3ZYHA

Crystal structure of pa-il lectin complexed with galbg0 at 1.5 a resolution
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
121
structure length
121
Chain Sequence
b'AWKGEVLANNEAGQVTSIIYNPGDVITIVAAGWASYGPTQKWGPQGDREHPDQGLICHDAFCGALVMKIGNSGTIPVNTGLFRWVAPNNVQGAITLIYNDVPGTYGNNSGSFSVNIGKDQS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PA-I galactophilic lectin
publication title A Glycopeptide Dendrimer Inhibitor of the Galactose Specific Lectin Leca and of Pseudomonas Aeruginosa Biofilms
pubmed doi rcsb
source organism Pseudomonas aeruginosa (strain atcc 15692 / dsm 22644 / cip 104116 / jcm 14847 /
molecule tags Sugar binding protein/inhibitor
total genus 23
structure length 121
sequence length 121
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07828 PA-IL PA-IL-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.430 Mainly Beta Sandwich Jelly Rolls Galactose-binding lectin 3zyhA00
4YW7A 2C24A 4CP9A 4LKDA 4A6SA 4BQ3A 1W8UA 2VXJA 1WCUA 2KR2A 4BQ4A 1W8WA 1HN0A 3ORJA 1L7LA 2O14A 4LK7A 3ZYBA 1W8TA 1GWLA 5D21A 1V0AA 1GWMA 1W90A 4CPBD 2WYFA 4AL9A 3F95A 1OKOA 2LROA 4LJHA 2K46A 4LK6A 1W9FA 1WMXA 4LKFA 3ZYHA 4LKEA 1GWKA 4YWAA 1UOJA 2JWPA 3UT0A 4BQ5A 4CPBA 2Q1FA 4YW6A 2LRPA 4CP9B 1WZXA 1W8ZA 4BQ2A 1OH3A 3ZYFA
chains in the Genus database with same CATH superfamily
2YC2A 3O1SA 1LU1A 3B9IA 4DIQA 3VDBA 4M0NA 5GZDA 3CJIB 3C7FA 3QD6A 2WNUC 2ZKNA 5ANQA 1MQTB 1LGCA 1L7LA 2VUAA 1CIYA 1CR7A 4H55A 2W1SA 2TBVA 2CYFA 3WP4A 3NSTA 1SCRA 4Q8KA 2W47A 1CONA 5H9QA 5A3PA 4M01A 1QJFA 3T09A 1VLNA 5JVVA 2JJ6A 4GB32 1NYWA 5K0UC 1ULEA 4RHV1 2WIIB 1AUYA 1STMA 2V5YA 1V6OA 4R8HA 2GNDA 3WQ0A 2JE9A 4JRLA 2WNUA 1KITA 1JZ5A 3MGUA 4DY5A 4UW5A 3ZPOA 2VZSA 2FCTA 5DUVA 1BJQA 2ADEA 4K8RB 4NMIA 2B46X 2GMMA 4CRQA 3KT4A 1IS6A 5A3OA 3KCCA 1F31A 1AR73 2D43A 3MW2A 5K0UA 2PLV2 3VDDC 2Y64A 3LCPA 4D0QA 1RUG2 3DEMA 3ZYPA 3KCXA 3RPQA 5IFTA 2J22A 4AFAA 4XYXA 2R061 2B39A 2WO7A 2VOWA 2XKOA 5SV8A 3AP6A 4NR1A 2NPIA 4XCBA 4QDQA 2WA4A 4WM7B 5CVRA 1YFUA 5JR2A 4RQPB 1MVEA 2UWCA 1N3PA 3VDDA 5JZGC 1VBE3 4KI5M 1D4M2 1PZ7A 4NIDA 3CL1A 2WC2A 1NLRA 1UAIA 3S0MA 1U5IA 4WVVA 3VBHC 4CCOA 5FYYA 2E26A 3LQCA 4IEOA 2JDNA 1COV1 1FXZA 4Y4YA 5DUWA 4AVBA 2YU1A 1I9RA 3DKWA 3D3AA 5JPMB 2MEV1 4HKOA 5DAXA 1RINA 3AL6A 3VGIA 1JZ6A 5JZGA 3KV5A 3B93A 4OVEA 3LOIA 5LATA 4GMP0 1OD3A 3J7HA 5FWJA 1UF2C 3VBHA 3LA7A 5A7WB 3QACA 4BM8A 5L7OC 2Y0IA 4NVPA 4OCTA 4CTEA 3T0DA 3VBRC 4WVMB 3HEIA 1LEDA 3P5BA 2WT0A 2PHWA 3DPRC 4IERA 1UZWA 4FOQA 4XF9A 4CUAA 2VMCA 2GZWA 4XILA 5C4WB 2B42B 4Y24A 1JOBA 2VW1A 2W46A 3OGSA 5BY5A 4Q2FA 5JOZA 3SKVA 1COV2 1U12A 5L7OA 1CZVA 1OKQA 4ZZ8A 3VBRA 5CBLA 5IHRA 1OVPA 3J7NA 3PMEA 2WFF3 2RM22 4BQ1A 4XF1A 1WA6X 2AACA 1DU3D 3DPRA 1TEIA 2WA3A 2D44A 3ALQA 3QLQA 2HWD3 4QX1A 3T4HB 3THTA 3THCA 4ARYA 1SLIA 4QB2A 2PHLA 3EHKA 3S7IA 2WLPA 3QBQA 3QH6A 1DFQA 3VLBB 4LO7A 2XJSA 3I2KA 2IXLA 1O3SA 3TNQA 3O1MA 1W99A 1VMFA 4B1LA 1HB4A 1OMIA 2XQRA 5FPVA 5DMYA 4YGEA 5T54A 3GXUA 1OI6A 1DGWX 2VPVA 3VKLA 1UOFA 4CEWC 1UZVA 4UXAA 4YG6A 3BOWA 1Z0HA 2GH2A 1CWPA 2ZGQA 2B5HA 4XOGA 2FDFA 3I2FA 1UYPA 5JOWA 4HK9A 3VZOA 4AI2A 4E8CA 4ZZ5A 5BNOB 3RZMA 4OZXA 3RG0A 5JXHA 2PHXA 1RITA 3TEZA 2BZDA 2RJ2A 5F2WA 2W3JA 1M06G 1ZZCA 4N8MA 1JN2P 1K5MC 4M3CA 5IVJA 2P2KA 4AW7A 1K12A 1F5FA 2VMHA 2DDUA 1F4AA 4Q4Y1 4Y20A 4CEWA 3GBWA 4LO6B 2QZ2A 4XEZA 3W59A 3SH3A 5IT6A 1JTZX 5DDJ1 1NXMA 1XXNA 3OUIA 4YNIA 5T55A 4FPYA 4BHPA 3HMYA 1WMEA 5CFDC 2EAAA 4FQZA 3SEPA 5JI9A 5ACA3 2BYVE 4AZZA 4BXFA 2E51A 3PVOA 1MEC2 2W68A 1AYN2 1RUI1 1UKRA 1K5MA 4OHWA 4CPBD 1GNYA 2BW8A 3KQ4B 3POBA 4OUEA 1VAMA 5LA9A 4XQDA 3WV6A 1RUF1 1ENQA 1AR83 4NE9A 4LIUA 3GHNA 1HV1A 3NMBA 3T08A 5FYTA 2VBBA 5CFDA 3FX3A 1QNWA 1UZYA 5FUNA 3FC0A 3RZGA 4JGZC 3LSDA 3ASIA 1YQ2A 3A0NA 1NAEA 1AL23 4ZPIA 5DUXA 4FBFA 2VXJA 3WNLA 4D94A 1ND2C 1GQGA 2J7MA 5J36A 4NIIA 5B4XA 3NJYA 3O1UA 4LR4A 1EPWA 1US2A 3H7YA 2ZGTA 4IGPA 3RWNA 1GWLA 1O5LA 1UYXA 2B8MA 4JHZA 5FYVA 2E7TA 3WW1A 1PM7A 5GZCA 1K42A 4JGZA 1W6OB 4GAZA 1Q8SA 2GP5A 2YGLA 2WNOA 3BN6A 4U2AA 3NKGA 4ZU5A 3S57A 2WZPP 1HLCA 5LK7B 5EP9A 5C3SA 5C6CA 3H8XA 5CISA 1RVF1 4AEKA 1PK6B 1GWKA 1RUF2 1IGOA 1YRZA 4EN6B 1ND2A 4DQAA 4GJZA 3LEGA 1I6XA 5BYNA 3ZN6A 4P9LA 2XJTA 1IPKA 3AYCA 2JKXA 3MEPA 1S0DA 1DQ6A 2VTXA 4WV8A 2ZGMA 5FZFA 4GD4A 2GC0A 1LHNA 1F5JA 3N7JA 5CKMA 4I3GA 4QT6A 4BU2A 3WINE 3TBDA 3MFCA 4XUOA 2P3IA 3GZEA 5JOYA 1OSGA 2D6LX 2XKPA 4MUVA 1YEWA 3R6SA 3U11A 4AFMA 4B29A 4YFZA 3N7KA 3C8XA 2JD4A 4HSLA 1IPSA 3UJQA 1PZ9A 2R49A 4QM9A 2K2SA 2GNBA 4JRAA 3H42B 3QH7A 2EIBA 1R083 1QNYA 4XZUG 1AR71 3PDQA 5FTTC 5CB7A 3ZFGC 1H4HA 1QIQA 3HQUA 2DCJA 4CDXB 1J59A 3ZXDA 2XB6C 1EPZA 1A8MA 2NM1A 3RS6A 4B4PA 3W58A 2ZCWA 2R042 3B94A 4AVTA 3URFA 2EXIA 1H1AA 2Y38A 1D4VB 3I8TA 3ZIXA 3ZYFA 1IG3A 3MW3A 5LZ6A 1RUE3 4DPNA 2A3WA 5CKNA 2ZGRA 3KCYA 2ZXQA 1MS4A 5J7MA 1KRIA 5EYYA 1MS3A 5H9RA 1NOVA 3ZFGA 3AX4A 4S2GA 2HWB2 3I2HA 4AEDC 5EJ1B 1POQA 5A32B 4OMCA 3O5SA 2JDUA 3C7HA 4EYUA 2GNTA 1O4ZA 1HQWA 2IFRA 3H1WA 1PHMA 2X05A 1LENA 3GDBA 3NL1A 4JGYC 3NVCA 4GWNA 1JYIA 3FL7A 4OHXA 4LKEA 3AKRA 1BEV2 1SBEA 1Y9QA 1FNZA 1Z7S1 2IWGB 3ROUA 1O4TA 1W2NA 4QPGB 4TN7A 4ARXA 1WZXA 3OPTA 4XDQA 1ZRFA 2B9VA 1AX0A 2DBIA 1ZBE3 3AXDA 5F3CA 5C5TA 1NE6A 5C33A 4AEDA 3HNBM 1BQPA 2YG0A 1I5ZA 4B7EA 3R4UA 5DQ0A 4Q4W3 3M3IA 4YVWB 4YSFA 1S0IA 4JGYA 2BNNA 1JYNA 1ULFA 5FQ0B 1IQDC 2ZMLA 4CUCA 4LO4B 3POEA 3OGVA 2FDHA 2W94A 2GH8A 4IE5A 4A7KA 3OBRA 2QBXA 3AMPA 5A3MA 5FUIA 3AJZA 4URAA 2NMOA 4I01A 3Q8BA 4BLIA 5FR3A 4CCKA 1EUUA 1OA3A 1Z7S2 1ODMA 1RUC1 3M3CA 3HQXA 4BQYA 4A41A 5JWPA 2RHPA 2Y6GA 4NHXA 3ME2A 3VD3A 3IDBB 4Q27A 3MZHA 1JYWA 3NQHA 2PMWB 3FBYA 4QQPA 2HWD1 1RUD3 1LOFC 3DXTA 4MGYE 4P5HA 3RWKX 3N36A 3USSA 3A0KA 4KNCA 2ATFA 2QUOA 3GZAA 2WR9A 5F7UA 2PHDA 4FFGA 1EY2A 5FYUA 5IJRA 4ZHNA 5KHGA 3HIFA 3GZTB 5FRAA 2O8OA 1HV0A 3PUAA 4HANA 3U37A 1VR3A 3FHIB 1EV11 4RYDA 3EYPA 1RUC2 3TRSB 3AB0A 3ATGA 4BH9A 1A78A 2A7AA 1HQNA 1OBNA 1Y7BA 1U5ZA 2K0GA 4E8DA 4AFBA 3WQ7A 4GXLA 1SCSA 1GANA 2VQAA 3GBGA 1MACA 3WNXA 4FQ4A 1XSRA 3UV9A 5C8CB 1WCSA 1WW7A 3DUIA 5HCAA 2VQUA 2CHHA 2W92A 1RUJ1 3I3DA 3H8RA 2RV9A 1KD7A 4WVWA 2PHUA 5IVCA 3KV9A 4HOOA 4UFLA 1H8TB 4N43B 1E5IA 1XNAA 1ZBA3 2D5FA 1CAWB 1OT5A 1Q8OA 3M3OA 2Y60A 4YW6A 5CZKA 5FZMA 4AEJA 1QOOA 2WWUA 4ZKTB 1Q8PA 5CYYA 1W8HA 2NYYA 2PAKA 4YM3A 3CDZB 3LPGA 4LKDA 1LCLA 1UY1A 3PJYA 5L9BA 4BQ4A 2HYXA 1Q8VA 2JX9A 3PVNA 1RUNA 5A33A 2GSYA 4QKFA 2J1VA 4OYUA 3ACHA 2PHFA 4CP1A 2VQ0A 1KJLA 4CU9A 1GWMA 1RUJ2 1DGWA 2VVDA 4HXCA 3FJSA 4HKLA 2AGSA 2YC0A 1XSQA 2NN8A 3ZSLA 2D93A 5C9AB 1GNHA 2BJSA 1NZCA 2RDNA 5JIUA 2BVBA 2Y8KA 1OFNA 2XJRA 3CO2A 4HVRA 3DYMA 3ZFFC 4UOJA 3ITQA 4XAAA 1YUDA 1TME3 3DF0A 1LTEA 4XFBA 2R072 1WLTA 3P3PA 4LUKA 1W8UA 5EPAA 4MZUA 5FFOC 4TWTA 5FJHA 1ZVFA 4L8QA 5F6KA 3H3LA 5LRRA 1QXPA 1QJZA 2VNRA 3CF6E 3NNFA 1VBD2 2WS92 3WCSA 3UKTA 1ONAA 2YU2A 3MIHA 1WA4A 5A7QA 3HNMA 2Y6LA 4LPLA 3S5QA 1OVSA 3OPZA 4Q0SA 1JYCA 3ZFFA 3WF4A 4QAWA 2EXJA 4BOWA 1QJY3 1UIKA 5A7SA 3ZSMA 3LOBA 1X50A 3LDBA 1X9TA 4IE4A 4EN9B 2WT1A 1IZ3A 1OLMA 3OD4A 4CP9B 3OBTA 3WP3A 5FCCA 3WXPA 1JZ7A 1ZNPA 5APAA 1DHKB 1VJ2A 3RMXA 1D2QA 1GV9A 1OPMA 1UKGA 3ZN4A 5LRSA 1ZRRA 4YM2A 5FREA 3IBMA 4Q0UA 1VBC3 2IC1A 4CU8A 3KVAA 1GSLA 2O1QA 1M4WA 1FMD2 1ND3B 2IXIA 3PUHA 1OA2A 1DQ4A 3I2IA 4LBKA 2DURA 2WAOA 5I91A 2G9FA 3RNSA 3B01A 2R32A 3MF6A 3WF3A 4DXTA 5A6YA 3VBFB 2RS53 5IK4A 2W1WA 2JE7A 1BYHA 4P9IA 1RUE1 3WR0A 1TMF1 4TSVA 4C1XA 1EP0A 5F6LB 2W52A 3WDVA 3T2OA 2H6BA 4LBOA 4LKFA 4K3UA 1X33A 3VBSB 2BP6A 4GIQA 1ALYA 1FV2A 1RMU1 1D0HA 2OVUA 3E6BA 3FE5A 5J48A 5I8TA 1OH3A 1XU1A 4KWLA 1JZ2A 2P3YA 4Y1UA 4FPJA 4CCEA 3WUDA 4HKWA 5C3PA 2RR12 4XJUA 1WW6A 2BTVC 1L3JA 1WCUA 1YLLA 2UWAA 1DLLA 3VBUC 3WVJA 2BBAA 3JU9A 2W1QA 2DU1A 2D97A 2PAEA 3CEWA 2QNKA 1ZBE1 1GZWA 5FZOB 4ZXEA 2ZX3A 2TUNA 3BTXA 2MHFA 1TMF2 3CKHA 4XQWA 5FK8A 1ENSA 3ZXAC 2A6WA 2QDRA 5L73A 1V6KA 4NHKA 4NWVA 1FAYA 3U10A 1RMU2 2BNOA 3VBUA 3K4ZA 3AL5A 1OQ1A 2AUYA 4P00B 3K46A 3JUUA 3ZYJB 1LKNA 4YFWA 5FY1A 3JD72 5BV6A 3MF9A 3M3QA 4ET7A 4UFKA 4HONA 3OEAA 1O6UA 5FZ7A 5L19A 4EZHA 4A3XA 4JAAA 1QOTA 4AI8A 1X7NA 3JBG1 4LKSA 1T6GC 1ZRIA 1FI2A 2DFBA 4X6QB 3F95A 1AR93 1X8MA 5FWEA 1POV1 5JXJA 3POIA 2N7GA 1S2KA 3PUIA 2JIJA 5F9TA 3M4FA 4QD2A 1BHGA 1DG6A 3M2MA 3QOPA 3JXSA 2HWE1 4TTGA 1EUTA 5FZHA 2RVAA 3PU8A 4AG4A 2R16A 2HEYF 1WCKA 4AHWA 1UYYA 4QX5A 4YVSC 4C90A 5FZKA 4BWOA 5AC93 4AE2A 1S4CA 3HNYM 2IUWA 3J8F2 1W2OA 4D6SA 4OHYA 2WAAA 1W0PA 2B45X 1CZSA 2H0VA 1OC1A 3AP4A 5T5OA 4TLFA 3T4VA 1HJGA 3BIEA 2BPA2 4I2OA 1EAH2 2WT2A 4QX0A 3V0AA 3OYWB 4B3NA 4FPFA 1B35C 3EJKA 3SEEA 4NUBA 2DCTA 5EZWA 4QQLA 1QJEA 3FBMA 4H3WA 4YVSA 1AJKA 2OYZA 4A7YA 3UT0A 4A2UA 1Y3TA 2ZGKA 3L2HA 1QJX1 4CPBA 2JG8C 2ZX2A 2HWE2 2KXLA 3QCWA 4FXKB 3U4SA 4Z92B 1ZZ9A 1WKYA 1UU5A 3MV11 4LBQB 4Y22A 3TYJA 1W6QB 5JSPA 3LZZA 1VBA2 3PUQA 4LBMA 3NWKA 4L92A 4XJ9A 1B35A 1XNBA 1RUOA 4CEYB 2WQ8A 1LOEA 1ZBA1 2KR2A 4PBOA 4RS5B 4MX3A 4RSUA 2BGCA 3CU7A 3MUY1 1JUIA 4GQ7A 1MPXA 1NX9A 5I8YA 2JG8A 4CVUA 4DMIA 1GOHA 4YG0A 1VMHA 3MIDA 4XUNA 1YQ6A 2ENRA 2SBAA 2E32A 4XHBA 5F3EA 2JDAA 4G4FA 3H1YA 1DP0A 3Q8CA 1DBNA 2XH6A 1X9PA 5KHJA 1ZZ6A 3MV01 4W65A 2DUOA 2ZGOA 1UU6A 3DGTA 3GALA 1XNDA 3IM0A 1E5SA 1HB2A 2IXHA 2X29A 1C5HA 3BKZA 5FZEA 4UW3A 5A3WA 4QHZA 3D6EA 3CQOA 2C24A 4QQHA 3FLPA 4CYDA 3E6DA 4JVAA 2GAUA 4JC1A 4DRRA 1UPSA 2WZR3 2XLGA 4V2VA 1JXNA 4K6BA 4IQPA 3KT7A 3ZSKA 2VZOA 2ZOEB 3E1F1 2GN7A 1JYVA 4TZDA 1IHMA 1VB2A 4H14A 4C91A 1BXHA 4P9WA 1CVNA 4AXOA 2ZGSA 1VALA 3NKTA 3HT2A 4MOAA 1V9U1 4YWAA 4DRVA 2V5DA 2UWBA 4Q29A 2ERFA 3PVBB 4Q5OA 4EQVA 2VOKA 1MEC3 1V6IA 5L9RA 3NAPC 4DNYA 4DO0A 5A3LA 1H30A 2GN3A 2WWSA 1CJPA 1OD5A 3D8CA 5EFUA 2XBO2 2Q5TA 1GQPA 4LLOA 3TN91 4IETA 3X29B 2MNGA 5FP8A 1MZ5A 3T1MA 3LGRA 3ETPA 1C8M2 1GKBA 4OQ8A 3CZUA 3OGGA 2QE3A 4OI4A 3OCPA 1UIJA 3PJQA 3RDIA 5IUQA 3LB9A 3GZUC 4CCCA 3IZOA 3JCIA 5F5CA 5F5IA 1PO22 3NAPA 4FPOB 2RS11 2ZS6B 3WCRA 4ASLA 3T0AA 2QQUA 4CA9A 2VH9A 1GOFA 1IQAA 2AZ5A 3AZZA 4CDWB 3WUCA 1UOJA 2CTVA 4PIYA 1V9U2 1D0GA 2WQ4A 2J1UA 5GLVA 5KWRA 4QPWA 3ZO0B 2NMNA 2CGNA 4MXWB 4CU7A 2XPJA 1VRH1 1S0EA 2E6VA 2PQQA 2ZTNA 1SZBA 3SNMA 5FLIA 5HXMA 5LEKA 2JG9C 1QF3A 4LHSA 1UL9A 2VTFA 1XPWA 5FZ9A 4XC9A 5J3UA 1GZ9A 3FMGA 3FUQA 1GUIA 4DZGA 4A4AA 4YLZA 1FPN3 4IDZA 4YGCA 2ZAAA 4ISRA 4YG3A 5LEJA 5A1AA 1DZTA 1N1YA 1ASJ2 5I0DA 2OS2A 4AR2A 5CFDB 1GR3A 2RS12 4MGSA 3ZM8A 3ZXLA 2WKKA 1NKGA 1AXKA 2WN3A 2W87A 2JG9A 4MVTA 1OH4A 2Q1MA 1NQDA 3AM2A 1O91A 4HPKB 3EBRA 1VIWB 3LFIA 1C28A 3OTFA 5M0TA 3RVHA 3H3UA 5FY7A 1LULA 3E5XA 2YY1A 4CCJA 3TEWA 3TEYA 5HXVA 4UBHA 1VRH2 2UY9A 5IVEA 1YCIA 4IE6A 1W6NA 4KH9A 2C9KA 3E5QA 3O1RA 1W0OA 4YW2A 2J1AA 1DCSA 2ZZQA 1BVP1 3WW2A 5IAXA 2ZEWA 1UXXX 4N7IA 1H9WA 1O7FA 4W8JA 2EICA 3ZSEA 2HH9A 5JIAA 1OXCA 4XF4A 3FHQA 4ZONA 1NLQA 4W4ZA 1GP5A 1ODNA 4CXXA 3AVSA 1NA1C 3O1OA 5LA0A 1NY71 1J3QA 1Q8QA 2DWRA 2IZWA 5AFBA 4FSJA 3B3QE 3ZSJA 2RS31 2YUEA 3H9AA 3IPVB 5FBJA 1N3OA 4RHV2 4A45A 2WNVB 5FYIA 3UNPA 5D8AC 1J83A 2F4LA 3I54A 5DZGA 4LO5B 5LBBA 2QQLA 2ZEYA 3R4SA 3HR9A 4GMP1 1DQ1A 3VZLA 3KV4A 1O3QA 2YV8A 4FTEA 3RRDA 3A4UA 2VNVA 1CIWA 3AFGA 1NA1A 4RFRB 2BGOA 2VULA 3B02A 4BPZA 2C5DA 1WLWA 4E9KA 3SISA 3SCGA 2QQJA 4BISA 1Q3EA 4LO8A 3W20A 4NRPA 3NW4A 2RMU1 5D8AA 1ULPA 1Q5OA 1YFYA 1YQ5A 3GHMA 3WHTA 4A42A 3RJ2X 5HI0A 4NIHA 4ES8A 2YDEA 2R062 1NY72 1PO11 3ZKYA 1DDLA 4YPJA 1CPNA 4JTOA 2RS32 5IFPA 3I59B 1CAXB 4DUXA 2AREA 4GH4C 5J37A 5CFCC 4BQ2A 2C26A 1HDKA 1UO9A 1CZTA 3SITA 1WBLA 2EF6A 3ZFGB 3KHBA 4OUSA 5DZEA 5IK8A 1BMV1 1ZA4A 1TNRA 4N7UA 5T52A 2BV4A 5CEHA 4UF0B 2WYSA 4E2SA 5JPNB 4URTA 5KC6A 3NV4A 1A8DA 2FQPA 4XVHA 4E2GA 4NIGA 4GH4A 5FZ8A 2MEV2 5LBEA 3U1XA 5CFCA 3POYA 2RMU2 1L7QA 4AGGA 1W8FA 4IV3C 3WDYA 4Y3OA 2VUCA 4DB5A 2XJVA 1SLCA 5A3UA 5BNPC 1PO12 4M3CF 1PMIA 2IVJA 5D2AA 3KF3A 5DABA 4IEYA 3K4AA 3WF0A 1TQ5A 4Y5TA 3BTZA 4L2NA 3UESA 5LASA 4JDNA 1YFWA 3VHOA 4LITA 4PI2A 3EB7A 2ORXA 4Q4V3 3GJAA 3RZHA 2AC1A 3HN1A 4IV3A 5LW9A 1BMV2 4PDWC 2EXHA 4AQTA 3A21A 5A3NA 4QPIB 1IS4A 2FMDA 3D5OA 1W39A 2IXKA 2X5IC 4XETA 5IVFA 4X8NA 1UZ0A 2FHRA 2BERA 1UMIA 4K21A 1V6MA 4AYUA 4XTPA 2ET1A 1PVC3 1W6MA 1R091 4PDWA 4R9DA 4HMZA 1NCQB 1W03A 5GZFA 3THPA 2H0BA 2XOMA 3DXUA 2JICA 3EXUA 5LWBA 5JXGA 2LTNA 2OXBA 2FD8A 2XXZA 2X5IA 3ZFEB 2PQSA 3T2TA 5KHKA 2ZA9A 3R0RA 1O8SA 2Y34A 3C7GA 3P3NA 4EJRA 3ORJA 2OPWA 2Y33A 2OZJA 5J09A 3H8OA 1G9BA 1CAUB 2OIIA 1QOSA 5F5QA 1UD1A 1NCRC 4I09A 4NHMA 4MLOA 2YBSA 3T2PA 1H2NA 1NG0A 1UPIA 2QCSB 3IKWA 4QM8A 2CNAA 3SH5A 3W5NA 3WNPA 5FPUA 2ZJCA 1SLAA 2ZEXA 3CJIC 3IMMA 3KHCA 1R092 4XABA 3MUZ1 2YROA 2WO1A 3FUOA 3USUA 4C8DA 1A6CA 1MQTC 1JI6A 2HYKA 2Q8DA 4XBNA 1BZWA 2VO5A 3PNAA 4Q4Y2 1NCRA 5GZGA 1JMUB 1H6XA 1YJKA 3HN3A 5DDJ2 4L0PA 3PVEA 3IIAA 3WP6A 4XJWA 5H9SA 3VHPA 3KM5A 5J1XA 2ILMA 3CJIA 4AFCA 5FO8B 1PIV3 1GICA 1MQTA 1RUI2 2I07B 1ZZ8A 1ZREA 5FV3A 4Z2AA 3Q8AA 1N47A 1QU0A 5BUVA 4FPHA 4G3YC 2WO2A 1HRV3 4PJYA 1KS5A 1S2EA 2BWAA 4W6YA 2ZMNA 1J84A 3H1MA 2JENA 3DYPA 3VBOB 2P6CA 4Y1VA 2P3JA 4K1ZA 1Y4WA 5KXCA 3JB8A 1OOPB 4LA2A 3B9CA 4RR3B 4WM7C 4XTMA 1AXYA 2WDBA 4GWJA 4PIZA 5GJ6A 2O14A 5CAZA 3U4XA 2XUEA 1YIPA 1KDMA 5I0TA 4RQPC 4AF9A 3GJBA 1ZYBA 1JZ8A 3THDA 2A3YA 2OX0A 1QEXA 1XYPA 3SHRA 4NJ4A 4ORFA 4R4XA 1FMD3 4HL0A 4KWUA 5KXEA 3G6JB 1S0GA 1SFPA 2E31A 4XBLA 4NOTA 4OQ9A 1S0FA 2E9QA 5ANNA 1RVF2 3HOBA 2HKXA 5JSRA 2G9ZA 4WM7A 2VZRA 4XUTA 2LUWA 3NNMA 4ASKA 4RQPA 1AYM3 4PLNA 5F1RA 1UQXA 1LHOA 5FZAA 3GYDA 3N9MA 2ID4A 1CD3G 2A73B 5TSWA 3F2ZA 3N9NA 4K7JA 4LQRA 1VBE1 2VM9A 3D0JA 3WSOA 2ARXA 3V0BB 4RGAA 2P17A 3VL8A 3MIGA 1UY2A 4LHKA 5GLTA 2VCBA 3OEBA 4S2HA 4CUGA 2Q8CA 4HLTA 4CUBA 5A70A 2VD7A 4KWJA 4XDOA 5GALA 3S6PA 4DUVA 1UXZA 4YW1A 1RUH3 3WNNA 1AR72 1S55A 3SXWA 3POSA 4XUQA 1XNTA 1XQNA 5A7WA 1SPPB 1R1A3 1TNFA 3BGAA 4YYOA 4WVMA 2XLFA 4NPRA 1A34A 2AYHA 3HAGA 3ZPYA 1AL0G 4P9YA 2QQKA 2BUKA 4QB6A 3WF2A 3IWZA 3H7JA 5JLVA 1LGBA 4PT6A 4AAPA 4PLOA 5I0SA 5I0RA 4IV1B 1YO8A 3NNLA 3OY8B 3ZLIA 1AX2A 4F8AA 1W90A 2WYFA 4NHYA 5A6QA 4NPMA 5HCHA 2VJXA 2CWSA 4YW3A 4IEUA 4RD7A 1J1TA 2ZX1A 2D6OX 3MPBA 2DVBA 3RZKA 1DF0A 1DQ2A 1UOBA 1GLHA 2DFCA 2X10A 2O0OA 3WD5A 3BUCA 4AGVA 3RGBA 1V70A 4AI9A 1AR63 2UY8A 2WFF1 4NAOA 1FX5A 2JXAA 2QZ3A 1KQRA 2LS6A 4COWA 4FPLA 4JTNA 4L9BA 1MZ6A 1Y9GA 2AENA 5FKBA 2XDVA 5A80A 1GYKA 3IIIA 3LA2A 1SBDA 1RTVA 1PVXA 2EIEA 3IMNA 4LNVA 5T5LA 1MS5A 1WW5A 3KGLA 3OOXA 1PGSA 3AZWA 4M00A 4Q4V1 3ZVXA 1QMJA 2HBTA 3ZN5A 5FLJA 4LK6A 4F7ZA 1DZRA 1VBB3 2UYBA 3E97A 3K51A 4LXLA 4QQOA 4AVCA 2D7FA 1LOFA 3WNKA 2HJIA 3OJBA 1JYXA 1NE4A 2IXCA 2AEYA 4J6GA 2GC1A 3LSEA 4R4ZA 5ISLA 4N53B 5BNNB 5GLZA 2OPKA 4K9SA 2GDFA 2WFF2 1NXD1 4IW3A 4UI9L 1YI7A 4PQ9A 3B00A 1GMMA 1ACCA 3FLRA 1PVC1 3MLKA 1CAVB 2JDKA 2HWD2 3VZJA 1C3HA 4AOCA 5C5UA 4KGGA 2BNMA 2B4KA 2ZHNA 4KGQA 4Q4X3 5L36A 1GP6A 3OSDA 3ZFEA 3MIFA 1QJU3 5FYCA 1W6PB 5A1LA 1IOAA 1OUXA 3RJRA 4CCNA 1RC6A 3WQBA 4LE4A 2DVFA 1I1EA 2JWPA 2TEPA 4X8PA 2PN5A 5ACA1 1EV12 3MO4A 3N35A 2YZ4A 4ATFA 1GNZA 4FTBA 3S30A 3B5LB 4XFAA 5FZ3A 2OA2A 5ABJB 2ZZJA 5G04L 4CZSA 2V4VA 3IAQA 4QHOA 4XE9A 1AR81 2JDHA 1FOD3 3WDUA 1PK6C 3MLLA 4QWNA 5C3QA 3IDEA 1IPJA 1DZQA 1AL21 4FPCA 2QDNA 2JEMA 2XL9A 4BYYA 1UZZA 5LA2A 2OKXA 2OZ6A 5IAVA 2XHNA 1W6OA 1QKQA 4QHBA 4OI1A 2RE9A 2IFWA 5LY2A 4CDQB 5ACA2 5BPXA 1RHI3 1PIV1 4JQRA 4Q26A 2V73A 3PURA 1PK6A 4RN5A 4ITCA 1V6JA 1MVQA 2W2IA 4AQ2A 3RYKA 1HB1A 1ENXA 4DXSA 2HWF3 2VY0A 4A6SA 2YB7A 4AHYA 3OUJA 4Y1XA 2GU9A 4WM8B 4IEQA 1HRV1 5K7PA 3AFKA 5IW0A 4FVVA 5C7GA 3FFQA 3EMRA 4IGQA 3PTRB 4Y1ZA 4CDXC 2HWC3 2VU9A 3WY6A 1AL22 2G9GA 4FOVA 1HRI3 1WD4A 2LM3A 3CJXA 4XIOA 5KR7A 5LK5A 3POGA 1J3RA 4NRMA 2GC3A 5JDBA 1QXRA 3AJYA 4QU1A 1LJ7A 4CDUB 1REDA 1BBT3 4LEJA 3VKOA 4XJ8A 1LOGA 4XURA 3ZKUA 4FAHA 2A75A 4ZS3A 4E4HA 3L9JT 2ORZA 4CDXA 2ZMKA 1QQP3 1F2NA 1W06A 2B7YA 1YI9A 2VC9A 3JZVA 4QX7A 4BQXA 1R081 2A70A 2DU0A 1H2KA 1XYOA 1GZTA 1HXS3 1HKDA 1LHVA 1GBGA 3IDAA 3I3EA 3A7QA 2DYCA 2DVDA 2ZACA 3A22A 5GLUA 4M4PA 4QPGC 1TE1B 2Q1ZB 2ZKLA 3ELNA 3HBZA 4LJHA 1DGRN 1E57A 4R9CA 2CAUA 4FOWA 3N9LA 4OHVA 2VMGA 5A32A 3BALA 3WQ1A 4BQ5A 2ADDA 1T6BX 2CU5A 2YBKA 3M8LA 4YVWC 3MICA 2VMFA 1VP6A 4YZ1A 1PX3A 3CHXA 3NNGA 1QGLA 2XL7A 4QB1A 4QPGA 4BMBA 4GB33 4YM1A 1R082 1RUH1 3CMGA 3MIEA 1J3PA 4GKYA 5E8AA 2PELA 1G6NA 5IATA 2WQZC 4LK7A 5EWSA 5EJ3A 2V72A 4YVWA 4CCDA 2XWJB 1VAVA 2F6BA 3BCWA 4AL9A 4XCAA 1OA4A 5FXZA 4AVVA 2VZTA 5FQ0A 3VD4A 1RUE2 4FFFA 4Q4W1 2HEWF 3I2GA 2LW8A 2PLV3 2ZGLA 4DY3A 1RUG3 3AVRA 3AKTA 4W50A 2D6MA 2ES3A 2EAKA 3BOPA 2Z79A 4AI1A 2GP3A 4L97A 5JUVA 4MG2A 4LULA 1KJRA 5FPAA 4D69A 4YZ4A 4D7TA 1UX6A 2XJQA 5DUUA 1OPOA 3U0ZA 2K9ZA 3WF1A 4GWMA 4KWKA 3WEZA 1CQ9A 4MV2A 3AMQA 5H9PA 2YBPA 4WVZA 1D4M3 1AR61 1H8VA 4HN0A 4R52A 4EN0A 3BTYA 1LR5A 1ZBE2 3O12A 2Q8EA 3HD8B 1G7YA 2I74A 1JHNA 4PBPA 4UFMA 5LBFA 2J1TA 4NROA 2X09A 4JKKA 4PQQA 3VD7A 1RUD1 2WNUB 3O1VA 2FCUA 4IEVA 4FXGB 5DXDA 2XMLA 5E16A 2ZHKA 4FO9A 5DG1A 3AZVA 3ZMNA 2WLQA 3FZ3A 3NJZA 5C8CC 2QVSB 2P5BA 4Q0PA 5K0UB 1MS0A 4J1WA 4OZOA 2R063 3SMHA 2AH2A 3WX5A 1MR5A 2VE1A 3O0VA 1DYOA 1QH7A 5LY1A 1NZIA 1XJAA 1K5JA 1H8TC 2D3SA 4N43C 1W8TA 2X53S 1PMHX 3LPFA 3JBG2 5FBZA 2VAUA 4Z07A 5C8CA 2RJKA 4QXKA 3VDDB 3TEXA 1SFYA 1RUD2 3LAGA 1COV3 5FOBB 2VUDA 4AGRA 4L99A 3SQOA 4AI0A 2DVAA 4Q4X1 1GOGA 1UY3A 2XVLA 3WOGA 3J7MA 4UWDA 1H8TA 1NA1B 2CY6A 4N43A 5K8SA 1SDWA 2RM23 4WZCA 1CAWA 1WCQA 3PUSA 1YXWA 1CX1A 4GJYA 4I3PA 4Q0QA 1XB9A 4XXPA 3ACIA 1N1TA 5JZGB 3ENRA 1UY0A 1RJ8A 4HFSA 2OUHA 2WZEA 3VBHB 2ZGPA 4BQWA 3NV3A 4IUGA 5DG2A 3UYJA 5FZ4A 5FKCA 4MGIE 5LB6A 1K3IA 2VZUA 4H2AA 1O59A 2PHTA 1FOD1 2XJPA 1HQLA 3K3NA 1YQ8A 1D7PM 1TG7A 3D82A 4A44A 5I93A 4F3JA 2PFWA 1N1VA 1YYNA 2WJSA 2D98A 1QJX2 1APNA 3KQRA 3E6CC 4XDPA 4QU2A 5I8SA 1C5IA 4P14A 1YQCA 1J58A 1SG3A 3S5AA 1UY4A 2DBNA 1LOBA 1KEXA 5L7OB 3DECA 4LLFA 2GMPA 3VBRB 3BPZA 3B7MA 1GQHA 1WUVA 1ZBA2 3DPRB 1KFUL 4HZFA 5FDBA 3O1PA 1WGPA 3WW3A 1TME1 5FYSA 4XXAA 2HWF1 2R6QA 3ZX7A 2OUJA 2LROA 5FYZA 4DXRA 1FATA 1PM4A 1PGL1 1Y9MA 1TZOA 4XHXA 5FY5A 4W6XA 3CLPA 4FFHA 2W5FA 3OF1A 1ND3C 5JI7A 2A6ZA 2YC4A 4U36A 1S0CA 3OD0A 1O8PA 1FT9A 1G9CA 2ET7A 1AYN3 2Z4FA 4AAXA 4GULA 3J26N 2ZGUA 2VOTA 3VBFC 2KM2A 4CP9A 1QJY1 4LOTA 5DAWA 1MS8A 2BOJA 2WO3A 4UYBA 2UU8A 3VBSC 1BBT1 4BA6A 1C8NA 2YXSA 1ND3A 2R7EB 5FPLA 4KU7A 1ZZ7A 3FLTA 2IVIB 5DAQA 3SCHA 1QQP1 1VBC1 1UX7A 5EQUA 3LEIA 3SH4A 4M3CB 1HXS1 4IXLA 4MGQA 3VBFA 1PGL2 2VZPA 1G9DA 4Y20B 4CEWB 4MGZE 5FMOL 4UW4A 5FP7A 1UMZA 3VBSA 2RS51 2VCMA 4NHLA 2QQPA 4EE2A 2Q8OA 2CDPA 2BFUS 4COVA 5IVVA 4IGOA 1QJY2 3TN92 4WBBA 1RUF3 1K5MB 5T50A 1ZX5A 4QGMA 2ETEA 1LRHA 5E6HA 1H0BA 4QXHA 4DEQA 4KL1A 2JDMA 3BB6A 1W2UA 4QGNA 4TXWA 1AHSA 5FZGA 1Y43B 1VBC2 3AZXA 3ZXJA 5EV7A 1XYNA 2BU9A 4LBLA 4Y26A 3NJXA 1REEA 4JDOA 1X8EA 5FZOA 5E1RA 1PX4A 5EJZB 3C2UA 4AQ6A 2ZGNA 3WP5A 4LHNA 4EROA 2V4AA 4OFGA 4QMAA 2EIDA 1E5RA 2RS52 2P6HA 1H1IA 2KA3A 2Q0AA 1FYUA 3GF6A 4O9EA 5LBCA 3J7LA 2FDKA 2WSVA 2PLV1 1RVF3 2A6VA 3ECQA 3MBWA 4R9BA 4JGZB 1RUG1 3ZXGA 2CGPA 1G8WA 2RJLA 4PI0A 2JE8A 2VW2A 4ASMB 2C6SA 1V0AA 4ZU4A 2R043 5KHIA 3LA3A 2VZ3A 1BLZA 1SMVA 2YHJA 1ND2B 3WLUA 3NRUA 2PTMA 1O5UA 5EIYB 1WLDA 3ZN6B 4C0BA 4TYSA 2QQWA 5HBAA 5FPZA 4H7LA 2R0HA 4Z1VA 4LBNA 1D4M1 1MS1A 3LKJA 3NV2A 2FDGA 2P1BA 3SC7X 2HWB3 4Z82A 3POJA 2XG3A 3LDKA 1WBFA 4A7ZA 3WW4A 1L7RA 2VZQA 4Z8BA 1AR91 1VMJA 2BGPA 4P9XA 1H1MA 4Y5SA 3ES4A 3AZYA 2WZ8A 1KXGA 1BEV3 2DTYA 3AKSA 4FP3A 4MHUA 3VUOA 2W0XA 4TLGA 3RYPA 3MHZA 4SBVA 4I02A 3ILFA 2VMIA 4OLLA 2BRTA 2OQ7A 1F4HA 3GCWA 3RYRA 5AC91 5FYHA 1ZRDA 1YIFA 3OYWA 3UGGA 1BCXA 1JBCA 2G19A 1ULDA 4CEYC 2WUHA 5JMOA 4RS5C 2VW0A 3CBNA 3MPPG 2NZ9A 4M3CE 2G1MA 1AR92 2MPFA 2X8KA 1W8NA 4LBQA 4O65A 1W6QA 2EIGA 3AKQA 5DAPA 5FY8A 1Z7S3 1ST8A 1WD3A 1XNCA 4CP0A 4LBJA 1JOPA 1KDKA 3IT8A 1A3KA 1W9WA 2RM21 4J25A 5T5PA 4CEYA 4RS5A 4PF5A 4B8EA 4DUWA 4UFHA 4QDRA 3ACGA 5ERLA 4YW5A 5AC92 2W91A 1WMXA 3RI8A 3ZOIA 4AEDB 5C70A 1B09A 4JQTA 2YGMA 4P02B 5J96B 4V2WA 2WL1A 2F17A 1O4YA 2VR4A 4JGYB 1N3QA 3D4KA 2DCZA 4BCUA 4ISQA 4O9GA 4XBQA 3WDWA 1RB8G 3AMHA 5FYMA 1IS5A 4JKMA 3VD9A 1RUC3 3MI8A 3KT1A 5BNPA 3WG1A 5F32A 1MZFA 3WG3A 3ZXEA 3N9PA 4PF1A 4HSJA 1GP4A 3IDCB 2VOXA 1WLCA 5JAXA 4E4SA 4YARA 5F2SA 2FZ2A 1QDCA 4J1XA 5KC5A 2CWMA 3VDCA 2A6YA 2WZR1 3IB3A 2J1RA 1DGLA 4M4RA 3RQ0A 4XFFA 4DEVA 1J1LA 3UK9A 3KWVA 4FTSA 4EWEA 3ILRA 2XVGA 1RYYA 4YW7A 4OHZA 4UW6A 5A6XA 5BNQA 4P5YA 4QDSA 3K4DA 1NQJA 3O14A 1W9YA 3KV6A 5FXXA 1EV13 3PMSA 3AP9A 1QWRA 2E53A 1OQDA 5FK7A 3IN9A 5FXVA 1MEC1 5T5JA 3V64A 4CDWC 1AYN1 1W05A 3AC0A 5JMCA 2VGDA 1WWYA 1SLTA 5E89A 4CP2A 1OUSA 3WHUA 4GKXA 5IK5A 3OB8A 1XE8A 3M70A 1DIWA 1FV3A 5FP3A 2D6NA 2W39A 2WZR2 4BIOA 4GZ9A 2P37A 2ARAA 1I5PA 1QH6A 4LA3A 3O1TA 1KGYA 1DYKA 4CDWA 3M1HA 2D3RA 1RUJ3 5FO7B 1IKQA 2C0ZA 4BB3A 2JIGA 2TNFA 5LA1A 4MXWA 3E5UA 1W8WA 2LALA 1H4GA 1F35A 1MZEA 1VB4A 2EALA 4HN1A 1T2XA 4XFHA 4O7XA 3PHMA 5GLWA 2E63A 2JB4A 4GWIA 1MS9A 1SFNA 4ATEA 1H9PA 4C0HA 1ENRA 2R073 4GA9A 3RSJA 1W9TA 3K77A 3AK0A 5FZ1A 5FZ0A 5A7OA 4R9AA 1O3RA 4EWDA 2C1FA 1VAKA 1K45A 3ZYHA 5K9YA 5CG8A 1XU2A 3JB4C 1FPN1 1VBD3 2WS93 4HETA 5FLHA 1SBFA 5HCBA 1I3HA 2RG4A 4YRDA 1LAJA 4QKDA 4Y33A 2D40A 4HPKA 4AEMA 5A33B 1HX6A 2OQ6A 1JHJA 2VCCA 3HJRA 1JODA 4FPGA 2A71A 2BWCA 3S7EA 3LD8A 3GGLA 3POWA 2CAVA 2P3KA 4META 1CN1A 2A6XA 3SKJE 3UGHA 3APBA 3VB9A 4IEZA 2YYOA 4IL7A 4KU8A 5KXDA 2J42A 2VVEA 1AVBA 2DUPA 2WNVC 4IEWA 1SACA 2Y6HA 4BIFA 2XVKA 1JH5A 3DV8A 3ST7A 4FPEA 4EV0A 1U0AA 1ULCA 4K20A 5F3IA 1LHUA 2Z5WA 3PTYA 1FPN2 2BOIA 1PMJX 3G7DA 2R041 4P9JA 2CDOA 5AVAA 1JOJA 1YHFA 3M3EA 4D6RA 4EN7B 3IPVA 5A6ZA 3DKQA 4S2FA 3VZMA 2WNVA 2ZHLA 1C1LA 4P08A 2QQIA 4ZS2A 1BK1A 5FPBA 2JD9A 5GM0A 3ZFFB 2JDYA 4FOYA 2HWB1 4NRQA 3BYWA 2QJVA 2ZBJA 3O7OA 1LOCA 4Y4RA 3ZXFA 3WG4A 3M7AA 1GZCA 4GALA 3RFRA 2RR13 1WMDA 2K46A 1BEV1 2XUMA 3FFZA 4Y1YA 5AVPA 1O3TA 5C4WC 1CPMA 4QXBA 2QTWB 2J1EA 3D0SA 5B2GB 1R1ZA 5FJKA 4COYA 4O61A 1OF4A 1V6NA 3ES1A 1W8ZA 3EQEA 4Q8LA 5FIXA 2E33A 4D3WA 2ZX0A 1CAXA 1TMF3 2Z2SB 3I59A 3ZYIB 4D6QA 5HPOA 4QGLA 1JU3A 1NLSA 2YPDA 3J4UH 1W04A 4LMFA 1HN0A 1RMU3 2CV6A 2VNGA 1LB2A 5C4WA 3OGJA 2A5ZA 2VOVA 3WDXA 1VBE2 2VVFA 3H8UA 1P8JA 1REFA 3JD73 3BODA 3N9QA 4OI2A 4UF0A 3DL3A 5FY4A 4BJ0A 5AFEA 1F15A 2WRAA 3LWCA 3LE0A 1KS4A 3AMMA 1LECA 4LIVA 3Q8FA 3VL9A 5HV0A 3I49A 3UJOA 2H6CA 4XZPA 3VN4A 4CCMA 3UKVA 3HWJA 4EZ4A 2P34A 5IVYA 4OULA 2KD7A 2HEVF 2VBDA 5FMCA 5A7NA 1UOGA 1XC6A 4QPIC 1WCDJ 5FY9A 1WMFA 4BK5A 1NUKA 3ETQA 4AVSA 4XMAA 4LT5A 2QQNA 1GZWB 5FMOS 3KB5A 4N9IA 1AX1A 4S2DA 1PNGA 3BTAA 1URXA 5GZEA 5BNOC 1CGPA 2PHRA 3AYEA 5F37A 3RZJA 4P9GA 2CGOA 3OPWA 1YNAA 3VD5A 1V6LA 4QKBA 1NCQC 2WWJA 3VBUB 3I2OA 4X6RB 1DYPA 2BQPA 3AYDA 2SLIA 4QPIA 3J8F3 2OW4A 2VMDA 3MLJA 1CJDA 3T0BA 1E5HA 3ZFEC 1C4RA 2BFUL 3ACFA 3RMYA 3K3OA 4FCAA 1UWWA 2Y6JA 1LNSA 1EAH3 3INAA 4XF0A 5FY0A 3VKFC 2JECA 1U5XA 3JBG3 5BNOA 1S1AA 1R64A 3LDRA 3VZKA 3CNAA 3FN9A 4B1MA 2QQOA 2VTXJ 1F8VA 2ZHMA 3KGZA 2YMZA 1POV3 1PNFA 1NCQA 1PZ8A 1H6YA 2BBVA 2VMEA 2GNMA 3R4DB 2J1SA 5DPNA 3W9AA 1TVGA 2HWE3 1HW5A 3C7OA 1QXJA 1SQ4A 2JKBA 2Y26A 3OUHA 4MH0E 5E88A 2VECA 1X82A 3VZNA 3WZ1A 2WFPA 5L9VA 5A7PA 3RZLA 1VBA3 1IG0A 4N90A 1CAUA 2C9AA 2RDQA 3O0XA 4HVOA 4Q4V2 2E7QA 5EXOA 5IK7A 4NN0A 4LORA 1UYZA 1AZDA 2B9UA 3UKNA 4CU6A 4YM0A 4YGDA 4AHXA 4ES9A 3I3MA 3ILNA 4BDVB 4Z2WA 1XE7A 3B69A 4IE0A 4LBQD 1BVVA 4MGKE 4UAPA 1C57A 1OLME 3V56A 5JSOA 2FZ1A 2BDRA 1RIRA 1ULOA 3LEMA 5HV4A 2YFZA 1WW4A 2VZVA 2WBKA 5CADA 4MHRA 5FOJB 3V0AB 4XFIA 4A6OA 1PVC2 1QJX3 1QHDA 1W3XA 1KFXL 1G9AA 1XE0A 2XHKA 4YVSB 2WN2A 2C4XA 4JHTA 4ZY9A 2AEZA 5EYXA 3N9OA 3WDTA 2R30A 4FFIA 1D2SA 4XIKA 3R05A 2VXRA 4HVQA 1OURA 1UN1A 3HPNA 1W2TA 2L9LA 4KBZA 4YGBA 3LF7A 4AVAA 3VBOC 4C1WA 4Y22B 3BU7A 4FT8A 3WT3A 4CXWA 2XGXA 3ZXKA 3KLSA 3C7EA 1H2MA 1YJLA 2Q1FA 4MYEA 4Y5Z0 3VKNA 1OOPC 2R1BA 3MYXA 3ZDVA 1B35B 2DUQA 4RR3C 1OQEA 1BK0A 2WSUA 2R071 3NNJA 2DV9A 4N9HA 3T1LA 3WNOA 4E2QA 4DS0A 4XF3A 1Z78A 4BE3A 1RGSA 4I0AA 2XJUA 1US3A 1RXFA 1Q43A 4ZU7A 2JG8B 1SDDB 3UETA 1VBD1 3U07A 2WS91 3VBOA 2EXKA 1QDOA 3I3BA 1AR82 3U14A 4K1YA 4LHLA 3KF5A 4EN8B 1JU4A 1OOPA 4KG0A 2XBO3 4RR3A 5GKAC 1U5YA 5G05L 4XACA 2FDIA 3Q8EA 2VG9A 4RFT0 1C1FA 1LESA 1SLBA 1YFXA 3JQXA 3I2JA 3ON7A 1C8M3 2YFUA 4IEXA 4RA0A 4LOSA 1F9KA 1NT0A 2VQTA 4AFDA 4KBBA 3BIWE 4SLIA 4XMIA 3O0WA 5F3GA 1PO23 5LCWL 1PIV2 3KS7A 2RDSA 1UCXA 1FMD1 4XJZA 2PA7A 4KMQA 4DOUA 3IAPA 1DGRA 1JYTA 1S0BA 3RI9A 3KVBA 5A3TA 5HCFA 1DQ0A 1V9U3 1W3VA 5FZDA 4H7MA 3W21A 5C8WA 1HRV2 4RGKA 3SCFA 3NV1A 2GMEA 3ZYBA 1HIXA 2P4EA 2WNEA 3VKMA 2ZX4A 4YZ2A 1AF9A 1PGW1 5FZCA 1OKOA 1YC61 3PL0A 3TN93 3DCQA 4E27A 1AYM1 5FMBA 2XR4A 4PHZA 3U78A 3N4MA 2Z69A 2FBEA 2FCVA 3V0BA 4QX2A 2W1UA 3T30A 2PAMA 2A1XA 5C3OA 2LRPA 3HT1A 3LIGA 1LODA 5FP9A 4EWAA 4QQ2A 1ASJ3 1UNBA 3TB0A 2RS13 1QY4A 4IV1C 4Q1RA 2RR11 5FPXA 2ZAHA 3I4IA 5T3NA 2YPJA 5FXWA 1SPPA 1ZRCA 1DLCA 4DINB 3NAPB 4IEPA 2QQVA 1UU4A 4BZ4A 3ZIWA 4YW4A 1FNYA 5SV5A 4OUMA 1LOAA 1RXGA 1UW8A 1R1A1 1VRH3 5FZBA 4JX0A 2W95A 5I0UA 3PIJA 5J98B 3AXEA 4CE8A 1X36A 1PGW2 1SEFA 4NAMA 3T3YA 3K75B 1H2LA 4IV1A 1AYM2 4G9SB 3OY8A 3U75A 3PIGA 3V65A 4QPYA 2EVXA 5FAXA 3VDAA 1W8OA 4FI9A 3JD71 1ZZBA 4FAGA 1UMHA 5KXBA 4JCKA 3TWIA 1JW6A 5C3RA 3BU0A 3I3QA 2ARCA 3AMNA 3ZYRA 4NIAA 3HBKA 4UFIA 4I0BA 1S0JA 1EYBA 1LGNA 1RUH2 1OLRA 4RHV3 4CXYA 3WNMA 3VHNA 1OHFA 2JG9B 4W6WA 4MO3M 1R1A2 4CSWA 4N53C 2XQXA 3CZJA 5BNNC 1YWKA 1JUHA 4INDA 3AP7A 4I30A 2EA7A 3DYOA 4YZ3A 4K8FA 4Q4W2 5F39A 4AHZA 3AKPA 2VUJA 3OBZA 5CA6A 5DAVA 2GALA 1W6NB 4XAEA 3UL2A 1JS9A 3DN7A 2RDRA 3KMHA 5IVBA 3UGFA 4DXZA 4JKLA 4D7SA 2DCYA 3L2YA 3MIBA 3BPSA 2DTWA 5DZFA 3KSCA 4D8MA 4QX3A 3J8F1 1W2AX 5FYBA 4XUPA 3ZR6A 4N53A 5BNNA 3NJVA 4UBGA 1VBB1 2RS33 2XLAA 5F5AA 3K2OA 2WINB 3OG2A 3VV1A 1EAH1 2DCKA 4AI3A 2I45A 5FP4A 3OGRA 1ULGA 3WG2A 3ZMOA 1SLLA 4D7YA 5JXIA 1CAVA 2JDPA 2Z42A 5BXXA 5B4NA 1AR62 1OF3A 2PYTA 3RZZA 3FWEA 4GMP3 3C3VA 2XONA 3MDPA 4B4QA 1DQ5A 2W9XA 3ZYGA 5ABJC 3GM8A 1JZ4A 4E4DX 2VZ1A 1W6PA 4ZXKA 4Q0VA 2AR6A 5EHDA 4FP2A 4WZFA 2ZABA 2V09A 3PU3A 2MEV3 1VBA1 5FO9B 1QJU1 5KBFA 2RMU3 2JB8A 1IKPA 2HLEA 5DN2A 1POV0 3H50A 1S2BA 3EO6A 3TOJA 4Q1PA 3TNPB 1VPHA 2FDJA 4L11A 1PO13 5CNAA 2PXJA 3N7MA 1VBB2 4XFGA 5D8AB 1GU3A 5ABJA 4HBNA 5C9AC 1OFSA 2VL4A 1W9SA 4RL7A 4XFCA 5CKQA 1CX4A 4PIXA 5FUPA 4M0HA 1OLQA 4CDQC 4NO4A 4DFSA 5JCTA 2R0FA 3AYAA 3K48A 4NPLA 1LHWA 2O8QA 4OMDA 5CIRA 4AQSA 3N3HA 4MGTA 2D3PA 4PCRA 4RGGA 3MW4A 1ZM1A 4LE3A 4B7KA 4WM8C 2QFEA 3P6BA 4Q4X2 4LUMA 1CESA 4JZRA 4MXVA 5C9AA 1QJU2 4COZA 2DF7A 2JDZA 2CL2A 4IE7A 4CDQA 4BXSV 3SLIA 4GH4B 5CFCB 5FZLA 3ABZA 1ZA7A 2E7AA 2QQMA 2GC2A 4AK3A 4AWDA 2D5HA 1G86A 1RL3A 1XNKA 1RHI1 5FMDA 1AJOA 2BEOA 2Q4SA 3A23A 2BVVA 2VBPA 3GBFA 4KG8A 4WM8A 3ZR5A 3KZ4C 4CDUC 4CCLA 2Q30A 4QXCA 1VRBA 4BK4A 3P1IA 4XPVA 3TAYA 4IESA 4COUA 4HG6B 3NO8A 4HK8A 3I2DA 2Y0OA 3T2QA 2G4IA 4MSVA 4ONUA 1Q56A 1FOD2 1G9FA 3W5MA 1JZ3A 4IV3B 2XBO1 2A3XA 2HWC1 4A3ZA 2HBUA 2W08A 1IS3A 4XJAA 2VCAA 1AXZA 1LEMA 5BNPB 3BI3A 1HRI1 4CDUA 4BQ3A 1C8M1 1RJ7A 5CG9A 2QKDA 2R1DA 2DVGA 3GNEA 2D6KA 1R093 2I2SA 3I97A 4KQ7A 4NWWA 4OI0A 4PLMA 1HJFA 4V1PA 1HB3A 1PO21 1RHI2 3LIHA 5IWFA 1XOYA 1W6MB 4Q4Y3 3GCXA 1TME2 2Y6KA 4PDWB 2HWF2 3AP5A 1W0NA 1V00A 2F4PA 3I7DA 1XBFA 1W9FA 3BVCA 4FPKA 4UT5A 5DDJ3 4BMEA 1VE0A 4BLJA 3ACLA 1LU2A 2ZPXA 2CSGA 5F8PA 2WABA 4QKNA 2OT7A 2X5IB 4B4RA 1SHWB 3MFAA 4HT1T 1HN1A 5K4LA 4UFJA 2HWC2 5C71A 3H0OA 1RUI3 2IXJA 2Y6FA 5A1FA 4LTAA 2NP0A 2D6PA 3KD4A 2NQYA 1HRI2 5CU1A 4XW3A 3FHAA 2ZEZA 4F83A 4K40A 2VNOA 3HQRA 2XWBB 1BKZA 3HVDA 3CIHA 1ASJ1 5D21A 1BBT2 1XRUA 3Q9OA 5FZIA 3PLQA 4JDMA 4I0WB 3N7LA 2ARBA 1QQP2 4GB31 1N1SA 5D1IA 4YZ5A 3USUB 1GFF2 3LEKA 5IYYA 5JOXA 3OBAA 4QX8A 2UURA 1W28A 4MADA 5JR7B 1HXS2 3ZDSA 3H3ZA 3VHRA 1NCRB 2NLRA 3POFA 4XQ4A 5FZ6A 4E4ZA 2FMYA 3J9SA 3JQWA 5KHHA 4JV4A 2UYAA 3LFMA
chains in the Genus database with same CATH topology
4YW7A 2C24A 4CP9A 4LKDA 4A6SA 4BQ3A 1W8UA 2VXJA 1WCUA 2KR2A 4BQ4A 1W8WA 1HN0A 3ORJA 1L7LA 2O14A 4LK7A 3ZYBA 1W8TA 1GWLA 5D21A 1V0AA 1GWMA 1W90A 4CPBD 2WYFA 4AL9A 3F95A 1OKOA 2LROA 4LJHA 2K46A 4LK6A 1W9FA 1WMXA 4LKFA 3ZYHA 4LKEA 1GWKA 4YWAA 1UOJA 2JWPA 3UT0A 4BQ5A 4CPBA 2Q1FA 4YW6A 2LRPA 4CP9B 1WZXA 1W8ZA 4BQ2A 1OH3A 3ZYFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YW7 A;  2C24 A;  4CP9 A;  4LKD A;  4A6S A;  4BQ3 A;  1W8U A;  2VXJ A;  1WCU A;  2KR2 A;  4BQ4 A;  1W8W A;  1HN0 A;  3ORJ A;  1L7L A;  2O14 A;  4LK7 A;  3ZYB A;  1W8T A;  1GWL A;  5D21 A;  1V0A A;  1GWM A;  1W90 A;  4CPB D;  2WYF A;  4AL9 A;  3F95 A;  1OKO A;  2LRO A;  4LJH A;  2K46 A;  4LK6 A;  1W9F A;  1WMX A;  4LKF A;  3ZYH A;  4LKE A;  1GWK A;  4YWA A;  1UOJ A;  2JWP A;  3UT0 A;  4BQ5 A;  4CPB A;  2Q1F A;  4YW6 A;  2LRP A;  4CP9 B;  1WZX A;  1W8Z A;  4BQ2 A;  1OH3 A;  3ZYF A; 
#chains in the Genus database with same CATH topology
 2YC2 A;  3O1S A;  1LU1 A;  3B9I A;  4DIQ A;  3VDB A;  4M0N A;  5GZD A;  3CJI B;  3C7F A;  3QD6 A;  2WNU C;  2ZKN A;  5ANQ A;  1MQT B;  1LGC A;  1L7L A;  2VUA A;  1CIY A;  1CR7 A;  4H55 A;  2W1S A;  2TBV A;  2CYF A;  3WP4 A;  3NST A;  1SCR A;  4Q8K A;  2W47 A;  1CON A;  5H9Q A;  5A3P A;  4M01 A;  1QJF A;  3T09 A;  1VLN A;  5JVV A;  2JJ6 A;  4GB3 2;  1NYW A;  5K0U C;  1ULE A;  4RHV 1;  2WII B;  1AUY A;  1STM A;  2V5Y A;  1V6O A;  4R8H A;  2GND A;  3WQ0 A;  2JE9 A;  4JRL A;  2WNU A;  1KIT A;  1JZ5 A;  3MGU A;  4DY5 A;  4UW5 A;  3ZPO A;  2VZS A;  2FCT A;  5DUV A;  1BJQ A;  2ADE A;  4K8R B;  4NMI A;  2B46 X;  2GMM A;  4CRQ A;  3KT4 A;  1IS6 A;  5A3O A;  3KCC A;  1F31 A;  1AR7 3;  2D43 A;  3MW2 A;  5K0U A;  2PLV 2;  3VDD C;  2Y64 A;  3LCP A;  4D0Q A;  1RUG 2;  3DEM A;  3ZYP A;  3KCX A;  3RPQ A;  5IFT A;  2J22 A;  4AFA A;  4XYX A;  2R06 1;  2B39 A;  2WO7 A;  2VOW A;  2XKO A;  5SV8 A;  3AP6 A;  4NR1 A;  2NPI A;  4XCB A;  4QDQ A;  2WA4 A;  4WM7 B;  5CVR A;  1YFU A;  5JR2 A;  4RQP B;  1MVE A;  2UWC A;  1N3P A;  3VDD A;  5JZG C;  1VBE 3;  4KI5 M;  1D4M 2;  1PZ7 A;  4NID A;  3CL1 A;  2WC2 A;  1NLR A;  1UAI A;  3S0M A;  1U5I A;  4WVV A;  3VBH C;  4CCO A;  5FYY A;  2E26 A;  3LQC A;  4IEO A;  2JDN A;  1COV 1;  1FXZ A;  4Y4Y A;  5DUW A;  4AVB A;  2YU1 A;  1I9R A;  3DKW A;  3D3A A;  5JPM B;  2MEV 1;  4HKO A;  5DAX A;  1RIN A;  3AL6 A;  3VGI A;  1JZ6 A;  5JZG A;  3KV5 A;  3B93 A;  4OVE A;  3LOI A;  5LAT A;  4GMP 0;  1OD3 A;  3J7H A;  5FWJ A;  1UF2 C;  3VBH A;  3LA7 A;  5A7W B;  3QAC A;  4BM8 A;  5L7O C;  2Y0I A;  4NVP A;  4OCT A;  4CTE A;  3T0D A;  3VBR C;  4WVM B;  3HEI A;  1LED A;  3P5B A;  2WT0 A;  2PHW A;  3DPR C;  4IER A;  1UZW A;  4FOQ A;  4XF9 A;  4CUA A;  2VMC A;  2GZW A;  4XIL A;  5C4W B;  2B42 B;  4Y24 A;  1JOB A;  2VW1 A;  2W46 A;  3OGS A;  5BY5 A;  4Q2F A;  5JOZ A;  3SKV A;  1COV 2;  1U12 A;  5L7O A;  1CZV A;  1OKQ A;  4ZZ8 A;  3VBR A;  5CBL A;  5IHR A;  1OVP A;  3J7N A;  3PME A;  2WFF 3;  2RM2 2;  4BQ1 A;  4XF1 A;  1WA6 X;  2AAC A;  1DU3 D;  3DPR A;  1TEI A;  2WA3 A;  2D44 A;  3ALQ A;  3QLQ A;  2HWD 3;  4QX1 A;  3T4H B;  3THT A;  3THC A;  4ARY A;  1SLI A;  4QB2 A;  2PHL A;  3EHK A;  3S7I A;  2WLP A;  3QBQ A;  3QH6 A;  1DFQ A;  3VLB B;  4LO7 A;  2XJS A;  3I2K A;  2IXL A;  1O3S A;  3TNQ A;  3O1M A;  1W99 A;  1VMF A;  4B1L A;  1HB4 A;  1OMI A;  2XQR A;  5FPV A;  5DMY A;  4YGE A;  5T54 A;  3GXU A;  1OI6 A;  1DGW X;  2VPV A;  3VKL A;  1UOF A;  4CEW C;  1UZV A;  4UXA A;  4YG6 A;  3BOW A;  1Z0H A;  2GH2 A;  1CWP A;  2ZGQ A;  2B5H A;  4XOG A;  2FDF A;  3I2F A;  1UYP A;  5JOW A;  4HK9 A;  3VZO A;  4AI2 A;  4E8C A;  4ZZ5 A;  5BNO B;  3RZM A;  4OZX A;  3RG0 A;  5JXH A;  2PHX A;  1RIT A;  3TEZ A;  2BZD A;  2RJ2 A;  5F2W A;  2W3J A;  1M06 G;  1ZZC A;  4N8M A;  1JN2 P;  1K5M C;  4M3C A;  5IVJ A;  2P2K A;  4AW7 A;  1K12 A;  1F5F A;  2VMH A;  2DDU A;  1F4A A;  4Q4Y 1;  4Y20 A;  4CEW A;  3GBW A;  4LO6 B;  2QZ2 A;  4XEZ A;  3W59 A;  3SH3 A;  5IT6 A;  1JTZ X;  5DDJ 1;  1NXM A;  1XXN A;  3OUI A;  4YNI A;  5T55 A;  4FPY A;  4BHP A;  3HMY A;  1WME A;  5CFD C;  2EAA A;  4FQZ A;  3SEP A;  5JI9 A;  5ACA 3;  2BYV E;  4AZZ A;  4BXF A;  2E51 A;  3PVO A;  1MEC 2;  2W68 A;  1AYN 2;  1RUI 1;  1UKR A;  1K5M A;  4OHW A;  4CPB D;  1GNY A;  2BW8 A;  3KQ4 B;  3POB A;  4OUE A;  1VAM A;  5LA9 A;  4XQD A;  3WV6 A;  1RUF 1;  1ENQ A;  1AR8 3;  4NE9 A;  4LIU A;  3GHN A;  1HV1 A;  3NMB A;  3T08 A;  5FYT A;  2VBB A;  5CFD A;  3FX3 A;  1QNW A;  1UZY A;  5FUN A;  3FC0 A;  3RZG A;  4JGZ C;  3LSD A;  3ASI A;  1YQ2 A;  3A0N A;  1NAE A;  1AL2 3;  4ZPI A;  5DUX A;  4FBF A;  2VXJ A;  3WNL A;  4D94 A;  1ND2 C;  1GQG A;  2J7M A;  5J36 A;  4NII A;  5B4X A;  3NJY A;  3O1U A;  4LR4 A;  1EPW A;  1US2 A;  3H7Y A;  2ZGT A;  4IGP A;  3RWN A;  1GWL A;  1O5L A;  1UYX A;  2B8M A;  4JHZ A;  5FYV A;  2E7T A;  3WW1 A;  1PM7 A;  5GZC A;  1K42 A;  4JGZ A;  1W6O B;  4GAZ A;  1Q8S A;  2GP5 A;  2YGL A;  2WNO A;  3BN6 A;  4U2A A;  3NKG A;  4ZU5 A;  3S57 A;  2WZP P;  1HLC A;  5LK7 B;  5EP9 A;  5C3S A;  5C6C A;  3H8X A;  5CIS A;  1RVF 1;  4AEK A;  1PK6 B;  1GWK A;  1RUF 2;  1IGO A;  1YRZ A;  4EN6 B;  1ND2 A;  4DQA A;  4GJZ A;  3LEG A;  1I6X A;  5BYN A;  3ZN6 A;  4P9L A;  2XJT A;  1IPK A;  3AYC A;  2JKX A;  3MEP A;  1S0D A;  1DQ6 A;  2VTX A;  4WV8 A;  2ZGM A;  5FZF A;  4GD4 A;  2GC0 A;  1LHN A;  1F5J A;  3N7J A;  5CKM A;  4I3G A;  4QT6 A;  4BU2 A;  3WIN E;  3TBD A;  3MFC A;  4XUO A;  2P3I A;  3GZE A;  5JOY A;  1OSG A;  2D6L X;  2XKP A;  4MUV A;  1YEW A;  3R6S A;  3U11 A;  4AFM A;  4B29 A;  4YFZ A;  3N7K A;  3C8X A;  2JD4 A;  4HSL A;  1IPS A;  3UJQ A;  1PZ9 A;  2R49 A;  4QM9 A;  2K2S A;  2GNB A;  4JRA A;  3H42 B;  3QH7 A;  2EIB A;  1R08 3;  1QNY A;  4XZU G;  1AR7 1;  3PDQ A;  5FTT C;  5CB7 A;  3ZFG C;  1H4H A;  1QIQ A;  3HQU A;  2DCJ A;  4CDX B;  1J59 A;  3ZXD A;  2XB6 C;  1EPZ A;  1A8M A;  2NM1 A;  3RS6 A;  4B4P A;  3W58 A;  2ZCW A;  2R04 2;  3B94 A;  4AVT A;  3URF A;  2EXI A;  1H1A A;  2Y38 A;  1D4V B;  3I8T A;  3ZIX A;  3ZYF A;  1IG3 A;  3MW3 A;  5LZ6 A;  1RUE 3;  4DPN A;  2A3W A;  5CKN A;  2ZGR A;  3KCY A;  2ZXQ A;  1MS4 A;  5J7M A;  1KRI A;  5EYY A;  1MS3 A;  5H9R A;  1NOV A;  3ZFG A;  3AX4 A;  4S2G A;  2HWB 2;  3I2H A;  4AED C;  5EJ1 B;  1POQ A;  5A32 B;  4OMC A;  3O5S A;  2JDU A;  3C7H A;  4EYU A;  2GNT A;  1O4Z A;  1HQW A;  2IFR A;  3H1W A;  1PHM A;  2X05 A;  1LEN A;  3GDB A;  3NL1 A;  4JGY C;  3NVC A;  4GWN A;  1JYI A;  3FL7 A;  4OHX A;  4LKE A;  3AKR A;  1BEV 2;  1SBE A;  1Y9Q A;  1FNZ A;  1Z7S 1;  2IWG B;  3ROU A;  1O4T A;  1W2N A;  4QPG B;  4TN7 A;  4ARX A;  1WZX A;  3OPT A;  4XDQ A;  1ZRF A;  2B9V A;  1AX0 A;  2DBI A;  1ZBE 3;  3AXD A;  5F3C A;  5C5T A;  1NE6 A;  5C33 A;  4AED A;  3HNB M;  1BQP A;  2YG0 A;  1I5Z A;  4B7E A;  3R4U A;  5DQ0 A;  4Q4W 3;  3M3I A;  4YVW B;  4YSF A;  1S0I A;  4JGY A;  2BNN A;  1JYN A;  1ULF A;  5FQ0 B;  1IQD C;  2ZML A;  4CUC A;  4LO4 B;  3POE A;  3OGV A;  2FDH A;  2W94 A;  2GH8 A;  4IE5 A;  4A7K A;  3OBR A;  2QBX A;  3AMP A;  5A3M A;  5FUI A;  3AJZ A;  4URA A;  2NMO A;  4I01 A;  3Q8B A;  4BLI A;  5FR3 A;  4CCK A;  1EUU A;  1OA3 A;  1Z7S 2;  1ODM A;  1RUC 1;  3M3C A;  3HQX A;  4BQY A;  4A41 A;  5JWP A;  2RHP A;  2Y6G A;  4NHX A;  3ME2 A;  3VD3 A;  3IDB B;  4Q27 A;  3MZH A;  1JYW A;  3NQH A;  2PMW B;  3FBY A;  4QQP A;  2HWD 1;  1RUD 3;  1LOF C;  3DXT A;  4MGY E;  4P5H A;  3RWK X;  3N36 A;  3USS A;  3A0K A;  4KNC A;  2ATF A;  2QUO A;  3GZA A;  2WR9 A;  5F7U A;  2PHD A;  4FFG A;  1EY2 A;  5FYU A;  5IJR A;  4ZHN A;  5KHG A;  3HIF A;  3GZT B;  5FRA A;  2O8O A;  1HV0 A;  3PUA A;  4HAN A;  3U37 A;  1VR3 A;  3FHI B;  1EV1 1;  4RYD A;  3EYP A;  1RUC 2;  3TRS B;  3AB0 A;  3ATG A;  4BH9 A;  1A78 A;  2A7A A;  1HQN A;  1OBN A;  1Y7B A;  1U5Z A;  2K0G A;  4E8D A;  4AFB A;  3WQ7 A;  4GXL A;  1SCS A;  1GAN A;  2VQA A;  3GBG A;  1MAC A;  3WNX A;  4FQ4 A;  1XSR A;  3UV9 A;  5C8C B;  1WCS A;  1WW7 A;  3DUI A;  5HCA A;  2VQU A;  2CHH A;  2W92 A;  1RUJ 1;  3I3D A;  3H8R A;  2RV9 A;  1KD7 A;  4WVW A;  2PHU A;  5IVC A;  3KV9 A;  4HOO A;  4UFL A;  1H8T B;  4N43 B;  1E5I A;  1XNA A;  1ZBA 3;  2D5F A;  1CAW B;  1OT5 A;  1Q8O A;  3M3O A;  2Y60 A;  4YW6 A;  5CZK A;  5FZM A;  4AEJ A;  1QOO A;  2WWU A;  4ZKT B;  1Q8P A;  5CYY A;  1W8H A;  2NYY A;  2PAK A;  4YM3 A;  3CDZ B;  3LPG A;  4LKD A;  1LCL A;  1UY1 A;  3PJY A;  5L9B A;  4BQ4 A;  2HYX A;  1Q8V A;  2JX9 A;  3PVN A;  1RUN A;  5A33 A;  2GSY A;  4QKF A;  2J1V A;  4OYU A;  3ACH A;  2PHF A;  4CP1 A;  2VQ0 A;  1KJL A;  4CU9 A;  1GWM A;  1RUJ 2;  1DGW A;  2VVD A;  4HXC A;  3FJS A;  4HKL A;  2AGS A;  2YC0 A;  1XSQ A;  2NN8 A;  3ZSL A;  2D93 A;  5C9A B;  1GNH A;  2BJS A;  1NZC A;  2RDN A;  5JIU A;  2BVB A;  2Y8K A;  1OFN A;  2XJR A;  3CO2 A;  4HVR A;  3DYM A;  3ZFF C;  4UOJ A;  3ITQ A;  4XAA A;  1YUD A;  1TME 3;  3DF0 A;  1LTE A;  4XFB A;  2R07 2;  1WLT A;  3P3P A;  4LUK A;  1W8U A;  5EPA A;  4MZU A;  5FFO C;  4TWT A;  5FJH A;  1ZVF A;  4L8Q A;  5F6K A;  3H3L A;  5LRR A;  1QXP A;  1QJZ A;  2VNR A;  3CF6 E;  3NNF A;  1VBD 2;  2WS9 2;  3WCS A;  3UKT A;  1ONA A;  2YU2 A;  3MIH A;  1WA4 A;  5A7Q A;  3HNM A;  2Y6L A;  4LPL A;  3S5Q A;  1OVS A;  3OPZ A;  4Q0S A;  1JYC A;  3ZFF A;  3WF4 A;  4QAW A;  2EXJ A;  4BOW A;  1QJY 3;  1UIK A;  5A7S A;  3ZSM A;  3LOB A;  1X50 A;  3LDB A;  1X9T A;  4IE4 A;  4EN9 B;  2WT1 A;  1IZ3 A;  1OLM A;  3OD4 A;  4CP9 B;  3OBT A;  3WP3 A;  5FCC A;  3WXP A;  1JZ7 A;  1ZNP A;  5APA A;  1DHK B;  1VJ2 A;  3RMX A;  1D2Q A;  1GV9 A;  1OPM A;  1UKG A;  3ZN4 A;  5LRS A;  1ZRR A;  4YM2 A;  5FRE A;  3IBM A;  4Q0U A;  1VBC 3;  2IC1 A;  4CU8 A;  3KVA A;  1GSL A;  2O1Q A;  1M4W A;  1FMD 2;  1ND3 B;  2IXI A;  3PUH A;  1OA2 A;  1DQ4 A;  3I2I A;  4LBK A;  2DUR A;  2WAO A;  5I91 A;  2G9F A;  3RNS A;  3B01 A;  2R32 A;  3MF6 A;  3WF3 A;  4DXT A;  5A6Y A;  3VBF B;  2RS5 3;  5IK4 A;  2W1W A;  2JE7 A;  1BYH A;  4P9I A;  1RUE 1;  3WR0 A;  1TMF 1;  4TSV A;  4C1X A;  1EP0 A;  5F6L B;  2W52 A;  3WDV A;  3T2O A;  2H6B A;  4LBO A;  4LKF A;  4K3U A;  1X33 A;  3VBS B;  2BP6 A;  4GIQ A;  1ALY A;  1FV2 A;  1RMU 1;  1D0H A;  2OVU A;  3E6B A;  3FE5 A;  5J48 A;  5I8T A;  1OH3 A;  1XU1 A;  4KWL A;  1JZ2 A;  2P3Y A;  4Y1U A;  4FPJ A;  4CCE A;  3WUD A;  4HKW A;  5C3P A;  2RR1 2;  4XJU A;  1WW6 A;  2BTV C;  1L3J A;  1WCU A;  1YLL A;  2UWA A;  1DLL A;  3VBU C;  3WVJ A;  2BBA A;  3JU9 A;  2W1Q A;  2DU1 A;  2D97 A;  2PAE A;  3CEW A;  2QNK A;  1ZBE 1;  1GZW A;  5FZO B;  4ZXE A;  2ZX3 A;  2TUN A;  3BTX A;  2MHF A;  1TMF 2;  3CKH A;  4XQW A;  5FK8 A;  1ENS A;  3ZXA C;  2A6W A;  2QDR A;  5L73 A;  1V6K A;  4NHK A;  4NWV A;  1FAY A;  3U10 A;  1RMU 2;  2BNO A;  3VBU A;  3K4Z A;  3AL5 A;  1OQ1 A;  2AUY A;  4P00 B;  3K46 A;  3JUU A;  3ZYJ B;  1LKN A;  4YFW A;  5FY1 A;  3JD7 2;  5BV6 A;  3MF9 A;  3M3Q A;  4ET7 A;  4UFK A;  4HON A;  3OEA A;  1O6U A;  5FZ7 A;  5L19 A;  4EZH A;  4A3X A;  4JAA A;  1QOT A;  4AI8 A;  1X7N A;  3JBG 1;  4LKS A;  1T6G C;  1ZRI A;  1FI2 A;  2DFB A;  4X6Q B;  3F95 A;  1AR9 3;  1X8M A;  5FWE A;  1POV 1;  5JXJ A;  3POI A;  2N7G A;  1S2K A;  3PUI A;  2JIJ A;  5F9T A;  3M4F A;  4QD2 A;  1BHG A;  1DG6 A;  3M2M A;  3QOP A;  3JXS A;  2HWE 1;  4TTG A;  1EUT A;  5FZH A;  2RVA A;  3PU8 A;  4AG4 A;  2R16 A;  2HEY F;  1WCK A;  4AHW A;  1UYY A;  4QX5 A;  4YVS C;  4C90 A;  5FZK A;  4BWO A;  5AC9 3;  4AE2 A;  1S4C A;  3HNY M;  2IUW A;  3J8F 2;  1W2O A;  4D6S A;  4OHY A;  2WAA A;  1W0P A;  2B45 X;  1CZS A;  2H0V A;  1OC1 A;  3AP4 A;  5T5O A;  4TLF A;  3T4V A;  1HJG A;  3BIE A;  2BPA 2;  4I2O A;  1EAH 2;  2WT2 A;  4QX0 A;  3V0A A;  3OYW B;  4B3N A;  4FPF A;  1B35 C;  3EJK A;  3SEE A;  4NUB A;  2DCT A;  5EZW A;  4QQL A;  1QJE A;  3FBM A;  4H3W A;  4YVS A;  1AJK A;  2OYZ A;  4A7Y A;  3UT0 A;  4A2U A;  1Y3T A;  2ZGK A;  3L2H A;  1QJX 1;  4CPB A;  2JG8 C;  2ZX2 A;  2HWE 2;  2KXL A;  3QCW A;  4FXK B;  3U4S A;  4Z92 B;  1ZZ9 A;  1WKY A;  1UU5 A;  3MV1 1;  4LBQ B;  4Y22 A;  3TYJ A;  1W6Q B;  5JSP A;  3LZZ A;  1VBA 2;  3PUQ A;  4LBM A;  3NWK A;  4L92 A;  4XJ9 A;  1B35 A;  1XNB A;  1RUO A;  4CEY B;  2WQ8 A;  1LOE A;  1ZBA 1;  2KR2 A;  4PBO A;  4RS5 B;  4MX3 A;  4RSU A;  2BGC A;  3CU7 A;  3MUY 1;  1JUI A;  4GQ7 A;  1MPX A;  1NX9 A;  5I8Y A;  2JG8 A;  4CVU A;  4DMI A;  1GOH A;  4YG0 A;  1VMH A;  3MID A;  4XUN A;  1YQ6 A;  2ENR A;  2SBA A;  2E32 A;  4XHB A;  5F3E A;  2JDA A;  4G4F A;  3H1Y A;  1DP0 A;  3Q8C A;  1DBN A;  2XH6 A;  1X9P A;  5KHJ A;  1ZZ6 A;  3MV0 1;  4W65 A;  2DUO A;  2ZGO A;  1UU6 A;  3DGT A;  3GAL A;  1XND A;  3IM0 A;  1E5S A;  1HB2 A;  2IXH A;  2X29 A;  1C5H A;  3BKZ A;  5FZE A;  4UW3 A;  5A3W A;  4QHZ A;  3D6E A;  3CQO A;  2C24 A;  4QQH A;  3FLP A;  4CYD A;  3E6D A;  4JVA A;  2GAU A;  4JC1 A;  4DRR A;  1UPS A;  2WZR 3;  2XLG A;  4V2V A;  1JXN A;  4K6B A;  4IQP A;  3KT7 A;  3ZSK A;  2VZO A;  2ZOE B;  3E1F 1;  2GN7 A;  1JYV A;  4TZD A;  1IHM A;  1VB2 A;  4H14 A;  4C91 A;  1BXH A;  4P9W A;  1CVN A;  4AXO A;  2ZGS A;  1VAL A;  3NKT A;  3HT2 A;  4MOA A;  1V9U 1;  4YWA A;  4DRV A;  2V5D A;  2UWB A;  4Q29 A;  2ERF A;  3PVB B;  4Q5O A;  4EQV A;  2VOK A;  1MEC 3;  1V6I A;  5L9R A;  3NAP C;  4DNY A;  4DO0 A;  5A3L A;  1H30 A;  2GN3 A;  2WWS A;  1CJP A;  1OD5 A;  3D8C A;  5EFU A;  2XBO 2;  2Q5T A;  1GQP A;  4LLO A;  3TN9 1;  4IET A;  3X29 B;  2MNG A;  5FP8 A;  1MZ5 A;  3T1M A;  3LGR A;  3ETP A;  1C8M 2;  1GKB A;  4OQ8 A;  3CZU A;  3OGG A;  2QE3 A;  4OI4 A;  3OCP A;  1UIJ A;  3PJQ A;  3RDI A;  5IUQ A;  3LB9 A;  3GZU C;  4CCC A;  3IZO A;  3JCI A;  5F5C A;  5F5I A;  1PO2 2;  3NAP A;  4FPO B;  2RS1 1;  2ZS6 B;  3WCR A;  4ASL A;  3T0A A;  2QQU A;  4CA9 A;  2VH9 A;  1GOF A;  1IQA A;  2AZ5 A;  3AZZ A;  4CDW B;  3WUC A;  1UOJ A;  2CTV A;  4PIY A;  1V9U 2;  1D0G A;  2WQ4 A;  2J1U A;  5GLV A;  5KWR A;  4QPW A;  3ZO0 B;  2NMN A;  2CGN A;  4MXW B;  4CU7 A;  2XPJ A;  1VRH 1;  1S0E A;  2E6V A;  2PQQ A;  2ZTN A;  1SZB A;  3SNM A;  5FLI A;  5HXM A;  5LEK A;  2JG9 C;  1QF3 A;  4LHS A;  1UL9 A;  2VTF A;  1XPW A;  5FZ9 A;  4XC9 A;  5J3U A;  1GZ9 A;  3FMG A;  3FUQ A;  1GUI A;  4DZG A;  4A4A A;  4YLZ A;  1FPN 3;  4IDZ A;  4YGC A;  2ZAA A;  4ISR A;  4YG3 A;  5LEJ A;  5A1A A;  1DZT A;  1N1Y A;  1ASJ 2;  5I0D A;  2OS2 A;  4AR2 A;  5CFD B;  1GR3 A;  2RS1 2;  4MGS A;  3ZM8 A;  3ZXL A;  2WKK A;  1NKG A;  1AXK A;  2WN3 A;  2W87 A;  2JG9 A;  4MVT A;  1OH4 A;  2Q1M A;  1NQD A;  3AM2 A;  1O91 A;  4HPK B;  3EBR A;  1VIW B;  3LFI A;  1C28 A;  3OTF A;  5M0T A;  3RVH A;  3H3U A;  5FY7 A;  1LUL A;  3E5X A;  2YY1 A;  4CCJ A;  3TEW A;  3TEY A;  5HXV A;  4UBH A;  1VRH 2;  2UY9 A;  5IVE A;  1YCI A;  4IE6 A;  1W6N A;  4KH9 A;  2C9K A;  3E5Q A;  3O1R A;  1W0O A;  4YW2 A;  2J1A A;  1DCS A;  2ZZQ A;  1BVP 1;  3WW2 A;  5IAX A;  2ZEW A;  1UXX X;  4N7I A;  1H9W A;  1O7F A;  4W8J A;  2EIC A;  3ZSE A;  2HH9 A;  5JIA A;  1OXC A;  4XF4 A;  3FHQ A;  4ZON A;  1NLQ A;  4W4Z A;  1GP5 A;  1ODN A;  4CXX A;  3AVS A;  1NA1 C;  3O1O A;  5LA0 A;  1NY7 1;  1J3Q A;  1Q8Q A;  2DWR A;  2IZW A;  5AFB A;  4FSJ A;  3B3Q E;  3ZSJ A;  2RS3 1;  2YUE A;  3H9A A;  3IPV B;  5FBJ A;  1N3O A;  4RHV 2;  4A45 A;  2WNV B;  5FYI A;  3UNP A;  5D8A C;  1J83 A;  2F4L A;  3I54 A;  5DZG A;  4LO5 B;  5LBB A;  2QQL A;  2ZEY A;  3R4S A;  3HR9 A;  4GMP 1;  1DQ1 A;  3VZL A;  3KV4 A;  1O3Q A;  2YV8 A;  4FTE A;  3RRD A;  3A4U A;  2VNV A;  1CIW A;  3AFG A;  1NA1 A;  4RFR B;  2BGO A;  2VUL A;  3B02 A;  4BPZ A;  2C5D A;  1WLW A;  4E9K A;  3SIS A;  3SCG A;  2QQJ A;  4BIS A;  1Q3E A;  4LO8 A;  3W20 A;  4NRP A;  3NW4 A;  2RMU 1;  5D8A A;  1ULP A;  1Q5O A;  1YFY A;  1YQ5 A;  3GHM A;  3WHT A;  4A42 A;  3RJ2 X;  5HI0 A;  4NIH A;  4ES8 A;  2YDE A;  2R06 2;  1NY7 2;  1PO1 1;  3ZKY A;  1DDL A;  4YPJ A;  1CPN A;  4JTO A;  2RS3 2;  5IFP A;  3I59 B;  1CAX B;  4DUX A;  2ARE A;  4GH4 C;  5J37 A;  5CFC C;  4BQ2 A;  2C26 A;  1HDK A;  1UO9 A;  1CZT A;  3SIT A;  1WBL A;  2EF6 A;  3ZFG B;  3KHB A;  4OUS A;  5DZE A;  5IK8 A;  1BMV 1;  1ZA4 A;  1TNR A;  4N7U A;  5T52 A;  2BV4 A;  5CEH A;  4UF0 B;  2WYS A;  4E2S A;  5JPN B;  4URT A;  5KC6 A;  3NV4 A;  1A8D A;  2FQP A;  4XVH A;  4E2G A;  4NIG A;  4GH4 A;  5FZ8 A;  2MEV 2;  5LBE A;  3U1X A;  5CFC A;  3POY A;  2RMU 2;  1L7Q A;  4AGG A;  1W8F A;  4IV3 C;  3WDY A;  4Y3O A;  2VUC A;  4DB5 A;  2XJV A;  1SLC A;  5A3U A;  5BNP C;  1PO1 2;  4M3C F;  1PMI A;  2IVJ A;  5D2A A;  3KF3 A;  5DAB A;  4IEY A;  3K4A A;  3WF0 A;  1TQ5 A;  4Y5T A;  3BTZ A;  4L2N A;  3UES A;  5LAS A;  4JDN A;  1YFW A;  3VHO A;  4LIT A;  4PI2 A;  3EB7 A;  2ORX A;  4Q4V 3;  3GJA A;  3RZH A;  2AC1 A;  3HN1 A;  4IV3 A;  5LW9 A;  1BMV 2;  4PDW C;  2EXH A;  4AQT A;  3A21 A;  5A3N A;  4QPI B;  1IS4 A;  2FMD A;  3D5O A;  1W39 A;  2IXK A;  2X5I C;  4XET A;  5IVF A;  4X8N A;  1UZ0 A;  2FHR A;  2BER A;  1UMI A;  4K21 A;  1V6M A;  4AYU A;  4XTP A;  2ET1 A;  1PVC 3;  1W6M A;  1R09 1;  4PDW A;  4R9D A;  4HMZ A;  1NCQ B;  1W03 A;  5GZF A;  3THP A;  2H0B A;  2XOM A;  3DXU A;  2JIC A;  3EXU A;  5LWB A;  5JXG A;  2LTN A;  2OXB A;  2FD8 A;  2XXZ A;  2X5I A;  3ZFE B;  2PQS A;  3T2T A;  5KHK A;  2ZA9 A;  3R0R A;  1O8S A;  2Y34 A;  3C7G A;  3P3N A;  4EJR A;  3ORJ A;  2OPW A;  2Y33 A;  2OZJ A;  5J09 A;  3H8O A;  1G9B A;  1CAU B;  2OII A;  1QOS A;  5F5Q A;  1UD1 A;  1NCR C;  4I09 A;  4NHM A;  4MLO A;  2YBS A;  3T2P A;  1H2N A;  1NG0 A;  1UPI A;  2QCS B;  3IKW A;  4QM8 A;  2CNA A;  3SH5 A;  3W5N A;  3WNP A;  5FPU A;  2ZJC A;  1SLA A;  2ZEX A;  3CJI C;  3IMM A;  3KHC A;  1R09 2;  4XAB A;  3MUZ 1;  2YRO A;  2WO1 A;  3FUO A;  3USU A;  4C8D A;  1A6C A;  1MQT C;  1JI6 A;  2HYK A;  2Q8D A;  4XBN A;  1BZW A;  2VO5 A;  3PNA A;  4Q4Y 2;  1NCR A;  5GZG A;  1JMU B;  1H6X A;  1YJK A;  3HN3 A;  5DDJ 2;  4L0P A;  3PVE A;  3IIA A;  3WP6 A;  4XJW A;  5H9S A;  3VHP A;  3KM5 A;  5J1X A;  2ILM A;  3CJI A;  4AFC A;  5FO8 B;  1PIV 3;  1GIC A;  1MQT A;  1RUI 2;  2I07 B;  1ZZ8 A;  1ZRE A;  5FV3 A;  4Z2A A;  3Q8A A;  1N47 A;  1QU0 A;  5BUV A;  4FPH A;  4G3Y C;  2WO2 A;  1HRV 3;  4PJY A;  1KS5 A;  1S2E A;  2BWA A;  4W6Y A;  2ZMN A;  1J84 A;  3H1M A;  2JEN A;  3DYP A;  3VBO B;  2P6C A;  4Y1V A;  2P3J A;  4K1Z A;  1Y4W A;  5KXC A;  3JB8 A;  1OOP B;  4LA2 A;  3B9C A;  4RR3 B;  4WM7 C;  4XTM A;  1AXY A;  2WDB A;  4GWJ A;  4PIZ A;  5GJ6 A;  2O14 A;  5CAZ A;  3U4X A;  2XUE A;  1YIP A;  1KDM A;  5I0T A;  4RQP C;  4AF9 A;  3GJB A;  1ZYB A;  1JZ8 A;  3THD A;  2A3Y A;  2OX0 A;  1QEX A;  1XYP A;  3SHR A;  4NJ4 A;  4ORF A;  4R4X A;  1FMD 3;  4HL0 A;  4KWU A;  5KXE A;  3G6J B;  1S0G A;  1SFP A;  2E31 A;  4XBL A;  4NOT A;  4OQ9 A;  1S0F A;  2E9Q A;  5ANN A;  1RVF 2;  3HOB A;  2HKX A;  5JSR A;  2G9Z A;  4WM7 A;  2VZR A;  4XUT A;  2LUW A;  3NNM A;  4ASK A;  4RQP A;  1AYM 3;  4PLN A;  5F1R A;  1UQX A;  1LHO A;  5FZA A;  3GYD A;  3N9M A;  2ID4 A;  1CD3 G;  2A73 B;  5TSW A;  3F2Z A;  3N9N A;  4K7J A;  4LQR A;  1VBE 1;  2VM9 A;  3D0J A;  3WSO A;  2ARX A;  3V0B B;  4RGA A;  2P17 A;  3VL8 A;  3MIG A;  1UY2 A;  4LHK A;  5GLT A;  2VCB A;  3OEB A;  4S2H A;  4CUG A;  2Q8C A;  4HLT A;  4CUB A;  5A70 A;  2VD7 A;  4KWJ A;  4XDO A;  5GAL A;  3S6P A;  4DUV A;  1UXZ A;  4YW1 A;  1RUH 3;  3WNN A;  1AR7 2;  1S55 A;  3SXW A;  3POS A;  4XUQ A;  1XNT A;  1XQN A;  5A7W A;  1SPP B;  1R1A 3;  1TNF A;  3BGA A;  4YYO A;  4WVM A;  2XLF A;  4NPR A;  1A34 A;  2AYH A;  3HAG A;  3ZPY A;  1AL0 G;  4P9Y A;  2QQK A;  2BUK A;  4QB6 A;  3WF2 A;  3IWZ A;  3H7J A;  5JLV A;  1LGB A;  4PT6 A;  4AAP A;  4PLO A;  5I0S A;  5I0R A;  4IV1 B;  1YO8 A;  3NNL A;  3OY8 B;  3ZLI A;  1AX2 A;  4F8A A;  1W90 A;  2WYF A;  4NHY A;  5A6Q A;  4NPM A;  5HCH A;  2VJX A;  2CWS A;  4YW3 A;  4IEU A;  4RD7 A;  1J1T A;  2ZX1 A;  2D6O X;  3MPB A;  2DVB A;  3RZK A;  1DF0 A;  1DQ2 A;  1UOB A;  1GLH A;  2DFC A;  2X10 A;  2O0O A;  3WD5 A;  3BUC A;  4AGV A;  3RGB A;  1V70 A;  4AI9 A;  1AR6 3;  2UY8 A;  2WFF 1;  4NAO A;  1FX5 A;  2JXA A;  2QZ3 A;  1KQR A;  2LS6 A;  4COW A;  4FPL A;  4JTN A;  4L9B A;  1MZ6 A;  1Y9G A;  2AEN A;  5FKB A;  2XDV A;  5A80 A;  1GYK A;  3III A;  3LA2 A;  1SBD A;  1RTV A;  1PVX A;  2EIE A;  3IMN A;  4LNV A;  5T5L A;  1MS5 A;  1WW5 A;  3KGL A;  3OOX A;  1PGS A;  3AZW A;  4M00 A;  4Q4V 1;  3ZVX A;  1QMJ A;  2HBT A;  3ZN5 A;  5FLJ A;  4LK6 A;  4F7Z A;  1DZR A;  1VBB 3;  2UYB A;  3E97 A;  3K51 A;  4LXL A;  4QQO A;  4AVC A;  2D7F A;  1LOF A;  3WNK A;  2HJI A;  3OJB A;  1JYX A;  1NE4 A;  2IXC A;  2AEY A;  4J6G A;  2GC1 A;  3LSE A;  4R4Z A;  5ISL A;  4N53 B;  5BNN B;  5GLZ A;  2OPK A;  4K9S A;  2GDF A;  2WFF 2;  1NXD 1;  4IW3 A;  4UI9 L;  1YI7 A;  4PQ9 A;  3B00 A;  1GMM A;  1ACC A;  3FLR A;  1PVC 1;  3MLK A;  1CAV B;  2JDK A;  2HWD 2;  3VZJ A;  1C3H A;  4AOC A;  5C5U A;  4KGG A;  2BNM A;  2B4K A;  2ZHN A;  4KGQ A;  4Q4X 3;  5L36 A;  1GP6 A;  3OSD A;  3ZFE A;  3MIF A;  1QJU 3;  5FYC A;  1W6P B;  5A1L A;  1IOA A;  1OUX A;  3RJR A;  4CCN A;  1RC6 A;  3WQB A;  4LE4 A;  2DVF A;  1I1E A;  2JWP A;  2TEP A;  4X8P A;  2PN5 A;  5ACA 1;  1EV1 2;  3MO4 A;  3N35 A;  2YZ4 A;  4ATF A;  1GNZ A;  4FTB A;  3S30 A;  3B5L B;  4XFA A;  5FZ3 A;  2OA2 A;  5ABJ B;  2ZZJ A;  5G04 L;  4CZS A;  2V4V A;  3IAQ A;  4QHO A;  4XE9 A;  1AR8 1;  2JDH A;  1FOD 3;  3WDU A;  1PK6 C;  3MLL A;  4QWN A;  5C3Q A;  3IDE A;  1IPJ A;  1DZQ A;  1AL2 1;  4FPC A;  2QDN A;  2JEM A;  2XL9 A;  4BYY A;  1UZZ A;  5LA2 A;  2OKX A;  2OZ6 A;  5IAV A;  2XHN A;  1W6O A;  1QKQ A;  4QHB A;  4OI1 A;  2RE9 A;  2IFW A;  5LY2 A;  4CDQ B;  5ACA 2;  5BPX A;  1RHI 3;  1PIV 1;  4JQR A;  4Q26 A;  2V73 A;  3PUR A;  1PK6 A;  4RN5 A;  4ITC A;  1V6J A;  1MVQ A;  2W2I A;  4AQ2 A;  3RYK A;  1HB1 A;  1ENX A;  4DXS A;  2HWF 3;  2VY0 A;  4A6S A;  2YB7 A;  4AHY A;  3OUJ A;  4Y1X A;  2GU9 A;  4WM8 B;  4IEQ A;  1HRV 1;  5K7P A;  3AFK A;  5IW0 A;  4FVV A;  5C7G A;  3FFQ A;  3EMR A;  4IGQ A;  3PTR B;  4Y1Z A;  4CDX C;  2HWC 3;  2VU9 A;  3WY6 A;  1AL2 2;  2G9G A;  4FOV A;  1HRI 3;  1WD4 A;  2LM3 A;  3CJX A;  4XIO A;  5KR7 A;  5LK5 A;  3POG A;  1J3R A;  4NRM A;  2GC3 A;  5JDB A;  1QXR A;  3AJY A;  4QU1 A;  1LJ7 A;  4CDU B;  1RED A;  1BBT 3;  4LEJ A;  3VKO A;  4XJ8 A;  1LOG A;  4XUR A;  3ZKU A;  4FAH A;  2A75 A;  4ZS3 A;  4E4H A;  3L9J T;  2ORZ A;  4CDX A;  2ZMK A;  1QQP 3;  1F2N A;  1W06 A;  2B7Y A;  1YI9 A;  2VC9 A;  3JZV A;  4QX7 A;  4BQX A;  1R08 1;  2A70 A;  2DU0 A;  1H2K A;  1XYO A;  1GZT A;  1HXS 3;  1HKD A;  1LHV A;  1GBG A;  3IDA A;  3I3E A;  3A7Q A;  2DYC A;  2DVD A;  2ZAC A;  3A22 A;  5GLU A;  4M4P A;  4QPG C;  1TE1 B;  2Q1Z B;  2ZKL A;  3ELN A;  3HBZ A;  4LJH A;  1DGR N;  1E57 A;  4R9C A;  2CAU A;  4FOW A;  3N9L A;  4OHV A;  2VMG A;  5A32 A;  3BAL A;  3WQ1 A;  4BQ5 A;  2ADD A;  1T6B X;  2CU5 A;  2YBK A;  3M8L A;  4YVW C;  3MIC A;  2VMF A;  1VP6 A;  4YZ1 A;  1PX3 A;  3CHX A;  3NNG A;  1QGL A;  2XL7 A;  4QB1 A;  4QPG A;  4BMB A;  4GB3 3;  4YM1 A;  1R08 2;  1RUH 1;  3CMG A;  3MIE A;  1J3P A;  4GKY A;  5E8A A;  2PEL A;  1G6N A;  5IAT A;  2WQZ C;  4LK7 A;  5EWS A;  5EJ3 A;  2V72 A;  4YVW A;  4CCD A;  2XWJ B;  1VAV A;  2F6B A;  3BCW A;  4AL9 A;  4XCA A;  1OA4 A;  5FXZ A;  4AVV A;  2VZT A;  5FQ0 A;  3VD4 A;  1RUE 2;  4FFF A;  4Q4W 1;  2HEW F;  3I2G A;  2LW8 A;  2PLV 3;  2ZGL A;  4DY3 A;  1RUG 3;  3AVR A;  3AKT A;  4W50 A;  2D6M A;  2ES3 A;  2EAK A;  3BOP A;  2Z79 A;  4AI1 A;  2GP3 A;  4L97 A;  5JUV A;  4MG2 A;  4LUL A;  1KJR A;  5FPA A;  4D69 A;  4YZ4 A;  4D7T A;  1UX6 A;  2XJQ A;  5DUU A;  1OPO A;  3U0Z A;  2K9Z A;  3WF1 A;  4GWM A;  4KWK A;  3WEZ A;  1CQ9 A;  4MV2 A;  3AMQ A;  5H9P A;  2YBP A;  4WVZ A;  1D4M 3;  1AR6 1;  1H8V A;  4HN0 A;  4R52 A;  4EN0 A;  3BTY A;  1LR5 A;  1ZBE 2;  3O12 A;  2Q8E A;  3HD8 B;  1G7Y A;  2I74 A;  1JHN A;  4PBP A;  4UFM A;  5LBF A;  2J1T A;  4NRO A;  2X09 A;  4JKK A;  4PQQ A;  3VD7 A;  1RUD 1;  2WNU B;  3O1V A;  2FCU A;  4IEV A;  4FXG B;  5DXD A;  2XML A;  5E16 A;  2ZHK A;  4FO9 A;  5DG1 A;  3AZV A;  3ZMN A;  2WLQ A;  3FZ3 A;  3NJZ A;  5C8C C;  2QVS B;  2P5B A;  4Q0P A;  5K0U B;  1MS0 A;  4J1W A;  4OZO A;  2R06 3;  3SMH A;  2AH2 A;  3WX5 A;  1MR5 A;  2VE1 A;  3O0V A;  1DYO A;  1QH7 A;  5LY1 A;  1NZI A;  1XJA A;  1K5J A;  1H8T C;  2D3S A;  4N43 C;  1W8T A;  2X53 S;  1PMH X;  3LPF A;  3JBG 2;  5FBZ A;  2VAU A;  4Z07 A;  5C8C A;  2RJK A;  4QXK A;  3VDD B;  3TEX A;  1SFY A;  1RUD 2;  3LAG A;  1COV 3;  5FOB B;  2VUD A;  4AGR A;  4L99 A;  3SQO A;  4AI0 A;  2DVA A;  4Q4X 1;  1GOG A;  1UY3 A;  2XVL A;  3WOG A;  3J7M A;  4UWD A;  1H8T A;  1NA1 B;  2CY6 A;  4N43 A;  5K8S A;  1SDW A;  2RM2 3;  4WZC A;  1CAW A;  1WCQ A;  3PUS A;  1YXW A;  1CX1 A;  4GJY A;  4I3P A;  4Q0Q A;  1XB9 A;  4XXP A;  3ACI A;  1N1T A;  5JZG B;  3ENR A;  1UY0 A;  1RJ8 A;  4HFS A;  2OUH A;  2WZE A;  3VBH B;  2ZGP A;  4BQW A;  3NV3 A;  4IUG A;  5DG2 A;  3UYJ A;  5FZ4 A;  5FKC A;  4MGI E;  5LB6 A;  1K3I A;  2VZU A;  4H2A A;  1O59 A;  2PHT A;  1FOD 1;  2XJP A;  1HQL A;  3K3N A;  1YQ8 A;  1D7P M;  1TG7 A;  3D82 A;  4A44 A;  5I93 A;  4F3J A;  2PFW A;  1N1V A;  1YYN A;  2WJS A;  2D98 A;  1QJX 2;  1APN A;  3KQR A;  3E6C C;  4XDP A;  4QU2 A;  5I8S A;  1C5I A;  4P14 A;  1YQC A;  1J58 A;  1SG3 A;  3S5A A;  1UY4 A;  2DBN A;  1LOB A;  1KEX A;  5L7O B;  3DEC A;  4LLF A;  2GMP A;  3VBR B;  3BPZ A;  3B7M A;  1GQH A;  1WUV A;  1ZBA 2;  3DPR B;  1KFU L;  4HZF A;  5FDB A;  3O1P A;  1WGP A;  3WW3 A;  1TME 1;  5FYS A;  4XXA A;  2HWF 1;  2R6Q A;  3ZX7 A;  2OUJ A;  2LRO A;  5FYZ A;  4DXR A;  1FAT A;  1PM4 A;  1PGL 1;  1Y9M A;  1TZO A;  4XHX A;  5FY5 A;  4W6X A;  3CLP A;  4FFH A;  2W5F A;  3OF1 A;  1ND3 C;  5JI7 A;  2A6Z A;  2YC4 A;  4U36 A;  1S0C A;  3OD0 A;  1O8P A;  1FT9 A;  1G9C A;  2ET7 A;  1AYN 3;  2Z4F A;  4AAX A;  4GUL A;  3J26 N;  2ZGU A;  2VOT A;  3VBF C;  2KM2 A;  4CP9 A;  1QJY 1;  4LOT A;  5DAW A;  1MS8 A;  2BOJ A;  2WO3 A;  4UYB A;  2UU8 A;  3VBS C;  1BBT 1;  4BA6 A;  1C8N A;  2YXS A;  1ND3 A;  2R7E B;  5FPL A;  4KU7 A;  1ZZ7 A;  3FLT A;  2IVI B;  5DAQ A;  3SCH A;  1QQP 1;  1VBC 1;  1UX7 A;  5EQU A;  3LEI A;  3SH4 A;  4M3C B;  1HXS 1;  4IXL A;  4MGQ A;  3VBF A;  1PGL 2;  2VZP A;  1G9D A;  4Y20 B;  4CEW B;  4MGZ E;  5FMO L;  4UW4 A;  5FP7 A;  1UMZ A;  3VBS A;  2RS5 1;  2VCM A;  4NHL A;  2QQP A;  4EE2 A;  2Q8O A;  2CDP A;  2BFU S;  4COV A;  5IVV A;  4IGO A;  1QJY 2;  3TN9 2;  4WBB A;  1RUF 3;  1K5M B;  5T50 A;  1ZX5 A;  4QGM A;  2ETE A;  1LRH A;  5E6H A;  1H0B A;  4QXH A;  4DEQ A;  4KL1 A;  2JDM A;  3BB6 A;  1W2U A;  4QGN A;  4TXW A;  1AHS A;  5FZG A;  1Y43 B;  1VBC 2;  3AZX A;  3ZXJ A;  5EV7 A;  1XYN A;  2BU9 A;  4LBL A;  4Y26 A;  3NJX A;  1REE A;  4JDO A;  1X8E A;  5FZO A;  5E1R A;  1PX4 A;  5EJZ B;  3C2U A;  4AQ6 A;  2ZGN A;  3WP5 A;  4LHN A;  4ERO A;  2V4A A;  4OFG A;  4QMA A;  2EID A;  1E5R A;  2RS5 2;  2P6H A;  1H1I A;  2KA3 A;  2Q0A A;  1FYU A;  3GF6 A;  4O9E A;  5LBC A;  3J7L A;  2FDK A;  2WSV A;  2PLV 1;  1RVF 3;  2A6V A;  3ECQ A;  3MBW A;  4R9B A;  4JGZ B;  1RUG 1;  3ZXG A;  2CGP A;  1G8W A;  2RJL A;  4PI0 A;  2JE8 A;  2VW2 A;  4ASM B;  2C6S A;  1V0A A;  4ZU4 A;  2R04 3;  5KHI A;  3LA3 A;  2VZ3 A;  1BLZ A;  1SMV A;  2YHJ A;  1ND2 B;  3WLU A;  3NRU A;  2PTM A;  1O5U A;  5EIY B;  1WLD A;  3ZN6 B;  4C0B A;  4TYS A;  2QQW A;  5HBA A;  5FPZ A;  4H7L A;  2R0H A;  4Z1V A;  4LBN A;  1D4M 1;  1MS1 A;  3LKJ A;  3NV2 A;  2FDG A;  2P1B A;  3SC7 X;  2HWB 3;  4Z82 A;  3POJ A;  2XG3 A;  3LDK A;  1WBF A;  4A7Z A;  3WW4 A;  1L7R A;  2VZQ A;  4Z8B A;  1AR9 1;  1VMJ A;  2BGP A;  4P9X A;  1H1M A;  4Y5S A;  3ES4 A;  3AZY A;  2WZ8 A;  1KXG A;  1BEV 3;  2DTY A;  3AKS A;  4FP3 A;  4MHU A;  3VUO A;  2W0X A;  4TLG A;  3RYP A;  3MHZ A;  4SBV A;  4I02 A;  3ILF A;  2VMI A;  4OLL A;  2BRT A;  2OQ7 A;  1F4H A;  3GCW A;  3RYR A;  5AC9 1;  5FYH A;  1ZRD A;  1YIF A;  3OYW A;  3UGG A;  1BCX A;  1JBC A;  2G19 A;  1ULD A;  4CEY C;  2WUH A;  5JMO A;  4RS5 C;  2VW0 A;  3CBN A;  3MPP G;  2NZ9 A;  4M3C E;  2G1M A;  1AR9 2;  2MPF A;  2X8K A;  1W8N A;  4LBQ A;  4O65 A;  1W6Q A;  2EIG A;  3AKQ A;  5DAP A;  5FY8 A;  1Z7S 3;  1ST8 A;  1WD3 A;  1XNC A;  4CP0 A;  4LBJ A;  1JOP A;  1KDK A;  3IT8 A;  1A3K A;  1W9W A;  2RM2 1;  4J25 A;  5T5P A;  4CEY A;  4RS5 A;  4PF5 A;  4B8E A;  4DUW A;  4UFH A;  4QDR A;  3ACG A;  5ERL A;  4YW5 A;  5AC9 2;  2W91 A;  1WMX A;  3RI8 A;  3ZOI A;  4AED B;  5C70 A;  1B09 A;  4JQT A;  2YGM A;  4P02 B;  5J96 B;  4V2W A;  2WL1 A;  2F17 A;  1O4Y A;  2VR4 A;  4JGY B;  1N3Q A;  3D4K A;  2DCZ A;  4BCU A;  4ISQ A;  4O9G A;  4XBQ A;  3WDW A;  1RB8 G;  3AMH A;  5FYM A;  1IS5 A;  4JKM A;  3VD9 A;  1RUC 3;  3MI8 A;  3KT1 A;  5BNP A;  3WG1 A;  5F32 A;  1MZF A;  3WG3 A;  3ZXE A;  3N9P A;  4PF1 A;  4HSJ A;  1GP4 A;  3IDC B;  2VOX A;  1WLC A;  5JAX A;  4E4S A;  4YAR A;  5F2S A;  2FZ2 A;  1QDC A;  4J1X A;  5KC5 A;  2CWM A;  3VDC A;  2A6Y A;  2WZR 1;  3IB3 A;  2J1R A;  1DGL A;  4M4R A;  3RQ0 A;  4XFF A;  4DEV A;  1J1L A;  3UK9 A;  3KWV A;  4FTS A;  4EWE A;  3ILR A;  2XVG A;  1RYY A;  4YW7 A;  4OHZ A;  4UW6 A;  5A6X A;  5BNQ A;  4P5Y A;  4QDS A;  3K4D A;  1NQJ A;  3O14 A;  1W9Y A;  3KV6 A;  5FXX A;  1EV1 3;  3PMS A;  3AP9 A;  1QWR A;  2E53 A;  1OQD A;  5FK7 A;  3IN9 A;  5FXV A;  1MEC 1;  5T5J A;  3V64 A;  4CDW C;  1AYN 1;  1W05 A;  3AC0 A;  5JMC A;  2VGD A;  1WWY A;  1SLT A;  5E89 A;  4CP2 A;  1OUS A;  3WHU A;  4GKX A;  5IK5 A;  3OB8 A;  1XE8 A;  3M70 A;  1DIW A;  1FV3 A;  5FP3 A;  2D6N A;  2W39 A;  2WZR 2;  4BIO A;  4GZ9 A;  2P37 A;  2ARA A;  1I5P A;  1QH6 A;  4LA3 A;  3O1T A;  1KGY A;  1DYK A;  4CDW A;  3M1H A;  2D3R A;  1RUJ 3;  5FO7 B;  1IKQ A;  2C0Z A;  4BB3 A;  2JIG A;  2TNF A;  5LA1 A;  4MXW A;  3E5U A;  1W8W A;  2LAL A;  1H4G A;  1F35 A;  1MZE A;  1VB4 A;  2EAL A;  4HN1 A;  1T2X A;  4XFH A;  4O7X A;  3PHM A;  5GLW A;  2E63 A;  2JB4 A;  4GWI A;  1MS9 A;  1SFN A;  4ATE A;  1H9P A;  4C0H A;  1ENR A;  2R07 3;  4GA9 A;  3RSJ A;  1W9T A;  3K77 A;  3AK0 A;  5FZ1 A;  5FZ0 A;  5A7O A;  4R9A A;  1O3R A;  4EWD A;  2C1F A;  1VAK A;  1K45 A;  3ZYH A;  5K9Y A;  5CG8 A;  1XU2 A;  3JB4 C;  1FPN 1;  1VBD 3;  2WS9 3;  4HET A;  5FLH A;  1SBF A;  5HCB A;  1I3H A;  2RG4 A;  4YRD A;  1LAJ A;  4QKD A;  4Y33 A;  2D40 A;  4HPK A;  4AEM A;  5A33 B;  1HX6 A;  2OQ6 A;  1JHJ A;  2VCC A;  3HJR A;  1JOD A;  4FPG A;  2A71 A;  2BWC A;  3S7E A;  3LD8 A;  3GGL A;  3POW A;  2CAV A;  2P3K A;  4MET A;  1CN1 A;  2A6X A;  3SKJ E;  3UGH A;  3APB A;  3VB9 A;  4IEZ A;  2YYO A;  4IL7 A;  4KU8 A;  5KXD A;  2J42 A;  2VVE A;  1AVB A;  2DUP A;  2WNV C;  4IEW A;  1SAC A;  2Y6H A;  4BIF A;  2XVK A;  1JH5 A;  3DV8 A;  3ST7 A;  4FPE A;  4EV0 A;  1U0A A;  1ULC A;  4K20 A;  5F3I A;  1LHU A;  2Z5W A;  3PTY A;  1FPN 2;  2BOI A;  1PMJ X;  3G7D A;  2R04 1;  4P9J A;  2CDO A;  5AVA A;  1JOJ A;  1YHF A;  3M3E A;  4D6R A;  4EN7 B;  3IPV A;  5A6Z A;  3DKQ A;  4S2F A;  3VZM A;  2WNV A;  2ZHL A;  1C1L A;  4P08 A;  2QQI A;  4ZS2 A;  1BK1 A;  5FPB A;  2JD9 A;  5GM0 A;  3ZFF B;  2JDY A;  4FOY A;  2HWB 1;  4NRQ A;  3BYW A;  2QJV A;  2ZBJ A;  3O7O A;  1LOC A;  4Y4R A;  3ZXF A;  3WG4 A;  3M7A A;  1GZC A;  4GAL A;  3RFR A;  2RR1 3;  1WMD A;  2K46 A;  1BEV 1;  2XUM A;  3FFZ A;  4Y1Y A;  5AVP A;  1O3T A;  5C4W C;  1CPM A;  4QXB A;  2QTW B;  2J1E A;  3D0S A;  5B2G B;  1R1Z A;  5FJK A;  4COY A;  4O61 A;  1OF4 A;  1V6N A;  3ES1 A;  1W8Z A;  3EQE A;  4Q8L A;  5FIX A;  2E33 A;  4D3W A;  2ZX0 A;  1CAX A;  1TMF 3;  2Z2S B;  3I59 A;  3ZYI B;  4D6Q A;  5HPO A;  4QGL A;  1JU3 A;  1NLS A;  2YPD A;  3J4U H;  1W04 A;  4LMF A;  1HN0 A;  1RMU 3;  2CV6 A;  2VNG A;  1LB2 A;  5C4W A;  3OGJ A;  2A5Z A;  2VOV A;  3WDX A;  1VBE 2;  2VVF A;  3H8U A;  1P8J A;  1REF A;  3JD7 3;  3BOD A;  3N9Q A;  4OI2 A;  4UF0 A;  3DL3 A;  5FY4 A;  4BJ0 A;  5AFE A;  1F15 A;  2WRA A;  3LWC A;  3LE0 A;  1KS4 A;  3AMM A;  1LEC A;  4LIV A;  3Q8F A;  3VL9 A;  5HV0 A;  3I49 A;  3UJO A;  2H6C A;  4XZP A;  3VN4 A;  4CCM A;  3UKV A;  3HWJ A;  4EZ4 A;  2P34 A;  5IVY A;  4OUL A;  2KD7 A;  2HEV F;  2VBD A;  5FMC A;  5A7N A;  1UOG A;  1XC6 A;  4QPI C;  1WCD J;  5FY9 A;  1WMF A;  4BK5 A;  1NUK A;  3ETQ A;  4AVS A;  4XMA A;  4LT5 A;  2QQN A;  1GZW B;  5FMO S;  3KB5 A;  4N9I A;  1AX1 A;  4S2D A;  1PNG A;  3BTA A;  1URX A;  5GZE A;  5BNO C;  1CGP A;  2PHR A;  3AYE A;  5F37 A;  3RZJ A;  4P9G A;  2CGO A;  3OPW A;  1YNA A;  3VD5 A;  1V6L A;  4QKB A;  1NCQ C;  2WWJ A;  3VBU B;  3I2O A;  4X6R B;  1DYP A;  2BQP A;  3AYD A;  2SLI A;  4QPI A;  3J8F 3;  2OW4 A;  2VMD A;  3MLJ A;  1CJD A;  3T0B A;  1E5H A;  3ZFE C;  1C4R A;  2BFU L;  3ACF A;  3RMY A;  3K3O A;  4FCA A;  1UWW A;  2Y6J A;  1LNS A;  1EAH 3;  3INA A;  4XF0 A;  5FY0 A;  3VKF C;  2JEC A;  1U5X A;  3JBG 3;  5BNO A;  1S1A A;  1R64 A;  3LDR A;  3VZK A;  3CNA A;  3FN9 A;  4B1M A;  2QQO A;  2VTX J;  1F8V A;  2ZHM A;  3KGZ A;  2YMZ A;  1POV 3;  1PNF A;  1NCQ A;  1PZ8 A;  1H6Y A;  2BBV A;  2VME A;  2GNM A;  3R4D B;  2J1S A;  5DPN A;  3W9A A;  1TVG A;  2HWE 3;  1HW5 A;  3C7O A;  1QXJ A;  1SQ4 A;  2JKB A;  2Y26 A;  3OUH A;  4MH0 E;  5E88 A;  2VEC A;  1X82 A;  3VZN A;  3WZ1 A;  2WFP A;  5L9V A;  5A7P A;  3RZL A;  1VBA 3;  1IG0 A;  4N90 A;  1CAU A;  2C9A A;  2RDQ A;  3O0X A;  4HVO A;  4Q4V 2;  2E7Q A;  5EXO A;  5IK7 A;  4NN0 A;  4LOR A;  1UYZ A;  1AZD A;  2B9U A;  3UKN A;  4CU6 A;  4YM0 A;  4YGD A;  4AHX A;  4ES9 A;  3I3M A;  3ILN A;  4BDV B;  4Z2W A;  1XE7 A;  3B69 A;  4IE0 A;  4LBQ D;  1BVV A;  4MGK E;  4UAP A;  1C57 A;  1OLM E;  3V56 A;  5JSO A;  2FZ1 A;  2BDR A;  1RIR A;  1ULO A;  3LEM A;  5HV4 A;  2YFZ A;  1WW4 A;  2VZV A;  2WBK A;  5CAD A;  4MHR A;  5FOJ B;  3V0A B;  4XFI A;  4A6O A;  1PVC 2;  1QJX 3;  1QHD A;  1W3X A;  1KFX L;  1G9A A;  1XE0 A;  2XHK A;  4YVS B;  2WN2 A;  2C4X A;  4JHT A;  4ZY9 A;  2AEZ A;  5EYX A;  3N9O A;  3WDT A;  2R30 A;  4FFI A;  1D2S A;  4XIK A;  3R05 A;  2VXR A;  4HVQ A;  1OUR A;  1UN1 A;  3HPN A;  1W2T A;  2L9L A;  4KBZ A;  4YGB A;  3LF7 A;  4AVA A;  3VBO C;  4C1W A;  4Y22 B;  3BU7 A;  4FT8 A;  3WT3 A;  4CXW A;  2XGX A;  3ZXK A;  3KLS A;  3C7E A;  1H2M A;  1YJL A;  2Q1F A;  4MYE A;  4Y5Z 0;  3VKN A;  1OOP C;  2R1B A;  3MYX A;  3ZDV A;  1B35 B;  2DUQ A;  4RR3 C;  1OQE A;  1BK0 A;  2WSU A;  2R07 1;  3NNJ A;  2DV9 A;  4N9H A;  3T1L A;  3WNO A;  4E2Q A;  4DS0 A;  4XF3 A;  1Z78 A;  4BE3 A;  1RGS A;  4I0A A;  2XJU A;  1US3 A;  1RXF A;  1Q43 A;  4ZU7 A;  2JG8 B;  1SDD B;  3UET A;  1VBD 1;  3U07 A;  2WS9 1;  3VBO A;  2EXK A;  1QDO A;  3I3B A;  1AR8 2;  3U14 A;  4K1Y A;  4LHL A;  3KF5 A;  4EN8 B;  1JU4 A;  1OOP A;  4KG0 A;  2XBO 3;  4RR3 A;  5GKA C;  1U5Y A;  5G05 L;  4XAC A;  2FDI A;  3Q8E A;  2VG9 A;  4RFT 0;  1C1F A;  1LES A;  1SLB A;  1YFX A;  3JQX A;  3I2J A;  3ON7 A;  1C8M 3;  2YFU A;  4IEX A;  4RA0 A;  4LOS A;  1F9K A;  1NT0 A;  2VQT A;  4AFD A;  4KBB A;  3BIW E;  4SLI A;  4XMI A;  3O0W A;  5F3G A;  1PO2 3;  5LCW L;  1PIV 2;  3KS7 A;  2RDS A;  1UCX A;  1FMD 1;  4XJZ A;  2PA7 A;  4KMQ A;  4DOU A;  3IAP A;  1DGR A;  1JYT A;  1S0B A;  3RI9 A;  3KVB A;  5A3T A;  5HCF A;  1DQ0 A;  1V9U 3;  1W3V A;  5FZD A;  4H7M A;  3W21 A;  5C8W A;  1HRV 2;  4RGK A;  3SCF A;  3NV1 A;  2GME A;  3ZYB A;  1HIX A;  2P4E A;  2WNE A;  3VKM A;  2ZX4 A;  4YZ2 A;  1AF9 A;  1PGW 1;  5FZC A;  1OKO A;  1YC6 1;  3PL0 A;  3TN9 3;  3DCQ A;  4E27 A;  1AYM 1;  5FMB A;  2XR4 A;  4PHZ A;  3U78 A;  3N4M A;  2Z69 A;  2FBE A;  2FCV A;  3V0B A;  4QX2 A;  2W1U A;  3T30 A;  2PAM A;  2A1X A;  5C3O A;  2LRP A;  3HT1 A;  3LIG A;  1LOD A;  5FP9 A;  4EWA A;  4QQ2 A;  1ASJ 3;  1UNB A;  3TB0 A;  2RS1 3;  1QY4 A;  4IV1 C;  4Q1R A;  2RR1 1;  5FPX A;  2ZAH A;  3I4I A;  5T3N A;  2YPJ A;  5FXW A;  1SPP A;  1ZRC A;  1DLC A;  4DIN B;  3NAP B;  4IEP A;  2QQV A;  1UU4 A;  4BZ4 A;  3ZIW A;  4YW4 A;  1FNY A;  5SV5 A;  4OUM A;  1LOA A;  1RXG A;  1UW8 A;  1R1A 1;  1VRH 3;  5FZB A;  4JX0 A;  2W95 A;  5I0U A;  3PIJ A;  5J98 B;  3AXE A;  4CE8 A;  1X36 A;  1PGW 2;  1SEF A;  4NAM A;  3T3Y A;  3K75 B;  1H2L A;  4IV1 A;  1AYM 2;  4G9S B;  3OY8 A;  3U75 A;  3PIG A;  3V65 A;  4QPY A;  2EVX A;  5FAX A;  3VDA A;  1W8O A;  4FI9 A;  3JD7 1;  1ZZB A;  4FAG A;  1UMH A;  5KXB A;  4JCK A;  3TWI A;  1JW6 A;  5C3R A;  3BU0 A;  3I3Q A;  2ARC A;  3AMN A;  3ZYR A;  4NIA A;  3HBK A;  4UFI A;  4I0B A;  1S0J A;  1EYB A;  1LGN A;  1RUH 2;  1OLR A;  4RHV 3;  4CXY A;  3WNM A;  3VHN A;  1OHF A;  2JG9 B;  4W6W A;  4MO3 M;  1R1A 2;  4CSW A;  4N53 C;  2XQX A;  3CZJ A;  5BNN C;  1YWK A;  1JUH A;  4IND A;  3AP7 A;  4I30 A;  2EA7 A;  3DYO A;  4YZ3 A;  4K8F A;  4Q4W 2;  5F39 A;  4AHZ A;  3AKP A;  2VUJ A;  3OBZ A;  5CA6 A;  5DAV A;  2GAL A;  1W6N B;  4XAE A;  3UL2 A;  1JS9 A;  3DN7 A;  2RDR A;  3KMH A;  5IVB A;  3UGF A;  4DXZ A;  4JKL A;  4D7S A;  2DCY A;  3L2Y A;  3MIB A;  3BPS A;  2DTW A;  5DZF A;  3KSC A;  4D8M A;  4QX3 A;  3J8F 1;  1W2A X;  5FYB A;  4XUP A;  3ZR6 A;  4N53 A;  5BNN A;  3NJV A;  4UBG A;  1VBB 1;  2RS3 3;  2XLA A;  5F5A A;  3K2O A;  2WIN B;  3OG2 A;  3VV1 A;  1EAH 1;  2DCK A;  4AI3 A;  2I45 A;  5FP4 A;  3OGR A;  1ULG A;  3WG2 A;  3ZMO A;  1SLL A;  4D7Y A;  5JXI A;  1CAV A;  2JDP A;  2Z42 A;  5BXX A;  5B4N A;  1AR6 2;  1OF3 A;  2PYT A;  3RZZ A;  3FWE A;  4GMP 3;  3C3V A;  2XON A;  3MDP A;  4B4Q A;  1DQ5 A;  2W9X A;  3ZYG A;  5ABJ C;  3GM8 A;  1JZ4 A;  4E4D X;  2VZ1 A;  1W6P A;  4ZXK A;  4Q0V A;  2AR6 A;  5EHD A;  4FP2 A;  4WZF A;  2ZAB A;  2V09 A;  3PU3 A;  2MEV 3;  1VBA 1;  5FO9 B;  1QJU 1;  5KBF A;  2RMU 3;  2JB8 A;  1IKP A;  2HLE A;  5DN2 A;  1POV 0;  3H50 A;  1S2B A;  3EO6 A;  3TOJ A;  4Q1P A;  3TNP B;  1VPH A;  2FDJ A;  4L11 A;  1PO1 3;  5CNA A;  2PXJ A;  3N7M A;  1VBB 2;  4XFG A;  5D8A B;  1GU3 A;  5ABJ A;  4HBN A;  5C9A C;  1OFS A;  2VL4 A;  1W9S A;  4RL7 A;  4XFC A;  5CKQ A;  1CX4 A;  4PIX A;  5FUP A;  4M0H A;  1OLQ A;  4CDQ C;  4NO4 A;  4DFS A;  5JCT A;  2R0F A;  3AYA A;  3K48 A;  4NPL A;  1LHW A;  2O8Q A;  4OMD A;  5CIR A;  4AQS A;  3N3H A;  4MGT A;  2D3P A;  4PCR A;  4RGG A;  3MW4 A;  1ZM1 A;  4LE3 A;  4B7K A;  4WM8 C;  2QFE A;  3P6B A;  4Q4X 2;  4LUM A;  1CES A;  4JZR A;  4MXV A;  5C9A A;  1QJU 2;  4COZ A;  2DF7 A;  2JDZ A;  2CL2 A;  4IE7 A;  4CDQ A;  4BXS V;  3SLI A;  4GH4 B;  5CFC B;  5FZL A;  3ABZ A;  1ZA7 A;  2E7A A;  2QQM A;  2GC2 A;  4AK3 A;  4AWD A;  2D5H A;  1G86 A;  1RL3 A;  1XNK A;  1RHI 1;  5FMD A;  1AJO A;  2BEO A;  2Q4S A;  3A23 A;  2BVV A;  2VBP A;  3GBF A;  4KG8 A;  4WM8 A;  3ZR5 A;  3KZ4 C;  4CDU C;  4CCL A;  2Q30 A;  4QXC A;  1VRB A;  4BK4 A;  3P1I A;  4XPV A;  3TAY A;  4IES A;  4COU A;  4HG6 B;  3NO8 A;  4HK8 A;  3I2D A;  2Y0O A;  3T2Q A;  2G4I A;  4MSV A;  4ONU A;  1Q56 A;  1FOD 2;  1G9F A;  3W5M A;  1JZ3 A;  4IV3 B;  2XBO 1;  2A3X A;  2HWC 1;  4A3Z A;  2HBU A;  2W08 A;  1IS3 A;  4XJA A;  2VCA A;  1AXZ A;  1LEM A;  5BNP B;  3BI3 A;  1HRI 1;  4CDU A;  4BQ3 A;  1C8M 1;  1RJ7 A;  5CG9 A;  2QKD A;  2R1D A;  2DVG A;  3GNE A;  2D6K A;  1R09 3;  2I2S A;  3I97 A;  4KQ7 A;  4NWW A;  4OI0 A;  4PLM A;  1HJF A;  4V1P A;  1HB3 A;  1PO2 1;  1RHI 2;  3LIH A;  5IWF A;  1XOY A;  1W6M B;  4Q4Y 3;  3GCX A;  1TME 2;  2Y6K A;  4PDW B;  2HWF 2;  3AP5 A;  1W0N A;  1V00 A;  2F4P A;  3I7D A;  1XBF A;  1W9F A;  3BVC A;  4FPK A;  4UT5 A;  5DDJ 3;  4BME A;  1VE0 A;  4BLJ A;  3ACL A;  1LU2 A;  2ZPX A;  2CSG A;  5F8P A;  2WAB A;  4QKN A;  2OT7 A;  2X5I B;  4B4R A;  1SHW B;  3MFA A;  4HT1 T;  1HN1 A;  5K4L A;  4UFJ A;  2HWC 2;  5C71 A;  3H0O A;  1RUI 3;  2IXJ A;  2Y6F A;  5A1F A;  4LTA A;  2NP0 A;  2D6P A;  3KD4 A;  2NQY A;  1HRI 2;  5CU1 A;  4XW3 A;  3FHA A;  2ZEZ A;  4F83 A;  4K40 A;  2VNO A;  3HQR A;  2XWB B;  1BKZ A;  3HVD A;  3CIH A;  1ASJ 1;  5D21 A;  1BBT 2;  1XRU A;  3Q9O A;  5FZI A;  3PLQ A;  4JDM A;  4I0W B;  3N7L A;  2ARB A;  1QQP 2;  4GB3 1;  1N1S A;  5D1I A;  4YZ5 A;  3USU B;  1GFF 2;  3LEK A;  5IYY A;  5JOX A;  3OBA A;  4QX8 A;  2UUR A;  1W28 A;  4MAD A;  5JR7 B;  1HXS 2;  3ZDS A;  3H3Z A;  3VHR A;  1NCR B;  2NLR A;  3POF A;  4XQ4 A;  5FZ6 A;  4E4Z A;  2FMY A;  3J9S A;  3JQW A;  5KHH A;  4JV4 A;  2UYA A;  3LFM A; 
#chains in the Genus database with same CATH homology
 4YW7 A;  2C24 A;  4CP9 A;  4LKD A;  4A6S A;  4BQ3 A;  1W8U A;  2VXJ A;  1WCU A;  2KR2 A;  4BQ4 A;  1W8W A;  1HN0 A;  3ORJ A;  1L7L A;  2O14 A;  4LK7 A;  3ZYB A;  1W8T A;  1GWL A;  5D21 A;  1V0A A;  1GWM A;  1W90 A;  4CPB D;  2WYF A;  4AL9 A;  3F95 A;  1OKO A;  2LRO A;  4LJH A;  2K46 A;  4LK6 A;  1W9F A;  1WMX A;  4LKF A;  3ZYH A;  4LKE A;  1GWK A;  4YWA A;  1UOJ A;  2JWP A;  3UT0 A;  4BQ5 A;  4CPB A;  2Q1F A;  4YW6 A;  2LRP A;  4CP9 B;  1WZX A;  1W8Z A;  4BQ2 A;  1OH3 A;  3ZYF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...