3ZYHA

Crystal structure of pa-il lectin complexed with galbg0 at 1.5 a resolution
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
121
structure length
121
Chain Sequence
b'AWKGEVLANNEAGQVTSIIYNPGDVITIVAAGWASYGPTQKWGPQGDREHPDQGLICHDAFCGALVMKIGNSGTIPVNTGLFRWVAPNNVQGAITLIYNDVPGTYGNNSGSFSVNIGKDQS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PA-I galactophilic lectin
molecule tags Sugar binding protein/inhibitor
source organism Pseudomonas aeruginosa (strain atcc 15692 / dsm 22644 / cip 104116 / jcm 14847 /
publication title A Glycopeptide Dendrimer Inhibitor of the Galactose Specific Lectin Leca and of Pseudomonas Aeruginosa Biofilms
pubmed doi rcsb
total genus 23
structure length 121
sequence length 121
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07828 PA-IL PA-IL-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.430 Mainly Beta Sandwich Jelly Rolls Galactose-binding lectin 3zyhA00
1GWMA 1W90A 2K46A 1W8UA 1OKOA 4LK6A 4LK7A 1V0AA 3ZYHA 4CP9B 4LJHA 2O14A 4BQ3A 1UOJA 3ZYBA 3ZYFA 1HN0A 4LKFA 4BQ5A 2KR2A 5D21A 1WCUA 4AL9A 4CPBA 2JWPA 2Q1FA 1WMXA 1W8ZA 4BQ2A 3ORJA 2LRPA 4YW7A 1WZXA 2LROA 4A6SA 4CP9A 4YW6A 1W9FA 4CPBD 2VXJA 4LKEA 3F95A 2C24A 2WYFA 1L7LA 1GWKA 1W8TA 1W8WA 4LKDA 4BQ4A 3UT0A 4YWAA 1OH3A 1GWLA
chains in the Genus database with same CATH superfamily
2ET7A 5JDBA 1MZ5A 4XDPA 1PMHX 4ES9A 1QKQA 2ZMKA 4P9XA 1SCSA 1W0NA 4CEWC 3DKWA 4XMIA 4XZPA 2BGOA 2J1VA 4FPYA 1UKGA 2QVSB 4YZ4A 4XJZA 3AFKA 1RUNA 1ZA7A 4XACA 1RUI2 1YNAA 2FMDA 2W47A 3AMNA 5FQ0A 4XAEA 4MUVA 2RS11 4TWTA 2GC1A 2HWF3 4JHZA 2WAAA 4C8DA 5L7OC 5CA6A 1CESA 2QNKA 1BBT1 1UYPA 3OPZA 3V64A 4AG4A 4LKEA 3JBG2 4Q8KA 3ZFEB 1EAH2 2Q5TA 4XFGA 4N53B 2A3WA 5FLJA 1QNYA 4AGVA 2J1AA 5I91A 2J1TA 1VBC3 2E32A 1OVPA 2A6ZA 2WFF3 4DXZA 3ZFEC 5DQ0A 2YBPA 1ALYA 4JRLA 1W9WA 3ZOIA 1HN0A 1UAIA 1ASJ1 2D98A 2VZTA 2ZX0A 5FZ4A 2Q30A 4QKNA 1TE1B 1RUE2 5A3TA 2FDGA 1NLQA 1RUH2 4RL7A 3WNLA 1O3TA 1ZZ9A 2XLAA 4Y5SA 1RVF1 4FOYA 1YRZA 4PLOA 3HQUA 3WF0A 1GWKA 2R1BA 5CYYA 4IEXA 2VMDA 5FMBA 2JG8C 4HN1A 3PVBB 1AL21 4DQAA 1OKOA 2VCMA 4QHOA 4AE2A 4GWJA 5F3GA 4BQXA 4MYEA 3QH6A 3RGBA 1VMFA 3GCXA 5ANNA 3MZHA 2EF6A 2XWBB 3GZAA 5LK5A 3T4HB 4AI0A 2JX9A 3PLQA 4LHLA 5FMCA 4U2AA 2GU9A 5DUWA 5CIRA 3DL3A 1QH6A 1F8VA 2E7AA 2FCVA 1Q8OA 4IEQA 1UYXA 3AZXA 1EPWA 1TME2 4MHRA 1J83A 3OGRA 5FUIA 2K9ZA 4LMFA 1UIKA 3SNMA 4N43A 2FDKA 1PK6C 4Y22B 1AL22 2FCUA 1W2NA 1SZBA 1W90A 1YJKA 4ISRA 4BQWA 4HXCA 3H8XA 3AYCA 1ZNPA 2RMU1 2YU2A 2FDJA 1MEC2 3IMNA 3NRUA 1YHFA 2B7YA 2XBO3 3N7JA 4XFFA 5FYBA 5LBBA 4MH0E 3MBWA 5IT6A 1D0HA 4HOOA 1DYPA 2W95A 3DXUA 1CZVA 1D4VB 4CSWA 4CPBA 1LTEA 2Z4FA 2EXHA 4DINB 2MEV3 1W6QB 4FVVA 4YW5A 3JD72 5HCBA 1DIWA 1A8MA 2UYAA 4XDOA 1PGL2 4PF5A 1R093 2Z42A 3MF9A 4BE3A 4W6YA 4Q0VA 1FNYA 3HN3A 3EMRA 5J09A 4LBOA 5F5IA 3VBOC 4H7LA 3MW4A 3OGJA 1C1LA 1C4RA 2XG3A 2Y0IA 3EQEA 5CFDB 1R1A2 3BIEA 4META 4QHZA 1XRUA 3TEXA 2P3YA 2RJLA 5LCWL 2A75A 2ARBA 3RWNA 2E9QA 3ACFA 3P6BA 1CAXA 2RG4A 4Y22A 1VBD3 1IZ3A 1AR81 1K45A 3LD8A 4QB2A 4YLZA 4YYOA 4AFBA 3DUIA 4BQ2A 1KXGA 2BV4A 3MV11 4K3UA 3TAYA 4CXXA 2BQPA 3ACIA 3D0JA 2P3JA 2W0XA 3M70A 1DDLA 4NHLA 2WZR1 3R0RA 5EXOA 3RI8A 1K42A 5JI9A 4AGGA 1LU2A 4BA6A 4A6OA 5JPNB 1H6XA 1RUD2 4I0AA 4LA2A 5T54A 3WR0A 3O1PA 2VQTA 3B02A 1IG0A 4Z82A 5FWEA 2B42B 4Y5TA 5LZ6A 3J7NA 3ECQA 2WJSA 3IPVA 4NN0A 3O1OA 4UFKA 1Z0HA 2ZMLA 3AKRA 4BYYA 2RS51 4QX1A 1NX9A 3CIHA 3ZYRA 1D4M1 5IAXA 4E2GA 2GNMA 1OF4A 2GNTA 3IKWA 2J1RA 3FX3A 3KZ4C 4NE9A 3ZMOA 4YW6A 1JYWA 4P5YA 3I8TA 5FPUA 2G9FA 2PLV2 3VBRA 1TMF2 2WYFA 2WZR2 1LHVA 2HWE1 3VBFB 3VKLA 4A7ZA 1YLLA 3MEPA 4UFLA 2HWF1 2ZHLA 3URFA 3ZXAC 1PO21 2EIDA 5GZEA 2TBVA 5EYXA 4HN0A 5A70A 1X82A 4RYDA 4LBMA 5FZOB 1SPPA 3AMHA 4G3YC 1ODNA 1QJU1 1RL3A 5CBLA 1E5SA 1HJFA 2JDYA 1LHUA 1W3XA 1O7FA 4IV1A 4PDWA 5F5QA 1POV0 4AL9A 3V0BB 3KVAA 1HRI1 1OMIA 2DV9A 5KXCA 2RDQA 5JCTA 1KQRA 2W08A 2QQKA 3PU8A 4Y24A 5C3OA 4BWOA 2PAKA 5BNOA 4QMAA 1HV1A 3ITQA 2P17A 4MZUA 4AW7A 3A22A 1BEV3 1DBNA 5FYZA 3VD9A 4HBNA 3VDAA 4OI0A 4XXAA 3LE0A 1LHNA 2JDHA 4ZS2A 2BBVA 4FPJA 3LA3A 4JQTA 2VMEA 4GZ9A 3ES1A 2ZX3A 1O6UA 2LTNA 2Y38A 1FYUA 2Q8DA 4XE9A 1MEC3 5C5TA 4XCBA 1COV2 3MIEA 3UETA 4RGKA 5C3RA 1T6BX 1W9SA 4I2OA 5IATA 3I3EA 1PHMA 2H6CA 2RE9A 3VBHB 5A7OA 2X5IC 5AC93 1RITA 2FDHA 3T0BA 1LAJA 2Y60A 3APBA 3VHNA 2KA3A 1LOEA 4AQ2A 4UYBA 2CU5A 3FUOA 1AUYA 2L9LA 3FBMA 4QB6A 4DXRA 1U5IA 2Z69A 3VBOB 3WG2A 1GYKA 1QJU3 4JVAA 4MSVA 4NRPA 2YGLA 1VBB1 4NIDA 1V9U2 4W6WA 1RUOA 1CAXB 1OUSA 4I0BA 4EV0A 2ZEXA 2GH8A 2ZGQA 4A2UA 5ACA1 5T55A 1NCRC 5A7SA 1QQP2 3VBRB 4HMZA 2YC4A 2J7MA 3ZYJB 2W92A 1NLSA 4AGRA 2E33A 4BLJA 2HEVF 1RUI3 2J42A 4EWEA 5A32B 5F3CA 5JUVA 2DVDA 2W1QA 2R30A 3L2HA 2WNOA 1JYCA 1RUD1 1LR5A 1WA6X 2B9VA 4N53C 3VKOA 1O5UA 1B09A 1GQPA 2DFCA 4KWKA 2VNGA 2QQOA 1PO23 4QPWA 1L7QA 2GNBA 4XQ4A 4QPIB 4QXKA 2VZSA 4CEWA 2BVBA 2P34A 2WS93 4MXVA 1UQXA 4XTPA 5A6XA 2GMPA 4DIQA 2HWC1 3IB3A 1ACCA 4MGQA 3W5MA 3VBUA 3A0NA 1C5HA 3RPQA 5EWSA 2WIIB 2X53S 4CDWA 3POEA 5CISA 1GANA 3WT3A 2X09A 1NY71 3AKQA 2XUEA 1D2SA 4CP2A 5GZCA 4COZA 1W28A 2XQXA 3LA2A 2FZ2A 1W6MB 1XE7A 3ORJA 3V56A 4ZU7A 4IQPA 1F31A 2ETEA 2QDNA 4W6XA 1VRH3 1GFF2 1VBD1 4Z2AA 5F1RA 2RS32 1QJX2 1BMV1 3CL1A 4PI2A 3RJ2X 4O65A 5F5CA 3U78A 1VE0A 4QT6A 3D6EA 3AP7A 3N9OA 1GV9A 4IV3B 4P9JA 5FZAA 4C91A 4GD4A 5F6KA 1JYNA 3BUCA 2XVGA 4PIXA 4AXOA 1D2QA 1PGW1 4OFGA 1RHI1 1H2LA 4CP9B 4YW1A 5A1FA 2VMIA 2JIJA 4XQDA 3GHNA 1UPSA 3RWKX 5FXZA 3X29B 1PO11 2QZ3A 3USUB 5FR3A 3GGLA 3SCFA 3H1MA 2B9UA 3E6BA 3VDCA 3H42B 4GA9A 1CAVB 3WV6A 1TMF1 1MZFA 4NWWA 1WWYA 3AP9A 2TUNA 3MLLA 1RINA 4FBFA 2BP6A 1S4CA 4CEYB 4IEPA 4LBQB 2GN7A 3OF1A 4ASLA 2YFZA 2ZZQA 2FQPA 1AYM1 1ZBE2 5A3PA 4ES8A 4M4RA 2R32A 3NNJA 2QE3A 2VXRA 3BTAA 4YZ2A 3RNSA 2NM1A 4QWNA 1MPXA 3T30A 4XOGA 1I1EA 1X9PA 2YFUA 1OQEA 4Q1PA 2PQSA 1HN1A 1XE8A 1BVVA 5I8TA 4NROA 5L7OA 1PVC1 1NXMA 4M3CE 4EN7B 4MLOA 4E27A 5K4LA 3T0AA 3WUDA 4URTA 3RZZA 3O1TA 1VBB2 4X6QB 3DKQA 1AYN1 3A0KA 3IDBB 3GBWA 4INDA 1S2KA 1Y9QA 3UK9A 5C70A 1SACA 2ZX2A 2R042 1D7PM 3NO8A 3SCGA 3VBFA 4Z2WA 4FFIA 1VBE2 4QPGB 3SEEA 1AR62 3O1MA 1QXPA 3RMXA 4D7SA 4IEZA 1OA3A 4TTGA 1K12A 3PL0A 3N9NA 2MPFA 1JMUB 3HBKA 4I02A 2D97A 4BU2A 2VTFA 1ASJ2 1WLDA 3ZR5A 4FO9A 4UWDA 3H8RA 5J1XA 3UKNA 4KL1A 1MQTA 1XB9A 3DCQA 1GZTA 2BUKA 3KS7A 3OGGA 3CKHA 1RHI2 4L97A 3UGGA 4MO3M 3AKPA 3WY6A 3V0AB 2HWD3 3ZSJA 2ERFA 4X8NA 5BYNA 1NAEA 4CXWA 1UOBA 4XAAA 4OQ8A 2IXJA 2XLFA 2NLRA 3I2HA 4P08A 1BBT2 3H1WA 1JBCA 4B7KA 4BM8A 1RUC3 1H2MA 3J4UH 4MOAA 3AZVA 2TEPA 2R073 4A3ZA 5FDBA 2E63A 5F9TA 1RUC2 3W58A 3VUOA 2J1UA 1TNRA 2VU9A 4J6GA 1RYYA 1G7YA 3K77A 4RGAA 2Y6HA 3ZO0B 4FTEA 1LULA 5IK7A 1H8VA 4QX3A 4HPKA 2HEWF 2XBO2 3AL5A 1HQLA 2OX0A 5FAXA 5TSWA 3THDA 4AFCA 4DXSA 3MI8A 4LXLA 1B35B 1A6CA 1V00A 4Q26A 4AI2A 4PI0A 1UZVA 3H7JA 1AX1A 4BXSV 3VKFC 5FMOL 1W2UA 3KF5A 3H8OA 1F4HA 5BNNC 2BW8A 2ENRA 3VBOA 1XSQA 2A3XA 3LSEA 1J1TA 1GNZA 2Q8CA 1OSGA 3DECA 3IAQA 3VZNA 5L9VA 5A7PA 2RM23 2VOVA 2GC0A 2DU1A 1U5XA 3WUCA 3ZFEA 1US2A 1JN2P 2GDFA 5FKCA 1JYVA 4XYXA 1CR7A 5FY7A 1A34A 2KR2A 4NPLA 2EALA 2IC1A 5A6ZA 5FZMA 3KT4A 3TRSB 4YFZA 2D5FA 2R1DA 1SLBA 1SLAA 2VZPA 2J1SA 4R8HA 1BXHA 1L7RA 2CHHA 2Y34A 4JC1A 3ZXKA 1CPMA 1PVXA 5IK4A 1QQP3 4KI5M 4LBLA 1QXJA 2OA2A 1PIV3 1NG0A 2R0FA 4CDXC 2EIEA 3GALA 4Q8LA 4GH4A 5FREA 1NXD1 1U5ZA 1WD3A 1YJLA 2IFWA 3I2IA 4DUVA 2W1SA 5EJ1B 5KHIA 1APNA 1KDKA 2JB4A 1XNDA 3AYEA 2BYVE 4K7JA 3WZ1A 3ZFFC 1MZEA 1MS3A 4DS0A 4NHKA 3H3LA 1U12A 5K8SA 3OBZA 1IQAA 4TSVA 1X7NA 5BV6A 2WQ4A 1W6PB 4QKDA 1BJQA 4GWMA 5DDJ1 1W8ZA 4W8JA 4HL0A 4YZ3A 4IEWA 2XB6C 3DV8A 4GB32 5FLHA 5FBJA 1MVQA 1UL9A 4XCAA 1FX5A 2XQRA 4TXWA 2NP0A 2ZMNA 1EPZA 1SLIA 4IV3A 1AXZA 3AXDA 4YPJA 4AR2A 4I09A 1I3HA 4PBOA 3PURA 4F8AA 3H8UA 5A3OA 3GBGA 3M3QA 2VG9A 2RR11 4Y3OA 3KCXA 2W9XA 2FDIA 1WCUA 1YYNA 2K2SA 4UW4A 4FTSA 2JWPA 2VCBA 4D7YA 2XKPA 4AEDA 1W06A 2GALA 4KGQA 1YFWA 3D5OA 1WCQA 5FZ1A 5FZ7A 1VBA1 1Y4WA 3POSA 3SKJE 1K5MB 3OD4A 2C24A 2CYFA 5C7GA 5FOJB 1KITA 4CE8A 2R061 3BPSA 2DCYA 4J1XA 2GH2A 1YFXA 2PQQA 3NQHA 1GWMA 3D8CA 3RYPA 3TOJA 1NCQC 4DEVA 5LB6A 2D44A 3MPBA 3U37A 1SQ4A 2YROA 3R4DB 4F7ZA 1KD7A 1OOPB 3M3CA 4LBKA 1UN1A 4MGYE 4DUWA 4HK9A 4I0WB 2GAUA 4ET7A 4ZHNA 1US3A 4E4SA 2VUDA 3J9SA 5L9RA 5FYUA 1C28A 2DURA 3D0SA 3JCIA 1YQ2A 5LBCA 3MGUA 5FP4A 3ZXJA 4N90A 2XOMA 3TNQA 4CU8A 5BNOC 2AREA 4N8MA 5FCCA 4YARA 2WRAA 3W20A 4DY3A 4XFIA 2P1BA 1YFYA 4AFAA 1ZVFA 2WFF2 4IGOA 3I3BA 1PNGA 3O1RA 3GF6A 3UT0A 5F7UA 1DYOA 4QX2A 4QQ2A 2IXHA 2OIIA 4XTMA 4DY5A 2DCZA 5FO8B 5KC6A 3C7GA 1R091 4H14A 1JH5A 3DGTA 1UPIA 5FJKA 1J84A 1W8HA 2P2KA 2PHUA 2YU1A 5FP7A 4NRQA 1YWKA 4EYUA 2X29A 5KWRA 1SG3A 4QDSA 2XPJA 5I0SA 5JWPA 2ZGRA 2R041 5I93A 4PLNA 3LDKA 4AEMA 5I0RA 3MLKA 4V2VA 3C2UA 3MIBA 2R16A 4FPLA 1ZZCA 4K21A 4YM1A 3M4FA 1QJY1 3NWKA 1RUH1 4AHYA 1DU3D 3MHZA 2CTVA 1QJEA 4GJYA 1S0DA 3LPFA 1KDMA 2DWRA 1ZZ7A 2VC9A 3V0AA 5FTTC 2VY0A 4P9YA 5K7PA 1H1MA 4RQPC 2BEOA 1QDCA 1N3OA 5ACA2 3P3NA 4JGYA 2C9AA 2JE9A 5DUUA 1EUUA 4HANA 1WCKA 5C8CA 3K3OA 4ZXKA 4AF9A 1OLQA 3AXEA 5E6HA 3ZXGA 4FCAA 3CLPA 4L11A 5DDJ2 3KHCA 1RXFA 3JB8A 2DUOA 3NAPC 3PMEA 1NCQA 4ZU5A 1O5LA 5AC91 2RDSA 5A3WA 3FBYA 1CAWB 2RS13 3HNYM 4S2DA 2VZ3A 4LO6B 4XUOA 3LAGA 1ZZ6A 3MUZ1 5FJHA 2OQ6A 5JZGB 4XDQA 3O1UA 4YSFA 1DGRA 4E8CA 5FP9A 5B4XA 2BOIA 4QGNA 2B45X 2F4LA 1O3SA 1H8TB 1YI9A 3NV3A 4D94A 1SLCA 3O0XA 4XILA 3VHRA 3KV5A 4ITCA 3S6PA 5BNQA 2DVGA 3AMQA 3AC0A 3J8F2 4HFSA 5EQUA 5C4WA 4BB3A 2D93A 1LJ7A 4N43B 2RDRA 4XEZA 2OVUA 3LIHA 2A6YA 3BN6A 5A7WB 1A3KA 2BOJA 1AR93 1UCXA 1KFXL 4I01A 1TNFA 1VPHA 4JDNA 4CCDA 4EN8B 1OFNA 3PIJA 5DAPA 4PQ9A 2RS52 2BJSA 4XW3A 3ENRA 3LDRA 5J98B 1MQTC 2PA7A 4L0PA 4UW3A 1JZ7A 4COVA 3QACA 1AL0G 1G9BA 3IT8A 1IHMA 4XJ9A 4EJRA 1W05A 4IE6A 1QOOA 1UZWA 2B46X 1DQ4A 2G19A 4IETA 1W99A 4QDQA 4WM8A 3W59A 2OQ7A 2VGDA 3BPZA 1ZRFA 1RMU3 1W8TA 4LUKA 5FP8A 2IWGB 1SFPA 4LT5A 4GB31 4G9SB 1S2BA 3OB8A 2P6HA 1X36A 3LDBA 5EJZB 5T5LA 3OSDA 2HWE3 3RQ0A 3Q8EA 1WA4A 3T08A 3ZFFA 4E4DX 3AMPA 1XBFA 4HK8A 2ZAAA 4N43C 3ZSEA 1GR3A 5CAZA 2W3JA 3B01A 4D3WA 3TWIA 3I97A 4IGPA 1RTVA 1L3JA 1FI2A 3BALA 3IDEA 4Y1UA 4BIFA 5C4WB 5C9AB 3VZMA 3LF7A 3U4XA 4JGYB 2YPJA 3C7FA 1LEMA 5J7MA 1LGCA 1VBC2 2AEZA 1COV3 3RVHA 3NW4A 2VZ1A 2XJSA 3ZSMA 1OOPC 1OVSA 1UU4A 3IIAA 3ZFGB 1OLMA 4YW4A 1T2XA 4CUAA 4XJ8A 1EAH1 4BPZA 2R063 2BERA 1CX1A 2VW1A 3RSJA 2DU0A 2HH9A 2WT1A 4XIOA 1H0BA 4XF1A 4BCUA 3WDXA 1UOJA 1K5MC 3ZFGC 5LW9A 1V9U3 3FUQA 5IVFA 3PNAA 3PTYA 2GZWA 2D7FA 5EP9A 5C3SA 1GNHA 4WVVA 3B94A 3JZVA 4MV2A 4QX7A 1R1A3 4BOWA 1STMA 5JXIA 4I30A 1QOTA 1REFA 4AHWA 3WG4A 1HRI3 5C4WC 4LKDA 1W8WA 2R49A 4IE7A 4KG0A 4LBQD 3UYJA 4IUGA 4ZXEA 1VB4A 5FXVA 2VTXJ 1WUVA 1W6MA 1YEWA 2H0VA 2YC2A 4LO8A 3WNXA 1FV2A 1J1LA 1W6OB 2VUCA 4Y20B 5IVYA 1WW7A 3MYXA 2LUWA 5KBFA 1O8SA 1GQGA 3TB0A 1MS8A 5FZ9A 5DDJ3 1S0EA 2XLGA 3GZEA 3OUIA 2JDAA 3VN4A 2ATFA 2WZEA 3G6JB 1OLME 5IYYA 3INAA 3LEGA 3LEMA 5F2WA 1R1ZA 1ZRIA 5HCFA 5F3IA 1P8JA 2VPVA 4KBZA 4PT6A 2RJKA 1C1FA 1LECA 2VR4A 3GNEA 4XF9A 1ND2C 4JAAA 2RMU3 2EIGA 4CCLA 1MS5A 1ZYBA 2NN8A 4YWAA 3KMHA 4W4ZA 2P37A 4CDXB 4FSJA 4NVPA 2D3SA 3CQOA 3R4SA 2PHFA 5LY1A 1FOD3 2HWC2 3EO6A 4LBQA 4LTAA 3KCCA 5C8WA 3OPWA 1MR5A 4EROA 4WVMA 2FBEA 3KV4A 3WHTA 2QFEA 1WKYA 5F5AA 3EYPA 2XONA 1LOCA 1JOPA 3R4UA 4AI8A 3VBHA 1JZ3A 1VAMA 5CKQA 4YW7A 5CG9A 1PGL1 1LOFA 2JDKA 4ZZ5A 2QQUA 4JDOA 3F95A 1N47A 3MF6A 5M0TA 4A7KA 1UO9A 3OBAA 5IVVA 3NJZA 4QX8A 4Q4V2 5FUNA 2A6WA 3HIFA 4XFBA 4EE2A 1BYHA 2Y6FA 4OYUA 1BVP1 1HW5A 1YC61 2WC2A 2VZVA 1GOGA 1VBC1 3WD5A 3WDYA 4JV4A 2C6SA 4Q4X1 5DABA 3ROUA 2WNVB 1WW5A 2JB8A 3BIWE 2MHFA 3GM8A 4GMP1 3LPGA 1GP5A 3QOPA 4AWDA 1HXS1 2QDRA 2WO1A 4QPIC 2IXLA 2GC3A 4AEJA 1YQ6A 4FOWA 5FFOC 3AKSA 5DAWA 1FXZA 4WZCA 2X5IA 1AR91 3JXSA 4GMP3 4BK5A 1AR61 1Q8SA 3JBG3 1NE4A 3MIDA 2JKXA 1YIPA 2WA3A 3ZSLA 5JXHA 4TLFA 4WM8B 2P3KA 3LQCA 3LSDA 2W46A 4N9IA 5IFTA 1OHFA 1GSLA 4QD2A 4QGLA 4KNCA 3DYMA 2UYBA 1O4YA 4QPIA 1NUKA 3BODA 1FMD1 3OGVA 1CN1A 5ABJC 5HV0A 5A3LA 5FYCA 5FPVA 1RUG1 5JSOA 5CFDA 2JEMA 3T2PA 3H7YA 1WCDJ 2SBAA 4A44A 1RUF1 3PUAA 3MO4A 5JIUA 1QHDA 2FD8A 2ET1A 3SQOA 4Y1VA 2DTWA 5FZKA 1MVEA 4OI1A 3S57A 1H8TC 5BUVA 2FCTA 3EXUA 3WW3A 3TEWA 2KXLA 4XUQA 1UMIA 1WCSA 4B4QA 2VW2A 3WQBA 2ZCWA 3PUQA 1IS3A 2GMEA 2RVAA 3VBHC 4AI3A 5EIYB 3UJOA 4AVBA 5FWJA 4MX3A 2N7GA 3H0OA 4LNVA 4CUCA 3ACGA 3F2ZA 1FMD2 3GCWA 4RS5A 4YVSC 3WVJA 5IVCA 5FZCA 3ZMNA 1NA1A 4NHMA 3DYOA 1EV11 3O1SA 1K3IA 1PO12 2V09A 2ZXQA 2PYTA 5FZIA 1IPKA 1EYBA 2W52A 5T50A 4RQPB 3LGRA 1JOBA 2YBSA 3ILFA 4HG6B 1DQ1A 2RS12 3ILNA 4HT1T 1PK6A 1ONAA 4M0HA 4Y1XA 5FPAA 4Y1YA 1XE0A 4ZONA 5FYVA 4I3PA 3BTZA 2ID4A 4IE0A 3WP3A 2HYXA 4MVTA 3H50A 4IEOA 4R9DA 4N9HA 1HXS2 1RUG3 1KJLA 4C90A 4KMQA 1WMDA 3FHQA 1FPN3 3OY8A 4XJUA 4R9AA 4LK6A 4Q4X3 5FZ3A 1HRV2 3NNFA 2PN5A 4V2WA 1FAYA 2RV9A 2WWUA 1QJY2 4WM8C 3NL1A 5LEJA 4DNYA 4CA9A 5FZOA 4LKFA 5JSPA 3N7KA 1JU3A 2RS53 4XMAA 2GSYA 3C7HA 3RRDA 3M2MA 3DF0A 1QJU2 2UU8A 3H3UA 5L7OB 3D4KA 4IV1B 4PDWB 4CU6A 3V0BA 5BNNA 1WLWA 3RZLA 1GKBA 2ZABA 4MHUA 1GZCA 5FPLA 5K0UA 5CADA 1ZZBA 5FOBB 3I3QA 1ZRDA 4J25A 5FYTA 5H9QA 3N9QA 1CZSA 4M01A 3ATGA 1OLRA 3Q9OA 2JDNA 4QAWA 4LPLA 1NQDA 2VQ0A 4FPFA 3WP6A 3U75A 4COUA 4S2FA 2PHWA 3N9PA 3CJXA 2B5HA 4CCMA 2VCAA 3B5LB 2B39A 5FZDA 1HRV1 1V0AA 3I2JA 4I3GA 1DGWA 4LIVA 4UF0A 2W91A 1REEA 4FFHA 1SBFA 4JKLA 2DUQA 2NYYA 2VQUA 4R52A 1DLCA 3WNPA 1UY0A 5A1AA 4YGCA 5FYIA 1EAH3 3GBFA 2I74A 2OT7A 3ACHA 3I3MA 2GP5A 2XGXA 2WS92 4LUMA 2X10A 5GJ6A 3IN9A 5GLVA 1HDKA 3SISA 5A80A 1JZ5A 2A5ZA 3CJIA 3CNAA 3UL2A 4B8EA 4AFMA 3HR9A 2XJVA 2WDBA 1HB2A 5J48A 5F32A 1AL23 1E5IA 3POBA 3FHIB 5DZEA 3S5QA 4OVEA 2PHXA 2CGPA 4IDZA 3RZGA 1JHJA 5A3NA 3LFMA 2RR13 4QU1A 4V1PA 5G04L 3USUA 4XUPA 4D0QA 2PXJA 1ZM1A 1DQ0A 2ZA9A 3NJYA 4IEVA 2Z5WA 4CCCA 3BB6A 4F83A 4LO5B 3WNKA 1MS9A 1IKPA 4PJYA 4QQHA 4KGGA 2JDUA 2CV6A 4QQLA 2BDRA 2XBO1 3HAGA 4P14A 1AR92 3T4VA 5AFBA 1FOD2 2IFRA 1ASJ3 1WMFA 1O59A 3D3AA 5FIXA 4CDUB 2VXJA 2YV8A 2Q1ZB 3ZKYA 2DUPA 3ZXFA 4AI9A 2WNVC 2XR4A 3MUY1 1GNYA 1AHSA 2QQPA 3P1IA 1LU1A 1N1SA 1H2NA 1JZ6A 2E6VA 1G9FA 1GMMA 2XUMA 1T6GC 4P02B 5BNPB 3BTYA 5K0UB 3SH3A 2E51A 3BOPA 4GKXA 2J22A 1LEDA 4LE4A 3KD4A 1LHOA 4BQ1A 5BPXA 1OURA 1ULFA 4LOTA 2W1WA 3WP5A 5CKNA 5KHKA 1MEC1 1WZXA 1VRH1 2WZPP 4K8FA 5CFCA 1UXZA 4FT8A 2VBPA 4GAZA 1OBNA 3AK0A 1J3QA 3E6DA 3KF3A 5LWBA 4Y26A 4X8PA 1Q56A 2XDVA 3ZN6A 5F39A 5CVRA 4QQPA 4B1LA 1UZ0A 2BNOA 2Z2SB 5L73A 2HWC3 2ZACA 3DN7A 4M00A 4UXAA 4X6RB 4ZS3A 3EJKA 1BQPA 3UV9A 1KS5A 4YZ5A 2DTYA 2EVXA 1QJY3 2RM21 2UY8A 2FDFA 2KM2A 5BNNB 4HVOA 3VZLA 2OW4A 3MFCA 4N7UA 4KH9A 2VNVA 2VE1A 2JG9A 1JW6A 1IS4A 1HQWA 2R043 2VO5A 2C9KA 3ACLA 3AL6A 4DRRA 5ABJA 3VL8A 1VBE3 2JXAA 1AR72 2AENA 2OZJA 3VLBB 1GP6A 2QQVA 3AX4A 4YM2A 3WLUA 1QOSA 3MIHA 4OUEA 1HX6A 4AAXA 1J3RA 2JE7A 4IERA 1Y9MA 3L9JT 2D5HA 1ZBE1 1V6OA 3PUHA 2R071 4B3NA 2YZ4A 4OQ9A 1LOGA 1R64A 5IFPA 4K6BA 4A3XA 2WT0A 4YZ1A 1MQTB 2VZRA 1JXNA 2WAOA 2P5BA 3N9MA 2AR6A 5CU1A 1C8NA 2C0ZA 4ONUA 4XHBA 2WABA 5A7WA 2EXIA 2VUAA 3CDZB 2A3YA 2E7TA 2YMZA 3B7MA 2R7EB 3HQRA 1IGOA 1NA1C 4KU8A 4L9BA 4OMDA 4YFWA 3U10A 4QX5A 3VBUB 4UBHA 1VRBA 2ZGSA 1OH4A 4UFJA 4PBPA 5GLTA 4B4RA 4R4XA 3E5XA 2DYCA 1NCQB 2D40A 1EY2A 1VIWB 3O14A 4Q4W2 1ENSA 3S0MA 3ZKUA 4IE5A 1LHWA 3WOGA 1YFUA 2PHRA 3AYDA 4BJ0A 2D6LX 3RS6A 3CF6E 3JB4C 2WINB 2WN3A 3N7MA 3POYA 4FOQA 1U5YA 2BFUS 1NZIA 1FPN2 3ZSKA 2Q4SA 3IZOA 3K2OA 4XETA 2ZOEB 4OHYA 1GBGA 3FLPA 3ZXLA 4AEKA 5JMCA 1LGBA 1UW8A 5DN2A 2RM22 1ENQA 3MIFA 4OUMA 5DAVA 1G9DA 1OPMA 1W9TA 2JG9C 5FBZA 4CDQB 2FZ1A 5HXMA 1PZ8A 1GWLA 4NAMA 1VR3A 4Q4W1 4EZHA 5CFDC 3T2QA 2CL2A 4KWUA 1VBA2 1Z78A 3SC7X 4E2SA 2V4VA 4Z1VA 5CZKA 2WL1A 4A7YA 4HVQA 4ZKTB 1VAVA 3LEKA 4MGIE 3VZJA 4HLTA 4Z07A 4MGTA 3NSTA 3WHUA 1DF0A 2HWE2 4MG2A 1CQ9A 4WM7C 1H30A 1C57A 2H6BA 1LCLA 2OXBA 2RS31 4S2HA 3AZWA 4NIHA 4ZPIA 2I45A 3POWA 3ST7A 3WNNA 1YIFA 4OCTA 3GJBA 1X8MA 2VZQA 2WWJA 5JOZA 3RZJA 4RHV2 3ZFFB 2R072 3NJVA 1GOFA 2WO3A 3J7LA 3ZN6B 5FY0A 2Q0AA 1OFSA 3WQ0A 3LOBA 3FL7A 1XYOA 5IUQA 5KXBA 2HWB3 1OD5A 1PIV1 2EXJA 4FTBA 3LEIA 2DCKA 2PAMA 4HONA 4CTEA 2V72A 1HRV3 2VULA 5FO9B 4CU9A 2NZ9A 1NLRA 1NOVA 2R062 1OPOA 4NR1A 4LBNA 3ZN4A 2VTXA 2AGSA 3OUHA 2GC2A 4LE3A 4LBJA 3WF2A 2LROA 4OHZA 5E8AA 5CFCB 1VRH2 4FPHA 4UFMA 1R081 2QQLA 5A3MA 2CWSA 4RSUA 1COV1 1VP6A 2BPA2 1QJFA 1JYXA 3N35A 3B00A 1HJGA 4D8MA 4KWLA 2BZDA 3WEZA 3TN93 4DRVA 5GLZA 4E4ZA 3OOXA 1OC1A 1KJRA 2H0BA 4UI9L 2HBTA 3NMBA 3WDUA 5C6CA 1PVC2 4LJHA 1RUI1 4FAGA 5LA0A 2EAKA 2IVIB 1B35C 2Y8KA 4GKYA 3S5AA 1PGSA 2AACA 3KWVA 4S2GA 5HV4A 1FMD3 3LIGA 4YG6A 5A1LA 2XJUA 3KM5A 4P9WA 3U07A 1EP0A 1RMU1 3TBDA 1IPJA 1W9FA 3A21A 5ABJB 4YW2A 1IS6A 1HIXA 1A8DA 1RUD3 1VAKA 3ELNA 4NOTA 5T5PA 5JR7B 1DZQA 1RVF3 3HMYA 3LZZA 4WZFA 4CUGA 2CAVA 2IXCA 1JYTA 2VMGA 4R9CA 3EHKA 4XURA 4QM8A 3ZXDA 4XFAA 3A23A 1YQCA 3WG3A 3VD4A 2VNOA 1O3RA 1POV1 4XIKA 2VD7A 5JIAA 3CU7A 1ST8A 2Y26A 2IXIA 5JVVA 5FRAA 4YVWC 2ZHNA 4AQSA 3H9AA 3CEWA 3OD0A 4TYSA 1QIQA 3NNGA 3PUIA 1YCIA 2ORXA 1CJPA 2YPDA 5HCAA 5LA2A 3MLJA 3M1HA 1UYYA 3HD8B 4ASKA 1ULCA 4Y4RA 4AVVA 2QBXA 1W2TA 2YDEA 5GALA 2VVEA 2RJ2A 4F3JA 4TLGA 1DP0A 1PX3A 4O61A 2OKXA 3U14A 3ZIWA 1QXRA 1RUF2 5EV7A 4DFSA 2A6VA 5C71A 2XWJB 1W3VA 3KV6A 4ASMB 5DG1A 5AFEA 3P3PA 2QQNA 3OGSA 3Q8AA 4OI2A 4JTNA 1D0GA 5CFCC 2VBBA 2VW0A 1XYPA 2OUJA 3K3NA 2C4XA 3IIIA 5FY1A 3OUJA 3UESA 4PCRA 2Y0OA 2A7AA 5FUPA 2ZPXA 5LASA 3BU0A 4NO4A 1PVC3 2UWCA 2NMNA 1OA4A 1JUHA 1TVGA 5H9SA 5LBEA 4QQOA 5JOYA 2ARXA 4IGQA 4UOJA 4C1WA 1DZTA 3VZOA 3ZLIA 2VECA 3K4ZA 4HSLA 4AQ6A 1PIV2 1RUE1 3JU9A 3KQRA 3VBUC 2YUEA 5JSRA 1CD3G 2ARAA 5IVBA 3UGHA 1DZRA 3I4IA 3FLTA 4TN7A 4XJWA 4COYA 3ZX7A 1Q5OA 1GLHA 2GP3A 2SLIA 2VVFA 3HWJA 4CDWB 4N53A 4P9LA 5KHHA 1AYN2 3BOWA 4CEYC 4YRDA 1D4M3 4WM7B 4R9BA 1ND3B 2Y64A 5GKAC 1CAWA 4M4PA 4CU7A 5GLWA 3ZIXA 3HVDA 2R0HA 2W2IA 5JI7A 1JTZX 2JG8A 4XABA 2YHJA 1ZREA 3A7QA 4Q0SA 5JLVA 5LA1A 5LA9A 1LODA 3NV4A 4RGGA 2EICA 1NCRA 1POV3 1OUXA 2BGCA 1ZRRA 4GH4B 2ZHKA 4NJ4A 2JKBA 2G9GA 1UMHA 1LB2A 4RHV1 1H1AA 3ZYIB 3H1YA 4B1MA 3E97A 1NQJA 5CB7A 2EIBA 5JXJA 1AR82 4NRMA 1N1VA 3I2OA 1RUJ1 3AJYA 3Q8BA 1V70A 4N7IA 2AUYA 3SH5A 5FYSA 4M3CA 1POQA 4Q4Y3 1Q8QA 3GXUA 2EXKA 4HSJA 4RFRB 5IVJA 2ZZJA 1HV0A 3O0VA 4Q4V3 3VV1A 2BTVC 1XU2A 1G6NA 1PO22 4AHXA 1CJDA 2BFUL 3USSA 1S2EA 3NNLA 2PELA 1F5JA 2Y6KA 4FOVA 4CVUA 3N4MA 3NKGA 4NHXA 4XUNA 1U0AA 1UX6A 1S0FA 2EA7A 3O5SA 3QBQA 1OKQA 5CKMA 3WCSA 1AX2A 1BK1A 4YNIA 2UWBA 1DGLA 5JOXA 3L2YA 5AVPA 1W8UA 4RQPA 2D43A 4Q29A 1K5JA 4ORFA 3DPRA 4EWAA 5A6QA 5IK5A 4NIGA 2OS2A 2WN2A 3T2OA 3U1XA 5I0DA 1HQNA 4AEDB 5A33A 1GP4A 1W6NA 4JGZB 4Q27A 1PM4A 1OI6A 5JMOA 4XVHA 2JIGA 4XBLA 5I0UA 5CEHA 3EBRA 1C3HA 4C1XA 5FLIA 5K9YA 5EPAA 2RS33 3BGAA 1IKQA 1S0IA 4RD7A 4GB33 3UKTA 2O0OA 4DXTA 1LOFC 2ARCA 4P9IA 1XQNA 1JZ4A 3GYDA 1TMF3 1RXGA 1CVNA 3MICA 2X8KA 3VBSC 3N9LA 1VBB3 1GOHA 3ILRA 4AHZA 2YYOA 1Y43B 3I2KA 2PLV1 1BLZA 1W6QA 3RYKA 1W8FA 3HNBM 1Z7S1 2WR9A 1REDA 3AVRA 1Q3EA 2P4EA 1H4HA 4XFHA 4CCOA 4GMP0 2AYHA 2V5DA 5APAA 3QCWA 5F2SA 4HZFA 3HEIA 1UU6A 4PQQA 3WSOA 4ARXA 4FP3A 1J58A 3CHXA 3VHPA 5C9AA 1DQ2A 5FQ0B 1AF9A 1AVBA 1G9AA 2VNRA 3R05A 1DFQA 4QKFA 1RB8G 2GN3A 4AFDA 3IM0A 2I2SA 1V9U1 2A1XA 3OEAA 3PU3A 4A41A 5FY4A 1QQP1 3WF3A 3IWZA 3WW2A 4XF4A 3QLQA 1AX0A 2ZX1A 5T52A 4CUBA 3T0DA 1BEV2 1AR71 1GUIA 1HB1A 4GALA 1OA2A 2DCJA 4QPGC 2V4AA 2XVLA 4LK7A 2XHKA 3VKNA 5LRSA 1ND3A 2BNMA 3RG0A 3VDBA 2WSUA 1PZ7A 1VMHA 4WVZA 5L19A 4QU2A 3SXWA 1VB2A 1XC6A 4JGYC 4O9GA 3OPTA 5FZFA 5DAXA 3POGA 4B4PA 2VOWA 1IOAA 4KWJA 4JX0A 5L9BA 5K0UC 3IPVB 3K51A 2IXKA 3ZDVA 5IW0A 4EN9B 4EQVA 4IEYA 1XXNA 1JOJA 4K9SA 3HNMA 1AR63 1E57A 2OPWA 2WZ8A 1QWRA 3I59A 4W50A 3CMGA 5C8CB 2BRTA 1MS0A 1PM7A 2QJVA 2QKDA 4FQZA 4IV1C 4JKKA 1TZOA 3OBTA 4PDWC 1AYM3 4U36A 4BISA 3WNMA 4CDUC 4KG8A 1W6OA 4AI1A 3BVCA 5ERLA 4D6QA 2XL9A 5EZWA 1QJX1 1YQ5A 4PIYA 2UY9A 1CIYA 1DQ5A 1H1IA 1F5FA 3SLIA 3DXTA 1ZZ8A 4FPKA 2NMOA 3AJZA 4IESA 3WCRA 1O4ZA 4RR3A 1O8PA 2VJXA 1PO13 2WO2A 3AKTA 3WDWA 1DCSA 1BHGA 3VBRC 2ZBJA 2W68A 1ULOA 1X33A 4GULA 1NCRB 1XYNA 1YQ8A 1UWWA 1XOYA 4MGZE 1BBT3 5T5OA 4AOCA 5HPOA 1XSRA 4LITA 5EFUA 3DPRC 5GLUA 1KFUL 3I3DA 3SCHA 1MACA 1DGWX 3NV2A 1WW4A 2VMHA 1ZBA3 4DOUA 2RHPA 4HETA 1PNFA 1GZ9A 4LHSA 2XJRA 4FXGB 4D6SA 5BNOB 3I2GA 4OI4A 4RS5C 1ND2A 3OYWB 4YVSA 1VALA 1CAUB 4JTOA 4LKSA 5SV5A 4CDXA 1LESA 2HJIA 1GICA 2HWB2 4XBQA 3OCPA 3PUSA 2Z79A 1YXWA 4Q4X2 4XPVA 4XZUG 3AB0A 5D21A 5JZGC 2X5IB 4AZZA 5KHJA 4J1WA 2IZWA 3ZR6A 4HKOA 4JKMA 3OEBA 1AYN3 1V6KA 5FZ0A 5FP3A 1IG3A 2GNDA 3U0ZA 3K4DA 3WW1A 1SPPB 4WVWA 4NAOA 2BBAA 3K46A 4AYUA 5A7NA 4KBBA 2D6KA 4OHXA 3ZYPA 3M3EA 3E5QA 1SBEA 3ALQA 1N1TA 2AC1A 1XNBA 1SDDB 1O91A 2GMMA 2UWAA 3WP4A 4Q2FA 3J8F1 3AZYA 5GZGA 1QF3A 1E5RA 2WWSA 3PIGA 1V6LA 2O1QA 5KHGA 3ZN5A 2LW8A 3HOBA 3NKTA 4LORA 5FK8A 1SDWA 3LOIA 2FMYA 2WA4A 4Y1ZA 3VZKA 2XJTA 3N7LA 5FMDA 2LRPA 1K5MA 3FHAA 3NJXA 1NY72 2ZJCA 2LS6A 3MIGA 5F8PA 1ZX5A 1W03A 4GIQA 3S7EA 4PIZA 4P5HA 4IEUA 3SH4A 5ACA3 5J37A 4BK4A 4MGSA 4L2NA 4SBVA 3B93A 2HBUA 4LA3A 3WG1A 2DVBA 3MW2A 2VOTA 2ZEYA 1OOPA 4H55A 2C26A 2Y6GA 2BNNA 2HYKA 3M3IA 2VH9A 4QXHA 3N36A 3OBRA 3ZYBA 5C8CC 2ORZA 2G9ZA 2XJQA 4KU7A 2WT2A 4A4AA 3WF4A 1E5HA 4LULA 1Q8PA 3MV01 5A33B 1RUG2 5CNAA 5D1IA 2RMU2 2AZ5A 4YVSB 1XNCA 2ADEA 2OPKA 5DUXA 3FE5A 4BXFA 1BK0A 4ZY9A 2JE8A 2VM9A 2VQAA 3J8F3 4W65A 3CZUA 1OT5A 2ZEWA 3ABZA 3WDTA 4FPCA 5AC92 4FPGA 2PMWB 4E8DA 5D8AC 2CDOA 2ZGKA 4AVCA 2F6BA 2G1MA 4OHWA 1R092 2R6QA 2J1EA 2A70A 1PMIA 3VKMA 1BEV1 4UFHA 2XHNA 2HLEA 4KQ7A 4LQRA 1QY4A 2VVDA 2W5FA 2JDPA 1H9WA 4RS5B 3VDDC 1NE6A 1ENXA 5D2AA 2WS91 2D6OX 1FATA 1VBA3 3ASIA 1NYWA 2YGMA 3PMSA 4Q4Y2 3ZXEA 1W2AX 5E89A 5ISLA 2B8MA 5FZ6A 4WBBA 2XKOA 2ZAHA 4CP9A 2E31A 3GJAA 3NVCA 3TEZA 1XJAA 1HRI2 2ZGMA 3THCA 1ODMA 2CNAA 4XFCA 3PJQA 1PX4A 1OH3A 1ULEA 4Q5OA 2CSGA 5H9PA 3S30A 1ZBE3 3CBNA 1CAUA 2XJPA 3FN9A 2V5YA 3LFIA 4NUBA 4CP1A 3B9IA 3T3YA 3OG2A 2HWF2 3MW3A 4FAHA 1LKNA 3ZYFA 3POJA 3VBSB 3CO2A 1AXYA 4HKWA 3SMHA 5FXWA 4M3CF 3VD3A 4Y4YA 2DBIA 1RUC1 1BZWA 3CZJA 5J36A 3RZKA 3THPA 3H3ZA 3I2FA 3PVOA 1JHNA 4PF1A 4QKBA 4Q4W3 4PLMA 1X8EA 2I07B 5FKBA 3HJRA 5HXVA 4EZ4A 3HQXA 2RR12 1I5PA 3PVEA 4QM9A 4CEWB 1H2KA 1L7LA 2MEV2 4BQ4A 3U4SA 3KQ4B 1PK6B 4FI9A 2WNVA 4E2QA 2XMLA 2K46A 1NKGA 4DEQA 1WLTA 5FV3A 1RUE3 4FXKB 4JDMA 2JD4A 1KRIA 4Q0UA 2WZR3 3C7EA 3O0WA 1S0CA 3UJQA 3T1LA 2ZKLA 1QNWA 3ON7A 5EYYA 2Q8OA 1A78A 2ZS6B 1F35A 1S55A 3JQWA 2Y33A 3AYAA 3FLRA 2D3RA 4B7EA 4BMBA 2TNFA 1ULDA 2E26A 1M4WA 3KVBA 4QGMA 2JECA 4YGBA 1OQDA 1AR83 5FY5A 5FPZA 3V65A 2OUHA 5AVAA 3VBSA 1JZ8A 1UKRA 3J26N 4Q4V1 2PFWA 3VD5A 1NA1B 3AP4A 1VMJA 3UKVA 5H9RA 1UF2C 3KGZA 3O7OA 4AVSA 1DLLA 2PHTA 3ETQA 4A42A 1Y3TA 4XHXA 2P6CA 1UYZA 1RUJ3 2CGNA 3LCPA 3GDBA 4R4ZA 5G05L 2ZEZA 5IJRA 1UY1A 5FZBA 3SHRA 4DZGA 3FZ3A 1TG7A 2O8OA 5FK7A 4LR4A 2F17A 4RR3C 5FYMA 1EUTA 4K1ZA 2OYZA 1GZWB 3JBG1 3KHBA 1G8WA 2YBKA 3JD71 1OF3A 5FZLA 3IDAA 3J7HA 4FQ4A 4CPBD 3PJYA 1HXS3 2JD9A 4NWVA 3R6SA 4NIAA 1BMV2 2VAUA 1H8TA 1OQ1A 2PTMA 1ND3C 3ETPA 4AVAA 1LOBA 5FZ8A 3IDCB 4GJZA 4O7XA 1JYIA 4URAA 3C8XA 3AFGA 3VGIA 2PLV3 2WSVA 1BCXA 3M3OA 3GZTB 4YW3A 4BMEA 1GQHA 5FPXA 4RN5A 3IAPA 1QJX3 4P00B 2BVVA 1SLLA 3ZYHA 1CPNA 1F2NA 3FFQA 5IWFA 1AJKA 1XU1A 4O9EA 3M7AA 3E1F1 4RA0A 5JOWA 1SCRA 1UY3A 2ZGLA 4MGKE 1XNAA 3THTA 3WQ1A 4ATFA 5BNPA 5C3QA 2VUJA 4FPEA 4ATEA 2JDMA 2XL7A 1C5IA 1H4GA 4GWNA 3DYPA 3WW4A 1G86A 2QCSB 4LHKA 5IHRA 1QU0A 4OHVA 4YM0A 1H9PA 2QZ2A 3J7MA 3ES4A 5T3NA 5F37A 2B4KA 4DPNA 4UW6A 2CAUA 2ZHMA 1O4TA 1JI6A 2X05A 1VBD2 5D8AB 1HKDA 1UIJA 2ZKNA 1OXCA 1W8OA 4Y33A 3PDQA 3QH7A 2BWCA 2JJ6A 1Z7S2 2KD7A 2VOXA 3NAPB 5JXGA 4TZDA 3LA7A 1I9RA 2HEYF 5FMOS 4P9GA 5C9AC 3B69A 2ILMA 2Q1FA 5E1RA 1WMXA 4Q4Y1 1RVF2 4BIOA 4C0HA 5DMYA 4H2AA 3T2TA 4XJAA 4A6SA 4EWDA 5FZGA 4CDQA 5GZDA 1W9YA 1FV3A 3I2DA 4C0BA 3SITA 4DO0A 2IVJA 3WXPA 4CRQA 4QB1A 4AVTA 1CX4A 2WFF1 1W6PA 5KR7A 2ZGUA 3HBZA 4M3CB 3LKJA 1O3QA 3ZFGA 1WW6A 4QDRA 3VDDA 4ZZ8A 2ZX4A 3WQ7A 2YXSA 3E5UA 1UD1A 1UOFA 2ZGOA 1RJ7A 1RUH3 4CDUA 4SLIA 2JDZA 4G4FA 3RDIA 1SEFA 1UMZA 4B29A 2C5DA 2WBKA 3ZM8A 2UURA 4YGEA 3TN92 1VLNA 3T09A 2CY6A 2W1UA 5A32A 1SBDA 1ULGA 1SLTA 3BU7A 3VHOA 1ZRCA 1F4AA 2BGPA 2Y6LA 3CJIB 3IMMA 1PGW2 1WMEA 4UT5A 4CYDA 3RZHA 3HPNA 1JUIA 4UW5A 5B2GB 4NHYA 2WNUA 2VZUA 3MDPA 5FY8A 1YI7A 2QQWA 2ES3A 3KSCA 4NIIA 1WD4A 1UX7A 2P3IA 4M0NA 4UBGA 5FY9A 5LEKA 3KT7A 1RHI3 3B3QE 3RYRA 4IV3C 1QMJA 4CP0A 2F4PA 2AEYA 1S0BA 2PHDA 3AMMA 3G7DA 5FO7B 1ENRA 2WQ8A 3PTRB 4Y20A 3SKVA 4BHPA 5BY5A 4QPGA 3BKZA 1R082 1W2OA 2JICA 3VB9A 3TN91 4COWA 5KXDA 3K75B 4YVWA 4A45A 2WO7A 1N1YA 4MXWB 4IL7A 1RJ8A 3LWCA 5I8YA 1UOGA 2VMCA 3AVSA 4PHZA 3NV1A 4GXLA 1UY4A 2JENA 5A7QA 5KC5A 5F6LB 4QHBA 3POFA 4Q0PA 5E88A 3KT1A 4BQYA 1ZBA1 3C3VA 4LOSA 4EN0A 2VBDA 1J59A 1LRHA 4NPMA 3VL9A 3FJSA 1CZTA 3LB9A 4IE4A 3JD73 2WNUC 3WINE 3TNPB 2ZGPA 4BQ3A 4CCEA 1N3PA 4FFGA 4BQ5A 1TQ5A 1UXXX 2HWB1 3FWEA 3IBMA 4JCKA 5DUVA 3HT2A 5JAXA 2WNEA 1M06G 4MADA 5ANQA 4D69A 3TEYA 2QQJA 3WDVA 1DYKA 3OTFA 2DVFA 1RGSA 3K4AA 1G9CA 1CWPA 4H7MA 4L92A 2DBNA 2ZTNA 2WFPA 1MZ6A 1QGLA 2RDNA 1F9KA 3AP6A 1MS1A 2DF7A 4HPKB 5DG2A 2D3PA 5D8AA 5FPBA 2VZOA 4CXYA 1DHKB 5A6YA 2OZ6A 1XNKA 5BXXA 1AJOA 1V6MA 1URXA 5LBFA 2ZGTA 4XQWA 5LATA 3VBFC 2DVAA 2G4IA 4JQRA 4IW3A 1Q8VA 1CIWA 5EHDA 3AP5A 1N3QA 1OD3A 3ME2A 4OUSA 3BTXA 4CDWC 2WYSA 3FFZA 4OLLA 2YG0A 1FNZA 1W0PA 1Q43A 4WV8A 5T5JA 5J96B 3BCWA 2C1FA 1EV12 4CDQC 5HCHA 3EB7A 2QUOA 2EAAA 3I59B 4BLIA 5CG8A 1SMVA 1EV13 4E4HA 1LENA 1R083 1UY2A 5I8SA 2Y6JA 2E7QA 1GZWA 1AXKA 1BKZA 2WUHA 3JUUA 1W39A 1D4M2 4Y5Z0 4L99A 5F3EA 3W5NA 1PMJX 1W0OA 3WNOA 3ZDSA 3VDDB 3AZZA 5FXXA 3W9AA 5A3UA 2VOKA 4EN6B 1JODA 4HKLA 2QTWB 3OY8B 3W21A 3HN1A 2HKXA 4AQTA 3ZPOA 2AH2A 1GU3A 4K8RB 4OZOA 5HBAA 1FOD1 5LRRA 4JRAA 5FYHA 1I6XA 4DMIA 4YG3A 5IVEA 2V73A 4YM3A 2DDUA 3E6CC 3NAPA 4K1YA 4Z92B 5DZFA 2Q1MA 3DPRB 2W39A 5DZGA 4DB5A 3KCYA 3RZMA 4LLFA 2VMFA 1SFNA 4K40A 3UNPA 1KGYA 3CJIC 5LY2A 3MFAA 3C7OA 2WLPA 2WKKA 4Q1RA 1DGRN 2XH6A 1ND2B 1AR73 3OYWA 1NZCA 4L8QA 1MS4A 1TEIA 4OMCA 4QXBA 3RJRA 4DUXA 3RFRA 2VL4A 1CAVA 3MPPG 5I0TA 1JU4A 1RIRA 1RMU2 1ULPA 1F15A 4BZ4A 3D82A 5DXDA 1LOAA 2D6MA 2HWD2 1IQDC 1YUDA 2QQMA 4CEYA 4CCJA 3I54A 4LO4B 3RMYA 1UZZA 4YVWB 5E16A 2QQIA 1CGPA 4E9KA 4UF0B 2ADDA 3B9CA 1PZ9A 1TME3 4RFT0 1DQ6A 4XXPA 1V6IA 2PAEA 3O1VA 1LNSA 1ZBA2 1AZDA 1X9TA 4LIUA 4UFIA 4HVRA 3PHMA 2DCTA 1IS5A 2CDPA 4FPOB 3PVNA 4FFFA 1B35A 3KLSA 3S7IA 5L36A 5B4NA 5KXEA 3VD7A 1XNTA 1WGPA 1S0JA 2WLQA 1HB4A 2WNUB 3UGFA 3ZVXA 4AEDC 1CONA 5C5UA 3P5BA 4CCNA 1SFYA 5GZFA 5SV8A 1Y7BA 3U11A 1X50A 1QEXA 3DEMA 2A71A 2HWD1 4XUTA 1JS9A 4ISQA 5HI0A 1C8M1 3GHMA 1V6NA 4GWIA 2YB7A 5FYYA 4YGDA 4QPYA 4XF3A 1S1AA 1UNBA 1W04A 2D6NA 4BDVB 1RC6A 2ZGNA 1C8M3 5C33A 4MXWA 2YY1A 4JZRA 1NT0A 4CZSA 4BH9A 4D6RA 3GZUC 1UU5A 1JZ2A 3RI9A 1S0GA 1J3PA 5IAVA 4H3WA 3KB5A 3Q8FA 2Q8EA 4AAPA 2D6PA 3NNMA 1Y9GA 3QD6A 4LEJA 5JPMB 1UZYA 1V6JA 2A73B 2MEV1 4LO7A 4ZU4A 3FC0A 4ARYA 2YC0A 1FT9A 5IK8A 2WQZC 5DPNA 4GQ7A 2MNGA 4QXCA 4CCKA 5BNPC 1WLCA 3KGLA 4UAPA 1W6NB 4JGZA 3BYWA 5GM0A 4AK3A 2O8QA 4XBNA 1SHWB 4GH4C 2O14A 3OJBA 4NPRA 1Z7S3 2BU9A 4FP2A 1H6YA 1KEXA 4QX0A 2E53A 3POIA 4IXLA 1RUJ2 3AM2A 4WM7A 5FZEA 4XF0A 1VBE1 3ZYGA 4Z8BA 5JZGA 5J3UA 2DFBA 4WVMB 2FHRA 4RHV3 3K48A 4RR3B 3M8LA 4XC9A 4YG0A 1FPN1 3I49A 4JGZC 2LALA 1QDOA 2W94A 3BI3A 3A4UA 1TME1 4D7TA 5FZHA 1DG6A 1ZA4A 1WBFA 2VCCA 3HT1A 1QJZA 1R1A1 5C3PA 4LLOA 2IUWA 4K20A 3JQXA 1XPWA 2XXZA 4OULA 1LGNA 3I7DA 1W8NA 1IPSA 1YO8A 2PHLA 4Q0QA 4LHNA 4OZXA 3O12A 2LM3A 2JG9B 2NQYA 2NPIA 3KV9A 1HLCA 3TYJA 1WBLA 3T1MA 1C8M2 2CGOA 1VJ2A 2XVKA 1HB3A 2BWAA 1AYM2 1KS4A 5JR2A 4NMIA 1RUF3 2CWMA 2W87A 2A6XA 3N3HA 3SEPA 3WF1A 1I5ZA 2K0GA 5DAQA 1QH7A 3FMGA 4JHTA 3ZPYA 5EJ3A 3WX5A 3Q8CA 2JG8B 5LK7B
chains in the Genus database with same CATH topology
1GWMA 1W90A 2K46A 1W8UA 1OKOA 4LK6A 4LK7A 1V0AA 3ZYHA 4CP9B 4LJHA 2O14A 4BQ3A 1UOJA 3ZYBA 3ZYFA 1HN0A 4LKFA 4BQ5A 2KR2A 5D21A 1WCUA 4AL9A 4CPBA 2JWPA 2Q1FA 1WMXA 1W8ZA 4BQ2A 3ORJA 2LRPA 4YW7A 1WZXA 2LROA 4A6SA 4CP9A 4YW6A 1W9FA 4CPBD 2VXJA 4LKEA 3F95A 2C24A 2WYFA 1L7LA 1GWKA 1W8TA 1W8WA 4LKDA 4BQ4A 3UT0A 4YWAA 1OH3A 1GWLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GWM A;  1W90 A;  2K46 A;  1W8U A;  1OKO A;  4LK6 A;  4LK7 A;  1V0A A;  3ZYH A;  4CP9 B;  4LJH A;  2O14 A;  4BQ3 A;  1UOJ A;  3ZYB A;  3ZYF A;  1HN0 A;  4LKF A;  4BQ5 A;  2KR2 A;  5D21 A;  1WCU A;  4AL9 A;  4CPB A;  2JWP A;  2Q1F A;  1WMX A;  1W8Z A;  4BQ2 A;  3ORJ A;  2LRP A;  4YW7 A;  1WZX A;  2LRO A;  4A6S A;  4CP9 A;  4YW6 A;  1W9F A;  4CPB D;  2VXJ A;  4LKE A;  3F95 A;  2C24 A;  2WYF A;  1L7L A;  1GWK A;  1W8T A;  1W8W A;  4LKD A;  4BQ4 A;  3UT0 A;  4YWA A;  1OH3 A;  1GWL A; 
#chains in the Genus database with same CATH topology
 2ET7 A;  5JDB A;  1MZ5 A;  4XDP A;  1PMH X;  4ES9 A;  1QKQ A;  2ZMK A;  4P9X A;  1SCS A;  1W0N A;  4CEW C;  3DKW A;  4XMI A;  4XZP A;  2BGO A;  2J1V A;  4FPY A;  1UKG A;  2QVS B;  4YZ4 A;  4XJZ A;  3AFK A;  1RUN A;  1ZA7 A;  4XAC A;  1RUI 2;  1YNA A;  2FMD A;  2W47 A;  3AMN A;  5FQ0 A;  4XAE A;  4MUV A;  2RS1 1;  4TWT A;  2GC1 A;  2HWF 3;  4JHZ A;  2WAA A;  4C8D A;  5L7O C;  5CA6 A;  1CES A;  2QNK A;  1BBT 1;  1UYP A;  3OPZ A;  3V64 A;  4AG4 A;  4LKE A;  3JBG 2;  4Q8K A;  3ZFE B;  1EAH 2;  2Q5T A;  4XFG A;  4N53 B;  2A3W A;  5FLJ A;  1QNY A;  4AGV A;  2J1A A;  5I91 A;  2J1T A;  1VBC 3;  2E32 A;  1OVP A;  2A6Z A;  2WFF 3;  4DXZ A;  3ZFE C;  5DQ0 A;  2YBP A;  1ALY A;  4JRL A;  1W9W A;  3ZOI A;  1HN0 A;  1UAI A;  1ASJ 1;  2D98 A;  2VZT A;  2ZX0 A;  5FZ4 A;  2Q30 A;  4QKN A;  1TE1 B;  1RUE 2;  5A3T A;  2FDG A;  1NLQ A;  1RUH 2;  4RL7 A;  3WNL A;  1O3T A;  1ZZ9 A;  2XLA A;  4Y5S A;  1RVF 1;  4FOY A;  1YRZ A;  4PLO A;  3HQU A;  3WF0 A;  1GWK A;  2R1B A;  5CYY A;  4IEX A;  2VMD A;  5FMB A;  2JG8 C;  4HN1 A;  3PVB B;  1AL2 1;  4DQA A;  1OKO A;  2VCM A;  4QHO A;  4AE2 A;  4GWJ A;  5F3G A;  4BQX A;  4MYE A;  3QH6 A;  3RGB A;  1VMF A;  3GCX A;  5ANN A;  3MZH A;  2EF6 A;  2XWB B;  3GZA A;  5LK5 A;  3T4H B;  4AI0 A;  2JX9 A;  3PLQ A;  4LHL A;  5FMC A;  4U2A A;  2GU9 A;  5DUW A;  5CIR A;  3DL3 A;  1QH6 A;  1F8V A;  2E7A A;  2FCV A;  1Q8O A;  4IEQ A;  1UYX A;  3AZX A;  1EPW A;  1TME 2;  4MHR A;  1J83 A;  3OGR A;  5FUI A;  2K9Z A;  4LMF A;  1UIK A;  3SNM A;  4N43 A;  2FDK A;  1PK6 C;  4Y22 B;  1AL2 2;  2FCU A;  1W2N A;  1SZB A;  1W90 A;  1YJK A;  4ISR A;  4BQW A;  4HXC A;  3H8X A;  3AYC A;  1ZNP A;  2RMU 1;  2YU2 A;  2FDJ A;  1MEC 2;  3IMN A;  3NRU A;  1YHF A;  2B7Y A;  2XBO 3;  3N7J A;  4XFF A;  5FYB A;  5LBB A;  4MH0 E;  3MBW A;  5IT6 A;  1D0H A;  4HOO A;  1DYP A;  2W95 A;  3DXU A;  1CZV A;  1D4V B;  4CSW A;  4CPB A;  1LTE A;  2Z4F A;  2EXH A;  4DIN B;  2MEV 3;  1W6Q B;  4FVV A;  4YW5 A;  3JD7 2;  5HCB A;  1DIW A;  1A8M A;  2UYA A;  4XDO A;  1PGL 2;  4PF5 A;  1R09 3;  2Z42 A;  3MF9 A;  4BE3 A;  4W6Y A;  4Q0V A;  1FNY A;  3HN3 A;  3EMR A;  5J09 A;  4LBO A;  5F5I A;  3VBO C;  4H7L A;  3MW4 A;  3OGJ A;  1C1L A;  1C4R A;  2XG3 A;  2Y0I A;  3EQE A;  5CFD B;  1R1A 2;  3BIE A;  4MET A;  4QHZ A;  1XRU A;  3TEX A;  2P3Y A;  2RJL A;  5LCW L;  2A75 A;  2ARB A;  3RWN A;  2E9Q A;  3ACF A;  3P6B A;  1CAX A;  2RG4 A;  4Y22 A;  1VBD 3;  1IZ3 A;  1AR8 1;  1K45 A;  3LD8 A;  4QB2 A;  4YLZ A;  4YYO A;  4AFB A;  3DUI A;  4BQ2 A;  1KXG A;  2BV4 A;  3MV1 1;  4K3U A;  3TAY A;  4CXX A;  2BQP A;  3ACI A;  3D0J A;  2P3J A;  2W0X A;  3M70 A;  1DDL A;  4NHL A;  2WZR 1;  3R0R A;  5EXO A;  3RI8 A;  1K42 A;  5JI9 A;  4AGG A;  1LU2 A;  4BA6 A;  4A6O A;  5JPN B;  1H6X A;  1RUD 2;  4I0A A;  4LA2 A;  5T54 A;  3WR0 A;  3O1P A;  2VQT A;  3B02 A;  1IG0 A;  4Z82 A;  5FWE A;  2B42 B;  4Y5T A;  5LZ6 A;  3J7N A;  3ECQ A;  2WJS A;  3IPV A;  4NN0 A;  3O1O A;  4UFK A;  1Z0H A;  2ZML A;  3AKR A;  4BYY A;  2RS5 1;  4QX1 A;  1NX9 A;  3CIH A;  3ZYR A;  1D4M 1;  5IAX A;  4E2G A;  2GNM A;  1OF4 A;  2GNT A;  3IKW A;  2J1R A;  3FX3 A;  3KZ4 C;  4NE9 A;  3ZMO A;  4YW6 A;  1JYW A;  4P5Y A;  3I8T A;  5FPU A;  2G9F A;  2PLV 2;  3VBR A;  1TMF 2;  2WYF A;  2WZR 2;  1LHV A;  2HWE 1;  3VBF B;  3VKL A;  4A7Z A;  1YLL A;  3MEP A;  4UFL A;  2HWF 1;  2ZHL A;  3URF A;  3ZXA C;  1PO2 1;  2EID A;  5GZE A;  2TBV A;  5EYX A;  4HN0 A;  5A70 A;  1X82 A;  4RYD A;  4LBM A;  5FZO B;  1SPP A;  3AMH A;  4G3Y C;  1ODN A;  1QJU 1;  1RL3 A;  5CBL A;  1E5S A;  1HJF A;  2JDY A;  1LHU A;  1W3X A;  1O7F A;  4IV1 A;  4PDW A;  5F5Q A;  1POV 0;  4AL9 A;  3V0B B;  3KVA A;  1HRI 1;  1OMI A;  2DV9 A;  5KXC A;  2RDQ A;  5JCT A;  1KQR A;  2W08 A;  2QQK A;  3PU8 A;  4Y24 A;  5C3O A;  4BWO A;  2PAK A;  5BNO A;  4QMA A;  1HV1 A;  3ITQ A;  2P17 A;  4MZU A;  4AW7 A;  3A22 A;  1BEV 3;  1DBN A;  5FYZ A;  3VD9 A;  4HBN A;  3VDA A;  4OI0 A;  4XXA A;  3LE0 A;  1LHN A;  2JDH A;  4ZS2 A;  2BBV A;  4FPJ A;  3LA3 A;  4JQT A;  2VME A;  4GZ9 A;  3ES1 A;  2ZX3 A;  1O6U A;  2LTN A;  2Y38 A;  1FYU A;  2Q8D A;  4XE9 A;  1MEC 3;  5C5T A;  4XCB A;  1COV 2;  3MIE A;  3UET A;  4RGK A;  5C3R A;  1T6B X;  1W9S A;  4I2O A;  5IAT A;  3I3E A;  1PHM A;  2H6C A;  2RE9 A;  3VBH B;  5A7O A;  2X5I C;  5AC9 3;  1RIT A;  2FDH A;  3T0B A;  1LAJ A;  2Y60 A;  3APB A;  3VHN A;  2KA3 A;  1LOE A;  4AQ2 A;  4UYB A;  2CU5 A;  3FUO A;  1AUY A;  2L9L A;  3FBM A;  4QB6 A;  4DXR A;  1U5I A;  2Z69 A;  3VBO B;  3WG2 A;  1GYK A;  1QJU 3;  4JVA A;  4MSV A;  4NRP A;  2YGL A;  1VBB 1;  4NID A;  1V9U 2;  4W6W A;  1RUO A;  1CAX B;  1OUS A;  4I0B A;  4EV0 A;  2ZEX A;  2GH8 A;  2ZGQ A;  4A2U A;  5ACA 1;  5T55 A;  1NCR C;  5A7S A;  1QQP 2;  3VBR B;  4HMZ A;  2YC4 A;  2J7M A;  3ZYJ B;  2W92 A;  1NLS A;  4AGR A;  2E33 A;  4BLJ A;  2HEV F;  1RUI 3;  2J42 A;  4EWE A;  5A32 B;  5F3C A;  5JUV A;  2DVD A;  2W1Q A;  2R30 A;  3L2H A;  2WNO A;  1JYC A;  1RUD 1;  1LR5 A;  1WA6 X;  2B9V A;  4N53 C;  3VKO A;  1O5U A;  1B09 A;  1GQP A;  2DFC A;  4KWK A;  2VNG A;  2QQO A;  1PO2 3;  4QPW A;  1L7Q A;  2GNB A;  4XQ4 A;  4QPI B;  4QXK A;  2VZS A;  4CEW A;  2BVB A;  2P34 A;  2WS9 3;  4MXV A;  1UQX A;  4XTP A;  5A6X A;  2GMP A;  4DIQ A;  2HWC 1;  3IB3 A;  1ACC A;  4MGQ A;  3W5M A;  3VBU A;  3A0N A;  1C5H A;  3RPQ A;  5EWS A;  2WII B;  2X53 S;  4CDW A;  3POE A;  5CIS A;  1GAN A;  3WT3 A;  2X09 A;  1NY7 1;  3AKQ A;  2XUE A;  1D2S A;  4CP2 A;  5GZC A;  4COZ A;  1W28 A;  2XQX A;  3LA2 A;  2FZ2 A;  1W6M B;  1XE7 A;  3ORJ A;  3V56 A;  4ZU7 A;  4IQP A;  1F31 A;  2ETE A;  2QDN A;  4W6X A;  1VRH 3;  1GFF 2;  1VBD 1;  4Z2A A;  5F1R A;  2RS3 2;  1QJX 2;  1BMV 1;  3CL1 A;  4PI2 A;  3RJ2 X;  4O65 A;  5F5C A;  3U78 A;  1VE0 A;  4QT6 A;  3D6E A;  3AP7 A;  3N9O A;  1GV9 A;  4IV3 B;  4P9J A;  5FZA A;  4C91 A;  4GD4 A;  5F6K A;  1JYN A;  3BUC A;  2XVG A;  4PIX A;  4AXO A;  1D2Q A;  1PGW 1;  4OFG A;  1RHI 1;  1H2L A;  4CP9 B;  4YW1 A;  5A1F A;  2VMI A;  2JIJ A;  4XQD A;  3GHN A;  1UPS A;  3RWK X;  5FXZ A;  3X29 B;  1PO1 1;  2QZ3 A;  3USU B;  5FR3 A;  3GGL A;  3SCF A;  3H1M A;  2B9U A;  3E6B A;  3VDC A;  3H42 B;  4GA9 A;  1CAV B;  3WV6 A;  1TMF 1;  1MZF A;  4NWW A;  1WWY A;  3AP9 A;  2TUN A;  3MLL A;  1RIN A;  4FBF A;  2BP6 A;  1S4C A;  4CEY B;  4IEP A;  4LBQ B;  2GN7 A;  3OF1 A;  4ASL A;  2YFZ A;  2ZZQ A;  2FQP A;  1AYM 1;  1ZBE 2;  5A3P A;  4ES8 A;  4M4R A;  2R32 A;  3NNJ A;  2QE3 A;  2VXR A;  3BTA A;  4YZ2 A;  3RNS A;  2NM1 A;  4QWN A;  1MPX A;  3T30 A;  4XOG A;  1I1E A;  1X9P A;  2YFU A;  1OQE A;  4Q1P A;  2PQS A;  1HN1 A;  1XE8 A;  1BVV A;  5I8T A;  4NRO A;  5L7O A;  1PVC 1;  1NXM A;  4M3C E;  4EN7 B;  4MLO A;  4E27 A;  5K4L A;  3T0A A;  3WUD A;  4URT A;  3RZZ A;  3O1T A;  1VBB 2;  4X6Q B;  3DKQ A;  1AYN 1;  3A0K A;  3IDB B;  3GBW A;  4IND A;  1S2K A;  1Y9Q A;  3UK9 A;  5C70 A;  1SAC A;  2ZX2 A;  2R04 2;  1D7P M;  3NO8 A;  3SCG A;  3VBF A;  4Z2W A;  4FFI A;  1VBE 2;  4QPG B;  3SEE A;  1AR6 2;  3O1M A;  1QXP A;  3RMX A;  4D7S A;  4IEZ A;  1OA3 A;  4TTG A;  1K12 A;  3PL0 A;  3N9N A;  2MPF A;  1JMU B;  3HBK A;  4I02 A;  2D97 A;  4BU2 A;  2VTF A;  1ASJ 2;  1WLD A;  3ZR5 A;  4FO9 A;  4UWD A;  3H8R A;  5J1X A;  3UKN A;  4KL1 A;  1MQT A;  1XB9 A;  3DCQ A;  1GZT A;  2BUK A;  3KS7 A;  3OGG A;  3CKH A;  1RHI 2;  4L97 A;  3UGG A;  4MO3 M;  3AKP A;  3WY6 A;  3V0A B;  2HWD 3;  3ZSJ A;  2ERF A;  4X8N A;  5BYN A;  1NAE A;  4CXW A;  1UOB A;  4XAA A;  4OQ8 A;  2IXJ A;  2XLF A;  2NLR A;  3I2H A;  4P08 A;  1BBT 2;  3H1W A;  1JBC A;  4B7K A;  4BM8 A;  1RUC 3;  1H2M A;  3J4U H;  4MOA A;  3AZV A;  2TEP A;  2R07 3;  4A3Z A;  5FDB A;  2E63 A;  5F9T A;  1RUC 2;  3W58 A;  3VUO A;  2J1U A;  1TNR A;  2VU9 A;  4J6G A;  1RYY A;  1G7Y A;  3K77 A;  4RGA A;  2Y6H A;  3ZO0 B;  4FTE A;  1LUL A;  5IK7 A;  1H8V A;  4QX3 A;  4HPK A;  2HEW F;  2XBO 2;  3AL5 A;  1HQL A;  2OX0 A;  5FAX A;  5TSW A;  3THD A;  4AFC A;  4DXS A;  3MI8 A;  4LXL A;  1B35 B;  1A6C A;  1V00 A;  4Q26 A;  4AI2 A;  4PI0 A;  1UZV A;  3H7J A;  1AX1 A;  4BXS V;  3VKF C;  5FMO L;  1W2U A;  3KF5 A;  3H8O A;  1F4H A;  5BNN C;  2BW8 A;  2ENR A;  3VBO A;  1XSQ A;  2A3X A;  3LSE A;  1J1T A;  1GNZ A;  2Q8C A;  1OSG A;  3DEC A;  3IAQ A;  3VZN A;  5L9V A;  5A7P A;  2RM2 3;  2VOV A;  2GC0 A;  2DU1 A;  1U5X A;  3WUC A;  3ZFE A;  1US2 A;  1JN2 P;  2GDF A;  5FKC A;  1JYV A;  4XYX A;  1CR7 A;  5FY7 A;  1A34 A;  2KR2 A;  4NPL A;  2EAL A;  2IC1 A;  5A6Z A;  5FZM A;  3KT4 A;  3TRS B;  4YFZ A;  2D5F A;  2R1D A;  1SLB A;  1SLA A;  2VZP A;  2J1S A;  4R8H A;  1BXH A;  1L7R A;  2CHH A;  2Y34 A;  4JC1 A;  3ZXK A;  1CPM A;  1PVX A;  5IK4 A;  1QQP 3;  4KI5 M;  4LBL A;  1QXJ A;  2OA2 A;  1PIV 3;  1NG0 A;  2R0F A;  4CDX C;  2EIE A;  3GAL A;  4Q8L A;  4GH4 A;  5FRE A;  1NXD 1;  1U5Z A;  1WD3 A;  1YJL A;  2IFW A;  3I2I A;  4DUV A;  2W1S A;  5EJ1 B;  5KHI A;  1APN A;  1KDK A;  2JB4 A;  1XND A;  3AYE A;  2BYV E;  4K7J A;  3WZ1 A;  3ZFF C;  1MZE A;  1MS3 A;  4DS0 A;  4NHK A;  3H3L A;  1U12 A;  5K8S A;  3OBZ A;  1IQA A;  4TSV A;  1X7N A;  5BV6 A;  2WQ4 A;  1W6P B;  4QKD A;  1BJQ A;  4GWM A;  5DDJ 1;  1W8Z A;  4W8J A;  4HL0 A;  4YZ3 A;  4IEW A;  2XB6 C;  3DV8 A;  4GB3 2;  5FLH A;  5FBJ A;  1MVQ A;  1UL9 A;  4XCA A;  1FX5 A;  2XQR A;  4TXW A;  2NP0 A;  2ZMN A;  1EPZ A;  1SLI A;  4IV3 A;  1AXZ A;  3AXD A;  4YPJ A;  4AR2 A;  4I09 A;  1I3H A;  4PBO A;  3PUR A;  4F8A A;  3H8U A;  5A3O A;  3GBG A;  3M3Q A;  2VG9 A;  2RR1 1;  4Y3O A;  3KCX A;  2W9X A;  2FDI A;  1WCU A;  1YYN A;  2K2S A;  4UW4 A;  4FTS A;  2JWP A;  2VCB A;  4D7Y A;  2XKP A;  4AED A;  1W06 A;  2GAL A;  4KGQ A;  1YFW A;  3D5O A;  1WCQ A;  5FZ1 A;  5FZ7 A;  1VBA 1;  1Y4W A;  3POS A;  3SKJ E;  1K5M B;  3OD4 A;  2C24 A;  2CYF A;  5C7G A;  5FOJ B;  1KIT A;  4CE8 A;  2R06 1;  3BPS A;  2DCY A;  4J1X A;  2GH2 A;  1YFX A;  2PQQ A;  3NQH A;  1GWM A;  3D8C A;  3RYP A;  3TOJ A;  1NCQ C;  4DEV A;  5LB6 A;  2D44 A;  3MPB A;  3U37 A;  1SQ4 A;  2YRO A;  3R4D B;  4F7Z A;  1KD7 A;  1OOP B;  3M3C A;  4LBK A;  1UN1 A;  4MGY E;  4DUW A;  4HK9 A;  4I0W B;  2GAU A;  4ET7 A;  4ZHN A;  1US3 A;  4E4S A;  2VUD A;  3J9S A;  5L9R A;  5FYU A;  1C28 A;  2DUR A;  3D0S A;  3JCI A;  1YQ2 A;  5LBC A;  3MGU A;  5FP4 A;  3ZXJ A;  4N90 A;  2XOM A;  3TNQ A;  4CU8 A;  5BNO C;  2ARE A;  4N8M A;  5FCC A;  4YAR A;  2WRA A;  3W20 A;  4DY3 A;  4XFI A;  2P1B A;  1YFY A;  4AFA A;  1ZVF A;  2WFF 2;  4IGO A;  3I3B A;  1PNG A;  3O1R A;  3GF6 A;  3UT0 A;  5F7U A;  1DYO A;  4QX2 A;  4QQ2 A;  2IXH A;  2OII A;  4XTM A;  4DY5 A;  2DCZ A;  5FO8 B;  5KC6 A;  3C7G A;  1R09 1;  4H14 A;  1JH5 A;  3DGT A;  1UPI A;  5FJK A;  1J84 A;  1W8H A;  2P2K A;  2PHU A;  2YU1 A;  5FP7 A;  4NRQ A;  1YWK A;  4EYU A;  2X29 A;  5KWR A;  1SG3 A;  4QDS A;  2XPJ A;  5I0S A;  5JWP A;  2ZGR A;  2R04 1;  5I93 A;  4PLN A;  3LDK A;  4AEM A;  5I0R A;  3MLK A;  4V2V A;  3C2U A;  3MIB A;  2R16 A;  4FPL A;  1ZZC A;  4K21 A;  4YM1 A;  3M4F A;  1QJY 1;  3NWK A;  1RUH 1;  4AHY A;  1DU3 D;  3MHZ A;  2CTV A;  1QJE A;  4GJY A;  1S0D A;  3LPF A;  1KDM A;  2DWR A;  1ZZ7 A;  2VC9 A;  3V0A A;  5FTT C;  2VY0 A;  4P9Y A;  5K7P A;  1H1M A;  4RQP C;  2BEO A;  1QDC A;  1N3O A;  5ACA 2;  3P3N A;  4JGY A;  2C9A A;  2JE9 A;  5DUU A;  1EUU A;  4HAN A;  1WCK A;  5C8C A;  3K3O A;  4ZXK A;  4AF9 A;  1OLQ A;  3AXE A;  5E6H A;  3ZXG A;  4FCA A;  3CLP A;  4L11 A;  5DDJ 2;  3KHC A;  1RXF A;  3JB8 A;  2DUO A;  3NAP C;  3PME A;  1NCQ A;  4ZU5 A;  1O5L A;  5AC9 1;  2RDS A;  5A3W A;  3FBY A;  1CAW B;  2RS1 3;  3HNY M;  4S2D A;  2VZ3 A;  4LO6 B;  4XUO A;  3LAG A;  1ZZ6 A;  3MUZ 1;  5FJH A;  2OQ6 A;  5JZG B;  4XDQ A;  3O1U A;  4YSF A;  1DGR A;  4E8C A;  5FP9 A;  5B4X A;  2BOI A;  4QGN A;  2B45 X;  2F4L A;  1O3S A;  1H8T B;  1YI9 A;  3NV3 A;  4D94 A;  1SLC A;  3O0X A;  4XIL A;  3VHR A;  3KV5 A;  4ITC A;  3S6P A;  5BNQ A;  2DVG A;  3AMQ A;  3AC0 A;  3J8F 2;  4HFS A;  5EQU A;  5C4W A;  4BB3 A;  2D93 A;  1LJ7 A;  4N43 B;  2RDR A;  4XEZ A;  2OVU A;  3LIH A;  2A6Y A;  3BN6 A;  5A7W B;  1A3K A;  2BOJ A;  1AR9 3;  1UCX A;  1KFX L;  4I01 A;  1TNF A;  1VPH A;  4JDN A;  4CCD A;  4EN8 B;  1OFN A;  3PIJ A;  5DAP A;  4PQ9 A;  2RS5 2;  2BJS A;  4XW3 A;  3ENR A;  3LDR A;  5J98 B;  1MQT C;  2PA7 A;  4L0P A;  4UW3 A;  1JZ7 A;  4COV A;  3QAC A;  1AL0 G;  1G9B A;  3IT8 A;  1IHM A;  4XJ9 A;  4EJR A;  1W05 A;  4IE6 A;  1QOO A;  1UZW A;  2B46 X;  1DQ4 A;  2G19 A;  4IET A;  1W99 A;  4QDQ A;  4WM8 A;  3W59 A;  2OQ7 A;  2VGD A;  3BPZ A;  1ZRF A;  1RMU 3;  1W8T A;  4LUK A;  5FP8 A;  2IWG B;  1SFP A;  4LT5 A;  4GB3 1;  4G9S B;  1S2B A;  3OB8 A;  2P6H A;  1X36 A;  3LDB A;  5EJZ B;  5T5L A;  3OSD A;  2HWE 3;  3RQ0 A;  3Q8E A;  1WA4 A;  3T08 A;  3ZFF A;  4E4D X;  3AMP A;  1XBF A;  4HK8 A;  2ZAA A;  4N43 C;  3ZSE A;  1GR3 A;  5CAZ A;  2W3J A;  3B01 A;  4D3W A;  3TWI A;  3I97 A;  4IGP A;  1RTV A;  1L3J A;  1FI2 A;  3BAL A;  3IDE A;  4Y1U A;  4BIF A;  5C4W B;  5C9A B;  3VZM A;  3LF7 A;  3U4X A;  4JGY B;  2YPJ A;  3C7F A;  1LEM A;  5J7M A;  1LGC A;  1VBC 2;  2AEZ A;  1COV 3;  3RVH A;  3NW4 A;  2VZ1 A;  2XJS A;  3ZSM A;  1OOP C;  1OVS A;  1UU4 A;  3IIA A;  3ZFG B;  1OLM A;  4YW4 A;  1T2X A;  4CUA A;  4XJ8 A;  1EAH 1;  4BPZ A;  2R06 3;  2BER A;  1CX1 A;  2VW1 A;  3RSJ A;  2DU0 A;  2HH9 A;  2WT1 A;  4XIO A;  1H0B A;  4XF1 A;  4BCU A;  3WDX A;  1UOJ A;  1K5M C;  3ZFG C;  5LW9 A;  1V9U 3;  3FUQ A;  5IVF A;  3PNA A;  3PTY A;  2GZW A;  2D7F A;  5EP9 A;  5C3S A;  1GNH A;  4WVV A;  3B94 A;  3JZV A;  4MV2 A;  4QX7 A;  1R1A 3;  4BOW A;  1STM A;  5JXI A;  4I30 A;  1QOT A;  1REF A;  4AHW A;  3WG4 A;  1HRI 3;  5C4W C;  4LKD A;  1W8W A;  2R49 A;  4IE7 A;  4KG0 A;  4LBQ D;  3UYJ A;  4IUG A;  4ZXE A;  1VB4 A;  5FXV A;  2VTX J;  1WUV A;  1W6M A;  1YEW A;  2H0V A;  2YC2 A;  4LO8 A;  3WNX A;  1FV2 A;  1J1L A;  1W6O B;  2VUC A;  4Y20 B;  5IVY A;  1WW7 A;  3MYX A;  2LUW A;  5KBF A;  1O8S A;  1GQG A;  3TB0 A;  1MS8 A;  5FZ9 A;  5DDJ 3;  1S0E A;  2XLG A;  3GZE A;  3OUI A;  2JDA A;  3VN4 A;  2ATF A;  2WZE A;  3G6J B;  1OLM E;  5IYY A;  3INA A;  3LEG A;  3LEM A;  5F2W A;  1R1Z A;  1ZRI A;  5HCF A;  5F3I A;  1P8J A;  2VPV A;  4KBZ A;  4PT6 A;  2RJK A;  1C1F A;  1LEC A;  2VR4 A;  3GNE A;  4XF9 A;  1ND2 C;  4JAA A;  2RMU 3;  2EIG A;  4CCL A;  1MS5 A;  1ZYB A;  2NN8 A;  4YWA A;  3KMH A;  4W4Z A;  2P37 A;  4CDX B;  4FSJ A;  4NVP A;  2D3S A;  3CQO A;  3R4S A;  2PHF A;  5LY1 A;  1FOD 3;  2HWC 2;  3EO6 A;  4LBQ A;  4LTA A;  3KCC A;  5C8W A;  3OPW A;  1MR5 A;  4ERO A;  4WVM A;  2FBE A;  3KV4 A;  3WHT A;  2QFE A;  1WKY A;  5F5A A;  3EYP A;  2XON A;  1LOC A;  1JOP A;  3R4U A;  4AI8 A;  3VBH A;  1JZ3 A;  1VAM A;  5CKQ A;  4YW7 A;  5CG9 A;  1PGL 1;  1LOF A;  2JDK A;  4ZZ5 A;  2QQU A;  4JDO A;  3F95 A;  1N47 A;  3MF6 A;  5M0T A;  4A7K A;  1UO9 A;  3OBA A;  5IVV A;  3NJZ A;  4QX8 A;  4Q4V 2;  5FUN A;  2A6W A;  3HIF A;  4XFB A;  4EE2 A;  1BYH A;  2Y6F A;  4OYU A;  1BVP 1;  1HW5 A;  1YC6 1;  2WC2 A;  2VZV A;  1GOG A;  1VBC 1;  3WD5 A;  3WDY A;  4JV4 A;  2C6S A;  4Q4X 1;  5DAB A;  3ROU A;  2WNV B;  1WW5 A;  2JB8 A;  3BIW E;  2MHF A;  3GM8 A;  4GMP 1;  3LPG A;  1GP5 A;  3QOP A;  4AWD A;  1HXS 1;  2QDR A;  2WO1 A;  4QPI C;  2IXL A;  2GC3 A;  4AEJ A;  1YQ6 A;  4FOW A;  5FFO C;  3AKS A;  5DAW A;  1FXZ A;  4WZC A;  2X5I A;  1AR9 1;  3JXS A;  4GMP 3;  4BK5 A;  1AR6 1;  1Q8S A;  3JBG 3;  1NE4 A;  3MID A;  2JKX A;  1YIP A;  2WA3 A;  3ZSL A;  5JXH A;  4TLF A;  4WM8 B;  2P3K A;  3LQC A;  3LSD A;  2W46 A;  4N9I A;  5IFT A;  1OHF A;  1GSL A;  4QD2 A;  4QGL A;  4KNC A;  3DYM A;  2UYB A;  1O4Y A;  4QPI A;  1NUK A;  3BOD A;  1FMD 1;  3OGV A;  1CN1 A;  5ABJ C;  5HV0 A;  5A3L A;  5FYC A;  5FPV A;  1RUG 1;  5JSO A;  5CFD A;  2JEM A;  3T2P A;  3H7Y A;  1WCD J;  2SBA A;  4A44 A;  1RUF 1;  3PUA A;  3MO4 A;  5JIU A;  1QHD A;  2FD8 A;  2ET1 A;  3SQO A;  4Y1V A;  2DTW A;  5FZK A;  1MVE A;  4OI1 A;  3S57 A;  1H8T C;  5BUV A;  2FCT A;  3EXU A;  3WW3 A;  3TEW A;  2KXL A;  4XUQ A;  1UMI A;  1WCS A;  4B4Q A;  2VW2 A;  3WQB A;  2ZCW A;  3PUQ A;  1IS3 A;  2GME A;  2RVA A;  3VBH C;  4AI3 A;  5EIY B;  3UJO A;  4AVB A;  5FWJ A;  4MX3 A;  2N7G A;  3H0O A;  4LNV A;  4CUC A;  3ACG A;  3F2Z A;  1FMD 2;  3GCW A;  4RS5 A;  4YVS C;  3WVJ A;  5IVC A;  5FZC A;  3ZMN A;  1NA1 A;  4NHM A;  3DYO A;  1EV1 1;  3O1S A;  1K3I A;  1PO1 2;  2V09 A;  2ZXQ A;  2PYT A;  5FZI A;  1IPK A;  1EYB A;  2W52 A;  5T50 A;  4RQP B;  3LGR A;  1JOB A;  2YBS A;  3ILF A;  4HG6 B;  1DQ1 A;  2RS1 2;  3ILN A;  4HT1 T;  1PK6 A;  1ONA A;  4M0H A;  4Y1X A;  5FPA A;  4Y1Y A;  1XE0 A;  4ZON A;  5FYV A;  4I3P A;  3BTZ A;  2ID4 A;  4IE0 A;  3WP3 A;  2HYX A;  4MVT A;  3H50 A;  4IEO A;  4R9D A;  4N9H A;  1HXS 2;  1RUG 3;  1KJL A;  4C90 A;  4KMQ A;  1WMD A;  3FHQ A;  1FPN 3;  3OY8 A;  4XJU A;  4R9A A;  4LK6 A;  4Q4X 3;  5FZ3 A;  1HRV 2;  3NNF A;  2PN5 A;  4V2W A;  1FAY A;  2RV9 A;  2WWU A;  1QJY 2;  4WM8 C;  3NL1 A;  5LEJ A;  4DNY A;  4CA9 A;  5FZO A;  4LKF A;  5JSP A;  3N7K A;  1JU3 A;  2RS5 3;  4XMA A;  2GSY A;  3C7H A;  3RRD A;  3M2M A;  3DF0 A;  1QJU 2;  2UU8 A;  3H3U A;  5L7O B;  3D4K A;  4IV1 B;  4PDW B;  4CU6 A;  3V0B A;  5BNN A;  1WLW A;  3RZL A;  1GKB A;  2ZAB A;  4MHU A;  1GZC A;  5FPL A;  5K0U A;  5CAD A;  1ZZB A;  5FOB B;  3I3Q A;  1ZRD A;  4J25 A;  5FYT A;  5H9Q A;  3N9Q A;  1CZS A;  4M01 A;  3ATG A;  1OLR A;  3Q9O A;  2JDN A;  4QAW A;  4LPL A;  1NQD A;  2VQ0 A;  4FPF A;  3WP6 A;  3U75 A;  4COU A;  4S2F A;  2PHW A;  3N9P A;  3CJX A;  2B5H A;  4CCM A;  2VCA A;  3B5L B;  2B39 A;  5FZD A;  1HRV 1;  1V0A A;  3I2J A;  4I3G A;  1DGW A;  4LIV A;  4UF0 A;  2W91 A;  1REE A;  4FFH A;  1SBF A;  4JKL A;  2DUQ A;  2NYY A;  2VQU A;  4R52 A;  1DLC A;  3WNP A;  1UY0 A;  5A1A A;  4YGC A;  5FYI A;  1EAH 3;  3GBF A;  2I74 A;  2OT7 A;  3ACH A;  3I3M A;  2GP5 A;  2XGX A;  2WS9 2;  4LUM A;  2X10 A;  5GJ6 A;  3IN9 A;  5GLV A;  1HDK A;  3SIS A;  5A80 A;  1JZ5 A;  2A5Z A;  3CJI A;  3CNA A;  3UL2 A;  4B8E A;  4AFM A;  3HR9 A;  2XJV A;  2WDB A;  1HB2 A;  5J48 A;  5F32 A;  1AL2 3;  1E5I A;  3POB A;  3FHI B;  5DZE A;  3S5Q A;  4OVE A;  2PHX A;  2CGP A;  4IDZ A;  3RZG A;  1JHJ A;  5A3N A;  3LFM A;  2RR1 3;  4QU1 A;  4V1P A;  5G04 L;  3USU A;  4XUP A;  4D0Q A;  2PXJ A;  1ZM1 A;  1DQ0 A;  2ZA9 A;  3NJY A;  4IEV A;  2Z5W A;  4CCC A;  3BB6 A;  4F83 A;  4LO5 B;  3WNK A;  1MS9 A;  1IKP A;  4PJY A;  4QQH A;  4KGG A;  2JDU A;  2CV6 A;  4QQL A;  2BDR A;  2XBO 1;  3HAG A;  4P14 A;  1AR9 2;  3T4V A;  5AFB A;  1FOD 2;  2IFR A;  1ASJ 3;  1WMF A;  1O59 A;  3D3A A;  5FIX A;  4CDU B;  2VXJ A;  2YV8 A;  2Q1Z B;  3ZKY A;  2DUP A;  3ZXF A;  4AI9 A;  2WNV C;  2XR4 A;  3MUY 1;  1GNY A;  1AHS A;  2QQP A;  3P1I A;  1LU1 A;  1N1S A;  1H2N A;  1JZ6 A;  2E6V A;  1G9F A;  1GMM A;  2XUM A;  1T6G C;  4P02 B;  5BNP B;  3BTY A;  5K0U B;  3SH3 A;  2E51 A;  3BOP A;  4GKX A;  2J22 A;  1LED A;  4LE4 A;  3KD4 A;  1LHO A;  4BQ1 A;  5BPX A;  1OUR A;  1ULF A;  4LOT A;  2W1W A;  3WP5 A;  5CKN A;  5KHK A;  1MEC 1;  1WZX A;  1VRH 1;  2WZP P;  4K8F A;  5CFC A;  1UXZ A;  4FT8 A;  2VBP A;  4GAZ A;  1OBN A;  3AK0 A;  1J3Q A;  3E6D A;  3KF3 A;  5LWB A;  4Y26 A;  4X8P A;  1Q56 A;  2XDV A;  3ZN6 A;  5F39 A;  5CVR A;  4QQP A;  4B1L A;  1UZ0 A;  2BNO A;  2Z2S B;  5L73 A;  2HWC 3;  2ZAC A;  3DN7 A;  4M00 A;  4UXA A;  4X6R B;  4ZS3 A;  3EJK A;  1BQP A;  3UV9 A;  1KS5 A;  4YZ5 A;  2DTY A;  2EVX A;  1QJY 3;  2RM2 1;  2UY8 A;  2FDF A;  2KM2 A;  5BNN B;  4HVO A;  3VZL A;  2OW4 A;  3MFC A;  4N7U A;  4KH9 A;  2VNV A;  2VE1 A;  2JG9 A;  1JW6 A;  1IS4 A;  1HQW A;  2R04 3;  2VO5 A;  2C9K A;  3ACL A;  3AL6 A;  4DRR A;  5ABJ A;  3VL8 A;  1VBE 3;  2JXA A;  1AR7 2;  2AEN A;  2OZJ A;  3VLB B;  1GP6 A;  2QQV A;  3AX4 A;  4YM2 A;  3WLU A;  1QOS A;  3MIH A;  4OUE A;  1HX6 A;  4AAX A;  1J3R A;  2JE7 A;  4IER A;  1Y9M A;  3L9J T;  2D5H A;  1ZBE 1;  1V6O A;  3PUH A;  2R07 1;  4B3N A;  2YZ4 A;  4OQ9 A;  1LOG A;  1R64 A;  5IFP A;  4K6B A;  4A3X A;  2WT0 A;  4YZ1 A;  1MQT B;  2VZR A;  1JXN A;  2WAO A;  2P5B A;  3N9M A;  2AR6 A;  5CU1 A;  1C8N A;  2C0Z A;  4ONU A;  4XHB A;  2WAB A;  5A7W A;  2EXI A;  2VUA A;  3CDZ B;  2A3Y A;  2E7T A;  2YMZ A;  3B7M A;  2R7E B;  3HQR A;  1IGO A;  1NA1 C;  4KU8 A;  4L9B A;  4OMD A;  4YFW A;  3U10 A;  4QX5 A;  3VBU B;  4UBH A;  1VRB A;  2ZGS A;  1OH4 A;  4UFJ A;  4PBP A;  5GLT A;  4B4R A;  4R4X A;  3E5X A;  2DYC A;  1NCQ B;  2D40 A;  1EY2 A;  1VIW B;  3O14 A;  4Q4W 2;  1ENS A;  3S0M A;  3ZKU A;  4IE5 A;  1LHW A;  3WOG A;  1YFU A;  2PHR A;  3AYD A;  4BJ0 A;  2D6L X;  3RS6 A;  3CF6 E;  3JB4 C;  2WIN B;  2WN3 A;  3N7M A;  3POY A;  4FOQ A;  1U5Y A;  2BFU S;  1NZI A;  1FPN 2;  3ZSK A;  2Q4S A;  3IZO A;  3K2O A;  4XET A;  2ZOE B;  4OHY A;  1GBG A;  3FLP A;  3ZXL A;  4AEK A;  5JMC A;  1LGB A;  1UW8 A;  5DN2 A;  2RM2 2;  1ENQ A;  3MIF A;  4OUM A;  5DAV A;  1G9D A;  1OPM A;  1W9T A;  2JG9 C;  5FBZ A;  4CDQ B;  2FZ1 A;  5HXM A;  1PZ8 A;  1GWL A;  4NAM A;  1VR3 A;  4Q4W 1;  4EZH A;  5CFD C;  3T2Q A;  2CL2 A;  4KWU A;  1VBA 2;  1Z78 A;  3SC7 X;  4E2S A;  2V4V A;  4Z1V A;  5CZK A;  2WL1 A;  4A7Y A;  4HVQ A;  4ZKT B;  1VAV A;  3LEK A;  4MGI E;  3VZJ A;  4HLT A;  4Z07 A;  4MGT A;  3NST A;  3WHU A;  1DF0 A;  2HWE 2;  4MG2 A;  1CQ9 A;  4WM7 C;  1H30 A;  1C57 A;  2H6B A;  1LCL A;  2OXB A;  2RS3 1;  4S2H A;  3AZW A;  4NIH A;  4ZPI A;  2I45 A;  3POW A;  3ST7 A;  3WNN A;  1YIF A;  4OCT A;  3GJB A;  1X8M A;  2VZQ A;  2WWJ A;  5JOZ A;  3RZJ A;  4RHV 2;  3ZFF B;  2R07 2;  3NJV A;  1GOF A;  2WO3 A;  3J7L A;  3ZN6 B;  5FY0 A;  2Q0A A;  1OFS A;  3WQ0 A;  3LOB A;  3FL7 A;  1XYO A;  5IUQ A;  5KXB A;  2HWB 3;  1OD5 A;  1PIV 1;  2EXJ A;  4FTB A;  3LEI A;  2DCK A;  2PAM A;  4HON A;  4CTE A;  2V72 A;  1HRV 3;  2VUL A;  5FO9 B;  4CU9 A;  2NZ9 A;  1NLR A;  1NOV A;  2R06 2;  1OPO A;  4NR1 A;  4LBN A;  3ZN4 A;  2VTX A;  2AGS A;  3OUH A;  2GC2 A;  4LE3 A;  4LBJ A;  3WF2 A;  2LRO A;  4OHZ A;  5E8A A;  5CFC B;  1VRH 2;  4FPH A;  4UFM A;  1R08 1;  2QQL A;  5A3M A;  2CWS A;  4RSU A;  1COV 1;  1VP6 A;  2BPA 2;  1QJF A;  1JYX A;  3N35 A;  3B00 A;  1HJG A;  4D8M A;  4KWL A;  2BZD A;  3WEZ A;  3TN9 3;  4DRV A;  5GLZ A;  4E4Z A;  3OOX A;  1OC1 A;  1KJR A;  2H0B A;  4UI9 L;  2HBT A;  3NMB A;  3WDU A;  5C6C A;  1PVC 2;  4LJH A;  1RUI 1;  4FAG A;  5LA0 A;  2EAK A;  2IVI B;  1B35 C;  2Y8K A;  4GKY A;  3S5A A;  1PGS A;  2AAC A;  3KWV A;  4S2G A;  5HV4 A;  1FMD 3;  3LIG A;  4YG6 A;  5A1L A;  2XJU A;  3KM5 A;  4P9W A;  3U07 A;  1EP0 A;  1RMU 1;  3TBD A;  1IPJ A;  1W9F A;  3A21 A;  5ABJ B;  4YW2 A;  1IS6 A;  1HIX A;  1A8D A;  1RUD 3;  1VAK A;  3ELN A;  4NOT A;  5T5P A;  5JR7 B;  1DZQ A;  1RVF 3;  3HMY A;  3LZZ A;  4WZF A;  4CUG A;  2CAV A;  2IXC A;  1JYT A;  2VMG A;  4R9C A;  3EHK A;  4XUR A;  4QM8 A;  3ZXD A;  4XFA A;  3A23 A;  1YQC A;  3WG3 A;  3VD4 A;  2VNO A;  1O3R A;  1POV 1;  4XIK A;  2VD7 A;  5JIA A;  3CU7 A;  1ST8 A;  2Y26 A;  2IXI A;  5JVV A;  5FRA A;  4YVW C;  2ZHN A;  4AQS A;  3H9A A;  3CEW A;  3OD0 A;  4TYS A;  1QIQ A;  3NNG A;  3PUI A;  1YCI A;  2ORX A;  1CJP A;  2YPD A;  5HCA A;  5LA2 A;  3MLJ A;  3M1H A;  1UYY A;  3HD8 B;  4ASK A;  1ULC A;  4Y4R A;  4AVV A;  2QBX A;  1W2T A;  2YDE A;  5GAL A;  2VVE A;  2RJ2 A;  4F3J A;  4TLG A;  1DP0 A;  1PX3 A;  4O61 A;  2OKX A;  3U14 A;  3ZIW A;  1QXR A;  1RUF 2;  5EV7 A;  4DFS A;  2A6V A;  5C71 A;  2XWJ B;  1W3V A;  3KV6 A;  4ASM B;  5DG1 A;  5AFE A;  3P3P A;  2QQN A;  3OGS A;  3Q8A A;  4OI2 A;  4JTN A;  1D0G A;  5CFC C;  2VBB A;  2VW0 A;  1XYP A;  2OUJ A;  3K3N A;  2C4X A;  3III A;  5FY1 A;  3OUJ A;  3UES A;  4PCR A;  2Y0O A;  2A7A A;  5FUP A;  2ZPX A;  5LAS A;  3BU0 A;  4NO4 A;  1PVC 3;  2UWC A;  2NMN A;  1OA4 A;  1JUH A;  1TVG A;  5H9S A;  5LBE A;  4QQO A;  5JOY A;  2ARX A;  4IGQ A;  4UOJ A;  4C1W A;  1DZT A;  3VZO A;  3ZLI A;  2VEC A;  3K4Z A;  4HSL A;  4AQ6 A;  1PIV 2;  1RUE 1;  3JU9 A;  3KQR A;  3VBU C;  2YUE A;  5JSR A;  1CD3 G;  2ARA A;  5IVB A;  3UGH A;  1DZR A;  3I4I A;  3FLT A;  4TN7 A;  4XJW A;  4COY A;  3ZX7 A;  1Q5O A;  1GLH A;  2GP3 A;  2SLI A;  2VVF A;  3HWJ A;  4CDW B;  4N53 A;  4P9L A;  5KHH A;  1AYN 2;  3BOW A;  4CEY C;  4YRD A;  1D4M 3;  4WM7 B;  4R9B A;  1ND3 B;  2Y64 A;  5GKA C;  1CAW A;  4M4P A;  4CU7 A;  5GLW A;  3ZIX A;  3HVD A;  2R0H A;  2W2I A;  5JI7 A;  1JTZ X;  2JG8 A;  4XAB A;  2YHJ A;  1ZRE A;  3A7Q A;  4Q0S A;  5JLV A;  5LA1 A;  5LA9 A;  1LOD A;  3NV4 A;  4RGG A;  2EIC A;  1NCR A;  1POV 3;  1OUX A;  2BGC A;  1ZRR A;  4GH4 B;  2ZHK A;  4NJ4 A;  2JKB A;  2G9G A;  1UMH A;  1LB2 A;  4RHV 1;  1H1A A;  3ZYI B;  3H1Y A;  4B1M A;  3E97 A;  1NQJ A;  5CB7 A;  2EIB A;  5JXJ A;  1AR8 2;  4NRM A;  1N1V A;  3I2O A;  1RUJ 1;  3AJY A;  3Q8B A;  1V70 A;  4N7I A;  2AUY A;  3SH5 A;  5FYS A;  4M3C A;  1POQ A;  4Q4Y 3;  1Q8Q A;  3GXU A;  2EXK A;  4HSJ A;  4RFR B;  5IVJ A;  2ZZJ A;  1HV0 A;  3O0V A;  4Q4V 3;  3VV1 A;  2BTV C;  1XU2 A;  1G6N A;  1PO2 2;  4AHX A;  1CJD A;  2BFU L;  3USS A;  1S2E A;  3NNL A;  2PEL A;  1F5J A;  2Y6K A;  4FOV A;  4CVU A;  3N4M A;  3NKG A;  4NHX A;  4XUN A;  1U0A A;  1UX6 A;  1S0F A;  2EA7 A;  3O5S A;  3QBQ A;  1OKQ A;  5CKM A;  3WCS A;  1AX2 A;  1BK1 A;  4YNI A;  2UWB A;  1DGL A;  5JOX A;  3L2Y A;  5AVP A;  1W8U A;  4RQP A;  2D43 A;  4Q29 A;  1K5J A;  4ORF A;  3DPR A;  4EWA A;  5A6Q A;  5IK5 A;  4NIG A;  2OS2 A;  2WN2 A;  3T2O A;  3U1X A;  5I0D A;  1HQN A;  4AED B;  5A33 A;  1GP4 A;  1W6N A;  4JGZ B;  4Q27 A;  1PM4 A;  1OI6 A;  5JMO A;  4XVH A;  2JIG A;  4XBL A;  5I0U A;  5CEH A;  3EBR A;  1C3H A;  4C1X A;  5FLI A;  5K9Y A;  5EPA A;  2RS3 3;  3BGA A;  1IKQ A;  1S0I A;  4RD7 A;  4GB3 3;  3UKT A;  2O0O A;  4DXT A;  1LOF C;  2ARC A;  4P9I A;  1XQN A;  1JZ4 A;  3GYD A;  1TMF 3;  1RXG A;  1CVN A;  3MIC A;  2X8K A;  3VBS C;  3N9L A;  1VBB 3;  1GOH A;  3ILR A;  4AHZ A;  2YYO A;  1Y43 B;  3I2K A;  2PLV 1;  1BLZ A;  1W6Q A;  3RYK A;  1W8F A;  3HNB M;  1Z7S 1;  2WR9 A;  1RED A;  3AVR A;  1Q3E A;  2P4E A;  1H4H A;  4XFH A;  4CCO A;  4GMP 0;  2AYH A;  2V5D A;  5APA A;  3QCW A;  5F2S A;  4HZF A;  3HEI A;  1UU6 A;  4PQQ A;  3WSO A;  4ARX A;  4FP3 A;  1J58 A;  3CHX A;  3VHP A;  5C9A A;  1DQ2 A;  5FQ0 B;  1AF9 A;  1AVB A;  1G9A A;  2VNR A;  3R05 A;  1DFQ A;  4QKF A;  1RB8 G;  2GN3 A;  4AFD A;  3IM0 A;  2I2S A;  1V9U 1;  2A1X A;  3OEA A;  3PU3 A;  4A41 A;  5FY4 A;  1QQP 1;  3WF3 A;  3IWZ A;  3WW2 A;  4XF4 A;  3QLQ A;  1AX0 A;  2ZX1 A;  5T52 A;  4CUB A;  3T0D A;  1BEV 2;  1AR7 1;  1GUI A;  1HB1 A;  4GAL A;  1OA2 A;  2DCJ A;  4QPG C;  2V4A A;  2XVL A;  4LK7 A;  2XHK A;  3VKN A;  5LRS A;  1ND3 A;  2BNM A;  3RG0 A;  3VDB A;  2WSU A;  1PZ7 A;  1VMH A;  4WVZ A;  5L19 A;  4QU2 A;  3SXW A;  1VB2 A;  1XC6 A;  4JGY C;  4O9G A;  3OPT A;  5FZF A;  5DAX A;  3POG A;  4B4P A;  2VOW A;  1IOA A;  4KWJ A;  4JX0 A;  5L9B A;  5K0U C;  3IPV B;  3K51 A;  2IXK A;  3ZDV A;  5IW0 A;  4EN9 B;  4EQV A;  4IEY A;  1XXN A;  1JOJ A;  4K9S A;  3HNM A;  1AR6 3;  1E57 A;  2OPW A;  2WZ8 A;  1QWR A;  3I59 A;  4W50 A;  3CMG A;  5C8C B;  2BRT A;  1MS0 A;  1PM7 A;  2QJV A;  2QKD A;  4FQZ A;  4IV1 C;  4JKK A;  1TZO A;  3OBT A;  4PDW C;  1AYM 3;  4U36 A;  4BIS A;  3WNM A;  4CDU C;  4KG8 A;  1W6O A;  4AI1 A;  3BVC A;  5ERL A;  4D6Q A;  2XL9 A;  5EZW A;  1QJX 1;  1YQ5 A;  4PIY A;  2UY9 A;  1CIY A;  1DQ5 A;  1H1I A;  1F5F A;  3SLI A;  3DXT A;  1ZZ8 A;  4FPK A;  2NMO A;  3AJZ A;  4IES A;  3WCR A;  1O4Z A;  4RR3 A;  1O8P A;  2VJX A;  1PO1 3;  2WO2 A;  3AKT A;  3WDW A;  1DCS A;  1BHG A;  3VBR C;  2ZBJ A;  2W68 A;  1ULO A;  1X33 A;  4GUL A;  1NCR B;  1XYN A;  1YQ8 A;  1UWW A;  1XOY A;  4MGZ E;  1BBT 3;  5T5O A;  4AOC A;  5HPO A;  1XSR A;  4LIT A;  5EFU A;  3DPR C;  5GLU A;  1KFU L;  3I3D A;  3SCH A;  1MAC A;  1DGW X;  3NV2 A;  1WW4 A;  2VMH A;  1ZBA 3;  4DOU A;  2RHP A;  4HET A;  1PNF A;  1GZ9 A;  4LHS A;  2XJR A;  4FXG B;  4D6S A;  5BNO B;  3I2G A;  4OI4 A;  4RS5 C;  1ND2 A;  3OYW B;  4YVS A;  1VAL A;  1CAU B;  4JTO A;  4LKS A;  5SV5 A;  4CDX A;  1LES A;  2HJI A;  1GIC A;  2HWB 2;  4XBQ A;  3OCP A;  3PUS A;  2Z79 A;  1YXW A;  4Q4X 2;  4XPV A;  4XZU G;  3AB0 A;  5D21 A;  5JZG C;  2X5I B;  4AZZ A;  5KHJ A;  4J1W A;  2IZW A;  3ZR6 A;  4HKO A;  4JKM A;  3OEB A;  1AYN 3;  1V6K A;  5FZ0 A;  5FP3 A;  1IG3 A;  2GND A;  3U0Z A;  3K4D A;  3WW1 A;  1SPP B;  4WVW A;  4NAO A;  2BBA A;  3K46 A;  4AYU A;  5A7N A;  4KBB A;  2D6K A;  4OHX A;  3ZYP A;  3M3E A;  3E5Q A;  1SBE A;  3ALQ A;  1N1T A;  2AC1 A;  1XNB A;  1SDD B;  1O91 A;  2GMM A;  2UWA A;  3WP4 A;  4Q2F A;  3J8F 1;  3AZY A;  5GZG A;  1QF3 A;  1E5R A;  2WWS A;  3PIG A;  1V6L A;  2O1Q A;  5KHG A;  3ZN5 A;  2LW8 A;  3HOB A;  3NKT A;  4LOR A;  5FK8 A;  1SDW A;  3LOI A;  2FMY A;  2WA4 A;  4Y1Z A;  3VZK A;  2XJT A;  3N7L A;  5FMD A;  2LRP A;  1K5M A;  3FHA A;  3NJX A;  1NY7 2;  2ZJC A;  2LS6 A;  3MIG A;  5F8P A;  1ZX5 A;  1W03 A;  4GIQ A;  3S7E A;  4PIZ A;  4P5H A;  4IEU A;  3SH4 A;  5ACA 3;  5J37 A;  4BK4 A;  4MGS A;  4L2N A;  4SBV A;  3B93 A;  2HBU A;  4LA3 A;  3WG1 A;  2DVB A;  3MW2 A;  2VOT A;  2ZEY A;  1OOP A;  4H55 A;  2C26 A;  2Y6G A;  2BNN A;  2HYK A;  3M3I A;  2VH9 A;  4QXH A;  3N36 A;  3OBR A;  3ZYB A;  5C8C C;  2ORZ A;  2G9Z A;  2XJQ A;  4KU7 A;  2WT2 A;  4A4A A;  3WF4 A;  1E5H A;  4LUL A;  1Q8P A;  3MV0 1;  5A33 B;  1RUG 2;  5CNA A;  5D1I A;  2RMU 2;  2AZ5 A;  4YVS B;  1XNC A;  2ADE A;  2OPK A;  5DUX A;  3FE5 A;  4BXF A;  1BK0 A;  4ZY9 A;  2JE8 A;  2VM9 A;  2VQA A;  3J8F 3;  4W65 A;  3CZU A;  1OT5 A;  2ZEW A;  3ABZ A;  3WDT A;  4FPC A;  5AC9 2;  4FPG A;  2PMW B;  4E8D A;  5D8A C;  2CDO A;  2ZGK A;  4AVC A;  2F6B A;  2G1M A;  4OHW A;  1R09 2;  2R6Q A;  2J1E A;  2A70 A;  1PMI A;  3VKM A;  1BEV 1;  4UFH A;  2XHN A;  2HLE A;  4KQ7 A;  4LQR A;  1QY4 A;  2VVD A;  2W5F A;  2JDP A;  1H9W A;  4RS5 B;  3VDD C;  1NE6 A;  1ENX A;  5D2A A;  2WS9 1;  2D6O X;  1FAT A;  1VBA 3;  3ASI A;  1NYW A;  2YGM A;  3PMS A;  4Q4Y 2;  3ZXE A;  1W2A X;  5E89 A;  5ISL A;  2B8M A;  5FZ6 A;  4WBB A;  2XKO A;  2ZAH A;  4CP9 A;  2E31 A;  3GJA A;  3NVC A;  3TEZ A;  1XJA A;  1HRI 2;  2ZGM A;  3THC A;  1ODM A;  2CNA A;  4XFC A;  3PJQ A;  1PX4 A;  1OH3 A;  1ULE A;  4Q5O A;  2CSG A;  5H9P A;  3S30 A;  1ZBE 3;  3CBN A;  1CAU A;  2XJP A;  3FN9 A;  2V5Y A;  3LFI A;  4NUB A;  4CP1 A;  3B9I A;  3T3Y A;  3OG2 A;  2HWF 2;  3MW3 A;  4FAH A;  1LKN A;  3ZYF A;  3POJ A;  3VBS B;  3CO2 A;  1AXY A;  4HKW A;  3SMH A;  5FXW A;  4M3C F;  3VD3 A;  4Y4Y A;  2DBI A;  1RUC 1;  1BZW A;  3CZJ A;  5J36 A;  3RZK A;  3THP A;  3H3Z A;  3I2F A;  3PVO A;  1JHN A;  4PF1 A;  4QKB A;  4Q4W 3;  4PLM A;  1X8E A;  2I07 B;  5FKB A;  3HJR A;  5HXV A;  4EZ4 A;  3HQX A;  2RR1 2;  1I5P A;  3PVE A;  4QM9 A;  4CEW B;  1H2K A;  1L7L A;  2MEV 2;  4BQ4 A;  3U4S A;  3KQ4 B;  1PK6 B;  4FI9 A;  2WNV A;  4E2Q A;  2XML A;  2K46 A;  1NKG A;  4DEQ A;  1WLT A;  5FV3 A;  1RUE 3;  4FXK B;  4JDM A;  2JD4 A;  1KRI A;  4Q0U A;  2WZR 3;  3C7E A;  3O0W A;  1S0C A;  3UJQ A;  3T1L A;  2ZKL A;  1QNW A;  3ON7 A;  5EYY A;  2Q8O A;  1A78 A;  2ZS6 B;  1F35 A;  1S55 A;  3JQW A;  2Y33 A;  3AYA A;  3FLR A;  2D3R A;  4B7E A;  4BMB A;  2TNF A;  1ULD A;  2E26 A;  1M4W A;  3KVB A;  4QGM A;  2JEC A;  4YGB A;  1OQD A;  1AR8 3;  5FY5 A;  5FPZ A;  3V65 A;  2OUH A;  5AVA A;  3VBS A;  1JZ8 A;  1UKR A;  3J26 N;  4Q4V 1;  2PFW A;  3VD5 A;  1NA1 B;  3AP4 A;  1VMJ A;  3UKV A;  5H9R A;  1UF2 C;  3KGZ A;  3O7O A;  4AVS A;  1DLL A;  2PHT A;  3ETQ A;  4A42 A;  1Y3T A;  4XHX A;  2P6C A;  1UYZ A;  1RUJ 3;  2CGN A;  3LCP A;  3GDB A;  4R4Z A;  5G05 L;  2ZEZ A;  5IJR A;  1UY1 A;  5FZB A;  3SHR A;  4DZG A;  3FZ3 A;  1TG7 A;  2O8O A;  5FK7 A;  4LR4 A;  2F17 A;  4RR3 C;  5FYM A;  1EUT A;  4K1Z A;  2OYZ A;  1GZW B;  3JBG 1;  3KHB A;  1G8W A;  2YBK A;  3JD7 1;  1OF3 A;  5FZL A;  3IDA A;  3J7H A;  4FQ4 A;  4CPB D;  3PJY A;  1HXS 3;  2JD9 A;  4NWV A;  3R6S A;  4NIA A;  1BMV 2;  2VAU A;  1H8T A;  1OQ1 A;  2PTM A;  1ND3 C;  3ETP A;  4AVA A;  1LOB A;  5FZ8 A;  3IDC B;  4GJZ A;  4O7X A;  1JYI A;  4URA A;  3C8X A;  3AFG A;  3VGI A;  2PLV 3;  2WSV A;  1BCX A;  3M3O A;  3GZT B;  4YW3 A;  4BME A;  1GQH A;  5FPX A;  4RN5 A;  3IAP A;  1QJX 3;  4P00 B;  2BVV A;  1SLL A;  3ZYH A;  1CPN A;  1F2N A;  3FFQ A;  5IWF A;  1AJK A;  1XU1 A;  4O9E A;  3M7A A;  3E1F 1;  4RA0 A;  5JOW A;  1SCR A;  1UY3 A;  2ZGL A;  4MGK E;  1XNA A;  3THT A;  3WQ1 A;  4ATF A;  5BNP A;  5C3Q A;  2VUJ A;  4FPE A;  4ATE A;  2JDM A;  2XL7 A;  1C5I A;  1H4G A;  4GWN A;  3DYP A;  3WW4 A;  1G86 A;  2QCS B;  4LHK A;  5IHR A;  1QU0 A;  4OHV A;  4YM0 A;  1H9P A;  2QZ2 A;  3J7M A;  3ES4 A;  5T3N A;  5F37 A;  2B4K A;  4DPN A;  4UW6 A;  2CAU A;  2ZHM A;  1O4T A;  1JI6 A;  2X05 A;  1VBD 2;  5D8A B;  1HKD A;  1UIJ A;  2ZKN A;  1OXC A;  1W8O A;  4Y33 A;  3PDQ A;  3QH7 A;  2BWC A;  2JJ6 A;  1Z7S 2;  2KD7 A;  2VOX A;  3NAP B;  5JXG A;  4TZD A;  3LA7 A;  1I9R A;  2HEY F;  5FMO S;  4P9G A;  5C9A C;  3B69 A;  2ILM A;  2Q1F A;  5E1R A;  1WMX A;  4Q4Y 1;  1RVF 2;  4BIO A;  4C0H A;  5DMY A;  4H2A A;  3T2T A;  4XJA A;  4A6S A;  4EWD A;  5FZG A;  4CDQ A;  5GZD A;  1W9Y A;  1FV3 A;  3I2D A;  4C0B A;  3SIT A;  4DO0 A;  2IVJ A;  3WXP A;  4CRQ A;  4QB1 A;  4AVT A;  1CX4 A;  2WFF 1;  1W6P A;  5KR7 A;  2ZGU A;  3HBZ A;  4M3C B;  3LKJ A;  1O3Q A;  3ZFG A;  1WW6 A;  4QDR A;  3VDD A;  4ZZ8 A;  2ZX4 A;  3WQ7 A;  2YXS A;  3E5U A;  1UD1 A;  1UOF A;  2ZGO A;  1RJ7 A;  1RUH 3;  4CDU A;  4SLI A;  2JDZ A;  4G4F A;  3RDI A;  1SEF A;  1UMZ A;  4B29 A;  2C5D A;  2WBK A;  3ZM8 A;  2UUR A;  4YGE A;  3TN9 2;  1VLN A;  3T09 A;  2CY6 A;  2W1U A;  5A32 A;  1SBD A;  1ULG A;  1SLT A;  3BU7 A;  3VHO A;  1ZRC A;  1F4A A;  2BGP A;  2Y6L A;  3CJI B;  3IMM A;  1PGW 2;  1WME A;  4UT5 A;  4CYD A;  3RZH A;  3HPN A;  1JUI A;  4UW5 A;  5B2G B;  4NHY A;  2WNU A;  2VZU A;  3MDP A;  5FY8 A;  1YI7 A;  2QQW A;  2ES3 A;  3KSC A;  4NII A;  1WD4 A;  1UX7 A;  2P3I A;  4M0N A;  4UBG A;  5FY9 A;  5LEK A;  3KT7 A;  1RHI 3;  3B3Q E;  3RYR A;  4IV3 C;  1QMJ A;  4CP0 A;  2F4P A;  2AEY A;  1S0B A;  2PHD A;  3AMM A;  3G7D A;  5FO7 B;  1ENR A;  2WQ8 A;  3PTR B;  4Y20 A;  3SKV A;  4BHP A;  5BY5 A;  4QPG A;  3BKZ A;  1R08 2;  1W2O A;  2JIC A;  3VB9 A;  3TN9 1;  4COW A;  5KXD A;  3K75 B;  4YVW A;  4A45 A;  2WO7 A;  1N1Y A;  4MXW B;  4IL7 A;  1RJ8 A;  3LWC A;  5I8Y A;  1UOG A;  2VMC A;  3AVS A;  4PHZ A;  3NV1 A;  4GXL A;  1UY4 A;  2JEN A;  5A7Q A;  5KC5 A;  5F6L B;  4QHB A;  3POF A;  4Q0P A;  5E88 A;  3KT1 A;  4BQY A;  1ZBA 1;  3C3V A;  4LOS A;  4EN0 A;  2VBD A;  1J59 A;  1LRH A;  4NPM A;  3VL9 A;  3FJS A;  1CZT A;  3LB9 A;  4IE4 A;  3JD7 3;  2WNU C;  3WIN E;  3TNP B;  2ZGP A;  4BQ3 A;  4CCE A;  1N3P A;  4FFG A;  4BQ5 A;  1TQ5 A;  1UXX X;  2HWB 1;  3FWE A;  3IBM A;  4JCK A;  5DUV A;  3HT2 A;  5JAX A;  2WNE A;  1M06 G;  4MAD A;  5ANQ A;  4D69 A;  3TEY A;  2QQJ A;  3WDV A;  1DYK A;  3OTF A;  2DVF A;  1RGS A;  3K4A A;  1G9C A;  1CWP A;  4H7M A;  4L92 A;  2DBN A;  2ZTN A;  2WFP A;  1MZ6 A;  1QGL A;  2RDN A;  1F9K A;  3AP6 A;  1MS1 A;  2DF7 A;  4HPK B;  5DG2 A;  2D3P A;  5D8A A;  5FPB A;  2VZO A;  4CXY A;  1DHK B;  5A6Y A;  2OZ6 A;  1XNK A;  5BXX A;  1AJO A;  1V6M A;  1URX A;  5LBF A;  2ZGT A;  4XQW A;  5LAT A;  3VBF C;  2DVA A;  2G4I A;  4JQR A;  4IW3 A;  1Q8V A;  1CIW A;  5EHD A;  3AP5 A;  1N3Q A;  1OD3 A;  3ME2 A;  4OUS A;  3BTX A;  4CDW C;  2WYS A;  3FFZ A;  4OLL A;  2YG0 A;  1FNZ A;  1W0P A;  1Q43 A;  4WV8 A;  5T5J A;  5J96 B;  3BCW A;  2C1F A;  1EV1 2;  4CDQ C;  5HCH A;  3EB7 A;  2QUO A;  2EAA A;  3I59 B;  4BLI A;  5CG8 A;  1SMV A;  1EV1 3;  4E4H A;  1LEN A;  1R08 3;  1UY2 A;  5I8S A;  2Y6J A;  2E7Q A;  1GZW A;  1AXK A;  1BKZ A;  2WUH A;  3JUU A;  1W39 A;  1D4M 2;  4Y5Z 0;  4L99 A;  5F3E A;  3W5N A;  1PMJ X;  1W0O A;  3WNO A;  3ZDS A;  3VDD B;  3AZZ A;  5FXX A;  3W9A A;  5A3U A;  2VOK A;  4EN6 B;  1JOD A;  4HKL A;  2QTW B;  3OY8 B;  3W21 A;  3HN1 A;  2HKX A;  4AQT A;  3ZPO A;  2AH2 A;  1GU3 A;  4K8R B;  4OZO A;  5HBA A;  1FOD 1;  5LRR A;  4JRA A;  5FYH A;  1I6X A;  4DMI A;  4YG3 A;  5IVE A;  2V73 A;  4YM3 A;  2DDU A;  3E6C C;  3NAP A;  4K1Y A;  4Z92 B;  5DZF A;  2Q1M A;  3DPR B;  2W39 A;  5DZG A;  4DB5 A;  3KCY A;  3RZM A;  4LLF A;  2VMF A;  1SFN A;  4K40 A;  3UNP A;  1KGY A;  3CJI C;  5LY2 A;  3MFA A;  3C7O A;  2WLP A;  2WKK A;  4Q1R A;  1DGR N;  2XH6 A;  1ND2 B;  1AR7 3;  3OYW A;  1NZC A;  4L8Q A;  1MS4 A;  1TEI A;  4OMC A;  4QXB A;  3RJR A;  4DUX A;  3RFR A;  2VL4 A;  1CAV A;  3MPP G;  5I0T A;  1JU4 A;  1RIR A;  1RMU 2;  1ULP A;  1F15 A;  4BZ4 A;  3D82 A;  5DXD A;  1LOA A;  2D6M A;  2HWD 2;  1IQD C;  1YUD A;  2QQM A;  4CEY A;  4CCJ A;  3I54 A;  4LO4 B;  3RMY A;  1UZZ A;  4YVW B;  5E16 A;  2QQI A;  1CGP A;  4E9K A;  4UF0 B;  2ADD A;  3B9C A;  1PZ9 A;  1TME 3;  4RFT 0;  1DQ6 A;  4XXP A;  1V6I A;  2PAE A;  3O1V A;  1LNS A;  1ZBA 2;  1AZD A;  1X9T A;  4LIU A;  4UFI A;  4HVR A;  3PHM A;  2DCT A;  1IS5 A;  2CDP A;  4FPO B;  3PVN A;  4FFF A;  1B35 A;  3KLS A;  3S7I A;  5L36 A;  5B4N A;  5KXE A;  3VD7 A;  1XNT A;  1WGP A;  1S0J A;  2WLQ A;  1HB4 A;  2WNU B;  3UGF A;  3ZVX A;  4AED C;  1CON A;  5C5U A;  3P5B A;  4CCN A;  1SFY A;  5GZF A;  5SV8 A;  1Y7B A;  3U11 A;  1X50 A;  1QEX A;  3DEM A;  2A71 A;  2HWD 1;  4XUT A;  1JS9 A;  4ISQ A;  5HI0 A;  1C8M 1;  3GHM A;  1V6N A;  4GWI A;  2YB7 A;  5FYY A;  4YGD A;  4QPY A;  4XF3 A;  1S1A A;  1UNB A;  1W04 A;  2D6N A;  4BDV B;  1RC6 A;  2ZGN A;  1C8M 3;  5C33 A;  4MXW A;  2YY1 A;  4JZR A;  1NT0 A;  4CZS A;  4BH9 A;  4D6R A;  3GZU C;  1UU5 A;  1JZ2 A;  3RI9 A;  1S0G A;  1J3P A;  5IAV A;  4H3W A;  3KB5 A;  3Q8F A;  2Q8E A;  4AAP A;  2D6P A;  3NNM A;  1Y9G A;  3QD6 A;  4LEJ A;  5JPM B;  1UZY A;  1V6J A;  2A73 B;  2MEV 1;  4LO7 A;  4ZU4 A;  3FC0 A;  4ARY A;  2YC0 A;  1FT9 A;  5IK8 A;  2WQZ C;  5DPN A;  4GQ7 A;  2MNG A;  4QXC A;  4CCK A;  5BNP C;  1WLC A;  3KGL A;  4UAP A;  1W6N B;  4JGZ A;  3BYW A;  5GM0 A;  4AK3 A;  2O8Q A;  4XBN A;  1SHW B;  4GH4 C;  2O14 A;  3OJB A;  4NPR A;  1Z7S 3;  2BU9 A;  4FP2 A;  1H6Y A;  1KEX A;  4QX0 A;  2E53 A;  3POI A;  4IXL A;  1RUJ 2;  3AM2 A;  4WM7 A;  5FZE A;  4XF0 A;  1VBE 1;  3ZYG A;  4Z8B A;  5JZG A;  5J3U A;  2DFB A;  4WVM B;  2FHR A;  4RHV 3;  3K48 A;  4RR3 B;  3M8L A;  4XC9 A;  4YG0 A;  1FPN 1;  3I49 A;  4JGZ C;  2LAL A;  1QDO A;  2W94 A;  3BI3 A;  3A4U A;  1TME 1;  4D7T A;  5FZH A;  1DG6 A;  1ZA4 A;  1WBF A;  2VCC A;  3HT1 A;  1QJZ A;  1R1A 1;  5C3P A;  4LLO A;  2IUW A;  4K20 A;  3JQX A;  1XPW A;  2XXZ A;  4OUL A;  1LGN A;  3I7D A;  1W8N A;  1IPS A;  1YO8 A;  2PHL A;  4Q0Q A;  4LHN A;  4OZX A;  3O12 A;  2LM3 A;  2JG9 B;  2NQY A;  2NPI A;  3KV9 A;  1HLC A;  3TYJ A;  1WBL A;  3T1M A;  1C8M 2;  2CGO A;  1VJ2 A;  2XVK A;  1HB3 A;  2BWA A;  1AYM 2;  1KS4 A;  5JR2 A;  4NMI A;  1RUF 3;  2CWM A;  2W87 A;  2A6X A;  3N3H A;  3SEP A;  3WF1 A;  1I5Z A;  2K0G A;  5DAQ A;  1QH7 A;  3FMG A;  4JHT A;  3ZPY A;  5EJ3 A;  3WX5 A;  3Q8C A;  2JG8 B;  5LK7 B; 
#chains in the Genus database with same CATH homology
 1GWM A;  1W90 A;  2K46 A;  1W8U A;  1OKO A;  4LK6 A;  4LK7 A;  1V0A A;  3ZYH A;  4CP9 B;  4LJH A;  2O14 A;  4BQ3 A;  1UOJ A;  3ZYB A;  3ZYF A;  1HN0 A;  4LKF A;  4BQ5 A;  2KR2 A;  5D21 A;  1WCU A;  4AL9 A;  4CPB A;  2JWP A;  2Q1F A;  1WMX A;  1W8Z A;  4BQ2 A;  3ORJ A;  2LRP A;  4YW7 A;  1WZX A;  2LRO A;  4A6S A;  4CP9 A;  4YW6 A;  1W9F A;  4CPB D;  2VXJ A;  4LKE A;  3F95 A;  2C24 A;  2WYF A;  1L7L A;  1GWK A;  1W8T A;  1W8W A;  4LKD A;  4BQ4 A;  3UT0 A;  4YWA A;  1OH3 A;  1GWL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...