3ZYHA

Crystal structure of pa-il lectin complexed with galbg0 at 1.5 a resolution
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
121
structure length
121
Chain Sequence
AWKGEVLANNEAGQVTSIIYNPGDVITIVAAGWASYGPTQKWGPQGDREHPDQGLICHDAFCGALVMKIGNSGTIPVNTGLFRWVAPNNVQGAITLIYNDVPGTYGNNSGSFSVNIGKDQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein/inhibitor
molecule keywords PA-I galactophilic lectin
publication title A Glycopeptide Dendrimer Inhibitor of the Galactose Specific Lectin Leca and of Pseudomonas Aeruginosa Biofilms
pubmed doi rcsb
source organism Pseudomonas aeruginosa (strain atcc 15692 / dsm 22644 / cip 104116 / jcm 14847 /
total genus 23
structure length 121
sequence length 121
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07828 PA-IL PA-IL-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.430 Mainly Beta Sandwich Jelly Rolls Galactose-binding lectin 3zyhA00
4LK7A 1GWKA 1L7LA 2WYFA 1GWLA 3UT0A 1W90A 2K46A 2LRPA 1W8UA 4LKFA 2Q1FA 4LKEA 4CP9A 3ZYBA 2JWPA 1HN0A 3ORJA 4YW7A 1UOJA 1W8WA 1GWMA 4YW6A 4YWAA 4BQ4A 4AL9A 1WZXA 5D21A 1W8TA 4CPBD 4LKDA 4A6SA 1V0AA 1WCUA 4BQ2A 1W9FA 4LK6A 3ZYFA 4CP9B 2VXJA 1W8ZA 4BQ3A 2O14A 4CPBA 1WMXA 1OH3A 1OKOA 2KR2A 3F95A 4LJHA 2C24A 3ZYHA 2LROA 4BQ5A
chains in the Genus database with same CATH superfamily
4RGGA 5JMCA 3WNLA 2WBKA 4DO0A 5FZ9A 3C7FA 1GWLA 3W9AA 4AGRA 3BYWA 1PO11 3MIFA 1O3RA 1W8OA 3WCSA 1DF0A 4Q4V3 2JG9C 1O4ZA 1W04A 5HBAA 4MXWB 4WVMB 4ZU7A 5C33A 2XWBB 2BZDA 5C3PA 5A7SA 2J1EA 2W94A 2HWC3 2CYFA 2CAVA 1O59A 1U0AA 2J1UA 3N9LA 5F1RA 3RDIA 2XMLA 2RS12 1QJX3 1ND2A 1WBFA 1SFPA 2F17A 2OZ6A 1LRHA 2WFF2 3UGHA 4LHNA 4Y20B 2DCJA 5FOJB 4JRLA 3TRSB 4Q4W2 4COUA 1ZRRA 3ZXJA 3ME2A 2WWUA 3MEPA 1W06A 5JSPA 3R0RA 2VQUA 3OGVA 4E4DX 3ZXFA 3SEPA 4QKDA 2IFWA 3ZYRA 2A75A 2HJIA 3V0AB 4M3CF 3NJVA 4A7YA 1COV2 1QGLA 5LK5A 4XHXA 2GH8A 4CXYA 4FQZA 1BHGA 2Y8KA 4KU7A 3OCPA 3FLRA 1GQHA 3M3QA 4IV1C 3RZLA 1N3QA 1PMJX 2DV9A 3CEWA 3GNEA 3P5BA 5TSWA 1BVP1 1SFYA 1OD5A 1YO8A 3BTAA 5CIRA 4YGBA 2ZEYA 2J42A 3MPBA 1YCIA 2FMDA 2D40A 3I54A 4F83A 1N3PA 1SBFA 1Y9MA 1MR5A 3PUQA 2FCTA 2EIGA 2VC9A 5DDJ2 5H9PA 3WNPA 4A7KA 1JTZX 3RS6A 4FTBA 3K48A 1VR3A 2AYHA 1KS4A 3J9SA 1YLLA 1MVEA 4QPIA 4P9LA 2W08A 2G19A 1W3XA 5EWSA 1MS1A 2IXLA 1QDCA 3FLPA 5LB6A 1YWKA 1VRH1 2QZ2A 3ORJA 2C5DA 1B35B 1VMJA 2Y0OA 1LHNA 2Q8EA 2ZX4A 1WZXA 1W8TA 1OURA 3ST7A 1ULOA 3HMYA 4A2UA 2W5FA 2WSVA 2ERFA 1C3HA 4A3XA 1V00A 2V5YA 4I30A 3KB5A 1RUOA 4FAHA 3H3ZA 1OOPB 1WLWA 4L0PA 4OYUA 4HL0A 4UF0A 4OHXA 4KI5M 4XDOA 2D6OX 3S5QA 1TVGA 1UZ0A 2BPA2 4XFCA 3UT0A 1X7NA 3MPPG 3DKQA 2OXBA 3GZTB 3FLTA 2B7YA 1UY0A 2GNBA 2RS53 4QHBA 4HBNA 5FIXA 1EP0A 5T5PA 4CDQB 1SDWA 2VG9A 3CZUA 4GB33 4HMZA 4QXBA 4UI9L 5FZ3A 4LMFA 2OKXA 4KWKA 5JAXA 3VUOA 1LODA 2F6BA 1QMJA 1PX3A 2QQKA 2IUWA 2AGSA 5CFCA 2V5DA 4P9YA 5IATA 4C8DA 1RUD3 4PCRA 4Y5SA 4IDZA 4NHLA 4CPBA 1OFNA 2QFEA 3POWA 4LBMA 1AF9A 2EIEA 5F9TA 1CX1A 1IKPA 4HPKB 1DQ2A 3IAPA 3PL0A 2R061 2Q8OA 1GBGA 4WVZA 2FD8A 4HK9A 1ST8A 1V6JA 1HW5A 1YC61 3GJBA 4AK3A 3AP6A 3PMEA 3UKNA 2DCYA 1YUDA 2BGOA 4LITA 3WUDA 1A8DA 2VUAA 3RG0A 4JGZC 3WDYA 3WNMA 2ZEXA 2DDUA 1FOD3 1QJU3 4YG3A 2VZRA 5L9BA 5FKBA 5FY8A 4CDWC 4XQ4A 4BOWA 1N1TA 5GZGA 3GALA 3H7YA 1FV3A 2PLV1 4MG2A 4S2DA 1K5JA 2HWE3 3NMBA 3M70A 4GD4A 4DNYA 3NNLA 1YQ5A 3O5SA 4EN6B 1HRV2 1MPXA 1MEC1 4HVOA 1W9TA 3J7HA 4ONUA 4PF1A 3U11A 3VDDC 5IVVA 4MO3M 1URXA 4IEXA 1V6OA 1S0DA 4P9JA 5FZ4A 1KDKA 3VKOA 2IVJA 2ZHKA 3AYEA 3LIHA 1YJKA 4PQ9A 1E5HA 2AH2A 5F3GA 4LA2A 3B7MA 1MS8A 2W92A 1ZRDA 3KLSA 5T54A 3I3QA 1H1IA 2NLRA 2WKKA 3QH7A 4TN7A 4YW6A 5JXHA 1ZBA1 1NE6A 4NRQA 3VBRA 4NIGA 3LE0A 1AR61 4DOUA 4TLGA 3O1SA 3UKTA 3I2JA 3DV8A 2E7AA 4N43C 5A32A 3BU0A 1AR91 1H9PA 4ISRA 1AL23 1OQDA 1O5UA 4QX7A 4XCAA 4KGQA 1EAH2 4B1LA 2XLFA 3VBFA 5I0UA 2ETEA 4JCKA 4AFAA 4LEJA 1O5LA 5FZCA 3ZSLA 2LROA 1M4WA 5A7PA 3MIHA 1AUYA 2VBPA 1BJQA 3H7JA 5FQ0B 1RUG2 2NZ9A 5A80A 4JDNA 1WW4A 1DQ5A 3LFIA 2H0BA 3DYOA 1RC6A 4OULA 5H9RA 4OI1A 5CA6A 1EV12 3VL9A 5DZFA 4XZUG 1XNCA 3A23A 2DUOA 3QD6A 2PHXA 1ZNPA 1EUUA 3DPRA 1LU1A 1XC6A 3SCFA 4IW3A 4LO6B 4AEJA 4AFCA 2P3KA 3HWJA 1MQTB 1JZ5A 3MFCA 1BXHA 1VBA2 4Z1VA 3TB0A 4Z92B 5KHKA 1UOFA 1YHFA 1GP4A 3VBOB 2C26A 1FT9A 4YRDA 5CKNA 2XJTA 1HB4A 4K20A 4Z82A 5J09A 4BCUA 1ALYA 2RHPA 2VBBA 2VNGA 2Z2SB 3FMGA 2YROA 4OLLA 1RUE1 1UL9A 1WD3A 4KQ7A 2P1BA 3Q8CA 4AR2A 4BHPA 3I49A 1RVF3 2JDKA 2JG9A 2WUHA 2ZHNA 1GOHA 5A7WA 3B9CA 4C0HA 4Q8KA 1ZRCA 5I0TA 3ATGA 3DCQA 1IS4A 4RS5A 4XFIA 3MLJA 1XYNA 2JDPA 3I8TA 4BDVB 4CDXC 1GZ9A 1QXRA 3JBG3 2JG8C 5EHDA 1ASJ2 3VBUB 4QKFA 5T3NA 4MHRA 3VZLA 3WP3A 3POYA 2DCKA 3H8XA 1H6YA 3EB7A 4FP2A 2MPFA 1DYKA 4UWDA 1KXGA 1K12A 2VO5A 4MGIE 4LT5A 1FATA 1PM4A 4B3NA 3V56A 1JYTA 1UD1A 5EJ1B 3LEGA 1QJFA 4EWEA 1QY4A 1VIWB 2DYCA 3RZMA 3OGJA 5C9AB 2WDBA 4B7KA 5JWPA 4HN1A 2V4AA 3VD3A 4UFLA 2F4PA 3ACIA 4K9SA 2RDNA 3PMSA 3B3QE 4A7ZA 4HSJA 4NHXA 1ZRFA 2VZQA 4N7UA 1YQ8A 2W87A 4IESA 4IETA 5EXOA 4IV1A 5A1AA 2ARXA 1O8SA 1JYVA 2O1QA 4N53A 1PZ7A 1NA1B 4YGEA 1Y43B 3WDVA 1R64A 1LOEA 4AQ2A 2BVVA 1DGWX 4FTEA 2VXJA 1UMZA 1JYCA 1POV3 4EE2A 1UU6A 5LBCA 2Y6KA 4JTOA 4PIXA 4XF0A 1PVC3 1C57A 1VALA 3OUJA 2JD4A 3MF6A 3NO8A 1R081 4IV3A 4GWIA 2CDOA 5BNOB 4CP2A 3WNNA 4FXKB 1PIV1 1CQ9A 3I97A 4IERA 4LLFA 1LGBA 4BJ0A 2VXRA 4EZHA 5CVRA 3H9AA 5IK7A 2OUHA 3AKPA 5BXXA 3VDCA 1JZ4A 4M00A 4GWNA 1DGLA 4LIVA 3WY6A 4Q4V2 2WL1A 4CYDA 3GF6A 1VB2A 2VGDA 5EJZB 5G05L 4AL9A 2AREA 5FYBA 4D0QA 2VUJA 1G9CA 1AHSA 4XDQA 2HWC2 3OY8B 3U1XA 2VE1A 3DECA 2XQRA 4O65A 3WQ7A 2BRTA 5KHJA 2CWSA 3RPQA 1W8ZA 3R6SA 2EIBA 4XXPA 1QJX2 4CDUC 4MHUA 1JUHA 3BN6A 5KHGA 1W6NB 4QPGC 3WF4A 1OKQA 1NKGA 4FSJA 1RL3A 2ZGQA 1XQNA 2HEYF 3S57A 2YYOA 3RZGA 3AZVA 5I91A 3AYDA 3MLLA 3RWKX 4WVWA 1GZWB 3NV3A 5F3IA 1H8TC 5FPVA 2C0ZA 4XQDA 1W6PA 5F5CA 3EJKA 3RRDA 3ZIXA 5FPXA 5DUVA 1UO9A 2MEV1 4PBOA 3AP4A 1XYOA 3H1MA 3SITA 3IKWA 2A7AA 1REDA 2J1AA 4NR1A 4HN0A 5HV4A 4GMP3 1VLNA 5DZGA 4JKKA 3HR9A 1HDKA 2A3WA 4AVVA 1ZBE1 2IC1A 1BCXA 4IEUA 2B42B 1V9U3 1PGW2 1WA6X 2IXCA 1XE7A 3S7IA 4W6XA 2X8KA 4QX1A 2EALA 2VMDA 2VZPA 4XBLA 1J58A 4ZONA 5FPBA 1RYYA 5HXMA 2ZKLA 5C4WC 1RUF3 1J1LA 2XHNA 3FN9A 1TNFA 4COZA 4ES9A 1WKYA 3ZFEB 2WT1A 5CYYA 4LUMA 2DUPA 3WQBA 2QQIA 2TUNA 3WNOA 3GBGA 1MZ5A 5JOYA 4G4FA 4BQ4A 3ZXAC 1VB4A 1F4HA 3HNBM 2VQ0A 3A0KA 2YHJA 3S5AA 1DQ1A 4QXHA 3NAPA 4W8JA 3NV2A 1RINA 3I2IA 2WO2A 2AZ5A 4AQSA 3B93A 3B01A 3H8RA 4RYDA 1ULFA 5JXGA 3W5MA 1P8JA 4RQPA 1NCQC 5F37A 2JDYA 3BIWE 3JD71 1OLME 2JJ6A 2VOXA 4I09A 2PA7A 5FZBA 3KCYA 2ZEZA 1QQP3 2WNOA 3WUCA 1TME1 3AMNA 5C3QA 2JD9A 2RS52 5BY5A 4Q4Y1 3UYJA 3HT1A 1AXZA 4GB32 2A5ZA 5IK5A 2EICA 1U5IA 4UFHA 3WF2A 3T0BA 4BQ1A 3K2OA 5DAVA 2FBEA 3SC7X 5D8AA 2EA7A 2W3JA 1RUD2 4DY3A 4R9AA 5FDBA 4Y33A 4UFJA 3ILRA 1GNZA 4WZFA 3DL3A 1C5HA 1LOGA 2DTWA 3S0MA 4EQVA 3DEMA 4NIAA 3WLUA 1AYM1 5I0DA 1NUKA 4UW6A 4TWTA 2RS33 1W2OA 4JAAA 1YFWA 2WNVC 4LBQA 1FOD2 4Q4X3 2R49A 1JS9A 4PLOA 2Q4SA 2D7FA 5FYCA 2ZMLA 2FDFA 2XVKA 3VKNA 2AR6A 2VMHA 4LK6A 3I2GA 5CFCB 4XFGA 1RUI3 4ZZ8A 3THDA 2HWE2 5ACA1 1FMD1 4NPLA 3HD8B 3VGIA 1KS5A 2JX9A 1EPZA 4DEVA 4P14A 4AHXA 4KMQA 2VOTA 3GHNA 2ADDA 3L9JT 5CFDB 1V6KA 4IEVA 3SMHA 3ZIWA 1BYHA 4OMCA 4ATEA 4CEWC 3FC0A 4W4ZA 5A33A 1N1YA 2E9QA 3R4UA 2WLQA 5F3EA 2FDHA 3CDZB 4YFZA 2JG8A 5LA9A 3QACA 4INDA 1TE1B 3ABZA 5C7GA 3VBHB 3AMMA 1IQAA 4UBHA 3BKZA 4LORA 2ZAHA 2ZOEB 2BW8A 3SXWA 2KA3A 4BE3A 1AL22 4XJ9A 1UU5A 2A73B 1CD3G 3I4IA 4JQTA 2IXKA 2B39A 3WW2A 1POQA 1IQDC 3HQXA 2GC0A 1D4VB 1T2XA 3KGLA 1W6MB 1G9DA 3CL1A 2A3YA 1ND2C 2I07B 3OUHA 4A42A 3KVAA 4BU2A 4L97A 4U36A 5GZFA 2QQJA 2OA2A 5I8YA 2W2IA 4P9WA 4D6RA 2XKOA 5JIAA 1PO23 2YY1A 2IWGB 2RM23 2Y6JA 2PHWA 1RITA 3TOJA 4YARA 4YW7A 3O1VA 2BP6A 4LE4A 5FZFA 3H50A 3LGRA 4RHV1 3AJZA 3MO4A 3HBZA 3VBRB 4DEQA 3D8CA 1X9PA 5CU1A 2VECA 5KC6A 2VBDA 1H0BA 4XUPA 4FPHA 4L99A 2VL4A 3K3OA 4LBNA 4YM3A 3NNJA 2XBO3 3PNAA 3T0AA 2EAKA 3WF1A 3K4DA 5SV5A 3LFMA 3MV11 1DQ0A 3VBFB 1LEMA 3GJAA 2XLAA 3JB8A 3PHMA 3UETA 1UX6A 3AJYA 2EXJA 5LASA 2W1WA 4K3UA 4K21A 3IN9A 2ORZA 3LKJA 1STMA 2UWBA 4RFRB 3GCWA 3WW1A 2EIDA 5JPNB 3HN1A 2ATFA 1IZ3A 1RMU1 1UF2C 1NQJA 4QPIC 3TAYA 4E2SA 4M0NA 3JBG2 4RR3C 4JRAA 4UAPA 1F4AA 3RSJA 1RIRA 3DPRB 2Y33A 2O8QA 4AHZA 1XNKA 5LBFA 1F31A 4BH9A 1C8NA 4CDUA 4DINB 5J36A 4YSFA 4V2WA 3D3AA 3AKQA 4QPGA 1TZOA 3BPSA 1R1A1 4MVTA 2XR4A 1Z7S1 4DB5A 4CVUA 1L7RA 5ABJC 1E5SA 3OPTA 3HVDA 2W47A 4CU8A 4DIQA 2YMZA 3RYKA 1AX0A 3A22A 2YGLA 3GYDA 4CU6A 1S2EA 1SQ4A 4Y5Z0 1Y7BA 3UESA 2FDIA 1VBB3 4J6GA 5H9SA 4ASLA 2JG9B 1X9TA 2HLEA 1PVXA 4KG8A 3EHKA 2AACA 3WG1A 4ARYA 3VHRA 5C70A 2R0FA 1WCDJ 4E9KA 5FPLA 4Y4YA 3AXEA 3NV1A 1CAVA 4RSUA 1JN2P 1JXNA 2D93A 3RMYA 5IVEA 2RS11 1H1AA 2K0GA 2AENA 1PVC2 2WFF1 3KWVA 1YQ2A 4Y26A 2YFZA 5LRRA 2BNMA 2Z42A 4OZOA 4Q4W1 4QB2A 2ZA9A 4AVCA 1D4M3 2BGCA 4D7SA 2GDFA 4PHZA 4Y1YA 5KR7A 5LK7B 1ZZ9A 5CZKA 4URTA 1D2SA 1DYPA 3TEZA 1COV1 5LWBA 4CRQA 2CAUA 4IV1B 3T1MA 2VCCA 3CKHA 2VULA 5KBFA 1IHMA 4YZ4A 3CU7A 1OHFA 1UZVA 2HWB2 4BQ2A 2X09A 1AJOA 5DMYA 4G9SB 1NCQA 1OPOA 3OBTA 3PTYA 4XFFA 3SEEA 1LOCA 4JHZA 3WG2A 2B9VA 3MW2A 3NKGA 2O8OA 5DDJ1 3VL8A 1BEV3 2B5HA 2XHKA 2D97A 3AVSA 3VV1A 5AC93 4LXLA 4HK8A 3WOGA 4PLMA 1SLIA 3NSTA 1HLCA 4OQ8A 3NRUA 2PMWB 4XJZA 4YW5A 1OLQA 1A6CA 1F15A 2A70A 3FUQA 4ZZ5A 1U5YA 2HWD3 4FPJA 4FO9A 5I93A 4B29A 3TEYA 4JHTA 1I1EA 2GC3A 2OT7A 3U78A 2ENRA 2ZX2A 3Q8BA 2Y6FA 4D94A 2VMGA 2DU0A 4MSVA 4CA9A 1V9U2 3ITQA 3WDTA 2VZVA 2D6PA 3VD5A 3GBFA 5BNPB 3FUOA 4GKXA 3TBDA 2B8MA 5FYSA 5FY4A 2GMPA 1DFQA 2XLGA 5FLHA 1HQNA 4XOGA 2HBTA 1GZCA 3J7LA 5FZOA 4TTGA 1WMDA 2WNVA 3S7EA 2X5IC 1JZ7A 1OVSA 1RUF2 2TEPA 1GU3A 5F2WA 1AR83 4LKEA 3CJIA 1HN1A 3ZX7A 3OYWA 1OFSA 4L92A 5FYTA 5FY1A 3SH5A 1UXXX 4YZ5A 3NV4A 1ZZ8A 1W8NA 1YQ6A 2VW0A 4YGDA 2FDKA 2DTYA 3ZYPA 2WT0A 4LUKA 4AEDA 4TZDA 3LAGA 4LKSA 5CB7A 2PTMA 2D98A 5J98B 4BM8A 4WM7A 1UWWA 1VBC1 1Y4WA 3OEBA 2NM1A 1QXPA 4IEYA 1IGOA 1XNBA 1CJDA 2XVGA 2OVUA 1W8FA 2P6HA 1LCLA 4JGZB 4HG6B 1CIYA 2W68A 1QQP2 1XPWA 1CZSA 4CDWB 4CP9B 1A78A 3OSDA 1CPMA 3N7LA 2RMU2 4RS5C 4X8NA 3SISA 1Q8QA 3PTRB 2ZEWA 3RI9A 3NNFA 2VD7A 2CSGA 3R4SA 5I8TA 2JEMA 4I0WB 4PDWA 2Q8DA 1W03A 2O14A 3DYMA 1W2UA 2JIJA 3JCIA 1AR73 1X8MA 3LPFA 1SMVA 1YQCA 2XXZA 3BCWA 2VW2A 4GA9A 4YVSA 4CP0A 2ADEA 1W6OA 2WS93 3POBA 1HRV1 3VDDB 2VVDA 1C1LA 4F3JA 1GWKA 4QX5A 2YXSA 4U2AA 4OHVA 1I6XA 5FREA 2R32A 4NRPA 2MNGA 4J25A 5I0SA 3WQ1A 4XF3A 2R7EB 4FPGA 4QM9A 3OGSA 2Y0IA 3C7HA 2RS32 1NT0A 3B9IA 4KWUA 4JQRA 2NMNA 1F5FA 2WLPA 3LB9A 3MIEA 3OB8A 1W8WA 2JE8A 4Q4X2 4ZPIA 4N43B 3C7GA 5FP9A 2AEYA 3TN93 1S0EA 3E6CC 4N53C 3T30A 4FAGA 2PAEA 4OUMA 2Z69A 3IAQA 4Q2FA 1EAH1 3LOIA 3G6JB 4X6QB 4Y22A 1WLCA 5GJ6A 4HT1T 2ZKNA 2RV9A 3X29B 3O7OA 4I02A 1UZZA 4FTSA 1NXD1 1S0BA 2B9UA 2P37A 2VCAA 3LDBA 1CAXA 3CJXA 4IV3C 4LIUA 3LIGA 1BVVA 1RUG1 3MDPA 3PUIA 4V1PA 5BNOA 2GMEA 2A6VA 4L11A 3WP4A 2K46A 3EMRA 5HCFA 1C5IA 1EV11 1F8VA 4RR3A 2W1QA 4MH0E 5DPNA 1W99A 2VNVA 1JH5A 5F2SA 1LR5A 1MS9A 4BQ3A 1SG3A 1GP6A 2VTXA 4P00B 4D7TA 5KXEA 2WJSA 1SLBA 5JIUA 4CUGA 2ZGTA 5DG1A 3T4VA 3QOPA 3PVNA 3WW3A 2Z79A 2ZHMA 1UKGA 2RJLA 1VBA1 2D5FA 3A0NA 3M3OA 2VOVA 4QDQA 5A3NA 5JZGA 5ABJA 3GZEA 1WMXA 4TSVA 3WDXA 3DF0A 3ZSJA 4AI8A 4CEYA 1CAUA 4DQAA 4OHZA 1KEXA 4N7IA 2R6QA 3Q8FA 4OFGA 3J8F3 3V65A 1I5PA 2WYSA 5IHRA 4CCDA 4XCBA 2RJ2A 4WZCA 3WCRA 2ZTNA 3AX4A 5A33B 1OUXA 4CDXB 2VOWA 3B69A 5FZLA 1G8WA 2BGPA 4XFAA 1PO22 4JGYB 5A7QA 2JG8B 1CGPA 4XJWA 2RM22 4OHWA 4ZS2A 3N4MA 4DXZA 4FPEA 1MVQA 2VQAA 1ASJ1 1SACA 2PHLA 1ENXA 3KCCA 4P5HA 1TQ5A 4MGSA 4K1YA 1KJLA 2GC2A 1MS0A 3O14A 4YZ3A 4ZS3A 1HQLA 5A1LA 5DAWA 1SPPA 1H8VA 4IGOA 1ND3A 5I8SA 1UU4A 4E8CA 4YM2A 4CXWA 3WG4A 1HIXA 2GSYA 2VZ3A 1Y9GA 2XBO2 3E6BA 1VBC2 3GZUC 5DUUA 5LY2A 5T55A 1Q3EA 3ACFA 1KQRA 3WINE 1CIWA 4D7YA 4HVQA 5A3PA 3MUY1 3W59A 3AMQA 3N9PA 1O6UA 2BTVC 4GULA 4LNVA 4BWOA 3LPGA 3JQXA 5A3WA 1PZ9A 1C8M3 4H14A 3I3EA 2WA3A 4M3CA 5ERLA 4AG4A 4NHMA 5FYIA 4EROA 2XUEA 1GWMA 3ZN6B 1VAMA 1R091 1FYUA 2VUCA 5F32A 5H9QA 2R073 3GZAA 3WHUA 2WNUB 1UCXA 1Y9QA 1RUH3 4HKOA 2VTFA 2CU5A 3D82A 3OGGA 4XYXA 3EYPA 3UNPA 4W50A 4Y1XA 1XXNA 3IPVB 5GM0A 3AP5A 3NJXA 2JECA 3NAPC 4FOWA 4M4RA 2CWMA 4GKYA 4BK5A 3WDUA 2WAAA 4RQPC 3OEAA 4NAMA 1UYXA 1YFUA 4Y1ZA 2D6LX 4EZ4A 1CAWA 1ENQA 1YI7A 3MV01 5I0RA 1VBB2 4AFDA 4HLTA 2X05A 1W8UA 4KG0A 4NHYA 2JDNA 5T50A 4YW2A 1RUC3 4O61A 4Q4V1 3USUB 1DCSA 3T2TA 4COWA 4ASKA 4EN7B 2WRAA 1YI9A 1IG0A 1SHWB 2PAKA 4FPKA 5DN2A 2HWC1 2ZGKA 4CDUB 5A3TA 5FMOL 3PVBB 1WLDA 1QJX1 4B4RA 2PYTA 3WR0A 1ZRIA 4XFBA 5D8AC 1DBNA 5KXDA 3PJQA 3WSOA 3M2MA 3HQRA 1UOGA 2Q5TA 5AVPA 1D4M2 2XG3A 4IEPA 4R9BA 2X5IA 3SLIA 2RE9A 3ACHA 1JU4A 1H8TB 1OA3A 4O9GA 4WM8C 2YGMA 4LO7A 3ZKYA 1W90A 4QQPA 2BU9A 4QD2A 2RDQA 1IG3A 3K46A 2BVBA 3ILFA 1JUIA 5E88A 3ECQA 2V4VA 5DQ0A 3W5NA 4K7JA 2WA4A 3BTYA 4RD7A 2BOIA 2G9GA 1VMFA 1DDLA 3ZXDA 1XYPA 1XSQA 4H2AA 2HWF3 1PGW1 1NG0A 3M4FA 2JXAA 3ZXGA 1JZ2A 3KSCA 1RJ8A 1UIJA 1VBD3 4LJHA 3POGA 5JCTA 1LENA 3V64A 1BEV2 2W39A 2WAOA 3IIAA 2WN3A 5C4WB 5AC92 5K9YA 2KD7A 4I0AA 5F8PA 4XJUA 1AL0G 1AYN3 5GZCA 3PJYA 5IAXA 1LJ7A 3M3EA 3NW4A 1T6BX 4AGGA 4EN0A 1O3QA 2HWD2 4PIYA 1UOBA 4I2OA 4LO8A 4XUQA 4PI2A 4WBBA 4KBZA 4Z2AA 3LOBA 5JXIA 3I3DA 1MS4A 2C1FA 2JE7A 2ZGLA 4KL1A 4KWJA 5EIYB 2YC0A 1ULGA 2WWJA 3IMMA 4P5YA 3O12A 4QDSA 5DXDA 1H2NA 5FZ6A 5C5TA 1GNYA 1FPN3 4XTPA 3BB6A 5J96B 2V09A 3ZSMA 2OIIA 1PK6A 3KF3A 5JR2A 3MF9A 4LHSA 4RFT0 1W6QA 4GALA 1X82A 4MV2A 5A6YA 4PF5A 3OPZA 4OI2A 2R043 3C2UA 1NZCA 1RUJ3 4URAA 5BUVA 1J3QA 4F8AA 1DHKB 1MS3A 3E1F1 3I59A 3N9QA 4NRMA 1AR82 1H2MA 1YRZA 2ES3A 4FPOB 4E4SA 2RS51 5M0TA 1CESA 1N3OA 2JKXA 4XJ8A 2JDAA 1FAYA 4GB31 1LOAA 1R092 3LD8A 2WZR3 1YEWA 2DFCA 1ACCA 1KD7A 5L7OB 3LA7A 3VDAA 2ZX3A 1TMF3 4MYEA 3PUSA 3A7QA 1WA4A 1RUD1 5FZ1A 1DLLA 2ZZQA 2DBNA 2RR13 4UFMA 4PJYA 3WHTA 2VR4A 4FPCA 3UL2A 1G7YA 1RUNA 5C3OA 4QGNA 2ET7A 1DGRN 4RN5A 1AYM3 4LBOA 4W6WA 4HFSA 1FV2A 1H4HA 2WC2A 4JZRA 2YUEA 5DABA 2WNVB 4CCNA 4LKFA 5L9RA 5FRAA 2BOJA 1D7PM 1K5MA 5C8CA 3FL7A 1WW7A 1FOD1 1QJU1 4LLOA 5FZ8A 4LQRA 2QJVA 4O7XA 5D1IA 5FFOC 4YFWA 1S0FA 3LZZA 1VBE3 1LTEA 3USSA 3ZR6A 1WBLA 1NCRA 4NIHA 4XUOA 2FHRA 5FY5A 4CU7A 1MACA 1WMEA 2B4KA 3AZZA 2HWE1 5C6CA 1PGL2 1AR72 3BU7A 4A6OA 2CV6A 4FPLA 3ES4A 4YG6A 1K45A 3ZFGC 5F3CA 2WS92 2UURA 1W0NA 2BNNA 2WNEA 3GCXA 4CEWB 1MZ6A 4SLIA 1TEIA 5K0UB 1TG7A 3M3CA 2A3XA 3NKTA 5IW0A 1ZZ7A 4GWMA 1WCKA 2YB7A 1JMUB 2FQPA 3VHOA 1W0PA 4K8RB 4N9HA 2ZXQA 4XXAA 5JVVA 5BNQA 1XNTA 2ZGPA 1ENSA 2JKBA 2BUKA 2IXJA 4ZY9A 4AF9A 4XAEA 4CPBD 1OLMA 2GP3A 3ZXKA 1BBT3 3KT1A 4DMIA 3DXUA 5LA0A 2VW1A 3G7DA 1LOFC 2BEOA 3AKSA 4HSLA 1AL21 3NL1A 1PGSA 3WW4A 1KDMA 1ND2B 4S2FA 1GUIA 1PHMA 1EYBA 2Q1ZB 3UK9A 3KQ4B 5J48A 4DY5A 3LWCA 4ES8A 2Z5WA 1F2NA 3V0BA 4LTAA 1RGSA 4JV4A 2Z4FA 4AGVA 2Y38A 4CXXA 5BNNC 4CCMA 3LA3A 4EN8B 2VM9A 2ZBJA 3SQOA 5F5AA 5DAXA 1ZYBA 4BB3A 4HOOA 1SCSA 4RHV3 1I3HA 2PQSA 5FYZA 4AE2A 2GH2A 1FXZA 2C4XA 1Y3TA 3N7MA 1OQEA 4QX8A 1RHI3 1Q8OA 5IT6A 3VBSA 2EXHA 4ISQA 1QJY3 5IYYA 2Y6GA 4BLJA 1SLAA 4GH4A 4AFBA 2GU9A 4JDOA 3PVOA 2DVAA 2N7GA 4FI9A 3ZDSA 4AEKA 3NVCA 2QQVA 4XUTA 4DRRA 5IVBA 5IVJA 4PQQA 5APAA 2D44A 1RVF1 4BQYA 1LEDA 4MXWA 4QPIB 4WVMA 1FNYA 1C28A 2CGNA 4IUGA 1AZDA 2XL7A 3IDEA 1FI2A 4AHYA 1OVPA 3JBG1 2P17A 3VBUC 1HXS3 1LHWA 5JPMB 3KD4A 4MX3A 3W20A 5E8AA 3OUIA 1SBDA 2BQPA 1GNHA 2ZS6B 4Y20A 3THCA 4CCOA 3IIIA 1REEA 1REFA 1Z7S3 3LSDA 4RGKA 2HKXA 5IFPA 3RJ2X 4DXTA 3LA2A 5DUXA 3ZYJB 1HV0A 2PHFA 4XVHA 1CAUB 4WM8A 4B4PA 4OI4A 3VD9A 2DF7A 2GNMA 4TYSA 1GMMA 3AYAA 4UF0B 4YZ2A 1AX1A 1XU2A 1QNYA 4NVPA 3K51A 4C1WA 3BOPA 4DZGA 5LEJA 4E27A 1UYZA 4FOYA 1C8M2 3OJBA 4S2HA 1SLLA 3ASIA 2GN7A 3MLKA 1QJU2 2ZJCA 3P3PA 3CJIC 3TNQA 3POSA 1QJZA 3RZJA 5FXZA 1UMIA 4FFIA 1J84A 1HRI3 2R072 2XQXA 2YG0A 3LQCA 4C1XA 1QOOA 1RUH2 3WV6A 1S0IA 5DZEA 4FCAA 3RVHA 4AEDC 3SKVA 3INAA 1HB2A 4YM0A 1PVC1 3URFA 2P3IA 4B7EA 5F5QA 1GZTA 1XJAA 4N90A 5FMOS 4NN0A 3HBKA 3THPA 4BMBA 4XPVA 1J1TA 3GHMA 3O0VA 1CPNA 4WM7C 3THTA 3VHPA 4GJYA 1DIWA 4XABA 2QQNA 2WWSA 3LCPA 2Y34A 1E57A 2ZMKA 2J1RA 1SDDB 2WQ4A 5B4NA 4GIQA 4KBBA 4XZPA 2XDVA 3BPZA 3FFQA 1RUC2 2XH6A 2EF6A 2JDHA 3D6EA 3ILNA 3ZPYA 1IS3A 2HWB1 4MGKE 4AWDA 5KXCA 3H8UA 2JDZA 5T5JA 1QU0A 5HCAA 1QH7A 3DUIA 3ETQA 4HKLA 1OOPA 2JICA 4PDWC 2YBKA 4QAWA 1MZFA 3B02A 3QBQA 4PBPA 5LBBA 1QHDA 3AK0A 1L7QA 4YVSC 3IDBB 3K4AA 4NWWA 2VMEA 2WYFA 2YZ4A 3MIBA 4AVTA 5L73A 4CDQA 1CAWB 1V6IA 2XKPA 2OUJA 3VZKA 5CADA 1AXYA 2VTXJ 4QB6A 5HXVA 4MZUA 4XW3A 4IEWA 4DUVA 1OD3A 2J7MA 2JB8A 4Q1RA 2JDMA 4GMP1 1W2TA 3FWEA 5L19A 2XL9A 4R4ZA 4DXRA 5A32B 1S1AA 1TNRA 5FZMA 2HWF2 1V9U1 1X33A 3J7NA 3KV4A 3NNMA 1QKQA 4R9DA 4UBGA 3R05A 4YG0A 4D6QA 3FHQA 1JOJA 2JENA 1VBD2 4AVBA 5JOZA 2XJRA 1YNAA 2P3JA 2H0VA 1C4RA 3U75A 3RGBA 2GMMA 4KNCA 3ZDVA 1KJRA 1N47A 4IE6A 1AYN2 2VNRA 3VDBA 5T52A 3L2YA 1RUF1 3IMNA 1Q8SA 1RVF2 2QQOA 4XMIA 3J7MA 3BGAA 4BIFA 1NOVA 4QHZA 2R30A 3UJQA 5BNOC 4XILA 1OUSA 1XNDA 1UZYA 2LALA 1LESA 2DURA 5E16A 1ZM1A 5A6XA 2A6XA 2Y6LA 3LDKA 2ZX0A 4NE9A 5GALA 3ENRA 3D0SA 4H7LA 2ID4A 5EP9A 1LU2A 1SCRA 2D6NA 3ZFGA 3ZN5A 5JZGC 5FWJA 1FPN2 2W95A 2ZGNA 3AZWA 3CIHA 5AVAA 4YYOA 3MZHA 2TBVA 2NPIA 4JKLA 5DG2A 2W0XA 3AFKA 2DVFA 5DUWA 1G86A 4CEYC 1PO13 4QU1A 3MIGA 2R042 3PUHA 4LHKA 5KWRA 1QF3A 2J1SA 3RZZA 4Y3OA 1QQP1 4M4PA 5A7WB 1RXGA 4RS5B 1EPWA 5EJ3A 3N3HA 2V73A 2PHUA 2NYYA 2RMU1 1FNZA 5JSOA 1LOFA 2WZR2 1US3A 3CQOA 5EYYA 4A3ZA 4QM8A 1W2AX 1GFF2 4W6YA 1XSRA 2PQQA 4KU8A 5EZWA 3PVEA 4QQHA 2NP0A 4Q0SA 1TMF2 3H0OA 1S0JA 2RR12 2HEVF 1OH3A 4LOSA 2E31A 2E7TA 2QNKA 4B8EA 2XVLA 3K77A 2H6BA 4G3YC 1E5RA 3S30A 1RJ7A 5FQ0A 2WSUA 5FCCA 1ND3C 3NWKA 4QPWA 4M0HA 5BNNA 4L9BA 3S6PA 2DWRA 1IPSA 1BZWA 1KFUL 2PFWA 2Q30A 2UY9A 2XJUA 1UKRA 3GM8A 1ULEA 3ZVXA 5HCHA 5FZEA 4CZSA 1UAIA 2ZZJA 4PI0A 5FKCA 2WT2A 2RS31 5FY9A 3PIGA 3IDCB 4FT8A 4AI0A 1S4CA 3ZSKA 1W05A 3JXSA 2R0HA 4Q4X1 1MQTA 2OPWA 3C3VA 1GICA 5HCBA 3RNSA 1J3PA 3LEIA 5F5IA 1F35A 3BUCA 4N53B 4CE8A 1VBE2 1BKZA 2GNTA 4LA3A 1OA2A 4AOCA 3POEA 4LBLA 5FY0A 2XUMA 3VBOA 5IVYA 4LR4A 3KVBA 4H3WA 2KR2A 1J83A 4DUWA 1DZQA 1QDOA 3B5LB 2DVBA 3VKFC 3HN3A 2AUYA 4IV3B 3WVJA 1G9AA 5KHHA 4RGAA 4JX0A 1YIPA 1UXZA 3AP7A 1YIFA 4GZ9A 3U14A 4COVA 4CTEA 3PU3A 2I74A 4Q1PA 5E89A 3GGLA 1VRH3 1JHJA 5LBEA 2QBXA 3VBUA 4GJZA 1QH6A 3AMHA 2QQPA 4UT5A 3WP6A 3TEXA 4IEOA 1QXJA 5A6QA 2VNOA 4NIIA 1CX4A 4YVWC 2IXHA 4NROA 4OQ9A 3T08A 1BBT2 3LEMA 5FAXA 4UW5A 1LHUA 5FMDA 1W3VA 3VKMA 2P3YA 3MBWA 4XIKA 4XQWA 2A1XA 2XPJA 2XJSA 5F39A 4NMIA 1BK1A 4K6BA 3ROUA 4AEMA 1S2BA 1XU1A 4PT6A 5FBZA 5C9AA 4H7MA 3U4XA 4EWDA 3I3BA 3SNMA 3I2DA 4Y24A 2RG4A 5FYYA 2YBPA 2YU2A 1OF4A 1O4YA 2LM3A 1JODA 3GDBA 4P9IA 1LECA 3H3LA 1PO21 4J1WA 3UGFA 1NA1A 4NIDA 1W6PB 2RM21 1WW6A 5C3RA 2BERA 3VB9A 3ZN4A 4FQ4A 2QQLA 3HNYM 4MUVA 3H1WA 2ET1A 2HYKA 1JZ6A 1RHI2 1ZA7A 2FMYA 5AFEA 4C90A 1GQPA 4FVVA 1QJY2 4IE0A 2R063 3Q8AA 2UU8A 5SV8A 4XMAA 2XBO1 5FZIA 4HZFA 3U10A 5LZ6A 2Q0AA 2Q8CA 2B46X 5EPAA 5J7MA 3K4ZA 4JC1A 3P3NA 4GQ7A 1JYIA 3IT8A 3JB4C 4FPYA 1YFXA 3M8LA 4LE3A 3VD7A 4LBJA 3O1OA 4MGYE 4ET7A 5GZEA 5FTTC 4C91A 4HXCA 4E2QA 5HV0A 4OVEA 4UW4A 1WUVA 1O7FA 1XB9A 2L9LA 2PLV3 4ZXKA 1HXS2 5FLIA 4RL7A 5J3UA 4L2NA 2EXIA 3NAPB 4K1ZA 2G4IA 4XAAA 4UXAA 5FUNA 2BFUS 1MEC3 3KHBA 5FP3A 3CF6E 2HBUA 1XRUA 4RQPB 5LA1A 1GZWA 4FOVA 3T2OA 5IK4A 1PK6C 5FPAA 1VBB1 4LPLA 4D6SA 5FZ7A 3TWIA 4XC9A 1ZBA3 1SBEA 1UQXA 3POIA 5T5LA 2D3PA 5A3MA 1L3JA 3U0ZA 1AR63 3O1RA 1LAJA 4Q29A 1IS6A 5B2GB 1ULDA 3OF1A 4I3GA 1AR93 3ZFFC 2E33A 4P9GA 3ELNA 2SLIA 3D4KA 1HRI2 5EQUA 5IK8A 3AYCA 4F7ZA 4ITCA 3OG2A 4QQOA 2NQYA 5D8AB 1RUI2 4NHKA 3C7OA 1NQDA 4GAZA 4Q8LA 4QPYA 4XF1A 5LA2A 1WWYA 3SHRA 3I3MA 2OW4A 1UIKA 4NO4A 4NJ4A 1D4M1 4WM8B 2IZWA 2SBAA 1UY1A 3FZ3A 3IDAA 2QDNA 2W52A 3ZFEA 3A21A 4LHLA 5LATA 2UY8A 2DCZA 4ATFA 4XEZA 1OXCA 4EJRA 1ZA4A 1LHOA 4Z8BA 2PELA 2DFBA 2MHFA 1GANA 2LS6A 2VQTA 4LBQB 5F7UA 2E6VA 1OC1A 2Y60A 5C8CC 1APNA 1K5MC 2NN8A 1WCUA 3RMXA 1UY4A 3KCXA 1RXFA 1OH4A 3BTXA 2GP5A 2RVAA 1NCRC 5FK8A 3OBZA 1OKOA 2PHTA 3BI3A 2ZGUA 2X53S 1V70A 5FP8A 1H2LA 3ZYHA 2ZMNA 1BEV1 3CMGA 1H6XA 1RUE3 4OI0A 4NUBA 4XTMA 5AC91 4DS0A 2VY0A 4R4XA 1CN1A 1R1ZA 5CISA 5FZ0A 2K2SA 2YV8A 4QDRA 5GLZA 1LB2A 1NE4A 2VMCA 1SZBA 4HETA 4R9CA 1H30A 1NYWA 1JHNA 3ZYBA 3B00A 4I3PA 1Z0HA 2HWD1 4OHYA 3MFAA 3TYJA 3NJZA 5JUVA 5C5UA 2D3SA 4QHOA 1QOSA 2BWAA 4AZZA 5FXWA 4BMEA 1DZTA 1JZ3A 4XF4A 1XNAA 3ETPA 1NY71 1VP6A 4AI9A 5FPUA 1O4TA 1WW5A 2RDSA 1UY3A 3ZMOA 1GOGA 5FYVA 3TNPB 2QCSB 1CVNA 2C6SA 5BNPC 1JYXA 1LGCA 2ILMA 3O1MA 2DBIA 3AB0A 1LHVA 3OPWA 1SEFA 4AW7A 3E5QA 1X50A 1E5IA 4E2GA 3I7DA 3MHZA 3BALA 4AVAA 1H4GA 5FV3A 1AR81 4QKBA 3NQHA 2P5BA 4WV8A 5IVCA 3AL5A 4EN9B 4UYBA 3OTFA 5D21A 3UV9A 3OD0A 1SFNA 5CKMA 5AFBA 3SKJE 2VUDA 3H3UA 5D2AA 1U5XA 3ON7A 1AXKA 1IS5A 1CR7A 2BDRA 2FZ1A 3T09A 4S2GA 1DU3D 1R083 4XBQA 4XJAA 2QQWA 5FYUA 3T2QA 3ZR5A 3JZVA 1ULCA 1PIV3 1US2A 3VBSC 5CFDA 3TEWA 1RB8G 2QVSB 3WEZA 4XBNA 3RFRA 5FR3A 5C3SA 3IM0A 1VE0A 4IEZA 5FK7A 2CGPA 3FX3A 4GH4C 2A6ZA 3T2PA 1CWPA 1PO12 5CG9A 4TLFA 1G9BA 5L9VA 2I2SA 4ASMB 3PURA 4UFKA 3KV6A 3VBHA 4YVWA 1PMIA 4DFSA 4AI3A 3CO2A 3RYRA 3T1LA 5GLVA 3ZKUA 2IFRA 4LULA 2FCUA 3POFA 3O0WA 3R4DB 4DUXA 3KT7A 1W6MA 5FMBA 1W28A 1QIQA 1MZEA 3ZFGB 4CUCA 4J1XA 1AR71 4QPGB 4AI1A 2DU1A 3ZM8A 3PLQA 2JIGA 3AMPA 4CP1A 4DRVA 2WS91 3CHXA 1Q8VA 3EO6A 5A3UA 4Y5TA 1ENRA 3WXPA 2CY6A 1S0GA 4IL7A 4NPMA 4AI2A 3KV9A 1JYNA 4META 1LKNA 2XWJB 3T4HB 4ZKTB 1A3KA 3L2HA 3P1IA 3RI8A 2MEV3 2ZAAA 3OGRA 2VAUA 4OUSA 5GLTA 2W1UA 2YC4A 4Q0QA 3DN7A 1J59A 1IPKA 4NAOA 2ZPXA 4YWAA 5FZHA 2CNAA 2ZGOA 5FZDA 3POJA 1W8HA 2GALA 5FZKA 3M3IA 1OT5A 1ZBE3 4UFIA 1GSLA 2PHDA 2QE3A 4QQLA 3TN91 5FXVA 1CAVB 2VZOA 4NOTA 3K75B 3AXDA 3HPNA 4M3CE 3N35A 5FYMA 2R1BA 4AYUA 1NAEA 4BQXA 2O0OA 3WP5A 5FY7A 4COYA 5CNAA 2OYZA 3BVCA 3F2ZA 4Y4RA 4LO4B 5BNNB 3WD5A 1HKDA 4BXFA 4UOJA 1G6NA 1OQ1A 1VAVA 3QCWA 3LDRA 4A45A 1DP0A 2J1TA 4BK4A 1VRH2 1PMHX 3MGUA 1BK0A 1MS5A 3NJYA 4YW3A 1LOBA 5GZDA 2Y26A 5FP4A 4QKNA 1B35C 4QXKA 3QLQA 3SCHA 2VU9A 2XJPA 4A6SA 2VJXA 3KS7A 1HV1A 2WZEA 2VZTA 1NY72 1ONAA 2VCMA 3E6DA 4IXLA 4QXCA 2QQMA 2CL2A 2FDGA 1NCQB 4Q26A 2ZABA 1OF3A 4BQWA 2XGXA 2XJQA 3JD73 1OOPC 5F6KA 3KZ4C 3J8F1 2KXLA 2VMIA 4IGPA 1S2KA 3T3YA 5JOXA 5K8SA 3IZOA 5LRSA 3O1UA 2ZGMA 1TME3 2WO7A 3C7EA 1KITA 1OSGA 5HPOA 2Q1FA 4IE4A 2A71A 4Q4Y3 5FBJA 4JGYC 2G9FA 5EV7A 4CDQC 3ZFFA 5JSRA 2QTWB 2OQ7A 3I2HA 3I2OA 1UPSA 4MGZE 2JDUA 3RJRA 2FDJA 2LUWA 3OD4A 3WNXA 1GQGA 1KFXL 2WZ8A 3APBA 2G1MA 2ZACA 2CDPA 2WINB 2UWCA 3AL6A 4XURA 1D0HA 2R062 4JVAA 1XOYA 3JUUA 4DXSA 5A6ZA 4H55A 1CZTA 2W9XA 3ZO0B 3ZPOA 4BQ5A 4QT6A 5FZGA 5EYXA 1AJKA 5FZOB 5FYHA 4BZ4A 3U07A 1GYKA 4D8MA 3MYXA 4IEQA 4KWLA 4BXSV 1WGPA 4ARXA 5JXJA 3H42B 4QMAA 1UPIA 4DPNA 1BLZA 1C8M1 1T6GC 4XF9A 2ZGRA 3CJIB 3WNKA 3OYWB 3HT2A 5IVFA 2R1DA 3O0XA 2H6CA 1XBFA 2AEZA 1OLRA 2PLV2 3N9MA 4AXOA 3ZYFA 2VZ1A 2R071 2WNUC 2W1SA 3LSEA 3U4SA 4AEDB 1ODNA 5ACA3 1FMD3 1JI6A 4QGMA 1RUH1 4GXLA 1NLQA 2VH9A 2XB6C 3MIDA 1MEC2 1PNGA 1WCSA 1H2KA 4HONA 4WM7B 4MOAA 4P08A 3T0DA 2IVIB 4P02B 3LEKA 4CCEA 1DGWA 2QKDA 2YPJA 2B45X 4W65A 5BYNA 3ZMNA 4GWJA 1YXWA 4E8DA 4BLIA 1GKBA 3VZOA 3H8OA 1V6LA 1DG6A 2VMFA 5A70A 4PLNA 4FFFA 2VZUA 4Z2WA 3IWZA 1ZBA2 1RUC1 2P6CA 4E4HA 2PXJA 2HWB3 1AR62 3JQWA 5IUQA 1ZZCA 4OCTA 1AR92 1PM7A 2HYXA 4CSWA 4Q5OA 5CAZA 5FJKA 3TN92 5BNPA 2E53A 3RYPA 1UW8A 4PDWB 5FO7B 4MLOA 4NWVA 2D6MA 2NMOA 3HAGA 4LBKA 4YVSB 3ALQA 1W6OB 3I2KA 3VKLA 5CEHA 5FMCA 4ZXEA 2YU1A 4B1MA 4FOQA 3Q9OA 3CZJA 4XHBA 5B4XA 1WLTA 4XE9A 1O3SA 1O91A 2LTNA 3D5OA 1DLCA 2UWAA 5KHIA 1S0CA 5FO8B 1HJFA 2DUQA 4IQPA 4LKDA 2BV4A 1HB1A 5T5OA 3UJOA 1MQTC 3BIEA 2OX0A 2PHRA 4CUBA 4ORFA 5LW9A 2Q1MA 2HH9A 1U12A 1I5ZA 2HWF1 2RJKA 4E4ZA 1O8PA 2VZSA 1ZZBA 1OMIA 5ANNA 2BJSA 4RA0A 1VBD1 4M01A 2HEWF 3VBOC 4Y22B 2AC1A 5JDBA 4JGZA 1RUE2 1XE0A 2XOMA 3J8F2 2EVXA 5DAPA 3UKVA 1KRIA 1CAXB 3GBWA 3ZXEA 1AYN1 3CBNA 1POV0 2GZWA 1RMU3 4BA6A 4CDWA 2P34A 3DYPA 1VMHA 4XUNA 4JKMA 3IBMA 4QX3A 4CP9A 2WR9A 2WABA 1UOJA 4RR3B 4MGTA 4N8MA 4HANA 2QQUA 3K3NA 4BPZA 2UYBA 4EV0A 4OZXA 1YJLA 4I0BA 4P9XA 4YNIA 4AAXA 2EAAA 1U5ZA 2QDRA 4YLZA 3PDQA 1R1A3 3E5UA 4Y1UA 5FP7A 5JZGB 3VDDA 2ZX1A 3W21A 4FFGA 1IKQA 1Z78A 4CCJA 4QGLA 5ABJB 1LNSA 4WVVA 2G9ZA 4YW1A 1M06G 1FPN1 1UYYA 2E7QA 4CEYB 2OZJA 3FHIB 3N7KA 5K4LA 4A4AA 4CU9A 3VZMA 4BISA 2TNFA 5C9AC 3BODA 3WX5A 2R041 1RUJ1 2OQ6A 2Y6HA 5E6HA 2BWCA 3WF3A 5A3LA 4Q0VA 3KMHA 2DCTA 3D0JA 3RZHA 1ZVFA 3V0AA 5FUPA 3PU8A 1NXMA 2RMU3 4N43A 5CG8A 4CUAA 1Q56A 1C1FA 1D2QA 1NA1C 3VHNA 2WZR1 1W9WA 1BQPA 4D3WA 5L7OC 2BFUL 2CTVA 2GN3A 2RS13 4IE7A 5FZAA 2E32A 2WFF3 2YDEA 1TMF1 1VPHA 1GLHA 4QX2A 5E1RA 1POV1 1R082 1J3RA 2RR11 4Q4W3 1SPPB 1ND3B 3EQEA 1PIV2 1AX2A 4AHWA 5A7NA 2UYAA 3E5XA 3MI8A 3SH3A 3ZSEA 2E63A 4GMP0 4AVSA 1HB3A 4Q27A 3SH4A 3AP9A 5FWEA 3FBYA 3VLBB 1COV3 3KQRA 1DQ6A 1PX4A 1GOFA 4Q0UA 5FXXA 5GLUA 1B35A 1AVBA 3VZJA 1NX9A 3CLPA 2WQZC 4M3CB 5GKAC 1QEXA 3HJRA 2BBVA 4Z07A 1IPJA 1V0AA 1CZVA 1VBE1 3AM2A 3WZ1A 3WG3A 3FJSA 4XACA 3ZYIB 4ZHNA 3CNAA 3N36A 3Q8EA 2WO1A 3AZXA 2FZ2A 4JDMA 5DDJ3 1VAKA 3MW3A 4XETA 2C24A 1GV9A 1JZ8A 5FJHA 4BIOA 3O1PA 3WQ0A 2BBAA 1BMV1 1H9WA 4CDXA 5K0UC 4D69A 5IFTA 1W0OA 5CBLA 1V6NA 5HI0A 4JGYA 1LULA 3O1TA 2BYVE 5KXBA 2A6YA 3A4UA 2QZ3A 2WQ8A 2MEV2 1PNFA 1HX6A 1DYOA 2P2KA 3PUAA 5K7PA 3OBAA 2JE9A 4KGGA 1N1VA 4HKWA 4YVWB 3DKWA 3ACLA 3I2FA 4UW3A 4HVRA 1BBT1 1W9FA 4Y1VA 1NLSA 1ZBE2 4C0BA 1QWRA 4B4QA 5J37A 1QOTA 3PIJA 2WO3A 3B94A 5JMOA 4HPKA 2KM2A 2C9AA 4A41A 4AQ6A 3KT4A 2VOKA 4K8FA 4EWAA 2ORXA 1EY2A 5KC5A 3BTZA 4AAPA 1L7LA 3LF7A 4CCKA 2QUOA 2R16A 2X5IB 3DXTA 1LGNA 1WD4A 5CKQA 4YGCA 3ZOIA 3HQUA 5A7OA 2Y64A 1K42A 3ZFEC 4CCLA 4PIZA 1QNWA 3ZN6A 3AZYA 2ARAA 3OBRA 3J26N 1N1SA 2WNUA 1JYWA 2ARBA 3WT3A 1QJEA 3KM5A 2X10A 3M1HA 5GLWA 4XDPA 5G04L 3IPVA 1RHI1 3E97A 1NZIA 1VBC3 1QJY1 5A1FA 3NNGA 4SBVA 1OBNA 5L36A 1PZ8A 4FBFA 3JD72 3OOXA 4K40A 4LK7A 3HEIA 1A8MA 2P4EA 2GC1A 5IWFA 1DZRA 2VCBA 2C9KA 1RUJ2 3FE5A 1TME2 5FO9B 4KH9A 1ODMA 1EUTA 3USUA 4YM1A 1WCQA 3U37A 4Q4Y2 1HN0A 3WDWA 3MUZ1 3HNMA 4QB1A 2FCVA 2LW8A 5JI9A 5JLVA 2VVEA 3UGGA 1UX7A 1D0GA 1HXS1 3N9OA 1GP5A 2YBSA 1OA4A 2D3RA 1ZX5A 5FUIA 3ZLIA 2E51A 4A44A 2IXIA 1UYPA 1ULPA 3WF0A 1HRV3 4YZ1A 1WMFA 1HQWA 1XE8A 1H8TA 2E26A 4QU2A 2GAUA 1G9FA 1PK6B 3KGZA 3KF5A 1OI6A 1AYM2 1W6QB 4R52A 4QQ2A 4XIOA 5BV6A 1H1MA 3DGTA 4I01A 5IAVA 5A3OA 3FHAA 3ZYGA 3AVRA 4FXGB 3N9NA 1Q5OA 3I59B 5LCWL 1A34A 3ZFFB 2PN5A 3AKTA 3FBMA 2YC2A 2X29A 2A6WA 4YW4A 5LY1A 1HRI1 1JOBA 5ACA2 3C8XA 1EAH3 4MGQA 5CFCC 1FMD2 1X8EA 1RUI1 1DQ4A 1RTVA 4FPFA 4MXVA 2ZHLA 5C4WA 3RQ0A 1OPMA 1UZWA 5LEKA 3KHCA 3P6BA 1RUG3 2W91A 1F5JA 3H1YA 1BMV2 1V6MA 2J1VA 5CFDC 4MADA 1IOAA 5FLJA 2BNOA 3HOBA 1SLCA 1EV13 4TXWA 1SLTA 3JU9A 5J1XA 2XJVA 2VPVA 1I9RA 5C8CB 1K5MB 2W46A 1S55A 4XFHA 2I45A 4FFHA 2JB4A 3MW4A 4N9IA 3VBHC 1JU3A 1VBA3 1W9SA 3ZXLA 1DGRA 1NLRA 1W9YA 3ACGA 3W58A 1NCRB 1F9KA 4JTNA 1O3TA 4ZU5A 2YPDA 2GNDA 2PAMA 2D5HA 1Q8PA 3VD4A 1Q43A 2D6KA 1JOPA 1UN1A 4QWNA 1ZREA 1JBCA 2OPKA 3GXUA 3J4UH 4L8QA 1B09A 1HJGA 1UY2A 4LBQD 1UMHA 2V72A 2J22A 4OMDA 4OUEA 5ANQA 3VN4A 2CHHA 1CJPA 1ASJ3 3SCGA 1KGYA 5L7OA 4RHV2 4LO5B 4QX0A 5FPZA 2XONA 1PGL1 1VJ2A 3VBRC 4IGQA 4ZU4A 3N7JA 4BYYA 4EYUA 4X6RB 2CGOA 3EXUA 4LOTA 1FX5A 3RZKA 1K3IA 5FOBB 2ARCA 2WN2A 1VRBA 1ZZ6A 1UNBA 5F6LB 4X8PA 3VBFC 2K9ZA 1CONA 2DVGA 3EBRA 5EFUA 1W39A 2EXKA 4FP3A 3HIFA 3ES1A 3V0BB 2F4LA 5C8WA 5C71A 2D43A 2LRPA 3RWNA 1RMU2 3VZNA 1JW6A 5IJRA 3M7AA 4AQTA 1YFYA 2ZCWA 3BOWA 4IE5A 4CCCA 2JWPA 5JOWA 1R093 1YYNA 5DAQA 3QH6A 3AC0A 5BPXA 3AKRA 3OY8A 2ZGSA 3KV5A 2DVDA 1GR3A 1X36A 3DPRC 3IB3A 3AFGA 5JI7A 4AFMA 2VVFA 2WZPP 2WFPA 4Q0PA 1R1A2 1W2NA 2WIIB 5ISLA 1W6NA 3VBSB 1Z7S2 4YPJA 3MICA 5JR7B 2RDRA 4R8HA 4CEWA 4NPRA 4O9EA 3FFZA 2OS2A 5K0UA 2YFUA 4V2VA 3F95A 4GH4B
chains in the Genus database with same CATH topology
4LK7A 1GWKA 1L7LA 2WYFA 1GWLA 3UT0A 1W90A 2K46A 2LRPA 1W8UA 4LKFA 2Q1FA 4LKEA 4CP9A 3ZYBA 2JWPA 1HN0A 3ORJA 4YW7A 1UOJA 1W8WA 1GWMA 4YW6A 4YWAA 4BQ4A 4AL9A 1WZXA 5D21A 1W8TA 4CPBD 4LKDA 4A6SA 1V0AA 1WCUA 4BQ2A 1W9FA 4LK6A 3ZYFA 4CP9B 2VXJA 1W8ZA 4BQ3A 2O14A 4CPBA 1WMXA 1OH3A 1OKOA 2KR2A 3F95A 4LJHA 2C24A 3ZYHA 2LROA 4BQ5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LK7 A;  1GWK A;  1L7L A;  2WYF A;  1GWL A;  3UT0 A;  1W90 A;  2K46 A;  2LRP A;  1W8U A;  4LKF A;  2Q1F A;  4LKE A;  4CP9 A;  3ZYB A;  2JWP A;  1HN0 A;  3ORJ A;  4YW7 A;  1UOJ A;  1W8W A;  1GWM A;  4YW6 A;  4YWA A;  4BQ4 A;  4AL9 A;  1WZX A;  5D21 A;  1W8T A;  4CPB D;  4LKD A;  4A6S A;  1V0A A;  1WCU A;  4BQ2 A;  1W9F A;  4LK6 A;  3ZYF A;  4CP9 B;  2VXJ A;  1W8Z A;  4BQ3 A;  2O14 A;  4CPB A;  1WMX A;  1OH3 A;  1OKO A;  2KR2 A;  3F95 A;  4LJH A;  2C24 A;  3ZYH A;  2LRO A;  4BQ5 A; 
#chains in the Genus database with same CATH topology
 4RGG A;  5JMC A;  3WNL A;  2WBK A;  4DO0 A;  5FZ9 A;  3C7F A;  1GWL A;  3W9A A;  4AGR A;  3BYW A;  1PO1 1;  3MIF A;  1O3R A;  1W8O A;  3WCS A;  1DF0 A;  4Q4V 3;  2JG9 C;  1O4Z A;  1W04 A;  5HBA A;  4MXW B;  4WVM B;  4ZU7 A;  5C33 A;  2XWB B;  2BZD A;  5C3P A;  5A7S A;  2J1E A;  2W94 A;  2HWC 3;  2CYF A;  2CAV A;  1O59 A;  1U0A A;  2J1U A;  3N9L A;  5F1R A;  3RDI A;  2XML A;  2RS1 2;  1QJX 3;  1ND2 A;  1WBF A;  1SFP A;  2F17 A;  2OZ6 A;  1LRH A;  2WFF 2;  3UGH A;  4LHN A;  4Y20 B;  2DCJ A;  5FOJ B;  4JRL A;  3TRS B;  4Q4W 2;  4COU A;  1ZRR A;  3ZXJ A;  3ME2 A;  2WWU A;  3MEP A;  1W06 A;  5JSP A;  3R0R A;  2VQU A;  3OGV A;  4E4D X;  3ZXF A;  3SEP A;  4QKD A;  2IFW A;  3ZYR A;  2A75 A;  2HJI A;  3V0A B;  4M3C F;  3NJV A;  4A7Y A;  1COV 2;  1QGL A;  5LK5 A;  4XHX A;  2GH8 A;  4CXY A;  4FQZ A;  1BHG A;  2Y8K A;  4KU7 A;  3OCP A;  3FLR A;  1GQH A;  3M3Q A;  4IV1 C;  3RZL A;  1N3Q A;  1PMJ X;  2DV9 A;  3CEW A;  3GNE A;  3P5B A;  5TSW A;  1BVP 1;  1SFY A;  1OD5 A;  1YO8 A;  3BTA A;  5CIR A;  4YGB A;  2ZEY A;  2J42 A;  3MPB A;  1YCI A;  2FMD A;  2D40 A;  3I54 A;  4F83 A;  1N3P A;  1SBF A;  1Y9M A;  1MR5 A;  3PUQ A;  2FCT A;  2EIG A;  2VC9 A;  5DDJ 2;  5H9P A;  3WNP A;  4A7K A;  1JTZ X;  3RS6 A;  4FTB A;  3K48 A;  1VR3 A;  2AYH A;  1KS4 A;  3J9S A;  1YLL A;  1MVE A;  4QPI A;  4P9L A;  2W08 A;  2G19 A;  1W3X A;  5EWS A;  1MS1 A;  2IXL A;  1QDC A;  3FLP A;  5LB6 A;  1YWK A;  1VRH 1;  2QZ2 A;  3ORJ A;  2C5D A;  1B35 B;  1VMJ A;  2Y0O A;  1LHN A;  2Q8E A;  2ZX4 A;  1WZX A;  1W8T A;  1OUR A;  3ST7 A;  1ULO A;  3HMY A;  4A2U A;  2W5F A;  2WSV A;  2ERF A;  1C3H A;  4A3X A;  1V00 A;  2V5Y A;  4I30 A;  3KB5 A;  1RUO A;  4FAH A;  3H3Z A;  1OOP B;  1WLW A;  4L0P A;  4OYU A;  4HL0 A;  4UF0 A;  4OHX A;  4KI5 M;  4XDO A;  2D6O X;  3S5Q A;  1TVG A;  1UZ0 A;  2BPA 2;  4XFC A;  3UT0 A;  1X7N A;  3MPP G;  3DKQ A;  2OXB A;  3GZT B;  3FLT A;  2B7Y A;  1UY0 A;  2GNB A;  2RS5 3;  4QHB A;  4HBN A;  5FIX A;  1EP0 A;  5T5P A;  4CDQ B;  1SDW A;  2VG9 A;  3CZU A;  4GB3 3;  4HMZ A;  4QXB A;  4UI9 L;  5FZ3 A;  4LMF A;  2OKX A;  4KWK A;  5JAX A;  3VUO A;  1LOD A;  2F6B A;  1QMJ A;  1PX3 A;  2QQK A;  2IUW A;  2AGS A;  5CFC A;  2V5D A;  4P9Y A;  5IAT A;  4C8D A;  1RUD 3;  4PCR A;  4Y5S A;  4IDZ A;  4NHL A;  4CPB A;  1OFN A;  2QFE A;  3POW A;  4LBM A;  1AF9 A;  2EIE A;  5F9T A;  1CX1 A;  1IKP A;  4HPK B;  1DQ2 A;  3IAP A;  3PL0 A;  2R06 1;  2Q8O A;  1GBG A;  4WVZ A;  2FD8 A;  4HK9 A;  1ST8 A;  1V6J A;  1HW5 A;  1YC6 1;  3GJB A;  4AK3 A;  3AP6 A;  3PME A;  3UKN A;  2DCY A;  1YUD A;  2BGO A;  4LIT A;  3WUD A;  1A8D A;  2VUA A;  3RG0 A;  4JGZ C;  3WDY A;  3WNM A;  2ZEX A;  2DDU A;  1FOD 3;  1QJU 3;  4YG3 A;  2VZR A;  5L9B A;  5FKB A;  5FY8 A;  4CDW C;  4XQ4 A;  4BOW A;  1N1T A;  5GZG A;  3GAL A;  3H7Y A;  1FV3 A;  2PLV 1;  4MG2 A;  4S2D A;  1K5J A;  2HWE 3;  3NMB A;  3M70 A;  4GD4 A;  4DNY A;  3NNL A;  1YQ5 A;  3O5S A;  4EN6 B;  1HRV 2;  1MPX A;  1MEC 1;  4HVO A;  1W9T A;  3J7H A;  4ONU A;  4PF1 A;  3U11 A;  3VDD C;  5IVV A;  4MO3 M;  1URX A;  4IEX A;  1V6O A;  1S0D A;  4P9J A;  5FZ4 A;  1KDK A;  3VKO A;  2IVJ A;  2ZHK A;  3AYE A;  3LIH A;  1YJK A;  4PQ9 A;  1E5H A;  2AH2 A;  5F3G A;  4LA2 A;  3B7M A;  1MS8 A;  2W92 A;  1ZRD A;  3KLS A;  5T54 A;  3I3Q A;  1H1I A;  2NLR A;  2WKK A;  3QH7 A;  4TN7 A;  4YW6 A;  5JXH A;  1ZBA 1;  1NE6 A;  4NRQ A;  3VBR A;  4NIG A;  3LE0 A;  1AR6 1;  4DOU A;  4TLG A;  3O1S A;  3UKT A;  3I2J A;  3DV8 A;  2E7A A;  4N43 C;  5A32 A;  3BU0 A;  1AR9 1;  1H9P A;  4ISR A;  1AL2 3;  1OQD A;  1O5U A;  4QX7 A;  4XCA A;  4KGQ A;  1EAH 2;  4B1L A;  2XLF A;  3VBF A;  5I0U A;  2ETE A;  4JCK A;  4AFA A;  4LEJ A;  1O5L A;  5FZC A;  3ZSL A;  2LRO A;  1M4W A;  5A7P A;  3MIH A;  1AUY A;  2VBP A;  1BJQ A;  3H7J A;  5FQ0 B;  1RUG 2;  2NZ9 A;  5A80 A;  4JDN A;  1WW4 A;  1DQ5 A;  3LFI A;  2H0B A;  3DYO A;  1RC6 A;  4OUL A;  5H9R A;  4OI1 A;  5CA6 A;  1EV1 2;  3VL9 A;  5DZF A;  4XZU G;  1XNC A;  3A23 A;  2DUO A;  3QD6 A;  2PHX A;  1ZNP A;  1EUU A;  3DPR A;  1LU1 A;  1XC6 A;  3SCF A;  4IW3 A;  4LO6 B;  4AEJ A;  4AFC A;  2P3K A;  3HWJ A;  1MQT B;  1JZ5 A;  3MFC A;  1BXH A;  1VBA 2;  4Z1V A;  3TB0 A;  4Z92 B;  5KHK A;  1UOF A;  1YHF A;  1GP4 A;  3VBO B;  2C26 A;  1FT9 A;  4YRD A;  5CKN A;  2XJT A;  1HB4 A;  4K20 A;  4Z82 A;  5J09 A;  4BCU A;  1ALY A;  2RHP A;  2VBB A;  2VNG A;  2Z2S B;  3FMG A;  2YRO A;  4OLL A;  1RUE 1;  1UL9 A;  1WD3 A;  4KQ7 A;  2P1B A;  3Q8C A;  4AR2 A;  4BHP A;  3I49 A;  1RVF 3;  2JDK A;  2JG9 A;  2WUH A;  2ZHN A;  1GOH A;  5A7W A;  3B9C A;  4C0H A;  4Q8K A;  1ZRC A;  5I0T A;  3ATG A;  3DCQ A;  1IS4 A;  4RS5 A;  4XFI A;  3MLJ A;  1XYN A;  2JDP A;  3I8T A;  4BDV B;  4CDX C;  1GZ9 A;  1QXR A;  3JBG 3;  2JG8 C;  5EHD A;  1ASJ 2;  3VBU B;  4QKF A;  5T3N A;  4MHR A;  3VZL A;  3WP3 A;  3POY A;  2DCK A;  3H8X A;  1H6Y A;  3EB7 A;  4FP2 A;  2MPF A;  1DYK A;  4UWD A;  1KXG A;  1K12 A;  2VO5 A;  4MGI E;  4LT5 A;  1FAT A;  1PM4 A;  4B3N A;  3V56 A;  1JYT A;  1UD1 A;  5EJ1 B;  3LEG A;  1QJF A;  4EWE A;  1QY4 A;  1VIW B;  2DYC A;  3RZM A;  3OGJ A;  5C9A B;  2WDB A;  4B7K A;  5JWP A;  4HN1 A;  2V4A A;  3VD3 A;  4UFL A;  2F4P A;  3ACI A;  4K9S A;  2RDN A;  3PMS A;  3B3Q E;  4A7Z A;  4HSJ A;  4NHX A;  1ZRF A;  2VZQ A;  4N7U A;  1YQ8 A;  2W87 A;  4IES A;  4IET A;  5EXO A;  4IV1 A;  5A1A A;  2ARX A;  1O8S A;  1JYV A;  2O1Q A;  4N53 A;  1PZ7 A;  1NA1 B;  4YGE A;  1Y43 B;  3WDV A;  1R64 A;  1LOE A;  4AQ2 A;  2BVV A;  1DGW X;  4FTE A;  2VXJ A;  1UMZ A;  1JYC A;  1POV 3;  4EE2 A;  1UU6 A;  5LBC A;  2Y6K A;  4JTO A;  4PIX A;  4XF0 A;  1PVC 3;  1C57 A;  1VAL A;  3OUJ A;  2JD4 A;  3MF6 A;  3NO8 A;  1R08 1;  4IV3 A;  4GWI A;  2CDO A;  5BNO B;  4CP2 A;  3WNN A;  4FXK B;  1PIV 1;  1CQ9 A;  3I97 A;  4IER A;  4LLF A;  1LGB A;  4BJ0 A;  2VXR A;  4EZH A;  5CVR A;  3H9A A;  5IK7 A;  2OUH A;  3AKP A;  5BXX A;  3VDC A;  1JZ4 A;  4M00 A;  4GWN A;  1DGL A;  4LIV A;  3WY6 A;  4Q4V 2;  2WL1 A;  4CYD A;  3GF6 A;  1VB2 A;  2VGD A;  5EJZ B;  5G05 L;  4AL9 A;  2ARE A;  5FYB A;  4D0Q A;  2VUJ A;  1G9C A;  1AHS A;  4XDQ A;  2HWC 2;  3OY8 B;  3U1X A;  2VE1 A;  3DEC A;  2XQR A;  4O65 A;  3WQ7 A;  2BRT A;  5KHJ A;  2CWS A;  3RPQ A;  1W8Z A;  3R6S A;  2EIB A;  4XXP A;  1QJX 2;  4CDU C;  4MHU A;  1JUH A;  3BN6 A;  5KHG A;  1W6N B;  4QPG C;  3WF4 A;  1OKQ A;  1NKG A;  4FSJ A;  1RL3 A;  2ZGQ A;  1XQN A;  2HEY F;  3S57 A;  2YYO A;  3RZG A;  3AZV A;  5I91 A;  3AYD A;  3MLL A;  3RWK X;  4WVW A;  1GZW B;  3NV3 A;  5F3I A;  1H8T C;  5FPV A;  2C0Z A;  4XQD A;  1W6P A;  5F5C A;  3EJK A;  3RRD A;  3ZIX A;  5FPX A;  5DUV A;  1UO9 A;  2MEV 1;  4PBO A;  3AP4 A;  1XYO A;  3H1M A;  3SIT A;  3IKW A;  2A7A A;  1RED A;  2J1A A;  4NR1 A;  4HN0 A;  5HV4 A;  4GMP 3;  1VLN A;  5DZG A;  4JKK A;  3HR9 A;  1HDK A;  2A3W A;  4AVV A;  1ZBE 1;  2IC1 A;  1BCX A;  4IEU A;  2B42 B;  1V9U 3;  1PGW 2;  1WA6 X;  2IXC A;  1XE7 A;  3S7I A;  4W6X A;  2X8K A;  4QX1 A;  2EAL A;  2VMD A;  2VZP A;  4XBL A;  1J58 A;  4ZON A;  5FPB A;  1RYY A;  5HXM A;  2ZKL A;  5C4W C;  1RUF 3;  1J1L A;  2XHN A;  3FN9 A;  1TNF A;  4COZ A;  4ES9 A;  1WKY A;  3ZFE B;  2WT1 A;  5CYY A;  4LUM A;  2DUP A;  3WQB A;  2QQI A;  2TUN A;  3WNO A;  3GBG A;  1MZ5 A;  5JOY A;  4G4F A;  4BQ4 A;  3ZXA C;  1VB4 A;  1F4H A;  3HNB M;  2VQ0 A;  3A0K A;  2YHJ A;  3S5A A;  1DQ1 A;  4QXH A;  3NAP A;  4W8J A;  3NV2 A;  1RIN A;  3I2I A;  2WO2 A;  2AZ5 A;  4AQS A;  3B93 A;  3B01 A;  3H8R A;  4RYD A;  1ULF A;  5JXG A;  3W5M A;  1P8J A;  4RQP A;  1NCQ C;  5F37 A;  2JDY A;  3BIW E;  3JD7 1;  1OLM E;  2JJ6 A;  2VOX A;  4I09 A;  2PA7 A;  5FZB A;  3KCY A;  2ZEZ A;  1QQP 3;  2WNO A;  3WUC A;  1TME 1;  3AMN A;  5C3Q A;  2JD9 A;  2RS5 2;  5BY5 A;  4Q4Y 1;  3UYJ A;  3HT1 A;  1AXZ A;  4GB3 2;  2A5Z A;  5IK5 A;  2EIC A;  1U5I A;  4UFH A;  3WF2 A;  3T0B A;  4BQ1 A;  3K2O A;  5DAV A;  2FBE A;  3SC7 X;  5D8A A;  2EA7 A;  2W3J A;  1RUD 2;  4DY3 A;  4R9A A;  5FDB A;  4Y33 A;  4UFJ A;  3ILR A;  1GNZ A;  4WZF A;  3DL3 A;  1C5H A;  1LOG A;  2DTW A;  3S0M A;  4EQV A;  3DEM A;  4NIA A;  3WLU A;  1AYM 1;  5I0D A;  1NUK A;  4UW6 A;  4TWT A;  2RS3 3;  1W2O A;  4JAA A;  1YFW A;  2WNV C;  4LBQ A;  1FOD 2;  4Q4X 3;  2R49 A;  1JS9 A;  4PLO A;  2Q4S A;  2D7F A;  5FYC A;  2ZML A;  2FDF A;  2XVK A;  3VKN A;  2AR6 A;  2VMH A;  4LK6 A;  3I2G A;  5CFC B;  4XFG A;  1RUI 3;  4ZZ8 A;  3THD A;  2HWE 2;  5ACA 1;  1FMD 1;  4NPL A;  3HD8 B;  3VGI A;  1KS5 A;  2JX9 A;  1EPZ A;  4DEV A;  4P14 A;  4AHX A;  4KMQ A;  2VOT A;  3GHN A;  2ADD A;  3L9J T;  5CFD B;  1V6K A;  4IEV A;  3SMH A;  3ZIW A;  1BYH A;  4OMC A;  4ATE A;  4CEW C;  3FC0 A;  4W4Z A;  5A33 A;  1N1Y A;  2E9Q A;  3R4U A;  2WLQ A;  5F3E A;  2FDH A;  3CDZ B;  4YFZ A;  2JG8 A;  5LA9 A;  3QAC A;  4IND A;  1TE1 B;  3ABZ A;  5C7G A;  3VBH B;  3AMM A;  1IQA A;  4UBH A;  3BKZ A;  4LOR A;  2ZAH A;  2ZOE B;  2BW8 A;  3SXW A;  2KA3 A;  4BE3 A;  1AL2 2;  4XJ9 A;  1UU5 A;  2A73 B;  1CD3 G;  3I4I A;  4JQT A;  2IXK A;  2B39 A;  3WW2 A;  1POQ A;  1IQD C;  3HQX A;  2GC0 A;  1D4V B;  1T2X A;  3KGL A;  1W6M B;  1G9D A;  3CL1 A;  2A3Y A;  1ND2 C;  2I07 B;  3OUH A;  4A42 A;  3KVA A;  4BU2 A;  4L97 A;  4U36 A;  5GZF A;  2QQJ A;  2OA2 A;  5I8Y A;  2W2I A;  4P9W A;  4D6R A;  2XKO A;  5JIA A;  1PO2 3;  2YY1 A;  2IWG B;  2RM2 3;  2Y6J A;  2PHW A;  1RIT A;  3TOJ A;  4YAR A;  4YW7 A;  3O1V A;  2BP6 A;  4LE4 A;  5FZF A;  3H50 A;  3LGR A;  4RHV 1;  3AJZ A;  3MO4 A;  3HBZ A;  3VBR B;  4DEQ A;  3D8C A;  1X9P A;  5CU1 A;  2VEC A;  5KC6 A;  2VBD A;  1H0B A;  4XUP A;  4FPH A;  4L99 A;  2VL4 A;  3K3O A;  4LBN A;  4YM3 A;  3NNJ A;  2XBO 3;  3PNA A;  3T0A A;  2EAK A;  3WF1 A;  3K4D A;  5SV5 A;  3LFM A;  3MV1 1;  1DQ0 A;  3VBF B;  1LEM A;  3GJA A;  2XLA A;  3JB8 A;  3PHM A;  3UET A;  1UX6 A;  3AJY A;  2EXJ A;  5LAS A;  2W1W A;  4K3U A;  4K21 A;  3IN9 A;  2ORZ A;  3LKJ A;  1STM A;  2UWB A;  4RFR B;  3GCW A;  3WW1 A;  2EID A;  5JPN B;  3HN1 A;  2ATF A;  1IZ3 A;  1RMU 1;  1UF2 C;  1NQJ A;  4QPI C;  3TAY A;  4E2S A;  4M0N A;  3JBG 2;  4RR3 C;  4JRA A;  4UAP A;  1F4A A;  3RSJ A;  1RIR A;  3DPR B;  2Y33 A;  2O8Q A;  4AHZ A;  1XNK A;  5LBF A;  1F31 A;  4BH9 A;  1C8N A;  4CDU A;  4DIN B;  5J36 A;  4YSF A;  4V2W A;  3D3A A;  3AKQ A;  4QPG A;  1TZO A;  3BPS A;  1R1A 1;  4MVT A;  2XR4 A;  1Z7S 1;  4DB5 A;  4CVU A;  1L7R A;  5ABJ C;  1E5S A;  3OPT A;  3HVD A;  2W47 A;  4CU8 A;  4DIQ A;  2YMZ A;  3RYK A;  1AX0 A;  3A22 A;  2YGL A;  3GYD A;  4CU6 A;  1S2E A;  1SQ4 A;  4Y5Z 0;  1Y7B A;  3UES A;  2FDI A;  1VBB 3;  4J6G A;  5H9S A;  4ASL A;  2JG9 B;  1X9T A;  2HLE A;  1PVX A;  4KG8 A;  3EHK A;  2AAC A;  3WG1 A;  4ARY A;  3VHR A;  5C70 A;  2R0F A;  1WCD J;  4E9K A;  5FPL A;  4Y4Y A;  3AXE A;  3NV1 A;  1CAV A;  4RSU A;  1JN2 P;  1JXN A;  2D93 A;  3RMY A;  5IVE A;  2RS1 1;  1H1A A;  2K0G A;  2AEN A;  1PVC 2;  2WFF 1;  3KWV A;  1YQ2 A;  4Y26 A;  2YFZ A;  5LRR A;  2BNM A;  2Z42 A;  4OZO A;  4Q4W 1;  4QB2 A;  2ZA9 A;  4AVC A;  1D4M 3;  2BGC A;  4D7S A;  2GDF A;  4PHZ A;  4Y1Y A;  5KR7 A;  5LK7 B;  1ZZ9 A;  5CZK A;  4URT A;  1D2S A;  1DYP A;  3TEZ A;  1COV 1;  5LWB A;  4CRQ A;  2CAU A;  4IV1 B;  3T1M A;  2VCC A;  3CKH A;  2VUL A;  5KBF A;  1IHM A;  4YZ4 A;  3CU7 A;  1OHF A;  1UZV A;  2HWB 2;  4BQ2 A;  2X09 A;  1AJO A;  5DMY A;  4G9S B;  1NCQ A;  1OPO A;  3OBT A;  3PTY A;  4XFF A;  3SEE A;  1LOC A;  4JHZ A;  3WG2 A;  2B9V A;  3MW2 A;  3NKG A;  2O8O A;  5DDJ 1;  3VL8 A;  1BEV 3;  2B5H A;  2XHK A;  2D97 A;  3AVS A;  3VV1 A;  5AC9 3;  4LXL A;  4HK8 A;  3WOG A;  4PLM A;  1SLI A;  3NST A;  1HLC A;  4OQ8 A;  3NRU A;  2PMW B;  4XJZ A;  4YW5 A;  1OLQ A;  1A6C A;  1F15 A;  2A70 A;  3FUQ A;  4ZZ5 A;  1U5Y A;  2HWD 3;  4FPJ A;  4FO9 A;  5I93 A;  4B29 A;  3TEY A;  4JHT A;  1I1E A;  2GC3 A;  2OT7 A;  3U78 A;  2ENR A;  2ZX2 A;  3Q8B A;  2Y6F A;  4D94 A;  2VMG A;  2DU0 A;  4MSV A;  4CA9 A;  1V9U 2;  3ITQ A;  3WDT A;  2VZV A;  2D6P A;  3VD5 A;  3GBF A;  5BNP B;  3FUO A;  4GKX A;  3TBD A;  2B8M A;  5FYS A;  5FY4 A;  2GMP A;  1DFQ A;  2XLG A;  5FLH A;  1HQN A;  4XOG A;  2HBT A;  1GZC A;  3J7L A;  5FZO A;  4TTG A;  1WMD A;  2WNV A;  3S7E A;  2X5I C;  1JZ7 A;  1OVS A;  1RUF 2;  2TEP A;  1GU3 A;  5F2W A;  1AR8 3;  4LKE A;  3CJI A;  1HN1 A;  3ZX7 A;  3OYW A;  1OFS A;  4L92 A;  5FYT A;  5FY1 A;  3SH5 A;  1UXX X;  4YZ5 A;  3NV4 A;  1ZZ8 A;  1W8N A;  1YQ6 A;  2VW0 A;  4YGD A;  2FDK A;  2DTY A;  3ZYP A;  2WT0 A;  4LUK A;  4AED A;  4TZD A;  3LAG A;  4LKS A;  5CB7 A;  2PTM A;  2D98 A;  5J98 B;  4BM8 A;  4WM7 A;  1UWW A;  1VBC 1;  1Y4W A;  3OEB A;  2NM1 A;  1QXP A;  4IEY A;  1IGO A;  1XNB A;  1CJD A;  2XVG A;  2OVU A;  1W8F A;  2P6H A;  1LCL A;  4JGZ B;  4HG6 B;  1CIY A;  2W68 A;  1QQP 2;  1XPW A;  1CZS A;  4CDW B;  4CP9 B;  1A78 A;  3OSD A;  1CPM A;  3N7L A;  2RMU 2;  4RS5 C;  4X8N A;  3SIS A;  1Q8Q A;  3PTR B;  2ZEW A;  3RI9 A;  3NNF A;  2VD7 A;  2CSG A;  3R4S A;  5I8T A;  2JEM A;  4I0W B;  4PDW A;  2Q8D A;  1W03 A;  2O14 A;  3DYM A;  1W2U A;  2JIJ A;  3JCI A;  1AR7 3;  1X8M A;  3LPF A;  1SMV A;  1YQC A;  2XXZ A;  3BCW A;  2VW2 A;  4GA9 A;  4YVS A;  4CP0 A;  2ADE A;  1W6O A;  2WS9 3;  3POB A;  1HRV 1;  3VDD B;  2VVD A;  1C1L A;  4F3J A;  1GWK A;  4QX5 A;  2YXS A;  4U2A A;  4OHV A;  1I6X A;  5FRE A;  2R32 A;  4NRP A;  2MNG A;  4J25 A;  5I0S A;  3WQ1 A;  4XF3 A;  2R7E B;  4FPG A;  4QM9 A;  3OGS A;  2Y0I A;  3C7H A;  2RS3 2;  1NT0 A;  3B9I A;  4KWU A;  4JQR A;  2NMN A;  1F5F A;  2WLP A;  3LB9 A;  3MIE A;  3OB8 A;  1W8W A;  2JE8 A;  4Q4X 2;  4ZPI A;  4N43 B;  3C7G A;  5FP9 A;  2AEY A;  3TN9 3;  1S0E A;  3E6C C;  4N53 C;  3T30 A;  4FAG A;  2PAE A;  4OUM A;  2Z69 A;  3IAQ A;  4Q2F A;  1EAH 1;  3LOI A;  3G6J B;  4X6Q B;  4Y22 A;  1WLC A;  5GJ6 A;  4HT1 T;  2ZKN A;  2RV9 A;  3X29 B;  3O7O A;  4I02 A;  1UZZ A;  4FTS A;  1NXD 1;  1S0B A;  2B9U A;  2P37 A;  2VCA A;  3LDB A;  1CAX A;  3CJX A;  4IV3 C;  4LIU A;  3LIG A;  1BVV A;  1RUG 1;  3MDP A;  3PUI A;  4V1P A;  5BNO A;  2GME A;  2A6V A;  4L11 A;  3WP4 A;  2K46 A;  3EMR A;  5HCF A;  1C5I A;  1EV1 1;  1F8V A;  4RR3 A;  2W1Q A;  4MH0 E;  5DPN A;  1W99 A;  2VNV A;  1JH5 A;  5F2S A;  1LR5 A;  1MS9 A;  4BQ3 A;  1SG3 A;  1GP6 A;  2VTX A;  4P00 B;  4D7T A;  5KXE A;  2WJS A;  1SLB A;  5JIU A;  4CUG A;  2ZGT A;  5DG1 A;  3T4V A;  3QOP A;  3PVN A;  3WW3 A;  2Z79 A;  2ZHM A;  1UKG A;  2RJL A;  1VBA 1;  2D5F A;  3A0N A;  3M3O A;  2VOV A;  4QDQ A;  5A3N A;  5JZG A;  5ABJ A;  3GZE A;  1WMX A;  4TSV A;  3WDX A;  3DF0 A;  3ZSJ A;  4AI8 A;  4CEY A;  1CAU A;  4DQA A;  4OHZ A;  1KEX A;  4N7I A;  2R6Q A;  3Q8F A;  4OFG A;  3J8F 3;  3V65 A;  1I5P A;  2WYS A;  5IHR A;  4CCD A;  4XCB A;  2RJ2 A;  4WZC A;  3WCR A;  2ZTN A;  3AX4 A;  5A33 B;  1OUX A;  4CDX B;  2VOW A;  3B69 A;  5FZL A;  1G8W A;  2BGP A;  4XFA A;  1PO2 2;  4JGY B;  5A7Q A;  2JG8 B;  1CGP A;  4XJW A;  2RM2 2;  4OHW A;  4ZS2 A;  3N4M A;  4DXZ A;  4FPE A;  1MVQ A;  2VQA A;  1ASJ 1;  1SAC A;  2PHL A;  1ENX A;  3KCC A;  4P5H A;  1TQ5 A;  4MGS A;  4K1Y A;  1KJL A;  2GC2 A;  1MS0 A;  3O14 A;  4YZ3 A;  4ZS3 A;  1HQL A;  5A1L A;  5DAW A;  1SPP A;  1H8V A;  4IGO A;  1ND3 A;  5I8S A;  1UU4 A;  4E8C A;  4YM2 A;  4CXW A;  3WG4 A;  1HIX A;  2GSY A;  2VZ3 A;  1Y9G A;  2XBO 2;  3E6B A;  1VBC 2;  3GZU C;  5DUU A;  5LY2 A;  5T55 A;  1Q3E A;  3ACF A;  1KQR A;  3WIN E;  1CIW A;  4D7Y A;  4HVQ A;  5A3P A;  3MUY 1;  3W59 A;  3AMQ A;  3N9P A;  1O6U A;  2BTV C;  4GUL A;  4LNV A;  4BWO A;  3LPG A;  3JQX A;  5A3W A;  1PZ9 A;  1C8M 3;  4H14 A;  3I3E A;  2WA3 A;  4M3C A;  5ERL A;  4AG4 A;  4NHM A;  5FYI A;  4ERO A;  2XUE A;  1GWM A;  3ZN6 B;  1VAM A;  1R09 1;  1FYU A;  2VUC A;  5F32 A;  5H9Q A;  2R07 3;  3GZA A;  3WHU A;  2WNU B;  1UCX A;  1Y9Q A;  1RUH 3;  4HKO A;  2VTF A;  2CU5 A;  3D82 A;  3OGG A;  4XYX A;  3EYP A;  3UNP A;  4W50 A;  4Y1X A;  1XXN A;  3IPV B;  5GM0 A;  3AP5 A;  3NJX A;  2JEC A;  3NAP C;  4FOW A;  4M4R A;  2CWM A;  4GKY A;  4BK5 A;  3WDU A;  2WAA A;  4RQP C;  3OEA A;  4NAM A;  1UYX A;  1YFU A;  4Y1Z A;  2D6L X;  4EZ4 A;  1CAW A;  1ENQ A;  1YI7 A;  3MV0 1;  5I0R A;  1VBB 2;  4AFD A;  4HLT A;  2X05 A;  1W8U A;  4KG0 A;  4NHY A;  2JDN A;  5T50 A;  4YW2 A;  1RUC 3;  4O61 A;  4Q4V 1;  3USU B;  1DCS A;  3T2T A;  4COW A;  4ASK A;  4EN7 B;  2WRA A;  1YI9 A;  1IG0 A;  1SHW B;  2PAK A;  4FPK A;  5DN2 A;  2HWC 1;  2ZGK A;  4CDU B;  5A3T A;  5FMO L;  3PVB B;  1WLD A;  1QJX 1;  4B4R A;  2PYT A;  3WR0 A;  1ZRI A;  4XFB A;  5D8A C;  1DBN A;  5KXD A;  3PJQ A;  3WSO A;  3M2M A;  3HQR A;  1UOG A;  2Q5T A;  5AVP A;  1D4M 2;  2XG3 A;  4IEP A;  4R9B A;  2X5I A;  3SLI A;  2RE9 A;  3ACH A;  1JU4 A;  1H8T B;  1OA3 A;  4O9G A;  4WM8 C;  2YGM A;  4LO7 A;  3ZKY A;  1W90 A;  4QQP A;  2BU9 A;  4QD2 A;  2RDQ A;  1IG3 A;  3K46 A;  2BVB A;  3ILF A;  1JUI A;  5E88 A;  3ECQ A;  2V4V A;  5DQ0 A;  3W5N A;  4K7J A;  2WA4 A;  3BTY A;  4RD7 A;  2BOI A;  2G9G A;  1VMF A;  1DDL A;  3ZXD A;  1XYP A;  1XSQ A;  4H2A A;  2HWF 3;  1PGW 1;  1NG0 A;  3M4F A;  2JXA A;  3ZXG A;  1JZ2 A;  3KSC A;  1RJ8 A;  1UIJ A;  1VBD 3;  4LJH A;  3POG A;  5JCT A;  1LEN A;  3V64 A;  1BEV 2;  2W39 A;  2WAO A;  3IIA A;  2WN3 A;  5C4W B;  5AC9 2;  5K9Y A;  2KD7 A;  4I0A A;  5F8P A;  4XJU A;  1AL0 G;  1AYN 3;  5GZC A;  3PJY A;  5IAX A;  1LJ7 A;  3M3E A;  3NW4 A;  1T6B X;  4AGG A;  4EN0 A;  1O3Q A;  2HWD 2;  4PIY A;  1UOB A;  4I2O A;  4LO8 A;  4XUQ A;  4PI2 A;  4WBB A;  4KBZ A;  4Z2A A;  3LOB A;  5JXI A;  3I3D A;  1MS4 A;  2C1F A;  2JE7 A;  2ZGL A;  4KL1 A;  4KWJ A;  5EIY B;  2YC0 A;  1ULG A;  2WWJ A;  3IMM A;  4P5Y A;  3O12 A;  4QDS A;  5DXD A;  1H2N A;  5FZ6 A;  5C5T A;  1GNY A;  1FPN 3;  4XTP A;  3BB6 A;  5J96 B;  2V09 A;  3ZSM A;  2OII A;  1PK6 A;  3KF3 A;  5JR2 A;  3MF9 A;  4LHS A;  4RFT 0;  1W6Q A;  4GAL A;  1X82 A;  4MV2 A;  5A6Y A;  4PF5 A;  3OPZ A;  4OI2 A;  2R04 3;  3C2U A;  1NZC A;  1RUJ 3;  4URA A;  5BUV A;  1J3Q A;  4F8A A;  1DHK B;  1MS3 A;  3E1F 1;  3I59 A;  3N9Q A;  4NRM A;  1AR8 2;  1H2M A;  1YRZ A;  2ES3 A;  4FPO B;  4E4S A;  2RS5 1;  5M0T A;  1CES A;  1N3O A;  2JKX A;  4XJ8 A;  2JDA A;  1FAY A;  4GB3 1;  1LOA A;  1R09 2;  3LD8 A;  2WZR 3;  1YEW A;  2DFC A;  1ACC A;  1KD7 A;  5L7O B;  3LA7 A;  3VDA A;  2ZX3 A;  1TMF 3;  4MYE A;  3PUS A;  3A7Q A;  1WA4 A;  1RUD 1;  5FZ1 A;  1DLL A;  2ZZQ A;  2DBN A;  2RR1 3;  4UFM A;  4PJY A;  3WHT A;  2VR4 A;  4FPC A;  3UL2 A;  1G7Y A;  1RUN A;  5C3O A;  4QGN A;  2ET7 A;  1DGR N;  4RN5 A;  1AYM 3;  4LBO A;  4W6W A;  4HFS A;  1FV2 A;  1H4H A;  2WC2 A;  4JZR A;  2YUE A;  5DAB A;  2WNV B;  4CCN A;  4LKF A;  5L9R A;  5FRA A;  2BOJ A;  1D7P M;  1K5M A;  5C8C A;  3FL7 A;  1WW7 A;  1FOD 1;  1QJU 1;  4LLO A;  5FZ8 A;  4LQR A;  2QJV A;  4O7X A;  5D1I A;  5FFO C;  4YFW A;  1S0F A;  3LZZ A;  1VBE 3;  1LTE A;  3USS A;  3ZR6 A;  1WBL A;  1NCR A;  4NIH A;  4XUO A;  2FHR A;  5FY5 A;  4CU7 A;  1MAC A;  1WME A;  2B4K A;  3AZZ A;  2HWE 1;  5C6C A;  1PGL 2;  1AR7 2;  3BU7 A;  4A6O A;  2CV6 A;  4FPL A;  3ES4 A;  4YG6 A;  1K45 A;  3ZFG C;  5F3C A;  2WS9 2;  2UUR A;  1W0N A;  2BNN A;  2WNE A;  3GCX A;  4CEW B;  1MZ6 A;  4SLI A;  1TEI A;  5K0U B;  1TG7 A;  3M3C A;  2A3X A;  3NKT A;  5IW0 A;  1ZZ7 A;  4GWM A;  1WCK A;  2YB7 A;  1JMU B;  2FQP A;  3VHO A;  1W0P A;  4K8R B;  4N9H A;  2ZXQ A;  4XXA A;  5JVV A;  5BNQ A;  1XNT A;  2ZGP A;  1ENS A;  2JKB A;  2BUK A;  2IXJ A;  4ZY9 A;  4AF9 A;  4XAE A;  4CPB D;  1OLM A;  2GP3 A;  3ZXK A;  1BBT 3;  3KT1 A;  4DMI A;  3DXU A;  5LA0 A;  2VW1 A;  3G7D A;  1LOF C;  2BEO A;  3AKS A;  4HSL A;  1AL2 1;  3NL1 A;  1PGS A;  3WW4 A;  1KDM A;  1ND2 B;  4S2F A;  1GUI A;  1PHM A;  1EYB A;  2Q1Z B;  3UK9 A;  3KQ4 B;  5J48 A;  4DY5 A;  3LWC A;  4ES8 A;  2Z5W A;  1F2N A;  3V0B A;  4LTA A;  1RGS A;  4JV4 A;  2Z4F A;  4AGV A;  2Y38 A;  4CXX A;  5BNN C;  4CCM A;  3LA3 A;  4EN8 B;  2VM9 A;  2ZBJ A;  3SQO A;  5F5A A;  5DAX A;  1ZYB A;  4BB3 A;  4HOO A;  1SCS A;  4RHV 3;  1I3H A;  2PQS A;  5FYZ A;  4AE2 A;  2GH2 A;  1FXZ A;  2C4X A;  1Y3T A;  3N7M A;  1OQE A;  4QX8 A;  1RHI 3;  1Q8O A;  5IT6 A;  3VBS A;  2EXH A;  4ISQ A;  1QJY 3;  5IYY A;  2Y6G A;  4BLJ A;  1SLA A;  4GH4 A;  4AFB A;  2GU9 A;  4JDO A;  3PVO A;  2DVA A;  2N7G A;  4FI9 A;  3ZDS A;  4AEK A;  3NVC A;  2QQV A;  4XUT A;  4DRR A;  5IVB A;  5IVJ A;  4PQQ A;  5APA A;  2D44 A;  1RVF 1;  4BQY A;  1LED A;  4MXW A;  4QPI B;  4WVM A;  1FNY A;  1C28 A;  2CGN A;  4IUG A;  1AZD A;  2XL7 A;  3IDE A;  1FI2 A;  4AHY A;  1OVP A;  3JBG 1;  2P17 A;  3VBU C;  1HXS 3;  1LHW A;  5JPM B;  3KD4 A;  4MX3 A;  3W20 A;  5E8A A;  3OUI A;  1SBD A;  2BQP A;  1GNH A;  2ZS6 B;  4Y20 A;  3THC A;  4CCO A;  3III A;  1REE A;  1REF A;  1Z7S 3;  3LSD A;  4RGK A;  2HKX A;  5IFP A;  3RJ2 X;  4DXT A;  3LA2 A;  5DUX A;  3ZYJ B;  1HV0 A;  2PHF A;  4XVH A;  1CAU B;  4WM8 A;  4B4P A;  4OI4 A;  3VD9 A;  2DF7 A;  2GNM A;  4TYS A;  1GMM A;  3AYA A;  4UF0 B;  4YZ2 A;  1AX1 A;  1XU2 A;  1QNY A;  4NVP A;  3K51 A;  4C1W A;  3BOP A;  4DZG A;  5LEJ A;  4E27 A;  1UYZ A;  4FOY A;  1C8M 2;  3OJB A;  4S2H A;  1SLL A;  3ASI A;  2GN7 A;  3MLK A;  1QJU 2;  2ZJC A;  3P3P A;  3CJI C;  3TNQ A;  3POS A;  1QJZ A;  3RZJ A;  5FXZ A;  1UMI A;  4FFI A;  1J84 A;  1HRI 3;  2R07 2;  2XQX A;  2YG0 A;  3LQC A;  4C1X A;  1QOO A;  1RUH 2;  3WV6 A;  1S0I A;  5DZE A;  4FCA A;  3RVH A;  4AED C;  3SKV A;  3INA A;  1HB2 A;  4YM0 A;  1PVC 1;  3URF A;  2P3I A;  4B7E A;  5F5Q A;  1GZT A;  1XJA A;  4N90 A;  5FMO S;  4NN0 A;  3HBK A;  3THP A;  4BMB A;  4XPV A;  1J1T A;  3GHM A;  3O0V A;  1CPN A;  4WM7 C;  3THT A;  3VHP A;  4GJY A;  1DIW A;  4XAB A;  2QQN A;  2WWS A;  3LCP A;  2Y34 A;  1E57 A;  2ZMK A;  2J1R A;  1SDD B;  2WQ4 A;  5B4N A;  4GIQ A;  4KBB A;  4XZP A;  2XDV A;  3BPZ A;  3FFQ A;  1RUC 2;  2XH6 A;  2EF6 A;  2JDH A;  3D6E A;  3ILN A;  3ZPY A;  1IS3 A;  2HWB 1;  4MGK E;  4AWD A;  5KXC A;  3H8U A;  2JDZ A;  5T5J A;  1QU0 A;  5HCA A;  1QH7 A;  3DUI A;  3ETQ A;  4HKL A;  1OOP A;  2JIC A;  4PDW C;  2YBK A;  4QAW A;  1MZF A;  3B02 A;  3QBQ A;  4PBP A;  5LBB A;  1QHD A;  3AK0 A;  1L7Q A;  4YVS C;  3IDB B;  3K4A A;  4NWW A;  2VME A;  2WYF A;  2YZ4 A;  3MIB A;  4AVT A;  5L73 A;  4CDQ A;  1CAW B;  1V6I A;  2XKP A;  2OUJ A;  3VZK A;  5CAD A;  1AXY A;  2VTX J;  4QB6 A;  5HXV A;  4MZU A;  4XW3 A;  4IEW A;  4DUV A;  1OD3 A;  2J7M A;  2JB8 A;  4Q1R A;  2JDM A;  4GMP 1;  1W2T A;  3FWE A;  5L19 A;  2XL9 A;  4R4Z A;  4DXR A;  5A32 B;  1S1A A;  1TNR A;  5FZM A;  2HWF 2;  1V9U 1;  1X33 A;  3J7N A;  3KV4 A;  3NNM A;  1QKQ A;  4R9D A;  4UBG A;  3R05 A;  4YG0 A;  4D6Q A;  3FHQ A;  1JOJ A;  2JEN A;  1VBD 2;  4AVB A;  5JOZ A;  2XJR A;  1YNA A;  2P3J A;  2H0V A;  1C4R A;  3U75 A;  3RGB A;  2GMM A;  4KNC A;  3ZDV A;  1KJR A;  1N47 A;  4IE6 A;  1AYN 2;  2VNR A;  3VDB A;  5T52 A;  3L2Y A;  1RUF 1;  3IMN A;  1Q8S A;  1RVF 2;  2QQO A;  4XMI A;  3J7M A;  3BGA A;  4BIF A;  1NOV A;  4QHZ A;  2R30 A;  3UJQ A;  5BNO C;  4XIL A;  1OUS A;  1XND A;  1UZY A;  2LAL A;  1LES A;  2DUR A;  5E16 A;  1ZM1 A;  5A6X A;  2A6X A;  2Y6L A;  3LDK A;  2ZX0 A;  4NE9 A;  5GAL A;  3ENR A;  3D0S A;  4H7L A;  2ID4 A;  5EP9 A;  1LU2 A;  1SCR A;  2D6N A;  3ZFG A;  3ZN5 A;  5JZG C;  5FWJ A;  1FPN 2;  2W95 A;  2ZGN A;  3AZW A;  3CIH A;  5AVA A;  4YYO A;  3MZH A;  2TBV A;  2NPI A;  4JKL A;  5DG2 A;  2W0X A;  3AFK A;  2DVF A;  5DUW A;  1G86 A;  4CEY C;  1PO1 3;  4QU1 A;  3MIG A;  2R04 2;  3PUH A;  4LHK A;  5KWR A;  1QF3 A;  2J1S A;  3RZZ A;  4Y3O A;  1QQP 1;  4M4P A;  5A7W B;  1RXG A;  4RS5 B;  1EPW A;  5EJ3 A;  3N3H A;  2V73 A;  2PHU A;  2NYY A;  2RMU 1;  1FNZ A;  5JSO A;  1LOF A;  2WZR 2;  1US3 A;  3CQO A;  5EYY A;  4A3Z A;  4QM8 A;  1W2A X;  1GFF 2;  4W6Y A;  1XSR A;  2PQQ A;  4KU8 A;  5EZW A;  3PVE A;  4QQH A;  2NP0 A;  4Q0S A;  1TMF 2;  3H0O A;  1S0J A;  2RR1 2;  2HEV F;  1OH3 A;  4LOS A;  2E31 A;  2E7T A;  2QNK A;  4B8E A;  2XVL A;  3K77 A;  2H6B A;  4G3Y C;  1E5R A;  3S30 A;  1RJ7 A;  5FQ0 A;  2WSU A;  5FCC A;  1ND3 C;  3NWK A;  4QPW A;  4M0H A;  5BNN A;  4L9B A;  3S6P A;  2DWR A;  1IPS A;  1BZW A;  1KFU L;  2PFW A;  2Q30 A;  2UY9 A;  2XJU A;  1UKR A;  3GM8 A;  1ULE A;  3ZVX A;  5HCH A;  5FZE A;  4CZS A;  1UAI A;  2ZZJ A;  4PI0 A;  5FKC A;  2WT2 A;  2RS3 1;  5FY9 A;  3PIG A;  3IDC B;  4FT8 A;  4AI0 A;  1S4C A;  3ZSK A;  1W05 A;  3JXS A;  2R0H A;  4Q4X 1;  1MQT A;  2OPW A;  3C3V A;  1GIC A;  5HCB A;  3RNS A;  1J3P A;  3LEI A;  5F5I A;  1F35 A;  3BUC A;  4N53 B;  4CE8 A;  1VBE 2;  1BKZ A;  2GNT A;  4LA3 A;  1OA2 A;  4AOC A;  3POE A;  4LBL A;  5FY0 A;  2XUM A;  3VBO A;  5IVY A;  4LR4 A;  3KVB A;  4H3W A;  2KR2 A;  1J83 A;  4DUW A;  1DZQ A;  1QDO A;  3B5L B;  2DVB A;  3VKF C;  3HN3 A;  2AUY A;  4IV3 B;  3WVJ A;  1G9A A;  5KHH A;  4RGA A;  4JX0 A;  1YIP A;  1UXZ A;  3AP7 A;  1YIF A;  4GZ9 A;  3U14 A;  4COV A;  4CTE A;  3PU3 A;  2I74 A;  4Q1P A;  5E89 A;  3GGL A;  1VRH 3;  1JHJ A;  5LBE A;  2QBX A;  3VBU A;  4GJZ A;  1QH6 A;  3AMH A;  2QQP A;  4UT5 A;  3WP6 A;  3TEX A;  4IEO A;  1QXJ A;  5A6Q A;  2VNO A;  4NII A;  1CX4 A;  4YVW C;  2IXH A;  4NRO A;  4OQ9 A;  3T08 A;  1BBT 2;  3LEM A;  5FAX A;  4UW5 A;  1LHU A;  5FMD A;  1W3V A;  3VKM A;  2P3Y A;  3MBW A;  4XIK A;  4XQW A;  2A1X A;  2XPJ A;  2XJS A;  5F39 A;  4NMI A;  1BK1 A;  4K6B A;  3ROU A;  4AEM A;  1S2B A;  1XU1 A;  4PT6 A;  5FBZ A;  5C9A A;  4H7M A;  3U4X A;  4EWD A;  3I3B A;  3SNM A;  3I2D A;  4Y24 A;  2RG4 A;  5FYY A;  2YBP A;  2YU2 A;  1OF4 A;  1O4Y A;  2LM3 A;  1JOD A;  3GDB A;  4P9I A;  1LEC A;  3H3L A;  1PO2 1;  4J1W A;  3UGF A;  1NA1 A;  4NID A;  1W6P B;  2RM2 1;  1WW6 A;  5C3R A;  2BER A;  3VB9 A;  3ZN4 A;  4FQ4 A;  2QQL A;  3HNY M;  4MUV A;  3H1W A;  2ET1 A;  2HYK A;  1JZ6 A;  1RHI 2;  1ZA7 A;  2FMY A;  5AFE A;  4C90 A;  1GQP A;  4FVV A;  1QJY 2;  4IE0 A;  2R06 3;  3Q8A A;  2UU8 A;  5SV8 A;  4XMA A;  2XBO 1;  5FZI A;  4HZF A;  3U10 A;  5LZ6 A;  2Q0A A;  2Q8C A;  2B46 X;  5EPA A;  5J7M A;  3K4Z A;  4JC1 A;  3P3N A;  4GQ7 A;  1JYI A;  3IT8 A;  3JB4 C;  4FPY A;  1YFX A;  3M8L A;  4LE3 A;  3VD7 A;  4LBJ A;  3O1O A;  4MGY E;  4ET7 A;  5GZE A;  5FTT C;  4C91 A;  4HXC A;  4E2Q A;  5HV0 A;  4OVE A;  4UW4 A;  1WUV A;  1O7F A;  1XB9 A;  2L9L A;  2PLV 3;  4ZXK A;  1HXS 2;  5FLI A;  4RL7 A;  5J3U A;  4L2N A;  2EXI A;  3NAP B;  4K1Z A;  2G4I A;  4XAA A;  4UXA A;  5FUN A;  2BFU S;  1MEC 3;  3KHB A;  5FP3 A;  3CF6 E;  2HBU A;  1XRU A;  4RQP B;  5LA1 A;  1GZW A;  4FOV A;  3T2O A;  5IK4 A;  1PK6 C;  5FPA A;  1VBB 1;  4LPL A;  4D6S A;  5FZ7 A;  3TWI A;  4XC9 A;  1ZBA 3;  1SBE A;  1UQX A;  3POI A;  5T5L A;  2D3P A;  5A3M A;  1L3J A;  3U0Z A;  1AR6 3;  3O1R A;  1LAJ A;  4Q29 A;  1IS6 A;  5B2G B;  1ULD A;  3OF1 A;  4I3G A;  1AR9 3;  3ZFF C;  2E33 A;  4P9G A;  3ELN A;  2SLI A;  3D4K A;  1HRI 2;  5EQU A;  5IK8 A;  3AYC A;  4F7Z A;  4ITC A;  3OG2 A;  4QQO A;  2NQY A;  5D8A B;  1RUI 2;  4NHK A;  3C7O A;  1NQD A;  4GAZ A;  4Q8L A;  4QPY A;  4XF1 A;  5LA2 A;  1WWY A;  3SHR A;  3I3M A;  2OW4 A;  1UIK A;  4NO4 A;  4NJ4 A;  1D4M 1;  4WM8 B;  2IZW A;  2SBA A;  1UY1 A;  3FZ3 A;  3IDA A;  2QDN A;  2W52 A;  3ZFE A;  3A21 A;  4LHL A;  5LAT A;  2UY8 A;  2DCZ A;  4ATF A;  4XEZ A;  1OXC A;  4EJR A;  1ZA4 A;  1LHO A;  4Z8B A;  2PEL A;  2DFB A;  2MHF A;  1GAN A;  2LS6 A;  2VQT A;  4LBQ B;  5F7U A;  2E6V A;  1OC1 A;  2Y60 A;  5C8C C;  1APN A;  1K5M C;  2NN8 A;  1WCU A;  3RMX A;  1UY4 A;  3KCX A;  1RXF A;  1OH4 A;  3BTX A;  2GP5 A;  2RVA A;  1NCR C;  5FK8 A;  3OBZ A;  1OKO A;  2PHT A;  3BI3 A;  2ZGU A;  2X53 S;  1V70 A;  5FP8 A;  1H2L A;  3ZYH A;  2ZMN A;  1BEV 1;  3CMG A;  1H6X A;  1RUE 3;  4OI0 A;  4NUB A;  4XTM A;  5AC9 1;  4DS0 A;  2VY0 A;  4R4X A;  1CN1 A;  1R1Z A;  5CIS A;  5FZ0 A;  2K2S A;  2YV8 A;  4QDR A;  5GLZ A;  1LB2 A;  1NE4 A;  2VMC A;  1SZB A;  4HET A;  4R9C A;  1H30 A;  1NYW A;  1JHN A;  3ZYB A;  3B00 A;  4I3P A;  1Z0H A;  2HWD 1;  4OHY A;  3MFA A;  3TYJ A;  3NJZ A;  5JUV A;  5C5U A;  2D3S A;  4QHO A;  1QOS A;  2BWA A;  4AZZ A;  5FXW A;  4BME A;  1DZT A;  1JZ3 A;  4XF4 A;  1XNA A;  3ETP A;  1NY7 1;  1VP6 A;  4AI9 A;  5FPU A;  1O4T A;  1WW5 A;  2RDS A;  1UY3 A;  3ZMO A;  1GOG A;  5FYV A;  3TNP B;  2QCS B;  1CVN A;  2C6S A;  5BNP C;  1JYX A;  1LGC A;  2ILM A;  3O1M A;  2DBI A;  3AB0 A;  1LHV A;  3OPW A;  1SEF A;  4AW7 A;  3E5Q A;  1X50 A;  1E5I A;  4E2G A;  3I7D A;  3MHZ A;  3BAL A;  4AVA A;  1H4G A;  5FV3 A;  1AR8 1;  4QKB A;  3NQH A;  2P5B A;  4WV8 A;  5IVC A;  3AL5 A;  4EN9 B;  4UYB A;  3OTF A;  5D21 A;  3UV9 A;  3OD0 A;  1SFN A;  5CKM A;  5AFB A;  3SKJ E;  2VUD A;  3H3U A;  5D2A A;  1U5X A;  3ON7 A;  1AXK A;  1IS5 A;  1CR7 A;  2BDR A;  2FZ1 A;  3T09 A;  4S2G A;  1DU3 D;  1R08 3;  4XBQ A;  4XJA A;  2QQW A;  5FYU A;  3T2Q A;  3ZR5 A;  3JZV A;  1ULC A;  1PIV 3;  1US2 A;  3VBS C;  5CFD A;  3TEW A;  1RB8 G;  2QVS B;  3WEZ A;  4XBN A;  3RFR A;  5FR3 A;  5C3S A;  3IM0 A;  1VE0 A;  4IEZ A;  5FK7 A;  2CGP A;  3FX3 A;  4GH4 C;  2A6Z A;  3T2P A;  1CWP A;  1PO1 2;  5CG9 A;  4TLF A;  1G9B A;  5L9V A;  2I2S A;  4ASM B;  3PUR A;  4UFK A;  3KV6 A;  3VBH A;  4YVW A;  1PMI A;  4DFS A;  4AI3 A;  3CO2 A;  3RYR A;  3T1L A;  5GLV A;  3ZKU A;  2IFR A;  4LUL A;  2FCU A;  3POF A;  3O0W A;  3R4D B;  4DUX A;  3KT7 A;  1W6M A;  5FMB A;  1W28 A;  1QIQ A;  1MZE A;  3ZFG B;  4CUC A;  4J1X A;  1AR7 1;  4QPG B;  4AI1 A;  2DU1 A;  3ZM8 A;  3PLQ A;  2JIG A;  3AMP A;  4CP1 A;  4DRV A;  2WS9 1;  3CHX A;  1Q8V A;  3EO6 A;  5A3U A;  4Y5T A;  1ENR A;  3WXP A;  2CY6 A;  1S0G A;  4IL7 A;  4NPM A;  4AI2 A;  3KV9 A;  1JYN A;  4MET A;  1LKN A;  2XWJ B;  3T4H B;  4ZKT B;  1A3K A;  3L2H A;  3P1I A;  3RI8 A;  2MEV 3;  2ZAA A;  3OGR A;  2VAU A;  4OUS A;  5GLT A;  2W1U A;  2YC4 A;  4Q0Q A;  3DN7 A;  1J59 A;  1IPK A;  4NAO A;  2ZPX A;  4YWA A;  5FZH A;  2CNA A;  2ZGO A;  5FZD A;  3POJ A;  1W8H A;  2GAL A;  5FZK A;  3M3I A;  1OT5 A;  1ZBE 3;  4UFI A;  1GSL A;  2PHD A;  2QE3 A;  4QQL A;  3TN9 1;  5FXV A;  1CAV B;  2VZO A;  4NOT A;  3K75 B;  3AXD A;  3HPN A;  4M3C E;  3N35 A;  5FYM A;  2R1B A;  4AYU A;  1NAE A;  4BQX A;  2O0O A;  3WP5 A;  5FY7 A;  4COY A;  5CNA A;  2OYZ A;  3BVC A;  3F2Z A;  4Y4R A;  4LO4 B;  5BNN B;  3WD5 A;  1HKD A;  4BXF A;  4UOJ A;  1G6N A;  1OQ1 A;  1VAV A;  3QCW A;  3LDR A;  4A45 A;  1DP0 A;  2J1T A;  4BK4 A;  1VRH 2;  1PMH X;  3MGU A;  1BK0 A;  1MS5 A;  3NJY A;  4YW3 A;  1LOB A;  5GZD A;  2Y26 A;  5FP4 A;  4QKN A;  1B35 C;  4QXK A;  3QLQ A;  3SCH A;  2VU9 A;  2XJP A;  4A6S A;  2VJX A;  3KS7 A;  1HV1 A;  2WZE A;  2VZT A;  1NY7 2;  1ONA A;  2VCM A;  3E6D A;  4IXL A;  4QXC A;  2QQM A;  2CL2 A;  2FDG A;  1NCQ B;  4Q26 A;  2ZAB A;  1OF3 A;  4BQW A;  2XGX A;  2XJQ A;  3JD7 3;  1OOP C;  5F6K A;  3KZ4 C;  3J8F 1;  2KXL A;  2VMI A;  4IGP A;  1S2K A;  3T3Y A;  5JOX A;  5K8S A;  3IZO A;  5LRS A;  3O1U A;  2ZGM A;  1TME 3;  2WO7 A;  3C7E A;  1KIT A;  1OSG A;  5HPO A;  2Q1F A;  4IE4 A;  2A71 A;  4Q4Y 3;  5FBJ A;  4JGY C;  2G9F A;  5EV7 A;  4CDQ C;  3ZFF A;  5JSR A;  2QTW B;  2OQ7 A;  3I2H A;  3I2O A;  1UPS A;  4MGZ E;  2JDU A;  3RJR A;  2FDJ A;  2LUW A;  3OD4 A;  3WNX A;  1GQG A;  1KFX L;  2WZ8 A;  3APB A;  2G1M A;  2ZAC A;  2CDP A;  2WIN B;  2UWC A;  3AL6 A;  4XUR A;  1D0H A;  2R06 2;  4JVA A;  1XOY A;  3JUU A;  4DXS A;  5A6Z A;  4H55 A;  1CZT A;  2W9X A;  3ZO0 B;  3ZPO A;  4BQ5 A;  4QT6 A;  5FZG A;  5EYX A;  1AJK A;  5FZO B;  5FYH A;  4BZ4 A;  3U07 A;  1GYK A;  4D8M A;  3MYX A;  4IEQ A;  4KWL A;  4BXS V;  1WGP A;  4ARX A;  5JXJ A;  3H42 B;  4QMA A;  1UPI A;  4DPN A;  1BLZ A;  1C8M 1;  1T6G C;  4XF9 A;  2ZGR A;  3CJI B;  3WNK A;  3OYW B;  3HT2 A;  5IVF A;  2R1D A;  3O0X A;  2H6C A;  1XBF A;  2AEZ A;  1OLR A;  2PLV 2;  3N9M A;  4AXO A;  3ZYF A;  2VZ1 A;  2R07 1;  2WNU C;  2W1S A;  3LSE A;  3U4S A;  4AED B;  1ODN A;  5ACA 3;  1FMD 3;  1JI6 A;  4QGM A;  1RUH 1;  4GXL A;  1NLQ A;  2VH9 A;  2XB6 C;  3MID A;  1MEC 2;  1PNG A;  1WCS A;  1H2K A;  4HON A;  4WM7 B;  4MOA A;  4P08 A;  3T0D A;  2IVI B;  4P02 B;  3LEK A;  4CCE A;  1DGW A;  2QKD A;  2YPJ A;  2B45 X;  4W65 A;  5BYN A;  3ZMN A;  4GWJ A;  1YXW A;  4E8D A;  4BLI A;  1GKB A;  3VZO A;  3H8O A;  1V6L A;  1DG6 A;  2VMF A;  5A70 A;  4PLN A;  4FFF A;  2VZU A;  4Z2W A;  3IWZ A;  1ZBA 2;  1RUC 1;  2P6C A;  4E4H A;  2PXJ A;  2HWB 3;  1AR6 2;  3JQW A;  5IUQ A;  1ZZC A;  4OCT A;  1AR9 2;  1PM7 A;  2HYX A;  4CSW A;  4Q5O A;  5CAZ A;  5FJK A;  3TN9 2;  5BNP A;  2E53 A;  3RYP A;  1UW8 A;  4PDW B;  5FO7 B;  4MLO A;  4NWV A;  2D6M A;  2NMO A;  3HAG A;  4LBK A;  4YVS B;  3ALQ A;  1W6O B;  3I2K A;  3VKL A;  5CEH A;  5FMC A;  4ZXE A;  2YU1 A;  4B1M A;  4FOQ A;  3Q9O A;  3CZJ A;  4XHB A;  5B4X A;  1WLT A;  4XE9 A;  1O3S A;  1O91 A;  2LTN A;  3D5O A;  1DLC A;  2UWA A;  5KHI A;  1S0C A;  5FO8 B;  1HJF A;  2DUQ A;  4IQP A;  4LKD A;  2BV4 A;  1HB1 A;  5T5O A;  3UJO A;  1MQT C;  3BIE A;  2OX0 A;  2PHR A;  4CUB A;  4ORF A;  5LW9 A;  2Q1M A;  2HH9 A;  1U12 A;  1I5Z A;  2HWF 1;  2RJK A;  4E4Z A;  1O8P A;  2VZS A;  1ZZB A;  1OMI A;  5ANN A;  2BJS A;  4RA0 A;  1VBD 1;  4M01 A;  2HEW F;  3VBO C;  4Y22 B;  2AC1 A;  5JDB A;  4JGZ A;  1RUE 2;  1XE0 A;  2XOM A;  3J8F 2;  2EVX A;  5DAP A;  3UKV A;  1KRI A;  1CAX B;  3GBW A;  3ZXE A;  1AYN 1;  3CBN A;  1POV 0;  2GZW A;  1RMU 3;  4BA6 A;  4CDW A;  2P34 A;  3DYP A;  1VMH A;  4XUN A;  4JKM A;  3IBM A;  4QX3 A;  4CP9 A;  2WR9 A;  2WAB A;  1UOJ A;  4RR3 B;  4MGT A;  4N8M A;  4HAN A;  2QQU A;  3K3N A;  4BPZ A;  2UYB A;  4EV0 A;  4OZX A;  1YJL A;  4I0B A;  4P9X A;  4YNI A;  4AAX A;  2EAA A;  1U5Z A;  2QDR A;  4YLZ A;  3PDQ A;  1R1A 3;  3E5U A;  4Y1U A;  5FP7 A;  5JZG B;  3VDD A;  2ZX1 A;  3W21 A;  4FFG A;  1IKQ A;  1Z78 A;  4CCJ A;  4QGL A;  5ABJ B;  1LNS A;  4WVV A;  2G9Z A;  4YW1 A;  1M06 G;  1FPN 1;  1UYY A;  2E7Q A;  4CEY B;  2OZJ A;  3FHI B;  3N7K A;  5K4L A;  4A4A A;  4CU9 A;  3VZM A;  4BIS A;  2TNF A;  5C9A C;  3BOD A;  3WX5 A;  2R04 1;  1RUJ 1;  2OQ6 A;  2Y6H A;  5E6H A;  2BWC A;  3WF3 A;  5A3L A;  4Q0V A;  3KMH A;  2DCT A;  3D0J A;  3RZH A;  1ZVF A;  3V0A A;  5FUP A;  3PU8 A;  1NXM A;  2RMU 3;  4N43 A;  5CG8 A;  4CUA A;  1Q56 A;  1C1F A;  1D2Q A;  1NA1 C;  3VHN A;  2WZR 1;  1W9W A;  1BQP A;  4D3W A;  5L7O C;  2BFU L;  2CTV A;  2GN3 A;  2RS1 3;  4IE7 A;  5FZA A;  2E32 A;  2WFF 3;  2YDE A;  1TMF 1;  1VPH A;  1GLH A;  4QX2 A;  5E1R A;  1POV 1;  1R08 2;  1J3R A;  2RR1 1;  4Q4W 3;  1SPP B;  1ND3 B;  3EQE A;  1PIV 2;  1AX2 A;  4AHW A;  5A7N A;  2UYA A;  3E5X A;  3MI8 A;  3SH3 A;  3ZSE A;  2E63 A;  4GMP 0;  4AVS A;  1HB3 A;  4Q27 A;  3SH4 A;  3AP9 A;  5FWE A;  3FBY A;  3VLB B;  1COV 3;  3KQR A;  1DQ6 A;  1PX4 A;  1GOF A;  4Q0U A;  5FXX A;  5GLU A;  1B35 A;  1AVB A;  3VZJ A;  1NX9 A;  3CLP A;  2WQZ C;  4M3C B;  5GKA C;  1QEX A;  3HJR A;  2BBV A;  4Z07 A;  1IPJ A;  1V0A A;  1CZV A;  1VBE 1;  3AM2 A;  3WZ1 A;  3WG3 A;  3FJS A;  4XAC A;  3ZYI B;  4ZHN A;  3CNA A;  3N36 A;  3Q8E A;  2WO1 A;  3AZX A;  2FZ2 A;  4JDM A;  5DDJ 3;  1VAK A;  3MW3 A;  4XET A;  2C24 A;  1GV9 A;  1JZ8 A;  5FJH A;  4BIO A;  3O1P A;  3WQ0 A;  2BBA A;  1BMV 1;  1H9W A;  4CDX A;  5K0U C;  4D69 A;  5IFT A;  1W0O A;  5CBL A;  1V6N A;  5HI0 A;  4JGY A;  1LUL A;  3O1T A;  2BYV E;  5KXB A;  2A6Y A;  3A4U A;  2QZ3 A;  2WQ8 A;  2MEV 2;  1PNF A;  1HX6 A;  1DYO A;  2P2K A;  3PUA A;  5K7P A;  3OBA A;  2JE9 A;  4KGG A;  1N1V A;  4HKW A;  4YVW B;  3DKW A;  3ACL A;  3I2F A;  4UW3 A;  4HVR A;  1BBT 1;  1W9F A;  4Y1V A;  1NLS A;  1ZBE 2;  4C0B A;  1QWR A;  4B4Q A;  5J37 A;  1QOT A;  3PIJ A;  2WO3 A;  3B94 A;  5JMO A;  4HPK A;  2KM2 A;  2C9A A;  4A41 A;  4AQ6 A;  3KT4 A;  2VOK A;  4K8F A;  4EWA A;  2ORX A;  1EY2 A;  5KC5 A;  3BTZ A;  4AAP A;  1L7L A;  3LF7 A;  4CCK A;  2QUO A;  2R16 A;  2X5I B;  3DXT A;  1LGN A;  1WD4 A;  5CKQ A;  4YGC A;  3ZOI A;  3HQU A;  5A7O A;  2Y64 A;  1K42 A;  3ZFE C;  4CCL A;  4PIZ A;  1QNW A;  3ZN6 A;  3AZY A;  2ARA A;  3OBR A;  3J26 N;  1N1S A;  2WNU A;  1JYW A;  2ARB A;  3WT3 A;  1QJE A;  3KM5 A;  2X10 A;  3M1H A;  5GLW A;  4XDP A;  5G04 L;  3IPV A;  1RHI 1;  3E97 A;  1NZI A;  1VBC 3;  1QJY 1;  5A1F A;  3NNG A;  4SBV A;  1OBN A;  5L36 A;  1PZ8 A;  4FBF A;  3JD7 2;  3OOX A;  4K40 A;  4LK7 A;  3HEI A;  1A8M A;  2P4E A;  2GC1 A;  5IWF A;  1DZR A;  2VCB A;  2C9K A;  1RUJ 2;  3FE5 A;  1TME 2;  5FO9 B;  4KH9 A;  1ODM A;  1EUT A;  3USU A;  4YM1 A;  1WCQ A;  3U37 A;  4Q4Y 2;  1HN0 A;  3WDW A;  3MUZ 1;  3HNM A;  4QB1 A;  2FCV A;  2LW8 A;  5JI9 A;  5JLV A;  2VVE A;  3UGG A;  1UX7 A;  1D0G A;  1HXS 1;  3N9O A;  1GP5 A;  2YBS A;  1OA4 A;  2D3R A;  1ZX5 A;  5FUI A;  3ZLI A;  2E51 A;  4A44 A;  2IXI A;  1UYP A;  1ULP A;  3WF0 A;  1HRV 3;  4YZ1 A;  1WMF A;  1HQW A;  1XE8 A;  1H8T A;  2E26 A;  4QU2 A;  2GAU A;  1G9F A;  1PK6 B;  3KGZ A;  3KF5 A;  1OI6 A;  1AYM 2;  1W6Q B;  4R52 A;  4QQ2 A;  4XIO A;  5BV6 A;  1H1M A;  3DGT A;  4I01 A;  5IAV A;  5A3O A;  3FHA A;  3ZYG A;  3AVR A;  4FXG B;  3N9N A;  1Q5O A;  3I59 B;  5LCW L;  1A34 A;  3ZFF B;  2PN5 A;  3AKT A;  3FBM A;  2YC2 A;  2X29 A;  2A6W A;  4YW4 A;  5LY1 A;  1HRI 1;  1JOB A;  5ACA 2;  3C8X A;  1EAH 3;  4MGQ A;  5CFC C;  1FMD 2;  1X8E A;  1RUI 1;  1DQ4 A;  1RTV A;  4FPF A;  4MXV A;  2ZHL A;  5C4W A;  3RQ0 A;  1OPM A;  1UZW A;  5LEK A;  3KHC A;  3P6B A;  1RUG 3;  2W91 A;  1F5J A;  3H1Y A;  1BMV 2;  1V6M A;  2J1V A;  5CFD C;  4MAD A;  1IOA A;  5FLJ A;  2BNO A;  3HOB A;  1SLC A;  1EV1 3;  4TXW A;  1SLT A;  3JU9 A;  5J1X A;  2XJV A;  2VPV A;  1I9R A;  5C8C B;  1K5M B;  2W46 A;  1S55 A;  4XFH A;  2I45 A;  4FFH A;  2JB4 A;  3MW4 A;  4N9I A;  3VBH C;  1JU3 A;  1VBA 3;  1W9S A;  3ZXL A;  1DGR A;  1NLR A;  1W9Y A;  3ACG A;  3W58 A;  1NCR B;  1F9K A;  4JTN A;  1O3T A;  4ZU5 A;  2YPD A;  2GND A;  2PAM A;  2D5H A;  1Q8P A;  3VD4 A;  1Q43 A;  2D6K A;  1JOP A;  1UN1 A;  4QWN A;  1ZRE A;  1JBC A;  2OPK A;  3GXU A;  3J4U H;  4L8Q A;  1B09 A;  1HJG A;  1UY2 A;  4LBQ D;  1UMH A;  2V72 A;  2J22 A;  4OMD A;  4OUE A;  5ANQ A;  3VN4 A;  2CHH A;  1CJP A;  1ASJ 3;  3SCG A;  1KGY A;  5L7O A;  4RHV 2;  4LO5 B;  4QX0 A;  5FPZ A;  2XON A;  1PGL 1;  1VJ2 A;  3VBR C;  4IGQ A;  4ZU4 A;  3N7J A;  4BYY A;  4EYU A;  4X6R B;  2CGO A;  3EXU A;  4LOT A;  1FX5 A;  3RZK A;  1K3I A;  5FOB B;  2ARC A;  2WN2 A;  1VRB A;  1ZZ6 A;  1UNB A;  5F6L B;  4X8P A;  3VBF C;  2K9Z A;  1CON A;  2DVG A;  3EBR A;  5EFU A;  1W39 A;  2EXK A;  4FP3 A;  3HIF A;  3ES1 A;  3V0B B;  2F4L A;  5C8W A;  5C71 A;  2D43 A;  2LRP A;  3RWN A;  1RMU 2;  3VZN A;  1JW6 A;  5IJR A;  3M7A A;  4AQT A;  1YFY A;  2ZCW A;  3BOW A;  4IE5 A;  4CCC A;  2JWP A;  5JOW A;  1R09 3;  1YYN A;  5DAQ A;  3QH6 A;  3AC0 A;  5BPX A;  3AKR A;  3OY8 A;  2ZGS A;  3KV5 A;  2DVD A;  1GR3 A;  1X36 A;  3DPR C;  3IB3 A;  3AFG A;  5JI7 A;  4AFM A;  2VVF A;  2WZP P;  2WFP A;  4Q0P A;  1R1A 2;  1W2N A;  2WII B;  5ISL A;  1W6N A;  3VBS B;  1Z7S 2;  4YPJ A;  3MIC A;  5JR7 B;  2RDR A;  4R8H A;  4CEW A;  4NPR A;  4O9E A;  3FFZ A;  2OS2 A;  5K0U A;  2YFU A;  4V2V A;  3F95 A;  4GH4 B; 
#chains in the Genus database with same CATH homology
 4LK7 A;  1GWK A;  1L7L A;  2WYF A;  1GWL A;  3UT0 A;  1W90 A;  2K46 A;  2LRP A;  1W8U A;  4LKF A;  2Q1F A;  4LKE A;  4CP9 A;  3ZYB A;  2JWP A;  1HN0 A;  3ORJ A;  4YW7 A;  1UOJ A;  1W8W A;  1GWM A;  4YW6 A;  4YWA A;  4BQ4 A;  4AL9 A;  1WZX A;  5D21 A;  1W8T A;  4CPB D;  4LKD A;  4A6S A;  1V0A A;  1WCU A;  4BQ2 A;  1W9F A;  4LK6 A;  3ZYF A;  4CP9 B;  2VXJ A;  1W8Z A;  4BQ3 A;  2O14 A;  4CPB A;  1WMX A;  1OH3 A;  1OKO A;  2KR2 A;  3F95 A;  4LJH A;  2C24 A;  3ZYH A;  2LRO A;  4BQ5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...