3HD8B

Crystal structure of the triticum aestivum xylanase inhibitor-iia in complex with bacillus subtilis xylanase
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
184
structure length
184
Chain Sequence
STDYWQNWTDGGGIVNAVNGSGGNYSVNWSNTGNFVVGKGWTTGSPFRTINYNAGVWAPNGNGYLTLYGWTRSPLIEYYVVDSWGTYRPTGTYKGTVKSDGGTYDIYTTTRYNAPSIDGDRTTFTQYWSVRQSKRPTGSNATITFTNHVNAWKSHGMNLGSNWAYQVMATEGYQSSGSSNVTVW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification of structural determinants for inhibition strength and specificity of wheat xylanase inhibitors TAXI-IA and TAXI-IIA
pubmed doi rcsb
source organism Triticum aestivum
molecule tags Hydrolase inhibitor/hydrolase
molecule keywords Xylanase inhibitor
total genus 48
structure length 184
sequence length 184
chains with identical sequence D
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2009-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00457 Glyco_hydro_11 Glycosyl hydrolases family 11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3hd8B00
3WX5A 3WQ0A 1HV0A 3VLBB 1QH7A 3VHOA 3MFAA 1REEA 2DCKA 3WQ7A 2BWAA 4HKLA 1XYOA 2B45X 1M4WA 3HD8B 3WQ1A 4IXLA 4XQDA 4HK8A 1XYNA 1ENXA 2C1FA 4HK9A 5HXVA 1H8VA 1UU4A 5K9YA 2JENA 4XQ4A 1H4GA 3WXPA 1AXKA 1BVVA 2VG9A 4S2GA 2BVVA 3VZLA 3VHPA 2VUJA 3VHNA 3VZNA 3MF6A 1F5JA 1QH6A 1HV1A 3WY6A 1IGOA 1KS5A 3RI9A 1W2UA 2VULA 3AMNA 4H7MA 3B7MA 2Z79A 3ZSEA 3LGRA 1UKRA 3VL8A 3AKRA 1PVXA 1OA3A 3B5LB 1OLQA 2DCZA 2D98A 2VGDA 3AKSA 4S2DA 3EXUA 2BW8A 1NLRA 2NQYA 1XNKA 3AKTA 1H1AA 3VGIA 2B42B 3AMPA 2NLRA 3LB9A 2DFBA 4NPRA 1UU5A 3AKPA 2BWCA 1XNCA 3WP6A 3WR0A 2JEMA 3WP5A 4S2HA 3VZKA 2DCJA 1H0BA 1OA4A 3VZOA 3VZMA 1KS4A 1OA2A 3MF9A 1BK1A 3AMHA 3WP3A 4S2FA 4HKOA 5K7PA 4XPVA 2B46X 1TE1B 3M4FA 2DFCA 3WP4A 1H4HA 1XNDA 2F6BA 1C5HA 2QZ2A 2DCYA 3O7OA 1UU6A 3VZJA 1YNAA 1BCXA 3WT3A 3AMMA 1XXNA 1C5IA 1OLRA 1XYPA 3AKQA 3RI8A 3VL9A 5EJ3A 2D97A 2JICA 3MFCA 1HIXA 1REDA 3AMQA 1T6GC 4XQWA 1XNBA 4HKWA 1REFA 2QZ3A
chains in the Genus database with same CATH superfamily
3RG0A 1JBCA 3WX5A 1FI2A 2WT2A 4M0NA 2QTWB 5SV8A 1LGCA 1SLBA 3VBRB 3AJYA 4R52A 1W6PA 1VB4A 4DIQA 5FZOA 4R9CA 1WA6X 4H14A 5A3NA 2WL1A 2RJLA 1GANA 2ZABA 3FFQA 5BNQA 3T1LA 4N53C 4J6GA 4NO4A 1W9WA 5CISA 1RUG1 2GH2A 4R9DA 3ILNA 1RTVA 1GZTA 1SLCA 4JDNA 2L9LA 1JN2P 2VM9A 1VBC1 5CADA 5BY5A 1EV13 2K2SA 1WKYA 2EIGA 1K5MA 2SBAA 3T1MA 1WCDJ 2RR12 4ES9A 1F15A 4OMCA 4XQ4A 3VBSB 1SBEA 1R082 5HCBA 1OT5A 2QE3A 1CAXA 1HXS3 1KGYA 1AF9A 1NKGA 5FZDA 3F95A 4FOQA 1K3IA 2V73A 5A33B 3FHAA 1OMIA 1W2OA 4B4RA 1HV1A 3RZZA 1IGOA 1BYHA 1MACA 4M4RA 4RQPC 4Y1VA 3ZX7A 4DS0A 2XB6C 4X6RB 5L9RA 1UN1A 5F3IA 3WW2A 1H2MA 3CHXA 3SHRA 4Q1RA 4Q27A 1H2LA 1V9U1 3C7FA 3VDCA 3B9CA 1UKRA 1FV2A 4OQ9A 5A7QA 2P5BA 2WZPP 3SCFA 1XNTA 4CCOA 3N36A 1OA3A 2RS51 2VNGA 3JU9A 3RYRA 3R4SA 4QHOA 2J7MA 3WHUA 5DDJ2 1ZBE3 1OVSA 1VBA2 3AKSA 2D7FA 2VXRA 1AYN1 1F35A 5FXZA 2R1DA 5FY7A 2Y6LA 4IEXA 4KU8A 5JI7A 4N43B 2R073 3V0BA 4DPNA 5C6CA 2RS31 4K7JA 1UYYA 3I4IA 1V70A 4MX3A 4O7XA 4AVSA 4B1LA 1IS6A 3S30A 4FPKA 4FAGA 2FDIA 3VD3A 3IT8A 2XKPA 4YVWC 1X8MA 4ZONA 4K3UA 3OGVA 4IGQA 3LEKA 3OSDA 3ZN6A 3GHNA 3J7MA 1W6OA 3AFGA 3LWCA 4I2OA 1Z78A 2WN2A 2FDGA 3HT1A 2MEV2 3W59A 1XB9A 1CGPA 3DKQA 3LEGA 4NPMA 3KD4A 3K2OA 1OOPC 3LOBA 3M4FA 3UETA 1YC61 2Z5WA 2J1SA 2IUWA 4IERA 1H4HA 3FE5A 4PI0A 2SLIA 5T5OA 2QKDA 1PGW2 1UOJA 1DCSA 1FYUA 1W8ZA 3CMGA 3WNPA 4AQSA 5LA1A 3POYA 4BM8A 2BEOA 2DTYA 1NQJA 4JC1A 4D94A 3AMMA 4DFSA 3AKQA 1B35C 3NAPC 5A1AA 1AVBA 1NZCA 2W52A 4CEYA 3MEPA 1AR92 1LOFC 2RDRA 3ZLIA 5CFDB 4LBOA 2J1TA 4YFWA 3J7NA 1QOTA 4GB33 5GALA 3T2TA 3U4SA 3DYPA 2D6KA 3QLQA 4NHLA 1AR91 3IPVA 2VOWA 3MV11 2BBAA 4PLMA 2Q30A 1W2AX 2PXJA 1JZ4A 5FY1A 4YGDA 1BXHA 1TQ5A 5D21A 1BVP1 3K75B 4Q0SA 1N3OA 1VMFA 5DUWA 1REEA 1XBFA 5F6KA 3SKJE 1ODMA 3U37A 5A7SA 4QQ2A 3ACHA 3ZDVA 2JXAA 1CAWB 3IWZA 3KZ4C 2DF7A 4E2SA 1PVC1 2JE8A 2V4AA 3HNYM 1YO8A 4YW4A 5A6YA 2LALA 2VMDA 4ATFA 2WJSA 4AYUA 2QDNA 4BPZA 2GN3A 2JE9A 4Q0VA 5DZGA 1KXGA 2W87A 4LMFA 1R1ZA 4Q0PA 1RUJ1 2JENA 3ZXDA 3C7GA 5JOWA 1RMU2 4IEYA 2QQJA 1H9PA 2PHLA 5ACA3 1O4ZA 4A7KA 1RGSA 1I1EA 1OSGA 1NYWA 2A6XA 4TLFA 5KHHA 2P37A 1YYNA 2VUJA 3JD73 1LCLA 3WEZA 3K77A 3B3QE 2WR9A 3FBYA 3POGA 5FPXA 4JGYB 1CVNA 2GNTA 2PLV3 2XONA 1FT9A 2ZEYA 1B35B 3BUCA 2PHUA 2OQ7A 2RMU1 3NNJA 4ARYA 3W58A 3V65A 1ZA7A 2A6YA 2K9ZA 1YQ8A 2Q1ZB 4SLIA 4D8MA 2Y64A 4CCCA 4Y5TA 1BZWA 2Y38A 2DCZA 2ZJCA 4DUVA 4YW1A 1QOSA 3INAA 4YVSA 2YXSA 2WWUA 4PBOA 2HYXA 3OUIA 1XNKA 2XLFA 1J1LA 1WGPA 1DGRA 5HI0A 1GQGA 1LNSA 3VBFB 1HXS1 1PVC2 4GZ9A 3CBNA 4NPRA 1AXZA 1LRHA 3IDBB 3RYPA 3LPGA 1G9BA 3VZKA 3ZYHA 3TAYA 2FCUA 2VC9A 2FBEA 5KWRA 3RS6A 1MS9A 4YLZA 3AP9A 2JDYA 1RUG2 1POV3 2LS6A 2CWSA 2XR4A 1YWKA 1QDCA 1QQP3 2OYZA 1SEFA 1NZIA 4BXSV 1Q8OA 1FMD3 3B02A 4YGCA 1X36A 4HKOA 3OBZA 3U14A 3PUHA 3LA3A 3ROUA 4FP2A 3OPZA 5FWJA 4ZU5A 1F9KA 3BIEA 2X29A 1K5MB 5FYBA 3ZIXA 3NSTA 4I02A 1ND2A 2D3PA 2IVJA 3CEWA 3AP7A 3BOWA 3VBHC 3O1SA 1LOGA 2ZEZA 4UF0B 4XBQA 1XXNA 3L9JT 4G9SB 4WZCA 3G7DA 1O4YA 4YG6A 5JCTA 5LATA 5EJ3A 1UWWA 3ON7A 4QGMA 2VU9A 4AHZA 1PX3A 4XETA 1MS4A 2H6CA 1RYYA 3E1F1 3KCCA 3ZMNA 3WNXA 1HN0A 1DBNA 1BBT1 3K4DA 4GH4B 4KL1A 5DG1A 1C1LA 2YZ4A 4JCKA 5FOJB 2HWC2 3AZVA 3POFA 1HQLA 4HBNA 5C9AA 1KDMA 3ZXGA 4FOVA 1YJKA 2QQLA 4W65A 2WNVB 3HVDA 3W9AA 3MZHA 4P02B 3RVHA 2A71A 1JYTA 4W4ZA 1PIV3 1V6LA 2OUJA 5GLVA 3PVBB 3NJVA 2ZACA 3ASIA 3KQRA 4XEZA 1TMF2 4LO6B 4XACA 4HT1T 2D3SA 1CX1A 4YM1A 2Y6JA 3DPRB 1AUYA 1KRIA 4IESA 2B9UA 1A8DA 4IV3A 4Y5Z0 1Q8VA 4E27A 2YYOA 4CVUA 1HJGA 4GB31 3ORJA 5FJHA 2Q8DA 3ZN6B 3ZFEC 1I9RA 4QAWA 4X8PA 1N3QA 1WW5A 1OKOA 3MW4A 1DYKA 1O59A 2QQNA 5D2AA 2RE9A 3VD7A 4ASLA 3ZIWA 4YM0A 2RM22 4BMEA 2BNMA 4MGZE 1LOFA 4QT6A 1KS5A 4BQ5A 5JOXA 1PGW1 5LA0A 1W2NA 2ZGOA 1D7PM 4COWA 5SV5A 1AL21 1YFWA 3DXUA 3JCIA 1RC6A 2JKBA 1S0GA 3A4UA 1CAUB 5A6ZA 2H0VA 5LBBA 3WW1A 3ZSEA 1PX4A 4Y20A 4EE2A 2W95A 4Q26A 2I74A 2TBVA 4YNIA 1W6MB 3FC0A 4B3NA 1FPN3 2XJVA 2WINB 3M3EA 4GKXA 4Q4X3 2HWB1 4XZPA 5F39A 1OLQA 2WO1A 2WQZC 2XQRA 1OD5A 2VGDA 4L92A 3ZKYA 2A5ZA 5CKQA 1OF3A 2A3YA 4FFGA 2H6BA 4QPIB 5GLUA 3OB8A 3GZEA 3IPVB 4HSLA 1UYXA 5K8SA 1VBE3 3H8OA 1O3TA 1VBA3 2VTXA 2W68A 4PQ9A 3VKNA 2ZZJA 4YG0A 3MV01 1JW6A 3S5AA 3QACA 5DUVA 4BQ3A 5A7NA 3Q8BA 3AMHA 1WBLA 3HNMA 4TZDA 2BV4A 4M4PA 1XJAA 1QJX2 4JX0A 2PHWA 2VY0A 4PF5A 5LZ6A 2ZGTA 4MGYE 1W06A 1L7QA 4MADA 5C5UA 3L2YA 4N8MA 5DAVA 1ZZ7A 4MUVA 3WZ1A 2UU8A 1NCQB 3GNEA 3EQEA 3LD8A 4QPWA 1IOAA 5I8SA 4MG2A 2D5FA 3AZYA 3CL1A 2VZTA 4RHV2 1DP0A 1PK6B 2F4PA 3ME2A 3PUQA 1YQ6A 4N9HA 1ULCA 3N9OA 4RQPB 5F5AA 4DB5A 5BNNC 3VDDA 3D0SA 1FATA 1GNZA 2WNUC 1N1YA 4OQ8A 4NHYA 1AR73 1Y9MA 3FLRA 1Q5OA 1RUF1 3ENRA 4FP3A 5LB6A 4E4HA 1UYPA 5B2GB 5KHIA 1IPKA 2Q5TA 1QHDA 2JDHA 3PL0A 4GQ7A 3SEEA 1WMFA 5I0RA 4LE3A 3K51A 3SMHA 1JODA 4WZFA 1AR63 5FZKA 3K3OA 5T5JA 1SDWA 1UPSA 1LHVA 1LKNA 1TME2 1YUDA 2ORZA 5LASA 1POV1 4CCNA 4UFKA 2HWD1 2RVAA 4CUGA 3DV8A 5C3RA 1WW7A 4CPBA 1ZZ9A 3B69A 4XFAA 4KWJA 2GMEA 1PGSA 2HWE2 1IZ3A 4UOJA 2BERA 3SC7X 2LTNA 1HN1A 2RS33 2WNEA 3CJIC 1FPN2 2ARCA 1RHI3 1LU1A 1HRV3 1LEMA 1DQ0A 4Y4RA 2O0OA 3NNFA 1JUIA 3ZYGA 1HX6A 1WLTA 1FPN1 1LOBA 4EN9B 2WYSA 5HPOA 5J48A 4QKNA 4J1XA 1IQAA 3RZKA 4KH9A 3SISA 1OH4A 3MPPG 1XOYA 2WO7A 4QQPA 1ZBA1 2GU9A 5T3NA 2EAAA 3MBWA 1JHNA 1LU2A 4B4PA 4IETA 3HAGA 4BJ0A 2R49A 3U78A 1ZZ8A 4JKLA 1YIPA 4I30A 5EV7A 2R042 1YHFA 4IGOA 1TNFA 5FOBB 1QXRA 1WMXA 2D93A 3IIAA 1OBNA 1S0BA 2YPDA 5FZ8A 2VG9A 1H30A 1J3QA 2Y6GA 2XH6A 1RUF2 4WM7A 3VHPA 2XOMA 1Q8PA 1C3HA 3MF6A 5FXXA 4CPBD 4XJ9A 1DFQA 2WAOA 3OGRA 5BNOC 3I3EA 4IEZA 3H7JA 3OF1A 3G6JB 5CFCC 4XF1A 1IPSA 1Z0HA 3MLJA 4AOCA 3M1HA 2OUHA 1A3KA 4RFT0 1QJU3 1YQ5A 3JD72 3HBKA 2Z79A 5CB7A 4IDZA 3LA2A 3SKVA 4AVVA 2XPJA 2ZGRA 4UF0A 4M3CF 5F9TA 3D4KA 4PDWC 5A32A 5IHRA 4FPYA 2VMIA 1VALA 1V6NA 1EAH1 1COV2 2ZHKA 1CJPA 3KB5A 4JV4A 4UW5A 2HWE1 1FV3A 2HWD3 4QX7A 3OPWA 4FXKB 4UFHA 1EPZA 4XCBA 3ACFA 1NLRA 1WCKA 2A3WA 2Y6FA 3LZZA 3TWIA 1G9CA 3VGIA 3R05A 1LGNA 3LF7A 3OD4A 4Q0UA 4BIOA 3KMHA 3M7AA 5JUVA 1V00A 2A6WA 1RUF3 1DGRN 2X09A 4AI1A 3BALA 3J7LA 1JZ7A 5F2SA 3LDBA 2VZRA 3Q8EA 3VDAA 3NKTA 3WNMA 4LA3A 3I3MA 1RHI1 1W9TA 3OBTA 4GMP0 2BGCA 2ZX1A 2DCJA 4KGGA 4YVWA 3VZMA 3WCSA 1K5JA 4Z07A 1PVC3 4RS5B 3UT0A 1XU1A 3I59A 1GP5A 5F5IA 4YRDA 4YZ5A 3NW4A 5A80A 2E7AA 4LBNA 3HN3A 4QD2A 2YGLA 1VBD2 2HWB3 2QQKA 4AQ2A 3AYAA 2JX9A 2ZMNA 1DLLA 3WV6A 5L7OB 2WRAA 5F7UA 2QZ2A 1ACCA 1GP6A 2WUHA 3IDCB 4QKBA 2RG4A 3RGBA 3ZSLA 4M00A 4LR4A 4MSVA 4KWUA 5IATA 2X10A 5LRRA 3ZFEA 1F2NA 1G6NA 3LFMA 1UO9A 3I7DA 1QJX3 1VBE1 1LJ7A 3NJYA 3MHZA 3VBUC 3POBA 4YZ4A 5A7WA 5FYMA 1UY1A 4A4AA 3H0OA 4LPLA 4Z1VA 1Q56A 5K0UB 1MZFA 2WFF3 1H6XA 2IXIA 1B09A 3DF0A 3GBFA 4Q4Y2 5J37A 3U0ZA 1WA4A 1C8M1 2J1RA 2XUMA 5EQUA 2QNKA 1UOFA 1CAUA 4LA2A 1VP6A 4Y20B 1UU5A 5IVYA 1C4RA 2WWJA 3JB4C 3VD9A 4CA9A 4YFZA 3WNNA 3P3PA 5D8AB 1QH7A 4XXPA 2R1BA 2AEYA 4N7UA 2WT1A 2Y6HA 3K3NA 4XDOA 2YG0A 3ZSJA 4AFBA 1SBDA 3QD6A 2DVGA 2VD7A 5CG9A 3WCRA 1M4WA 3OGSA 3N3HA 1OF4A 2QUOA 3ZXJA 1R092 1T2XA 4QX5A 2YUEA 4BZ4A 1W8TA 2WA4A 4LQRA 1LECA 3X29B 4V2VA 3I2KA 1CPNA 1KFUL 2Y60A 4QX2A 3ACLA 5C7GA 5C8WA 3KGZA 1F4HA 1RUD3 2UWCA 5BNNA 1H6YA 2VZSA 3FUOA 3J8F1 4HOOA 3AYEA 2R063 5LA9A 2JDNA 2ZGPA 3ZO0B 2FCTA 1VBE2 1OFSA 4CDQA 4NVPA 5L36A 4WVWA 4EZ4A 5LY1A 2W08A 4LKDA 1J58A 1NCQA 1VIWB 2CTVA 2Q1MA 1DGWX 1PM4A 2PYTA 2RDNA 2DTWA 1PK6A 4I01A 2RM21 1JZ5A 1W6NA 1VAVA 2ENRA 4IE4A 3VDDB 3HOBA 3HQRA 2JG8B 2VVEA 2KD7A 1CPMA 2NMOA 4JTOA 4RGGA 2G1MA 5C3QA 3NAPB 5FZBA 3I2IA 3K46A 4S2DA 4AZZA 4A6SA 4LJHA 3LEIA 4R4XA 2IVIB 4FO9A 1VAKA 2RS11 4PHZA 3ATGA 5A3UA 4D0QA 5ABJC 1Y7BA 1VLNA 3KHBA 4I3GA 3KGLA 3KSCA 3H50A 2EA7A 3BTAA 3OUHA 4DEQA 1E5IA 2VTFA 5IVCA 4J1WA 4COYA 2RS32 4AI9A 4QDRA 3TBDA 3POIA 1GWLA 2O1QA 3MW2A 4O61A 4COVA 3WF4A 1RUH1 2PHFA 3ZN5A 3CJIA 2JDUA 4OLLA 4AHWA 4JQTA 5BXXA 1VMJA 4XF9A 4RL7A 4XPVA 2XDVA 1GFF2 1DGLA 2VMEA 2Q8CA 4CSWA 1Z7S3 3CZJA 2E31A 4CP9B 1W28A 5ISLA 4BH9A 4GJZA 4EJRA 5GLTA 3O1VA 3FFZA 2BYVE 2XBO1 4DZGA 1SMVA 5E89A 3WUCA 3O1RA 1BCXA 1BEV3 2ZTNA 1FOD1 2IFRA 3VBHA 4BLJA 4HVQA 4K20A 1FMD2 1GQPA 3RI8A 2VNRA 2ZS6B 4LBMA 5IAVA 5FKBA 4PIYA 1GV9A 1NCQC 4JDMA 4LULA 4LNVA 4TWTA 4QX3A 1ZZCA 5DXDA 3T2OA 4A3ZA 2BU9A 1K12A 1RVF2 4HVOA 4FFIA 1DLCA 1DU3D 3J8F3 4QM9A 3NNLA 4I0WB 1IS5A 3ZXKA 4YARA 5C8CB 2B4KA 2F4LA 4AGGA 2VBDA 1I3HA 3VHRA 1W6QB 4Q4W1 5JOZA 3I8TA 5CEHA 1H2KA 1US3A 3PIGA 3KF3A 3TN91 4J25A 2R0HA 1BKZA 2I07B 1PMHX 3DKWA 4U2AA 2FZ1A 1CJDA 2RM23 2FMDA 5BPXA 3UKVA 5FYZA 1LOCA 2HEVF 3I3DA 4IXLA 2BBVA 4QKFA 4HANA 1YRZA 3H1YA 1AJKA 4CCEA 1XYNA 3AYCA 2ZX0A 1MQTC 4FOYA 3D3AA 5IFPA 3GM8A 2AACA 4GWMA 1CZSA 1NE6A 2D6MA 4YVWB 3VBRA 2XHNA 1RUI3 4RS5A 1ULEA 4L0PA 1W6PB 2EXKA 5FPLA 4BQXA 1ZBA2 5FZOB 1O8PA 2RJKA 3GZAA 4ZS3A 2XJQA 2ZX3A 1R083 2WZR1 1XE8A 3N9QA 4JTNA 3VZNA 5CVRA 5FZAA 1NXMA 2LROA 3OD0A 2ZEWA 3K4AA 4K1ZA 4MV2A 1QH6A 1RMU3 4XFIA 3WY6A 3ZPOA 2XLAA 5LA2A 1JOPA 4Y5SA 4XMIA 1FOD3 4D7SA 1OURA 3AMNA 1A6CA 2DBIA 3I3QA 3OEBA 4X8NA 3UKTA 1GZCA 4QM8A 1OC1A 2WS93 5FPUA 3RWKX 3V0AB 3VBSA 2VOXA 1ULOA 1MZ5A 1P8JA 3DYMA 2R0FA 5LEKA 1J84A 2ARAA 3KWVA 4LIVA 2AZ5A 4A45A 1C28A 1CAXB 3IB3A 3AZZA 5K0UA 2W46A 4CEWC 3LIGA 5CFDC 2BW8A 2GSYA 3C3VA 5ANNA 3QCWA 1H1AA 4YVSC 4WBBA 1UL9A 2NLRA 4HL0A 1V9U2 1R1A3 4Y24A 5ERLA 4A41A 4IV1C 4CU8A 4XUNA 2HH9A 5F1RA 1WCUA 3KCYA 5IW0A 2WFF2 3BIWE 4F83A 2ZGMA 3FL7A 5FZGA 5C3OA 1HKDA 1OLME 3MF9A 4QX0A 1OLMA 1VBC3 5JSOA 1BK0A 2GC0A 4BK4A 5FXVA 5GZDA 2UY9A 1UX7A 3BPSA 1CN1A 3B9IA 2JD4A 2DDUA 4XHXA 2VPVA 4AEDA 1XQNA 3KF5A 2P3JA 2WLQA 4KGQA 4W6WA 3WP4A 1VBB3 2EVXA 3O0VA 4JKKA 4QPGB 2NP0A 3AVRA 2YC4A 3SXWA 1R081 1ND3C 3O7OA 4P9JA 2ZGQA 4RS5C 3ZFFC 5FCCA 4KNCA 1J59A 5G04L 3USSA 3O12A 5GZGA 1N1VA 2JE7A 4UW3A 1OVPA 5F3CA 1C5IA 2C9KA 4OHXA 1GMMA 1O8SA 1HRI2 1W6OB 1N47A 3O0XA 2Q1FA 3E6BA 3W20A 5A3MA 4XE9A 2JB8A 2KM2A 2R7EB 4GB32 4W6XA 5FZ3A 2WS91 1Y3TA 3WINE 1RUE1 2CAVA 3JQWA 4AVBA 4HKWA 1W6NB 2AEZA 5FKCA 1EAH3 3WVJA 4D7YA 3UNPA 1QNYA 4RHV1 4LHKA 5J96B 3H3LA 5FY8A 2BUKA 3TNQA 3WQBA 4COZA 1ENRA 1PZ8A 4OFGA 2WNUA 2FDKA 1FX5A 1VAMA 4FPHA 5H9SA 5K0UC 4CTEA 1W39A 1BHGA 2B9VA 4XJ8A 1NOVA 1KITA 4GMP3 1L7LA 5FY9A 5FZ4A 4Y1UA 4ZS2A 1Q8QA 4WVVA 2AH2A 1XSQA 4I0AA 3DN7A 2EICA 4GD4A 3HNBM 3NL1A 3ZR5A 3PURA 4ZY9A 2BFUS 1DG6A 5G05L 2A75A 1JS9A 2VQAA 3ES4A 3OEAA 5AFEA 1T6BX 4IV1A 3E97A 1R1A2 2WABA 4HK9A 5J1XA 4CXYA 3ZYFA 5CIRA 1NY71 4Q4Y3 1R64A 2MNGA 2PA7A 3AVSA 3SLIA 2FQPA 1LAJA 4P9XA 1VBB2 2EIEA 1VMHA 4FFFA 3ZOIA 3WXPA 1PMJX 3PIJA 4IQPA 2BVVA 2MHFA 1VBB1 1WD4A 2VVDA 4Q4W3 5JZGA 2P34A 3MUY1 4KI5M 2GDFA 4Q2FA 2Y8KA 2QQIA 1XC6A 3A21A 4A3XA 2HBUA 4PBPA 1OH3A 1XE0A 1QJX1 3S7EA 2P3KA 3HIFA 1FOD2 5LBFA 4OULA 5FIXA 5FMOL 5EZWA 3SQOA 3LGRA 5KXDA 3BTZA 2XVGA 2ZGKA 3VBHB 3AP4A 4AFCA 3AKRA 1SLIA 3GCWA 1JOJA 3LKJA 3NNMA 4AF9A 1NQDA 2JWPA 4AFDA 4XURA 3KS7A 1UMZA 3FLTA 4XTMA 4PIXA 5F32A 3E5UA 4RFRB 2D3RA 3ETPA 3A7QA 4WM7C 2AC1A 1RVF1 1SLTA 2LM3A 4FPEA 2A3XA 2P4EA 4LITA 1JYIA 4RHV3 4FVVA 2Q0AA 1RUOA 1NX9A 4NRQA 4I0BA 5FMCA 1IG3A 2DU0A 5A6QA 3I2OA 3N7JA 4Z2AA 1UF2C 3AMPA 3GF6A 1ZNPA 4WM8B 2YFUA 3PUIA 3ES1A 1W6QA 5GZCA 4LBJA 4HETA 1X7NA 2ILMA 1GYKA 2RS12 4NROA 1JHJA 5JIUA 2JEMA 1MS3A 4DUXA 4AW7A 2BPA2 1SFPA 4C91A 3VZOA 2HWD2 1JXNA 1SFYA 4PLNA 1HB4A 2IXLA 4CZSA 1COV3 3PUSA 2PAKA 4IE7A 4A6OA 2VJXA 1RUJ3 1IPJA 1VRH2 4YVSB 2B46X 4L99A 3BVCA 5BYNA 2EALA 2G9GA 2CY6A 3CIHA 1WZXA 4FCAA 4BK5A 2DFCA 1RUI2 1WW6A 3PNAA 3UL2A 5IVBA 1KEXA 4URAA 4NR1A 1OFNA 1YEWA 2AYHA 5KXBA 2TEPA 1O5UA 1ASJ2 2A70A 1KJRA 2WIIB 4QX1A 3POSA 5ANQA 1W90A 4FTSA 2VZQA 4FPGA 5A3PA 1GOHA 4NN0A 2CDOA 2VQ0A 1G9DA 5GLZA 4XDPA 2R32A 4PF1A 4XQWA 3DPRC 3Q8FA 2YV8A 3AXEA 3V0AA 2RHPA 1V6MA 1ND2B 3GZUC 3A0KA 1KFXL 5FUNA 3T0BA 4FFHA 3T2QA 4ARXA 4V2WA 2RR11 3FZ3A 3SH5A 3T08A 4F7ZA 2LUWA 3BTYA 3VHOA 3O1TA 2ORXA 3MICA 5J98B 5LK5A 3W21A 2P6HA 5FLHA 5EYYA 3WQ7A 3RJ2X 1IHMA 4Q4X2 5FQ0B 4RGAA 1HXS2 3PJYA 4QPIC 1GP4A 1RUC2 2WQ4A 3EO6A 2PELA 2RS53 5FZHA 1OI6A 5IYYA 4GH4A 2QBXA 4GWJA 1UPIA 4IE6A 3WSOA 5AC93 1WMEA 5I91A 2VCAA 1MZEA 2Z2SB 3IBMA 1OQ1A 4LBQB 4Y33A 2QQPA 2CGPA 5EHDA 4HMZA 1JOBA 1O3QA 1ODNA 2D6NA 2ARXA 1MS1A 4Y1YA 3N4MA 2E32A 2G19A 5JDBA 3PTRB 5JPNB 2OX0A 4XUOA 3VKOA 5AC92 4LOTA 5FREA 1S0FA 2BOIA 3LIHA 1R093 4RN5A 1POQA 4AEDB 4BU2A 3BGAA 2YBKA 2B7YA 1CQ9A 1OPMA 2EF6A 2CNAA 2BOJA 3DXTA 4AI8A 1SACA 2I2SA 3WF3A 1PMIA 2JD9A 1QJFA 5FPBA 2OKXA 3O0WA 5JPMB 4IV3B 2W1SA 5CKNA 1LR5A 3PVEA 1JYCA 4GXLA 5JOYA 3AL5A 4GAZA 5KR7A 4C0HA 5DUUA 1O3RA 5T54A 1H9WA 3B5LB 2XJSA 1IG0A 2GZWA 1RINA 1H1IA 2D98A 3IM0A 1UY3A 1OKQA 4Q4Y1 3AJZA 3J26N 4IEQA 5E88A 5C3SA 5CFCB 1YI7A 4L9BA 2P2KA 1AX2A 3OY8A 4CP0A 3RDIA 5M0TA 3UJOA 5ABJA 1K5MC 4DRRA 2UURA 3PJQA 2GC2A 1I5PA 3RSJA 1PK6C 5HBAA 4YG3A 4E2QA 3IDEA 3AKPA 4M3CE 2BWCA 4QU2A 2WNUB 4LBKA 4FT8A 1X33A 4JRLA 3WP6A 5LCWL 4AE2A 4FBFA 1W6MA 1STMA 4N7IA 5LWBA 2PLV2 3HMYA 5C4WC 1SFNA 2ID4A 2ZGUA 3S6PA 2OPKA 1SG3A 2VCBA 4UAPA 5AC91 4INDA 3DUIA 4FOWA 5A1FA 2XJPA 4RSUA 3HEIA 4IV1B 1VRBA 2ZKLA 2G4IA 4AVAA 1C57A 4ZZ8A 2HEYF 4QB1A 2J1EA 5DDJ1 1QF3A 2OS2A 3H8RA 1WW4A 1GLHA 1HLCA 3GDBA 1R091 2ADEA 1DIWA 2BFUL 1UD1A 4AI0A 5FWEA 2ZBJA 3THDA 4CUAA 5J36A 4YGEA 4N53B 2XWBB 4P9WA 5FYYA 5JZGB 2YC2A 1EPWA 2W5FA 2WQ8A 1BQPA 2JICA 3MFCA 3MIDA 3N7LA 5KC5A 4U36A 1WWYA 4GKYA 4IV3C 4K21A 3AYDA 5E6HA 4YW6A 3USUB 4FAHA 3THCA 2VNVA 5ACA1 2JG9B 2RDQA 2C6SA 2WA3A 4QB6A 2JG9C 1NLQA 3H1MA 3WQ0A 4BA6A 4MVTA 3T09A 1DZRA 4PDWB 1H8TC 4BMBA 1IKQA 1A8MA 2ERFA 1XSRA 1PM7A 2TNFA 4OVEA 3THTA 4XUTA 1W3VA 2PLV1 5F3GA 4OHVA 1W8OA 5FZMA 1UCXA 3D82A 3HQXA 4ITCA 2VECA 4YW7A 1S1AA 2MPFA 2JIGA 1W04A 4DXRA 4N90A 4M3CB 4CDWB 4NRMA 2DBNA 4WM8A 2DVDA 1S0DA 2RV9A 4QKDA 4HK8A 3AM2A 3BB6A 2CDPA 4MZUA 2YFZA 1ALYA 1G7YA 2BZDA 3CJXA 5EIYB 1UAIA 4A7ZA 4WV8A 4A7YA 3RWNA 4LLOA 4E9KA 1QDOA 4AQTA 3H8XA 1XRUA 5D1IA 4E4ZA 2VW2A 4XHBA 4TN7A 2XMLA 2Z69A 4NHMA 3HN1A 2W1QA 4MGKE 4QWNA 5EJ1B 5FLJA 3VZLA 4P14A 5A3TA 1CX4A 2QFEA 3TEZA 3ZDSA 5JXIA 1DF0A 1E5SA 3N9NA 4HN1A 5FYUA 4OUMA 5EXOA 4BQYA 4EN8B 2DWRA 2W1WA 3LPFA 3NVCA 4QPYA 2FDHA 3E6DA 1LHOA 2DU1A 4H7MA 5DUXA 4GWIA 5GJ6A 3UJQA 1ZREA 4P5HA 2XJUA 4BDVB 1AR61 1ZM1A 4XBNA 4K8FA 1PVXA 1GZ9A 1TG7A 1CR7A 4KG0A 5FYTA 2Q8OA 4NIDA 2UYBA 3UYJA 3GZTB 4CEWB 1IS4A 2P1BA 2ATFA 4FPFA 5CA6A 1UOBA 1JZ8A 2GP3A 1VBC2 4XFCA 2UWBA 3EXUA 3ZYIB 3H8UA 3J9SA 2NQYA 4ATEA 2QDRA 4E4SA 2ZA9A 2Y0OA 3AX4A 2VOTA 2LW8A 5E1RA 3MIBA 4QMAA 3MIFA 2HWF1 2YY1A 5FV3A 1UY0A 4YM2A 4AQ6A 1H8TA 4UYBA 4SBVA 1C1FA 3NJXA 3C8XA 4Q1PA 1VRH1 1UYZA 1W99A 5KXEA 4UBGA 3BOPA 2VVFA 1OA2A 3DYOA 3R4UA 1ZBA3 4WVMA 3N9LA 1H1MA 3UESA 1S0IA 3P1IA 4COUA 2DUPA 2FDJA 2Z4FA 3KM5A 4S2FA 1MVEA 2VL4A 2VMHA 5IVFA 1V6OA 4FQ4A 5IK4A 3CF6E 5TSWA 4EN6B 3K4ZA 1G86A 4PT6A 2B5HA 4FI9A 1MQTB 4LBQA 2KXLA 3B94A 3FWEA 1UXXX 5FP8A 5C3PA 1AR62 3JBG2 1QEXA 3AZWA 3UKNA 1XPWA 3AP6A 2D43A 4FPCA 4DUWA 1AR82 4BCUA 2YB7A 3I59B 3C7HA 1UIJA 1EV11 3DEMA 4E8DA 1AJOA 1NCRC 5FY5A 4XC9A 3KV9A 2EAKA 3T2PA 5H9QA 4B7EA 4B1MA 1DYPA 1ULPA 2X5IB 4E4DX 3W5MA 2JDPA 2HWE3 4GA9A 3I54A 3N9PA 2VMCA 4P9YA 2NN8A 4LBQD 1A78A 1MS8A 4Z2WA 3TRSB 4AFMA 4DY5A 1O6UA 1UY2A 4GALA 3WDYA 2PHRA 4YW2A 4LO8A 4YZ3A 1LHNA 4JDOA 1UZ0A 4MYEA 2WN3A 5IVJA 4EV0A 3M3IA 1L7RA 5DDJ3 5A7WB 1Y4WA 5CFCA 1A34A 3TN92 2ZMLA 2VOVA 2BWAA 5ABJB 3OPTA 5I93A 3IKWA 3HT2A 3ILRA 3V64A 1JYNA 4CCDA 5FZFA 2E63A 3WDUA 2YROA 1HRV2 2OQ6A 4RR3A 1UU4A 5K9YA 3POJA 4RGKA 1JMUB 2OZJA 4XCAA 1GUIA 2VW1A 4OI1A 3RMXA 4AHXA 3LSDA 3MGUA 1W9YA 4TXWA 1VBA1 1XU2A 3ZXFA 1LHUA 2GNBA 4N43C 1TMF3 3O1PA 2GMMA 1OPOA 3GJAA 1GOFA 3KVBA 4Y1ZA 1DYOA 5B4NA 5GLWA 1ND3A 5JXGA 1MS0A 3THPA 4BYYA 2V72A 5FMBA 1NY72 1KQRA 5BNNB 2E26A 4P08A 3R4DB 2O8QA 3JUUA 4B8EA 2KA3A 3ETQA 2GN7A 3OCPA 1JZ6A 1UMIA 2ADDA 4P9GA 3UGGA 1HB2A 3BU0A 5T52A 1JYWA 1JTZX 2C0ZA 1ST8A 3ZFGC 2D5HA 1FNYA 2ZXQA 1W0PA 2VAUA 3GALA 3USUA 1CIWA 3U11A 5JSRA 2BGOA 4NHKA 4IEPA 4LIUA 4KBZA 1D0GA 1O91A 1WCSA 2WZEA 2OA2A 5EJZB 2DVFA 3MUZ1 3ZMOA 4CRQA 4HXCA 1PIV1 2J1VA 2O8OA 1SCSA 2WZ8A 2XGXA 1NLSA 3LDRA 5FZLA 3NNGA 3PLQA 2WDBA 1PNFA 5AVPA 2DVAA 1PIV2 4GWNA 4XF4A 3IMMA 1Y9GA 4AAPA 3JBG3 5KHJA 4XUPA 3I2FA 1PO12 2PAMA 3OGJA 4HPKA 4PQQA 4FTBA 4M3CA 3NV1A 2CYFA 4BOWA 4CDWA 3DL3A 1Q3EA 2Y26A 2K0GA 5JVVA 2YU1A 5EP9A 3SITA 4EWDA 2QQOA 1GSLA 3HJRA 5CKMA 5C8CC 4XF0A 1QQP2 4CXWA 2E33A 2WSUA 3J8F2 3HBZA 4MXWA 1GBGA 1X50A 4L2NA 3Q9OA 4QHBA 5FZ1A 1SQ4A 1TMF1 1I6XA 2OZ6A 1DGWA 2A1XA 4P00B 5L9VA 5FPVA 4CDXB 4QXKA 5H9PA 1KDKA 4AEJA 4C1XA 3IAQA 3MO4A 5GKAC 5FXWA 1ZRCA 4TSVA 3RZLA 3VBUA 1W8HA 3KCXA 1X8EA 3LDKA 5EFUA 3WG4A 2GH8A 2BNOA 1RUJ2 1PZ7A 1VRH3 1W9SA 1YQ2A 4Q5OA 4LTAA 1POV0 4RYDA 2D40A 4YSFA 4HVRA 4XJAA 4NUBA 4AR2A 4AG4A 3OBRA 3FMGA 3D0JA 4CP9A 2WZR2 1N1SA 2AR6A 4CCLA 1E57A 3E5QA 1GNYA 2BGPA 1HV0A 1ULDA 2RS13 2W9XA 1ULGA 3S7IA 3T30A 3OJBA 3UGHA 2QQMA 4QDSA 5FRAA 2K46A 1VE0A 1YFYA 3MFAA 3OYWA 3LSEA 4LT5A 1J3RA 3O14A 5FY4A 5HXMA 3ZXLA 2RMU3 3NKGA 1V0AA 2C5DA 3MLKA 5JLVA 4XYXA 3EBRA 2IXJA 1ZRDA 3LQCA 3M70A 4GH4C 4UW4A 3FX3A 1S2BA 1OUSA 1QQP1 2X53S 2CHHA 4O65A 2UY8A 3SNMA 4CCMA 4WVMB 1QJU2 5JMOA 4LOSA 1V6KA 3S5QA 5A70A 1NT0A 4HN0A 5BNPB 1AR93 1HDKA 4RA0A 4D3WA 2JIJA 3CU7A 5HCFA 1NUKA 1C8NA 1NAEA 4XFBA 3VHNA 3ZSMA 2XBO3 5FYHA 5FDBA 5JI9A 1BEV1 2ZX4A 4Y4YA 1ZX5A 2E6VA 4EZHA 3M3OA 1JU4A 4JHTA 1TVGA 5JR2A 2W47A 5JZGC 2OXBA 1MQTA 3ZYPA 5BV6A 2CSGA 4Q29A 4BISA 4ZPIA 3JBG1 3B7MA 1RB8G 3LOIA 1FMD1 1WLCA 5DAWA 3WDVA 1RIRA 3CDZB 5LY2A 5C5TA 5APAA 5IWFA 2WLPA 5FZ6A 2ETEA 2ZHMA 3H3ZA 4LKFA 1CZVA 4H2AA 2ZHLA 1UZZA 4XJZA 5I0DA 2CGNA 4QU1A 5E8AA 1SBFA 3LA7A 4NHXA 1QXJA 5FP3A 5CNAA 4XXAA 3ZYRA 2B42B 2A6VA 2CV6A 2DFBA 1SCRA 2RMU2 1UNBA 3ZFFB 1N1TA 3JD71 3VKFC 5FP4A 1RJ7A 4MGIE 4E2GA 1RXGA 1HQNA 1MPXA 2UYAA 1QWRA 2R072 4K8RB 1RUG3 4P9IA 3WNOA 1C8M3 4MOAA 1VR3A 1MVQA 3POWA 5LBCA 2D6OX 3BCWA 4DRVA 3LEMA 2W94A 4FPJA 2D6LX 4MO3M 2EIDA 3WF2A 3I2HA 5IAXA 1VBD3 4OCTA 4ISQA 2GMPA 2XKOA 3HQUA 4XILA 1Y9QA 5FO8B 3KV5A 3R0RA 4LK6A 5FFOC 4IE0A 1S0JA 4RR3B 1XNDA 2DUQA 4P5YA 4QXBA 1HB1A 1G8WA 2X05A 1VJ2A 1RHI2 1AXYA 1FXZA 1YNAA 5F2WA 4B4QA 3KV6A 1UY4A 4FQZA 2CGOA 4KG8A 4NWVA 3HWJA 2CU5A 4CXXA 5BUVA 4XUQA 1DZTA 1QMJA 5JR7B 1ASJ1 4AEDC 5FZ0A 4OMDA 3NJZA 5F6LB 2J22A 1ND3B 1T6GC 2HKXA 5FZ9A 3AK0A 3R6SA 4NAMA 1W8NA 1EV12 4GJYA 4QPGA 5FLIA 5FYIA 2XL9A 3A0NA 2WSVA 3D8CA 4BIFA 1GR3A 2VCMA 5AFBA 1OOPA 1S4CA 1AYM2 5CZKA 1QOOA 1AYN3 4IEUA 1K45A 3AFKA 3RZHA 2R071 4H55A 2GNDA 3WF1A 2CAUA 2VCCA 3KT7A 3MIHA 2JDAA 3PMSA 2DCKA 4QX8A 1QIQA 1MS5A 5A33A 4EN7B 1DQ2A 1GOGA 3DGTA 1XYOA 4W50A 3LCPA 1QXPA 4JAAA 4XQDA 1HB3A 3NRUA 4Q4X1 4UXAA 2AENA 4KWKA 5FR3A 1U5XA 4HFSA 2PHDA 4OI0A 2C1FA 2W3JA 3SH4A 3TEYA 1H8VA 4AVTA 3QBQA 2IZWA 4Q0QA 5C4WA 5FUPA 3WDWA 1H4GA 2DYCA 4JGZB 5I8YA 1JI6A 3WW4A 5IT6A 1BBT3 2OW4A 4D6SA 1TME1 2Y33A 2XXZA 5HV4A 1IS3A 2MEV3 2OPWA 3RZJA 4YZ2A 5JIAA 1AR72 5C33A 4E8CA 3V0BB 3RZGA 2C24A 3WOGA 1EUTA 4FPOB 2VH9A 1RUH3 2VULA 1AR71 1S2EA 3A22A 2BVBA 5CBLA 2IXHA 3MW3A 5BNPC 1SHWB 3RYKA 4JRAA 2D44A 1VBD1 4AHYA 4BHPA 5DQ0A 1ZA4A 1JZ2A 1D2QA 4L97A 2WNOA 3QH6A 1LOAA 2J42A 2JDMA 3VBUB 4AEKA 3ST7A 4HONA 3FUQA 4D6RA 1RUE2 2QQWA 5KHKA 4Y22A 1ZBE2 3PTYA 5L19A 4YPJA 3I2DA 2YBPA 1X9PA 2V09A 3LB9A 3T3YA 1WCQA 4JGYC 4K6BA 2VNOA 3GCXA 5KXCA 3GJBA 3WP5A 3PU8A 4DNYA 3VDBA 1AZDA 2DURA 3A23A 2VBPA 5IFTA 2P6CA 3MLLA 2PQQA 5H9RA 5C70A 4EWAA 2P3YA 1LHWA 1W0OA 2E9QA 2W39A 3FJSA 5CFDA 5BNOB 5E16A 3ECQA 4UFLA 5A7PA 3NQHA 3VBOC 2E51A 3M2MA 1JYVA 2W1UA 1QKQA 4YW5A 4BLIA 1ENQA 3VBFC 4OHYA 1YJLA 2YPJA 3I97A 4META 4LXLA 1TME3 4Q4V1 2QVSB 4B7KA 4CU7A 5D8AC 1AYN2 5FK7A 3APBA 3LAGA 5LK7B 4CCJA 1H2NA 4NMIA 1W0NA 4C90A 4HSJA 3WDTA 1FNZA 4PI2A 4F8AA 3VL9A 4BQ4A 1BMV1 1E5HA 1U5ZA 2CL2A 2VZ3A 2GNMA 4AL9A 3TYJA 2D97A 1UX6A 5A1LA 1BLZA 5FUIA 1W3XA 1CAWA 1RUI1 4LUMA 3B00A 3MPBA 2I45A 5FZ7A 1RVF3 3RQ0A 2YU2A 3ZFGB 3ZYJB 4HG6B 4JVAA 3VD4A 4EYUA 1YLLA 3KLSA 2MEV1 3E5XA 1JUHA 1WLDA 2JG8C 2R16A 2V5YA 5IUQA 4LO4B 3H3UA 2ZGNA 3VLBB 1GNHA 1PO21 4CDUB 4W6YA 2VMGA 2DUOA 4NRPA 5F37A 4ASMB 3ZVXA 3Q8AA 2J1AA 2JJ6A 1QGLA 3VB9A 3T0DA 1V6JA 4XIKA 5FP7A 1RL3A 1SLAA 1UKGA 1NE4A 2B45X 4IGPA 3ILFA 3HD8B 2HWF2 1ND2C 2PFWA 4JGYA 4C8DA 1OHFA 1COV1 1MEC2 3D6EA 4FSJA 1LULA 5GM0A 1ENXA 4YWAA 4XFGA 1US2A 3ZSKA 2XJTA 1APNA 5HXVA 5IK7A 3CLPA 1ASJ3 5JSPA 4Q4W2 5CG8A 3PMEA 2W2IA 5I0UA 1Z7S1 2A73B 1OUXA 1EAH2 4CP2A 4S2GA 2E53A 2A7AA 3DCQA 1CESA 4N9IA 1LGBA 2ET7A 3VD5A 5FQ0A 2R6QA 2PN5A 3VBOA 1RUH2 1YFUA 2QQVA 4C1WA 5JXHA 3VBFA 2ZPXA 1CD3G 2R062 2NZ9A 4K40A 4ES8A 5DMYA 5KBFA 4PIZA 4QPGC 4DXTA 4KBBA 4PCRA 4KQ7A 1HRV1 2R041 1K42A 3LFIA 1AX1A 2XVLA 5CYYA 4ZXEA 4BE3A 3WG1A 4XTPA 2WBKA 1JH5A 2Y34A 3EMRA 3M3CA 4QQOA 5EYXA 5IJRA 5LBEA 1YIFA 1RJ8A 3BYWA 3BI3A 5IK5A 4Q4V3 1KD7A 3NV3A 3U75A 2XVKA 3VUOA 4FPLA 3FBMA 2C26A 3BPZA 1W8FA 2PAEA 1F4AA 1PO23 2WZR3 4W8JA 3CKHA 2QJVA 5JAXA 1OOPB 1EP0A 1ZYBA 2WO3A 3TEWA 1ZVFA 3ZR6A 4EWEA 5FY0A 2FDFA 3PHMA 3FHIB 4MHUA 4AI2A 2FMYA 2PMWB 1HRI3 4KU7A 2XUEA 5ACA2 3WP3A 3T4VA 4QHZA 1EYBA 1XE7A 2C4XA 5FMOS 5KC6A 1W8UA 2E7TA 3ZN4A 4CUBA 5K7PA 4XBLA 1N3PA 1OQDA 1PNGA 1BMV2 3OY8B 3N7KA 4QGNA 1C8M2 3JXSA 2YGMA 4OI4A 1J1TA 1V6IA 5J7MA 2YBSA 2NYYA 5L9BA 3U07A 1QU0A 3JB8A 2R061 5C4WB 3CO2A 3QH7A 3RNSA 2OVUA 1O4TA 1UU6A 5FP9A 1O7FA 3OTFA 4JGZA 2V4VA 5FZIA 2DV9A 2P3IA 1WUVA 5GZEA 4CEYC 4QGLA 5FBZA 5C9AB 1DQ1A 2WNVA 1TZOA 2GAUA 4F3JA 1U5YA 1X82A 1RXFA 5JMCA 2ZHNA 4CDWC 2VQUA 3AMQA 4CUCA 1O5LA 1UZWA 3CNAA 4JQRA 1UZYA 2ZCWA 3CZUA 4V1PA 3WG2A 1AX0A 3DPRA 3RFRA 2IC1A 2VZOA 4KMQA 5A3WA 4OUEA 3U4XA 2JKXA 2F17A 4UT5A 5L73A 3RZMA 2Q4SA 5FJKA 1ONAA 2Z42A 4MGQA 3VBRC 3TEXA 4ZU7A 1OD3A 1GQHA 3GHMA 1NCRB 4R8HA 1QJEA 4XJUA 4N53A 3KQ4B 4QXCA 1SPPA 2XLGA 4Y22B 1AL0G 4ZU4A 3TB0A 3ZPYA 4HKLA 2WS92 4EN0A 2ZEXA 2AGSA 1LOEA 4QDQA 3T0AA 1JU3A 3NWKA 3WQ1A 1ZRRA 1XNAA 2XJRA 4R9AA 3IDAA 5L7OC 1HRI1 2JG9A 2ET1A 2BNNA 3BN6A 4UI9L 1G9FA 1NXD1 2RDSA 2YHJA 4IEVA 3WNKA 1TNRA 1DQ4A 4XFFA 4IEWA 4I09A 2O14A 1EY2A 4PDWA 1IQDC 1DQ6A 2ES3A 2RS52 2VZPA 4L11A 5DG2A 2YC0A 3VBSC 3HPNA 3WF0A 3NMBA 1BVVA 4MGTA 4OHZA 4LLFA 1PO11 4KWLA 1BJQA 3NV2A 4BQWA 4DO0A 1D2SA 3WD5A 1D0HA 4D7TA 5BNOA 1SLLA 2WT0A 2HWC1 4LHLA 4URTA 5FZEA 3VKMA 4CU6A 3ELNA 4QPIA 3O1OA 1UZVA 1JZ3A 3AZXA 1W2UA 4Q4V2 4R4ZA 4AGVA 2NMNA 4UW6A 4CP1A 2YDEA 3TNPB 3RRDA 4DQAA 1W8WA 1CONA 3RJRA 2Y6KA 4XF3A 3VL8A 2WKKA 5FYVA 2YMZA 4MLOA 1UQXA 3MIEA 2XWJB 4K1YA 3GBWA 1ZZ6A 3OG2A 1UMHA 2EIBA 3IMNA 4XMAA 5FYSA 1DZQA 1S2KA 1UOGA 4C0BA 3D5OA 3U1XA 2WYFA 5FK8A 4ET7A 1D4VB 5J3UA 3ABZA 2G9ZA 2WWSA 4DXSA 4XOGA 3I3BA 1F5FA 4TYSA 5A3OA 3AKTA 4ONUA 4BQ2A 2GC3A 5DAQA 3ZFGA 4ZZ5A 4OZOA 3ZXEA 1J83A 2VUAA 4NPLA 1AR81 1I5ZA 1Q8SA 2BRTA 2WO2A 4LBLA 4Y3OA 3SH3A 1PO22 4RQPA 4CDUA 4GULA 4AWDA 1U0AA 4LE4A 5T5LA 3L2HA 1H0BA 4OYUA 4D69A 4MXVA 1CWPA 4IEOA 4G4FA 4CEWA 2VXJA 3SCGA 2HEWF 1S0EA 2R043 4DXZA 2VE1A 3N9MA 3PU3A 4CCKA 1MEC1 4UFMA 5FYCA 2IWGB 4NWWA 1TE1B 2ZAHA 4LO5B 4H3WA 4H7LA 2VUDA 2V5DA 4AK3A 2AUYA 1YQCA 4TLGA 3TN93 3E6CC 3UK9A 4Y26A 4CU9A 2D6PA 3O5SA 4NJ4A 3ZXAC 2GP5A 4DINB 4DMIA 4Z92B 3UGFA 1H8TB 4WM8C 3T4HB 1YCIA 4XIOA 4M0HA 3P5BA 4ZHNA 3WT3A 3KT1A 4BB3A 1HJFA 3QOPA 1OLRA 4DOUA 3HR9A 2VO5A 3EYPA 3FN9A 4AXOA 1LENA 4IE5A 3WHTA 2VZ1A 4OI2A 3VBOB 3MIGA 5T55A 1QJU1 2EXHA 4UWDA 1KJLA 1F31A 4G3YC 1REDA 4AI3A 1CAVB 5DZEA 5CAZA 2PTMA 1LESA 1S0CA 1PO13 3SCHA 2UWAA 3ITQA 1W03A 2XG3A 4ASKA 4HZFA 4NOTA 1RMU1 3IAPA 2KR2A 2W92A 1PHMA 2XL7A 4WM7B 3K48A 5F3EA 4XZUG 3C7OA 4XVHA 1HQWA 4PLOA 5KHGA 3IN9A 3JZVA 4OHWA 1LTEA 5IVVA 5J09A 2ZGLA 1LODA 2X5IA 1MZ6A 2FD8A 4YZ1A 5F5CA 3GYDA 5DAXA 4A42A 4FXGB 5FPAA 2VZUA 2FHRA 2A6ZA 1RUNA 4JGZC 4DY3A 2OIIA 5A32B 2ZKNA 4Q8KA 4A2UA 1HW5A 3P6BA 4AAXA 2HBTA 1AXKA 1CZTA 1AR83 1GICA 1NA1C 5FTTC 3O1UA 3WUDA 4JKMA 1NA1B 1BBT2 5T5PA 4OZXA 2ZZQA 5B4XA 1OQEA 1RUD2 1AL22 5A6XA 3PVNA 1GZWB 5DN2A 1ZRIA 4MGSA 4JHZA 2VTXJ 3ZKUA 1UIKA 1ULFA 4RR3C 3EHKA 2BDRA 3TOJA 1AHSA 4QXHA 2XQXA 3DECA 5CU1A 1D4M2 1LB2A 2G9FA 1IKPA 5F8PA 4LUKA 2WFF1 3KHCA 2NM1A 5IVEA 1W05A 3M3QA 3H9AA 4UFJA 3ZM8A 1D4M1 3V56A 4AGRA 4NIIA 3LE0A 5LRSA 3JQXA 3NV4A 2WAAA 2ZMKA 1ENSA 3AP5A 3N7MA 4EROA 1WLWA 4NIAA 2FZ2A 1GWKA 3PUAA 3F2ZA 5FMDA 4CDQC 5L7OA 4LKSA 5LW9A 4GIQA 2TUNA 4GMP1 1AYM1 3ACIA 1XNCA 2HWC3 1J3PA 4PJYA 4Z8BA 3WG3A 3C2UA 4X6QB 3ZFEB 1NCRA 2X8KA 4B29A 1OA4A 2BJSA 1RUE3 2DCTA 1KS4A 3B01A 3KVAA 3M8LA 4UBHA 1SPPB 4Z82A 4A44A 3S57A 4OUSA 4TTGA 4XAEA 5AVAA 2B39A 2VW0A 4D6QA 3I2GA 3J4UH 4NIHA 2VR4A 5A3LA 2HYKA 2X5IC 4XJWA 1S55A 2ZAAA 3RMYA 1RUD1 2C9AA 3KV4A 1MR5A 3I2JA 3UV9A 2NPIA 2HWB2 3S0MA 2JDKA 2DCYA 1UW8A 4DEVA 4CYDA 3MYXA 4NAOA 3AXDA 3VZJA 1ZZBA 4YGBA 5D8AA 1VB2A 3WNLA 2E7QA 2P17A 4P9LA 4XABA 5HCAA 2AREA 1XYPA 2ZOEB 5FAXA 4XFHA 5I0TA 1R1A1 4LK7A 4MHRA 2QCSB 4Q8LA 3PVOA 2ARBA 4QQHA 1CIYA 4HPKB 3U10A 1GU3A 1HIXA 4QB2A 4BWOA 3OGGA 5DZFA 1E5RA 5DAPA 2VMFA 3FHQA 5EWSA 4N43A 5A7OA 1DHKB 2B8MA 2IXKA 3GGLA 2QZ3A 1QJY3 3N35A 1MEC3 4MXWB 4RD7A 2BP6A 5T50A 4CDUC 4ZXKA 4O9EA 1SZBA 3WLUA 3H7YA 5LEJA 4NIGA 4CDXA 2VBBA 4YM3A 3FLPA 2HLEA 3CQOA 5HCHA 2BQPA 1YFXA 4CDQB 2EXIA 2LRPA 1V9U3 1AYM3 2W91A 2PHXA 4ZKTB 2RJ2A 2VQTA 3ACGA 4LEJA 1FAYA 2EXJA 3AL6A 1NG0A 4Y1XA 1JYXA 1O3SA 4MH0E 2QQUA 1GKBA 4NE9A 4XW3A 1ZBE1 2W0XA 4LKEA 1WMDA 2DVBA 2XHKA 5JWPA 5JXJA 2JG8A 1PZ9A 4HLTA 3I49A 3VDDC 4IUGA 1RITA 2XBO2 4LO7A 3NAPA 1WBFA 3OYWB 5I8TA 1F8VA 1G9AA 1SDDB 3BTXA 1EUUA 4K9SA 5EPAA 1F5JA 4CEYB 5C9AC 4O9GA 3RI9A 3AC0A 3BODA 2H0BA 4BXFA 1W2TA 2GALA 4AEMA 2JECA 4FTEA 1UXZA 5FPZA 2WFPA 3NO8A 3Q8CA 4I3PA 4LORA 4QQLA 3C7EA 2R30A 1DQ5A 1RUC3 4L8QA 1PGL1 3SEPA 4ORFA 4M01A 4AVCA 2JDZA 2IXCA 3B93A 1OXCA 5BNPA 1Q43A 4XDQA 5FO7B 4XAAA 1QJY2 2BTVC 5IK8A 1PGL2 3CJIB 4R9BA 2Q8EA 4JZRA 2FCVA 1CAVA 1QJY1 1WD3A 2WC2A 3MI8A 3O1MA 3WDXA 1TEIA 3BU7A 3J7HA 4YW3A 1X9TA 5FO9B 2RR13 3POEA 5I0SA 3VN4A 1W9FA 2WNVC 2JB4A 1M06G 1URXA 3WR0A 5HV0A 4CDXC 4S2HA 3OOXA 2PHTA 1LEDA 1U5IA 2VZVA 4EQVA 1BK1A 4WVZA 3P3NA 5GZFA 2OT7A 1QJZA 3URFA 5C71A 4IL7A 5K4LA 4YYOA 3W5NA 3EB7A 2Y0IA 3MDPA 4UFIA 3GBGA 5DABA 3OUJA 2ZX2A 1YI9A 3KT4A 1Y43B 1D4M3 4BQ1A 3RPQA 3ZFFA 2F6BA 3H42B 3WW3A 5DPNA 1C5HA 5C8CA 3AB0A 3IZOA 2CWMA 4LHNA 1B35A 1ZRFA 1QY4A 3VV1A 2IFWA 3EJKA 2N7GA 4LHSA 1AL23 1DDLA 1U12A 1BEV2 2HWF3 1NA1A 2ZGSA 2PQSA 1YXWA 4ISRA 2J1UA 2VOKA 4CE8A 1GZWA 3BKZA 3ZYBA 1Z7S2 3IIIA 2HJIA 2GC1A 4IW3A 5FBJA 1RUC1 1VPHA 3H1WA 1XNBA 3PDQA 1L3JA 1REFA 5FZCA 1GWMA 4AFAA 5F5QA 2VUCA 3VKLA 3GXUA 1QNWA 3OBAA 3ALQA
chains in the Genus database with same CATH topology
3RG0A 1JBCA 3WX5A 1FI2A 2WT2A 4M0NA 5SV8A 1LGCA 1SLBA 3VBRB 3AJYA 4R52A 1W6PA 1VB4A 4R9CA 4H14A 2WL1A 2RJLA 1GANA 2ZABA 3FFQA 5BNQA 3T1LA 4N53C 4J6GA 4NO4A 1RUG1 2GH2A 4R9DA 3ILNA 1RTVA 1SLCA 4JDNA 1JN2P 1VBC1 5CADA 5BY5A 1EV13 2K2SA 2EIGA 3T1MA 1K5MA 2SBAA 1WCDJ 2RR12 4ES9A 4XQ4A 3VBSB 1SBEA 1R082 5HCBA 2QE3A 1CAXA 1HXS3 1AF9A 4FOQA 2V73A 5A33B 1OMIA 4B4RA 1HV1A 3RZZA 1IGOA 1BYHA 1MACA 4RQPC 3ZX7A 4Y1VA 4DS0A 2XB6C 4X6RB 1UN1A 3WW2A 1H2MA 3SHRA 4Q1RA 4Q27A 1H2LA 1V9U1 4AI1A 3B9CA 1UKRA 1FV2A 2WZPP 3SCFA 3N36A 1OA3A 2RS51 2VNGA 3JU9A 3RYRA 3R4SA 3WHUA 5DDJ2 1ZBE3 1VBA2 3AKSA 2D7FA 2VXRA 1AYN1 2R1DA 4IEXA 4KU8A 3V0BA 5JI7A 4N43B 2R073 4DPNA 5C6CA 2RS31 4K7JA 3I4IA 1V70A 4MX3A 4AVSA 1IS6A 3S30A 4FPKA 4FAGA 3IT8A 2XKPA 4YVWC 1X8MA 4K3UA 3ZN6A 3GHNA 1W6OA 3AFGA 3LWCA 4I2OA 1Z78A 3HT1A 2MEV2 3W59A 1CGPA 3KD4A 1OOPC 3LOBA 3M4FA 2Z5WA 4IERA 1H4HA 3FE5A 2SLIA 5T5OA 2QKDA 1PGW2 4AQSA 1FYUA 3POYA 4BM8A 2BEOA 2DTYA 1NQJA 4JC1A 4D94A 3AMMA 4DFSA 3AKQA 1B35C 3NAPC 1AVBA 1NZCA 2W52A 4CEYA 3MEPA 1AR92 1LOFC 5CFDB 4LBOA 4YFWA 1QOTA 4GB33 5GALA 3T2TA 3QLQA 2D6KA 4NHLA 1AR91 3IPVA 2VOWA 4PLMA 2Q30A 4YGDA 1BXHA 1TQ5A 1BVP1 4Q0SA 1N3OA 5DUWA 1REEA 5F6KA 4QQ2A 2JXAA 1CAWB 3IWZA 3KZ4C 2DF7A 4E2SA 1PVC1 4YW4A 1YO8A 2LALA 4ATFA 2WJSA 4AYUA 2QDNA 4BPZA 2GN3A 2JE9A 4Q0VA 5DZGA 1KXGA 1R1ZA 4Q0PA 1RUJ1 2JENA 3ZXDA 5JOWA 1RMU2 4IEYA 1H9PA 2PHLA 5ACA3 1O4ZA 4A7KA 1RGSA 1I1EA 1OSGA 1NYWA 2A6XA 4TLFA 5KHHA 2P37A 1YYNA 2VUJA 3JD73 1LCLA 3B3QE 3FBYA 5FPXA 4JGYB 1CVNA 2GNTA 2PLV3 1FT9A 1B35B 2PHUA 2RMU1 3W58A 3V65A 2A6YA 2K9ZA 2Q1ZB 4SLIA 1BZWA 2Y38A 2DCZA 2ZJCA 4YW1A 1QOSA 3INAA 4YVSA 2YXSA 4PBOA 1XNKA 2XLFA 1J1LA 1WGPA 1DGRA 5HI0A 1GQGA 3VBFB 1HXS1 1PVC2 4NPRA 1AXZA 1LRHA 3IDBB 3RYPA 1G9BA 3VZKA 3TAYA 2FBEA 5KWRA 3RS6A 1MS9A 4YLZA 3AP9A 1RUG2 1POV3 2CWSA 1YWKA 1QDCA 1QQP3 2OYZA 1SEFA 1Q8OA 1FMD3 3B02A 4YGCA 1X36A 4HKOA 3LA3A 3ROUA 4FP2A 3OPZA 4ZU5A 1F9KA 2X29A 1K5MB 3ZIXA 3NSTA 4I02A 1ND2A 2D3PA 3CEWA 3AP7A 3BOWA 3VBHC 1LOGA 4XBQA 1XXNA 3L9JT 4G9SB 4WZCA 3G7DA 1O4YA 4YG6A 5JCTA 5EJ3A 4QGMA 2VU9A 4AHZA 4XETA 1MS4A 2H6CA 3ZMNA 3KCCA 3WNXA 1DBNA 1BBT1 4GH4B 4KL1A 5DG1A 1C1LA 2YZ4A 4JCKA 5FOJB 2HWC2 3AZVA 1HQLA 4HBNA 5C9AA 1KDMA 3ZXGA 4FOVA 1YJKA 4W65A 2WNVB 3W9AA 3MZHA 2A71A 1PIV3 1V6LA 2OUJA 5GLVA 3PVBB 2ZACA 3ASIA 3KQRA 4XEZA 1TMF2 4LO6B 4HT1T 2D3SA 4YM1A 3DPRB 1AUYA 1KRIA 4IESA 2B9UA 1A8DA 4IV3A 4Y5Z0 1Q8VA 4E27A 2YYOA 4GB31 3ZN6B 3ZFEC 1I9RA 4X8PA 1N3QA 1WW5A 3MW4A 1DYKA 2RE9A 4ASLA 3ZIWA 4YM0A 2RM22 4BMEA 2BNMA 4MGZE 1LOFA 4QT6A 1KS5A 5JOXA 1PGW1 2ZGOA 4COWA 5SV5A 1AL21 1YFWA 3JCIA 1RC6A 2JKBA 1S0GA 3A4UA 1CAUB 2H0VA 3WW1A 3ZSEA 4Y20A 4Q26A 2I74A 2TBVA 4YNIA 1W6MB 3FC0A 4B3NA 1FPN3 2XJVA 2WINB 3M3EA 4GKXA 4Q4X3 2HWB1 4XZPA 1OLQA 2WQZC 1OD5A 2VGDA 4L92A 2A5ZA 2A3YA 2H6BA 4QPIB 5GLUA 3IPVB 4HSLA 5K8SA 1VBE3 1O3TA 1VBA3 2W68A 4PQ9A 3VKNA 2ZZJA 4YG0A 1JW6A 3QACA 5DUVA 3AMHA 1WBLA 4TZDA 1QJX2 2PHWA 2VY0A 4PF5A 2ZGTA 4MGYE 3L2YA 1ZZ7A 4MUVA 3WZ1A 2UU8A 1NCQB 3GNEA 3EQEA 1IOAA 5I8SA 2D5FA 3AZYA 3CL1A 4RHV2 2F4PA 1PK6B 3ME2A 4N9HA 1ULCA 4RQPB 4DB5A 5BNNC 3VDDA 3D0SA 1FATA 1GNZA 2WNUC 1N1YA 1AR73 3FLRA 5B2GB 1Q5OA 1RUF1 3ENRA 4FP3A 5KHIA 1IPKA 2Q5TA 1QHDA 4GQ7A 1WMFA 5I0RA 4LE3A 3K51A 3SMHA 4WZFA 1AR63 5T5JA 1SDWA 1UPSA 1LHVA 1LKNA 1TME2 1YUDA 1POV1 2HWD1 3DV8A 1WW7A 1ZZ9A 3B69A 4XFAA 4KWJA 2GMEA 1PGSA 2HWE2 1IZ3A 2LTNA 2RS33 2WNEA 3CJIC 1FPN2 1RHI3 1LU1A 1HRV3 1LEMA 1DQ0A 2O0OA 1JUIA 3ZYGA 1HX6A 1WLTA 1FPN1 1LOBA 4EN9B 5J48A 4J1XA 1IQAA 4KH9A 3SISA 3MPPG 5T3NA 4QQPA 1ZBA1 2GU9A 4B4PA 2EAAA 1JHNA 1LU2A 4IETA 3HAGA 2R49A 1ZZ8A 5EV7A 1YIPA 4I30A 5FOBB 2R042 1YHFA 1TNFA 1QXRA 2D93A 3IIAA 1S0BA 2VG9A 1H30A 1J3QA 4WM7A 2XH6A 1RUF2 3VHPA 1Q8PA 1C3HA 3MF6A 4XJ9A 1DFQA 5BNOC 4IEZA 3H7JA 3OF1A 3G6JB 5CFCC 4XF1A 1Z0HA 3MLJA 3M1HA 2OUHA 1A3KA 4RFT0 1QJU3 3JD72 4CRQA 5CB7A 2Z79A 4AVVA 2XPJA 3LA2A 1M06G 2ZGRA 4M3CF 5F9TA 3D4KA 4PDWC 5A32A 4FPYA 2VMIA 1VALA 1V6NA 1EAH1 1COV2 2ZHKA 1CJPA 3KB5A 4JV4A 4UW5A 2HWE1 1FV3A 2HWD3 4FXKB 1EPZA 1NLRA 1WCKA 2A3WA 3LZZA 3TWIA 1G9CA 3VGIA 3R05A 1LGNA 4Q0UA 3OD4A 4BIOA 1BMV1 3KMHA 3M7AA 1V00A 2A6WA 1RUF3 1DGRN 3BALA 3NKTA 4LA3A 1RHI1 4GMP0 3OBTA 2BGCA 2ZX1A 2DCJA 4KGGA 4YVWA 3VZMA 3WCSA 4Z07A 1PVC3 4RS5B 1XU1A 3I59A 4YRDA 4YZ5A 3NW4A 2E7AA 4LBNA 4QD2A 2YGLA 1VBD2 2HWB3 4AQ2A 3AYAA 2JX9A 2ZMNA 1DLLA 3WV6A 5L7OB 2QZ2A 3IDCB 3ZSLA 4M00A 4LR4A 4MSVA 5LRRA 3ZFEA 1F2NA 1G6NA 3I7DA 1QJX3 1VBE1 1LJ7A 3VBUC 4YZ4A 3H0OA 4Z1VA 1Q56A 5K0UB 1MZFA 2WFF3 2IXIA 3DF0A 1B09A 3GBFA 4Q4Y2 5J37A 3U0ZA 1WA4A 1C8M1 2XUMA 2QNKA 1CAUA 4LA2A 1VP6A 4Y20B 1UU5A 1C4RA 3JB4C 4YFZA 3P3PA 5D8AB 1QH7A 4XXPA 2R1BA 4N7UA 2WT1A 3ZSJA 4AFBA 1SBDA 3QD6A 2DVGA 5CG9A 3WCRA 1M4WA 3ZXJA 3N3HA 2QUOA 1R092 4QX5A 2YUEA 4BZ4A 2WA4A 3X29B 1LECA 1CPNA 1KFUL 3ACLA 5C8WA 3KGZA 1RUD3 2UWCA 5BNNA 3FUOA 3J8F1 3AYEA 2R063 3ZO0B 2ZGPA 1VBE2 1OFSA 4CDQA 4NVPA 5L36A 4WVWA 2W08A 1J58A 1NCQA 1VIWB 2CTVA 2Q1MA 1DGWX 2PYTA 2DTWA 1PK6A 4I01A 2RM21 1W6NA 1VAVA 2ENRA 3VDDB 2JG8B 2VVEA 1CPMA 2NMOA 4JTOA 4RGGA 3NAPB 4S2DA 4R4XA 5ABJC 4FO9A 1VAKA 2RS11 3ATGA 1Y7BA 1VLNA 4I3GA 3KGLA 3KSCA 3H50A 2EA7A 3BTAA 4J1WA 4COYA 2RS32 3TBDA 2O1QA 3MW2A 4COVA 1RUH1 2PHFA 3ZN5A 3CJIA 4OLLA 4AHWA 5BXXA 4XF9A 4RL7A 4XPVA 1GFF2 1DGLA 1Z7S3 4BH9A 4EJRA 5GLTA 3FFZA 2BYVE 2XBO1 4DZGA 1SMVA 5E89A 3WUCA 1BCXA 1BEV3 2ZTNA 1FOD1 2IFRA 3VBHA 4BLJA 4HVQA 4K20A 1FMD2 3RI8A 2VNRA 2ZS6B 4LBMA 4PIYA 1GV9A 1NCQC 4JDMA 4LULA 4LNVA 4TWTA 5DXDA 1ZZCA 1RVF2 4HVOA 4QM9A 1DU3D 3J8F3 4I0WB 1IS5A 3ZXKA 4YARA 5C8CB 4AGGA 1I3HA 3VHRA 1W6QB 4Q4W1 5JOZA 3I8TA 1H2KA 3TN91 2R0HA 1BKZA 2I07B 3DKWA 4U2AA 2FZ1A 1CJDA 2RM23 2FMDA 5BPXA 3UKVA 1LOCA 2HEVF 4IXLA 2BBVA 4HANA 1YRZA 3H1YA 1AJKA 3AYCA 1XYNA 2ZX0A 1MQTC 4FOYA 4GWMA 1NE6A 2D6MA 4YVWB 3VBRA 1RUI3 4RS5A 1ULEA 1W6PB 2EXKA 1ZBA2 3GZAA 2RJKA 2XJQA 2ZX3A 1R083 2WZR1 1XE8A 4JTNA 3VZNA 5CVRA 1NXMA 3OD0A 4K1ZA 4MV2A 4XFIA 1QH6A 1RMU3 3WY6A 2XLAA 4XMIA 1FOD3 4D7SA 3AMNA 1A6CA 4X8NA 3UKTA 1GZCA 4QM8A 2WS93 3V0AB 3VBSA 2VOXA 1MZ5A 5LEKA 2R0FA 2AZ5A 1C28A 1CAXB 3AZZA 5K0UA 4CEWC 5CFDC 2BW8A 2GSYA 3C3VA 3QCWA 1H1AA 4YVSC 4WBBA 1UL9A 2NLRA 4HL0A 1V9U2 1R1A3 4Y24A 4IV1C 5F1RA 3KCYA 2WFF2 3BIWE 4F83A 2ZGMA 1HKDA 3MF9A 5JSOA 1VBC3 2GC0A 5GZDA 2UY9A 1CN1A 3B9IA 2JD4A 4XHXA 2VPVA 4AEDA 1XQNA 2P3JA 2WLQA 4KGQA 4W6WA 3WP4A 1VBB3 2EVXA 3O0VA 4QPGB 2NP0A 3SXWA 1R081 1ND3C 3O7OA 4P9JA 2ZGQA 4RS5C 3ZFFC 5FCCA 4KNCA 1J59A 3USSA 3O12A 5GZGA 1N1VA 2JE7A 4UW3A 1C5IA 4OHXA 1HRI2 1W6OB 1N47A 3O0XA 3E6BA 5A3MA 4XE9A 2KM2A 4GB32 4W6XA 2WS91 1Y3TA 3WINE 1RUE1 2CAVA 3JQWA 4AVBA 4HKWA 1W6NB 1EAH3 3WVJA 4D7YA 1QNYA 4RHV1 4LHKA 5J96B 2BUKA 3TNQA 4COZA 1ENRA 1PZ8A 4OFGA 2WNUA 1FX5A 1VAMA 4FPHA 5H9SA 5K0UC 4CTEA 1W39A 4XJ8A 1NOVA 1KITA 4GMP3 4Y1UA 1Q8QA 4WVVA 2AH2A 4I0AA 3DN7A 3NL1A 2BFUS 1DG6A 2A75A 2VQAA 3ES4A 5AFEA 4IV1A 3E97A 1R1A2 4HK9A 5CIRA 1NY71 4Q4Y3 2MNGA 2PA7A 3SLIA 2FQPA 4P9XA 1VBB2 3WXPA 4IQPA 2BVVA 2MHFA 1VBB1 1WD4A 2VVDA 4Q4W3 5JZGA 2P34A 4Q2FA 2GDFA 4A3XA 4PBPA 1QJX1 3S7EA 2P3KA 3HIFA 1FOD2 4OULA 5FMOL 5EZWA 3LGRA 5KXDA 2XVGA 2ZGKA 3VBHB 3AP4A 4AFCA 3AKRA 1SLIA 3LKJA 1JOJA 4AF9A 1NQDA 4AFDA 3KS7A 1UMZA 3FLTA 4XTMA 4PIXA 3E5UA 2D3RA 4WM7C 4Z82A 2LM3A 1RVF1 1SLTA 4FPEA 1JYIA 2A3XA 4RHV3 4FVVA 2Q0AA 1RUOA 4I0BA 2DU0A 3N7JA 1UF2C 3AMPA 3GF6A 1ZNPA 4WM8B 3ES1A 1W6QA 5GZCA 4LBJA 4HETA 1X7NA 2ILMA 1GYKA 2RS12 5JIUA 2JEMA 1MS3A 4AW7A 2BPA2 4C91A 3VZOA 2HWD2 1JXNA 1SFYA 4PLNA 2IXLA 4CZSA 1COV3 2PAKA 4YVSB 1RUJ3 1IPJA 1VRH2 2B46X 4L99A 5BYNA 2EALA 2G9GA 2CY6A 4FCAA 2DFCA 1RUI2 1WW6A 3PNAA 3UL2A 4NR1A 1OFNA 2AYHA 5KXBA 2TEPA 1O5UA 1ASJ2 2A70A 1KJRA 2WIIB 3POSA 4FTSA 4FPGA 4NN0A 2VQ0A 1G9DA 5GLZA 2R32A 4XQWA 3DPRC 2YV8A 3AXEA 3V0AA 2RHPA 1V6MA 1ND2B 3GZUC 3A0KA 1KFXL 2RR11 3FZ3A 3SH5A 4F7ZA 2LUWA 3VHOA 3MICA 5J98B 5LK5A 5FLHA 3WQ7A 5EYYA 3RJ2X 1IHMA 4Q4X2 5FQ0B 4RGAA 1HXS2 3PJYA 4QPIC 1RUC2 2WQ4A 3EO6A 2PELA 2RS53 1OI6A 4GH4A 1UPIA 5AC93 1WMEA 5I91A 1MZEA 2Z2SB 3IBMA 1OQ1A 4LBQB 2CGPA 2QQPA 4HMZA 1O3QA 2D6NA 2ARXA 1MS1A 4Y1YA 3N4MA 5JDBA 5JPNB 5AC92 3VKOA 5FREA 1S0FA 1R093 4AEDB 2B7YA 1CQ9A 1OPMA 2EF6A 2CNAA 4AI8A 1SACA 2I2SA 1PMIA 3O0WA 5JPMB 4IV3B 1LR5A 3PVEA 1JYCA 4GXLA 5JOYA 4C0HA 5DUUA 1O3RA 5T54A 1H9WA 3B5LB 2XJSA 2GZWA 1RINA 1H1IA 2D98A 3IM0A 1OKQA 4Q4Y1 3AJZA 3J26N 4IEQA 5E88A 5CFCB 1YI7A 4L9BA 2P2KA 1AX2A 3OY8A 4CP0A 3RDIA 3UJOA 5ABJA 1K5MC 4DRRA 2UURA 3PJQA 2GC2A 3RSJA 1PK6C 5HBAA 4YG3A 4E2QA 3IDEA 3AKPA 4M3CE 2BWCA 4QU2A 2WNUB 4LBKA 4FT8A 1X33A 4JRLA 3WP6A 4AE2A 4FBFA 1W6MA 4N7IA 2PLV2 3HMYA 5C4WC 1SFNA 2ZGUA 3S6PA 2OPKA 5AC91 4INDA 3DUIA 4FOWA 2XJPA 4RSUA 4IV1B 2ZKLA 2G4IA 4AVAA 1C57A 2HEYF 5DDJ1 1QF3A 1WW4A 1GLHA 1HLCA 1R091 1DIWA 2BFUL 1UD1A 4AI0A 2ZBJA 5J36A 4YGEA 4N53B 2XWBB 4P9WA 5JZGB 1EPWA 1BQPA 2JICA 3MFCA 3MIDA 3N7LA 5KC5A 4U36A 4GKYA 4IV3C 4K21A 3AYDA 3USUB 4FAHA 5ACA1 2JG9B 2WA3A 4BA6A 3WQ0A 2JG9C 3H1MA 4MVTA 1DZRA 4PDWB 1H8TC 4BMBA 1IKQA 1A8MA 2ERFA 1PM7A 2TNFA 4OVEA 3THTA 2PLV1 4OHVA 1UCXA 3D82A 3HQXA 4ITCA 2VECA 1S1AA 2MPFA 4N90A 4M3CB 4CDWB 4WM8A 2DVDA 1S0DA 4HK8A 3AM2A 3BB6A 4MZUA 1ALYA 1G7YA 3CJXA 1UAIA 4A7ZA 4WV8A 4A7YA 3RWNA 4LLOA 4E9KA 1QDOA 4AQTA 1XRUA 5D1IA 4E4ZA 2VW2A 4XHBA 2Z69A 4NHMA 3HN1A 4MGKE 5FLJA 3VZLA 4P14A 1CX4A 2QFEA 3ZDSA 1DF0A 4HN1A 4EN8B 4OUMA 5EXOA 2DWRA 3NVCA 4QPYA 3E6DA 1LHOA 2DU1A 4H7MA 5DUXA 5GJ6A 3UJQA 1ZREA 4P5HA 2XJUA 1AR61 1ZM1A 4XBNA 4K8FA 1PVXA 1GZ9A 1CR7A 4KG0A 2Q8OA 2UYBA 3GZTB 4CEWB 1IS4A 2ATFA 4FPFA 5CA6A 1VBC2 4XFCA 2UWBA 3EXUA 3ZYIB 3H8UA 3J9SA 2NQYA 4ATEA 2QDRA 4E4SA 2ZA9A 2Y0OA 3AX4A 5E1RA 3MIBA 4QMAA 3MIFA 2HWF1 2YY1A 4YM2A 4AQ6A 1H8TA 4SBVA 1C1FA 4Q1PA 1VRH1 5KXEA 4UBGA 3BOPA 2VVFA 1OA2A 4WVMA 3R4UA 1ZBA3 4COUA 1H1MA 1S0IA 2DUPA 3KM5A 4S2FA 1MVEA 2VMHA 1V6OA 4FQ4A 5IK4A 3CF6E 5TSWA 4EN6B 1G86A 2B5HA 4LBQA 1MQTB 2KXLA 3B94A 3FWEA 1AR62 3JBG2 3AZWA 3UKNA 3AP6A 2D43A 4FPCA 1AR82 4BCUA 3I59B 1UIJA 1EV11 1AJOA 1NCRC 2EAKA 5H9QA 4B7EA 1DYPA 2X5IB 4E4DX 2HWE3 4GA9A 3I54A 4P9YA 2NN8A 4LBQD 1A78A 1MS8A 4Z2WA 3TRSB 4AFMA 4DY5A 3WDYA 4GALA 2PHRA 4YW2A 4LO8A 4YZ3A 1LHNA 4JDOA 4MYEA 4EV0A 3M3IA 5DDJ3 5CFCA 3TN92 2ZMLA 2VOVA 2BWAA 5ABJB 5I93A 3IKWA 3HT2A 3ILRA 3V64A 2E63A 3WDUA 2YROA 1HRV2 4RR3A 1UU4A 5K9YA 2OZJA 2VW1A 4OI1A 3RMXA 4AHXA 3LSDA 3MGUA 1VBA1 1XU2A 3ZXFA 1LHUA 2GNBA 4N43C 1TMF3 2GMMA 1OPOA 4Y1ZA 5GLWA 1ND3A 1MS0A 3THPA 4BYYA 1NY72 1KQRA 5BNNB 3R4DB 2O8QA 3JUUA 4B8EA 2KA3A 3ETQA 2GN7A 3OCPA 4P9GA 5T52A 1JTZX 2C0ZA 3ZFGC 2D5HA 1FNYA 1W0PA 3USUA 3GALA 1CIWA 3U11A 5JSRA 4NHKA 4IEPA 1D0GA 1O91A 1WCSA 2OA2A 2DVFA 3ZMOA 1PIV1 2O8OA 1SCSA 2XGXA 1NLSA 3PLQA 1PNFA 5AVPA 2DVAA 1PIV2 4GWNA 4XF4A 3JBG3 5KHJA 3OGJA 1PO12 2PAMA 4HPKA 4FTBA 4M3CA 3NV1A 2CYFA 4BOWA 4CDWA 3DL3A 1Q3EA 2Y26A 2K0GA 5JVVA 4EWDA 3SITA 1GSLA 5C8CC 4XF0A 1QQP2 2WSUA 3J8F2 3HBZA 4MXWA 1GBGA 1X50A 4L2NA 3Q9OA 4QHBA 1SQ4A 1TMF1 1I6XA 2OZ6A 1DGWA 4CDXB 4QXKA 5H9PA 1KDKA 4AEJA 4C1XA 5GKAC 1ZRCA 4TSVA 3VBUA 3KCXA 1X8EA 5EFUA 3WG4A 2GH8A 2BNOA 1RUJ2 1PZ7A 1VRH3 4LTAA 1POV0 2D40A 4YSFA 4HVRA 4XJAA 4AG4A 3OBRA 3FMGA 3D0JA 2WZR2 1N1SA 2AR6A 1E57A 3E5QA 1HV0A 1ULDA 2RS13 1ULGA 3S7IA 3OJBA 5FRAA 1YFYA 3MFAA 3OYWA 3LSEA 4LT5A 1J3RA 3O14A 3ZXLA 2RMU3 3NKGA 2C5DA 3MLKA 5JLVA 4XYXA 3EBRA 2IXJA 1ZRDA 3M70A 4GH4C 4UW4A 3FX3A 1S2BA 1QQP1 2X53S 2UY8A 3SNMA 4WVMB 1QJU2 1V6KA 4HN0A 5BNPB 1AR93 1HDKA 4RA0A 4D3WA 3CU7A 5HCFA 1C8NA 4XFBA 5JI9A 3VHNA 3ZSMA 2XBO3 5FDBA 1BEV1 2ZX4A 4Y4YA 1ZX5A 2E6VA 3M3OA 5JZGC 3ZYPA 1MQTA 5BV6A 4Q29A 3JBG1 3B7MA 1RB8G 3LOIA 1FMD1 1WLCA 3WDVA 1RIRA 2WLPA 2ETEA 2ZHMA 3H3ZA 2ZHLA 1UZZA 4XJZA 2CGNA 5E8AA 1SBFA 3LA7A 1QXJA 5CNAA 4XXAA 3ZYRA 2B42B 2A6VA 2CV6A 2DFBA 1SCRA 2RMU2 3ZFFB 1N1TA 3JD71 3VKFC 1RJ7A 4MGIE 4E2GA 1HQNA 2UYAA 1QWRA 2R072 4P9IA 1RUG3 1C8M3 1VR3A 1MVQA 3POWA 2D6OX 3BCWA 4DRVA 4FPJA 2D6LX 1VBD3 4ISQA 2GMPA 2XKOA 4XILA 1Y9QA 5FO8B 3R0RA 5FFOC 1S0JA 4RR3B 1XNDA 2DUQA 1G8WA 1VJ2A 1RHI2 1AXYA 1FXZA 1YNAA 4B4QA 4FQZA 2CGOA 4KG8A 4NWVA 3HWJA 5BUVA 1DZTA 1QMJA 5JR7B 1ASJ1 4AEDC 3NJZA 5F6LB 1ND3B 1T6GC 2HKXA 3AK0A 3R6SA 1EV12 4QPGA 5FLIA 2XL9A 3A0NA 2WSVA 3D8CA 4BIFA 1GR3A 5AFBA 1OOPA 1AYM2 1QOOA 1AYN3 4IEUA 3AFKA 2R071 4H55A 2GNDA 2CAUA 3KT7A 3MIHA 3PMSA 2DCKA 1MS5A 5A33A 4EN7B 1DQ2A 3DGTA 1XYOA 3LCPA 1QXPA 4JAAA 4XQDA 4Q4X1 4UXAA 2AENA 4KWKA 1U5XA 4HFSA 2PHDA 4OI0A 2C1FA 3SH4A 1H8VA 4AVTA 3QBQA 2IZWA 4Q0QA 5C4WA 3WDWA 1H4GA 2DYCA 4JGZB 5I8YA 3WW4A 5IT6A 1BBT3 2OW4A 1TME1 1IS3A 2MEV3 4YZ2A 5JIAA 1AR72 5C33A 3V0BB 3WOGA 4FPOB 2VH9A 1RUH3 2VULA 1AR71 2BVBA 5CBLA 2IXHA 3MW3A 5BNPC 3RYKA 4JRAA 2D44A 1VBD1 4AHYA 4BHPA 1ZA4A 1D2QA 4L97A 3QH6A 1LOAA 3VBUB 4AEKA 3ST7A 3FUQA 1RUE2 5KHKA 4Y22A 1ZBE2 3PTYA 5L19A 3I2DA 2V09A 3LB9A 4JGYC 4K6BA 2VNOA 5KXCA 3WP5A 4DNYA 1AZDA 2DURA 3MLLA 2PQQA 5H9RA 4EWAA 1LHWA 1W0OA 2E9QA 2W39A 3FJSA 5CFDA 5BNOB 5E16A 3ECQA 3VBOC 2E51A 3M2MA 4YW5A 1QKQA