3HQRA

Phd2:mn:nog:hif1-alpha substrate complex
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
225
structure length
225
Chain Sequence
QTKPLPALKLALEYIVPCMNKHGICVVDDFLGKETGQQIGDEVRALHDTGKFTDGQLVSQKSDSSKDIRGDKITWIEGKEPGCETIGLLMSSMDDLIRHCNGKLGSYKINGRTKAMVACYPGNGTGYVRHVDNPNGDGRCVTCIYYLNKDWDAKVSGGILRIFPEGKAQFADIEPKFDRLLFFWSDRRNPHEVQPAYATRYAITVWYFDADERAAAKVKYLTGEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/transcription
molecule keywords Egl nine homolog 1
publication title Structural basis for binding of hypoxia-inducible factor to the oxygen-sensing prolyl hydroxylases
pubmed doi rcsb
source organism Homo sapiens
total genus 66
structure length 225
sequence length 225
ec nomenclature ec 1.14.11.29: Hypoxia-inducible factor-proline dioxygenase.
pdb deposition date 2009-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13640 2OG-FeII_Oxy_3 2OG-Fe(II) oxygenase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.620 Mainly Beta Sandwich Jelly Rolls q2cbj1_9rhob like domain 3hqrA00
2FCUA 5IATA 4Q5OA 5DAXA 4ZONA 2RDSA 5C5UA 2RDQA 4NHLA 5LASA 5LBCA 4NHMA 3NNFA 3OBZA 3HQUA 3GJAA 5L9RA 4UWDA 2FCVA 3EMRA 4MHUA 5LATA 2JIJA 3HQRA 4KBZA 4XAAA 5A3UA 2HBUA 3OUJA 5DAQA 5EQUA 2JIGA 4ZPIA 5IAXA 3KT1A 3KT4A 5L9BA 3GJBA 2Y33A 2G19A 5LBEA 2Y34A 3NNJA 5EP9A 3NNLA 3GZEA 4JZRA 4XC9A 2A1XA 5L9VA 2FCTA 5LBFA 4XACA 5C5TA 5IAVA 4BQXA 5HV4A 4NHKA 4NHXA 4XCBA 3DKQA 4XCAA 2RDRA 4NMIA 4NHYA 4IW3A 5LBBA 3NNMA 2HBTA 2RDNA 5ERLA 5M0TA 3OUHA 2V4AA 5LA9A 3KT7A 4J25A 3BVCA 5DAWA 3MGUA 5EPAA 2RG4A 3ITQA 3OUIA 3W21A 4Y5TA 4BQYA 5DAPA 4BQWA 2G1MA 4XABA 4Y5SA 3W20A 3PL0A 5DAVA 5HV0A 5LB6A 4NAOA 2OPWA 4MHRA
chains in the Genus database with same CATH superfamily
1PK6C 1UX7A 1VRH1 2VQAA 4CCMA 2QQKA 1NY72 1Q5OA 2A3XA 2D5FA 2VG9A 2PLV1 2XJUA 2YY1A 3N35A 4LO4B 5IJRA 1OPOA 2Z4FA 1QQP1 1RHI2 3C8XA 4MGZE 4BB3A 3E6BA 1GZWB 3VDBA 1PVXA 1ENQA 3T2QA 4F3JA 2KD7A 2JKXA 2GC0A 1DGRN 4GQ7A 1LEMA 3GJAA 2GN3A 3ACFA 3OTFA 1AR93 3V56A 1LRHA 3THCA 3OPTA 3BALA 1CIYA 1RMU2 1UYYA 4HMZA 2FCVA 3NV3A 3J26N 4LEJA 2XL7A 4R9DA 4K8FA 3AP5A 1QOSA 3GNEA 3ON7A 1ZRCA 1PMIA 5T54A 2PMWB 2VMCA 1SFYA 2Z5WA 2A73B 3AL6A 4JHTA 4NPRA 5LATA 2B7YA 2UYBA 3MIGA 1PZ9A 5DUUA 1UZ0A 2WT2A 4BU2A 5BNPA 2D6PA 3WF4A 1F5JA 2H6CA 4YW2A 4ZU7A 4S2GA 2DVBA 3LGRA 1UU6A 5A6QA 3ZYRA 4CP0A 3N7MA 4AVTA 1ULGA 3J4UH 4CTEA 1LAJA 1J59A 5CNAA 3FMGA 4WVVA 3G7DA 4ZPIA 1RB8G 3H3ZA 3TAYA 2VPVA 3T1MA 1UMIA 2DCZA 1OOPB 2DYCA 5F3IA 1GNZA 4DUVA 4HVQA 1VBB1 4N53A 4LBLA 4LOTA 3CBNA 5FBJA 5FPLA 3DV8A 1M4WA 1JBCA 1NCRA 1W6OB 1VMJA 2KM2A 3I7DA 4XOGA 1R1A3 4GA9A 5JPMB 2PHFA 1GANA 3MF9A 4GWJA 3VLBB 4URAA 1RUC3 1ULFA 1IG0A 1ZX5A 4FCAA 2ZGRA 4R9CA 5C5TA 4MGQA 2VOVA 2UURA 2YG0A 3I2JA 2W92A 4BE3A 1LGBA 5CBLA 3I3MA 2WA4A 2G4IA 1AXZA 3WG4A 5FFOC 5CFCB 2NQYA 1RUH1 3Q9OA 1K5MC 5T55A 1SPPB 2GNTA 5CADA 4DXSA 4AHWA 2PYTA 2HWC1 2VMEA 4RSUA 1FOD2 5ANNA 4IW3A 3VZLA 3BYWA 1CJDA 1CQ9A 1YI7A 2V4VA 2OX0A 2V72A 1NQDA 1D4M3 2D6MA 3B9IA 3SISA 3FN9A 2NLRA 3AL5A 5JPNB 1X82A 5KC5A 2F6BA 1PO11 4XZUG 4OQ9A 5A7SA 2J1AA 5I0UA 1LGCA 4MADA 3CHXA 5ABJC 1HRI1 3N9PA 5J7MA 1AYN2 2D5HA 4W65A 3H3UA 1QJY1 2HWB3 4I0WB 1NLRA 1XXNA 4MGKE 2WNUB 3VBSC 3WR0A 2R0HA 2DCYA 5JR2A 3AKPA 2PHUA 4XHBA 1EP0A 5IVVA 2YFZA 3LA3A 1N1SA 2F4PA 5EV7A 1UO9A 2W5FA 1O5LA 4YPJA 5I0DA 3AMQA 2BEOA 3H42B 1H2LA 4BCUA 3SEPA 5F6KA 5TSWA 1W2TA 3MF6A 4PLNA 3RS6A 2IFRA 4LBMA 5IUQA 5LB6A 3I3DA 1WBLA 4OUEA 3S7EA 3NNGA 1DQ0A 3TN92 1F4HA 1F5FA 2YC2A 4LO5B 4BM8A 4CDWC 1S0JA 2VW0A 1VBA1 3E1F1 2NYYA 5F3GA 5ACA3 1NXMA 3O0VA 2BTVC 2DVDA 5AC92 1ZZ9A 4ZU5A 3T4VA 4TZDA 2IXKA 4NHLA 3ES1A 1QWRA 3OYWA 2I07B 3WF1A 4Q26A 4XQ4A 4A4AA 5C3RA 1BKZA 3KQ4B 4JRAA 2ZX4A 4QGNA 4Q29A 1ZRFA 1FV2A 1UY2A 3I3QA 2WINB 1GOHA 1OD3A 1XE7A 2QZ3A 1UMHA 3ECQA 5DDJ1 3DYOA 3NKTA 4I2OA 3MFAA 2NMOA 4XF1A 4D6RA 1QKQA 1UZVA 5F5CA 2P2KA 3J8F1 3AVSA 2R071 3E5UA 3AZVA 4NPMA 4O9EA 4QAWA 3J7HA 4TLFA 4FPGA 3RDIA 3N7KA 5C8WA 2LALA 1UU5A 2EIEA 4KGGA 3AMMA 5FYIA 4Q4W1 1QDOA 4Q27A 4PIZA 2W94A 4BISA 1OF4A 4IQPA 2VUCA 2JG9A 3J7LA 3OUJA 4P02B 4XEZA 5CKQA 5F32A 4FOWA 5JCTA 2JE8A 4UBHA 4MGIE 4CSWA 3JB8A 3H1MA 2VU9A 3GDBA 1MS3A 4QKBA 5HCBA 2CWMA 1E5RA 4UT5A 1W8OA 2MEV3 1ZZ7A 3G6JB 3M7AA 1Y9MA 5FYTA 2ZAAA 2NMNA 4AQ6A 2XQXA 1V6MA 1RC6A 2QQOA 5FQ0B 4CDWB 5LEJA 4CZSA 1RVF1 2AH2A 4GMP0 1GZ9A 1JN2P 1YQ5A 4DNYA 1ULDA 3BIWE 3GGLA 2GALA 2W9XA 3A23A 2J1RA 3POGA 3PVOA 5C3QA 1QJU3 4XJWA 3N9NA 5GLTA 4CCKA 5IVBA 2VOTA 5T52A 2ZX1A 1FNYA 2R6QA 4E2QA 1RUF2 1UIJA 4LLFA 3FHAA 5IVEA 1AR63 3ELNA 3UETA 5FOJB 4LO6B 1C8NA 2XMLA 4E4ZA 1RUG1 2XLGA 1XU1A 2LW8A 4XF3A 3JCIA 2WZPP 1IQDC 4E4HA 3O1PA 4NJ4A 3LOBA 1V6JA 2YMZA 5EJZB 3ACGA 2VM9A 1ENSA 1N1TA 4IEYA 4A41A 1HN1A 4D6SA 1A3KA 4EZHA 4GWIA 2VQUA 5F7UA 2WO3A 3UKVA 1WCDJ 1YXWA 3MYXA 3BVCA 1JZ3A 2WS93 2XWBB 4Q0UA 1KEXA 3VL9A 5DAWA 4BIFA 2LRPA 2EA7A 4IEOA 1YQ8A 1QY4A 4YG0A 2O14A 3VZKA 4ZZ8A 1O3TA 2BUKA 4XF9A 1KITA 3OOXA 3OGJA 5DMYA 4AI1A 2DTYA 1JZ6A 4MV2A 3L2YA 4AHYA 1QXPA 1ZBA2 1BEV2 3K75B 3W20A 4XDPA 4ARXA 4LA3A 5GZDA 2EXHA 3ES4A 2LS6A 1HQLA 3HWJA 4AHZA 3POSA 1RUOA 1EV13 5HV0A 2E51A 2PFWA 4LO8A 1JZ8A 3DKWA 2JWPA 4G4FA 4Q8LA 5FZIA 1OFSA 1C1FA 2SLIA 4N9HA 3I59B 5FWEA 3VKOA 2RDSA 1UZZA 2VMHA 2QFEA 2VZOA 1W06A 1WLWA 5JI7A 1QNYA 2MNGA 2A3WA 2RS31 2ATFA 1XU2A 2YGMA 4Z92B 2ZA9A 4YVSB 3IIIA 3P3NA 4XMAA 2C24A 2GSYA 5KBFA 4DB5A 4AEDA 1FAYA 5FLJA 4TLGA 2WFF1 4D7YA 5A33B 4XAEA 4CCLA 2BFUS 2HWD2 2YZ4A 3C7FA 4IV3A 4XFCA 3LA7A 4E4DX 1NOVA 2FDKA 3IN9A 1OSGA 5JXGA 1L3JA 2QJVA 1UY3A 1LNSA 4Y4RA 1DP0A 4ZS3A 3ZSMA 4DFSA 2PHTA 3OSDA 3VZOA 4RS5A 2R16A 5A6ZA 1KFXL 1GNHA 2BNNA 1H8VA 2GC1A 3LCPA 3CEWA 1QF3A 2ZGUA 1MR5A 1I6XA 4FPJA 1OC1A 2YV8A 2DV9A 4DIQA 5KR7A 1JYCA 1ZBE3 5BXXA 3QH7A 3KT1A 1PMJX 3OGRA 4A2UA 3GJBA 3A21A 3PNAA 4IDZA 4MVTA 2CAUA 2GNMA 4HN1A 3AMNA 3I2IA 3ZM8A 5LWBA 2XONA 3NNJA 4G9SB 5LZ6A 1QJX1 1H8TA 4HETA 1W90A 1PM4A 4HPKB 4YW4A 5FZ3A 2Y6LA 1UOGA 1SQ4A 3ZN5A 3AYEA 3VKFC 3AFGA 1RUH3 2PQQA 2XG3A 2CV6A 1R081 3QLQA 5F3EA 2HWC3 5KXCA 5T5PA 1MEC2 2VTXA 5FLHA 1NKGA 2AEZA 4DPNA 2EXKA 4BPZA 1MQTB 1H2MA 1W99A 3UKTA 4AFMA 4XW3A 3WF0A 2C0ZA 1KS4A 2OA2A 1W8ZA 3DCQA 2L9LA 4CCNA 4COUA 1PO13 2PN5A 2VH9A 1VPHA 3TB0A 3RJRA 3RZKA 3IPVB 3MLKA 3ZN4A 1PIV3 3JQWA 1CR7A 3PMEA 1WCSA 4RHV3 3DYPA 1Z7S3 4TWTA 4LTAA 4FPCA 4UW6A 3K48A 1F9KA 2CTVA 4HL0A 4UFLA 4NIAA 1NZIA 1GV9A 3BU0A 3ALQA 5CKNA 2HWF3 3IT8A 2YU1A 2W52A 2QQNA 1CJPA 3MW2A 4Y5TA 1OLME 4GJYA 1C1LA 2JG9C 1FPN2 4HSJA 5FUIA 4BQYA 2ARCA 2XL9A 1LODA 3AMPA 2RMU2 4LK7A 3U4SA 1FT9A 1MS9A 1OUXA 1S2BA 4FAHA 1ND2B 3SCHA 5FY9A 4CDXB 3RYPA 1S2EA 2YHJA 3VN4A 1RUD2 4OHWA 4UW5A 2OPWA 1U0AA 2YC0A 1H6YA 1HX6A 2DUQA 5KXBA 3NAPA 3NJVA 4EE2A 2Y38A 3MICA 4MOAA 1HB1A 2RM22 3IDCB 1PMHX 4CU9A 1MZ5A 3C7OA 3M3OA 1EPZA 3ZMNA 4HZFA 5DDJ3 3I2FA 3FFQA 4M3CA 3ZVXA 2J1TA 4JDMA 1PGL1 5IK8A 3NNFA 3J8F3 5DUWA 4XPVA 2XLFA 4ASMB 4UYBA 1OVSA 3ZYPA 3FHIB 4XF4A 2D97A 5L9RA 3E97A 4EWEA 4JKLA 2ARBA 1B09A 4Q4W3 3GBWA 1IS4A 2ZPXA 4MGSA 5IVCA 1MS1A 1OURA 4RFT0 3UNPA 3VUOA 2W1QA 3ZN6B 4Q4Y3 5LRSA 5K9YA 4QHBA 1N1YA 2DUPA 3HQRA 2Q1MA 1JZ7A 1XPWA 1QOOA 1D0HA 2RR13 1GZWA 3IDBB 4OUMA 4E8CA 2HWE1 3WY6A 2A70A 4C91A 4EN0A 2VOXA 2QTWB 3OBAA 2GP5A 3WW2A 4CCDA 1ZZ8A 4U2AA 3WCRA 1VE0A 1WW4A 3WDXA 5C4WA 5JOXA 2BVBA 1QMJA 3KT4A 4P5YA 3MW4A 3OEBA 1GKBA 5FZ7A 3ROUA 3ZYGA 5CG9A 1W0NA 3VBOB 1BYHA 1LECA 4M3CF 3BUCA 5K4LA 3C2UA 2VZTA 4PF5A 2VECA 2Q30A 1AR91 3AKSA 2FDFA 2GDFA 2OKXA 3WUDA 4LIUA 2OVUA 5F3CA 2X5IB 3LF7A 4QU2A 4NUBA 4RA0A 3WNPA 1SLBA 1UOJA 1V9U2 4LKSA 2AENA 3BTXA 4XCAA 3LEMA 3T0BA 2A7AA 4IE6A 1S55A 1OBNA 2BZDA 1URXA 4RGAA 5EZWA 4CEYB 2AR6A 2CNAA 3DXUA 4RGKA 1GWMA 4BXSV 4AEDC 4LUMA 2QQIA 1AJOA 5FWJA 1V6LA 3KVAA 3UKNA 2W08A 4FSJA 1W6OA 2WR9A 5BV6A 4IV3C 4L99A 2R7EB 1GZCA 1UZYA 2OUJA 4FBFA 3BTZA 3FUOA 2OQ7A 2RS53 4OZOA 1KQRA 2ZGMA 2DVGA 1IGOA 4P9XA 3GZUC 4DUXA 5FDBA 4LOSA 3KMHA 4HLTA 1YWKA 2WLPA 4FAGA 1YJLA 1C4RA 3BIEA 2J1VA 4XYXA 1W0OA 2DF7A 4COWA 5FZCA 3OUIA 4XE9A 1N47A 3I54A 2A5ZA 2AEYA 2ENRA 1R1A1 1LOBA 5JMCA 1TG7A 4BIOA 3POIA 4KGQA 3DN7A 2GC3A 4BQWA 1RUC1 3GZAA 4QB2A 5A3TA 1LHNA 4F83A 5DZFA 5FMOL 4CDUC 2BNOA 3AX4A 1G9AA 4UFMA 3LDKA 4Q4V2 2ET7A 2HLEA 4Q0PA 4WM7B 5LA0A 1EUTA 3JZVA 4ISRA 4CP1A 2DCTA 1H8TC 1GLHA 1W2UA 3K77A 3FLTA 4P9LA 4FPEA 3SLIA 3ZXGA 4IEQA 1UOFA 2WFF3 5K0UB 3PMSA 4HT1T 5CB7A 4KG8A 4QKDA 4MGTA 1G9FA 4NIHA 1D4M1 3MI8A 3RZGA 1MVQA 1Z78A 3FLRA 4AFCA 5L36A 5B2GB 4N43B 2D44A 2XB6C 4QX1A 1AL23 1VBC2 3I8TA 4UAPA 3WP3A 4Y1UA 2WO2A 4UWDA 3I2KA 5CG8A 3MZHA 1BQPA 1MS5A 3AC0A 1WLTA 1HDKA 4HK9A 3OY8B 2R072 3Q8AA 4DUWA 1AR71 2HWB1 1ZVFA 1KJLA 1TME3 4UXAA 4XTMA 4LKDA 4XMIA 2AZ5A 4Z2AA 4Q4X2 1EAH3 3ZXEA 1LU2A 4CYDA 5FP4A 3M8LA 4IEXA 4BQ5A 1ENRA 4A3XA 2JJ6A 3A0NA 1J83A 3HT1A 4QPGB 3LSDA 5LY2A 4AL9A 4COZA 3B00A 2H6BA 3NO8A 4JTNA 1UN1A 5T5JA 2ZX2A 3UT0A 3H1YA 1QJX3 1OA4A 1AYM2 2BQPA 4AZZA 2XJTA 1GQGA 2ZMNA 4PBOA 5I8TA 3ZOIA 1K5MA 1W9YA 2C1FA 1RXFA 1OKOA 1S0CA 3BTYA 3DYMA 2MHFA 4KG0A 5ACA1 1DGWX 1FNZA 2VCMA 2ZGPA 4NR1A 2GP3A 3RWKX 1PZ7A 1KS5A 3BI3A 2VL4A 1GR3A 1RHI3 2W47A 4WM8B 4CDUB 2HYKA 5FZKA 4DS0A 2IC1A 1PVC2 4YZ3A 4PDWB 4BQ4A 3CO2A 4QDSA 5FZFA 3Q8CA 1NLQA 1WA6X 2Q1FA 3WOGA 4AI8A 2ZHNA 4CDQC 4M0HA 3ST7A 5E89A 4ARYA 4DOUA 5GM0A 1GWLA 3H50A 4YM1A 4QGLA 3M4FA 2JX9A 3EO6A 4NHXA 4BA6A 5FPAA 1MZEA 3JB4C 4YYOA 1D2SA 2ORZA 2ORXA 3MUY1 4DEVA 4UI9L 4YM3A 3TWIA 4JGYB 4I09A 4EYUA 4IL7A 1HN0A 4KQ7A 5HBAA 2ZKNA 2XJQA 4IXLA 1JU3A 3WDUA 4AVVA 2PQSA 3D5OA 2JECA 1JOPA 2ZGOA 4A6SA 5FUNA 5M0TA 2PA7A 5FQ0A 5LK5A 4CDWA 5A3LA 1Y3TA 5LA9A 1YFUA 2FDGA 4LUKA 1POV3 1XYOA 2BU9A 3H3LA 4SLIA 4BXFA 3M3IA 4XVHA 4ASLA 4XFHA 3VBHB 1ASJ2 2BWAA 1WW6A 1PO21 2D93A 2W91A 4AFAA 1U5IA 2VGDA 3P3PA 1RGSA 3S7IA 1UPSA 4QX2A 3KCCA 3QACA 3VDAA 3HT2A 3ZYBA 2PHXA 2GU9A 3VKLA 1J1TA 2NM1A 3B7MA 1IS5A 4R9AA 5CIRA 5KXDA 1VBE1 4FFHA 1YFYA 4H7MA 4K3UA 1QJU1 2J1SA 3RRDA 5JXJA 2D3RA 2Q4SA 5BY5A 1BLZA 1ULOA 2VZSA 3GBFA 3FHQA 3GZTB 1XQNA 3WNKA 3GYDA 4WVMB 4EN7B 5GZGA 2QQVA 1AR61 3ILFA 4QKNA 1FOD3 4QHOA 3WDTA 1UMZA 4HBNA 1DHKB 5FAXA 4YARA 4CDQB 1BK0A 2JB8A 2X53S 3ZXKA 1WUVA 1TEIA 5C3SA 3BOWA 1X8EA 4Y5Z0 5BNOB 4XHXA 3SKJE 1JYNA 5FLIA 2TNFA 2W39A 1E57A 2JDYA 2WBKA 1OOPC 4JTOA 4QXHA 4Y20B 5A1AA 2WS91 1XRUA 3JXSA 2R041 3BTAA 5FZHA 3H9AA 1JZ5A 1AYN3 5HI0A 1MACA 3N7LA 1OXCA 1MZFA 2VCBA 2JICA 2YYOA 4C0HA 4N7UA 5A3MA 4P9GA 1ULPA 1O6UA 3C7EA 4RD7A 2J42A 1K12A 2VC9A 3D82A 5FYHA 4LHLA 4QPWA 3HD8B 3ZXLA 4CVUA 1W6PA 1EV11 2RE9A 1E5HA 4HVRA 4ISQA 1U5YA 2B9VA 4YZ2A 2P5BA 3TN93 5A7WB 1DCSA 5CFCC 2XR4A 3BCWA 2JIGA 1D2QA 1H1AA 3KV6A 3F2ZA 4LHNA 4OI4A 4XJ9A 5A33A 4DO0A 4Y1XA 4IE5A 3ATGA 3OG2A 4KL1A 1JUIA 3M3CA 5AC93 2OQ6A 4NOTA 4QXKA 4AVCA 2TUNA 2JDUA 3RG0A 3PU8A 3I2HA 4AK3A 1QXRA 3T2PA 3AK0A 3KGZA 2RS11 4AI3A 2J1EA 1YQCA 1IG3A 4XUPA 1PHMA 1W9SA 2CDPA 1FXZA 2Y6GA 4FPYA 4RGGA 2FCTA 1G9BA 1JXNA 1US3A 4JDOA 2Q0AA 4F7ZA 3N3HA 1UYZA 1WMXA 1GICA 2HEWF 3U75A 3WHTA 2WNUC 1RUJ2 5F5AA 1DQ6A 1AL0G 4IEPA 1LULA 4LNVA 5FP9A 5A3NA 2W1UA 1SG3A 2ARAA 2Y6FA 1UKGA 1VAMA 3OBTA 1AX1A 1SEFA 3KF3A 1W9WA 2R061 3M3QA 3N9QA 5CYYA 4O7XA 4QQLA 2D3SA 1IS6A 3NNMA 4QWNA 2IVJA 1CAXB 4HPKA 1CONA 3INAA 3WD5A 2DTWA 5A3OA 1T6BX 1ZBE1 2GMMA 1TNRA 1YLLA 3VHRA 3FLPA 1ZM1A 1GMMA 4A44A 3TNQA 4FO9A 4ZS2A 1ODNA 5JUVA 2VZ3A 4Q1RA 4LBNA 4M4PA 4XDOA 5EPAA 1Q8VA 5CVRA 4E2GA 5C6CA 4K7JA 1C8M2 3LSEA 1HIXA 1WLDA 1QHDA 2JD9A 2EIGA 4Q8KA 4CP2A 5CU1A 2ZTNA 4MLOA 4CXXA 4GULA 3IPVA 4XZPA 1UAIA 1GQHA 2Q8DA 2C9AA 2WZR2 4BHPA 3RZJA 4D3WA 4MG2A 5EXOA 3WV6A 2LM3A 2P1BA 2VMDA 3JBG2 2BBAA 4BOWA 2ZMLA 4XJAA 2WZ8A 5FR3A 3AMHA 1K45A 4AI9A 4Y33A 2DCKA 1HJFA 4NVPA 5BNNC 4YSFA 4BQ3A 3CLPA 3WF3A 1N3PA 1C3HA 3ZLIA 4LT5A 2FDJA 2VUJA 1RUE2 5EFUA 1PGL2 5KHKA 3ZXAC 1HXS2 1PIV1 4LBOA 3O1TA 4KU7A 1GZTA 1W8HA 1IKQA 2ZBJA 2DCJA 4LK6A 4RHV1 1AR73 2NZ9A 1MPXA 1Z7S1 1YUDA 4QQOA 1UY1A 4RQPB 4CU8A 1JYWA 4ZHNA 4CEWC 3RZZA 3IWZA 4IERA 4UFIA 3ZXFA 5CISA 3F95A 3FBMA 4R9BA 3MIFA 5C3OA 1B35B 3CL1A 2HWF1 2VTFA 5JIAA 3AZZA 2BOIA 2WSVA 4QPYA 5I0TA 4I3GA 3RMXA 3IMMA 5IVJA 4FOVA 4QKFA 1MS0A 1U5ZA 2IXCA 1BEV3 1RL3A 1OLQA 1POQA 3DPRB 1CZSA 3VD7A 5GZCA 3QH6A 1JI6A 2YXSA 4XAAA 3ZIXA 2A6ZA 1BBT1 1JU4A 3I2GA 4HG6B 2JG8B 3O0WA 5H9PA 3WP6A 4HSLA 3WNLA 4W6YA 3WW1A 5F2WA 5SV8A 2XUEA 3IIAA 4Y1ZA 1LOFA 4I0AA 4XUOA 2QDRA 2WC2A 4L8QA 2P4EA 3LD8A 4GH4C 4MXWA 4QX8A 4BH9A 4JX0A 3ZN6A 3B69A 3ZX7A 1GOFA 5A32B 1AR92 3LDBA 3HBKA 1RUI1 4IEVA 5BNNB 2KR2A 1VP6A 2DFCA 2OT7A 1HB2A 2K46A 1XSRA 3DECA 3IM0A 3A7QA 4KWKA 1S0GA 2HWD3 1BMV1 2V09A 2A71A 2ZGSA 5FZGA 3GBGA 4DXTA 3MDPA 1ZA7A 1OPMA 1BVP1 4AYUA 4Q4Y1 1VR3A 3UYJA 1BVVA 1CAVB 4NHYA 5HPOA 4GB32 4DXZA 5JSRA 4CEWB 4YRDA 1UZWA 1C57A 2IVIB 2RR11 4H7LA 4E8DA 2VZ1A 1YI9A 4FTEA 3C3VA 1GBGA 2XPJA 3A0KA 2HBTA 4JKKA 5ERLA 3VDDC 4W50A 5F37A 3OUHA 1PO23 3PUAA 4NIGA 3L2HA 3HN1A 2JDAA 4LITA 3K2OA 4LHSA 2WLQA 5I93A 1CAWB 2IFWA 1HRV2 3NW4A 1CAUB 2WWUA 4CE8A 3ZPOA 2JKBA 2UYAA 3RWNA 1U12A 1DFQA 1VBE3 1J3RA 2Q8EA 2RG4A 3AM2A 4V1PA 3USSA 2IUWA 4C1WA 2WL1A 4W8JA 1COV2 3N9LA 2YPDA 4KI5M 5F9TA 2E63A 2VMIA 4FFIA 4YGBA 4YVSC 3VBFB 3N4MA 4XQDA 4CEYA 3VBUB 2QVSB 1NCQB 3MIHA 5FPVA 3H8XA 3ILRA 4XBQA 5A7OA 1S0DA 2I2SA 4Q0VA 3H1WA 4E9KA 4XBNA 5E88A 2ZABA 3B9CA 4BLIA 1J3QA 1MEC3 2EICA 5JXIA 4IETA 4FP2A 4GH4B 5D21A 1TMF2 1VBD1 2YBSA 5IVFA 1J58A 2ADEA 3BOPA 1WMFA 3O5SA 2WABA 2XBO2 2BBVA 2XDVA 1V6NA 1O8SA 1K3IA 5DAXA 3RYKA 2R32A 3MUZ1 4RFRB 1HKDA 2DFBA 3LQCA 3Q8EA 1H4HA 2LTNA 1CESA 1UXZA 2R043 2QBXA 1XB9A 3MIDA 4QX3A 3WXPA 3TRSB 1NE6A 2XKPA 1DGLA 3MPPG 3BGAA 4Y1VA 1OQ1A 1PGW1 4BMEA 4NIDA 1OKQA 1GFF2 1SACA 4NIIA 2RS51 4FPKA 4XFFA 5FTTC 4QQPA 1QGLA 2CGNA 5DN2A 1W2NA 2KXLA 3CQOA 1SFPA 3CMGA 1PX3A 3R05A 4WM7A 1Q8SA 4BYYA 3V0BB 4H3WA 3IZOA 4XFAA 2BFUL 3HNMA 3ZFFB 3VDDB 1JHJA 2HH9A 3ZFEC 5DQ0A 3PUQA 1FPN3 1NQJA 4YM0A 4D0QA 5K0UA 3WINE 2RMU3 2FDHA 1LKNA 1MZ6A 1NA1B 1O3QA 1XYNA 5J48A 2HBUA 1MQTC 2R0FA 3JD72 4BK4A 1H1IA 3KHCA 1YCIA 3PUHA 3ENRA 4HK8A 1T6GC 2RS13 4LORA 5DPNA 1EY2A 3AKTA 1PM7A 2Q8CA 1FX5A 2RM23 2Y34A 3OY8A 1ULEA 5T50A 3LIHA 3TEZA 1AR82 1R64A 2YBPA 3WNNA 1FMD1 1UY0A 3FC0A 3ZKUA 2BRTA 2VVFA 5D8AB 1WW5A 1UQXA 1UX6A 2V5DA 1LHWA 4XC9A 2GN7A 2LROA 2RV9A 4FXGB 5FYVA 2RJLA 4QPGA 5L9VA 2R063 3I3BA 5LBFA 1AL21 3MV01 4Y26A 3IAPA 1SLTA 4K21A 3WEZA 3O1RA 1E5IA 4BQXA 3ZYIB 4O65A 1SDDB 3WW4A 1YEWA 2D6KA 1TME1 3EHKA 2B45X 2AGSA 2XJPA 3OGSA 4INDA 4XCBA 3SCGA 3WG2A 4D69A 1OT5A 1EAH1 2X8KA 2BVVA 3DL3A 3O7OA 4ZXKA 4WM8A 1FATA 4CDUA 1H4GA 1ND2C 2VVEA 3CNAA 1AX2A 4CDXC 2ZGQA 2AYHA 3VHPA 3X29B 1R092 3MLLA 1W3XA 2ZCWA 5IK7A 3MW3A 5F5QA 5FP7A 3JQXA 5BUVA 2Y0IA 4PI2A 2IXLA 2J7MA 1DBNA 4QX0A 5FYYA 1PNGA 3ZFEB 1G9DA 2DWRA 2MEV2 1NY71 1MVEA 3RZMA 2P6HA 1RHI1 1CX4A 3NMBA 4WZCA 5FZDA 1BCXA 2N7GA 2VJXA 4LA2A 3SMHA 3WQ0A 2DU1A 3ZFGB 3Q8FA 2XJRA 2VBBA 2D6LX 3JU9A 2OXBA 1QJU2 1Y9QA 1YFXA 1RIRA 1RMU1 2CU5A 1LOFC 4BWOA 1Y7BA 2WO7A 5T3NA 5FRAA 5FK8A 2X09A 3ZYFA 3GCWA 5FZ6A 4GJZA 1V9U3 1DIWA 1XNTA 2EVXA 3GALA 4K20A 1A6CA 4AGRA 3P1IA 1UXXX 4JRLA 2BYVE 1S1AA 2NN8A 3VHNA 1H9PA 3ME2A 2OYZA 4QMAA 2KA3A 3VBHA 2VZVA 5LASA 2HEYF 3PLQA 4JHZA 2XQRA 1OF3A 4FPHA 3SQOA 5IYYA 1L7QA 1Q56A 2VBPA 4XUQA 1PZ8A 1V0AA 3WQBA 1POV1 3W58A 1WD3A 4CRQA 1JOJA 2VO5A 1X33A 5EWSA 3VBOC 1W8UA 5F1RA 4AFBA 2ADDA 2P37A 5DG1A 2Y6HA 1GWKA 1IQAA 2D40A 3HIFA 4MXVA 1BBT3 3MO4A 2VUDA 2E7QA 4WVZA 3GXUA 4WVMA 2EALA 2JDPA 1VRH2 5IT6A 2O0OA 4OMDA 1LHVA 2QQUA 2PLV2 4JKMA 4I01A 3AFKA 2VOKA 4CDQA 4YW5A 1QQP2 4MZUA 3RGBA 2EIBA 4QHZA 5FZMA 2X5IC 3ILNA 2Q8OA 5IW0A 5KWRA 1OMIA 1NX9A 1SBDA 5ISLA 3QOPA 5FP8A 4Y20A 4CEYC 2I45A 2VAUA 3EXUA 5L9BA 1RUI3 1YIFA 4XQWA 3R4DB 4XDQA 3ZSLA 1FOD1 1XJAA 2BV4A 2LUWA 2B4KA 2JDKA 5D1IA 5HCAA 4LBQB 3K46A 3K4DA 2GNBA 3USUB 4AXOA 4OHYA 3DGTA 4Y1YA 3LDRA 2GMPA 2A1XA 4ZZ5A 2ZHLA 4J6GA 4MSVA 2FQPA 5FYBA 4AVBA 1AYN1 4AFDA 3VZNA 5HV4A 2E32A 1ND3C 3PVBB 4OCTA 2W1WA 3FBYA 5A7WA 3WX5A 1W0PA 4TTGA 3UGFA 2WN3A 1WKYA 1DU3D 4NMIA 3LEGA 4GZ9A 4Q4X3 3WQ7A 1VBB2 4B4PA 5C33A 3V65A 1QU0A 3H8UA 4K8RB 4MGYE 2XOMA 1F35A 2GH2A 3AP9A 1YIPA 5FOBB 3WDYA 3K3OA 4LE3A 1Y9GA 2F4LA 4WM7C 4Y4YA 1OA2A 4AWDA 2E31A 1AYM3 4EWDA 5B4NA 3TN91 2P17A 3T08A 3NV2A 4W4ZA 3U07A 3H7JA 5FZ9A 1I1EA 1XE8A 4OUSA 5AC91 5K0UC 2PAMA 2EIDA 1F4AA 2ZX0A 2VZUA 3KF5A 1VBD3 1LJ7A 2WDBA 1RUH2 3K3NA 1N3OA 1UNBA 3LE0A 4CP9B 1PVC3 2I74A 5G05L 4QM9A 2HWC2 4N43C 1OOPA 3U11A 2P3IA 2RVAA 5GLWA 3WHUA 2BGPA 3VBRB 1CAXA 2ES3A 4OZXA 4BLJA 2CGPA 4UOJA 1KGYA 2P3JA 5F8PA 4LO7A 5FO9B 5H9SA 4WVWA 4ZXEA 4YFZA 2XH6A 1UF2C 1S0EA 1XSQA 5IHRA 1PO12 1H0BA 3S6PA 4AQTA 4OYUA 1HRI2 1JW6A 1LESA 1PIV2 1VJ2A 4QPGC 2RDQA 4WZFA 4PHZA 1QJY2 4XIOA 1PNFA 4CUBA 4I30A 3ZR6A 4NHMA 1ND3B 4FP3A 4QXBA 5CFCA 3PIGA 2WZEA 1SPPA 3LA2A 1WW7A 3HEIA 4L92A 2D6OX 5FY7A 2YROA 3ZPYA 1H9WA 1O8PA 2RHPA 4PJYA 3RZLA 3KD4A 1NYWA 4WM8C 1EUUA 5FZLA 2BWCA 3AXEA 5T5OA 3VD3A 4D7SA 1ASJ3 4NWWA 1NT0A 3LPFA 4DEQA 1VBA2 4W6XA 4AI2A 4PDWC 2BP6A 4IEWA 1TE1B 2EAKA 2EXJA 2JIJA 4QXCA 1Y43B 4UF0B 1BJQA 4KBZA 4QDRA 1OLMA 4UW3A 1O4YA 4K1ZA 3B93A 3LAGA 1STMA 2VOWA 1CPNA 1DQ1A 5LW9A 1FMD3 2WNUA 3BN6A 4O9GA 3FX3A 3POBA 4P08A 4RQPA 2G9FA 5IFTA 1YQ2A 1FYUA 2W2IA 3POEA 4HN0A 5JXHA 5IAXA 4OVEA 5B4XA 4JGYC 4RR3B 1VALA 1YQ6A 1B35A 2VR4A 2Y33A 1I3HA 4XURA 5JOWA 3O1VA 5DDJ2 4BK5A 1C28A 1CN1A 1JOBA 4RL7A 3CJIB 4XJZA 5I91A 3KZ4C 1UW8A 1JTZX 3J8F2 3OCPA 4UFHA 1OA3A 4FTSA 3DPRA 3IKWA 1IPJA 2VNOA 4YVWB 4LBJA 1SZBA 4Q4W2 2JDNA 1W9FA 4Y22B 2QUOA 2VNRA 1D4VB 2YC4A 1G6NA 2Q1ZB 2DDUA 2ZZQA 3MIBA 5EYYA 4AOCA 3VBHC 1AUYA 2C5DA 1OD5A 3H8OA 2HYXA 1RUNA 1S0FA 1NAEA 4B1MA 5C8CB 1SBEA 5FMOS 3UK9A 3QBQA 4MYEA 2WNOA 3OPWA 1RTVA 1ZBA1 1BEV1 3HJRA 4QQHA 1ALYA 2P6CA 4YW6A 4FQ4A 5A32A 2CAVA 2XGXA 5JVVA 3I49A 2ZJCA 3PDQA 2E6VA 1O4TA 3ZXDA 4FFGA 1RVF2 5BNNA 3KT7A 1XNAA 1YFWA 3N36A 4J25A 3ZSKA 4EROA 4OI0A 2ZX3A 4IE0A 5FBZA 4XFIA 1W6MB 1ZRDA 3NL1A 1RMU3 2PAEA 5KXEA 4M00A 3AP4A 3ZMOA 2GAUA 1AVBA 2JXAA 1CAVA 4H14A 2ARXA 2VULA 5BNOC 4NRMA 4CEWA 3ACIA 1RUG2 4QX7A 1L7LA 5DAPA 4BJ0A 1UYXA 1UOBA 2B39A 2HJIA 4Y5SA 2B9UA 5HXVA 3TBDA 3URFA 4ZY9A 3RI9A 2HWD1 2OS2A 4XXPA 4B8EA 5BYNA 2PHDA 5IK4A 3L9JT 5KC6A 4CCCA 1CAWA 3M1HA 1CAUA 1RUJ3 2BDRA 5EJ1B 4X8PA 4EV0A 1O91A 3VZJA 1TQ5A 5KHJA 3WT3A 4Z8BA 5C3PA 4QQ2A 4L9BA 3S0MA 2BPA2 1W2OA 3CJXA 3PVEA 5C5UA 2X05A 3GF6A 3T2TA 5GLVA 4V2VA 3VBUA 1LCLA 1NCQA 5E16A 5GKAC 4B3NA 3KM5A 3HQUA 3BB6A 1E5SA 3PURA 2O1QA 4X6QB 3J7MA 3SCFA 3T0AA 3DF0A 2VW2A 2UWBA 1VAVA 2K0GA 4GH4A 3T3YA 2VCAA 1GQPA 1LOEA 1KDMA 1W04A 5FZOB 4DXRA 1C8M3 4MHUA 2J1UA 4NE9A 1LHUA 4YM2A 2Y0OA 4PF1A 4AVSA 1A34A 2DU0A 2GH8A 1O7FA 4NRQA 1J3PA 3NJXA 2OUHA 5GJ6A 1SLCA 1JYVA 2FZ1A 2VZQA 2GNDA 4GMP3 1HB4A 3HOBA 4N7IA 5FY0A 4ET7A 5EJ3A 4PCRA 2IWGB 2D98A 4A45A 2WZR3 1I5ZA 1OQEA 2E7AA 1MEC1 2RS32 5CFDB 4KBBA 1PGSA 4OHZA 3JBG3 3VD9A 1O4ZA 4AW7A 3AYCA 5EQUA 4LKFA 3HMYA 3U1XA 2WFF2 4A7YA 1W6NB 3GHNA 4H2AA 2G19A 1I5PA 3NV4A 5L73A 3V0BA 1RUE3 1SLLA 2VZPA 2ZEZA 2C9KA 4JGZC 2VTXJ 5FPXA 3H8RA 1HXS3 5AVPA 1R1ZA 3VDDA 3B3QE 3VDCA 3UGHA 3SH3A 3ZSEA 2Y64A 1WCQA 1CX1A 4FT8A 2WT0A 3GM8A 3I59A 3I4IA 4QGMA 5H9QA 3TOJA 2PTMA 3NJZA 5F5IA 1SFNA 1DG6A 4YZ1A 4EN9B 1EYBA 5L19A 2Q5TA 2DVAA 4CPBA 2VMGA 4F8AA 2ILMA 2XVKA 4YVSA 4OULA 2YBKA 2ID4A 1GUIA 4AEJA 4D8MA 1N3QA 4Q1PA 1ENXA 2VMFA 3KLSA 3P5BA 1FPN1 2FDIA 3KS7A 1H1MA 2JB4A 1CD3G 4BQ2A 2RMU1 4X8NA 2JDHA 1QJX2 2YUEA 2WAAA 4MUVA 2G9ZA 4YG3A 2WT1A 1LHOA 1AHSA 4GKXA 4SBVA 1RUD1 3B94A 2WWJA 3M3EA 3HR9A 4IV1C 1US2A 4TN7A 1ZNPA 3VKMA 1GP5A 3E5XA 1R082 5FZAA 3OD4A 3MPBA 5FO8B 1GP6A 3OB8A 3ZYHA 1AXKA 5FPUA 5JAXA 2RM21 5IVYA 3UL2A 1J1LA 2WO1A 4ORFA 3ITQA 1JS9A 2X29A 5FYZA 5F39A 5JZGB 3O1UA 4RQPC 5FPZA 5C4WB 4IGOA 4OFGA 3EJKA 2G1MA 1HQWA 4AAXA 1B35C 4K6BA 1IPSA 5A7QA 2HEVF 1KDKA 3WG1A 2OIIA 1WZXA 5CAZA 4JGZB 3TNPB 4W6WA 3ZFEA 3SKVA 5T5LA 1VIWB 3IBMA 4QPIB 2A6YA 1JMUB 4GB33 5IFPA 3VZMA 2BJSA 3DPRC 2OZ6A 1W9TA 1YNAA 2YPJA 5F2SA 3E6DA 2XXZA 1FV3A 1MQTA 4HFSA 4HKLA 5ANQA 4C0BA 2W0XA 2VE1A 3BODA 4PQ9A 2JG8C 4S2DA 5A7PA 3ZFGA 1Q8QA 1GP4A 1QJEA 4P9JA 5FYCA 1KJRA 4YZ4A 4IESA 3V0AB 1HRV3 3PIJA 4J1WA 4CXYA 4FFFA 1G8WA 2BOJA 4HXCA 5L7OC 5JOZA 5FZEA 2X10A 3ACLA 4GAZA 3PUIA 4D6QA 1W2AX 1HLCA 4JVAA 1N1VA 1OQDA 1IZ3A 2QCSB 3RNSA 1COV3 4YGCA 4B7EA 4AGGA 4V2WA 2B5HA 5DUXA 2WNVC 1PK6B 5FKCA 1W8WA 3FFZA 4IV1B 1AJKA 4S2HA 1RUF3 3SH5A 2Z69A 1IKPA 2BGOA 2WYSA 1LGNA 5EIYB 3S57A 3QCWA 1ST8A 2ZEXA 2D6NA 2ZXQA 5LK7B 1VAKA 2VNGA 1XNKA 2VCCA 1LENA 1TMF3 1V9U1 1SLIA 1VLNA 5DAQA 2XBO3 4Q0SA 5AFBA 5FJHA 5FK7A 2D43A 4LBKA 3SHRA 3FUQA 1HV0A 2XWJB 4COVA 1BHGA 1ND2A 4QT6A 4CDXA 1ZYBA 5FZ8A 3RVHA 1TVGA 3PU3A 2OZJA 2VQ0A 1WWYA 1UPIA 1WCUA 5KHIA 3AXDA 3M70A 3HNYM 3OPZA 3AJZA 1H30A 2A6WA 2ETEA 3ETQA 1OH3A 2Y8KA 3AKQA 4MH0E 2XHKA 1ZBA3 4JV4A 1Q43A 2HWE2 4LQRA 1YC61 5A80A 1X9TA 1V6OA 3VBFC 4AE2A 1ACCA 1NG0A 3IDEA 4XUNA 3VBUC 2RDRA 1NCQC 4X6RB 3ASIA 2WNEA 3FE5A 1CPMA 3ZKYA 2HKXA 3A4UA 5L7OB 4LBQA 2Z2SB 3AP7A 3WP4A 4QU1A 3USUA 3QD6A 4AQ2A 5A7NA 1HQNA 2O8QA 2PHWA 2ZEYA 3THTA 3JD73 4Q4V1 4CUCA 3DXTA 4QB1A 2QDNA 2G9GA 5JI9A 1I9RA 1IPKA 2WNVB 4WBBA 3RYRA 1ODMA 2GMEA 2WQ4A 2ZGKA 3KSCA 3KWVA 5DZGA 4ONUA 1DGRA 5G04L 3KV4A 5FXWA 1AR83 2V73A 3CDZB 3BKZA 2R49A 2UWAA 4CU7A 1DQ4A 2A75A 1DQ5A 2W46A 5FZ4A 1K5MB 1NUKA 1TNFA 2AACA 1GU3A 1DYOA 3FZ3A 2XVGA 2WQZC 3VBOA 1VBC1 5LY1A 2QQMA 1YJKA 3PL0A 3J7NA 1F8VA 3U78A 5JOYA 4ASKA 4K9SA 5J09A 4YG6A 3FWEA 3ZFFC 2W3JA 1REDA 1Y4WA 3O1SA 1DLLA 3OJBA 4WV8A 2Y6JA 3RMYA 4Q5OA 5A70A 5IATA 1DDLA 1OFNA 4Q4X1 1C5HA 1NE4A 5E6HA 4CCEA 5ABJB 1CZVA 5I8SA 4GKYA 1POV0 4R8HA 2ZOEB 3POFA 1NA1C 2X5IA 2FMDA 1S0BA 1UL9A 5I0SA 1ZZBA 3POWA 4XETA 2VY0A 2P3KA 1R093 4CP9A 3OF1A 3VBSB 1AYM1 4A6OA 1R1A2 1OI6A 4KWUA 2V5YA 2QE3A 2GZWA 3VBRA 4CPBD 1RUC2 4M4RA 4YGDA 3AVRA 4MX3A 3SITA 5CEHA 3SH4A 3M2MA 2A3YA 4PT6A 5C9AC 2ERFA 2ZMKA 1RJ7A 3VD5A 1W8TA 1UD1A 4OI1A 2JDMA 1XC6A 5D8AC 4ES8A 2CL2A 3KCXA 5JIUA 5FYMA 3LFMA 3OGGA 3ZXJA 4XF0A 1H6XA 2YFUA 1PVC1 3K4AA 3RJ2X 2ET1A 2WRAA 3AZWA 1WLCA 1JUHA 4META 4UW4A 3RPQA 3ZYJB 1S0IA 3RI8A 4CA9A 4DMIA 4KNCA 3AZXA 1ND3A 5A3UA 4I02A 1WMEA 3D0SA 1D4M2 2OPKA 1VRBA 3S5AA 2ZHMA 5LA2A 1SBFA 2FD8A 4XXAA 4DINB 3UV9A 4B29A 3HPNA 2Y26A 1DGWA 3DUIA 4L2NA 4QM8A 4COYA 3LEIA 5JDBA 3D6EA 5FY8A 1AR72 2HWB2 3O0XA 5FY4A 4EN6B 3GZEA 4JQTA 2E7TA 3S30A 1Q8OA 2B46X 1DZRA 4XILA 5JLVA 4UF0A 1QXJA 3WF2A 3IMNA 4B1LA 2ZACA 4GALA 4RYDA 5FIXA 4QDQA 5LA1A 1LEDA 3WW3A 5BNPC 3N9OA 1UCXA 3PTRB 4L11A 4CCJA 4XACA 5IAVA 2XJVA 3VV1A 5AVAA 4KWLA 4L97A 4HKOA 4FOYA 5HXMA 1AXYA 1JYIA 1ASJ1 2IXJA 1RUD3 3DKQA 3NQHA 2DURA 4RR3A 3UGGA 3ZFGC 4N43A 1UYPA 1VRH3 1X8MA 4XFBA 4LMFA 3RZHA 5ACA2 2PLV3 3JUUA 3LEKA 4M3CE 4CXWA 3PJYA 3CJIA 4NO4A 1XYPA 1QQP3 2CY6A 3WUCA 4AQSA 4BZ4A 4R52A 3WQ1A 2ZEWA 1W6QB 4N53C 1W05A 2W68A 4YWAA 3V64A 5C9AB 1JYXA 2QNKA 4IE7A 2ZHKA 1SHWB 4NRPA 1Q3EA 4YLZA 5DUVA 1NCRC 3SC7X 1QH6A 1BK1A 3ORJA 4YVWA 2VZRA 3WNOA 1X7NA 3LB9A 4UFKA 2E33A 4Y22A 3VGIA 1ZRIA 1M06G 4D7TA 4TSVA 3WDVA 4ZU4A 3MGUA 2WIIB 2BGCA 4KMQA 4RN5A 3ETPA 2IZWA 1W6PB 4QX5A 3W21A 4FPLA 5C8CA 2PELA 1O5UA 4D94A 4E4SA 2VNVA 5KHHA 1A8DA 1QH7A 2Y6KA 3ZDVA 3BPZA 3U37A 3NJYA 4XABA 4CUGA 5CKMA 1T2XA 4LXLA 4Q2FA 3O1MA 4CCOA 3HQXA 5A1LA 1QDCA 2H0BA 4IEZA 4KWJA 4I0BA 4NROA 4OMCA 3WVJA 2R1BA 1G7YA 4FI9A 2IXIA 4PDWA 3VB9A 1RXGA 4EQVA 3LWCA 1V6KA 1W6MA 4HANA 4GIQA 1QNWA 2R1DA 4LIVA 1VBB3 1OUSA 3VKNA 3I2DA 4AAPA 4B7KA 5J36A 5BNPB 2ZZJA 1JZ2A 2WSUA 2YB7A 1PO22 4URTA 5LBCA 2QQLA 1H2KA 1KXGA 2QKDA 3POYA 1WD4A 4OI2A 5AFEA 4DY3A 3BU7A 1W28A 4JGYA 1LB2A 1VMHA 1W8FA 5FMBA 3U14A 5C71A 1SCSA 1UU4A 1TZOA 1VBE2 3B5LB 5JMOA 4XJUA 1RINA 1Q8PA 1OH4A 1YO8A 3N9MA 1QIQA 4OLLA 4QB6A 3T09A 3EB7A 3HVDA 4N90A 5FY5A 4N53B 3W59A 1XOYA 2WUHA 3I3EA 4LBQD 4EZ4A 3T1LA 5I8YA 1YHFA 1NCRB 2WQ8A 1AR62 2BNMA 4JQRA 3EBRA 5FZ1A 1LTEA 3MIEA 2R30A 4BQ1A 3CKHA 3KVBA 1P8JA 3C7GA 1MS4A 1OLRA 1JHNA 2UU8A 3MFCA 3TEWA 5A6XA 2MPFA 2YU2A 3GHMA 4FOQA 4BDVB 2CSGA 1RUJ1 4YGEA 3THDA 4P9IA 3THPA 1LOAA 4ITCA 3H0OA 4GXLA 5DABA 1BXHA 2WS92 2R042 3D4KA 3R6SA 1HRI3 5LRRA 3WLUA 5DZEA 5FZOA 3T2OA 5BNQA 5EP9A 1QJY3 3CZUA 4YFWA 3NWKA 3CF6E 4YNIA 3WDWA 3GCXA 1W03A 1J84A 4JAAA 2XKOA 3AZYA 1LOGA 3ABZA 2W95A 3PUSA 3KB5A 3S5QA 4CU6A 2UY8A 2Z42A 3APBA 5CFDA 2VVDA 1U5XA 5A3PA 1EV12 2C4XA 5A6YA 4C8DA 2PHRA 1C8M1 3EYPA 4Q4V3 1DZTA 5BNOA 1NZCA 4Y3OA 2SBAA 1VBA3 1W6NA 4C1XA 3ZDSA 4GMP1 2VD7A 3MEPA 2UY9A 2A6XA 4O61A 4J1XA 3VBRC 4L0PA 1A78A 5KHGA 5K8SA 1G86A 4ATEA 4A7ZA 2WZR1 2C26A 1MS8A 3RSJA 2AREA 2RS12 2WAOA 5SV5A 3JBG1 4E2SA 1JH5A 4K40A 1LR5A 5FMCA 1V00A 5FXXA 4B4QA 1WCKA 3AYDA 5GLZA 4M0NA 4FQZA 5A3WA 1RUE1 1VBC3 2B8MA 3W5MA 1HXS1 3ZR5A 2RJKA 2VBDA 1IOAA 3OYWB 5BPXA 2R073 1WA4A 1ZRRA 2NPIA 4NWVA 3LKJA 1A8MA 2R062 3WNMA 2FBEA 2F17A 4NPLA 2W1SA 2FZ2A 3MBWA 1S4CA 1JYTA 1O59A 2Z79A 3IDAA 4P9YA 5DAVA 4MXWB 1EPWA 3BPSA 2QQWA 1K5JA 5D2AA 2YGLA 3FL7A 1HW5A 1ZBE2 2EAAA 2FCUA 3UJOA 2E9QA 4G3YC 3K4ZA 3EQEA 4LR4A 5FXZA 2ZKLA 4PI0A 3U4XA 1W3VA 4UFJA 2EXIA 1JZ4A 3I97A 5J96B 2XLAA 3LOIA 2ZGTA 4XIKA 2OW4A 4FPFA 5JZGA 2AC1A 1XNCA 3NSTA 3OBZA 5J37A 4PIYA 3Q8BA 4A42A 2E53A 2JG9B 3HNBM 1RVF3 2TEPA 4QD2A 1IS3A 2JE9A 2QZ2A 4RR3C 2QQJA 4NAMA 5FP3A 1ULCA 4U36A 2BERA 4JGZA 1RJ8A 2DUOA 4PBPA 3CJIC 2FHRA 5FREA 3EMRA 3WCSA 1HB3A 4M01A 5EHDA 3WZ1A 4DZGA 4N9IA 4QPIA 3B01A 2PHLA 4DY5A 4R4XA 4YW7A 4YW1A 3RFRA 1RUG3 4YVWC 3LPGA 4LJHA 1NXD1 4XBLA 1GSLA 5J3UA 2NP0A 2CDOA 1LOCA 3SXWA 4ATFA 1DQ2A 2E26A 1REEA 4RHV2 2CWSA 1DYKA 1Z7S2 1IHMA 1DZQA 2PXJA 2WN2A 3WG3A 1ZREA 3V0AA 5FPBA 1RYYA 5C70A 3IAQA 5C8CC 1HV1A 5FKBA 2EF6A 4YZ5A 4JC1A 4Z1VA 4GB31 2HWF2 2TBVA 1SDWA 4JDNA 4DRVA 4K1YA 1XE0A 3OEAA 5FV3A 5A1FA 2QQPA 3T30A 3DEMA 5FMDA 5FYSA 1OVPA 1PK6A 5APAA 2RJ2A 4IV1A 1X9PA 2DVFA 4IE4A 2CHHA 3E5QA 3O14A 3LZZA 1HRV1 3KGLA 1CGPA 4RS5C 1BZWA 1CVNA 5LCWL 1GYKA 2BW8A 4I3PA 5FJKA 3KCYA 4EN8B 2D3PA 1BBT2 4HVOA 5JSOA 1ONAA 4AG4A 4LLOA 5EYXA 1D0GA 4NHKA 1COV1 2CYFA 2ZGNA 4GD4A 3CZJA 4UBGA 4XFGA 4DRRA 3O1OA 4XTPA 3PVNA 5E8AA 4LKEA 4AEMA 4A3ZA 1RUF1 1W39A 4NN0A 4Z82A 3WSOA 3C7HA 1ZA4A 5LBBA 3O12A 3E6CC 5K7PA 2ZAHA 4AVAA 3TYJA 4AR2A 2WFPA 2GC2A 2RS33 2VQTA 1K42A 4FTBA 1TMF1 3OD0A 3LFIA 2JE7A 1L7RA 2XBO1 1UKRA 1RUI2 3HBZA 5DG2A 5LEKA 1SCRA 2J22A 1D7PM 1G9CA 4TYSA 4IUGA 3W9AA 1BMV2 4A7KA 1F15A 4KH9A 4B4RA 4AHXA 2VW1A 2JG8A 5FO7B 2AUYA 1QOTA 2JDZA 3NVCA 5CA6A 3AP6A 3D8CA 3KV5A 4Q4Y2 2WWSA 5GALA 2D7FA 5GLUA 5L7OA 3R4UA 1AF9A 2RR12 3N7JA 2PAKA 4AEDB 4EJRA 3CU7A 5DXDA 1GOGA 3AJYA 3ZSJA 2XHNA 3D0JA 1C5IA 4NAOA 4IV3B 5CZKA 1QEXA 4MHRA 5JR7B 4C90A 2WNVA 1JODA 4Z07A 5H9RA 5HCHA 5FZ0A 5GZFA 3PJQA 2WKKA 4ZONA 3TEYA 1KD7A 1KRIA 1Z0HA 3OGVA 5JWPA 4RS5B 4YW3A 1AZDA 4AI0A 1ZZ6A 4ZKTB 5CFDC 5FXVA 4PLOA 1QJFA 3NV1A 4Q0QA 1UY4A 5HCFA 1XNBA 3OBRA 3JD71 3W5NA 3HAGA 4AF9A 4HONA 4EWAA 1XNDA 3PTYA 4DQAA 1X36A 1W8NA 5FUPA 1R083 4H55A 1S2KA 3B02A 2IXHA 3CIHA 1F31A 4AGVA 5F6LB 2Y60A 1VBD2 1AR81 1CZTA 1PX4A 4IGQA 4ES9A 1OHFA 3NRUA 1HJGA 2DBIA 2ZGLA 5GZEA 5IWFA 2DBNA 1H8TB 2P34A 4P00B 4XJ8A 3SEEA 3AKRA 5ABJA 2C6SA 3NAPC 1YRZA 3KQRA 2XVLA 2VXRA 1RITA 2XJSA 2VXJA 1KFUL 3D3AA 4BMBA 4MO3M 4JCKA 4TXWA 3RQ0A 2P3YA 5J98B 4E27A 2CGOA 3KV9A 4P14A 1NLSA 3VBFA 3VBSA 1PGW2 3VL8A 2RS52 3MHZA 1O3RA 1CWPA 3K51A 4OQ8A 1X50A 5C7GA 4GWMA 1SLAA 1UIKA 2VUAA 1DLCA 3A22A 4PIXA 5LBEA 1O3SA 2JENA 3POJA 3J9SA 4XUTA 1LU1A 3IB3A 3P6BA 3SNMA 3NNLA 3MLJA 4HOOA 1GNYA 2A6VA 2K9ZA 1R091 4JZRA 2O8OA 3UESA 1YYNA 2UWCA 2W87A 2XUMA 4N8MA 4KU8A 3U0ZA 3R0RA 3ZIWA 3AB0A 2MEV1 1REFA 2K2SA 4P5HA 2JD4A 1WGPA 4IEUA 5E1RA 2YDEA 5JSPA 1AX0A 1XBFA 4CUAA 2FMYA 5JZGC 4LE4A 4IGPA 1ZZCA 3WP5A 5I0RA 3AYAA 1VMFA 2WJSA 3NKGA 4PLMA 5C4WC 3WNXA 2WYFA 4P9WA 4PQQA 4OHVA 5FYUA 5FCCA 5J1XA 1DYPA 4LULA 5FZBA 1CIWA 1FMD2 1UWWA 4FXKB 4AEKA 2H0VA 2RDNA 3ZFFA 3FJSA 4Z2WA 2V4AA 3VD4A 1VB4A 3U10A 4FVVA 4HKWA 4QPIC 3T0DA 1AL22 3LIGA 3NAPB 4OHXA 1NA1A 3MV11 3TEXA 5FY1A 1SMVA 3ACHA 1V6IA 1WMDA 1H2NA 1QJZA 3H7YA 1TME2 4LHKA 3T4HB 4M3CB 3ZO0B 1EAH2 3UJQA 3VHOA 1VB2A 1DF0A 3HN3A 4GWNA 1APNA 4FPOB 1FI2A 4R4ZA 1V70A 2ZS6B 2WA3A 4S2FA 1W6QA 4LPLA 4Y24A 5C9AA 3KHBA 2HWE3 3I2OA 2B42B 1F2NA 5D8AA 3R4SA 3PHMA 2JEMA 5IK5A 1WBFA
chains in the Genus database with same CATH topology
2FCUA 5IATA 4Q5OA 5DAXA 4ZONA 2RDSA 5C5UA 2RDQA 4NHLA 5LASA 5LBCA 4NHMA 3NNFA 3OBZA 3HQUA 3GJAA 5L9RA 4UWDA 2FCVA 3EMRA 4MHUA 5LATA 2JIJA 3HQRA 4KBZA 4XAAA 5A3UA 2HBUA 3OUJA 5DAQA 5EQUA 2JIGA 4ZPIA 5IAXA 3KT1A 3KT4A 5L9BA 3GJBA 2Y33A 2G19A 5LBEA 2Y34A 3NNJA 5EP9A 3NNLA 3GZEA 4JZRA 4XC9A 2A1XA 5L9VA 2FCTA 5LBFA 4XACA 5C5TA 5IAVA 4BQXA 5HV4A 4NHKA 4NHXA 4XCBA 3DKQA 4XCAA 2RDRA 4NMIA 4NHYA 4IW3A 5LBBA 3NNMA 2HBTA 2RDNA 5ERLA 5M0TA 3OUHA 2V4AA 5LA9A 3KT7A 4J25A 3BVCA 5DAWA 3MGUA 5EPAA 2RG4A 3ITQA 3OUIA 3W21A 4Y5TA 4BQYA 5DAPA 4BQWA 2G1MA 4XABA 4Y5SA 3W20A 3PL0A 5DAVA 5HV0A 5LB6A 4NAOA 2OPWA 4MHRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FCU A;  5IAT A;  4Q5O A;  5DAX A;  4ZON A;  2RDS A;  5C5U A;  2RDQ A;  4NHL A;  5LAS A;  5LBC A;  4NHM A;  3NNF A;  3OBZ A;  3HQU A;  3GJA A;  5L9R A;  4UWD A;  2FCV A;  3EMR A;  4MHU A;  5LAT A;  2JIJ A;  3HQR A;  4KBZ A;  4XAA A;  5A3U A;  2HBU A;  3OUJ A;  5DAQ A;  5EQU A;  2JIG A;  4ZPI A;  5IAX A;  3KT1 A;  3KT4 A;  5L9B A;  3GJB A;  2Y33 A;  2G19 A;  5LBE A;  2Y34 A;  3NNJ A;  5EP9 A;  3NNL A;  3GZE A;  4JZR A;  4XC9 A;  2A1X A;  5L9V A;  2FCT A;  5LBF A;  4XAC A;  5C5T A;  5IAV A;  4BQX A;  5HV4 A;  4NHK A;  4NHX A;  4XCB A;  3DKQ A;  4XCA A;  2RDR A;  4NMI A;  4NHY A;  4IW3 A;  5LBB A;  3NNM A;  2HBT A;  2RDN A;  5ERL A;  5M0T A;  3OUH A;  2V4A A;  5LA9 A;  3KT7 A;  4J25 A;  3BVC A;  5DAW A;  3MGU A;  5EPA A;  2RG4 A;  3ITQ A;  3OUI A;  3W21 A;  4Y5T A;  4BQY A;  5DAP A;  4BQW A;  2G1M A;  4XAB A;  4Y5S A;  3W20 A;  3PL0 A;  5DAV A;  5HV0 A;  5LB6 A;  4NAO A;  2OPW A;  4MHR A; 
#chains in the Genus database with same CATH topology
 1PK6 C;  1UX7 A;  1VRH 1;  2VQA A;  4CCM A;  2QQK A;  1NY7 2;  1Q5O A;  2A3X A;  2D5F A;  2VG9 A;  2PLV 1;  2XJU A;  2YY1 A;  3N35 A;  4LO4 B;  5IJR A;  1OPO A;  2Z4F A;  1QQP 1;  1RHI 2;  3C8X A;  4MGZ E;  4BB3 A;  3E6B A;  1GZW B;  3VDB A;  1PVX A;  1ENQ A;  3T2Q A;  4F3J A;  2KD7 A;  2JKX A;  2GC0 A;  1DGR N;  4GQ7 A;  1LEM A;  3GJA A;  2GN3 A;  3ACF A;  3OTF A;  1AR9 3;  3V56 A;  1LRH A;  3THC A;  3OPT A;  3BAL A;  1CIY A;  1RMU 2;  1UYY A;  4HMZ A;  2FCV A;  3NV3 A;  3J26 N;  4LEJ A;  2XL7 A;  4R9D A;  4K8F A;  3AP5 A;  1QOS A;  3GNE A;  3ON7 A;  1ZRC A;  1PMI A;  5T54 A;  2PMW B;  2VMC A;  1SFY A;  2Z5W A;  2A73 B;  3AL6 A;  4JHT A;  4NPR A;  5LAT A;  2B7Y A;  2UYB A;  3MIG A;  1PZ9 A;  5DUU A;  1UZ0 A;  2WT2 A;  4BU2 A;  5BNP A;  2D6P A;  3WF4 A;  1F5J A;  2H6C A;  4YW2 A;  4ZU7 A;  4S2G A;  2DVB A;  3LGR A;  1UU6 A;  5A6Q A;  3ZYR A;  4CP0 A;  3N7M A;  4AVT A;  1ULG A;  3J4U H;  4CTE A;  1LAJ A;  1J59 A;  5CNA A;  3FMG A;  4WVV A;  3G7D A;  4ZPI A;  1RB8 G;  3H3Z A;  3TAY A;  2VPV A;  3T1M A;  1UMI A;  2DCZ A;  1OOP B;  2DYC A;  5F3I A;  1GNZ A;  4DUV A;  4HVQ A;  1VBB 1;  4N53 A;  4LBL A;  4LOT A;  3CBN A;  5FBJ A;  5FPL A;  3DV8 A;  1M4W A;  1JBC A;  1NCR A;  1W6O B;  1VMJ A;  2KM2 A;  3I7D A;  4XOG A;  1R1A 3;  4GA9 A;  5JPM B;  2PHF A;  1GAN A;  3MF9 A;  4GWJ A;  3VLB B;  4URA A;  1RUC 3;  1ULF A;  1IG0 A;  1ZX5 A;  4FCA A;  2ZGR A;  4R9C A;  5C5T A;  4MGQ A;  2VOV A;  2UUR A;  2YG0 A;  3I2J A;  2W92 A;  4BE3 A;  1LGB A;  5CBL A;  3I3M A;  2WA4 A;  2G4I A;  1AXZ A;  3WG4 A;  5FFO C;  5CFC B;  2NQY A;  1RUH 1;  3Q9O A;  1K5M C;  5T55 A;  1SPP B;  2GNT A;  5CAD A;  4DXS A;  4AHW A;  2PYT A;  2HWC 1;  2VME A;  4RSU A;  1FOD 2;  5ANN A;  4IW3 A;  3VZL A;  3BYW A;  1CJD A;  1CQ9 A;  1YI7 A;  2V4V A;  2OX0 A;  2V72 A;  1NQD A;  1D4M 3;  2D6M A;  3B9I A;  3SIS A;  3FN9 A;  2NLR A;  3AL5 A;  5JPN B;  1X82 A;  5KC5 A;  2F6B A;  1PO1 1;  4XZU G;  4OQ9 A;  5A7S A;  2J1A A;  5I0U A;  1LGC A;  4MAD A;  3CHX A;  5ABJ C;  1HRI 1;  3N9P A;  5J7M A;  1AYN 2;  2D5H A;  4W65 A;  3H3U A;  1QJY 1;  2HWB 3;  4I0W B;  1NLR A;  1XXN A;  4MGK E;  2WNU B;  3VBS C;  3WR0 A;  2R0H A;  2DCY A;  5JR2 A;  3AKP A;  2PHU A;  4XHB A;  1EP0 A;  5IVV A;  2YFZ A;  3LA3 A;  1N1S A;  2F4P A;  5EV7 A;  1UO9 A;  2W5F A;  1O5L A;  4YPJ A;  5I0D A;  3AMQ A;  2BEO A;  3H42 B;  1H2L A;  4BCU A;  3SEP A;  5F6K A;  5TSW A;  1W2T A;  3MF6 A;  4PLN A;  3RS6 A;  2IFR A;  4LBM A;  5IUQ A;  5LB6 A;  3I3D A;  1WBL A;  4OUE A;  3S7E A;  3NNG A;  1DQ0 A;  3TN9 2;  1F4H A;  1F5F A;  2YC2 A;  4LO5 B;  4BM8 A;  4CDW C;  1S0J A;  2VW0 A;  1VBA 1;  3E1F 1;  2NYY A;  5F3G A;  5ACA 3;  1NXM A;  3O0V A;  2BTV C;  2DVD A;  5AC9 2;  1ZZ9 A;  4ZU5 A;  3T4V A;  4TZD A;  2IXK A;  4NHL A;  3ES1 A;  1QWR A;  3OYW A;  2I07 B;  3WF1 A;  4Q26 A;  4XQ4 A;  4A4A A;  5C3R A;  1BKZ A;  3KQ4 B;  4JRA A;  2ZX4 A;  4QGN A;  4Q29 A;  1ZRF A;  1FV2 A;  1UY2 A;  3I3Q A;  2WIN B;  1GOH A;  1OD3 A;  1XE7 A;  2QZ3 A;  1UMH A;  3ECQ A;  5DDJ 1;  3DYO A;  3NKT A;  4I2O A;  3MFA A;  2NMO A;  4XF1 A;  4D6R A;  1QKQ A;  1UZV A;  5F5C A;  2P2K A;  3J8F 1;  3AVS A;  2R07 1;  3E5U A;  3AZV A;  4NPM A;  4O9E A;  4QAW A;  3J7H A;  4TLF A;  4FPG A;  3RDI A;  3N7K A;  5C8W A;  2LAL A;  1UU5 A;  2EIE A;  4KGG A;  3AMM A;  5FYI A;  4Q4W 1;  1QDO A;  4Q27 A;  4PIZ A;  2W94 A;  4BIS A;  1OF4 A;  4IQP A;  2VUC A;  2JG9 A;  3J7L A;  3OUJ A;  4P02 B;  4XEZ A;  5CKQ A;  5F32 A;  4FOW A;  5JCT A;  2JE8 A;  4UBH A;  4MGI E;  4CSW A;  3JB8 A;  3H1M A;  2VU9 A;  3GDB A;  1MS3 A;  4QKB A;  5HCB A;  2CWM A;  1E5R A;  4UT5 A;  1W8O A;  2MEV 3;  1ZZ7 A;  3G6J B;  3M7A A;  1Y9M A;  5FYT A;  2ZAA A;  2NMN A;  4AQ6 A;  2XQX A;  1V6M A;  1RC6 A;  2QQO A;  5FQ0 B;  4CDW B;  5LEJ A;  4CZS A;  1RVF 1;  2AH2 A;  4GMP 0;  1GZ9 A;  1JN2 P;  1YQ5 A;  4DNY A;  1ULD A;  3BIW E;  3GGL A;  2GAL A;  2W9X A;  3A23 A;  2J1R A;  3POG A;  3PVO A;  5C3Q A;  1QJU 3;  4XJW A;  3N9N A;  5GLT A;  4CCK A;  5IVB A;  2VOT A;  5T52 A;  2ZX1 A;  1FNY A;  2R6Q A;  4E2Q A;  1RUF 2;  1UIJ A;  4LLF A;  3FHA A;  5IVE A;  1AR6 3;  3ELN A;  3UET A;  5FOJ B;  4LO6 B;  1C8N A;  2XML A;  4E4Z A;  1RUG 1;  2XLG A;  1XU1 A;  2LW8 A;  4XF3 A;  3JCI A;  2WZP P;  1IQD C;  4E4H A;  3O1P A;  4NJ4 A;  3LOB A;  1V6J A;  2YMZ A;  5EJZ B;  3ACG A;  2VM9 A;  1ENS A;  1N1T A;  4IEY A;  4A41 A;  1HN1 A;  4D6S A;  1A3K A;  4EZH A;  4GWI A;  2VQU A;  5F7U A;  2WO3 A;  3UKV A;  1WCD J;  1YXW A;  3MYX A;  3BVC A;  1JZ3 A;  2WS9 3;  2XWB B;  4Q0U A;  1KEX A;  3VL9 A;  5DAW A;  4BIF A;  2LRP A;  2EA7 A;  4IEO A;  1YQ8 A;  1QY4 A;  4YG0 A;  2O14 A;  3VZK A;  4ZZ8 A;  1O3T A;  2BUK A;  4XF9 A;  1KIT A;  3OOX A;  3OGJ A;  5DMY A;  4AI1 A;  2DTY A;  1JZ6 A;  4MV2 A;  3L2Y A;  4AHY A;  1QXP A;  1ZBA 2;  1BEV 2;  3K75 B;  3W20 A;  4XDP A;  4ARX A;  4LA3 A;  5GZD A;  2EXH A;  3ES4 A;  2LS6 A;  1HQL A;  3HWJ A;  4AHZ A;  3POS A;  1RUO A;  1EV1 3;  5HV0 A;  2E51 A;  2PFW A;  4LO8 A;  1JZ8 A;  3DKW A;  2JWP A;  4G4F A;  4Q8L A;  5FZI A;  1OFS A;  1C1F A;  2SLI A;  4N9H A;  3I59 B;  5FWE A;  3VKO A;  2RDS A;  1UZZ A;  2VMH A;  2QFE A;  2VZO A;  1W06 A;  1WLW A;  5JI7 A;  1QNY A;  2MNG A;  2A3W A;  2RS3 1;  2ATF A;  1XU2 A;  2YGM A;  4Z92 B;  2ZA9 A;  4YVS B;  3III A;  3P3N A;  4XMA A;  2C24 A;  2GSY A;  5KBF A;  4DB5 A;  4AED A;  1FAY A;  5FLJ A;  4TLG A;  2WFF 1;  4D7Y A;  5A33 B;  4XAE A;  4CCL A;  2BFU S;  2HWD 2;  2YZ4 A;  3C7F A;  4IV3 A;  4XFC A;  3LA7 A;  4E4D X;  1NOV A;  2FDK A;  3IN9 A;  1OSG A;  5JXG A;  1L3J A;  2QJV A;  1UY3 A;  1LNS A;  4Y4R A;  1DP0 A;  4ZS3 A;  3ZSM A;  4DFS A;  2PHT A;  3OSD A;  3VZO A;  4RS5 A;  2R16 A;  5A6Z A;  1KFX L;  1GNH A;  2BNN A;  1H8V A;  2GC1 A;  3LCP A;  3CEW A;  1QF3 A;  2ZGU A;  1MR5 A;  1I6X A;  4FPJ A;  1OC1 A;  2YV8 A;  2DV9 A;  4DIQ A;  5KR7 A;  1JYC A;  1ZBE 3;  5BXX A;  3QH7 A;  3KT1 A;  1PMJ X;  3OGR A;  4A2U A;  3GJB A;  3A21 A;  3PNA A;  4IDZ A;  4MVT A;  2CAU A;  2GNM A;  4HN1 A;  3AMN A;  3I2I A;  3ZM8 A;  5LWB A;  2XON A;  3NNJ A;  4G9S B;  5LZ6 A;  1QJX 1;  1H8T A;  4HET A;  1W90 A;  1PM4 A;  4HPK B;  4YW4 A;  5FZ3 A;  2Y6L A;  1UOG A;  1SQ4 A;  3ZN5 A;  3AYE A;  3VKF C;  3AFG A;  1RUH 3;  2PQQ A;  2XG3 A;  2CV6 A;  1R08 1;  3QLQ A;  5F3E A;  2HWC 3;  5KXC A;  5T5P A;  1MEC 2;  2VTX A;  5FLH A;  1NKG A;  2AEZ A;  4DPN A;  2EXK A;  4BPZ A;  1MQT B;  1H2M A;  1W99 A;  3UKT A;  4AFM A;  4XW3 A;  3WF0 A;  2C0Z A;  1KS4 A;  2OA2 A;  1W8Z A;  3DCQ A;  2L9L A;  4CCN A;  4COU A;  1PO1 3;  2PN5 A;  2VH9 A;  1VPH A;  3TB0 A;  3RJR A;  3RZK A;  3IPV B;  3MLK A;  3ZN4 A;  1PIV 3;  3JQW A;  1CR7 A;  3PME A;  1WCS A;  4RHV 3;  3DYP A;  1Z7S 3;  4TWT A;  4LTA A;  4FPC A;  4UW6 A;  3K48 A;  1F9K A;  2CTV A;  4HL0 A;  4UFL A;  4NIA A;  1NZI A;  1GV9 A;  3BU0 A;  3ALQ A;  5CKN A;  2HWF 3;  3IT8 A;  2YU1 A;  2W52 A;  2QQN A;  1CJP A;  3MW2 A;  4Y5T A;  1OLM E;  4GJY A;  1C1L A;  2JG9 C;  1FPN 2;  4HSJ A;  5FUI A;  4BQY A;  2ARC A;  2XL9 A;  1LOD A;  3AMP A;  2RMU 2;  4LK7 A;  3U4S A;  1FT9 A;  1MS9 A;  1OUX A;  1S2B A;  4FAH A;  1ND2 B;  3SCH A;  5FY9 A;  4CDX B;  3RYP A;  1S2E A;  2YHJ A;  3VN4 A;  1RUD 2;  4OHW A;  4UW5 A;  2OPW A;  1U0A A;  2YC0 A;  1H6Y A;  1HX6 A;  2DUQ A;  5KXB A;  3NAP A;  3NJV A;  4EE2 A;  2Y38 A;  3MIC A;  4MOA A;  1HB1 A;  2RM2 2;  3IDC B;  1PMH X;  4CU9 A;  1MZ5 A;  3C7O A;  3M3O A;  1EPZ A;  3ZMN A;  4HZF A;  5DDJ 3;  3I2F A;  3FFQ A;  4M3C A;  3ZVX A;  2J1T A;  4JDM A;  1PGL 1;  5IK8 A;  3NNF A;  3J8F 3;  5DUW A;  4XPV A;  2XLF A;  4ASM B;  4UYB A;  1OVS A;  3ZYP A;  3FHI B;  4XF4 A;  2D97 A;  5L9R A;  3E97 A;  4EWE A;  4JKL A;  2ARB A;  1B09 A;  4Q4W 3;  3GBW A;  1IS4 A;  2ZPX A;  4MGS A;  5IVC A;  1MS1 A;  1OUR A;  4RFT 0;  3UNP A;  3VUO A;  2W1Q A;  3ZN6 B;  4Q4Y 3;  5LRS A;  5K9Y A;  4QHB A;  1N1Y A;  2DUP A;  3HQR A;  2Q1M A;  1JZ7 A;  1XPW A;  1QOO A;  1D0H A;  2RR1 3;  1GZW A;  3IDB B;  4OUM A;  4E8C A;  2HWE 1;  3WY6 A;  2A70 A;  4C91 A;  4EN0 A;  2VOX A;  2QTW B;  3OBA A;  2GP5 A;  3WW2 A;  4CCD A;  1ZZ8 A;  4U2A A;  3WCR A;  1VE0 A;  1WW4 A;  3WDX A;  5C4W A;  5JOX A;  2BVB A;  1QMJ A;  3KT4 A;  4P5Y A;  3MW4 A;  3OEB A;  1GKB A;  5FZ7 A;  3ROU A;  3ZYG A;  5CG9 A;  1W0N A;  3VBO B;  1BYH A;  1LEC A;  4M3C F;  3BUC A;  5K4L A;  3C2U A;  2VZT A;  4PF5 A;  2VEC A;  2Q30 A;  1AR9 1;  3AKS A;  2FDF A;  2GDF A;  2OKX A;  3WUD A;  4LIU A;  2OVU A;  5F3C A;  2X5I B;  3LF7 A;  4QU2 A;  4NUB A;  4RA0 A;  3WNP A;  1SLB A;  1UOJ A;  1V9U 2;  4LKS A;  2AEN A;  3BTX A;  4XCA A;  3LEM A;  3T0B A;  2A7A A;  4IE6 A;  1S55 A;  1OBN A;  2BZD A;  1URX A;  4RGA A;  5EZW A;  4CEY B;  2AR6 A;  2CNA A;  3DXU A;  4RGK A;  1GWM A;  4BXS V;  4AED C;  4LUM A;  2QQI A;  1AJO A;  5FWJ A;  1V6L A;  3KVA A;  3UKN A;  2W08 A;  4FSJ A;  1W6O A;  2WR9 A;  5BV6 A;  4IV3 C;  4L99 A;  2R7E B;  1GZC A;  1UZY A;  2OUJ A;  4FBF A;  3BTZ A;  3FUO A;  2OQ7 A;  2RS5 3;  4OZO A;  1KQR A;  2ZGM A;  2DVG A;  1IGO A;  4P9X A;  3GZU C;  4DUX A;  5FDB A;  4LOS A;  3KMH A;  4HLT A;  1YWK A;  2WLP A;  4FAG A;  1YJL A;  1C4R A;  3BIE A;  2J1V A;  4XYX A;  1W0O A;  2DF7 A;  4COW A;  5FZC A;  3OUI A;  4XE9 A;  1N47 A;  3I54 A;  2A5Z A;  2AEY A;  2ENR A;  1R1A 1;  1LOB A;  5JMC A;  1TG7 A;  4BIO A;  3POI A;  4KGQ A;  3DN7 A;  2GC3 A;  4BQW A;  1RUC 1;  3GZA A;  4QB2 A;  5A3T A;  1LHN A;  4F83 A;  5DZF A;  5FMO L;  4CDU C;  2BNO A;  3AX4 A;  1G9A A;  4UFM A;  3LDK A;  4Q4V 2;  2ET7 A;  2HLE A;  4Q0P A;  4WM7 B;  5LA0 A;  1EUT A;  3JZV A;  4ISR A;  4CP1 A;  2DCT A;  1H8T C;  1GLH A;  1W2U A;  3K77 A;  3FLT A;  4P9L A;  4FPE A;  3SLI A;  3ZXG A;  4IEQ A;  1UOF A;  2WFF 3;  5K0U B;  3PMS A;  4HT1 T;  5CB7 A;  4KG8 A;  4QKD A;  4MGT A;  1G9F A;  4NIH A;  1D4M 1;  3MI8 A;  3RZG A;  1MVQ A;  1Z78 A;  3FLR A;  4AFC A;  5L36 A;  5B2G B;  4N43 B;  2D44 A;  2XB6 C;  4QX1 A;  1AL2 3;  1VBC 2;  3I8T A;  4UAP A;  3WP3 A;  4Y1U A;  2WO2 A;  4UWD A;  3I2K A;  5CG8 A;  3MZH A;  1BQP A;  1MS5 A;  3AC0 A;  1WLT A;  1HDK A;  4HK9 A;  3OY8 B;  2R07 2;  3Q8A A;  4DUW A;  1AR7 1;  2HWB 1;  1ZVF A;  1KJL A;  1TME 3;  4UXA A;  4XTM A;  4LKD A;  4XMI A;  2AZ5 A;  4Z2A A;  4Q4X 2;  1EAH 3;  3ZXE A;  1LU2 A;  4CYD A;  5FP4 A;  3M8L A;  4IEX A;  4BQ5 A;  1ENR A;  4A3X A;  2JJ6 A;  3A0N A;  1J83 A;  3HT1 A;  4QPG B;  3LSD A;  5LY2 A;  4AL9 A;  4COZ A;  3B00 A;  2H6B A;  3NO8 A;  4JTN A;  1UN1 A;  5T5J A;  2ZX2 A;  3UT0 A;  3H1Y A;  1QJX 3;  1OA4 A;  1AYM 2;  2BQP A;  4AZZ A;  2XJT A;  1GQG A;  2ZMN A;  4PBO A;  5I8T A;  3ZOI A;  1K5M A;  1W9Y A;  2C1F A;  1RXF A;  1OKO A;  1S0C A;  3BTY A;  3DYM A;  2MHF A;  4KG0 A;  5ACA 1;  1DGW X;  1FNZ A;  2VCM A;  2ZGP A;  4NR1 A;  2GP3 A;  3RWK X;  1PZ7 A;  1KS5 A;  3BI3 A;  2VL4 A;  1GR3 A;  1RHI 3;  2W47 A;  4WM8 B;  4CDU B;  2HYK A;  5FZK A;  4DS0 A;  2IC1 A;  1PVC 2;  4YZ3 A;  4PDW B;  4BQ4 A;  3CO2 A;  4QDS A;  5FZF A;  3Q8C A;  1NLQ A;  1WA6 X;  2Q1F A;  3WOG A;  4AI8 A;  2ZHN A;  4CDQ C;  4M0H A;  3ST7 A;  5E89 A;  4ARY A;  4DOU A;  5GM0 A;  1GWL A;  3H50 A;  4YM1 A;  4QGL A;  3M4F A;  2JX9 A;  3EO6 A;  4NHX A;  4BA6 A;  5FPA A;  1MZE A;  3JB4 C;  4YYO A;  1D2S A;  2ORZ A;  2ORX A;  3MUY 1;  4DEV A;  4UI9 L;  4YM3 A;  3TWI A;  4JGY B;  4I09 A;  4EYU A;  4IL7 A;  1HN0 A;  4KQ7 A;  5HBA A;  2ZKN A;  2XJQ A;  4IXL A;  1JU3 A;  3WDU A;  4AVV A;  2PQS A;  3D5O A;  2JEC A;  1JOP A;  2ZGO A;  4A6S A;  5FUN A;  5M0T A;  2PA7 A;  5FQ0 A;  5LK5 A;  4CDW A;  5A3L A;  1Y3T A;  5LA9 A;  1YFU A;  2FDG A;  4LUK A;  1POV 3;  1XYO A;  2BU9 A;  3H3L A;  4SLI A;  4BXF A;  3M3I A;  4XVH A;  4ASL A;  4XFH A;  3VBH B;  1ASJ 2;  2BWA A;  1WW6 A;  1PO2 1;  2D93 A;  2W91 A;  4AFA A;  1U5I A;  2VGD A;  3P3P A;  1RGS A;  3S7I A;  1UPS A;  4QX2 A;  3KCC A;  3QAC A;  3VDA A;  3HT2 A;  3ZYB A;  2PHX A;  2GU9 A;  3VKL A;  1J1T A;  2NM1 A;  3B7M A;  1IS5 A;  4R9A A;  5CIR A;  5KXD A;  1VBE 1;  4FFH A;  1YFY A;  4H7M A;  4K3U A;  1QJU 1;  2J1S A;  3RRD A;  5JXJ A;  2D3R A;  2Q4S A;  5BY5 A;  1BLZ A;  1ULO A;  2VZS A;  3GBF A;  3FHQ A;  3GZT B;  1XQN A;  3WNK A;  3GYD A;  4WVM B;  4EN7 B;  5GZG A;  2QQV A;  1AR6 1;  3ILF A;  4QKN A;  1FOD 3;  4QHO A;  3WDT A;  1UMZ A;  4HBN A;  1DHK B;  5FAX A;  4YAR A;  4CDQ B;  1BK0 A;  2JB8 A;  2X53 S;  3ZXK A;  1WUV A;  1TEI A;  5C3S A;  3BOW A;  1X8E A;  4Y5Z 0;  5BNO B;  4XHX A;  3SKJ E;  1JYN A;  5FLI A;  2TNF A;  2W39 A;  1E57 A;  2JDY A;  2WBK A;  1OOP C;  4JTO A;  4QXH A;  4Y20 B;  5A1A A;  2WS9 1;  1XRU A;  3JXS A;  2R04 1;  3BTA A;  5FZH A;  3H9A A;  1JZ5 A;  1AYN 3;  5HI0 A;  1MAC A;  3N7L A;  1OXC A;  1MZF A;  2VCB A;  2JIC A;  2YYO A;  4C0H A;  4N7U A;  5A3M A;  4P9G A;  1ULP A;  1O6U A;  3C7E A;  4RD7 A;  2J42 A;  1K12 A;  2VC9 A;  3D82 A;  5FYH A;  4LHL A;  4QPW A;  3HD8 B;  3ZXL A;  4CVU A;  1W6P A;  1EV1 1;  2RE9 A;  1E5H A;  4HVR A;  4ISQ A;  1U5Y A;  2B9V A;  4YZ2 A;  2P5B A;  3TN9 3;  5A7W B;  1DCS A;  5CFC C;  2XR4 A;  3BCW A;  2JIG A;  1D2Q A;  1H1A A;  3KV6 A;  3F2Z A;  4LHN A;  4OI4 A;  4XJ9 A;  5A33 A;  4DO0 A;  4Y1X A;  4IE5 A;  3ATG A;  3OG2 A;  4KL1 A;  1JUI A;  3M3C A;  5AC9 3;  2OQ6 A;  4NOT A;  4QXK A;  4AVC A;  2TUN A;  2JDU A;  3RG0 A;  3PU8 A;  3I2H A;  4AK3 A;  1QXR A;  3T2P A;  3AK0 A;  3KGZ A;  2RS1 1;  4AI3 A;  2J1E A;  1YQC A;  1IG3 A;  4XUP A;  1PHM A;  1W9S A;  2CDP A;  1FXZ A;  2Y6G A;  4FPY A;  4RGG A;  2FCT A;  1G9B A;  1JXN A;  1US3 A;  4JDO A;  2Q0A A;  4F7Z A;  3N3H A;  1UYZ A;  1WMX A;  1GIC A;  2HEW F;  3U75 A;  3WHT A;  2WNU C;  1RUJ 2;  5F5A A;  1DQ6 A;  1AL0 G;  4IEP A;  1LUL A;  4LNV A;  5FP9 A;  5A3N A;  2W1U A;  1SG3 A;  2ARA A;  2Y6F A;  1UKG A;  1VAM A;  3OBT A;  1AX1 A;  1SEF A;  3KF3 A;  1W9W A;  2R06 1;  3M3Q A;  3N9Q A;  5CYY A;  4O7X A;  4QQL A;  2D3S A;  1IS6 A;  3NNM A;  4QWN A;  2IVJ A;  1CAX B;  4HPK A;  1CON A;  3INA A;  3WD5 A;  2DTW A;  5A3O A;  1T6B X;  1ZBE 1;  2GMM A;  1TNR A;  1YLL A;  3VHR A;  3FLP A;  1ZM1 A;  1GMM A;  4A44 A;  3TNQ A;  4FO9 A;  4ZS2 A;  1ODN A;  5JUV A;  2VZ3 A;  4Q1R A;  4LBN A;  4M4P A;  4XDO A;  5EPA A;  1Q8V A;  5CVR A;  4E2G A;  5C6C A;  4K7J A;  1C8M 2;  3LSE A;  1HIX A;  1WLD A;  1QHD A;  2JD9 A;  2EIG A;  4Q8K A;  4CP2 A;  5CU1 A;  2ZTN A;  4MLO A;  4CXX A;  4GUL A;  3IPV A;  4XZP A;  1UAI A;  1GQH A;  2Q8D A;  2C9A A;  2WZR 2;  4BHP A;  3RZJ A;  4D3W A;  4MG2 A;  5EXO A;  3WV6 A;  2LM3 A;  2P1B A;  2VMD A;  3JBG 2;  2BBA A;  4BOW A;  2ZML A;  4XJA A;  2WZ8 A;  5FR3 A;  3AMH A;  1K45 A;  4AI9 A;  4Y33 A;  2DCK A;  1HJF A;  4NVP A;  5BNN C;  4YSF A;  4BQ3 A;  3CLP A;  3WF3 A;  1N3P A;  1C3H A;  3ZLI A;  4LT5 A;  2FDJ A;  2VUJ A;  1RUE 2;  5EFU A;  1PGL 2;  5KHK A;  3ZXA C;  1HXS 2;  1PIV 1;  4LBO A;  3O1T A;  4KU7 A;  1GZT A;  1W8H A;  1IKQ A;  2ZBJ A;  2DCJ A;  4LK6 A;  4RHV 1;  1AR7 3;  2NZ9 A;  1MPX A;  1Z7S 1;  1YUD A;  4QQO A;  1UY1 A;  4RQP B;  4CU8 A;  1JYW A;  4ZHN A;  4CEW C;  3RZZ A;  3IWZ A;  4IER A;  4UFI A;  3ZXF A;  5CIS A;  3F95 A;  3FBM A;  4R9B A;  3MIF A;  5C3O A;  1B35 B;  3CL1 A;  2HWF 1;  2VTF A;  5JIA A;  3AZZ A;  2BOI A;  2WSV A;  4QPY A;  5I0T A;  4I3G A;  3RMX A;  3IMM A;  5IVJ A;  4FOV A;  4QKF A;  1MS0 A;  1U5Z A;  2IXC A;  1BEV 3;  1RL3 A;  1OLQ A;  1POQ A;  3DPR B;  1CZS A;  3VD7 A;  5GZC A;  3QH6 A;  1JI6 A;  2YXS A;  4XAA A;  3ZIX A;  2A6Z A;  1BBT 1;  1JU4 A;  3I2G A;  4HG6 B;  2JG8 B;  3O0W A;  5H9P A;  3WP6 A;  4HSL A;  3WNL A;  4W6Y A;  3WW1 A;  5F2W A;  5SV8 A;  2XUE A;  3IIA A;  4Y1Z A;  1LOF A;  4I0A A;  4XUO A;  2QDR A;  2WC2 A;  4L8Q A;  2P4E A;  3LD8 A;  4GH4 C;  4MXW A;  4QX8 A;  4BH9 A;  4JX0 A;  3ZN6 A;  3B69 A;  3ZX7 A;  1GOF A;  5A32 B;  1AR9 2;  3LDB A;  3HBK A;  1RUI 1;  4IEV A;  5BNN B;  2KR2 A;  1VP6 A;  2DFC A;  2OT7 A;  1HB2 A;  2K46 A;  1XSR A;  3DEC A;  3IM0 A;  3A7Q A;  4KWK A;  1S0G A;  2HWD 3;  1BMV 1;  2V09 A;  2A71 A;  2ZGS A;  5FZG A;  3GBG A;  4DXT A;  3MDP A;  1ZA7 A;  1OPM A;  1BVP 1;  4AYU A;  4Q4Y 1;  1VR3 A;  3UYJ A;  1BVV A;  1CAV B;  4NHY A;  5HPO A;  4GB3 2;  4DXZ A;  5JSR A;  4CEW B;  4YRD A;  1UZW A;  1C57 A;  2IVI B;  2RR1 1;  4H7L A;  4E8D A;  2VZ1 A;  1YI9 A;  4FTE A;  3C3V A;  1GBG A;  2XPJ A;  3A0K A;  2HBT A;  4JKK A;  5ERL A;  3VDD C;  4W50 A;  5F37 A;  3OUH A;  1PO2 3;  3PUA A;  4NIG A;  3L2H A;  3HN1 A;  2JDA A;  4LIT A;  3K2O A;  4LHS A;  2WLQ A;  5I93 A;  1CAW B;  2IFW A;  1HRV 2;  3NW4 A;  1CAU B;  2WWU A;  4CE8 A;  3ZPO A;  2JKB A;  2UYA A;  3RWN A;  1U12 A;  1DFQ A;  1VBE 3;  1J3R A;  2Q8E A;  2RG4 A;  3AM2 A;  4V1P A;  3USS A;  2IUW A;  4C1W A;  2WL1 A;  4W8J A;  1COV 2;  3N9L A;  2YPD A;  4KI5 M;  5F9T A;  2E63 A;  2VMI A;  4FFI A;  4YGB A;  4YVS C;  3VBF B;  3N4M A;  4XQD A;  4CEY A;  3VBU B;  2QVS B;  1NCQ B;  3MIH A;  5FPV A;  3H8X A;  3ILR A;  4XBQ A;  5A7O A;  1S0D A;  2I2S A;  4Q0V A;  3H1W A;  4E9K A;  4XBN A;  5E88 A;  2ZAB A;  3B9C A;  4BLI A;  1J3Q A;  1MEC 3;  2EIC A;  5JXI A;  4IET A;  4FP2 A;  4GH4 B;  5D21 A;  1TMF 2;  1VBD 1;  2YBS A;  5IVF A;  1J58 A;  2ADE A;  3BOP A;  1WMF A;  3O5S A;  2WAB A;  2XBO 2;  2BBV A;  2XDV A;  1V6N A;  1O8S A;  1K3I A;  5DAX A;  3RYK A;  2R32 A;  3MUZ 1;  4RFR B;  1HKD A;  2DFB A;  3LQC A;  3Q8E A;  1H4H A;  2LTN A;  1CES A;  1UXZ A;  2R04 3;  2QBX A;  1XB9 A;  3MID A;  4QX3 A;  3WXP A;  3TRS B;  1NE6 A;  2XKP A;  1DGL A;  3MPP G;  3BGA A;  4Y1V A;  1OQ1 A;  1PGW 1;  4BME A;  4NID A;  1OKQ A;  1GFF 2;  1SAC A;  4NII A;  2RS5 1;  4FPK A;  4XFF A;  5FTT C;  4QQP A;  1QGL A;  2CGN A;  5DN2 A;  1W2N A;  2KXL A;  3CQO A;  1SFP A;  3CMG A;  1PX3 A;  3R05 A;  4WM7 A;  1Q8S A;  4BYY A;  3V0B B;  4H3W A;  3IZO A;  4XFA A;  2BFU L;  3HNM A;  3ZFF B;  3VDD B;  1JHJ A;  2HH9 A;  3ZFE C;  5DQ0 A;  3PUQ A;  1FPN 3;  1NQJ A;  4YM0 A;  4D0Q A;  5K0U A;  3WIN E;  2RMU 3;  2FDH A;  1LKN A;  1MZ6 A;  1NA1 B;  1O3Q A;  1XYN A;  5J48 A;  2HBU A;  1MQT C;  2R0F A;  3JD7 2;  4BK4 A;  1H1I A;  3KHC A;  1YCI A;  3PUH A;  3ENR A;  4HK8 A;  1T6G C;  2RS1 3;  4LOR A;  5DPN A;  1EY2 A;  3AKT A;  1PM7 A;  2Q8C A;  1FX5 A;  2RM2 3;  2Y34 A;  3OY8 A;  1ULE A;  5T50 A;  3LIH A;  3TEZ A;  1AR8 2;  1R64 A;  2YBP A;  3WNN A;  1FMD 1;  1UY0 A;  3FC0 A;  3ZKU A;  2BRT A;  2VVF A;  5D8A B;  1WW5 A;  1UQX A;  1UX6 A;  2V5D A;  1LHW A;  4XC9 A;  2GN7 A;  2LRO A;  2RV9 A;  4FXG B;  5FYV A;  2RJL A;  4QPG A;  5L9V A;  2R06 3;  3I3B A;  5LBF A;  1AL2 1;  3MV0 1;  4Y26 A;  3IAP A;  1SLT A;  4K21 A;  3WEZ A;  3O1R A;  1E5I A;  4BQX A;  3ZYI B;  4O65 A;  1SDD B;  3WW4 A;  1YEW A;  2D6K A;  1TME 1;  3EHK A;  2B45 X;  2AGS A;  2XJP A;  3OGS A;  4IND A;  4XCB A;  3SCG A;  3WG2 A;  4D69 A;  1OT5 A;  1EAH 1;  2X8K A;  2BVV A;  3DL3 A;  3O7O A;  4ZXK A;  4WM8 A;  1FAT A;  4CDU A;  1H4G A;  1ND2 C;  2VVE A;  3CNA A;  1AX2 A;  4CDX C;  2ZGQ A;  2AYH A;  3VHP A;  3X29 B;  1R09 2;  3MLL A;  1W3X A;  2ZCW A;  5IK7 A;  3MW3 A;  5F5Q A;  5FP7 A;  3JQX A;  5BUV A;  2Y0I A;  4PI2 A;  2IXL A;  2J7M A;  1DBN A;  4QX0 A;  5FYY A;  1PNG A;  3ZFE B;  1G9D A;  2DWR A;  2MEV 2;  1NY7 1;  1MVE A;  3RZM A;  2P6H A;  1RHI 1;  1CX4 A;  3NMB A;  4WZC A;  5FZD A;  1BCX A;  2N7G A;  2VJX A;  4LA2 A;  3SMH A;  3WQ0 A;  2DU1 A;  3ZFG B;  3Q8F A;  2XJR A;  2VBB A;  2D6L X;  3JU9 A;  2OXB A;  1QJU 2;  1Y9Q A;  1YFX A;  1RIR A;  1RMU 1;  2CU5 A;  1LOF C;  4BWO A;  1Y7B A;  2WO7 A;  5T3N A;  5FRA A;  5FK8 A;  2X09 A;  3ZYF A;  3GCW A;  5FZ6 A;  4GJZ A;  1V9U 3;  1DIW A;  1XNT A;  2EVX A;  3GAL A;  4K20 A;  1A6C A;  4AGR A;  3P1I A;  1UXX X;  4JRL A;  2BYV E;  1S1A A;  2NN8 A;  3VHN A;  1H9P A;  3ME2 A;  2OYZ A;  4QMA A;  2KA3 A;  3VBH A;  2VZV A;  5LAS A;  2HEY F;  3PLQ A;  4JHZ A;  2XQR A;  1OF3 A;  4FPH A;  3SQO A;  5IYY A;  1L7Q A;  1Q56 A;  2VBP A;  4XUQ A;  1PZ8 A;  1V0A A;  3WQB A;  1POV 1;  3W58 A;  1WD3 A;  4CRQ A;  1JOJ A;  2VO5 A;  1X33 A;  5EWS A;  3VBO C;  1W8U A;  5F1R A;  4AFB A;  2ADD A;  2P37 A;  5DG1 A;  2Y6H A;  1GWK A;  1IQA A;  2D40 A;  3HIF A;  4MXV A;  1BBT 3;  3MO4 A;  2VUD A;  2E7Q A;  4WVZ A;  3GXU A;  4WVM A;  2EAL A;  2JDP A;  1VRH 2;  5IT6 A;  2O0O A;  4OMD A;  1LHV A;  2QQU A;  2PLV 2;  4JKM A;  4I01 A;  3AFK A;  2VOK A;  4CDQ A;  4YW5 A;  1QQP 2;  4MZU A;  3RGB A;  2EIB A;  4QHZ A;  5FZM A;  2X5I C;  3ILN A;  2Q8O A;  5IW0 A;  5KWR A;  1OMI A;  1NX9 A;  1SBD A;  5ISL A;  3QOP A;  5FP8 A;  4Y20 A;  4CEY C;  2I45 A;  2VAU A;  3EXU A;  5L9B A;  1RUI 3;  1YIF A;  4XQW A;  3R4D B;  4XDQ A;  3ZSL A;  1FOD 1;  1XJA A;  2BV4 A;  2LUW A;  2B4K A;  2JDK A;  5D1I A;  5HCA A;  4LBQ B;  3K46 A;  3K4D A;  2GNB A;  3USU B;  4AXO A;  4OHY A;  3DGT A;  4Y1Y A;  3LDR A;  2GMP A;  2A1X A;  4ZZ5 A;  2ZHL A;  4J6G A;  4MSV A;  2FQP A;  5FYB A;  4AVB A;  1AYN 1;  4AFD A;  3VZN A;  5HV4 A;  2E32 A;  1ND3 C;  3PVB B;  4OCT A;  2W1W A;  3FBY A;  5A7W A;  3WX5 A;  1W0P A;  4TTG A;  3UGF A;  2WN3 A;  1WKY A;  1DU3 D;  4NMI A;  3LEG A;  4GZ9 A;  4Q4X 3;  3WQ7 A;  1VBB 2;  4B4P A;  5C33 A;  3V65 A;  1QU0 A;  3H8U A;  4K8R B;  4MGY E;  2XOM A;  1F35 A;  2GH2 A;  3AP9 A;  1YIP A;  5FOB B;  3WDY A;  3K3O A;  4LE3 A;  1Y9G A;  2F4L A;  4WM7 C;  4Y4Y A;  1OA2 A;  4AWD A;  2E31 A;  1AYM 3;  4EWD A;  5B4N A;  3TN9 1;  2P17 A;  3T08 A;  3NV2 A;  4W4Z A;  3U07 A;  3H7J A;  5FZ9 A;  1I1E A;  1XE8 A;  4OUS A;  5AC9 1;  5K0U C;  2PAM A;  2EID A;  1F4A A;  2ZX0 A;  2VZU A;  3KF5 A;  1VBD 3;  1LJ7 A;  2WDB A;  1RUH 2;  3K3N A;  1N3O A;  1UNB A;  3LE0 A;  4CP9 B;  1PVC 3;  2I74 A;  5G05 L;  4QM9 A;  2HWC 2;  4N43 C;  1OOP A;  3U11 A;  2P3I A;  2RVA A;  5GLW A;  3WHU A;  2BGP A;  3VBR B;  1CAX A;  2ES3 A;  4OZX A;  4BLJ A;  2CGP A;  4UOJ A;  1KGY A;  2P3J A;  5F8P A;  4LO7 A;  5FO9 B;  5H9S A;  4WVW A;  4ZXE A;  4YFZ A;  2XH6 A;  1UF2 C;  1S0E A;  1XSQ A;  5IHR A;  1PO1 2;  1H0B A;  3S6P A;  4AQT A;  4OYU A;  1HRI 2;  1JW6 A;  1LES A;  1PIV 2;  1VJ2 A;  4QPG C;  2RDQ A;  4WZF A;  4PHZ A;  1QJY 2;  4XIO A;  1PNF A;  4CUB A;  4I30 A;  3ZR6 A;  4NHM A;  1ND3 B;  4FP3 A;  4QXB A;  5CFC A;  3PIG A;  2WZE A;  1SPP A;  3LA2 A;  1WW7 A;  3HEI A;  4L92 A;  2D6O X;  5FY7 A;  2YRO A;  3ZPY A;  1H9W A;  1O8P A;  2RHP A;  4PJY A;  3RZL A;  3KD4 A;  1NYW A;  4WM8 C;  1EUU A;  5FZL A;  2BWC A;  3AXE A;  5T5O A;  3VD3 A;  4D7S A;  1ASJ 3;  4NWW A;  1NT0 A;  3LPF A;  4DEQ A;  1VBA 2;  4W6X A;  4AI2 A;  4PDW C;  2BP6 A;  4IEW A;  1TE1 B;  2EAK A;  2EXJ A;  2JIJ A;  4QXC A;  1Y43 B;  4UF0 B;  1BJQ A;  4KBZ A;  4QDR A;  1OLM A;  4UW3 A;  1O4Y A;  4K1Z A;  3B93 A;  3LAG A;  1STM A;  2VOW A;  1CPN A;  1DQ1 A;  5LW9 A;  1FMD 3;  2WNU A;  3BN6 A;  4O9G A;  3FX3 A;  3POB A;  4P08 A;  4RQP A;  2G9F A;  5IFT A;  1YQ2 A;  1FYU A;  2W2I A;  3POE A;  4HN0 A;  5JXH A;  5IAX A;  4OVE A;  5B4X A;  4JGY C;  4RR3 B;  1VAL A;  1YQ6 A;  1B35 A;  2VR4 A;  2Y33 A;  1I3H A;  4XUR A;  5JOW A;  3O1V A;  5DDJ 2;  4BK5 A;  1C28 A;  1CN1 A;  1JOB A;  4RL7 A;  3CJI B;  4XJZ A;  5I91 A;  3KZ4 C;  1UW8 A;  1JTZ X;  3J8F 2;  3OCP A;  4UFH A;  1OA3 A;  4FTS A;  3DPR A;  3IKW A;  1IPJ A;  2VNO A;  4YVW B;  4LBJ A;  1SZB A;  4Q4W 2;  2JDN A;  1W9F A;  4Y22 B;  2QUO A;  2VNR A;  1D4V B;  2YC4 A;  1G6N A;  2Q1Z B;  2DDU A;  2ZZQ A;  3MIB A;  5EYY A;  4AOC A;  3VBH C;  1AUY A;  2C5D A;  1OD5 A;  3H8O A;  2HYX A;  1RUN A;  1S0F A;  1NAE A;  4B1M A;  5C8C B;  1SBE A;  5FMO S;  3UK9 A;  3QBQ A;  4MYE A;  2WNO A;  3OPW A;  1RTV A;  1ZBA 1;  1BEV 1;  3HJR A;  4QQH A;  1ALY A;  2P6C A;  4YW6 A;  4FQ4 A;  5A32 A;  2CAV A;  2XGX A;  5JVV A;  3I49 A;  2ZJC A;  3PDQ A;  2E6V A;  1O4T A;  3ZXD A;  4FFG A;  1RVF 2;  5BNN A;  3KT7 A;  1XNA A;  1YFW A;  3N36 A;  4J25 A;  3ZSK A;  4ERO A;  4OI0 A;  2ZX3 A;  4IE0 A;  5FBZ A;  4XFI A;  1W6M B;  1ZRD A;  3NL1 A;  1RMU 3;  2PAE A;  5KXE A;  4M00 A;  3AP4 A;  3ZMO A;  2GAU A;  1AVB A;  2JXA A;  1CAV A;  4H14 A;  2ARX A;  2VUL A;  5BNO C;  4NRM A;  4CEW A;  3ACI A;  1RUG 2;  4QX7 A;  1L7L A;  5DAP A;  4BJ0 A;  1UYX A;  1UOB A;  2B39 A;  2HJI A;  4Y5S A;  2B9U A;  5HXV A;  3TBD A;  3URF A;  4ZY9 A;  3RI9 A;  2HWD 1;  2OS2 A;  4XXP A;  4B8E A;  5BYN A;  2PHD A;  5IK4 A;  3L9J T;  5KC6 A;  4CCC A;  1CAW A;  3M1H A;  1CAU A;  1RUJ 3;  2BDR A;  5EJ1 B;  4X8P A;  4EV0 A;  1O91 A;  3VZJ A;  1TQ5 A;  5KHJ A;  3WT3 A;  4Z8B A;  5C3P A;  4QQ2 A;  4L9B A;  3S0M A;  2BPA 2;  1W2O A;  3CJX A;  3PVE A;  5C5U A;  2X05 A;  3GF6 A;  3T2T A;  5GLV A;  4V2V A;  3VBU A;  1LCL A;  1NCQ A;  5E16 A;  5GKA C;  4B3N A;  3KM5 A;  3HQU A;  3BB6 A;  1E5S A;  3PUR A;  2O1Q A;  4X6Q B;  3J7M A;  3SCF A;  3T0A A;  3DF0 A;  2VW2 A;  2UWB A;  1VAV A;  2K0G A;  4GH4 A;  3T3Y A;  2VCA A;  1GQP A;  1LOE A;  1KDM A;  1W04 A;  5FZO B;  4DXR A;  1C8M 3;  4MHU A;  2J1U A;  4NE9 A;  1LHU A;  4YM2 A;  2Y0O A;  4PF1 A;  4AVS A;  1A34 A;  2DU0 A;  2GH8 A;  1O7F A;  4NRQ A;  1J3P A;  3NJX A;  2OUH A;  5GJ6 A;  1SLC A;  1JYV A;  2FZ1 A;  2VZQ A;  2GND A;  4GMP 3;  1HB4 A;  3HOB A;  4N7I A;  5FY0 A;  4ET7 A;  5EJ3 A;  4PCR A;  2IWG B;  2D98 A;  4A45 A;  2WZR 3;  1I5Z A;  1OQE A;  2E7A A;  1MEC 1;  2RS3 2;  5CFD B;  4KBB A;  1PGS A;  4OHZ A;  3JBG 3;  3VD9 A;  1O4Z A;  4AW7 A;  3AYC A;  5EQU A;  4LKF A;  3HMY A;  3U1X A;  2WFF 2;  4A7Y A;  1W6N B;  3GHN A;  4H2A A;  2G19 A;  1I5P A;  3NV4 A;  5L73 A;  3V0B A;  1RUE 3;  1SLL A;  2VZP A;  2ZEZ A;  2C9K A;  4JGZ C;  2VTX J;  5FPX A;  3H8R A;  1HXS 3;  5AVP A;  1R1Z A;  3VDD A;  3B3Q E;  3VDC A;  3UGH A;  3SH3 A;  3ZSE A;  2Y64 A;  1WCQ A;  1CX1 A;  4FT8 A;  2WT0 A;  3GM8 A;  3I59 A;  3I4I A;  4QGM A;  5H9Q A;  3TOJ A;  2PTM A;  3NJZ A;  5F5I A;  1SFN A;  1DG6 A;  4YZ1 A;  4EN9 B;  1EYB A;  5L19 A;  2Q5T A;  2DVA A;  4CPB A;  2VMG A;  4F8A A;  2ILM A;  2XVK A;  4YVS A;  4OUL A;  2YBK A;  2ID4 A;  1GUI A;  4AEJ A;  4D8M A;  1N3Q A;  4Q1P A;  1ENX A;  2VMF A;  3KLS A;  3P5B A;  1FPN 1;  2FDI A;  3KS7 A;  1H1M A;  2JB4 A;  1CD3 G;  4BQ2 A;  2RMU 1;  4X8N A;  2JDH A;  1QJX 2;  2YUE A;  2WAA A;  4MUV A;  2G9Z A;  4YG3 A;  2WT1 A;  1LHO A;  1AHS A;  4GKX A;  4SBV A;  1RUD 1;  3B94 A;  2WWJ A;  3M3E A;  3HR9 A;  4IV1 C;  1US2 A;  4TN7 A;  1ZNP A;  3VKM A;  1GP5 A;  3E5X A;  1R08 2;  5FZA A;  3OD4 A;  3MPB A;  5FO8 B;  1GP6 A;  3OB8 A;  3ZYH A;  1AXK A;  5FPU A;  5JAX A;  2RM2 1;  5IVY A;  3UL2 A;  1J1L A;  2WO1 A;  4ORF A;  3ITQ A;  1JS9 A;  2X29 A;  5FYZ A;  5F39 A;  5JZG B;  3O1U A;  4RQP C;  5FPZ A;  5C4W B;  4IGO A;  4OFG A;  3EJK A;  2G1M A;  1HQW A;  4AAX A;  1B35 C;  4K6B A;  1IPS A;  5A7Q A;  2HEV F;  1KDK A;  3WG1 A;  2OII A;  1WZX A;  5CAZ A;  4JGZ B;  3TNP B;  4W6W A;  3ZFE A;  3SKV A;  5T5L A;  1VIW B;  3IBM A;  4QPI B;  2A6Y A;  1JMU B;  4GB3 3;  5IFP A;  3VZM A;  2BJS A;  3DPR C;  2OZ6 A;  1W9T A;  1YNA A;  2YPJ A;  5F2S A;  3E6D A;  2XXZ A;  1FV3 A;  1MQT A;  4HFS A;  4HKL A;  5ANQ A;  4C0B A;  2W0X A;  2VE1 A;  3BOD A;  4PQ9 A;  2JG8 C;  4S2D A;  5A7P A;  3ZFG A;  1Q8Q A;  1GP4 A;  1QJE A;  4P9J A;  5FYC A;  1KJR A;  4YZ4 A;  4IES A;  3V0A B;  1HRV 3;  3PIJ A;  4J1W A;  4CXY A;  4FFF A;  1G8W A;  2BOJ A;  4HXC A;  5L7O C;  5JOZ A;  5FZE A;  2X10 A;  3ACL A;  4GAZ A;  3PUI A;  4D6Q A;  1W2A X;  1HLC A;  4JVA A;  1N1V A;  1OQD A;  1IZ3 A;  2QCS B;  3RNS A;  1COV 3;  4YGC A;  4B7E A;  4AGG A;  4V2W A;  2B5H A;  5DUX A;  2WNV C;  1PK6 B;  5FKC A;  1W8W A;  3FFZ A;  4IV1 B;  1AJK A;  4S2H A;  1RUF 3;  3SH5 A;  2Z69 A;  1IKP A;  2BGO A;  2WYS A;  1LGN A;  5EIY B;  3S57 A;  3QCW A;  1ST8 A;  2ZEX A;  2D6N A;  2ZXQ A;  5LK7 B;  1VAK A;  2VNG A;  1XNK A;  2VCC A;  1LEN A;  1TMF 3;  1V9U 1;  1SLI A;  1VLN A;  5DAQ A;  2XBO 3;  4Q0S A;  5AFB A;  5FJH A;  5FK7 A;  2D43 A;  4LBK A;  3SHR A;  3FUQ A;  1HV0 A;  2XWJ B;  4COV A;  1BHG A;  1ND2 A;  4QT6 A;  4CDX A;  1ZYB A;  5FZ8 A;  3RVH A;  1TVG A;  3PU3 A;  2OZJ A;  2VQ0 A;  1WWY A;  1UPI A;  1WCU A;  5KHI A;  3AXD A;  3M70 A;  3HNY M;  3OPZ A;  3AJZ A;  1H30 A;  2A6W A;  2ETE A;  3ETQ A;  1OH3 A;  2Y8K A;  3AKQ A;  4MH0 E;  2XHK A;  1ZBA 3;  4JV4 A;  1Q43 A;  2HWE 2;  4LQR A;  1YC6 1;  5A80 A;  1X9T A;  1V6O A;  3VBF C;  4AE2 A;  1ACC A;  1NG0 A;  3IDE A;  4XUN A;  3VBU C;  2RDR A;  1NCQ C;  4X6R B;  3ASI A;  2WNE A;  3FE5 A;  1CPM A;  3ZKY A;  2HKX A;  3A4U A;  5L7O B;  4LBQ A;  2Z2S B;  3AP7 A;  3WP4 A;  4QU1 A;  3USU A;  3QD6 A;  4AQ2 A;  5A7N A;  1HQN A;  2O8Q A;  2PHW A;  2ZEY A;  3THT A;  3JD7 3;  4Q4V 1;  4CUC A;  3DXT A;  4QB1 A;  2QDN A;  2G9G A;  5JI9 A;  1I9R A;  1IPK A;  2WNV B;  4WBB A;  3RYR A;  1ODM A;  2GME A;  2WQ4 A;  2ZGK A;  3KSC A;  3KWV A;  5DZG A;  4ONU A;  1DGR A;  5G04 L;  3KV4 A;  5FXW A;  1AR8 3;  2V73 A;  3CDZ B;  3BKZ A;  2R49 A;  2UWA A;  4CU7 A;  1DQ4 A;  2A75 A;  1DQ5 A;  2W46 A;  5FZ4 A;  1K5M B;  1NUK A;  1TNF A;  2AAC A;  1GU3 A;  1DYO A;  3FZ3 A;  2XVG A;  2WQZ C;  3VBO A;  1VBC 1;  5LY1 A;  2QQM A;  1YJK A;  3PL0 A;  3J7N A;  1F8V A;  3U78 A;  5JOY A;  4ASK A;  4K9S A;  5J09 A;  4YG6 A;  3FWE A;  3ZFF C;  2W3J A;  1RED A;  1Y4W A;  3O1S A;  1DLL A;  3OJB A;  4WV8 A;  2Y6J A;  3RMY A;  4Q5O A;  5A70 A;  5IAT A;  1DDL A;  1OFN A;  4Q4X 1;  1C5H A;  1NE4 A;  5E6H A;  4CCE A;  5ABJ B;  1CZV A;  5I8S A;  4GKY A;  1POV 0;  4R8H A;  2ZOE B;  3POF A;  1NA1 C;  2X5I A;  2FMD A;  1S0B A;  1UL9 A;  5I0S A;  1ZZB A;  3POW A;  4XET A;  2VY0 A;  2P3K A;  1R09 3;  4CP9 A;  3OF1 A;  3VBS B;  1AYM 1;  4A6O A;  1R1A 2;  1OI6 A;  4KWU A;  2V5Y A;  2QE3 A;  2GZW A;  3VBR A;  4CPB D;  1RUC 2;  4M4R A;  4YGD A;  3AVR A;  4MX3 A;  3SIT A;  5CEH A;  3SH4 A;  3M2M A;  2A3Y A;  4PT6 A;  5C9A C;  2ERF A;  2ZMK A;  1RJ7 A;  3VD5 A;  1W8T A;  1UD1 A;  4OI1 A;  2JDM A;  1XC6 A;  5D8A C;  4ES8 A;  2CL2 A;  3KCX A;  5JIU A;  5FYM A;  3LFM A;  3OGG A;  3ZXJ A;  4XF0 A;  1H6X A;  2YFU A;  1PVC 1;  3K4A A;  3RJ2 X;  2ET1 A;  2WRA A;  3AZW A;  1WLC A;  1JUH A;  4MET A;  4UW4 A;  3RPQ A;  3ZYJ B;  1S0I A;  3RI8 A;  4CA9 A;  4DMI A;  4KNC A;  3AZX A;  1ND3 A;  5A3U A;  4I02 A;  1WME A;  3D0S A;  1D4M 2;  2OPK A;  1VRB A;  3S5A A;  2ZHM A;  5LA2 A;  1SBF A;  2FD8 A;  4XXA A;  4DIN B;  3UV9 A;  4B29 A;  3HPN A;  2Y26 A;  1DGW A;  3DUI A;  4L2N A;  4QM8 A;  4COY A;  3LEI A;  5JDB A;  3D6E A;  5FY8 A;  1AR7 2;  2HWB 2;  3O0X A;  5FY4 A;  4EN6 B;  3GZE A;  4JQT A;  2E7T A;  3S30 A;  1Q8O A;  2B46 X;  1DZR A;  4XIL A;  5JLV A;  4UF0 A;  1QXJ A;  3WF2 A;  3IMN A;  4B1L A;  2ZAC A;  4GAL A;  4RYD A;  5FIX A;  4QDQ A;  5LA1 A;  1LED A;  3WW3 A;  5BNP C;  3N9O A;  1UCX A;  3PTR B;  4L11 A;  4CCJ A;  4XAC A;  5IAV A;  2XJV A;  3VV1 A;  5AVA A;  4KWL A;  4L97 A;  4HKO A;  4FOY A;  5HXM A;  1AXY A;  1JYI A;  1ASJ 1;  2IXJ A;  1RUD 3;  3DKQ A;  3NQH A;  2DUR A;  4RR3 A;  3UGG A;  3ZFG C;  4N43 A;  1UYP A;  1VRH 3;  1X8M A;  4XFB A;  4LMF A;  3RZH A;  5ACA 2;  2PLV 3;  3JUU A;  3LEK A;  4M3C E;  4CXW A;  3PJY A;  3CJI A;  4NO4 A;  1XYP A;  1QQP 3;  2CY6 A;  3WUC A;  4AQS A;  4BZ4 A;  4R52 A;  3WQ1 A;  2ZEW A;  1W6Q B;  4N53 C;  1W05 A;  2W68 A;  4YWA A;  3V64 A;  5C9A B;  1JYX A;  2QNK A;  4IE7 A;  2ZHK A;  1SHW B;  4NRP A;  1Q3E A;  4YLZ A;  5DUV A;  1NCR C;  3SC7 X;  1QH6 A;  1BK1 A;  3ORJ A;  4YVW A;  2VZR A;  3WNO A;  1X7N A;  3LB9 A;  4UFK A;  2E33 A;  4Y22 A;  3VGI A;  1ZRI A;  1M06 G;  4D7T A;  4TSV A;  3WDV A;  4ZU4 A;  3MGU A;  2WII B;  2BGC A;  4KMQ A;  4RN5 A;  3ETP A;  2IZW A;  1W6P B;  4QX5 A;  3W21 A;  4FPL A;  5C8C A;  2PEL A;  1O5U A;  4D94 A;  4E4S A;  2VNV A;  5KHH A;  1A8D A;  1QH7 A;  2Y6K A;  3ZDV A;  3BPZ A;  3U37 A;  3NJY A;  4XAB A;  4CUG A;  5CKM A;  1T2X A;  4LXL A;  4Q2F A;  3O1M A;  4CCO A;  3HQX A;  5A1L A;  1QDC A;  2H0B A;  4IEZ A;  4KWJ A;  4I0B A;  4NRO A;  4OMC A;  3WVJ A;  2R1B A;  1G7Y A;  4FI9 A;  2IXI A;  4PDW A;  3VB9 A;  1RXG A;  4EQV A;  3LWC A;  1V6K A;  1W6M A;  4HAN A;  4GIQ A;  1QNW A;  2R1D A;  4LIV A;  1VBB 3;  1OUS A;  3VKN A;  3I2D A;  4AAP A;  4B7K A;  5J36 A;  5BNP B;  2ZZJ A;  1JZ2 A;  2WSU A;  2YB7 A;  1PO2 2;  4URT A;  5LBC A;  2QQL A;  1H2K A;  1KXG A;  2QKD A;  3POY A;  1WD4 A;  4OI2 A;  5AFE A;  4DY3 A;  3BU7 A;  1W28 A;  4JGY A;  1LB2 A;  1VMH A;  1W8F A;  5FMB A;  3U14 A;  5C71 A;  1SCS A;  1UU4 A;  1TZO A;  1VBE 2;  3B5L B;  5JMO A;  4XJU A;  1RIN A;  1Q8P A;  1OH4 A;  1YO8 A;  3N9M A;  1QIQ A;  4OLL A;  4QB6 A;  3T09 A;  3EB7 A;  3HVD A;  4N90 A;  5FY5 A;  4N53 B;  3W59 A;  1XOY A;  2WUH A;  3I3E A;  4LBQ D;  4EZ4 A;  3T1L A;  5I8Y A;  1YHF A;  1NCR B;  2WQ8 A;  1AR6 2;  2BNM A;  4JQR A;  3EBR A;  5FZ1 A;  1LTE A;  3MIE A;  2R30 A;  4BQ1 A;  3CKH A;  3KVB A;  1P8J A;  3C7G A;  1MS4 A;  1OLR A;  1JHN A;  2UU8 A;  3MFC A;  3TEW A;  5A6X A;  2MPF A;  2YU2 A;  3GHM A;  4FOQ A;  4BDV B;  2CSG A;  1RUJ 1;  4YGE A;  3THD A;  4P9I A;  3THP A;  1LOA A;  4ITC A;  3H0O A;  4GXL A;  5DAB A;  1BXH A;  2WS9 2;  2R04 2;  3D4K A;  3R6S A;  1HRI 3;  5LRR A;  3WLU A;  5DZE A;  5FZO A;  3T2O A;  5BNQ A;  5EP9 A;  1QJY 3;  3CZU A;  4YFW A;  3NWK A;  3CF6 E;  4YNI A;  3WDW A;  3GCX A;  1W03 A;  1J84 A;  4JAA A;  2XKO A;  3AZY A;  1LOG A;  3ABZ A;  2W95 A;  3PUS A;  3KB5 A;  3S5Q A;  4CU6 A;  2UY8 A;  2Z42 A;  3APB A;  5CFD A;  2VVD A;  1U5X A;  5A3P A;  1EV1 2;  2C4X A;  5A6Y A;  4C8D A;  2PHR A;  1C8M 1;  3EYP A;  4Q4V 3;  1DZT A;  5BNO A;  1NZC A;  4Y3O A;  2SBA A;  1VBA 3;  1W6N A;  4C1X A;  3ZDS A;  4GMP 1;  2VD7 A;  3MEP A;  2UY9 A;  2A6X A;  4O61 A;  4J1X A;  3VBR C;  4L0P A;  1A78 A;  5KHG A;  5K8S A;  1G86 A;  4ATE A;  4A7Z A;  2WZR 1;  2C26 A;  1MS8 A;  3RSJ A;  2ARE A;  2RS1 2;  2WAO A;  5SV5 A;  3JBG 1;  4E2S A;  1JH5 A;  4K40 A;  1LR5 A;  5FMC A;  1V00 A;  5FXX A;  4B4Q A;  1WCK A;  3AYD A;  5GLZ A;  4M0N A;  4FQZ A;  5A3W A;  1RUE 1;  1VBC 3;  2B8M A;  3W5M A;  1HXS 1;  3ZR5 A;  2RJK A;  2VBD A;  1IOA A;  3OYW B;  5BPX A;  2R07 3;  1WA4 A;  1ZRR A;  2NPI A;  4NWV A;  3LKJ A;  1A8M A;  2R06 2;  3WNM A;  2FBE A;  2F17 A;  4NPL A;  2W1S A;  2FZ2 A;  3MBW A;  1S4C A;  1JYT A;  1O59 A;  2Z79 A;  3IDA A;  4P9Y A;  5DAV A;  4MXW B;  1EPW A;  3BPS A;  2QQW A;  1K5J A;  5D2A A;  2YGL A;  3FL7 A;  1HW5 A;  1ZBE 2;  2EAA A;  2FCU A;  3UJO A;  2E9Q A;  4G3Y C;  3K4Z A;  3EQE A;  4LR4 A;  5FXZ A;  2ZKL A;  4PI0 A;  3U4X A;  1W3V A;  4UFJ A;  2EXI A;  1JZ4 A;  3I97 A;  5J96 B;  2XLA A;  3LOI A;  2ZGT A;  4XIK A;  2OW4 A;  4FPF A;  5JZG A;  2AC1 A;  1XNC A;  3NST A;  3OBZ A;  5J37 A;  4PIY A;  3Q8B A;  4A42 A;  2E53 A;  2JG9 B;  3HNB M;  1RVF 3;  2TEP A;  4QD2 A;  1IS3 A;  2JE9 A;  2QZ2 A;  4RR3 C;  2QQJ A;  4NAM A;  5FP3 A;  1ULC A;  4U36 A;  2BER A;  4JGZ A;  1RJ8 A;  2DUO A;  4PBP A;  3CJI C;  2FHR A;  5FRE A;  3EMR A;  3WCS A;  1HB3 A;  4M01 A;  5EHD A;  3WZ1 A;  4DZG A;  4N9I A;  4QPI A;  3B01 A;  2PHL A;  4DY5 A;  4R4X A;  4YW7 A;  4YW1 A;  3RFR A;  1RUG 3;  4YVW C;  3LPG A;  4LJH A;  1NXD 1;  4XBL A;  1GSL A;  5J3U A;  2NP0 A;  2CDO A;  1LOC A;  3SXW A;  4ATF A;  1DQ2 A;  2E26 A;  1REE A;  4RHV 2;  2CWS A;  1DYK A;  1Z7S 2;  1IHM A;  1DZQ A;  2PXJ A;  2WN2 A;  3WG3 A;  1ZRE A;  3V0A A;  5FPB A;  1RYY A;  5C70 A;  3IAQ A;  5C8C C;  1HV1 A;  5FKB A;  2EF6 A;  4YZ5 A;  4JC1 A;  4Z1V A;  4GB3 1;  2HWF 2;  2TBV A;  1SDW A;  4JDN A;  4DRV A;  4K1Y A;  1XE0 A;  3OEA A;  5FV3 A;  5A1F A;  2QQP A;  3T30 A;  3DEM A;  5FMD A;  5FYS A;  1OVP A;  1PK6 A;  5APA A;  2RJ2 A;  4IV1 A;  1X9P A;  2DVF A;  4IE4 A;  2CHH A;  3E5Q A;  3O14 A;  3LZZ A;  1HRV 1;  3KGL A;  1CGP A;  4RS5 C;  1BZW A;  1CVN A;  5LCW L;  1GYK A;  2BW8 A;  4I3P A;  5FJK A;  3KCY A;  4EN8 B;  2D3P A;  1BBT 2;  4HVO A;  5JSO A;  1ONA A;  4AG4 A;  4LLO A;  5EYX A;  1D0G A;  4NHK A;  1COV 1;  2CYF A;  2ZGN A;  4GD4 A;  3CZJ A;  4UBG A;  4XFG A;  4DRR A;  3O1O A;  4XTP A;  3PVN A;  5E8A A;  4LKE A;  4AEM A;  4A3Z A;  1RUF 1;  1W39 A;  4NN0 A;  4Z82 A;  3WSO A;  3C7H A;  1ZA4 A;  5LBB A;  3O12 A;  3E6C C;  5K7P A;  2ZAH A;  4AVA A;  3TYJ A;  4AR2 A;  2WFP A;  2GC2 A;  2RS3 3;  2VQT A;  1K42 A;  4FTB A;  1TMF 1;  3OD0 A;  3LFI A;  2JE7 A;  1L7R A;  2XBO 1;  1UKR A;  1RUI 2;  3HBZ A;  5DG2 A;  5LEK A;  1SCR A;  2J22 A;  1D7P M;  1G9C A;  4TYS A;  4IUG A;  3W9A A;  1BMV 2;  4A7K A;  1F15 A;  4KH9 A;  4B4R A;  4AHX A;  2VW1 A;  2JG8 A;  5FO7 B;  2AUY A;  1QOT A;  2JDZ A;  3NVC A;  5CA6 A;  3AP6 A;  3D8C A;  3KV5 A;  4Q4Y 2;  2WWS A;  5GAL A;  2D7F A;  5GLU A;  5L7O A;  3R4U A;  1AF9 A;  2RR1 2;  3N7J A;  2PAK A;  4AED B;  4EJR A;  3CU7 A;  5DXD A;  1GOG A;  3AJY A;  3ZSJ A;  2XHN A;  3D0J A;  1C5I A;  4NAO A;  4IV3 B;  5CZK A;  1QEX A;  4MHR A;  5JR7 B;  4C90 A;  2WNV A;  1JOD A;  4Z07 A;  5H9R A;  5HCH A;  5FZ0 A;  5GZF A;  3PJQ A;  2WKK A;  4ZON A;  3TEY A;  1KD7 A;  1KRI A;  1Z0H A;  3OGV A;  5JWP A;  4RS5 B;  4YW3 A;  1AZD A;  4AI0 A;  1ZZ6 A;  4ZKT B;  5CFD C;  5FXV A;  4PLO A;  1QJF A;  3NV1 A;  4Q0Q A;  1UY4 A;  5HCF A;  1XNB A;  3OBR A;  3JD7 1;  3W5N A;  3HAG A;  4AF9 A;  4HON A;  4EWA A;  1XND A;  3PTY A;  4DQA A;  1X36 A;  1W8N A;  5FUP A;  1R08 3;  4H55 A;  1S2K A;  3B02 A;  2IXH A;  3CIH A;  1F31 A;  4AGV A;  5F6L B;  2Y60 A;  1VBD 2;  1AR8 1;  1CZT A;  1PX4 A;  4IGQ A;  4ES9 A;  1OHF A;  3NRU A;  1HJG A;  2DBI A;  2ZGL A;  5GZE A;  5IWF A;  2DBN A;  1H8T B;  2P34 A;  4P00 B;  4XJ8 A;  3SEE A;  3AKR A;  5ABJ A;  2C6S A;  3NAP C;  1YRZ A;  3KQR A;  2XVL A;  2VXR A;  1RIT A;  2XJS A;  2VXJ A;  1KFU L;  3D3A A;  4BMB A;  4MO3 M;  4JCK A;  4TXW A;  3RQ0 A;  2P3Y A;  5J98 B;  4E27 A;  2CGO A;  3KV9 A;  4P14 A;  1NLS A;  3VBF A;  3VBS A;  1PGW 2;  3VL8 A;  2RS5 2;  3MHZ A;  1O3R A;  1CWP A;  3K51 A;  4OQ8 A;  1X50 A;  5C7G A;  4GWM A;  1SLA A;  1UIK A;  2VUA A;  1DLC A;  3A22 A;  4PIX A;  5LBE A;  1O3S A;  2JEN A;  3POJ A;  3J9S A;  4XUT A;  1LU1 A;  3IB3 A;  3P6B A;  3SNM A;  3NNL A;  3MLJ A;  4HOO A;  1GNY A;  2A6V A;  2K9Z A;  1R09 1;  4JZR A;  2O8O A;  3UES A;  1YYN A;  2UWC A;  2W87 A;  2XUM A;  4N8M A;  4KU8 A;  3U0Z A;  3R0R A;  3ZIW A;  3AB0 A;  2MEV 1;  1REF A;  2K2S A;  4P5H A;  2JD4 A;  1WGP A;  4IEU A;  5E1R A;  2YDE A;  5JSP A;  1AX0 A;  1XBF A;  4CUA A;  2FMY A;  5JZG C;  4LE4 A;  4IGP A;  1ZZC A;  3WP5 A;  5I0R A;  3AYA A;  1VMF A;  2WJS A;  3NKG A;  4PLM A;  5C4W C;  3WNX A;  2WYF A;  4P9W A;  4PQQ A;  4OHV A;  5FYU A;  5FCC A;  5J1X A;  1DYP A;  4LUL A;  5FZB A;  1CIW A;  1FMD 2;  1UWW A;  4FXK B;  4AEK A;  2H0V A;  2RDN A;  3ZFF A;  3FJS A;  4Z2W A;  2V4A A;  3VD4 A;  1VB4 A;  3U10 A;  4FVV A;  4HKW A;  4QPI C;  3T0D A;  1AL2 2;  3LIG A;  3NAP B;  4OHX A;  1NA1 A;  3MV1 1;  3TEX A;  5FY1 A;  1SMV A;  3ACH A;  1V6I A;  1WMD A;  1H2N A;  1QJZ A;  3H7Y A;  1TME 2;  4LHK A;  3T4H B;  4M3C B;  3ZO0 B;  1EAH 2;  3UJQ A;  3VHO A;  1VB2 A;  1DF0 A;  3HN3 A;  4GWN A;  1APN A;  4FPO B;  1FI2 A;  4R4Z A;  1V70 A;  2ZS6 B;  2WA3 A;  4S2F A;  1W6Q A;  4LPL A;  4Y24 A;  5C9A A;  3KHB A;  2HWE 3;  3I2O A;  2B42 B;  1F2N A;  5D8A A;  3R4S A;  3PHM A;  2JEM A;  5IK5 A;  1WBF A; 
#chains in the Genus database with same CATH homology
 2FCU A;  5IAT A;  4Q5O A;  5DAX A;  4ZON A;  2RDS A;  5C5U A;  2RDQ A;  4NHL A;  5LAS A;  5LBC A;  4NHM A;  3NNF A;  3OBZ A;  3HQU A;  3GJA A;  5L9R A;  4UWD A;  2FCV A;  3EMR A;  4MHU A;  5LAT A;  2JIJ A;  3HQR A;  4KBZ A;  4XAA A;  5A3U A;  2HBU A;  3OUJ A;  5DAQ A;  5EQU A;  2JIG A;  4ZPI A;  5IAX A;  3KT1 A;  3KT4 A;  5L9B A;  3GJB A;  2Y33 A;  2G19 A;  5LBE A;  2Y34 A;  3NNJ A;  5EP9 A;  3NNL A;  3GZE A;  4JZR A;  4XC9 A;  2A1X A;  5L9V A;  2FCT A;  5LBF A;  4XAC A;  5C5T A;  5IAV A;  4BQX A;  5HV4 A;  4NHK A;  4NHX A;  4XCB A;  3DKQ A;  4XCA A;  2RDR A;  4NMI A;  4NHY A;  4IW3 A;  5LBB A;  3NNM A;  2HBT A;  2RDN A;  5ERL A;  5M0T A;  3OUH A;  2V4A A;  5LA9 A;  3KT7 A;  4J25 A;  3BVC A;  5DAW A;  3MGU A;  5EPA A;  2RG4 A;  3ITQ A;  3OUI A;  3W21 A;  4Y5T A;  4BQY A;  5DAP A;  4BQW A;  2G1M A;  4XAB A;  4Y5S A;  3W20 A;  3PL0 A;  5DAV A;  5HV0 A;  5LB6 A;  4NAO A;  2OPW A;  4MHR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...