3HD8B

Crystal structure of the triticum aestivum xylanase inhibitor-iia in complex with bacillus subtilis xylanase
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
184
structure length
184
Chain Sequence
STDYWQNWTDGGGIVNAVNGSGGNYSVNWSNTGNFVVGKGWTTGSPFRTINYNAGVWAPNGNGYLTLYGWTRSPLIEYYVVDSWGTYRPTGTYKGTVKSDGGTYDIYTTTRYNAPSIDGDRTTFTQYWSVRQSKRPTGSNATITFTNHVNAWKSHGMNLGSNWAYQVMATEGYQSSGSSNVTVW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Xylanase inhibitor
publication title Identification of structural determinants for inhibition strength and specificity of wheat xylanase inhibitors TAXI-IA and TAXI-IIA
pubmed doi rcsb
source organism Triticum aestivum
molecule tags Hydrolase inhibitor/hydrolase
total genus 48
structure length 184
sequence length 184
chains with identical sequence D
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2009-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00457 Glyco_hydro_11 Glycosyl hydrolases family 11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3hd8B00
1YNAA 1QH6A 2BVVA 2QZ2A 3AMMA 3LB9A 3VZOA 3VZMA 1UKRA 1XYPA 4NPRA 2F6BA 3O7OA 3WP5A 1W2UA 4S2GA 2JICA 3AKSA 1REDA 1UU4A 1OLRA 3VZLA 1F5JA 4H7MA 4XQWA 2NLRA 2BWAA 3VHPA 3WT3A 1C5HA 1KS5A 1PVXA 1C5IA 1XNKA 4S2HA 3ZSEA 3VGIA 3AKTA 1IGOA 3MFCA 3RI9A 3VL9A 1XNBA 1KS4A 2DCYA 3VHNA 3AKRA 3MF9A 2C1FA 2DFBA 1T6GC 5HXVA 5K7PA 2Z79A 3LGRA 3VLBB 2VULA 1REEA 1XXNA 1QH7A 1XNCA 2BW8A 5K9YA 1UU5A 2JENA 1OA4A 1XYNA 1H4GA 2DCJA 3WP6A 3EXUA 3VZNA 1XYOA 3WR0A 4HK9A 5EJ3A 3B7MA 2B45X 1H0BA 3VZJA 1OA2A 3WX5A 2VUJA 1M4WA 2D98A 1HV1A 3B5LB 2B46X 2VG9A 3MFAA 1HV0A 3WY6A 1H1AA 3VL8A 3AMPA 3WXPA 1H4HA 4S2DA 3AMQA 4HKOA 2JEMA 3MF6A 3AKQA 1BK1A 3AMHA 2B42B 4XQDA 4XPVA 3M4FA 3HD8B 3AMNA 4S2FA 2DFCA 3VZKA 2NQYA 1ENXA 3WQ7A 2QZ3A 2VGDA 3WP3A 3WQ1A 4HK8A 2BWCA 1HIXA 3RI8A 1XNDA 1REFA 3AKPA 4HKWA 4IXLA 3VHOA 1TE1B 2DCKA 1NLRA 4HKLA 1BCXA 1AXKA 1OA3A 1H8VA 3WQ0A 3WP4A 2D97A 2DCZA 1UU6A 4XQ4A 1OLQA 1BVVA
chains in the Genus database with same CATH superfamily
1PNFA 4M01A 2UY8A 1UKRA 2C9AA 3JD71 4A7KA 4LKSA 4LOTA 1RUD2 1ZVFA 2EXKA 2VMFA 1AX0A 2RS32 3U4XA 4RYDA 4KNCA 4PCRA 1RVF1 4AVAA 4DXTA 2CDOA 4QX7A 3UJQA 2BOJA 2WNVA 2W95A 5AVPA 3AP7A 4AHWA 2EA7A 1PM4A 1PVXA 1OHFA 3ZDVA 1NA1B 1RYYA 2X29A 2ZHLA 2PHFA 3ON7A 5FMCA 1R1A1 1T6BX 1CPNA 4IEYA 4TXWA 3WNKA 3QBQA 4HPKB 4EQVA 3DPRB 2ZOEB 4MGQA 4RGGA 3MIFA 2WFPA 3LEKA 3NV1A 3PVOA 5CNAA 5JPMB 1VRH3 5D8AB 2ORZA 4JX0A 1XRUA 3LGRA 5D1IA 4MGSA 5LEKA 3SHRA 4CE8A 1TVGA 3NKTA 2I07B 4OLLA 2QQNA 1PZ7A 2DCJA 3PURA 3I2IA 4QM9A 1P8JA 3KWVA 4WV8A 1GFF2 2JG9A 5I8TA 5BNOB 4CCCA 3R4UA 1VBA2 1STMA 4GA9A 4KQ7A 4M00A 2DF7A 5B4XA 5FXWA 1C57A 2B45X 3C3VA 4QKBA 1WCKA 2RMU2 5CFDC 4YVWC 2UWBA 3TEZA 4AZZA 2XWBB 4KWJA 5J7MA 1XU1A 3DL3A 1WW5A 2XG3A 1Q8VA 1JI6A 1C28A 2QJVA 3AL5A 3NNGA 4M4PA 4YGBA 5KHIA 4AW7A 3FUOA 1QJZA 1OBNA 2DUOA 5LWBA 4BQXA 1R1ZA 1YLLA 4FBFA 3I7DA 3WXPA 4AG4A 5BNPB 3ZXJA 3ACIA 4YZ5A 3GBFA 2XQRA 5CFCA 4ISQA 1YQ8A 3I2DA 4HG6B 2XL7A 3BIWE 2R043 4P9GA 5CVRA 2XUMA 4QDSA 1V6JA 3HMYA 3AMHA 4NN0A 1VB2A 2B42B 1RUE1 2J1VA 3ZYFA 5EV7A 1GP4A 1GZCA 2SLIA 4RS5B 5A7WB 1EV12 1JHJA 4LKDA 1UW8A 2QBXA 2CGOA 2ZGKA 5FY9A 1WD4A 4N9IA 2VCAA 5JWPA 1FMD2 1X82A 1ZBA3 5IK4A 2NYYA 4E4ZA 3MW3A 2O8QA 3IKWA 1YXWA 1AR71 2XB6C 2VQTA 3AZWA 4I0AA 1C1FA 4IXLA 1COV1 2DCKA 2WZEA 3I2KA 3OGVA 3O0WA 4YNIA 2R1DA 4XZUG 4F83A 4K8RB 2DTYA 3LEMA 2VQ0A 1C8M3 4JVAA 4AE2A 1FATA 4TYSA 4ZPIA 5FY7A 3N9LA 4QDQA 3WUDA 1F2NA 1QOTA 3M7AA 4DXZA 1W3XA 4R9BA 2CTVA 4BK5A 1UU6A 3S30A 2WR9A 5A7SA 4C8DA 2F4LA 2YC4A 3GYDA 3M2MA 1QH6A 2RS52 4OZOA 3VZMA 5C5TA 1NCQB 1RUG1 2BZDA 1AYN3 5F5CA 4Q4Y2 4CCDA 4BU2A 4MGYE 5A7QA 2BVBA 5FMOS 3USSA 1Z7S1 5C3OA 5SV8A 4YG0A 3PVNA 2BFUL 1QKQA 2X8KA 4XJ8A 2BWAA 1E5SA 3D0JA 5FV3A 1OLMA 4JQTA 1C5HA 1DGRN 1CZSA 1O3RA 2RHPA 3DUIA 4LBKA 2VMEA 4FPEA 2CNAA 4Y22B 4YW6A 1XU2A 4QQLA 4EV0A 1CX1A 5A70A 3RZGA 4LHNA 1HQWA 2A71A 5G05L 3B9CA 2NMOA 3AYDA 1JHNA 1UN1A 4FOVA 4XACA 4AHYA 4AL9A 5FQ0B 1Y9GA 2WAOA 3WDUA 4CVUA 4INDA 2YG0A 2XR4A 4QGMA 2OX0A 1B35B 4J6GA 2JWPA 1UZWA 1H8TB 1F35A 2ENRA 4QKNA 2GMPA 1J84A 5C3SA 5C71A 2R16A 2VULA 5I0DA 1IZ3A 1RVF3 4YVSB 5LASA 5KBFA 5FYCA 3CHXA 1QJX2 4AFBA 4IGQA 4QXBA 2PHDA 3ZFFA 4IV1A 1LHWA 4LULA 4BE3A 2FMDA 3H42B 4RL7A 4ZU5A 5JIAA 3M1HA 1ND3B 2RM22 1K3IA 4FPJA 1HRV2 4FPYA 5FZCA 1JZ2A 1OQDA 4LBJA 3BUCA 2K2SA 2VNRA 4PI0A 2WS92 1M4WA 3GZEA 5IVEA 1DQ0A 1LEDA 1YIFA 1HV1A 4N8MA 5E89A 3PJQA 5JOWA 5T3NA 2BYVE 3AZVA 3KF5A 3MFAA 3N7KA 4Q0VA 5FYBA 3WY6A 2YYOA 2VZRA 4AK3A 4NROA 1DP0A 4KBBA 4YZ4A 3HBKA 1GZWB 1O6UA 4CXYA 1LOEA 4NIHA 2W0XA 5KR7A 4CP1A 3KT7A 5F3GA 1FNZA 3PJYA 1YJKA 1BK1A 2JG9C 1MS5A 2A75A 1O7FA 5DXDA 5FAXA 2LALA 2Q8EA 4BJ0A 4DUXA 5F3CA 5FO9B 2XXZA 1UMHA 2XGXA 1VIWB 1UPSA 3EQEA 1Q8PA 1NCRB 2OPKA 5IW0A 4MADA 3U07A 3RZLA 5BPXA 3SEEA 1U5IA 2WT2A 3A0NA 5KHJA 4XJAA 1LU1A 4N43B 2G1MA 2PHWA 4M3CA 1W28A 5FXVA 3JQXA 4Q4W2 2ARBA 3L2HA 1QQP2 4XF3A 3GALA 3WP3A 2IZWA 1FV3A 1VB4A 1W2OA 3J26N 5T50A 3CNAA 4RQPA 2Z42A 4A3XA 3RI8A 4AHZA 2QQMA 2ZGPA 2EAKA 4Y20B 4UFLA 3UYJA 4CYDA 1FV2A 2WWSA 5FYUA 1OUSA 3MDPA 4Q0PA 1VBD3 5CISA 4IEXA 4LLOA 1E5HA 2D5HA 1LOBA 2OPWA 5IWFA 1IQDC 2GDFA 1C3HA 1UCXA 2WZ8A 1RUE3 3ZX7A 1VAVA 4CP2A 1QXRA 5JI7A 5K0UA 2WO2A 5FZ8A 4CEYC 1MZ5A 2VUCA 4MGZE 4ET7A 3GM8A 5KXBA 5JXJA 1S0IA 2Y6JA 3K46A 1BVVA 3F2ZA 4QPYA 2A70A 2ZX1A 1KDMA 3G6JB 4CDUB 1R082 2BEOA 1G8WA 1AR73 3IDAA 4FXGB 4NWWA 4Q1RA 4AEJA 5BXXA 4W4ZA 3G7DA 2MNGA 3KT1A 4HANA 1COV3 1H6YA 2Y26A 1GZTA 2W94A 4COWA 3J7HA 4LIUA 4BLIA 1PVC3 1SFPA 2W87A 4PLNA 5C9AA 1H2KA 4NR1A 1IG0A 2HWD1 2RR11 4DUVA 1SMVA 2P4EA 2XHNA 3GBGA 2E53A 2VOTA 5LBCA 2BGPA 2MEV2 2YHJA 2ZEZA 1LOFA 4I02A 4QGNA 4NIAA 4YARA 4LHLA 4XBLA 1AR91 1C8NA 2QQKA 3VDAA 4DEQA 1TME2 2BBVA 1ULDA 4HN0A 1RUG3 1ULFA 4GMP3 5GZDA 1AHSA 1MEC1 1Z7S3 1BQPA 1SQ4A 1PHMA 4JGZA 4DY3A 2BP6A 1O59A 5BNNB 1TZOA 1XYNA 1OFNA 4PT6A 3EXUA 3LD8A 3CEWA 4FT8A 4LUKA 4UFKA 3MZHA 2WQZC 2JG8A 1ODMA 1PK6A 4UF0A 4COYA 4DUWA 3ELNA 1SLTA 3T2PA 1G9AA 3C7FA 4DXSA 3VB9A 1YCIA 4UW5A 2XHKA 4PIXA 3RZMA 5C8CA 5FZ4A 3TN93 4FSJA 1UYPA 5FJKA 1JOBA 3KHCA 4MXWA 1VAMA 1VMJA 2SBAA 4WM8A 1M06G 3CL1A 3ZYJB 4XFFA 2WAAA 2VVFA 4E9KA 4EJRA 3O1SA 1UAIA 4XVHA 2PQSA 2WABA 4GH4B 1W6QB 4QPIC 3ZFFC 3MF6A 1N1TA 3AK0A 3AKQA 3BB6A 4IV1C 4PDWC 3ZYIB 1DZRA 3S6PA 4AEKA 4IEWA 4XF1A 2FDGA 2W5FA 4TN7A 1YO8A 4XJWA 1OKOA 4D6QA 4YG6A 4ORFA 1X33A 4XIOA 2QE3A 4GB32 2AENA 5A6YA 2HYXA 2W1QA 1O5UA 1O91A 1QXPA 1VBC2 4YW5A 1ZRIA 4BCUA 3WW2A 1RUI1 1ACCA 3WOGA 3H7JA 4AFDA 2ZHMA 2R0FA 2FDKA 2W08A 2JB4A 3PVEA 4Y1UA 4UOJA 1OQEA 1WW7A 1ENRA 3VKNA 4Q4V2 4Q0UA 1POV0 3WCSA 3AC0A 4OHWA 1GP5A 3ZO0B 5FYTA 4Q0QA 3CF6E 5FIXA 3U37A 1H2LA 1OA3A 3RYPA 5DUUA 4Q1PA 5JIUA 4FOWA 2LRPA 4WM7C 5DDJ2 3AB0A 2JE8A 1F9KA 2DCZA 4LKEA 1MVQA 4LTAA 1JOJA 4JCKA 2XBO2 4RGKA 5LA0A 4WZFA 2YGMA 1O8SA 4GD4A 2HLEA 3GCXA 5IT6A 4KWUA 4NPRA 4XDOA 5HPOA 4LBQB 4C1WA 2JIJA 3I2FA 1LHOA 4RQPC 1YQCA 3JBG2 3SH5A 3BYWA 4CTEA 4XTMA 5AC92 2W1SA 3V0AB 4TLFA 4Z92B 4G4FA 3VHPA 3BTYA 2NM1A 3ZIXA 1H9PA 4KU8A 4YVWB 4E2QA 1C5IA 3ZSLA 1R092 3MV01 5CFDB 1EAH2 4QPGC 5FZHA 1WZXA 4AAPA 2IC1A 4AF9A 1KS4A 1RUH2 5K0UC 1VMFA 3MF9A 3VBUA 1BEV3 3BTAA 3SCHA 3V65A 4QT6A 1LOGA 1UY0A 4MHRA 4AXOA 1RMU3 2YROA 2JDKA 3O1TA 4OYUA 4QWNA 5A3LA 4HVRA 4UT5A 1WMXA 3OY8B 5ANQA 3MUY1 3VLBB 2YPDA 4LK7A 1R64A 4LORA 5K9YA 4B4PA 2VZTA 4ISRA 3CLPA 4UFMA 2WZR2 4DXRA 2O14A 4CCKA 1AX1A 1J1TA 1OVSA 2DDUA 3DGTA 4Q26A 1MS4A 2C26A 4R4ZA 4COVA 1AR62 3UV9A 1PGW1 1ZBE3 1ZZ9A 3I3MA 2HWD3 1MQTA 1GU3A 1I3HA 3KLSA 5EHDA 2R062 4AQ6A 1NXD1 1AR93 1LOFC 3NAPC 4XDPA 4AQ2A 2JE7A 3LKJA 3V64A 4KH9A 5A1FA 4QAWA 4RFT0 3ACLA 2Y0OA 3EMRA 3KCCA 2D5FA 2VMCA 3LE0A 1OD3A 4FPHA 4RFRB 3VKFC 1PIV2 4CEWC 3AMPA 4KG8A 5F3EA 2ERFA 4O9EA 5FZOA 2W68A 4JGZC 4F3JA 2ZABA 3AP6A 1W9YA 3NW4A 4R9CA 4MOAA 1GMMA 3K77A 1V6IA 4IUGA 4PI2A 2HBUA 4QXCA 4AQSA 5IUQA 2WNOA 2KD7A 2JG8C 4LQRA 4P9LA 3LIHA 3AJZA 4TSVA 3ZYHA 3MI8A 3OGSA 1W0NA 1PO12 2GNBA 4CCOA 3VD9A 4XBNA 2Y38A 3USUB 1G86A 4GALA 4IESA 1V0AA 3DKWA 1ULOA 1UWWA 5C8CC 1ENSA 1RUF1 3NRUA 3A21A 1CAWA 1WBLA 2A5ZA 4UXAA 3U1XA 2Q1FA 2VOVA 3CIHA 3KMHA 2VY0A 4AFCA 3LOBA 5A3WA 3ZKUA 1SPPB 2Y60A 4HK8A 4CXWA 3IAPA 1FX5A 3RJ2X 3LA7A 1GYKA 5IVVA 4C91A 1PGSA 3WDYA 4RD7A 5FO8B 1O8PA 3UKNA 1RJ8A 1FPN1 1VMHA 3AFKA 3E5UA 3E5QA 3LSDA 3DECA 3PIGA 4MHUA 2ET1A 3Q8BA 5FZGA 4SLIA 3KVAA 4Q8KA 1W9TA 3ZXKA 3I59B 3J8F2 4QHOA 1SLBA 4NHXA 4XETA 3QLQA 4LNVA 2OUHA 1UZYA 3ASIA 4HXCA 4META 5FY1A 3V0BA 2WNUA 1OC1A 5JSRA 5L7OC 2OZ6A 1S0JA 5LA2A 4UWDA 1NYWA 2WT1A 1RUI3 2XJPA 3NNJA 5E16A 4CUBA 5LCWL 4LO8A 2BFUS 2A6WA 2VZOA 4IL7A 1JUHA 3HR9A 3WP5A 2LROA 3ZXFA 3W5NA 4RR3A 3ZXLA 2OQ6A 4BK4A 1QJY2 1U0AA 2X53S 3OBZA 1ND2A 4BIFA 4YGDA 3THPA 4NIDA 4MSVA 1AL22 3O12A 5LK7B 3UT0A 4YZ1A 3U75A 1IPJA 1IS5A 4IEZA 4XIKA 5FPVA 2GU9A 2ZX0A 4FAHA 3VD4A 5I0RA 1AJOA 3VBRC 1EPWA 1LRHA 3VBSA 1NAEA 2DCYA 2LM3A 3AZZA 4EN7B 1AR83 1GZ9A 1QF3A 2ZEWA 3B9IA 4TLGA 4YW7A 1QJU2 1I1EA 3AYAA 1EY2A 1HB3A 4OUMA 5GLUA 1NQDA 3GZAA 2WZPP 5K7PA 3N9NA 4B1LA 4H3WA 2VZUA 1W6PA 4CCMA 4LT5A 4Y24A 5F9TA 2W1UA 1VRH1 5I8YA 1BJQA 2JG9B 4XE9A 1XOYA 4OI0A 5J36A 1JZ3A 1D4M2 2HEVF 3OYWA 1OSGA 2B9VA 5HCFA 3ZLIA 1JN2P 2ADDA 5GJ6A 2CYFA 4LO7A 3VZNA 5ERLA 1W6NB 4G9SB 3OJBA 3TOJA 2P3JA 1Q56A 4CUAA 4I3GA 4YG3A 4QX8A 4KBZA 4Y1VA 1NUKA 3R05A 2BV4A 2ID4A 1G9CA 1IKQA 4N53A 5CAZA 2K46A 1F5FA 5FYZA 4AI9A 1GKBA 5HXMA 1GQHA 4LBLA 3BI3A 1KRIA 5FPAA 1IHMA 3D3AA 1WCDJ 2B46X 1JBCA 1GLHA 5I0SA 1BMV1 4HZFA 4YW3A 5FPZA 5JXGA 1S55A 1FT9A 5JVVA 4XFHA 1A8MA 1EUUA 3VD3A 1AYM1 1W8NA 2ORXA 3VKMA 2R072 3I3BA 2QQIA 1RL3A 4F7ZA 4CEYB 2BPA2 3ATGA 5LZ6A 1ZREA 2PHUA 1TNFA 5IVJA 5IK5A 4GXLA 3VBOA 3NV3A 3B93A 2A73B 3Q8CA 2R041 4ASMB 1MQTC 3H1WA 3M4FA 3VKLA 3VDDC 5CKMA 2W47A 5SV5A 4KGGA 3CU7A 1GOHA 1V9U3 4XCBA 5E8AA 4XJ9A 4ZZ5A 1OOPA 2XQXA 3WF4A 5A3PA 5KXEA 4J1WA 5T5OA 2BDRA 4OHXA 3MIBA 2P5BA 2QZ3A 4QB6A 3ES4A 2WLPA 4X6QB 2JDMA 2BWCA 4O7XA 2YZ4A 5FYSA 5I8SA 3LWCA 3ZSJA 2WKKA 1WBFA 4Y1YA 3H8RA 2Q8DA 2ES3A 2OUJA 2PN5A 5ACA2 3R4SA 2NP0A 3O1PA 1CIWA 5GM0A 2O0OA 3FJSA 5KHGA 4PIZA 4HKLA 2V5YA 1LU2A 1JYWA 1IQAA 3P6BA 3LEIA 4B3NA 4NAOA 3JD72 4C90A 2RE9A 1FOD1 4BHPA 3ZPYA 2RDNA 1MZFA 4IEQA 5DG2A 4QPWA 1RUF3 4D69A 5JOZA 2P2KA 3OBTA 1YNAA 3HQXA 4WVZA 5KHKA 1MZ6A 2ZACA 1JYNA 4L11A 4LR4A 3HQUA 5CU1A 5IVCA 3SKVA 4CRQA 3T30A 1VBE2 2UWAA 1S4CA 5G04L 2A6XA 3BODA 3X29B 3AZXA 3FBYA 1AYN1 3K4AA 1XBFA 3M70A 4LO5B 3M3CA 3EB7A 5GLZA 2WINB 3UETA 1UYZA 2DWRA 3W20A 1R1A2 4HSJA 1FPN3 2JDHA 3H50A 4B7EA 1L7QA 3IDCB 2W3JA 2XPJA 1SEFA 3WG1A 1E5IA 1HN1A 1MR5A 1N3PA 3KB5A 4FPGA 3VGIA 3AKTA 4E8DA 1K5MC 4XCAA 1IGOA 1SDDB 2UURA 1KXGA 3BGAA 5LATA 2EIGA 1JZ8A 4L8QA 1H1MA 4DPNA 3LA3A 4CU7A 2ILMA 4DEVA 1JU4A 4N7IA 2IXHA 1T6GC 1TMF2 5FFOC 2XH6A 1LOCA 1W2NA 4QPIB 3ZFFB 1UIJA 3TRSB 4IV1B 4PDWB 4L9BA 5A7OA 4XFGA 1VE0A 1UMIA 4LBNA 4Y5Z0 5BYNA 1OT5A 2HEYF 2VL4A 2YXSA 4QM8A 1YI7A 3IM0A 4JGYA 5FREA 2FCVA 3ECQA 4JKMA 2FDHA 3JZVA 3ZVXA 1UIKA 3VBSC 1GQGA 5J37A 2X05A 3WX5A 2VUJA 1AF9A 5FR3A 2ZGRA 1UY1A 2VNGA 5FPBA 1JZ4A 4PJYA 2FD8A 5FZBA 5FZ3A 5KXCA 3S5AA 3FWEA 4N7UA 2MPFA 2VG9A 1Q8SA 2E63A 2OS2A 2WO1A 3POGA 1CZVA 4GWJA 5EQUA 3RZKA 2XMLA 4CP9B 1U5XA 2VC9A 3SEPA 1K42A 4FCAA 1Y9QA 1FYUA 1H4HA 5GKAC 2Q8OA 3TBDA 4D0QA 2JDZA 4XXPA 3ZKYA 3C2UA 3RFRA 3WEZA 2WSUA 3AMQA 5IFPA 2W1WA 1NY72 2IUWA 3UKTA 3HT2A 2VVDA 3OBRA 4WM7B 3SCFA 1Q3EA 2W92A 1W6MA 4QHZA 4ZKTB 5H9SA 3U11A 4EN6B 3ITQA 3VUOA 3H8XA 1JS9A 3CKHA 4M3CB 2UWCA 3HNBM 3MW2A 4N53C 5A33B 2E7QA 4FP3A 4V2VA 4XJUA 3ZR5A 4NJ4A 3ETQA 3K2OA 4RQPB 1RUJ2 4P00B 4OCTA 1IPKA 1COV2 2ZHNA 4XFCA 1DBNA 1ENXA 3HN1A 5IFTA 4BOWA 2HWC1 2GMMA 1AYM3 2OW4A 3ZDSA 2ZJCA 1MS9A 1F4HA 2E6VA 4NHMA 2ARAA 4QPGB 5JPNB 1DLLA 2RDSA 3PUHA 5IVBA 3NMBA 1EPZA 4U36A 4YRDA 5K0UB 1K5JA 1S2KA 3ABZA 4Q27A 3T2QA 3O1RA 1VBD1 3WDWA 5FPLA 3VBOC 1W8FA 2WLQA 3LFMA 4EROA 4AVTA 3ROUA 3N9OA 4DRVA 2ZEYA 2Z5WA 3ACHA 2BNOA 4E27A 4FPKA 4ITCA 1OOPC 2GNMA 2MHFA 4A6OA 1AXZA 3RJRA 2XJSA 1ZZBA 4M0HA 2BNMA 2H0VA 4QX2A 1GWKA 1W2UA 3I2JA 1W8WA 4M0NA 3WF2A 2X5IA 2WDBA 5IAVA 1S0GA 2VNVA 3O5SA 2OA2A 1F5JA 3B01A 3ZN4A 2PLV2 4NO4A 2NLRA 3FHAA 4MG2A 4HMZA 1GWLA 1KS5A 1G9FA 2H0BA 2VAUA 3NAPB 1RGSA 1FOD3 4WVVA 4WVMA 2RDQA 1UOJA 2JDUA 1PVC1 4MXVA 3C8XA 1S0CA 4CEWB 1GV9A 2C6SA 4IV3A 1VJ2A 1A8DA 3P5BA 1OQ1A 3FFZA 1VBA1 3MEPA 4JGZB 4JTNA 2GC0A 2WIIB 3E5XA 3OPWA 5HXVA 3OD0A 4IEUA 3S7IA 1D0HA 4GMP1 2RMU1 1WMDA 2JG8B 3KCXA 4LXLA 4UF0B 3P1IA 4CU8A 3OOXA 2CAVA 2IWGB 1DQ6A 2ZGNA 3LPFA 2PAKA 1VR3A 4UI9L 3WDXA 2RJLA 3GCWA 4QKDA 3HJRA 3FFQA 4A4AA 2P6HA 1W6OA 4J1XA 3O14A 1DZQA 1JYCA 1WLTA 1IOAA 3IIIA 5FZ7A 1V6NA 5C8CB 3B7MA 4ONUA 2Y0IA 2EIDA 4MXWB 2PFWA 3MW4A 1ENQA 4K40A 5C4WA 5KXDA 5L36A 5CKNA 2AH2A 1U5YA 1OF3A 4COUA 4JDNA 1U12A 2D98A 4QXHA 4QQPA 1LGCA 3JB4C 4OQ8A 2P6CA 2VUAA 3TN91 2WYFA 3PUAA 4YGCA 1H1AA 2WJSA 3NV2A 3J9SA 4XAAA 4XHBA 1RTVA 4AYUA 4A3ZA 1EV11 5CG9A 3IT8A 3S5QA 4IE6A 5GLWA 2AC1A 4S2DA 3OGJA 1ZX5A 2WNVC 3RQ0A 2D3RA 4HKOA 4JGYC 2WT0A 5DAVA 2JDNA 2FCUA 4CDXA 1YRZA 5FUNA 4BB3A 4UW3A 4Y4RA 5L7OB 1PO22 2GALA 1ZZ6A 5FYIA 3WHUA 3EJKA 5JSPA 1UZ0A 1WCQA 3THTA 2Y6FA 4XQDA 3NKGA 3VDBA 2H6BA 1US2A 2G9ZA 5F6LB 3T3YA 1L3JA 4H2AA 5F7UA 2ZKNA 2P34A 4QXKA 4JV4A 3VZKA 3KZ4C 2FCTA 2NQYA 2VNOA 5K4LA 1XPWA 3S0MA 3E97A 2OIIA 4XUTA 1KEXA 4UFIA 4BQYA 1UYYA 4JZRA 4A2UA 4FFGA 3AL6A 1B09A 1UO9A 3VBRB 1KFUL 3H3LA 5EJ1B 4NIIA 5LEJA 5FBZA 4Q4Y1 5DUWA 2EXIA 1GWMA 2XONA 1PX3A 4NVPA 3U4SA 2PTMA 4RHV2 4F8AA 5IHRA 1OPMA 3WQ0A 1QHDA 1TNRA 3ZYGA 1OD5A 4AWDA 1NA1A 1TG7A 5FYVA 2RS13 2DBIA 1UY4A 3RDIA 1DQ2A 3W9AA 3LB9A 2VVEA 2HWC3 4E2GA 2AZ5A 4XHXA 3NJYA 1HQNA 5A6ZA 3FUQA 1MS8A 3K48A 1V70A 3NJZA 2JICA 5D8AA 2RR12 1UU4A 5E6HA 2RV9A 4QMAA 4D94A 2DUQA 2XOMA 4Z2AA 5CFCC 2A6YA 2HWE2 2RS33 2VZQA 2ZX2A 1XE8A 3N35A 3RYRA 5FZLA 2C9KA 4QKFA 4YW1A 2DU0A 4K3UA 1J1LA 1QJX1 2ZMNA 1W3VA 3LDBA 3PHMA 5FY4A 1YIPA 1V00A 1MEC2 5BNOA 2VOWA 1X36A 5DG1A 2JE9A 4LUMA 4G3YC 1OH4A 5FUPA 4W8JA 1XSRA 2PAEA 4ZHNA 4P5YA 2CAUA 1BEV1 2Y34A 3VV1A 2TUNA 4GULA 3H8OA 2RM21 4Q29A 4CU6A 1HRV1 2QCSB 1RMU1 1Y43B 4Z8BA 1QU0A 1HXS2 2WS91 5C33A 3ZMNA 3FC0A 4P9WA 3LIGA 1NG0A 2IXLA 5IVFA 4Z1VA 1FAYA 1MQTB 1KITA 1VBB1 4I3PA 2F17A 3N9PA 3O0XA 3VDDB 1WWYA 4MX3A 5A3MA 2QQWA 3RRDA 3TNPB 3PDQA 5GZEA 4BLJA 5IATA 2P3IA 2KXLA 4A42A 1ZBE1 3Q9OA 4FTBA 3WNLA 5FZ9A 1W0PA 2HWB2 2GAUA 2C4XA 4IV3C 3FMGA 1X50A 1VBA3 3H8UA 3POJA 4NPMA 1J59A 5FZOB 5CIRA 1NQJA 4AEMA 4FI9A 4L2NA 1JZ5A 1SFYA 1X9PA 3K75B 3MLKA 2ZA9A 4RS5A 1OPOA 1PMHX 4XF9A 2RMU3 2P17A 4DIQA 4FAGA 3GJAA 2ARXA 3HAGA 1RHI2 3AP5A 5FYYA 3ZYRA 4K6BA 3T1MA 4GMP0 1QQP1 1OUXA 1S1AA 3OB8A 5JMCA 3M8LA 4AGVA 2ETEA 2P37A 3VKOA 3POBA 4BYYA 1CAVA 4HBNA 5C4WC 2GC2A 1CAWB 1UD1A 2GN7A 2J42A 4EE2A 3FBMA 3IAQA 3KV5A 4B8EA 2J1AA 3H9AA 4I01A 5F8PA 4KG0A 1E5RA 2EIEA 2QDNA 4XXAA 4Z82A 2E9QA 4HONA 5FYHA 3W58A 2Q5TA 4BDVB 3KV9A 1GNZA 4XUNA 3WLUA 4IEOA 2D3SA 1N1SA 3PL0A 1CQ9A 2G19A 1EV13 3VBFA 3OUIA 2DU1A 3W21A 1HIXA 4XEZA 3WUCA 4YM0A 1NCQA 3KQ4B 1JYXA 3T4HB 1FMD3 1K5MB 3TEXA 2QNKA 2FQPA 3RVHA 4XABA 1HLCA 2LS6A 1YI9A 3RPQA 3V0BB 1DDLA 4XMIA 5LB6A 2EAAA 5DQ0A 5FJHA 3VBHA 1NE6A 5DZFA 1UPIA 5F3IA 3K4ZA 5B2GB 4IW3A 5IJRA 4IERA 4XDQA 3U78A 2YGLA 3K51A 3ALQA 1JOPA 3HOBA 4Y22A 5GALA 4O61A 4PBOA 5J3UA 5CYYA 1LHNA 1QNYA 2PMWB 4Q4X2 4IQPA 2D44A 2GZWA 1ZRCA 5FQ0A 2ZEXA 4Z07A 4LA3A 5I91A 2A3WA 2MEV1 1NXMA 2GC3A 4MGIE 1LODA 3JQWA 5EXOA 5FZ1A 1B35A 2BUKA 3OG2A 1TME1 2RS53 4ES9A 4EZ4A 3ORJA 2CGPA 3VBSB 2EIBA 2WFF2 3IDBB 4Q4Y3 5L9VA 4YVSA 2WN3A 4ZXKA 3WT3A 3LDRA 4GAZA 1RUC2 3AYCA 3T2OA 5LRSA 1O4YA 4KMQA 4QD2A 4YLZA 4FPFA 3BKZA 5DUVA 3MFCA 1MZEA 3PIJA 1JZ7A 1W6PB 2BNNA 2CHHA 1BVP1 2XJRA 3PMSA 2HWF2 4NHYA 1EP0A 1MS0A 2WA4A 1AR81 1ND3A 2DVDA 4N9HA 5DZGA 4COZA 3PUIA 3OYWB 1CGPA 5F5QA 1JU3A 4OMCA 3NNFA 4KWLA 2PAMA 4DFSA 4XZPA 2XJUA 4RN5A 4BQ5A 1QH7A 1AXYA 2PHTA 3L9JT 1OURA 5FLHA 1Y9MA 1UU5A 1ASJ2 3MIHA 2FHRA 4N53B 4IGPA 5A7NA 3DXTA 1HDKA 4ZZ8A 2JDYA 3POSA 3B3QE 1WMFA 5FPUA 1HRI2 1PGL2 4CCEA 1QJX3 3J7LA 5T54A 1ALYA 3ZN6A 4JAAA 4CPBD 3HT1A 3ZFEA 2VZVA 2ZHKA 2RM23 4Q8LA 2OXBA 1HRV3 1NCRA 3APBA 3WNPA 4DO0A 2B5HA 5H9QA 1PZ8A 5GLTA 4D6RA 2A6VA 1EYBA 2WS93 4CDWA 2L9LA 4GB31 1UKGA 4N43A 4GWIA 3E6DA 3JUUA 3QD6A 1LB2A 2Y33A 4YFWA 3W5MA 3T4VA 4AEDA 1VBC1 2VUDA 3VBOB 5A6XA 1VBB3 5M0TA 2F4PA 3IPVB 4YZ3A 4EN9B 2N7GA 1KFXL 3DYMA 2OVUA 2JEMA 5BY5A 1RUF2 2QQUA 2TNFA 3SQOA 1W99A 3LOIA 4P5HA 5E88A 1OOPB 3RS6A 4A7YA 3WF3A 3NWKA 1LEMA 2HJIA 4XAEA 5C9AC 3H3ZA 1GBGA 4Q0SA 1O3TA 4K21A 3B94A 3FN9A 1BBT2 5AVAA 1C1LA 1PM7A 1V9U1 2VH9A 3KCYA 1LTEA 1MS3A 4LLFA 5DAXA 4R9AA 3RSJA 2FDFA 2WO3A 2BOIA 5DDJ1 3A7QA 2CU5A 4WVWA 3WQ1A 1HX6A 4EYUA 4NRQA 3OCPA 4JRAA 1Q8QA 3LZZA 1HJGA 3N9QA 4IE7A 2DURA 1QQP3 4Q4W3 2OYZA 4CDUA 2YBPA 3D8CA 4RGAA 1WCSA 4UW4A 3M3OA 5FMOL 1PK6C 4FFFA 3JBG1 3S57A 1I5ZA 3QCWA 1H8VA 3POEA 4JTOA 1CX4A 5AC91 1O3QA 5JZGA 3VN4A 5CADA 3ZXAC 1S0EA 2XVLA 5T5PA 4DINB 1QDOA 1EAH1 3D4KA 1D2SA 4Y1XA 5DABA 2E32A 4WM8C 1RUH1 4EWEA 1CAXB 5FY8A 4AHXA 3VBFC 5CBLA 1KGYA 3HNMA 4YM2A 2ZGLA 4XMAA 5HI0A 3HIFA 2IXKA 1R083 4UBHA 5LRRA 4B4RA 4DNYA 5JCTA 2IFRA 2CV6A 2EXJA 3GJBA 3DEMA 4S2HA 2XVGA 4Q2FA 3VBHC 3ZSMA 2ZGTA 3WG4A 1ONAA 1XNBA 4ZY9A 3RMXA 1VRH2 3URFA 5CZKA 1NOVA 2WN2A 2WZR1 5C3PA 2WBKA 4LIVA 3GGLA 3FX3A 4X8PA 1AR61 4HOOA 4XUPA 2GP3A 3N7JA 4QX3A 3DV8A 3HBZA 4DMIA 2WNVB 2WQ8A 4JGYB 1YFYA 2MEV3 3FLPA 2R061 3OBAA 2WC2A 3EHKA 5FP4A 4NHLA 5B4NA 1PMJX 1TME3 2W9XA 3POIA 2BW8A 2JENA 1OA4A 1BHGA 4YM1A 3ZPOA 4V2WA 2GNTA 3WP6A 1GP6A 1US3A 2VPVA 3T0BA 1AZDA 1UOBA 2OT7A 2V72A 1PIV1 4DRRA 3H1YA 4GH4A 2ZGOA 1ZZ7A 2QKDA 1XE0A 2IXIA 1UMZA 5A32A 5LW9A 4QX5A 3K3NA 4OUSA 1CWPA 3GZUC 1W0OA 5FYMA 1J58A 3ENRA 4JQRA 2DUPA 1K12A 1PO11 4ARYA 5FY5A 3PUQA 4DZGA 1UNBA 3JXSA 5DUXA 3I2OA 2R042 2XLGA 3IZOA 4GWNA 1G9BA 3CJIA 4OHYA 4Q5OA 1W06A 4A6SA 4YFZA 4R9DA 4PQ9A 1A34A 5DAWA 2NPIA 1JODA 5JAXA 1UZZA 4JDMA 1VALA 5AFEA 1RXFA 2YUEA 4LA2A 1ZBA2 4XJZA 2IXJA 4XPVA 1YUDA 1QXJA 3MICA 3AMNA 3NSTA 2G9GA 4I2OA 3B69A 3NNMA 3ZFEC 4BISA 2AUYA 3VBUC 2E31A 1JZ6A 1ZZCA 2R6QA 4ZS3A 5ISLA 1Y3TA 2Y6HA 4Y5SA 2D43A 3WQ7A 5LK5A 1AL0G 5F2SA 4GB33 2BTVC 4CDWC 1LKNA 3BCWA 3AVRA 4D7YA 5CFCB 2J7MA 3SH4A 5LA1A 3HN3A 1VBC3 1XNDA 2VCBA 2CDPA 4UFJA 3AKPA 1C8M2 4AEDC 3N7MA 5EFUA 4MZUA 1SLCA 4XFBA 5C3RA 1SCSA 4C0BA 1J3RA 3MV11 5K8SA 3H7YA 5HBAA 5FKCA 1BCXA 1LHUA 2A3YA 2R0HA 4Q4V3 3MPBA 3WP4A 5FZAA 4BQ4A 2Q30A 5CFDA 4YVWA 1AYN2 3ZFGA 1AL21 4XUQA 5FMBA 3B02A 1DLCA 4AI0A 2PHLA 3WW3A 1DCSA 2VBDA 2Y64A 2C0ZA 3NO8A 4LMFA 3VZOA 4R8HA 5A3NA 3N4MA 5DDJ3 4MGKE 4OMDA 3FLRA 2V09A 1Q8OA 2VQAA 2XBO3 4D6SA 1QJU1 3M3QA 3KS7A 1QY4A 1E57A 1REDA 2I74A 2VXJA 4P08A 5FP7A 3R6SA 3OY8A 2ZS6B 4HLTA 4WVMB 3WNMA 4MUVA 3TEWA 3NL1A 3I54A 3LSEA 1OFSA 4Y26A 3LEGA 3TEYA 4IV3B 3JBG3 1IG3A 2AEYA 3ZSEA 1QIQA 5BNQA 1WW4A 1D4M1 5JR7B 3RI9A 3VL9A 4YW4A 5DPNA 5AC93 4UW6A 3LFIA 2QQJA 5FOBB 5JZGC 4LBOA 5EYXA 1OVPA 1R093 2Y6KA 3H3UA 1EAH3 4LKFA 1RVF2 4CCNA 3UGFA 4P9JA 2V4VA 3T0AA 5FRAA 3A0KA 1RUH3 2Z79A 5A7PA 5JI9A 1ULGA 3OEAA 1QJEA 3SLIA 2Q1ZB 4FFHA 3ZM8A 3IB3A 5A3UA 5HCAA 4JHZA 4W65A 5C4WB 2IVIB 3WNOA 4CA9A 3ZXDA 4EN0A 3IWZA 4IETA 3IMMA 1W8TA 2ZTNA 5FXZA 3GZTB 1D0GA 1MVEA 3MUZ1 3PNAA 5F39A 5I93A 3CJXA 4BXFA 5FLIA 2XWJB 3DYPA 1N3OA 3HNYM 3OF1A 4QQHA 5FBJA 3T2TA 2R071 3N7LA 1LHVA 4OHVA 3SXWA 1GNHA 1A6CA 4OQ9A 2VMIA 1T2XA 2LTNA 1DGRA 1DQ5A 1NZIA 2WZR3 2Q8CA 2IVJA 3AJYA 2WNUC 1AR63 3AM2A 2CY6A 2W2IA 2KM2A 2R063 4D3WA 5LY1A 2D7FA 2D6LX 2D40A 2EVXA 3THCA 2TBVA 4L92A 1N1YA 2C24A 4RR3C 4W50A 4XFIA 4ZS2A 5F32A 1V6OA 4CXXA 2XVKA 4NUBA 1ND2C 1UXXX 1PIV3 3V56A 1CN1A 2DCTA 1WUVA 2W52A 3LA2A 1HW5A 1CAUA 1UY2A 4YYOA 1H30A 5LA9A 5ACA1 4NHKA 1W8UA 1CZTA 2ZKLA 2XUEA 5FK8A 1YFWA 4FPLA 1VLNA 1XNAA 2DFCA 3OGGA 5C8WA 1RXGA 1UZVA 2A3XA 1PO13 4AVBA 2RJ2A 2E33A 1WLCA 2GNDA 3AYEA 2VCCA 2QFEA 1VBD2 1LCLA 4N90A 3OSDA 1S0DA 3NJVA 1WLWA 3ME2A 5I0UA 2UY9A 4MVTA 4K9SA 3QH7A 3CJIC 1RUE2 2GP5A 4IEVA 2YFZA 4BMEA 3DN7A 1H2NA 5JR2A 1H1IA 1VBE1 3WNNA 5FMDA 2QTWB 1QEXA 2QVSB 3MIDA 1AXKA 2VO5A 2VU9A 1DU3D 2YPJA 2WSVA 4PHZA 4W6XA 5FO7B 2D97A 2QQLA 1O3SA 2K0GA 4UFHA 5DAPA 4CPBA 1AR72 5GZGA 3J8F3 1DQ4A 1PZ9A 2RS11 2BVVA 5DZEA 1HB2A 3R0RA 2B9UA 2XJVA 4NRPA 5ANNA 5I0TA 1LR5A 2QDRA 1YQ6A 2P3YA 4GKYA 1JYTA 2VW1A 1PVC2 1OLRA 1D7PM 1TMF1 2DTWA 4QHBA 2JD9A 3A22A 1SCRA 3L2YA 1RUD1 3WDTA 4OI4A 1QJY3 1PMIA 3ILFA 2D3PA 2RS31 2W39A 4HT1T 3RMYA 1RUG2 1W6NA 1CESA 3SITA 2VCMA 4E8CA 1AL23 4LJHA 5EWSA 3ZFGC 4CDQA 3RNSA 2C1FA 3KV4A 1QGLA 4LE4A 5E1RA 1Z7S2 2CSGA 2GSYA 3EO6A 3BOPA 3AP9A 3ACGA 1Z0HA 2VMGA 2DVAA 1RC6A 3O1OA 4XF0A 1SBFA 1JTZX 1QJU3 2BQPA 5D21A 5FXXA 3DKQA 2O8OA 2VMDA 1CPMA 1GNYA 4LHSA 3ZR6A 2BJSA 1ZA7A 4AR2A 3J7MA 3AFGA 3T1LA 2ZGMA 5C9AB 4MLOA 1DZTA 5CB7A 1APNA 3TNQA 5L73A 4HK9A 1W9FA 1X9TA 4BA6A 3TN92 5TSWA 1D4M3 3RZHA 3T0DA 4DQAA 2DVGA 4H14A 5AFBA 3FLTA 1SHWB 3VD5A 4CEYA 2ZAAA 3E6BA 1NY71 4NAMA 1OA2A 4K20A 2XJTA 5EJZB 1XJAA 2QQPA 3GHMA 4MGTA 1XNTA 4XFAA 4QX1A 5FP3A 4EN8B 1HV0A 2Z4FA 3FHQA 1GANA 2D6KA 1F15A 3WSOA 2RG4A 3Q8EA 3KHBA 2R32A 4CUCA 3EBRA 1X7NA 1PK6B 1XQNA 1RUJ1 4BWOA 1CAVB 3OUJA 1KQRA 3MBWA 3CMGA 4XURA 3BN6A 5A1AA 4HFSA 1H9WA 3LDKA 3BU7A 5EIYB 2X09A 2R073 2AGSA 2FZ2A 3FE5A 4QB2A 5FZDA 5HCBA 1QOOA 4WM8B 1DGLA 1ULEA 3VBFB 4JRLA 4QU1A 2VZSA 1QWRA 2WWUA 5ABJA 5C7GA 4IDZA 1LJ7A 4IGOA 1XSQA 2J1EA 3RG0A 2CWMA 1S2EA 3PMEA 1I6XA 3BIEA 4KL1A 4GIQA 2R1BA 5FP9A 3BTZA 3VBHB 1I5PA 1SLIA 3N9MA 1J3QA 1OXCA 3UL2A 1FMD1 1NLRA 2IXCA 1NZCA 4P9IA 1I9RA 3SCGA 4X8NA 5LBFA 4AI3A 2VR4A 4CCLA 1NX9A 5F37A 5ACA3 2GH2A 4R4XA 2LUWA 2TEPA 3H1MA 2PLV1 1OF4A 5JOXA 4YZ2A 3MO4A 3WINE 2Y6GA 4R52A 4XQ4A 2A7AA 3HEIA 1WCUA 4XYXA 1QMJA 4CU9A 3JD73 2YC0A 3UGHA 4OZXA 2ZGUA 1FI2A 3SH3A 2FBEA 1XE7A 3OPZA 1WLDA 3E6CC 5FZ6A 1AX2A 1YC61 4J25A 3O7OA 1LNSA 4CSWA 3IBMA 4U2AA 4WBBA 5J96B 5CEHA 2JKBA 4NWVA 4X6RB 1GSLA 1BYHA 3D0SA 2V4AA 2JIGA 4QPIA 3UK9A 3ZMOA 5FWJA 4H7MA 1VBE3 2JD4A 2RS51 4PDWA 3I2GA 2Q0AA 1N1VA 2XJQA 1N47A 1URXA 1XNKA 1BEV2 1V6MA 3UNPA 3WV6A 1R1A3 1IS6A 3GNEA 3OUHA 3ZN5A 1RMU2 1OLME 4P9XA 3C7GA 3WF0A 5DMYA 4Y1ZA 3S7EA 1W04A 1OMIA 4LHKA 4BQ3A 2DFBA 5FZFA 2VD7A 2Q1MA 1RINA 5CA6A 4EWAA 5FZMA 1VBB2 2AACA 2FZ1A 4L0PA 1KDKA 4OI1A 1POV1 3MPPG 4HPKA 3DPRA 4NMIA 2J1SA 1XXNA 2QQVA 4DB5A 4L97A 1OH3A 1QNWA 5FZ0A 3BOWA 1TMF3 1ZBE2 4NIGA 2HWD2 2YU1A 4CP9A 1S0FA 3Q8FA 4FTSA 2PA7A 3KD4A 2YY1A 3GHNA 3UESA 1RUD3 3C7OA 4P9YA 3C7EA 3ZN6B 3ZFEB 4Y4YA 1AR92 4WZCA 5D2AA 1KJRA 3O1VA 3VBUB 5GZCA 1GOFA 2DV9A 4ATFA 1H0BA 3I2HA 1YWKA 4I09A 4WM7A 4HVQA 3WDVA 3WW1A 2PYTA 2ZMLA 4FFIA 4CDQC 4CDWB 1DHKB 1PO21 1UYXA 5F5IA 4AEDB 3SMHA 4PBPA 1WA4A 2WNEA 2WWJA 4FQ4A 1ST8A 3WG2A 3WVJA 3FZ3A 5J1XA 1C4RA 2IFWA 4CCJA 2OZJA 3RGBA 1JW6A 5FZEA 2PELA 2X5IC 4XTPA 2EF6A 4LBQD 4URTA 1U5ZA 3WCRA 1UL9A 1WKYA 2PHXA 3ZOIA 4EZHA 5BNPA 4QPGA 3THDA 3POYA 3U14A 1UF2C 1DGWX 3AXDA 1YJLA 1ZYBA 3B00A 2WUHA 3HD8B 1TQ5A 3ILNA 4S2FA 1YFXA 2VECA 1DF0A 2PXJA 3NVCA 4FP2A 5C5UA 4AI8A 1HB1A 3PUSA 1S0BA 3DCQA 4AVVA 1HJFA 2RJKA 3VHRA 2JXAA 1H6XA 1MACA 2R49A 4RHV1 3ZIWA 3ES1A 2AR6A 5A7WA 1NLQA 4M3CE 4KU7A 3HQRA 1RUJ3 2D6OX 3MYXA 4W6WA 4D8MA 1J83A 4HETA 2A1XA 3DF0A 5BV6A 1UOGA 4LPLA 3JB8A 4SBVA 4YM3A 1F31A 3HVDA 4Q4W1 5JZGB 1A78A 1SLLA 2LW8A 3A4UA 5IVYA 3P3NA 2R7EB 5JXHA 3KV6A 3WZ1A 5A1LA 1RUI2 3ZSKA 2YU2A 4D7TA 2JJ6A 3CZJA 3OTFA 2R30A 3UGGA 3NAPA 2VJXA 3WQBA 2HWE1 4QU2A 1CVNA 2JX9A 5ABJC 3AZYA 2NN8A 4GZ9A 2AYHA 2GH8A 4CEWA 1XYPA 4E4HA 2HYKA 3LAGA 5IYYA 3GDBA 1CD3G 5FCCA 1V6LA 5F5AA 1RIRA 4S2GA 5FP8A 2VW0A 2J1RA 1JUIA 4OVEA 2YFUA 3INAA 2B7YA 4GWMA 3KVBA 4XQWA 4JC1A 2I45A 2D6PA 5KWRA 1AR82 2BU9A 2Z69A 1HXS1 4CDXC 2WNUB 1R081 4PF5A 4E2SA 1AJKA 1CR7A 2BBAA 3IIAA 2GN3A 2JECA 5FPXA 4BZ4A 2PLV3 5T52A 1HKDA 3U0ZA 1PNGA 4FQZA 2EXHA 3HPNA 1IS4A 1H2MA 4C1XA 1GR3A 4HL0A 5BUVA 1W8OA 3AVSA 3D5OA 4P14A 2ZX4A 4RR3B 1OI6A 2BGOA 1G7YA 2CWSA 2DBNA 2A6ZA 3PTRB 4FOYA 2QUOA 4XOGA 1ND2B 2D6MA 2ZBJA 4NPLA 5H9PA 3GBWA 1J3PA 1LGBA 3Q8AA 4ASLA 1LGNA 1Q43A 1REEA 2HWB1 4MV2A 3FL7A 1KD7A 4YWAA 4XW3A 3T08A 3WW4A 2ET7A 3I3QA 4O65A 1H4GA 5A32B 1H8TA 3PU3A 5HV4A 1GICA 1LULA 4FOQA 5EJ3A 1DYOA 3J4UH 2ZZQA 1QOSA 1XC6A 1AUYA 3CQOA 2OKXA 1RHI1 1AVBA 1BZWA 4QDRA 4W6YA 5L7OA 2CL2A 1BLZA 3ZXEA 3JCIA 3ACFA 4BQ1A 1NA1C 4KI5M 4BXSV 4AVCA 5HV0A 1O4TA 2WQ4A 3CJIB 3K3OA 2EALA 1POV3 4ASKA 4XC9A 5KC5A 5FUIA 2P1BA 4LBMA 2XKPA 2J22A 3H0OA 3LCPA 3DPRC 3MIGA 5F6KA 2VZPA 1PGW2 2VZ3A 4HN1A 1NLSA 1RJ7A 3TYJA 2UU8A 5D8AC 5J48A 1F8VA 1A3KA 5T5LA 3HWJA 4JKLA 1GZWA 2V5DA 3IDEA 1V9U2 4JKKA 3VBRA 1YYNA 4HVOA 3P3PA 1CJDA 3KGLA 5DAQA 1SG3A 2YV8A 2ARCA 1WMEA 5JSOA 3RZJA 1PO23 2XKOA 5FWEA 3O0VA 3WNXA 5BNOC 4HSLA 4UYBA 1XB9A 4IEPA 4NOTA 3KT4A 3NJXA 4P02B 5DN2A 4B7KA 3LF7A 4ES8A 2NZ9A 2VZ1A 2E51A 2VMHA 1JMUB 4K8FA 1GUIA 2KR2A 3PTYA 4L99A 4E4DX 3I3DA 3GXUA 4YW2A 1L7RA 2E7TA 4Q4X1 3VHOA 2BGCA 5H9RA 4EWDA 1D2QA 3ZFGB 3AP4A 3U10A 3OD4A 2JKXA 5BNPC 3DXUA 4PLMA 2YB7A 1LECA 3DYOA 3M3EA 4Y20A 1FNYA 1SDWA 3O1MA 1W90A 4QGLA 4Q4V1 4TTGA 2WFF1 1YHFA 3D82A 1ULPA 3TB0A 2E7AA 1WA6X 4Y33A 1HN0A 1RUC1 5F2WA 1G9DA 4V1PA 1QJFA 1DGWA 1L7LA 1O5LA 2QZ2A 4RHV3 4TWTA 3RYKA 5A3TA 2VM9A 2EICA 1FPN2 1CIYA 4RS5C 2ATFA 1V6KA 2HWF1 1SFNA 4NRMA 2K9ZA 5EP9A 3MHZA 2YC2A 4CP0A 2XBO1 1DG6A 1W2TA 4ZXEA 2VBBA 4CUGA 2XL9A 3PLQA 4QQOA 1G6NA 2ZZJA 5CG8A 4YPJA 5GZFA 5JUVA 1GOGA 1ULCA 3NNLA 3IMNA 1SBEA 2RR13 2WL1A 1F4AA 2DVFA 2YMZA 3KGZA 1ASJ1 2V73A 4CZSA 3VDDA 1MPXA 1LAJA 3VHNA 2Y6LA 3AKRA 3SKJE 4K1ZA 2HWE3 1SZBA 5FY0A 1WW6A 1DQ1A 2NMNA 1O4ZA 1PGL1 1HRI1 1R091 1VPHA 2ZGSA 3I3EA 3WHTA 3WF1A 2FDIA 1SBDA 2AREA 3QACA 5EYYA 3I49A 4A7ZA 2ZMKA 5KHHA 1ZA4A 4FTEA 1MEC3 1POQA 2WO7A 2XLAA 5A33A 1DIWA 2VTFA 4TZDA 5L9BA 2B39A 5JOYA 3MGUA 3N3HA 1XNCA 1NCQC 1LOAA 4I0BA 1JYVA 4RSUA 4ZU4A 1XYOA 1HXS3 5HCHA 4A44A 2H6CA 2GMEA 3KSCA 3KM5A 3RZZA 2D93A 5J98B 5BNNA 3A23A 4QB1A 4AQTA 4MYEA 1Z78A 4QQ2A 3PU8A 4YGEA 4GJZA 5T5JA 1JXNA 2UYAA 4BQ2A 2FDJA 3TAYA 3TWIA 2ZAHA 3ETPA 4UBGA 4QX0A 3KF3A 4LE3A 2PHRA 5FOJB 1GQPA 2HWB3 5JMOA 3BU0A 2B8MA 1DYKA 2VQUA 5A80A 1BBT1 2WA3A 5IK7A 2D6NA 1B35C 1CAUB 4IE5A 3RWNA 1QDCA 4K7JA 2ZXQA 1H8TC 1UXZA 3D6EA 1SLAA 3T09A 1X8MA 2E26A 3BPSA 4LOSA 5LBBA 2P3KA 4YVSC 4B29A 1K5MA 2XLFA 1LENA 3W59A 1RHI3 5FZKA 4AFMA 3E1F1 1MS1A 2JDAA 1W6QA 4XF4A 2Z2SB 1BMV2 2JB8A 4DS0A 1HB4A 3IN9A 2ZPXA 2FMYA 1AYM2 1BXHA 3ZYBA 4OUEA 2VXRA 4GQ7A 1ND3C 1W9SA 2O1QA 2RVAA 3CDZB 2BERA 1FXZA 4XUOA 3SISA 2VGDA 3VD7A 3NQHA 4PLOA 3J7NA 2VOKA 1D4VB 3UKVA 1W6MB 5GLVA 3OGRA 5C6CA 4BH9A 1REFA 4Z2WA 1UQXA 1ZM1A 4HKWA 4DOUA 4B4QA 1IKPA 1W05A 4JDOA 5APAA 4A45A 4C0HA 2HKXA 3GF6A 2VE1A 1UY3A 1NE4A 2GC1A 3BVCA 4OULA 5EPAA 3MLLA 1RUOA 1JH5A 4ZU7A 4IE0A 1BKZA 1VRBA 1W8HA 1YQ5A 4BMBA 1UX7A 4GKXA 4M3CF 3BTXA 4XILA 2ZGQA 1OLQA 4A41A 5FDBA 2HBTA 3AMMA 3J8F1 4LEJA 4M4RA 1RITA 2HH9A 1NCRC 1VAKA 4ATEA 2F6BA 4ZONA 4FPOB 1YEWA 4N43C 5A3OA 3BPZA 2J1TA 3AKSA 2OQ7A 3MLJA 1FOD2 4PF1A 1IPSA 2RDRA 4Q4X3 5FLJA 3VZLA 4BIOA 3C7HA 1RB8G 4B1MA 2VW2A 1Y7BA 4LBQA 4URAA 4CDQB 1KJLA 4PQQA 1SACA 1ODNA 3ST7A 4FPCA 1NKGA 1WGPA 1QJY1 1S2BA 3I4IA 3OEBA 2VTXA 2WFF3 3V0AA 4AAXA 2ADEA 4KGQA 1RUC3 2DYCA 2CGNA 4BQWA 2VBPA 3SC7X 2PQQA 1IS3A 2X5IB 3N36A 5IK8A 4XBQA 1HQLA 1NT0A 3O1UA 3UJOA 2B4KA 4LK6A 1N3QA 2HWF3 3MIEA 2YBKA 2YBSA 4BM8A 2DVBA 3JU9A 4IE4A 1X8EA 3ILRA 2YDEA 3M3IA 2W46A 4AI2A 4E4SA 5JDBA 4FXKB 1ZRFA 2C5DA 3PVBB 5CKQA 4Y5TA 5EZWA 3ZYPA 1W03A 2X10A 3ZXGA 1CJPA 4CDUC 1W9WA 3CBNA 3R4DB 3POWA 5FTTC 4NE9A 4JHTA 3POFA 4Y3OA 3WR0A 3IPVA 1ZRRA 5KC6A 1ASJ3 4RA0A 3AX4A 5J09A 3VDCA 4AVSA 5T55A 1CONA 4AFAA 1UOFA 3VZJA 4YSFA 2G4IA 3KQRA 3OPTA 3CZUA 4UAPA 1HRI3 4LO4B 4O9GA 3B5LB 4FVVA 4AGRA 1RUNA 2I2SA 4AI1A 2KA3A 1PX4A 5F1RA 1W2AX 2VOXA 1W39A 1ZBA1 2W91A 2WRAA 2UYBA 1OKQA 2ZX3A 3VL8A 4AOCA 5L19A 4KWKA 4I30A 3EYPA 1W6OB 3AXEA 4I0WB 4GJYA 4H55A 2VTXJ 2HEWF 3QH6A 4ARXA 4H7LA 1EUTA 4LO6B 1Q5OA 5FZIA 3RWKX 1DYPA 2Y8KA 5A6QA 1ZNPA 5ABJB 3QOPA 1C8M1 4PIYA 5BNNC 3WD5A 3LQCA 1YQ2A 2J1UA 5FKBA 3CO2A 2BRTA 5FK7A 4D7SA 4OI2A 5JLVA 4MO3M 2QQOA 3SNMA 4AGGA 3LPGA 3USUA 2ZCWA 1ZZ8A 5C70A 1WD3A 4FO9A 5LBEA 1BBT3 1TEIA 4CDXB 4OHZA 1DFQA 3I97A 5JXIA 1JYIA 4BPZA 5L9RA 5LY2A 2Q4SA 1CAXA 1TE1B 3BALA 2WYSA 4OFGA 1SPPA 2JDPA 2RS12 1LESA 1YFUA 2G9FA 3NV4A 4K1YA 4GH4C 3I8TA 3F95A 2HWC2 4LITA 1W8ZA 2AEZA 5IAXA 1VP6A 1Y4WA 5C3QA 1ZRDA 3K4DA 1K45A 3FHIB 2XDVA 1BK0A 3I59A 1UX6A 3WG3A 4DY5A 4MH0E
chains in the Genus database with same CATH topology
1PNFA 4M01A 2UY8A 1UKRA 2C9AA 3JD71 4A7KA 1RUD2 1ZVFA 2EXKA 1AX0A 2RS32 3U4XA 4KNCA 4PCRA 1RVF1 4AVAA 3UJQA 2WNVA 5AVPA 3AP7A 4AHWA 2EA7A 1PVXA 1OHFA 1NA1B 2X29A 2ZHLA 2PHFA 1R1A1 1CPNA 4IEYA 3QBQA 4HPKB 3DPRB 2ZOEB 4RGGA 3MIFA 2WFPA 3NV1A 3PVOA 5CNAA 5JPMB 1VRH3 5D8AB 5LEKA 1XRUA 3LGRA 5D1IA 3SHRA 3NKTA 2I07B 4OLLA 1PZ7A 2DCJA 4QM9A 4WV8A 1GFF2 2JG9A 5I8TA 5BNOB 3R4UA 1VBA2 4GA9A 4KQ7A 4M00A 2DF7A 1C57A 2B45X 3C3VA 1WCKA 2RMU2 5CFDC 4YVWC 2UWBA 2XWBB 4KWJA 5J7MA 1XU1A 3DL3A 1WW5A 2XG3A 1Q8VA 1C28A 2QJVA 4YGBA 5KHIA 4AW7A 3FUOA 1QJZA 2DUOA 1R1ZA 1YLLA 4FBFA 3I7DA 3WXPA 4AG4A 5BNPB 3ZXJA 4YZ5A 3GBFA 5CFCA 4ISQA 3I2DA 2XL7A 3BIWE 2R043 4P9GA 5CVRA 2XUMA 1V6JA 3HMYA 3AMHA 4NN0A 1VB2A 2B42B 1RUE1 5EV7A 1GZCA 2SLIA 4RS5B 1EV12 1UW8A 2ZGKA 2CGOA 1WD4A 4N9IA 5JWPA 1FMD2 1X82A 1ZBA3 5IK4A 2NYYA 4E4ZA 3MW3A 2O8QA 3IKWA 1YXWA 1AR71 2XB6C 3AZWA 4I0AA 1C1FA 4IXLA 1COV1 2DCKA 3O0WA 4YNIA 2R1DA 4F83A 2DTYA 2VQ0A 1C8M3 4JVAA 4AE2A 1FATA 4TYSA 3WUDA 1F2NA 1QOTA 3M7AA 4DXZA 4R9BA 2CTVA 1UU6A 3S30A 3GYDA 3M2MA 1QH6A 2RS52 3VZMA 1NCQB 1RUG1 1AYN3 4Q4Y2 4MGYE 2BVBA 5FMOS 3USSA 1Z7S1 5SV8A 4YG0A 3PVNA 2BFUL 1QKQA 2X8KA 4XJ8A 2BWAA 3D0JA 1C5HA 1DGRN 1O3RA 2RHPA 3DUIA 4LBKA 4FPEA 2CNAA 4Y22B 1XU2A 4QQLA 4EV0A 4LHNA 1HQWA 2A71A 3B9CA 2NMOA 3AYDA 1JHNA 1UN1A 4FOVA 4AHYA 5FQ0B 3WDUA 4INDA 4QGMA 1B35B 4J6GA 1H8TB 2ENRA 2GMPA 2R16A 2VULA 1IZ3A 1RVF3 4YVSB 5KBFA 1QJX2 2PHDA 3ZFFA 4IV1A 1LHWA 4LULA 4BE3A 2FMDA 4RL7A 4ZU5A 5JIAA 3M1HA 1ND3B 2RM22 4FPJA 1HRV2 4FPYA 1OQDA 4LBJA 2K2SA 2VNRA 2WS92 1M4WA 1DQ0A 1LEDA 1YIFA 1HV1A 5E89A 3PJQA 5JOWA 5T3NA 2BYVE 3AZVA 3MFAA 4AK3A 3N7KA 4Q0VA 3WY6A 2YYOA 4KBBA 4YZ4A 1GZWB 1LOEA 2W0XA 4CP1A 3KT7A 1FNZA 3PJYA 1YJKA 1BK1A 2JG9C 1MS5A 2A75A 1O7FA 5DXDA 5FAXA 2LALA 5FO9B 2XGXA 1VIWB 1UPSA 3EQEA 1Q8PA 1NCRB 2OPKA 3U07A 5BPXA 1U5IA 2WT2A 3A0NA 5KHJA 4XJAA 1LU1A 4N43B 2PHWA 4M3CA 3JQXA 4Q4W2 2ARBA 3L2HA 1QQP2 4XF3A 3GALA 3WP3A 2IZWA 1FV3A 1VB4A 3J26N 5T50A 3CNAA 4RQPA 2Z42A 4A3XA 3RI8A 4AHZA 2ZGPA 2EAKA 4Y20B 4CYDA 1FV2A 2WWSA 3MDPA 4Q0PA 1VBD3 4IEXA 4LLOA 2D5HA 1LOBA 2GDFA 1C3HA 1UCXA 1RUE3 3ZX7A 1VAVA 4CP2A 1QXRA 5JI7A 5K0UA 4CEYC 1MZ5A 4MGZE 5KXBA 1S0IA 1BVVA 4QPYA 2A70A 2ZX1A 1KDMA 3G6JB 4CDUB 1R082 2BEOA 1G8WA 1AR73 4NWWA 4FXGB 4Q1RA 4AEJA 5BXXA 3G7DA 2MNGA 3KT1A 4HANA 1COV3 2Y26A 4COWA 4BLIA 1PVC3 5C9AA 4PLNA 1H2KA 4NR1A 2HWD1 2RR11 1SMVA 3GBGA 2E53A 2MEV2 2YHJA 4I02A 4QGNA 1LOFA 4YARA 5A33B 4LHLA 4XBLA 1AR91 1C8NA 2BBVA 1TME2 1ULDA 4HN0A 1RUG3 1ULFA 4GMP3 5GZDA 1AHSA 1MEC1 1Z7S3 1BQPA 1SQ4A 1PHMA 4JGZA 4DY3A 5BNNB 1XYNA 1OFNA 3EXUA 4LUKA 3CEWA 4FT8A 3MZHA 2WQZC 2JG8A 1PK6A 4COYA 3ELNA 1SLTA 1G9AA 1YCIA 4UW5A 2XHKA 4PIXA 5C8CA 3TN93 4FSJA 4MXWA 1VAMA 2SBAA 4WM8A 1M06G 3CL1A 3ZYJB 4XFFA 2VVFA 4E9KA 4EJRA 1UAIA 4GH4B 1W6QB 4QPIC 3ZFFC 3MF6A 1N1TA 3AK0A 3AKQA 3BB6A 4IV1C 4PDWC 3ZYIB 1DZRA 3S6PA 4AEKA 4IEWA 4XF1A 1YO8A 4XJWA 4YG6A 4ORFA 1X33A 4XIOA 2QE3A 4GB32 2AENA 1O5UA 1O91A 1QXPA 1VBC2 4YW5A 4BCUA 3WW2A 1RUI1 3WOGA 3H7JA 4AFDA 2ZHMA 2R0FA 2W08A 3PVEA 4Y1UA 1OQEA 1WW7A 1ENRA 3VKNA 4Q4V2 4Q0UA 1POV0 3WCSA 4OHWA 3ZO0B 4Q0QA 3CF6E 1H2LA 1OA3A 3RYPA 5DUUA 4Q1PA 5JIUA 4FOWA 4WM7C 5DDJ2 3AB0A 1F9KA 2DCZA 4LTAA 1MVQA 1JOJA 4JCKA 2XBO2 4WZFA 2YGMA 5IT6A 4NPRA 4LBQB 4C1WA 1LHOA 4RQPC 3JBG2 3SH5A 4CTEA 4XTMA 5AC92 3V0AB 4TLFA 4Z92B 4G4FA 3VHPA 2NM1A 3ZIXA 1H9PA 4KU8A 4YVWB 4E2QA 1C5IA 3ZSLA 1R092 5CFDB 1EAH2 4QPGC 2IC1A 4AF9A 1KS4A 1RUH2 5K0UC 3MF9A 3VBUA 1BEV3 3BTAA 3SCHA 3V65A 4QT6A 1LOGA 4AXOA 1RMU3 2YROA 5A3LA 4HVRA 3OY8B 3VLBB 5K9YA 4B4PA 4ISRA 3CLPA 2WZR2 1AX1A 1J1TA 3DGTA 4Q26A 1MS4A 4R4ZA 4COVA 1AR62 3UV9A 1PGW1 1ZBE3 1ZZ9A 2HWD3 1MQTA 1I3HA 3KLSA 2R062 4AQ6A 1NXD1 1AR93 1LOFC 3NAPC 4AQ2A 2JE7A 3LKJA 3V64A 4KH9A 4RFT0 3ACLA 2Y0OA 3KCCA 2D5FA 4CEWC 4FPHA 3VKFC 1PIV2 3AMPA 4KG8A 2ERFA 4O9EA 2W68A 4JGZC 4F3JA 2ZABA 3AP6A 3NW4A 4R9CA 1V6IA 4AQSA 5IUQA 2JG8C 4P9LA 3AJZA 4TSVA 3MI8A 1PO12 2GNBA 4XBNA 2Y38A 3USUB 1G86A 4GALA 4IESA 3DKWA 5C8CC 1ENSA 1RUF1 1CAWA 1WBLA 2A5ZA 4UXAA 2VOVA 3KMHA 2VY0A 4AFCA 3LOBA 4HK8A 1FX5A 3RJ2X 3LA7A 1GYKA 4C91A 1PGSA 3WDYA 4RD7A 5FO8B 3UKNA 1RJ8A 1FPN1 3AFKA 3E5UA 3E5QA 3LSDA 2ET1A 4Q8KA 4SLIA 3ZXKA 3I59B 3J8F2 1SLBA 4XETA 3QLQA 4LNVA 2OUHA 1UZYA 3ASIA 4META 3V0BA 2WNUA 5L7OC 5JSRA 2OZ6A 1S0JA 2WT1A 2XJPA 1RUI3 1NYWA 5E16A 4LO8A 2BFUS 2A6WA 4IL7A 1JUHA 3HR9A 3WP5A 3ZXFA 4RR3A 3ZXLA 1QJY2 1U0AA 2X53S 1ND2A 4BIFA 4YGDA 3THPA 4MSVA 1AL22 3O12A 5LK7B 4YZ1A 1IPJA 1IS5A 4IEZA 4XIKA 4FAHA 2GU9A 2ZX0A 5I0RA 1AJOA 3VBRC 1EPWA 1LRHA 3VBSA 2DCYA 2LM3A 3AZZA 4EN7B 1AR83 1GZ9A 1QF3A 1I1EA 3B9IA 1QJU2 3AYAA 1EY2A 4OUMA 2WZPP 5GLUA 1NQDA 3GZAA 5K7PA 4H3WA 1W6PA 4LT5A 4Y24A 5F9TA 1VRH1 5I8YA 1BJQA 2JG9B 4XE9A 4OI0A 5J36A 1D4M2 2HEVF 3OYWA 1OSGA 5HCFA 1JN2P 5GJ6A 2CYFA 4LO7A 3VZNA 1W6NB 4G9SB 3OJBA 3TOJA 2P3JA 1Q56A 4I3GA 4YG3A 4Y1VA 3R05A 1G9CA 1IKQA 4N53A 5CAZA 1F5FA 1GKBA 1GQHA 4LBLA 1KRIA 1IHMA 1WCDJ 2B46X 1JBCA 1GLHA 5I0SA 1BMV1 4HZFA 4YW3A 5FPZA 1S55A 1FT9A 5JVVA 4XFHA 1A8MA 1AYM1 3VKMA 2R072 1RL3A 4F7ZA 4CEYB 2BPA2 3ATGA 1ZREA 2PHUA 1TNFA 5IK5A 4GXLA 3VBOA 3NV3A 3B93A 2A73B 4ASMB 2R041 1MQTC 3H1WA 3M4FA 3VKLA 3VDDC 5SV5A 4KGGA 3CU7A 1V9U3 5E8AA 4XJ9A 1OOPA 5KXEA 4J1WA 5T5OA 4OHXA 3MIBA 2QZ3A 3ES4A 2WLPA 4X6QB 2BWCA 2YZ4A 5I8SA 3LWCA 3ZSJA 2WKKA 1WBFA 4Y1YA 2ES3A 2OUJA 2PN5A 5ACA2 3R4SA 2NP0A 1CIWA 5GM0A 2O0OA 3FJSA 5KHGA 4PIZA 4HKLA 2V5YA 1LU2A 1IQAA 4B3NA 4C90A 3JD72 2RE9A 1FOD1 4BHPA 3ZPYA 1MZFA 4IEQA 5DG2A 1RUF3 4D69A 5JOZA 2P2KA 3OBTA 1YNAA 3HQXA 4WVZA 5KHKA 1MZ6A 2ZACA 4L11A 4LR4A 5CU1A 4CRQA 1VBE2 2UWAA 2A6XA 3BODA 3X29B 3AZXA 3FBYA 1AYN1 3M70A 4LO5B 3M3CA 5GLZA 2WINB 2DWRA 1R1A2 4HSJA 1FPN3 3H50A 4B7EA 2XPJA 3IDCB 1SEFA 3WG1A 1MR5A 3KB5A 1N3PA 4FPGA 3VGIA 3AKTA 1K5MC 1IGOA 2UURA 1KXGA 2EIGA 4L8QA 1H1MA 4DPNA 3LA3A 2ILMA 4N7IA 2IXHA 1T6GC 1TMF2 5FFOC 2XH6A 1LOCA 4QPIB 3ZFFB 1UIJA 3TRSB 4IV1B 4PDWB 4L9BA 4XFGA 4LBNA 4Y5Z0 5BYNA 2HEYF 4QM8A 2YXSA 1YI7A 3IM0A 4JGYA 5FREA 3ECQA 3JZVA 3ZVXA 1UIKA 3VBSC 1GQGA 5J37A 3WX5A 2VUJA 1AF9A 2ZGRA 2VNGA 4PJYA 5KXCA 3FWEA 4N7UA 2MPFA 2VG9A 1Q8SA 2E63A 1U5XA 4FCAA 1Y9QA 1FYUA 1H4HA 5GKAC 2Q8OA 3TBDA 2JDZA 4XXPA 3C2UA 2WSUA 3AMQA 3UKTA 1NY72 3HT2A 2VVDA 3OBRA 4WM7B 3SCFA 1Q3EA 1W6MA 4ZKTB 5H9SA 3U11A 4EN6B 3VUOA 4M3CB 2UWCA 3MW2A 4N53C 2E7QA 4FP3A 4XJUA 3ETQA 4RQPB 1RUJ2 1IPKA 1COV2 2ZHNA 4XFCA 1DBNA 1ENXA 3HN1A 4BOWA 2HWC1 2GMMA 1AYM3 2OW4A 3ZDSA 2ZJCA 1MS9A 2E6VA 4NHMA 4QPGB 5JPNB 1DLLA 1EPZA 4U36A 4YRDA 5K0UB 1S2KA 4Q27A 1VBD1 3WDWA 3VBOC 2WLQA 4EROA 4AVTA 3ROUA 4DRVA 2Z5WA 2BNOA 4E27A 4FPKA 4ITCA 1OOPC 2GNMA 2MHFA 1AXZA 3RJRA 2XJSA 1ZZBA 4M0HA 2BNMA 2H0VA 1W2UA 4M0NA 2X5IA 1S0GA 3O5SA 2OA2A 1F5JA 3B01A 3ZN4A 2PLV2 4NO4A 2NLRA 4HMZA 1KS5A 2H0BA 1G9FA 3NAPB 1RGSA 1FOD3 4WVVA 4WVMA 1PVC1 4MXVA 1S0CA 4CEWB 1GV9A 4IV3A 1VJ2A 1A8DA 1OQ1A 3FFZA 1VBA1 3MEPA 4JGZB 4JTNA 2GC0A 2WIIB 3E5XA 5HXVA 3OD0A 4IEUA 3S7IA 1D0HA 4GMP1 2RMU1 1WMDA 2JG8B 3KCXA 2CAVA 2IWGB 1DQ6A 2ZGNA 2PAKA 1VR3A 3WDXA 2RJLA 3FFQA 1W6OA 4J1XA 3O14A 1DZQA 1JYCA 1WLTA 1IOAA 5C8CB 1V6NA 3B7MA 4ONUA 2Y0IA 5KXDA 4MXWB 2PFWA 3MW4A 1ENQA 4K40A 5C4WA 5L36A 2AH2A 1U5YA 4COUA 4JDNA 1U12A 2D98A 4QQPA 1LGCA 3JB4C 2VUAA 3TN91 4YGCA 1H1AA 2WJSA 3NV2A 3J9SA 4XHBA 1RTVA 4AYUA 1EV11 5CG9A 3IT8A 5GLWA 4S2DA 3OGJA 1ZX5A 2WNVC 3RQ0A 2D3RA 4HKOA 4JGYC 2WT0A 4CDXA 1YRZA 5L7OB 4UW3A 1PO22 2GALA 1ZZ6A 3WHUA 3EJKA 5JSPA 3THTA 4XQDA 3NKGA 2H6BA 5F6LB 1L3JA 2ZKNA 2P34A 4QXKA 4JV4A 3VZKA 3KZ4C 2VNOA 2NQYA 3S0MA 3E97A 2OIIA 4A2UA 1B09A 3VBRB 1KFUL 5LEJA 5FBZA 4Q4Y1 5DUWA 2EXIA 4NVPA 4F8AA 2PTMA 4RHV2 1OPMA 3WQ0A 1QHDA 1TNRA 3ZYGA 1OD5A 4AWDA 1NA1A 2RS13 3RDIA 1DQ2A 3W9AA 3LB9A 2VVEA 2HWC3 4E2GA 2AZ5A 4XHXA 1HQNA 3FUQA 1MS8A 3K48A 1V70A 3NJZA 2JICA 5D8AA 2RR12 1UU4A 4QMAA 4D94A 2DUQA 5CFCC 2A6YA 2HWE2 2RS33 2ZX2A 1XE8A 3N35A 3RYRA 4YW1A 2DU0A 4K3UA 1J1LA 1QJX1 2ZMNA 3PHMA 1YIPA 1V00A 1MEC2 5BNOA 2VOWA 1X36A 5DG1A 2JE9A 4LUMA 4G3YC 2PAEA 2CAUA 1BEV1 3VV1A 2TUNA 4GULA 2RM21 4Q29A 1HRV1 2QCSB 1RMU1 1Y43B 4Z8BA 1QU0A 1HXS2 2WS91 5C33A 3ZMNA 3FC0A 4P9WA 1NG0A 2IXLA 4Z1VA 1FAYA 1MQTB 1KITA 1VBB1 4I3PA 3VDDB 3O0XA 4MX3A 5A3MA 3TNPB 3RRDA 4BLJA 5GZEA 2P3IA 2KXLA 1ZBE1 3Q9OA 4FTBA 1W0PA 2HWB2 2GAUA 4IV3C 3FMGA 1X50A 1VBA3 3H8UA 1J59A 5CIRA 1NQJA 4AEMA 4L2NA 1SFYA 3MLKA 2ZA9A 4RS5A 1OPOA 4XF9A 2RMU3 2P17A 4FAGA 2ARXA 3HAGA 1RHI2 3AP5A 3ZYRA 4K6BA 3T1MA 4GMP0 1QQP1 1S1AA 5JMCA 3M8LA 4AGVA 2ETEA 2P37A 3VKOA 4BYYA 1CAVA 4HBNA 5C4WC 2GC2A 1CAWB 1UD1A 2GN7A 3FBMA 4B8EA 3H9AA 4I01A 4KG0A 2QDNA 4XXAA 4Z82A 2E9QA 3W58A 2Q5TA 1GNZA 3WLUA 4IEOA 2D3SA 1N1SA 1CQ9A 3VBFA 1EV13 2DU1A 1HIXA 4XEZA 3WUCA 4YM0A 1NCQA 1FMD3 1K5MB 2QNKA 2FQPA 1HLCA 3RPQA 1YI9A 3V0BB 1DDLA 4XMIA 2EAAA 3VBHA 1NE6A 5DZFA 1UPIA 5B2GB 4IERA 4XDQA 2YGLA 3K51A 3ALQA 4Y22A 5GALA 4PBOA 5J3UA 1LHNA 1QNYA 4Q4X2 4IQPA 2D44A 2GZWA 1ZRCA 5FQ0A 4Z07A 4LA3A 5I91A 2A3WA 2MEV1 1NXMA 2GC3A 4MGIE 1LODA 3JQWA 5EXOA 1B35A 2BUKA 1TME1 2RS53 4ES9A 2CGPA 3VBSB 2WFF2 3IDBB 4Q4Y3 4YVSA 4ZXKA 3WT3A 1RUC2 3AYCA 5LRSA 1O4YA 4QD2A 4YLZA 4FPFA 5DUVA 3MFCA 1MZEA 1W6PB 2BNNA 2XJRA 1BVP1 3PMSA 2HWF2 1EP0A 1MS0A 2WA4A 1AR81 1ND3A 2DVDA 4N9HA 5DZGA 4COZA 3OYWB 1CGPA 5F5QA 4DFSA 4KWLA 2PAMA 4XZPA 2XJUA 1QH7A 1AXYA 2PHTA 3L9JT 5FLHA 1UU5A 1ASJ2 3MIHA 2FHRA 4N53B 1HDKA 3POSA 3B3QE 1WMFA 1PGL2 1HRI2 1QJX3 5T54A 1ALYA 3ZN6A 4JAAA 3HT1A 3ZFEA 2ZHKA 2RM23 4Q8LA 1HRV3 1NCRA 3APBA 2B5HA 5H9QA 1PZ8A 5GLTA 2A6VA 1EYBA 2WS93 4CDWA 4GB31 4N43A 1UKGA 1LB2A 3E6DA 3JUUA 3QD6A 4YFWA 4AEDA 1VBC1 3VBOB 1VBB3 2F4PA 3IPVB 4YZ3A 4EN9B 2N7GA 1KFXL 2OVUA 2JEMA 5BY5A 1RUF2 2TNFA 3LOIA 4P5HA 5E88A 1OOPB 3RS6A 4A7YA 3NWKA 1LEMA 2HJIA 5C9AC 3H3ZA 1GBGA 4Q0SA 1O3TA 4K21A 3B94A 1BBT2 5AVAA 1C1LA 1PM7A 1V9U1 2VH9A 3KCYA 1LTEA 1MS3A 4LLFA 3RSJA 4R9AA 5DDJ1 3WQ1A 4WVWA 1HX6A 3OCPA 4JRAA 1Q8QA 3LZZA 4Q4W3 2OYZA 2DURA 1QQP3 4CDUA 3D8CA 4RGAA 1WCSA 4UW4A 3M3OA 5FMOL 1PK6C 3JBG1 1I5ZA 3QCWA 1H8VA 4JTOA 1CX4A 5AC91 1O3QA 5JZGA 3VN4A 5CADA 3ZXAC 1S0EA 2XVLA 5T5PA 4DINB 1QDOA 1EAH1 3D4KA 1D2SA 4Y1XA 4WM8C 1RUH1 4EWEA 1CAXB 4AHXA 3VBFC 5CBLA 4YM2A 2ZGLA 4XMAA 5HI0A 3HIFA 2IXKA 1R083 4UBHA 5LRRA 4B4RA 4DNYA 5JCTA 2IFRA 2CV6A 2EXJA 4S2HA 2XVGA 4Q2FA 3VBHC 3ZSMA 2ZGTA 3WG4A 1ONAA 1XNBA 3URFA 3RMXA 1VRH2 1NOVA 2WZR1 4X8PA 3FX3A 1AR61 3N7JA 3DV8A 3HBZA 4DMIA 2WNVB 4JGYB 1YFYA 2MEV3 3FLPA 2R061 2WC2A 3EHKA 4NHLA 1TME3 2BW8A 2JENA 1OA4A 4YM1A 3WP6A 2GNTA 2VPVA 1AZDA 4DRRA 1PIV1 3H1YA 4GH4A 2ZGOA 1ZZ7A 2QKDA 2IXIA 1UMZA 5A32A 4QX5A 4OUSA 3GZUC 1W0OA 1J58A 3ENRA 4JQRA 2DUPA 1PO11 4DZGA 5DUXA 2R042 2XLGA 4GWNA 1G9BA 3CJIA 4OHYA 4YFZA 4R9DA 4PQ9A 2NPIA 5JAXA 1UZZA 4JDMA 1VALA 5AFEA 2YUEA 4LA2A 1ZBA2 4XJZA 2IXJA 4XPVA 1YUDA 1QXJA 3MICA 3AMNA 3NSTA 2G9GA 4I2OA 3B69A 3ZFEC 2AUYA 3VBUC 1ZZCA 2R6QA 1Y3TA 2D43A 3WQ7A 5LK5A 1AL0G 4GB33 2BTVC 4CDWC 1LKNA 3BCWA 4D7YA 5CFCB 3SH4A 1VBC3 1XNDA 3AKPA 1C8M2 4AEDC 3N7MA 5EFUA 4MZUA 1SLCA 4XFBA 1SCSA 4C0BA 1J3RA 5K8SA 3H7YA 5HBAA 1BCXA 1LHUA 2A3YA 2R0HA 4Q4V3 3MPBA 3WP4A 2Q30A 5CFDA 4YVWA 1AYN2 3ZFGA 1AL21 3B02A 4AI0A 2PHLA 3WW3A 3NO8A 2C0ZA 3VZOA 3N4MA 4R8HA 5DDJ3 4MGKE 3FLRA 2V09A 2XBO3 1Q8OA 2VQAA 1QJU1 3M3QA 3KS7A 1QY4A 1E57A 1REDA 2I74A 3R6SA 3OY8A 2ZS6B 4HLTA 4WVMB 4MUVA 3NL1A 3I54A 3LSEA 1OFSA 4Y26A 4IV3B 3JBG3 3ZSEA 5BNQA 1WW4A 1D4M1 5JR7B 3RI9A 3VL9A 4YW4A 5AC93 4UW6A 5FOBB 5JZGC 4LBOA 5EYXA 1R093 3H3UA 1EAH3 1RVF2 4P9JA 5FRAA 3A0KA 1RUH3 2Z79A 5JI9A 1ULGA 3SLIA 2Q1ZB 5HCAA 4W65A 5C4WB 3ZXDA 4EN0A 3IWZA 4IETA 2ZTNA 3GZTB 1D0GA 1MVEA 3PNAA 5I93A 3CJXA 5FLIA 2XWJB 3T2TA 1N3OA 3OF1A 4QQHA 2R071 3N7LA 1LHVA 4OHVA 3SXWA 1GNHA 1A6CA 2VMIA 2LTNA 2WZR3 1DGRA 1DQ5A 3AJYA 2WNUC 1AR63 3AM2A 2CY6A 2KM2A 2R063 4D3WA 2D7FA 2D6LX 2D40A 2EVXA 2TBVA 4L92A 1N1YA 4RR3C 4XFIA 1V6OA 2XVKA 1ND2C 1PIV3 3V56A 1CN1A 2DCTA 1WUVA 2W52A 3LA2A 1HW5A 1CAUA 4YYOA 1H30A 5ACA1 4NHKA 2ZKLA 1YFWA 4FPLA 1VLNA 2DFCA 3OGGA 5C8WA 2A3XA 1PO13 4AVBA 1WLCA 2GNDA 3AYEA 2QFEA 1VBD2 1LCLA 4N90A 1S0DA 1WLWA 3ME2A 5I0UA 2UY9A 4MVTA 4K9SA 3QH7A 3CJIC 1RUE2 4IEVA 4BMEA 3DN7A 1H2NA 1H1IA 1VBE1 2QVSB 3MIDA 1AXKA 2VU9A 1DU3D 2YPJA 2WSVA 1O3SA 4W6XA 5FO7B 2D97A 2K0GA 1AR72 5GZGA 3J8F3 1DQ4A 1PZ9A 2RS11 2BVVA 5DZEA 3R0RA 2B9UA 2XJVA 5I0TA 1LR5A 2QDRA 4GKYA 2VW1A 1PVC2 1OLRA 1TMF1 2DTWA 4QHBA 1SCRA 3L2YA 1RUD1 3WDTA 4OI4A 1QJY3 1PMIA 3ILFA 2D3PA 2RS31 2W39A 4HT1T 3RMYA 1RUG2 1W6NA 1CESA 3SITA 1AL23 5EWSA 3ZFGC 4CDQA 3RNSA 2C1FA 1QGLA 4LE4A 5E1RA 1Z7S2 2GSYA 3EO6A 3BOPA 3AP9A 1Z0HA 2VMGA 2DVAA 1RC6A 4XF0A 1SBFA 1JTZX 1QJU3 2BQPA 2O8OA 1CPMA 3AFGA 3T1LA 2ZGMA 5C9AB 4MLOA 1DZTA 5CB7A 1APNA 3TNQA 5L73A 4HK9A 4BA6A 3TN92 5TSWA 1D4M3 4DQAA 2DVGA 4H14A 5AFBA 3FLTA 4CEYA 2ZAAA 3E6BA 1NY71 1OA2A 4K20A 2XJTA 2QQPA 3GHMA 4XFAA 4EN8B 1HV0A 1GANA 2D6KA 2R32A 3EBRA 1X7NA 1PK6B 1XQNA 1RUJ1 4BWOA 1CAVB 1KQRA 4HFSA 1H9WA 3BU7A 2R073 2AGSA 2FZ2A 3FE5A 5HCBA 1QOOA 4WM8