJFA 3ZYBA 3FBYA 1OFNA 1JU4A 3SITA 3AM2A 1E5RA 1QJEA 1NY72 3DECA 2GMPA 4IE5A 4ZPIA 1XJAA 4LMFA 1WD3A 4QD2A 3KZ4C 1RUJ2 4XHXA 3NNJA 1XOYA 4PI2A 1W8HA 1C5IA 1VBB1 1JODA 1HXS1 5FZMA 3IT8A 5BNNA 2JE7A 1WW6A 1U5IA 2CAUA 4WM7B 4BB3A 3O1VA 2JDMA 1RUD3 4QX3A 2CU5A 2VXJA 4YW6A 3WXPA 2GMEA 4WM8B 1XSQA 5FZ8A 4RFT0 2QQWA 1V9U1 2VOXA 3WINE 3KCXA 4AEJA 4C1WA 1RUI2 2JDZA 2WNEA 4LHLA 1IPSA 4KNCA 1CX4A 1YWKA 2BNNA 2LS6A 2XJRA 4YVWA 1B09A 1ALYA 5FREA 5DXDA 2RMU2 1FMD2 4UI9L 5D1IA 4DNYA 5DUXA 3MI8A 3MPBA 3PUQA 4N9IA 4M00A 2X8KA 3VB9A 2ZAHA 4BH9A 3I2JA 1GBGA 2XL7A 4LIUA 4B7EA 4BHPA 1M06G 5KHGA 4PCRA 4E4DX 5FZCA 3WY6A 3VBSB 3QOPA 2VVDA 3R6SA 1H8TA 5BY5A 2XKPA 3CJXA 1G86A 3IAQA 4Q1RA 2IC1A 2RS11 1DLCA 5D8AB 2PHRA 3O1RA 2VM9A 1NQDA 1PGW1 1X82A 1BVP1 4NJ4A 5K8SA 1QWRA 3GBGA 4LT5A 2QE3A 1A34A 2XLFA 3M3CA 3ZKUA 1WMDA 4KU8A 5FZDA 2D3RA 1AR91 2AR6A 2XJVA 2BFUL 3AX4A 4XMAA 5LRRA 4FPYA 1XRUA 1RUNA 1GZCA 3EYPA 3OY8A 3WG1A 4D7TA 1SACA 3GZTB 1LENA 4QKDA 3TN93 4OHYA 3ME2A 2ZPXA 3MW2A 4AHYA 4C8DA 1W8FA 2C9AA 4XXAA 3MLKA 2BFUS 2DUOA 2VXRA 1S55A 1FX5A 4N90A 5FZ9A 5GLZA 4E8CA 4M4PA 4BQ2A 5IVEA 1TMF3 4UT5A 1ZZ7A 5J1XA 2ARBA 4IE7A 5GZFA 4CEWC 4KMQA 2JIJA 2O8QA 3MFAA 2VNOA 2XQRA 3AB0A 2NQYA 2RE9A 2XVKA 3PJYA 1ACCA 1H9WA 1RUG3 5L19A 5FR3A 3ACHA 3PVEA 2B9UA 3HIFA 1I3HA 4OQ9A 2FMYA 3G7DA 4LITA 3WG4A 5LBFA 4DPNA 1FV3A 1GOFA 2XJTA 3GJBA 4UFLA 3FJSA 3Q9OA 2GZWA 2WDBA 2ZZQA 1ZBA2 2WYSA 1WW7A 3K3NA 4Q5OA 3JCIA 5JR7B 3LA7A 3TBDA 2YMZA 3N7MA 3MIBA 4UOJA 5A3LA 5JR2A 4Q4X1 3R4UA 4RA0A 4UFMA 3D3AA 4UF0B 3HAGA 2CTVA 4AXOA 1KDMA 1PVXA 1VMJA 2F17A 4HETA 1UYPA 3HVDA 3QCWA 5T54A 4BZ4A 5KHIA 1NA1A 1VBE2 5C3SA 2YHJA 4WVMB 5CNAA 2C4XA 1JXNA 3AK0A 2Y0OA 1XNBA 2UU8A 4HOOA 1IS5A 2BDRA 1XE0A 5DG2A 4L2NA 3AXDA 3QACA 4BU2A 1MEC1 4LTAA 2VW0A 5LA2A 4AEDA 1WCUA 2PXJA 4FOWA 2QQPA 1QGLA 1C3HA 2FHRA 1S0BA 1JYWA 2FZ1A 4Q2FA 4EN8B 2WRAA 1KJLA 1HB4A 2D97A 2ET1A 3WNKA 3O1SA 4URTA 4UW3A 2DUQA 3WCRA 5FP8A 4AWDA 3AKRA 1TME3 4WZCA 2HWC2 4PBPA 3HQRA 4Y26A 3WEZA 4CUGA 3C7HA 1W28A 5CKQA 4KBBA 2V5DA 1N1VA 2HEYF 2QFEA 3RWNA 5LA0A 4HZFA 5I8YA 2NPIA 2Y33A 3LIGA 1ZZBA 5I0DA 1LOCA 4MGKE 5FJKA 5J7MA 2HWB2 5ISLA 1CZSA 1D0HA 2YG0A 4LUMA 3U07A 3H0OA 1XNAA 1H2LA 5FMCA 1UL9A 3NO8A 2B46X 2VW2A 4EE2A 3OPWA 2IUWA 2VOWA 2WZR2 4S2FA 5C9AA 2VMFA 4ZHNA 1HRV2 4CCOA 5LK7B 3ACLA 1AVBA 1BK0A 3R05A 4NE9A 5IFTA 3WDVA 2XMLA 3EQEA 3NQHA 4BLJA 3HEIA 2R062 5ABJB 4R9AA 1SFNA 5A3MA 1MS9A 1JU3A 1VE0A 1YHFA 1G7YA 1AL21 4X6RB 5GZEA 4ZY9A 3TNQA 1PO22 1LAJA 2HWE3 5JMOA 2YROA 5FOBB 1SZBA 1DQ1A 5AFEA 3HQXA 5C5UA 1YI9A 1N3OA 3IMNA 1HQLA 3GYDA 2HWF3 3IB3A 3WNMA 1QJX2 4HSLA 1POV1 3UKNA 4YVSC 2QQJA 4Q4V3 3AMHA 1VAVA 2C0ZA 1OKOA 4U2AA 3AXEA 3WNOA 1CWPA 5SV5A 1H2MA 3T30A 2C26A 4PT6A 4AEMA 4JGYB 3LWCA 4ZKTB 4MGQA 4Y22B 3WF0A 5CFDB 4NIAA 2VTFA 2VNGA 3WV6A 1OMIA 5FYBA 2ZGRA 1ENQA 4UFJA 1ZREA 3VBOA 4XFAA 1DQ6A 4SLIA 1QF3A 2KA3A 2D93A 4M3CB 2DCJA 4LBQA 3K4DA 1C8M2 4JDOA 2R30A 4XAEA 1EAH1 4Y33A 4IETA 1O59A 3M70A 2HWD1 3I2FA 4OI2A 4KWJA 3URFA 5DAPA 1ZNPA 3GZUC 1MZ6A 2LW8A 4ONUA 3FFZA 3UGHA 1OLRA 1VMHA 3VL8A 3CQOA 4TXWA 2B4KA 3VD3A 1D4VB 3CKHA 5HV4A 3IIIA 3MGUA 1HB1A 4JKKA 4NRPA 3FUOA 4FSJA 1ULEA 3POGA 3JU9A 4BQ3A 4IV3A 4HPKA 2JE9A 2PN5A 3WX5A 2I45A 1GP5A 3SC7X 4MXWA 5A6ZA 4FPLA 1XBFA 1HV0A 4XEZA 4D8MA 4EN0A 2XBO1 5FLHA 3HNYM 3IPVA 3CL1A 1URXA 3W59A 1NE6A 5FZOB 5L36A 1SLLA 4FOVA 4GIQA 3CNAA 2UYAA 3NNMA 1NZCA 1F8VA 2Q8CA 4AI9A 1NOVA 3USUB 1JZ2A 4MG2A 4QAWA 1D7PM 1JYNA 3KGLA 3B01A 4B1LA 3VZMA 3FLTA 4CDUC 3NJZA 2W91A 3B3QE 5LBEA 2VC9A 1ENSA 5CG9A 1JH5A 1POQA 1G8WA 4Q4Y1 4DOUA 5FLIA 3DUIA 1RL3A 3QH7A 5E88A 1PO11 4P9WA 2XOMA 2Q4SA 3S5AA 1N3QA 4XQDA 1A8DA 1QXRA 4FTSA 2GC1A 1U0AA 1H1AA 2VMGA 3NJYA 3PTRB 4V2WA 5T55A 1VBD3 4DEQA 1NLRA 1OD3A 2RS32 3I2GA 3LD8A 4XF4A 1R1A1 2ZEWA 4R9BA 1WLTA 2PLV3 4AQSA 5KXEA 2A3YA 1S0FA 4MGIE 4N53B 2ZXQA 2PFWA 4PJYA 4FOQA 3WNNA 1C8NA 2GU9A 4IEPA 5FFOC 1IZ3A 3VD7A 3RG0A 1EUUA 3H8UA 1O5LA 3KHBA 4AVAA 2D6LX 3GBWA 4NPMA 2GSYA 1RVF3 1W8ZA 2D6MA 2W39A 4QDQA 1Y9GA 5JLVA 4TTGA 1VB4A 1JYCA 3U10A 3GZAA 1EP0A 2VUJA 3MW3A 4RR3B 5A33B 3T0DA 1MS0A 1CD3G 2A1XA 2UYBA 3T2OA 4OUSA 3UL2A 4JQTA 4D3WA 3MIDA 4YFZA 4XUOA 3SXWA 4DEVA 4YARA 5I0SA 2DUPA 2HEVF 5IVYA 3ON7A 4Y4YA 4EROA 3U37A 3K51A 3M4FA 2QDNA 2B45X 1RUD2 3H3UA 1DYOA 4K1YA 5FPLA 2ZHMA 3S6PA 2VBDA 4E4SA 5FPUA 1CAWB 2Y8KA 2ZMLA 2NP0A 3BPZA 5FZGA 5FZAA 5FYHA 1VBA1 5A7WB 5JSRA 1MS4A 1UAIA 2P5BA 2XDVA 3BGAA 3CEWA 4N7UA 4H7LA 1H8VA 1OUSA 3JD73 5BNNC 2FCTA 2BP6A 3ZSJA 4XBQA 3WSOA 4OZXA 3FLPA 2WJSA 3GCXA 3AKSA 3D0SA 1TE1B 1ND2A 3JUUA 4RGKA 4Y1VA 4CUCA 2RR13 3C7EA 1PZ9A 1RUF3 1UX6A 1ULDA 3VGIA 4HVQA 1LU1A 5LA9A 1LHNA 3DPRA 2DCZA 4CDXB 1FPN3 1DQ4A 1LB2A 1IPJA 2ZTNA 1K3IA 3AL6A 2R073 1BEV3 3C8XA 1W8UA 1LEDA 2W52A 4MXVA 3RYRA 1NCQA 3FMGA 3ZSEA 4CSWA 1ULGA 1H8TC 5K4LA 1HIXA 3TN92 2JECA 3CJIA 2ZHNA 4CDQA 1OD5A 1U5YA 2C6SA 2ZHKA 5DDJ3 3BU0A 4NHLA 1FNZA 1OH3A 2MNGA 2J1UA 4Z92B 2A71A 5FLJA 3KCYA 3V0BB 2CAVA 4LBNA 1C28A 4YGDA 1NCRA 1TMF2 1FNYA 2JG8A 3PLQA 3OD4A 4QGMA 5GZDA 4TYSA 4GMP3 4BQ4A 4V1PA 4Z07A 5LCWL 1GLHA 4OMDA 1E57A 2O8OA 4Z1VA 1CIWA 3PDQA 1KQRA 3KV5A 5FO8B 1QOSA 1RUG2 1ZYBA 2WNVB 4IGOA 3SKJE 4KI5M 2J1RA 3WG3A 1UOBA 3CO2A 3HBKA 2QQMA 4Q1PA 2HH9A 4P08A 2WWSA 3ZDSA 1OF3A 1LRHA 4QPGA 3RNSA 4YZ2A 2OPKA 3RS6A 3UJQA 2VECA 3APBA 3DN7A 1IKPA 4OHXA 1W6MA 1L3JA 3M8LA 4FAHA 2A75A 2HBUA 2AC1A 3POFA 4JVAA 2XJPA 1X9PA 3N9QA 2RS53 3UNPA 3VBUA 4NRMA 5JMCA 4EJRA 2ZGUA 3VZLA 4YM0A 1GKBA 2JWPA 1SLTA 1AR61 1LKNA 1LOBA 4Q8LA 2JB4A 2CGPA 3ACFA 1UXZA 5FY9A 1BJQA 4I30A 5BV6A 4JV4A 4J1WA 2IWGB 2UURA 1ZX5A 4BQWA 1JUIA 2V72A 3WNPA 3ZN5A 3KGZA 1UOFA 3PTYA 5IUQA 3ZVXA 4RYDA 3J7LA 1LODA 3KF5A 4FPFA 4LO8A 3OPTA 4AF9A 5IVBA 2ORZA 2BTVC 4NRQA 4PF5A 4TWTA 5KXCA 5C3RA 2XLAA 2A5ZA 4GZ9A 2QUOA 3VZKA 1VIWB 4P5HA 2ZGMA 1LHUA 3AJYA 1ND3B 2XVGA 1TME2 4FFIA 2GDFA 2VW1A 4K7JA 4P5YA 3LOIA 5FQ0B 1XC6A 2BWAA 4HXCA 1LECA 1RUH1 4QKNA 4HG6B 3OBTA 3HBZA 5A3TA 1XXNA 3A22A 4LBLA 5FCCA 2FCVA 1LGCA 1YIFA 2JKXA 4FPOB 4RS5A 4COVA 2PELA 2Y26A 3AYAA 5LW9A 3B69A 2BVVA 1FYUA 2W0XA 3F95A 1DFQA 2W68A 5FZIA 1IHMA 4NIIA 3I4IA 1YQCA 4F8AA 2RMU1 1V6OA 2ZGQA 3EBRA 4NAOA 2QDRA 3MUY1 2IVIB 5DUUA 5IYYA 1Y7BA 4CP9B 3SKVA 1ODMA 4BOWA 5ERLA 1AR73 3VKOA 2TNFA 1YC61 4XUPA 1OOPB 2FBEA 4XETA 5EV7A 1UZWA 3ZFGA 1DP0A 5FZHA 2ZABA 5BNPA 4K8RB 2D6PA 1AYM2 4EWEA 1GANA 1Q8VA 1WCQA 2HLEA 1UWWA 4IGQA 3MIFA 5FRAA 1MR5A 5CFCB 1UPIA 4IE6A 4MADA 1OXCA 4UAPA 4ARYA 5A3NA 3SH3A 2HWE2 3R4SA 2R0FA 2Q8EA 5CISA 5C9AC 2XQXA 3ZYJB 3ZFFA 4FP3A 4QX5A 3OUHA 2HWF2 2R043 3HN1A 4G3YC 4D7YA 4I0BA 3POJA 2YC2A 4LUKA 1W8OA 4ZU5A 1OI6A 5B2GB 2R7EB 2JDUA 2WC2A 3T08A 4Q4V2 2O1QA 4BYYA 3N9PA 3ROUA 3OPZA 1D4M3 3F2ZA 4JX0A 1Q8PA 1JHNA 2Y6KA 3NWKA 4X8NA 3I59A 4O61A 5EHDA 3VN4A 3BB6A 2I07B 5FXWA 5CEHA 1ASJ1 1A8MA 3AVRA 4Z8BA 3LA3A 4V2VA 4Y1ZA 2V09A 1QDOA 3AZYA 1H6YA 4I3GA 3O12A 2YPJA 3O1MA 3OBAA 4MGZE 3FZ3A 2X5IA 2SBAA 2J22A 5HPOA 4YM1A 4M3CE 3ZXDA 2BNOA 4LBKA 4OQ8A 2YBPA 1W9TA 4YVSB 5J96B 2VNRA 4JDMA 3ILNA 5CFDC 5LATA 2P17A 1UZYA 3ZYHA 4YWAA 3IZOA 5J3UA 1ZBA1 3ZN4A 4Y3OA 3AKQA 1RUE3 3PU3A 3POSA 1AF9A 2DCYA 3VBOC 1CAVB 2RDQA 3RMXA 3ZXEA 5C3PA 3WCSA 4EV0A 2Y38A 4RHV3 4IEWA 5DUWA 1QJU3 5FZ7A 3V65A 4B3NA 2H6BA 1ZRFA 1VBE1 2E9QA 2WT0A 4LEJA 4XURA 4M0HA 2NZ9A 2ZEYA 4IQPA 5LB6A 3B9CA 5JVVA 4JHZA 3AZVA 1UD1A 1ZZ9A 4CCEA 2PAMA 4GD4A 4D6RA 4LOSA 1MS3A 4GWMA 4XILA 1IG0A 4IV3C 4CPBA 1AYN3 1OT5A 3W5NA 2VOKA 2NYYA 4LQRA 3BKZA 1U5ZA 3RGBA 4AL9A 5HCHA 3B00A 4AHXA 5FY4A 4QHOA 3AMNA 1F2NA 4YZ5A 2D40A 2D6KA 2W9XA 3BODA 1RJ8A 4CZSA 3JBG1 3WP6A 1PIV1 2NLRA 5H9PA 1J84A 1R082 5D2AA 5SV8A 4D69A 1HLCA 2W87A 1Q8SA 1H4GA 1VBD2 1W6QB 1QJY3 3ACIA 3J4UH 4FPKA 4NIDA 3MLLA 4E4HA 2HWB1 5FKCA 2OUJA 4MGSA 4X6QB 3ZKYA 2PLV2 2EALA 5C8CB 4Q0QA 1UU4A 3FFQA 1DU3D 2PHUA 5FP4A 4CDUB 3DCQA 1J3RA 2ZBJA 5BXXA 2ERFA 2OA2A 4W6YA 1IS6A 2FQPA 3WQ0A 4W8JA 5C4WB 1UX7A 1O6UA 3M2MA 4ZZ8A 1NQJA 2A6YA 3M3IA 4JAAA 1RVF2 2UWCA 3SH4A 1X33A 2R061 1W9WA 4K20A 3I97A 5FUIA 5FZ1A 1R093 1I9RA 4H2AA 5I8TA 1VBB3 1VR3A 1RUC3 3BIWE 1WCKA 1OVSA 1UY4A 4A7YA 3W5MA 1UMIA 1H4HA 1S2BA 1US3A 3O1TA 2P3YA 3CIHA 1V9U3 3VUOA 4JGZA 3H8OA 3KCCA 4JTOA 3BTZA 1PK6A 2OX0A 1QKQA 1JUHA 2WZPP 2PQSA 4MO3M 4R4XA 3VBFA 2JB8A 3OUJA 3ZFEA 4EN9B 4J6GA 4AR2A 4EN7B 1EPWA 3NJXA 3USSA 2ZGSA 3NNLA 2LM3A 2RDRA 4BXSV 4AE2A 3VDBA 1APNA 2W5FA 4BQ1A 4A3ZA 2KR2A 1COV1 2WKKA 2Q8DA 3OEBA 3LF7A 1PVC1 2R1DA 3JD72 2PHTA 2DVGA 4NWWA 5H9RA 4L0PA 3SCGA 2VJXA 3ZIXA 4AAPA 2R6QA 3JQWA 4ORFA 1YO8A 5G04L 4H7MA 2ADEA 3VDDA 3NAPA 3KQRA 1LOGA 1UY0A 1REDA 1WWYA 3A0NA 3PUHA 5FYCA 5DABA 3I2DA 5LEKA 1QJZA 1C8M1 5JCTA 3FL7A 3KQ4B 4NHYA 2RR12 4BISA 2RM23 1RUF2 5EJZB 1PX3A 1SBDA 4FVVA 1OVPA 1GQPA 3GM8A 3AFGA 1FPN2 3EMRA 4CTEA 3A21A 1DZQA 2IFRA 4P02B 4XF3A 1O8SA 3SQOA 4AI8A 2R072 1BEV2 4S2DA 4FBFA 1MS1A 1ZZCA 4WVWA 3NV2A 5BNNB 2ZGPA 3LGRA 3I2HA 3ATGA 4GH4A 4BLIA 2VZSA 5JSOA 1WBFA 3RZGA 1ND2C 5JI9A 2GALA 3KF3A 2K0GA 5DDJ2 1BCXA 3I2OA 1AR83 2CWMA 4HT1T 5IWFA 4CDXC 1US2A 1IPKA 1QH6A 4IUGA 2VD7A 2IXJA 1W03A 2VZUA 1LGNA 3I8TA 3OG2A 3NRUA 4FO9A 3PNAA 4NROA 4XJ9A 5I93A 4B1MA 1PGL2 5ACA1 4META 2VBPA 1I6XA 2ORXA 4PLOA 4CE8A 4W65A 4ET7A 2LALA 5L7OA 2EIBA 3CJIC 2QQKA 2JD9A 2GP5A 5LBCA 5F1RA 1SEFA 3CLPA 3LOBA 2VQTA 1H8TB 5FK7A 4EZ4A 1H0BA 3FHQA 1XYOA 3PUAA 3ITQA 4Q4X3 4CRQA 2IXKA 3LIHA 5EWSA 5E8AA 5KHHA 1NCRC 3AP7A 3LDBA 2JG8C 1LEMA 2RJLA 4QU1A 5FYIA 3MV11 3D0JA 3DGTA 4KH9A 4CXYA 2A6WA 1UIJA 2DF7A 2WNVC 2RS52 4PDWA 3RWKX 5A6QA 3ZN6A 4AVVA 5BUVA 2BNMA 1H6XA 1XYNA 2E51A 2VZOA 3MIGA 3NV3A 1HX6A 2QKDA 5IJRA 1MVEA 1ZA4A 4LK7A 4OHZA 4GWIA 3OY8B 5BNOA 1ZA7A 5E1RA 3LFIA 3DXUA 2A3WA 2GNMA 3H8XA 4QPGC 1F4HA 2C24A 4W4ZA 1YJKA 1SQ4A 1D2QA 4AQTA 1GSLA 2XVLA 4LO4B 1IKQA 2CWSA 1BYHA 1GNHA 3U14A 4QX7A 2FDIA 3H7YA 1QDCA 3ES1A 4A4AA 4QPWA 4YG3A 3VBUC 5DAQA 2K46A 4I0AA 1QEXA 1RIRA 5EZWA 3MLJA 2WFF3 5FUNA 3MHZA 2XONA 2RDNA 1QQP3 3A7QA 1WCDJ 1RUD1 3WDUA 3AKTA 2ADDA 3FUQA 4XTMA 1W2UA 4UFIA 1UO9A 5FOJB 5EYXA 3S57A 5FMOL 5J09A 2WO1A 3ZXJA 1NLQA 1X36A 3MFCA 4KWLA 2GP3A 1ND3C 5JOZA 3IM0A 2W2IA 3P6BA 4QKBA 5HBAA 2JG9A 3M1HA 3HT1A 4JKLA 4LKSA 4P9JA 2JDYA 2HYKA 4Q4W1 1JYTA 4RL7A 5JZGA 3AVSA 1AR72 2YC0A 3N7KA 3KLSA 5LRSA 1GFF2 3O1UA 2OQ7A 5FY5A 3AP6A 3T09A 1HB3A 5DG1A 1G9BA 3DEMA 4Z2WA 2ZMKA 4RS5C 1QXPA 4XJAA 1R64A 3VBHA 4D0QA 4PIZA 1IS4A 2JDPA 3HNBM 1ZVFA 2QQIA 4XAAA 3ZYPA 4XFCA 4AEDB 3LSDA 1RHI1 4GAZA 3VV1A 4JRAA 4ATEA 1V6KA 5A6XA 4NN0A 2ID4A 4LHKA 3UKTA 2NMNA 4FQZA 1JS9A 1HB2A 1OOPC 2FZ2A 1ENXA 1SFPA 4OULA 4NHMA 2R042 4WBBA 2J1TA 3ZFGC 2QZ2A 3RZJA 4LBOA 3MF9A 5FZ6A 1HDKA 1D2SA 5CFCC 2DYCA 5A3PA 1GYKA 1BVVA 3WNLA 2VE1A 2NM1A 1PNGA 1D4M2 1G6NA 2P3KA 4FTEA 4A3XA 3TN91 1J59A 1GOHA 5HV0A 5C3QA 3AJZA 2OS2A 2VG9A 4AQ2A 1OLQA 3N36A 4LA2A 4QQLA 3J7MA 3AZXA 2HEWF 4GQ7A 4YW2A 2A3XA 4XUTA 3VDAA 1QNWA 2UY9A 3MW4A 2GNBA 2D3SA 2IXHA 5C9AB 4IW3A 1XU1A 4XMIA 1LHVA 1W9YA 3MV01 1UMHA 1G9FA 1RUG1 1UMZA 1UQXA 2A73B 1AYM3 2JJ6A 2VQAA 5DN2A 1W6PA 3WVJA 4AK3A 4L97A 4Y1UA 3PIJA 3DXTA 4N43A 3GALA 3KMHA 4HKOA 2VUAA 4WVZA 4QXHA 1O3TA 3UETA 1NE4A 5FYMA 1RUE2 3BTXA 4Z2AA 2YFUA 4AVBA 2XJUA 1QH7A 3VBRC 1SDWA 3OBRA 4F7ZA 2ZKNA 2WBKA 4RHV2 2XBO3 3N35A 5JPMB 1QJU2 1HQWA 1CAUA 1DZRA 2ILMA 3GXUA 4MZUA 3U4SA 1WMFA 5CADA 3U0ZA 1W2AX 2VOTA 4GJYA 5J98B 3J7HA 5K0UA 2R1BA 2F4LA 4ASLA 1I1EA 1Q56A 3RMYA 1DQ2A 3U1XA 4U36A 3VKFC 1GZWA 3POEA 3N7JA 1CVNA 1K45A 2DFBA 2ZACA 2OVUA 1IS3A 4Q0VA 4CEYA 4I09A 2L9LA 3T2TA 5A3WA 3QH6A 2Y64A 3NNGA 2DVBA 2VCBA 1AYN2 3ZR6A 5DMYA 1JMUB 4FXKB 2DVAA 5IFPA 5FWEA 3O1PA 4B7KA 2DFCA 3LA2A 5FZ4A 3VBOB 1PO13 3JZVA 4YRDA 4AFBA 3EHKA 1OA2A 4LBQB 1TME1 2EICA 4ISQA 4GB31 5JIUA 1NT0A 3X29B 3KWVA 3NVCA 3QBQA 4JGYA 1FOD3 4JRLA 5FP3A 4E2QA 4LORA 5GLWA 1N3PA 2BOJA 4GWJA 4PQ9A 3TOJA 5B4NA 1HQNA 5C71A 3I3BA 1R1A3 4MV2A 4ZS3A 5I91A 4YM3A 1YJLA 5KBFA 1QJY2 1WUVA 3AFKA 1WBLA 1IG3A 1RMU2 1JOJA 1NZIA 3LFMA 4S2HA 4XQ4A 4CU9A 3IDBB 3RZMA 2XJSA 2G4IA 3E6DA 1YQ6A 3ELNA 4HPKB 4IV3B 4JHTA 4JZRA 3VD9A 2BQPA 1V6LA 1LOFA 4MXWB 1SFYA 5C70A 2WLPA 3LE0A 1OFSA 4AVTA 1B35A 4J25A 1F31A 5T3NA 5L9VA 2W1WA 1K5JA 4CA9A 1YFYA 2QNKA 2WYFA 4LBMA 4MSVA 4NR1A 4OUEA 1RYYA 1R092 4AGVA 1VBB2 1GMMA 1PHMA 2E32A 2YU2A 1RUC2 3I54A 3OUIA 5C8CC 2W1SA 1EV11 1PMJX 1QIQA 2HWE1 4QPIC 2WNUC 1W9SA 1VAKA 3AP5A 5CKMA 3P5BA 1V9U2 5FP9A 5C4WC 5F6LB 3KV9A 1KXGA 4FFHA 5HCBA 2W92A 3KSCA 4AW7A 3I2IA 1W90A 1SDDB 3GHMA 5FZOA 3MZHA 2V4VA 5BPXA 1VBA3 4Q4V1 5F3IA 3PMSA 2GAUA 1R083 4XZPA 1BBT1 2D43A 1H30A 3PVBB 1JOPA 1WMEA 2EIDA 1DQ5A 5JXHA 4P14A 3ZXLA 3H8RA 3B93A 1YUDA 1O4ZA 4Y20B 3WW1A 3C7GA 1OLME 2BU9A 3H7JA 5FYSA 4MYEA 2VNVA 3OBZA 4JGZC 2YY1A 4DMIA 3D82A 3FE5A 1W0PA 3VBFC 4UWDA 3WF1A 4AI2A 2QBXA 3ZFEC 1QNYA 1VRH1 2XGXA 3FC0A 3DV8A 1UF2C 4LOTA 2ZGKA 3WR0A 4COWA 1RITA 2Q30A 4AFDA 1DYPA 3HMYA 4GKYA 4EWDA 2P1BA 3RI9A 1VBC1 2Y6LA 4LJHA 2RM22 3WD5A 5JI7A 4LHSA 1AR92 4CDWA 2VUCA 1RTVA 4I2OA 3TRSB 3T1LA 1CESA 1SLCA 4J1XA 4B4PA 3VDDC 2CYFA 2Q5TA 3NAPC 2EXJA 4ES8A 3WW3A 3SCHA 3UGFA 3PURA 5FYVA 3VHNA 1J3QA 1Y43B 4XUNA 2XPJA 1DDLA 4P9GA 1L7RA 1DQ0A 1W6OA 1MQTA 3E5XA 1AR82 4IEVA 4YG6A 4CP2A 1PX4A 4GULA 5LWBA 1JZ8A 4JCKA 2YZ4A 5D21A 5A33A 3TNPB 3ZLIA 2J7MA 1W2TA 3HWJA 3CHXA 1PZ7A 2VQUA 5A3OA 1MACA 2VZRA 2B5HA 1JBCA 4GMP0 4M01A 3AP4A 4GH4C 3WDWA 1J58A 4RSUA 2P37A 5EPAA 4AI0A 3Q8CA 2JEMA 2PHFA 2HYXA 4KQ7A 3AL5A 3MIEA 1GWMA 4XF9A 4YLZA 4S2GA 3PUIA 5F3EA 4YVWC 3R0RA 2J1VA 4HLTA 4Q4X2 2B9VA 2Z79A 4ARXA 2YYOA 1E5SA 1ND2B 1OHFA 5F37A 5LZ6A 2ZX3A 1LCLA 4HANA 4A7ZA 2VCMA 2BPA2 2A6XA 5A32B 1SPPA 1AZDA 1XPWA 5EJ3A 2XWBB 4XJZA 3TAYA 5JXJA 3MDPA 2I2SA 5L7OC 3B5LB 1E5IA 1RINA 4AFCA 1H9PA 5DUVA 4Y5TA 3KM5A 1NCQB 3MIHA 1RXGA 1UNBA 4AGRA 1NKGA 2QQNA 1FT9A 2DU0A 5DAWA 1AJOA 3K46A 4JQRA 4QGNA 1AX1A 4BK4A 3CJIB 4CDQB 3FHAA 4NOTA 1LR5A 1QXJA 2AENA 4HN0A 2DBIA 5FZ3A 2QVSB 1BKZA 3UYJA 2WT2A 1NCRB 2JDAA 3T0BA 3V0AA 2JG8B 3CU7A 1VRBA 5EJ1B 5FZ0A 2HJIA 5FYTA 3GDBA 4QXKA 1RUH3 2PHWA 2WFF2 1GU3A 5AC91 1RGSA 3NL1A 2IXLA 2J1AA 3PUSA 4MH0E 4Q0PA 2VVFA 1NXD1 4WZFA 3SMHA 3W20A 5T5PA 3VD4A 1XB9A 3WT3A 1EPZA 1QQP2 2YXSA 3E5UA 4MUVA 4PF1A 1OKQA 5DZGA 3WUDA 1ZZ6A 1AXZA 3J8F1 3PVOA 2O0OA 2WS91 1LOAA 2BGOA 3OGRA 4QPGB 3BYWA 2QQOA 3M7AA 2CGOA 4OI1A 3WF2A 5JOYA 1W6MB 3HT2A 3E6BA 1V6MA 2C9KA 4R52A 4LNVA 3VL9A 4DINB 1ZRIA 2Y60A 3RZZA 5CG8A 3VBUB 3S0MA 3JD71 3RZHA 5DZFA 1YEWA 2BEOA 4QB6A 4LKFA 1JYIA 4OI0A 4AAXA 4ITCA 5L73A 2E31A 2P6HA 5EYYA 3B7MA 4KG8A 1O5UA 5GZGA 3N9OA 1HJGA 1Z7S3 3O7OA 2YBSA 4BMEA 5F5CA 1XNTA 1C4RA 2RR11 4FQ4A 1NY71 5LA1A 1NA1C 1RUF1 1AL0G 2JG9C 1LULA 2UY8A 3I7DA 3THPA 4CEWA 4MHUA 4XIKA 4P9LA 3O1OA 5JZGC 1RUJ1 1FPN1 4HVRA 4OI4A 5KXBA 3N7LA 2W46A 3DYOA 2CNAA 3UESA 1W8TA 2XJQA 4QX0A 2JE8A 3NSTA 2RJ2A 3VBHC 3ETQA 2E7QA 2ES3A 2ZAAA 4OHVA 4AEDC 4IXLA 1PZ8A 1ASJ3 1J3PA 4I0WB 5T5LA 3U78A 5A1AA 1RUI1 1Y9QA 1YQ2A 4XF0A 4RS5B 2Y0IA 4UBHA 4BK5A 2DURA 1EYBA 2R16A 3ZSMA 1N1TA 2WR9A 3AMMA 3CZJA 4YG0A 3OJBA 3VZOA 2NN8A 4I3PA 3T1MA 3OD0A 2MHFA 1FMD1 4YNIA 3IDCB 3PJQA 5L9RA 1UZ0A 3TB0A 2MEV3 5FYYA 1SHWB 2DTWA 1VPHA 1U12A 4UYBA 4G4FA 4B8EA 4NPLA 5H9QA 2VAUA 1ZBE3 1YQ8A 3LPGA 3OGJA 4N8MA 4YW5A 3ZFGB 1SCRA 2P6CA 1W0NA 4CU8A 5BNPB 2EXHA 2VTXA 4HK8A 4K40A 1MS8A 4YM2A 4DZGA 4EN6B 4LPLA 3D5OA 3GF6A 2ZZJA 1WA6X 5FKBA 3C7OA 1MZFA 3PHMA 4XW3A 5F2SA 4MVTA 4TLFA 4XJUA 5GKAC 3A4UA 4XUQA 4LBQD 2WA3A 3ZFFB 5IVCA 3BTYA 2C1FA 4FCAA 2VMIA 2D7FA 2XBO2 3D8CA 3NV4A 4NHKA 4XIOA 3OTFA 4MLOA 2BZDA 4CCKA 3O0VA 1SLBA 4QT6A 2IZWA 2FD8A 4OFGA 4E9KA 2WO7A 4N43C 1MS5A 1LESA 4L8QA 3FN9A 4QMAA 3C2UA 3D6EA 3J9SA 1GQHA 1KS4A 3I59B 4D7SA 1W06A 1Q8OA 5FPZA 2BBVA 2RVAA 3KT1A 3RSJA 4EZHA 2PYTA 4BWOA 3AYEA 3ST7A 3W58A 4NIGA 1XU2A 1G9DA 4K9SA 2OZJA 1X7NA 2QQUA 3JBG3 4UW6A 1OQ1A 3VBRB 1VMFA 4CP1A 4IESA 2R32A 4IV1A 1PO12 4XE9A 1UU6A 4MHRA 2YC4A 2ZA9A 2GNDA 4NO4A 3T3YA 5T50A 1OF4A 2D6NA 1OQEA 4KL1A 1FOD2 1W3XA 1N1YA 2E63A 2WINB 4FXGB 4CEYC 4EQVA 5CAZA 3NJVA 1NXMA 1S2KA 4QXBA 1R1A2 1XE7A 1ZRDA 1NLSA 1WCSA 4E27A 3INAA 4CP0A 1DZTA 3SEPA 1DHKB 1N1SA 1YFUA 4XCBA 1Q43A 1V00A 1JHJA 2B39A 5F8PA 4K21A 1GR3A 2G9GA 4G9SB 3E5QA 4MGYE 5FJHA 5LY2A 2TBVA 1GP4A 1Y4WA 1CAXB 1AR71 1X50A 4UW5A 3ZX7A 1HRI3 3H1WA 4R8HA 3KD4A 3I3EA 4QM9A 4M0NA 5IK4A 1U5XA 1OSGA 1ZRRA 3PL0A 1K42A 1P8JA 1TVGA 3WF3A 2AACA 2CL2A 2DDUA 2VZTA 3NMBA 4DO0A 3E1F1 2H0VA 1AXYA 3HN3A 2IXIA 4AVCA 3MYXA 2VR4A 4DQAA 3U75A 5IAVA 4QB2A 5L9BA 1NUKA 3OYWA 1GZTA 3N9MA 1LOFC 3IMMA 5DAVA 3J7NA 4LLOA 4WV8A 3KHCA 2HWC1 2R041 1GZ9A 1TNRA 2JIGA 3IDEA 3KVAA 4XDQA 3CMGA 1B35C 5F39A 5M0TA 5E16A 1JTZX 1COV3 1VBA2 4W50A 5FXVA 1X8EA 1H2NA 2EAAA 1PVC3 4ISRA 1W2OA 1O4TA 2WWJA 4HBNA 5JWPA 1BK1A 1L7LA 5FPVA 5FMBA 2QQLA 1OURA 1RMU3 1O4YA 1UW8A 3ZOIA 1ZZ8A 4HVOA 2QQVA 4RQPA 4K6BA 1WW4A 1XQNA 2PQQA 2R49A 2Y6HA 4FI9A 5CIRA 3THTA 3TWIA 4A2UA 4DY5A 5JDBA 4DUWA 2WZR1 3TEZA 5CBLA 1YLLA 4QPIB 4UFHA 2WNUB 5KC5A 1YQ5A 1HRV1 4ASKA 3PMEA 1VJ2A 2K2SA 5FBZA 5I0TA 3WQ1A 2H0BA 4BQXA 4DIQA 1WA4A 2EXIA 4E2GA 2RV9A 1NYWA 2VBBA 1WGPA 2YV8A 5KHJA 1UIKA 2ZKLA 1HXS3 4QX8A 1VALA 1PO21 3RRDA 1J1LA 2WWUA 3VKNA 1RUE1 2FMDA 4COYA 4GALA 4IL7A 1PM7A 2OIIA 2AH2A 1K5MA 1QJX1 2IFWA 1GICA 2AEZA 4JGZB 1PK6B 1PNFA 2B7YA 3KVBA 4RHV1 1QJU1 5BYNA 5K9YA 1JYXA 3LKJA 3VBFB 4FPCA 3ZFEB 1T6GC 1KD7A 4PIXA 4BPZA 3KV6A 4DY3A 2PA7A 2G9FA 1W6NB 3DYPA 4PIYA 5IVVA 5GZCA 4JKMA 3WDYA 3N4MA 4XOGA 1YXWA 5FWJA 3ETPA 4HKWA 2VCAA 3LZZA 2FCUA 1Q8QA 4BDVB 1AYN1 2RS13 3FWEA 4KWKA 1Z78A 2E7TA 4H3WA 4P9IA 2FDKA 3ZO0B 3VDDB 3NAPB 1MQTC 5DQ0A 1AHSA 1F5FA 2D5HA 1HJFA 1LJ7A 5K7PA 2Y6JA 1ULFA 3E97A 4HFSA 4YGBA 3IIAA 3BPSA 4DXRA 3BOWA 1AR93 3MBWA 1DGLA 5CZKA 4Q26A 2ZX4A 5LK5A 5JPNB 2CV6A 4L9BA 5IT6A 5IVJA 4LK6A 4JDNA 1QJY1 1BQPA 1JZ7A 2YFZA 2VCCA 2A70A 2BV4A 3MEPA 1IQDC 1J83A 4GH4B 4ASMB 2P2KA 4OHWA 3D4KA 1N47A 2UWBA 1ONAA 4XF1A 3K75B 1W99A 2VOVA 3DPRC 3UKVA 4YVWB 5FZKA 2Z4FA 4DUXA 3KV4A 4QXCA 5FIXA 4A41A 4N9HA 1NX9A 4DRVA 1R091 3ASIA 1A6CA 1NCQC 1O7FA 1YFWA 4HK9A 4WM7A 4WVVA 3AMPA 3S7IA 1RUC1 3V64A 5A7PA 1RUH2 3DKQA 5IATA 1OA3A 1HN0A 4WM8A 3I3MA 2DCTA 4CDQC 2H6CA 1WMXA 5L7OB 1UXXX 2TUNA 3ZXKA 4CXXA 2WAAA 5JXIA 4OVEA 1ZRCA 4AVSA 1OH4A 3M3OA 1DBNA 5FYUA 4XFFA 1MZEA 5CYYA 4AFAA 4N7IA 1E5HA 1V6IA 5CU1A 2A6ZA 2PMWB 3FHIB 4Y1XA 3ILFA 5F6KA 5CB7A 1LHOA 1A3KA 1TZOA 5FXZA 5H9SA 3BALA 4Q4W3 4DXSA 1XNDA 3EO6A 1I5ZA 2DTYA 4Q0UA 3E6CC 1LNSA 5DAXA 2RS31 5CKNA 3S30A 1VB2A 4PDWB 2D5FA 2WQ4A 3VBSA 3ZN6B 1NAEA 2Q1ZB 4XXPA 1MEC3 1DLLA 4LO5B 4OCTA 5FUPA 3VKMA 5C7GA 2J1EA 2P3IA 3ALQA 5BNOB 5KWRA 2WN3A 1W04A 2BJSA 5D8AA 3MF6A 2Z5WA 3P3NA 1RHI3 1BMV2 4COZA 1Y9MA 1Z7S2 1MPXA 3GJAA 1RB8G 1ULOA 1V70A 3ZIWA 3KB5A 4XFIA 5GLUA 3Q8AA 2RM21 1VLNA 4BIOA 3NV1A 2ZGOA 1S1AA 1POV0 4ATFA 2YB7A 4CCMA 4DXTA 4QQOA 4YSFA 4LULA 2VMEA 2ZCWA 5LBBA 2OKXA 3RFRA 3BUCA 1KFXL 3O0XA 5FY7A 5IW0A 3MPPG 4FOYA 3W21A 4QQHA 1ASJ2 4QX2A 3RI8A 1AXKA 1M4WA 1R1ZA 2GMMA 2J1SA 3HD8B 4CVUA 4QHBA 1O3RA 3W9AA 1AR81 4TN7A 2AEYA 1WZXA 4IDZA 2VY0A 2WAOA 5FPXA 1S0IA 2W47A 4YW1A 1FAYA 4SBVA 1V0AA 2WIIB 5GM0A 2AREA 1ST8A 2VZ1A 2Y6GA 5FMOS 5A7SA 3ZSKA 1NA1B 2MEV2 2JG9B 4DB5A 3PVNA 3NKTA 5JOWA 2JD4A 1DYKA 5JZGB 1CPMA 4BXFA 1ZBE2 1AL23 3NKGA 4F83A 1UKRA 4XACA 2ETEA 3TEWA 3IBMA 3TEYA 3AP9A 3VBHB 5FO7B 5LASA 3BOPA 3ENRA 4UF0A 1TEIA 2PHDA 2JDKA 2LRPA 4YW7A 4E8DA 2BVBA 2LROA 5IAXA 1POV3 5FY1A 2WUHA 2W08A 4WVMA 4E4ZA 1YYNA 4FTBA 3THCA 3J26N 1S4CA 2ZMNA 2A6VA 5CA6A 2ET7A 5BNPC 4ZXKA 4P9YA 5A7QA 2V5YA 4W6XA 4DRRA 3EXUA 1LTEA 3OGVA 3VLBB 3LAGA 1X9TA 3N9NA 4ES9A 3UGGA 3AZZA 1FATA 3N3HA 3OGSA 1HN1A 2DWRA 2GN7A 5FPAA 2FDFA 3WHUA 3RYKA 4Y1YA 1DGWA 1ULCA 5A1FA 3ZFFC 2Z69A 4FPJA 3RVHA 5A70A 2FDJA 3ZYGA 1TMF1 2B42B 1BHGA 4L99A 3WDTA 4C91A 1L7QA 5HXVA 2EXKA 5FZEA 3WG2A 4GB33 1EAH3 4KGGA 2HWD3 3JBG2 1OPMA 5APAA 3WP3A 2WFF1 4KWUA 1PIV2 4ZONA 2WQ8A 3RZKA 1DIWA 1OBNA 1S0EA 1Z0HA 2GH8A 4Z82A 1W6PB 1KRIA 2WA4A 1Q3EA 3LDRA 5CVRA 4YFWA 5C6CA 1QQP1 3EJKA 5J37A 2BRTA 1GNYA 4Y4RA 1BXHA 2Y6FA 4QB1A 5G05L 3VHPA 4N43B 5FZFA 4CPBD 1CX1A 3KT4A 1JYVA 3I3QA 1CJDA 4IEOA 2EAKA 3K4AA 4YZ1A 3H1YA 2X5IC 1YI7A 3LB9A 3IN9A 4K8FA 2VH9A 4IV1C 4RFRB 2XR4A 2X29A 5GALA 4IEZA 1W3VA 1UOGA 4I02A 4LE3A 2ARCA 1CAUB 3O5SA 2VGDA 5FTTC 2AZ5A 4YW4A 5ABJA 1GV9A 2D6OX 3RYPA 1D0GA 2Q1FA 1HRI2 5K0UB 3RZLA 4NWVA 2NMOA 2VL4A
chains in the Genus database with same CATH topology
1EV13 3AZWA 2KM2A 3AYCA 1GZWB 2RHPA 4CEYB 1C1LA 3L2HA 4YZ3A 3NW4A 4Q4Y3 4XQWA 2RJKA 4B29A 4PLNA 3VHRA 1QOOA 2OYZA 4C1XA 2ZGTA 1TNFA 4XTPA 1BBT3 4O9EA 1XNKA 3SHRA 2QJVA 2LUWA 2DVDA 4XJWA 1COV2 3B9IA 1XE8A 5CFDA 4Y22A 1LHWA 1PVC2 2Z42A 2UWAA 4L11A 3AYDA 4AG4A 2V73A 1IQAA 1LOEA 3ZYIB 2C5DA 2WQZC 3CF6E 1VRH3 4FP2A 4M3CA 5FO9B 5AVAA 4PBOA 2PHXA 3UK9A 4EWAA 1VBC3 3GNEA 4XBNA 1SBFA 3IPVB 4BIFA 4COUA 1W0OA 1AYM1 3QD6A 1B35B 4BM8A 3ILRA 1HXS2 2OZ6A 4Q29A 3DKWA 3M3QA 3BTAA 4RQPC 3RPQA 5HCAA 5GLVA 1IOAA 3UJOA 1SLAA 2WFPA 2HWF1 3POYA 4R9CA 3BCWA 3WP5A 2OUHA 4IEUA 1W39A 3FLRA 5TSWA 4I01A 5ACA2 4PLMA 3ZXAC 2E53A 3USUA 1KS5A 4IEQA 5DZEA 1C5HA 1C1FA 2DCKA 2D3PA 4GKXA 5JIAA 4QQPA 3SLIA 1PK6C 2BW8A 3RJRA 2D98A 1K5MC 1OQDA 2N7GA 3RQ0A 2PTMA 2RS12 4XFBA 3WDXA 3JB8A 1ENRA 1WLDA 1PGW2 2GNTA 1WD4A 4KGQA 5GJ6A 1MZ5A 2CY6A 1DGRN 5KHKA 1CQ9A 4Y5Z0 4Y20A 1CR7A 1FOD1 4H55A 3H3ZA 3R4DB 4Y24A 1WW5A 2GC0A 4N53A 4CDWB 2WLQA 1CJPA 3OCPA 2DU1A 1HKDA 1CPNA 3RDIA 4RGAA 2F6BA 1CN1A 1W6OB 1MQTB 4RR3A 5JOXA 4LBJA 4ZU4A 2E6VA 1QHDA 2IXCA 4M3CF 4FPEA 1KJRA 4LHNA 5AC93 4BE3A 1YNAA 4BCUA 2ZX2A 3L2YA 4B4RA 2ZS6B 3GHNA 1UU5A 1CAWA 3J8F3 1H1IA 2WS93 2YUEA 4GWNA 3U11A 2GN3A 4XYXA 3L9JT 1RUOA 4QQ2A 4OLLA 3DF0A 2VMHA 1SMVA 2XL9A 1YCIA 1R081 4AEKA 2EA7A 2VULA 5HI0A 4K1ZA 3DPRB 5C8WA 4Q4W2 4WM7C 1AR63 1PMIA 5C33A 3SNMA 1VBD1 2KXLA 4Q27A 1F9KA 4WM8C 1CGPA 4BA6A 1ZM1A 2PLV1 1MEC2 2X53S 3WW4A 4XFGA 3SH5A 1RHI2 1G9CA 4NPRA 1AJKA 3QLQA 4CDXA 1REFA 1RVF1 5A32A 5I0UA 5E89A 3B94A 3VHOA 1RUJ3 4PDWC 2VPVA 3V0AB 4UXAA 3VBSC 1JN2P 2BGCA 4UBGA 1BZWA 4RGGA 3JQXA 4YW3A 5BNOC 1GQGA 2XUMA 1FV2A 2ENRA 3AKPA 3IKWA 5D8AC 3O14A 1UPSA 5IK8A 2PAEA 1AX0A 1RUI3 5KXDA 2WL1A 3V0BA 4CYDA 4QGLA 2RMU3 1FMD3 1KDKA 5I8SA 2ZHLA 3DL3A 2F4PA 1XYPA 1VP6A 2WNVA 3AMQA 4XFHA 5F9TA 1LU2A 2AUYA 1TQ5A 3HR9A 1O91A 1S0DA 1AL22 3TYJA 4JC1A 4YYOA 3B02A 1UCXA 2BUKA 4ZU7A 3ZYRA 1VAMA 1SCSA 3JB4C 4OUMA 1EY2A 4BMBA 2AGSA 1Y3TA 1S0GA 1F5JA 4FPGA 4XJ8A 1QOTA 1KFUL 4CEWB 1OPOA 5F5QA 3WLUA 3OGGA 5FDBA 1O3QA 2R071 1BEV1 1UKGA 4UW4A 2JICA 3WNXA 4LO6B 5T5OA 5T5JA 1SBEA 4AYUA 1S0CA 5DDJ1 2B8MA 4AFMA 3UV9A 3MICA 2CGNA 4XHBA 3H50A 3S7EA 1V6NA 1PGL1 4D94A 1AUYA 3WQ7A 1ND3A 2EF6A 3M3EA 5FQ0A 4GMP1 2YDEA 2QCSB 4C90A 4GB32 1EAH2 2WT1A 2JXAA 2XLGA 2ATFA 2HWD2 1PGSA 3ES4A 1ZBA3 1YRZA 3GBFA 4AHZA 4DFSA 1DG6A 4R9DA 2AYHA 1VBE3 3WZ1A 1UN1A 4NVPA 4F3JA 1OOPA 2RS51 4GXLA 2I74A 4L92A 1WLCA 1JW6A 5CFCA 2VQ0A 3H1MA 4AQ6A 3WP4A 4DXZA 2ZOEB 1GNZA 2GH2A 1H1MA 1BMV1 3SCFA 1EV12 1Z7S1 2HWC3 4Q4Y2 2ZGLA 3VZJA 5ABJC 1CONA 1PIV3 2MPFA 2X5IB 5K0UC 4A7KA 4LR4A 4IV1B 1BBT2 4QM8A 1UZZA 4DS0A 4P9XA 3ECQA 2VU9A 3H9AA 4LE4A 1NG0A 4R4ZA 2HWB3 3IWZA 2BYVE 2Q0AA 4MX3A 3ZXGA 5KC6A 3ZPYA 1FI2A 2WZR3 5FAXA 3WW2A 4YGEA 5T52A 1O3SA 2ZX1A 1HRV3 3VBRA 5JAXA 1VRH2 4H14A 2SLIA 3ZMNA 2GC3A 2LTNA 2OW4A 4XBLA 2JENA 3P3PA 4HSJA 2K9ZA 2MEV1 2ARXA 4QU2A 4TSVA 4YVSA 2R063 4JGYC 1VBC2 4INDA 1DGWX 2HKXA 4KG0A 1IGOA 2PHLA 1ZBE1 3C3VA 1C57A 1PO23 4B4QA 3LCPA 4AGGA 5AVPA 1CAVA 3FX3A 1LGBA 4FT8A 2Q8OA 2D44A 4TZDA 1QJX3 2DVFA 1RJ7A 3ZXFA 3OYWB 5IK5A 1DF0A 2PAKA 1CAXA 4IEYA 4IERA 2JX9A 5J48A 4HL0A 5EXOA 1D4M1 2EIGA 1V6JA 1KITA 2TEPA 4LA3A 5BNQA 3RJ2X 1S0JA 4RQPB 2EVXA 3VKLA 4YZ4A 2ZX0A 1QY4A 2WSVA 2QZ3A 3WUCA 4C0BA 2YGLA 2Z2SB 1C8M3 2XG3A 1FXZA 2BWCA 3OF1A 1MVQA 3O0WA 4HMZA 4AHWA 5HCFA 3KT7A 2R0HA 4HKLA 4HN1A 1YIPA 1W6QA 5J36A 3V56A 4LO7A 3FBMA 1QMJA 1YFXA 2XKOA 1Q5OA 3K48A 5C8CA 4K3UA 4CDUA 1SLIA 4QPIA 2WNUA 1DGRA 2XWJB 1REEA 2Q1MA 4O9GA 2P34A 4X8PA 5C4WA 4C0HA 1K5MB 1WLWA 2XH6A 2DV9A 4QPYA 1H2KA 4LLFA 3A0KA 5ACA3 3WOGA 1HRI1 1XNCA 1A78A 5AFBA 4CDWC 4E2SA 4N53C 4FAGA 3WHTA 5AC92 2E7AA 5EFUA 3VZNA 3U4XA 4FPHA 4Q0SA 5GLTA 3ZSLA 5LEJA 4IEXA 3SISA 3J8F2 4RD7A 2WS92 4GA9A 4YGCA 4KU7A 1QU0A 1HW5A 2VVEA 4RR3C 3BU7A 1X8MA 1J1TA 2ZJCA 1W6NA 3POWA 5JSPA 2P3JA 4JTNA 2XHKA 3ZMOA 3G6JB 5I0RA 2RS33 4W6WA 1RC6A 2YGMA 1HV1A 1AR62 2JKBA 3LSEA 1RMU1 2XB6C 4AI1A 2WSUA 1AX2A 2ZGNA 1OA4A 4AI3A 4Q8KA 1G9AA 2GC2A 2A7AA 3KS7A 4XPVA 3FBYA 1OFNA 3SITA 3AM2A 1NY72 2GMPA 1WD3A 4QD2A 3KZ4C 1RUJ2 4XHXA 1C5IA 1VBB1 1HXS1 3IT8A 5BNNA 2JE7A 1WW6A 1U5IA 2CAUA 4WM7B 1RUD3 3WXPA 2GMEA 4WM8B 4RFT0 2VOXA 1V9U1 3WINE 4AEJA 3KCXA 4C1WA 2JDZA 1RUI2 2WNEA 4LHLA 4KNCA 1CX4A 1YWKA 2BNNA 2XJRA 4YVWA 1B09A 1ALYA 5FREA 5DXDA 2RMU2 1FMD2 5D1IA 4DNYA 5DUXA 3MI8A 3MPBA 4N9IA 4M00A 2X8KA 2ZAHA 4BH9A 1GBGA 2XL7A 4B7EA 4BHPA 1M06G 5KHGA 4PCRA 4E4DX 3WY6A 3VBSB 3QOPA 2VVDA 3R6SA 1H8TA 5BY5A 2XKPA 3CJXA 1G86A 4Q1RA 2IC1A 2RS11 5D8AB 2PHRA 1NQDA 1PGW1 1X82A 1BVP1 5K8SA 1QWRA 3GBGA 4LT5A 2QE3A 2XLFA 3M3CA 1WMDA 4KU8A 2D3RA 1AR91 2AR6A 2XJVA 2BFUL 3AX4A 4XMAA 5LRRA 4FPYA 1XRUA 1RUNA 1GZCA 3OY8A 3WG1A 4D7TA 1SACA 3GZTB 1LENA 3TN93 4OHYA 3ME2A 2ZPXA 3MW2A 4AHYA 2C9AA 4XXAA 3MLKA 2BFUS 2DUOA 2VXRA 1S55A 1FX5A 4N90A 5GLZA 1TMF3 1ZZ7A 2ARBA 5GZFA 4CEWC 2O8QA 3MFAA 2VNOA 3AB0A 2NQYA 2RE9A 2XVKA 3PJYA 1RUG3 1H9WA 5L19A 3PVEA 2B9UA 3HIFA 1I3HA 2FMYA 3G7DA 4DPNA 3WG4A 1FV3A 2XJTA 3FJSA 3Q9OA 2GZWA 2ZZQA 1ZBA2 1WW7A 3JCIA 5JR7B 3LA7A 3TBDA 2YMZA 3N7MA 3MIBA 5A3LA 4Q4X1 3R4UA 4RA0A 3HAGA 2CTVA 4AXOA 1KDMA 1PVXA 4HETA 5KHIA 3QCWA 5T54A 4BZ4A 1NA1A 1VBE2 2YHJA 4WVMB 5CNAA 1JXNA 3AK0A 2Y0OA 1XNBA 2UU8A 1IS5A 5DG2A 4L2NA 3AXDA 3QACA 1MEC1 4LTAA 2VW0A 4AEDA 2QQPA 4FOWA 1QGLA 1C3HA 2FHRA 1S0BA 2FZ1A 4Q2FA 4EN8B 1KJLA 2D97A 2ET1A 4URTA 4UW3A 2DUQA 3WCRA 4AWDA 3AKRA 1TME3 4WZCA 2HWC2 4PBPA 4Y26A 4KBBA 1N1VA 2HEYF 2QFEA 3RWNA 4HZFA 5I8YA 2NPIA 1ZZBA 1LOCA 4MGKE 5J7MA 2HWB2 1D0HA 3U07A 4LUMA 3H0OA 1H2LA 1UL9A 3NO8A 2B46X 2VW2A 5C9AA 2VOWA 2WZR2 4S2FA 1HRV2 5LK7B 3ACLA 1AVBA 3R05A 3WDVA 3EQEA 4BLJA 2R062 5ABJB 4R9AA 1SFNA 5A3MA 1MS9A 1YHFA 5GZEA 1G7YA 1AL21 4X6RB 3TNQA 1PO22 2HWE3 2YROA 5FOBB 1DQ1A 5AFEA 3HQXA 1YI9A 1N3OA 3IMNA 1HQLA 3GYDA 2HWF3 1QJX2 4HSLA 1POV1 3UKNA 4YVSC 4Q4V3 3AMHA 1VAVA 2C0ZA 4U2AA 3AXEA 5SV5A 1H2MA 4AEMA 4JGYB 3LWCA 4ZKTB 5CFDB 4Y22B 2VNGA 3WV6A 1OMIA 2ZGRA 1ENQA 1ZREA 3VBOA 4XFAA 1DQ6A 4SLIA 1QF3A 2KA3A 2D93A 4M3CB 2DCJA 4LBQA 1C8M2 4JDOA 2R30A 1EAH1 4IETA 3M70A 2HWD1 4OI2A 4KWJA 3URFA 1ZNPA 3GZUC 1MZ6A 4ONUA 3FFZA 1OLRA 3VL8A 1D4VB 3MGUA 3FUOA 4FSJA 1ULEA 3JU9A 4IV3A 4HPKA 2JE9A 2PN5A 3WX5A 2I45A 4MXWA 4FPLA 1HV0A 4XEZA 4EN0A 2XBO1 5FLHA 3IPVA 3CL1A 1URXA 3W59A 1NE6A 5L36A 1SLLA 4FOVA 4GIQA 3CNAA 2UYAA 1NZCA 1F8VA 1NOVA 3USUB 3KGLA 3B01A 4CDUC 3VZMA 3FLTA 3NJZA 3B3QE 5CG9A 1ENSA 1JH5A 1G8WA 4Q4Y1 4DOUA 5FLIA 3DUIA 1RL3A 3QH7A 5E88A 1PO11 4P9WA 2Q4SA 1N3QA 4XQDA 1A8DA 1QXRA 4FTSA 2GC1A 2VMGA 1H1AA 1U0AA 5T55A 1VBD3 1NLRA 2RS32 4XF4A 1R1A1 4R9BA 1WLTA 2PLV3 4AQSA 5KXEA 2A3YA 1S0FA 4MGIE 4N53B 4PJYA 2PFWA 4FOQA 1C8NA 2GU9A 4IEPA 5FFOC 1IZ3A 3RG0A 3H8UA 1O5LA 4AVAA 2D6LX 3GBWA 3TWIA 2GSYA 1RVF3 2D6MA 2W39A 5JLVA 1VB4A 1JYCA 3U10A 3GZAA 1EP0A 2VUJA 3MW3A 4RR3B 5A33B 1MS0A 1CD3G 2UYBA 4OUSA 3UL2A 4D3WA 3MIDA 4YFZA 3SXWA 4YARA 5I0SA 2DUPA 2HEVF 4Y4YA 4EROA 3K51A 3M4FA 2QDNA 2B45X 1RUD2 3H3UA 4E4SA 4K1YA 3S6PA 2ZHMA 1CAWB 2ZMLA 2NP0A 3BPZA 1VBA1 5JSRA 1MS4A 1UAIA 3CEWA 4N7UA 4H7LA 1H8VA 3JD73 5BNNC 3ZSJA 4XBQA 4OZXA 3FLPA 2WJSA 3AKSA 3D0SA 1TE1B 1ND2A 3JUUA 4Y1VA 2RR13 1PZ9A 1RUF3 1UX6A 1ULDA 3VGIA 4HVQA 1LU1A 1LHNA 3DPRA 2DCZA 4CDXB 1FPN3 1DQ4A 1LB2A 1IPJA 2ZTNA 2R073 1BEV3 3RYRA 1LEDA 2W52A 4MXVA 1NCQA 3FMGA 3ZSEA 1ULGA 1H8TC 1HIXA 3TN92 2JECA 3CJIA 2ZHNA 4CDQA 1OD5A 1U5YA 2ZHKA 5DDJ3 4NHLA 1FNZA 2MNGA 4Z92B 2A71A 5FLJA 3KCYA 3V0BB 2CAVA 4LBNA 1C28A 4YGDA 1NCRA 1TMF2 1FNYA 2JG8A 3PLQA 3OD4A 4QGMA 5GZDA 4TYSA 4GMP3 4V1PA 4Z07A 1GLHA 1E57A 2O8OA 4Z1VA 1CIWA 1KQRA 5FO8B 1QOSA 1RUG2 1ZYBA 2WNVB 3WG3A 3CO2A 4Q1PA 2WWSA 3ZDSA 1LRHA 4QPGA 3RNSA 4YZ2A 2OPKA 3RS6A 3UJQA 2VECA 3APBA 3DN7A 1IKPA 4OHXA 1W6MA 1L3JA 3M8LA 4FAHA 2A75A 4JVAA 2XJPA 2RS53 3VBUA 5JMCA 4EJRA 2ZGUA 3VZLA 4YM0A 1GKBA 1SLTA 1AR61 1LKNA 1LOBA 4Q8LA 2CGPA 1BJQA 4I30A 5BV6A 4JV4A 4J1WA 2IWGB 2UURA 1ZX5A 1JUIA 3ZN5A 3KGZA 3PTYA 5IUQA 3ZVXA 1LODA 4AF9A 4FPFA 4LO8A 2BTVC 4PF5A 4TWTA 5KXCA 2XLAA 2A5ZA 2QUOA 3VZKA 1VIWB 4P5HA 2ZGMA 1LHUA 3AJYA 1ND3B 2XVGA 1TME2 4K7JA 2GDFA 2VW1A 5FQ0B 5IK7A 3LOIA 2BWAA 1LECA 1RUH1 3OBTA 3HBZA 1XXNA 5FCCA 4LBLA 1LGCA 1YIFA 4RS5A 4FPOB 4COVA 2PELA 2Y26A 3AYAA 3B69A 2BVVA 1FYUA 2W0XA 1DFQA 2W68A 1IHMA 3I4IA 4F8AA 2RMU1 1V6OA 2ZGQA 3EBRA 2QDRA 5DUUA 1Y7BA 4BOWA 1AR73 3VKOA 2TNFA 1OOPB 2FBEA 4XETA 5EV7A 3ZFGA 2ZABA 5BNPA 2D6PA 1AYM2 4EWEA 1GANA 1Q8VA 3MIFA 5FRAA 1MR5A 5CFCB 1UPIA 3SH3A 2HWE2 3R4SA 2R0FA 5C9AC 3ZYJB 3ZFFA 4FP3A 4QX5A 2HWF2 2R043 3HN1A 4G3YC 4D7YA 4I0BA 4LUKA 4ZU5A 1OI6A 5B2GB 2WC2A 4Q4V2 2O1QA 4BYYA 3ROUA 3OPZA 1D4M3 3VN4A 1Q8PA 1JHNA 3NWKA 4X8NA 3I59A 3BB6A 2I07B 1ASJ1 1A8MA 4Z8BA 3LA3A 4Y1ZA 2V09A 1QDOA 3AZYA 4I3GA 3O12A 2YPJA 4MGZE 3FZ3A 2X5IA 2SBAA 4YM1A 4M3CE 3ZXDA 2BNOA 4LBKA 4YVSB 5J96B 2VNRA 4JDMA 3ILNA 5CFDC 2P17A 1UZYA 5J3UA 1ZBA1 3ZN4A 3AKQA 1RUE3 3POSA 1AF9A 2DCYA 3VBOC 1CAVB 3RMXA 3ZXEA 3WCSA 4EV0A 2Y38A 4RHV3 4IEWA 5DUWA 1QJU3 3V65A 4B3NA 2H6BA 1ZRFA 1VBE1 2E9QA 2WT0A 4LEJA 4M0HA 2NZ9A 4IQPA 3B9CA 5JVVA 3AZVA 1UD1A 1ZZ9A 2PAMA 1MS3A 4GWMA 4XILA 4IV3C 1AYN3 2VOKA 2NYYA 1U5ZA 3B00A 4AHXA 3AMNA 1F2NA 4YZ5A 2D40A 2D6KA 3BODA 1RJ8A 4CZSA 3JBG1 3WP6A 1PIV1 2NLRA 5H9PA 1R082 5SV8A 4D69A 1HLCA 1Q8SA 1H4GA 1VBD2 1W6QB 1QJY3 3J4UH 4FPKA 3MLLA 2HWB1 2OUJA 4X6QB 2PLV2 2EALA 5C8CB 4Q0QA 1UU4A 3FFQA 1DU3D 2PHUA 4CDUB 1J3RA 2ZBJA 5BXXA 2ERFA 2OA2A 4W6YA 1IS6A 2FQPA 3WQ0A 5C4WB 3M2MA 1NQJA 2A6YA 3M3IA 4JAAA 1RVF2 2UWCA 3SH4A 1X33A 2R061 4K20A 1R093 1I9RA 5I8TA 1VBB3 1VR3A 1RUC3 3BIWE 1WCKA 4A7YA 1H4HA 1S2BA 1V9U3 3VUOA 4JGZA 3KCCA 4JTOA 1PK6A 1QKQA 1JUHA 2WZPP 4R4XA 3VBFA 3ZFEA 4EN9B 4J6GA 4EN7B 1EPWA 3USSA 2ZGSA 2LM3A 4AE2A 1APNA 4BQ1A 1COV1 2WKKA 1PVC1 2R1DA 3JD72 2PHTA 2DVGA 4NWWA 5H9RA 3SCGA 3ZIXA 2R6QA 3JQWA 4ORFA 1YO8A 4H7MA 3VDDA 3NAPA 3KQRA 1LOGA 1REDA 3A0NA 3I2DA 5LEKA 1QJZA 1C8M1 5JCTA 2RR12 2RM23 1RUF2 1SBDA 4FVVA 3AFGA 1FPN2 4CTEA 1DZQA 2IFRA 4XF3A 4AI8A 2R072 1BEV2 4S2DA 4FBFA 1MS1A 1ZZCA 4WVWA 3NV2A 5BNNB 2ZGPA 3LGRA 4GH4A 3ATGA 4BLIA 5JSOA 1WBFA 1ND2C 5JI9A 2GALA 2K0GA 5DDJ2 1BCXA 1AR83 2CWMA 4HT1T 4CDXC 1IPKA 1QH6A 2IXJA 4FO9A 1LGNA 3I8TA 1PGL2 5I93A 3PNAA 4XJ9A 5ACA1 4META 4PLOA 1I6XA 4W65A 2LALA 5L7OA 3CJIC 5F1RA 1SEFA 3CLPA 3LOBA 1H8TB 1H0BA 1XYOA 4Q4X3 4CRQA 2IXKA 5EWSA 5E8AA 5KHHA 1NCRC 3AP7A 2JG8C 1LEMA 2RJLA 3D0JA 3DGTA 4KH9A 2A6WA 1UIJA 2DF7A 2WNVC 2RS52 4PDWA 5BUVA 3ZN6A 4AVVA 2BNMA 1XYNA 2E51A 3MIGA 3NV3A 1HX6A 2QKDA 1MVEA 1ZA4A 4OHZA 3OY8B 5BNOA 5E1RA 2A3WA 2GNMA 4QPGC 1YJKA 1SQ4A 1D2QA 4AQTA 1GSLA 2XVLA 4LO4B 1IKQA 2CWSA 1BYHA 1GNHA 3H7YA 1QDCA 3ES1A 4YG3A 3VBUC 4I0AA 1RIRA 5EZWA 3MLJA 2WFF3 1QQP3 1WCDJ 1RUD1 3WDUA 3AKTA 3FUQA 4XTMA 1W2UA 5FOJB 5EYXA 5FMOL 5J09A 3ZXJA 3MFCA 1X36A 4KWLA 5JOZA 1ND3C 3IM0A 5HBAA 2JG9A 3M1HA 3HT1A 4P9JA 4Q4W1 2HYKA 4RL7A 5JZGA 1AR72 2YC0A 3N7KA 3KLSA 5LRSA 1GFF2 3AP6A 1G9BA 5DG1A 4Z2WA 2ZMKA 4RS5C 1QXPA 4XJAA 3VBHA 4PIZA 1IS4A 1ZVFA 3ZYPA 4XFCA 4AEDB 3LSDA 1RHI1 3VV1A 4JRAA 4ATEA 1V6KA 4NN0A 4LHKA 3UKTA 2NMNA 4FQZA 1OOPC 2FZ2A 1ENXA 4OULA 4NHMA 2R042 4WBBA 3ZFGC 2QZ2A 4LBOA 3MF9A 1HDKA 1D2SA 5CFCC 2DYCA 1GYKA 1BVVA 2NM1A 1PNGA 1D4M2 1G6NA 2P3KA 4FTEA 4A3XA 3TN91 1J59A 3AJZA 2VG9A 4AQ2A 1OLQA 3N36A 4LA2A 4QQLA 3AZXA 2HEWF 4GQ7A 4YW2A 2A3XA 1QNWA 2UY9A 3MW4A 2GNBA 2D3SA 2IXHA 5C9AB 1XU1A 4XMIA 1LHVA 2JJ6A 1G9FA 1RUG1 1UMZA 2A73B 2VQAA 1AYM3 1W6PA 3WVJA 4AK3A 4L97A 4Y1UA 4N43A 3GALA 3KMHA 4HKOA 2VUAA 4WVZA 1O3TA 1NE4A 1RUE2 4AVBA 2XJUA 1QH7A 3VBRC 1SDWA 3OBRA 4F7ZA 2ZKNA 4RHV2 2XBO3 3N35A 5JPMB 1QJU2 1HQWA 1CAUA 1DZRA 2ILMA 4MZUA 3U0ZA 5CADA 1WMFA 5J98B 5K0UA 2R1BA 4ASLA 1I1EA 1Q56A 3RMYA 1DQ2A 4U36A 3VKFC 1GZWA 3N7JA 1CVNA 2DFBA 2ZACA 4Q0VA 2OVUA 1IS3A 4CEYA 4I09A 3T2TA 3QH6A 2DVBA 1AYN2 4FXKB 2DVAA 4B7KA 2DFCA 3LA2A 3VBOB 1PO13 3JZVA 4YRDA 4AFBA 3EHKA 1OA2A 4LBQB 1TME1 4ISQA 5JIUA 4GB31 3X29B 3NVCA 3QBQA 4JGYA 1FOD3 4JRLA 4E2QA 5GLWA 1N3PA 4PQ9A 3TOJA 1HQNA 1R1A3 4MV2A 5I91A 4YM3A 1YJLA 5KBFA 1QJY2 1WUVA 3AFKA 1WBLA 1RMU2 1JOJA 4XQ4A 4S2HA 3IDBB 2XJSA 2G4IA 3E6DA 3ELNA 4IV3B 4HPKB 2BQPA 1V6LA 1LOFA 4MXWB 1SFYA 2WLPA 1OFSA 4AVTA 1B35A 1F31A 5T3NA 1YFYA 2QNKA 4LBMA 4MSVA 4NR1A 1R092 4AGVA 1VBB2 1PHMA 3I54A 1RUC2 5C8CC 1EV11 2HWE1 4QPIC 2WNUC 1VAKA 3AP5A 1V9U2 5C4WC 5F6LB 1KXGA 5HCBA 3KSCA 4AW7A 3GHMA 3MZHA 5BPXA 1VBA3 4Q4V1 3PMSA 2GAUA 1R083 4XZPA 1BBT1 2D43A 1H30A 3PVBB 1WMEA 1DQ5A 4P14A 3ZXLA 3B93A 1YUDA 1O4ZA 4Y20B 3WW1A 3H7JA 4MYEA 4JGZC 2YY1A 4DMIA 3D82A 3FE5A 1W0PA 3VBFC 4AI2A 3ZFEC 1QNYA 1VRH1 2XGXA 3FC0A 3DV8A 1UF2C 3WR0A 2ZGKA 4COWA 1RITA 2Q30A 4AFDA 1DYPA 3HMYA 4GKYA 4EWDA 3RI9A 1VBC1 2RM22 3WD5A 5JI7A 1AR92 4CDWA 4I2OA 1RTVA 3TRSB 3T1LA 1CESA 1SLCA 4J1XA 4B4PA 3VDDC 2CYFA 2Q5TA 3NAPC 2EXJA 4ES8A 3WW3A 3SCHA 3VHNA 1J3QA 1Y43B 2XPJA 1DDLA 4P9GA 3E5XA 1DQ0A 1W6OA 1MQTA 4IEVA 1AR82 4YG6A 4CP2A 4GULA 4JCKA 2YZ4A 5A33A 3TNPB 3HWJA 1PZ7A 1MACA 2B5HA 1JBCA 4GMP0 4M01A 3AP4A 4GH4C 3WDWA