3HD8B

Crystal structure of the triticum aestivum xylanase inhibitor-iia in complex with bacillus subtilis xylanase
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
184
structure length
184
Chain Sequence
STDYWQNWTDGGGIVNAVNGSGGNYSVNWSNTGNFVVGKGWTTGSPFRTINYNAGVWAPNGNGYLTLYGWTRSPLIEYYVVDSWGTYRPTGTYKGTVKSDGGTYDIYTTTRYNAPSIDGDRTTFTQYWSVRQSKRPTGSNATITFTNHVNAWKSHGMNLGSNWAYQVMATEGYQSSGSSNVTVW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase inhibitor/hydrolase
molecule keywords Xylanase inhibitor
publication title Identification of structural determinants for inhibition strength and specificity of wheat xylanase inhibitors TAXI-IA and TAXI-IIA
pubmed doi rcsb
source organism Triticum aestivum
total genus 48
structure length 184
sequence length 184
chains with identical sequence D
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2009-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00457 Glyco_hydro_11 Glycosyl hydrolases family 11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3hd8B00
1OA3A 3VZKA 3WQ7A 1OA4A 2JEMA 3AKSA 3VHPA 4HKWA 1H8VA 1BK1A 1XNCA 4NPRA 1OLRA 1IGOA 2BW8A 2C1FA 1M4WA 3RI9A 1REDA 3LB9A 1PVXA 3AKQA 1KS5A 1TE1B 1XNDA 1BCXA 3ZSEA 1H4GA 3VHOA 3MF6A 1F5JA 2DFCA 4XQDA 3WY6A 4IXLA 2VGDA 3WQ0A 3HD8B 2BVVA 2DCZA 3AKPA 2VUJA 1H0BA 3WP6A 3VL8A 1H1AA 3AKTA 4S2HA 4HK8A 2JENA 1KS4A 2DCYA 2F6BA 1NLRA 3VZLA 1W2UA 1XXNA 1XNBA 3AMNA 3B5LB 3VZOA 3MFAA 1XYNA 2D98A 4XPVA 1REEA 2NQYA 1QH6A 2JICA 3MF9A 3MFCA 1H4HA 1AXKA 3VLBB 3O7OA 4S2FA 2DCKA 1BVVA 4HKOA 3RI8A 3EXUA 3M4FA 3WX5A 1HV0A 3VZJA 2Z79A 1T6GC 3VZMA 2DFBA 5K9YA 3VHNA 2BWAA 3AMHA 3WP5A 3WP4A 1YNAA 1C5HA 1UU5A 1UU6A 4S2GA 3B7MA 4S2DA 1QH7A 2BWCA 2QZ2A 2QZ3A 2B46X 2D97A 3WXPA 1ENXA 1REFA 3AMMA 3WQ1A 1UKRA 2B45X 3AMPA 5EJ3A 5K7PA 5HXVA 3VZNA 2NLRA 1C5IA 2VG9A 3LGRA 1UU4A 4HK9A 2B42B 1HV1A 1HIXA 4HKLA 3AKRA 3WT3A 2VULA 1OLQA 1XNKA 3WP3A 3AMQA 1OA2A 3VL9A 4XQWA 3VGIA 1XYPA 3WR0A 1XYOA 4XQ4A 2DCJA 4H7MA
chains in the Genus database with same CATH superfamily
1JYIA 1LRHA 3B3QE 5FR3A 3H7YA 5J98B 4YM2A 1PVC3 2IXJA 4NE9A 4DY3A 4ZU7A 2ZS6B 1OF3A 2LTNA 4Q4X3 1QJY1 1R64A 3CBNA 3E6DA 1X7NA 2OT7A 3JQXA 4QX2A 2PQSA 3OUIA 1FATA 1W28A 3ZXGA 3KHBA 1M4WA 1MZ6A 2HWF1 1LKNA 1MEC2 4IEOA 1W2TA 3RI9A 1LOAA 4Q0UA 1OQEA 3QD6A 1YI7A 5C8CA 1MQTB 4PCRA 5DPNA 1GZWB 1ZBE3 3GHNA 3DKQA 5KXCA 2F4LA 4IEYA 1V6KA 4XF9A 1J1TA 3J8F3 1MS5A 3T4VA 1MS1A 5FQ0B 4YVSC 5DABA 3CL1A 4QQOA 4AFBA 4C1WA 3Q8CA 1UF2C 4AVAA 2ORXA 1NLSA 1ENRA 2VQAA 4GJYA 1AJOA 1WBFA 4ATFA 4NR1A 2VL4A 2W95A 2A6XA 2VM9A 5A7WB 2J22A 4FPKA 4RS5A 4F7ZA 1CAUA 1W8HA 5D8AC 2VBBA 1PIV2 3KM5A 3NV3A 1CPMA 5FZ8A 4LR4A 1XE7A 2JDKA 5F5CA 5FY4A 4OI4A 2DVDA 4Y1UA 3RMYA 4H14A 1REEA 2DUQA 2XWBB 1HN0A 3T0DA 4MX3A 3TNPB 5DZGA 3WD5A 4AHWA 2HWB1 4XCAA 5KXEA 3E97A 3HJRA 1US3A 5T3NA 3O1MA 2V72A 5JXIA 1BXHA 2VVFA 3D4KA 4I0WB 3I8TA 4GH4A 2DFBA 4RGKA 4LTAA 4ZXEA 2DF7A 3QACA 4W50A 4C91A 1RHI2 1RUH3 3VDBA 4I09A 2AGSA 1UU6A 1JI6A 1GZTA 3B7MA 5FPXA 2A73B 1QNWA 3WDWA 3VDDC 1CAWB 1YEWA 3THTA 5A1AA 5IK5A 1CAXA 3WNMA 3H1WA 2WO2A 1LNSA 2OUHA 5G05L 3WZ1A 1DYPA 1PMHX 2AZ5A 3BGAA 4LO5B 1I6XA 4BM8A 4YARA 4XAEA 3NV2A 5BXXA 4GMP3 2OUJA 3IWZA 2R061 1QQP3 5EQUA 1SPPB 1VR3A 2XWJB 5FYUA 3IAPA 3LGRA 2ARBA 4XMAA 2ZHNA 5GLTA 3EQEA 1EPZA 4ES8A 4UAPA 1Z7S1 3I2OA 2K0GA 4CDXA 4L0PA 2V73A 1KEXA 1RJ8A 5D1IA 3FBYA 3THCA 1GNHA 4CUBA 5FZEA 1F35A 2XKOA 4ZZ5A 3SHRA 2VPVA 4XJAA 3FLTA 3ZYPA 3ZMOA 2Q1MA 3P6BA 4AVVA 5F6KA 5L7OC 1C28A 3WF4A 2CGOA 2QQKA 3IPVA 2X8KA 1HXS2 1FOD2 4ZU4A 1UIJA 1QJU2 1MEC1 2A3YA 1ZRIA 1LU2A 4KH9A 2GC2A 5FYCA 4QKBA 3DPRC 3GF6A 3H8OA 1PGW2 3AP7A 4QPIC 3MIHA 3O14A 4X6RB 5FV3A 5DUVA 3T08A 5C9AB 4R8HA 1NCRB 3H0OA 3NRUA 4HKWA 2C1FA 2P5BA 5AC91 2WNVC 4Y5Z0 3NW4A 4IQPA 3U4SA 4DPNA 2ZCWA 3FBMA 2GAUA 4IV1C 4YFWA 2CSGA 2DTWA 3KT4A 3W5NA 3KZ4C 2RS52 3IIIA 1OC1A 2OPKA 1BCXA 2EXIA 2I45A 3M2MA 1AR81 1C8NA 1UD1A 3DGTA 1BHGA 1AZDA 2RS33 4FPGA 4HBNA 1SDDB 2ET1A 1PIV1 2VVDA 2P34A 4YVWB 2XMLA 3ON7A 3P1IA 5IVEA 3ZN5A 3HOBA 5JR7B 1H2KA 3VL8A 4EWEA 2WSUA 3FUOA 2WS92 5CG9A 4XJZA 2W68A 3AYCA 4LE4A 2B8MA 3MDPA 3PHMA 3WDUA 2AREA 4NIAA 1A34A 1OPMA 1ULOA 3DUIA 4NOTA 3POSA 3NNGA 2ZMNA 4EN9B 2YG0A 3RZMA 1L7RA 1Y9GA 3AP9A 4XDPA 5T52A 5F8PA 3ZFFB 2NMOA 1UX6A 3J7NA 1OD5A 1UOFA 4Y1VA 5JOXA 1OHFA 1PMJX 1RHI1 4CEWA 2HWE1 1D0HA 3RI8A 5SV5A 1SCSA 2EXHA 1AR91 1X9TA 1YI9A 1ZM1A 4NHLA 4X8NA 5F2SA 5FPBA 4XHXA 3NNLA 3WCSA 3BYWA 1C1FA 1V6MA 1AX0A 4QQ2A 4QHZA 5FXXA 1W8FA 3TAYA 2VMIA 2D3SA 5FZLA 1QEXA 1GKBA 4F3JA 1D4M3 2V5DA 3MLLA 4KU7A 2QZ2A 3DECA 1OVPA 4Q4V2 3VBSB 3ZLIA 3FMGA 1DBNA 4JTNA 3ORJA 1W2OA 1XQNA 4ARYA 1ENXA 3EHKA 1N3QA 4A41A 3BTXA 1Q5OA 1G9DA 3ZFGA 4NAOA 1UYYA 3H3LA 1C1LA 4M3CB 3V65A 3ZYIB 2FZ2A 2VG9A 5A7OA 1CZVA 1AYN3 2X29A 2RVAA 1KRIA 4QGLA 3CQOA 1RUG1 4BLJA 1VRBA 3I54A 4CDQC 1O3SA 1HXS1 1I5ZA 5CFDB 1QJU1 2VZQA 4IE4A 1VBA1 2SLIA 3R0RA 2KD7A 4YZ3A 1G9AA 2VTXA 5FZOB 3Q8BA 4PQQA 4YFZA 4LOTA 4Z2WA 2H0VA 5DAWA 4DEVA 5CBLA 1QJEA 3CJIB 4IEPA 4PBPA 5I91A 3FWEA 4JGYC 4IERA 4QDSA 4EWAA 1YC61 2JDHA 4QX5A 1J83A 1CVNA 4K9SA 4BQWA 2FDHA 2CAUA 4LBKA 1RL3A 4Q27A 2JDPA 3ZIWA 4LIVA 1DQ2A 1TNRA 3WQ7A 5FY5A 3ZFEC 1MQTA 3CKHA 2J1SA 3SMHA 1JZ5A 1GZWA 1U5ZA 2R071 3AK0A 2KA3A 2PHRA 3OGGA 2DU0A 3BB6A 2FCVA 4H2AA 5F5IA 3I59B 4AEDC 3I4IA 4B3NA 3POBA 3LCPA 4NJ4A 5FQ0A 5JOZA 3VKNA 5KC5A 2PLV3 2NP0A 4KU8A 4XXPA 4DNYA 5JMOA 2HWD3 2IXKA 4QXKA 1KFUL 3B00A 1KITA 1VAKA 1KQRA 3W21A 2R16A 2GMMA 5A7WA 1RUD1 2Y26A 2QQOA 4IETA 1XU2A 1ACCA 1ZRDA 2FZ1A 2W39A 1F4AA 1RUI3 5LBBA 2HEYF 2Y38A 3HQRA 5JIUA 4BXFA 3JB8A 3VN4A 1L7LA 3AKPA 2WO3A 3ETPA 1VBD3 1JN2P 5JMCA 5EYYA 1GOGA 5A7SA 3VHRA 1KS4A 4P9GA 2DU1A 4IEZA 1RVF3 3ELNA 3K77A 2ZHMA 2XJTA 1QOSA 4CCJA 1H30A 2ETEA 4H55A 1PX4A 1QXPA 3KCYA 3PUSA 5FUPA 4AI3A 5JDBA 3K46A 4LHLA 3V0AB 5FDBA 1CZSA 1WCSA 1C8M3 1BVP1 4WVZA 1DGRN 4X8PA 4AGVA 2TEPA 4B1MA 4UBHA 3IKWA 4LA3A 4PF5A 4O9GA 4P02B 3BKZA 2WAOA 4YVSB 1RXFA 1CAWA 2V5YA 4Q4V1 5FXVA 1OF4A 2YU1A 1EV12 3R6SA 2BERA 4ISRA 1JOPA 4LBNA 3T3YA 3RZLA 1D4VB 4HSLA 3AP4A 4LKFA 3M3QA 2AR6A 1RJ7A 1C5HA 2Q8CA 3H8RA 5FY7A 2VJXA 1SPPA 2SBAA 2FDGA 3AFKA 3K2OA 5D8AB 5C8WA 2CGNA 3ES4A 2FDKA 2Z2SB 5LW9A 3H9AA 3HBZA 5HCAA 3LA2A 5A70A 3KVAA 2PA7A 3WUCA 4BYYA 3AMPA 4CCMA 4LIUA 4JTOA 1VBE1 3HMYA 1JOBA 2V09A 4XETA 2NLRA 1C5IA 4C0HA 1CIWA 2XBO3 1VBB2 5D2AA 1H8TC 3D0JA 4I30A 3H8UA 2XGXA 1XSRA 4LE3A 1N3OA 3RPQA 2E26A 4P00B 3LPFA 3NJYA 4XFGA 3FZ3A 1JS9A 3MW4A 1AYM2 3BIWE 2FMYA 5L19A 5JLVA 3WLUA 4AYUA 4RYDA 1WBLA 2DUOA 3EYPA 1HQLA 3MIFA 2XJVA 4EZ4A 1BQPA 1UMIA 1VALA 5C9AA 4M0NA 3AZVA 3WHTA 1R1A2 4D6QA 2BP6A 4Q4Y2 3VDDB 1QMJA 4NRPA 5CKQA 3GM8A 3RSJA 2GN7A 3MW2A 3DF0A 1NG0A 1RMU3 1BJQA 4GMP0 3VD4A 4AK3A 4EJRA 1HRV2 4GB32 4CEYC 3EO6A 3OD0A 3PDQA 1V6IA 4LO8A 5DAQA 1X50A 3DEMA 1RC6A 2HYXA 4AVSA 4LUMA 1GUIA 1B09A 3ZYRA 3SNMA 4KWKA 3KGLA 4YVWA 4R9AA 1IPSA 4QU1A 1KS5A 2D43A 1VB2A 2F17A 5FYBA 5F1RA 2DV9A 3U14A 5L7OB 5A3NA 4K40A 2R6QA 1OURA 5D21A 4CU8A 3MZHA 1FV3A 2P3KA 5CB7A 3C3VA 3LWCA 4NMIA 4UW3A 1TME3 1LTEA 4DFSA 3OGVA 1TZOA 1UNBA 2RV9A 3DPRB 4CZSA 1XC6A 1QJX1 2ZMLA 2D6LX 1W8UA 3GNEA 4JQTA 2VBDA 4XC9A 5DDJ2 3ZFFA 5A3TA 2BGCA 1RINA 3LDBA 5JZGA 5LZ6A 3BTZA 1YLLA 1ULDA 4NHYA 4XJ9A 1QXRA 4BQ4A 2ZTNA 3OBRA 2WDBA 3AZYA 1SBDA 1V9U3 3VZLA 5SV8A 5IHRA 1IG3A 4BMBA 2J7MA 2OYZA 1W2NA 4KWJA 3WNPA 2OXBA 1HW5A 4UFKA 3D3AA 4IV1B 4BB3A 3DYPA 2D98A 3TB0A 5HPOA 1EV11 1UX7A 2BUKA 1F5FA 3LEIA 4XFIA 1AXYA 4A6OA 1IS3A 5BNQA 3J26N 4EV0A 4YGDA 1W39A 2XOMA 4I0BA 4KI5M 4XF0A 2DCKA 2RR13 4YGBA 4HKOA 4CXXA 4I02A 3N7LA 1ZRCA 1SBEA 5EHDA 1POV3 3ZPYA 3VBSA 5A33B 3E5QA 1LOFA 5C4WC 1LOGA 3OEAA 2VMHA 1VBC1 4XUTA 3ZXEA 3JU9A 5IATA 4WM8C 4OZXA 2JDYA 4BQ1A 3SKVA 3AMHA 1PX3A 1VLNA 4AZZA 1F15A 1GYKA 4LHNA 1D7PM 4M3CA 2BZDA 1KJRA 1V0AA 2W1UA 2AH2A 3FX3A 2R043 4S2DA 3N9LA 4JDOA 4XFFA 2W2IA 4DUWA 5I0RA 3UKTA 4Q4X1 5T5OA 1OI6A 1ULFA 4QD2A 4INDA 5CFDA 4ASLA 5KHJA 3NMBA 4JRAA 4YM1A 1W9WA 5ACA2 4URAA 1AR72 3ES1A 4Q8LA 1UKRA 2B45X 1AYM1 4D69A 5FZOA 5GLVA 2XJSA 4DIQA 3GJAA 1CX4A 3IZOA 3PUAA 3BCWA 4P5YA 1N3PA 4B4QA 4LT5A 1ZYBA 1UU4A 3RWKX 1VRH2 3DCQA 1R1A1 5BPXA 1AF9A 4MV2A 4Q4Y1 4HG6B 3H50A 1SBFA 2DVFA 4R52A 3SCGA 1NY72 3J8F1 3VBHC 3AKRA 4BIOA 1TMF2 5FMOL 4UFLA 4MO3M 1PGL1 3SITA 3O5SA 4AVBA 4Y1ZA 1NQDA 5FMOS 2VQ0A 2C9KA 4LITA 1HRV1 3M70A 3PNAA 5FOJB 1WCKA 1COV3 2GN3A 4YW1A 2CWMA 1PHMA 1OH4A 2PHWA 1NE4A 1R093 1CWPA 1WW7A 3GCWA 1GBGA 1VP6A 2ADDA 3KV9A 2D7FA 4CDWA 3B94A 4ORFA 1EUTA 1K3IA 1YQ6A 2ZX3A 4QX0A 5C3QA 5HV0A 3O1SA 2VQTA 2CTVA 4PLNA 1AR62 4BISA 5FO7B 2WFF2 1VE0A 3HVDA 3LEMA 2XLGA 2ZGLA 4XE9A 2OIIA 4CDQB 3IDEA 1ZZ6A 5LY2A 1GANA 4WZCA 1REDA 3N9QA 2LUWA 5I8SA 1YFWA 1MVQA 1S2EA 1UO9A 5ERLA 4GWIA 4P9IA 1OKOA 2WZ8A 5E16A 1YQ2A 2FMDA 4XAAA 2HWC2 4IEUA 3WG1A 5DDJ1 3TN93 3ZSEA 4E4SA 4JGYB 2G9GA 2BU9A 4O9EA 3KV4A 1UAIA 4OQ9A 4FXKB 3RZGA 3UGGA 2HEWF 1AL0G 1X8EA 4LBQB 2VZ3A 3KF5A 4MGKE 5I0TA 4LHKA 1O3RA 1W2AX 1QF3A 2DFCA 2PHTA 2R30A 3NJVA 3M7AA 4Q1PA 3ZFEB 4IE6A 1NQJA 2IXHA 2ZGMA 2VUJA 4XF3A 1JZ8A 5AFEA 1QU0A 3BPSA 5F3EA 3VBUB 2BDRA 2WABA 3P3NA 5LEJA 3PMEA 4XABA 3KQ4B 4QGMA 1NLRA 4AEDB 3I97A 3MEPA 1W2UA 2W3JA 1GSLA 5DMYA 1FNYA 4YVSA 1QQP1 2Z42A 4QGNA 4OCTA 5DG2A 3WDTA 2CY6A 4JVAA 2A70A 5FZ4A 3PUHA 1NAEA 1MS9A 5A7QA 1CN1A 3WF1A 2RDRA 1FAYA 1H6XA 2WUHA 3PURA 4A6SA 4ZS3A 1ENQA 5FJKA 4CCOA 4MADA 2OA2A 1XOYA 5BNOC 5BY5A 1FMD2 1UY1A 4DEQA 3WX5A 1O3QA 4W4ZA 2FCUA 1IKPA 2C9AA 2Y0OA 1RUC1 2WRAA 4LQRA 3ZSKA 3VHNA 4IV3C 5ACA1 2YV8A 5JCTA 2Y34A 2LALA 4N7UA 4UT5A 3WG3A 2TNFA 5EJZB 4XXAA 1QOOA 2XHNA 4QB6A 4M0HA 2XKPA 1S2KA 4TZDA 1VRH1 2YPDA 1GR3A 4CP2A 4XACA 5JIAA 4MH0E 2RMU3 1N1YA 3GCXA 3PIGA 4UW6A 1NY71 2QQIA 5L36A 4EZHA 1TMF1 5FP8A 4AW7A 2X53S 3OUJA 2VCCA 3OF1A 5HXVA 4AHZA 3GDBA 4YG0A 4LO6B 4FFHA 1NA1C 5F2WA 4TLFA 4CU9A 2VW2A 4U2AA 2TUNA 1RUNA 2YYOA 2GH2A 3VDDA 4QKDA 1HIXA 2D6OX 1CESA 2OPWA 3ILNA 5JOWA 1LR5A 4TN7A 4GWJA 3WT3A 1KJLA 1JHJA 1DGWX 5DG1A 2YZ4A 3CJXA 1N1VA 5BNNC 1O4YA 1O91A 4XQWA 3MLJA 2IWGB 5GJ6A 2JB8A 1C3HA 4GKYA 3WG4A 3ZVXA 4HN1A 3LDRA 4NRQA 4QHOA 2DVGA 2G9ZA 2UY8A 1DQ0A 5LRSA 5CEHA 3THDA 2LRPA 3FHAA 1H6YA 3WOGA 1A78A 1UZWA 3FLPA 2NPIA 1UY4A 2JE8A 2HWC1 3TYJA 1H8VA 1GV9A 4NPRA 1UYXA 1H8TB 1E5RA 4LXLA 5KBFA 5JSOA 3POIA 2P3JA 4BQ3A 4CCEA 4B7KA 3ZN4A 3MIGA 4I3PA 5FP4A 2GNTA 3PMSA 1XNTA 5C3SA 1UIKA 2WC2A 4OYUA 5CFCC 3U10A 3OJBA 4YW4A 4RD7A 1Z0HA 4UFMA 1O59A 4HONA 2ZPXA 3X29B 5KHKA 1WLTA 3GZEA 3J4UH 1GMMA 2PHXA 2G4IA 4HOOA 4IV1A 4KMQA 3UGFA 1W04A 3NL1A 2EIEA 4AI0A 2DUPA 5FUNA 2QQPA 1YXWA 2PMWB 3RZKA 4MGIE 4A3ZA 4CEYB 3VDCA 1WMDA 5K0UC 1MS8A 2JE7A 2JKBA 5IAXA 3TOJA 3VV1A 4RQPC 1W8NA 1UYPA 2OVUA 1SQ4A 2VQUA 4UF0B 5LA0A 1WMEA 1FMD1 1S0FA 1RUF2 2OZ6A 1LHWA 5A33A 3JCIA 3WEZA 3NKGA 4Q4W3 3LA7A 1MZEA 1F2NA 1RTVA 5FY8A 2NQYA 2PYTA 3OCPA 4IW3A 4ATEA 2IVIB 5IVCA 5AC92 5CVRA 2YU2A 5FJHA 4BHPA 1H4HA 2ZBJA 5BV6A 4BH9A 4RHV2 5FYIA 4A4AA 3JD73 4L92A 5F3IA 3ZXFA 1HV0A 2ENRA 4COYA 3K3NA 1QKQA 3WW2A 3K48A 2YROA 4P5HA 1RUJ2 5FLIA 3S5AA 3MBWA 5AFBA 1AR82 5GM0A 5JAXA 1S0BA 5FZAA 1PK6C 2I2SA 2VNVA 2YC4A 2XJQA 4Q5OA 1JYCA 1OOPC 3U78A 3FE5A 4CPBA 3O1VA 2J42A 4WVWA 4MZUA 5APAA 4FTEA 1FPN3 5LY1A 3VBRC 3ZXLA 2WLQA 1IHMA 4E4ZA 2NZ9A 1GWLA 2DTYA 3FHIB 3MLKA 3WF0A 1MACA 3VZNA 2YPJA 1POV0 2HWD1 3C7FA 4P08A 3AYEA 3WCRA 5JXHA 4FPEA 1W3VA 2VNOA 1JYWA 5C33A 2XJRA 5A6XA 3ZR6A 5FPLA 4XILA 4GZ9A 4WM8B 2VOXA 3KHCA 5EP9A 2HWE2 2JDNA 1OLQA 1XNKA 3BU7A 5T54A 2VXJA 1G9BA 1AR92 4QXHA 3PTYA 4B4PA 4QAWA 4NIGA 3HNYM 4N53C 1XNAA 1LOBA 1IG0A 2GP3A 4ZS2A 4D7SA 2ARAA 2FDFA 1RVF1 4LKDA 3OB8A 1A3KA 2YDEA 1IPJA 5ABJC 4FP2A 3AKSA 4M00A 3H1YA 3VHPA 5IVBA 2BJSA 3I2GA 4JGYA 2C24A 3ACFA 4XYXA 4YW7A 1BK1A 1UY2A 1F4HA 5FZIA 4BZ4A 2AEZA 3OPWA 4LBQA 3A0KA 1J3QA 3VBHB 2ILMA 3WVJA 2ZZJA 3AKQA 1PO12 1V70A 4IGQA 4PIYA 3PVOA 3ZFEA 1K5JA 2BGOA 4JC1A 5CYYA 4QQHA 4QT6A 2PQQA 3VBUA 4HFSA 3PUIA 1RUG2 1JYNA 5EWSA 4M3CE 1I9RA 1JHNA 1EAH3 3VKLA 4AEDA 1LOEA 4FFFA 1VBA2 3N9PA 2WO7A 5AVPA 3K51A 3R05A 4K20A 1RUF1 4G9SB 1IS5A 3ZMNA 5IT6A 4Y22B 1FI2A 4RSUA 1YFUA 2WA3A 1YIFA 2O8QA 4AE2A 1BYHA 1YQCA 2D40A 3IDAA 3O1TA 5A32B 3I2IA 3ZM8A 1MS4A 1DQ5A 3M3CA 1PO23 1W6QB 1MPXA 4RHV1 5L9VA 5IVFA 3B5LB 4JGZC 3WNKA 5CNAA 2R072 2W94A 5J09A 4J1XA 4OI1A 4CDUC 5IK7A 1Q8SA 4XPVA 1AR73 1S0JA 2H6CA 2BTVC 1QH6A 2GC3A 1S0IA 1RUJ1 1VB4A 2XVKA 4KGQA 1ZVFA 4NROA 2BBAA 3VLBB 4MVTA 3D5OA 2R0HA 3NAPC 3ZYFA 4CA9A 3IMNA 1W8OA 2E9QA 5A1LA 1UYZA 2YC2A 3ABZA 4N9IA 4D7YA 2R49A 2P17A 2WFPA 3HIFA 4AOCA 3O1PA 3VZMA 4IEWA 3N4MA 3PVEA 3TEZA 2VOVA 4JKKA 1RUD2 3OYWB 3HN1A 3WP5A 4LK6A 1E5IA 2JG9A 1U5XA 4OULA 4SLIA 2ZGNA 3E5UA 4O61A 1RMU1 3WW4A 3NNJA 1BKZA 4AG4A 2CWSA 2P2KA 3LKJA 3K4ZA 2ZX1A 4Y5TA 5C3PA 5FP3A 4Y5SA 2MNGA 3SLIA 3HBKA 3BUCA 4BA6A 2Y6FA 5BNOB 5IVYA 5J3UA 3POGA 3ZSLA 1WCUA 1DGWA 3RGBA 4OHVA 1Q8QA 3T2TA 2VZRA 4BMEA 4C90A 1NCQC 1S4CA 3QH7A 2X5IC 2MEV3 4ONUA 3DXUA 2ZMKA 1UW8A 1BEV3 1YIPA 2A3XA 2JDMA 3NQHA 4IV3B 4GWNA 1TME1 4YWAA 3JBG2 4ZKTB 1URXA 1I1EA 3VKOA 5EIYB 5A3WA 3B9CA 5CISA 4UOJA 2UWAA 2VE1A 4QKNA 1H8TA 3KCXA 4RS5C 3UKVA 4B7EA 4H7MA 4XOGA 1R083 4E2SA 4AHXA 5FYTA 2MHFA 3VZKA 2ID4A 3T09A 1BZWA 1H9PA 3ETQA 3AM2A 1PO11 1UZZA 1ZREA 2AC1A 1YRZA 1A8DA 1IS4A 2CHHA 2IZWA 3LSDA 3USSA 1NA1B 2Z4FA 4N7IA 3J7HA 3LB9A 5A7PA 1T2XA 2ARCA 1OT5A 1LCLA 1VBE2 2RR11 4LO7A 3MPPG 1GP4A 1QJY3 2VMGA 3T2OA 2J1EA 2V4AA 3IAQA 4QU2A 4PJYA 2ZGQA 3QBQA 3ECQA 5BNNB 4CEYA 5LB6A 1MZ5A 4PBOA 5F5AA 4EYUA 1DYOA 5FZ1A 2HWF3 1SMVA 5C6CA 1ZBA3 3MGUA 5FXZA 2RJKA 1LHNA 1KFXL 2R1BA 1UN1A 3CDZB 2D3RA 2DYCA 2KXLA 4K1YA 1SLCA 1N1TA 5B4XA 3CZJA 4P14A 4J6GA 4MHRA 3WSOA 2QQWA 4AF9A 1LGCA 4GXLA 4Q8KA 1DU3D 3IT8A 5DUUA 2YFUA 3LA3A 2A7AA 3UV9A 4HANA 4A44A 4AXOA 1GICA 1BBT2 1WZXA 5LBCA 2ZHKA 4QXBA 1S55A 1Y3TA 1AL22 1RUE2 2AYHA 1XYNA 5F5QA 2VCMA 2RS12 3G6JB 4W6YA 4KL1A 3DXTA 4COZA 4TTGA 1GP6A 1UKGA 4GQ7A 3UL2A 1ASJ3 2OS2A 4GIQA 1JUHA 5CFCB 2XJUA 2CYFA 2R0FA 2QTWB 3P5BA 1GZ9A 3UKNA 1EYBA 3OGJA 4IE5A 2WZEA 1TNFA 4Y4YA 5T5PA 3A0NA 4D0QA 4NPLA 2CNAA 2WBKA 2V4VA 3RZZA 1COV1 5F39A 2ZGRA 2N7GA 2GNMA 2HWB3 4OLLA 2E53A 4Q0VA 4MXWB 1C57A 1R1ZA 2WYFA 1R091 4FXGB 2B4KA 3D8CA 5C3OA 2B39A 2WZR3 4S2GA 5K0UB 3I2FA 1WLDA 2BWCA 4HVOA 2XVLA 4RQPB 2J1TA 3LE0A 3NKTA 3ZN6B 2VZUA 5HI0A 3D6EA 1ZZ8A 2D3PA 5I8YA 1QJX2 2P37A 1REFA 1JU4A 3HQUA 3HT1A 3AYDA 3LAGA 4BJ0A 5FMCA 4K3UA 5FBZA 4WM8A 2BNMA 4AQ6A 4ET7A 5EJ3A 3ZYGA 5GZFA 4CTEA 1S1AA 3JBG1 4M4RA 4R4ZA 1ZRRA 3VKFC 4L2NA 2WYSA 4P9JA 1ULGA 2R7EB 4AQ2A 3S57A 3MO4A 3IBMA 1QNYA 2W91A 4BOWA 3SC7X 2WWSA 2OKXA 3AYAA 4N43C 1ONAA 2R063 2WIIB 1HRI2 3DYOA 2ORZA 4KG8A 1PK6B 2LROA 1MS3A 1ZNPA 4P9LA 2RM23 2EAKA 2IXLA 2RG4A 4Q29A 4XJ8A 1Z7S3 3INAA 3VBOC 1OOPB 1VBC2 2XUEA 5DUXA 4DUVA 4WV8A 4XIKA 3BI3A 1G86A 4GWMA 3VBHA 2XXZA 3QH6A 3I2JA 5FY9A 5TSWA 3U1XA 1PM4A 1GFF2 2Q30A 3VBRB 2JEMA 1PVC2 4W8JA 5B4NA 1ZZCA 2PAEA 3G7DA 4Q4X2 4R9DA 2OX0A 1QWRA 1J1LA 1MEC3 2VMDA 2XG3A 2W0XA 1SDWA 2YGLA 1YO8A 2EIBA 3EB7A 3LF7A 4LA2A 3HNMA 5JSRA 3IIAA 2ZA9A 1TQ5A 2Y6JA 4Y22A 2FD8A 4D8MA 2B7YA 3S0MA 4UW5A 2ADEA 1NCRA 4QXCA 3WNLA 1CR7A 1UOBA 5A32A 3O12A 3NSTA 5FPUA 3QOPA 4N53B 3POJA 3J8F2 3UK9A 3THPA 1W6QA 4Y20B 4FOVA 1ND3C 4WVVA 2PXJA 1PGL2 4PHZA 2VZVA 1BBT1 1D2SA 3ZOIA 3N3HA 3PLQA 3HD8B 1AL21 2Y0IA 2DCZA 1K45A 1RUE1 5ABJB 3SH3A 3L2HA 3R4DB 4FQZA 2RS11 4WBBA 5CG8A 4TYSA 1HDKA 4WZFA 3OEBA 5FZFA 3Q8EA 2DCYA 3VKMA 4R9BA 3S7EA 4B4RA 1PIV3 1W9SA 4PI2A 5AVAA 2GALA 5K4LA 5GLWA 2MPFA 2XVGA 5T5LA 3ZYHA 1OQ1A 3JQWA 3O0WA 5KR7A 1RGSA 2Y6KA 3FFZA 1S0GA 3OBTA 5LBFA 4CP1A 2C26A 1DQ6A 1MR5A 3TBDA 3CHXA 2DWRA 3C2UA 2YB7A 2P4EA 1YUDA 3MF9A 3OYWA 3NV4A 2BNOA 1JYTA 4HN0A 5J36A 3N36A 2VUCA 1AX1A 3U37A 4TLGA 5FREA 3ACLA 1MVEA 4NIHA 3MUZ1 3V0BB 4UI9L 3VZJA 2HBTA 2P6CA 2JWPA 2Y60A 3GZAA 3ENRA 5K9YA 1RHI3 4XTPA 1MQTC 4AQTA 5JPNB 1WCQA 1DLLA 2VU9A 3ZR5A 4IDZA 1RUH2 2CV6A 2WNVB 5JVVA 3VB9A 5BNOA 2QZ3A 4BLIA 3PL0A 2JE9A 1QOTA 5A3OA 3W9AA 4JGZB 4YM0A 3MI8A 3WF3A 1Q8PA 3ZSJA 1NYWA 1K5MC 1W3XA 2VZOA 3WNOA 4CDUB 4JZRA 4KQ7A 5C3RA 2GC1A 5IFPA 4QPIB 4Z8BA 3WINE 3WNNA 3SQOA 1HRI1 3VBFC 2FCTA 1APNA 4XJWA 3NAPB 3BOPA 1QQP2 4MOAA 2Y6LA 3TRSB 3OBAA 5JUVA 2IVJA 2B42B 1T6BX 4LKEA 2UY9A 3UYJA 3TEWA 3GBWA 3VBUC 3IM0A 1WD3A 1JXNA 2WNOA 3C8XA 5FFOC 1X82A 4AWDA 5IAVA 2WJSA 2YUEA 2E63A 4Y3OA 2WN2A 4D94A 2B9UA 4BK5A 1PVC1 5C70A 5FLHA 1GU3A 3RWNA 4FPJA 1XJAA 1HXS3 4L97A 1NA1A 4QKFA 1FOD3 1RUC2 3WR0A 1QJU3 2PHDA 3MIBA 1W99A 3LPGA 5FYHA 1S0EA 3U4XA 5LA2A 2YC0A 3OG2A 2BEOA 4FFIA 3SCHA 4L8QA 3RZHA 3CJIA 2ZGSA 3AJYA 5BNNA 4QHBA 1X9PA 1ZBE1 2UYAA 1Z78A 2VUAA 2Y8KA 1GWKA 2L9LA 3OGRA 4RGGA 3ILFA 5CA6A 3WDXA 2GC0A 2O1QA 2Q5TA 1NCQB 2X5IB 3VD3A 4F8AA 1GQGA 2RS53 2VNGA 1AXZA 1DIWA 1EUUA 4DXSA 5FO9B 3BU0A 5A1FA 5EJ1B 3URFA 3FN9A 3DL3A 4HETA 1Y7BA 3SISA 1CIYA 3I59A 2WQ8A 4Y1YA 5FZ6A 4QX3A 2G19A 4Q1RA 3ME2A 2RS32 3TEYA 1S2BA 3KCCA 4UFJA 3ST7A 4DXZA 5GKAC 1CD3G 2VGDA 1G7YA 2BVVA 4DMIA 4O65A 1ZZ7A 2WZPP 1IQDC 2EIDA 3KV6A 3N9NA 2ZEWA 3HPNA 2WS93 1RUD3 3AKTA 3NWKA 2KM2A 2WINB 3B9IA 2VXRA 4HZFA 5CFCA 4XCBA 5LA9A 3MHZA 4XBNA 5L9RA 2JB4A 3TWIA 2WQZC 1J3RA 1ZA7A 2FDIA 1W8TA 4E2GA 3Q8FA 4C8DA 4Z1VA 1QXJA 1LHVA 2P1BA 2J1VA 4ISQA 5A3PA 3MFCA 5GZDA 3R4UA 2PFWA 3E5XA 1LULA 4XFHA 1PZ8A 2GMEA 3LOIA 5K0UA 4FAGA 3H8XA 1RUH1 4LBOA 2DCTA 1BVVA 4RQPA 3AFGA 3PU8A 4I0AA 5LK5A 3KF3A 2QKDA 3ZN6A 1XBFA 1LJ7A 2W1SA 4KGGA 3V0AA 3NJZA 1CAXB 2HYKA 4E4DX 1SLIA 2AENA 1FV2A 4BIFA 2BWAA 5FWJA 4XFBA 2WNUC 1VPHA 3LQCA 4YLZA 5I93A 5LRRA 1CX1A 4BU2A 4N9HA 3M1HA 4GMP1 4Q4V3 5IVJA 4LJHA 5KWRA 4ZHNA 1W05A 2D5HA 3BOWA 3OPZA 4YG3A 2CDPA 4YRDA 5FZ3A 3MW3A 1GQHA 4K1ZA 4FAHA 2QJVA 3WDVA 1B35C 5CAZA 3JUUA 4KBBA 5DQ0A 4AL9A 4XZPA 5GZEA 3ZPOA 1PK6A 5J1XA 1QDCA 3M3EA 5D8AA 1AYN2 2HBUA 2IXIA 4HK9A 2W1WA 1BK0A 1OOPA 4AGGA 1ULCA 3ZXKA 4QPGC 3VUOA 2A71A 4P9YA 3W59A 4XMIA 2VTFA 2XDVA 1E5SA 2CAVA 4OHZA 2VULA 3VBRA 3MYXA 5F6LB 1HX6A 1PZ9A 1VMFA 1X36A 4L9BA 2EICA 1C4RA 2WLPA 3RMXA 5JZGC 1GOFA 2BFUS 5GALA 4XQ4A 5L9BA 1KGYA 1W6PB 1L7QA 3APBA 1UY0A 5JXJA 3LDKA 5E89A 5JXGA 1OA3A 5J37A 2EIGA 2XONA 1OA4A 3HNBM 4EN7B 4B1LA 1RXGA 5KHGA 3RS6A 4LBLA 5J48A 2ZGPA 5FOBB 3U75A 1I3HA 2QNKA 3H3ZA 3VD7A 3PJYA 4FP3A 4ITCA 4PI0A 3SH4A 4MGZE 4N53A 4FFGA 2E32A 1IZ3A 4Y20A 3FLRA 4DO0A 3USUB 2XR4A 2RJ2A 3WF2A 2PLV2 1OKQA 2O14A 2RS31 1VMJA 4AAPA 4I01A 1DDLA 2A6ZA 4Z92B 4NHMA 1UQXA 4N43B 4AFMA 2HWD2 2D6NA 5ABJA 3N7MA 3BTYA 1ST8A 2J1UA 4FI9A 4AEKA 5GLUA 3MICA 4Y24A 1JH5A 4Y26A 1JTZX 1NE6A 3VBOB 5F3GA 2WSVA 4WM7C 4PIZA 2Q8EA 5FYMA 1RUI2 2FBEA 3B69A 4ES9A 3I3MA 2ZAHA 1W9TA 4EN6B 3AZWA 1LB2A 2ZEZA 3DYMA 3WV6A 4QB1A 5A6YA 2VVEA 1H1AA 2PAKA 5L7OA 1VBD2 4ZU5A 3GALA 4BQ2A 4Z07A 2JENA 4FOQA 2F6BA 3AVRA 4DUXA 1RVF2 3D82A 4BE3A 4XF4A 4XFAA 5J7MA 3V0BA 2TBVA 1WMXA 1QGLA 1QJX3 2BRTA 3DPRA 3RYPA 5IYYA 4OMDA 3ZKYA 4FTBA 2ZGUA 3UETA 5CKNA 2E7QA 2XQXA 1CJPA 1N1SA 1C8M2 3MPBA 1H2MA 2VY0A 1BEV1 2WNVA 4CUCA 1XRUA 2BV4A 4GALA 4MUVA 4S2FA 3T4HB 5DAPA 3C7GA 1LESA 1D4M1 1ND3B 3EXUA 3WDYA 3NNFA 4JGZA 1JZ3A 1EV13 4RR3C 4A3XA 3OSDA 5KC6A 1VAVA 1Q43A 4QM8A 3FC0A 3WQBA 3U0ZA 2DVAA 4CDUA 2D6PA 4CDWC 4RGAA 4QPIA 1R081 3GYDA 1AJKA 3RZJA 5H9SA 1PMIA 4FT8A 2D6MA 3MIDA 3OPTA 4PLOA 3N7KA 1FYUA 5GZGA 4CUAA 1V6NA 2AEYA 3NAPA 1QH7A 1BMV2 2ZKNA 2D6KA 1Q8VA 3E6BA 2D97A 4RA0A 1NT0A 5DZEA 1AYN1 4JDMA 4W6WA 2BVBA 4R4XA 4AFAA 3IDCB 5IK8A 5KXDA 4MYEA 4XURA 5JWPA 1DZTA 1ND2C 1F8VA 3O1OA 2VMEA 1SFYA 4CE8A 4PIXA 3B93A 4YZ1A 1CONA 2UYBA 1J59A 1VBB3 1XB9A 5L73A 4AI1A 3ZSMA 2VZPA 4E8DA 2XBO2 1O8PA 3LEGA 4IL7A 3I7DA 4COUA 4FPYA 4AGRA 2Q1ZB 1UXXX 4SBVA 5FKCA 1JW6A 1POQA 1AYM3 1O6UA 1ZBA1 4CCLA 3WW1A 2JD4A 4HLTA 1SACA 3KWVA 4CCDA 4CVUA 2JG8C 4J25A 1NOVA 1LU1A 3I2HA 1R1A3 2GZWA 4HPKB 1G6NA 5C5TA 1G9CA 4FSJA 4Q4Y3 3VGIA 1XYPA 1GOHA 5ANQA 1JZ7A 2Z69A 4A7KA 1SLBA 4DS0A 1DCSA 3RFRA 4P9WA 1NCQA 1K5MB 2X5IA 1HN1A 2PLV1 4K8FA 1OUXA 2QQLA 1RMU2 3ACHA 4AVCA 1HRV3 4GB33 4CYDA 4FPFA 2GP5A 4B29A 1G8WA 1M06G 3VBFB 1O4TA 3S5QA 5C4WB 2VBPA 3T2QA 1ASJ1 5IWFA 2GNBA 1RUI1 4LMFA 1YCIA 4XZUG 4AI9A 2QQMA 2XHKA 3L9JT 3T0BA 3FJSA 1XNDA 3V64A 2XL9A 2VUDA 1VBD1 1OFNA 4CDQA 4E2QA 4XDQA 2ZX4A 5FIXA 5JOYA 2WZR1 1HQWA 1TME2 3PVBB 4RN5A 4BXSV 3UJQA 4GKXA 3WUDA 4XTMA 3T2PA 1HB4A 2X09A 4J1WA 4QDRA 5DDJ3 1HJGA 4A7ZA 1OSGA 2CL2A 3PTRB 3WP6A 1W0OA 4CXWA 1DQ4A 4M01A 2W9XA 1JODA 3I3EA 3N7JA 5J96B 4MSVA 1C8M1 5H9PA 4FCAA 5DUWA 1JZ4A 3W58A 1H1MA 1YYNA 1E57A 4AI8A 1V9U2 1LENA 2K46A 1CPNA 3LFMA 3NJXA 5CU1A 3MUY1 3RYKA 2VOKA 5FMDA 2EAAA 4FQ4A 3KV5A 2RE9A 2ARXA 3ZXJA 1WW4A 1US2A 2HJIA 3KT7A 1EPWA 4META 4NHXA 4AI2A 1WLWA 2YFZA 1Q3EA 5FCCA 2Q1FA 3H7JA 2OQ6A 1YFYA 4HL0A 2BPA2 3OBZA 2RR12 1BMV1 3MV11 3M4FA 1OUSA 5F32A 4BCUA 4UBGA 4QX7A 1DP0A 2RM21 2KR2A 4AAXA 3FL7A 3AL5A 4L99A 5BYNA 3ASIA 4X6QB 1J3PA 5B2GB 2VC9A 3CEWA 5E8AA 5C7GA 3RJRA 4YM3A 4LOSA 2JDAA 3PIJA 4DXTA 1O3TA 2EVXA 3POYA 2E6VA 2GU9A 2Z5WA 2R042 1YWKA 3GGLA 4A2UA 4NAMA 2XBO1 1RUC3 5ANNA 5A3UA 4GULA 2OW4A 5ACA3 1IKQA 4E9KA 1UMHA 3AMMA 1LODA 2RDQA 5BNPC 5LCWL 2ET7A 3BTAA 2CU5A 2BQPA 3LSEA 2VD7A 3S30A 3V56A 3KT1A 2GMPA 2Q4SA 3O1UA 5HBAA 3AZXA 2NM1A 1IS6A 1VRH3 2BGPA 1LEDA 1UL9A 5ISLA 1W6PA 4H7LA 2PELA 4IESA 4PDWC 3LIHA 4UFHA 5I8TA 2VCBA 3E6CC 1TMF3 1LGBA 3L2YA 4Y4RA 4JHZA 3B02A 2PAMA 4BDVB 1JOJA 3IDBB 4N8MA 5BUVA 1WCDJ 2WNUB 3ILRA 3AMQA 4UFIA 4FPOB 2Q8OA 5IFTA 1X33A 3T0AA 5E1RA 3BN6A 1COV2 4QX8A 3ZIXA 5FUIA 2JJ6A 2QUOA 3A23A 1RYYA 4FTSA 2VW0A 2WO1A 3MIEA 4HXCA 1ODNA 4XUQA 1R092 3USUA 1JU3A 5JSPA 4N90A 3ZKUA 5C8CC 2ZX2A 4N43A 1B35B 4JCKA 5EYXA 1FNZA 3J7MA 1UPSA 1HB2A 3WG2A 1AR63 1EP0A 2XB6C 2WFF3 4MHUA 3RQ0A 3BODA 2DBNA 4NN0A 1LECA 5FK8A 2BW8A 3DN7A 2NMNA 3VBOA 2D44A 3IB3A 4QPGB 2P6HA 2XJPA 2VMCA 4ARXA 5HCHA 1O7FA 2QE3A 1UZVA 2EALA 5HCBA 4LO4B 1V6JA 5FYZA 4JX0A 4M3CF 2B5HA 1SEFA 2HWC3 3Q8AA 3GZUC 1W6NB 1PM7A 2C6SA 4XBQA 1MZFA 4IEQA 4M4PA 5FBJA 4BQ5A 4K6BA 3TN92 5JZGB 2YGMA 1ZA4A 3MF6A 1V00A 2WR9A 2NN8A 5F3CA 4XW3A 1F5JA 4IEVA 5CIRA 1U5YA 1V9U1 5E88A 2ZOEB 4UXAA 1LGNA 2ZEXA 1SHWB 4XVHA 4CCKA 4W6XA 1G9FA 3BVCA 4XF1A 4EE2A 4RFRB 3F2ZA 4EQVA 5E6HA 2Y6GA 1SZBA 4HK8A 5FZMA 4AHYA 3RDIA 2B9VA 1CQ9A 1H1IA 1HKDA 1WGPA 2A6WA 2UURA 1XXNA 1CJDA 1ND3A 1ULEA 2D93A 3CLPA 4CUGA 3MFAA 1POV1 2JX9A 1YJKA 4FOYA 4GH4C 4QQPA 4DQAA 2YY1A 1OPOA 1PNFA 5FWEA 4LULA 2E31A 3HQXA 3J7LA 2VTXJ 4PQ9A 4YGCA 4MLOA 1NZIA 1S0DA 1A6CA 3PU3A 1FMD3 4UF0A 3AVSA 3N9OA 2NYYA 1LAJA 3M8LA 4WM7B 4CCCA 3BIEA 2UU8A 2R041 3HEIA 4GAZA 2A1XA 1JBCA 4ASMB 4FVVA 4HVQA 2Z79A 1K12A 1FOD1 2J1RA 4OI2A 4LBMA 4P9XA 4OQ8A 2D5FA 4XFCA 1QHDA 4NVPA 4YYOA 4PT6A 1OLMA 3FFQA 3W20A 4D3WA 1W03A 3E1F1 3I2KA 4FBFA 4C0BA 4GJZA 1PGW1 2XUMA 2IC1A 1O8SA 1W8ZA 3VD5A 2VAUA 5FYSA 2EF6A 4D7TA 5GLZA 2A75A 4CDXC 1ODMA 2C4XA 3JB4C 1NKGA 2JD9A 2QQVA 2RMU2 4Q0PA 5FZBA 2LM3A 4AFCA 1ENSA 4LBJA 4BWOA 5K7PA 5EZWA 4AQSA 1SLLA 5DZFA 2JKXA 2RS51 4URTA 4V1PA 4JAAA 2IUWA 4V2WA 5FZHA 5LASA 2JDUA 2J1AA 3H1MA 4HPKA 1L3JA 4JDNA 1YHFA 3KLSA 1UZ0A 1WD4A 2I74A 5A80A 4BK4A 3SEEA 4RR3B 3AP6A 2WT2A 1K5MA 1QIQA 2W47A 2VECA 1DF0A 4CDWB 4LLOA 2OQ7A 4K7JA 3WP3A 4V2VA 5FZKA 3VBFA 3UNPA 3I2DA 3ACGA 2XPJA 2Y64A 3AXDA 4OI0A 2WS91 3QLQA 4PLMA 5C4WA 5A6ZA 3BPZA 1WUVA 5A7NA 1W6OB 2JXAA 1YQ5A 3RJ2X 1SCRA 2IFWA 5EPAA 2QCSB 2A5ZA 1W6MB 3KS7A 1ND2B 4XHBA 4OFGA 2ZABA 3DKWA 2AUYA 2W08A 2ATFA 1OQDA 2HH9A 4BQYA 4CU6A 1YFXA 4OVEA 4DXRA 1WA6X 1IGOA 3TN91 1HB3A 1D0GA 2F4PA 2W52A 4NUBA 2O0OA 4CRQA 2E7AA 5FPVA 1S0CA 3OTFA 4ZPIA 4D6RA 2GSYA 1OBNA 1LHOA 4QQLA 3KMHA 3RRDA 4GA9A 1GLHA 2WKKA 2C0ZA 1F31A 4LEJA 1DZQA 4YG6A 3ZXDA 5IUQA 2ZXQA 2JG8B 1QDOA 3LOBA 3AP5A 2PHUA 4JKMA 2K9ZA 2PN5A 4O7XA 4YZ2A 1H4GA 2JG9C 1STMA 1Q56A 1WW6A 2IFRA 1EY2A 2R1DA 1LOCA 4FO9A 5IK4A 4ZY9A 5IW0A 4JV4A 4MG2A 1DQ1A 1O5LA 2BOJA 1WA4A 4OHYA 2YBSA 3ALQA 5FZ0A 2VCAA 4IXLA 3WY6A 2BBVA 4YSFA 5K8SA 1W0NA 1H0BA 4UWDA 4DRVA 3S7IA 3T1MA 5A3MA 3O0VA 1TVGA 4EN8B 4OZOA 1QY4A 2WWUA 1RITA 4S2HA 4COWA 4CEWC 4IE7A 4KNCA 3MV01 1P8JA 4NHKA 1LHUA 4OUMA 3WHUA 1RUF3 4K8RB 1XNBA 4Y1XA 3CNAA 1OXCA 2EA7A 2JECA 2WL1A 3SCFA 4CP9B 4Q4W2 5C71A 3LIGA 3LD8A 2YXSA 1ZBE2 4NWVA 1SLAA 4QPYA 5AC93 2ZGOA 4XEZA 5JI7A 3CU7A 4XIOA 4Q0SA 4RHV3 5DAXA 3O7OA 5C5UA 3POEA 4ZONA 4E8CA 1U5IA 1W8WA 2QFEA 4F83A 4KWUA 4Q26A 3JD72 3ACIA 2GH8A 2VOWA 2RJLA 3EBRA 3KD4A 4QX1A 4TSVA 1JZ6A 4YZ5A 1JYVA 3I49A 1RUJ3 2H0BA 1D2QA 3ZFGC 1O4ZA 2RMU1 1AR83 3JZVA 3PUQA 2ES3A 3RYRA 3TNQA 3CZUA 2EXJA 3U11A 3KVBA 4YW3A 1SFNA 2ZGKA 3WP4A 5EXOA 3FHQA 5T55A 1DLCA 4FPLA 1HLCA 4YPJA 4C1XA 2B46X 3CO2A 3O0XA 3R4SA 5F37A 5LEKA 3I3DA 2HKXA 4QB2A 3Q9OA 3A21A 4UW4A 3A4UA 3WQ1A 3OY8B 1FPN2 1ULPA 2JIJA 1JUIA 2YBPA 4CCNA 4YW5A 1GNYA 2YMZA 2ZEYA 1XPWA 5FXWA 2WNUA 1SG3A 4A45A 2DVBA 4LHSA 2QQNA 3UJOA 3A7QA 3ZX7A 4IE0A 4JQRA 4XJUA 1HV1A 2UWCA 4ZXKA 3ATGA 2Q8DA 3SH5A 4E4HA 4CP0A 5A6QA 4A7YA 1GNZA 2QVSB 2HWE3 3WW3A 1B35A 1K42A 2ZX0A 2BYVE 1AR93 3VL9A 3RVHA 1NUKA 4QMAA 5FPAA 4E27A 3AC0A 1VMHA 3HAGA 1AHSA 2WA4A 4CPBD 2DCJA 1BLZA 4QPGA 1UXZA 1DZRA 2OZJA 3OD4A 1JZ2A 4IV3A 4MGQA 4WVMB 5BNPB 4IUGA 3H3UA 1ZZ9A 2W87A 1W6NA 1DG6A 1CAVB 2WAAA 2XQRA 3I3BA 5LA1A 3KQRA 5JPMB 2ZACA 1AVBA 1XNCA 1KDKA 5FY1A 3RG0A 5HV4A 4NIDA 5FZGA 2UWBA 4PDWB 1NLQA 2I07B 2W5FA 1H2LA 3UESA 4COVA 1PO13 1PVXA 4MGTA 4DZGA 1KDMA 5DXDA 4ASKA 5FZ9A 4AEJA 5JR2A 2ZKLA 1F9KA 1IQAA 1DFQA 1UMZA 2CGPA 2ZHLA 4KWLA 4Y33A 5FAXA 2H6BA 5DN2A 1TE1B 1RUG3 1Y43B 3F95A 4GD4A 1NXMA 4FPCA 3K3OA 1W06A 4MXVA 3VHOA 1WMFA 2K2SA 4OMCA 1EAH2 1VBA3 3KSCA 2W1QA 5FYVA 3PJQA 3ITQA 2W92A 5C8CB 2VR4A 4BPZA 1Y9QA 4Q4W1 4TWTA 4YW2A 5LATA 4AEMA 3B01A 3AL6A 4XDOA 4MGSA 5T5JA 3LFIA 5FZDA 1XE8A 2WQ4A 1HQNA 1DHKB 2W46A 4B8EA 3I3QA 1U0AA 5I0DA 3GXUA 2LW8A 2R32A 4WM7A 1PO22 2LS6A 4LBQD 2IXCA 2ERFA 1UPIA 1OVSA 1VBB1 2R073 5CKMA 2C5DA 2VOTA 3JD71 1V6OA 1ALYA 3O1RA 5LBEA 3GBGA 2JICA 3AJZA 1W9FA 1OH3A 2O8OA 4HMZA 1KXGA 1UOGA 4RS5B 1CAUB 5EFUA 3JXSA 1VIWB 1V6LA 4FPHA 5FY0A 4JKLA 1WKYA 3K75B 3C7HA 2QDNA 5EV7A 4EROA 2G9FA 1DGLA 4HVRA 1FPN1 2BNNA 3GJBA 4Q0QA 1XSQA 2VZTA 1YNAA 4AFDA 5GZCA 4H3WA 2WN3A 2VZSA 1GP5A 3UGHA 3VDAA 2JIGA 1FT9A 1UY3A 5FP7A 4GB31 2EXKA 2WWJA 2E33A 3OGSA 3FUQA 5FO8B 4LUKA 4RR3A 2VMFA 2RDSA 3GHMA 4GH4B 1HB1A 2XL7A 3KB5A 4MXWA 1SFPA 1W0PA 4JHTA 4QDQA 1WW5A 2DURA 2QBXA 1LEMA 3CMGA 4KBZA 2GDFA 4AVTA 5C9AC 1NCRC 3ZYJB 1IPKA 3A22A 2E7TA 3DV8A 3NO8A 4DINB 3ZDSA 3POFA 4NWWA 2A6VA 4YW6A 3ZDVA 1ZX5A 2ZJCA 4XUOA 3EMRA 4U36A 2XH6A 1W6OA 4QWNA 3NVCA 4HKLA 5HCFA 1OD3A 1O5UA 3W5MA 2WT1A 1RIRA 4IEXA 2MEV2 3CF6E 1YQ8A 4L11A 1JMUB 1BEV2 1W6MA 1ND2A 3JBG3 3H42B 3KGZA 4IGOA 5FK7A 5FPZA 2RHPA 2FHRA 1OA2A 3SEPA 1D4M2 4MGYE 5FMBA 1H2NA 2G1MA 3LEKA 2X05A 1GWMA 1NZCA 2VH9A 4OUEA 2VW1A 4DB5A 4XUNA 1PNGA 2BOIA 2FDJA 2XLFA 3WNXA 4CDXB 1R082 1W90A 4ZZ8A 1XE0A 4YVWC 2DBIA 1GQPA 1UZYA 3AZZA 2FQPA 4PF1A 3C7OA 3EJKA 1MS0A 2JG8A 5M0TA 4R9CA 1HJFA 2RDNA 3IPVB 1OLRA 4YNIA 2ZAAA 2HLEA 4I2OA 4LNVA 4DRRA 3BALA 5G04L 5H9QA 1EAH1 3NNMA 1ZRFA 4CXYA 4G4FA 1VBE3 4I3GA 1TEIA 4BQXA 2BFUL 4RFT0 5CADA 2CDOA 3ZFFC 1OFSA 1Q8OA 1QJY2 2GNDA 3K4AA 1RB8G 1UWWA 2VZ1A 4OHXA 1OLME 3SKJE 3VD9A 4XBLA 4DOUA 5CZKA 1UCXA 3QCWA 1VJ2A 5F7UA 1AX2A 3GBFA 3UT0A 1YJLA 2HWF2 1ZBA2 4W65A 3GZTB 5DAVA 1CGPA 1PO21 2ZGTA 3J9SA 4XQDA 4CP9A 3LZZA 3WQ0A 4TXWA 4QM9A 3N9MA 3T1LA 4CSWA 4FOWA 4HSJA 3AX4A 2WT0A 1AR71 2XLAA 3S6PA 1WWYA 1N47A 2JDZA 4G3YC 3ZO0B 3ZYBA 4NO4A 1BBT3 3IN9A 3VBSC 3AXEA 1LOFC 3AMNA 3VZOA 4OHWA 1AL23 5IJRA 4XUPA 1RUE3 2ZZQA 1W9YA 4YZ4A 1U12A 2E51A 5FZCA 3ROUA 2X10A 2RS13 3OOXA 3SXWA 3NV1A 4EWDA 3POWA 1H9WA 1NX9A 1AXKA 1CZTA 3M3IA 4NPMA 4NIIA 2JG9B 4D6SA 1IOAA 1ASJ2 5JI9A 1RUOA 2A3WA 1A8MA 4HT1T 1XU1A 5H9RA 5T50A 5F9TA 1PGSA 1QJFA 2Q0AA 3P3PA 4NRMA 2AACA 1X8MA 1JYXA 1J84A 2A6YA 1J58A 3T30A 1I5PA 4KG0A 5CFDC 1AUYA 2QQUA 1T6GC 3IMMA 4LLFA 3HWJA 3C7EA 3OY8A 2HWB2 1Y9MA 4Q2FA 1NXD1 4AR2A 3CJIC 4EN0A 1UU5A 5KHHA 2WZR2 4CEWB 5LK7B 1Y4WA 3AB0A 3OUHA 5FTTC 1VAMA 1DGRA 1FXZA 4OUSA 1AR61 4IGPA 4CU7A 2PTMA 2WFF1 1SLTA 2YBKA 2HEVF 3PVNA 3WXPA 5I0SA 5IVVA 2Y6HA 3HR9A 3ZXAC 4Z2AA 1UOJA 2P3IA 2YHJA 5FP9A 5FYYA 3K4DA 4Z82A 3HT2A 2MEV1 1KD7A 2P3YA 2WNEA 1WLCA 4LORA 3RNSA 4K21A 5KHIA 5LWBA 3HN3A 5FRAA 5A3LA 2QQJA 5I0UA 3CIHA 2QDRA 1DYKA 4LPLA 1GZCA 4RL7A 5HXMA 2Y33A 3U07A 1ZZBA 4QPWA 1TG7A 1E5HA 1QJZA 5KXBA 3TEXA 2VNRA 3ZFGB 4LK7A 1PZ7A 3M3OA 4WVMA 1HRI3 4UYBA 5FZ7A 5BNPA 2VO5A 4YGEA 2DDUA 2R062 3D0SA 1CAVA 2PHLA 4LKSA 1FX5A 1VBC3 1OMIA 2RM22 4JRLA 2PHFA 1XYOA 1Z7S2 3N35A 5FKBA 4A42A 4DY5A 5FLJA 4PDWA
chains in the Genus database with same CATH topology
1JYIA 1LRHA 3B3QE 3H7YA 5J98B 4YM2A 1PVC3 2IXJA 4DY3A 4ZU7A 2ZS6B 2LTNA 4Q4X3 1QJY1 3E6DA 1X7NA 3JQXA 1FATA 3ZXGA 1M4WA 1MZ6A 2HWF1 1LKNA 1MEC2 4IEOA 3RI9A 1LOAA 4Q0UA 1OQEA 3QD6A 1YI7A 5C8CA 1MQTB 4PCRA 1GZWB 1ZBE3 3GHNA 5KXCA 4IEYA 1V6KA 4XF9A 1J1TA 3J8F3 1MS5A 1MS1A 5FQ0B 4YVSC 3CL1A 4QQOA 4AFBA 4C1WA 4AVAA 1UF2C 1NLSA 1ENRA 2VQAA 1AJOA 1WBFA 4ATFA 4NR1A 2A6XA 4FPKA 4RS5A 4F7ZA 1CAUA 5D8AC 1PIV2 3KM5A 3NV3A 1CPMA 4LR4A 1XE7A 3RMYA 4OI4A 2DVDA 4Y1UA 4H14A 1REEA 2DUQA 2XWBB 4MX3A 3TNPB 5DZGA 3WD5A 4AHWA 2HWB1 5KXEA 3E97A 5T3NA 1BXHA 2VVFA 3D4KA 4I0WB 3I8TA 4GH4A 2DFBA 4LTAA 2DF7A 3QACA 4C91A 1RHI2 1RUH3 4I09A 2AGSA 1UU6A 3B7MA 5FPXA 2A73B 1QNWA 3WDWA 3VDDC 1CAWB 3THTA 5IK5A 1CAXA 3H1WA 2OUHA 3WZ1A 4BM8A 1DYPA 4LO5B 2AZ5A 4YARA 1I6XA 3NV2A 5BXXA 4GMP3 2OUJA 3IWZA 2R061 1QQP3 1VR3A 2XWJB 3LGRA 2ARBA 4XMAA 2ZHNA 5GLTA 3EQEA 1EPZA 4ES8A 1Z7S1 2K0GA 4CDXA 2V73A 1RJ8A 5D1IA 3FBYA 1GNHA 2XKOA 3SHRA 2VPVA 4XJAA 3FLTA 3ZYPA 3ZMOA 2Q1MA 4AVVA 5F6KA 5L7OC 1C28A 2CGOA 3IPVA 2X8KA 1HXS2 1FOD2 4ZU4A 1UIJA 1QJU2 1MEC1 2A3YA 1LU2A 4KH9A 2GC2A 3DPRC 3GF6A 1PGW2 3AP7A 4QPIC 3MIHA 3O14A 4X6RB 5DUVA 5C9AB 4R8HA 1NCRB 3H0OA 4HKWA 2C1FA 5AC91 2WNVC 4Y5Z0 3NW4A 4IQPA 4DPNA 2ZCWA 3FBMA 2GAUA 4IV1C 4YFWA 2DTWA 3KT4A 3KZ4C 2RS52 2OPKA 1BCXA 2EXIA 2I45A 3M2MA 1AR81 1C8NA 1UD1A 3DGTA 1AZDA 2RS33 4FPGA 4HBNA 2ET1A 1PIV1 2VVDA 2P34A 4YVWB 3ZN5A 3VL8A 5JR7B 1H2KA 4EWEA 2WSUA 3FUOA 2WS92 5CG9A 4XJZA 2W68A 3AYCA 4LE4A 2B8MA 3MDPA 3PHMA 3WDUA 2AREA 1OPMA 3DUIA 4NOTA 3POSA 2ZMNA 4EN9B 3AP9A 5T52A 3ZFFB 2NMOA 1UX6A 1OD5A 4Y1VA 5JOXA 1OHFA 1RHI1 4CEWA 2HWE1 1D0HA 3RI8A 5SV5A 1SCSA 2EXHA 1AR91 1YI9A 4NHLA 1ZM1A 4X8NA 4XHXA 3WCSA 1C1FA 1V6MA 1AX0A 4QQ2A 3TAYA 2VMIA 2D3SA 1GKBA 4F3JA 1D4M3 3MLLA 4KU7A 2QZ2A 4Q4V2 3VBSB 3FMGA 1DBNA 4JTNA 1XQNA 1ENXA 3EHKA 1N3QA 1Q5OA 1G9DA 3ZFGA 1C1LA 4M3CB 3V65A 3ZYIB 2FZ2A 2VG9A 2X29A 1AYN3 1KRIA 4QGLA 1RUG1 4BLJA 3I54A 4CDQC 1O3SA 1HXS1 1I5ZA 5CFDB 1QJU1 1VBA1 2SLIA 3R0RA 4YZ3A 1G9AA 4YFZA 5CBLA 4Z2WA 2H0VA 3CJIB 4IEPA 4PBPA 5I91A 3FWEA 4JGYC 4IERA 4EWAA 4QX5A 1CVNA 4K9SA 2CAUA 4LBKA 1RL3A 4Q27A 3ZIWA 1DQ2A 1TNRA 3WQ7A 3ZFEC 1MQTA 3SMHA 1GZWA 1U5ZA 2R071 3AK0A 2KA3A 2PHRA 3OGGA 2DU0A 3BB6A 4AEDC 3I59B 5JOZA 3I4IA 4B3NA 3LCPA 5FQ0A 5KC5A 3VKNA 2PLV3 2NP0A 4KU8A 4XXPA 4DNYA 2HWD3 2IXKA 4QXKA 1KFUL 3B00A 1KITA 1VAKA 1KQRA 2R16A 2GMMA 1RUD1 2Y26A 4IETA 1XU2A 1ZRDA 2FZ1A 2W39A 1RUI3 2HEYF 2Y38A 5JIUA 3JB8A 3VN4A 3AKPA 1VBD3 1JN2P 5JMCA 5EYYA 3VHRA 1KS4A 4P9GA 2DU1A 4IEZA 1RVF3 3ELNA 2ZHMA 2XJTA 1QOSA 1H30A 2ETEA 4H55A 1QXPA 3KCYA 4AI3A 5JDBA 3V0AB 4LHLA 5FDBA 1WCSA 1C8M3 1BVP1 4WVZA 1DGRN 4X8PA 4AGVA 2TEPA 4UBHA 3IKWA 4LA3A 4PF5A 4O9GA 4YVSB 1CAWA 2V5YA 4Q4V1 1EV12 3R6SA 4ISRA 4LBNA 1D4VB 4HSLA 3AP4A 3M3QA 2AR6A 1RJ7A 1C5HA 2SBAA 3AFKA 5D8AB 5C8WA 2CGNA 3ES4A 2Z2SB 3H9AA 3HBZA 5HCAA 3LA2A 2PA7A 3WUCA 4BYYA 3AMPA 4JTOA 1VBE1 3HMYA 4XETA 2V09A 2NLRA 1C5IA 4C0HA 1CIWA 2XBO3 1VBB2 1H8TC 3D0JA 4I30A 3H8UA 2XGXA 4LE3A 3RPQA 1N3OA 4XFGA 3FZ3A 3MW4A 5L19A 1AYM2 3BIWE 2FMYA 5JLVA 3WLUA 4AYUA 1WBLA 2DUOA 1HQLA 3MIFA 2XJVA 1BQPA 1VALA 5C9AA 4M0NA 3AZVA 3WHTA 1R1A2 4Q4Y2 3VDDB 1QMJA 3RSJA 2GN7A 3MW2A 3DF0A 1NG0A 1RMU3 1BJQA 4GMP0 4AK3A 4EJRA 1HRV2 4GB32 4CEYC 3EO6A 3OD0A 4LO8A 1V6IA 1X50A 1RC6A 4AVSA 4LUMA 1B09A 3ZYRA 3SNMA 4KWKA 3KGLA 4YVWA 4R9AA 1KS5A 2D43A 1VB2A 5F1RA 2DV9A 5L7OB 4K40A 2R6QA 3MZHA 1FV3A 2P3KA 5CB7A 3C3VA 3LWCA 4UW3A 1TME3 1LTEA 4DFSA 3DPRB 4CZSA 3GNEA 1QJX1 2ZMLA 2D6LX 5DDJ2 3ZFFA 2BGCA 1RINA 5JZGA 1YLLA 1ULDA 4XJ9A 1QXRA 2ZTNA 3OBRA 3VZLA 3AZYA 1SBDA 1V9U3 5SV8A 4BMBA 2OYZA 4KWJA 1HW5A 4IV1B 2D98A 3TB0A 1EV11 2BUKA 4XFIA 1F5FA 1AXYA 1IS3A 5BNQA 3J26N 4EV0A 4YGDA 1W39A 4I0BA 4XF0A 2DCKA 2RR13 4YGBA 4HKOA 4I02A 3N7LA 1ZRCA 1SBEA 3ZPYA 1POV3 5A33B 3VBSA 3E5QA 1LOFA 5C4WC 1LOGA 2VMHA 1VBC1 3ZXEA 3JU9A 4WM8C 4OZXA 4BQ1A 3AMHA 1VLNA 1GYKA 4LHNA 4U36A 4M3CA 1KJRA 2AH2A 3FX3A 2R043 4S2DA 4JDOA 4XFFA 5I0RA 3UKTA 4Q4X1 5T5OA 1OI6A 1ULFA 4QD2A 4INDA 5CFDA 4ASLA 5KHJA 4YM1A 4JRAA 5ACA2 1AR72 3ES1A 4Q8LA 1UKRA 2B45X 1AYM1 4D69A 5GLVA 2XJSA 1CX4A 3BCWA 1N3PA 4B4QA 4LT5A 1ZYBA 1UU4A 1VRH2 1R1A1 5BPXA 1AF9A 4MV2A 4Q4Y1 3H50A 1SBFA 2DVFA 4R52A 3SCGA 1NY72 3J8F1 3VBHC 3AKRA 4BIOA 1TMF2 5FMOL 1PGL1 3SITA 3O5SA 4AVBA 4Y1ZA 1NQDA 5FMOS 2VQ0A 1HRV1 3M70A 3PNAA 5FOJB 1WCKA 1COV3 2GN3A 4YW1A 2CWMA 1PHMA 2PHWA 1NE4A 1R093 1WW7A 1GBGA 1VP6A 2D7FA 4CDWA 3B94A 4ORFA 2ZX3A 2CTVA 4PLNA 1AR62 5FO7B 2WFF2 2XLGA 2ZGLA 4XE9A 2OIIA 4CDQB 3IDEA 1ZZ6A 1GANA 4WZCA 1REDA 2LUWA 5I8SA 1YFWA 1MVQA 4P9IA 5E16A 2FMDA 2HWC2 4IEUA 3WG1A 5DDJ1 3TN93 3ZSEA 4E4SA 4JGYB 2G9GA 4O9EA 1UAIA 4FXKB 2HEWF 1AL0G 1X8EA 4LBQB 4MGKE 5I0TA 4LHKA 1O3RA 2PHTA 1QF3A 2DFCA 2R30A 3M7AA 4Q1PA 3ZFEB 1NQJA 2IXHA 2ZGMA 2VUJA 4XF3A 5AFEA 1QU0A 3VBUB 3P3NA 5LEJA 3PMEA 4QGMA 1NLRA 4AEDB 3MEPA 1W2UA 1GSLA 1FNYA 4YVSA 1QQP1 2Z42A 4QGNA 5DG2A 3WDTA 2CY6A 4JVAA 2A70A 1MS9A 1CN1A 1FAYA 1ENQA 2OA2A 5BNOC 5BY5A 1FMD2 3WX5A 1O3QA 1IKPA 2C9AA 2Y0OA 1RUC1 3ZSKA 3VHNA 4IV3C 5ACA1 2YV8A 5JCTA 2LALA 4N7UA 3WG3A 2TNFA 4XXAA 1QOOA 4M0HA 2XKPA 1S2KA 4TZDA 1VRH1 1GR3A 4CP2A 5JIAA 4MH0E 2RMU3 1N1YA 4UW6A 1NY71 5L36A 1TMF1 4AW7A 2X53S 3OF1A 5HXVA 4AHZA 4YG0A 4LO6B 1NA1C 4TLFA 2VW2A 4U2AA 2TUNA 1RUNA 2YYOA 2GH2A 3VDDA 1HIXA 2D6OX 1CESA 3ILNA 5JOWA 1LR5A 3WT3A 1KJLA 1DGWX 5DG1A 2YZ4A 3CJXA 1N1VA 5BNNC 1O4YA 1O91A 4XQWA 3MLJA 2IWGB 5GJ6A 3WG4A 1C3HA 4GKYA 3ZVXA 4HN1A 2DVGA 2UY8A 5LRSA 1DQ0A 3WOGA 1A78A 3FLPA 2NPIA 3TYJA 2HWC1 1H8VA 1GV9A 4NPRA 1H8TB 5KBFA 5JSOA 2P3JA 4B7KA 3ZN4A 3MIGA 4I3PA 2GNTA 3PMSA 1UIKA 2WC2A 5CFCC 3U10A 3OJBA 4YW4A 4RD7A 1Z0HA 2ZPXA 3X29B 5KHKA 1WLTA 3J4UH 2PHXA 2G4IA 4IV1A 3NL1A 4AI0A 2DUPA 2QQPA 1YXWA 4MGIE 4CEYB 1WMDA 5K0UC 1MS8A 2JE7A 2JKBA 3TOJA 3VV1A 4RQPC 2OVUA 1SQ4A 1WMEA 1FMD1 1S0FA 1RUF2 2OZ6A 1LHWA 5A33A 3JCIA 3NKGA 4Q4W3 3LA7A 1MZEA 1F2NA 1RTVA 2NQYA 2PYTA 3OCPA 4ATEA 5AC92 5CVRA 4BHPA 1H4HA 2ZBJA 5BV6A 4BH9A 4RHV2 3JD73 4L92A 3ZXFA 1HV0A 2ENRA 4COYA 1QKQA 3WW2A 3K48A 2YROA 4P5HA 1RUJ2 5FLIA 5AFBA 1AR82 5GM0A 5JAXA 1S0BA 1PK6C 2I2SA 2XJQA 1JYCA 1OOPC 3FE5A 4WVWA 4MZUA 4FTEA 1FPN3 3VBRC 3ZXLA 2WLQA 1IHMA 4E4ZA 2NZ9A 2DTYA 3FHIB 3MLKA 1MACA 3VZNA 2YPJA 1POV0 2HWD1 3AYEA 3WCRA 4FPEA 2VNOA 5C33A 2XJRA 4XILA 4WM8B 2VOXA 2HWE2 1OLQA 1XNKA 3BU7A 5T54A 1G9BA 1AR92 3PTYA 4B4PA 4N53C 1LOBA 4D7SA 1RVF1 1A3KA 2YDEA 1IPJA 5ABJC 4FP2A 3AKSA 4M00A 3H1YA 3VHPA 4JGYA 4XYXA 1BK1A 4BZ4A 4LBQA 3A0KA 1J3QA 3VBHB 2ILMA 3WVJA 2ZZJA 3AKQA 1PO12 1V70A 4PIYA 3PVOA 3ZFEA 4JC1A 4QQHA 4QT6A 2PQQA 3VBUA 4HFSA 1RUG2 5EWSA 4M3CE 1I9RA 1JHNA 1EAH3 3VKLA 4AEDA 1LOEA 1VBA2 5AVPA 3K51A 3R05A 4K20A 1RUF1 4G9SB 1IS5A 3ZMNA 5IT6A 4Y22B 1FI2A 4RSUA 1YFUA 2WA3A 1YIFA 2O8QA 4AE2A 1BYHA 2D40A 5A32B 1MS4A 1DQ5A 3M3CA 1PO23 1W6QB 4RHV1 3B5LB 4JGZC 5CNAA 2R072 5J09A 4J1XA 4OI1A 4CDUC 5IK7A 1Q8SA 4XPVA 1AR73 1S0JA 2BTVC 2H6CA 1QH6A 2GC3A 1S0IA 1RUJ1 1VB4A 2XVKA 4KGQA 1ZVFA 3VLBB 4MVTA 3D5OA 2R0HA 3NAPC 3IMNA 2E9QA 4N9IA 4D7YA 2R49A 2P17A 2WFPA 3HIFA 3VZMA 4IEWA 3N4MA 3PVEA 2VOVA 1RUD2 3OYWB 3HN1A 3WP5A 2JG9A 4SLIA 1U5XA 4OULA 2ZGNA 3E5UA 1RMU1 3WW4A 1BKZA 4AG4A 2CWSA 2P2KA 3LKJA 2ZX1A 2MNGA 3SLIA 4BA6A 5BNOB 5J3UA 3ZSLA 1DGWA 4OHVA 1Q8QA 3T2TA 4BMEA 4C90A 1NCQC 3QH7A 2X5IC 2MEV3 4ONUA 2ZMKA 1UW8A 1BEV3 1YIPA 2A3XA 4IV3B 4GWNA 1TME1 4ZKTB 3JBG2 1URXA 1I1EA 3VKOA 3B9CA 2UWAA 4RS5C 1H8TA 3KCXA 3UKVA 4B7EA 4H7MA 4XOGA 1R083 4E2SA 4AHXA 2MHFA 3VZKA 1BZWA 1H9PA 3ETQA 3AM2A 1PO11 1UZZA 1ZREA 1YRZA 1A8DA 1IS4A 2IZWA 3LSDA 3USSA 1NA1B 4N7IA 3LB9A 2RR11 1LCLA 1VBE2 4LO7A 3MPPG 1QJY3 2VMGA 4QU2A 4PJYA 2ZGQA 3QBQA 3ECQA 5BNNB 4CEYA 1MZ5A 4PBOA 2HWF3 1SMVA 5C6CA 1ZBA3 3MGUA 2RJKA 1LHNA 1KFXL 2R1BA 1UN1A 2D3RA 2DYCA 2KXLA 4K1YA 1SLCA 1N1TA 4P14A 4J6GA 4AF9A 1LGCA 4GXLA 4Q8KA 1DU3D 3IT8A 5DUUA 3LA3A 2A7AA 3UV9A 4HANA 4AXOA 1GICA 1BBT2 2ZHKA 1S55A 1Y3TA 1AL22 1RUE2 2AYHA 1XYNA 5F5QA 2RS12 3G6JB 4W6YA 4KL1A 4COZA 4GQ7A 1UKGA 3UL2A 1ASJ3 4GIQA 5CFCB 1JUHA 2XJUA 2CYFA 2R0FA 1GZ9A 3UKNA 1EYBA 3OGJA 1TNFA 4Y4YA 5T5PA 3A0NA 2CNAA 3RZZA 1COV1 2ZGRA 2N7GA 2GNMA 2HWB3 4OLLA 2E53A 4Q0VA 4MXWB 1C57A 1R1ZA 4FXGB 1R091 3D8CA 2B39A 2WZR3 4S2GA 5K0UB 1WLDA 2BWCA 4HVOA 2XVLA 4RQPB 3NKTA 3ZN6B 5HI0A 3D6EA 1ZZ8A 2D3PA 5I8YA 1QJX2 2P37A 1REFA 3HT1A 3AYDA 3LAGA 4K3UA 5FBZA 4WM8A 2BNMA 4AQ6A 5EJ3A 3ZYGA 5GZFA 4CTEA 1S1AA 3JBG1 4R4ZA 1ZRRA 3VKFC 4L2NA 4P9JA 1ULGA 4AQ2A 3IBMA 1QNYA 4BOWA 2WWSA 3AYAA 4N43C 1ONAA 2R063 2WIIB 1HRI2 4KG8A 1PK6B 1MS3A 1ZNPA 4P9LA 2RM23 2IXLA 2EAKA 4XJ8A 4Q29A 3VBOC 1Z7S3 3INAA 1OOPB 1VBC2 5DUXA 4WV8A 4XIKA 1G86A 4GWMA 3VBHA 3QH6A 5TSWA 1GFF2 2Q30A 3VBRB 2JEMA 1PVC2 1ZZCA 2PAEA 3G7DA 4Q4X2 4R9DA 1QWRA 1J1LA 1MEC3 2XG3A 2W0XA 1SDWA 2YGLA 1YO8A 4LA2A 5JSRA 3IIAA 2ZA9A 1TQ5A 4Y22A 2B7YA 3S0MA 4UW5A 1NCRA 1CR7A 5A32A 3O12A 3NSTA 3QOPA 4N53B 3J8F2 3UK9A 3THPA 1W6QA 4Y20B 4FOVA 1ND3C 4WVVA 1PGL2 1BBT1 1D2SA 3N3HA 3PLQA 3HD8B 1AL21 2Y0IA 2DCZA 1RUE1 5ABJB 3SH3A 3L2HA 3R4DB 4FQZA 2RS11 4WBBA 5CG8A 4TYSA 1HDKA 4WZFA 3VKMA 2DCYA 4R9BA 3S7EA 4B4RA 1PIV3 5AVAA 2GALA 5GLWA 2MPFA 2XVGA 5T5LA 1OQ1A 3JQWA 3O0WA 1RGSA 3FFZA 1S0GA 3OBTA 4CP1A 1DQ6A 1MR5A 3TBDA 2DWRA 3C2UA 1YUDA 3MF9A 3OYWA 3NV4A 2BNOA 4HN0A 5J36A 3N36A 1AX1A 5FREA 3ACLA 1MVEA 3V0BB 3VZJA 3GZAA 3ENRA 5K9YA 1RHI3 4XTPA 1MQTC 4AQTA 5JPNB 1DLLA 2VU9A 1RUH2 2CV6A 2WNVB 5JVVA 5BNOA 2QZ3A 4BLIA 2JE9A 1QOTA 3W9AA 4JGZB 4YM0A 3MI8A 1Q8PA 3ZSJA 1NYWA 1K5MC 4CDUB 4KQ7A 2GC1A 4QPIB 4Z8BA 3WINE 1HRI1 3VBFC 1APNA 4XJWA 3NAPB 3BOPA 1QQP2 3TRSB 2B42B 2UY9A 3GBWA 3IM0A 1WD3A 1JXNA 4AWDA 5FFOC 1X82A 2WJSA 2YUEA 2E63A 4D94A 2B9UA 1PVC1 5FLHA 3RWNA 4FPJA 1HXS3 4L97A 1NA1A 1FOD3 1RUC2 3WR0A 1QJU3 2PHDA 3MIBA 1S0EA 3U4XA 2YC0A 2BEOA 3SCHA 4L8QA 3CJIA 2ZGSA 3AJYA 5BNNA 4QHBA 1ZBE1 2UYAA 1Z78A 2VUAA 4RGGA 3ILFA 5CA6A 3WDXA 2GC0A 2O1QA 2Q5TA 1NCQB 2X5IB 4F8AA 1GQGA 2RS53 2VNGA 1AXZA 1DIWA 5FO9B 3URFA 3DL3A 4HETA 1Y7BA 3SISA 3I59A 4Y1YA 4Q1RA 3ME2A 2RS32 1S2BA 3KCCA 4DXZA 3ST7A 5GKAC 1CD3G 2VGDA 1G7YA 2BVVA 4DMIA 1ZZ7A 2WZPP 2WS93 1RUD3 3AKTA 3NWKA 2KM2A 2WINB 3B9IA 2VXRA 4HZFA 5CFCA 4XBNA 2WQZC 1J3RA 4E2GA 4Z1VA 1QXJA 1LHVA 4ISQA 3MFCA 5GZDA 3R4UA 2PFWA 3E5XA 1LULA 4XFHA 1PZ8A 2GMEA 3LOIA 5K0UA 4FAGA 1RUH1 4LBOA 2DCTA 1BVVA 4RQPA 3AFGA 4I0AA 5LK5A 2QKDA 3ZN6A 1LJ7A 4KGGA 3V0AA 3NJZA 1CAXB 2HYKA 4E4DX 1SLIA 2AENA 1FV2A 4BIFA 2BWAA 4XFBA 2WNUC 4YLZA 5I93A 5LRRA 4N9HA 3M1HA 4GMP1 4Q4V3 5KWRA 2D5HA 3BOWA 3OPZA 4YG3A 4YRDA 4FAHA 3MW3A 1GQHA 4K1ZA 2QJVA 3WDVA 1B35C 5CAZA 3JUUA 4KBBA 4XZPA 5GZEA 1PK6A 1QDCA 3M3EA 5D8AA 1AYN2 2IXIA 4HK9A 1OOPA 4AGGA 1ULCA 3ZXKA 4QPGC 3VUOA 2A71A 4P9YA 3W59A 4XMIA 2CAVA 4OHZA 2VULA 3VBRA 3MYXA 5F6LB 1HX6A 1PZ9A 4L9BA 1X36A 1C4RA 2WLPA 3RMXA 5JZGC 2BFUS 5GALA 4XQ4A 1W6PB 3APBA 5E89A 1OA3A 5J37A 2EIGA 1OA4A 4EN7B 5KHGA 3RS6A 4LBLA 5J48A 2ZGPA 5FOBB 1I3HA 2QNKA 3H3ZA 3PJYA 4FP3A 4ITCA 3SH4A 4MGZE 4N53A 1IZ3A 4Y20A 3FLRA 3USUB 2PLV2 1OKQA 2RS31 4I01A 1DDLA 2A6ZA 4Z92B 4NHMA 4N43B 4AFMA 2HWD2 2D6NA 5ABJA 3N7MA 4AEKA 5GLUA 3MICA 4Y24A 1JH5A 4Y26A 1JTZX 1NE6A 3VBOB 2WSVA 4WM7C 4PIZA 1RUI2 2FBEA 3B69A 4ES9A 2ZAHA 4EN6B 3AZWA 1LB2A 3WV6A 2VVEA 1H1AA 2PAKA 5L7OA 1VBD2 4ZU5A 3GALA 4Z07A 2JENA 4FOQA 2F6BA 1RVF2 3D82A 4BE3A 4XF4A 4XFAA 5J7MA 3V0BA 2TBVA 1QGLA 1QJX3 3DPRA 3RYPA 4FTBA 2ZGUA 2E7QA 1CJPA 1N1SA 1C8M2 3MPBA 1H2MA 2VY0A 1BEV1 2WNVA 1XRUA 4MUVA 4GALA 4S2FA 1LESA 1D4M1 1ND3B 3EXUA 3WDYA 4JGZA 1EV13 4RR3C 4A3XA 5KC6A 1VAVA 1Q43A 4QM8A 3FC0A 3U0ZA 2DVAA 4CDUA 2D6PA 4CDWC 4RGAA 4QPIA 1R081 3GYDA 1AJKA 5H9SA 1PMIA 4FT8A 2D6MA 3MIDA 4PLOA 3N7KA 1FYUA 5GZGA 1V6NA 3NAPA 1QH7A 1BMV2 2ZKNA 2D6KA 1Q8VA 3E6BA 2D97A 4RA0A 5DZEA 1AYN1 4JDMA 4W6WA 2BVBA 4R4XA 4AFAA 3IDCB 5IK8A 5KXDA 4MYEA 5JWPA 1DZTA 1ND2C 1F8VA 1SFYA 4PIXA 3B93A 4YZ1A 1CONA 2UYBA 1J59A 1VBB3 5L73A 4AI1A 3ZSMA 2XBO2 4IL7A 3I7DA 4COUA 4FPYA 4AGRA 2Q1ZB 4SBVA 1JW6A 1AYM3 1ZBA1 3WW1A 2JD4A 4HLTA 1SACA 2JG8C 1NOVA 1LU1A 1R1A3 2GZWA 4HPKB 1G6NA 1G9CA 4FSJA 4Q4Y3 3VGIA 1XYPA 2Z69A 4A7KA 1SLBA 4DS0A 4P9WA 1NCQA 1K5MB 2X5IA 2PLV1 4K8FA 1RMU2 4AVCA 1HRV3 4GB33 4CYDA 4FPFA 4B29A 1G8WA 1M06G 3VBFB 1O4TA 5C4WB 1ASJ1 2GNBA 1RUI1 1YCIA 2XHKA 3L9JT 3V64A 3FJSA 1XNDA 2XL9A 1VBD1 1OFNA 4CDQA 4E2QA 4XDQA 2ZX4A 5JOYA 2WZR1 1HQWA 1TME2 3PVBB 3UJQA 4GKXA 3WUDA 4XTMA 4J1WA 4A7ZA 5DDJ3 1OSGA 2CL2A 3WP6A 1W0OA 1DQ4A 4M01A 5J96B 3N7JA 4MSVA 1C8M1 5H9PA 4FCAA 5DUWA 3W58A 1H1MA 1E57A 1YYNA 4AI8A 1V9U2 1LENA 1CPNA 5CU1A 3RYKA 2VOKA 2EAAA 4FQ4A 2RE9A 2ARXA 3ZXJA 1WW4A 2HJIA 3KT7A 1EPWA 4META 4AI2A 1WLWA 1Q3EA 5FCCA 3H7JA 2BPA2 1YFYA 4HL0A 2RR12 1BMV1 3M4FA 4BCUA 4UBGA 2RM21 4L99A 5BYNA 3ASIA 4X6QB 1J3PA 5B2GB 3CEWA 5E8AA 3RJRA 4YM3A 1O3TA 2EVXA 3POYA 2E6VA 2GU9A 2Z5WA 2R042 1YWKA 4A2UA 2XBO1 1RUC3 4GULA 2OW4A 5ACA3 1IKQA 4E9KA 3AMMA 1LODA 5BNPC 2ET7A 3BTAA 2BQPA 3LSEA 3S30A 3V56A 3KT1A 2GMPA 2Q4SA 5HBAA 3AZXA 2NM1A 1IS6A 1VRH3 1LEDA 1UL9A