3HD8B

Crystal structure of the triticum aestivum xylanase inhibitor-iia in complex with bacillus subtilis xylanase
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
184
structure length
184
Chain Sequence
STDYWQNWTDGGGIVNAVNGSGGNYSVNWSNTGNFVVGKGWTTGSPFRTINYNAGVWAPNGNGYLTLYGWTRSPLIEYYVVDSWGTYRPTGTYKGTVKSDGGTYDIYTTTRYNAPSIDGDRTTFTQYWSVRQSKRPTGSNATITFTNHVNAWKSHGMNLGSNWAYQVMATEGYQSSGSSNVTVW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification of structural determinants for inhibition strength and specificity of wheat xylanase inhibitors TAXI-IA and TAXI-IIA
pubmed doi rcsb
source organism Triticum aestivum
molecule tags Hydrolase inhibitor/hydrolase
molecule keywords Xylanase inhibitor
total genus 48
structure length 184
sequence length 184
chains with identical sequence D
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2009-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00457 Glyco_hydro_11 Glycosyl hydrolases family 11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3hd8B00
2DCJA 1XNCA 1HV1A 1XNBA 1UU6A 2BWCA 3VZLA 1REFA 3O7OA 3VGIA 2BW8A 1UKRA 1C5HA 3AMHA 4S2DA 2JENA 3AMNA 3VZNA 1M4WA 2VULA 3WP4A 3WR0A 1QH7A 2QZ2A 3LB9A 2C1FA 3LGRA 3AKPA 3MFCA 3WQ0A 1REEA 5K7PA 1F5JA 2DFCA 5K9YA 3WP6A 1REDA 3MF6A 3VHOA 3EXUA 1NLRA 3RI9A 4XQWA 1OLRA 1PVXA 2BVVA 3WP5A 2F6BA 3VLBB 1BK1A 1H0BA 3AKRA 1H4GA 1OA2A 3WT3A 3VZJA 3VZOA 1C5IA 4S2HA 1KS5A 2D98A 4HKLA 3AKQA 5HXVA 3ZSEA 4S2FA 2D97A 4HKWA 4NPRA 3WQ1A 3MFAA 3B5LB 3VL9A 1UU4A 2VUJA 2JEMA 2B45X 3WX5A 3VZKA 2DCZA 2VG9A 1XYPA 3VHNA 1XNDA 2NQYA 3WQ7A 1ENXA 1IGOA 4XQ4A 3HD8B 1T6GC 3VHPA 1QH6A 1AXKA 1OLQA 1W2UA 2Z79A 1OA3A 3WXPA 1UU5A 3AMPA 3B7MA 4XPVA 3VZMA 3MF9A 1H1AA 4HKOA 2BWAA 4XQDA 2VGDA 2B46X 3WY6A 2DCKA 1KS4A 2DCYA 1BVVA 1TE1B 2DFBA 3WP3A 1XXNA 2NLRA 1HIXA 1YNAA 4IXLA 1OA4A 3AMMA 4S2GA 1H8VA 4HK9A 2QZ3A 1XYOA 2B42B 1XYNA 1HV0A 1H4HA 3VL8A 3AKTA 3RI8A 4H7MA 5EJ3A 3M4FA 3AKSA 3AMQA 1XNKA 1BCXA 2JICA 4HK8A
chains in the Genus database with same CATH superfamily
3H1YA 1XNCA 4COYA 3VD3A 5JWPA 2HWD1 2WL1A 3OBRA 4RHV3 4A4AA 5HCAA 2Y6GA 3BU0A 1K5MA 5LY2A 4PJYA 3ZYGA 2W9XA 2IC1A 4XBLA 1UZ0A 1H30A 1V9U2 1DG6A 2EXIA 4LTAA 5ABJA 1AL21 1PIV1 2P2KA 1JYWA 3MYXA 1VMHA 2JENA 1V6OA 3OG2A 2E7TA 3FFZA 3EMRA 1PGSA 1QOOA 2IVJA 3AFKA 3VBSA 4PHZA 3LFMA 2J1VA 3VBSB 1NCRB 2BJSA 2B9UA 4JAAA 4Q4V1 2VPVA 3NNLA 4YLZA 3UYJA 1RUH1 3WDYA 1OUSA 5JIUA 5C3SA 4KWKA 5LK5A 4ARYA 4EROA 2HEWF 1HRI3 4LBQA 3WV6A 4CXWA 4M3CA 4BK4A 4DEQA 5IVVA 4OMDA 1QQP3 4CCEA 4ASMB 1DGWA 4WVMA 1NLRA 3RRDA 1W0PA 5LRRA 2AENA 1PVXA 4XYXA 4FFHA 1EYBA 3VDAA 1VBA1 4CDQB 4G3YC 2YFUA 2BQPA 5CFDA 3WDUA 2AGSA 1NKGA 3O0WA 3BVCA 1ZBA2 4LKEA 3AC0A 2FCTA 3HNYM 3WZ1A 3ZX7A 5GZCA 3I2JA 4QX3A 4K8RB 3T4VA 1HN1A 3BOPA 5CIRA 3SEPA 1YQCA 2DURA 2HWB1 3VHNA 1KITA 1OXCA 3ROUA 5F5QA 3U11A 4XJAA 4CUCA 2I74A 1UMZA 2ZKNA 5J7MA 3U10A 1AR63 4PLNA 1VLNA 2RS12 1UY1A 2R1BA 2WFF2 1DF0A 1PVC2 4NMIA 2E32A 4OMCA 2HYKA 3RZKA 4AHXA 1NZCA 3ATGA 1PO11 1JZ5A 1JUHA 3GJAA 4KG8A 5C5TA 2RJKA 3V65A 2EXHA 3WUDA 1Q8VA 2BPA2 1L3JA 3I2KA 2Z79A 4JKLA 3WNOA 2Y6FA 5A32A 3V0BA 5ISLA 2RR13 2A73B 5B4NA 2R49A 2VUCA 4GKYA 1ZZBA 4FPKA 1KFUL 1C28A 2R30A 1YUDA 1X8MA 2BWAA 3J7NA 4FQZA 5JOYA 5FZ7A 3VDBA 2Q1MA 4PDWB 3HVDA 2ZHKA 5ERLA 2QQNA 1N1TA 5BNPB 3M2MA 4M4RA 5EQUA 1KJLA 1VJ2A 2E51A 4BIOA 5F3CA 3ZDVA 4YYOA 1AR62 5KHKA 1RUD3 5EJ1B 2ET7A 1VBE2 2OVUA 3TBDA 5JCTA 2WLQA 1YEWA 5D1IA 5A7SA 2WS93 1PMIA 4XFFA 1PX3A 4ATFA 4E27A 1G7YA 1RUC1 1OMIA 2GZWA 4JGYC 1KXGA 4NE9A 1DU3D 1OH4A 4GMP3 4JTOA 3DPRB 1W04A 2ORXA 3NKGA 3T0AA 2K9ZA 1AX2A 3OBZA 1A8MA 2QDRA 5B4XA 3RYKA 3ZN6B 4DUWA 2JG9B 2W95A 4FXKB 5BNNC 5JOXA 2R042 4K20A 3LD8A 1MPXA 3IMMA 2WQ4A 5A7OA 1O3SA 2XQRA 1AYM2 5FZMA 2BWCA 1RUC3 2VNVA 2VQUA 5FYSA 4QU2A 1LCLA 4W8JA 4R9AA 2YUEA 4U36A 3L2HA 4I02A 2RJLA 4P00B 3GCWA 4YZ1A 4AI0A 1AXYA 1I6XA 3IIIA 1UY2A 2E7QA 4XIKA 4UAPA 2VULA 3WG2A 4RR3C 5A7QA 3WR0A 2P34A 1LENA 4TTGA 1CAUA 2BNNA 1GKBA 2HH9A 1G9FA 2XBO1 1EPWA 1ACCA 2R32A 3J7LA 4URAA 1O7FA 3JD73 1XPWA 3S5QA 3BTAA 2RDSA 4GA9A 3UL2A 1OQEA 1J59A 4QQOA 1AR93 3PMEA 3DYOA 4OUMA 4ITCA 3LIGA 4QDRA 2JG9C 2W1UA 4XQWA 3PU3A 2XJPA 3M3OA 5FUPA 2D7FA 1DHKB 5I8YA 3POYA 2V72A 1G9AA 4NN0A 2LW8A 3WT3A 1PO13 1YFYA 2FCUA 4M01A 3E5QA 1ZRCA 4JGYB 4IE0A 1YQ5A 1VPHA 4XABA 3PJQA 5FREA 4XTMA 3POBA 5CB7A 4L8QA 1CX1A 4GB33 4PBOA 1BXHA 5T5PA 5A3UA 2HKXA 2RS31 4M0NA 1RUE3 3W58A 1R1ZA 1UZVA 4YNIA 1OT5A 3EYPA 3JD72 5CFDB 4CDQA 1OKOA 1PIV2 1DGRA 4YGEA 3AZWA 1VIWB 1UX6A 1U0AA 2A75A 3DKWA 1OUXA 3LKJA 4UFKA 4M3CB 4ZONA 4IEYA 1RUH2 1FT9A 5FK7A 3SHRA 2QNKA 4QXKA 1BKZA 4CP1A 2ZKLA 4GJZA 2C6SA 2QQKA 4ISRA 5CKMA 3L2YA 2JDNA 3LIHA 5T5OA 4Y22B 3USSA 5BNNA 1S0BA 3AMPA 4BH9A 3WF3A 1H8TB 2RS53 3FWEA 5IVFA 2PFWA 2YPJA 1X7NA 4HN1A 1CAXB 4XF4A 3N3HA 4YM2A 4QM8A 3W21A 5FO8B 2IFRA 1RUOA 4A3XA 1A8DA 1Q8OA 2VOWA 2VC9A 1VAKA 4JCKA 3OBTA 2PHDA 3SQOA 5FUNA 1NXMA 5BNPC 2DUOA 3BTYA 3RMXA 2CU5A 2C9AA 2C9KA 2WABA 2XGXA 4LKSA 1RYYA 3BPZA 3N4MA 3CLPA 5BNOA 1XYOA 2WIIB 3M8LA 4P9GA 4AL9A 3VB9A 3ZPOA 5JR2A 2VMEA 3AKTA 5FZHA 1PK6C 1S0IA 4NHMA 3AYAA 3M4FA 4FCAA 1KDMA 1UZWA 3HIFA 4M3CE 2XBO2 2ZGNA 4B29A 4FP2A 2YY1A 4GAZA 3AMQA 3T30A 3FJSA 3RZMA 2RMU2 4FFGA 1QDOA 4CXXA 4LHKA 4QQHA 1ULPA 1IPSA 5FZ1A 3ILFA 3TEYA 1GOFA 1JXNA 2D93A 4GWNA 1ZRDA 2Q30A 3HT2A 1GWKA 1HXS2 1QGLA 2WN3A 2HWC2 1UCXA 5EXOA 4DB5A 5DUVA 1W6QB 4DY3A 2WAAA 4FPJA 4GULA 1ZRRA 4MH0E 4Q4Y3 2E9QA 1CR7A 1OI6A 5A7NA 1B35C 2OT7A 4RGKA 2JX9A 4GIQA 1VRH3 3ZO0B 1DLCA 1KEXA 4AE2A 1ZX5A 2PA7A 4XF9A 4LO6B 3SKVA 3TN91 2UURA 4YW4A 4B8EA 2VZUA 2VUDA 4GZ9A 5A33B 3LB9A 2JXAA 4CRQA 2MEV3 5HV4A 3IAQA 1JTZX 4DUVA 1XE7A 5A3MA 1OPMA 3GM8A 4QDSA 3ZFFC 3DV8A 2WKKA 2WFPA 2BZDA 3PVOA 1MR5A 5F2WA 2VVDA 2KM2A 2XDVA 4PQ9A 4LA2A 1JI6A 1RUJ3 4Z07A 2HYXA 2V4AA 4FQ4A 4AGGA 3PTYA 1POQA 1GUIA 2PHUA 5CFDC 1BK1A 1VBC3 1W39A 4UWDA 2DU1A 2HWE1 5FZEA 3RG0A 1MZFA 2TNFA 3C2UA 4LBMA 5DAVA 4ARXA 2OPKA 5JMOA 3ZFEC 2QBXA 2ARCA 3C7FA 1EP0A 5B2GB 2AR6A 3GXUA 1PM4A 1BLZA 4YZ4A 5AFBA 5HCHA 3H7JA 3HQXA 4RA0A 2X10A 1AR72 3MIDA 4Y20B 2VZQA 3DXUA 3KMHA 4XDQA 5K4LA 3TEXA 2WLPA 3R0RA 5SV5A 3GDBA 1O4ZA 1GWLA 3DPRA 3WW3A 2WNVC 4BXSV 3KCYA 1MS5A 5FCCA 4UFMA 3K4AA 4CTEA 1W8TA 4PI2A 4IEUA 4C0BA 2ZPXA 5FP7A 1O59A 2KA3A 3GHNA 4IGOA 3WF0A 2ZZQA 4AI2A 2CTVA 5FMOL 3MZHA 4A6SA 4P9LA 2XR4A 5G05L 4GWIA 3C7GA 3SXWA 1X9TA 4Y3OA 3MPBA 3I2IA 4HLTA 2PHWA 3TNPB 1UMIA 3ZM8A 3D3AA 5FP4A 3JBG2 4XCAA 2A6VA 5APAA 3D8CA 5FY0A 4GJYA 4YW5A 4EWEA 3IMNA 4OHWA 4EN8B 3AX4A 1BVVA 4FPHA 5GZEA 2IXKA 1X82A 2VCBA 1YO8A 2E6VA 5CYYA 2V09A 2X5IC 1ODNA 4DNYA 1JHNA 4PIXA 2Z69A 5JUVA 4URTA 4E8DA 4WBBA 3NL1A 1EAH1 1W90A 2JE8A 4E4DX 1Q8SA 1QJZA 3UGFA 1NOVA 1SBDA 5IK8A 4Q29A 5F8PA 1SPPA 3I97A 5EWSA 1TZOA 4JHTA 4LLOA 5A6ZA 2P3IA 3V0AB 1R1A2 3OPTA 4C1WA 5FY8A 2W87A 2WT2A 3HN1A 2V4VA 3RYRA 4AFMA 1WW4A 1FMD3 1C3HA 1ND3A 2K46A 2JICA 1UWWA 3A4UA 2YDEA 3KCCA 1WCDJ 2D3RA 4UT5A 3FBYA 4YFWA 1MEC1 2WZ8A 1KRIA 5FYTA 1A6CA 3POJA 5DG1A 2R061 3O5SA 4X8NA 2GU9A 4IQPA 4JGZA 4EYUA 4QB2A 1G9CA 4QPIC 3BI3A 1LNSA 1JYTA 4XJUA 3LE0A 1LOAA 2WYFA 5JI7A 4HSJA 1ENSA 3FLTA 3RZGA 2TBVA 1QJU2 5F3EA 1WBLA 3VKMA 1GP4A 1HRI1 2IUWA 4ZS3A 1XQNA 3HQRA 2P6HA 5GZDA 1QEXA 5LEJA 2YC0A 3DGTA 4V1PA 1HQNA 1X8EA 1DP0A 4CU8A 1K45A 1VAVA 2A3XA 2IXCA 2RDQA 3FUOA 2C24A 2RM22 5FZLA 1HQLA 3NJZA 2R072 1LOFA 3CNAA 1CAXA 1IQDC 5E89A 1Z7S1 4IERA 3GALA 3THCA 3OGJA 3MF6A 1RL3A 2PMWB 1PK6A 1X33A 3KT7A 3K4DA 4NRMA 1N3OA 2HWD2 5KC5A 2BVVA 2D43A 3JZVA 4OVEA 5L7OB 1H0BA 4DY5A 4E2QA 1AR71 3VZJA 4D7SA 3F2ZA 4OUSA 5KHIA 3OCPA 4L99A 4PCRA 4B1LA 2BGPA 1JBCA 1GZCA 5EYYA 4IDZA 4CUGA 1HB1A 4UBGA 1W9FA 4HKLA 4UF0A 1J58A 2ENRA 2XMLA 2D97A 2XLAA 4LBOA 1ZZCA 4Y4YA 2F4LA 3Q8EA 2A71A 4IV3B 3KF3A 5BPXA 4CP9B 5BNQA 1NQJA 3D5OA 2CL2A 3KM5A 1E57A 2NMOA 2RM23 4E9KA 4QMAA 3ITQA 2VG9A 3FZ3A 3SISA 4TLFA 2VNGA 3UETA 3HWJA 4D7YA 3WW2A 1PO22 3WQ7A 1CN1A 4QU1A 4W65A 1IGOA 2WS91 3OYWA 4CU7A 3KCXA 1W9TA 1GQGA 3K75B 1FNZA 1U5XA 2VNOA 1W6NA 4NR1A 4OQ9A 3HQUA 5ACA2 2X5IB 5DDJ3 1SBEA 1VMJA 4DMIA 4Q4Y2 1HKDA 4WVVA 5A3WA 3ZR5A 4OHXA 5IAVA 3ENRA 4QQ2A 3ZSMA 2W1QA 1ZNPA 3VUOA 1WMDA 3B7MA 3J9SA 1Y4WA 3KVBA 1YYNA 4CU6A 5CNAA 2Q0AA 2ZMKA 5GZGA 2CWMA 2E31A 1W9WA 2ID4A 1PGW2 3P6BA 4XFHA 4NAMA 5GLTA 3IPVB 4LOTA 5D8AC 1J3QA 2XVLA 4XUOA 3WY6A 1HN0A 5LRSA 3WG3A 2PN5A 1ALYA 4FFFA 3ES4A 1R64A 4I0AA 2DUQA 3VBRA 3QD6A 5IVYA 3H3UA 3CJXA 3MUY1 3PUAA 2D6LX 1RUJ2 4XZPA 2OKXA 2QQPA 2E63A 1NCQB 2HBTA 4N53C 2RMU1 2YBKA 3RMYA 3WHUA 2A6YA 3G7DA 4HOOA 3WQBA 3GF6A 4HONA 4N8MA 4PLMA 4NVPA 5CKNA 3M1HA 1D4M1 2Z5WA 1US2A 4UYBA 3ZFFA 2VBPA 1RUE1 4QHZA 3SNMA 5C5UA 4MGIE 1KJRA 1OC1A 1R091 3M3CA 3OUJA 1I5ZA 4YM3A 1QJFA 1QXJA 5T5LA 3ZN6A 3PDQA 3PUHA 4WV8A 1Y9QA 3UKNA 4PIYA 5ABJC 1IG0A 2WC2A 1OHFA 5FZCA 5FZ4A 5KWRA 1BHGA 2XJTA 5JAXA 1REFA 1UXZA 2WO3A 3VBUB 5LWBA 2IXIA 2R071 3T1LA 3NKTA 1AJKA 5F39A 1RVF1 1CZVA 1GSLA 2QDNA 1V00A 3PIJA 4DINB 1CQ9A 1WWYA 4ZS2A 2J1AA 4CCDA 4Y24A 2VCCA 1RMU3 4DO0A 1BJQA 4IGQA 3IKWA 3RZZA 1JN2P 4E2SA 3O1PA 4XUNA 2WBKA 1YFXA 1JU3A 5JXJA 2QZ2A 4YVWA 2FDHA 1N1SA 2EXJA 2DF7A 5EP9A 2CGPA 4Q0UA 3LGRA 2ORZA 1MQTB 1W8FA 3LEMA 5A7PA 4PDWA 2RS51 2J1UA 2PAKA 4Q0VA 4Q4V3 1UXXX 3FFQA 5FJKA 3VHOA 1W8ZA 4TZDA 4GWJA 4AHYA 4DPNA 1LAJA 3Q9OA 3FL7A 3M3IA 1JYNA 2VQTA 1AR61 4AZZA 3POIA 3RJ2X 1GANA 1QNYA 1H4GA 1OA2A 4GXLA 4I0BA 5ANQA 1K5JA 1PIV3 5T50A 4M0HA 4R9DA 4F7ZA 2EIEA 4OI2A 1RUI2 1MS3A 1YI7A 1Z7S2 2EVXA 4R9CA 4XBNA 5FZOB 4EZHA 2GSYA 3UV9A 1RUC2 3AKQA 1PZ7A 1JYVA 3GYDA 3A22A 3N36A 1WCKA 4NPRA 3FN9A 4NUBA 3JQWA 5FPBA 5HBAA 3KB5A 3AZYA 3GNEA 5CEHA 1TME1 3APBA 5LK7B 2XJQA 5JDBA 2R1DA 3GZAA 5JOZA 2PHLA 3N9NA 3LF7A 1XC6A 4JDMA 4COUA 4RN5A 5F9TA 3I49A 2OXBA 1MZ6A 4OHZA 3LDKA 1QJEA 1RUF3 4A44A 5KXBA 3USUB 1F9KA 3DXTA 1RUG2 4GMP0 4LJHA 3MIHA 1A78A 5J09A 3I3QA 5AC91 2IFWA 5FYMA 4COWA 1O3RA 1JODA 1SG3A 4LT5A 1S0CA 2DVBA 1ULEA 4ZPIA 1YCIA 2QTWB 1H1AA 4Y1ZA 2HWF3 5A1LA 4AI3A 1BMV1 3B94A 2IZWA 4LBQB 3W20A 2ZHMA 3AP6A 1AYN1 3FUQA 5A3OA 2OS2A 3QCWA 4XJ8A 4CU9A 5LA1A 1NA1C 2Q1FA 2VOVA 2EF6A 3ZSLA 3BGAA 3AYEA 4AQ6A 1HIXA 2EALA 1NE6A 1CAVA 3IIAA 4JKMA 4K1YA 4BHPA 3S7EA 2C5DA 2XJUA 2HWD3 5F6KA 5LA9A 2TUNA 2Y64A 1FNYA 4DS0A 5J96B 3ZXJA 5EHDA 1NA1A 2E7AA 1HXS3 2ZGUA 2LALA 3ZYRA 2XXZA 1OOPC 2BBAA 4D8MA 4I30A 5EJ3A 1W9SA 3AKSA 2FCVA 2Q4SA 4RS5C 4LXLA 1IZ3A 4COZA 1IKPA 1JZ6A 3T0DA 3K3OA 5FPXA 1FOD1 2HWF2 3H1MA 3NSTA 2EAKA 3ZXEA 4UFIA 1TMF2 5FLIA 1YQ6A 2XUEA 2HJIA 4IGPA 5FO7B 3BKZA 4RS5B 1HV1A 4WZCA 2MEV2 2Q1ZB 5A6YA 1QY4A 3OBAA 2ADEA 1JUIA 3WHTA 3O7OA 3BTXA 1ZBE3 3N7LA 1W2TA 5CISA 5F3GA 5F3IA 2BGOA 3GCXA 5T5JA 5FOBB 5FZGA 1X9PA 2OZJA 1JU4A 2DVFA 4IV3A 1MS9A 3H3ZA 4CP9A 2VMCA 5L7OC 5FXVA 1LOBA 3VBHB 2JDHA 4BMBA 3NNGA 4MZUA 2ZBJA 4A6OA 4UF0B 4ES8A 2WT1A 4KU7A 1CPNA 1N1YA 3B00A 1GOGA 1RMU1 2P17A 5CADA 3IZOA 5GM0A 5JIAA 4AVTA 4CCOA 1XU2A 2BFUL 4CUAA 4FI9A 4XJZA 4LITA 1LR5A 4ZXKA 3KT4A 1S0EA 2I2SA 1RXGA 3BCWA 3ILRA 4AI9A 2D6KA 3LWCA 4J25A 2DV9A 4DZGA 2I45A 2YBPA 2OUJA 1XOYA 4QDQA 1PHMA 5KXDA 4Y1YA 4P5YA 1VAMA 2HWE2 3MI8A 5H9PA 3WW1A 2WN2A 3ZFGB 4QPYA 4XURA 4D6SA 3UKVA 1SMVA 3VKNA 2WNVB 2YFZA 1C5IA 1CGPA 5HXVA 2GNDA 4JRLA 3E6BA 1UNBA 4S2FA 3I59B 3WQ1A 1NLQA 2HWB3 2XJRA 3SCFA 3OTFA 5C8CA 3OD4A 1FOD3 3N35A 2WDBA 3ZLIA 4AW7A 4BZ4A 2DUPA 5FPAA 1F15A 3RJRA 4BU2A 1ASJ2 4IV1B 4H14A 3O1UA 2PQSA 4K6BA 2W1SA 3DECA 1LOGA 1ODMA 3A0KA 4H7LA 1YXWA 3VDDC 4FO9A 5FO9B 4XILA 5DAQA 2P6CA 1GNHA 2A6WA 4DXZA 5FYHA 2VNRA 4XQ4A 5FUIA 3DYPA 4CDXC 3O1SA 4MYEA 1DYPA 1QXRA 1WA6X 1QU0A 3AYCA 1YHFA 4IW3A 1ND3B 4P14A 4HANA 1YIFA 4AAPA 2J1EA 4N9IA 2A6ZA 3P3PA 3WDWA 3VHRA 5A1FA 2EIDA 4XW3A 2ZGOA 2ATFA 1S0GA 3FE5A 5CBLA 5C4WA 4BQ3A 4XQDA 4JGYA 1UX7A 2ZGQA 1W03A 4COVA 4Y26A 5FBJA 4NPLA 2O14A 1UOJA 5FZAA 2QE3A 1ZBA1 4BPZA 3SH3A 3S57A 3ME2A 5IUQA 1DZRA 3O1RA 1S0DA 4KI5M 4KMQA 2QQIA 4A41A 3DEMA 4TYSA 1LOEA 2B42B 1A34A 3VKLA 3N7MA 2WZR2 5M0TA 4H7MA 1W6MA 2CGOA 3MLJA 1CAUB 2HWC1 3WNMA 1QJX2 4XFGA 2FDIA 2Y34A 2WNEA 3BN6A 5F5IA 3IDEA 1NT0A 2X09A 2PLV1 3I3DA 4QGMA 2PLV3 4PIZA 5JZGC 1BQPA 3MIBA 2B9VA 2JKXA 1JYIA 1D7PM 1R081 1ULDA 2FZ2A 5FZDA 2P37A 1VBE3 4IE7A 1XJAA 4AEKA 2VO5A 3E5UA 4UW5A 2CWSA 1OBNA 2QJVA 1GNZA 2NM1A 1Q43A 3MV01 3RYPA 1N3PA 4JC1A 2UU8A 3ZFEB 2ARBA 3J8F3 4YRDA 5HV0A 4OQ8A 4G9SB 4QXCA 5I0DA 4S2DA 4X8PA 4BE3A 4QX8A 1NCQC 3VZNA 1A3KA 3TNQA 1Z78A 2D3SA 3N7JA 5FIXA 4LKDA 5JXIA 1W0NA 1WBFA 3T0BA 1W8OA 3MEPA 5JPMB 1AYM3 3PUIA 4B3NA 3IBMA 1IG3A 1RITA 1CONA 3GZTB 4IEQA 5ANNA 1YLLA 1NCRC 3FLRA 3I7DA 3NNMA 2LM3A 5GALA 5A7WB 5A1AA 4NROA 3PVEA 2XWBB 3WP6A 2ZX4A 2R6QA 2GMMA 5DUWA 2K0GA 4RFT0 3B9CA 3OUHA 4P02B 1LHUA 1JZ4A 2VZTA 2W92A 4PQQA 3H8RA 2G9FA 2XVGA 5BYNA 1HJGA 3W5NA 1E5SA 1F4AA 4K40A 5BNPA 2XL9A 3ON7A 1MEC3 1QJU1 4E4HA 2YC4A 5DUXA 5C70A 2BP6A 2Y6HA 4XIOA 4UW6A 1ZZ8A 5CZKA 2ET1A 2I07B 4OZOA 3U4XA 4YVWC 5A32B 1DZTA 2BNOA 3BPSA 4BCUA 2DCZA 2WNOA 1UW8A 3FHQA 2D3PA 4KG0A 4OI1A 3OD0A 1UL9A 2LS6A 1H2MA 5GJ6A 1LU1A 1OKQA 1POV3 1RXFA 4IV3C 4LPLA 5EPAA 3IN9A 2AREA 3E6DA 4YM0A 1TMF3 1IS4A 3X29B 4GD4A 1OSGA 3EO6A 4MGKE 2IWGB 4JGZC 3O0XA 3VKOA 1K42A 3HD8B 4LHLA 4V2VA 3TEWA 3LEGA 1CIWA 4DFSA 4AQ2A 4AR2A 3EHKA 1ZBE2 5BV6A 3AZVA 5C9AA 1O5LA 3WXPA 4QGLA 4MHRA 1COV3 3VKFC 2EXKA 4CVUA 2UYBA 1HRI2 4HXCA 4EV0A 2XOMA 4O65A 1OVPA 2CAUA 1HJFA 4JZRA 1X50A 3F95A 3CU7A 3ZIWA 3FX3A 4FTEA 5DZGA 2DCKA 4MLOA 1V6MA 2DCYA 2MPFA 1AX1A 1O8PA 2VU9A 4GH4B 4WZFA 5FPVA 2EAAA 5GLVA 3MO4A 2G4IA 3OB8A 4HPKA 3I2GA 4L11A 4N43B 1W6MB 4NHYA 1JOBA 3PLQA 2NLRA 3BALA 5A80A 2VZOA 2SBAA 4OUEA 5DDJ1 1W99A 4FAGA 4Q4X1 3JB8A 1DIWA 1W2NA 4R8HA 3VV1A 1YRZA 1NAEA 2OPWA 2GNBA 3I8TA 4Q1RA 4NRPA 2VQ0A 4RGGA 3RI8A 4GALA 3K51A 3JQXA 1NCRA 2ZAHA 3A7QA 5H9RA 3RWNA 3VN4A 2D40A 4I0WB 5BNNB 4QPGC 1DQ1A 3POSA 5BXXA 4H3WA 4RR3A 2RM21 1UPSA 2VW2A 4HFSA 4RQPC 5JMCA 5DABA 2QCSB 1WD3A 3MLLA 2HWB2 3BU7A 2D6OX 1WKYA 3VBFB 2WFF3 3VBSC 1AUYA 5IW0A 3ABZA 1PVC3 2AC1A 4AGRA 1DGLA 3T4HB 2RS11 1DZQA 4LBNA 1ONAA 5T52A 3SCHA 4AK3A 2ZX1A 1W2AX 4AEDB 3ES1A 1VBB1 1O4YA 1RUNA 4AEDA 1V6KA 3GZEA 1CJPA 4YVSC 1Q8QA 4B4QA 5C6CA 5L36A 2W46A 3H8OA 4XCBA 1RUI3 2ZGKA 4MGQA 4AQSA 1LHVA 5F6LB 3ALQA 2PAEA 2QQMA 1LTEA 4FSJA 4QHBA 3VBOC 2BOIA 2XJSA 4AEJA 4EN0A 5K9YA 2QKDA 4ONUA 4XHBA 3POEA 3ZYIB 3U78A 2O1QA 2NN8A 1DQ4A 3AXDA 1PZ9A 1PMJX 2DBIA 4LUMA 1SHWB 4YW1A 3JBG3 2W08A 2G19A 4WM8A 2BOJA 4MOAA 1RTVA 5A70A 3AVSA 4AOCA 5JSRA 4NWVA 3M70A 1TME3 4GH4A 2JEMA 1RUG3 2B45X 3WX5A 3IT8A 5K0UB 1C8M3 3MW2A 2J7MA 4Q0QA 3OGSA 4AVBA 2L9LA 2DWRA 2UWAA 3I54A 4BQ4A 4FBFA 1FATA 4QB1A 1ND2C 4WVWA 3M3EA 3LDRA 5C9AC 1IKQA 1XBFA 2NQYA 1BVP1 2R0HA 4OHVA 2FMDA 3ZN5A 4CEYA 3Q8FA 4CDXA 1LGBA 1EUUA 2GALA 4Q4W3 3C7OA 1FV3A 4EN6B 1YI9A 2WWUA 2GNMA 2ZA9A 2OX0A 3PTRB 2ZXQA 1OLQA 4UFLA 4EN9B 1SDDB 3VBHC 4RQPA 4YGBA 4BA6A 3NO8A 4IE6A 5FP9A 1OF4A 2TEPA 1QMJA 1L7RA 1NG0A 5C8CC 3NJVA 1C8M2 3KV6A 3LFIA 5FWJA 2F17A 3R05A 5FXZA 4ES9A 3ZXFA 3ZYFA 4BM8A 1COV1 1X36A 3N9PA 4BIFA 3CDZB 2WSVA 1YNAA 4P5HA 2XQXA 3SITA 1PZ8A 5D2AA 4YARA 3AP5A 3JCIA 4XC9A 5L9BA 3VDDB 4S2GA 4HK9A 3AJZA 4Q4W2 3VBFC 3ORJA 4Q5OA 3SEEA 3I2DA 2FDJA 3VL8A 2PXJA 1Z0HA 1H1IA 1D4M2 3VBOA 1XE8A 1PX4A 3EB7A 2ZEXA 2KXLA 4V2WA 3R4DB 1C57A 4N7IA 5A7WA 5IK5A 4KGQA 3S0MA 3V0BB 1UZYA 1BCXA 3DYMA 4HK8A 3TYJA 1AJOA 3QH7A 4QPIB 5EV7A 2V73A 1QQP2 3NAPA 1H2KA 2Y6JA 1AVBA 1IPJA 3MDPA 5FPZA 4A2UA 1OF3A 2Z42A 2Z2SB 3POGA 3ECQA 2P1BA 1HLCA 1RGSA 2H6BA 4W6XA 2JG8A 1UU6A 1DGRN 3AP4A 2PHRA 4FPYA 4K21A 4LIUA 5DXDA 1YJLA 2PHXA 5JVVA 4NIHA 3NV2A 4KBBA 3KZ4C 2VMDA 1IS6A 4N43C 4Q1PA 1QXPA 1WLWA 4ZU5A 1SCSA 1HB3A 4QT6A 1FMD2 1H6YA 1QKQA 3AMNA 5JZGB 4DRRA 4XZUG 4IUGA 3WF2A 3LSDA 2WZPP 1N1VA 1QH7A 5CVRA 5HCBA 3WEZA 5A3PA 3B3QE 2C1FA 2OQ6A 4A42A 1H9PA 2PQQA 3AKPA 4UFHA 1G9DA 2VQAA 3FLPA 2X53S 2XHNA 1F2NA 4SBVA 1Q56A 1ZA4A 1WCQA 4X6QB 2ZEWA 5I0TA 3U4SA 1JHJA 2JG8B 3THPA 4AHZA 1ZA7A 2RS13 4Z2WA 1O3QA 2JDZA 1VBD3 2Y33A 5LZ6A 1VRH1 2OYZA 2CHHA 4LBQD 1HRV2 2W47A 5FZOA 3ZYJB 3NAPB 2VMFA 5IAXA 2SLIA 2GC1A 1N47A 1V9U3 2V5YA 2PHTA 3J8F1 3MIFA 4OULA 2UWCA 1NY71 5H9QA 2JDPA 2YV8A 3DKQA 1MQTC 2G1MA 4KBZA 1HW5A 5FDBA 4FOWA 4YWAA 1CX4A 1WMEA 2WO7A 2GC3A 5LCWL 1MS4A 3MFAA 1GZWB 4M00A 5FK8A 2KR2A 4BXFA 1UOBA 4Q8KA 2PAMA 5AVPA 3CKHA 1OD3A 4UFJA 3HAGA 3RWKX 5ABJB 4HG6B 2GP5A 2VL4A 4BQ1A 4L0PA 1SFPA 2AH2A 1GQHA 3HNMA 2GN7A 2BV4A 1S0FA 1K5MB 1VBD1 1ZREA 1LB2A 2ZX2A 1U5ZA 2XL7A 3MLKA 1GV9A 2IVIB 4BQYA 2BUKA 1G86A 5CFCC 3E1F1 4LIVA 1W2OA 4XXPA 1S4CA 4CE8A 2EICA 3C8XA 2RDNA 2VBDA 4CA9A 1ZBA3 3NRUA 1NXD1 2VOTA 2CDPA 2AEZA 3LA3A 4XFBA 4ZKTB 4ZXEA 4HKOA 2W68A 4L2NA 3QH6A 4EWDA 4MG2A 1XU1A 1OLMA 4QQPA 1DLLA 3UT0A 1WMXA 3AL6A 4N53B 4FOQA 5FZBA 1TE1B 3WCSA 1J83A 1DYKA 3WUCA 3ZKYA 1BMV2 4IXLA 3B02A 5FLJA 2WT0A 1POV1 2P5BA 1XSQA 1LECA 3SCGA 1NLSA 1XSRA 1EAH2 1H8VA 1MS0A 4UI9L 2ES3A 1O91A 3PJYA 3RQ0A 1H4HA 4JHZA 2AYHA 2W1WA 1TVGA 2D6NA 3FBMA 5IJRA 2JD9A 2VE1A 3WNKA 1R1A1 2DVGA 1M06G 2WFF1 1NY72 3HR9A 2ZJCA 1GBGA 4K7JA 5FJHA 2J22A 3UJOA 4IESA 2GH8A 2JKBA 3B93A 4QXBA 3IPVA 1UYYA 1HB2A 1V70A 4LO4B 1JW6A 2P3KA 5J36A 1NUKA 4AFBA 2RG4A 3R6SA 4TLGA 3VBHA 3CL1A 4PT6A 3AZXA 1XNBA 2E26A 4INDA 1UY3A 4OZXA 2Z4FA 1CWPA 4WM7C 1PO12 3NNFA 2C4XA 5LBEA 1STMA 1C5HA 4BLJA 3I2OA 1EAH3 1E5IA 1GWMA 2ZOEB 3CF6E 4OHYA 2Y0IA 1AYM1 2ZACA 2WWJA 4HL0A 2ZGMA 2Y60A 3IAPA 4HN0A 4RS5A 4UOJA 3NAPC 3PVBB 4CSWA 4D7TA 3OSDA 1MEC2 2K2SA 3A0NA 1RHI2 3O14A 3KLSA 1CZSA 1OOPB 4HSLA 1POV0 4L97A 3ZXGA 2R7EB 3IWZA 3UGHA 5I8TA 1RUI1 4Q4W1 3MIEA 4AVVA 2WQ8A 3N9QA 3CJIB 1IHMA 3UKTA 4XAAA 3VD4A 2C26A 4J6GA 2CDOA 5E16A 3W9AA 1WLCA 2P4EA 2VZPA 2Y38A 5IVCA 1NA1B 1YIPA 2NYYA 4MO3M 1VBE1 4XETA 4B4PA 3BODA 3VZOA 4GWMA 1ZBE1 2WO1A 1CAVB 2XH6A 3C7EA 1E5RA 1GZWA 3ZR6A 2D98A 1US3A 2LRPA 3HBZA 4QPWA 5C4WC 1PK6B 2EIGA 2OW4A 3CJIC 3LSEA 4EQVA 2W52A 2VH9A 5L73A 2R16A 2YG0A 1OFNA 4LORA 2KD7A 2DDUA 2VM9A 1NQDA 3LEKA 3TN92 5CFCA 1MACA 5LY1A 1XNDA 4JRAA 4CCLA 1W6PA 3RS6A 2WINB 1QJU3 3GBFA 4B4RA 1PO21 2WAOA 1T2XA 5FKBA 1LHWA 5KR7A 5DMYA 4OI0A 1V9U1 1T6GC 4K1ZA 4FPFA 2XG3A 2HEVF 4LHSA 1AXKA 1NZIA 4XUPA 2NZ9A 4N90A 1V6LA 1BBT1 3JD71 3M3QA 2E33A 3DUIA 2XBO3 5FYUA 2BEOA 3MW3A 4XBQA 1RINA 5C9AB 2DU0A 5JZGA 4XAEA 1EV13 2WNUB 3K2OA 3WINE 4ZY9A 2B46X 3T2QA 3UNPA 3N9OA 2QFEA 2Y26A 2Q8EA 2YU2A 2WNUA 4TN7A 1CESA 4E2GA 2A1XA 3IB3A 4BMEA 3ILNA 1RUF2 1GZ9A 3AYDA 3EQEA 4YW7A 1WW5A 2RR11 3ZSJA 4CP0A 4NJ4A 2VOXA 1KQRA 1SPPB 1VBA2 2VVFA 4Q4Y1 1CIYA 4QB6A 4JQTA 2YB7A 4KWJA 2ZZJA 3VBRC 2A3YA 2JDMA 3TRSB 3ZMNA 2VZVA 2XONA 2FDKA 1JH5A 1SLTA 4UBHA 3LEIA 5FZ3A 1R083 1W6PB 4PI0A 5IVJA 3RDIA 4ASKA 2QQUA 4FPCA 4Q0PA 4MGTA 4NIDA 4FOYA 1RJ8A 2A6XA 3K48A 1UYPA 4I3GA 5LB6A 1H9WA 2GC0A 1ND2B 1Y3TA 4A45A 4ZZ5A 4EZ4A 4XDPA 4JV4A 3KV4A 5IVEA 3GZUC 1BEV2 5FMOS 2D6PA 5CA6A 2JDUA 4YVSB 1AL22 4K3UA 4RL7A 4A7KA 4RYDA 3ZIXA 3G6JB 4CCKA 5KC6A 3PUQA 4CDWA 1ZRFA 2UWBA 2P3YA 1FXZA 1WMFA 1D4VB 2N7GA 4C91A 3U14A 2Y0OA 3R4SA 4AFCA 3KSCA 5LW9A 2ZGPA 1ULGA 1O5UA 3JU9A 1D0GA 2WR9A 1VMFA 4AEMA 3I3BA 2YHJA 4LBJA 3MFCA 4Y20A 3CMGA 3WDTA 3U75A 1REEA 3ZFEA 5I93A 4QX5A 3QBQA 2VD7A 2VOKA 3Q8BA 3I2HA 4FPLA 5HCFA 5IATA 2JIGA 3H50A 4Q0SA 1KGYA 1WA4A 3KVAA 2ZHNA 3URFA 4IEPA 4MADA 3ZFFB 5BNOC 1F8VA 4KH9A 2CAVA 5FXXA 5FZFA 4DQAA 3WD5A 1LHNA 3OOXA 5IHRA 4F3JA 3W59A 4XF1A 4XMIA 1KS5A 2QQOA 4HETA 2A5ZA 5HXMA 1Y9MA 2NMNA 2ZMLA 3WF1A 1B35B 3I4IA 4HKWA 2FMYA 4N7UA 1JS9A 1V6IA 2XLFA 2GMPA 3PU8A 1BK0A 1SQ4A 4AI8A 1SDWA 4OLLA 2W3JA 5FZ6A 2VZ3A 1W0OA 4GKXA 1CD3G 5HI0A 2RS33 4E8CA 3AP7A 1UPIA 2XJVA 3JXSA 3NJYA 2YU1A 1RB8G 1B35A 1WW7A 4A7YA 5FPLA 1V6JA 2BRTA 5JSOA 3RZHA 4BK5A 1RMU2 2ZCWA 1VBB2 1W6NB 2BYVE 3JBG1 3MGUA 3VHPA 1RHI1 5FV3A 3S6PA 5L9VA 3OYWB 1O3TA 5FMDA 1FOD2 2HWF1 1GOHA 2VXJA 4NO4A 5C8WA 1UU5A 2OUHA 1YQ8A 5E1RA 3E6CC 2ARAA 2RDRA 2IXLA 3CQOA 4GH4C 5JXGA 4J1XA 3D4KA 1PNFA 2JWPA 2YZ4A 2BDRA 2G9ZA 2BERA 4FPOB 1VE0A 2YYOA 4FTBA 2X29A 5FXWA 1RHI3 1KS4A 5EJZB 4MUVA 4IL7A 1FPN3 4CDUB 1Y9GA 4UW4A 4YPJA 1NX9A 1W8NA 2RV9A 2LUWA 2VJXA 4QX0A 3RSJA 3U37A 3BOWA 3VBFA 3AP9A 1PNGA 2UYAA 5I0UA 4IV1A 1OH3A 3VD9A 1JZ3A 3KV5A 1JYCA 3AMMA 4HVQA 1OQDA 1VBB3 1SEFA 5C8CB 3PMSA 1JYXA 1WGPA 3LPFA 3TEZA 5D8AA 4Y5TA 4F8AA 5LATA 2OQ7A 3I59A 1PVC1 2XPJA 1DFQA 1UD1A 2ZGTA 4Z8BA 5KBFA 2JDAA 4GB32 1VRBA 1FYUA 5JPNB 3KQ4B 2R041 2BU9A 3LDBA 4MGYE 4WM7B 4GMP1 1UYZA 3OEBA 1VB4A 3QOPA 3RNSA 1FPN2 2VVEA 4N43A 1DQ6A 3NWKA 3SC7X 3WNXA 4I2OA 2HBUA 4L92A 1WW6A 2BW8A 3NV1A 3FMGA 2QVSB 1GP5A 3BYWA 2J1RA 5DN2A 3THDA 4LMFA 4ZU7A 3HT1A 4Q4X3 4ATEA 5JR7B 3UK9A 2VMIA 1M4WA 4BYYA 1EV11 2R062 1OQ1A 2PLV2 2A3WA 5AFEA 3ZXAC 3TB0A 1AYN3 4IEXA 2B39A 4CEWB 4EN7B 4P9JA 5LEKA 5FWEA 2ETEA 1LGNA 5FP8A 2H6CA 4KNCA 1AXZA 1EUTA 2XKOA 3BTZA 2VMHA 1GNYA 3OPZA 1F5FA 3PURA 1PO23 3WNLA 2JIJA 4FFIA 1CAWB 2W0XA 3E5XA 3DF0A 5FYBA 2DYCA 5C3OA 2GMEA 4D0QA 4P9YA 3T09A 2RJ2A 3POWA 3R4UA 3SKJE 4Q27A 4BDVB 2JE9A 2QQJA 1WZXA 4F83A 3VD5A 1W05A 2VBBA 3SH5A 5T3NA 2R063 4A3ZA 2DVDA 3CBNA 1H1MA 1JOJA 1OURA 2WZEA 2G9GA 5T54A 4J1WA 1FAYA 3VZKA 4XMAA 4P9WA 3ETPA 5CFCB 1QJY2 1R082 4FT8A 4LK6A 4YZ3A 1L7QA 2VZ1A 3H1WA 4QX2A 3WSOA 1XYPA 2RMU3 1AX0A 5GZFA 4A7ZA 4IEOA 5FYZA 1JOPA 1SLLA 1PMHX 4LHNA 1ENXA 1HXS1 4XJ9A 1U5YA 5FOJB 2VY0A 4GQ7A 4QX7A 1XB9A 1WLTA 5LA2A 4YZ2A 1MVEA 5E88A 5FYCA 4QXHA 2YC2A 2MHFA 3EBRA 4Q8LA 5FZ9A 3VDDA 1W2UA 4ISQA 1OA3A 4HMZA 2FBEA 3DPRC 5FMBA 4ET7A 4XUTA 5A3TA 1LHOA 1YFWA 4META 5GLZA 4O7XA 1W8HA 3CJIA 4MHUA 4YG0A 3HJRA 5KHHA 3MF9A 1BBT3 3RVHA 2VW0A 4H55A 4YGDA 3LA2A 4FTSA 4FOVA 4BLIA 1ZYBA 4LKFA 4Y5Z0 4MVTA 1OOPA 5DUUA 4KQ7A 1E5HA 1S0JA 2DFBA 1UIJA 3T08A 1CAWA 2BVBA 4W50A 4LUKA 2VR4A 4LBLA 1HB4A 5A6XA 1COV2 4XFCA 1RVF3 1URXA 1VBC2 2YGMA 4MSVA 4BQ5A 1OLME 1YWKA 3VDCA 4RHV1 2CGNA 4CDXB 2VCAA 3T1MA 1QHDA 4RFRB 5FLHA 4XHXA 3MW4A 1S55A 4MGSA 4QM9A 1GP6A 4B1MA 4NIIA 3HPNA 3PIGA 4LEJA 3H9AA 5ACA1 2YMZA 3K46A 3P3NA 5FKCA 5F37A 5FZIA 5KHGA 3HOBA 2ZS6B 1AR73 2HLEA 5FYIA 1DQ2A 3AJYA 3L9JT 1W8WA 3HN3A 3IDBB 2ZEZA 4QGNA 3S7IA 2WUHA 3D82A 5KHJA 3VGIA 1FPN1 2RE9A 1PGW1 4O9GA 1UKRA 4WM8B 5IFPA 3OY8B 1Z7S3 3ZXDA 3NJXA 1W6QA 3KS7A 4YW3A 2B8MA 2F4PA 2W2IA 4YVWB 5A6QA 5E6HA 3K4ZA 3NVCA 2OZ6A 2W91A 4RGAA 3ZPYA 1W6OB 2CV6A 1APNA 3J7MA 4EWAA 5C33A 2B4KA 4P08A 4CDQC 2FDGA 2VMGA 2GH2A 5AC93 5D8AB 3MV11 4BJ0A 3WW4A 2RHPA 4BQ2A 2WS92 3WQ0A 4CDUA 2CSGA 1F5JA 3ZYHA 1RUE2 2Q8OA 4YM1A 4BWOA 4YGCA 3IM0A 3K3NA 1Q5OA 5FYYA 5C3PA 3AKRA 1QJY1 3GBWA 3ACIA 4DOUA 1S2BA 3H0OA 2Q8CA 5T55A 2D5FA 4HVRA 4XFIA 4AWDA 1K12A 2AACA 3ZSEA 4Y1VA 2BGCA 4Y33A 2YROA 3AL5A 1UZZA 2WNUC 4WVMB 1W6OA 4XTPA 1R1A3 2XVKA 1J84A 1HX6A 1YJKA 4KWUA 3ZMOA 5AC92 5KXCA 3I3MA 1AR82 2CNAA 3SLIA 5F1RA 1H8TA 3OY8A 1W9YA 4FXGB 2JB4A 4Y22A 5EFUA 2ZGSA 5DQ0A 3CO2A 2ZTNA 1ZM1A 3WCRA 4CEYC 4XJWA 1D4M3 2B7YA 1J1LA 3CIHA 2J1SA 1TME2 2A70A 5K0UC 3PL0A 2WA4A 4AVAA 1PGL2 3OGGA 3POFA 4CZSA 5GKAC 1JMUB 1UOFA 2VCMA 3WOGA 2VTFA 4IE5A 4UW3A 1D2QA 1OD5A 2WRAA 5C7GA 3RPQA 1JZ2A 4XPVA 3VZMA 3U0ZA 1GMMA 3JUUA 4Z1VA 3HBKA 2XKPA 4CEWC 1GQPA 1AR83 1ULOA 4ZHNA 2VW1A 2FQPA 4MX3A 2R073 3O0VA 4TWTA 4SLIA 4JVAA 2ZAAA 2DTWA 1I9RA 3INAA 2BBVA 1O8SA 1GR3A 1W8UA 4YSFA 5FAXA 3ACFA 2D44A 3FHIB 3LPGA 4G4FA 2JE7A 3AK0A 1LU2A 3KD4A 1IPKA 3WVJA 3ZDSA 1UYXA 5GLUA 3OF1A 3OEAA 4JDNA 5FR3A 1XYNA 3H7YA 3MUZ1 4LK7A 5IVBA 3B01A 3MICA 3N7KA 5AVAA 4DEVA 1GU3A 3PHMA 1K3IA 2WSUA 3NQHA 3Q8AA 3WLUA 4OFGA 2JDYA 4LO8A 4C90A 1WCSA 1LOFC 1DQ0A 1RIRA 2XUMA 3WNPA 1CJDA 3WDXA 3CEWA 1C1LA 4CDWB 5A3LA 3KHCA 1RUG1 5FY7A 2CY6A 3SH4A 4AEDC 5L7OA 1CZTA 1QJY3 2C0ZA 5A3NA 4YVSA 5JSPA 1AZDA 1W28A 4L9BA 4Q26A 3VZLA 4W6YA 1Q8PA 3AZZA 3HNBM 3IDAA 5DG2A 1S2EA 5LBFA 3KHBA 2ZMNA 4FPEA 5J98B 1UIKA 2OA2A 1QNWA 1LEDA 1OPOA 4QKNA 1ND2A 4XUQA 3O1OA 2GDFA 4LBKA 4QKBA 3H8UA 1ZZ6A 3U1XA 2PELA 4NHLA 4LA3A 2MEV1 3GBGA 3N9LA 1KDKA 1EPZA 2LROA 2XHKA 1H8TC 3AFGA 4LOSA 5FZ0A 4QHOA 3A21A 1PGL1 2AUYA 3U07A 1W3VA 1ZZ9A 3NMBA 3USUA 4DUXA 4QPGA 2XLGA 1DGWX 5H9SA 1ASJ3 5C3RA 1LGCA 4MGZE 5K7PA 1BEV1 1I3HA 1LODA 1TNRA 2PYTA 2J1TA 3MPPG 4JGZB 3KF5A 4YW2A 1B09A 5LBCA 5DAXA 4HT1T 5FRAA 1FV2A 4XF3A 1RJ7A 3VLBB 5LA0A 4OYUA 3LZZA 3H42B 4R52A 5FZ8A 1MVQA 5FQ0A 3BUCA 1RUF1 4NAOA 5IT6A 5JI9A 1UOGA 2GP3A 4XVHA 4NHXA 3ZSKA 1C8M1 3HEIA 5SV8A 3OJBA 4CPBD 4CEWA 1FI2A 1U12A 2ARXA 1HQWA 3CZJA 3NV3A 4Y1UA 4CEYB 2HWC3 2DCTA 3B5LB 4NIAA 4B7EA 3T3YA 1RUD2 3BIWE 4QKDA 4HBNA 1FMD1 1VRH2 3D0JA 4AF9A 5K0UA 2QQVA 3KQRA 5BUVA 1NE4A 5G04L 2IXJA 1QDCA 3ZKUA 5I0SA 1ULCA 3MBWA 4BQWA 4P9IA 3WNNA 1OFSA 5F5CA 3NV4A 1Y43B 4OI4A 4PLOA 1OVSA 4WM7A 1ENQA 4IEZA 1ASJ1 1C1FA 2HWE3 4BB3A 4C1XA 3LOIA 1W06A 2Q5TA 1YC61 3D0SA 4FVVA 4Z82A 5KXEA 1GYKA 4Z2AA 1SFNA 1BZWA 1KD7A 2YXSA 4NIGA 1FX5A 4O61A 1F31A 1P8JA 3J4UH 4CDUC 5CG8A 4BISA 3ASIA 1QWRA 5L19A 4UXAA 2B5HA 1DBNA 1UKGA 2VGDA 5FTTC 2HEYF 1XRUA 2JJ6A 4DXTA 1R092 3O1MA 1QJX1 2DBNA 2ZX3A 1D0HA 1DCSA 1YQ2A 4Y5SA 5FMCA 5L9RA 1IS3A 2WZR1 5JXHA 1Q3EA 4KGGA 3WP3A 5LBBA 1PM7A 1SLCA 2PHFA 5FY9A 2JB8A 1OA4A 3NW4A 4CXYA 3J8F2 2RR12 3DN7A 1O6UA 4JQRA 5J1XA 2FZ1A 2P3JA 2Y8KA 4W6WA 1TQ5A 2RS32 3WG1A 3O12A 1HV0A 1G8WA 3D6EA 3QACA 5J3UA 4XDOA 1CVNA 3RZJA 3ELNA 5F7UA 3MIGA 2YPDA 5F2SA 1Y7BA 4AYUA 2WJSA 3SMHA 4KL1A 3LA7A 4I09A 3AVRA 1D2SA 1VALA 5LASA 5EIYB 1IOAA 1QIQA 4AVSA 4KU8A 1NCQA 4NWWA 3ACHA 1JZ7A 1R093 2H0BA 4QD2A 4RR3B 4TSVA 3THTA 2AZ5A 1GLHA 5IK7A 3KV9A 4BQXA 3J7HA 4KWLA 3VBRB 1LKNA 1VP6A 4M3CF 4CDWC 3NNJA 3LAGA 1KFXL 5IWFA 2YBSA 2VZRA 3OPWA 3ZVXA 3GHMA 5C71A 5HPOA 3AMHA 3ZFGA 3ST7A 2JECA 2JG8C 4ORFA 5A33A 3RFRA 1RC6A 3WP4A 3C3VA 5I0RA 2ZX0A 2WZR3 5DAWA 3CZUA 1RUJ1 2VXRA 5FYVA 4LE3A 4N9HA 2PTMA 3S30A 3UJQA 4HPKB 1QQP1 2LTNA 1QJX3 1MS8A 3T2TA 2ERFA 4K8FA 2ADDA 3S5AA 3ZOIA 4LULA 2DTYA 1EY2A 1C8NA 1RUH3 2DFCA 5J37A 1XNTA 1H2LA 1REDA 5TSWA 3KGZA 5E8AA 4B7KA 3RI9A 1QOSA 1DDLA 1OLRA 4XOGA 3ZYPA 2F6BA 4N53A 5DPNA 5IK4A 5J48A 1J1TA 1DYOA 1EV12 1AL0G 4IV1C 4LR4A 4LO7A 5CAZA 3WG4A 4R4XA 4CUBA 4S2HA 4P9XA 2XWJB 2GNTA 2VUAA 1AR92 1VR3A 4XFAA 3I3EA 4CCJA 3FC0A 4PDWC 3VL9A 1C4RA 1QF3A 1UU4A 2MNGA 2FDFA 4W4ZA 5DAPA 5ACA3 5BNOB 4MXVA 4E4SA 4Q4X2 4LLFA 4O9EA 3T2PA 1UAIA 2JD4A 2W5FA 1BYHA 2WA3A 3VD7A 4I01A 3ZFGC 1RUD1 5FBZA 4GB31 1BBT2 2QQLA 4AFDA 4ASLA 3H3LA 1AYN2 2QQWA 2OIIA 3AXEA 5FP3A 4M4PA 5CG9A 1UF2C 1GICA 1MZ5A 1LJ7A 4Q2FA 5F5AA 4D3WA 4FAHA 2CYFA 4X6RB 2ZGLA 1ENRA 3ETQA 3J26N 3RGBA 5I91A 4AHWA 4Z92B 3HMYA 4MXWB 4C8DA 4YZ5A 1G9BA 2WWSA 1N3QA 1CPMA 4LO5B 2A7AA 1GZTA 3AM2A 1F4HA 3TN93 3ZYBA 1G6NA 1BEV3 4CCNA 1AR91 4ZZ8A 2R0FA 4QQLA 4AI1A 2QUOA 1WD4A 2J42A 3ZN4A 3P5BA 3OGRA 2V5DA 4IEWA 4AVCA 4D6QA 2AEYA 4YW6A 1VBD2 4R4ZA 3KWVA 2DVAA 4FP3A 1QOTA 3MHZA 2VECA 1HRV3 5GLWA 1ZRIA 2ZEYA 2FHRA 4XF0A 2ZABA 3DL3A 1TMF1 3JB4C 5EZWA 1IQAA 5FY5A 3TWIA 1WCUA 3BIEA 1DQ5A 2BTVC 1YFUA 3OUIA 3N9MA 4DXSA 1UMHA 3LCPA 1MS1A 2RS52 3A23A 3CHXA 2W94A 5D21A 2BFUS 4DIQA 1UY0A 3ACGA 4CCMA 1W3XA 3B9IA 3C7HA 4IETA 3V0AA 4XE9A 2XB6C 2VAUA 4ZU4A 1TG7A 1IS5A 1XNKA 1AHSA 2H0VA 2IXHA 2O8OA 1LEMA 5JLVA 5IFTA 4QKFA 1XE0A 5DDJ2 1J3RA 2DCJA 4CYDA 1UY4A 4TXWA 1VBA3 1VB2A 2UY8A 1LESA 3LOBA 3ZXLA 1I1EA 4I3PA 4QWNA 2O8QA 4XXAA 1O4TA 1K5MC 3AB0A 1H6XA 4H2AA 1SCRA 4QPIA 4JDOA 4RSUA 2UY9A 4HVOA 4LQRA 3O1TA 3W5MA 2YGLA 4CPBA 2GN3A 4EE2A 3VBOB 3V64A 1SACA 2Y6KA 1WUVA 2D6MA 5FFOC 1AR81 1NYWA 1RVF2 5DZFA 3ZXKA 4R9BA 4WM8C 1MQTA 3OGVA 4QAWA 1AL23 4JKKA 5C3QA 2NP0A 5CU1A 2BNMA 3EXUA 5C4WB 1JZ8A 3BB6A 4D69A 4RD7A 1L7LA 2NPIA 4NPMA 5JOWA 1F35A 1SLAA 3WDVA 1UN1A 3WP5A 1SLBA 3ACLA 2Q8DA 2JG9A 3GGLA 1TEIA 1LOCA 4LNVA 3H8XA 5FQ0B 4LE4A 3QLQA 4PF1A 3VBUA 1ZVFA 3TAYA 5FPUA 1XNAA 4Y4RA 1ST8A 5DZEA 4AFAA 2VUJA 4JX0A 2O0OA 2WO2A 3DCQA 4RQPB 2R043 2ZHLA 4WVZA 1S1AA 1J3PA 4QPGB 2W39A 4AQTA 5IYYA 3M7AA 4PBPA 4EJRA 4D94A 3RZLA 3K77A 4AGVA 4YG6A 2GC2A 1H2NA 5K8SA 1TNFA 4XACA 4HZFA 2GAUA 2EA7A 2VZSA 4JTNA 4NHKA 4NOTA 2JDKA 5EYXA 3UESA 4MV2A 4MXWA 3KT1A 3IDCB 4AG4A 2WNVA 4AAXA 3PNAA 1QH6A 2EIBA 4PF5A 4QX1A 1S2KA 3GJBA 3V56A 4Q4V2 4AXOA 1VBC1 2RVAA 1V0AA 3EJKA 4FPGA 4NRQA 4BOWA 4DRVA 1T6BX 2ILMA 2X8KA 1UO9A 4YFZA 4CP2A 3PUSA 1HRV1 4IE4A 2X05A 3Q8CA 4K9SA 3PVNA 4Y1XA 4YG3A 1LRHA 1ULFA 1V6NA 1ND3C 4XEZA 1SFYA 3TOJA 5FZKA 1SZBA 5BY5A 1WLDA 2E53A 3WF4A 4CCCA 4RHV2 1AF9A 3VBUC 1I5PA 1U5IA 5I8SA 1XXNA 3LQCA 1SBFA 3KGLA 1SLIA 2VTXJ 2Y6LA 2WYSA 2X5IA 4D6RA 4C0HA 3O1VA 2VTXA 3FHAA 2QZ3A 5FY1A 4U2AA 1MZEA 3P1IA 4OCTA 3T2OA 3UGGA 3I2FA 1HDKA 2ZGRA 5F32A 1LULA 3E97A 3B69A 4IEVA 2WQZC 1GFF2 1ZZ7A 1UQXA 4E4ZA 2D5HA 5FY4A 2FD8A 5CKQA 4DXRA
chains in the Genus database with same CATH topology
3H1YA 1XNCA 4COYA 5JWPA 2HWD1 2WL1A 3OBRA 4RHV3 5HCAA 1K5MA 4PJYA 3ZYGA 2IC1A 4XBLA 1H30A 1V9U2 1DG6A 2EXIA 4LTAA 5ABJA 1AL21 1PIV1 2P2KA 3MYXA 2JENA 1V6OA 2E7TA 3FFZA 1PGSA 1QOOA 3AFKA 3VBSA 3VBSB 1NCRB 4JAAA 2B9UA 4Q4V1 2VPVA 4YLZA 1RUH1 3WDYA 5JIUA 4KWKA 5LK5A 4EROA 2HEWF 1HRI3 4LBQA 3WV6A 4M3CA 1QQP3 4ASMB 1DGWA 4WVMA 1NLRA 3RRDA 1W0PA 5LRRA 2AENA 1PVXA 4XYXA 1EYBA 1VBA1 4CDQB 4G3YC 2BQPA 5CFDA 3WDUA 2AGSA 3O0WA 1ZBA2 3WZ1A 3ZX7A 5GZCA 3BOPA 5CIRA 2DURA 2HWB1 3VHNA 1KITA 3ROUA 5F5QA 3U11A 4XJAA 2I74A 1UMZA 2ZKNA 5J7MA 3U10A 1AR63 4PLNA 1VLNA 2RS12 2R1BA 2WFF2 1DF0A 1PVC2 2HYKA 4AHXA 1NZCA 3ATGA 1PO11 1JUHA 4KG8A 2RJKA 3V65A 2EXHA 3WUDA 1Q8VA 2BPA2 1L3JA 3V0BA 2Z79A 5A32A 2RR13 2A73B 2R49A 4GKYA 1ZZBA 4FPKA 1KFUL 1C28A 2R30A 1YUDA 1X8MA 2BWAA 4FQZA 5JOYA 2Q1MA 4PDWB 2ZHKA 1N1TA 5BNPB 3M2MA 1KJLA 1VJ2A 2E51A 4BIOA 1AR62 4YYOA 5KHKA 1RUD3 2ET7A 1VBE2 2OVUA 3TBDA 5JCTA 2WLQA 5D1IA 2WS93 1PMIA 4XFFA 4ATFA 4E27A 1G7YA 1RUC1 1OMIA 2GZWA 4JGYC 1KXGA 1DU3D 4JTOA 4GMP3 3DPRB 3NKGA 2K9ZA 1AX2A 1A8MA 2QDRA 3RYKA 3ZN6B 2JG9B 4FXKB 5JOXA 5BNNC 2R042 4K20A 2WQ4A 1O3SA 1AYM2 2BWCA 1RUC3 4QU2A 1LCLA 4R9AA 2YUEA 4U36A 3L2HA 4I02A 2RJLA 4YZ1A 4AI0A 1AXYA 1I6XA 2E7QA 4XIKA 2VULA 3WG2A 4RR3C 3WR0A 2P34A 1LENA 1CAUA 2BNNA 1GKBA 1G9FA 2XBO1 1EPWA 2R32A 1O7FA 3JD73 3BTAA 4GA9A 3UL2A 1OQEA 1J59A 4QQOA 1AR93 3PMEA 4OUMA 4ITCA 2JG9C 4XQWA 2XJPA 3M3OA 2D7FA 1DHKB 5I8YA 3POYA 1G9AA 4NN0A 3WT3A 1PO13 1YFYA 4M01A 3E5QA 1ZRCA 4JGYB 3PJQA 5FREA 4XTMA 5CB7A 4L8QA 4GB33 4PBOA 1BXHA 5T5PA 2HKXA 2RS31 4M0NA 1RUE3 3W58A 1R1ZA 4YNIA 3JD72 5CFDB 4CDQA 1PIV2 1DGRA 4YGEA 3AZWA 1VIWB 1UX6A 1U0AA 2A75A 3DKWA 3LKJA 4M3CB 4IEYA 1RUH2 1FT9A 3SHRA 2QNKA 4QXKA 1BKZA 4CP1A 2ZKLA 4ISRA 3L2YA 5T5OA 3USSA 5BNNA 4Y22B 1S0BA 3AMPA 4BH9A 1H8TB 2RS53 3FWEA 2PFWA 2YPJA 1X7NA 4HN1A 1CAXB 4XF4A 3N3HA 4YM2A 4QM8A 5FO8B 2IFRA 1RUOA 4A3XA 1A8DA 1Q8OA 2VOWA 4JCKA 1VAKA 3OBTA 2PHDA 1NXMA 5BNPC 2DUOA 3RMXA 2C9AA 2XGXA 3BPZA 3N4MA 3CLPA 5BNOA 1XYOA 2WIIB 3M8LA 4P9GA 3AKTA 1PK6C 1S0IA 4NHMA 3AYAA 3M4FA 4FCAA 1KDMA 3HIFA 4M3CE 4B29A 2XBO2 2ZGNA 4CDUA 4FP2A 2YY1A 3AMQA 3FJSA 2RMU2 1QDOA 4LHKA 4QQHA 3ILFA 1JXNA 2D93A 4GWNA 1ZRDA 2Q30A 3HT2A 1HXS2 1QGLA 2HWC2 1UCXA 5EXOA 4DB5A 5DUVA 1W6QB 4DY3A 4FPJA 4GULA 4MH0E 1ZRRA 4Q4Y3 2E9QA 1CR7A 1OI6A 1B35C 2JX9A 4GIQA 1VRH3 3ZO0B 4AE2A 1ZX5A 2PA7A 4XF9A 4LO6B 3TN91 2UURA 4YW4A 4B8EA 5A33B 3LB9A 2JXAA 4CRQA 2MEV3 5A3MA 1JTZX 1XE7A 1OPMA 3ZFFC 3DV8A 2WKKA 2WFPA 3PVOA 1MR5A 2VVDA 2KM2A 4PQ9A 4LA2A 1RUJ3 4Z07A 4FQ4A 4AGGA 3PTYA 2PHUA 5CFDC 1BK1A 1VBC3 1W39A 2DU1A 2HWE1 3RG0A 1MZFA 2TNFA 3C2UA 4LBMA 2OPKA 3ZFEC 1EP0A 5B2GB 2AR6A 4YZ4A 5AFBA 3H7JA 3HQXA 4RA0A 1AR72 3MIDA 4Y20B 3KMHA 4XDQA 2WLPA 3R0RA 5SV5A 1O4ZA 3DPRA 3WW3A 2WNVC 3KCYA 1MS5A 5FCCA 4CTEA 4IEUA 4C0BA 2ZPXA 2KA3A 3GHNA 4AI2A 2ZZQA 2CTVA 5FMOL 3MZHA 4P9LA 3SXWA 3MPBA 4HLTA 3TNPB 2PHWA 3JBG2 2A6VA 3D8CA 4YW5A 4EWEA 3IMNA 4OHWA 4EN8B 3AX4A 1BVVA 4FPHA 5GZEA 2IXKA 1X82A 1YO8A 2E6VA 2V09A 2X5IC 4DNYA 1JHNA 4PIXA 2Z69A 4URTA 4WBBA 3NL1A 1EAH1 4E4DX 1Q8SA 1QJZA 5IK8A 1NOVA 1SBDA 4Q29A 5EWSA 4LLOA 2P3IA 3V0AB 1R1A2 4C1WA 2WT2A 3HN1A 3RYRA 4AFMA 1WW4A 1FMD3 1C3HA 1ND3A 3A4UA 2JICA 2YDEA 3KCCA 1WCDJ 2D3RA 3FBYA 4YFWA 1MEC1 1KRIA 1A6CA 5DG1A 2R061 3O5SA 4X8NA 2GU9A 4IQPA 4JGZA 1G9CA 4QPIC 4XJUA 1LOAA 5JI7A 4HSJA 1ENSA 3FLTA 2TBVA 1QJU2 1WBLA 3VKMA 1HRI1 1XQNA 5GZDA 5LEJA 2YC0A 3DGTA 4V1PA 1HQNA 1X8EA 2A3XA 1VAVA 3FUOA 2IXCA 2RM22 1HQLA 3NJZA 2R072 1LOFA 3CNAA 1CAXA 5E89A 1Z7S1 4IERA 3GALA 3OGJA 3MF6A 1RL3A 1PK6A 1X33A 3KT7A 1N3OA 2HWD2 5KC5A 2BVVA 2D43A 3JZVA 4OVEA 5L7OB 1H0BA 4DY5A 4E2QA 1AR71 3VZJA 4D7SA 4OUSA 5KHIA 3OCPA 4L99A 4PCRA 1JBCA 1GZCA 5EYYA 4UBGA 4HKLA 1J58A 2ENRA 2D97A 2XLAA 4LBOA 1ZZCA 4Y4YA 2A71A 4IV3B 5BPXA 5BNQA 1NQJA 3D5OA 2CL2A 3KM5A 1E57A 2NMOA 2RM23 4E9KA 4QMAA 2VG9A 3FZ3A 3SISA 4TLFA 2VNGA 3HWJA 4D7YA 3WW2A 1PO22 3WQ7A 1CN1A 4W65A 1IGOA 2WS91 3OYWA 3KCXA 1GQGA 1FNZA 1U5XA 2VNOA 1W6NA 4NR1A 5ACA2 2X5IB 5DDJ3 1SBEA 4DMIA 4Q4Y2 1HKDA 4WVVA 4OHXA 3ENRA 4QQ2A 3ZSMA 1ZNPA 3VUOA 1WMDA 3B7MA 3J9SA 5GZGA 1YYNA 5CNAA 2Q0AA 2ZMKA 2CWMA 5GLTA 1PGW2 4XFHA 3IPVB 5D8AC 3WY6A 1J3QA 2XVLA 5LRSA 3WG3A 2PN5A 1ALYA 3ES4A 4I0AA 2DUQA 3VBRA 3QD6A 3H3UA 3CJXA 2D6LX 1RUJ2 4XZPA 2QQPA 2E63A 1NCQB 4N53C 2RMU1 3RMYA 3WHUA 2A6YA 3G7DA 3GF6A 4PLMA 4NVPA 3M1HA 1D4M1 2Z5WA 3ZFFA 1RUE1 3SNMA 4MGIE 1KJRA 1R091 3M3CA 1I5ZA 4YM3A 1QXJA 5T5LA 3ZN6A 4WV8A 1Y9QA 3UKNA 4PIYA 5ABJC 2WC2A 1OHFA 5KWRA 2XJTA 5JAXA 1REFA 3VBUB 2IXIA 2R071 3T1LA 3NKTA 1AJKA 1RVF1 1GSLA 2QDNA 1V00A 4DINB 1CQ9A 4Y24A 1RMU3 1BJQA 3IKWA 3RZZA 1JN2P 4E2SA 1YFXA 2QZ2A 4YVWA 1N1SA 2EXJA 2DF7A 2CGPA 4Q0UA 3LGRA 1MQTB 4PDWA 2RS51 2PAKA 4Q0VA 4Q4V3 3FFQA 3VHOA 4TZDA 4AHYA 4DPNA 3Q9OA 3M3IA 1AR61 3RJ2X 1GANA 1QNYA 1H4GA 1OA2A 4GXLA 4I0BA 5T50A 1PIV3 4M0HA 4R9DA 4F7ZA 4OI2A 1RUI2 1MS3A 1YI7A 1Z7S2 2EVXA 4R9CA 4XBNA 2GSYA 3UV9A 1RUC2 3AKQA 1PZ7A 3GYDA 3N36A 1WCKA 4NPRA 3JQWA 5HBAA 3KB5A 3AZYA 3GNEA 1TME1 3APBA 5LK7B 2XJQA 5JDBA 2R1DA 3GZAA 5JOZA 2PHLA 4COUA 4JDMA 5F9TA 1MZ6A 4OHZA 1RUF3 5KXBA 3USUB 1F9KA 1RUG2 4GMP0 3MIHA 1A78A 5J09A 5AC91 2IFWA 4COWA 1O3RA 4LT5A 1S0CA 2DVBA 1ULEA 1YCIA 4Y1ZA 1H1AA 2HWF3 4AI3A 1BMV1 3B94A 2IZWA 4LBQB 2ZHMA 3AP6A 1AYN1 3FUQA 3QCWA 4XJ8A 1NA1C 2VOVA 2EF6A 3ZSLA 4AQ6A 3AYEA 4BHPA 1HIXA 2EALA 1NE6A 1CAVA 3IIAA 4K1YA 3S7EA 2C5DA 2XJUA 2HWD3 5F6KA 2TUNA 1FNYA 4DS0A 5J96B 3ZXJA 1NA1A 2E7AA 1HXS3 2ZGUA 2LALA 3ZYRA 1OOPC 4I30A 5EJ3A 3AKSA 2Q4SA 4RS5C 4COZA 1IZ3A 1IKPA 5FPXA 1FOD1 2HWF2 3H1MA 3NSTA 2EAKA 3ZXEA 1TMF2 5FLIA 5FO7B 2HJIA 4RS5B 1HV1A 4WZCA 2MEV2 2Q1ZB 1QY4A 1JUIA 3WHTA 3O7OA 1ZBE3 3N7LA 5T5JA 5FOBB 2OZJA 2DVFA 4IV3A 1MS9A 3H3ZA 5L7OC 1LOBA 3VBHB 4BMBA 4MZUA 2ZBJA 4ES8A 2WT1A 4KU7A 1CPNA 1N1YA 3B00A 2P17A 1RMU1 5CADA 5JIAA 5GM0A 4AVTA 1XU2A 2BFUL 4XJZA 1LR5A 4ZXKA 3KT4A 1S0EA 2I2SA 3BCWA 3ILRA 2D6KA 3LWCA 2DV9A 4DZGA 2I45A 2OUJA 1PHMA 5KXDA 4Y1YA 1VAMA 2HWE2 3MI8A 5H9PA 3WW1A 3ZFGB 4QPYA 3UKVA 1SMVA 3VKNA 2WNVB 1C5IA 1CGPA 5HXVA 2GNDA 4JRLA 3E6BA 4S2FA 3I59B 3WQ1A 2HWB3 2XJRA 3SCFA 3OTFA 5C8CA 3OD4A 1FOD3 3N35A 4AW7A 4BZ4A 2DUPA 3RJRA 1ASJ2 4IV1B 4H14A 4K6BA 3VDDC 1LOGA 3A0KA 4H7LA 1YXWA 4FO9A 5FO9B 4XILA 1GNHA 2A6WA 4DXZA 2VNRA 4XQ4A 4CDXC 4MYEA 1DYPA 1QXRA 1QU0A 3AYCA 1YHFA 4P14A 1ND3B 4HANA 1YIFA 3WDWA 4N9IA 2A6ZA 3P3PA 3VHRA 4XW3A 2ZGOA 2ATFA 1S0GA 3FE5A 5CBLA 5C4WA 4XQDA 4JGYA 2ZGQA 4COVA 4Y26A 2QE3A 1ZBA1 4BPZA 3SH3A 3ME2A 5IUQA 1DZRA 1S0DA 4TYSA 1LOEA 2B42B 3VKLA 3N7MA 2WZR2 4H7MA 1W6MA 2CGOA 3MLJA 1CAUB 2HWC1 1QJX2 4XFGA 2WNEA 3IDEA 2PLV1 4QGMA 2PLV3 4PIZA 5JZGC 1BQPA 3MIBA 1JYIA 1ULDA 1R081 2FZ2A 2P37A 1VBE3 4AEKA 3E5UA 4UW5A 2CWSA 2QJVA 1GNZA 2NM1A 1Q43A 3RYPA 1N3PA 4JC1A 2UU8A 3ZFEB 2ARBA 3J8F3 4YRDA 4G9SB 4S2DA 4X8PA 4BE3A 1NCQC 3VZNA 1A3KA 3TNQA 1Z78A 2D3SA 3N7JA 1WBFA 3MEPA 5JPMB 1AYM3 4B3NA 3IBMA 1RITA 1CONA 3GZTB 4IEQA 1YLLA 1NCRC 3FLRA 3I7DA 2LM3A 5GALA 3WP6A 3PVEA 2XWBB 2ZX4A 2R6QA 2GMMA 5DUWA 2K0GA 4RFT0 3B9CA 1LHUA 2G9FA 2XVGA 5BYNA 4K40A 5BNPA 2XL9A 1MEC3 1QJU1 5DUXA 4XIOA 4UW6A 1ZZ8A 2ET1A 2I07B 3U4XA 4YVWC 5A32B 1DZTA 2BNOA 4BCUA 2DCZA 1UW8A 4KG0A 2D3PA 4OI1A 3OD0A 1UL9A 1H2MA 5GJ6A 1LU1A 1OKQA 1POV3 4IV3C 3IN9A 2AREA 3E6DA 4YM0A 1TMF3 1IS4A 3X29B 1OSGA 3EO6A 4MGKE 2IWGB 4JGZC 3O0XA 3VKOA 3HD8B 4LHLA 1CIWA 4DFSA 4AQ2A 3EHKA 1ZBE2 5BV6A 3AZVA 5C9AA 1O5LA 3WXPA 4QGLA 1COV3 3VKFC 2EXKA 2UYBA 1HRI2 4EV0A 2CAUA 3ZIWA 4FTEA 1X50A 3CU7A 3FX3A 5DZGA 2DCKA 4MLOA 1V6MA 2DCYA 2MPFA 1AX1A 2VU9A 4GH4B 4WZFA 3RNSA 2EAAA 5GLVA 2G4IA 4HPKA 4L11A 4N43B 1W6MB 3PLQA 2NLRA 3BALA 2SBAA 5DDJ1 4FAGA 4Q4X1 3JB8A 1DIWA 4R8HA 3VV1A 1YRZA 2GNBA 3I8TA 4Q1RA 2VQ0A 4RGGA 3RI8A 4GALA 3K51A 3JQXA 1NCRA 2ZAHA 5H9RA 3RWNA 3VN4A 5BNNB 2D40A 4I0WB 4QPGC 1DQ1A 3POSA 5BXXA 4H3WA 4RR3A 2RM21 1UPSA 2VW2A 4HFSA 4RQPC 5JMCA 2QCSB 1WD3A 3MLLA 2HWB2 3BU7A 2D6OX 3VBFB 2WFF3 3VBSC 1AUYA 4AGRA 1PVC3 1DGLA 2RS11 1DZQA 4LBNA 1ONAA 5T52A 3SCHA 4AK3A 2ZX1A 4AEDB 3ES1A 1VBB1 1O4YA 1RUNA 4AEDA 1V6KA 1CJPA 4YVSC 1Q8QA 4B4QA 5C6CA 5L36A 1RUI3 2ZGKA 4AQSA 1LHVA 5F6LB 3ALQA 2PAEA 1LTEA 4FSJA 4QHBA 3VBOC 4AEJA 2XJSA 5K9YA 4EN0A 2QKDA 4ONUA 4XHBA 3ZYIB 2O1QA 2NN8A 1DQ4A 3AXDA 1PZ9A 4LUMA 4YW1A 3JBG3 2W08A 4WM8A 1RTVA 5JSRA 4NWVA 3M70A 1TME3 4GH4A 2JEMA 1RUG3 2B45X 3WX5A 3IT8A 5K0UB 1C8M3 3MW2A 4Q0QA 4AVBA 2DWRA 2UWAA 3I54A 4FBFA 1FATA 1ND2C 4WVWA 3M3EA 5C9AC 1IKQA 2R0HA 1BVP1 2NQYA 4OHVA 2FMDA 3ZN5A 4CEYA 4CDXA 1LGBA 2GALA 4Q4W3 1FV3A 4EN6B 1YI9A 2GNMA 2ZA9A 1OLQA 4EN9B 3VBHC 4RQPA 4YGBA 4BA6A 3NO8A 2TEPA 1QMJA 1NG0A 5C8CC 1C8M2 3R05A 4ES9A 3ZXFA 4BM8A 1COV1 1X36A 4BIFA 2WSVA 1YNAA 4P5HA 3SITA 1PZ8A 4YARA 3AP5A 3JCIA 3VDDB 4S2GA 4HK9A 3AJZA 4Q4W2 3VBFC 3I2DA 3VL8A 1Z0HA 1H1IA 1D4M2 3VBOA 1XE8A 2KXLA 3R4DB 1C57A 4N7IA 5IK5A 4KGQA 3S0MA 3V0BB 1UZYA 1BCXA 4HK8A 3TYJA 1AJOA 3QH7A 4QPIB 5EV7A 2V73A 1QQP2 3NAPA 1H2KA 1AVBA 1IPJA 3MDPA 5FPZA 4A2UA 2Z42A 2Z2SB 3ECQA 1HLCA 1RGSA 2H6BA 4W6XA 2JG8A 1UU6A 1DGRN 3AP4A 2PHRA 4FPYA 4K21A 5DXDA 5JVVA 1YJLA 2PHXA 3NV2A 4KBBA 3KZ4C 4Q1PA 1IS6A 4N43C 1QXPA 1WLWA 4ZU5A 1SCSA 4QT6A 1FMD2 1QKQA 3AMNA 5JZGB 4DRRA 3LSDA 2WZPP 1N1VA 1QH7A 5CVRA 5HCBA 3B3QE 2C1FA 1H9PA 2PQQA 3AKPA 1G9DA 2VQAA 3FLPA 2X53S 1F2NA 4SBVA 1Q56A 1ZA4A 5I0TA 4X6QB 4Z2WA 2JG8B 3THPA 4AHZA 1O3QA 2RS13 2JDZA 1VBD3 1VRH1 2OYZA 4LBQD 1HRV2 3ZYJB 3NAPB 2SLIA 2GC1A 1N47A 1V9U3 2V5YA 2PHTA 3J8F1 3MIFA 4OULA 2UWCA 1NY71 5H9QA 4OI0A 2YV8A 1MQTC 1HW5A 5FDBA 4FOWA 1CX4A 1WMEA 2GC3A 1MS4A 3MFAA 1GZWB 4M00A 4Q8KA 2PAMA 5AVPA 3HAGA 5ABJB 4BQ1A 2AH2A 1GQHA 2GN7A 1S0FA 1K5MB 1VBD1 1ZREA 1LB2A 2ZX2A 1U5ZA 2XL7A 3MLKA 1GV9A 2BUKA 1G86A 5CFCC 4XXPA 1ZBA3 1NXD1 3LA3A 4XFBA 4ZKTB 4HKOA 2W68A 4L2NA 3QH6A 4EWDA 1XU1A 4QQPA 1DLLA 4N53B 4FOQA 1TE1B 3WCSA 1DYKA 3WUCA 4IXLA 3B02A 5FLJA 2WT0A 1POV1 1LECA 3SCGA 1NLSA 1EAH2 1H8VA 1MS0A 2ES3A 1O91A 3PJYA 3RQ0A 1H4HA 2AYHA 2D6NA 3FBMA 1R1A1 2DVGA 1M06G 2WFF1 1NY72 3HR9A 2ZJCA 1GBGA 4K7JA 3UJOA 4IESA 2GH8A 2JKBA 3B93A 3IPVA 1V70A 4LO4B 1JW6A 2P3KA 5J36A 4AFBA 3VBHA 3R6SA 3CL1A 3AZXA 1XNBA 4INDA 4OZXA 4WM7C 1PO12 1C5HA 4BLJA 1EAH3 2ZOEB 3CF6E 4OHYA 2Y0IA 1AYM1 2ZACA 4HL0A 2ZGMA 4HN0A 4RS5A 3NAPC 3PVBB 4D7TA 1MEC2 2K2SA 3A0NA 1RHI2 3O14A 3KLSA 1OOPB 4HSLA 4L97A 1POV0 3ZXGA 3IWZA 5I8TA 1RUI1 4Q4W1 3MIEA 4AVVA 3CJIB 1IHMA 3UKTA 4J6GA 3W9AA 5E16A 1WLCA 2Y38A 1NA1B 1YIPA 2NYYA 1VBE1 4XETA 4B4PA 3BODA 3VZOA 4GWMA 1ZBE1 1CAVB 2XH6A 1GZWA 2D98A 3HBZA 5C4WC 1PK6B 2EIGA 2OW4A 3CJIC 3LSEA 2W52A 2VH9A 5L73A 2R16A 1OFNA 1NQDA 3TN92 5CFCA 1MACA 1XNDA 4JRAA 1W6PA 3RS6A 2WINB 1QJU3 3GBFA 4B4RA 1PO21 1LHWA 1V9U1 1T6GC 4K1ZA 4FPFA 2XG3A 2HEVF 1AXKA 2NZ9A 4N90A 1V6LA 1BBT1 3JD71 3M3QA 3DUIA 2XBO3 2BEOA 3MW3A 4XBQA 1RINA 5C9AB 2DU0A 5JZGA 1EV13 2WNUB 3WINE 2B46X 2QFEA 2Y26A 2WNUA 1CESA 4E2GA 4BMEA 3ILNA 1RUF2 1GZ9A 3AYDA 3EQEA 1WW5A 2RR11 3ZSJA 4CP0A 2VOXA 1KQRA 1VBA2 2VVFA 4Q4Y1 4KWJA 2ZZJA 3VBRC 2A3YA 3TRSB 3ZMNA 1JH5A 1SLTA 4UBHA 1R083 1W6PB 3RDIA 4Q0PA 4FPCA 4FOYA 1RJ8A 2A6XA 3K48A 4I3GA 1H9WA 2GC0A 1ND2B 1Y3TA 4JV4A 3GZUC 1BEV2 5FMOS 2D6PA 5CA6A 4YVSB 1AL22 4K3UA 4RL7A 4A7KA 3ZIXA 3G6JB 5KC6A 4CDWA 1ZRFA 2UWBA 1FXZA 1WMFA 1D4VB 2N7GA 4C91A 2Y0OA 3R4SA 4AFCA 3KSCA 2ZGPA 1ULGA 1O5UA 3JU9A 1D0GA 4AEMA 4Y20A 2YHJA 4LBJA 3MFCA 3WDTA 3ZFEA 1REEA 5I93A 4QX5A 3QBQA 2VOKA 4FPLA 5HCFA 3H50A 4Q0SA 3ZFFB 1WA4A 5BNOC 2ZHNA 3URFA 4IEPA 4KH9A 2CAVA 4DQAA 3WD5A 1LHNA 1BMV2 4F3JA 3W59A 4XF1A 4XMIA 1KS5A 4HETA 1F8VA 2A5ZA 2NMNA 2ZMLA 1B35B 3I4IA 4HKWA 2FMYA 4N7UA 1V6IA 2XLFA 2GMPA 1SQ4A 4AI8A 1SDWA 4OLLA 1W0OA 4GKXA 1CD3G 5HI0A 2RS33 3AP7A 1UPIA 2XJVA 1RB8G 1B35A 1WW7A 4A7YA 1V6JA 5JSOA 1RMU2 2ZCWA 1VBB2 1W6NB 2BYVE 3JBG1 3MGUA 3VHPA 1RHI1 3S6PA 3OYWB 1O3TA 1FOD2 2HWF1 4NO4A 5C8WA 1UU5A 2OUHA 5E1RA 3E6CC 2IXLA 4GH4C 4J1XA 3D4KA 1PNFA 2YZ4A 4FPOB 2YYOA 4FTBA 2X29A 1RHI3 1KS4A 4MUVA 4IL7A 1FPN3 4CDUB 4UW4A 2LUWA 3RSJA 3BOWA 3VBFA 3AP9A 1PNGA 2UYAA 5I0UA 4IV1A 1JYCA 3AMMA 4HVQA 1OQDA 1VBB3 1SEFA 5C8CB 3PMSA 1WGPA 5D8AA 4F8AA 3I59A 1PVC1 2XPJA 1DFQA 1UD1A 2ZGTA 4Z8BA 5KBFA 4GB32 1FYUA 5JPNB 2R041 4MGYE 4WM7B 4GMP1 3QOPA 1VB4A 1FPN2 2VVEA 4N43A 1DQ6A 3NWKA 3WNXA 4I2OA 4L92A 1WW6A 2BW8A 3NV1A 3FMGA 2QVSB 4ZU7A 3HT1A 4Q4X3 4ATEA 5JR7B 3UK9A 2VMIA 1M4WA 4BYYA 1EV11 2R062 1OQ1A 2PLV2 2A3WA 5AFEA 3ZXAC 3TB0A 1AYN3 4IEXA 2B39A 4CEWB 4EN7B 4P9JA 5LEKA 2ETEA 1LGNA 2H6CA 4KNCA 1AXZA 2XKOA 2VMHA 3OPZA 1F5FA 1PO23 1CAWB 2W0XA 3E5XA 3DF0A 2DYCA 2GMEA 4P9YA 3POWA 3R4UA 4Q27A 2JE9A 4F83A 3SH5A 5T3NA 2R063 2DVDA 1H1MA 1JOJA 2G9GA 5T54A 4J1WA 1FAYA 3VZKA 4XMAA 4P9WA 5CFCB 1QJY2 1R082 4FT8A 4YZ3A 3H1WA 1XYPA 2RMU3 1AX0A 5GZFA 4A7ZA 4IEOA 1SLLA 4LHNA 1ENXA 1HXS1 4XJ9A 1U5YA 5FOJB 2VY0A 4GQ7A 1WLTA 4YZ2A 1MVEA 5E88A 4Q8LA 2MHFA 3EBRA 3VDDA 1W2UA 4ISQA 1OA3A 4HMZA 2FBEA 3DPRC 1LHOA 1YFWA 4META 5GLZA 3CJIA 4YG0A 5KHHA 3MF9A 1BBT3 2VW0A 4H55A 4YGDA 3LA2A 4FTSA 4FOVA 4BLIA