3ZYHA

Crystal structure of pa-il lectin complexed with galbg0 at 1.5 a resolution
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
121
structure length
121
Chain Sequence
AWKGEVLANNEAGQVTSIIYNPGDVITIVAAGWASYGPTQKWGPQGDREHPDQGLICHDAFCGALVMKIGNSGTIPVNTGLFRWVAPNNVQGAITLIYNDVPGTYGNNSGSFSVNIGKDQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PA-I galactophilic lectin
publication title A Glycopeptide Dendrimer Inhibitor of the Galactose Specific Lectin Leca and of Pseudomonas Aeruginosa Biofilms
pubmed doi rcsb
source organism Pseudomonas aeruginosa (strain atcc 15692 / dsm 22644 / cip 104116 / jcm 14847 /
molecule tags Sugar binding protein/inhibitor
total genus 23
structure length 121
sequence length 121
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07828 PA-IL PA-IL-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.430 Mainly Beta Sandwich Jelly Rolls Galactose-binding lectin 3zyhA00
1OH3A 4AL9A 4BQ4A 3ORJA 1W90A 4CP9A 1GWKA 2LROA 3F95A 2KR2A 3ZYFA 1OKOA 4YW7A 3UT0A 1WCUA 2VXJA 3ZYHA 4BQ5A 1W8WA 2O14A 4LK6A 4LK7A 4CPBA 2K46A 4LJHA 2Q1FA 4CP9B 1W8TA 4LKFA 1W8ZA 5D21A 2JWPA 4CPBD 1WMXA 4YW6A 1W8UA 1W9FA 4BQ3A 3ZYBA 1HN0A 1GWMA 1L7LA 4YWAA 2LRPA 4LKDA 1GWLA 2C24A 1V0AA 4LKEA 1UOJA 4BQ2A 4A6SA 2WYFA 1WZXA
chains in the Genus database with same CATH superfamily
4NMIA 3NAPC 5FUPA 4A4AA 5C3OA 2GALA 2HKXA 3J9SA 1PO22 2WZPP 4YVWB 1BKZA 4BB3A 5A6XA 1MVEA 1W9SA 2Y33A 4QQHA 4CU8A 5ABJB 2IVIB 3GXUA 1DLLA 3LPGA 3OGGA 2YU2A 1W8NA 3AJZA 5C6CA 3GBWA 1DGLA 4IQPA 3VLBB 1GU3A 4COVA 2OYZA 5J98B 3H3UA 3T0BA 3P6BA 1KJRA 3ZR5A 5BNOC 3LQCA 4FVVA 4WM7A 2HBUA 3FBYA 5T5JA 3WOGA 4EZHA 2PHFA 4XXAA 4OQ8A 2WLPA 4HKOA 4XJZA 2VXRA 4KBZA 4DRVA 3FHIB 4CU7A 3AP9A 1UWWA 3AB0A 3GHMA 4ES8A 1TME1 2PHUA 1W90A 1YLLA 3ES4A 4XFBA 3HVDA 2DVDA 2WNUA 1N1YA 2WAOA 3A21A 2NMOA 3ZSLA 2CGPA 1F4AA 3VBSB 1JYVA 1MS8A 2Y8KA 3D0JA 3O0XA 2SBAA 2VNOA 5EPAA 3TN91 3S7IA 1GZTA 3ZFFB 2HWB2 1PK6C 5A3UA 1OC1A 2Q1ZB 3NWKA 2ZGKA 4LTAA 2VOTA 1H8TA 1REDA 1NA1B 2B45X 3MF6A 4LULA 3E1F1 3ST7A 1UYZA 1V9U3 2RDRA 3PVBB 5BNNA 4ZS2A 2NMNA 1IS6A 1HDKA 3MV11 4Q26A 4Q8LA 1YHFA 2HYXA 2YPDA 2R7EB 5ISLA 2WA3A 2D6NA 2HEVF 4JTOA 2D97A 3BVCA 4N53C 1COV2 2GAUA 2LS6A 3D4KA 3VKNA 3LA3A 5LBCA 5C9AB 4D94A 1JZ5A 2WNOA 2FDFA 1XB9A 4XBQA 2PYTA 2RE9A 2RDSA 4A44A 4W8JA 4LT5A 1SCRA 1H6XA 4NWVA 5CKQA 4HETA 3K3OA 3WDVA 4HN1A 1WMDA 2VZ1A 5CFDC 4OUEA 1X9TA 2ZJCA 4RHV1 3RFRA 4M4RA 1WLCA 4K3UA 4DUWA 2BFUS 1AR91 1QXJA 3P5BA 1PM4A 2AYHA 3HR9A 5D8AB 3FX3A 4XIOA 3OBZA 5FZ0A 5F3IA 4LO6B 2IWGB 3PLQA 1VBD2 4GH4A 4XUNA 5FYTA 3SHRA 2VTXJ 3K77A 2DURA 4JGYB 1W3XA 3LDKA 2R042 1BMV2 4XJ8A 1PHMA 2KA3A 3HQXA 3FE5A 2R0FA 1BEV1 1XPWA 4OUSA 3RZGA 3SCFA 4BJ0A 2D3PA 4NIIA 3CJXA 4FPKA 3KSCA 5FPAA 1YIFA 2YC2A 5CZKA 3AFKA 1RUD3 2B8MA 3KVAA 1O6UA 1W6QA 5F5AA 4E2QA 3TEXA 3A4UA 3B5LB 2RS52 2V4VA 3H8RA 3PJYA 4M01A 3AKQA 4YZ3A 3Q8EA 1RVF2 3UV9A 1OF3A 4TYSA 3P3PA 3I3DA 3KV6A 4R4ZA 3AMPA 3WD5A 2Y26A 2W47A 4IETA 3VDDC 4XFFA 3AYDA 3JBG2 2CV6A 3FUOA 5F5CA 4ZHNA 3AFGA 2AZ5A 1GR3A 2N7GA 5KXBA 5B4XA 4XTMA 1BYHA 3LSDA 1SLLA 2ET7A 4E2SA 3BTZA 3R4SA 1YQ6A 5CG8A 2C0ZA 2DV9A 2PN5A 1PIV3 2W87A 1FNYA 3LPFA 2HBTA 4P14A 3AK0A 5DAXA 3W20A 4AEDB 2VOKA 1FOD3 4ES9A 3BOWA 1DYOA 1G9BA 1CAXA 3JZVA 1TG7A 4JDOA 4BM8A 4MOAA 1GP5A 2BGOA 1LHWA 5DPNA 2RV9A 3E6DA 4OHWA 4BCUA 2FDHA 3AXDA 4IEXA 2WZ8A 2WIIB 2Z42A 3JD73 3HN3A 3V56A 2TBVA 4YW3A 3G7DA 3UGHA 3ZXAC 2VC9A 3THCA 1FYUA 1CN1A 5T52A 2AEYA 3H7YA 2WSVA 2L9LA 3VD4A 4XF0A 2JDNA 4IXLA 4D69A 2OZJA 4AQ2A 4LBNA 1QQP2 4EE2A 5E6HA 1PGW2 2W5FA 1UOFA 4LBLA 4FQZA 3KB5A 5EYXA 5EQUA 1QJX1 4AAXA 4AYUA 1GWMA 5JCTA 2Q8DA 5FP7A 3BTYA 4B29A 3FLTA 5CAZA 1GANA 1Q8OA 2Y64A 4WVMB 2CL2A 2PHLA 3VBUA 4URAA 1S0FA 1WLWA 1RUD2 2OUJA 4CSWA 5BY5A 2JG8A 5I93A 2BU9A 3K46A 1OSGA 4LMFA 4R9DA 1SEFA 2CDOA 1JU4A 2X53S 1YJLA 4IW3A 1NKGA 1GWKA 3OPWA 4FOWA 4C0BA 3BIEA 1O59A 2BNMA 4IE0A 3OYWB 4IEUA 4C91A 2ARAA 1C8M3 2R6QA 3VV1A 3WZ1A 1CVNA 1LJ7A 4I0AA 4XAEA 4JX0A 2C6SA 2VCAA 2VNGA 3KZ4C 4GMP1 4QGLA 5IVCA 2VU9A 3CJIC 3HOBA 4LA3A 1FPN1 2RMU3 2RR13 2FQPA 5IFTA 1S4CA 2W46A 4OLLA 4CEWC 5JVVA 1W8FA 4LKEA 4Z8BA 4TTGA 4K1YA 4FSJA 2WFF2 3CBNA 5IVBA 1IS3A 1KQRA 1NX9A 1AXKA 1DHKB 1QJFA 5FPBA 3RPQA 2D5FA 2WS92 4MHUA 5F2WA 1YXWA 2J22A 3VD3A 4CDWC 3BOPA 3BKZA 5JMOA 1AYN3 4UFJA 4CP9A 4L8QA 4CDXA 1WCUA 2LM3A 4ATFA 3U4SA 3OOXA 4Q4V3 5F9TA 3LD8A 3M3EA 2KM2A 5J1XA 1X33A 2OXBA 2HEYF 1W8ZA 4I3PA 1V6JA 4QX2A 3ZO0B 2D3RA 3UKVA 3MZHA 4KWKA 1RUG3 5LBFA 3HT2A 4K9SA 2JDAA 4ZKTB 1JU3A 4NHLA 1LCLA 2GH2A 2I2SA 4FPEA 3O1UA 1QXPA 3HQUA 1C5HA 4Q1RA 2X5IB 3ACLA 3ZXGA 3HIFA 1OLQA 3CL1A 2BQPA 2JDUA 4AHWA 1WCQA 1O4ZA 3E6CC 4XUOA 2JEMA 5BNNC 3EJKA 3OTFA 3VDAA 5LA1A 4HSJA 5L19A 2YGMA 4Y1VA 3LEIA 2DWRA 1ENQA 1N1SA 3H1YA 5F2SA 3I3EA 4BPZA 3KHCA 2VBBA 5C5UA 4QXCA 4UWDA 4QDRA 1QJY3 2XQRA 3BPSA 2VD7A 5GZGA 3ZR6A 1BMV1 1PMIA 3U75A 5FBJA 2QFEA 5LA0A 2Q30A 3O5SA 4LIVA 3SEPA 5J7MA 5C4WA 5FZKA 5FZHA 5CA6A 4FOYA 3ZVXA 2XLGA 3VUOA 2A3WA 1R64A 1DQ2A 2WNVA 4FPHA 1QNWA 4XURA 1O8PA 3GZAA 3CNAA 2I07B 2DYCA 4N43A 4F83A 1IG0A 2OS2A 1MS3A 5CU1A 1S55A 5C8WA 2DVBA 2E7TA 3MIGA 1CPMA 1CJPA 1AYN2 1V9U1 2HEWF 2UYAA 3A22A 5JXGA 4IV1A 2D40A 2X05A 1NOVA 1LHUA 1YC61 4GWIA 4E8CA 1ZA7A 5J3UA 1VAVA 1V6IA 5GZDA 2J42A 1OT5A 4GH4C 1VBC2 4KG0A 2OQ7A 3DPRC 2P3JA 1AXZA 3W59A 1CAUA 3DEMA 1WMEA 4FPOB 4CRQA 2JD9A 3NV4A 4IGOA 3I2FA 4O65A 2CAUA 4KU8A 2QE3A 4UYBA 5HI0A 4AZZA 3W58A 1W0NA 3MIDA 5DDJ3 2QVSB 1AR83 1KEXA 2GP3A 1XSRA 3POSA 5GZFA 5IAVA 4JDMA 5HPOA 1ST8A 2ARCA 1SLIA 2LALA 4ASKA 4R9CA 1K5MB 5AFEA 5K7PA 3I3BA 2R32A 1SG3A 1W6NB 1WCKA 2VAUA 4SBVA 3ZIXA 4E8DA 3AL6A 1NT0A 4L0PA 3J7NA 3IKWA 3GNEA 4AHYA 2W08A 1W8TA 1UN1A 5FZBA 3RZZA 1H4GA 1QJEA 2VMIA 4QPIC 1NCQC 1NZCA 2PHWA 5FBZA 3VL9A 2J1SA 5CFCB 5A3PA 1Q56A 3BUCA 2HWF3 4IE5A 3GZEA 2WA4A 1MZ5A 4MYEA 1QJY2 4RYDA 4QM9A 1Y9QA 3KHBA 1HV0A 3N7LA 2D6LX 1H30A 4OVEA 1I3HA 2R072 5C5TA 4QPGB 1XU1A 3BGAA 3CU7A 4CDQC 2RG4A 3WUDA 4QPWA 4DB5A 3VKMA 4YVWA 3CZJA 4E4DX 2VCBA 1V70A 2XHNA 3KGLA 1RUD1 3B9IA 1V6OA 4H3WA 2HWD3 2B9UA 1XRUA 4WVWA 3RYPA 3VBHB 5A33B 3C7GA 4HSLA 5LCWL 3I59B 4Y4YA 1OKQA 1RHI2 1WWYA 2QJVA 3OGJA 4NPRA 5A7SA 2QQIA 3WNMA 2ZX3A 2GP5A 2CGOA 4RQPA 5LRRA 1PVC2 4R9AA 1EV13 2NLRA 2VZVA 2JD4A 4P9JA 3RYRA 2TEPA 4UBHA 4YFWA 5KHJA 2W52A 4WVZA 2VOXA 3U4XA 4NR1A 1MS4A 1XJAA 3ZX7A 2WT0A 3W21A 1W04A 1GKBA 1MACA 4RN5A 1G86A 1PIV1 3KV4A 1PMHX 5JR7B 3VZJA 2EXJA 3LOIA 1FOD1 5H9QA 4MGZE 1AX1A 1AR82 4EN7B 3VBSA 5I0SA 1ULDA 1XC6A 3D5OA 4RA0A 3WF1A 5FPVA 3ZFFA 2XVLA 3WP4A 4XVHA 3JD71 1C57A 4LJHA 1SCSA 4MG2A 3OD0A 1XSQA 1YQ2A 1UYPA 1SDDB 3PU3A 1NA1A 5A7NA 2XVGA 1C4RA 3JUUA 3TAYA 3GCWA 2XDVA 4Y20B 4CDUB 1VE0A 2YXSA 1PX4A 5FZ9A 3ZXKA 3T2QA 2IFRA 3D82A 4BXFA 3VBRC 3S57A 1VALA 4YFZA 4YLZA 2YBPA 4MGTA 1AX2A 1KFUL 2BEOA 4QQPA 4FXGB 5KXDA 5L7OC 4FXKB 2OZ6A 3H3ZA 5C9AA 3O1MA 3PJQA 3J4UH 2HWD2 2XJQA 3RJRA 1YRZA 4GWJA 4YW1A 4YYOA 1SPPB 3AZYA 3EO6A 4NE9A 1ENRA 1HRI3 4DPNA 1N1TA 1IS5A 4BMEA 3RDIA 2R062 4AW7A 4I3GA 4LHNA 1LULA 4WM8C 1C8M1 1OFNA 2JKBA 2GNMA 5JSPA 1JOPA 2WZR3 3VBFB 3I2GA 5KBFA 3DYPA 3E97A 2Y38A 2BVVA 2RMU1 1OPMA 2EA7A 2YU1A 4M0NA 5D8AA 2RR11 2P3KA 2B5HA 2JG9C 4L2NA 1ONAA 2LW8A 1R092 1UY3A 5F37A 4OI0A 4JGYA 4Y22A 2C4XA 3ZYRA 1U5ZA 4LO5B 3HN1A 1W6OB 3M8LA 4MGQA 4P9WA 5D2AA 2A3YA 4XJ9A 1VP6A 3RQ0A 3WP5A 4XF3A 3WEZA 3MLKA 2JB4A 3K48A 5IVVA 2MPFA 4YVSA 3UJOA 3C2UA 3HQRA 4DUXA 2D7FA 2QQPA 1QWRA 5FZOA 3OSDA 3I49A 3ZLIA 3V0BB 2RM22 3MPPG 4Q4V1 3ZN6A 5JXIA 4BE3A 2HWC2 1DIWA 3LWCA 3AM2A 1RUOA 2C1FA 2OIIA 3NV1A 1VMFA 4RGKA 3WR0A 2JDKA 3GJBA 1RUG1 1UXXX 3WW2A 3KLSA 2JENA 5FIXA 2QKDA 3PTYA 2XGXA 3WCSA 4C90A 1BJQA 4YM1A 1LOAA 5GLUA 1U5XA 1C1FA 5FFOC 4GZ9A 4SLIA 3H3LA 2PLV2 3C7FA 4PLMA 1CZTA 1NUKA 2A1XA 4XHXA 2E33A 3OPTA 5FMOS 4NIAA 3U37A 4AEDA 5F3CA 3H9AA 5FLJA 5IK5A 1XNKA 3IPVB 1YYNA 1RUH3 2H6CA 1K3IA 1S0EA 2XJVA 5K4LA 3RSJA 5DUXA 2XG3A 3NNGA 4CXWA 1ZREA 1UZVA 2VUCA 3VKFC 2ES3A 2JDZA 4I01A 5J36A 1XE0A 2WR9A 3MHZA 3MLJA 5FZIA 5EV7A 3M7AA 1K5JA 4INDA 1F15A 1WA4A 3TYJA 3MICA 2P6HA 1DYPA 2XWBB 3BCWA 3BN6A 3P3NA 4O61A 4BQ1A 1NLRA 4XMIA 2VBDA 3ENRA 4I0BA 1AR63 4GQ7A 4BZ4A 2EIBA 2VO5A 2DCKA 1Q8PA 4QKDA 1ZZ6A 2BJSA 3J8F3 2CY6A 5CADA 4CPBA 2GNBA 5JLVA 3PUSA 2XJSA 5EJ3A 3H50A 4QT6A 1WD4A 4WVMA 1NCRB 1UY2A 2BWCA 1W06A 2QNKA 5FPZA 4B4RA 2O0OA 1ZBE3 3S5QA 1CX1A 3UGGA 4QX1A 3E5QA 3N9LA 1O5UA 1RTVA 2XUEA 1VBE3 4BU2A 2D6KA 4L97A 3FZ3A 1UO9A 1JYTA 2JJ6A 1VMHA 2H6BA 3KCCA 1RC6A 2VGDA 4V2VA 4I2OA 1YFUA 3B3QE 4YG3A 1VMJA 1JH5A 3WW1A 3OYWA 3VHNA 1YIPA 5LATA 1A6CA 1OLMA 1S0IA 2OT7A 3G6JB 5CIRA 3LFMA 5IAXA 5C7GA 4JAAA 4ZY9A 4IEPA 1JMUB 1OQDA 4ORFA 5DDJ1 5FYMA 2JKXA 4EWAA 3TN92 4M00A 3KM5A 3T2OA 4QKFA 2AENA 4XQWA 5ABJC 2EAKA 2NP0A 4CDXB 1IS4A 4KGGA 4WV8A 3B94A 3BIWE 3U78A 2GDFA 4N8MA 5L73A 4X6RB 1RUNA 4XDQA 4P9LA 3T3YA 3ZFEC 5JZGC 3SITA 2GSYA 2HWF1 3ILNA 1JHJA 5A3WA 3M4FA 2FBEA 4LOTA 3IN9A 4LBOA 1J1LA 4HKWA 4DIQA 4XAAA 2Q1MA 1FAYA 4YARA 3FBMA 4IV3C 4AI2A 3KWVA 2VR4A 3IB3A 3WDXA 2AH2A 4PF1A 1AVBA 5DAVA 4BA6A 4CZSA 5APAA 3UETA 3IBMA 5I8TA 1AL23 2IXHA 3GCXA 5L36A 3EXUA 1UD1A 3ZFFC 3N9QA 4UXAA 5FDBA 4HBNA 1ZZ7A 3RZHA 1ULPA 4PQQA 1LOEA 5A1FA 3ZYGA 4AEJA 3Q8FA 2X5IA 4GD4A 4QD2A 1S0CA 4ZZ5A 1LECA 1UIJA 5E16A 4RHV2 1NA1C 3MW4A 1OMIA 1EV11 4G9SB 5DG1A 1HXS3 1AR92 2VL4A 3URFA 4MV2A 4XF1A 2SLIA 2WLQA 4QMAA 4UW6A 3I54A 1ENSA 3KMHA 3EBRA 5CEHA 3KV9A 3ZFGC 2WNVB 2PHXA 1G6NA 2XVKA 2JX9A 1QNYA 1ASJ3 1B35B 1G9CA 4HG6B 1BEV2 3POIA 4CYDA 1EPWA 4KBBA 5C9AC 1DYKA 1O4YA 2B46X 1VLNA 5FP9A 1XNBA 2A7AA 4COWA 1D4M3 3THDA 3L2HA 1C3HA 3ACGA 1S0GA 4MXWA 3VB9A 5CKNA 5EZWA 1HRV3 1F8VA 1IKQA 4JDNA 4XHBA 1CONA 1IPSA 4AR2A 4BIOA 1DLCA 4CCKA 4H55A 4MX3A 1ND2A 3B93A 1NAEA 4QDSA 4Z92B 2ET1A 3VGIA 2WT1A 3HJRA 1OBNA 3PUHA 4NIHA 3R4DB 2WRAA 4RS5B 3LB9A 1EPZA 1GP4A 1FPN3 2PQSA 4PF5A 1ND3B 3ME2A 1M4WA 1SQ4A 3AP4A 1BVP1 1LOFC 1J3PA 4I0WB 4JGYC 4UBGA 1UOGA 3UJQA 4CTEA 3H1WA 3FL7A 4K1ZA 4PDWC 5DUVA 1QF3A 1ZZ8A 1R1A3 1X9PA 1HRI1 4BDVB 2WWUA 5FWEA 3WQBA 1OVPA 4LBMA 1OXCA 4OULA 1UOJA 2VNVA 5FZDA 3UGFA 3WSOA 2WZR1 1K5MA 4JKKA 1W6NA 5LBBA 4JRAA 2GN3A 4PBOA 4BMBA 4QM8A 4Y4RA 3DYOA 2LROA 2YPJA 1H4HA 1HB4A 5A7PA 4BXSV 4ONUA 5FYCA 5CFCA 4KWUA 3K4DA 3RVHA 3DKWA 1OOPA 1QJX2 4XTPA 4UFHA 1JZ7A 1OLME 3N9PA 3QH6A 1UQXA 3SEEA 4CUAA 4CEYA 4OMCA 4OQ9A 4IESA 1DG6A 1UU4A 5FYBA 3KT4A 4QPGA 1SLBA 4IGQA 2GMMA 4RQPB 1S1AA 5FKCA 1ZRFA 1A8DA 4B3NA 2O8QA 4FAHA 5FMCA 3DF0A 3VDBA 4A6SA 3JQWA 4B4QA 4XJAA 5A33A 4XPVA 3VBHA 5FCCA 3RZLA 2ZAAA 1PMJX 4HMZA 1UU6A 2GNDA 1ODNA 2D6PA 3I59A 4KWLA 3WF4A 2G1MA 1AL0G 2VZPA 2P3IA 2Y6LA 4PJYA 3Q9OA 1RB8G 2A6XA 4NO4A 4NVPA 5G04L 2WKKA 3WNNA 2EIDA 5F6KA 3MFAA 4AFDA 5FZ6A 3BI3A 1FPN2 1MZEA 2W68A 2WABA 2PELA 4NHXA 1JYIA 1ZBA3 2C9KA 4MHRA 1L3JA 3GDBA 1STMA 4D3WA 4QX8A 1J1TA 1X7NA 5LB6A 4HLTA 3HT1A 4ZXEA 1RUH1 5C33A 2QQUA 4RGAA 3TB0A 1RUI3 1UMHA 2WYFA 2VW2A 4BK4A 3QLQA 1JW6A 2AR6A 3A23A 3N36A 3KCXA 4NRQA 3UT0A 3VN4A 2PXJA 1AYM3 1EAH1 4MUVA 1VRH3 1W03A 5FREA 4DXRA 3LEGA 4Y20A 2W1QA 4CDUA 3I2KA 1UX6A 4EV0A 4P02B 1AR61 2FDJA 2ATFA 1H9WA 4QAWA 4HOOA 3OJBA 1ZA4A 2Y34A 2ZZJA 3J8F1 4JHTA 4D8MA 4P00B 5LEJA 3WG1A 4DMIA 1GWLA 1KJLA 1CWPA 5A3TA 5T50A 4Z2WA 4W4ZA 5C8CC 1MQTC 1ZBE1 4UOJA 2J1VA 1WW7A 5CYYA 3S30A 3UESA 1VBE1 4OZOA 1SPPA 4FP3A 3HPNA 2VPVA 1DDLA 1HQNA 4WZCA 1LU2A 5HXMA 5BXXA 5FOBB 1TZOA 3AMNA 1RGSA 4AEMA 5FO7B 3VBFA 4Y22B 1V6MA 3O1PA 2VOWA 3W5NA 5M0TA 2PHDA 3OPZA 1JN2P 3BU0A 3RZMA 3KV5A 1WBLA 5KWRA 4YVSB 4BQWA 4IEWA 1C5IA 3VBOC 2ERFA 5BYNA 5FZOB 2JE8A 3CKHA 2GMEA 1BK1A 3ZN6B 2VMHA 2JECA 2X5IC 3H42B 2PAKA 2FCUA 3AKRA 4XBLA 5LY2A 2YFUA 4KGQA 1V9U2 2PQQA 1W6OA 4QU1A 1XE7A 5FPUA 3IDBB 3Q8CA 1Q5OA 3HWJA 2E63A 4XFHA 2EXIA 1H1IA 3VHOA 5A7QA 2W2IA 4Q8KA 5F8PA 4YZ4A 3V0BA 5LRSA 4CPBD 3MUY1 5F6LB 4LORA 1AJOA 1H1MA 3APBA 3A7QA 1VBA3 2XB6C 4J25A 1TEIA 2WYSA 5K9YA 2FZ2A 2GMPA 4YZ5A 4RR3B 4MZUA 1AL21 3NJXA 4WBBA 4P5YA 5DZFA 5F5IA 1NG0A 4JTNA 2WUHA 2YUEA 2VCCA 1H2MA 4GB31 1A34A 4JGZC 2DCZA 3A0KA 5FZ7A 3W9AA 4FTSA 3NAPB 1GBGA 5DABA 1HX6A 3VKLA 1GSLA 4AAPA 2WDBA 2D3SA 3HBKA 1HXS1 1VBB3 2JB8A 3GF6A 5FXZA 1F35A 4QX7A 4D0QA 3IPVA 3DXTA 5FY7A 3K75B 2D44A 3HNMA 2BWAA 2VMEA 1SLTA 1SFPA 5CISA 3LOBA 5FJHA 3SISA 1ASJ1 5JOZA 5GLTA 5FP3A 5BNOB 3V64A 5C3SA 2QBXA 1S2EA 1UY1A 3GBGA 4X8NA 2E6VA 3MYXA 3TWIA 2XJTA 4HPKB 1D4M1 4FO9A 3NSTA 1FATA 1LOBA 4ZPIA 3S6PA 3N9OA 3WDWA 4QHZA 5FOJB 3BPZA 5FRAA 1HRV1 4ASMB 4NUBA 5BNPC 2YG0A 1YFXA 4N7IA 3ASIA 3ZMNA 2RS33 4MVTA 2PHRA 2QQMA 2QZ3A 2BW8A 1ZRCA 4GXLA 3CQOA 4RSUA 1NCRA 3ACIA 5T5OA 1UU5A 2JDMA 1GMMA 3SC7X 4EWEA 1PK6B 2VUDA 1NY71 1Y3TA 5EWSA 1WMXA 1F9KA 3OF1A 3WP6A 5C71A 1UIKA 1ULOA 3H1MA 2B7YA 2B4KA 4K21A 2ZEXA 5FY4A 1PIV2 1RUJ3 3ILRA 4AVSA 5L9VA 5EHDA 1FOD2 4IEVA 4LUMA 1R1A1 4GJZA 4FTEA 5IATA 1MEC3 2A6VA 3IIIA 1SHWB 2W94A 4WM7C 1JHNA 4AI3A 4N53B 3OUJA 3JD72 4RFT0 1MS9A 4XDOA 1W3VA 3GM8A 1W05A 1T6BX 3VHRA 5C70A 1F5FA 3KQ4B 3J7HA 4QGNA 4QPYA 4WVVA 4BOWA 3ILFA 3IWZA 3WXPA 4OHYA 3NJVA 2DDUA 2BRTA 2WNUC 2C26A 1NLSA 2ZGSA 4ZONA 1WCDJ 3WNXA 1CPNA 2VZ3A 3KT1A 1OA3A 2UY8A 2LRPA 3VZLA 5BV6A 5FQ0B 3VD5A 4X8PA 2E26A 1H1AA 3EQEA 2ZACA 4MGYE 5JUVA 5GZCA 3D3AA 4FAGA 1H8TC 1O91A 2QQVA 4XILA 4AFMA 5SV5A 5GLWA 2XBO1 3ALQA 3FFZA 5IUQA 1T2XA 3TNPB 4LA2A 2UY9A 5FK7A 3I8TA 4Y1UA 1DQ6A 1D4VB 4RD7A 1H8VA 1C8M2 4PIYA 3IDCB 2A6WA 4ARYA 3K3NA 1U5YA 2RVAA 1BLZA 1DQ5A 3VHPA 4ZZ8A 2RS13 1PGSA 4MGKE 3U14A 3WP3A 1US2A 2RMU2 2Y6GA 4A7ZA 2RR12 1VAKA 1ZBA1 3WF0A 4FFGA 3WDUA 2E9QA 1JUHA 4MXWB 4NROA 3U07A 1IPJA 1LGNA 3GBFA 3ECQA 2P4EA 4JKMA 3WHTA 2CSGA 1B35A 3MV01 2ORZA 2KD7A 5E89A 1RUI1 2KR2A 4PCRA 4ARXA 1NE6A 2ZEYA 3LSEA 1ND2B 2WSUA 3I2OA 2BUKA 3LGRA 5EJZB 1LEDA 1W9TA 2ZMLA 5FYIA 4Q4V2 1DGRN 1JODA 3NNJA 4FP2A 4FTBA 1RJ8A 2YBKA 1KITA 3SKJE 4EQVA 1AYM1 1URXA 1VRH1 4OYUA 4XETA 1NXD1 3CZUA 4CUGA 5FY1A 3DCQA 2BBAA 3MW3A 4LKDA 1RUG2 4MSVA 4Y3OA 3VZKA 2QUOA 4JKLA 5LK7B 4UI9L 4XYXA 1S0JA 3BTXA 3LIGA 3AMHA 4B4PA 3NV2A 3PDQA 4RS5A 1Y4WA 1Q3EA 4CE8A 1ND3A 2CAVA 1NZIA 4IEOA 2XONA 1MZFA 2FMDA 2WZEA 3LF7A 5T3NA 3ZN4A 4AFCA 1UZ0A 3WG4A 1S0BA 2IXJA 3AP7A 5I0UA 3LEMA 2W1WA 1W2OA 3IZOA 1HIXA 4AGRA 5G05L 3TBDA 2BTVC 4YGCA 5JR2A 5KC5A 1RUE3 4AI8A 1W2UA 1OOPB 3USSA 1LHNA 5KHIA 5JXHA 4Q0VA 5T5LA 4CEYB 3QCWA 1XBFA 1NQDA 5FYUA 5H9PA 3S0MA 2VMGA 3GZTB 3QD6A 2CHHA 4BLIA 2YB7A 4EWDA 3P1IA 3PU8A 4FI9A 4G3YC 2V4AA 4Q4X3 4ATEA 3WNPA 4LHLA 2WQ4A 4YW7A 4YG6A 3O0VA 1WLDA 4ASLA 1LNSA 2AC1A 2WC2A 4XUQA 3CJIB 5HCFA 4A7KA 1LOGA 1MZ6A 2PAEA 1LR5A 1F2NA 2VVDA 1BZWA 1F5JA 5I0DA 1CX4A 4E4HA 5A1LA 2GN7A 5BPXA 5BNQA 2OPKA 1W8UA 5FLIA 1LKNA 2J1AA 5IK4A 1OHFA 2MHFA 2Q4SA 3E5XA 3MGUA 5FMDA 2JXAA 1HQLA 4YW4A 1XYNA 4CEWB 2Y60A 1W8HA 2YROA 3PIGA 3RWKX 3N7MA 3O1RA 5IHRA 2LUWA 1I5PA 1VBA1 4CUBA 4CDWB 4XW3A 4XEZA 4LLFA 4F7ZA 3LE0A 5FYSA 5C3PA 2W95A 5DDJ2 3VBUC 3I7DA 5FK8A 3PTRB 3WF2A 4ET7A 3MPBA 4HKLA 5HXVA 3NW4A 3C8XA 4XDPA 2I45A 2JG8C 1QJZA 3WY6A 2FZ1A 1F31A 4GKXA 3BTAA 2Q1FA 5DAPA 5ACA3 3NNLA 1AF9A 4KU7A 3R6SA 2QQKA 1JZ6A 1GQPA 1VBB1 4I02A 1EUTA 1IKPA 1V6KA 1LHOA 3GGLA 3NNFA 5DZGA 2HWF2 3ELNA 4G4FA 1PZ7A 1W6PB 2MNGA 2JIGA 4UAPA 4JHZA 3I2DA 3DYMA 4EYUA 3B7MA 1UPSA 1W6MB 3IMNA 4LITA 4X6QB 1ZNPA 3WW3A 4K8RB 4M3CB 1QIQA 3T4HB 1YJKA 4Q4X2 4LO8A 4TWTA 3ZYHA 2IXIA 4UFKA 4DXSA 3O1SA 5FZCA 2YV8A 4TN7A 2ZKNA 4MH0E 1GICA 2WFPA 4NJ4A 1Z78A 2QDRA 5IK8A 2RS31 2YHJA 4CDXC 2EICA 2X10A 1APNA 1QHDA 1F4HA 4XZPA 1EV12 5AC93 4D6SA 1YEWA 2DTYA 4B1LA 4BISA 5DMYA 4W6WA 2G9FA 3NNMA 5FO8B 2QQJA 4B7KA 3J7LA 2YZ4A 5FMBA 3ROUA 3ETPA 4BHPA 1Q43A 2XXZA 3AMMA 4IERA 4Y1YA 1FNZA 2O1QA 4C1WA 4YGBA 1RUJ1 1Y9MA 4BQXA 5DZEA 3WUCA 3ZYIB 4CCNA 2FCVA 2DTWA 3OGVA 4LE4A 2DUPA 3Q8BA 5F3EA 1VJ2A 2BNNA 1MEC1 3KGZA 1FXZA 5IK7A 1UL9A 3T4VA 1RJ7A 3NQHA 4JQRA 4YPJA 2RDQA 4FPFA 3DPRB 4S2FA 3RRDA 3AZZA 2Y6JA 5KC6A 4LQRA 4AQTA 1PM7A 1X8MA 3CMGA 1FV3A 2DVGA 2WBKA 3DUIA 2VQTA 2ZEZA 4K20A 5FO9B 5K0UA 4XZUG 2P6CA 1KS4A 1YCIA 2WQ8A 4QXBA 4YG0A 4JRLA 3PIJA 4LR4A 5FZ4A 5LA9A 3WT3A 3ZSJA 1GNYA 3BALA 3RZJA 2ZS6B 1REEA 5C4WC 2VG9A 4CXXA 4JVAA 5KHKA 2IVJA 2XMLA 2ZX4A 2UWAA 2WNVC 2W9XA 2WWSA 1BHGA 4NN0A 1QJU3 2WO3A 4V1PA 4N43C 1UZWA 4QPIB 3QH7A 4ZU5A 4RR3A 4KL1A 4DY5A 5KR7A 1O3QA 4NIGA 1RUF3 2GC1A 1HRI2 2EIGA 5FTTC 1DGWA 1OQ1A 3FFQA 4IV1C 5I0TA 1Q8SA 3RG0A 4EN0A 3AL5A 2XPJA 1JS9A 2WZR2 3LIHA 3NAPA 4UT5A 1R1ZA 1BBT1 1KS5A 5D1IA 5ANQA 2D93A 1WW5A 2RS11 4QKBA 4CCOA 5CG9A 1EAH3 4AFAA 3RNSA 5FZFA 1LGBA 1VIWB 1X8EA 3M1HA 4HVOA 1GYKA 4TZDA 1ZRDA 1OURA 4A45A 1BQPA 5CNAA 1BCXA 2W3JA 3ITQA 3W5MA 5DQ0A 1JZ4A 3TNQA 1TMF1 4L92A 5FZLA 2A6YA 4XCAA 5BNOA 1I9RA 2YFZA 3WV6A 1UNBA 4Y1XA 3SKVA 4OMDA 4HPKA 1LODA 1WGPA 3ZDSA 2BVBA 1YWKA 1WUVA 2GC0A 5JIUA 2JE7A 3MW2A 2ZGPA 4LEJA 2Y6KA 3D8CA 3ABZA 1W99A 2DFBA 1LRHA 2B39A 1ULFA 3L9JT 1IQAA 3AZXA 1VB4A 4XFAA 1IPKA 4QQLA 3PMSA 4META 5FLHA 5FWJA 2JDHA 3POWA 4Q4Y3 1IZ3A 5EIYB 2CTVA 4FPLA 5I91A 5JDBA 1KFXL 3PURA 2QZ2A 3LEKA 4UFLA 2ZX0A 1UMZA 5AVAA 1PK6A 2EVXA 4OI2A 3GYDA 1XQNA 2VBPA 3FHQA 1R083 1W2NA 4XUTA 4YVWC 1O3SA 2F4LA 4E4SA 2UWCA 3N9MA 2Z5WA 4OI4A 4QB6A 4R9BA 4C0HA 2ZX2A 1OH4A 1RUH2 3B02A 3LA7A 2VZQA 2WNEA 4AE2A 1HJFA 3PUIA 3MFCA 4RQPC 4XFIA 4XABA 1CAVB 2WN3A 4Y5SA 3VBRB 2OX0A 3ZPYA 1D2SA 1GNZA 1FX5A 2A3XA 3ZPOA 1C8NA 1DFQA 1RUE1 4MGIE 4N53A 5L7OB 3O1OA 4QX3A 2CDPA 4DZGA 5HV4A 1J84A 5FZ8A 5A32B 5A1AA 3NVCA 4AHZA 1EAH2 2ORXA 1GOFA 1W2TA 4R52A 1E5RA 5IJRA 4Q1PA 3NV3A 1XOYA 1WW6A 1U12A 3WDYA 4D7TA 4AVVA 4E9KA 2BOJA 1AR62 4RGGA 4CP0A 2R30A 3I97A 5JOYA 3R05A 1RUC3 3VBSC 3OEAA 4Q4X1 1HV1A 1AHSA 3J8F2 3KT7A 1GZWA 5F5QA 1ACCA 4OCTA 5FY8A 5HCBA 2BGCA 2E51A 3MI8A 5FQ0A 5FKBA 5CFDA 5HCHA 1L7RA 3R0RA 2P34A 4ISQA 4GB33 1E57A 1PZ8A 1ZBE2 4QB1A 5L9RA 2OVUA 4K40A 1XNDA 1OI6A 1YFWA 3E5UA 1VBE2 2HWE1 4GAZA 4DINB 2JG9B 1O3TA 1Z7S3 3IDEA 3LA2A 5HV0A 2NYYA 5FZ3A 1YQ8A 3AZWA 3M2MA 3USUB 2AUYA 3ZKUA 4DRRA 1QH6A 4XMAA 2GC2A 1REFA 3KF5A 2IXCA 2J1EA 3ATGA 3VKOA 5A70A 5J37A 4NAMA 1SBDA 2XUMA 1R082 3FJSA 2YGLA 1RXFA 4COYA 1UKRA 4FBFA 3TEZA 3SH5A 2VVFA 3WQ1A 2CWSA 5BUVA 1T6GC 3CF6E 4KMQA 1JTZX 1YO8A 5ACA1 1L7QA 2FMYA 4DNYA 4XQ4A 2BERA 1OFSA 3VDDA 3O14A 4LLOA 4PT6A 1ODMA 1WZXA 2C5DA 4QDQA 1IG3A 3AP5A 4P9XA 3H8XA 1TNRA 4YW5A 3NKGA 2BOIA 1A3KA 5D8AC 1JI6A 4KNCA 3FUQA 1HB1A 1UAIA 3CO2A 3AKPA 2OUHA 4GULA 4FOVA 4MADA 4J1WA 3ETQA 5EP9A 2GC3A 1G9DA 4YGEA 4P08A 1ULCA 5FY9A 1H2LA 3PMEA 1AL22 2K9ZA 1X82A 2ZHKA 4QXHA 1LHVA 3GZUC 2Q0AA 3QACA 1NYWA 2ZMNA 4YVSC 1SBEA 3MUZ1 4GB32 2X09A 2Y6FA 4AG4A 4JV4A 4JZRA 3UNPA 1GZ9A 2DF7A 3T2PA 4HK8A 5TSWA 4CCEA 3J7MA 5A7WB 4CXYA 1KDMA 1UYYA 5AC91 3NL1A 2ZX1A 1HXS2 4J6GA 4QQ2A 4WZFA 4P9YA 4JCKA 4Q2FA 1RMU3 2FD8A 1PX3A 1XYPA 2OQ6A 4AOCA 4CCJA 4DEVA 1JZ8A 4NPLA 4PBPA 3H0OA 4AQSA 3ZYJB 1OUXA 5A6QA 2HWB3 3NRUA 1LU1A 1PO13 2PAMA 1ASJ2 2ZGOA 3LFIA 2W1UA 2YBSA 2XLFA 4CCMA 5AFBA 3POGA 5GLZA 4YZ2A 1PZ9A 2ZEWA 3IAPA 1S0DA 1D4M2 5FYZA 4AEDC 4K6BA 3VZMA 1AJKA 3N4MA 2UU8A 1HRV2 5FYVA 2V5YA 2XBO3 1LEMA 2ZZQA 2BGPA 5GJ6A 4M0HA 4CP2A 5FR3A 3U0ZA 1AUYA 1COV3 1OPOA 3RMYA 2XL9A 3CJIA 2MEV1 4XUPA 4EROA 5KHGA 4CA9A 1GP6A 3HD8B 1DGRA 3PVNA 1X36A 1NY72 3ZXFA 1Z0HA 2QQNA 3POJA 5JPNB 1G9FA 1QXRA 4PI0A 4XIKA 2VTFA 3BB6A 4CEWA 4EZ4A 1QJU1 5DUWA 1XU2A 5LWBA 1ULEA 2H0BA 1UCXA 2QCSB 1HB3A 3ZFEB 1R1A2 4EN8B 5JZGB 3AVRA 1D2QA 4CDWA 1RUF1 4DQAA 5A3OA 1WCSA 4Q0SA 1CESA 5IVEA 2W92A 4PIZA 5FMOL 4XOGA 2G9ZA 4NPMA 4IV3B 1GQHA 1LESA 1UPIA 4P5HA 1UZZA 5J09A 4HFSA 1NE4A 5IVJA 1MS1A 1RMU2 1VBD3 2ARXA 4DXTA 3RS6A 1CZVA 3VD9A 1CZSA 2R043 5FZMA 5F3GA 5C3RA 1DBNA 2QTWB 4YSFA 2ADEA 4COUA 1PO12 3DXUA 3RYKA 4UW5A 1VRBA 1W9YA 1JYWA 1X50A 1W6PA 1N3OA 3ZYBA 1GOGA 4A42A 1LENA 1XNTA 2VE1A 1WLTA 1W6MA 4UW4A 3AMQA 2RS53 5C3QA 2X8KA 5T54A 4M3CA 1SLAA 1CIYA 1RVF3 2EAAA 3RI8A 4XCBA 2DVAA 3SH4A 3C7EA 2XBO2 3ORJA 3WVJA 3JBG3 3KS7A 2ZKLA 3ZFGB 4CU6A 4RL7A 1ENXA 1KD7A 3KCYA 1DGWX 1JOBA 2O14A 5A3NA 4Q4Y1 1ALYA 2VZTA 3UK9A 3OB8A 3C7OA 2F17A 4GJYA 2K0GA 3MIBA 3AX4A 3POYA 2BYVE 3O0WA 2DFCA 4AQ6A 4AXOA 1EY2A 3I2HA 1H9PA 2AEZA 1R081 3CEWA 1ZBA2 2ZXQA 2ETEA 4R8HA 3RZKA 2ZGLA 1W0PA 5GZEA 2DCTA 4KH9A 1RUI2 5A80A 3EYPA 4D6QA 5EYYA 4LBQD 5K0UB 2OA2A 2XQXA 4N7UA 4OHZA 2VULA 1PGL1 2W91A 3DECA 1QQP3 3DPRA 4D7YA 1AR73 1W9WA 4OI1A 1AX0A 1AYM2 2ZGUA 1VRH2 4MGSA 4PDWB 4Q27A 1WW4A 4D6RA 4I30A 4AF9A 4EN9B 5JXJA 1TNFA 2JICA 2JDYA 1HN0A 2NQYA 2ZMKA 5ERLA 1RUC1 2WL1A 1G8WA 4S2HA 1YI7A 4M4PA 2PTMA 1LGCA 5FJKA 2FDIA 3T0DA 2X29A 2YC0A 4AI9A 2VY0A 1UZYA 3THPA 4YM2A 4QPIA 1CAWB 1NCQA 4NWWA 1XNCA 3ZSEA 4KQ7A 2Q8EA 2VW0A 2J1UA 1QDCA 1Z7S1 2A5ZA 2CYFA 1ND2C 2ZGNA 4LBQB 5FZ1A 1DP0A 3NJZA 1QGLA 4HVQA 4LKFA 5D21A 1OUSA 3POBA 4M3CF 1MR5A 1ZVFA 4NHYA 3SXWA 4QKNA 3U10A 3WINE 5I8YA 4GA9A 1SLCA 1L7LA 5HBAA 4UF0B 5DUUA 4CDQA 3PHMA 4FFHA 3ZXEA 3RWNA 2WFF3 3PUAA 1B09A 2EF6A 2VM9A 1UW8A 2WS93 4LO4B 3OUIA 2XKOA 4C1XA 5FZAA 2D98A 1Y9GA 4HK9A 3X29B 5JSOA 2BZDA 4AI1A 4BWOA 3K4AA 1HQWA 3AC0A 1A8MA 4AL9A 4BQ4A 3H8OA 1ZRIA 2DUOA 2HYKA 3HBZA 2V72A 2D6MA 1K5MC 2VXJA 1N1VA 4TXWA 1JUIA 4Z07A 2XH6A 4K8FA 1PO21 4A7YA 1AR72 3LDRA 1JXNA 4FFFA 3SQOA 2P17A 3O1TA 2VCMA 3HNBM 1JBCA 3BODA 1BXHA 4NAOA 4NRMA 4YW6A 3UYJA 4PIXA 3QOPA 4AGGA 4AGVA 5CFCC 4RFRB 3HMYA 5JSRA 5KXCA 3VL8A 1MPXA 1OOPC 3OY8B 1VBA2 4H2AA 4NOTA 3IDAA 4URTA 3DGTA 2R1BA 3I4IA 4ZXKA 3N35A 4CEYC 5JI9A 5LA2A 4QPGC 3SLIA 5H9SA 4XFGA 3OBTA 1K42A 4NIDA 3FC0A 2R1DA 2FDGA 4Q4W3 1RITA 1J58A 1WMFA 1SZBA 2ILMA 1GNHA 1Q8VA 2F4PA 3VBHC 4E27A 4CVUA 1HKDA 2IXKA 4M3CE 1VBB2 5GLVA 3RGBA 4BK5A 1VR3A 1RMU1 5IW0A 3SCGA 3ZXLA 5FYHA 3IT8A 3FMGA 1E5SA 2VUAA 1EYBA 1CAVA 3FN9A 3GJAA 5LASA 3RJ2X 2VJXA 3VBRA 1UOBA 4DUVA 1LOCA 1S2BA 2OKXA 2HWB1 2YDEA 1PO11 1GZWB 5L7OA 1QOSA 4PI2A 3SNMA 4HZFA 5C8CB 3EHKA 1MQTB 5A32A 5CFDB 3AP6A 1JOJA 4FCAA 3T1LA 4BIFA 1HB2A 4XF4A 1H2NA 5CKMA 4ZU7A 2XOMA 1ZZCA 2ZGMA 1V6NA 1H0BA 4QGMA 5K8SA 3MEPA 3ZSMA 1YQ5A 2ZHLA 4L9BA 4P9GA 4WM8A 2RS32 3CIHA 4U36A 2WJSA 4CUCA 1COV1 1VBC3 1GV9A 5JI7A 2UWBA 2VH9A 1P8JA 4BYYA 5JOWA 2ZGTA 3WQ0A 1GUIA 1W2AX 1SMVA 1CIWA 1JYNA 3KVBA 2V73A 2CU5A 3WW4A 1POV0 1BBT3 3LDBA 4O7XA 3VDCA 4CDUC 3VBOB 3WQ7A 2ZOEB 2JG9A 1GFF2 4H7LA 2KXLA 1UXZA 2VNRA 2Z79A 1VAMA 4F3JA 1RUJ2 3USUA 2ARBA 1UMIA 3OBAA 4CCLA 1OVSA 1DF0A 2HH9A 5E1RA 3CDZB 3THTA 4MXVA 4FT8A 3UKTA 4YM3A 5E8AA 1TMF3 2Y0IA 1MEC2 5A6ZA 3VDDB 3Q8AA 4Q4W2 2ZBJA 3AVSA 4ITCA 3HAGA 4IGPA 1KDKA 1QKQA 1VB2A 4UFIA 4XJUA 3HEIA 3EMRA 4OHVA 5FV3A 4A3ZA 1LB2A 1QOTA 5B4NA 3FLRA 4HVRA 2Z2SB 1VBD1 5FXVA 3T2TA 4LPLA 4AEKA 4AVTA 3AYEA 4W50A 1YI9A 5KHHA 1LTEA 2OW4A 4IE4A 2R041 2DBNA 4LHKA 2J1TA 2R073 3LCPA 3VBFC 1NLQA 2CNAA 3B9CA 1OF4A 2WQZC 4UW3A 4FPGA 3M70A 1Q8QA 3DL3A 4IEYA 1BVVA 4JGZB 2Q8OA 2WT2A 2OPWA 1QOOA 1O8SA 1H6YA 1XXNA 2CGNA 3ZSKA 1FV2A 2ZAHA 1A78A 2GNTA 2RS51 1RHI3 3HNYM 4W65A 1RVF1 3QBQA 5HCAA 5J48A 2YY1A 4OHXA 1BK0A 1PVC3 2K46A 4DFSA 1MVQA 1YFYA 1SACA 3JBG1 4IUGA 3I3MA 5GALA 5LZ6A 3NMBA 3WNKA 3KF3A 4BQ3A 1N3QA 4FFIA 5FZEA 5FP8A 5F7UA 5CB7A 3IAQA 2VVEA 5A7WA 2BFUL 1BBT2 2R49A 3MIFA 2K2SA 1HW5A 2E32A 2J1RA 2RS12 3FLPA 3M3CA 3OGSA 2A75A 3B69A 5CBLA 2R0HA 5EJ1B 5IWFA 4PQ9A 2IC1A 5E88A 3ZMOA 5BNPB 2DU0A 3R4UA 3V0AA 1O5LA 1POV3 1UY4A 1CQ9A 4EN6B 3DKQA 3LAGA 1E5IA 2PMWB 1TMF2 5JIAA 1FT9A 5FUNA 2ZTNA 4BQ5A 1V00A 3BYWA 2P2KA 5F39A 2HJIA 1M06G 3ZDVA 1ZZBA 2JWPA 1RYYA 3K4ZA 2DCJA 1ULGA 5F1RA 5IYYA 2BV4A 4FOQA 5LBEA 2IFWA 4L11A 1QQP1 1PGW1 1AR71 4I09A 4XBNA 1D7PM 2HWE3 4EJRA 5F32A 3TEYA 1DQ1A 2XJRA 2ZA9A 4N90A 3AZVA 2RJ2A 5A3MA 1IGOA 1KRIA 2IZWA 3OCPA 1NQJA 3I3QA 4WM7B 2D6OX 3LKJA 4W6XA 1WD3A 4Y1ZA 4H7MA 2RJLA 5ABJA 2VZRA 3LZZA 4H14A 2A73B 2GU9A 2NPIA 4QWNA 1I1EA 1XNAA 3T09A 3ES1A 2NM1A 2PA7A 3WCRA 3N7JA 1U5IA 2GZWA 4Q0PA 1ZX5A 2QQOA 4V2WA 4DEQA 1DZTA 2R063 1OQEA 5EFUA 1SFYA 1XYOA 3T1MA 2WNUB 4CCDA 2QQLA 3ZFEA 4LBKA 2ZGRA 5JZGA 2P3YA 1YNAA 2AREA 2PFWA 1MS0A 3WG3A 1WBFA 1NCRC 1XE8A 3EB7A 1TVGA 2DUQA 4LBJA 5EXOA 2VMCA 4COZA 1VPHA 1RUE2 3JXSA 2DU1A 4QXKA 3AXEA 4GIQA 4IV3A 2JDPA 3TRSB 4DS0A 4Q29A 1H8TB 1W8OA 1R093 3ACFA 4JC1A 4HANA 2VQ0A 5LW9A 2WFF1 1OD3A 3ZYPA 2ZHMA 5BNNB 2RDNA 4B7EA 2WS91 2CWMA 2BBVA 2QQWA 1DZRA 4XFCA 5GKAC 1TE1B 3KQRA 1FMD3 4OZXA 4GWMA 3WNOA 1ZRRA 3ZXDA 4DOUA 5FAXA 2RM23 2UYBA 2B9VA 4DO0A 2Z4FA 2HWC3 3OD4A 2XKPA 2IUWA 1GLHA 2G4IA 2XJUA 1CJDA 3K51A 4Z1VA 2HWE2 4QHBA 4JQTA 2E7QA 1W28A 1UX7A 2VMDA 1IOAA 4QHOA 3WDTA 2JIJA 2XL7A 3ZFGA 4Z2AA 2ZPXA 2VZUA 5I0RA 2BPA2 1WKYA 3AKTA 4NRPA 4BLJA 1HLCA 5FP4A 2D43A 2IXLA 1J3QA 4MLOA 2BP6A 2PLV3 3L2YA 2WO1A 1DCSA 1EUUA 5H9RA 3IMMA 3ZOIA 3DV8A 4Q4W1 4QX5A 4GWNA 5LEKA 2EALA 5ACA2 4XQDA 4GH4B 1W9FA 4Q0UA 3ZM8A 1EP0A 1HJGA 4Q5OA 2FHRA 3K2OA 4LXLA 1CGPA 3CHXA 3GALA 4XE9A 4IE7A 3T30A 2Z69A 3MBWA 3FHAA 1V0AA 4FQ4A 2XLAA 3B01A 2JE9A 1ZYBA 2XR4A 3RI9A 1E5HA 4TLFA 4IEZA 4AI0A 3MO4A 2MEV3 4ZU4A 1CD3G 1C28A 1N47A 4XXPA 4Y24A 5FXWA 5A6YA 2W0XA 3BU7A 4YZ1A 1LOFA 2VMFA 1W6QB 3F95A 2ZHNA 3AJYA 3I2IA 4XJWA 2DBIA 4PDWA 4A6OA 1JYXA 3O1VA 1AYN1 1B35C 1FMD2 1YUDA 1UY0A 3J26N 3WLUA 1GQGA 4A3XA 1NCQB 2WO2A 5A3LA 1DU3D 1PNGA 4TSVA 4AHXA 4IDZA 4J1XA 1GZCA 3AYCA 4YNIA 2VZOA 1K45A 2DVFA 1VBC1 1J83A 1TME3 2PHTA 3KD4A 1UKGA 1DQ4A 3MIEA 5AC92 5FPXA 4E4ZA 3S5AA 2Q8CA 2FCTA 1DQ0A 3ZXJA 4CDQB 3OG2A 1CAWA 1W0OA 4FPCA 4LO7A 4P9IA 1GOHA 4A2UA 4B8EA 5JPMB 2R16A 1CAXB 2RHPA 1O4TA 4GALA 4LBQA 4N9IA 3ON7A 4LUKA 5T55A 3TN93 3NKTA 4R4XA 3IM0A 5DG2A 4F8AA 4QQOA 4BQYA 3T08A 1JZ2A 4DXZA 1QEXA 4N9HA 3SMHA 1IQDC 4RS5C 4XACA 5FUIA 1ND3C 4UF0A 1G7YA 1JYCA 3JB8A 1WA6X 1KGYA 3FWEA 3AYAA 2UURA 3WF3A 4FPJA 1J59A 1UYXA 1US3A 3OEBA 2VQUA 3PVOA 4NHKA 1U0AA 4QU2A 3WNLA 2WO7A 4XF9A 1QJY1 4Y5Z0 3VZOA 2E53A 4BQ2A 3A0NA 2Q5TA 2VTXA 3WHUA 1I6XA 5T5PA 1KXGA 2R071 2MEV2 3VBUB 3U11A 2E7AA 2EXHA 4KG8A 5AVPA 2ZGQA 2WAAA 5LY1A 1LAJA 1OD5A 5JWPA 3TEWA 1DZQA 2JG8B 3AKSA 4TLGA 1K12A 2W1SA 4CU9A 3MF9A 3M3QA 2QDNA 4QB2A 1QJU2 3UL2A 1RHI1 5IFPA 4Q0QA 3F2ZA 3OY8A 3D6EA 4OFGA 2YMZA 3C7HA 1QU0A 3SCHA 3WX5A 4YW2A 5IVYA 2VQAA 1OLRA 4RHV3 1PVC1 2NN8A 1RUF2 5JAXA 4D7SA 4U2AA 2XHKA 4HL0A 4S2GA 1RL3A 3PUQA 2HLEA 1AR93 1RINA 3SH3A 1QMJA 2D5HA 1TME2 4CP1A 1CR7A 1ZM1A 1OA2A 3DN7A 2VZSA 3ZN5A 4C8DA 1YQCA 2A70A 2I74A 5IVFA 1G9AA 4QX0A 3IIAA 1OKOA 1AR81 1BEV3 2WINB 2XWJB 2AGSA 4LK7A 4KI5M 2J7MA 4PHZA 4CP9B 1POV1 4CCCA 4Z82A 5FY5A 2LTNA 3PL0A 4W6YA 4Y26A 3JCIA 4LNVA 3MDPA 4WM8B 2BNOA 5C8CA 1C1LA 5FXXA 1MQTA 3B00A 1QY4A 1PNFA 1Y43B 3UKNA 4GMP0 4DY3A 2VW1A 1TQ5A 2E31A 3JQXA 2WWJA 3OUHA 4B1MA 1V6LA 3RMXA 2Y0OA 2TUNA 4HONA 3ZIWA 4O9EA 3N7KA 2ENRA 2EIEA 5B2GB 1UF2C 3V65A 4FPYA 4XC9A 2VECA 5DAQA 3TOJA 4Q4Y2 3POEA 2ZCWA 3OBRA 4ISRA 4LK6A 2A71A 4AWDA 3JU9A 2O8OA 4AFBA 4L99A 4HXCA 3D0SA 2HWD1 2GH8A 3C3VA 2A6ZA 2AACA 4AK3A 3JB4C 3VBOA 2F6BA 1O7FA 3NO8A 5FZGA 4YWAA 5CVRA 2R061 2TNFA 5DAWA 3ACHA 1MS5A 2WN2A 3H7JA 3VD7A 2P5BA 3O12A 4E2GA 5J96B 4Y33A 1AZDA 1OA4A 2ADDA 4LE3A 5I8SA 1AXYA 3WG2A 4A41A 5C4WB 2VOVA 2VUJA 1PGL2 1PVXA 5FYYA 4NHMA 3INAA 2Y6HA 1PO23 2H0VA 2P37A 3GHNA 3M3IA 1HN1A 3M3OA 4S2DA 3ZYFA 1QH7A 1R091 3OGRA 3PVEA 4N43B 1QJX3 4O9GA 4IE6A 4PLNA 4YGDA 4MO3M 1RXGA 1I5ZA 1NXMA 2DCYA 1SDWA 4OUMA 4YM0A 4IV1B 1RUC2 2G19A 3VZNA 2W39A 4K7JA 5GM0A 3POFA 2V09A 1S2KA 1SBFA 2BDRA 1FMD1 1IHMA 2RJKA 3I2JA 3N3HA 3ZKYA 4JGZA 1FI2A 1RIRA 2C9AA 2NZ9A 2P1BA 4AVCA 2C24A 3MLLA 2RM21 4AVBA 4BH9A 5JOXA 5JMCA 2HWC1 3CLPA 1CAUB 4AVAA 5IT6A 4PLOA 1H2KA 4LHSA 3PNAA 3N9NA 4LOSA 3S7EA 2FDKA 1OH3A 2YC4A 1D0HA 1Z7S2 4GMP3 4Y5TA 5K0UC 3E6BA 5KXEA 1QDOA 4LIUA 1ZZ9A 2ZABA 3H8UA 1W8WA 5DN2A 4ZS3A 5FY0A 1JZ3A 3V0AB 2G9GA 5SV8A 3U1XA 1POQA 1W39A 5DXDA 4LKSA 1O3RA 1N3PA 5FPLA 1SFNA 5ANNA 2PLV1 4HT1T 2EXKA 4IL7A 4HN0A 4KWJA 1J3RA 4YRDA 3O7OA 1Y7BA 4RR3C 2B42B 3MIHA 5LK5A 3T0AA 3NJYA 5BNPA 2XJPA 2V5DA 5L9BA 1D0GA 5A7OA 2ID4A 4IEQA 2YYOA 4UFMA 4GKYA
chains in the Genus database with same CATH topology
1OH3A 4AL9A 4BQ4A 3ORJA 1W90A 4CP9A 1GWKA 2LROA 3F95A 2KR2A 3ZYFA 1OKOA 4YW7A 3UT0A 1WCUA 2VXJA 3ZYHA 4BQ5A 1W8WA 2O14A 4LK6A 4LK7A 4CPBA 2K46A 4LJHA 2Q1FA 4CP9B 1W8TA 4LKFA 1W8ZA 5D21A 2JWPA 4CPBD 1WMXA 4YW6A 1W8UA 1W9FA 4BQ3A 3ZYBA 1HN0A 1GWMA 1L7LA 4YWAA 2LRPA 4LKDA 1GWLA 2C24A 1V0AA 4LKEA 1UOJA 4BQ2A 4A6SA 2WYFA 1WZXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OH3 A;  4AL9 A;  4BQ4 A;  3ORJ A;  1W90 A;  4CP9 A;  1GWK A;  2LRO A;  3F95 A;  2KR2 A;  3ZYF A;  1OKO A;  4YW7 A;  3UT0 A;  1WCU A;  2VXJ A;  3ZYH A;  4BQ5 A;  1W8W A;  2O14 A;  4LK6 A;  4LK7 A;  4CPB A;  2K46 A;  4LJH A;  2Q1F A;  4CP9 B;  1W8T A;  4LKF A;  1W8Z A;  5D21 A;  2JWP A;  4CPB D;  1WMX A;  4YW6 A;  1W8U A;  1W9F A;  4BQ3 A;  3ZYB A;  1HN0 A;  1GWM A;  1L7L A;  4YWA A;  2LRP A;  4LKD A;  1GWL A;  2C24 A;  1V0A A;  4LKE A;  1UOJ A;  4BQ2 A;  4A6S A;  2WYF A;  1WZX A; 
#chains in the Genus database with same CATH topology
 4NMI A;  3NAP C;  5FUP A;  4A4A A;  5C3O A;  2GAL A;  2HKX A;  3J9S A;  1PO2 2;  2WZP P;  4YVW B;  1BKZ A;  4BB3 A;  5A6X A;  1MVE A;  1W9S A;  2Y33 A;  4QQH A;  4CU8 A;  5ABJ B;  2IVI B;  3GXU A;  1DLL A;  3LPG A;  3OGG A;  2YU2 A;  1W8N A;  3AJZ A;  5C6C A;  3GBW A;  1DGL A;  4IQP A;  3VLB B;  1GU3 A;  4COV A;  2OYZ A;  5J98 B;  3H3U A;  3T0B A;  3P6B A;  1KJR A;  3ZR5 A;  5BNO C;  3LQC A;  4FVV A;  4WM7 A;  2HBU A;  3FBY A;  5T5J A;  3WOG A;  4EZH A;  2PHF A;  4XXA A;  4OQ8 A;  2WLP A;  4HKO A;  4XJZ A;  2VXR A;  4KBZ A;  4DRV A;  3FHI B;  4CU7 A;  3AP9 A;  1UWW A;  3AB0 A;  3GHM A;  4ES8 A;  1TME 1;  2PHU A;  1W90 A;  1YLL A;  3ES4 A;  4XFB A;  3HVD A;  2DVD A;  2WNU A;  1N1Y A;  2WAO A;  3A21 A;  2NMO A;  3ZSL A;  2CGP A;  1F4A A;  3VBS B;  1JYV A;  1MS8 A;  2Y8K A;  3D0J A;  3O0X A;  2SBA A;  2VNO A;  5EPA A;  3TN9 1;  3S7I A;  1GZT A;  3ZFF B;  2HWB 2;  1PK6 C;  5A3U A;  1OC1 A;  2Q1Z B;  3NWK A;  2ZGK A;  4LTA A;  2VOT A;  1H8T A;  1RED A;  1NA1 B;  2B45 X;  3MF6 A;  4LUL A;  3E1F 1;  3ST7 A;  1UYZ A;  1V9U 3;  2RDR A;  3PVB B;  5BNN A;  4ZS2 A;  2NMN A;  1IS6 A;  1HDK A;  3MV1 1;  4Q26 A;  4Q8L A;  1YHF A;  2HYX A;  2YPD A;  2R7E B;  5ISL A;  2WA3 A;  2D6N A;  2HEV F;  4JTO A;  2D97 A;  3BVC A;  4N53 C;  1COV 2;  2GAU A;  2LS6 A;  3D4K A;  3VKN A;  3LA3 A;  5LBC A;  5C9A B;  4D94 A;  1JZ5 A;  2WNO A;  2FDF A;  1XB9 A;  4XBQ A;  2PYT A;  2RE9 A;  2RDS A;  4A44 A;  4W8J A;  4LT5 A;  1SCR A;  1H6X A;  4NWV A;  5CKQ A;  4HET A;  3K3O A;  3WDV A;  4HN1 A;  1WMD A;  2VZ1 A;  5CFD C;  4OUE A;  1X9T A;  2ZJC A;  4RHV 1;  3RFR A;  4M4R A;  1WLC A;  4K3U A;  4DUW A;  2BFU S;  1AR9 1;  1QXJ A;  3P5B A;  1PM4 A;  2AYH A;  3HR9 A;  5D8A B;  3FX3 A;  4XIO A;  3OBZ A;  5FZ0 A;  5F3I A;  4LO6 B;  2IWG B;  3PLQ A;  1VBD 2;  4GH4 A;  4XUN A;  5FYT A;  3SHR A;  2VTX J;  3K77 A;  2DUR A;  4JGY B;  1W3X A;  3LDK A;  2R04 2;  1BMV 2;  4XJ8 A;  1PHM A;  2KA3 A;  3HQX A;  3FE5 A;  2R0F A;  1BEV 1;  1XPW A;  4OUS A;  3RZG A;  3SCF A;  4BJ0 A;  2D3P A;  4NII A;  3CJX A;  4FPK A;  3KSC A;  5FPA A;  1YIF A;  2YC2 A;  5CZK A;  3AFK A;  1RUD 3;  2B8M A;  3KVA A;  1O6U A;  1W6Q A;  5F5A A;  4E2Q A;  3TEX A;  3A4U A;  3B5L B;  2RS5 2;  2V4V A;  3H8R A;  3PJY A;  4M01 A;  3AKQ A;  4YZ3 A;  3Q8E A;  1RVF 2;  3UV9 A;  1OF3 A;  4TYS A;  3P3P A;  3I3D A;  3KV6 A;  4R4Z A;  3AMP A;  3WD5 A;  2Y26 A;  2W47 A;  4IET A;  3VDD C;  4XFF A;  3AYD A;  3JBG 2;  2CV6 A;  3FUO A;  5F5C A;  4ZHN A;  3AFG A;  2AZ5 A;  1GR3 A;  2N7G A;  5KXB A;  5B4X A;  4XTM A;  1BYH A;  3LSD A;  1SLL A;  2ET7 A;  4E2S A;  3BTZ A;  3R4S A;  1YQ6 A;  5CG8 A;  2C0Z A;  2DV9 A;  2PN5 A;  1PIV 3;  2W87 A;  1FNY A;  3LPF A;  2HBT A;  4P14 A;  3AK0 A;  5DAX A;  3W20 A;  4AED B;  2VOK A;  1FOD 3;  4ES9 A;  3BOW A;  1DYO A;  1G9B A;  1CAX A;  3JZV A;  1TG7 A;  4JDO A;  4BM8 A;  4MOA A;  1GP5 A;  2BGO A;  1LHW A;  5DPN A;  2RV9 A;  3E6D A;  4OHW A;  4BCU A;  2FDH A;  3AXD A;  4IEX A;  2WZ8 A;  2WII B;  2Z42 A;  3JD7 3;  3HN3 A;  3V56 A;  2TBV A;  4YW3 A;  3G7D A;  3UGH A;  3ZXA C;  2VC9 A;  3THC A;  1FYU A;  1CN1 A;  5T52 A;  2AEY A;  3H7Y A;  2WSV A;  2L9L A;  3VD4 A;  4XF0 A;  2JDN A;  4IXL A;  4D69 A;  2OZJ A;  4AQ2 A;  4LBN A;  1QQP 2;  4EE2 A;  5E6H A;  1PGW 2;  2W5F A;  1UOF A;  4LBL A;  4FQZ A;  3KB5 A;  5EYX A;  5EQU A;  1QJX 1;  4AAX A;  4AYU A;  1GWM A;  5JCT A;  2Q8D A;  5FP7 A;  3BTY A;  4B29 A;  3FLT A;  5CAZ A;  1GAN A;  1Q8O A;  2Y64 A;  4WVM B;  2CL2 A;  2PHL A;  3VBU A;  4URA A;  1S0F A;  1WLW A;  1RUD 2;  2OUJ A;  4CSW A;  5BY5 A;  2JG8 A;  5I93 A;  2BU9 A;  3K46 A;  1OSG A;  4LMF A;  4R9D A;  1SEF A;  2CDO A;  1JU4 A;  2X53 S;  1YJL A;  4IW3 A;  1NKG A;  1GWK A;  3OPW A;  4FOW A;  4C0B A;  3BIE A;  1O59 A;  2BNM A;  4IE0 A;  3OYW B;  4IEU A;  4C91 A;  2ARA A;  1C8M 3;  2R6Q A;  3VV1 A;  3WZ1 A;  1CVN A;  1LJ7 A;  4I0A A;  4XAE A;  4JX0 A;  2C6S A;  2VCA A;  2VNG A;  3KZ4 C;  4GMP 1;  4QGL A;  5IVC A;  2VU9 A;  3CJI C;  3HOB A;  4LA3 A;  1FPN 1;  2RMU 3;  2RR1 3;  2FQP A;  5IFT A;  1S4C A;  2W46 A;  4OLL A;  4CEW C;  5JVV A;  1W8F A;  4LKE A;  4Z8B A;  4TTG A;  4K1Y A;  4FSJ A;  2WFF 2;  3CBN A;  5IVB A;  1IS3 A;  1KQR A;  1NX9 A;  1AXK A;  1DHK B;  1QJF A;  5FPB A;  3RPQ A;  2D5F A;  2WS9 2;  4MHU A;  5F2W A;  1YXW A;  2J22 A;  3VD3 A;  4CDW C;  3BOP A;  3BKZ A;  5JMO A;  1AYN 3;  4UFJ A;  4CP9 A;  4L8Q A;  4CDX A;  1WCU A;  2LM3 A;  4ATF A;  3U4S A;  3OOX A;  4Q4V 3;  5F9T A;  3LD8 A;  3M3E A;  2KM2 A;  5J1X A;  1X33 A;  2OXB A;  2HEY F;  1W8Z A;  4I3P A;  1V6J A;  4QX2 A;  3ZO0 B;  2D3R A;  3UKV A;  3MZH A;  4KWK A;  1RUG 3;  5LBF A;  3HT2 A;  4K9S A;  2JDA A;  4ZKT B;  1JU3 A;  4NHL A;  1LCL A;  2GH2 A;  2I2S A;  4FPE A;  3O1U A;  1QXP A;  3HQU A;  1C5H A;  4Q1R A;  2X5I B;  3ACL A;  3ZXG A;  3HIF A;  1OLQ A;  3CL1 A;  2BQP A;  2JDU A;  4AHW A;  1WCQ A;  1O4Z A;  3E6C C;  4XUO A;  2JEM A;  5BNN C;  3EJK A;  3OTF A;  3VDA A;  5LA1 A;  4HSJ A;  5L19 A;  2YGM A;  4Y1V A;  3LEI A;  2DWR A;  1ENQ A;  1N1S A;  3H1Y A;  5F2S A;  3I3E A;  4BPZ A;  3KHC A;  2VBB A;  5C5U A;  4QXC A;  4UWD A;  4QDR A;  1QJY 3;  2XQR A;  3BPS A;  2VD7 A;  5GZG A;  3ZR6 A;  1BMV 1;  1PMI A;  3U75 A;  5FBJ A;  2QFE A;  5LA0 A;  2Q30 A;  3O5S A;  4LIV A;  3SEP A;  5J7M A;  5C4W A;  5FZK A;  5FZH A;  5CA6 A;  4FOY A;  3ZVX A;  2XLG A;  3VUO A;  2A3W A;  1R64 A;  1DQ2 A;  2WNV A;  4FPH A;  1QNW A;  4XUR A;  1O8P A;  3GZA A;  3CNA A;  2I07 B;  2DYC A;  4N43 A;  4F83 A;  1IG0 A;  2OS2 A;  1MS3 A;  5CU1 A;  1S55 A;  5C8W A;  2DVB A;  2E7T A;  3MIG A;  1CPM A;  1CJP A;  1AYN 2;  1V9U 1;  2HEW F;  2UYA A;  3A22 A;  5JXG A;  4IV1 A;  2D40 A;  2X05 A;  1NOV A;  1LHU A;  1YC6 1;  4GWI A;  4E8C A;  1ZA7 A;  5J3U A;  1VAV A;  1V6I A;  5GZD A;  2J42 A;  1OT5 A;  4GH4 C;  1VBC 2;  4KG0 A;  2OQ7 A;  3DPR C;  2P3J A;  1AXZ A;  3W59 A;  1CAU A;  3DEM A;  1WME A;  4FPO B;  4CRQ A;  2JD9 A;  3NV4 A;  4IGO A;  3I2F A;  4O65 A;  2CAU A;  4KU8 A;  2QE3 A;  4UYB A;  5HI0 A;  4AZZ A;  3W58 A;  1W0N A;  3MID A;  5DDJ 3;  2QVS B;  1AR8 3;  1KEX A;  2GP3 A;  1XSR A;  3POS A;  5GZF A;  5IAV A;  4JDM A;  5HPO A;  1ST8 A;  2ARC A;  1SLI A;  2LAL A;  4ASK A;  4R9C A;  1K5M B;  5AFE A;  5K7P A;  3I3B A;  2R32 A;  1SG3 A;  1W6N B;  1WCK A;  2VAU A;  4SBV A;  3ZIX A;  4E8D A;  3AL6 A;  1NT0 A;  4L0P A;  3J7N A;  3IKW A;  3GNE A;  4AHY A;  2W08 A;  1W8T A;  1UN1 A;  5FZB A;  3RZZ A;  1H4G A;  1QJE A;  2VMI A;  4QPI C;  1NCQ C;  1NZC A;  2PHW A;  5FBZ A;  3VL9 A;  2J1S A;  5CFC B;  5A3P A;  1Q56 A;  3BUC A;  2HWF 3;  4IE5 A;  3GZE A;  2WA4 A;  1MZ5 A;  4MYE A;  1QJY 2;  4RYD A;  4QM9 A;  1Y9Q A;  3KHB A;  1HV0 A;  3N7L A;  2D6L X;  1H30 A;  4OVE A;  1I3H A;  2R07 2;  5C5T A;  4QPG B;  1XU1 A;  3BGA A;  3CU7 A;  4CDQ C;  2RG4 A;  3WUD A;  4QPW A;  4DB5 A;  3VKM A;  4YVW A;  3CZJ A;  4E4D X;  2VCB A;  1V70 A;  2XHN A;  3KGL A;  1RUD 1;  3B9I A;  1V6O A;  4H3W A;  2HWD 3;  2B9U A;  1XRU A;  4WVW A;  3RYP A;  3VBH B;  5A33 B;  3C7G A;  4HSL A;  5LCW L;  3I59 B;  4Y4Y A;  1OKQ A;  1RHI 2;  1WWY A;  2QJV A;  3OGJ A;  4NPR A;  5A7S A;  2QQI A;  3WNM A;  2ZX3 A;  2GP5 A;  2CGO A;  4RQP A;  5LRR A;  1PVC 2;  4R9A A;  1EV1 3;  2NLR A;  2VZV A;  2JD4 A;  4P9J A;  3RYR A;  2TEP A;  4UBH A;  4YFW A;  5KHJ A;  2W52 A;  4WVZ A;  2VOX A;  3U4X A;  4NR1 A;  1MS4 A;  1XJA A;  3ZX7 A;  2WT0 A;  3W21 A;  1W04 A;  1GKB A;  1MAC A;  4RN5 A;  1G86 A;  1PIV 1;  3KV4 A;  1PMH X;  5JR7 B;  3VZJ A;  2EXJ A;  3LOI A;  1FOD 1;  5H9Q A;  4MGZ E;  1AX1 A;  1AR8 2;  4EN7 B;  3VBS A;  5I0S A;  1ULD A;  1XC6 A;  3D5O A;  4RA0 A;  3WF1 A;  5FPV A;  3ZFF A;  2XVL A;  3WP4 A;  4XVH A;  3JD7 1;  1C57 A;  4LJH A;  1SCS A;  4MG2 A;  3OD0 A;  1XSQ A;  1YQ2 A;  1UYP A;  1SDD B;  3PU3 A;  1NA1 A;  5A7N A;  2XVG A;  1C4R A;  3JUU A;  3TAY A;  3GCW A;  2XDV A;  4Y20 B;  4CDU B;  1VE0 A;  2YXS A;  1PX4 A;  5FZ9 A;  3ZXK A;  3T2Q A;  2IFR A;  3D82 A;  4BXF A;  3VBR C;  3S57 A;  1VAL A;  4YFZ A;  4YLZ A;  2YBP A;  4MGT A;  1AX2 A;  1KFU L;  2BEO A;  4QQP A;  4FXG B;  5KXD A;  5L7O C;  4FXK B;  2OZ6 A;  3H3Z A;  5C9A A;  3O1M A;  3PJQ A;  3J4U H;  2HWD 2;  2XJQ A;  3RJR A;  1YRZ A;  4GWJ A;  4YW1 A;  4YYO A;  1SPP B;  3AZY A;  3EO6 A;  4NE9 A;  1ENR A;  1HRI 3;  4DPN A;  1N1T A;  1IS5 A;  4BME A;  3RDI A;  2R06 2;  4AW7 A;  4I3G A;  4LHN A;  1LUL A;  4WM8 C;  1C8M 1;  1OFN A;  2JKB A;  2GNM A;  5JSP A;  1JOP A;  2WZR 3;  3VBF B;  3I2G A;  5KBF A;  3DYP A;  3E97 A;  2Y38 A;  2BVV A;  2RMU 1;  1OPM A;  2EA7 A;  2YU1 A;  4M0N A;  5D8A A;  2RR1 1;  2P3K A;  2B5H A;  2JG9 C;  4L2N A;  1ONA A;  2LW8 A;  1R09 2;  1UY3 A;  5F37 A;  4OI0 A;  4JGY A;  4Y22 A;  2C4X A;  3ZYR A;  1U5Z A;  4LO5 B;  3HN1 A;  1W6O B;  3M8L A;  4MGQ A;  4P9W A;  5D2A A;  2A3Y A;  4XJ9 A;  1VP6 A;  3RQ0 A;  3WP5 A;  4XF3 A;  3WEZ A;  3MLK A;  2JB4 A;  3K48 A;  5IVV A;  2MPF A;  4YVS A;  3UJO A;  3C2U A;  3HQR A;  4DUX A;  2D7F A;  2QQP A;  1QWR A;  5FZO A;  3OSD A;  3I49 A;  3ZLI A;  3V0B B;  2RM2 2;  3MPP G;  4Q4V 1;  3ZN6 A;  5JXI A;  4BE3 A;  2HWC 2;  1DIW A;  3LWC A;  3AM2 A;  1RUO A;  2C1F A;  2OII A;  3NV1 A;  1VMF A;  4RGK A;  3WR0 A;  2JDK A;  3GJB A;  1RUG 1;  1UXX X;  3WW2 A;  3KLS A;  2JEN A;  5FIX A;  2QKD A;  3PTY A;  2XGX A;  3WCS A;  4C90 A;  1BJQ A;  4YM1 A;  1LOA A;  5GLU A;  1U5X A;  1C1F A;  5FFO C;  4GZ9 A;  4SLI A;  3H3L A;  2PLV 2;  3C7F A;  4PLM A;  1CZT A;  1NUK A;  2A1X A;  4XHX A;  2E33 A;  3OPT A;  5FMO S;  4NIA A;  3U37 A;  4AED A;  5F3C A;  3H9A A;  5FLJ A;  5IK5 A;  1XNK A;  3IPV B;  1YYN A;  1RUH 3;  2H6C A;  1K3I A;  1S0E A;  2XJV A;  5K4L A;  3RSJ A;  5DUX A;  2XG3 A;  3NNG A;  4CXW A;  1ZRE A;  1UZV A;  2VUC A;  3VKF C;  2ES3 A;  2JDZ A;  4I01 A;  5J36 A;  1XE0 A;  2WR9 A;  3MHZ A;  3MLJ A;  5FZI A;  5EV7 A;  3M7A A;  1K5J A;  4IND A;  1F15 A;  1WA4 A;  3TYJ A;  3MIC A;  2P6H A;  1DYP A;  2XWB B;  3BCW A;  3BN6 A;  3P3N A;  4O61 A;  4BQ1 A;  1NLR A;  4XMI A;  2VBD A;  3ENR A;  4I0B A;  1AR6 3;  4GQ7 A;  4BZ4 A;  2EIB A;  2VO5 A;  2DCK A;  1Q8P A;  4QKD A;  1ZZ6 A;  2BJS A;  3J8F 3;  2CY6 A;  5CAD A;  4CPB A;  2GNB A;  5JLV A;  3PUS A;  2XJS A;  5EJ3 A;  3H50 A;  4QT6 A;  1WD4 A;  4WVM A;  1NCR B;  1UY2 A;  2BWC A;  1W06 A;  2QNK A;  5FPZ A;  4B4R A;  2O0O A;  1ZBE 3;  3S5Q A;  1CX1 A;  3UGG A;  4QX1 A;  3E5Q A;  3N9L A;  1O5U A;  1RTV A;  2XUE A;  1VBE 3;  4BU2 A;  2D6K A;  4L97 A;  3FZ3 A;  1UO9 A;  1JYT A;  2JJ6 A;  1VMH A;  2H6B A;  3KCC A;  1RC6 A;  2VGD A;  4V2V A;  4I2O A;  1YFU A;  3B3Q E;  4YG3 A;  1VMJ A;  1JH5 A;  3WW1 A;  3OYW A;  3VHN A;  1YIP A;  5LAT A;  1A6C A;  1OLM A;  1S0I A;  2OT7 A;  3G6J B;  5CIR A;  3LFM A;  5IAX A;  5C7G A;  4JAA A;  4ZY9 A;  4IEP A;  1JMU B;  1OQD A;  4ORF A;  5DDJ 1;  5FYM A;  2JKX A;  4EWA A;  3TN9 2;  4M00 A;  3KM5 A;  3T2O A;  4QKF A;  2AEN A;  4XQW A;  5ABJ C;  2EAK A;  2NP0 A;  4CDX B;  1IS4 A;  4KGG A;  4WV8 A;  3B94 A;  3BIW E;  3U78 A;  2GDF A;  4N8M A;  5L73 A;  4X6R B;  1RUN A;  4XDQ A;  4P9L A;  3T3Y A;  3ZFE C;  5JZG C;  3SIT A;  2GSY A;  2HWF 1;  3ILN A;  1JHJ A;  5A3W A;  3M4F A;  2FBE A;  4LOT A;  3IN9 A;  4LBO A;  1J1L A;  4HKW A;  4DIQ A;  4XAA A;  2Q1M A;  1FAY A;  4YAR A;  3FBM A;  4IV3 C;  4AI2 A;  3KWV A;  2VR4 A;  3IB3 A;  3WDX A;  2AH2 A;  4PF1 A;  1AVB A;  5DAV A;  4BA6 A;  4CZS A;  5APA A;  3UET A;  3IBM A;  5I8T A;  1AL2 3;  2IXH A;  3GCX A;  5L36 A;  3EXU A;  1UD1 A;  3ZFF C;  3N9Q A;  4UXA A;  5FDB A;  4HBN A;  1ZZ7 A;  3RZH A;  1ULP A;  4PQQ A;  1LOE A;  5A1F A;  3ZYG A;  4AEJ A;  3Q8F A;  2X5I A;  4GD4 A;  4QD2 A;  1S0C A;  4ZZ5 A;  1LEC A;  1UIJ A;  5E16 A;  4RHV 2;  1NA1 C;  3MW4 A;  1OMI A;  1EV1 1;  4G9S B;  5DG1 A;  1HXS 3;  1AR9 2;  2VL4 A;  3URF A;  4MV2 A;  4XF1 A;  2SLI A;  2WLQ A;  4QMA A;  4UW6 A;  3I54 A;  1ENS A;  3KMH A;  3EBR A;  5CEH A;  3KV9 A;  3ZFG C;  2WNV B;  2PHX A;  1G6N A;  2XVK A;  2JX9 A;  1QNY A;  1ASJ 3;  1B35 B;  1G9C A;  4HG6 B;  1BEV 2;  3POI A;  4CYD A;  1EPW A;  4KBB A;  5C9A C;  1DYK A;  1O4Y A;  2B46 X;  1VLN A;  5FP9 A;  1XNB A;  2A7A A;  4COW A;  1D4M 3;  3THD A;  3L2H A;  1C3H A;  3ACG A;  1S0G A;  4MXW A;  3VB9 A;  5CKN A;  5EZW A;  1HRV 3;  1F8V A;  1IKQ A;  4JDN A;  4XHB A;  1CON A;  1IPS A;  4AR2 A;  4BIO A;  1DLC A;  4CCK A;  4H55 A;  4MX3 A;  1ND2 A;  3B93 A;  1NAE A;  4QDS A;  4Z92 B;  2ET1 A;  3VGI A;  2WT1 A;  3HJR A;  1OBN A;  3PUH A;  4NIH A;  3R4D B;  2WRA A;  4RS5 B;  3LB9 A;  1EPZ A;  1GP4 A;  1FPN 3;  2PQS A;  4PF5 A;  1ND3 B;  3ME2 A;  1M4W A;  1SQ4 A;  3AP4 A;  1BVP 1;  1LOF C;  1J3P A;  4I0W B;  4JGY C;  4UBG A;  1UOG A;  3UJQ A;  4CTE A;  3H1W A;  3FL7 A;  4K1Z A;  4PDW C;  5DUV A;  1QF3 A;  1ZZ8 A;  1R1A 3;  1X9P A;  1HRI 1;  4BDV B;  2WWU A;  5FWE A;  3WQB A;  1OVP A;  4LBM A;  1OXC A;  4OUL A;  1UOJ A;  2VNV A;  5FZD A;  3UGF A;  3WSO A;  2WZR 1;  1K5M A;  4JKK A;  1W6N A;  5LBB A;  4JRA A;  2GN3 A;  4PBO A;  4BMB A;  4QM8 A;  4Y4R A;  3DYO A;  2LRO A;  2YPJ A;  1H4H A;  1HB4 A;  5A7P A;  4BXS V;  4ONU A;  5FYC A;  5CFC A;  4KWU A;  3K4D A;  3RVH A;  3DKW A;  1OOP A;  1QJX 2;  4XTP A;  4UFH A;  1JZ7 A;  1OLM E;  3N9P A;  3QH6 A;  1UQX A;  3SEE A;  4CUA A;  4CEY A;  4OMC A;  4OQ9 A;  4IES A;  1DG6 A;  1UU4 A;  5FYB A;  3KT4 A;  4QPG A;  1SLB A;  4IGQ A;  2GMM A;  4RQP B;  1S1A A;  5FKC A;  1ZRF A;  1A8D A;  4B3N A;  2O8Q A;  4FAH A;  5FMC A;  3DF0 A;  3VDB A;  4A6S A;  3JQW A;  4B4Q A;  4XJA A;  5A33 A;  4XPV A;  3VBH A;  5FCC A;  3RZL A;  2ZAA A;  1PMJ X;  4HMZ A;  1UU6 A;  2GND A;  1ODN A;  2D6P A;  3I59 A;  4KWL A;  3WF4 A;  2G1M A;  1AL0 G;  2VZP A;  2P3I A;  2Y6L A;  4PJY A;  3Q9O A;  1RB8 G;  2A6X A;  4NO4 A;  4NVP A;  5G04 L;  2WKK A;  3WNN A;  2EID A;  5F6K A;  3MFA A;  4AFD A;  5FZ6 A;  3BI3 A;  1FPN 2;  1MZE A;  2W68 A;  2WAB A;  2PEL A;  4NHX A;  1JYI A;  1ZBA 3;  2C9K A;  4MHR A;  1L3J A;  3GDB A;  1STM A;  4D3W A;  4QX8 A;  1J1T A;  1X7N A;  5LB6 A;  4HLT A;  3HT1 A;  4ZXE A;  1RUH 1;  5C33 A;  2QQU A;  4RGA A;  3TB0 A;  1RUI 3;  1UMH A;  2WYF A;  2VW2 A;  4BK4 A;  3QLQ A;  1JW6 A;  2AR6 A;  3A23 A;  3N36 A;  3KCX A;  4NRQ A;  3UT0 A;  3VN4 A;  2PXJ A;  1AYM 3;  1EAH 1;  4MUV A;  1VRH 3;  1W03 A;  5FRE A;  4DXR A;  3LEG A;  4Y20 A;  2W1Q A;  4CDU A;  3I2K A;  1UX6 A;  4EV0 A;  4P02 B;  1AR6 1;  2FDJ A;  2ATF A;  1H9W A;  4QAW A;  4HOO A;  3OJB A;  1ZA4 A;  2Y34 A;  2ZZJ A;  3J8F 1;  4JHT A;  4D8M A;  4P00 B;  5LEJ A;  3WG1 A;  4DMI A;  1GWL A;  1KJL A;  1CWP A;  5A3T A;  5T50 A;  4Z2W A;  4W4Z A;  5C8C C;  1MQT C;  1ZBE 1;  4UOJ A;  2J1V A;  1WW7 A;  5CYY A;  3S30 A;  3UES A;  1VBE 1;  4OZO A;  1SPP A;  4FP3 A;  3HPN A;  2VPV A;  1DDL A;  1HQN A;  4WZC A;  1LU2 A;  5HXM A;  5BXX A;  5FOB B;  1TZO A;  3AMN A;  1RGS A;  4AEM A;  5FO7 B;  3VBF A;  4Y22 B;  1V6M A;  3O1P A;  2VOW A;  3W5N A;  5M0T A;  2PHD A;  3OPZ A;  1JN2 P;  3BU0 A;  3RZM A;  3KV5 A;  1WBL A;  5KWR A;  4YVS B;  4BQW A;  4IEW A;  1C5I A;  3VBO C;  2ERF A;  5BYN A;  5FZO B;  2JE8 A;  3CKH A;  2GME A;  1BK1 A;  3ZN6 B;  2VMH A;  2JEC A;  2X5I C;  3H42 B;  2PAK A;  2FCU A;  3AKR A;  4XBL A;  5LY2 A;  2YFU A;  4KGQ A;  1V9U 2;  2PQQ A;  1W6O A;  4QU1 A;  1XE7 A;  5FPU A;  3IDB B;  3Q8C A;  1Q5O A;  3HWJ A;  2E63 A;  4XFH A;  2EXI A;  1H1I A;  3VHO A;  5A7Q A;  2W2I A;  4Q8K A;  5F8P A;  4YZ4 A;  3V0B A;  5LRS A;  4CPB D;  3MUY 1;  5F6L B;  4LOR A;  1AJO A;  1H1M A;  3APB A;  3A7Q A;  1VBA 3;  2XB6 C;  4J25 A;  1TEI A;  2WYS A;  5K9Y A;  2FZ2 A;  2GMP A;  4YZ5 A;  4RR3 B;  4MZU A;  1AL2 1;  3NJX A;  4WBB A;  4P5Y A;  5DZF A;  5F5I A;  1NG0 A;  4JTN A;  2WUH A;  2YUE A;  2VCC A;  1H2M A;  4GB3 1;  1A34 A;  4JGZ C;  2DCZ A;  3A0K A;  5FZ7 A;  3W9A A;  4FTS A;  3NAP B;  1GBG A;  5DAB A;  1HX6 A;  3VKL A;  1GSL A;  4AAP A;  2WDB A;  2D3S A;  3HBK A;  1HXS 1;  1VBB 3;  2JB8 A;  3GF6 A;  5FXZ A;  1F35 A;  4QX7 A;  4D0Q A;  3IPV A;  3DXT A;  5FY7 A;  3K75 B;  2D44 A;  3HNM A;  2BWA A;  2VME A;  1SLT A;  1SFP A;  5CIS A;  3LOB A;  5FJH A;  3SIS A;  1ASJ 1;  5JOZ A;  5GLT A;  5FP3 A;  5BNO B;  3V64 A;  5C3S A;  2QBX A;  1S2E A;  1UY1 A;  3GBG A;  4X8N A;  2E6V A;  3MYX A;  3TWI A;  2XJT A;  4HPK B;  1D4M 1;  4FO9 A;  3NST A;  1FAT A;  1LOB A;  4ZPI A;  3S6P A;  3N9O A;  3WDW A;  4QHZ A;  5FOJ B;  3BPZ A;  5FRA A;  1HRV 1;  4ASM B;  4NUB A;  5BNP C;  2YG0 A;  1YFX A;  4N7I A;  3ASI A;  3ZMN A;  2RS3 3;  4MVT A;  2PHR A;  2QQM A;  2QZ3 A;  2BW8 A;  1ZRC A;  4GXL A;  3CQO A;  4RSU A;  1NCR A;  3ACI A;  5T5O A;  1UU5 A;  2JDM A;  1GMM A;  3SC7 X;  4EWE A;  1PK6 B;  2VUD A;  1NY7 1;  1Y3T A;  5EWS A;  1WMX A;  1F9K A;  3OF1 A;  3WP6 A;  5C71 A;  1UIK A;  1ULO A;  3H1M A;  2B7Y A;  2B4K A;  4K21 A;  2ZEX A;  5FY4 A;  1PIV 2;  1RUJ 3;  3ILR A;  4AVS A;  5L9V A;  5EHD A;  1FOD 2;  4IEV A;  4LUM A;  1R1A 1;  4GJZ A;  4FTE A;  5IAT A;  1MEC 3;  2A6V A;  3III A;  1SHW B;  2W94 A;  4WM7 C;  1JHN A;  4AI3 A;  4N53 B;  3OUJ A;  3JD7 2;  4RFT 0;  1MS9 A;  4XDO A;  1W3V A;  3GM8 A;  1W05 A;  1T6B X;  3VHR A;  5C70 A;  1F5F A;  3KQ4 B;  3J7H A;  4QGN A;  4QPY A;  4WVV A;  4BOW A;  3ILF A;  3IWZ A;  3WXP A;  4OHY A;  3NJV A;  2DDU A;  2BRT A;  2WNU C;  2C26 A;  1NLS A;  2ZGS A;  4ZON A;  1WCD J;  3WNX A;  1CPN A;  2VZ3 A;  3KT1 A;  1OA3 A;  2UY8 A;  2LRP A;  3VZL A;  5BV6 A;  5FQ0 B;  3VD5 A;  4X8P A;  2E26 A;  1H1A A;  3EQE A;  2ZAC A;  4MGY E;  5JUV A;  5GZC A;  3D3A A;  4FAG A;  1H8T C;  1O91 A;  2QQV A;  4XIL A;  4AFM A;  5SV5 A;  5GLW A;  2XBO 1;  3ALQ A;  3FFZ A;  5IUQ A;  1T2X A;  3TNP B;  4LA2 A;  2UY9 A;  5FK7 A;  3I8T A;  4Y1U A;  1DQ6 A;  1D4V B;  4RD7 A;  1H8V A;  1C8M 2;  4PIY A;  3IDC B;  2A6W A;  4ARY A;  3K3N A;  1U5Y A;  2RVA A;  1BLZ A;  1DQ5 A;  3VHP A;  4ZZ8 A;  2RS1 3;  1PGS A;  4MGK E;  3U14 A;  3WP3 A;  1US2 A;  2RMU 2;  2Y6G A;  4A7Z A;  2RR1 2;  1VAK A;  1ZBA 1;  3WF0 A;  4FFG A;  3WDU A;  2E9Q A;  1JUH A;  4MXW B;  4NRO A;  3U07 A;  1IPJ A;  1LGN A;  3GBF A;  3ECQ A;  2P4E A;  4JKM A;  3WHT A;  2CSG A;  1B35 A;  3MV0 1;  2ORZ A;  2KD7 A;  5E89 A;  1RUI 1;  2KR2 A;  4PCR A;  4ARX A;  1NE6 A;  2ZEY A;  3LSE A;  1ND2 B;  2WSU A;  3I2O A;  2BUK A;  3LGR A;  5EJZ B;  1LED A;  1W9T A;  2ZML A;  5FYI A;  4Q4V 2;  1DGR N;  1JOD A;  3NNJ A;  4FP2 A;  4FTB A;  1RJ8 A;  2YBK A;  1KIT A;  3SKJ E;  4EQV A;  1AYM 1;  1URX A;  1VRH 1;  4OYU A;  4XET A;  1NXD 1;  3CZU A;  4CUG A;  5FY1 A;  3DCQ A;  2BBA A;  3MW3 A;  4LKD A;  1RUG 2;  4MSV A;  4Y3O A;  3VZK A;  2QUO A;  4JKL A;  5LK7 B;  4UI9 L;  4XYX A;  1S0J A;  3BTX A;  3LIG A;  3AMH A;  4B4P A;  3NV2 A;  3PDQ A;  4RS5 A;  1Y4W A;  1Q3E A;  4CE8 A;  1ND3 A;  2CAV A;  1NZI A;  4IEO A;  2XON A;  1MZF A;  2FMD A;  2WZE A;  3LF7 A;  5T3N A;  3ZN4 A;  4AFC A;  1UZ0 A;  3WG4 A;  1S0B A;  2IXJ A;  3AP7 A;  5I0U A;  3LEM A;  2W1W A;  1W2O A;  3IZO A;  1HIX A;  4AGR A;  5G05 L;  3TBD A;  2BTV C;  4YGC A;  5JR2 A;  5KC5 A;  1RUE 3;  4AI8 A;  1W2U A;  1OOP B;  3USS A;  1LHN A;  5KHI A;  5JXH A;  4Q0V A;  5T5L A;  4CEY B;  3QCW A;  1XBF A;  1NQD A;  5FYU A;  5H9P A;  3S0M A;  2VMG A;  3GZT B;  3QD6 A;  2CHH A;  4BLI A;  2YB7 A;  4EWD A;  3P1I A;  3PU8 A;  4FI9 A;  4G3Y C;  2V4A A;  4Q4X 3;  4ATE A;  3WNP A;  4LHL A;  2WQ4 A;  4YW7 A;  4YG6 A;  3O0V A;  1WLD A;  4ASL A;  1LNS A;  2AC1 A;  2WC2 A;  4XUQ A;  3CJI B;  5HCF A;  4A7K A;  1LOG A;  1MZ6 A;  2PAE A;  1LR5 A;  1F2N A;  2VVD A;  1BZW A;  1F5J A;  5I0D A;  1CX4 A;  4E4H A;  5A1L A;  2GN7 A;  5BPX A;  5BNQ A;  2OPK A;  1W8U A;  5FLI A;  1LKN A;  2J1A A;  5IK4 A;  1OHF A;  2MHF A;  2Q4S A;  3E5X A;  3MGU A;  5FMD A;  2JXA A;  1HQL A;  4YW4 A;  1XYN A;  4CEW B;  2Y60 A;  1W8H A;  2YRO A;  3PIG A;  3RWK X;  3N7M A;  3O1R A;  5IHR A;  2LUW A;  1I5P A;  1VBA 1;  4CUB A;  4CDW B;  4XW3 A;  4XEZ A;  4LLF A;  4F7Z A;  3LE0 A;  5FYS A;  5C3P A;  2W95 A;  5DDJ 2;  3VBU C;  3I7D A;  5FK8 A;  3PTR B;  3WF2 A;  4ET7 A;  3MPB A;  4HKL A;  5HXV A;  3NW4 A;  3C8X A;  4XDP A;  2I45 A;  2JG8 C;  1QJZ A;  3WY6 A;  2FZ1 A;  1F31 A;  4GKX A;  3BTA A;  2Q1F A;  5DAP A;  5ACA 3;  3NNL A;  1AF9 A;  4KU7 A;  3R6S A;  2QQK A;  1JZ6 A;  1GQP A;  1VBB 1;  4I02 A;  1EUT A;  1IKP A;  1V6K A;  1LHO A;  3GGL A;  3NNF A;  5DZG A;  2HWF 2;  3ELN A;  4G4F A;  1PZ7 A;  1W6P B;  2MNG A;  2JIG A;  4UAP A;  4JHZ A;  3I2D A;  3DYM A;  4EYU A;  3B7M A;  1UPS A;  1W6M B;  3IMN A;  4LIT A;  4X6Q B;  1ZNP A;  3WW3 A;  4K8R B;  4M3C B;  1QIQ A;  3T4H B;  1YJK A;  4Q4X 2;  4LO8 A;  4TWT A;  3ZYH A;  2IXI A;  4UFK A;  4DXS A;  3O1S A;  5FZC A;  2YV8 A;  4TN7 A;  2ZKN A;  4MH0 E;  1GIC A;  2WFP A;  4NJ4 A;  1Z78 A;  2QDR A;  5IK8 A;  2RS3 1;  2YHJ A;  4CDX C;  2EIC A;  2X10 A;  1APN A;  1QHD A;  1F4H A;  4XZP A;  1EV1 2;  5AC9 3;  4D6S A;  1YEW A;  2DTY A;  4B1L A;  4BIS A;  5DMY A;  4W6W A;  2G9F A;  3NNM A;  5FO8 B;  2QQJ A;  4B7K A;  3J7L A;  2YZ4 A;  5FMB A;  3ROU A;  3ETP A;  4BHP A;  1Q43 A;  2XXZ A;  3AMM A;  4IER A;  4Y1Y A;  1FNZ A;  2O1Q A;  4C1W A;  4YGB A;  1RUJ 1;  1Y9M A;  4BQX A;  5DZE A;  3WUC A;  3ZYI B;  4CCN A;  2FCV A;  2DTW A;  3OGV A;  4LE4 A;  2DUP A;  3Q8B A;  5F3E A;  1VJ2 A;  2BNN A;  1MEC 1;  3KGZ A;  1FXZ A;  5IK7 A;  1UL9 A;  3T4V A;  1RJ7 A;  3NQH A;  4JQR A;  4YPJ A;  2RDQ A;  4FPF A;  3DPR B;  4S2F A;  3RRD A;  3AZZ A;  2Y6J A;  5KC6 A;  4LQR A;  4AQT A;  1PM7 A;  1X8M A;  3CMG A;  1FV3 A;  2DVG A;  2WBK A;  3DUI A;  2VQT A;  2ZEZ A;  4K20 A;  5FO9 B;  5K0U A;  4XZU G;  2P6C A;  1KS4 A;  1YCI A;  2WQ8 A;  4QXB A;  4YG0 A;  4JRL A;  3PIJ A;  4LR4 A;  5FZ4 A;  5LA9 A;  3WT3 A;  3ZSJ A;  1GNY A;  3BAL A;  3RZJ A;  2ZS6 B;  1REE A;  5C4W C;  2VG9 A;  4CXX A;  4JVA A;  5KHK A;  2IVJ A;  2XML A;  2ZX4 A;  2UWA A;  2WNV C;  2W9X A;  2WWS A;  1BHG A;  4NN0 A;  1QJU 3;  2WO3 A;  4V1P A;  4N43 C;  1UZW A;  4QPI B;  3QH7 A;  4ZU5 A;  4RR3 A;  4KL1 A;  4DY5 A;  5KR7 A;  1O3Q A;  4NIG A;  1RUF 3;  2GC1 A;  1HRI 2;  2EIG A;  5FTT C;  1DGW A;  1OQ1 A;  3FFQ A;  4IV1 C;  5I0T A;  1Q8S A;  3RG0 A;  4EN0 A;  3AL5 A;  2XPJ A;  1JS9 A;  2WZR 2;  3LIH A;  3NAP A;  4UT5 A;  1R1Z A;  1BBT 1;  1KS5 A;  5D1I A;  5ANQ A;  2D93 A;  1WW5 A;  2RS1 1;  4QKB A;  4CCO A;  5CG9 A;  1EAH 3;  4AFA A;  3RNS A;  5FZF A;  1LGB A;  1VIW B;  1X8E A;  3M1H A;  4HVO A;  1GYK A;  4TZD A;  1ZRD A;  1OUR A;  4A45 A;  1BQP A;  5CNA A;  1BCX A;  2W3J A;  3ITQ A;  3W5M A;  5DQ0 A;  1JZ4 A;  3TNQ A;  1TMF 1;  4L92 A;  5FZL A;  2A6Y A;  4XCA A;  5BNO A;  1I9R A;  2YFZ A;  3WV6 A;  1UNB A;  4Y1X A;  3SKV A;  4OMD A;  4HPK A;  1LOD A;  1WGP A;  3ZDS A;  2BVB A;  1YWK A;  1WUV A;  2GC0 A;  5JIU A;  2JE7 A;  3MW2 A;  2ZGP A;  4LEJ A;  2Y6K A;  3D8C A;  3ABZ A;  1W99 A;  2DFB A;  1LRH A;  2B39 A;  1ULF A;  3L9J T;  1IQA A;  3AZX A;  1VB4 A;  4XFA A;  1IPK A;  4QQL A;  3PMS A;  4MET A;  5FLH A;  5FWJ A;  2JDH A;  3POW A;  4Q4Y 3;  1IZ3 A;  5EIY B;  2CTV A;  4FPL A;  5I91 A;  5JDB A;  1KFX L;  3PUR A;  2QZ2 A;  3LEK A;  4UFL A;  2ZX0 A;  1UMZ A;  5AVA A;  1PK6 A;  2EVX A;  4OI2 A;  3GYD A;  1XQN A;  2VBP A;  3FHQ A;  1R08 3;  1W2N A;  4XUT A;  4YVW C;  1O3S A;  2F4L A;  4E4S A;  2UWC A;  3N9M A;  2Z5W A;  4OI4 A;  4QB6 A;  4R9B A;  4C0H A;  2ZX2 A;  1OH4 A;  1RUH 2;  3B02 A;  3LA7 A;  2VZQ A;  2WNE A;  4AE2 A;  1HJF A;  3PUI A;  3MFC A;  4RQP C;  4XFI A;  4XAB A;  1CAV B;  2WN3 A;  4Y5S A;  3VBR B;  2OX0 A;  3ZPY A;  1D2S A;  1GNZ A;  1FX5 A;  2A3X A;  3ZPO A;  1C8N A;  1DFQ A;  1RUE 1;  4MGI E;  4N53 A;  5L7O B;  3O1O A;  4QX3 A;  2CDP A;  4DZG A;  5HV4 A;  1J84 A;  5FZ8 A;  5A32 B;  5A1A A;  3NVC A;  4AHZ A;  1EAH 2;  2ORX A;  1GOF A;  1W2T A;  4R52 A;  1E5R A;  5IJR A;  4Q1P A;  3NV3 A;  1XOY A;  1WW6 A;  1U12 A;  3WDY A;  4D7T A;  4AVV A;  4E9K A;  2BOJ A;  1AR6 2;  4RGG A;  4CP0 A;  2R30 A;  3I97 A;  5JOY A;  3R05 A;  1RUC 3;  3VBS C;  3OEA A;  4Q4X 1;  1HV1 A;  1AHS A;  3J8F 2;  3KT7 A;  1GZW A;  5F5Q A;  1ACC A;  4OCT A;  5FY8 A;  5HCB A;  2BGC A;  2E51 A;  3MI8 A;  5FQ0 A;  5FKB A;  5CFD A;  5HCH A;  1L7R A;  3R0R A;  2P34 A;  4ISQ A;  4GB3 3;  1E57 A;  1PZ8 A;  1ZBE 2;  4QB1 A;  5L9R A;  2OVU A;  4K40 A;  1XND A;  1OI6 A;  1YFW A;  3E5U A;  1VBE 2;  2HWE 1;  4GAZ A;  4DIN B;  2JG9 B;  1O3T A;  1Z7S 3;  3IDE A;  3LA2 A;  5HV0 A;  2NYY A;  5FZ3 A;  1YQ8 A;  3AZW A;  3M2M A;  3USU B;  2AUY A;  3ZKU A;  4DRR A;  1QH6 A;  4XMA A;  2GC2 A;  1REF A;  3KF5 A;  2IXC A;  2J1E A;  3ATG A;  3VKO A;  5A70 A;  5J37 A;  4NAM A;  1SBD A;  2XUM A;  1R08 2;  3FJS A;  2YGL A;  1RXF A;  4COY A;  1UKR A;  4FBF A;  3TEZ A;  3SH5 A;  2VVF A;  3WQ1 A;  2CWS A;  5BUV A;  1T6G C;  3CF6 E;  4KMQ A;  1JTZ X;  1YO8 A;  5ACA 1;  1L7Q A;  2FMY A;  4DNY A;  4XQ4 A;  2BER A;  1OFS A;  3VDD A;  3O14 A;  4LLO A;  4PT6 A;  1ODM A;  1WZX A;  2C5D A;  4QDQ A;  1IG3 A;  3AP5 A;  4P9X A;  3H8X A;  1TNR A;  4YW5 A;  3NKG A;  2BOI A;  1A3K A;  5D8A C;  1JI6 A;  4KNC A;  3FUQ A;  1HB1 A;  1UAI A;  3CO2 A;  3AKP A;  2OUH A;  4GUL A;  4FOV A;  4MAD A;  4J1W A;  3ETQ A;  5EP9 A;  2GC3 A;  1G9D A;  4YGE A;  4P08 A;  1ULC A;  5FY9 A;  1H2L A;  3PME A;  1AL2 2;  2K9Z A;  1X82 A;  2ZHK A;  4QXH A;  1LHV A;  3GZU C;  2Q0A A;  3QAC A;  1NYW A;  2ZMN A;  4YVS C;  1SBE A;  3MUZ 1;  4GB3 2;  2X09 A;  2Y6F A;  4AG4 A;  4JV4 A;  4JZR A;  3UNP A;  1GZ9 A;  2DF7 A;  3T2P A;  4HK8 A;  5TSW A;  4CCE A;  3J7M A;  5A7W B;  4CXY A;  1KDM A;  1UYY A;  5AC9 1;  3NL1 A;  2ZX1 A;  1HXS 2;  4J6G A;  4QQ2 A;  4WZF A;  4P9Y A;  4JCK A;  4Q2F A;  1RMU 3;  2FD8 A;  1PX3 A;  1XYP A;  2OQ6 A;  4AOC A;  4CCJ A;  4DEV A;  1JZ8 A;  4NPL A;  4PBP A;  3H0O A;  4AQS A;  3ZYJ B;  1OUX A;  5A6Q A;  2HWB 3;  3NRU A;  1LU1 A;  1PO1 3;  2PAM A;  1ASJ 2;  2ZGO A;  3LFI A;  2W1U A;  2YBS A;  2XLF A;  4CCM A;  5AFB A;  3POG A;  5GLZ A;  4YZ2 A;  1PZ9 A;  2ZEW A;  3IAP A;  1S0D A;  1D4M 2;  5FYZ A;  4AED C;  4K6B A;  3VZM A;  1AJK A;  3N4M A;  2UU8 A;  1HRV 2;  5FYV A;  2V5Y A;  2XBO 3;  1LEM A;  2ZZQ A;  2BGP A;  5GJ6 A;  4M0H A;  4CP2 A;  5FR3 A;  3U0Z A;  1AUY A;  1COV 3;  1OPO A;  3RMY A;  2XL9 A;  3CJI A;  2MEV 1;  4XUP A;  4ERO A;  5KHG A;  4CA9 A;  1GP6 A;  3HD8 B;  1DGR A;  3PVN A;  1X36 A;  1NY7 2;  3ZXF A;  1Z0H A;  2QQN A;  3POJ A;  5JPN B;  1G9F A;  1QXR A;  4PI0 A;  4XIK A;  2VTF A;  3BB6 A;  4CEW A;  4EZ4 A;  1QJU 1;  5DUW A;  1XU2 A;  5LWB A;  1ULE A;  2H0B A;  1UCX A;  2QCS B;  1HB3 A;  3ZFE B;  1R1A 2;  4EN8 B;  5JZG B;  3AVR A;  1D2Q A;  4CDW A;  1RUF 1;  4DQA A;  5A3O A;  1WCS A;  4Q0S A;  1CES A;  5IVE A;  2W92 A;  4PIZ A;  5FMO L;  4XOG A;  2G9Z A;  4NPM A;  4IV3 B;  1GQH A;  1LES A;  1UPI A;  4P5H A;  1UZZ A;  5J09 A;  4HFS A;  1NE4 A;  5IVJ A;  1MS1 A;  1RMU 2;  1VBD 3;  2ARX A;  4DXT A;  3RS6 A;  1CZV A;  3VD9 A;  1CZS A;  2R04 3;  5FZM A;  5F3G A;  5C3R A;  1DBN A;  2QTW B;  4YSF A;  2ADE A;  4COU A;  1PO1 2;  3DXU A;  3RYK A;  4UW5 A;  1VRB A;  1W9Y A;  1JYW A;  1X50 A;  1W6P A;  1N3O A;  3ZYB A;  1GOG A;  4A42 A;  1LEN A;  1XNT A;  2VE1 A;  1WLT A;  1W6M A;  4UW4 A;  3AMQ A;  2RS5 3;  5C3Q A;  2X8K A;  5T54 A;  4M3C A;  1SLA A;  1CIY A;  1RVF 3;  2EAA A;  3RI8 A;  4XCB A;  2DVA A;  3SH4 A;  3C7E A;  2XBO 2;  3ORJ A;  3WVJ A;  3JBG 3;  3KS7 A;  2ZKL A;  3ZFG B;  4CU6 A;  4RL7 A;  1ENX A;  1KD7 A;  3KCY A;  1DGW X;  1JOB A;  2O14 A;  5A3N A;  4Q4Y 1;  1ALY A;  2VZT A;  3UK9 A;  3OB8 A;  3C7O A;  2F17 A;  4GJY A;  2K0G A;  3MIB A;  3AX4 A;  3POY A;  2BYV E;  3O0W A;  2DFC A;  4AQ6 A;  4AXO A;  1EY2 A;  3I2H A;  1H9P A;  2AEZ A;  1R08 1;  3CEW A;  1ZBA 2;  2ZXQ A;  2ETE A;  4R8H A;  3RZK A;  2ZGL A;  1W0P A;  5GZE A;  2DCT A;  4KH9 A;  1RUI 2;  5A80 A;  3EYP A;  4D6Q A;  5EYY A;  4LBQ D;  5K0U B;  2OA2 A;  2XQX A;  4N7U A;  4OHZ A;  2VUL A;  1PGL 1;  2W91 A;  3DEC A;  1QQP 3;  3DPR A;  4D7Y A;  1AR7 3;  1W9W A;  4OI1 A;  1AX0 A;  1AYM 2;  2ZGU A;  1VRH 2;  4MGS A;  4PDW B;  4Q27 A;  1WW4 A;  4D6R A;  4I30 A;  4AF9 A;  4EN9 B;  5JXJ A;  1TNF A;  2JIC A;  2JDY A;  1HN0 A;  2NQY A;  2ZMK A;  5ERL A;  1RUC 1;  2WL1 A;  1G8W A;  4S2H A;  1YI7 A;  4M4P A;  2PTM A;  1LGC A;  5FJK A;  2FDI A;  3T0D A;  2X29 A;  2YC0 A;  4AI9 A;  2VY0 A;  1UZY A;  3THP A;  4YM2 A;  4QPI A;  1CAW B;  1NCQ A;  4NWW A;  1XNC A;  3ZSE A;  4KQ7 A;  2Q8E A;  2VW0 A;  2J1U A;  1QDC A;  1Z7S 1;  2A5Z A;  2CYF A;  1ND2 C;  2ZGN A;  4LBQ B;  5FZ1 A;  1DP0 A;  3NJZ A;  1QGL A;  4HVQ A;  4LKF A;  5D21 A;  1OUS A;  3POB A;  4M3C F;  1MR5 A;  1ZVF A;  4NHY A;  3SXW A;  4QKN A;  3U10 A;  3WIN E;  5I8Y A;  4GA9 A;  1SLC A;  1L7L A;  5HBA A;  4UF0 B;  5DUU A;  4CDQ A;  3PHM A;  4FFH A;  3ZXE A;  3RWN A;  2WFF 3;  3PUA A;  1B09 A;  2EF6 A;  2VM9 A;  1UW8 A;  2WS9 3;  4LO4 B;  3OUI A;  2XKO A;  4C1X A;  5FZA A;  2D98 A;  1Y9G A;  4HK9 A;  3X29 B;  5JSO A;  2BZD A;  4AI1 A;  4BWO A;  3K4A A;  1HQW A;  3AC0 A;  1A8M A;  4AL9 A;  4BQ4 A;  3H8O A;  1ZRI A;  2DUO A;  2HYK A;  3HBZ A;  2V72 A;  2D6M A;  1K5M C;  2VXJ A;  1N1V A;  4TXW A;  1JUI A;  4Z07 A;  2XH6 A;  4K8F A;  1PO2 1;  4A7Y A;  1AR7 2;  3LDR A;  1JXN A;  4FFF A;  3SQO A;  2P17 A;  3O1T A;  2VCM A;  3HNB M;  1JBC A;  3BOD A;  1BXH A;  4NAO A;  4NRM A;  4YW6 A;  3UYJ A;  4PIX A;  3QOP A;  4AGG A;  4AGV A;  5CFC C;  4RFR B;  3HMY A;  5JSR A;  5KXC A;  3VL8 A;  1MPX A;  1OOP C;  3OY8 B;  1VBA 2;  4H2A A;  4NOT A;  3IDA A;  4URT A;  3DGT A;  2R1B A;  3I4I A;  4ZXK A;  3N35 A;  4CEY C;  5JI9 A;  5LA2 A;  4QPG C;  3SLI A;  5H9S A;  4XFG A;  3OBT A;  1K42 A;  4NID A;  3FC0 A;  2R1D A;  2FDG A;  4Q4W 3;  1RIT A;  1J58 A;  1WMF A;  1SZB A;  2ILM A;  1GNH A;  1Q8V A;  2F4P A;  3VBH C;  4E27 A;  4CVU A;  1HKD A;  2IXK A;  4M3C E;  1VBB 2;  5GLV A;  3RGB A;  4BK5 A;  1VR3 A;  1RMU 1;  5IW0 A;  3SCG A;  3ZXL A;  5FYH A;  3IT8 A;  3FMG A;  1E5S A;  2VUA A;  1EYB A;  1CAV A;  3FN9 A;  3GJA A;  5LAS A;  3RJ2 X;  2VJX A;  3VBR A;  1UOB A;  4DUV A;  1LOC A;  1S2B A;  2OKX A;  2HWB 1;  2YDE A;  1PO1 1;  1GZW B;  5L7O A;  1QOS A;  4PI2 A;  3SNM A;  4HZF A;  5C8C B;  3EHK A;  1MQT B;  5A32 A;  5CFD B;  3AP6 A;  1JOJ A;  4FCA A;  3T1L A;  4BIF A;  1HB2 A;  4XF4 A;  1H2N A;  5CKM A;  4ZU7 A;  2XOM A;  1ZZC A;  2ZGM A;  1V6N A;  1H0B A;  4QGM A;  5K8S A;  3MEP A;  3ZSM A;  1YQ5 A;  2ZHL A;  4L9B A;  4P9G A;  4WM8 A;  2RS3 2;  3CIH A;  4U36 A;  2WJS A;  4CUC A;  1COV 1;  1VBC 3;  1GV9 A;  5JI7 A;  2UWB A;  2VH9 A;  1P8J A;  4BYY A;  5JOW A;  2ZGT A;  3WQ0 A;  1GUI A;  1W2A X;  1SMV A;  1CIW A;  1JYN A;  3KVB A;  2V73 A;  2CU5 A;  3WW4 A;  1POV 0;  1BBT 3;  3LDB A;  4O7X A;  3VDC A;  4CDU C;  3VBO B;  3WQ7 A;  2ZOE B;  2JG9 A;  1GFF 2;  4H7L A;  2KXL A;  1UXZ A;  2VNR A;  2Z79 A;  1VAM A;  4F3J A;  1RUJ 2;  3USU A;  2ARB A;  1UMI A;  3OBA A;  4CCL A;  1OVS A;  1DF0 A;  2HH9 A;  5E1R A;  3CDZ B;  3THT A;  4MXV A;  4FT8 A;  3UKT A;  4YM3 A;  5E8A A;  1TMF 3;  2Y0I A;  1MEC 2;  5A6Z A;  3VDD B;  3Q8A A;  4Q4W 2;  2ZBJ A;  3AVS A;  4ITC A;  3HAG A;  4IGP A;  1KDK A;  1QKQ A;  1VB2 A;  4UFI A;  4XJU A;  3HEI A;  3EMR A;  4OHV A;  5FV3 A;  4A3Z A;  1LB2 A;  1QOT A;  5B4N A;  3FLR A;  4HVR A;  2Z2S B;  1VBD 1;  5FXV A;  3T2T A;  4LPL A;  4AEK A;  4AVT A;  3AYE A;  4W50 A;  1YI9 A;  5KHH A;  1LTE A;  2OW4 A;  4IE4 A;  2R04 1;  2DBN A;  4LHK A;  2J1T A;  2R07 3;  3LCP A;  3VBF C;  1NLQ A;  2CNA A;  3B9C A;  1OF4 A;  2WQZ C;  4UW3 A;  4FPG A;  3M70 A;  1Q8Q A;  3DL3 A;  4IEY A;  1BVV A;  4JGZ B;  2Q8O A;  2WT2 A;  2OPW A;  1QOO A;  1O8S A;  1H6Y A;  1XXN A;  2CGN A;  3ZSK A;  1FV2 A;  2ZAH A;  1A78 A;  2GNT A;  2RS5 1;  1RHI 3;  3HNY M;  4W65 A;  1RVF 1;  3QBQ A;  5HCA A;  5J48 A;  2YY1 A;  4OHX A;  1BK0 A;  1PVC 3;  2K46 A;  4DFS A;  1MVQ A;  1YFY A;  1SAC A;  3JBG 1;  4IUG A;  3I3M A;  5GAL A;  5LZ6 A;  3NMB A;  3WNK A;  3KF3 A;  4BQ3 A;  1N3Q A;  4FFI A;  5FZE A;  5FP8 A;  5F7U A;  5CB7 A;  3IAQ A;  2VVE A;  5A7W A;  2BFU L;  1BBT 2;  2R49 A;  3MIF A;  2K2S A;  1HW5 A;  2E32 A;  2J1R A;  2RS1 2;  3FLP A;  3M3C A;  3OGS A;  2A75 A;  3B69 A;  5CBL A;  2R0H A;  5EJ1 B;  5IWF A;  4PQ9 A;  2IC1 A;  5E88 A;  3ZMO A;  5BNP B;  2DU0 A;  3R4U A;  3V0A A;  1O5L A;  1POV 3;  1UY4 A;  1CQ9 A;  4EN6 B;  3DKQ A;  3LAG A;  1E5I A;  2PMW B;  1TMF 2;  5JIA A;  1FT9 A;  5FUN A;  2ZTN A;  4BQ5 A;  1V00 A;  3BYW A;  2P2K A;  5F39 A;  2HJI A;  1M06 G;  3ZDV A;  1ZZB A;  2JWP A;  1RYY A;  3K4Z A;  2DCJ A;  1ULG A;  5F1R A;  5IYY A;  2BV4 A;  4FOQ A;  5LBE A;  2IFW A;  4L11 A;  1QQP 1;  1PGW 1;  1AR7 1;  4I09 A;  4XBN A;  1D7P M;  2HWE 3;  4EJR A;  5F32 A;  3TEY A;  1DQ1 A;  2XJR A;  2ZA9 A;  4N90 A;  3AZV A;  2RJ2 A;  5A3M A;  1IGO A;  1KRI A;  2IZW A;  3OCP A;  1NQJ A;  3I3Q A;  4WM7 B;  2D6O X;  3LKJ A;  4W6X A;  1WD3 A;  4Y1Z A;  4H7M A;  2RJL A;  5ABJ A;  2VZR A;  3LZZ A;  4H14 A;  2A73 B;  2GU9 A;  2NPI A;  4QWN A;  1I1E A;  1XNA A;  3T09 A;  3ES1 A;  2NM1 A;  2PA7 A;  3WCR A;  3N7J A;  1U5I A;  2GZW A;  4Q0P A;  1ZX5 A;  2QQO A;  4V2W A;  4DEQ A;  1DZT A;  2R06 3;  1OQE A;  5EFU A;  1SFY A;  1XYO A;  3T1M A;  2WNU B;  4CCD A;  2QQL A;  3ZFE A;  4LBK A;  2ZGR A;  5JZG A;  2P3Y A;  1YNA A;  2ARE A;  2PFW A;  1MS0 A;  3WG3 A;  1WBF A;  1NCR C;  1XE8 A;  3EB7 A;  1TVG A;  2DUQ A;  4LBJ A;  5EXO A;  2VMC A;  4COZ A;  1VPH A;  1RUE 2;  3JXS A;  2DU1 A;  4QXK A;  3AXE A;  4GIQ A;  4IV3 A;  2JDP A;  3TRS B;  4DS0 A;  4Q29 A;  1H8T B;  1W8O A;  1R09 3;  3ACF A;  4JC1 A;  4HAN A;  2VQ0 A;  5LW9 A;  2WFF 1;  1OD3 A;  3ZYP A;  2ZHM A;  5BNN B;  2RDN A;  4B7E A;  2WS9 1;  2CWM A;  2BBV A;  2QQW A;  1DZR A;  4XFC A;  5GKA C;  1TE1 B;  3KQR A;  1FMD 3;  4OZX A;  4GWM A;  3WNO A;  1ZRR A;  3ZXD A;  4DOU A;  5FAX A;  2RM2 3;  2UYB A;  2B9V A;  4DO0 A;  2Z4F A;  2HWC 3;  3OD4 A;  2XKP A;  2IUW A;  1GLH A;  2G4I A;  2XJU A;  1CJD A;  3K51 A;  4Z1V A;  2HWE 2;  4QHB A;  4JQT A;  2E7Q A;  1W28 A;  1UX7 A;  2VMD A;  1IOA A;  4QHO A;  3WDT A;  2JIJ A;  2XL7 A;  3ZFG A;  4Z2A A;  2ZPX A;  2VZU A;  5I0R A;  2BPA 2;  1WKY A;  3AKT A;  4NRP A;  4BLJ A;  1HLC A;  5FP4 A;  2D43 A;  2IXL A;  1J3Q A;  4MLO A;  2BP6 A;  2PLV 3;  3L2Y A;  2WO1 A;  1DCS A;  1EUU A;  5H9R A;  3IMM A;  3ZOI A;  3DV8 A;  4Q4W 1;  4QX5 A;  4GWN A;  5LEK A;  2EAL A;  5ACA 2;  4XQD A;  4GH4 B;  1W9F A;  4Q0U A;  3ZM8 A;  1EP0 A;  1HJG A;  4Q5O A;  2FHR A;  3K2O A;  4LXL A;  1CGP A;  3CHX A;  3GAL A;  4XE9 A;  4IE7 A;  3T30 A;  2Z69 A;  3MBW A;  3FHA A;  1V0A A;  4FQ4 A;  2XLA A;  3B01 A;  2JE9 A;  1ZYB A;  2XR4 A;  3RI9 A;  1E5H A;  4TLF A;  4IEZ A;  4AI0 A;  3MO4 A;  2MEV 3;  4ZU4 A;  1CD3 G;  1C28 A;  1N47 A;  4XXP A;  4Y24 A;  5FXW A;  5A6Y A;  2W0X A;  3BU7 A;  4YZ1 A;  1LOF A;  2VMF A;  1W6Q B;  3F95 A;  2ZHN A;  3AJY A;  3I2I A;  4XJW A;  2DBI A;  4PDW A;  4A6O A;  1JYX A;  3O1V A;  1AYN 1;  1B35 C;  1FMD 2;  1YUD A;  1UY0 A;  3J26 N;  3WLU A;  1GQG A;  4A3X A;  1NCQ B;  2WO2 A;  5A3L A;  1DU3 D;  1PNG A;  4TSV A;  4AHX A;  4IDZ A;  4J1X A;  1GZC A;  3AYC A;  4YNI A;  2VZO A;  1K45 A;  2DVF A;  1VBC 1;  1J83 A;  1TME 3;  2PHT A;  3KD4 A;  1UKG A;  1DQ4 A;  3MIE A;  5AC9 2;  5FPX A;  4E4Z A;  3S5A A;  2Q8C A;  2FCT A;  1DQ0 A;  3ZXJ A;  4CDQ B;  3OG2 A;  1CAW A;  1W0O A;  4FPC A;  4LO7 A;  4P9I A;  1GOH A;  4A2U A;  4B8E A;  5JPM B;  2R16 A;  1CAX B;  2RHP A;  1O4T A;  4GAL A;  4LBQ A;  4N9I A;  3ON7 A;  4LUK A;  5T55 A;  3TN9 3;  3NKT A;  4R4X A;  3IM0 A;  5DG2 A;  4F8A A;  4QQO A;  4BQY A;  3T08 A;  1JZ2 A;  4DXZ A;  1QEX A;  4N9H A;  3SMH A;  1IQD C;  4RS5 C;  4XAC A;  5FUI A;  1ND3 C;  4UF0 A;  1G7Y A;  1JYC A;  3JB8 A;  1WA6 X;  1KGY A;  3FWE A;  3AYA A;  2UUR A;  3WF3 A;  4FPJ A;  1J59 A;  1UYX A;  1US3 A;  3OEB A;  2VQU A;  3PVO A;  4NHK A;  1U0A A;  4QU2 A;  3WNL A;  2WO7 A;  4XF9 A;  1QJY 1;  4Y5Z 0;  3VZO A;  2E53 A;  4BQ2 A;  3A0N A;  2Q5T A;  2VTX A;  3WHU A;  1I6X A;  5T5P A;  1KXG A;  2R07 1;  2MEV 2;  3VBU B;  3U11 A;  2E7A A;  2EXH A;  4KG8 A;  5AVP A;  2ZGQ A;  2WAA A;  5LY1 A;  1LAJ A;  1OD5 A;  5JWP A;  3TEW A;  1DZQ A;  2JG8 B;  3AKS A;  4TLG A;  1K12 A;  2W1S A;  4CU9 A;  3MF9 A;  3M3Q A;  2QDN A;  4QB2 A;  1QJU 2;  3UL2 A;  1RHI 1;  5IFP A;  4Q0Q A;  3F2Z A;  3OY8 A;  3D6E A;  4OFG A;  2YMZ A;  3C7H A;  1QU0 A;  3SCH A;  3WX5 A;  4YW2 A;  5IVY A;  2VQA A;  1OLR A;  4RHV 3;  1PVC 1;  2NN8 A;  1RUF 2;  5JAX A;  4D7S A;  4U2A A;  2XHK A;  4HL0 A;  4S2G A;  1RL3 A;  3PUQ A;  2HLE A;  1AR9 3;  1RIN A;  3SH3 A;  1QMJ A;  2D5H A;  1TME 2;  4CP1 A;  1CR7 A;  1ZM1 A;  1OA2 A;  3DN7 A;  2VZS A;  3ZN5 A;  4C8D A;  1YQC A;  2A70 A;  2I74 A;  5IVF A;  1G9A A;  4QX0 A;  3IIA A;  1OKO A;  1AR8 1;  1BEV 3;  2WIN B;  2XWJ B;  2AGS A;  4LK7 A;  4KI5 M;  2J7M A;  4PHZ A;  4CP9 B;  1POV 1;  4CCC A;  4Z82 A;  5FY5 A;  2LTN A;  3PL0 A;  4W6Y A;  4Y26 A;  3JCI A;  4LNV A;  3MDP A;  4WM8 B;  2BNO A;  5C8C A;  1C1L A;  5FXX A;  1MQT A;  3B00 A;  1QY4 A;  1PNF A;  1Y43 B;  3UKN A;  4GMP 0;  4DY3 A;  2VW1 A;  1TQ5 A;  2E31 A;  3JQX A;  2WWJ A;  3OUH A;  4B1M A;  1V6L A;  3RMX A;  2Y0O A;  2TUN A;  4HON A;  3ZIW A;  4O9E A;  3N7K A;  2ENR A;  2EIE A;  5B2G B;  1UF2 C;  3V65 A;  4FPY A;  4XC9 A;  2VEC A;  5DAQ A;  3TOJ A;  4Q4Y 2;  3POE A;  2ZCW A;  3OBR A;  4ISR A;  4LK6 A;  2A71 A;  4AWD A;  3JU9 A;  2O8O A;  4AFB A;  4L99 A;  4HXC A;  3D0S A;  2HWD 1;  2GH8 A;  3C3V A;  2A6Z A;  2AAC A;  4AK3 A;  3JB4 C;  3VBO A;  2F6B A;  1O7F A;  3NO8 A;  5FZG A;  4YWA A;  5CVR A;  2R06 1;  2TNF A;  5DAW A;  3ACH A;  1MS5 A;  2WN2 A;  3H7J A;  3VD7 A;  2P5B A;  3O12 A;  4E2G A;  5J96 B;  4Y33 A;  1AZD A;  1OA4 A;  2ADD A;  4LE3 A;  5I8S A;  1AXY A;  3WG2 A;  4A41 A;  5C4W B;  2VOV A;  2VUJ A;  1PGL 2;  1PVX A;  5FYY A;  4NHM A;  3INA A;  2Y6H A;  1PO2 3;  2H0V A;  2P37 A;  3GHN A;  3M3I A;  1HN1 A;  3M3O A;  4S2D A;  3ZYF A;  1QH7 A;  1R09 1;  3OGR A;  3PVE A;  4N43 B;  1QJX 3;  4O9G A;  4IE6 A;  4PLN A;  4YGD A;  4MO3 M;  1RXG A;  1I5Z A;  1NXM A;  2DCY A;  1SDW A;  4OUM A;  4YM0 A;  4IV1 B;  1RUC 2;  2G19 A;  3VZN A;  2W39 A;  4K7J A;  5GM0 A;  3POF A;  2V09 A;  1S2K A;  1SBF A;  2BDR A;  1FMD 1;  1IHM A;  2RJK A;  3I2J A;  3N3H A;  3ZKY A;  4JGZ A;  1FI2 A;  1RIR A;  2C9A A;  2NZ9 A;  2P1B A;  4AVC A;  2C24 A;  3MLL A;  2RM2 1;  4AVB A;  4BH9 A;  5JOX A;  5JMC A;  2HWC 1;  3CLP A;  1CAU B;  4AVA A;  5IT6 A;  4PLO A;  1H2K A;  4LHS A;  3PNA A;  3N9N A;  4LOS A;  3S7E A;  2FDK A;  1OH3 A;  2YC4 A;  1D0H A;  1Z7S 2;  4GMP 3;  4Y5T A;  5K0U C;  3E6B A;  5KXE A;  1QDO A;  4LIU A;  1ZZ9 A;  2ZAB A;  3H8U A;  1W8W A;  5DN2 A;  4ZS3 A;  5FY0 A;  1JZ3 A;  3V0A B;  2G9G A;  5SV8 A;  3U1X A;  1POQ A;  1W39 A;  5DXD A;  4LKS A;  1O3R A;  1N3P A;  5FPL A;  1SFN A;  5ANN A;  2PLV 1;  4HT1 T;  2EXK A;  4IL7 A;  4HN0 A;  4KWJ A;  1J3R A;  4YRD A;  3O7O A;  1Y7B A;  4RR3 C;  2B42 B;  3MIH A;  5LK5 A;  3T0A A;  3NJY A;  5BNP A;  2XJP A;  2V5D A;  5L9B A;  1D0G A;  5A7O A;  2ID4 A;  4IEQ A;  2YYO A;  4UFM A;  4GKY A; 
#chains in the Genus database with same CATH homology
 1OH3 A;  4AL9 A;  4BQ4 A;  3ORJ A;  1W90 A;  4CP9 A;  1GWK A;  2LRO A;  3F95 A;  2KR2 A;  3ZYF A;  1OKO A;  4YW7 A;  3UT0 A;  1WCU A;  2VXJ A;  3ZYH A;  4BQ5 A;  1W8W A;  2O14 A;  4LK6 A;  4LK7 A;  4CPB A;  2K46 A;  4LJH A;  2Q1F A;  4CP9 B;  1W8T A;  4LKF A;  1W8Z A;  5D21 A;  2JWP A;  4CPB D;  1WMX A;  4YW6 A;  1W8U A;  1W9F A;  4BQ3 A;  3ZYB A;  1HN0 A;  1GWM A;  1L7L A;  4YWA A;  2LRP A;  4LKD A;  1GWL A;  2C24 A;  1V0A A;  4LKE A;  1UOJ A;  4BQ2 A;  4A6S A;  2WYF A;  1WZX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...