3HD8B

Crystal structure of the triticum aestivum xylanase inhibitor-iia in complex with bacillus subtilis xylanase
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
184
structure length
184
Chain Sequence
b'STDYWQNWTDGGGIVNAVNGSGGNYSVNWSNTGNFVVGKGWTTGSPFRTINYNAGVWAPNGNGYLTLYGWTRSPLIEYYVVDSWGTYRPTGTYKGTVKSDGGTYDIYTTTRYNAPSIDGDRTTFTQYWSVRQSKRPTGSNATITFTNHVNAWKSHGMNLGSNWAYQVMATEGYQSSGSSNVTVW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Xylanase inhibitor
publication title Identification of structural determinants for inhibition strength and specificity of wheat xylanase inhibitors TAXI-IA and TAXI-IIA
pubmed doi rcsb
source organism Triticum aestivum
molecule tags Hydrolase inhibitor/hydrolase
total genus 48
structure length 184
sequence length 184
chains with identical sequence D
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2009-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00457 Glyco_hydro_11 Glycosyl hydrolases family 11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3hd8B00
1M4WA 3WQ7A 1TE1B 3VZNA 2DFBA 4HKOA 2C1FA 2F6BA 1OLRA 2NQYA 4XQ4A 2B45X 1HV1A 2VGDA 1QH7A 4S2DA 4S2GA 3MF6A 3LB9A 1HV0A 3VL8A 1PVXA 3WXPA 3WP4A 3VHPA 2DCZA 3AKRA 3WQ1A 2JEMA 1XNCA 3AMHA 2QZ3A 4S2HA 3AKQA 1H0BA 3WY6A 2B46X 2D97A 1W2UA 3AMNA 3VZKA 1OA2A 2NLRA 2BW8A 2VUJA 1H8VA 3MFAA 4HKLA 1XYNA 3AKTA 1BCXA 1C5IA 1XNDA 2VG9A 1H1AA 3VGIA 2JICA 2JENA 3WR0A 2VULA 1BK1A 2DCJA 1XXNA 5EJ3A 3RI9A 1AXKA 3AKSA 3LGRA 1OLQA 3AMMA 1REFA 1NLRA 1YNAA 1BVVA 3WX5A 1XNKA 3AKPA 5K9YA 3WP5A 1OA4A 5HXVA 1XYPA 5K7PA 2BVVA 3WT3A 2DCKA 4HK8A 3ZSEA 1REEA 1IGOA 4HK9A 1UKRA 3VZJA 1F5JA 1UU4A 1T6GC 2DFCA 1REDA 3O7OA 3WQ0A 3VL9A 3MFCA 4IXLA 3VLBB 1UU5A 1HIXA 4XPVA 2B42B 3MF9A 3M4FA 1QH6A 3AMPA 4HKWA 2BWAA 2D98A 3B7MA 4NPRA 3WP6A 1ENXA 3VZMA 3HD8B 1OA3A 3AMQA 3VHOA 1H4HA 2BWCA 1KS5A 3B5LB 3VZOA 3RI8A 1UU6A 3EXUA 2QZ2A 4H7MA 1KS4A 3VHNA 1XNBA 1H4GA 4S2FA 3WP3A 2DCYA 1XYOA 2Z79A 1C5HA 4XQDA 3VZLA 4XQWA
chains in the Genus database with same CATH superfamily
3HQXA 4IEUA 1JUIA 5FZHA 1RMU3 3PUIA 2HLEA 2KR2A 3GNEA 1ZA7A 1LHWA 2WWUA 3PLQA 3OGVA 4ITCA 4CPBA 3PUHA 4L0PA 5CZKA 2ATFA 5FZEA 4QKBA 2HH9A 2I74A 2VD7A 2WLPA 4LIVA 4LO7A 1EYBA 4LBJA 4YFWA 4AFCA 4D69A 3APBA 1LOFC 3E1F1 2IFWA 3SCGA 4AVVA 2W3JA 5T5OA 5C3QA 1JXNA 1X9PA 5FTTC 5FZ8A 3LCPA 4HVRA 4AG4A 4CTEA 2ZX1A 5ABJC 1GP5A 3H42B 1O5UA 3SITA 2ERFA 5FY9A 2B46X 2VW2A 3LPFA 2XR4A 3PTRB 2ZMKA 4OI4A 2Q1FA 1N3PA 4JGZC 3K46A 4D8MA 1E5SA 3RZGA 1CZTA 1W8WA 5LASA 1PX4A 2LUWA 4AI1A 4XUNA 3D82A 4DXRA 3HIFA 3IBMA 5JDBA 1I5PA 4RFRB 2E7QA 3AKTA 5EHDA 1O8PA 2GN7A 1QGLA 1RUG1 4GJYA 1PO23 2WBKA 3VGIA 1A6CA 1UYXA 4LNVA 2KM2A 3MLKA 3U1XA 1LKNA 3HPNA 1O4ZA 1QF3A 1JOBA 1SFNA 1U5IA 4QM9A 4U36A 2TEPA 1H6YA 1I6XA 4GMP1 2QQPA 3HT2A 2J1TA 4AFMA 4AGVA 1UMHA 1MZEA 3KCCA 3N4MA 2VMHA 4YG0A 4YW4A 1UOJA 3KCXA 3WDYA 4A7YA 4XF1A 2K46A 1H2KA 2DTYA 2XBO3 2WS91 4CUGA 2ZCWA 5LA1A 1AR73 3J7LA 1PM4A 4LITA 1GLHA 4XJAA 2ZGRA 4GQ7A 1GOHA 5ACA1 1AXYA 2OXBA 4B8EA 2ZHNA 3ES1A 2XJVA 2D6KA 2FZ1A 3MLLA 4AFBA 3V0BB 3GCWA 3O1SA 1VRBA 4U2AA 3B3QE 1FXZA 1I3HA 1YHFA 2ES3A 2HWD2 4YSFA 4R9AA 4BQXA 2XH6A 4FPCA 1K5MC 5GALA 4NIHA 4K40A 1WBFA 2R32A 2A6YA 1PIV2 3MIHA 5FZMA 4YW3A 1UU5A 2E6VA 4XPVA 4HPKA 5DAWA 5C4WC 5LA0A 4P9YA 3AYCA 2W94A 5IVEA 1GOFA 3S30A 1BEV2 3HN1A 3AMPA 3RGBA 4WZCA 4QX5A 3NNMA 3RYKA 1D4M1 1L7LA 4RGGA 4YYOA 1JZ6A 2XL9A 4N7UA 1FOD2 3KHCA 1UY0A 1SZBA 1VBB2 2FQPA 5GZCA 5C5TA 1I1EA 3M3EA 2W92A 3CMGA 2GMPA 1AL21 5T55A 3MO4A 2V09A 4KI5M 1QJU1 1V6NA 4D7TA 1NQDA 2QJVA 5A3PA 2R071 3H8RA 3O1OA 1RUG3 1W0PA 3NRUA 1LGBA 1MZFA 1WA4A 1XB9A 1J84A 3R0RA 1C5HA 4E9KA 1UMIA 5J96B 3D0SA 4P14A 4TSVA 1IS4A 3Q8FA 1DG6A 3DL3A 1ZZ7A 4GMP3 1TE1B 4O65A 4CDUA 5KXCA 2JDAA 1YI7A 4JQRA 5D8AA 3ENRA 4A44A 2C1FA 2F6BA 5FWEA 4GIQA 1Y43B 1IS5A 1MPXA 5DABA 1AJOA 2JDPA 3N7KA 1QJY1 3RRDA 4NHKA 2DVFA 1QNWA 4V1PA 1RVF1 4CDWB 4QXKA 4Q8KA 3VDAA 5H9QA 3O1VA 2VBDA 4E8DA 2WS93 3EYPA 3WQ1A 2DTWA 2XJSA 5DZEA 3H8XA 3PMEA 1O3RA 3EJKA 4WVWA 1GBGA 1SLLA 2OKXA 4XF3A 4B3NA 4YW5A 5ACA3 3LA2A 1K3IA 3TNPB 3WNXA 5IK4A 3M3QA 1KXGA 4FFIA 1AF9A 4XXAA 4QHOA 1WGPA 1RUC1 1ZVFA 1BMV2 4GWMA 2YB7A 3CZUA 4AI2A 4PBPA 4OI2A 4CDQB 2PAKA 1RUH2 2BUKA 4NHMA 2WABA 4HSLA 1H8VA 2EXKA 2WNUB 5IVFA 2IVIB 4P9JA 3UGHA 1OOPC 4B7EA 3GZAA 4CP2A 3M1HA 3OYWB 3IB3A 3OG2A 4EN0A 5C70A 3I3QA 4UOJA 5FJHA 2DUPA 5C9AC 1D4M3 3OD4A 2FDHA 1G6NA 2WO1A 3OJBA 1DYKA 4P5HA 5BV6A 5J7MA 3MPPG 1UOGA 3K51A 2A5ZA 1GOGA 1WCKA 3K2OA 5LEKA 4XMAA 2XJUA 1AL23 4R52A 1NAEA 3CQOA 4LO6B 4Z2WA 1QJU3 3ECQA 4Q4W1 3WQBA 2R073 1MEC1 4IEZA 3WG3A 1G86A 2VJXA 5FYCA 5F5AA 2VPVA 1FYUA 2PHTA 3FUQA 5C8CB 5I0DA 1UZ0A 3RNSA 3I2HA 4UFIA 3A0KA 4QX2A 4R9CA 4CVUA 1ND2B 1ODMA 3I2KA 1XSQA 1C1FA 5IAVA 4YZ3A 1JYWA 3KQRA 1LU2A 2GNTA 1UY3A 2YU1A 1SBDA 1OVPA 2ET1A 2ZGSA 3AZZA 1UKRA 1JW6A 1YFWA 4SLIA 4Y5TA 3CLPA 4Z82A 2DWRA 1CAXB 2WC2A 3I2GA 1QJY3 4XFCA 2XLFA 2BFUL 5B2GB 1RVF3 3LEMA 5JXGA 1NT0A 3Q8EA 3UJOA 1H2NA 2OT7A 3T1MA 1NKGA 3M4FA 4QPGA 1SACA 2AEYA 3JZVA 1QH6A 4OHVA 2BGPA 1SLBA 3T0AA 5CADA 5JPNB 2BWAA 1STMA 1NXD1 4COUA 2BV4A 3PVOA 4EN9B 4LTAA 4TWTA 4Q4Y1 1QXRA 1W9SA 4X8NA 1DU3D 5FZ7A 2YBKA 1JZ4A 1MQTB 1RUC3 4X6QB 1W9YA 3VZOA 3VBUB 1C28A 3N9PA 4LBQA 3O1UA 2ZEXA 3DF0A 3V0AB 2J7MA 5FUPA 1POQA 2ILMA 3AZXA 1QDOA 1DF0A 1XE0A 1YFUA 3O0VA 2PMWB 3ZYGA 1UWWA 5BYNA 5J48A 4AQSA 3KLSA 3O1TA 2FD8A 2XUMA 2RJKA 4NIGA 5DAVA 4XETA 5LZ6A 1G9BA 4G9SB 1HQLA 2R061 1LOGA 1X8EA 4KBZA 2IXCA 3HVDA 5AVAA 1WMDA 2NQYA 2B45X 2UU8A 4NAOA 4Q4W3 4C8DA 1MEC3 4C91A 1VLNA 5BNPB 4A41A 4BYYA 1IQDC 2WO3A 5IVCA 4YW6A 3T09A 4Z8BA 2FDFA 3NJVA 4RYDA 5J1XA 4NROA 5GZGA 2XPJA 4LOSA 4ONUA 4CZSA 1ZRCA 4GWJA 3K4ZA 3WG2A 1UCXA 4AZZA 1GWLA 3NSTA 5EZWA 5HCHA 2FMYA 3KWVA 4F3JA 1G9AA 1GWMA 2HWD1 3U0ZA 2J1UA 4Q29A 4BQ4A 2R0HA 3QH7A 3C2UA 4D0QA 1ENSA 2WKKA 3OB8A 4NMIA 2VCMA 5FZLA 3SEPA 2PELA 2ET7A 1PIV1 2VMDA 3PDQA 4QHBA 1NY72 4UF0A 3OD0A 4AF9A 2C24A 5ABJB 4DEQA 5FP7A 2JDUA 3O0WA 1AYM1 1BEV1 1VMFA 4XHBA 1O3TA 5JXJA 1Q5OA 2MEV1 4MADA 4ES9A 1HLCA 5C3PA 1AUYA 1U5XA 4NRMA 5BNOA 5JMCA 4IE5A 1UW8A 2VVEA 4Q4Y3 3FFQA 4QKDA 2W1UA 1NA1A 1W39A 4JGZB 4FTSA 1JMUB 1ULGA 1J58A 4FOWA 2VZRA 4HFSA 3J7MA 5L19A 5DXDA 1QIQA 1JZ5A 2CDPA 2CNAA 3CIHA 2FCTA 4MV2A 5FQ0A 2UY9A 4JTNA 3MDPA 3T2PA 1CJDA 4JGYA 2Y33A 2GAUA 4QQPA 4YVSA 5FZ3A 3O0XA 4CCKA 1SPPB 2Y38A 3K3NA 1HKDA 2V73A 1VBC2 4P02B 2R063 2YUEA 3KM5A 2D6LX 3E5UA 5H9SA 4M3CB 4CDUC 4WZFA 1A8MA 1ZBA2 2I2SA 4DMIA 1AR62 2ZHMA 2BFUS 3FMGA 1Q8QA 1R1ZA 2X5IA 2XKPA 2SLIA 4XEZA 4W4ZA 5FDBA 1G8WA 2F4LA 3U4XA 1WW7A 1N1YA 1VIWB 4AEMA 5GLZA 1PO12 1N1VA 2D44A 3JQWA 1OC1A 3DXTA 3FWEA 3ZR5A 4PT6A 1S0GA 1QWRA 5F9TA 4N90A 1FI2A 5FZ6A 3B7MA 4KU8A 4XCBA 3BIWE 1UXXX 1ENXA 3RSJA 5B4NA 1UZWA 3MIFA 2HWD3 1SHWB 3U10A 4JX0A 5FKBA 5FY1A 2BWCA 4DXSA 1K5MB 1XNTA 1AYN2 2JG9A 1RUH1 4XURA 2RV9A 1OQDA 3IDEA 3GZEA 1PIV3 2YPJA 2DVBA 1AJKA 1LULA 2JDYA 3MUZ1 5C4WB 2QQWA 5K0UA 2QQIA 1AYM3 1BEV3 1LU1A 4BJ0A 2MEV3 3I3BA 5D1IA 1Q43A 2DBNA 5FXXA 4AHXA 4IL7A 1C57A 2WZ8A 3ZN4A 1V6KA 2JE9A 5FYBA 4P08A 4CXXA 2VO5A 2IC1A 4Y3OA 4BDVB 2RDNA 1MS0A 3KF3A 1SFYA 4YGEA 4ZKTB 4FQZA 2XB6C 1O5LA 2SBAA 4LLOA 4DXZA 1MS9A 4R8HA 4LPLA 4XF4A 3VHPA 1JI6A 2GSYA 5BY5A 2DCZA 1D2QA 3OY8A 1E5IA 2QZ3A 4OMCA 3AZWA 5DDJ1 4CCNA 3UJQA 4PJYA 5FZFA 4L99A 2H0VA 4NE9A 3P5BA 5DZGA 4B7KA 4E4HA 3PUAA 2VR4A 5LW9A 5AFEA 1D4VB 2XHKA 4LBNA 4WVMA 1LESA 4Y1YA 2P4EA 1P8JA 1UAIA 1C1LA 4ISQA 5LRRA 1VB4A 1E57A 5CISA 1BJQA 2ZHLA 2Z42A 3N9OA 2YGLA 3T2TA 3OBTA 4C90A 5TSWA 1GMMA 4JAAA 3T0BA 1LECA 2A6VA 2YBPA 3PVNA 4L11A 3DYPA 4R9BA 4CU6A 3FC0A 4QPGC 3ITQA 1W2NA 2AYHA 2WJSA 3EHKA 2A6WA 3S7IA 1RIRA 1YFYA 3FL7A 1QOTA 4FFGA 1PGL2 2C26A 3AKSA 2WZR2 4OYUA 1RUH3 5EJZB 2Y34A 3NW4A 1NLRA 4J25A 1SG3A 3NNJA 2GNMA 5DAQA 5FAXA 4MLOA 1OOPB 1TNRA 1W6QA 2NMOA 3O14A 4LIUA 5DAXA 1ZNPA 3WP5A 4AL9A 4DRVA 1DZQA 5DQ0A 5A3TA 2ORZA 5C9AB 1X7NA 3OBRA 4LHKA 4QMAA 4E2QA 3WINE 5EWSA 3RFRA 5HV0A 5KWRA 1JU4A 4MYEA 3JU9A 3N7LA 5HPOA 1PMIA 2BGOA 3ZLIA 3UGGA 4BA6A 4NRPA 3PVBB 4OI1A 5GLVA 2QQVA 3TYJA 2GC3A 5L9BA 1H1MA 1JUHA 5JAXA 4Q27A 3MFCA 2J22A 1O4YA 2EIGA 4CUBA 2BOIA 4IERA 4AGRA 5DDJ3 2ZGNA 3IDCB 1J3RA 3H1YA 5D21A 2GMMA 2D3PA 1HQNA 5FOBB 3RZHA 2WAOA 3VZMA 5FZOA 3NQHA 1FNYA 2IXKA 1W8HA 2ARAA 3MPBA 4NWWA 3NKGA 4CUAA 4B1MA 4D6SA 2WN2A 2VC9A 3CHXA 4UFKA 4CU7A 3GBFA 4H7MA 1KS4A 3ZR6A 2R1DA 5FZ0A 3MIBA 2W1WA 1GNYA 1C4RA 5GZFA 4ZZ5A 3ZO0B 5GKAC 5FYIA 2CGNA 4AHWA 2LM3A 2D6MA 1UKGA 4KGQA 1ZX5A 4KG0A 5GLWA 2QNKA 2QQNA 5BNOC 4IQPA 3R4SA 4XFBA 5H9PA 5JSOA 4XFIA 4I09A 4QWNA 3MUY1 3O1PA 1NA1C 5FZCA 4F83A 2TNFA 1XPWA 4Q1RA 3IIAA 1W8ZA 3ZOIA 2HWC2 2WT1A 3OPZA 4LHNA 1QOSA 3MV01 4UYBA 5JR2A 2X53S 3ZPYA 1OD5A 1DCSA 3PUQA 4S2HA 2RMU2 2GH8A 2E63A 4LQRA 4AAXA 1FPN2 4YARA 4I2OA 1U0AA 2YPDA 4JGYC 1Q56A 2QQOA 1VBC1 2Q8OA 1RHI2 4XJZA 1YJLA 2YC2A 3AMNA 3NVCA 4LR4A 2BYVE 2OX0A 3WF2A 3W9AA 4CCLA 5T52A 4XJ8A 1ZBA1 2GH2A 2G9ZA 2IUWA 1AR61 3ZXFA 5FO9B 2R6QA 1JYIA 3ZKUA 3FLRA 1KFXL 2JE8A 1FV3A 1K5JA 4IW3A 5E6HA 2X5IC 1OD3A 3KV4A 4WM7A 5A6XA 1UIJA 5C7GA 4H14A 1F4AA 4OHXA 4XFGA 3LFIA 5FUIA 3BI3A 1O8SA 1SLCA 4Y5SA 4GAZA 1GANA 3LSEA 4LBOA 2IWGB 4HL0A 4Y1UA 3JXSA 5J09A 3KZ4C 5A3OA 3CO2A 2UYAA 1UNBA 3VD3A 3OOXA 3FHQA 2JG9C 2XL7A 4UBGA 1L7QA 4AVAA 1UX7A 1IKPA 5LRSA 2IXHA 3LA7A 1LOEA 4XFHA 3WX5A 1XNAA 1GQGA 4AI0A 2HEYF 2BBAA 2UYBA 5FFOC 2A1XA 3LAGA 1LENA 2DYCA 3IZOA 4HOOA 4BCUA 4BZ4A 5K0UC 5K7PA 4YG3A 4JHZA 3BYWA 5F5QA 2RS11 2BU9A 4MH0E 1U12A 2X05A 1WW4A 2VZPA 1IGOA 1HJFA 1XE7A 2G19A 4N8MA 4UBHA 2PHDA 3BN6A 5IVYA 3ZKYA 4N53C 2VXRA 1KITA 1DQ4A 4KL1A 3EB7A 4ARXA 4FFHA 4OHWA 3GHNA 4OUMA 4LKFA 4DQAA 2ZOEB 4QX3A 3I2FA 1POV0 1CX4A 4P9XA 1MZ5A 5A3LA 1BBT2 4CP9B 1OQ1A 1LHNA 4RA0A 1EPWA 2WAAA 2VCAA 5A3WA 5IUQA 4CEYA 1IQAA 3LKJA 3VBHA 3VBRA 1VBC3 2ZGMA 4QKFA 4NIIA 4LE3A 4E27A 3HD8B 2WNVA 4PCRA 2V4AA 1OA3A 4M3CF 3ACFA 1HB3A 3I8TA 3VHOA 2BPA2 3S6PA 4CDUB 2UWAA 2MNGA 1W06A 2KA3A 3L9JT 4GH4A 1ZBA3 3ATGA 1O6UA 1AR63 4GB32 2BNOA 4R4ZA 4TTGA 4KH9A 3H7YA 2JDZA 2EA7A 1BHGA 2R1BA 2VZQA 4LHSA 3ROUA 2VCCA 2WNOA 5I8YA 1DZRA 1H2LA 1UQXA 2A70A 2G9FA 1Q8PA 1ZZ8A 3A23A 3BGAA 2DCYA 2QFEA 2W5FA 3BU0A 2NM1A 5FIXA 4ZU5A 1S1AA 2E33A 3VUOA 2P6HA 4A7KA 5FLJA 3E6DA 1PGL1 3VZNA 1NCRA 1DYOA 2FBEA 4BQ5A 3X29B 2YMZA 4S2DA 5KHKA 1TNFA 5FPUA 3MF6A 2CGOA 1HV0A 1J3QA 1SDDB 4HANA 3JBG2 3MIDA 3WDUA 1W6PA 1DGRA 1O7FA 1WW6A 2ZAAA 3AKRA 4FPEA 2EIDA 3HQRA 4QPWA 2XUEA 4A6OA 1H0BA 1KDKA 4AVTA 2RS13 2D97A 1S0JA 4AQTA 1HB4A 3H9AA 2CAUA 5F6LB 4XF0A 1C3HA 3ME2A 1PHMA 4LUKA 2RS32 4YZ4A 1GNZA 5A80A 4H2AA 2X8KA 3NMBA 3IM0A 5FPBA 2XVGA 3CJIA 3LDKA 2LROA 2A3XA 5DN2A 3WW4A 4YG6A 3KQ4B 3C3VA 2YY1A 3DYOA 4QGNA 4ZU4A 5FO7B 3ZFEA 1WMFA 1RUI1 2D7FA 1TMF2 2D3SA 4K8FA 4KWLA 2JENA 3FHIB 1MS3A 2Y6JA 1BLZA 2VMFA 2JB8A 1QQP2 3POEA 3W59A 5I8TA 5EJ3A 5FYHA 2EAAA 1YI9A 3UKTA 4DFSA 2YBSA 4JDNA 3O12A 4UFMA 1GZTA 1YNAA 2FDJA 1DYPA 5CIRA 3IPVA 4XBLA 1Q8OA 5FYMA 5K8SA 1V6OA 3I2OA 4QPGB 1GUIA 5JLVA 3D8CA 3HAGA 4CP0A 1IHMA 4IE6A 1QJZA 4IV3C 1N3QA 4PLNA 3ACHA 4J1XA 1E5HA 4YLZA 5A1LA 3VB9A 1XU1A 4JTOA 4XILA 5FPLA 4ZZ8A 1K12A 4KQ7A 1VRH2 2PQQA 3N36A 3NNLA 1HN1A 1SBEA 2HWC1 3P1IA 4LBQB 4FPLA 4PDWA 1RITA 3GCXA 4N43A 4H55A 4UW6A 4QQHA 2Y0IA 4DNYA 1BVP1 4IEOA 2WWJA 4RR3A 1FPN1 3CJXA 3OGRA 4PIYA 2FDIA 3WD5A 1GNHA 1QHDA 2NYYA 1KDMA 1YC61 4LT5A 4FP3A 4BQ2A 3U4SA 2P3YA 5F37A 2VXJA 1UN1A 1JHNA 1PVC2 4P9WA 3AXDA 4UT5A 1ACCA 2OZ6A 3MZHA 3LSDA 5KHJA 1OT5A 1YQ8A 3W58A 2IVJA 2X09A 3N9QA 3GZUC 2ZGUA 1LOCA 4JC1A 4XACA 1JYNA 4LK6A 2K9ZA 1RUI3 4GMP0 1WBLA 5C8WA 4UFLA 4WM7C 4XIOA 4Y20A 1FNZA 4RL7A 4GULA 2BBVA 1ZYBA 5JCTA 1PNFA 2D6PA 3AZYA 3OUHA 4H7LA 2GMEA 3F2ZA 4OVEA 3V56A 1KJLA 3AP7A 3PIGA 3KMHA 3DXUA 1BK0A 1UD1A 3AFKA 3P6BA 1HV1A 4K8RB 2UWBA 2VGDA 1JN2P 3U07A 4OUEA 4XIKA 5T5JA 4XBNA 1RUE2 1RYYA 4FQ4A 1URXA 1X8MA 4DUWA 3VL8A 1CAUA 3MGUA 4YNIA 4BK4A 1JZ7A 4UF0B 4EJRA 2RS52 4OCTA 3S5QA 1Z78A 3QD6A 4MO3M 4GJZA 4A45A 2D5HA 4MGSA 1COV1 1QU0A 2OZJA 5BNOB 1W03A 4JV4A 1RUOA 3M3CA 2J1AA 5T5PA 3RWNA 2O0OA 2VE1A 4UWDA 4FPHA 4AEDA 1NA1B 3H0OA 4LKEA 5LK5A 5DG2A 3T1LA 3KGZA 2WZPP 1ZBE2 4CU9A 5EIYB 2HWC3 2VUJA 1W3XA 4B4QA 3T4HB 1RGSA 2RDSA 2PHUA 3AJZA 3EQEA 2WZEA 1BBT1 1RJ7A 2O14A 1L3JA 2YDEA 1FPN3 3J8F1 2DVDA 4JGYB 3ZYHA 3SH3A 3C7FA 2LALA 1ALYA 4K3UA 2UWCA 4META 4YGCA 3HBKA 4CEYC 1O3SA 2XWJB 3HWJA 4PLMA 3RI9A 3VBHC 3VBRC 5FBZA 5IFPA 2WNVC 4GB31 3ILNA 2Q1ZB 2W2IA 4YW2A 4AGGA 3GZTB 4GH4C 4URTA 2X5IB 2AZ5A 4Y1ZA 3PU3A 2YGMA 1GWKA 3D5OA 2XJPA 4I02A 1OA4A 1YIFA 2ZX0A 3INAA 5LB6A 1BYHA 1ZA4A 2DUOA 3LEIA 4AFAA 1GQHA 3WT3A 4IEQA 2QQMA 3AYAA 2XLAA 2A6XA 3MW4A 1GQPA 1OFSA 4FPFA 4O9EA 1J1TA 3WDTA 3TEYA 3WV6A 4ORFA 3BPZA 5DUVA 2Y60A 3N9MA 2DFCA 1NCRC 2AACA 2JG9B 5CU1A 3ST7A 3SISA 3HBZA 3MYXA 4TLGA 4XE9A 4CP1A 1OURA 4M3CE 1EAH1 4WVZA 3SH4A 1C8M1 2VTXA 1HIXA 3CZJA 3VDDA 5K0UB 1LCLA 4E2SA 5E89A 2PAMA 4M0HA 3WLUA 5FYVA 3NNGA 5I8SA 1ULDA 1W0NA 2WWSA 4QXHA 4YRDA 1COV3 4BOWA 1S0CA 3LF7A 3TB0A 3ZYRA 2RS31 4OUSA 1B09A 1Y4WA 2DURA 3WSOA 3UETA 5J36A 3ZYPA 4N53B 3SHRA 1DQ1A 1KS5A 2FCVA 4QPIC 4K1ZA 2BERA 5FZDA 1OKQA 1SFPA 4CEWA 4A7ZA 3BB6A 3NAPA 2W95A 3CJIC 5EYYA 2KXLA 2VZTA 2B9UA 1BBT3 1U5ZA 3KCYA 1NE4A 1TMF1 2P34A 4WM8A 3J8F3 1CZVA 2J1VA 2PAEA 1W3VA 3OY8B 3ZFEC 2Y64A 2GNBA 3POSA 1ONAA 1VBE2 5I93A 2P1BA 4LE4A 3THCA 3A21A 4M4RA 4WVMB 3CF6E 1WKYA 4IEVA 3RJRA 4CXWA 4GB33 4ES8A 3ORJA 4Y4YA 3GGLA 1OF4A 3Q8AA 5FZGA 5I0TA 4BQWA 4FBFA 1D0GA 2NN8A 2WL1A 4YPJA 4TYSA 3I2JA 1I9RA 2JEMA 3VBFA 3IDAA 1VB2A 1F9KA 3GHMA 3AKQA 3TBDA 3WNPA 3J7NA 4MVTA 1CIWA 1UPSA 4RFT0 1PK6A 2BOJA 3AK0A 2GALA 1WUVA 2XONA 2QQLA 4COZA 1ZREA 1GZCA 4BXFA 1VRH1 2WQ8A 4O7XA 4PBOA 4NUBA 1US2A 1G7YA 1VPHA 2VBBA 3USSA 2Q4SA 5CKQA 2NMNA 3OF1A 4FXGB 1EAH3 4DRRA 1C8M3 3BPSA 1ZRIA 4D6QA 3W21A 3KT7A 3LA3A 1W6QB 2VMCA 4PDWC 1RL3A 4N43C 4I0WB 4XFFA 3AXEA 1JH5A 5DUUA 1NCQA 1UF2C 3FLPA 5GM0A 1VBD2 5FREA 2IZWA 3B02A 4LKSA 4QU1A 4RR3C 1DGLA 3M8LA 5LATA 4V2VA 4K9SA 2RS33 4XF9A 5EXOA 1PVC1 5FY8A 4MGKE 4MUVA 3TEXA 1A8DA 1JU3A 3E6BA 4HZFA 1W28A 2C0ZA 5FCCA 3Q9OA 4IDZA 4JQTA 3W20A 2HWE2 1H8TA 5FZ1A 3TAYA 3D3AA 3UT0A 3ZFGA 4HBNA 2XVKA 4QD2A 4RSUA 3SQOA 3AKPA 1SCRA 1ODNA 1TMF3 4Y1VA 3V0BA 4EV0A 4P9LA 1JODA 2VOTA 3GXUA 3T2OA 3SCHA 1JTZX 2WSUA 2E7AA 1QJEA 4BHPA 1V6LA 3AZVA 3R4UA 5FJKA 4COYA 3FUOA 3NV3A 4QGLA 3WG4A 5KR7A 2VZVA 2ZX4A 2ZBJA 2P37A 5FZOB 2RJLA 2VU9A 3KV5A 3AC0A 4NAMA 2ORXA 5FLHA 1VALA 3ZSKA 2ZPXA 2CWSA 4R4XA 4O9GA 3I2DA 3E5QA 3ZFFA 1FOD1 1RUE1 1RTVA 1UYZA 2P2KA 1DHKB 1VBB1 2ZGTA 3GF6A 3CL1A 4LA3A 4XW3A 5JI9A 3ZPOA 5C33A 3MI8A 3FN9A 1VBA2 1CR7A 4MGQA 5B4XA 2RS51 3T08A 4B4PA 3DKQA 4Y5Z0 3J7HA 1TQ5A 2ZEYA 1KD7A 3CBNA 4IV3B 4QAWA 1WLDA 4L8QA 4UW4A 3WNMA 2PA7A 3R05A 3UK9A 4RQPA 1TME2 4AVCA 3AMQA 1F15A 5A3NA 1VRH3 2E31A 1MS1A 2E51A 1FV2A 1GICA 4AEDC 1HN0A 4JDOA 3AP9A 1RXFA 2W52A 2ZKLA 3EXUA 2WT2A 2XG3A 2VUCA 1CVNA 4DINB 3J9SA 4KMQA 3U75A 2WT0A 2JB4A 2RG4A 3P3NA 1WLWA 3E5XA 2O8OA 5D8AC 4PF5A 3THDA 4QXCA 2TUNA 4LKDA 4DS0A 4LHLA 4DY5A 1IZ3A 1G9FA 4DUVA 1SLTA 3RS6A 2R042 2ADDA 3ZVXA 2HEVF 4IV1A 3WF1A 4AK3A 3BKZA 4HVOA 4PF1A 4MGYE 4M0NA 5CAZA 3FE5A 1PVC3 3S57A 2JD4A 4QKNA 1OQEA 1OUSA 2A6ZA 4HVQA 1QH7A 2VZOA 2WQ4A 5FZ9A 2PHFA 4LORA 1BMV1 1QJX2 1LAJA 1X82A 4AI3A 1LRHA 3LD8A 4DIQA 4CCJA 2LW8A 1DIWA 5A33B 4WM7B 2VOVA 3AMHA 4LA2A 3VKOA 4XFAA 3ZXLA 4FPJA 3VKNA 5F3CA 1RB8G 2MHFA 2CYFA 1YRZA 3IIIA 3J4UH 3KVBA 5F39A 4CE8A 1FAYA 4Y1XA 1LTEA 4GZ9A 2CL2A 1QXPA 2VUAA 1FOD3 1RUE3 3K75B 4Q0VA 1VBB3 1TVGA 1GU3A 4BB3A 4PQ9A 5IAXA 3WOGA 3TEZA 2C4XA 2HWB2 4AWDA 2VM9A 2RS53 2W9XA 1S0EA 1US3A 1CPNA 1EV12 1LR5A 1XNDA 4EWEA 5JUVA 2P3JA 4M01A 1QKQA 4OLLA 3VDDC 3K4DA 4B29A 2VULA 1XXNA 2DVGA 4LJHA 4OFGA 5IVJA 1CWPA 2BEOA 4HXCA 3H50A 3HNYM 4W6YA 1TG7A 5DZFA 5GLUA 1UX6A 1W2OA 1Z7S2 1REFA 1VAMA 2PLV2 4DPNA 4CEWC 1XNKA 4CCDA 3C7OA 2Q5TA 3NAPC 2B9VA 4Q4X2 2HBUA 1KGYA 2N7GA 2H0BA 4WM8C 5HXMA 1JHJA 1D2SA 4IGOA 4K6BA 4CEYB 1BQPA 1D0HA 3VBRB 3VBHB 5F5IA 4HK9A 2Y6LA 5F1RA 2WO2A 2WNVB 1UMZA 3MEPA 2OW4A 3VZJA 2V5DA 2YZ4A 1F5JA 4HN1A 4ZXEA 4GH4B 1M06G 1X36A 1ZZCA 3VKMA 2BNMA 1VR3A 2YU2A 3P3PA 1HRI2 3MF9A 3VD4A 3RVHA 1IG0A 4GA9A 1HJGA 1W6MA 4FOYA 1DGWX 3VBFC 3WG1A 4QXBA 3POFA 2D98A 2WA3A 4NPRA 1S0DA 1Y9MA 1YWKA 2WYSA 4MZUA 2QDNA 4A42A 4TZDA 3DEMA 1PK6C 1H4HA 1ZZBA 3WVJA 3UV9A 5JIAA 1NCRB 1PZ8A 3NJZA 4H3WA 1N3OA 1OLME 3RI8A 4XUPA 2QCSB 1HQWA 4NJ4A 1PO22 3ZN5A 4NHYA 1K42A 4HONA 5HI0A 4ISRA 4P00B 4ASMB 4ASKA 4Q0SA 1H4GA 2GDFA 2AENA 4IGQA 3M2MA 1AVBA 1W6PB 4C0BA 3VKLA 1UO9A 5FXVA 2PXJA 5DUWA 4QGMA 2HBTA 3KVAA 5CFDA 3V64A 5J37A 1LOAA 1QMJA 1NCQC 5EYXA 5FPXA 4Q5OA 3ZMOA 1BXHA 1M4WA 2Z5WA 5JMOA 1S2EA 4ZXKA 4YWAA 1ZM1A 2DU1A 5BNPA 5HV4A 4QPIB 3WNOA 1YEWA 3K48A 2HWE1 1YIPA 2XBO2 3OGGA 3VV1A 2C5DA 4FO9A 4ZHNA 2JJ6A 5FXWA 4AHZA 3E6CC 3CJIB 4YM2A 3T3YA 4MSVA 1H8TC 3HNMA 3WP4A 3ZFGC 3H8OA 4MOAA 3IAPA 4NIAA 1MS4A 1XNCA 5A32A 3ZFEB 1NY71 3ILRA 5CA6A 1AXZA 4Q4V2 3RYPA 3MIEA 5A7QA 3U14A 3W5MA 1GFF2 4MXWA 4X8PA 2YC0A 1LOFA 1Q3EA 2Q8DA 1AHSA 5KXEA 4K21A 1CJPA 4W6WA 2EICA 1AR82 2XKOA 4LK7A 3ZFFC 4FI9A 2VH9A 3LE0A 3ZXDA 3IPVB 4XUQA 3MHZA 2ZGLA 2TBVA 1F31A 2ZEZA 5LWBA 1LJ7A 1L7RA 2DDUA 1CGPA 3E97A 1RUJ2 4PI0A 1CAWA 1LGCA 2WSVA 3BOWA 1TME1 3N7MA 4FPYA 2W08A 4LBKA 4LEJA 4X6RB 4AQ2A 1GZWA 5LA9A 1ULEA 4RQPC 5E1RA 2IXJA 4URAA 1CN1A 3TRSB 4QDQA 2VZUA 1UYYA 1QNYA 1D7PM 1RUG2 2ARCA 2W0XA 3AMMA 3B69A 3OCPA 4K7JA 4W6XA 4YVSC 3B9IA 4PQQA 4CCCA 3AP4A 1WWYA 5KHGA 2VNGA 4PDWB 4N43B 5HXVA 4FPKA 1T2XA 4UI9L 4HG6B 1RJ8A 1UOFA 2R041 5BNNA 2XJQA 4RR3B 2HEWF 3SCFA 2DCKA 1PO11 3WCRA 2OPKA 4GWNA 4IV1C 2R30A 4DEVA 3MW2A 1BKZA 5JR7B 1O3QA 2FDGA 1J83A 1CD3G 4P9IA 1NG0A 3LFMA 2HWE3 4LBMA 3ZSJA 4Y33A 2WS92 2DF7A 1QJX1 4QDSA 4QQ2A 3WQ0A 2A3YA 1AYN1 4IXLA 2PHWA 4EN6B 5ACA2 3K77A 3WNNA 1QXJA 4XC9A 1JOJA 5L36A 4Y20B 5APAA 4HKWA 5KXDA 3LIHA 1IS6A 5A7WA 3GBWA 4HPKB 2ID4A 3F95A 3SH5A 5IK7A 4AHYA 2VQUA 4L9BA 1NOVA 1S2KA 3B5LB 3ZXJA 4IEYA 1GP6A 3NV4A 5JI7A 4W50A 4FT8A 5KHHA 2BTVC 1OF3A 5IJRA 3O1MA 2XJRA 1EV11 1CAUB 1X33A 5BUVA 5FYTA 1S2BA 2CU5A 1D4M2 4BQYA 3WHUA 1T6BX 4SBVA 5FYZA 5LA2A 4XQDA 4A2UA 4QB6A 3RZMA 1MS8A 1TME3 2ZGKA 5FOJB 2WIIB 2YFUA 2E32A 4RD7A 1F35A 2NP0A 3PTYA 4LBLA 4HKOA 4AEDB 1W8TA 2R072 1Z7S1 2XWBB 3I3DA 3NKTA 4RN5A 2PLV1 2BVBA 4EYUA 2VW0A 2WO7A 2ZZQA 1IOAA 1PZ7A 2PHLA 2GN3A 3THPA 5D8AB 1SLIA 4IEWA 4HSJA 5JOXA 1OPOA 4Q4X1 2J1EA 4CSWA 2ETEA 5FZKA 3DUIA 2J1RA 2E53A 2QUOA 4MGZE 2R043 3TWIA 1DQ5A 2I07B 3WY6A 3I7DA 2RJ2A 1FMD2 1VP6A 4QT6A 1PO13 4ZY9A 1CQ9A 4ATEA 3I59A 1JBCA 1VE0A 2Z2SB 4XAAA 2HYXA 1W05A 4BQ3A 1QJY2 4JVAA 1XQNA 2AREA 3JD72 1RVF2 1OA2A 2R49A 2YHJA 3B94A 2EAKA 3LDRA 4RGAA 2Y6FA 1XJAA 1DQ2A 1QJX3 1HB1A 4XHXA 5BXXA 3WEZA 3O5SA 4YW1A 2WZR1 1AYN3 5FZ4A 3UL2A 2W1QA 1HRI1 1ST8A 4UXAA 2RE9A 4IETA 5FPZA 5JSPA 4CA9A 1ULCA 4QX8A 2BQPA 5H9RA 1BK1A 2DCJA 3TN92 2ENRA 5M0TA 3VBSA 2VECA 3AP6A 3HNBM 4NWVA 3USUA 3SNMA 1VAKA 4NHLA 2XMLA 1A78A 4DY3A 4L2NA 5CNAA 3ZYJB 4XOGA 4CYDA 3KSCA 4E4DX 1OSGA 4D6RA 1EV13 2V5YA 1SMVA 5A3MA 1N47A 1YO8A 2JG8A 2YYOA 3BTAA 3NNFA 4FPGA 3VDDB 3IMMA 2BNNA 2GNDA 1VAVA 2K2SA 4HK8A 5CFDC 2Q8CA 5CFCA 2R0FA 3KD4A 4CCOA 4Q26A 4CPBD 4XXPA 1Z7S3 2ZACA 5A1AA 1OUXA 2PLV3 1E5RA 1DQ6A 2X10A 5K4LA 2OS2A 3ACGA 3DCQA 2AEZA 1W6OA 4CEWB 3RMXA 3VD5A 4YM3A 2Y26A 3NAPB 4Q4X3 3OPTA 2XGXA 5A1FA 5A7PA 3VN4A 5F8PA 4WM8B 1YUDA 4OQ8A 4Q4V1 3WF4A 2DCTA 3PVEA 1IPKA 1QY4A 1OH4A 4F7ZA 4LUMA 3AVRA 5KXBA 1X50A 2WQZC 1SDWA 1UXZA 3BCWA 1AR92 2Q1MA 3NL1A 3POWA 2WN3A 2ZEWA 2JIJA 1FX5A 3KGLA 1NXMA 1W0OA 2QBXA 3FLTA 2OPWA 4IE0A 3I49A 2D43A 2RM22 1AR81 1PGW2 4XZUG 1ULOA 2D6NA 2WZR3 5IK8A 1V9U2 1XNBA 1HRI3 4EN7B 1YXWA 1YFXA 4INDA 1WLCA 3H3ZA 2QQJA 4P5YA 4MGTA 3WUCA 2WINB 4Q4Y2 1UOBA 3VBFB 2VZ3A 4YM0A 2F17A 2DBIA 1RUJ1 1ULPA 4L97A 3VZLA 1AX0A 1UY2A 3I3MA 2VNOA 1PK6B 1V6MA 1EP0A 2RMU1 4RS5A 5DG1A 2ZHKA 5DAPA 4NOTA 3PUSA 2XXZA 3ZN6A 1RHI1 1WD3A 4Q0PA 4YM1A 2ZAHA 3LB9A 2CDOA 3PNAA 4Z07A 3DECA 2EIBA 4I3GA 2R7EB 2XJTA 1H9PA 4D94A 2JDNA 4YVWA 2EXHA 1JYCA 2ZX2A 1UPIA 3OEBA 4BK5A 5FP8A 5JIUA 1YQCA 4UFHA 5FPAA 5FXZA 4I3PA 2R062 1NCQB 4AI8A 3OUIA 5BNNC 5FP4A 5L9RA 4ARYA 2WYFA 5AFBA 2RDRA 4I30A 2G1MA 4P9GA 3KS7A 5J3UA 4K20A 5LBCA 4BQ1A 1W6NA 2VUDA 4JDMA 2E26A 2BW8A 5EV7A 4YZ5A 3BTYA 4Y24A 5JZGA 1H8TB 3DPRA 3ZFGB 1PZ9A 2QKDA 3POJA 4JZRA 1RC6A 3POIA 1QJFA 1R082 2VG9A 1WLTA 3OUJA 1H1AA 1NE6A 3DYMA 2B4KA 3FX3A 5GLTA 3RMYA 3HQUA 4W8JA 4E4SA 1N1TA 3GBGA 2BP6A 4Q4V3 5IVBA 4XUTA 4PI2A 3SLIA 1H2MA 4E4ZA 1IPJA 3VDCA 2PHRA 1W90A 4I0BA 4YGBA 4AR2A 4XUOA 5IYYA 1W8FA 2JIGA 1OLQA 5FYYA 1AR83 1OPMA 1F4HA 1R092 2PTMA 4OQ9A 3ZFFB 5I0SA 5FRAA 3UNPA 3WHTA 4AE2A 1AYM2 2KD7A 3S7EA 2MEV2 4NO4A 1HX6A 2WFPA 1WCUA 3ZXGA 1W8UA 2AH2A 1DLCA 1MS5A 3A7QA 3O1RA 3GYDA 1Q8VA 3SKJE 1RUJ3 2O8QA 2GC1A 3WDWA 4PIZA 1BZWA 5FQ0B 1REEA 3AYEA 1GR3A 2RMU3 4HMZA 2W39A 5JXIA 2A7AA 3DN7A 4RQPB 2WFF2 3AVSA 1HDKA 4AQ6A 2VVFA 1UU4A 3G7DA 1W04A 1RHI3 1LHVA 4YVSB 4QX0A 5F2SA 5FK8A 4BWOA 3J26N 1QOOA 3O7OA 4TLFA 4CP9A 5ISLA 5CG8A 1PM7A 3M3OA 4KBBA 3N9NA 3VL9A 4XJWA 3GJAA 3BTZA 1CONA 2B42B 3AL5A 1IS3A 1OLMA 1W8OA 3C8XA 4MHRA 1ZRDA 3ZSLA 1FMD1 4XVHA 4CDXA 1X9TA 3ACLA 4EZHA 5FY0A 1JOPA 2UY8A 4N7IA 1RINA 3VBOA 4LOTA 2IFRA 4IV1B 3RQ0A 3T4VA 1CAVA 2AR6A 1NZIA 4E2GA 2B39A 2HWF2 3JD71 4GALA 3IT8A 5BPXA 2VNRA 1LOBA 5T3NA 3THTA 3Q8BA 4Q1PA 1GKBA 1Y9GA 1UU6A 2JDMA 2UURA 1RUD2 2VL4A 3M70A 3R4DB 4XCAA 2LS6A 2E7TA 2YV8A 2ZXQA 3QBQA 5C71A 5L7OA 3RZLA 3WW3A 3NV2A 4XTMA 1HB2A 2OQ7A 3JBG1 3VD7A 5JOZA 3TN91 3RG0A 3ETPA 1UIKA 4O61A 1F5FA 2ADEA 1UZYA 3I2IA 3OSDA 1W2AX 4Y22A 2D93A 3B9CA 3Q8CA 4I01A 5GJ6A 3ZSMA 3VBSC 4BXSV 1R64A 4BMEA 1WCSA 1OLRA 2DVAA 3ZIXA 1ND3A 4Q0UA 4MXVA 1B35A 5AVPA 2Y6HA 4BMBA 1HXS2 1DFQA 3BODA 4DO0A 4A6SA 2GP3A 4GKXA 5FMBA 3AYDA 4BE3A 2OUJA 1KEXA 3LOBA 4V2WA 2EALA 5IW0A 4MX3A 5E88A 3POGA 1JZ2A 4OMDA 2JG8C 3UKVA 3MW3A 3PMSA 2ZABA 4J1WA 1W2UA 1SEFA 3S0MA 1LODA 5F5CA 3IN9A 4NRQA 1UY1A 1H6XA 1WMXA 2QDRA 1QQP1 5CFCC 3MIGA 4B1LA 4BH9A 4AXOA 5A6QA 2A71A 1DDLA 2WR9A 2X29A 1JZ3A 1WW5A 5FMCA 4A3ZA 3L2YA 3MFAA 5DDJ2 3EO6A 2CGPA 1C5IA 1CZSA 4I0AA 5EQUA 4KWUA 3UESA 5GZDA 3ETQA 2VMIA 3OEAA 3OPWA 2JICA 3HEIA 1FMD3 2D5FA 4FTEA 4IE7A 5AC92 5I91A 1DP0A 5JXHA 1AR91 4FFFA 5GZEA 1EUTA 1AXKA 3JD73 2PHXA 2YXSA 1YJKA 1YCIA 3BVCA 3T30A 2RM21 4AVBA 1MVQA 1PGW1 4LBQD 4UAPA 1G9DA 5CBLA 1V9U1 2RR12 2VBPA 4JRLA 3D6EA 3WCSA 1BVVA 3WDVA 2J1SA 2QQKA 1VJ2A 4FOQA 2GP5A 5K9YA 4ET7A 5C6CA 1XYPA 4QM8A 5CB7A 5C3OA 3JBG3 5A7NA 3TN93 3LEKA 1W6MB 5FMDA 4MGIE 5FY7A 5DPNA 2JDKA 2JE7A 3IDBB 3BU7A 1ASJ2 2VOWA 3M3IA 2Q0AA 3OGJA 2Q30A 5FP3A 5KBFA 1RUNA 4QB1A 3U11A 1SBFA 2W46A 2WUHA 4RS5C 4AEJA 2IXLA 2WNEA 5ANNA 1KFUL 1NLQA 2JD9A 3RDIA 3HJRA 1W2TA 2ZMLA 4Z92B 3H8UA 4JKMA 3KV9A 5G05L 5D2AA 3ES4A 1DZTA 5BNQA 4CCMA 2Y6GA 2EXIA 2QTWB 4KGGA 3ACIA 2HJIA 1ZRFA 4YVWC 5T54A 5DUXA 5F3IA 5G04L 1OXCA 3NO8A 5CFDB 3CNAA 4QQOA 2YROA 3RYRA 1W99A 3NWKA 4TN7A 4ZU7A 1PX3A 1FATA 3KF5A 2A75A 2ARXA 1QQP3 3JB8A 3LEGA 5F32A 4LO8A 4YW7A 4J6GA 3OGSA 5HBAA 3AL6A 5A7OA 3A22A 1R081 4PLOA 1AZDA 5JZGC 2VNVA 2JXAA 3DPRC 3U78A 4XABA 4NPMA 4HETA 3RWKX 3ZIWA 2Y0OA 5IWFA 3ILFA 1MZ6A 2Z79A 5ANQA 5A32B 5CEHA 3DGTA 5F7UA 2RHPA 3BTXA 3FFZA 1AR93 1LHOA 2V4VA 5SV5A 4MXWB 1XRUA 3NV1A 2W91A 2VZSA 3R6SA 2RM23 3PJYA 1R091 5LEJA 3VKFC 1PMJX 3DKWA 1UZVA 4S2GA 1YLLA 1V9U3 3NJXA 1WD4A 4EQVA 5LK7B 2FHRA 1GSLA 2Y8KA 4B4RA 1ZBE1 4R9DA 5EFUA 1TEIA 1ZZ9A 3ZXAC 3ZYBA 3AFGA 4QPYA 4UFJA 3JUUA 1SLAA 4EROA 5FPVA 2ZGQA 2OUHA 1I5ZA 1IG3A 4KG8A 4COVA 3PU8A 2WLQA 1CAWB 3EBRA 5JWPA 1V6IA 2WFF1 5LCWL 1GZWB 2VY0A 5FY4A 3PJQA 2VAUA 3WW1A 5L73A 4FAHA 3WUDA 1VMJA 2NLRA 1LNSA 5T5LA 1HRV2 4CDWA 4Y4RA 2CV6A 1O91A 4M4PA 4E8CA 1UL9A 2HYKA 1SCSA 2JWPA 2ZA9A 3JB4C 2EF6A 5FZAA 2ARBA 4JCKA 1VMHA 4YZ2A 3WR0A 5BNNB 2YFZA 4XJ9A 5IFTA 2CSGA 1CESA 3JCIA 4XTPA 4CDXC 3HR9A 2I45A 4N9IA 2VZ1A 4NHXA 4Q0QA 2HWF1 4OZXA 3T2QA 2L9LA 3VBOC 2VOKA 3WNLA 5C5UA 5CKNA 4KWKA 1EUUA 1LHUA 2NPIA 4CDQA 3IAQA 5CKMA 2CAVA 1TZOA 2PYTA 4Z2AA 3N3HA 1XSRA 1RUD1 1A3KA 2W68A 2WNUA 4GD4A 1J1LA 4RHV2 2Q8EA 3ZDVA 3ZYIB 4ATFA 4NVPA 1S55A 4C1WA 1R083 4HLTA 4EE2A 1GZ9A 4LXLA 3OYWA 2P6CA 1ENQA 4EZ4A 5L7OC 4FSJA 3FBYA 4UW3A 4FOVA 4IEPA 1C8NA 1RUF2 3UGFA 3S5AA 3D0JA 3ZSEA 1JYVA 5FY5A 5F3GA 5A7WB 3SC7X 3JQXA 2CTVA 5LY2A 3PL0A 3TOJA 1R093 3PHMA 3H3LA 1CPMA 1REDA 3GM8A 2VVDA 3MV11 2FMDA 3UYJA 2QQUA 1HXS1 1ND3C 4D7SA 2B5HA 1S4CA 1UZZA 2AGSA 1R1A2 1B35C 1OFNA 2ZGOA 3LQCA 4FAGA 5IT6A 1ZBE3 4A3XA 1WZXA 4N9HA 2RS12 5KC6A 3VD9A 5C8CA 2QVSB 4N53A 5IVVA 3I4IA 1PGSA 1ND2A 2C9AA 2P17A 2YG0A 3GDBA 4M00A 3CDZB 4CXYA 2FDKA 3ASIA 1H1IA 3WP6A 5LY1A 5FUNA 4OHYA 1RXGA 3VDBA 2WFF3 3TNQA 2BDRA 5JOWA 1F8VA 4XDPA 1F2NA 1CAXA 1RMU2 5F2WA 3H3UA 1VBE1 3A0NA 4IUGA 4LO5B 3N35A 5FZBA 4EN8B 1W9TA 3AJYA 2P3KA 3KV6A 4XZPA 5FYUA 1IPSA 1OHFA 1CX1A 1HW5A 4W65A 4QU2A 5IK5A 5IHRA 1ULFA 3H7JA 1IKQA 1APNA 2GU9A 3QH6A 4JRAA 4XDQA 5FMOL 1LB2A 1XYOA 4FTBA 3HOBA 3N9LA 5AC91 2JECA 2RDQA 4JHTA 3VZKA 4DOUA 3GALA 2ZJCA 5HCFA 1KQRA 1MQTA 3I59B 1OVSA 2HWF3 4FCAA 5FLIA 5LBBA 3WQ7A 4CU8A 1JS9A 2XQRA 1V6JA 2DFBA 1J3PA 4LMFA 5EPAA 1ENRA 4UW5A 4ZS2A 5FZIA 4XQ4A 2D3RA 5HCBA 3VBUA 3ZX7A 4ASLA 3NJYA 5CVRA 1JYTA 2P5BA 4OZOA 1S0FA 3V0AA 1RUD3 2FCUA 2RR11 4F8AA 4AOCA 4GWIA 4QHZA 5F3EA 4MG2A 1KRIA 1Y3TA 4ZPIA 1YQ6A 4BIFA 5A6ZA 3ZXKA 3KB5A 2PN5A 5LBEA 2O1QA 2WA4A 4GXLA 4FVVA 4EWAA 1ASJ1 3MICA 4AAPA 3MBWA 3V65A 1LEMA 3HT1A 2BRTA 3ON7A 3VBSB 1VBD1 2K0GA 2AC1A 4DZGA 1O59A 3ZXEA 3USUB 1EPZA 1Y7BA 1AX2A 3POYA 5C3SA 4HN0A 3QACA 2JKXA 4WVVA 4XJUA 3LIGA 3SXWA 1HXS3 4BLJA 4BLIA 1W9FA 3AX4A 4HKLA 3A4UA 3ZM8A 1NQJA 2DU0A 1CIYA 2E9QA 2VOXA 1LEDA 3OBAA 1AR72 1Y9QA 2JG8B 3OBZA 1QDCA 2ZGPA 5EP9A 2DV9A 2LTNA 3N7JA 1LGNA 4YFZA 5CG9A 2VTXJ 2VQTA 3AP5A 1U5YA 3AB0A 5CFCB 3C7HA 3LGRA 1WCQA 1VBE3 1XBFA 3EMRA 4BPZA 2ZKNA 1V0AA 4C1XA 5A3UA 5FWJA 1H30A 4AW7A 1RUI2 5FYSA 4IESA 1W6OB 4G3YC 5ABJA 3ZMNA 2B8MA 4QQLA 1MR5A 1PNGA 3D4KA 4JKKA 1VBA1 4XMIA 2BVVA 3ALQA 4WV8A 5AC93 2VW1A 4Y26A 4KU7A 2GC0A 3H1WA 4JGZA 4K1YA 3M7AA 4OULA 2F4PA 1S0IA 1K45A 1YQ5A 3KHBA 4KWJA 3T0DA 1FT9A 1OI6A 5CYYA 5JSRA 3BALA 2RR13 3LOIA 4Q8LA 3WF0A 1DQ0A 4IV3A 1AL0G 3VLBB 1ZRRA 5FBJA 5F6KA 1NYWA 4QB2A 2A73B 5J98B 3VHRA 1ZZ6A 1SPPA 4XBQA 1ASJ3 4CCEA 3WNKA 4C0HA 2VCBA 1VBD3 4Q2FA 4IE4A 3WZ1A 5FR3A 4YGDA 4RS5B 4M3CA 3K4AA 5E16A 3U37A 3IMNA 2OQ6A 3L2HA 3B01A 2A3WA 3HMYA 1HRV1 2QZ2A 3ZN6B 1AX1A 2LRPA 2VQ0A 1SQ4A 2BJSA 4CDWC 1DLLA 2EVXA 4XAEA 1H9WA 4WBBA 1V70A 1UY4A 3H1MA 3WP3A 2BZDA 2J42A 4YVWB 5FMOS 2R16A 3POBA 4FP2A 1O4TA 2H6BA 2VMGA 2OA2A 1DBNA 1WCDJ 3B93A 3LWCA 3QCWA 4L92A 5FKCA 4BU2A 3B00A 3IWZA 2WRAA 5ERLA 2JKBA 5KHIA 4OI0A 2FZ2A 2H6CA 4AFDA 1K5MA 2P3IA 3ABZA 5A33A 2GZWA 1W6NB 1UYPA 3LPGA 1MACA 4XDOA 4EWDA 3PURA 3QLQA 4RHV1 4CDQC 5C4WA 4FPOB 3I97A 2NZ9A 1GP4A 3I3EA 4LLFA 2XVLA 1WA6X 1PVXA 2WNUC 3LZZA 4NPLA 1NZCA 3DPRB 3WW2A 3SEEA 3WXPA 5JZGB 3BIEA 1XU2A 3BUCA 5A70A 3RZJA 1RUF1 1VBA3 1YYNA 2HWB1 2W87A 2OVUA 4BISA 5A6YA 4LULA 4IGPA 5KC5A 3RZZA 3GJBA 5I0UA 3CEWA 1OKOA 1POV1 2CWMA 4MHUA 1V00A 5FO8B 3WF3A 5I0RA 2XHNA 4QX7A 4FXKB 4CUCA 3DV8A 4TXWA 4YZ1A 1AL22 1NLSA 2B7YA 5FP9A 2YC4A 4NN0A 1R1A1 2GC2A 1JYXA 1QJU2 3BOPA 4GKYA 4QX1A 4BIOA 1XYNA 1JZ8A 1BCXA 3K3OA 4AEKA 1COV2 2G4IA 4D3WA 2V72A 5DMYA 2MPFA 5HCAA 3FJSA 2C6SA 1KJRA 1NUKA 1WMEA 2IXIA 2C9KA 1Z0HA 3URFA 3ZDSA 4D7YA 3OTFA 1S0BA 4ZS3A 3IKWA 5C8CC 2RVAA 5SV8A 1ND2C 2W1SA 1W9WA 2ZZJA 1XOYA 3RZKA 1RMU1 1QEXA 2CY6A 2EXJA 3FHAA 4KNCA 3TEWA 2AUYA 1GYKA 1NX9A 1DGRN 2JX9A 3HN3A 1HRV3 4DB5A 4DUXA 2ZMNA 4IEXA 5IATA 3J8F2 2VTFA 1DGWA 2Y6KA 3G6JB 2Z69A 4PHZA 2OYZA 5FV3A 5C3RA 3CU7A 1G9CA 1OMIA 1GV9A 4NR1A 4QDRA 4AYUA 2DUQA 3W5NA 2XOMA 4CDXB 2W47A 2XDVA 3VBOB 5EJ1B 1J59A 4G4FA 1CAVB 2OIIA 3ZYFA 1MQTC 1XE8A 2EIEA 1RUC2 2PFWA 4COWA 2VQAA 2D6OX 1PMHX 1T6GC 5JOYA 3VBUC 4HT1T 3LDBA 2ZTNA 4RHV3 3WDXA 1N1SA 4XYXA 4JKLA 1OOPA 5A7SA 3SMHA 4AI9A 3MLJA 2CHHA 5L7OB 4ZONA 1PO21 4AVSA 3FZ3A 3KT4A 3KT1A 1RUF3 2HWB3 2G9GA 2ZS6B 2QE3A 3I54A 5C9AA 1A34A 4RGKA 5JVVA 1Q8SA 2WDBA 3QOPA 2XLGA 2BGCA 4CRQA 1POV3 5L9VA 2JDHA 3C7GA 4Y22B 2PQSA 3CKHA 5E8AA 5T50A 5JPMB 1YQ2A 3RJ2X 4A4AA 1EAH2 4DXTA 1C8M2 1W8NA 2Z4FA 1EY2A 4OHZA 1ND3B 5LBFA 4Z1VA 3FBMA 2HKXA 1XC6A 1R1A3 3AM2A 1B35B 3VHNA 4Q4W2 2XQXA 1OH3A 1MEC2 5BNPC 4NIDA 4S2FA 1MVEA 2XBO1 3C7EA 1OBNA 2ZX3A 5FK7A 1AR71 3UKNA 2VMEA 3ELNA 4QPIA 3SKVA 4LO4B 4PIXA 3RPQA 4BM8A 2D40A 3PIJA 4XQWA
chains in the Genus database with same CATH topology
3HQXA 4IEUA 1JUIA 1RMU3 3GNEA 1LHWA 3PLQA 4ITCA 2ATFA 4AFCA 2I74A 4YFWA 2WLPA 4LO7A 1EYBA 4LBJA 4D69A 3APBA 1LOFC 3SCGA 2IFWA 4AVVA 5T5OA 1JXNA 5ABJC 5FTTC 3LCPA 4HVRA 4AG4A 4CTEA 2ZX1A 1O5UA 3SITA 2ERFA 2B46X 2VW2A 2ZMKA 4OI4A 1N3PA 4JGZC 2LUWA 4AI1A 3D82A 5JDBA 3HIFA 3IBMA 2E7QA 3AKTA 2GN7A 1QGLA 1RUG1 1PO23 3VGIA 1A6CA 4LNVA 2KM2A 3MLKA 1LKNA 1O4ZA 1QF3A 1U5IA 1SFNA 4QM9A 4U36A 2TEPA 1I6XA 4GMP1 2QQPA 3HT2A 4AFMA 4AGVA 1MZEA 3KCCA 3N4MA 2VMHA 4YG0A 4YW4A 3KCXA 3WDYA 4A7YA 4XF1A 1H2KA 2DTYA 2XBO3 2WS91 2ZCWA 1AR73 1GLHA 4XJAA 2ZGRA 4GQ7A 5ACA1 1AXYA 4B8EA 2ZHNA 3ES1A 2XJVA 2D6KA 2FZ1A 3MLLA 4AFBA 3V0BB 4U2AA 4YSFA 3B3QE 1FXZA 1I3HA 1YHFA 2ES3A 2HWD2 4R9AA 2XH6A 4FPCA 1K5MC 4K40A 1WBFA 2R32A 2A6YA 1PIV2 3MIHA 4YW3A 1UU5A 2E6VA 4XPVA 4HPKA 5C4WC 4P9YA 3AYCA 3S30A 1BEV2 3HN1A 3AMPA 4WZCA 4QX5A 3RYKA 1D4M1 4RGGA 4YYOA 2XL9A 4N7UA 1FOD2 1VBB2 2FQPA 5GZCA 1I1EA 3M3EA 2GMPA 1AL21 5T55A 2V09A 1QJU1 1V6NA 4D7TA 1NQDA 2QJVA 2R071 1RUG3 1W0PA 1LGBA 1MZFA 1WA4A 3R0RA 1C5HA 4E9KA 5J96B 3D0SA 4P14A 4TSVA 1IS4A 1DG6A 3DL3A 1ZZ7A 4GMP3 1TE1B 4CDUA 4JQRA 1YI7A 5D8AA 3ENRA 2C1FA 2F6BA 4GIQA 1Y43B 1IS5A 1AJOA 3RRDA 3N7KA 1QJY1 4NHKA 2DVFA 1QNWA 4V1PA 1RVF1 4CDWB 4QXKA 4Q8KA 5H9QA 2WS93 3WQ1A 2DTWA 2XJSA 5DZEA 3PMEA 1O3RA 3EJKA 4WVWA 1GBGA 1SLLA 5ACA3 4XF3A 4B3NA 4YW5A 5IK4A 3LA2A 3TNPB 3WNXA 3M3QA 1KXGA 1AF9A 4XXAA 1WGPA 1RUC1 1ZVFA 1BMV2 4GWMA 4AI2A 4PBPA 4OI2A 4CDQB 2PAKA 1RUH2 2BUKA 4NHMA 4HSLA 1H8VA 2EXKA 2WNUB 4CP2A 4P9JA 1OOPC 4B7EA 3GZAA 3M1HA 3OYWB 4EN0A 2DUPA 5C9AC 1D4M3 3OD4A 1G6NA 3OJBA 1DYKA 4P5HA 5BV6A 5J7MA 3MPPG 3K51A 2A5ZA 1WCKA 5LEKA 4XMAA 2XJUA 1AL23 4R52A 4LO6B 4Z2WA 1QJU3 3ECQA 4Q4W1 2R073 1MEC1 4IEZA 3WG3A 1G86A 2VPVA 1FYUA 2PHTA 3FUQA 5C8CB 3RNSA 3A0KA 4R9CA 1ND2B 1C1FA 4YZ3A 3KQRA 1LU2A 2GNTA 4SLIA 1SBDA 2ET1A 2ZGSA 5GALA 3AZZA 1UKRA 1JW6A 1YFWA 4Z82A 3CLPA 2DWRA 1CAXB 2WC2A 1QJY3 4XFCA 2XLFA 2BFUL 5B2GB 1RVF3 3UJOA 1H2NA 3T1MA 3M4FA 4QPGA 1SACA 3JZVA 4OHVA 1QH6A 1SLBA 5CADA 5JPNB 2BWAA 4EN9B 1NXD1 4COUA 3PVOA 4LTAA 4TWTA 4Q4Y1 1QXRA 4X8NA 1DU3D 1MQTB 1RUC3 4X6QB 3VZOA 3VBUB 1C28A 4LBQA 3DF0A 3V0AB 2ILMA 3AZXA 1QDOA 1DF0A 1YFUA 3O0VA 3ZYGA 5BYNA 5J48A 4AQSA 3KLSA 2XUMA 2RJKA 4XETA 1G9BA 4G9SB 1HQLA 2R061 1LOGA 1X8EA 2IXCA 5AVAA 1WMDA 2NQYA 2B45X 2UU8A 4Q4W3 1MEC3 4C91A 1VLNA 5BNPB 4BYYA 4Z8BA 5GZGA 2XPJA 1ZRCA 4ONUA 4CZSA 3WG2A 1UCXA 5EZWA 3NSTA 2FMYA 4F3JA 1G9AA 2HWD1 3U0ZA 4Q29A 2R0HA 3QH7A 3C2UA 1ENSA 2WKKA 2PELA 2ET7A 1PIV1 4QHBA 1NY72 3OD0A 4AF9A 5ABJB 3O0WA 1AYM1 1BEV1 4XHBA 1O3TA 1Q5OA 2MEV1 4ES9A 1HLCA 1AUYA 1U5XA 5BNOA 5JMCA 4Q4Y3 1UW8A 2VVEA 3FFQA 1NA1A 1W39A 4JGZB 4FTSA 1ULGA 1J58A 4FOWA 4HFSA 5L19A 5DXDA 2CNAA 5FQ0A 4MV2A 2UY9A 4JTNA 3MDPA 1CJDA 4JGYA 2GAUA 4QQPA 4YVSA 3O0XA 2Y38A 1HKDA 2V73A 1VBC2 2R063 2YUEA 3KM5A 2D6LX 3E5UA 5H9SA 4M3CB 4CDUC 4WZFA 1A8MA 1ZBA2 2I2SA 4DMIA 1AR62 2ZHMA 2BFUS 3FMGA 1Q8QA 1R1ZA 2X5IA 2XKPA 2SLIA 4XEZA 5FDBA 3U4XA 1G8WA 1WW7A 1N1YA 1VIWB 4AEMA 5GLZA 1PO12 1N1VA 2D44A 3JQWA 3FWEA 1S0GA 1QWRA 5F9TA 4N90A 1FI2A 3B7MA 4KU8A 3BIWE 3RSJA 1ENXA 3MIFA 2HWD3 3U10A 2BWCA 1K5MB 2JG9A 1AYN2 1RUH1 1OQDA 3IDEA 2YPJA 1PIV3 2DVBA 1AJKA 1LULA 5C4WB 5K0UA 1AYM3 1BEV3 1LU1A 2MEV3 5D1IA 1Q43A 4AHXA 4IL7A 1C57A 3ZN4A 1V6KA 2JE9A 2IC1A 1MS0A 4YGEA 1SFYA 4ZKTB 4FQZA 2XB6C 1O5LA 2SBAA 4LLOA 4DXZA 1MS9A 4R8HA 4XF4A 3VHPA 2GSYA 5BY5A 2DCZA 1D2QA 3OY8A 2QZ3A 3AZWA 5DDJ1 3UJQA 4PJYA 4L99A 2H0VA 4B7KA 5DZGA 5AFEA 1D4VB 2XHKA 4LBNA 4WVMA 1LESA 4Y1YA 1UAIA 1C1LA 4ISQA 5LRRA 1VB4A 1E57A 1BJQA 2ZHLA 2Z42A 2YGLA 3T2TA 3OBTA 4C90A 5TSWA 4JAAA 1LECA 2A6VA 3PVNA 4L11A 4R9BA 3FC0A 4QPGC 2AYHA 2WJSA 3EHKA 2A6WA 3S7IA 1RIRA 1YFYA 1QOTA 1PGL2 3AKSA 2WZR2 1RUH3 3NW4A 1NLRA 2GNMA 5FAXA 4MLOA 1OOPB 1TNRA 1W6QA 2NMOA 3O14A 4DRVA 1ZNPA 3WP5A 1DZQA 5C9AB 1X7NA 3OBRA 4LHKA 4QMAA 4E2QA 3WINE 5KWRA 4MYEA 3JU9A 3N7LA 1PMIA 4BA6A 3PVBB 4OI1A 5GLVA 3TYJA 2GC3A 1H1MA 1JUHA 5JAXA 4Q27A 3MFCA 1O4YA 2EIGA 4IERA 4AGRA 5DDJ3 2ZGNA 3IDCB 1J3RA 3H1YA 2GMMA 2D3PA 1HQNA 5FOBB 3VZMA 1FNYA 2IXKA 3MPBA 4NWWA 3NKGA 3GBFA 4H7MA 1KS4A 2R1DA 3MIBA 1C4RA 5GZFA 3ZO0B 5GKAC 4AHWA 2CGNA 2LM3A 2D6MA 1UKGA 4KGQA 1ZX5A 4KG0A 5GLWA 2QNKA 5BNOC 4IQPA 3R4SA 4XFBA 5H9PA 5JSOA 4XFIA 4I09A 1NA1C 4F83A 2TNFA 4Q1RA 3IIAA 2HWC2 2WT1A 3OPZA 4LHNA 1QOSA 2X53S 3ZPYA 1OD5A 4S2HA 2RMU2 2GH8A 2E63A 4YARA 1FPN2 4I2OA 1U0AA 4JGYC 1Q56A 1VBC1 2Q8OA 1RHI2 4XJZA 1YJLA 3AMNA 3NVCA 4LR4A 2BYVE 3W9AA 5T52A 4XJ8A 1ZBA1 2GH2A 1AR61 3ZXFA 5FO9B 2R6QA 1JYIA 3FLRA 1KFXL 1FV3A 2X5IC 4WM7A 1UIJA 4H14A 4OHXA 4XFGA 1SLCA 1GANA 3LSEA 4LBOA 2IWGB 4HL0A 4Y1UA 5J09A 3KZ4C 3CO2A 2UYAA 2JG9C 2XL7A 4UBGA 5LRSA 4AVAA 1IKPA 2IXHA 3LA7A 1LOEA 4XFHA 3WX5A 1GQGA 4AI0A 2HEYF 2UYBA 5FFOC 3LAGA 1LENA 2DYCA 4BZ4A 4BCUA 5K7PA 5K0UC 4YG3A 5F5QA 2RS11 4MH0E 1U12A 1WW4A 1IGOA 1XE7A 4UBHA 2PHDA 4N53C 2VXRA 1KITA 1DQ4A 4KL1A 4OHWA 3GHNA 4OUMA 4DQAA 2ZOEB 1POV0 1CX4A 4P9XA 1MZ5A 5A3LA 1BBT2 1OQ1A 1LHNA 4RA0A 1EPWA 5IUQA 4CEYA 1IQAA 3LKJA 3VBHA 3VBRA 1VBC3 2ZGMA 4LE3A 4E27A 3HD8B 2WNVA 4PCRA 1OA3A 4M3CF 3I8TA 3VHOA 2BPA2 3S6PA 4CDUB 2UWAA 2MNGA 2KA3A 3L9JT 4GH4A 1ZBA3 3ATGA 1AR63 4GB32 2BNOA 4R4ZA 4KH9A 3H7YA 2JDZA 2EA7A 2R1BA 3ROUA 5I8YA 1DZRA 1H2LA 2A70A 2G9FA 1Q8PA 1ZZ8A 2DCYA 2QFEA 2NM1A 4ZU5A 1S1AA 3VUOA 4A7KA 5FLJA 3E6DA 1PGL1 3VZNA 1NCRA 2FBEA 3X29B 2YMZA 4S2DA 5KHKA 1TNFA 3MF6A 2CGOA 1HV0A 1J3QA 4HANA 3JBG2 3MIDA 3WDUA 1W6PA 1DGRA 1O7FA 1WW6A 2ZAAA 3AKRA 4FPEA 1H0BA 1KDKA 4AVTA 2RS13 2D97A 1S0JA 4AQTA 3H9AA 2CAUA 5F6LB 4XF0A 1C3HA 3ME2A 1PHMA 4LUKA 2RS32 4YZ4A 1GNZA 2X8KA 3IM0A 2XVGA 3CJIA 2A3XA 3WW4A 4YG6A 3C3VA 2YY1A 4QGNA 4ZU4A 5FO7B 3ZFEA 1WMFA 1RUI1 2D7FA 1TMF2 2D3SA 4K8FA 4KWLA 2JENA 3FHIB 1MS3A 1QQP2 3W59A 5I8TA 5EJ3A 2EAAA 1YI9A 3UKTA 4DFSA 4JDNA 3O12A 1YNAA 1DYPA 5CIRA 3IPVA 4XBLA 1Q8OA 5K8SA 1V6OA 4QPGB 5JLVA 3D8CA 3HAGA 4CP0A 1IHMA 1QJZA 4IV3C 1N3QA 4PLNA 4J1XA 4YLZA 1XU1A 4JTOA 4XILA 4KQ7A 1VRH2 2PQQA 3N36A 1SBEA 2HWC1 4LBQB 4FPLA 4PDWA 1RITA 4N43A 4UW6A 4H55A 4QQHA 2Y0IA 4DNYA 1BVP1 4IEOA 4RR3A 1FPN1 3CJXA 4PIYA 3WD5A 1GNHA 1QHDA 2NYYA 1KDMA 4LT5A 4FP3A 1UN1A 1JHNA 1PVC2 4P9WA 3AXDA 2OZ6A 3MZHA 3LSDA 5KHJA 3W58A 3GZUC 2ZGUA 1LOCA 4JC1A 2K9ZA 1RUI3 4GMP0 1WBLA 5C8WA 4Y20A 4WM7C 4XIOA 2BBVA 1FNZA 4RL7A 4GULA 1ZYBA 5JCTA 1PNFA 2D6PA 3AZYA 4H7LA 2GMEA 4OVEA 3V56A 1KJLA 3AP7A 3KMHA 1UD1A 3AFKA 1HV1A 2UWBA 2VGDA 1JN2P 3U07A 4XIKA 5T5JA 4XBNA 1RUE2 4FQ4A 1URXA 1X8MA 3VL8A 1CAUA 3MGUA 4YNIA 4EJRA 2RS52 1Z78A 3QD6A 2D5HA 1COV1 1QU0A 2OZJA 5BNOB 4JV4A 1RUOA 3M3CA 5T5PA 3RWNA 2O0OA 4FPHA 4AEDA 1NA1B 3H0OA 5LK5A 5DG2A 3T1LA 3KGZA 2WZPP 1ZBE2 2HWC3 2VUJA 4B4QA 1RGSA 3AJZA 2PHUA 3EQEA 1BBT1 1RJ7A 1L3JA 2YDEA 1FPN3 3J8F1 2DVDA 4JGYB 3SH3A 2LALA 1ALYA 4K3UA 2UWCA 4META 4YGCA 4CEYC 1O3SA 2XWJB 3HWJA 4PLMA 3RI9A 3VBHC 3VBRC 5FBZA 2WNVC 4GB31 3ILNA 2Q1ZB 4YW2A 4AGGA 3GZTB 4GH4C 4URTA 2X5IB 2AZ5A 4Y1ZA 2YGMA 4I02A 3D5OA 2XJPA 1OA4A 1YIFA 2ZX0A 3INAA 1BYHA 1ZA4A 2DUOA 4AFAA 1GQHA 3WT3A 4IEQA 3AYAA 2XLAA 2A6XA 3MW4A 1OFSA 4FPFA 4O9EA 1J1TA 3WDTA 3WV6A 4ORFA 3BPZA 5DUVA 2DFCA 1NCRC 5CU1A 2JG9B 3ST7A 3SISA 3HBZA 3MYXA 4XE9A 4CP1A 4M3CE 1EAH1 4WVZA 3SH4A 1C8M1 1HIXA 3VDDA 5K0UB 1LCLA 4E2SA 5E89A 2PAMA 4M0HA 3WLUA 5I8SA 1ULDA 2WWSA 4YRDA 1COV3 4BOWA 1S0CA 3TB0A 3ZYRA 2RS31 4OUSA 1B09A 2DURA 5J36A 3ZYPA 4N53B 3SHRA 1DQ1A 1KS5A 4QPIC 4K1ZA 1OKQA 4CEWA 4A7ZA 3BB6A 3NAPA 5EYYA 3CJIC 2KXLA 2B9UA 1BBT3 1U5ZA 3KCYA 1NE4A 1TMF1 2P34A 4WM8A 3J8F3 3OY8B 2PAEA 3ZFEC 2GNBA 3POSA 1ONAA 1VBE2 5I93A 4LE4A 4WVMB 3CF6E 4IEVA 3RJRA 4GB33 4ES8A 4Y4YA 5I0TA 4FBFA 1D0GA 2NN8A 2WL1A 4TYSA 1I9RA 2JEMA 3VBFA 1VB2A 1F9KA 3GHMA 3AKQA 3TBDA 4MVTA 1CIWA 1UPSA 4RFT0 1PK6A 3AK0A 2GALA 1WUVA 4COZA 1ZREA 1GZCA 1VRH1 4PBOA 1G7YA 3USSA 2Q4SA 2NMNA 3OF1A 4FXGB 1EAH3 4DRRA 1C8M3 3KT7A 3LA3A 1W6QB 4PDWC 1RL3A 4N43C 4I0WB 4XFFA 3AXEA 1JH5A 5DUUA 1NCQA 1UF2C 3FLPA 5GM0A 1VBD2 5FREA 2IZWA 3B02A 4RR3C 1DGLA 3M8LA 4K9SA 2RS33 4XF9A 5EXOA 1PVC1 4MGKE 4MUVA 1A8DA 3E6BA 4HZFA 2C0ZA 5FCCA 3Q9OA 2HWE2 1H8TA 3TAYA 3ZFGA 4HBNA 2XVKA 4QD2A 4RSUA 3AKPA 1SCRA 1TMF3 4Y1VA 3V0BA 4EV0A 4P9LA 3SCHA 1JTZX 2WSUA 2E7AA 4BHPA 4COYA 1V6LA 3AZVA 3R4UA 3FUOA 3NV3A 4QGLA 3WG4A 2ZX4A 2ZBJA 2P37A 2RJLA 2VU9A 5FLHA 3ZSKA 1VALA 2ZPXA 2CWSA 4R4XA 4O9GA 3I2DA 3E5QA 3ZFFA 1FOD1 1RUE1 1RTVA 2P2KA 2ZGTA 1DHKB 1VBB1 3GF6A 4Z07A 3CL1A 4LA3A 4XW3A 5JI9A 5C33A 3MI8A 1VBA2 1CR7A 2RS51 4B4PA 4Y5Z0 1TQ5A 1KD7A 4UW4A 4IV3B 1WLDA 4L8QA 2PA7A 3R05A 3UK9A 4RQPA 1TME2 4AVCA 3AMQA 1VRH3 1MS1A 2E51A 1FV2A 1GICA 4AEDC 4JDOA 3AP9A 2W52A 2ZKLA 3EXUA 2WT2A 2XG3A 1CVNA 4DINB 3J9SA 2WT0A 3P3NA 1WLWA 3E5XA 2O8OA 5D8AC 4PF5A 2TUNA 4DS0A 4LHLA 4DY5A 1IZ3A 1G9FA 1SLTA 3RS6A 2R042 3ZVXA 2HEVF 4IV1A 4AK3A 4HVOA 4MGYE 4M0NA 5CAZA 3FE5A 1PVC3 2JD4A 4HVQA 1OQEA 2A6ZA 1QH7A 2WQ4A 2PHFA 1BMV1 1QJX2 1X82A 4AI3A 1LRHA 1DIWA 5A33B 4WM7B 2VOVA 3AMHA 4LA2A 3VKOA 4XFAA 3ZXLA 4FPJA 3VKNA 1RB8G 2MHFA 2CYFA 1YRZA 3J4UH 1FAYA 4Y1XA 1LTEA 2CL2A 1QXPA 2VUAA 1FOD3 1RUE3 4Q0VA 1VBB3 4PQ9A 3WOGA 2HWB2 4AWDA 2RS53 1S0EA 1XNDA 1CPNA 1EV12 1LR5A 4EWEA 2P3JA 4M01A 1QKQA 4OLLA 3VDDC 4B29A 2VULA 1XXNA 2DVGA 4OFGA 2BEOA 3H50A 4W6YA 5DZFA 5GLUA 1UX6A 1Z7S2 1REFA 1VAMA 2PLV2 4DPNA 4CEWC 1XNKA 2Q5TA 3NAPC 4Q4X2 2N7GA 2H0BA 4WM8C 1D2SA 4K6BA 4CEYB 1BQPA 1D0HA 3VBRB 3VBHB 4HK9A 2WNVB 1UMZA 3MEPA 2OW4A 3VZJA 2YZ4A 4HN1A 1F5JA 4GH4B 1M06G 1X36A 1ZZCA 3VKMA 2BNMA 1VR3A 3P3PA 1HRI2 3MF9A 4GA9A 1W6MA 4FOYA 1DGWX 3VBFC 3WG1A 4D7SA 2D98A 2WA3A 4NPRA 1S0DA 4TZDA 1YWKA 4MZUA 2QDNA 1PK6C 1H4HA 1ZZBA 3WVJA 3UV9A 5JIAA 1NCRB 1PZ8A 3NJZA 4H3WA 1N3OA 3RI8A 2QCSB 1HQWA 1PO22 3ZN5A 5HI0A 4ISRA 4ASMB 4Q0SA 1H4GA 2GDFA 2AENA 3M2MA 1AVBA 1W6PB 4C0BA 3VKLA 5DUWA 4QGMA 5CFDA 3V64A 5J37A 1LOAA 1QMJA 1NCQC 5EYXA 5FPXA 3ZMOA 1BXHA 1M4WA 2Z5WA 4ZXKA 1ZM1A 2DU1A 5BNPA 4QPIB 3K48A 2HWE1 1YIPA 2XBO2 3OGGA 3VV1A 2C5DA 4FO9A 3E6CC 2JJ6A 4AHZA 3CJIB 4YM2A 4MSVA 1H8TC 3WP4A 3ZFGC 1MS4A 1XNCA 5A32A 3ZFEB 1NY71 3ILRA 5CA6A 1AXZA 4Q4V2 3RYPA 3MIEA 1GFF2 4MXWA 4X8PA 2YC0A 1LOFA 1Q3EA 1AHSA 5KXEA 4K21A 1CJPA 4W6WA 1AR82 2XKOA 3ZFFC 2VH9A 3ZXDA 3IPVB 2ZGLA 2TBVA 1F31A 1LJ7A 1CGPA 3E97A 1RUJ2 1CAWA 1LGCA 2WSVA 3BOWA 1TME1 3N7MA 4FPYA 2W08A 4LBKA 4LEJA 4X6RB 4AQ2A 1GZWA 1ULEA 4RQPC 5E1RA 2IXJA 1CN1A 3TRSB 3AMMA 1QNYA 1RUG2 3OCPA 2W0XA 4K7JA 3B69A 4W6XA 4YVSC 5EWSA 3B9IA 3AP4A 5KHGA 2VNGA 4PDWB 4N43B 5HXVA 4FPKA 1RJ8A 2R041 5BNNA 2XJQA 4RR3B 2HEWF 3SCFA 2DCKA 1PO11 3WCRA 2OPKA 4GWNA 4IV1C 2R30A 3MW2A 1BKZA 5JR7B 1O3QA 4P9IA 1CD3G 1NG0A 2HWE3 4LBMA 3ZSJA 2WS92 2DF7A 1QJX1 4QQ2A 3WQ0A 2A3YA 1AYN1 4IXLA 2PHWA 4EN6B 5ACA2 1QXJA 1JOJA 5L36A 4Y20B 4HKWA 5KXDA 1IS6A 3GBWA 4HPKB 3SH5A 5IK7A 4AHYA 4L9BA 1NOVA 1S2KA 3B5LB 3ZXJA 4IEYA 3NV4A 5JI7A 4FT8A 5KHHA 2BTVC 2XJRA 1EV11 1CAUB 1X33A 5BUVA 1S2BA 1D4M2 3WHUA 4SBVA 4XQDA 4A2UA 1MS8A 1TME3 2ZGKA 5FOJB 2WIIB 4RD7A 3PTYA 4LBLA 4HKOA 4AEDB 2R072 1Z7S1 2XWBB 3NKTA 2PLV1 2BVBA 2VW0A 2ZZQA 1IOAA 1PZ7A 2PHLA 2GN3A 3THPA 5D8AB 1SLIA 4IEWA 4HSJA 5JOXA 1OPOA 4Q4X1 2ETEA 3DUIA 2E53A 2QUOA 4MGZE 2R043 3TWIA 1DQ5A 2I07B 3WY6A 3I7DA 1FMD2 1VP6A 4QT6A 1PO13 1CQ9A 4ATEA 3I59A 1JBCA 2Z2SB 1QJY2 4JVAA 1XQNA 2AREA 3JD72 1RVF2 1OA2A 2R49A 2YHJA 3B94A 2EAKA 4RGAA 1DQ2A 1QJX3 4XHXA 5BXXA 3O5SA 4YW1A 2WZR1 1AYN3 3UL2A 1HRI1 4UXAA 2RE9A 4IETA 5FPZA 5JSPA 1ULCA 2BQPA 5H9RA 1BK1A 2DCJA 3TN92 2ENRA 3VBSA 2VECA 3AP6A 4NWVA 3USUA 3SNMA 1VAKA 4NHLA 1A78A 4DY3A 4L2NA 5CNAA 3ZYJB 4XOGA 4CYDA 3KSCA 4E4DX 1OSGA 1EV13 2V5YA 1SMVA 5A3MA 1N47A 1YO8A 2JG8A 2YYOA 3BTAA 4FPGA 3VDDB 2BNNA 2GNDA 1VAVA 2K2SA 4HK8A 5CFDC 5CFCA 2R0FA 3KD4A 4Q26A 4XXPA 1Z7S3 2ZACA 2PLV3 1DQ6A 1W6OA 4CEWB 3RMXA 4YM3A 2Y26A 3NAPB 4Q4X3 2XGXA 3VN4A 4WM8B 1YUDA 4Q4V1 2DCTA 3PVEA 1IPKA 1QY4A 4F7ZA 4LUMA 5KXBA 1X50A 2WQZC 1SDWA 3BCWA 1AR92 2Q1MA 3NL1A 3POWA 3KGLA 5KXCA 1FX5A 1NXMA 1W0OA 3FLTA 2RM22 2D43A 1AR81 1PGW2 2D6NA 2WZR3 5IK8A 1V9U2 1XNBA 1HRI3 4EN7B 1YXWA 1YFXA 4INDA 1WLCA 3H3ZA 3WUCA 2WINB 4Q4Y2 3VBFB 4YM0A 1RUJ1 4L97A 3VZLA 1AX0A 2VNOA 1PK6B 1V6MA 1EP0A 2RMU1 4RS5A 5DG1A 2ZHKA 4NOTA 3ZN6A 1RHI1 1WD3A 4Q0PA 4YM1A 2ZAHA 3LB9A 3PNAA 4I3GA 2XJTA 1H9PA 4D94A 4YVWA 2EXHA 1JYCA 2ZX2A 1UPIA 5JIUA 4I3PA 2R062 1NCQB 4AI8A 5BNNC 5AFBA 4I30A 5J3UA 4P9GA 3KS7A 4K20A 4BQ1A 1W6NA 4JDMA 2BW8A 5EV7A 4YZ5A 4Y24A 5JZGA 1H8TB 3DPRA 3ZFGB 1PZ9A 2QKDA 1RC6A 1R082 2VG9A 1WLTA 1H1AA 1NE6A 4E4SA 5GLTA 3FX3A 3RMYA 1N1TA 3GBGA 4Q4V3 3SLIA 1H2MA 4E4ZA 1IPJA 2PHRA 4I0BA 4YGBA 1OLQA 1AR83 1OPMA 1R092 2PTMA 5I0SA 3ZFFB 5FRAA 3WHTA 4AE2A 1AYM2 3S7EA 2MEV2 4NO4A 1HX6A 2WFPA 3ZXGA 2AH2A 1MS5A 3GYDA 1Q8VA 1RUJ3 2O8QA 2GC1A 3WDWA 4PIZA 1BZWA 5FQ0B 1REEA 3AYEA 1GR3A 2RMU3 4HMZA 2W39A 2A7AA 3DN7A 4RQPB 2WFF2 1HDKA 4AQ6A 2VVFA 1UU4A 3G7DA 1RHI3 1LHVA 4YVSB 4BWOA 3J26N 1QOOA 3O7OA 4TLFA 5CG8A 1PM7A 3M3OA 4KBBA 3VL9A 4XJWA 1CONA 2B42B 1IS3A 1ZRDA 3ZSLA 1FMD1 4CDXA 3ACLA 2UY8A 4N7IA 1RINA 3VBOA 2IFRA 4IV1B