4V2WA

Jmjd2a complexed with ni(ii), nog and histone h3k27me3 peptide (16-35)
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
348
structure length
348
Chain Sequence
TLNPSARIMTFYPTMEEFRNFSRYIAYIESQGAHRAGLAKVVPPKEWKPRASYDDIDDLVIPAPIQQLVTGQSGLFTQYNIQKKAMTVREFRKIANSDKYCTPRYSEFEELERKYWKNLTFNPPIYGADVNGTLYEKHVDEWNIGRLRTILDLVEKESGITIEGVNTPYLYFGMWKTSFAWHTEDMDLYSINYLHFGEPKSWYSVPPEHGKRLERLAKGFFPGSAQSCEAFLRHKMTLISPLMLKKYGIPFDKVTQEAGEFMITFPYGYHAGFNHGFNCAESTNFATRRWIEYGKQAVLCSCRKDMVKISMDVFVRKFQPERYKLWKAGKDNTVIDHTLPTPEAAEFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LYSINE-SPECIFIC DEMETHYLASE 4A
publication title Studies on the Catalytic Domains of Multiple Jmjc Oxygenases Using Peptide Substrates.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 105
structure length 348
sequence length 348
chains with identical sequence B
ec nomenclature ec 1.14.11.-:
pdb deposition date 2014-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF02375 JmjN jmjN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 4v2wA01
5FZOB 5A1LA 4GJYA 4D6SA 3LD8A 4Y3OA 5FZ0A 5FPLA 5FV3A 5A7SA 2WWJA 4DIQA 3NJYA 3KV9A 5F32A 4HONA 5LW9A 5FY1A 3ZLIA 5FZ6A 4UF0A 5A7QA 3U4SA 5FZLA 4CUGA 5IVCA 3PURA 2XMLA 5FZOA 4CCLA 3KV4A 5FYVA 5LWBA 4QXBA 2YBPA 3AL5A 5IW0A 4D6RA 4CSWA 5FYZA 5FPUA 5FPBA 4UF0B 4BU2A 2WWUA 5FYSA 5FZBA 5FXWA 5FZEA 2Q8DA 4EZHA 5IVJA 2XDVA 3N9NA 5E6HA 3ZPOA 3PDQA 5KR7A 5FY9A 4D6QA 5FZKA 5FZHA 5FYUA 5FYBA 5FY4A 5FZAA 5FPVA 3RVHA 4HOOA 5FBJA 5FJKA 4GAZA 5FWEA 3DXTA 4QWNA 5FZ9A 4QXHA 5FZGA 5FZ3A 2Q8CA 4GJZA 5FZIA 5CEHA 2YU1A 4QU1A 4Y4RA 2Q8EA 5FZDA 4EYUA 5FP7A 2GP5A 5FP4A 4IGOA 5FUNA 5FZ4A 4IGQA 4CCNA 5IVBA 4XDOA 4QX8A 3AVRA 5FZFA 5IWFA 5FYTA 4TN7A 5K4LA 4EZ4A 5A3WA 2P5BA 2OQ7A 4C8DA 5ISLA 5F3IA 3K3NA 4LXLA 2GP3A 2W2IA 4QXCA 5A7OA 5FUPA 5F3CA 3DXUA 3N9QA 5FY0A 5IVFA 5FY8A 4E4HA 4LITA 4CCOA 2OS2A 1VRBA 3KV5A 5F3GA 5FYIA 4CCJA 5FWJA 5LY1A 5A7WB 5A3NA 3KVAA 5FZMA 4URAA 5ANQA 5FY5A 3KVBA 4CCMA 5A3PA 3UYJA 5A1FA 5FZ7A 5FXVA 3PU3A 3PTRB 5FYMA 2OX0A 4BXFA 5IVEA 3N9OA 5FYYA 4V2VA 5F2SA 5F39A 4BISA 2VD7A 3PUAA 3PUQA 4NUBA 4Y33A 5F3EA 3N9LA 2YBKA 2OT7A 5A7WA 5F5AA 5F37A 5FXXA 2YBSA 5A80A 4ASKA 5F2WA 5FZ1A 2XXZA 5F5CA 4V2WA 5IVYA 5FZCA 2PXJA 5FP8A 3AVSA 3N9MA 3OPTA 5IVVA 5FY7A 5F5IA 4LIVA 5LY2A 5FP3A 3PUSA 4XDPA 4AAPA 4QX7A 2OQ6A 5FYCA 4LIUA 5FP9A 3K3OA 3N9PA 4IGPA 4DO0A 2XUEA 5A7PA 2YU2A 5FZ8A 4CCKA 5A3TA 2YPDA 3K2OA 5FJHA 5FPAA 3PU8A 3KV6A 5FXZA 5A7NA 5FYHA 3LDBA 4GD4A 3OPWA 4AI9A 3U78A 3AL6A
chains in the Genus database with same CATH superfamily
1C57A 1GQGA 4AI1A 4QHOA 4G9SB 4XPVA 1RXGA 2Y6HA 3P3PA 4B1LA 4D6SA 4V1PA 3ZYFA 5I0RA 1EPZA 2O8QA 4L9BA 4CPBA 1OOPA 4DQAA 4TTGA 4AFMA 1LCLA 3IAQA 4GULA 1JN2P 4M01A 4AEDC 1GUIA 1YI9A 1BVP1 4FOQA 3BTAA 2UY9A 2JG9C 3POEA 5KXDA 1AJOA 3AP6A 4A3ZA 1FV2A 1Z0HA 3DPRA 1WLCA 3HBZA 3OB8A 2BV4A 3TBDA 2E9QA 2X10A 1ZBA3 3VKOA 3U75A 3IDAA 1O5UA 4SBVA 4WM8A 3T2PA 2WIIB 3VBOB 1NXMA 2R6QA 2YROA 1SMVA 3H42B 4AAXA 2WWUA 5LATA 2VOVA 2IXCA 5JOXA 1W8WA 1DHKB 5FZEA 1LGCA 1MZ6A 3W58A 2XGXA 2W95A 1MS3A 1DQ2A 1HDKA 2ZGRA 4JTNA 4QU2A 1GP6A 2JE8A 4YVSC 1RUI3 4PT6A 3RMYA 3OYWB 2E7AA 1OKQA 2YGLA 1D2SA 1DYPA 1Q8SA 3LIGA 1VBE2 3VBHB 1PO11 1UX6A 4XHBA 5A6QA 2UWAA 3A0KA 3DGTA 4CEWC 1Y7BA 1C4RA 3MICA 1R64A 2H6BA 3HQXA 2RDSA 2RJ2A 4C1XA 3AFGA 3VBFB 2BPA2 3I8TA 1FNZA 3LZZA 2OW4A 4Q4W3 2VW0A 3VBSC 3RZKA 2VOTA 4OQ9A 1DGRA 1MS8A 2WT0A 4DINB 2WN2A 2P6HA 3ZXJA 1IKPA 3ZOIA 1RUE2 1SDWA 2OQ7A 4YVWC 1S0GA 4QPYA 4LBMA 1J84A 5FY0A 4S2FA 4M00A 2HBUA 3MIBA 5BNOB 2PQSA 4CCOA 4HSJA 1WW4A 2D3RA 3I2OA 1F5FA 1REEA 3I2JA 4LE4A 5EP9A 2XL9A 1JYNA 2ARCA 2J7MA 3RYRA 4W65A 1QY4A 1W8ZA 5ANQA 2LM3A 1FAYA 2BU9A 2FDGA 1RUF3 4W8JA 4RHV1 4W50A 1W6MA 4XF4A 5T5JA 1AR81 1ZZCA 2RG4A 2XJSA 4YGBA 1W28A 5C8CA 1Y43B 3U14A 1CJPA 4LO8A 4G3YC 4R8HA 3CL1A 2WNUA 4CUBA 1RUC3 2ET1A 2R1BA 4OI0A 3RGBA 3Q9OA 3CZJA 3J4UH 1RUH2 4QX2A 2XBO1 1LULA 2PN5A 3FE5A 2IXKA 4Q4V1 3C7FA 1RYYA 2IC1A 1NLQA 2Z42A 5FZ1A 5L7OA 1H8TA 2OA2A 2WUHA 4JX0A 2CHHA 2HLEA 1BEV2 3N9MA 2RMU3 1LOGA 2GC0A 2GZWA 4NO4A 3H8UA 2MNGA 2HYXA 2WZ8A 1AR72 1NYWA 2O0OA 2VZSA 5FP9A 1DQ6A 4AVCA 1DLCA 5JI7A 4DO0A 2WAAA 2ZS6B 3I3DA 4R4ZA 1QOSA 3ZKUA 4IETA 3M8LA 4AI9A 1PX4A 4QX5A 3CEWA 3ACHA 3WF2A 1RB8G 4HSLA 3ZFGB 5KHKA 2XKOA 2YPJA 4ZZ5A 2WWJA 4MZUA 4MADA 3UGHA 4C0HA 1EV12 1R1ZA 3KT7A 5IAVA 1S0EA 3P6BA 3ZFFA 2ZTNA 4NAOA 1XBFA 4PI0A 2Q1MA 2Y60A 3EBRA 4KMQA 2OIIA 2XWJB 5E89A 5T54A 2VXJA 4CU6A 4LHKA 1F9KA 4FP3A 1PMJX 2YYOA 5LWBA 2HEWF 3NV3A 4QGMA 1GOHA 1FYUA 5A32A 1IS6A 1RUD3 3HNMA 4P5HA 4Q4X2 2JG9B 5CBLA 2ID4A 3S6PA 4OI2A 2WO2A 2VMEA 2KA3A 3BB6A 1JTZX 4MXWB 5CFDA 5FXWA 4NRQA 3MFAA 5IVJA 5K0UA 4PJYA 2VW2A 4DS0A 2VNVA 4LOSA 4FTEA 3BUCA 2QVSB 5LBBA 4E27A 4U2AA 3C8XA 2LS6A 4NHYA 5T52A 4XABA 1ZA7A 5GZGA 4J25A 4B29A 1WD3A 2Q8CA 1H8TC 3ALQA 1F2NA 2VUAA 1H2NA 2QZ3A 1O3TA 4META 4GWIA 3AKSA 2DFBA 3BALA 3K51A 3VZLA 1DBNA 2BJSA 1GICA 3OY8A 4IV1C 3ZMNA 4GXLA 1BYHA 1F4HA 1MEC3 1OVPA 2IXIA 2DUQA 3VBUC 4CCCA 3AZZA 1PVC3 5J48A 3E6BA 5FZFA 4D7TA 3E5XA 5CAZA 3MBWA 3W20A 4FP2A 5C9AA 1ENXA 3E6CC 1AL0G 3AP5A 3DL3A 3M3CA 1ND3B 1UWWA 4GMP0 1CAWB 1TE1B 2ZKLA 3N35A 4RD7A 4Q27A 5DAWA 2G19A 3KGZA 4R4XA 3HN3A 1MS0A 1UY2A 3W9AA 3KD4A 4LBQD 5BNPB 1ZZ7A 2JG8C 2VZVA 2TBVA 1HRV2 1PO13 3H8XA 1JS9A 1LRHA 1QEXA 1CPMA 3VLBB 4X8PA 5B2GB 2DF7A 5FQ0B 2VOWA 3WLUA 3NKTA 5G04L 4CDXB 4PBPA 5E16A 2CNAA 2V4AA 3M2MA 1R081 3UESA 1UZWA 1TME1 1UMHA 4ZPIA 2O8OA 2WNVA 2VBBA 4V2VA 2J1RA 3RWKX 4N9HA 1UO9A 2JENA 1QQP2 1O4YA 2B42B 1OC1A 2HYKA 4YW2A 3UNPA 2R30A 3THPA 4E2QA 2R062 3OBRA 1WW5A 2PLV2 4COZA 4B8EA 3UKNA 1E5RA 1XNTA 1V6KA 1VJ2A 2GN3A 1KFUL 2X29A 5FP8A 1I9RA 3AMNA 5GZEA 4NR1A 4AI2A 1LGNA 5FO7B 1BMV2 1Q5OA 1OA2A 1Q56A 3JBG1 4JDOA 5FYCA 2CWMA 2ENRA 3R6SA 2WO7A 1RUJ2 5L9VA 1OKOA 5FPAA 4YYOA 1XRUA 2I07B 2WYFA 3I59A 4XXPA 1SLCA 2LTNA 1AF9A 3DEMA 2ZX2A 3OG2A 3WG3A 1LB2A 1AR83 4IXLA 1B35A 3WG2A 1ZRRA 3WNMA 5KHGA 3EHKA 1RGSA 3AZXA 4AQTA 2XJUA 3NJYA 3QBQA 2YMZA 2FCTA 3VD4A 3ST7A 1K42A 1H8VA 1MZ5A 1SQ4A 1AL23 2XBO3 2WZPP 2JDKA 4Q4V3 3GXUA 4XJAA 4FSJA 4RSUA 5IVCA 2OXBA 3GZUC 1UOJA 3PVBB 1G8WA 1WMFA 4QDQA 1AYN1 2G4IA 3ELNA 4CDUC 4S2DA 3GM8A 3EO6A 4I0BA 3ABZA 4QM9A 4D6RA 1D4M1 1LR5A 2QJVA 2FZ2A 4AG4A 5LK7B 4COWA 3N7MA 4ITCA 4AOCA 3FMGA 1C8NA 5AFBA 3J26N 2A1XA 4N7IA 1ZNPA 3PDQA 1SFYA 3S30A 2R072 4WM7A 4DOUA 5FYBA 4AYUA 2LRPA 3GZTB 1WCQA 3URFA 1Z7S2 4QXHA 1GR3A 3ZYHA 4R9DA 3RDIA 4L99A 4I30A 1DGRN 4IEOA 4JGYB 5JMCA 1S0IA 4JKKA 3NNLA 1YLLA 2QQVA 4Y20A 2BRTA 1ULDA 2BNNA 2QZ2A 3KHBA 2PA7A 3JCIA 3JZVA 4CCEA 4QX8A 1UOGA 1W3XA 4KU8A 4C1WA 2VTXA 2WFPA 5JR2A 1O7FA 2J1UA 3NNFA 4Y1XA 1ND2A 4TN7A 5K4LA 5LEKA 1KEXA 3O0XA 1W0OA 2Q30A 1YQ8A 1S1AA 2E6VA 3GNEA 4FBFA 5KXEA 2W2IA 5F3CA 2D6KA 3LA2A 1AXYA 2VXRA 4AI8A 4GWNA 2IVIB 2YHJA 4IEYA 1I6XA 2HWC2 2UY8A 1MVEA 1YQ5A 4H3WA 3WCRA 5A3NA 4BH9A 2Z5WA 3B3QE 2JDMA 1POV1 1NZCA 1CVNA 2VZRA 1X9TA 2WJSA 4JC1A 4K1YA 4NWVA 4UT5A 5LA2A 3ZXAC 1JYTA 3LE0A 3JXSA 1PK6B 1W05A 2JG8B 1LESA 2ZHKA 1KGYA 3FFQA 5C5TA 3WHTA 2IXHA 4MLOA 1QJU2 5F6LB 4P9XA 3T2QA 5KC5A 1NA1C 1ULGA 3PUAA 1UY0A 5A7WA 1QH7A 3CHXA 4AGVA 3A21A 1ZVFA 1WA4A 2HWD2 3VBRA 3HD8B 5FMDA 4CDQB 1HB4A 2V72A 2VQAA 2VPVA 3I2DA 3N36A 5LRRA 1RUG1 5FOJB 5JIUA 4PI2A 4ZU7A 3VHOA 1XSRA 2D6OX 3E1F1 3LPFA 1QOOA 1ALYA 3I7DA 4LPLA 3FFZA 5D8AA 3V0AA 2ZGKA 4RA0A 4FOVA 4XJWA 1C8M1 1R1A1 1I5ZA 1IQAA 4GA9A 2FD8A 2P3KA 1GNHA 3D6EA 4PIYA 1CAUA 3OBZA 5HV4A 1IGOA 2E53A 1VBE1 3SCFA 1J83A 4XDQA 1F15A 5EJZB 3WNXA 4BK5A 2A75A 5BNNA 1NE6A 2VMGA 2WFF3 5A33A 4NN0A 2BFUS 5JPMB 3WW4A 2QDRA 1R083 2VJXA 3RRDA 1F31A 3O7OA 3L9JT 4XJ9A 3GF6A 2DYCA 5DG1A 1ND2C 3T2TA 1QJX2 1D0GA 1FMD2 4N9IA 1UZYA 1DQ1A 1GWMA 1PGL2 1RIRA 2D98A 5LBEA 2JDNA 2WWSA 3LKJA 4HVQA 1H2LA 4QXBA 3JBG3 1XPWA 4JV4A 5IFPA 3WOGA 2HBTA 2V5DA 4ZS2A 3GZEA 2J1TA 1W8HA 1W6QB 4BE3A 4DEQA 2E7TA 3VL9A 1VB2A 2GC2A 4A6OA 1WUVA 4HZFA 2GALA 2FDFA 5KXBA 3B00A 4TXWA 1YFWA 4CE8A 4NIGA 5FK8A 3HNYM 3PVEA 4EN8B 5JOYA 4MVTA 4YZ4A 4JGZA 1JBCA 4IV3A 3UKVA 3WDYA 3W59A 5E8AA 4Y22B 1GZTA 4EE2A 3IBMA 1UKRA 2EIBA 2VG9A 2XB6C 2ZX3A 5FZ9A 5GLUA 2ZKNA 3FLTA 1WCDJ 3BN6A 3DV8A 1RUH1 3TB0A 1XYOA 2CL2A 5C71A 4ONUA 2G9GA 2YV8A 3U07A 5F6KA 2F4LA 5LASA 1AYN3 1OVSA 1TEIA 1IG3A 4ZZ8A 3GBFA 1BEV1 3GDBA 4N53B 1IPSA 1UW8A 5APAA 3UGGA 2K0GA 1H1AA 1MQTA 2HWF2 1D4M3 1V6LA 1AR71 2VMCA 1ENRA 2IXLA 4IE5A 1UX7A 2Z2SB 2BGCA 4QQLA 3ZIXA 1JH5A 2WR9A 4EZ4A 3M3IA 1YCIA 4P02B 4RR3A 2GSYA 4GH4B 4IEVA 5C7GA 3VKMA 3LCPA 1HV1A 1OH4A 2BERA 1LKNA 2GMMA 2F6BA 1NQJA 2LROA 1W90A 4CDWA 4N8MA 3POWA 4GWJA 1EV11 4W6YA 3GJAA 2BP6A 5CYYA 4Q8LA 4URAA 3U10A 1MS5A 1SLLA 2EALA 4FPOB 1JHNA 1HXS2 2L9LA 4HK9A 4YZ1A 1U5IA 5EHDA 4C0BA 1V6NA 4QDRA 1UKGA 4YG6A 4HPKB 1DGLA 4JCKA 1JYXA 3RJRA 1O8SA 4AXOA 1SPPA 3K46A 2D44A 3PNAA 5FYYA 3MPPG 4YPJA 2VZ1A 5K8SA 3O1VA 4XYXA 1R092 4OI4A 1QHDA 2NYYA 4RQPA 2VZQA 1WLWA 5DAVA 3VKNA 1XE8A 4YW3A 3T09A 1Q8QA 3PVOA 3UKTA 2BZDA 1WMDA 2JKXA 4GMP1 1D2QA 3ZFEC 4ES8A 5EWSA 2A6XA 4DUVA 4IE0A 3WW3A 2VCBA 3VD3A 2K9ZA 1COV1 4QGLA 2YU2A 1POV3 2ZGPA 2E51A 1IHMA 4QHBA 5DDJ2 1CAVB 1VAVA 2ARXA 4AQ2A 4LT5A 2ILMA 3OPWA 3U78A 4BMBA 3C7OA 2A3WA 3MPBA 4XE9A 1WBLA 1VE0A 2WS92 2BWAA 2ZPXA 4Q26A 1VBB1 4BQWA 1AUYA 1FOD3 4IEZA 4DIQA 3BI3A 4CCDA 4NIDA 5T5LA 1JXNA 2ET7A 4EQVA 4NE9A 5C4WC 4S2HA 4GQ7A 3ZLIA 3ECQA 3VZNA 2CWSA 1NCRA 2LW8A 3A0NA 2MEV1 2DV9A 2RVAA 4OLLA 4EN9B 1RUG3 2DVDA 1E5SA 1REFA 1WMXA 2XMLA 3KV4A 2VTXJ 3ZN5A 4UFKA 4DXRA 1IS5A 2NMOA 2CAVA 4IEUA 4KBZA 4QPGA 1BLZA 3HQRA 2PELA 1U5ZA 2PHRA 1BBT2 3ZSJA 3W5NA 2HJIA 1C8M3 1R1A3 1W2NA 3LEGA 4NJ4A 5CZKA 3SCGA 1ASJ2 1OA4A 2ZA9A 3C7EA 4XFFA 4NHLA 3WQ7A 1VBE3 1HRV1 2XR4A 2KXLA 1GLHA 4LHSA 4KG0A 5E6HA 4JHZA 3AJZA 2ZCWA 3POYA 3E5QA 4DFSA 1YHFA 2C1FA 3CJIA 2NLRA 4YFWA 3V65A 4E2SA 2DTWA 3VBFA 3Q8BA 1GSLA 1S2EA 3PMSA 3IWZA 3ZO0B 3WDTA 3U37A 3LDKA 1VBA2 4O65A 1RMU2 4BB3A 4Q4Y2 5FZ3A 1ZRIA 2BUKA 1OQDA 2DWRA 3N4MA 2BTVC 3T1LA 1DG6A 3NRUA 3UT0A 1VLNA 1C5IA 3UJOA 5J1XA 4CXYA 1ZM1A 1F35A 1K5MA 2A5ZA 5JI9A 3WNNA 1AR62 2ES3A 5BNOA 1ULPA 3FBYA 1QIQA 1OF3A 3C7GA 2W08A 2V4VA 1PNFA 3THCA 5KHJA 3B9IA 4FOWA 1JZ2A 5L9BA 1JYVA 1GANA 3ZXDA 5FTTC 4WVWA 4AVSA 5JSRA 3NAPB 4MSVA 1RITA 1RHI3 1H0BA 3DXUA 1NCQC 2Q0AA 4ZY9A 4COYA 2OS2A 4HLTA 4ISQA 1IPKA 3KT4A 1UPSA 2XVKA 3PUHA 2DCTA 4NROA 2VY0A 4F8AA 1J3RA 1QXPA 3KM5A 4AVVA 2TUNA 2XG3A 1MR5A 4Q2FA 4XJUA 2X05A 1UN1A 2CV6A 4JRLA 1YFUA 4BQ3A 1A8DA 3L2YA 1FV3A 4XQ4A 1MS9A 1C1FA 3KQ4B 1BEV3 1QKQA 1YNAA 3D0JA 4P9YA 1DGWX 4YZ2A 3RZLA 1NZIA 3M1HA 3WDVA 5A3OA 5JCTA 3B01A 5JMOA 4OHWA 1AR73 4DRVA 4B4RA 3MV11 1S0JA 5CG9A 5DQ0A 3J7NA 4M3CB 3FL7A 5DN2A 4Z07A 2W39A 4RGGA 4YW1A 4CP0A 2J1SA 3C2UA 2GAUA 4D8MA 1NT0A 4XACA 1W6OA 1W8OA 5CKMA 4HT1T 3CBNA 1DQ4A 1C28A 1US2A 2O1QA 2XVGA 2R071 2RE9A 3HWJA 3LDRA 3H3UA 2XQXA 4MUVA 5FMOL 1EV13 4UWDA 3ZFEB 5CA6A 3WT3A 1Z7S1 3POJA 3K2OA 2IXJA 2EIEA 1HJFA 1A78A 2B39A 2VBPA 4LR4A 1UMZA 2G1MA 4XXAA 4MG2A 4GJYA 4E9KA 4PDWA 1OT5A 2Y6KA 4YM2A 5EJ3A 4A2UA 3BTZA 1MS4A 4QB1A 4BM8A 4I3GA 3KWVA 2ZAAA 1J58A 3MV01 5JDBA 1VB4A 1FX5A 1B09A 1VBD2 4K40A 4G4FA 4MXWA 3LFMA 5I8SA 1QNWA 4AI0A 1GFF2 5I0UA 5C4WB 1T6GC 5I91A 3OUIA 1XU2A 1JOBA 3E5UA 1J3QA 4AEMA 4GMP3 3LEIA 4H2AA 1OUXA 3U1XA 4OQ8A 4D7SA 4FO9A 4LMFA 5KWRA 2AYHA 4YLZA 4OHYA 1LHVA 1QMJA 1COV3 3AZVA 3WDWA 3WXPA 1PZ8A 1SLBA 3ES4A 2Q8DA 5A6ZA 2YXSA 2JD4A 3ILRA 4RS5B 3PUIA 3T1MA 2J42A 3ETQA 3OEBA 4ES9A 1S0DA 2QE3A 4KNCA 4F3JA 1VBB3 3CO2A 1GNZA 4N43A 1K45A 2RS13 3WX5A 5ABJB 5T55A 1UF2C 3IDCB 2VQTA 2XOMA 1SFNA 2EXJA 4MGTA 3DXTA 2NN8A 2ZGTA 4QWNA 2W52A 2HWD1 3WVJA 3IIIA 3ENRA 5CFCA 4Y4RA 2MEV3 3P1IA 1LAJA 1HLCA 5J37A 4GKXA 1LOAA 5FP4A 1EP0A 1ND3A 2DFCA 5SV5A 3WG4A 2VM9A 1CAWA 1JYIA 4AFAA 2GMPA 1BKZA 4CRQA 2RV9A 1N1VA 2A6ZA 3AMHA 4K7JA 4TYSA 1VR3A 5BNPA 4RGKA 5FYTA 2JECA 1HRV3 4KBBA 4FAGA 3POFA 2QTWB 4OHXA 5ISLA 2PHLA 5DUWA 4CDXA 4QT6A 3VDDC 4Q1RA 5IVFA 3N9QA 1GZCA 3HNBM 1UAIA 4I3PA 4GB32 4K21A 3FHIB 4CCJA 2VULA 4QMAA 5L19A 4W6WA 1YQ6A 2D5FA 1IQDC 1JUIA 4XIOA 3S5QA 4LULA 2AENA 5A1FA 5JZGC 4OYUA 3ZSKA 3KCXA 4XFHA 4WVVA 1EYBA 4BQ4A 1NXD1 1PGL1 4MGSA 3R05A 4FXKB 1OPOA 2E63A 3N3HA 4CEYB 4MYEA 4DY5A 2EA7A 1NX9A 2OVUA 4MX3A 5F39A 1AHSA 1GZWB 2GMEA 4OMCA 2VR4A 4EWAA 5F37A 1G9CA 5DZEA 4EN6B 2CDPA 4BWOA 1PNGA 3GCXA 4OUMA 2QUOA 2RM22 5C3OA 1W6PA 1CX1A 1EUTA 4OI1A 5FZCA 1FATA 1JOJA 4HVRA 4N43C 3UJQA 4XF0A 5LRSA 1J59A 1OOPC 1PVXA 2GN7A 3H8OA 2BBVA 1DYOA 2WDBA 2KM2A 4FPLA 3ILFA 1QJY2 5CFCC 3W21A 1YYNA 5JSOA 2ZHLA 4Q0UA 4Z8BA 2RS33 4CU9A 3ZSMA 2Y33A 2BNOA 2DCYA 2VZUA 1OI6A 3RS6A 3DPRC 5FJHA 3RWNA 4EJRA 5IK5A 3ZYIB 2NM1A 1ZZBA 2V5YA 4BQ1A 2VQUA 1YO8A 3AL6A 4WM8C 4X6QB 1AX2A 1US3A 3LD8A 4LHNA 5A7SA 5FO9B 1BHGA 4QM8A 1TVGA 2QQJA 1NKGA 2P3YA 4WBBA 1GOFA 1LODA 2HWE1 4GZ9A 4IUGA 1JU3A 3VN4A 1W8UA 2E26A 3NJVA 4YFZA 2ZX1A 3J7MA 5FZOA 4CCLA 1VRH2 3QLQA 5FYVA 5KXCA 1GQHA 3PIGA 1KRIA 3RG0A 5C6CA 2Y38A 2BGOA 1W9YA 3I3BA 1OLRA 2R073 2Q8OA 1CAXB 1PIV2 1UD1A 2JE7A 3O1TA 1PZ7A 3DCQA 1HQWA 1Z7S3 3I2IA 4K6BA 3ZYPA 5CKQA 2CSGA 1CZSA 2VECA 2D6MA 4JGYA 5KR7A 3QACA 1AJKA 4XHXA 1EAH2 3HBKA 1VMJA 3MIGA 1V9U2 5DPNA 4QQHA 4K9SA 1IS3A 1X9PA 5J36A 2P17A 2ZGQA 2RR11 1JZ6A 4BDVB 2VVDA 1R091 2Z4FA 5AVPA 4ZXKA 2WLQA 1XJAA 4BZ4A 2YFUA 1ODMA 1SHWB 1OBNA 3ZXFA 4AHXA 3Q8EA 3O1SA 1H30A 4AEDB 3PVNA 2TNFA 5IYYA 1GNYA 2J1AA 4IGOA 4FTBA 5DUUA 2D5HA 1Q8PA 1XYNA 4HK8A 3NMBA 3KHCA 1UU4A 5IK4A 1ZA4A 4HN1A 4I02A 3MIFA 4J6GA 1W04A 3WF0A 4IERA 3S0MA 1ZZ6A 4FVVA 5I0DA 2RS52 2ZGSA 5EJ1B 5AFEA 4E4DX 3BOPA 2Y64A 5C8CC 4YW7A 1W39A 2NPIA 2YC4A 1G7YA 2WNUC 1PK6A 3WY6A 1L7QA 2ZAHA 1YI7A 1O4ZA 3APBA 4JDMA 3MGUA 4AVBA 3AYEA 3KV5A 1VRBA 3AKPA 5L7OC 3BTXA 1W9TA 1OD5A 1Z78A 4HFSA 4Y26A 4YVSB 1CZTA 5HXVA 1RL3A 3VDDB 3KVAA 5LY1A 1JZ3A 2R042 1PGSA 5FREA 3JD71 2B45X 3ZN6B 1C5HA 3O1UA 4ZHNA 2VCCA 2FMYA 4RGAA 2FDHA 2VGDA 4PQ9A 1DQ5A 2ORZA 2C5DA 3T3YA 4CEWB 2OX0A 4BXFA 1PZ9A 5JZGB 1C1LA 1AYM1 2QNKA 3N9OA 3AC0A 4XMAA 2CTVA 3ZYRA 4DXTA 3TEZA 4MXVA 2YY1A 3INAA 2VD7A 1U12A 3JB8A 4LBQB 3T0DA 2YBKA 1SEFA 3JU9A 1ASJ1 1QJZA 3SH5A 3DYOA 1F8VA 3TN92 4XTPA 3VBSB 3BOWA 1H6YA 1XSQA 3I2FA 5ANNA 3QH7A 3ZFFC 2W1QA 4XFAA 4YVWB 2PYTA 3AXDA 1KS5A 1W03A 4XDPA 4B7EA 4UXAA 3VKFC 1JYCA 1PM7A 2JE9A 1JYWA 3M3OA 3OD4A 1VBA1 1RINA 1RMU1 4Q4Y1 3EXUA 3PU8A 2EAKA 1OXCA 3CNAA 4UW6A 1H2KA 4XC9A 2BQPA 4HL0A 3IZOA 5FPLA 1V70A 1ZBA2 3MIDA 2Q4SA 1WCKA 1AR61 4R52A 3WV6A 4CPBD 1XU1A 3T0BA 5CFDC 5I0TA 4M0HA 4NVPA 4UI9L 5EV7A 4MGKE 4AI3A 1HN1A 5FY1A 4A3XA 5IFTA 5K0UC 3RZJA 4P9WA 4DXZA 4FPEA 1W6QA 4BIFA 1NG0A 3IDBB 5FZLA 2BNMA 5LBFA 2WNEA 5CG8A 3BPSA 3ROUA 1XXNA 4XQDA 2ZXQA 4IEPA 3AYAA 1RUI2 4DXSA 2YBPA 3ZX7A 1FI2A 2ZGNA 1W99A 4Y22A 4UF0B 4URTA 2A3XA 4FCAA 1H9WA 1O8PA 3FC0A 4RHV3 4XILA 3HN1A 3ZMOA 3HEIA 3PHMA 3PTYA 4LQRA 5ERLA 3IN9A 4OCTA 2WAOA 3LGRA 5IK7A 1APNA 1F4AA 1ULOA 4HVOA 2WKKA 4N53A 4Q4W2 4KI5M 3K48A 4HOOA 5C9AC 1SACA 2VO5A 2HWE3 2ZMLA 4YM3A 2ZJCA 4MGZE 1TQ5A 5FZIA 4A44A 1SBFA 3MIHA 5FP7A 3EMRA 3LA3A 1UY1A 2Y0OA 4GH4A 5DUVA 4EROA 4BQ5A 3M70A 1FXZA 1QXJA 3HVDA 1QF3A 2JIJA 4R9CA 4P9LA 4DUXA 2VAUA 2BVVA 5F1RA 2ZEXA 4YGEA 1WZXA 4BOWA 2Q5TA 4XFBA 1BCXA 5G05L 1KS4A 2GU9A 4MGIE 1CX4A 3MW3A 5A3WA 3H9AA 5KHIA 1GOGA 2WNVC 2XJTA 4Y24A 4F83A 4LXLA 4ASKA 5FPZA 4QXCA 1DCSA 1O3RA 5GZCA 2FDJA 4HPKA 2C24A 2VZ3A 3F95A 5C8CB 3RZMA 5EXOA 4BYYA 2Y26A 1JMUB 1RUC2 2WNUB 4MV2A 2RR13 4QQPA 2X5IA 5JAXA 2VVEA 3WZ1A 2SLIA 2WRAA 1R093 5FY5A 4CU8A 5AC92 1BVVA 5L7OB 2JB8A 1VBD1 1H8TB 1G9BA 2RMU2 4LUMA 3WCSA 3WINE 1XQNA 2AZ5A 4OHZA 3QH6A 3T2OA 1QOTA 3K4AA 3Q8CA 4HBNA 3MI8A 5A1AA 4DRRA 2KR2A 4H14A 4IV1B 4JKMA 3AP7A 4QKFA 4H7LA 3OPZA 1HW5A 4LA3A 1B35C 3VBUB 1BQPA 1LOBA 1QNYA 5IVYA 3I3MA 1HB2A 2PXJA 3SKJE 2DUOA 2J22A 5BPXA 5EYYA 4KL1A 4RYDA 4B4QA 3N7JA 3RI8A 3LIHA 1ZYBA 3HMYA 3LF7A 2XKPA 4IQPA 1UMIA 3K3OA 3N9PA 3ZFFB 2H0BA 4A7YA 5DZFA 1Y9GA 2RJLA 1VMFA 3JD73 4YM0A 4QDSA 1PHMA 2QBXA 2VC9A 1GP4A 3LDBA 4W4ZA 5DZGA 1X8MA 2JDZA 3SITA 5IHRA 1DYKA 2VZOA 3AM2A 1QWRA 4O7XA 1AYM3 4EV0A 5B4NA 3ZSLA 5A32B 1RUD2 3KV9A 5FLHA 1X36A 4XIKA 4AF9A 4YW6A 1BJQA 2ZBJA 3FUOA 5LW9A 2SBAA 1UIKA 3ZDSA 1ASJ3 3ASIA 4P00B 3U4SA 5J7MA 3O1MA 5HPOA 3I2HA 4WM7C 5CKNA 1QJEA 3VDCA 5K0UB 1ZZ9A 2XJPA 2FBEA 1D0HA 1TG7A 2D6PA 4J1XA 4HKOA 2X5IC 1AZDA 2QQUA 5L73A 2XHKA 4Y5SA 5HCHA 3BU7A 4QPIA 2WYSA 3KLSA 4Z92B 1QXRA 1SFPA 1WBFA 1VBA3 5FZBA 1OLMA 4Q4Y3 3RPQA 4EZHA 1ULCA 2XUMA 5CU1A 1TME3 2VMFA 2DCZA 1O59A 3IPVA 1W0PA 3UV9A 1K3IA 1OLQA 3G7DA 5FZHA 1OQ1A 1AR63 3OY8B 4JKLA 4QPWA 5FZAA 1MEC2 4AEKA 3LEKA 3TEXA 4GAZA 1PVC2 5FZGA 5FIXA 3VHRA 4F7ZA 4XF9A 4Y1ZA 2VUDA 5CNAA 3S5AA 4XOGA 3SHRA 1RUE1 2RM21 3ZPYA 1LNSA 4XUNA 4CP1A 5C9AB 4D3WA 4DB5A 2ADEA 1VP6A 3JUUA 2DBNA 3NAPA 1MS1A 3FWEA 1BXHA 1VPHA 2NZ9A 4OZXA 4LO5B 2XVLA 1VIWB 4QKNA 4CDUB 1QJY1 1UZ0A 3THDA 1H1IA 3FBMA 3MF6A 1PO12 1PX3A 5LB6A 4DUWA 3U4XA 4I2OA 1HB1A 5C3SA 2WNOA 1N3PA 2VUJA 3HQUA 2WQZC 4UAPA 4WVZA 1HRI2 2UURA 4E4HA 1W8NA 3VBRC 1RUNA 1H4GA 2WNVB 2GC1A 1W6NA 2C0ZA 1AXZA 2ATFA 4GALA 3GHMA 4CP9A 5B4XA 1CPNA 5I8TA 4FPJA 4M3CA 3NL1A 4TLGA 5D8AC 4BQ2A 3DECA 4PLOA 3AKQA 2ZZJA 3K75B 2D93A 2QQNA 2ZEYA 5IVEA 2XL7A 2DDUA 4MOAA 1WW7A 1ZZ8A 4OHVA 1H2MA 3CDZB 4BISA 1PIV1 1TNFA 2MPFA 3K77A 4O61A 2DTYA 4ZU5A 5FMBA 2AEYA 3LFIA 4XUQA 1X50A 3WP5A 5BNNC 4JQRA 4LORA 5D1IA 2R16A 1NY72 3BODA 2BDRA 2X09A 4WVMB 4CTEA 1QDCA 1XE7A 4Y1YA 3A22A 5KC6A 2IWGB 2FMDA 4QQOA 1XNAA 5HBAA 1LHUA 2IFWA 3H3ZA 4QX7A 3ACIA 4QB2A 1V9U1 2CY6A 1ENSA 3BPZA 1YQ2A 3HT2A 1AL22 5A7PA 2VE1A 2XBO2 4CCKA 4D7YA 4P9IA 4E2GA 1XC6A 2PTMA 1STMA 1VBD3 4RFT0 4K8RB 1Q8OA 3DYMA 4Q4X1 2IUWA 3VDBA 4HONA 1EUUA 3TNPB 4J1WA 1NA1B 2GH2A 3POSA 1MZFA 1AR92 2K46A 2RS51 1NQDA 4JGZC 4IV3C 3RZHA 2ZGLA 2IFRA 2NMNA 2A71A 1YJKA 2VCAA 2OZ6A 3FJSA 2DCJA 4ZXEA 2WA4A 1KJRA 5ABJA 2VMHA 2PAEA 2DCKA 2I74A 5BV6A 1LHWA 1Q8VA 3A4UA 4LHLA 1ZRCA 4P9JA 1MQTC 2F17A 4HETA 2JKBA 3MZHA 2FDKA 4AVTA 3VBOA 2GH8A 1ZBE2 5FJKA 4RR3C 1ST8A 3SQOA 3AP4A 1W3VA 3N7KA 1WGPA 5CEHA 4KWKA 1ND2B 1UU5A 2PAMA 3BGAA 1T2XA 3AKRA 3OF1A 4CDWC 3P5BA 3S57A 2P1BA 5FDBA 5JXJA 3OBAA 3TEWA 1W9SA 3IMNA 3ON7A 2Z69A 3D5OA 4IGQA 3OYWA 4LBOA 1SDDB 2A6VA 2B8MA 3H1WA 3OUHA 4FI9A 3MLJA 5A3MA 2ZABA 3ZR5A 2ZACA 4AGRA 1VALA 3KB5A 3VBHA 5LK5A 3O14A 2YC0A 3U11A 3IMMA 2B9VA 2LUWA 5IWFA 2ORXA 4Y5Z0 4FPHA 5EFUA 1O4TA 1CZVA 4C8DA 1WWYA 3ZXGA 5CADA 1QDOA 4Q0VA 2DVAA 1XB9A 2RDQA 4RQPC 3WW1A 1QQP1 3IIAA 3WDXA 1KDKA 4B1MA 5A7WB 2PHXA 4YARA 3U0ZA 3I3EA 1S55A 4XW3A 2R061 3KF3A 1SBEA 1OFSA 2PLV1 3M4FA 3J8F2 1G9FA 5FO8B 1RUE3 1LOEA 3B02A 2RM23 1V6IA 1X82A 4LBJA 3PTRB 5FYMA 4WZCA 3ZKYA 3W5MA 1BMV1 3ZDVA 3RSJA 3V0AB 3GALA 4LUKA 3VDAA 3PUQA 5F3EA 4NUBA 1S2BA 3NO8A 4X6RB 3ZR6A 1QJY3 1RUJ1 4CZSA 2EF6A 2YC2A 1W2UA 4XAEA 3KSCA 3AXEA 2RHPA 2WFF2 5GM0A 4DPNA 1M06G 4PBOA 5LY2A 4CXXA 4UFHA 5HCAA 2H0VA 3KMHA 3LAGA 5CIRA 1NCRC 2FDIA 4AVAA 2OQ6A 2WT2A 3NV1A 3VHNA 1RUH3 5T3NA 2XUEA 1KXGA 3VZMA 1LEDA 1NUKA 1JUHA 3S7IA 4QPGC 5C3PA 4UYBA 5JUVA 1N3QA 1PMHX 3QOPA 4DEVA 5FY9A 2XLGA 4D6QA 1U5XA 3VUOA 5LCWL 4QXKA 4KU7A 5FV3A 4Z2WA 4AHZA 1Y4WA 5IUQA 4JZRA 3JBG2 5EQUA 2G9FA 1CAXA 1FT9A 4NHXA 3TWIA 4AFBA 4XETA 1FNYA 1LOFA 1OA3A 2Y6JA 2ZGMA 1A6CA 3CMGA 3CJIC 5FZ6A 3D4KA 5I93A 2QCSB 4XFIA 3VBFC 1T6BX 1J1LA 3ZYGA 1IG0A 4M3CF 2Q1ZB 3TOJA 1E5IA 3ZFGA 1WCSA 3WNLA 1W2TA 4JGZB 3MIEA 1YFXA 4B4PA 4IV3B 3AMPA 1X7NA 3THTA 1V6OA 1V9U3 3WP3A 1VBC2 1RUC1 2ZHMA 5FPBA 5DAPA 4K20A 2YB7A 5FUIA 4A4AA 1K5MC 4IESA 2W68A 5AC91 3I2KA 3SNMA 5BNOC 3UGFA 5IK8A 1TZOA 3OGSA 4AEDA 4AW7A 5JOZA 4XZPA 2XPJA 4MHRA 1UYYA 1U0AA 2JG9A 2YFZA 3CJXA 3FUQA 2VMIA 4KG8A 4OUEA 2CAUA 4Q4X3 5FY4A 3F2ZA 3RVHA 3GGLA 1D4M2 2Y34A 3H3LA 4LBLA 5E1RA 3ACGA 4Q5OA 2Y0IA 2JICA 3AMQA 3GBGA 2RS53 1J3PA 2W91A 4ATFA 4D69A 5FZDA 3MUY1 4KGGA 3R0RA 2WT1A 2P34A 4JRAA 2E7QA 2WL1A 3POIA 2XJRA 5FZ4A 3ZIWA 1DZRA 4DY3A 4CDWB 2HWC1 3AVRA 4FFGA 2PAKA 4X8NA 2AC1A 2W47A 3A7QA 4YVSA 4ASLA 3MEPA 1H4HA 2AUYA 3OUJA 1XOYA 3PLQA 4HXCA 2P37A 1HQLA 1A3KA 4NPMA 1N1SA 4YG0A 5LA0A 3FZ3A 1XYPA 3VKLA 4Q0SA 1K12A 5T5OA 2BOJA 4CEWA 1UL9A 4GIQA 3VB9A 1LHNA 1QJU1 1SPPB 4AHWA 1LOFC 5C5UA 5FYIA 1RUD1 3LPGA 2DVBA 4OVEA 4LBQA 3X29B 2B46X 4A7KA 2R1DA 1WKYA 1NLRA 1ZRFA 4I0WB 3NQHA 3ZXLA 3ZFGC 4SLIA 4N7UA 2FCUA 3VBSA 2BVBA 3ZN4A 1LECA 4A6SA 1PMIA 2CGPA 1EY2A 3O1RA 3CKHA 4LK7A 4CVUA 3V64A 4YVWA 3PJQA 4FQZA 4ATEA 3SXWA 2CDOA 3TEYA 3AYDA 3D3AA 5A80A 1RUOA 3GHNA 2WSUA 3LB9A 4COUA 4FAHA 2Y6LA 5DG2A 4PDWC 2ZHNA 1JZ7A 5FQ0A 1DZTA 3ETPA 2F4PA 2BBAA 2WO3A 4XZUG 5FK7A 4CXWA 4YNIA 2ZOEB 1LEMA 5C3RA 3B93A 3GJBA 1FOD2 3QCWA 3A23A 4AHYA 1QQP3 4AAPA 1NCQB 1GMMA 3OGGA 3MF9A 5IATA 3MW2A 4UFLA 2HEYF 4XUOA 3VD5A 1MEC1 1FMD1 1QJX1 2UU8A 3ES1A 3MDPA 2RDNA 3UETA 2R063 5SV8A 1PVC1 3SC7X 2PLV3 3UL2A 1NCRB 3H0OA 3KV6A 5FYHA 2YGMA 5H9PA 1BK0A 1RUG2 3P3NA 4BJ0A 5IT6A 4JHTA 2QQLA 1REDA 3LSEA 1NE4A 1SG3A 3OTFA 1ZRDA 4QPGB 2UYAA 4QKBA 1C8M2 1R1A2 2WZR2 2GDFA 3RNSA 4XURA 2B4KA 4GKYA 1RUJ3 4UBHA 1CQ9A 1YC61 1POV0 4NPLA 1OHFA 1E57A 4UF0A 4A41A 3WF1A 2O14A 5GJ6A 4QD2A 5FMOS 4AR2A 3CJIB 1J1TA 3TRSB 2XONA 3VD9A 1HRI1 4YGCA 1VMHA 2AH2A 4LTAA 3S7EA 2ZX0A 4BCUA 4CUAA 1LOCA 2FCVA 1W0NA 5FYZA 4CSWA 3WNPA 2JD9A 4NHMA 1ND3C 1PO22 2VUCA 2H6CA 4YSFA 2ZEZA 1A8MA 2XDVA 3N9NA 4AQ6A 3C3VA 1OH3A 5M0TA 3AKTA 3ZYJB 1K5MB 2VOKA 5JOWA 2A73B 5FZKA 5FYUA 5BNPC 1V6MA 2HWB2 3NJXA 5LZ6A 2HWF1 5EYXA 5FWEA 3VHPA 1GU3A 4CDXC 4GJZA 1O91A 4QU1A 3HPNA 2DU0A 1EPWA 1OLME 5F8PA 1NY71 1QU0A 1QH6A 4XAAA 1H9PA 2R32A 3H1YA 4YZ5A 3OEAA 5FUNA 1RHI2 3OGJA 3ZXKA 2X8KA 3VZKA 2D6NA 2BW8A 2OZJA 2PHDA 5DABA 1HIXA 2VL4A 1GYKA 4UFIA 5HI0A 1QGLA 1D4VB 1AL21 1HXS1 5AC93 4O9EA 5DAXA 2D3PA 3LEMA 4I01A 2WC2A 5F3IA 5ACA2 3DYPA 4NPRA 4UOJA 2PFWA 4AE2A 2OPKA 4GWMA 4LITA 3WDUA 2JB4A 4FPKA 1KDMA 2JDHA 2PHWA 2VQ0A 4KWLA 5A3UA 1FPN2 5FRAA 4AEJA 5LEJA 2ZMNA 5FZMA 4IV1A 2AR6A 1WW6A 3HT1A 3USUB 3KT1A 3UYJA 1S4CA 3WQ1A 1Y3TA 1AR91 2VH9A 3VBUA 1UXZA 3SCHA 4B3NA 1WLTA 1LJ7A 1RJ8A 1W6OB 3MW4A 1RVF2 5IAXA 3B9CA 1C3HA 1I5PA 3AFKA 4OULA 4Q1PA 1GKBA 4HG6B 3HAGA 4M4RA 1CESA 1Y9QA 2HWC3 3NJZA 4XQWA 1MZEA 2D43A 4AK3A 3WF4A 5DDJ1 2I45A 5F2WA 3TAYA 3ZVXA 2C9KA 1ULFA 3WEZA 4YRDA 2JG8A 2JJ6A 4M3CE 1UU6A 1TNRA 2VZTA 2E32A 3J9SA 3KGLA 1OUSA 1TMF2 3DKQA 2WABA 3KZ4C 2WS91 4I0AA 4KWJA 5FY7A 1CIWA 5F5IA 4XF3A 4ARXA 4PDWB 1QJU3 5D2AA 5FFOC 2JWPA 4INDA 1AXKA 1URXA 1XNCA 5FKCA 5KHHA 1CONA 4K1ZA 4RN5A 2HWD3 2WBKA 1Q3EA 1ZBE1 3WSOA 4CDQA 4E8CA 5A7NA 4BMEA 2VNOA 1AX1A 4GD4A 3FX3A 4XBQA 1YIFA 2D7FA 2DVFA 1GWKA 3VD7A 4BXSV 1UOFA 4Y3OA 4PLNA 3O1PA 1BBT1 3USSA 3PIJA 1SBDA 2AREA 5DAQA 3I49A 1KFXL 3V0BB 2JX9A 1COV2 2ERFA 4JGYC 1UYXA 3KCYA 3V56A 3NNJA 1JU4A 1N1YA 1E5HA 4WZFA 5A3LA 1ODNA 2P4EA 3SKVA 3BYWA 4YG3A 4AFCA 4ASMB 4YGDA 3SISA 1VBB2 2XWBB 2RS12 4N43B 1NLSA 1OOPB 3FLRA 4LKEA 4FXGB 4XFCA 1QJX3 1FMD3 1M4WA 4XJZA 5BNQA 1QJFA 5EPAA 3HOBA 5CFCB 3NV4A 4P5YA 3H50A 2A6WA 2MEV2 4PCRA 4D0QA 3WW2A 1GZ9A 3J8F1 2QQIA 4HANA 4ET7A 3DPRB 1UNBA 3BIWE 1GWLA 1JZ5A 2GNTA 4NIHA 3AX4A 5C8WA 4WM8B 4FPCA 3WG1A 4E4SA 1UPIA 1W9FA 5FBJA 3ME2A 2PHTA 4OMDA 4HKWA 4XFGA 4LE3A 2BWCA 4NAMA 3K4DA 5AVAA 3SLIA 1PK6C 5CVRA 4CDUA 2V09A 4LLFA 4AFDA 2E33A 1V00A 4LJHA 5JSPA 3NKGA 5T50A 5K7PA 5BUVA 3VZJA 3R4SA 4L2NA 4UFMA 2GP5A 4A7ZA 4PIZA 2WFF1 2J1EA 4FT8A 2ADDA 1HRI3 4XDOA 3HJRA 2W46A 2VOXA 3Q8FA 3H8RA 3OD0A 2C9AA 4LO4B 4CDQC 1W8FA 1MVQA 4FFIA 5JXIA 1VAMA 4FFHA 1YQCA 5LBCA 2HH9A 5I8YA 1RC6A 3RMXA 3K3NA 5C33A 4Z1VA 2GP3A 3I4IA 4FOYA 4FFFA 4L11A 5CB7A 1YEWA 1GQPA 2B5HA 1IS4A 4NOTA 4YWAA 2HWF3 4ZS3A 5HCBA 3KVBA 4LLOA 4BQYA 2Y6FA 1HB3A 4JDNA 3WUCA 5A3PA 4WVMA 5FMCA 1W6PB 1AVBA 3Q8AA 5A6YA 1YUDA 1OFNA 3BIEA 3WQ0A 3AJYA 3MLLA 3KQRA 1I1EA 4OZOA 3CIHA 1KQRA 3B5LB 5J96B 5GLWA 1DFQA 1LU1A 1WA6X 1PGW2 2BFUL 2JDAA 5F5AA 3OCPA 2RS32 2YBSA 5BXXA 1VBC1 1RUF2 4OUSA 2VNGA 3AYCA 1HXS3 3R4DB 1KJLA 1RXFA 1W6MB 4EWEA 5F7UA 1SCRA 5DMYA 1X8EA 4U36A 4BLIA 2D6LX 4M0NA 1XE0A 4XBNA 3WD5A 4LIVA 1SCSA 1OF4A 2MHFA 2VNRA 3PUSA 4QX0A 4YZ3A 5GKAC 2HEVF 2VTFA 3NNMA 1S2KA 1GP5A 1JZ4A 5FZ8A 1NA1A 3T30A 5FXZA 4UW4A 5FPXA 5FLIA 1AR93 2B9UA 2P6CA 2XXZA 4IEWA 3LQCA 5FZOB 3WNOA 4FPGA 3WHUA 4A45A 2XQRA 3EJKA 1DIWA 2W92A 2W5FA 4BIOA 2D40A 4IE7A 3IKWA 3AB0A 2E31A 5DDJ3 4BPZA 1CAVA 3CZUA 4L0PA 4ARYA 2IVJA 1OSGA 1F5JA 4CUGA 5J09A 1UQXA 1BK1A 3VZOA 3GZAA 4N53C 5JIAA 4RL7A 4AQSA 2CGOA 2ARAA 2WS93 3ZXEA 3DUIA 3RZGA 2ZX4A 4XUPA 3IT8A 3MFCA 3CQOA 4LK6A 2AACA 2VBDA 3ITQA 3VGIA 4CP2A 2XLFA 3I97A 3ACLA 3D0SA 3RJ2X 5FPUA 1ZBE3 4XEZA 4GH4C 3H7JA 3O5SA 4Y1UA 1H6XA 2W1SA 1BZWA 5DXDA 5FAXA 1UY3A 4KH9A 2YUEA 2AGSA 2VZPA 3ZYBA 2P2KA 5D21A 3JQXA 1BBT3 4Q0QA 1XNDA 3H1MA 3RFRA 1UYPA 2YG0A 2OPWA 2ETEA 2W9XA 3AK0A 2PMWB 3LSDA 2ZEWA 3GCWA 4I09A 5CFDB 2TEPA 5LA9A 2Q8EA 4NIIA 4Y5TA 5F5QA 5HCFA 4EYUA 5FOBB 3HIFA 2R7EB 4ZKTB 1YJLA 2WN3A 2Y8KA 2JDPA 3KS7A 5GZDA 5IVBA 4GB31 4H7MA 3IAPA 2EIGA 5F9TA 1G9AA 4Z82A 1FOD1 1ONAA 2EXHA 3POBA 1RMU3 2X53S 2OYZA 1S0CA 2W87A 3WNKA 5C70A 2JIGA 4XCAA 1OURA 4Q0PA 1OPMA 3I3QA 2QQOA 2C26A 3J8F3 3EYPA 5A7OA 3O1OA 4IE4A 5FLJA 4PLMA 3SMHA 5F3GA 2D97A 1POQA 2D3SA 1LENA 2WZR1 2R0HA 2A6YA 5HV0A 2VMDA 4WV8A 5DUXA 3IDEA 1IOAA 4E8DA 3D8CA 2OUHA 1VAKA 1P8JA 1NAEA 4IDZA 5JVVA 1WMEA 2CGNA 1HX6A 1CWPA 1KITA 3N9LA 2A70A 2W94A 1JW6A 2JXAA 5I0SA 1MACA 4NMIA 1O3QA 1YXWA 1L7RA 3LOBA 1PO21 2A7AA 2DVGA 4P9GA 4K8FA 3KCCA 3SEPA 3WQBA 1OMIA 3OGRA 2UWCA 3OPTA 4QX3A 1ACCA 4N90A 5L36A 2BYVE 2V73A 3KF5A 4JQTA 1GV9A 3IM0A 1N47A 5FR3A 3AZWA 2R49A 2HWB1 1UZZA 5GALA 4HN0A 4ZONA 4R9BA 4OFGA 4EN7B 4TZDA 2YPDA 2GNMA 1DGWA 4CA9A 2Q1FA 3G6JB 4FTSA 4NRMA 1YFYA 1VRH1 2FQPA 5A1LA 5TSWA 3RI9A 4TSVA 5FZ0A 4QPIC 1RHI1 4S2GA 2K2SA 4TLFA 4LKFA 2EXIA 5A70A 4UFJA 3ZFEA 1YWKA 2QQKA 4L97A 5FBZA 4MHUA 2UYBA 1VBC3 1YIPA 3CF6E 3I59B 2N7GA 2DBIA 3OBTA 1JHJA 4RHV2 3PURA 1LU2A 3MUZ1 2VCMA 1AR82 2W0XA 1O3SA 2EVXA 3ZM8A 1B35B 4AL9A 2JEMA 2ZGUA 3BKZA 1EAH1 2EIDA 5ACA1 4YM1A 3BTYA 2PHFA 1K5JA 3AL5A 3WUDA 1CN1A 1XNBA 1N1TA 1ULEA 2A3YA 1V0AA 2FZ1A 2KD7A 4CU7A 4Q4V2 2QQPA 2HWE2 3MO4A 5HXMA 4BU2A 1CGPA 1FPN1 1XNKA 2WQ8A 4AWDA 3NAPC 3PL0A 3VL8A 5C4WA 3ZPOA 5J3UA 2DUPA 4LEJA 2RDRA 4FPYA 4DNYA 3T4VA 1IZ3A 4PF1A 5JXGA 1RVF1 4LKDA 1HQNA 5FPVA 2DURA 4L92A 2XHNA 4B7KA 4QAWA 2C4XA 4BK4A 1W06A 1S0FA 3J7LA 4MO3M 3WF3A 2YU1A 1G9DA 3SEEA 2W1UA 1HN0A 4RS5A 3E97A 1UXXX 1CD3G 2UWBA 2WINB 3NV2A 5H9RA 1WCUA 2BEOA 2GNDA 3T4HB 4WM7B 5KBFA 1CIYA 1TMF1 1Y9MA 2YZ4A 1D7PM 2XLAA 2EAAA 4NRPA 2XJQA 2RR12 4MGQA 1DP0A 3QD6A 2X5IB 2R041 3D82A 4PQQA 3GBWA 1W2AX 1L7LA 3JB4C 3FHAA 2AEZA 1DZQA 1G6NA 2XH6A 3WP4A 3ZSEA 4A42A 4Y20B 3AMMA 3PJYA 1DF0A 2VU9A 3NVCA 3M7AA 1UCXA 5FY8A 2BGPA 2I2SA 4XJ8A 1NOVA 5GLVA 2RJKA 4MH0E 4ZU4A 5CISA 3ACFA 1X33A 2WA3A 1ENQA 1JODA 2JDUA 4XMIA 3MYXA 5JLVA 1LTEA 1JZ8A 1S0BA 2JDYA 3H7YA 4HKLA 3TN91 1IKQA 3K4ZA 1HKDA 5FXVA 3DKWA 3TNQA 3NSTA 3RYPA 4Y4YA 2IZWA 5EIYB 4BA6A 4M4PA 4GB33 5GLZA 4Z2AA 4C90A 2P3IA 2RS11 2QKDA 2XJVA 1G86A 1NCQA 3B94A 3L2HA 4YW5A 5GLTA 5FXXA 4LNVA 3JD72 5F5CA 4IL7A 1WLDA 3M3QA 4P14A 4V2WA 4NWWA 2CU5A 4XVHA 3SH4A 5BY5A 2PQQA 4LO7A 3DN7A 3B69A 4D94A 4CEYA 2FHRA 5IVVA 1KD7A 2Z79A 2C6SA 1AYM2 1ZBA1 4CUCA 2B7YA 5FP3A 2R0FA 3N7LA 5IJRA 1GZWA 3O12A 3O0VA 4EWDA 3NNGA 3WP6A 4LIUA 3MHZA 1L3JA 3VBRB 2BOIA 4RFRB 2WZR3 5A3TA 2WQ4A 3C7HA 4RS5C 1N3OA 4COVA 4YW4A 2G9ZA 2WSVA 2W1WA 5JWPA 3O0WA 3I2GA 4CCNA 5ABJC 4PIXA 1Q43A 4LO6B 5D8AB 2EICA 1O6UA 2QDNA 1RUI1 3M3EA 4LBNA 2GNBA 1OD3A 5FCCA 4EN0A 5F32A 5FKBA 1CAUB 4IEQA 4LKSA 4IEXA 5JXHA 3UK9A 3NW4A 4QPIB 1YRZA 2VVFA 1SZBA 3FHQA 3OGVA 5A7QA 5BNNB 1DU3D 2HKXA 1SLAA 1W2OA 3E6DA 4W6XA 3RYKA 3T0AA 3FN9A 5A33B 1PO23 3JQWA 4JVAA 1A34A 3LOIA 1R082 4Q8KA 2NQYA 1TME2 3VBOC 2QQMA 5C3QA 3J7HA 3IPVB 1AX0A 4ISRA 5H9QA 5IW0A 4Q29A 1UYZA 4Q4W1 1V6JA 1RJ7A 2WLPA 3RQ0A 2HWB3 2ZGOA 5FYSA 2YDEA 5JR7B 1PM4A 4QX1A 3AP9A 4BLJA 4IE6A 5LA1A 1RTVA 1VRH3 1WD4A 3IB3A 1ZREA 3VBHC 5BYNA 1PIV3 4O9GA 1UOBA 2P3JA 4QHZA 3POGA 3HR9A 5E88A 4QQ2A 4FPFA 1PGW1 4E4ZA 2RS31 4JAAA 4XCBA 1W8TA 1RUF1 2EXKA 1OQEA 3EB7A 4L8QA 4KQ7A 2QQWA 3OSDA 4CEYC 1LGBA 4XTMA 1H1MA 3EQEA 1EAH3 5ACA3 3SH3A 1HJGA 4LBKA 1HV0A 4UW5A 3PMEA 1UY4A 3R4UA 4MGYE 4NHKA 1W6NB 1DDLA 2GC3A 3ILNA 1LHOA 3CU7A 1IPJA 3BVCA 1UIJA 1FPN3 4CP9B 4DZGA 5A6XA 3USUA 3MLKA 1U5YA 3AZYA 4KGQA 1DQ0A 2P5BA 4LA2A 1AYN2 5T5PA 4TWTA 3FLPA 5FUPA 2RMU1 4P08A 4IW3A 1SLIA 1CR7A 1RVF3 4XUTA 1MQTB 1UZVA 3B7MA 4XBLA 5FWJA 2PHUA 2W3JA 3BCWA 2CYFA 1GBGA 1JOPA 2ZMKA 3T08A 1ZX5A 4DMIA 3I54A 5JPNB 1O5LA 4CCMA 5EZWA 1MPXA 4FQ4A 4RR3B 4UW3A 4K3UA 5FZ7A 5GZFA 4CYDA 3PU3A 5H9SA 3BU0A 3ATGA 4PHZA 3RZZA 1JI6A 4NIAA 2QFEA 4BQXA 1SLTA 1TMF3 3ORJA 2NP0A 1DLLA 2LALA 1CJDA 4UBGA 5F2SA 2WO1A 2VW1A 4Y33A 3VDDA 3TYJA 3VV1A 2OT7A 2OKXA 2ARBA 2R043 4LOTA 4QB6A 3ZN6A 2J1VA 2WZEA 3DF0A 4Y1VA 3OJBA 3CLPA 3LWCA 5J98B 3LA7A 3AVSA 4ORFA 5JZGA 4BHPA 4JTOA 4AGGA 2Y6GA 3OOXA 4R9AA 4H55A 1I3HA 4QKDA 4AZZA 4C91A 3WR0A 4IGPA 4RQPB 3V0BA 4XF1A 5K9YA 3GYDA 4KWUA 4PF5A 2ZZQA 5L9RA 3TN93 1W9WA 2DU1A 4HMZA 4QGNA 2OUJA 3NWKA
chains in the Genus database with same CATH topology
5FZOB 5A1LA 4GJYA 4D6SA 3LD8A 4Y3OA 5FZ0A 5FPLA 5FV3A 5A7SA 2WWJA 4DIQA 3NJYA 3KV9A 5F32A 4HONA 5LW9A 5FY1A 3ZLIA 5FZ6A 4UF0A 5A7QA 3U4SA 5FZLA 4CUGA 5IVCA 3PURA 2XMLA 5FZOA 4CCLA 3KV4A 5FYVA 5LWBA 4QXBA 2YBPA 3AL5A 5IW0A 4D6RA 4CSWA 5FYZA 5FPUA 5FPBA 4UF0B 4BU2A 2WWUA 5FYSA 5FZBA 5FXWA 5FZEA 2Q8DA 4EZHA 5IVJA 2XDVA 3N9NA 5E6HA 3ZPOA 3PDQA 5KR7A 5FY9A 4D6QA 5FZKA 5FZHA 5FYUA 5FYBA 5FY4A 5FZAA 5FPVA 3RVHA 4HOOA 5FBJA 5FJKA 4GAZA 5FWEA 3DXTA 4QWNA 5FZ9A 4QXHA 5FZGA 5FZ3A 2Q8CA 4GJZA 5FZIA 5CEHA 2YU1A 4QU1A 4Y4RA 2Q8EA 5FZDA 4EYUA 5FP7A 2GP5A 5FP4A 4IGOA 5FUNA 5FZ4A 4IGQA 4CCNA 5IVBA 4XDOA 4QX8A 3AVRA 5FZFA 5IWFA 5FYTA 4TN7A 5K4LA 4EZ4A 5A3WA 2P5BA 2OQ7A 4C8DA 5ISLA 5F3IA 3K3NA 4LXLA 2GP3A 2W2IA 4QXCA 5A7OA 5FUPA 5F3CA 3DXUA 3N9QA 5FY0A 5IVFA 5FY8A 4E4HA 4LITA 4CCOA 2OS2A 1VRBA 3KV5A 5F3GA 5FYIA 4CCJA 5FWJA 5LY1A 5A7WB 5A3NA 3KVAA 5FZMA 4URAA 5ANQA 5FY5A 3KVBA 4CCMA 5A3PA 3UYJA 5A1FA 5FZ7A 5FXVA 3PU3A 3PTRB 5FYMA 2OX0A 4BXFA 5IVEA 3N9OA 5FYYA 4V2VA 5F2SA 5F39A 4BISA 2VD7A 3PUAA 3PUQA 4NUBA 4Y33A 5F3EA 3N9LA 2YBKA 2OT7A 5A7WA 5F5AA 5F37A 5FXXA 2YBSA 5A80A 4ASKA 5F2WA 5FZ1A 2XXZA 5F5CA 4V2WA 5IVYA 5FZCA 2PXJA 5FP8A 3AVSA 3N9MA 3OPTA 5IVVA 5FY7A 5F5IA 4LIVA 5LY2A 5FP3A 3PUSA 4XDPA 4AAPA 4QX7A 2OQ6A 5FYCA 4LIUA 5FP9A 3K3OA 3N9PA 4IGPA 4DO0A 2XUEA 5A7PA 2YU2A 5FZ8A 4CCKA 5A3TA 2YPDA 3K2OA 5FJHA 5FPAA 3PU8A 3KV6A 5FXZA 5A7NA 5FYHA 3LDBA 4GD4A 3OPWA 4AI9A 3U78A 3AL6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FZO B;  5A1L A;  4GJY A;  4D6S A;  3LD8 A;  4Y3O A;  5FZ0 A;  5FPL A;  5FV3 A;  5A7S A;  2WWJ A;  4DIQ A;  3NJY A;  3KV9 A;  5F32 A;  4HON A;  5LW9 A;  5FY1 A;  3ZLI A;  5FZ6 A;  4UF0 A;  5A7Q A;  3U4S A;  5FZL A;  4CUG A;  5IVC A;  3PUR A;  2XML A;  5FZO A;  4CCL A;  3KV4 A;  5FYV A;  5LWB A;  4QXB A;  2YBP A;  3AL5 A;  5IW0 A;  4D6R A;  4CSW A;  5FYZ A;  5FPU A;  5FPB A;  4UF0 B;  4BU2 A;  2WWU A;  5FYS A;  5FZB A;  5FXW A;  5FZE A;  2Q8D A;  4EZH A;  5IVJ A;  2XDV A;  3N9N A;  5E6H A;  3ZPO A;  3PDQ A;  5KR7 A;  5FY9 A;  4D6Q A;  5FZK A;  5FZH A;  5FYU A;  5FYB A;  5FY4 A;  5FZA A;  5FPV A;  3RVH A;  4HOO A;  5FBJ A;  5FJK A;  4GAZ A;  5FWE A;  3DXT A;  4QWN A;  5FZ9 A;  4QXH A;  5FZG A;  5FZ3 A;  2Q8C A;  4GJZ A;  5FZI A;  5CEH A;  2YU1 A;  4QU1 A;  4Y4R A;  2Q8E A;  5FZD A;  4EYU A;  5FP7 A;  2GP5 A;  5FP4 A;  4IGO A;  5FUN A;  5FZ4 A;  4IGQ A;  4CCN A;  5IVB A;  4XDO A;  4QX8 A;  3AVR A;  5FZF A;  5IWF A;  5FYT A;  4TN7 A;  5K4L A;  4EZ4 A;  5A3W A;  2P5B A;  2OQ7 A;  4C8D A;  5ISL A;  5F3I A;  3K3N A;  4LXL A;  2GP3 A;  2W2I A;  4QXC A;  5A7O A;  5FUP A;  5F3C A;  3DXU A;  3N9Q A;  5FY0 A;  5IVF A;  5FY8 A;  4E4H A;  4LIT A;  4CCO A;  2OS2 A;  1VRB A;  3KV5 A;  5F3G A;  5FYI A;  4CCJ A;  5FWJ A;  5LY1 A;  5A7W B;  5A3N A;  3KVA A;  5FZM A;  4URA A;  5ANQ A;  5FY5 A;  3KVB A;  4CCM A;  5A3P A;  3UYJ A;  5A1F A;  5FZ7 A;  5FXV A;  3PU3 A;  3PTR B;  5FYM A;  2OX0 A;  4BXF A;  5IVE A;  3N9O A;  5FYY A;  4V2V A;  5F2S A;  5F39 A;  4BIS A;  2VD7 A;  3PUA A;  3PUQ A;  4NUB A;  4Y33 A;  5F3E A;  3N9L A;  2YBK A;  2OT7 A;  5A7W A;  5F5A A;  5F37 A;  5FXX A;  2YBS A;  5A80 A;  4ASK A;  5F2W A;  5FZ1 A;  2XXZ A;  5F5C A;  4V2W A;  5IVY A;  5FZC A;  2PXJ A;  5FP8 A;  3AVS A;  3N9M A;  3OPT A;  5IVV A;  5FY7 A;  5F5I A;  4LIV A;  5LY2 A;  5FP3 A;  3PUS A;  4XDP A;  4AAP A;  4QX7 A;  2OQ6 A;  5FYC A;  4LIU A;  5FP9 A;  3K3O A;  3N9P A;  4IGP A;  4DO0 A;  2XUE A;  5A7P A;  2YU2 A;  5FZ8 A;  4CCK A;  5A3T A;  2YPD A;  3K2O A;  5FJH A;  5FPA A;  3PU8 A;  3KV6 A;  5FXZ A;  5A7N A;  5FYH A;  3LDB A;  4GD4 A;  3OPW A;  4AI9 A;  3U78 A;  3AL6 A; 
#chains in the Genus database with same CATH topology
 1C57 A;  1GQG A;  4AI1 A;  4QHO A;  4G9S B;  4XPV A;  1RXG A;  2Y6H A;  3P3P A;  4B1L A;  4D6S A;  4V1P A;  3ZYF A;  5I0R A;  1EPZ A;  2O8Q A;  4L9B A;  4CPB A;  1OOP A;  4DQA A;  4TTG A;  4AFM A;  1LCL A;  3IAQ A;  4GUL A;  1JN2 P;  4M01 A;  4AED C;  1GUI A;  1YI9 A;  1BVP 1;  4FOQ A;  3BTA A;  2UY9 A;  2JG9 C;  3POE A;  5KXD A;  1AJO A;  3AP6 A;  4A3Z A;  1FV2 A;  1Z0H A;  3DPR A;  1WLC A;  3HBZ A;  3OB8 A;  2BV4 A;  3TBD A;  2E9Q A;  2X10 A;  1ZBA 3;  3VKO A;  3U75 A;  3IDA A;  1O5U A;  4SBV A;  4WM8 A;  3T2P A;  2WII B;  3VBO B;  1NXM A;  2R6Q A;  2YRO A;  1SMV A;  3H42 B;  4AAX A;  2WWU A;  5LAT A;  2VOV A;  2IXC A;  5JOX A;  1W8W A;  1DHK B;  5FZE A;  1LGC A;  1MZ6 A;  3W58 A;  2XGX A;  2W95 A;  1MS3 A;  1DQ2 A;  1HDK A;  2ZGR A;  4JTN A;  4QU2 A;  1GP6 A;  2JE8 A;  4YVS C;  1RUI 3;  4PT6 A;  3RMY A;  3OYW B;  2E7A A;  1OKQ A;  2YGL A;  1D2S A;  1DYP A;  1Q8S A;  3LIG A;  1VBE 2;  3VBH B;  1PO1 1;  1UX6 A;  4XHB A;  5A6Q A;  2UWA A;  3A0K A;  3DGT A;  4CEW C;  1Y7B A;  1C4R A;  3MIC A;  1R64 A;  2H6B A;  3HQX A;  2RDS A;  2RJ2 A;  4C1X A;  3AFG A;  3VBF B;  2BPA 2;  3I8T A;  1FNZ A;  3LZZ A;  2OW4 A;  4Q4W 3;  2VW0 A;  3VBS C;  3RZK A;  2VOT A;  4OQ9 A;  1DGR A;  1MS8 A;  2WT0 A;  4DIN B;  2WN2 A;  2P6H A;  3ZXJ A;  1IKP A;  3ZOI A;  1RUE 2;  1SDW A;  2OQ7 A;  4YVW C;  1S0G A;  4QPY A;  4LBM A;  1J84 A;  5FY0 A;  4S2F A;  4M00 A;  2HBU A;  3MIB A;  5BNO B;  2PQS A;  4CCO A;  4HSJ A;  1WW4 A;  2D3R A;  3I2O A;  1F5F A;  1REE A;  3I2J A;  4LE4 A;  5EP9 A;  2XL9 A;  1JYN A;  2ARC A;  2J7M A;  3RYR A;  4W65 A;  1QY4 A;  1W8Z A;  5ANQ A;  2LM3 A;  1FAY A;  2BU9 A;  2FDG A;  1RUF 3;  4W8J A;  4RHV 1;  4W50 A;  1W6M A;  4XF4 A;  5T5J A;  1AR8 1;  1ZZC A;  2RG4 A;  2XJS A;  4YGB A;  1W28 A;  5C8C A;  1Y43 B;  3U14 A;  1CJP A;  4LO8 A;  4G3Y C;  4R8H A;  3CL1 A;  2WNU A;  4CUB A;  1RUC 3;  2ET1 A;  2R1B A;  4OI0 A;  3RGB A;  3Q9O A;  3CZJ A;  3J4U H;  1RUH 2;  4QX2 A;  2XBO 1;  1LUL A;  2PN5 A;  3FE5 A;  2IXK A;  4Q4V 1;  3C7F A;  1RYY A;  2IC1 A;  1NLQ A;  2Z42 A;  5FZ1 A;  5L7O A;  1H8T A;  2OA2 A;  2WUH A;  4JX0 A;  2CHH A;  2HLE A;  1BEV 2;  3N9M A;  2RMU 3;  1LOG A;  2GC0 A;  2GZW A;  4NO4 A;  3H8U A;  2MNG A;  2HYX A;  2WZ8 A;  1AR7 2;  1NYW A;  2O0O A;  2VZS A;  5FP9 A;  1DQ6 A;  4AVC A;  1DLC A;  5JI7 A;  4DO0 A;  2WAA A;  2ZS6 B;  3I3D A;  4R4Z A;  1QOS A;  3ZKU A;  4IET A;  3M8L A;  4AI9 A;  1PX4 A;  4QX5 A;  3CEW A;  3ACH A;  3WF2 A;  1RB8 G;  4HSL A;  3ZFG B;  5KHK A;  2XKO A;  2YPJ A;  4ZZ5 A;  2WWJ A;  4MZU A;  4MAD A;  3UGH A;  4C0H A;  1EV1 2;  1R1Z A;  3KT7 A;  5IAV A;  1S0E A;  3P6B A;  3ZFF A;  2ZTN A;  4NAO A;  1XBF A;  4PI0 A;  2Q1M A;  2Y60 A;  3EBR A;  4KMQ A;  2OII A;  2XWJ B;  5E89 A;  5T54 A;  2VXJ A;  4CU6 A;  4LHK A;  1F9K A;  4FP3 A;  1PMJ X;  2YYO A;  5LWB A;  2HEW F;  3NV3 A;  4QGM A;  1GOH A;  1FYU A;  5A32 A;  1IS6 A;  1RUD 3;  3HNM A;  4P5H A;  4Q4X 2;  2JG9 B;  5CBL A;  2ID4 A;  3S6P A;  4OI2 A;  2WO2 A;  2VME A;  2KA3 A;  3BB6 A;  1JTZ X;  4MXW B;  5CFD A;  5FXW A;  4NRQ A;  3MFA A;  5IVJ A;  5K0U A;  4PJY A;  2VW2 A;  4DS0 A;  2VNV A;  4LOS A;  4FTE A;  3BUC A;  2QVS B;  5LBB A;  4E27 A;  4U2A A;  3C8X A;  2LS6 A;  4NHY A;  5T52 A;  4XAB A;  1ZA7 A;  5GZG A;  4J25 A;  4B29 A;  1WD3 A;  2Q8C A;  1H8T C;  3ALQ A;  1F2N A;  2VUA A;  1H2N A;  2QZ3 A;  1O3T A;  4MET A;  4GWI A;  3AKS A;  2DFB A;  3BAL A;  3K51 A;  3VZL A;  1DBN A;  2BJS A;  1GIC A;  3OY8 A;  4IV1 C;  3ZMN A;  4GXL A;  1BYH A;  1F4H A;  1MEC 3;  1OVP A;  2IXI A;  2DUQ A;  3VBU C;  4CCC A;  3AZZ A;  1PVC 3;  5J48 A;  3E6B A;  5FZF A;  4D7T A;  3E5X A;  5CAZ A;  3MBW A;  3W20 A;  4FP2 A;  5C9A A;  1ENX A;  3E6C C;  1AL0 G;  3AP5 A;  3DL3 A;  3M3C A;  1ND3 B;  1UWW A;  4GMP 0;  1CAW B;  1TE1 B;  2ZKL A;  3N35 A;  4RD7 A;  4Q27 A;  5DAW A;  2G19 A;  3KGZ A;  4R4X A;  3HN3 A;  1MS0 A;  1UY2 A;  3W9A A;  3KD4 A;  4LBQ D;  5BNP B;  1ZZ7 A;  2JG8 C;  2VZV A;  2TBV A;  1HRV 2;  1PO1 3;  3H8X A;  1JS9 A;  1LRH A;  1QEX A;  1CPM A;  3VLB B;  4X8P A;  5B2G B;  2DF7 A;  5FQ0 B;  2VOW A;  3WLU A;  3NKT A;  5G04 L;  4CDX B;  4PBP A;  5E16 A;  2CNA A;  2V4A A;  3M2M A;  1R08 1;  3UES A;  1UZW A;  1TME 1;  1UMH A;  4ZPI A;  2O8O A;  2WNV A;  2VBB A;  4V2V A;  2J1R A;  3RWK X;  4N9H A;  1UO9 A;  2JEN A;  1QQP 2;  1O4Y A;  2B42 B;  1OC1 A;  2HYK A;  4YW2 A;  3UNP A;  2R30 A;  3THP A;  4E2Q A;  2R06 2;  3OBR A;  1WW5 A;  2PLV 2;  4COZ A;  4B8E A;  3UKN A;  1E5R A;  1XNT A;  1V6K A;  1VJ2 A;  2GN3 A;  1KFU L;  2X29 A;  5FP8 A;  1I9R A;  3AMN A;  5GZE A;  4NR1 A;  4AI2 A;  1LGN A;  5FO7 B;  1BMV 2;  1Q5O A;  1OA2 A;  1Q56 A;  3JBG 1;  4JDO A;  5FYC A;  2CWM A;  2ENR A;  3R6S A;  2WO7 A;  1RUJ 2;  5L9V A;  1OKO A;  5FPA A;  4YYO A;  1XRU A;  2I07 B;  2WYF A;  3I59 A;  4XXP A;  1SLC A;  2LTN A;  1AF9 A;  3DEM A;  2ZX2 A;  3OG2 A;  3WG3 A;  1LB2 A;  1AR8 3;  4IXL A;  1B35 A;  3WG2 A;  1ZRR A;  3WNM A;  5KHG A;  3EHK A;  1RGS A;  3AZX A;  4AQT A;  2XJU A;  3NJY A;  3QBQ A;  2YMZ A;  2FCT A;  3VD4 A;  3ST7 A;  1K42 A;  1H8V A;  1MZ5 A;  1SQ4 A;  1AL2 3;  2XBO 3;  2WZP P;  2JDK A;  4Q4V 3;  3GXU A;  4XJA A;  4FSJ A;  4RSU A;  5IVC A;  2OXB A;  3GZU C;  1UOJ A;  3PVB B;  1G8W A;  1WMF A;  4QDQ A;  1AYN 1;  2G4I A;  3ELN A;  4CDU C;  4S2D A;  3GM8 A;  3EO6 A;  4I0B A;  3ABZ A;  4QM9 A;  4D6R A;  1D4M 1;  1LR5 A;  2QJV A;  2FZ2 A;  4AG4 A;  5LK7 B;  4COW A;  3N7M A;  4ITC A;  4AOC A;  3FMG A;  1C8N A;  5AFB A;  3J26 N;  2A1X A;  4N7I A;  1ZNP A;  3PDQ A;  1SFY A;  3S30 A;  2R07 2;  4WM7 A;  4DOU A;  5FYB A;  4AYU A;  2LRP A;  3GZT B;  1WCQ A;  3URF A;  1Z7S 2;  4QXH A;  1GR3 A;  3ZYH A;  4R9D A;  3RDI A;  4L99 A;  4I30 A;  1DGR N;  4IEO A;  4JGY B;  5JMC A;  1S0I A;  4JKK A;  3NNL A;  1YLL A;  2QQV A;  4Y20 A;  2BRT A;  1ULD A;  2BNN A;  2QZ2 A;  3KHB A;  2PA7 A;  3JCI A;  3JZV A;  4CCE A;  4QX8 A;  1UOG A;  1W3X A;  4KU8 A;  4C1W A;  2VTX A;  2WFP A;  5JR2 A;  1O7F A;  2J1U A;  3NNF A;  4Y1X A;  1ND2 A;  4TN7 A;  5K4L A;  5LEK A;  1KEX A;  3O0X A;  1W0O A;  2Q30 A;  1YQ8 A;  1S1A A;  2E6V A;  3GNE A;  4FBF A;  5KXE A;  2W2I A;  5F3C A;  2D6K A;  3LA2 A;  1AXY A;  2VXR A;  4AI8 A;  4GWN A;  2IVI B;  2YHJ A;  4IEY A;  1I6X A;  2HWC 2;  2UY8 A;  1MVE A;  1YQ5 A;  4H3W A;  3WCR A;  5A3N A;  4BH9 A;  2Z5W A;  3B3Q E;  2JDM A;  1POV 1;  1NZC A;  1CVN A;  2VZR A;  1X9T A;  2WJS A;  4JC1 A;  4K1Y A;  4NWV A;  4UT5 A;  5LA2 A;  3ZXA C;  1JYT A;  3LE0 A;  3JXS A;  1PK6 B;  1W05 A;  2JG8 B;  1LES A;  2ZHK A;  1KGY A;  3FFQ A;  5C5T A;  3WHT A;  2IXH A;  4MLO A;  1QJU 2;  5F6L B;  4P9X A;  3T2Q A;  5KC5 A;  1NA1 C;  1ULG A;  3PUA A;  1UY0 A;  5A7W A;  1QH7 A;  3CHX A;  4AGV A;  3A21 A;  1ZVF A;  1WA4 A;  2HWD 2;  3VBR A;  3HD8 B;  5FMD A;  4CDQ B;  1HB4 A;  2V72 A;  2VQA A;  2VPV A;  3I2D A;  3N36 A;  5LRR A;  1RUG 1;  5FOJ B;  5JIU A;  4PI2 A;  4ZU7 A;  3VHO A;  1XSR A;  2D6O X;  3E1F 1;  3LPF A;  1QOO A;  1ALY A;  3I7D A;  4LPL A;  3FFZ A;  5D8A A;  3V0A A;  2ZGK A;  4RA0 A;  4FOV A;  4XJW A;  1C8M 1;  1R1A 1;  1I5Z A;  1IQA A;  4GA9 A;  2FD8 A;  2P3K A;  1GNH A;  3D6E A;  4PIY A;  1CAU A;  3OBZ A;  5HV4 A;  1IGO A;  2E53 A;  1VBE 1;  3SCF A;  1J83 A;  4XDQ A;  1F15 A;  5EJZ B;  3WNX A;  4BK5 A;  2A75 A;  5BNN A;  1NE6 A;  2VMG A;  2WFF 3;  5A33 A;  4NN0 A;  2BFU S;  5JPM B;  3WW4 A;  2QDR A;  1R08 3;  2VJX A;  3RRD A;  1F31 A;  3O7O A;  3L9J T;  4XJ9 A;  3GF6 A;  2DYC A;  5DG1 A;  1ND2 C;  3T2T A;  1QJX 2;  1D0G A;  1FMD 2;  4N9I A;  1UZY A;  1DQ1 A;  1GWM A;  1PGL 2;  1RIR A;  2D98 A;  5LBE A;  2JDN A;  2WWS A;  3LKJ A;  4HVQ A;  1H2L A;  4QXB A;  3JBG 3;  1XPW A;  4JV4 A;  5IFP A;  3WOG A;  2HBT A;  2V5D A;  4ZS2 A;  3GZE A;  2J1T A;  1W8H A;  1W6Q B;  4BE3 A;  4DEQ A;  2E7T A;  3VL9 A;  1VB2 A;  2GC2 A;  4A6O A;  1WUV A;  4HZF A;  2GAL A;  2FDF A;  5KXB A;  3B00 A;  4TXW A;  1YFW A;  4CE8 A;  4NIG A;  5FK8 A;  3HNY M;  3PVE A;  4EN8 B;  5JOY A;  4MVT A;  4YZ4 A;  4JGZ A;  1JBC A;  4IV3 A;  3UKV A;  3WDY A;  3W59 A;  5E8A A;  4Y22 B;  1GZT A;  4EE2 A;  3IBM A;  1UKR A;  2EIB A;  2VG9 A;  2XB6 C;  2ZX3 A;  5FZ9 A;  5GLU A;  2ZKN A;  3FLT A;  1WCD J;  3BN6 A;  3DV8 A;  1RUH 1;  3TB0 A;  1XYO A;  2CL2 A;  5C71 A;  4ONU A;  2G9G A;  2YV8 A;  3U07 A;  5F6K A;  2F4L A;  5LAS A;  1AYN 3;  1OVS A;  1TEI A;  1IG3 A;  4ZZ8 A;  3GBF A;  1BEV 1;  3GDB A;  4N53 B;  1IPS A;  1UW8 A;  5APA A;  3UGG A;  2K0G A;  1H1A A;  1MQT A;  2HWF 2;  1D4M 3;  1V6L A;  1AR7 1;  2VMC A;  1ENR A;  2IXL A;  4IE5 A;  1UX7 A;  2Z2S B;  2BGC A;  4QQL A;  3ZIX A;  1JH5 A;  2WR9 A;  4EZ4 A;  3M3I A;  1YCI A;  4P02 B;  4RR3 A;  2GSY A;  4GH4 B;  4IEV A;  5C7G A;  3VKM A;  3LCP A;  1HV1 A;  1OH4 A;  2BER A;  1LKN A;  2GMM A;  2F6B A;  1NQJ A;  2LRO A;  1W90 A;  4CDW A;  4N8M A;  3POW A;  4GWJ A;  1EV1 1;  4W6Y A;  3GJA A;  2BP6 A;  5CYY A;  4Q8L A;  4URA A;  3U10 A;  1MS5 A;  1SLL A;  2EAL A;  4FPO B;  1JHN A;  1HXS 2;  2L9L A;  4HK9 A;  4YZ1 A;  1U5I A;  5EHD A;  4C0B A;  1V6N A;  4QDR A;  1UKG A;  4YG6 A;  4HPK B;  1DGL A;  4JCK A;  1JYX A;  3RJR A;  1O8S A;  4AXO A;  1SPP A;  3K46 A;  2D44 A;  3PNA A;  5FYY A;  3MPP G;  4YPJ A;  2VZ1 A;  5K8S A;  3O1V A;  4XYX A;  1R09 2;  4OI4 A;  1QHD A;  2NYY A;  4RQP A;  2VZQ A;  1WLW A;  5DAV A;  3VKN A;  1XE8 A;  4YW3 A;  3T09 A;  1Q8Q A;  3PVO A;  3UKT A;  2BZD A;  1WMD A;  2JKX A;  4GMP 1;  1D2Q A;  3ZFE C;  4ES8 A;  5EWS A;  2A6X A;  4DUV A;  4IE0 A;  3WW3 A;  2VCB A;  3VD3 A;  2K9Z A;  1COV 1;  4QGL A;  2YU2 A;  1POV 3;  2ZGP A;  2E51 A;  1IHM A;  4QHB A;  5DDJ 2;  1CAV B;  1VAV A;  2ARX A;  4AQ2 A;  4LT5 A;  2ILM A;  3OPW A;  3U78 A;  4BMB A;  3C7O A;  2A3W A;  3MPB A;  4XE9 A;  1WBL A;  1VE0 A;  2WS9 2;  2BWA A;  2ZPX A;  4Q26 A;  1VBB 1;  4BQW A;  1AUY A;  1FOD 3;  4IEZ A;  4DIQ A;  3BI3 A;  4CCD A;  4NID A;  5T5L A;  1JXN A;  2ET7 A;  4EQV A;  4NE9 A;  5C4W C;  4S2H A;  4GQ7 A;  3ZLI A;  3ECQ A;  3VZN A;  2CWS A;  1NCR A;  2LW8 A;  3A0N A;  2MEV 1;  2DV9 A;  2RVA A;  4OLL A;  4EN9 B;  1RUG 3;  2DVD A;  1E5S A;  1REF A;  1WMX A;  2XML A;  3KV4 A;  2VTX J;  3ZN5 A;  4UFK A;  4DXR A;  1IS5 A;  2NMO A;  2CAV A;  4IEU A;  4KBZ A;  4QPG A;  1BLZ A;  3HQR A;  2PEL A;  1U5Z A;  2PHR A;  1BBT 2;  3ZSJ A;  3W5N A;  2HJI A;  1C8M 3;  1R1A 3;  1W2N A;  3LEG A;  4NJ4 A;  5CZK A;  3SCG A;  1ASJ 2;  1OA4 A;  2ZA9 A;  3C7E A;  4XFF A;  4NHL A;  3WQ7 A;  1VBE 3;  1HRV 1;  2XR4 A;  2KXL A;  1GLH A;  4LHS A;  4KG0 A;  5E6H A;  4JHZ A;  3AJZ A;  2ZCW A;  3POY A;  3E5Q A;  4DFS A;  1YHF A;  2C1F A;  3CJI A;  2NLR A;  4YFW A;  3V65 A;  4E2S A;  2DTW A;  3VBF A;  3Q8B A;  1GSL A;  1S2E A;  3PMS A;  3IWZ A;  3ZO0 B;  3WDT A;  3U37 A;  3LDK A;  1VBA 2;  4O65 A;  1RMU 2;  4BB3 A;  4Q4Y 2;  5FZ3 A;  1ZRI A;  2BUK A;  1OQD A;  2DWR A;  3N4M A;  2BTV C;  3T1L A;  1DG6 A;  3NRU A;  3UT0 A;  1VLN A;  1C5I A;  3UJO A;  5J1X A;  4CXY A;  1ZM1 A;  1F35 A;  1K5M A;  2A5Z A;  5JI9 A;  3WNN A;  1AR6 2;  2ES3 A;  5BNO A;  1ULP A;  3FBY A;  1QIQ A;  1OF3 A;  3C7G A;  2W08 A;  2V4V A;  1PNF A;  3THC A;  5KHJ A;  3B9I A;  4FOW A;  1JZ2 A;  5L9B A;  1JYV A;  1GAN A;  3ZXD A;  5FTT C;  4WVW A;  4AVS A;  5JSR A;  3NAP B;  4MSV A;  1RIT A;  1RHI 3;  1H0B A;  3DXU A;  1NCQ C;  2Q0A A;  4ZY9 A;  4COY A;  2OS2 A;  4HLT A;  4ISQ A;  1IPK A;  3KT4 A;  1UPS A;  2XVK A;  3PUH A;  2DCT A;  4NRO A;  2VY0 A;  4F8A A;  1J3R A;  1QXP A;  3KM5 A;  4AVV A;  2TUN A;  2XG3 A;  1MR5 A;  4Q2F A;  4XJU A;  2X05 A;  1UN1 A;  2CV6 A;  4JRL A;  1YFU A;  4BQ3 A;  1A8D A;  3L2Y A;  1FV3 A;  4XQ4 A;  1MS9 A;  1C1F A;  3KQ4 B;  1BEV 3;  1QKQ A;  1YNA A;  3D0J A;  4P9Y A;  1DGW X;  4YZ2 A;  3RZL A;  1NZI A;  3M1H A;  3WDV A;  5A3O A;  5JCT A;  3B01 A;  5JMO A;  4OHW A;  1AR7 3;  4DRV A;  4B4R A;  3MV1 1;  1S0J A;  5CG9 A;  5DQ0 A;  3J7N A;  4M3C B;  3FL7 A;  5DN2 A;  4Z07 A;  2W39 A;  4RGG A;  4YW1 A;  4CP0 A;  2J1S A;  3C2U A;  2GAU A;  4D8M A;  1NT0 A;  4XAC A;  1W6O A;  1W8O A;  5CKM A;  4HT1 T;  3CBN A;  1DQ4 A;  1C28 A;  1US2 A;  2O1Q A;  2XVG A;  2R07 1;  2RE9 A;  3HWJ A;  3LDR A;  3H3U A;  2XQX A;  4MUV A;  5FMO L;  1EV1 3;  4UWD A;  3ZFE B;  5CA6 A;  3WT3 A;  1Z7S 1;  3POJ A;  3K2O A;  2IXJ A;  2EIE A;  1HJF A;  1A78 A;  2B39 A;  2VBP A;  4LR4 A;  1UMZ A;  2G1M A;  4XXA A;  4MG2 A;  4GJY A;  4E9K A;  4PDW A;  1OT5 A;  2Y6K A;  4YM2 A;  5EJ3 A;  4A2U A;  3BTZ A;  1MS4 A;  4QB1 A;  4BM8 A;  4I3G A;  3KWV A;  2ZAA A;  1J58 A;  3MV0 1;  5JDB A;  1VB4 A;  1FX5 A;  1B09 A;  1VBD 2;  4K40 A;  4G4F A;  4MXW A;  3LFM A;  5I8S A;  1QNW A;  4AI0 A;  1GFF 2;  5I0U A;  5C4W B;  1T6G C;  5I91 A;  3OUI A;  1XU2 A;  1JOB A;  3E5U A;  1J3Q A;  4AEM A;  4GMP 3;  3LEI A;  4H2A A;  1OUX A;  3U1X A;  4OQ8 A;  4D7S A;  4FO9 A;  4LMF A;  5KWR A;  2AYH A;  4YLZ A;  4OHY A;  1LHV A;  1QMJ A;  1COV 3;  3AZV A;  3WDW A;  3WXP A;  1PZ8 A;  1SLB A;  3ES4 A;  2Q8D A;  5A6Z A;  2YXS A;  2JD4 A;  3ILR A;  4RS5 B;  3PUI A;  3T1M A;  2J42 A;  3ETQ A;  3OEB A;  4ES9 A;  1S0D A;  2QE3 A;  4KNC A;  4F3J A;  1VBB 3;  3CO2 A;  1GNZ A;  4N43 A;  1K45 A;  2RS1 3;  3WX5 A;  5ABJ B;  5T55 A;  1UF2 C;  3IDC B;  2VQT A;  2XOM A;  1SFN A;  2EXJ A;  4MGT A;  3DXT A;  2NN8 A;  2ZGT A;  4QWN A;  2W52 A;  2HWD 1;  3WVJ A;  3III A;  3ENR A;  5CFC A;  4Y4R A;  2MEV 3;  3P1I A;  1LAJ A;  1HLC A;  5J37 A;  4GKX A;  1LOA A;  5FP4 A;  1EP0 A;  1ND3 A;  2DFC A;  5SV5 A;  3WG4 A;  2VM9 A;  1CAW A;  1JYI A;  4AFA A;  2GMP A;  1BKZ A;  4CRQ A;  2RV9 A;  1N1V A;  2A6Z A;  3AMH A;  4K7J A;  4TYS A;  1VR3 A;  5BNP A;  4RGK A;  5FYT A;  2JEC A;  1HRV 3;  4KBB A;  4FAG A;  3POF A;  2QTW B;  4OHX A;  5ISL A;  2PHL A;  5DUW A;  4CDX A;  4QT6 A;  3VDD C;  4Q1R A;  5IVF A;  3N9Q A;  1GZC A;  3HNB M;  1UAI A;  4I3P A;  4GB3 2;  4K21 A;  3FHI B;  4CCJ A;  2VUL A;  4QMA A;  5L19 A;  4W6W A;  1YQ6 A;  2D5F A;  1IQD C;  1JUI A;  4XIO A;  3S5Q A;  4LUL A;  2AEN A;  5A1F A;  5JZG C;  4OYU A;  3ZSK A;  3KCX A;  4XFH A;  4WVV A;  1EYB A;  4BQ4 A;  1NXD 1;  1PGL 1;  4MGS A;  3R05 A;  4FXK B;  1OPO A;  2E63 A;  3N3H A;  4CEY B;  4MYE A;  4DY5 A;  2EA7 A;  1NX9 A;  2OVU A;  4MX3 A;  5F39 A;  1AHS A;  1GZW B;  2GME A;  4OMC A;  2VR4 A;  4EWA A;  5F37 A;  1G9C A;  5DZE A;  4EN6 B;  2CDP A;  4BWO A;  1PNG A;  3GCX A;  4OUM A;  2QUO A;  2RM2 2;  5C3O A;  1W6P A;  1CX1 A;  1EUT A;  4OI1 A;  5FZC A;  1FAT A;  1JOJ A;  4HVR A;  4N43 C;  3UJQ A;  4XF0 A;  5LRS A;  1J59 A;  1OOP C;  1PVX A;  2GN7 A;  3H8O A;  2BBV A;  1DYO A;  2WDB A;  2KM2 A;  4FPL A;  3ILF A;  1QJY 2;  5CFC C;  3W21 A;  1YYN A;  5JSO A;  2ZHL A;  4Q0U A;  4Z8B A;  2RS3 3;  4CU9 A;  3ZSM A;  2Y33 A;  2BNO A;  2DCY A;  2VZU A;  1OI6 A;  3RS6 A;  3DPR C;  5FJH A;  3RWN A;  4EJR A;  5IK5 A;  3ZYI B;  2NM1 A;  1ZZB A;  2V5Y A;  4BQ1 A;  2VQU A;  1YO8 A;  3AL6 A;  4WM8 C;  4X6Q B;  1AX2 A;  1US3 A;  3LD8 A;  4LHN A;  5A7S A;  5FO9 B;  1BHG A;  4QM8 A;  1TVG A;  2QQJ A;  1NKG A;  2P3Y A;  4WBB A;  1GOF A;  1LOD A;  2HWE 1;  4GZ9 A;  4IUG A;  1JU3 A;  3VN4 A;  1W8U A;  2E26 A;  3NJV A;  4YFZ A;  2ZX1 A;  3J7M A;  5FZO A;  4CCL A;  1VRH 2;  3QLQ A;  5FYV A;  5KXC A;  1GQH A;  3PIG A;  1KRI A;  3RG0 A;  5C6C A;  2Y38 A;  2BGO A;  1W9Y A;  3I3B A;  1OLR A;  2R07 3;  2Q8O A;  1CAX B;  1PIV 2;  1UD1 A;  2JE7 A;  3O1T A;  1PZ7 A;  3DCQ A;  1HQW A;  1Z7S 3;  3I2I A;  4K6B A;  3ZYP A;  5CKQ A;  2CSG A;  1CZS A;  2VEC A;  2D6M A;  4JGY A;  5KR7 A;  3QAC A;  1AJK A;  4XHX A;  1EAH 2;  3HBK A;  1VMJ A;  3MIG A;  1V9U 2;  5DPN A;  4QQH A;  4K9S A;  1IS3 A;  1X9P A;  5J36 A;  2P17 A;  2ZGQ A;  2RR1 1;  1JZ6 A;  4BDV B;  2VVD A;  1R09 1;  2Z4F A;  5AVP A;  4ZXK A;  2WLQ A;  1XJA A;  4BZ4 A;  2YFU A;  1ODM A;  1SHW B;  1OBN A;  3ZXF A;  4AHX A;  3Q8E A;  3O1S A;  1H30 A;  4AED B;  3PVN A;  2TNF A;  5IYY A;  1GNY A;  2J1A A;  4IGO A;  4FTB A;  5DUU A;  2D5H A;  1Q8P A;  1XYN A;  4HK8 A;  3NMB A;  3KHC A;  1UU4 A;  5IK4 A;  1ZA4 A;  4HN1 A;  4I02 A;  3MIF A;  4J6G A;  1W04 A;  3WF0 A;  4IER A;  3S0M A;  1ZZ6 A;  4FVV A;  5I0D A;  2RS5 2;  2ZGS A;  5EJ1 B;  5AFE A;  4E4D X;  3BOP A;  2Y64 A;  5C8C C;  4YW7 A;  1W39 A;  2NPI A;  2YC4 A;  1G7Y A;  2WNU C;  1PK6 A;  3WY6 A;  1L7Q A;  2ZAH A;  1YI7 A;  1O4Z A;  3APB A;  4JDM A;  3MGU A;  4AVB A;  3AYE A;  3KV5 A;  1VRB A;  3AKP A;  5L7O C;  3BTX A;  1W9T A;  1OD5 A;  1Z78 A;  4HFS A;  4Y26 A;  4YVS B;  1CZT A;  5HXV A;  1RL3 A;  3VDD B;  3KVA A;  5LY1 A;  1JZ3 A;  2R04 2;  1PGS A;  5FRE A;  3JD7 1;  2B45 X;  3ZN6 B;  1C5H A;  3O1U A;  4ZHN A;  2VCC A;  2FMY A;  4RGA A;  2FDH A;  2VGD A;  4PQ9 A;  1DQ5 A;  2ORZ A;  2C5D A;  3T3Y A;  4CEW B;  2OX0 A;  4BXF A;  1PZ9 A;  5JZG B;  1C1L A;  1AYM 1;  2QNK A;  3N9O A;  3AC0 A;  4XMA A;  2CTV A;  3ZYR A;  4DXT A;  3TEZ A;  4MXV A;  2YY1 A;  3INA A;  2VD7 A;  1U12 A;  3JB8 A;  4LBQ B;  3T0D A;  2YBK A;  1SEF A;  3JU9 A;  1ASJ 1;  1QJZ A;  3SH5 A;  3DYO A;  1F8V A;  3TN9 2;  4XTP A;  3VBS B;  3BOW A;  1H6Y A;  1XSQ A;  3I2F A;  5ANN A;  3QH7 A;  3ZFF C;  2W1Q A;  4XFA A;  4YVW B;  2PYT A;  3AXD A;  1KS5 A;  1W03 A;  4XDP A;  4B7E A;  4UXA A;  3VKF C;  1JYC A;  1PM7 A;  2JE9 A;  1JYW A;  3M3O A;  3OD4 A;  1VBA 1;  1RIN A;  1RMU 1;  4Q4Y 1;  3EXU A;  3PU8 A;  2EAK A;  1OXC A;  3CNA A;  4UW6 A;  1H2K A;  4XC9 A;  2BQP A;  4HL0 A;  3IZO A;  5FPL A;  1V70 A;  1ZBA 2;  3MID A;  2Q4S A;  1WCK A;  1AR6 1;  4R52 A;  3WV6 A;  4CPB D;  1XU1 A;  3T0B A;  5CFD C;  5I0T A;  4M0H A;  4NVP A;  4UI9 L;  5EV7 A;  4MGK E;  4AI3 A;  1HN1 A;  5FY1 A;  4A3X A;  5IFT A;  5K0U C;  3RZJ A;  4P9W A;  4DXZ A;  4FPE A;  1W6Q A;  4BIF A;  1NG0 A;  3IDB B;  5FZL A;  2BNM A;  5LBF A;  2WNE A;  5CG8 A;  3BPS A;  3ROU A;  1XXN A;  4XQD A;  2ZXQ A;  4IEP A;  3AYA A;  1RUI 2;  4DXS A;  2YBP A;  3ZX7 A;  1FI2 A;  2ZGN A;  1W99 A;  4Y22 A;  4UF0 B;  4URT A;  2A3X A;  4FCA A;  1H9W A;  1O8P A;  3FC0 A;  4RHV 3;  4XIL A;  3HN1 A;  3ZMO A;  3HEI A;  3PHM A;  3PTY A;  4LQR A;  5ERL A;  3IN9 A;  4OCT A;  2WAO A;  3LGR A;  5IK7 A;  1APN A;  1F4A A;  1ULO A;  4HVO A;  2WKK A;  4N53 A;  4Q4W 2;  4KI5 M;  3K48 A;  4HOO A;  5C9A C;  1SAC A;  2VO5 A;  2HWE 3;  2ZML A;  4YM3 A;  2ZJC A;  4MGZ E;  1TQ5 A;  5FZI A;  4A44 A;  1SBF A;  3MIH A;  5FP7 A;  3EMR A;  3LA3 A;  1UY1 A;  2Y0O A;  4GH4 A;  5DUV A;  4ERO A;  4BQ5 A;  3M70 A;  1FXZ A;  1QXJ A;  3HVD A;  1QF3 A;  2JIJ A;  4R9C A;  4P9L A;  4DUX A;  2VAU A;  2BVV A;  5F1R A;  2ZEX A;  4YGE A;  1WZX A;  4BOW A;  2Q5T A;  4XFB A;  1BCX A;  5G05 L;  1KS4 A;  2GU9 A;  4MGI E;  1CX4 A;  3MW3 A;  5A3W A;  3H9A A;  5KHI A;  1GOG A;  2WNV C;  2XJT A;  4Y24 A;  4F83 A;  4LXL A;  4ASK A;  5FPZ A;  4QXC A;  1DCS A;  1O3R A;  5GZC A;  2FDJ A;  4HPK A;  2C24 A;  2VZ3 A;  3F95 A;  5C8C B;  3RZM A;  5EXO A;  4BYY A;  2Y26 A;  1JMU B;  1RUC 2;  2WNU B;  4MV2 A;  2RR1 3;  4QQP A;  2X5I A;  5JAX A;  2VVE A;  3WZ1 A;  2SLI A;  2WRA A;  1R09 3;  5FY5 A;  4CU8 A;  5AC9 2;  1BVV A;  5L7O B;  2JB8 A;  1VBD 1;  1H8T B;  1G9B A;  2RMU 2;  4LUM A;  3WCS A;  3WIN E;  1XQN A;  2AZ5 A;  4OHZ A;  3QH6 A;  3T2O A;  1QOT A;  3K4A A;  3Q8C A;  4HBN A;  3MI8 A;  5A1A A;  4DRR A;  2KR2 A;  4H14 A;  4IV1 B;  4JKM A;  3AP7 A;  4QKF A;  4H7L A;  3OPZ A;  1HW5 A;  4LA3 A;  1B35 C;  3VBU B;  1BQP A;  1LOB A;  1QNY A;  5IVY A;  3I3M A;  1HB2 A;  2PXJ A;  3SKJ E;  2DUO A;  2J22 A;  5BPX A;  5EYY A;  4KL1 A;  4RYD A;  4B4Q A;  3N7J A;  3RI8 A;  3LIH A;  1ZYB A;  3HMY A;  3LF7 A;  2XKP A;  4IQP A;  1UMI A;  3K3O A;  3N9P A;  3ZFF B;  2H0B A;  4A7Y A;  5DZF A;  1Y9G A;  2RJL A;  1VMF A;  3JD7 3;  4YM0 A;  4QDS A;  1PHM A;  2QBX A;  2VC9 A;  1GP4 A;  3LDB A;  4W4Z A;  5DZG A;  1X8M A;  2JDZ A;  3SIT A;  5IHR A;  1DYK A;  2VZO A;  3AM2 A;  1QWR A;  4O7X A;  1AYM 3;  4EV0 A;  5B4N A;  3ZSL A;  5A32 B;  1RUD 2;  3KV9 A;  5FLH A;  1X36 A;  4XIK A;  4AF9 A;  4YW6 A;  1BJQ A;  2ZBJ A;  3FUO A;  5LW9 A;  2SBA A;  1UIK A;  3ZDS A;  1ASJ 3;  3ASI A;  4P00 B;  3U4S A;  5J7M A;  3O1M A;  5HPO A;  3I2H A;  4WM7 C;  5CKN A;  1QJE A;  3VDC A;  5K0U B;  1ZZ9 A;  2XJP A;  2FBE A;  1D0H A;  1TG7 A;  2D6P A;  4J1X A;  4HKO A;  2X5I C;  1AZD A;  2QQU A;  5L73 A;  2XHK A;  4Y5S A;  5HCH A;  3BU7 A;  4QPI A;  2WYS A;  3KLS A;  4Z92 B;  1QXR A;  1SFP A;  1WBF A;  1VBA 3;  5FZB A;  1OLM A;  4Q4Y 3;  3RPQ A;  4EZH A;  1ULC A;  2XUM A;  5CU1 A;  1TME 3;  2VMF A;  2DCZ A;  1O59 A;  3IPV A;  1W0P A;  3UV9 A;  1K3I A;  1OLQ A;  3G7D A;  5FZH A;  1OQ1 A;  1AR6 3;  3OY8 B;  4JKL A;  4QPW A;  5FZA A;  1MEC 2;  4AEK A;  3LEK A;  3TEX A;  4GAZ A;  1PVC 2;  5FZG A;  5FIX A;  3VHR A;  4F7Z A;  4XF9 A;  4Y1Z A;  2VUD A;  5CNA A;  3S5A A;  4XOG A;  3SHR A;  1RUE 1;  2RM2 1;  3ZPY A;  1LNS A;  4XUN A;  4CP1 A;  5C9A B;  4D3W A;  4DB5 A;  2ADE A;  1VP6 A;  3JUU A;  2DBN A;  3NAP A;  1MS1 A;  3FWE A;  1BXH A;  1VPH A;  2NZ9 A;  4OZX A;  4LO5 B;  2XVL A;  1VIW B;  4QKN A;  4CDU B;  1QJY 1;  1UZ0 A;  3THD A;  1H1I A;  3FBM A;  3MF6 A;  1PO1 2;  1PX3 A;  5LB6 A;  4DUW A;  3U4X A;  4I2O A;  1HB1 A;  5C3S A;  2WNO A;  1N3P A;  2VUJ A;  3HQU A;  2WQZ C;  4UAP A;  4WVZ A;  1HRI 2;  2UUR A;  4E4H A;  1W8N A;  3VBR C;  1RUN A;  1H4G A;  2WNV B;  2GC1 A;  1W6N A;  2C0Z A;  1AXZ A;  2ATF A;  4GAL A;  3GHM A;  4CP9 A;  5B4X A;  1CPN A;  5I8T A;  4FPJ A;  4M3C A;  3NL1 A;  4TLG A;  5D8A C;  4BQ2 A;  3DEC A;  4PLO A;  3AKQ A;  2ZZJ A;  3K75 B;  2D93 A;  2QQN A;  2ZEY A;  5IVE A;  2XL7 A;  2DDU A;  4MOA A;  1WW7 A;  1ZZ8 A;  4OHV A;  1H2M A;  3CDZ B;  4BIS A;  1PIV 1;  1TNF A;  2MPF A;  3K77 A;  4O61 A;  2DTY A;  4ZU5 A;  5FMB A;  2AEY A;  3LFI A;  4XUQ A;  1X50 A;  3WP5 A;  5BNN C;  4JQR A;  4LOR A;  5D1I A;  2R16 A;  1NY7 2;  3BOD A;  2BDR A;  2X09 A;  4WVM B;  4CTE A;  1QDC A;  1XE7 A;  4Y1Y A;  3A22 A;  5KC6 A;  2IWG B;  2FMD A;  4QQO A;  1XNA A;  5HBA A;  1LHU A;  2IFW A;  3H3Z A;  4QX7 A;  3ACI A;  4QB2 A;  1V9U 1;  2CY6 A;  1ENS A;  3BPZ A;  1YQ2 A;  3HT2 A;  1AL2 2;  5A7P A;  2VE1 A;  2XBO 2;  4CCK A;  4D7Y A;  4P9I A;  4E2G A;  1XC6 A;  2PTM A;  1STM A;  1VBD 3;  4RFT 0;  4K8R B;  1Q8O A;  3DYM A;  4Q4X 1;  2IUW A;  3VDB A;  4HON A;  1EUU A;  3TNP B;  4J1W A;  1NA1 B;  2GH2 A;  3POS A;  1MZF A;  1AR9 2;  2K46 A;  2RS5 1;  1NQD A;  4JGZ C;  4IV3 C;  3RZH A;  2ZGL A;  2IFR A;  2NMN A;  2A71 A;  1YJK A;  2VCA A;  2OZ6 A;  3FJS A;  2DCJ A;  4ZXE A;  2WA4 A;  1KJR A;  5ABJ A;  2VMH A;  2PAE A;  2DCK A;  2I74 A;  5BV6 A;  1LHW A;  1Q8V A;  3A4U A;  4LHL A;  1ZRC A;  4P9J A;  1MQT C;  2F17 A;  4HET A;  2JKB A;  3MZH A;  2FDK A;  4AVT A;  3VBO A;  2GH8 A;  1ZBE 2;  5FJK A;  4RR3 C;  1ST8 A;  3SQO A;  3AP4 A;  1W3V A;  3N7K A;  1WGP A;  5CEH A;  4KWK A;  1ND2 B;  1UU5 A;  2PAM A;  3BGA A;  1T2X A;  3AKR A;  3OF1 A;  4CDW C;  3P5B A;  3S57 A;  2P1B A;  5FDB A;  5JXJ A;  3OBA A;  3TEW A;  1W9S A;  3IMN A;  3ON7 A;  2Z69 A;  3D5O A;  4IGQ A;  3OYW A;  4LBO A;  1SDD B;  2A6V A;  2B8M A;  3H1W A;  3OUH A;  4FI9 A;  3MLJ A;  5A3M A;  2ZAB A;  3ZR5 A;  2ZAC A;  4AGR A;  1VAL A;  3KB5 A;  3VBH A;  5LK5 A;  3O14 A;  2YC0 A;  3U11 A;  3IMM A;  2B9V A;  2LUW A;  5IWF A;  2ORX A;  4Y5Z 0;  4FPH A;  5EFU A;  1O4T A;  1CZV A;  4C8D A;  1WWY A;  3ZXG A;  5CAD A;  1QDO A;  4Q0V A;  2DVA A;  1XB9 A;  2RDQ A;  4RQP C;  3WW1 A;  1QQP 1;  3IIA A;  3WDX A;  1KDK A;  4B1M A;  5A7W B;  2PHX A;  4YAR A;  3U0Z A;  3I3E A;  1S55 A;  4XW3 A;  2R06 1;  3KF3 A;  1SBE A;  1OFS A;  2PLV 1;  3M4F A;  3J8F 2;  1G9F A;  5FO8 B;  1RUE 3;  1LOE A;  3B02 A;  2RM2 3;  1V6I A;  1X82 A;  4LBJ A;  3PTR B;  5FYM A;  4WZC A;  3ZKY A;  3W5M A;  1BMV 1;  3ZDV A;  3RSJ A;  3V0A B;  3GAL A;  4LUK A;  3VDA A;  3PUQ A;  5F3E A;  4NUB A;  1S2B A;  3NO8 A;  4X6R B;  3ZR6 A;  1QJY 3;  1RUJ 1;  4CZS A;  2EF6 A;  2YC2 A;  1W2U A;  4XAE A;  3KSC A;  3AXE A;  2RHP A;  2WFF 2;  5GM0 A;  4DPN A;  1M06 G;  4PBO A;  5LY2 A;  4CXX A;  4UFH A;  5HCA A;  2H0V A;  3KMH A;  3LAG A;  5CIR A;  1NCR C;  2FDI A;  4AVA A;  2OQ6 A;  2WT2 A;  3NV1 A;  3VHN A;  1RUH 3;  5T3N A;  2XUE A;  1KXG A;  3VZM A;  1LED A;  1NUK A;  1JUH A;  3S7I A;  4QPG C;  5C3P A;  4UYB A;  5JUV A;  1N3Q A;  1PMH X;  3QOP A;  4DEV A;  5FY9 A;  2XLG A;  4D6Q A;  1U5X A;  3VUO A;  5LCW L;  4QXK A;  4KU7 A;  5FV3 A;  4Z2W A;  4AHZ A;  1Y4W A;  5IUQ A;  4JZR A;  3JBG 2;  5EQU A;  2G9F A;  1CAX A;  1FT9 A;  4NHX A;  3TWI A;  4AFB A;  4XET A;  1FNY A;  1LOF A;  1OA3 A;  2Y6J A;  2ZGM A;  1A6C A;  3CMG A;  3CJI C;  5FZ6 A;  3D4K A;  5I93 A;  2QCS B;  4XFI A;  3VBF C;  1T6B X;  1J1L A;  3ZYG A;  1IG0 A;  4M3C F;  2Q1Z B;  3TOJ A;  1E5I A;  3ZFG A;  1WCS A;  3WNL A;  1W2T A;  4JGZ B;  3MIE A;  1YFX A;  4B4P A;  4IV3 B;  3AMP A;  1X7N A;  3THT A;  1V6O A;  1V9U 3;  3WP3 A;  1VBC 2;  1RUC 1;  2ZHM A;  5FPB A;  5DAP A;  4K20 A;  2YB7 A;  5FUI A;  4A4A A;  1K5M C;  4IES A;  2W68 A;  5AC9 1;  3I2K A;  3SNM A;  5BNO C;  3UGF A;  5IK8 A;  1TZO A;  3OGS A;  4AED A;  4AW7 A;  5JOZ A;  4XZP A;  2XPJ A;  4MHR A;  1UYY A;  1U0A A;  2JG9 A;  2YFZ A;  3CJX A;  3FUQ A;  2VMI A;  4KG8 A;  4OUE A;  2CAU A;  4Q4X 3;  5FY4 A;  3F2Z A;  3RVH A;  3GGL A;  1D4M 2;  2Y34 A;  3H3L A;  4LBL A;  5E1R A;  3ACG A;  4Q5O A;  2Y0I A;  2JIC A;  3AMQ A;  3GBG A;  2RS5 3;  1J3P A;  2W91 A;  4ATF A;  4D69 A;  5FZD A;  3MUY 1;  4KGG A;  3R0R A;  2WT1 A;  2P34 A;  4JRA A;  2E7Q A;  2WL1 A;  3POI A;  2XJR A;  5FZ4 A;  3ZIW A;  1DZR A;  4DY3 A;  4CDW B;  2HWC 1;  3AVR A;  4FFG A;  2PAK A;  4X8N A;  2AC1 A;  2W47 A;  3A7Q A;  4YVS A;  4ASL A;  3MEP A;  1H4H A;  2AUY A;  3OUJ A;  1XOY A;  3PLQ A;  4HXC A;  2P37 A;  1HQL A;  1A3K A;  4NPM A;  1N1S A;  4YG0 A;  5LA0 A;  3FZ3 A;  1XYP A;  3VKL A;  4Q0S A;  1K12 A;  5T5O A;  2BOJ A;  4CEW A;  1UL9 A;  4GIQ A;  3VB9 A;  1LHN A;  1QJU 1;  1SPP B;  4AHW A;  1LOF C;  5C5U A;  5FYI A;  1RUD 1;  3LPG A;  2DVB A;  4OVE A;  4LBQ A;  3X29 B;  2B46 X;  4A7K A;  2R1D A;  1WKY A;  1NLR A;  1ZRF A;  4I0W B;  3NQH A;  3ZXL A;  3ZFG C;  4SLI A;  4N7U A;  2FCU A;  3VBS A;  2BVB A;  3ZN4 A;  1LEC A;  4A6S A;  1PMI A;  2CGP A;  1EY2 A;  3O1R A;  3CKH A;  4LK7 A;  4CVU A;  3V64 A;  4YVW A;  3PJQ A;  4FQZ A;  4ATE A;  3SXW A;  2CDO A;  3TEY A;  3AYD A;  3D3A A;  5A80 A;  1RUO A;  3GHN A;  2WSU A;  3LB9 A;  4COU A;  4FAH A;  2Y6L A;  5DG2 A;  4PDW C;  2ZHN A;  1JZ7 A;  5FQ0 A;  1DZT A;  3ETP A;  2F4P A;  2BBA A;  2WO3 A;  4XZU G;  5FK7 A;  4CXW A;  4YNI A;  2ZOE B;  1LEM A;  5C3R A;  3B93 A;  3GJB A;  1FOD 2;  3QCW A;  3A23 A;  4AHY A;  1QQP 3;  4AAP A;  1NCQ B;  1GMM A;  3OGG A;  3MF9 A;  5IAT A;  3MW2 A;  4UFL A;  2HEY F;  4XUO A;  3VD5 A;  1MEC 1;  1FMD 1;  1QJX 1;  2UU8 A;  3ES1 A;  3MDP A;  2RDN A;  3UET A;  2R06 3;  5SV8 A;  1PVC 1;  3SC7 X;  2PLV 3;  3UL2 A;  1NCR B;  3H0O A;  3KV6 A;  5FYH A;  2YGM A;  5H9P A;  1BK0 A;  1RUG 2;  3P3N A;  4BJ0 A;  5IT6 A;  4JHT A;  2QQL A;  1RED A;  3LSE A;  1NE4 A;  1SG3 A;  3OTF A;  1ZRD A;  4QPG B;  2UYA A;  4QKB A;  1C8M 2;  1R1A 2;  2WZR 2;  2GDF A;  3RNS A;  4XUR A;  2B4K A;  4GKY A;  1RUJ 3;  4UBH A;  1CQ9 A;  1YC6 1;  1POV 0;  4NPL A;  1OHF A;  1E57 A;  4UF0 A;  4A41 A;  3WF1 A;  2O14 A;  5GJ6 A;  4QD2 A;  5FMO S;  4AR2 A;  3CJI B;  1J1T A;  3TRS B;  2XON A;  3VD9 A;  1HRI 1;  4YGC A;  1VMH A;  2AH2 A;  4LTA A;  3S7E A;  2ZX0 A;  4BCU A;  4CUA A;  1LOC A;  2FCV A;  1W0N A;  5FYZ A;  4CSW A;  3WNP A;  2JD9 A;  4NHM A;  1ND3 C;  1PO2 2;  2VUC A;  2H6C A;  4YSF A;  2ZEZ A;  1A8M A;  2XDV A;  3N9N A;  4AQ6 A;  3C3V A;  1OH3 A;  5M0T A;  3AKT A;  3ZYJ B;  1K5M B;  2VOK A;  5JOW A;  2A73 B;  5FZK A;  5FYU A;  5BNP C;  1V6M A;  2HWB 2;  3NJX A;  5LZ6 A;  2HWF 1;  5EYX A;  5FWE A;  3VHP A;  1GU3 A;  4CDX C;  4GJZ A;  1O91 A;  4QU1 A;  3HPN A;  2DU0 A;  1EPW A;  1OLM E;  5F8P A;  1NY7 1;  1QU0 A;  1QH6 A;  4XAA A;  1H9P A;  2R32 A;  3H1Y A;  4YZ5 A;  3OEA A;  5FUN A;  1RHI 2;  3OGJ A;  3ZXK A;  2X8K A;  3VZK A;  2D6N A;  2BW8 A;  2OZJ A;  2PHD A;  5DAB A;  1HIX A;  2VL4 A;  1GYK A;  4UFI A;  5HI0 A;  1QGL A;  1D4V B;  1AL2 1;  1HXS 1;  5AC9 3;  4O9E A;  5DAX A;  2D3P A;  3LEM A;  4I01 A;  2WC2 A;  5F3I A;  5ACA 2;  3DYP A;  4NPR A;  4UOJ A;  2PFW A;  4AE2 A;  2OPK A;  4GWM A;  4LIT A;  3WDU A;  2JB4 A;  4FPK A;  1KDM A;  2JDH A;  2PHW A;  2VQ0 A;  4KWL A;  5A3U A;  1FPN 2;  5FRA A;  4AEJ A;  5LEJ A;  2ZMN A;  5FZM A;  4IV1 A;  2AR6 A;  1WW6 A;  3HT1 A;  3USU B;  3KT1 A;  3UYJ A;  1S4C A;  3WQ1 A;  1Y3T A;  1AR9 1;  2VH9 A;  3VBU A;  1UXZ A;  3SCH A;  4B3N A;  1WLT A;  1LJ7 A;  1RJ8 A;  1W6O B;  3MW4 A;  1RVF 2;  5IAX A;  3B9C A;  1C3H A;  1I5P A;  3AFK A;  4OUL A;  4Q1P A;  1GKB A;  4HG6 B;  3HAG A;  4M4R A;  1CES A;  1Y9Q A;  2HWC 3;  3NJZ A;  4XQW A;  1MZE A;  2D43 A;  4AK3 A;  3WF4 A;  5DDJ 1;  2I45 A;  5F2W A;  3TAY A;  3ZVX A;  2C9K A;  1ULF A;  3WEZ A;  4YRD A;  2JG8 A;  2JJ6 A;  4M3C E;  1UU6 A;  1TNR A;  2VZT A;  2E32 A;  3J9S A;  3KGL A;  1OUS A;  1TMF 2;  3DKQ A;  2WAB A;  3KZ4 C;  2WS9 1;  4I0A A;  4KWJ A;  5FY7 A;  1CIW A;  5F5I A;  4XF3 A;  4ARX A;  4PDW B;  1QJU 3;  5D2A A;  5FFO C;  2JWP A;  4IND A;  1AXK A;  1URX A;  1XNC A;  5FKC A;  5KHH A;  1CON A;  4K1Z A;  4RN5 A;  2HWD 3;  2WBK A;  1Q3E A;  1ZBE 1;  3WSO A;  4CDQ A;  4E8C A;  5A7N A;  4BME A;  2VNO A;  1AX1 A;  4GD4 A;  3FX3 A;  4XBQ A;  1YIF A;  2D7F A;  2DVF A;  1GWK A;  3VD7 A;  4BXS V;  1UOF A;  4Y3O A;  4PLN A;  3O1P A;  1BBT 1;  3USS A;  3PIJ A;  1SBD A;  2ARE A;  5DAQ A;  3I49 A;  1KFX L;  3V0B B;  2JX9 A;  1COV 2;  2ERF A;  4JGY C;  1UYX A;  3KCY A;  3V56 A;  3NNJ A;  1JU4 A;  1N1Y A;  1E5H A;  4WZF A;  5A3L A;  1ODN A;  2P4E A;  3SKV A;  3BYW A;  4YG3 A;  4AFC A;  4ASM B;  4YGD A;  3SIS A;  1VBB 2;  2XWB B;  2RS1 2;  4N43 B;  1NLS A;  1OOP B;  3FLR A;  4LKE A;  4FXG B;  4XFC A;  1QJX 3;  1FMD 3;  1M4W A;  4XJZ A;  5BNQ A;  1QJF A;  5EPA A;  3HOB A;  5CFC B;  3NV4 A;  4P5Y A;  3H50 A;  2A6W A;  2MEV 2;  4PCR A;  4D0Q A;  3WW2 A;  1GZ9 A;  3J8F 1;  2QQI A;  4HAN A;  4ET7 A;  3DPR B;  1UNB A;  3BIW E;  1GWL A;  1JZ5 A;  2GNT A;  4NIH A;  3AX4 A;  5C8W A;  4WM8 B;  4FPC A;  3WG1 A;  4E4S A;  1UPI A;  1W9F A;  5FBJ A;  3ME2 A;  2PHT A;  4OMD A;  4HKW A;  4XFG A;  4LE3 A;  2BWC A;  4NAM A;  3K4D A;  5AVA A;  3SLI A;  1PK6 C;  5CVR A;  4CDU A;  2V09 A;  4LLF A;  4AFD A;  2E33 A;  1V00 A;  4LJH A;  5JSP A;  3NKG A;  5T50 A;  5K7P A;  5BUV A;  3VZJ A;  3R4S A;  4L2N A;  4UFM A;  2GP5 A;  4A7Z A;  4PIZ A;  2WFF 1;  2J1E A;  4FT8 A;  2ADD A;  1HRI 3;  4XDO A;  3HJR A;  2W46 A;  2VOX A;  3Q8F A;  3H8R A;  3OD0 A;  2C9A A;  4LO4 B;  4CDQ C;  1W8F A;  1MVQ A;  4FFI A;  5JXI A;  1VAM A;  4FFH A;  1YQC A;  5LBC A;  2HH9 A;  5I8Y A;  1RC6 A;  3RMX A;  3K3N A;  5C33 A;  4Z1V A;  2GP3 A;  3I4I A;  4FOY A;  4FFF A;  4L11 A;  5CB7 A;  1YEW A;  1GQP A;  2B5H A;  1IS4 A;  4NOT A;  4YWA A;  2HWF 3;  4ZS3 A;  5HCB A;  3KVB A;  4LLO A;  4BQY A;  2Y6F A;  1HB3 A;  4JDN A;  3WUC A;  5A3P A;  4WVM A;  5FMC A;  1W6P B;  1AVB A;  3Q8A A;  5A6Y A;  1YUD A;  1OFN A;  3BIE A;  3WQ0 A;  3AJY A;  3MLL A;  3KQR A;  1I1E A;  4OZO A;  3CIH A;  1KQR A;  3B5L B;  5J96 B;  5GLW A;  1DFQ A;  1LU1 A;  1WA6 X;  1PGW 2;  2BFU L;  2JDA A;  5F5A A;  3OCP A;  2RS3 2;  2YBS A;  5BXX A;  1VBC 1;  1RUF 2;  4OUS A;  2VNG A;  3AYC A;  1HXS 3;  3R4D B;  1KJL A;  1RXF A;  1W6M B;  4EWE A;  5F7U A;  1SCR A;  5DMY A;  1X8E A;  4U36 A;  4BLI A;  2D6L X;  4M0N A;  1XE0 A;  4XBN A;  3WD5 A;  4LIV A;  1SCS A;  1OF4 A;  2MHF A;  2VNR A;  3PUS A;  4QX0 A;  4YZ3 A;  5GKA C;  2HEV F;  2VTF A;  3NNM A;  1S2K A;  1GP5 A;  1JZ4 A;  5FZ8 A;  1NA1 A;  3T30 A;  5FXZ A;  4UW4 A;  5FPX A;  5FLI A;  1AR9 3;  2B9U A;  2P6C A;  2XXZ A;  4IEW A;  3LQC A;  5FZO B;  3WNO A;  4FPG A;  3WHU A;  4A45 A;  2XQR A;  3EJK A;  1DIW A;  2W92 A;  2W5F A;  4BIO A;  2D40 A;  4IE7 A;  3IKW A;  3AB0 A;  2E31 A;  5DDJ 3;  4BPZ A;  1CAV A;  3CZU A;  4L0P A;  4ARY A;  2IVJ A;  1OSG A;  1F5J A;  4CUG A;  5J09 A;  1UQX A;  1BK1 A;  3VZO A;  3GZA A;  4N53 C;  5JIA A;  4RL7 A;  4AQS A;  2CGO A;  2ARA A;  2WS9 3;  3ZXE A;  3DUI A;  3RZG A;  2ZX4 A;  4XUP A;  3IT8 A;  3MFC A;  3CQO A;  4LK6 A;  2AAC A;  2VBD A;  3ITQ A;  3VGI A;  4CP2 A;  2XLF A;  3I97 A;  3ACL A;  3D0S A;  3RJ2 X;  5FPU A;  1ZBE 3;  4XEZ A;  4GH4 C;  3H7J A;  3O5S A;  4Y1U A;  1H6X A;  2W1S A;  1BZW A;  5DXD A;  5FAX A;  1UY3 A;  4KH9 A;  2YUE A;  2AGS A;  2VZP A;  3ZYB A;  2P2K A;  5D21 A;  3JQX A;  1BBT 3;  4Q0Q A;  1XND A;  3H1M A;  3RFR A;  1UYP A;  2YG0 A;  2OPW A;  2ETE A;  2W9X A;  3AK0 A;  2PMW B;  3LSD A;  2ZEW A;  3GCW A;  4I09 A;  5CFD B;  2TEP A;  5LA9 A;  2Q8E A;  4NII A;  4Y5T A;  5F5Q A;  5HCF A;  4EYU A;  5FOB B;  3HIF A;  2R7E B;  4ZKT B;  1YJL A;  2WN3 A;  2Y8K A;  2JDP A;  3KS7 A;  5GZD A;  5IVB A;  4GB3 1;  4H7M A;  3IAP A;  2EIG A;  5F9T A;  1G9A A;  4Z82 A;  1FOD 1;  1ONA A;  2EXH A;  3POB A;  1RMU 3;  2X53 S;  2OYZ A;  1S0C A;  2W87 A;  3WNK A;  5C70 A;  2JIG A;  4XCA A;  1OUR A;  4Q0P A;  1OPM A;  3I3Q A;  2QQO A;  2C26 A;  3J8F 3;  3EYP A;  5A7O A;  3O1O A;  4IE4 A;  5FLJ A;  4PLM A;  3SMH A;  5F3G A;  2D97 A;  1POQ A;  2D3S A;  1LEN A;  2WZR 1;  2R0H A;  2A6Y A;  5HV0 A;  2VMD A;  4WV8 A;  5DUX A;  3IDE A;  1IOA A;  4E8D A;  3D8C A;  2OUH A;  1VAK A;  1P8J A;  1NAE A;  4IDZ A;  5JVV A;  1WME A;  2CGN A;  1HX6 A;  1CWP A;  1KIT A;  3N9L A;  2A70 A;  2W94 A;  1JW6 A;  2JXA A;  5I0S A;  1MAC A;  4NMI A;  1O3Q A;  1YXW A;  1L7R A;  3LOB A;  1PO2 1;  2A7A A;  2DVG A;  4P9G A;  4K8F A;  3KCC A;  3SEP A;  3WQB A;  1OMI A;  3OGR A;  2UWC A;  3OPT A;  4QX3 A;  1ACC A;  4N90 A;  5L36 A;  2BYV E;  2V73 A;  3KF5 A;  4JQT A;  1GV9 A;  3IM0 A;  1N47 A;  5FR3 A;  3AZW A;  2R49 A;  2HWB 1;  1UZZ A;  5GAL A;  4HN0 A;  4ZON A;  4R9B A;  4OFG A;  4EN7 B;  4TZD A;  2YPD A;  2GNM A;  1DGW A;  4CA9 A;  2Q1F A;  3G6J B;  4FTS A;  4NRM A;  1YFY A;  1VRH 1;  2FQP A;  5A1L A;  5TSW A;  3RI9 A;  4TSV A;  5FZ0 A;  4QPI C;  1RHI 1;  4S2G A;  2K2S A;  4TLF A;  4LKF A;  2EXI A;  5A70 A;  4UFJ A;  3ZFE A;  1YWK A;  2QQK A;  4L97 A;  5FBZ A;  4MHU A;  2UYB A;  1VBC 3;  1YIP A;  3CF6 E;  3I59 B;  2N7G A;  2DBI A;  3OBT A;  1JHJ A;  4RHV 2;  3PUR A;  1LU2 A;  3MUZ 1;  2VCM A;  1AR8 2;  2W0X A;  1O3S A;  2EVX A;  3ZM8 A;  1B35 B;  4AL9 A;  2JEM A;  2ZGU A;  3BKZ A;  1EAH 1;  2EID A;  5ACA 1;  4YM1 A;  3BTY A;  2PHF A;  1K5J A;  3AL5 A;  3WUD A;  1CN1 A;  1XNB A;  1N1T A;  1ULE A;  2A3Y A;  1V0A A;  2FZ1 A;  2KD7 A;  4CU7 A;  4Q4V 2;  2QQP A;  2HWE 2;  3MO4 A;  5HXM A;  4BU2 A;  1CGP A;  1FPN 1;  1XNK A;  2WQ8 A;  4AWD A;  3NAP C;  3PL0 A;  3VL8 A;  5C4W A;  3ZPO A;  5J3U A;  2DUP A;  4LEJ A;  2RDR A;  4FPY A;  4DNY A;  3T4V A;  1IZ3 A;  4PF1 A;  5JXG A;  1RVF 1;  4LKD A;  1HQN A;  5FPV A;  2DUR A;  4L92 A;  2XHN A;  4B7K A;  4QAW A;  2C4X A;  4BK4 A;  1W06 A;  1S0F A;  3J7L A;  4MO3 M;  3WF3 A;  2YU1 A;  1G9D A;  3SEE A;  2W1U A;  1HN0 A;  4RS5 A;  3E97 A;  1UXX X;  1CD3 G;  2UWB A;  2WIN B;  3NV2 A;  5H9R A;  1WCU A;  2BEO A;  2GND A;  3T4H B;  4WM7 B;  5KBF A;  1CIY A;  1TMF 1;  1Y9M A;  2YZ4 A;  1D7P M;  2XLA A;  2EAA A;  4NRP A;  2XJQ A;  2RR1 2;  4MGQ A;  1DP0 A;  3QD6 A;  2X5I B;  2R04 1;  3D82 A;  4PQQ A;  3GBW A;  1W2A X;  1L7L A;  3JB4 C;  3FHA A;  2AEZ A;  1DZQ A;  1G6N A;  2XH6 A;  3WP4 A;  3ZSE A;  4A42 A;  4Y20 B;  3AMM A;  3PJY A;  1DF0 A;  2VU9 A;  3NVC A;  3M7A A;  1UCX A;  5FY8 A;  2BGP A;  2I2S A;  4XJ8 A;  1NOV A;  5GLV A;  2RJK A;  4MH0 E;  4ZU4 A;  5CIS A;  3ACF A;  1X33 A;  2WA3 A;  1ENQ A;  1JOD A;  2JDU A;  4XMI A;  3MYX A;  5JLV A;  1LTE A;  1JZ8 A;  1S0B A;  2JDY A;  3H7Y A;  4HKL A;  3TN9 1;  1IKQ A;  3K4Z A;  1HKD A;  5FXV A;  3DKW A;  3TNQ A;  3NST A;  3RYP A;  4Y4Y A;  2IZW A;  5EIY B;  4BA6 A;  4M4P A;  4GB3 3;  5GLZ A;  4Z2A A;  4C90 A;  2P3I A;  2RS1 1;  2QKD A;  2XJV A;  1G86 A;  1NCQ A;  3B94 A;  3L2H A;  4YW5 A;  5GLT A;  5FXX A;  4LNV A;  3JD7 2;  5F5C A;  4IL7 A;  1WLD A;  3M3Q A;  4P14 A;  4V2W A;  4NWW A;  2CU5 A;  4XVH A;  3SH4 A;  5BY5 A;  2PQQ A;  4LO7 A;  3DN7 A;  3B69 A;  4D94 A;  4CEY A;  2FHR A;  5IVV A;  1KD7 A;  2Z79 A;  2C6S A;  1AYM 2;  1ZBA 1;  4CUC A;  2B7Y A;  5FP3 A;  2R0F A;  3N7L A;  5IJR A;  1GZW A;  3O12 A;  3O0V A;  4EWD A;  3NNG A;  3WP6 A;  4LIU A;  3MHZ A;  1L3J A;  3VBR B;  2BOI A;  4RFR B;  2WZR 3;  5A3T A;  2WQ4 A;  3C7H A;  4RS5 C;  1N3O A;  4COV A;  4YW4 A;  2G9Z A;  2WSV A;  2W1W A;  5JWP A;  3O0W A;  3I2G A;  4CCN A;  5ABJ C;  4PIX A;  1Q43 A;  4LO6 B;  5D8A B;  2EIC A;  1O6U A;  2QDN A;  1RUI 1;  3M3E A;  4LBN A;  2GNB A;  1OD3 A;  5FCC A;  4EN0 A;  5F32 A;  5FKB A;  1CAU B;  4IEQ A;  4LKS A;  4IEX A;  5JXH A;  3UK9 A;  3NW4 A;  4QPI B;  1YRZ A;  2VVF A;  1SZB A;  3FHQ A;  3OGV A;  5A7Q A;  5BNN B;  1DU3 D;  2HKX A;  1SLA A;  1W2O A;  3E6D A;  4W6X A;  3RYK A;  3T0A A;  3FN9 A;  5A33 B;  1PO2 3;  3JQW A;  4JVA A;  1A34 A;  3LOI A;  1R08 2;  4Q8K A;  2NQY A;  1TME 2;  3VBO C;  2QQM A;  5C3Q A;  3J7H A;  3IPV B;  1AX0 A;  4ISR A;  5H9Q A;  5IW0 A;  4Q29 A;  1UYZ A;  4Q4W 1;  1V6J A;  1RJ7 A;  2WLP A;  3RQ0 A;  2HWB 3;  2ZGO A;  5FYS A;  2YDE A;  5JR7 B;  1PM4 A;  4QX1 A;  3AP9 A;  4BLJ A;  4IE6 A;  5LA1 A;  1RTV A;  1VRH 3;  1WD4 A;  3IB3 A;  1ZRE A;  3VBH C;  5BYN A;  1PIV 3;  4O9G A;  1UOB A;  2P3J A;  4QHZ A;  3POG A;  3HR9 A;  5E88 A;  4QQ2 A;  4FPF A;  1PGW 1;  4E4Z A;  2RS3 1;  4JAA A;  4XCB A;  1W8T A;  1RUF 1;  2EXK A;  1OQE A;  3EB7 A;  4L8Q A;  4KQ7 A;  2QQW A;  3OSD A;  4CEY C;  1LGB A;  4XTM A;  1H1M A;  3EQE A;  1EAH 3;  5ACA 3;  3SH3 A;  1HJG A;  4LBK A;  1HV0 A;  4UW5 A;  3PME A;  1UY4 A;  3R4U A;  4MGY E;  4NHK A;  1W6N B;  1DDL A;  2GC3 A;  3ILN A;  1LHO A;  3CU7 A;  1IPJ A;  3BVC A;  1UIJ A;  1FPN 3;  4CP9 B;  4DZG A;  5A6X A;  3USU A;  3MLK A;  1U5Y A;  3AZY A;  4KGQ A;  1DQ0 A;  2P5B A;  4LA2 A;  1AYN 2;  5T5P A;  4TWT A;  3FLP A;  5FUP A;  2RMU 1;  4P08 A;  4IW3 A;  1SLI A;  1CR7 A;  1RVF 3;  4XUT A;  1MQT B;  1UZV A;  3B7M A;  4XBL A;  5FWJ A;  2PHU A;  2W3J A;  3BCW A;  2CYF A;  1GBG A;  1JOP A;  2ZMK A;  3T08 A;  1ZX5 A;  4DMI A;  3I54 A;  5JPN B;  1O5L A;  4CCM A;  5EZW A;  1MPX A;  4FQ4 A;  4RR3 B;  4UW3 A;  4K3U A;  5FZ7 A;  5GZF A;  4CYD A;  3PU3 A;  5H9S A;  3BU0 A;  3ATG A;  4PHZ A;  3RZZ A;  1JI6 A;  4NIA A;  2QFE A;  4BQX A;  1SLT A;  1TMF 3;  3ORJ A;  2NP0 A;  1DLL A;  2LAL A;  1CJD A;  4UBG A;  5F2S A;  2WO1 A;  2VW1 A;  4Y33 A;  3VDD A;  3TYJ A;  3VV1 A;  2OT7 A;  2OKX A;  2ARB A;  2R04 3;  4LOT A;  4QB6 A;  3ZN6 A;  2J1V A;  2WZE A;  3DF0 A;  4Y1V A;  3OJB A;  3CLP A;  3LWC A;  5J98 B;  3LA7 A;  3AVS A;  4ORF A;  5JZG A;  4BHP A;  4JTO A;  4AGG A;  2Y6G A;  3OOX A;  4R9A A;  4H55 A;  1I3H A;  4QKD A;  4AZZ A;  4C91 A;  3WR0 A;  4IGP A;  4RQP B;  3V0B A;  4XF1 A;  5K9Y A;  3GYD A;  4KWU A;  4PF5 A;  2ZZQ A;  5L9R A;  3TN9 3;  1W9W A;  2DU1 A;  4HMZ A;  4QGN A;  2OUJ A;  3NWK A; 
#chains in the Genus database with same CATH homology
 5FZO B;  5A1L A;  4GJY A;  4D6S A;  3LD8 A;  4Y3O A;  5FZ0 A;  5FPL A;  5FV3 A;  5A7S A;  2WWJ A;  4DIQ A;  3NJY A;  3KV9 A;  5F32 A;  4HON A;  5LW9 A;  5FY1 A;  3ZLI A;  5FZ6 A;  4UF0 A;  5A7Q A;  3U4S A;  5FZL A;  4CUG A;  5IVC A;  3PUR A;  2XML A;  5FZO A;  4CCL A;  3KV4 A;  5FYV A;  5LWB A;  4QXB A;  2YBP A;  3AL5 A;  5IW0 A;  4D6R A;  4CSW A;  5FYZ A;  5FPU A;  5FPB A;  4UF0 B;  4BU2 A;  2WWU A;  5FYS A;  5FZB A;  5FXW A;  5FZE A;  2Q8D A;  4EZH A;  5IVJ A;  2XDV A;  3N9N A;  5E6H A;  3ZPO A;  3PDQ A;  5KR7 A;  5FY9 A;  4D6Q A;  5FZK A;  5FZH A;  5FYU A;  5FYB A;  5FY4 A;  5FZA A;  5FPV A;  3RVH A;  4HOO A;  5FBJ A;  5FJK A;  4GAZ A;  5FWE A;  3DXT A;  4QWN A;  5FZ9 A;  4QXH A;  5FZG A;  5FZ3 A;  2Q8C A;  4GJZ A;  5FZI A;  5CEH A;  2YU1 A;  4QU1 A;  4Y4R A;  2Q8E A;  5FZD A;  4EYU A;  5FP7 A;  2GP5 A;  5FP4 A;  4IGO A;  5FUN A;  5FZ4 A;  4IGQ A;  4CCN A;  5IVB A;  4XDO A;  4QX8 A;  3AVR A;  5FZF A;  5IWF A;  5FYT A;  4TN7 A;  5K4L A;  4EZ4 A;  5A3W A;  2P5B A;  2OQ7 A;  4C8D A;  5ISL A;  5F3I A;  3K3N A;  4LXL A;  2GP3 A;  2W2I A;  4QXC A;  5A7O A;  5FUP A;  5F3C A;  3DXU A;  3N9Q A;  5FY0 A;  5IVF A;  5FY8 A;  4E4H A;  4LIT A;  4CCO A;  2OS2 A;  1VRB A;  3KV5 A;  5F3G A;  5FYI A;  4CCJ A;  5FWJ A;  5LY1 A;  5A7W B;  5A3N A;  3KVA A;  5FZM A;  4URA A;  5ANQ A;  5FY5 A;  3KVB A;  4CCM A;  5A3P A;  3UYJ A;  5A1F A;  5FZ7 A;  5FXV A;  3PU3 A;  3PTR B;  5FYM A;  2OX0 A;  4BXF A;  5IVE A;  3N9O A;  5FYY A;  4V2V A;  5F2S A;  5F39 A;  4BIS A;  2VD7 A;  3PUA A;  3PUQ A;  4NUB A;  4Y33 A;  5F3E A;  3N9L A;  2YBK A;  2OT7 A;  5A7W A;  5F5A A;  5F37 A;  5FXX A;  2YBS A;  5A80 A;  4ASK A;  5F2W A;  5FZ1 A;  2XXZ A;  5F5C A;  4V2W A;  5IVY A;  5FZC A;  2PXJ A;  5FP8 A;  3AVS A;  3N9M A;  3OPT A;  5IVV A;  5FY7 A;  5F5I A;  4LIV A;  5LY2 A;  5FP3 A;  3PUS A;  4XDP A;  4AAP A;  4QX7 A;  2OQ6 A;  5FYC A;  4LIU A;  5FP9 A;  3K3O A;  3N9P A;  4IGP A;  4DO0 A;  2XUE A;  5A7P A;  2YU2 A;  5FZ8 A;  4CCK A;  5A3T A;  2YPD A;  3K2O A;  5FJH A;  5FPA A;  3PU8 A;  3KV6 A;  5FXZ A;  5A7N A;  5FYH A;  3LDB A;  4GD4 A;  3OPW A;  4AI9 A;  3U78 A;  3AL6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...