2RJKA

Crystal structure of human tl1a extracellular domain c95s mutant
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
160
structure length
141
Chain Sequence
GDKPRAHLTVVRQTPTQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFIYSQVTFRGMKPDSITVVITKVTDSYPEPTQLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cytokine
molecule keywords TNF superfamily ligand TL1A
publication title Biochemical and structural characterization of the human TL1A ectodomain.
pubmed doi rcsb
source organism Homo sapiens
total genus 26
structure length 141
sequence length 160
ec nomenclature
pdb deposition date 2007-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00229 TNF TNF(Tumour Necrosis Factor) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.40 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2rjkA01
1D0GA 3FC0A 2O0OA 1OQEA 1D4VB 4RSUA 2HEWF 2Z5WA 3TYJA 5L19A 3LKJA 4QQ2A 2HEYF 2KA3A 5KWRA 1JH5A 4TWTA 4N90A 1I9RA 1PK6B 2JG8B 5TSWA 4HT1T 4KGGA 2JG8C 1KXGA 1D2QA 2OIIA 4E4DX 3K51A 2R32A 2JG9B 1TNFA 1XU2A 4KGQA 3URFA 3V56A 1U5ZA 1DU3D 1WCKA 3ME2A 2WNUB 4KG8A 4G4FA 2WNUC 3QBQA 3QD6A 5BNQA 4QPYA 4MXVA 1RJ7A 1U5YA 2X29A 2RJKA 2TNFA 4MXWB 1PK6C 2RE9A 3AB0A 4OULA 1GR3A 5CIRA 2QE3A 3L9JT 4G3YC 1OSGA 2WNVB 4QQPA 4D7YA 4EN0A 2WNVC 4OUMA 2JG9C 4NN0A 1C3HA 2E7AA 1U5XA 1DG6A 1OQDA 2TUNA 3K48A 3B93A 2JG8A 1S55A 5KC6A 5HBAA 1IQAA 2ZJCA 2AZ5A 4E4SA 2R30A 4MSVA 1O91A 4F3JA 3ALQA 2RJLA 2R6QA 3MI8A 2ZPXA 1RJ8A 1KD7A 2WNUA 4GIQA 1TNRA 1C28A 4OUSA 4DB5A 2Q8OA 1A8MA 2Q1MA 1PK6A 3B9IA 4MXWA 2HEVF 4TSVA 1JTZX 4QQOA 2QDNA 3IT8A 4DOUA 4J6GA 4QQHA 1ALYA 4QQLA 2WNVA 3WD5A 3B94A 2JG9A 5L36A 1XU1A 5KC5A 3TWIA
chains in the Genus database with same CATH superfamily
5FXXA 4RHV3 4F7ZA 2KXLA 3MDPA 4QX3A 4XJ8A 4BE3A 1UMZA 1UKRA 2HEWF 3AMHA 4ZU7A 5JDBA 2VOTA 2BEOA 1K5MC 2XL9A 2ZXQA 3UYJA 4ZXKA 2CSGA 4QMAA 2HWE2 2VXJA 3ZFGB 3CJIC 2Z42A 3THCA 1EUUA 4QKDA 1PK6B 3ZXAC 5FZMA 3CDZB 5TSWA 2C5DA 4JAAA 5A7NA 2YGLA 5FYYA 2QQMA 2ZAHA 3U11A 1MS0A 2GH8A 3VDDA 3BIEA 2E6VA 4BMBA 1OA3A 1LOFC 4C0BA 4FQZA 4OYUA 4RGAA 2D93A 5E16A 1EUTA 5BUVA 2LM3A 1WW7A 4FBFA 5GM0A 4Y1YA 1GQPA 1DHKB 2CWSA 4PQQA 5FLJA 2JE7A 3EQEA 3DECA 4L2NA 3C8XA 1MS5A 4CDQB 5EHDA 1NT0A 5JVVA 4CEWB 2WNOA 1X9PA 5CIRA 2YBSA 1SLTA 1QIQA 3HN3A 3SEPA 2GNDA 1EY2A 2ZX4A 5D21A 2Q5TA 4MX3A 1W9SA 4PF1A 4QPIB 2D5HA 4MADA 1U5YA 4DRRA 4A44A 1WMFA 5FYHA 2J1SA 1E5HA 1WBLA 3VLBB 4HL0A 3C7EA 1VBC3 5ABJC 1RUE2 2Q1FA 4M3CF 3O0XA 1Q8VA 3T4VA 4PHZA 5EJ1B 4IQPA 2RDRA 2WZ8A 3QACA 2P3YA 1XBFA 1MACA 1JOBA 2YHJA 2ZGOA 3WZ1A 2O8QA 5EV7A 2PHLA 3Q8CA 2Y60A 3ZFFB 5FK8A 1C3HA 1VB4A 4QB2A 4RGKA 3IBMA 1GZTA 1PO22 1VMJA 2WKKA 4K7JA 1JZ2A 1ZBA2 1JZ6A 4WVVA 1W8UA 4X6QB 1YFXA 2ZGSA 2JG8A 4A6OA 1ZYBA 1RC6A 2ADEA 1GKBA 3RRDA 2FZ2A 4YG0A 4Y1UA 1O3QA 4OCTA 5L9RA 5C4WB 1DGWX 4FAHA 4YM3A 5FY5A 4CDUA 2XQRA 1Y9GA 2AZ5A 4CCCA 1B35A 2XUEA 1QOSA 4JZRA 2ADDA 4CCKA 5C8CA 4UYBA 4GWJA 1RVF3 2D7FA 3CEWA 4SLIA 4BLIA 1JYVA 3AP9A 2WRAA 3VBFA 1ULFA 3KT1A 1O3RA 3K3NA 1YYNA 1YI7A 5A3NA 4AVAA 1AVBA 2OA2A 2R0HA 3ECQA 4OUEA 2CAVA 3ST7A 4WVMB 1CAXB 3LDBA 2RG4A 4CCNA 4Q0SA 1ND2A 3FMGA 2V5YA 2Q8OA 5LA0A 1MQTA 4WM8A 1CONA 1H2MA 2A3YA 3JQWA 1SFYA 1TME3 3DYMA 2YUEA 4GKXA 4Y26A 3LA7A 4GA9A 4BISA 1GP4A 1A78A 4RS5A 3ZFEC 2ZBJA 4Q4V2 3N7KA 3MZHA 5A3TA 1FV2A 2JD9A 2PN5A 2VL4A 4I2OA 2JICA 1OBNA 2WA4A 2WNEA 1H2NA 3MF9A 3T1LA 1F2NA 3MV01 3WF4A 3PVNA 4ZY9A 1K5MB 2JDPA 3PIGA 3CMGA 1NOVA 4YVWA 1HKDA 1JUIA 5BNOC 4ZPIA 3I3DA 1YQ5A 4MHRA 4GWIA 3TN91 3VKLA 1VRH3 1C4RA 3R4DB 4CTEA 5IFPA 5J98B 4FPKA 1CAWB 3O0WA 5FXVA 4O61A 4GD4A 3DL3A 3AX4A 1V70A 1OUXA 3DPRA 4XJUA 3JBG1 2I45A 1FNZA 2BWCA 5DAVA 3OGJA 1EV11 1D2QA 4CPBD 3DKWA 4LITA 2DVBA 3KS7A 2LW8A 3LIGA 2D6MA 1Y4WA 1XE8A 4M01A 4FFIA 5FYIA 4GULA 1DGLA 1LJ7A 1TVGA 2A5ZA 3THPA 1W6QB 3MEPA 1M06G 2J7MA 2B46X 3JD73 1LESA 4CU8A 4I01A 1X9TA 2BP6A 3FE5A 1V9U3 3JXSA 4Q4W2 2W5FA 1BVP1 2EXHA 3MF6A 4Y20A 4XQDA 2FDKA 3WF0A 1QJY2 1UCXA 4IL7A 2P3IA 4PDWC 2MNGA 3WX5A 5J36A 5DABA 1RUI2 2WT1A 1E5IA 4DEVA 3ZYFA 1AJOA 1XNAA 4XZUG 2VUJA 5LATA 3T2QA 3ACGA 1MS1A 4ES8A 4QU2A 5IVJA 4IGQA 2QZ3A 2GDFA 4XFFA 4AI9A 3WEZA 1OXCA 4G9SB 5DAWA 1VBA2 3IDBB 3O1SA 4PI0A 4UWDA 4K9SA 2JE8A 4EWEA 4E8DA 5FUIA 1D4M2 5LA1A 1S2EA 1YIFA 1JUHA 1LHVA 1PNGA 4M0HA 4RR3A 2WQ4A 4XFAA 3H3LA 3TEXA 4MGYE 2GALA 2W94A 5A6YA 5HBAA 1GWMA 4XUQA 2DVAA 2WZR3 2VVDA 4A4AA 1DLLA 1L7QA 4QAWA 2WN2A 4Q1PA 2YPJA 3LEKA 4JGYA 4BJ0A 1STMA 5F2SA 2FHRA 3AMPA 4CP9B 2HWC3 3J8F3 1HV0A 4F3JA 4B3NA 1BBT2 1UPIA 1POV0 4A42A 5L7OC 4XF4A 4XFGA 3S5QA 1FOD2 1O7FA 2WNUA 2VTXJ 4B1LA 3RS6A 3WNXA 1AXZA 3UESA 2VG9A 5M0TA 4QXKA 2JDNA 5IK5A 4BXSV 3KD4A 2ID4A 3OGRA 3ZFEB 2VR4A 4HPKA 4UW4A 1QNYA 3NNJA 4QM8A 1JTZX 3POFA 4QQOA 2HBTA 1QJFA 2VTFA 5B4XA 3I49A 1NE4A 1ZRCA 2RS11 1X36A 2VGDA 3IT8A 4YW7A 3NNLA 3NNFA 3OYWB 3VKMA 3SH3A 4QQLA 1W9TA 2V72A 3RJ2X 5LY2A 3B94A 2DU0A 1SG3A 2G1MA 5E88A 4CUCA 2R16A 4J1XA 3FLTA 4LR4A 5AC92 2XJVA 2Q8EA 4ASMB 5KHIA 1QJU2 1YLLA 2PHUA 1RUC2 1MPXA 2AC1A 1WKYA 2E26A 1ZZ7A 3LKJA 1FATA 4P14A 4KWUA 5KWRA 1SBDA 5JZGC 3AKQA 2RS33 1HW5A 1MQTB 4QXHA 3AXDA 5I8YA 2DFBA 5BYNA 2R073 2UU8A 1RUNA 1SACA 2PLV2 2WR9A 3VBUC 5LBFA 4CSWA 5ISLA 1SFPA 2HWF2 3PUSA 2ILMA 1LU1A 4YG6A 1LENA 4GMP3 2VZQA 4NWVA 4UFLA 1WA4A 2R063 2PA7A 2WO1A 3AKSA 5FYSA 5A7PA 3ZYJB 4AEDC 1O3SA 3J4UH 2BFUL 2WWUA 3NJVA 1VJ2A 1UX7A 3LEMA 3OF1A 3J7LA 2QDRA 1PZ7A 1OVPA 5FZDA 3URFA 4AQ2A 1J59A 3D6EA 5F7UA 3H7JA 1W6OA 4BQ1A 4YVWB 3I2HA 5CEHA 4O9EA 5LY1A 3T0DA 5A80A 1RUE1 3VDBA 3ZYGA 4H2AA 2RM22 3ZOIA 3AMMA 5T54A 1EAH3 1YWKA 1HB2A 4OI2A 1PX4A 1W9WA 3H9AA 1D0HA 2UYBA 3QD6A 3HQXA 1TMF2 1UN1A 2ORZA 2FBEA 2FDJA 4IESA 1LTEA 2Q8DA 1XE7A 3DCQA 5BPXA 2X53S 5A32A 2PHTA 2BNMA 2RE9A 3M3QA 3M70A 3N3HA 4J1WA 4OI1A 1CAVB 4ITCA 3O1RA 3E5XA 2V5DA 5LW9A 5FYMA 3H8OA 4YARA 1IPJA 2GC0A 3K4DA 3DYOA 3ILRA 4IW3A 1VLNA 2ZEZA 4JDOA 4D7YA 1LNSA 3RZMA 4NWWA 4XE9A 1HN0A 4PIXA 1IPSA 4OUMA 5FBJA 4QHBA 2OZ6A 1SBFA 4XDPA 4AR2A 3NJXA 1JI6A 4XOGA 5FP3A 3I3BA 1OURA 1ST8A 3OUHA 3ATGA 2IXHA 4XQ4A 4OQ8A 3S7IA 1YO8A 3GALA 5FFOC 2WT0A 1NXD1 4YM1A 3AJYA 1YQ8A 4XBNA 4EWAA 4OHYA 4BOWA 1IQAA 2BZDA 4FT8A 2VZ1A 3HT2A 4YZ2A 4MG2A 3H8RA 1V00A 3PL0A 1GZ9A 5T55A 2NZ9A 2A71A 1W6NB 3ILFA 5DUVA 5K0UA 5L7OB 1F4AA 3MBWA 1JYWA 2PHXA 4OHZA 2QQLA 5JOWA 4LO8A 1ZRDA 1UYPA 1AL0G 1FMD1 3RI8A 3ZXEA 5FMDA 2QZ2A 5J37A 4I30A 4YSFA 1ZRRA 1GNZA 4BQWA 4RQPA 2ENRA 4XXAA 1Q8QA 1RYYA 4RR3B 1XNDA 2Q1MA 5DQ0A 4HOOA 2W52A 2H0VA 2PAKA 4AWDA 5BNNA 1NZIA 1LAJA 1NX9A 2GP3A 4MH0E 4S2FA 4YW1A 2P1BA 4JGYB 4NRPA 2WQ8A 4HN0A 2FD8A 3F95A 1S0GA 1UY1A 2WC2A 2R7EB 5KC5A 2AREA 4NRQA 5FYBA 1PM4A 1BEV2 4XABA 1WLDA 4XUOA 5FPBA 5I0DA 4ZHNA 2NP0A 3TEYA 2Z5WA 4GB32 1PZ8A 2QQVA 5L19A 1CPNA 4LBQD 5JZGB 3I2IA 4AG4A 4Q4X2 2H6CA 3WW4A 5LEKA 3WQ7A 5KR7A 2VUAA 3VBUB 4Y22A 3WF2A 1UZZA 3M3EA 4K20A 4N90A 4TWTA 3BGAA 5FO8B 4COWA 2JKXA 2YV8A 2CYFA 3GHMA 1QXRA 5FUPA 1AYM1 4R52A 4AEDB 1A34A 3OGSA 4DXRA 2ATFA 1F5FA 2EIGA 4AFAA 2KM2A 2ZHNA 5EPAA 1YC61 1LGNA 3VZLA 1O8SA 4L11A 4Q4W1 5FZKA 1Z0HA 2DCJA 4P08A 3PU3A 1SEFA 3KF3A 4MUVA 1GU3A 4MHUA 2XKOA 1RUI1 5I0SA 4A7YA 1O5LA 2H6BA 3O5SA 5L9BA 3WV6A 4IV3C 5DAQA 2W92A 1Q3EA 2XL7A 4XXPA 2XWJB 4N53C 4Q1RA 4QKFA 4EZ4A 4HN1A 1UU5A 2RJKA 5A33B 3K4AA 5FQ0B 3U07A 2ET7A 2JDYA 3N9OA 5LA2A 1J58A 2W91A 5FKBA 1JHJA 1WCUA 3HOBA 1SBEA 3FFQA 4IXLA 4U36A 1UPSA 2A3XA 3E6BA 3HMYA 1RUF2 5EYXA 1WLCA 5C3PA 2QUOA 2R1BA 3I3EA 2V4VA 4CXWA 1IQDC 1W6OB 1XB9A 2GU9A 1LCLA 2C9KA 1H6YA 4LT5A 4YZ5A 1MS4A 3RZJA 3LIHA 4FP2A 4N43A 1NE6A 3ZDSA 1LEMA 4EV0A 4AEJA 1RIRA 3KVBA 3GBGA 2XVLA 4KWKA 1FAYA 3ZSLA 2PHWA 3ZIWA 2ORXA 2PFWA 3TN93 1O4TA 5HV0A 4BPZA 4CRQA 5LRSA 1Q5OA 3HBKA 2AH2A 4MSVA 4TZDA 4A7KA 1I6XA 2DVDA 1PGL1 2XR4A 1HRV2 3H42B 1GOHA 5C7GA 1DQ0A 2VD7A 3ON7A 3TBDA 3JCIA 2DFCA 3JBG3 2ZGMA 4M3CB 1ASJ2 1NG0A 4P9XA 1C28A 4I3GA 1EV13 4E9KA 1PMHX 3NV2A 1W2TA 3KV5A 4IUGA 5JLVA 4B7EA 3ILNA 3IPVA 2Y6GA 4XILA 1FV3A 2VQTA 3LDKA 1GSLA 1RUG2 1HXS2 3MW4A 2FDIA 1YUDA 1Q8PA 3SHRA 2ES3A 2NMOA 5IYYA 1QJX1 4IV1A 5FTTC 1JODA 4XUPA 4Y1VA 2VMCA 4XUTA 5LZ6A 4ZZ5A 5I0TA 5K0UB 1G9BA 1S0DA 1AR62 1H2LA 3ZSKA 4BQ5A 1RUD2 1RUH2 1S0IA 1HLCA 3V0BB 1D4VB 4PIZA 5F39A 1YEWA 1W8ZA 2HWB1 4LBOA 1K42A 1VR3A 4BLJA 3KT7A 4FXKB 2EXIA 4GQ7A 5BNPC 2RMU2 4COUA 3IDEA 3NAPC 3PDQA 4RQPB 1UOFA 2YY1A 4JV4A 2ZA9A 1PVXA 4UFMA 1MEC2 3W9AA 2W2IA 4E8CA 2EXKA 4F8AA 1MR5A 4QX0A 4ZS3A 1QDOA 1ZBE2 1K3IA 4FCAA 4E2QA 3MYXA 1QXPA 4OHVA 2RM21 4XCAA 2QCSB 2VO5A 4MGIE 3ENRA 3PVBB 3RDIA 1R082 3KGZA 3RPQA 5AFEA 3ME2A 1FPN2 4HKOA 4XF0A 5F9TA 3AYEA 1ZRFA 3KCYA 2I2SA 3PHMA 4HONA 4IV3B 1H6XA 1XNCA 4Q4Y2 1XC6A 1HB4A 3UK9A 1JZ5A 4N53B 4FTSA 3KGLA 3PMEA 4LBMA 1OVSA 4Y1ZA 3RZZA 1SLAA 3TNPB 1R092 3QOPA 4Y22B 3U37A 5JMOA 4PLNA 2RR12 4BHPA 5FRAA 2PXJA 4AE2A 3DKQA 3OD4A 2XJUA 3DV8A 5DAXA 4FAGA 2E9QA 2X5IC 1MS3A 2OS2A 3D5OA 3LF7A 3SC7X 1PK6C 4AF9A 2CGPA 3NWKA 1QEXA 1W2NA 1CJDA 1REFA 1ULOA 2FCTA 1UMHA 2IVIB 4OULA 4OZXA 1COV1 2QE3A 4X8NA 4EROA 4YGEA 3LOBA 2Q1ZB 2VQUA 1LB2A 3ITQA 1W8OA 3GZEA 2XGXA 4LBKA 4LHNA 2WNVC 3OPZA 3A22A 3MICA 2Y34A 2RS13 3NMBA 5C3RA 1MZ6A 5H9PA 3N7LA 5H9SA 3FLPA 4IEQA 2X05A 3MW2A 2BUKA 3B69A 1S55A 3A0KA 4I09A 4QB6A 3USUA 2WT2A 1NLSA 3ACHA 5CYYA 3VZNA 3HQRA 3O1UA 3KVAA 4KH9A 4ZS2A 4IEZA 3I8TA 2QQNA 4AVSA 2MEV1 1C8M2 4XFHA 5FZGA 1VBD2 5K4LA 2BPA2 3VD5A 2RJLA 5EP9A 5LWBA 4YZ4A 5F3IA 5JR2A 2A7AA 2DDUA 1W3XA 1UIKA 4LXLA 1HN1A 3O7OA 4YFWA 5HI0A 3N9PA 2RDSA 1ULGA 2WINB 1KGYA 4YGCA 3J26N 2IFRA 4U2AA 5DG2A 5HCAA 4K8RB 2UWCA 5CG8A 4W6WA 1PMJX 5FPUA 5FZ3A 3LSEA 3M4FA 5F8PA 1JN2P 3VB9A 1ZNPA 5F6KA 4EN6B 1KITA 2JB4A 2OUHA 3MUZ1 4BYYA 4MXWA 3IWZA 5FPLA 1OC1A 3IAQA 3WXPA 1H1IA 1RUJ1 1S0EA 2B45X 2EIBA 2YBKA 3OEBA 1QMJA 4LUMA 4GB31 1RUE3 2ARBA 1J3RA 1V6LA 2A70A 2XVGA 1WCQA 1W8NA 3WR0A 5F1RA 1CN1A 4FXGB 4XFCA 3NW4A 3LCPA 4KQ7A 3RMYA 4XHXA 5ACA2 4RSUA 5FO9B 5IK8A 3SLIA 2QNKA 2XBO1 3W21A 5BNPB 5I91A 3NAPB 4IE5A 4XTMA 3V0AB 1RL3A 1F31A 1S0BA 3HPNA 2KA3A 2GZWA 3BPZA 3CIHA 4UXAA 4UOJA 3UKVA 4EN9B 4M00A 3VHRA 3DUIA 4D7SA 4YNIA 1PO11 1Z7S1 4AZZA 3D8CA 1YJKA 3GZAA 5FKCA 1AYN2 1OT5A 2JB8A 1OOPA 1RMU2 3BTXA 5J48A 1Y7BA 1UX6A 1X82A 4XMIA 4AL9A 5JSRA 4MYEA 2BBVA 4NVPA 2BFUS 5FYZA 1DQ5A 1O6UA 2I74A 3A23A 3C7FA 4UBGA 5LBCA 1MVQA 3PVOA 4NOTA 1JZ7A 4PI2A 2ZGUA 3NQHA 1ZVFA 3GZUC 5CKNA 1ZM1A 3TB0A 3BCWA 4LKDA 2JEMA 1OQ1A 2PHFA 3SXWA 3O14A 1OPMA 3KHBA 2X5IB 4MXVA 5IT6A 2FDFA 1QOOA 4CUBA 1UOJA 1O59A 1FMD3 3WSOA 2VOVA 1N3OA 4LO7A 1F4HA 4HVRA 2WSUA 1GR3A 4BWOA 1FI2A 4G3YC 2VAUA 4LBQA 1YCIA 2WNVB 4TLGA 2G19A 4YRDA 2VCAA 1G9DA 3IAPA 3U14A 1H1MA 3D0JA 1AX1A 4QX7A 1HDKA 4O65A 3C7OA 3OGVA 3KSCA 4DUWA 2W9XA 3AC0A 1DQ1A 3FHIB 4N9IA 2ARXA 2R043 4QXCA 4DXZA 1W0OA 1CWPA 4CUAA 1H30A 1N1SA 2Y8KA 3RJRA 5FPZA 2CY6A 2IXKA 3KCCA 5KHKA 1RXGA 1BLZA 4XJWA 3ZN6A 3ZSMA 1XE0A 4CCMA 5C3QA 5LCWL 2W08A 3WG2A 2PTMA 2RS52 4FQ4A 2ZPXA 3NL1A 3VDDC 2VZTA 1IS5A 3LAGA 2BU9A 5HXMA 1AYM3 3POJA 4COYA 3MIHA 4OUSA 3EXUA 4CXXA 4CXYA 4KBZA 5CFCA 3VD4A 1UZ0A 4DFSA 4KL1A 3WG1A 4Q4W3 2OT7A 3DF0A 1RUD1 5IHRA 2EIDA 3WDUA 4LE4A 2UURA 5ERLA 3RNSA 4QQHA 5DXDA 3WNPA 1CZVA 2B8MA 1PVC1 3VBOA 4DRVA 5A1AA 4P5HA 2XJPA 1W90A 4BDVB 2Q4SA 1JYCA 2PYTA 2YROA 3EMRA 4WZFA 1IG0A 2MPFA 1WUVA 3KZ4C 5J3UA 2HYKA 4EN7B 2E53A 2C1FA 1WW4A 4X6RB 1AR81 2AEYA 3ORJA 4YLZA 2AYHA 1WLTA 3OBRA 5CADA 4MGTA 1QQP1 4NHKA 2D5FA 3ES1A 4AHYA 4YVSA 3T09A 4OMDA 1IPKA 3FL7A 1CJPA 4K21A 2JG8C 2YFZA 5FYCA 3WHUA 4AQTA 1GFF2 2GNTA 5IVVA 2ZX1A 4Q4Y1 2UYAA 1W6PB 2Y6HA 2HH9A 1S1AA 4CDUC 4CCOA 3N9MA 4GJYA 4RHV2 4LK7A 1B35C 2NM1A 2Q0AA 1AHSA 3LA2A 5A3LA 3AYDA 1H9PA 1HB3A 5JPMB 4M4RA 5GLZA 5C8CC 1HRI1 1DIWA 4ISRA 3VBFC 1NKGA 1O5UA 1BQPA 4YYOA 3ZN5A 4JGZA 4Q8KA 2W46A 1O3TA 5DN2A 3DXTA 2DWRA 4H55A 3P1IA 1VMFA 2FZ1A 2XLGA 3KMHA 5A7WA 3ZXGA 4QX2A 5JCTA 1ND2C 3MIEA 1N1YA 4P9IA 3KT4A 3SEEA 2ZACA 1MQTC 4WM8C 3RYPA 2VQ0A 5FMBA 3TAYA 3WF3A 2VBDA 1DQ4A 1S0JA 1UZWA 1ULCA 4Q29A 5DDJ1 1U5IA 1GZCA 3RQ0A 5F6LB 1HQLA 3EB7A 5T5PA 1W6MB 2X09A 4XAEA 1HV1A 4RS5C 4D7TA 2VMIA 3BOPA 3PURA 4EZHA 1UY3A 2R0FA 1OI6A 2LS6A 4FTEA 3NO8A 1O4YA 4B4PA 4URAA 5FR3A 5FPVA 3ZPYA 3POIA 1QJX3 4OHXA 1U5XA 2CHHA 1OFNA 2HWD1 1ZREA 4YVWC 5FPXA 3B93A 2OXBA 1NAEA 1VBD1 1AZDA 3KHCA 3W58A 3ZXFA 3AZXA 5GLTA 1UD1A 1NY72 4IEWA 3MW3A 1VBC2 4K40A 2K9ZA 5ANQA 4C1WA 1HIXA 1MS9A 3LWCA 3DPRC 2A6ZA 5FY4A 3WUCA 2HWB3 1I3HA 2VVEA 1V6OA 2G9ZA 3ZXKA 2XUMA 3UETA 4H7MA 4E4SA 3CZJA 4GMP0 3R05A 4KWLA 3VDDB 4LBQB 1VBB1 4R8HA 2YZ4A 5EIYB 3MI8A 1UZVA 4OHWA 4WM7A 2GMMA 5FZFA 3OY8A 5DUUA 1RB8G 1RHI1 1T6BX 5T5LA 2EAKA 3PMSA 3T08A 3C2UA 1NUKA 1ZZ9A 4QPGA 2J1TA 1GOFA 3GBWA 4URTA 4AHZA 4DB5A 1LHOA 2RM23 4QDQA 1CVNA 1AR71 3S57A 1Y9MA 3D82A 2DBNA 3KWVA 5FWJA 1X7NA 4COZA 3OPTA 4B1MA 1X33A 2QQOA 3ROUA 4DMIA 2VMHA 4D6QA 3ZN6B 4AK3A 1JZ3A 5FY0A 1ZA7A 1XYNA 1RVF2 3FBYA 3M3OA 1JHNA 4WV8A 2TEPA 1YJLA 3ZN4A 1HJFA 4AI1A 2OQ6A 2QJVA 5FO7B 4FTBA 1AL21 5IJRA 4A7ZA 1ZX5A 5D1IA 2P4EA 1DLCA 1G9AA 2F4LA 3MHZA 4GJZA 5CVRA 1AR91 2Y6KA 4V1PA 5HXVA 1COV3 3WP4A 2AACA 3OUJA 5CFCB 3JUUA 4YW2A 1UKGA 5JOZA 1PGW2 1US3A 1I9RA 2JG8B 3ZYHA 3EHKA 3BPSA 4B4QA 1OD3A 1RGSA 4RR3C 1Z78A 2CDPA 2PAEA 1UOBA 3ZSJA 1L3JA 1NCQA 2BRTA 4CCLA 1VPHA 3LFMA 4CDUB 3PUQA 1UMIA 4Z2WA 4B29A 1B35B 1I5PA 2D40A 1UY4A 2SBAA 4V2WA 1XU2A 4C91A 3VBOB 4JGYC 5C8CB 2HWE1 5CG9A 1DF0A 3A0NA 4K1ZA 1WCKA 3VBFB 3CKHA 4QWNA 4JHTA 2QQJA 3VL9A 4LKFA 4UFIA 3VHPA 2B4KA 1VRH2 3VGIA 4LTAA 5C6CA 2H0BA 5FYTA 3QH6A 2W87A 1XOYA 4E2SA 5FZ1A 4G4FA 1NCRA 1LOAA 2MEV3 4HZFA 1YXWA 2WNUC 4LQRA 2K2SA 4CEYA 1KDMA 1ND2B 1ND3A 4ZONA 4OI4A 4WM8B 4AVTA 2YC2A 1W3VA 2EAAA 5DAPA 4YVSB 1QGLA 2XLFA 1KJRA 5GJ6A 4LE3A 2P3JA 4ZU5A 3OD0A 4BQ3A 3LQCA 4RS5B 3WINE 2BERA 4XPVA 4DIQA 1YRZA 3DYPA 5B2GB 2GMPA 4JKMA 3VHNA 2ZOEB 5IVYA 1JXNA 1ACCA 2C6SA 3JD72 1RUOA 2VZOA 4XBQA 3I4IA 1RUJ3 3GCXA 3AVRA 1LEDA 4UFHA 4GB33 4BMEA 5AVAA 4UW6A 5FY1A 1OQDA 1V9U2 1ULDA 4LBJA 1PNFA 3IZOA 4ORFA 1APNA 4ZXEA 2JDAA 3ZDVA 4AVCA 2WSVA 4N8MA 1YQ6A 1XNBA 1B09A 5KC6A 1GNYA 3A7QA 2JENA 3DPRB 4C1XA 5FLIA 3CL1A 4NHMA 5FZOA 1OUSA 3VZOA 5F5IA 1NA1A 2QQUA 3Q9OA 2VY0A 2XBO3 5JWPA 1WMEA 4GAZA 1QJZA 3LPGA 3LPFA 1PO21 4DQAA 1O91A 2WAAA 3A4UA 3AVSA 1ZBA1 3FX3A 3BTAA 1PO13 5IFTA 1Z7S3 2ZGPA 4EWDA 1Y43B 4QT6A 5EQUA 5FJKA 5CFDA 1SQ4A 1TNRA 2OPWA 1SLLA 3IMMA 5GZDA 2P37A 4QX8A 3ES4A 1CZSA 5IAXA 4YW5A 3KCXA 3LGRA 3N9LA 2WO2A 4KMQA 1TEIA 4ZZ8A 2DUPA 4QXBA 2NN8A 5LK5A 5I0RA 3OGGA 4ET7A 1H4HA 3PUAA 4H14A 1QOTA 3ZYIB 4Q0PA 4Y20B 2WZR2 1KS4A 1W8TA 1W8FA 2A73B 2DTWA 4TSVA 2JX9A 3NVCA 2IZWA 5DG1A 1GBGA 1FYUA 5L73A 2HWC2 2KD7A 3J8F2 2ERFA 5LBBA 2ARAA 1OLME 1VP6A 1S2KA 3R4UA 4Y5SA 3WF1A 3INAA 4BXFA 3FWEA 1G9CA 4I0AA 3MLLA 2IXLA 3IM0A 4R4ZA 2E63A 4AEMA 3UKNA 2WZEA 4CU7A 4YW4A 3LEGA 4NIIA 4QQ2A 2GN7A 4LIVA 1ZZ6A 3HN1A 4Q4V1 4C0HA 1LOEA 2DBIA 2LROA 3VBSA 1OKQA 4CZSA 4IETA 2G4IA 3VBRA 2SLIA 3B01A 4BIFA 4BK4A 2EVXA 2O1QA 1LKNA 4AXOA 3I2JA 4DEQA 4KGGA 1K45A 5C9AA 2L9LA 1JS9A 4XVHA 4UF0A 3POSA 3K51A 5CNAA 3WDYA 4E4DX 4NJ4A 5HCFA 2N7GA 4WBBA 3GBFA 1LULA 5T3NA 3ETPA 4D0QA 4LLOA 2ZZQA 3I2KA 3V56A 4Z8BA 1J1LA 1U5ZA 3B02A 4LA3A 3WDTA 3RZLA 4JKKA 5K0UC 1S2BA 4W65A 4MOAA 4AGVA 2YMZA 4DPNA 4MGQA 2WNUB 3NJZA 3O12A 4L92A 5CKQA 4QB1A 5SV8A 1UY2A 3OCPA 1LODA 2RS32 2W3JA 3VDAA 1WD4A 3IKWA 4PBPA 4RA0A 1H9WA 3ELNA 2VUCA 5FREA 3RYRA 4DZGA 3IDCB 4RQPC 2K0GA 4HPKB 4TXWA 4HSLA 1W8HA 3D0SA 3LOIA 3AB0A 1DBNA 2ET1A 4RN5A 1ENSA 2PELA 3KF5A 2J42A 3WLUA 5BNNC 2VNGA 2XPJA 3SH4A 2DVFA 3D3AA 4QQPA 2W95A 1PMIA 3OPWA 3ZVXA 3W5MA 4XYXA 1CESA 2NLRA 4LA2A 3POWA 3GZTB 1QJY1 1KFUL 2BV4A 3T2OA 5F5QA 2IXJA 4W6XA 1VE0A 4IEUA 3PIJA 1U0AA 5EXOA 5JIAA 3ZMOA 1PVC3 4DINB 2PHDA 2BTVC 4EN8B 5FCCA 4XEZA 5D2AA 5FZ9A 4AI8A 2Y26A 4Z1VA 3IDAA 5FP8A 1US2A 5FMOS 2HJIA 1I5ZA 2CGOA 3GNEA 1CD3G 1VBA1 4CUGA 1OLQA 4XC9A 3PVEA 3VBHA 3M3CA 2WWSA 5JR7B 3HR9A 4JHZA 1AR83 2XJTA 1D4M1 2P5BA 5C4WA 5A3MA 4IERA 4AI3A 1QQP3 2LALA 2V09A 3M7AA 3N7JA 4CCJA 1H4GA 1RINA 2AR6A 2ZS6B 1JZ8A 4ZU4A 4AHXA 3J9SA 2YFUA 3T3YA 5K8SA 3J7NA 1SPPA 4HG6B 4Q5OA 4Q4Y3 5K7PA 4JC1A 3SISA 4O9GA 3VUOA 3AMNA 2AENA 4DXSA 1RVF1 3AYAA 2P3KA 3ETQA 2IWGB 3HVDA 1WW5A 4B7KA 4YZ3A 1BBT1 2VZPA 4GH4A 5ANNA 5FZOB 1HRI3 4P5YA 3X29B 1R1A2 3K75B 5DZFA 5IVFA 4UW3A 1FOD1 4Y1XA 4M3CE 4AVBA 1JW6A 1JU4A 5A32B 1ALYA 3ZR6A 5GZFA 4CDWA 3O1OA 2J1RA 4FPYA 1UAIA 2YGMA 5FPAA 1YFYA 2JG9A 4FPOB 3CZUA 4R9CA 2ZTNA 1UYXA 1LECA 2DCZA 1S0FA 1OQEA 2EA7A 1DGRA 4LHSA 2DUQA 5DDJ3 3TYJA 2IFWA 3TOJA 3OB8A 4CCDA 5LASA 3ZYPA 2WL1A 1E57A 5FOBB 1JOPA 4IEOA 3HBZA 4FI9A 3HWJA 3P5BA 4N43C 4BZ4A 3WQ1A 2GC1A 2P6CA 3AKPA 2XH6A 3N4MA 4GALA 2XLAA 5AC91 2VH9A 1QJU1 2ETEA 1WLWA 1QWRA 2D3SA 2G9GA 1PM7A 1RUC1 2MHFA 1ULEA 1H8TA 2HWD3 3C7GA 3P6BA 4K6BA 4META 5IUQA 1CX1A 1GYKA 1VBD3 4P00B 1V6JA 4FO9A 4YGDA 5KXEA 3UNPA 1DU3D 1SLCA 2VUDA 4NHXA 3RI9A 1UW8A 1X8MA 3G6JB 4IDZA 3B00A 4A45A 4YPJA 2PLV1 3BI3A 1BMV2 4Z92B 3ASIA 3MIGA 4RYDA 5L9VA 2WZPP 2HWF1 2Q30A 2EIEA 5T5OA 2JIGA 5FY9A 4AI0A 4DXTA 5HV4A 1WMXA 1BK1A 1G9FA 3H1WA 3VBSB 1VBB3 2YG0A 4JDNA 2P34A 5FDBA 3WT3A 3K2OA 4D69A 1C5IA 4IE7A 5HCHA 5D8AA 1T2XA 4FPGA 1VIWB 2J1EA 4A41A 2P6HA 1RHI3 3ACIA 5JXJA 3WNKA 1HQNA 5BNNB 3RYKA 2B5HA 4CDXA 4XFBA 1RITA 4IEXA 4XZPA 1AR73 1J83A 3WW1A 4IV1C 1BYHA 3I54A 4FFHA 2VZSA 1XYPA 2GMEA 5E8AA 3WP6A 3K77A 3V64A 4S2DA 2DURA 4EE2A 1TMF1 2E32A 3W20A 1DFQA 5DZEA 2Z79A 3LD8A 2VOWA 5IVEA 4YW6A 3ZFGA 1O8PA 2XG3A 4XAAA 1DDLA 4LKSA 1N1VA 1CR7A 3H8UA 1AXKA 4DY3A 3RVHA 4XTPA 3PTRB 1AL23 1UO9A 1L7RA 3NNMA 5FZHA 2BGCA 2ZJCA 3OUIA 5FWEA 1E5RA 2WO3A 5EWSA 4DY5A 1WD3A 1AR93 4PQ9A 4FOWA 4JDMA 3RFRA 2QKDA 1OPOA 5E89A 3SCGA 2Y0IA 4RFRB 3PUIA 2R6QA 2YPDA 3MPBA 5F2WA 2W47A 4CDQA 4XMAA 2YDEA 3T4HB 4CEWA 4TLFA 2CGNA 5FJHA 4R9AA 2EALA 4QKBA 3I97A 1Q8SA 5JOYA 2GC2A 3WQ0A 2VM9A 2WS92 2Y38A 1W99A 4QPIA 3ZO0B 4R9DA 2HWE3 2WDBA 2RHPA 3A21A 3WDWA 3TN92 4RGGA 4M4PA 2VECA 2Z4FA 3EYPA 1DGRN 4PT6A 4QGMA 4MV2A 1U12A 1XSRA 2XHNA 5I0UA 1JU3A 2OX0A 2BQPA 1SDDB 3JBG2 3L2HA 3OJBA 1IS4A 3TNQA 2VW1A 3H50A 4L99A 3TWIA 3GHNA 3ZFFA 5A1FA 5J1XA 2JDHA 1LHNA 1EV12 2DU1A 3HT1A 4KI5M 1CGPA 2WQZC 4BA6A 1SPPB 2DTYA 4NIDA 1GICA 4UAPA 3O1PA 2VMGA 1DZQA 2KR2A 4IGOA 5IATA 1JYXA 2JE9A 4K1YA 3S0MA 2E33A 4AYUA 3FZ3A 1IS3A 2UY8A 4HLTA 2C4XA 4N43B 2GP5A 1JYTA 4ARYA 2ZMNA 1BCXA 3WW3A 1MVEA 3WCSA 3EBRA 1BEV1 3VZJA 2BJSA 2ZGNA 1C5HA 5FBZA 2OKXA 1V6NA 2LRPA 2W0XA 1LHUA 2VCBA 3DEMA 5JXIA 2GNMA 2NQYA 2DCTA 4Q4X1 2JG9B 3AZWA 4S2GA 5DZGA 1OD5A 3VD3A 2QQPA 4Q27A 2CAUA 2CWMA 2VTXA 3M8LA 3VHOA 2D98A 3U78A 1CAXA 4Z07A 5C3OA 3JB8A 1OF3A 3H1YA 1PO23 3PJQA 4I02A 1ZBA3 2YXSA 2EXJA 2BWAA 2VOKA 3IPVB 1PZ9A 4NHYA 5FOJB 1RJ7A 1DZRA 2FCVA 2X29A 3FLRA 3MV11 2R49A 2TNFA 2ZEYA 1ZZ8A 2VNVA 2RVAA 4GKYA 3AP6A 3BTZA 3AFGA 3MIDA 2A3WA 4IV1B 3MIFA 5DMYA 2IXCA 5J96B 5F32A 4NIAA 4LOSA 3IB3A 5FZ7A 3WHTA 3O1MA 2WFF2 4AGRA 1FT9A 4K3UA 4LOTA 2OW4A 1W8WA 3ZXDA 1K5MA 3JQXA 3I2FA 1T6GC 1LR5A 1AXYA 2XMLA 3WNMA 1GP5A 3T30A 1PIV2 3CJIA 1VBE2 2JDZA 4JVAA 3HNMA 4Z82A 1GOGA 4UFJA 4NAOA 5T5JA 1POV1 3I3QA 2QVSB 1FX5A 4MLOA 4NHLA 4COVA 1UXXX 2WJSA 4CP0A 2OPKA 4AVVA 1RUF1 1C8NA 3OBZA 1BZWA 4NR1A 1LOFA 3VZMA 3FUQA 4NPMA 3ZYBA 3RGBA 3RG0A 3F2ZA 3POEA 1J84A 4Q4V3 4LO5B 2R30A 4Q26A 3HD8B 1XQNA 2QQWA 4BQ2A 4WVWA 4I0BA 1FNYA 1GLHA 1OOPC 1RJ8A 1W6QA 4XDQA 4Y5Z0 2RS12 3U4XA 3EO6A 1MZEA 2X8KA 4LIUA 4GIQA 5GZCA 3U10A 1URXA 1R1A1 1GV9A 1ONAA 4X8PA 3W5NA 2XOMA 4UW5A 3MPPG 1A8MA 1UNBA 2CV6A 4FFFA 5FMCA 1YFUA 3S30A 3SCFA 4IE4A 5A6ZA 4IEPA 5ABJA 4DUXA 3WW2A 5FMOL 3MFCA 4BU2A 4E4HA 1HRV1 4OZOA 5BY5A 4LEJA 4P9YA 1QJEA 4BQYA 4D6RA 2ZMLA 4L0PA 2XQXA 4XJ9A 4AFBA 2QQIA 3ACLA 2ZEXA 4LBLA 4GXLA 1ASJ1 4O7XA 2FDHA 2Y6JA 4QD2A 4B4RA 2DCYA 2W1QA 3KQ4B 2JXAA 4NROA 4NUBA 1XU1A 4PLMA 2WLQA 5A3PA 4XETA 2D6NA 5BXXA 5FP7A 3WP5A 2PMWB 1UXZA 3APBA 1RUG1 1HXS1 3POYA 3WG4A 1OA2A 4Y4RA 1NXMA 3BVCA 3BTYA 3UT0A 5JOXA 4XFIA 5JXHA 4YGBA 3H1MA 1OHFA 3NNGA 3U0ZA 2D43A 2B9VA 3BB6A 3GJAA 4Y5TA 1UIJA 2QBXA 3USUB 1AR61 2J1AA 3SCHA 4MZUA 1REDA 1QJY3 1RUH1 5FZCA 2ZCWA 1V6KA 4A6SA 1RUI3 4LLFA 4CP9A 1YNAA 3RWNA 3IIIA 1BMV1 2NMNA 3ZX7A 1ENQA 2R32A 3VKFC 1TZOA 5JPNB 4R9BA 1C57A 4SBVA 3QH7A 1UWWA 2XONA 3N36A 2RMU1 1OLRA 4AFMA 2ZEWA 4JTOA 3RSJA 5C5TA 1WA6X 4A2UA 1ZZCA 4B8EA 3CJXA 1OA4A 1WCSA 1MEC1 4N9HA 4AAXA 2ZGTA 1VBA3 4OMCA 4XF9A 5G05L 4E2GA 1ZBE1 4NPRA 2BGOA 1GWKA 3NRUA 1D4M3 4QU1A 4TN7A 1YIPA 1ODNA 4LMFA 1W03A 3ZFEA 5BNQA 4LHKA 3W59A 3AYCA 5CA6A 2E7QA 5CFCC 5A1LA 4KU8A 2QFEA 4XF3A 5EYYA 2D6OX 3RWKX 3UV9A 4MXWB 1O4ZA 2C0ZA 1BJQA 3NJYA 5EFUA 1R081 2BNOA 3BU7A 1ULPA 3OYWA 1FPN1 5CKMA 5A7QA 4C8DA 2VOXA 5C70A 1OSGA 3AKRA 2V4AA 2PQQA 3J7MA 1W2UA 2A6VA 4RD7A 5BNOA 1UF2C 1YI9A 1R091 1BBT3 2RR11 2VCCA 1N47A 4W8JA 2ARCA 3HEIA 3VBOC 1FOD3 3TEZA 5FLHA 2BOJA 2YBPA 1SFNA 4QDRA 4CCEA 1W0NA 3C3VA 3AZZA 3ZKUA 4FPCA 5IWFA 5JUVA 1JMUB 1EPZA 1KS5A 1VAVA 2NPIA 2A75A 1FMD2 1NLRA 4XQWA 1QH7A 1W0PA 2YB7A 1F35A 3WNOA 2X10A 4CU6A 2CU5A 5FUNA 4YVSC 3AP7A 3B9CA 4JRAA 4XUNA 4YW3A 3BIWE 4JCKA 2XJQA 3UJQA 2AGSA 1OOPB 2WS91 3PJYA 5FK7A 1WBFA 3PTYA 1IOAA 1IG3A 1VMHA 1CAUA 3ACFA 3ALQA 4CE8A 4LJHA 5LA9A 3OSDA 5FAXA 2ZGLA 4M0NA 2R042 5AC93 1A3KA 5A3UA 2ZHLA 1QJU3 4AFCA 3ZXLA 5GALA 3CJIB 1RUC3 1VAMA 2LUWA 2RV9A 3HNYM 4ES9A 3CU7A 1CIWA 1G86A 1KJLA 2EF6A 1GZWA 2JIJA 2F6BA 3Q8FA 4PDWA 4OI0A 1C8M1 1ODMA 1S4CA 1GNHA 2CDOA 2WWJA 1G7YA 1NZCA 3B9IA 1SCSA 3KLSA 4JGZC 4ATEA 5IK4A 4XW3A 2HEVF 3BUCA 3VV1A 2O8OA 3GXUA 3WNNA 2PLV3 1CAVA 2W39A 1DZTA 4J6GA 2D3RA 2HWF3 4QPWA 3SKVA 4CA9A 5C71A 1QY4A 1NQDA 2WFPA 1EYBA 1MS8A 1QU0A 4PLOA 5EJZB 5GKAC 3WD5A 2IC1A 5GLWA 1HJGA 3BOWA 2CL2A 4XACA 5JXGA 3WOGA 1AX0A 1AYM2 1D0GA 4H3WA 1LU2A 1CIYA 2JD4A 4AW7A 4MGZE 3AL6A 1EP0A 1DCSA 3H3ZA 2ZHMA 1PGSA 4MVTA 4AQSA 1DYOA 1JH5A 1SCRA 4QDSA 5ABJB 5JAXA 5K9YA 3N9QA 2W1SA 2Y6FA 4CVUA 4HK8A 1TMF3 5CU1A 4HSJA 4BIOA 4NIHA 4BK5A 1KXGA 2OIIA 2D44A 5ACA1 4LO6B 2WBKA 4QGNA 1W6NA 2VZUA 4W4ZA 5CZKA 4AOCA 5L7OA 1XSQA 2WIIB 1GANA 3OBTA 1QHDA 2WLPA 1V6MA 3JB4C 2Y64A 3PNAA 3SNMA 5I8TA 1J1TA 4IE0A 2W68A 1F9KA 1OLMA 4FPHA 3MUY1 4I3PA 3SKJE 4WM7C 4L97A 2JECA 2R1DA 4D3WA 5IVCA 4KWJA 5DUWA 2ZAAA 3VZKA 1AYN1 3THDA 3H8XA 1IZ3A 5FZ4A 4IE6A 3C7HA 1RMU1 4QPGC 1TME2 5DUXA 5C33A 2WFF1 4OVEA 4NAMA 2E51A 1RXFA 1J3PA 2JKBA 1CX4A 1XPWA 4BM8A 1UZYA 2A6YA 2XJSA 4QHOA 3T0BA 1PIV1 3PU8A 4NPLA 2F4PA 2Y0OA 1IGOA 1VBE1 2ZX2A 3VD7A 4BQ4A 4UI9L 4Y4YA 4YM0A 4I0WB 3ZM8A 2CTVA 4JX0A 2VBPA 3HQUA 5A7OA 4BCUA 2VW0A 1XNKA 3CBNA 3E6DA 3LFIA 2E7AA 2F17A 4MGKE 3FFZA 4INDA 5FIXA 4AAPA 3THTA 5JZGA 3BU0A 4E4ZA 2VMEA 3HIFA 2GH2A 1PGL2 1IS6A 1FXZA 2OYZA 3VBUA 1W2AX 3JZVA 3WCRA 1H0BA 2HYXA 5A6XA 1LHWA 2I07B 1PHMA 4HBNA 5H9RA 1G6NA 2C26A 2GC3A 2RDNA 4FPFA 4IEVA 4LK6A 4AEDA 2XXZA 3VKOA 3D4KA 4HKWA 5FZ8A 4ARXA 4AI2A 4JRLA 2ZMKA 3OEAA 3SITA 3PUHA 1NCQC 5FYUA 4DUVA 5F5CA 3MGUA 5IVBA 5BNOB 1W04A 4EYUA 4PJYA 1QJX2 1BEV3 3WG3A 3VDCA 1W39A 2NYYA 1A6CA 1OFSA 4JGZB 4Q4X3 4Y24A 1LOCA 4XIOA 3GGLA 4A3ZA 3B5LB 1NCRC 1W9YA 5A33A 2ZKNA 3EJKA 5A7WB 3N9NA 3I59A 5JSPA 2RS51 4BH9A 2HWB2 4CEYC 1WWYA 1ND3C 4MO3M 3ZKYA 5FQ0A 4JTNA 3LE0A 2ZKLA 2EICA 2GN3A 4L9BA 4XJAA 1GQGA 2IVJA 2BVVA 3LA3A 1WZXA 1UQXA 1C1FA 5KBFA 5L36A 4ZKTB 1CAUB 2A6XA 3E97A 1DQ2A 4PIYA 1XXNA 2GSYA 2O0OA 3E5QA 3FC0A 4FPJA 4QHZA 3USSA 3J7HA 4CU9A 3ABZA 1H2KA 3MIBA 2E31A 4E27A 1KFXL 2ZHKA 4FPEA 5A3WA 1SZBA 3HJRA 4PDWB 1GZWB 1OH3A 2VXRA 3CHXA 2DVGA 3MFAA 2ZX0A 2YC0A 3VD9A 1C1LA 3S7EA 2ZGRA 1W06A 3MLKA 4J25A 3WQBA 4AFDA 5JIUA 3AL5A 2AUYA 3NV3A 1POQA 5C3SA 3U75A 3S5AA 1HQWA 1NA1C 3AK0A 3ZPOA 1POV3 3I2GA 4P02B 1F15A 1TE1B 2PQSA 1SLIA 5T50A 2W1WA 4M3CA 3FHAA 4WM7B 2VVFA 1RUF3 1W28A 2XVKA 2VZRA 3OY8B 2UY9A 5FY7A 4RFT0 3FN9A 1Y3TA 5EJ3A 1COV2 4JQTA 3UJOA 4DS0A 4FPLA 3FBMA 4QPGB 3IN9A 5CFDC 4JKLA 4Y33A 1MZFA 2VW2A 3POGA 1ZA4A 1DYKA 4LKEA 3KM5A 3E5UA 1J3QA 1YHFA 4RHV1 3UGGA 3UKTA 4DO0A 5B4NA 1R1A3 1R64A 4KU7A 3KV6A 4FOQA 1YQ2A 5FP9A 1L7LA 4XBLA 1CPMA 4H7LA 1H1AA 4YFZA 4LULA 3V65A 3T2TA 3KV4A 1Y9QA 3V0BA 1QF3A 1HRV3 1VRBA 4HETA 3MO4A 1TG7A 4NN0A 3AP4A 1K5JA 2D6LX 3N7MA 4RL7A 2MEV2 1ASJ3 4XIKA 5I8SA 2BDRA 5FZEA 2BGPA 2TUNA 2YC4A 2PHRA 2FMYA 5C5UA 3OOXA 3CF6E 1WGPA 4QX1A 5KHGA 3N35A 1UYYA 3HAGA 2R072 4UBHA 3AMQA 1E5SA 2WYSA 3AZYA 5SV5A 3VBSC 5CBLA 3FHQA 2JDUA 2XWBB 1RUG3 1HXS3 3B7MA 4FVVA 5FZ0A 2R041 3VBRC 3GM8A 4ASLA 2R062 2BNNA 1GP6A 1NCQB 3VN4A 2XDVA 4LNVA 4S2HA 5C9AC 2B42B 4PF5A 3LB9A 5F5AA 2W1UA 4IGPA 1KDKA 1AR63 2VJXA 3RZKA 1RUJ2 1RUD3 3FJSA 2K46A 3OBAA 1LGBA 1RUH3 2WO7A 1NY71 4IV3A 1VBC1 4OFGA 3UGHA 5EZWA 4CYDA 1DP0A 1SDWA 4N53A 1UU4A 5FXZA 3HNBM 1EAH2 2VPVA 3DGTA 5LK7B 1NCRB 2YU1A 3Q8EA 4MGSA 3BN6A 3T0AA 4CEYB 1N1TA 2RMU3 3POBA 3T1MA 1ND3B 5F37A 4HKLA 1XNTA 3AZVA 2XBO2 1MEC3 2D6PA 5APAA 4FP3A 5H9QA 5IK7A 3P3NA 4Q0UA 4DOUA 1NQJA 1S0CA 2OQ7A 1ZBE3 2Y33A 3AKTA 4IEYA 5GLUA 5KXDA 3K4ZA 1Q43A 2P2KA 5A70A 1PO12 1PX3A 1KQRA 1Z7S2 4L8QA 2Q8CA 4EQVA 4HFSA 5FP4A 1W2OA 4XCBA 3Q8BA 1RTVA 4HMZA 1R083 1X50A 2DUOA 1A8DA 3E1F1 1FPN3 1UL9A 4P9LA 4XURA 5LB6A 2Z69A 2ZZJA 2IUWA 3U1XA 3LZZA 4UFKA 3PLQA 1R093 5FZBA 4D8MA 4P9GA 3I59B 1X8EA 2RR13 4UT5A 5BV6A 4QGLA 2LTNA 1NA1B 1W05A 3AXEA 1W9FA 4HVQA 1QNWA 2RDQA 5JI9A 4Q0QA 3BODA 4N7IA 4Q8LA 2HKXA 1M4WA 3WP3A 1TNFA 3VBHC 4JQRA 2OZJA 2A6WA 2YYOA 4KGQA 5FZIA 1JZ4A 2WABA 1TME1 3WUDA 4WVZA 5IAVA 1PGW1 5C8WA 3RZGA 1IKQA 3I2DA 5C4WC 2BYVE 4Z2AA 5CFDB 2WA3A 2VU9A 3AFKA 2RJ2A 3GYDA 5F3GA 2OVUA 5DPNA 4GZ9A 4QM9A 4CPBA 2TBVA 5KXBA 2WS93 3BKZA 1SHWB 2J1UA 4ISQA 4QPYA 2WN3A 3GCWA 2VMFA 3U4SA 1BHGA 3K46A 1WW6A 2D97A 5FZ6A 3E6CC 1Q56A 5A7SA 1BXHA 5LRRA 4PBOA 1VRH1 4GH4C 3L9JT 2FQPA 3BYWA 3CO2A 1DGWA 1C8M3 2WUHA 4CDWC 4EJRA 5HCBA 3FUOA 1WCDJ 2JG9C 5AVPA 5BNPA 2QTWB 4NO4A 3NAPA 1F5JA 3S6PA 3V0AA 4AEKA 5FY8A 1XJAA 4FOYA 5IW0A 4AHWA 3AM2A 2VNOA 5J09A 1G8WA 2VC9A 2BOIA 4KNCA 4YZ1A 3OTFA 2IXIA 1V6IA 1IKPA 1JOJA 2DV9A 3AJZA 3UL2A 3ZYRA 5A6QA 1UU6A 3VBRB 1HB1A 1XYOA 1Q8OA 3H7YA 1LOGA 4FFGA 4BQXA 1YQCA 5G04L 1VAKA 3GJBA 3JD71 3O1VA 3WDXA 2Y6LA 4QX5A 3LEIA 5C9AB 4UF0B 1V9U1 2VZVA 3IMNA 5CISA 2YU2A 4DNYA 1QKQA 2D3PA 1H8TC 5T52A 4KBBA 4K8FA 4CP1A 2J1VA 2J22A 3CQOA 5ACA3 1SLBA 4ATFA 1GWLA 3WY6A 1PVC2 4N7UA 5GZGA 1WMDA 4FSJA 3LDRA 3JU9A 4TYSA 2XB6C 4WZCA 4P9JA 2X5IA 3M3IA 1PK6A 1BKZA 1JYIA 5JMCA 1KRIA 2AEZA 1N3QA 4YM2A 2VCMA 4LPLA 2QDNA 5KHJA 2BBAA 4GWNA 5D8AC 2JJ6A 1GUIA 2ZX3A 5KXCA 3AP5A 1AR82 3CLPA 3ZIXA 4P9WA 1OMIA 2WNVA 1AYN3 3LSDA 3O0VA 1QQP2 5JSOA 4A3XA 1RMU3 2B7YA 1DQ6A 3ZXJA 2A1XA 5CB7A 2HBUA 2WFF3 4CDXC 1K12A 1NYWA 1I1EA 4C90A 3R0RA 5FZAA 3ZSEA 2BW8A 2WZR1 1REEA 5JI7A 4AGGA 1JYNA 1PIV3 2HEYF 3SMHA 3UGFA 1VBE3 2HWC1 3J8F1 5FV3A 3SQOA 2G9FA 1CZTA 3H0OA 1JBCA 4XJZA 1HRI2 2C9AA 2BVBA 2D6KA 4HK9A 4V2VA 1LRHA 5F3EA 1R1ZA 3ZFGC 4HT1T 4D6SA 4W50A 4Y3OA 3Q8AA 3P3PA 5I93A 1P8JA 2GAUA 4LO4B 3VBHB 4BB3A 2P17A 3G7DA 1AX2A 1QH6A 3TRSB 3NV4A 4XDOA 3RMXA 5E6HA 3M1HA 2O14A 2UWAA 2UWBA 4PCRA 2OUJA 2WYFA 1VALA 2DYCA 1CQ9A 3T2PA 2VQAA 1BVVA 3MLJA 3NV1A 3I7DA 5DDJ2 4W6YA 5HPOA 3CNAA 2CNAA 1VB2A 2V73A 4KG8A 4LORA 4CDQC 2VE1A 1UYZA 3VKNA 2XKPA 3QCWA 4CEWC 4XF1A 5A3OA 3QBQA 1QDCA 1AUYA 4HXCA 3SH5A 5J7MA 1F8VA 3KB5A 4QKNA 3GDBA 1GQHA 1TQ5A 5E1RA 2XHKA 1D2SA 1UY0A 1DYPA 2HLEA 2PAMA 4FOVA 2WAOA 4QPIC 4GH4B 2HWD2 3M2MA 3I3MA 1OF4A 1AF9A 1QXJA 3IIAA 4OLLA 4CDWB 2VNRA 1GMMA 2RS31 5GZEA 1YFWA 4AQ6A 4HANA 2DCKA 2FDGA 2B9UA 4EN0A 5LBEA 1LOBA 2R071 3ZR5A 2RS53 2E7TA 2XJRA 4CP2A 3I2OA 1KEXA 4Q2FA 5CAZA 1ENXA 4Q0VA 4KG0A 4WVMA 2VZ3A 4GMP1 5FZLA 3ZFFC 1DG6A 2R061 1NLQA 1VBB2 3K48A 2GNBA 3QLQA 4R4XA 3VL8A 4YWAA 4YG3A 4ASKA 3BALA 1RHI2 5GLVA 3O1TA 3B3QE 3L2YA 1LGCA 3GF6A 4LHLA 4NMIA 2VMDA 4LBNA 3WNLA 2VBBA 2FCUA 1ENRA 1UOGA 3H3UA 1IHMA 1OH4A 3RZHA 1AR72 4NE9A 1W6PA 3DN7A 5AFBA 1EAH1 1H8TB 1HX6A 1N3PA 2JDMA 3KV9A 2Z2SB 1AJKA 1BK0A 2FMDA 1KD7A 4D94A 4LUKA 1ZZBA 4F83A 2JDKA 3NKTA 3NSTA 3OG2A 3WVJA 3ZMNA 1XRUA 2ZGQA 2DF7A 5LEJA 2VULA 1CAWA 5F3CA 1H8VA 4NRMA 1AL22 5KHHA 1OKOA 3TEWA 2ZGKA 3NKGA 1MZ5A 4OQ9A 2ZABA 4GWMA 5D8AB 4NIGA 3R4SA 1AR92 1EPWA 4HVOA 3WDVA 3DXUA 3KQRA 5FYVA 1D7PM 4ONUA 1W6MA 2QQKA 3K3OA 3R6SA 4CDXB 1SMVA 2JWPA 1ZRIA 2B39A 2C24A 4XHBA 5FXWA 1V0AA 3ZLIA 4TTGA
chains in the Genus database with same CATH topology
4RHV3 4F7ZA 2KXLA 3MDPA 4XJ8A 4BE3A 1UMZA 1UKRA 2HEWF 3AMHA 4ZU7A 5JDBA 2BEOA 1K5MC 2XL9A 4ZXKA 4QMAA 2HWE2 3ZFGB 3CJIC 2Z42A 1PK6B 3ZXAC 5TSWA 2C5DA 4JAAA 2YGLA 2ZAHA 3U11A 1MS0A 2GH8A 3VDDA 2E6VA 4BMBA 1OA3A 1LOFC 4C0BA 4FQZA 4RGAA 2D93A 5E16A 5BUVA 2LM3A 1WW7A 4FBFA 5GM0A 4Y1YA 1DHKB 2CWSA 5FLJA 2JE7A 3EQEA 4L2NA 4CDQB 1MS5A 4CEWB 5JVVA 1SLTA 2GNDA 1EY2A 2ZX4A 2Q5TA 4MX3A 4QPIB 2D5HA 1U5YA 4DRRA 1WMFA 1WBLA 3VLBB 4HL0A 1VBC3 5ABJC 1RUE2 4M3CF 3O0XA 1Q8VA 4IQPA 3QACA 1MACA 2YHJA 2ZGOA 3WZ1A 2O8QA 5EV7A 2PHLA 3ZFFB 1C3HA 1VB4A 3IBMA 1PO22 2WKKA 4K7JA 1ZBA2 4WVVA 4X6QB 1YFXA 2ZGSA 2JG8A 1ZYBA 1RC6A 1GKBA 3RRDA 2FZ2A 4YG0A 4Y1UA 1O3QA 1DGWX 4FAHA 4YM3A 4CDUA 2AZ5A 1B35A 1QOSA 5C8CA 4SLIA 1RVF3 2D7FA 3CEWA 4BLIA 3AP9A 3VBFA 1ULFA 3KT1A 1O3RA 1YYNA 1YI7A 4AVAA 1AVBA 2OA2A 2R0HA 3ECQA 2CAVA 3ST7A 4WVMB 1CAXB 4Q0SA 1ND2A 3FMGA 2V5YA 2Q8OA 1MQTA 4WM8A 1CONA 1H2MA 2A3YA 3JQWA 1SFYA 1TME3 2YUEA 4GKXA 4Y26A 3LA7A 4GA9A 3ZFEC 1A78A 4RS5A 2ZBJA 4Q4V2 3N7KA 3MZHA 1FV2A 2PN5A 4I2OA 2JICA 2WA4A 2WNEA 1H2NA 3MF9A 3T1LA 1F2NA 3PVNA 1K5MB 4YVWA 1NOVA 1HKDA 1JUIA 5BNOC 3TN91 3VKLA 4CTEA 1VRH3 1C4RA 3R4DB 5J98B 4FPKA 1CAWB 3O0WA 3DL3A 3AX4A 1V70A 3DPRA 4XJUA 3JBG1 2I45A 1FNZA 2BWCA 3OGJA 1EV11 1D2QA 3DKWA 2DVBA 3KS7A 2D6MA 1XE8A 4M01A 4GULA 1DGLA 1LJ7A 2A5ZA 3THPA 1W6QB 3MEPA 1M06G 2B46X 3JD73 1LESA 4I01A 3FE5A 1V9U3 4Q4W2 1BVP1 2EXHA 3MF6A 4Y20A 4XQDA 1QJY2 1UCXA 4IL7A 2P3IA 4PDWC 2MNGA 3WX5A 5J36A 1RUI2 2WT1A 1AJOA 2VUJA 1MS1A 4ES8A 4QU2A 2QZ3A 2GDFA 4XFFA 4G9SB 1VBA2 3IDBB 4EWEA 4K9SA 1D4M2 1YIFA 1JUHA 1LHVA 1PNGA 4M0HA 4RR3A 2WQ4A 4XFAA 4MGYE 2GALA 5HBAA 2DVAA 2WZR3 2VVDA 1DLLA 4Q1PA 2YPJA 4JGYA 2FHRA 3AMPA 2HWC3 3J8F3 1HV0A 4F3JA 4B3NA 1BBT2 1UPIA 1POV0 5L7OC 4XF4A 4XFGA 1FOD2 1O7FA 2WNUA 3RS6A 3WNXA 1AXZA 2VG9A 4QXKA 5IK5A 3KD4A 3ZFEB 4HPKA 4UW4A 1QNYA 4QM8A 1JTZX 4QQOA 1NE4A 1ZRCA 2RS11 1X36A 2VGDA 3IT8A 3VKMA 3OYWB 3SH3A 4QQLA 3RJ2X 3B94A 2DU0A 5E88A 2R16A 4J1XA 3FLTA 4LR4A 5AC92 2XJVA 4ASMB 5KHIA 1QJU2 1YLLA 2PHUA 1RUC2 1ZZ7A 3LKJA 1FATA 4P14A 5KWRA 1SBDA 5JZGC 3AKQA 2RS33 1HW5A 1MQTB 5I8YA 3AXDA 2DFBA 5BYNA 2R073 2UU8A 1RUNA 1SACA 2PLV2 3VBUC 2HWF2 2ILMA 1LU1A 4YG6A 1LENA 4GMP3 4NWVA 1WA4A 2R063 2PA7A 3AKSA 3ZYJB 4AEDC 1O3SA 3J4UH 2BFUL 1VJ2A 3OF1A 2QDRA 1PZ7A 3URFA 4AQ2A 1J59A 3D6EA 3H7JA 1W6OA 4BQ1A 4YVWB 4O9EA 1RUE1 3ZYGA 2RM22 3AMMA 5T54A 1EAH3 1YWKA 4OI2A 3H9AA 1D0HA 2UYBA 3QD6A 3HQXA 1TMF2 1UN1A 4IESA 2FBEA 1LTEA 1XE7A 5BPXA 2X53S 5A32A 2PHTA 2BNMA 2RE9A 3M3QA 3M70A 3N3HA 4J1WA 4OI1A 1CAVB 4ITCA 3E5XA 4YARA 1IPJA 2GC0A 4JDOA 3ILRA 4D7YA 1VLNA 4NWWA 4XE9A 4PIXA 4OUMA 4QHBA 2OZ6A 1SBFA 4XOGA 4XQ4A 3ATGA 2IXHA 3S7IA 1YO8A 3GALA 5FFOC 2WT0A 1NXD1 4YM1A 3AJYA 4OHYA 4XBNA 4EWAA 4BOWA 1IQAA 4FT8A 3HT2A 4YZ2A 1V00A 1GZ9A 5T55A 2NZ9A 2A71A 1W6NB 3ILFA 5DUVA 5K0UA 5L7OB 2PHXA 4OHZA 5JOWA 4LO8A 1ZRDA 1AL0G 1FMD1 3RI8A 3ZXEA 2QZ2A 5J37A 4I30A 4YSFA 1ZRRA 1GNZA 4RQPA 2ENRA 4XXAA 1Q8QA 4RR3B 1XNDA 2Q1MA 2W52A 2H0VA 2PAKA 4AWDA 5BNNA 4MH0E 4S2FA 4YW1A 4JGYB 4HN0A 1S0GA 2WC2A 5KC5A 2AREA 1BEV2 1WLDA 2NP0A 2Z5WA 4GB32 1PZ8A 5L19A 1CPNA 4LBQD 5JZGB 4AG4A 4Q4X2 2H6CA 3WW4A 5LEKA 3WQ7A 2VUAA 3VBUB 4Y22A 1UZZA 3M3EA 4K20A 4N90A 4TWTA 5FO8B 4COWA 2YV8A 2CYFA 3GHMA 1QXRA 4AEDB 1AYM1 4R52A 2ATFA 1F5FA 2EIGA 4AFAA 2KM2A 2ZHNA 1LGNA 3VZLA 4L11A 4Q4W1 1Z0HA 2DCJA 4MUVA 1SEFA 2XKOA 1RUI1 5I0SA 4A7YA 1O5LA 2H6BA 3O5SA 3WV6A 4IV3C 1Q3EA 2XL7A 4XXPA 2XWJB 4N53C 4Q1RA 4HN1A 1UU5A 2RJKA 5A33B 5FQ0B 3U07A 2ET7A 1J58A 4IXLA 1SBEA 3FFQA 4U36A 1UPSA 2A3XA 3E6BA 3HMYA 1RUF2 5EYXA 1WLCA 2QUOA 2R1BA 1W6OB 2GU9A 1LCLA 4LT5A 4YZ5A 1MS4A 4FP2A 4N43A 1NE6A 3ZDSA 1LEMA 4EV0A 4AEJA 1RIRA 3GBGA 2XVLA 4KWKA 1FAYA 3ZSLA 2PHWA 3ZIWA 2PFWA 3TN93 1O4TA 4BPZA 4CRQA 5LRSA 1Q5OA 2AH2A 4MSVA 4TZDA 4A7KA 1I6XA 2DVDA 1PGL1 1HRV2 1DQ0A 3TBDA 3JCIA 2DFCA 3JBG3 2ZGMA 4M3CB 1ASJ2 1NG0A 4P9XA 1C28A 4I3GA 1EV13 4E9KA 3NV2A 5JLVA 4B7EA 3ILNA 3IPVA 4XILA 1FV3A 1GSLA 1RUG2 1HXS2 3MW4A 1YUDA 1Q8PA 3SHRA 2ES3A 2NMOA 1QJX1 4IV1A 5FTTC 4Y1VA 5I0TA 5K0UB 1G9BA 1S0DA 1AR62 1H2LA 3ZSKA 1RUD2 1RUH2 1S0IA 1HLCA 3V0BB 1D4VB 4PIZA 4LBOA 2HWB1 1VR3A 4BLJA 3KT7A 4FXKB 2EXIA 4GQ7A 5BNPC 2RMU2 4COUA 3IDEA 3NAPC 4RQPB 2YY1A 4JV4A 2ZA9A 1PVXA 1MEC2 3W9AA 2EXKA 4F8AA 1MR5A 1QDOA 1ZBE2 4FCAA 4E2QA 3MYXA 1QXPA 4OHVA 2RM21 2QCSB 4MGIE 3ENRA 3PVBB 3RDIA 1R082 3KGZA 3RPQA 5AFEA 3ME2A 1FPN2 4HKOA 4XF0A 5F9TA 3AYEA 1ZRFA 3KCYA 2I2SA 3PHMA 4IV3B 4Q4Y2 1XNCA 3UK9A 4N53B 4FTSA 3KGLA 3PMEA 4LBMA 4Y1ZA 3RZZA 1SLAA 3TNPB 1R092 3QOPA 4Y22B 4PLNA 2RR12 4BHPA 5FRAA 4AE2A 3OD4A 2XJUA 3DV8A 4FAGA 2E9QA 2X5IC 1MS3A 3D5OA 2CGPA 4AF9A 1PK6C 3NWKA 4OULA 1CJDA 1REFA 4OZXA 4X8NA 5CIRA 1COV1 2QE3A 3LOBA 4EROA 4YGEA 2Q1ZB 1LB2A 2XGXA 4LBKA 4LHNA 2WNVC 3OPZA 3MICA 2RS13 1MZ6A 5H9PA 3N7LA 5H9SA 3FLPA 4IEQA 3MW2A 2BUKA 3B69A 1S55A 3A0KA 4I09A 3USUA 3VZNA 2WT2A 1NLSA 4KH9A 4IEZA 3I8TA 4AVSA 2MEV1 1C8M2 4XFHA 1VBD2 2BPA2 2RJLA 4YZ4A 2A7AA 1UIKA 3O7OA 4YFWA 5HI0A 1ULGA 2WINB 4YGCA 3J26N 2IFRA 4U2AA 5DG2A 5HCAA 2UWCA 5CG8A 4W6WA 3LSEA 3M4FA 1JN2P 1ZNPA 5F6KA 4EN6B 1KITA 2OUHA 4BYYA 4MXWA 3IWZA 3WXPA 1H1IA 1RUJ1 1S0EA 2B45X 4LUMA 1QMJA 4GB31 1RUE3 2ARBA 1J3RA 1V6LA 2A70A 2XVGA 3WR0A 5F1RA 1CN1A 4FXGB 4XFCA 3NW4A 3LCPA 4KQ7A 3RMYA 4XHXA 5ACA2 4RSUA 5FO9B 5IK8A 3SLIA 2QNKA 2XBO1 5BNPB 5I91A 3NAPB 4XTMA 3V0AB 1RL3A 1F31A 1S0BA 2KA3A 2GZWA 3BPZA 3UKVA 4UXAA 4EN9B 4M00A 3VHRA 3DUIA 4D7SA 4YNIA 1PO11 1Z7S1 3D8CA 1YJKA 3GZAA 1AYN2 1OOPA 1RMU2 5J48A 1Y7BA 1UX6A 1X82A 4XMIA 5JSRA 2BBVA 4MYEA 4NVPA 2BFUS 1DQ5A 2I74A 4UBGA 1MVQA 3PVOA 4NOTA 2ZGUA 1ZVFA 3GZUC 1ZM1A 3TB0A 3BCWA 2JEMA 1OQ1A 2PHFA 3SXWA 3O14A 1OPMA 4MXVA 2X5IB 5IT6A 1QOOA 1FMD3 2VOVA 1N3OA 4LO7A 4HVRA 2WSUA 1GR3A 4BWOA 1FI2A 4G3YC 4LBQA 1YCIA 2WNVB 4YRDA 1G9DA 1H1MA 3D0JA 1AX1A 1HDKA 3KSCA 1DQ1A 3FHIB 4N9IA 2ARXA 2R043 4DXZA 1W0OA 1H30A 1N1SA 3RJRA 5FPZA 2CY6A 2IXKA 3KCCA 5KHKA 4XJWA 3ZN6A 3ZSMA 2W08A 3WG2A 2PTMA 2RS52 4FQ4A 2ZPXA 3NL1A 3VDDC 1IS5A 3LAGA 1AYM3 4COYA 3MIHA 4OUSA 3EXUA 5CFCA 4DFSA 4KL1A 3WG1A 4Q4W3 3DF0A 1RUD1 3WDUA 4LE4A 2UURA 3RNSA 4QQHA 5DXDA 2B8MA 1PVC1 3VBOA 4DRVA 4P5HA 2XJPA 2Q4SA 1JYCA 2PYTA 2YROA 4WZFA 2MPFA 1WUVA 3KZ4C 2HYKA 4EN7B 2E53A 2C1FA 1WW4A 4X6RB 1AR81 4YLZA 2AYHA 1WLTA 3OBRA 5CADA 1QQP1 4NHKA 2D5FA 3ES1A 4AHYA 4YVSA 1IPKA 4K21A 1CJPA 3WHUA 2JG8C 4AQTA 1GFF2 2GNTA 2ZX1A 4Q4Y1 2UYAA 1W6PB 1S1AA 4CDUC 4RHV2 1B35C 2NM1A 2Q0AA 1AHSA 3LA2A 5A3LA 3AYDA 1H9PA 5JPMB 5GLZA 5C8CC 1HRI1 1DIWA 4ISRA 3VBFC 1O5UA 1BQPA 4YYOA 3ZN5A 4JGZA 4Q8KA 1O3TA 2DWRA 4H55A 3ZXGA 2FZ1A 2XLGA 3KMHA 5JCTA 1ND2C 3MIEA 1N1YA 4P9IA 3KT4A 2ZACA 1MQTC 4WM8C 3RYPA 2VQ0A 3TAYA 5DDJ1 1DQ4A 1S0JA 4Q29A 1ULCA 1U5IA 1GZCA 3RQ0A 5F6LB 1HQLA 5T5PA 1W6MB 1HV1A 4RS5C 4D7TA 2VMIA 3BOPA 2R0FA 1OI6A 4FTEA 3NO8A 1O4YA 4B4PA 3ZPYA 1QJX3 4OHXA 1U5XA 1OFNA 2HWD1 1ZREA 4YVWC 5FPXA 3B93A 1VBD1 1AZDA 3W58A 3ZXFA 3AZXA 5GLTA 1UD1A 1NY72 4IEWA 3MW3A 1VBC2 4K40A 2K9ZA 4C1WA 1HIXA 1MS9A 3LWCA 3DPRC 2A6ZA 3WUCA 2HWB3 1I3HA 2VVEA 1V6OA 3ZXKA 2XUMA 4H7MA 4E4SA 4GMP0 3R05A 4KWLA 3VDDB 4LBQB 1VBB1 4R8HA 2YZ4A 3MI8A 4OHWA 4WM7A 2GMMA 3OY8A 5DUUA 1RB8G 1RHI1 5T5LA 2EAKA 3PMSA 3C2UA 4QPGA 1ZZ9A 3GBWA 4AHZA 4URTA 4DB5A 1LHOA 2RM23 1CVNA 1AR71 3D82A 1X7NA 4COZA 1X33A 3ROUA 4DMIA 2VMHA 3ZN6B 4AK3A 1XYNA 1RVF2 3FBYA 3M3OA 1JHNA 4WV8A 2TEPA 1YJLA 3ZN4A 4AI1A 2QJVA 5FO7B 4FTBA 1AL21 4A7ZA 1ZX5A 5D1IA 1G9AA 5CVRA 1AR91 4V1PA 5HXVA 1COV3 3WP4A 5CFCB 3JUUA 4YW2A 1UKGA 5JOZA 1PGW2 1I9RA 2JG8B 3EHKA 4B4QA 1RGSA 4RR3C 1Z78A 2PAEA 3ZSJA 1L3JA 1NCQA 4CDUB 4Z2WA 4B29A 1B35B 2D40A 2SBAA 1XU2A 4C91A 3VBOB 4JGYC 5C8CB 2HWE1 5CG9A 1DF0A 3A0NA 4K1ZA 1WCKA 3VBFB 3VL9A 5C6CA 3VHPA 3VGIA 1VRH2 4LTAA 2H0BA 3QH6A 4E2SA 4G4FA 1NCRA 1LOAA 2MEV3 4HZFA 1YXWA 2WNUC 2K2SA 4CEYA 1KDMA 1ND2B 1ND3A 4OI4A 4WM8B 4AVTA 2EAAA 4YVSB 1QGLA 2XLFA 1KJRA 5GJ6A 4LE3A 2P3JA 4ZU5A 3OD0A 4RS5B 3WINE 4XPVA 1YRZA 5B2GB 2GMPA 3VHNA 2ZOEB 1JXNA 3JD72 1RUOA 4XBQA 3I4IA 1RUJ3 1LEDA 4GB33 4BMEA 5AVAA 4UW6A 1OQDA 1V9U2 1ULDA 4LBJA 1PNFA 4ORFA 1APNA 4AVCA 2WSVA 1XNBA 1B09A 5KC6A 2JENA 3DPRB 4C1XA 5FLIA 3CL1A 4NHMA 3VZOA 1NA1A 3Q9OA 2VY0A 2XBO3 5JWPA 1WMEA 1QJZA 1PO21 4DQAA 1O91A 3A4UA 3FX3A 1ZBA1 3BTAA 1PO13 1Z7S3 2ZGPA 4EWDA 1Y43B 4QT6A 5CFDA 1SQ4A 1TNRA 5GZDA 1SLLA 2P37A 3ES4A 4YW5A 3KCXA 3LGRA 1TEIA 2DUPA 2NN8A 5LK5A 5I0RA 3OGGA 1H4HA 3ZYIB 4H14A 1QOTA 4Q0PA 4Y20B 2WZR2 1KS4A 2A73B 2DTWA 4TSVA 2JX9A 3NVCA 2IZWA 5DG1A 1GBGA 1FYUA 5L73A 2HWC2 3J8F2 2ERFA 1VP6A 1S2KA 3R4UA 3INAA 1G9CA 3FWEA 4I0AA 3MLLA 2IXLA 3IM0A 4R4ZA 2E63A 4AEMA 3UKNA 4YW4A 4QQ2A 2GN7A 1ZZ6A 3HN1A 4Q4V1 4C0HA 1LOEA 3VBSA 1OKQA 4CZSA 4IETA 2G4IA 3VBRA 2SLIA 3B01A 4BIFA 2EVXA 2O1QA 1LKNA 4AXOA 4KGGA 5C9AA 3WDYA 3POSA 3K51A 5CNAA 4E4DX 5HCFA 2N7GA 4WBBA 3GBFA 1LULA 5T3NA 4LLOA 2ZZQA 4Z8BA 3V56A 1J1LA 1U5ZA 3B02A 4LA3A 3WDTA 5K0UC 1S2BA 4W65A 4AGVA 2YMZA 4DPNA 2WNUB 3NJZA 3O12A 4L92A 5SV8A 3OCPA 1LODA 2RS32 1WD4A 3IKWA 4PBPA 4RA0A 1H9WA 3ELNA 5FREA 3RYRA 4DZGA 3IDCB 4RQPC 2K0GA 4HPKB 4HSLA 3D0SA 3LOIA 3AB0A 1DBNA 2ET1A 1ENSA 2PELA 3WLUA 2XPJA 5BNNC 2VNGA 3SH4A 2DVFA 4QQPA 3ZVXA 1PMIA 4XYXA 1CESA 2NLRA 4LA2A 3POWA 3GZTB 1QJY1 1KFUL 5F5QA 2IXJA 4W6XA 4IEUA 1U0AA 5EXOA 5JIAA 3ZMOA 1PVC3 4DINB 2PHDA 2BTVC 4EN8B 5FCCA 4XEZA 4AI8A 2Y26A 4Z1VA 5FMOS 2HJIA 1I5ZA 2CGOA 3GNEA 1CD3G 1VBA1 1OLQA 3VBHA 3PVEA 3M3CA 2WWSA 5JR7B 3HR9A 1AR83 2XJTA 1D4M1 5C4WA 5A3MA 4IERA 4AI3A 1QQP3 2LALA 2V09A 3M7AA 3N7JA 1H4GA 1RINA 2AR6A 2ZS6B 4ZU4A 4AHXA 3J9SA 5K8SA 4Q4Y3 5K7PA 4JC1A 3SISA 4O9GA 3VUOA 3AMNA 2AENA 1RVF1 3AYAA 2P3KA 3ETQA 2IWGB 1WW5A 4B7KA 4YZ3A 1BBT1 4GH4A 3X29B 1HRI3 1R1A2 5DZFA 4UW3A 1FOD1 4Y1XA 4M3CE 4AVBA 1JW6A 5A32B 1ALYA 4CDWA 5GZFA 4FPYA 1UAIA 2YGMA 1YFYA 2JG9A 4FPOB 4R9CA 2ZTNA 1LECA 2DCZA 1S0FA 1OQEA 2EA7A 1DGRA 2DUQA 5DDJ3 3TYJA 2IFWA 3TOJA 3ZYPA 2WL1A 1E57A 5FOBB 4IEOA 3HBZA 3HWJA 4N43C 4BZ4A 3WQ1A 2GC1A 3AKPA 2XH6A 3N4MA 4GALA 2XLAA 5AC91 2VH9A 1QJU1 2ETEA 1WLWA 1QWRA 2D3SA 2G9GA 1PM7A 1RUC1 2MHFA 1ULEA 1H8TA 2HWD3 4K6BA 4META 5IUQA 1GYKA 1VBD3 1V6JA 4FO9A 4YGDA 5KXEA 1DU3D 1SLCA 3RI9A 1UW8A 1X8MA 3G6JB 3B00A 2PLV1 1BMV2 4Z92B 3ASIA 3MIGA 2WZPP 2HWF1 2Q30A 5T5OA 4AI0A 1BK1A 1G9FA 3H1WA 3VBSB 1VBB3 4JDNA 2P34A 5FDBA 3WT3A 4D69A 1C5IA 5D8AA 4FPGA 1VIWB 1RHI3 1HQNA 5BNNB 3RYKA 2B5HA 4CDXA 4XFBA 1RITA 4IEXA 4XZPA 1AR73 3WW1A 4IV1C 1BYHA 3I54A 1XYPA 2GMEA 5E8AA 3WP6A 3V64A 4S2DA 2DURA 1TMF1 1DFQA 5DZEA 2Z79A 2VOWA 3ZFGA 2XG3A 1DDLA 1N1VA 1CR7A 3H8UA 1AXKA 4DY3A 4XTPA 1AL23 2BGCA 2ZJCA 5EWSA 4DY5A 1WD3A 1AR93 4PQ9A 4FOWA 4JDMA 2QKDA 1OPOA 5E89A 3SCGA 2Y0IA 2R6QA 3MPBA 4CDQA 4XMAA 2YDEA 4CEWA 4TLFA 2CGNA 4R9AA 2EALA 1Q8SA 5JOYA 2GC2A 3WQ0A 2WS92 2Y38A 4QPIA 3ZO0B 4R9DA 2HWE3 2RHPA 3WDWA 3TN92 4RGGA 2VECA 1DGRN 4QGMA 4MV2A 1U12A 5I0UA 2BQPA 3JBG2 3L2HA 3OJBA 3TWIA 1IS4A 3TNQA 2VW1A 3H50A 4L99A 3ZFFA 3GHNA 1LHNA 1EV12 2DU1A 3HT1A 1CGPA 2WQZC 4BA6A 2DTYA 1GICA 2VMGA 1DZQA 2JE9A 4K1YA 3S0MA 4AYUA 3FZ3A 1IS3A 2UY8A 4HLTA 4N43B 2ZMNA 1BCXA 3WW3A 1MVEA 3WCSA 3EBRA 1BEV1 3VZJA 2ZGNA 1C5HA 5FBZA 1V6NA 2W0XA 1LHUA 2GNMA 2NQYA 2DCTA 4Q4X1 2JG9B 3AZWA 4S2GA 5DZGA 1OD5A 2QQPA 4Q27A 2CAUA 2CWMA 3M8LA 3VHOA 2D98A 1CAXA 4Z07A 3JB8A 3H1YA 1PO23 3PJQA 4I02A 1ZBA3 2YXSA 2EXJA 2BWAA 2VOKA 3IPVB 1PZ9A 5FOJB 1RJ7A 1DZRA 2X29A 3FLRA 2R49A 2TNFA 1ZZ8A 4GKYA 3AP6A 3AFGA 3MIDA 2A3WA 4IV1B 3MIFA 5J96B 2IXCA 3WHTA 2WFF2 4AGRA 1FT9A 4K3UA 2OW4A 3ZXDA 1K5MA 3JQXA 1T6GC 1LR5A 1AXYA 1PIV2 3CJIA 1VBE2 2JDZA 4JVAA 4Z82A 5T5JA 1POV1 2QVSB 1FX5A 4MLOA 4NHLA 4COVA 2WJSA 4CP0A 2OPKA 4AVVA 1RUF1 1C8NA 1BZWA 4NR1A 1LOFA 3VZMA 3FUQA 3RG0A 4Q4V3 4Q26A 4LO5B 2R30A 3HD8B 1XQNA 4WVWA 4I0BA 1FNYA 1GLHA 1OOPC 1RJ8A 1W6QA 4XDQA 4Y5Z0 2RS12 3U4XA 3EO6A 1MZEA 2X8KA 5GZCA 4GIQA 3U10A 1URXA 1R1A1 1GV9A 1ONAA 4X8PA 4UW5A 3MPPG 1A8MA 2CV6A 1YFUA 3S30A 3SCFA 4IEPA 5ABJA 3WW2A 5FMOL 3MFCA 1HRV1 5BY5A 4LEJA 4P9YA 2ZMLA 4XJ9A 4AFBA 3ACLA 4LBLA 4GXLA 1ASJ1 4QD2A 4B4RA 2DCYA 2JXAA 4PLMA 1XU1A 2WLQA 4XETA 2D6NA 5BXXA 3WP5A 3APBA 1RUG1 1HXS1 3POYA 3WG4A 1OA2A 1NXMA 5JOXA 4XFIA 4YGBA 3H1MA 1OHFA 3U0ZA 2D43A 3BB6A 1UIJA 3USUB 1AR61 3SCHA 4MZUA 1REDA 1QJY3 1RUH1 2ZCWA 1V6KA 1RUI3 4LLFA 1BMV1 1YNAA 3RWNA 2NMNA 3ZX7A 1ENQA 2R32A 3VKFC 5JPNB 4R9BA 1C57A 4SBVA 3QH7A 3N36A 2RMU1 1OLRA 4AFMA 4JTOA 3RSJA 4A2UA 1ZZCA 4B8EA 3CJXA 1OA4A 1WCSA 1MEC1 4N9HA 2ZGTA 1VBA3 4XF9A 4E2GA 1ZBE1 4NPRA 1D4M3 1YIPA 3ZFEA 5BNQA 4LHKA 3W59A 3AYCA 5CA6A 2E7QA 5CFCC 4KU8A 2QFEA 4XF3A 5EYYA 2D6OX 3UV9A 4MXWB 1O4ZA 2C0ZA 1BJQA 5EFUA 1R081 2BNOA 3BU7A 3OYWA 1FPN1 2VOXA 1OSGA 3AKRA 2PQQA 1W2UA 2A6VA 4RD7A 5BNOA 1UF2C 1YI9A 1R091 1BBT3 2RR11 1N47A 3VBOC 1FOD3 5FLHA 1SFNA 3C3VA 3AZZA 4FPCA 1EPZA 1KS5A 1VAVA 2NPIA 2A75A 1FMD2 1NLRA 4XQWA 1QH7A 1W0PA 4YVSC 3AP7A 3B9CA 4JRAA 4YW3A 3BIWE 4JCKA 2XJQA 3UJQA 1OOPB 2WS91 2AGSA 3PJYA 1WBFA 3PTYA 1IOAA 3ALQA 1CAUA 5FAXA 2ZGLA 4M0NA 2R042 5AC93 1A3KA 2ZHLA 1QJU3 4AFCA 3ZXLA 5GALA 3CJIB 1RUC3 1VAMA 2LUWA 4ES9A 3CU7A 1CIWA 1G86A 1KJLA 2EF6A 1GZWA 4PDWA 2F6BA 4OI0A 1C8M1 1GNHA 4