3HQRA

Phd2:mn:nog:hif1-alpha substrate complex
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
225
structure length
225
Chain Sequence
QTKPLPALKLALEYIVPCMNKHGICVVDDFLGKETGQQIGDEVRALHDTGKFTDGQLVSQKSDSSKDIRGDKITWIEGKEPGCETIGLLMSSMDDLIRHCNGKLGSYKINGRTKAMVACYPGNGTGYVRHVDNPNGDGRCVTCIYYLNKDWDAKVSGGILRIFPEGKAQFADIEPKFDRLLFFWSDRRNPHEVQPAYATRYAITVWYFDADERAAAKVKYLTGEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Egl nine homolog 1
publication title Structural basis for binding of hypoxia-inducible factor to the oxygen-sensing prolyl hydroxylases
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/transcription
total genus 66
structure length 225
sequence length 225
ec nomenclature ec 1.14.11.29: Hypoxia-inducible factor-proline dioxygenase.
pdb deposition date 2009-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13640 2OG-FeII_Oxy_3 2OG-Fe(II) oxygenase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.620 Mainly Beta Sandwich Jelly Rolls q2cbj1_9rhob like domain 3hqrA00
4NHYA 5LBCA 4ZONA 4KBZA 5HV4A 5A3UA 4Y5TA 2G1MA 5LA9A 4IW3A 5DAPA 5IAVA 3PL0A 4NHXA 2Y34A 4XABA 2A1XA 3NNMA 2RG4A 2Y33A 4NHLA 3NNFA 4MHRA 2JIJA 2HBUA 5DAWA 3HQRA 4Q5OA 5DAQA 3NNLA 5EP9A 4XC9A 4ZPIA 5M0TA 3ITQA 5L9VA 3KT1A 2RDSA 2V4AA 2FCUA 3OUHA 2RDNA 3KT4A 5EQUA 3EMRA 4Y5SA 3NNJA 4BQXA 3OUIA 5DAVA 2OPWA 3KT7A 5EPAA 2FCTA 4UWDA 5L9BA 4MHUA 5L9RA 5C5TA 3OBZA 5IAXA 2FCVA 4NMIA 2RDRA 5LASA 5ERLA 5IATA 4NHKA 5LBBA 3MGUA 2HBTA 4NHMA 4XCBA 4JZRA 5HV0A 5LBFA 3GJBA 3W21A 2RDQA 2G19A 5C5UA 4XAAA 4BQYA 3DKQA 3HQUA 4J25A 3GJAA 5LB6A 4BQWA 5LATA 3W20A 4NAOA 5LBEA 2JIGA 4XCAA 3BVCA 4XACA 3OUJA 5DAXA 3GZEA
chains in the Genus database with same CATH superfamily
3NV1A 2HWD1 4LEJA 3LA7A 3OJBA 5FMCA 3IIAA 1D4VB 1OA4A 3WW3A 1BVVA 1N3QA 3C7FA 3OPWA 4IW3A 4I0WB 1MVEA 4DEVA 2CAUA 3JBG1 4P9JA 2X10A 1UOJA 4OFGA 1ULEA 1UL9A 2O8OA 5FPVA 3SEEA 5E1RA 3ZR6A 1G7YA 3OY8B 4AI1A 5IVCA 4E4HA 3DXTA 1JI6A 3ZIXA 2AEYA 1GLHA 5FP7A 3ZDSA 4BK5A 5FRAA 3RZLA 2UWAA 3C7EA 1AL23 1PIV2 3VBFA 2WLPA 4GXLA 4LHKA 4QKFA 5A7OA 1CGPA 1JMUB 1CN1A 2VW0A 4QT6A 4TSVA 2WJSA 1HJFA 4AYUA 4YFZA 1W0NA 1VBA3 3ON7A 2DVGA 3BGAA 4LO7A 4LO4B 4Q4V1 4GKYA 2ZEZA 5GJ6A 5GLZA 3I3DA 5A1LA 1LGNA 1TVGA 2R6QA 1OF3A 3WSOA 1PZ8A 2B4KA 2XLAA 3ITQA 4QPYA 2X5IA 3VZNA 1Z7S1 1MQTA 3BU7A 3I2GA 1V70A 1SHWB 3U10A 1EUUA 1F5FA 1LGBA 1UN1A 2WN3A 3POIA 4IERA 4XBQA 1DFQA 3TEXA 4AHZA 2QQKA 4CDWC 1XB9A 2VUAA 2IXKA 3OTFA 5C4WB 1ND3C 2D6KA 4JAAA 3VBRB 4COUA 3SCHA 5FXVA 2VMFA 4WZCA 2XQRA 3NW4A 2Q8EA 3HT2A 3ZXAC 5FZ7A 4AFBA 4P02B 4CEWA 4BXSV 4D69A 2DURA 4A7ZA 2FCTA 4JDNA 5FMBA 4UYBA 5D8AB 1ULFA 3ZN6B 4LK7A 1T2XA 4CDXA 2BERA 1FPN3 3KV4A 3HR9A 4QDRA 4XW3A 3LSDA 1RVF3 3O14A 1MEC2 4OI1A 2Z5WA 1LKNA 4LBOA 1PGSA 5A7NA 2P6HA 3KMHA 5T5LA 4UW4A 2Q30A 3ZMNA 3ZVXA 5FYUA 1YO8A 3TRSB 4MXWB 2VTXA 1DQ5A 1CAXB 1QKQA 1AR83 3GALA 3IB3A 2E53A 4QX7A 2CWMA 1OFNA 2R0FA 1SLLA 5KR7A 2BW8A 4HKLA 1L7QA 1UYPA 3ZYIB 4XAAA 1HV1A 3LEIA 5LZ6A 1CD3G 3T2QA 1QNYA 4JRAA 4YVSA 5FK8A 5CZKA 1O3RA 3RZZA 1JHNA 1AR61 5C8CB 1CWPA 1O8PA 1H2KA 2R041 5AVAA 4AEJA 3SITA 2ZEWA 3MUY1 1D2QA 5F2SA 3C3VA 1HXS3 1LEDA 4ONUA 2P5BA 5T3NA 4XZUG 4P9IA 3WF0A 5C4WA 4E2QA 3PU3A 5KXEA 4UFMA 1PMHX 4LIUA 3HVDA 1QJU2 4AAPA 1O91A 5FAXA 4FOVA 1QNWA 2ARCA 4TLGA 1QIQA 5FP3A 1WD4A 2VO5A 3C2UA 4R4XA 1Q8VA 3DEMA 3F2ZA 3O1RA 5FO7B 3WHUA 3SLIA 4F3JA 2PELA 3BYWA 4DUVA 1PO12 5FREA 2VOXA 2ZX4A 4QQOA 3THCA 1JS9A 3ETPA 3JQWA 4Y5TA 4CP1A 1FOD2 4NWWA 3A23A 4NHXA 3S7IA 1Q8PA 1VRH1 2A73B 3U1XA 4BMEA 3JCIA 5KHHA 1DYPA 3KF5A 3TOJA 4MXWA 5F3CA 2A3WA 2EAAA 1GYKA 4SBVA 4Y22B 5JMOA 5ABJB 2GH2A 3EO6A 3MO4A 1JOPA 1O4TA 2A6VA 2ZEYA 1V6NA 2RS13 3W5MA 4MGYE 3TWIA 1D0GA 5AVPA 1C5IA 3K48A 5T55A 3NL1A 2E63A 3NNGA 5JI7A 1D4M2 1NKGA 4DXRA 3LPGA 2XKOA 1PVXA 3VV1A 4AHXA 5JAXA 2YC0A 4FP3A 3LGRA 3UETA 4OHXA 4CUAA 4Z92B 4YZ3A 4I3GA 3JQXA 3RNSA 1DGWA 1IQAA 1LCLA 2E31A 1AF9A 2AACA 4XQWA 1GQHA 2PLV3 3VDDB 2YFZA 1ZM1A 4FP2A 3GNEA 4NVPA 4QHOA 4I02A 4EZHA 4YG0A 4D0QA 3JB4C 3W5NA 4XF9A 2CNAA 1RUG3 4JKKA 4WVVA 2ERFA 4HBNA 1G86A 1QXJA 4M3CE 2BWCA 5FIXA 1GU3A 3SKVA 2HWF2 1I1EA 3BUCA 5JOYA 3DYMA 1PIV1 2XBO2 1GKBA 4JVAA 5FZCA 3AYAA 4QGMA 3THDA 1JYNA 2WSUA 2PHRA 1GV9A 1J58A 3QACA 4FO9A 4ES8A 3LEKA 4BQ5A 1OQ1A 4XJUA 1S2KA 1AZDA 3W58A 1VR3A 2YG0A 2RR12 5IJRA 1KS5A 1WA4A 5A6ZA 3O12A 3WQ7A 3OEBA 3FX3A 2D6LX 2PHUA 5A6XA 1AR73 3KCXA 5FZ9A 4K8RB 1AR92 4NMIA 4GMP0 5FY7A 5I8SA 2ORXA 3JU9A 4IDZA 4N53A 2HWC3 4QU1A 2VNVA 4LT5A 1W99A 2CAVA 5IW0A 1F2NA 1PNFA 2VMIA 1W2AX 3VBFC 4OYUA 3B02A 5AC93 4HN1A 1C1LA 3AJYA 4M4RA 4RGAA 4HANA 3FLPA 4M0NA 5LCWL 1WWYA 5KC5A 4OUSA 1WBFA 1QDCA 4BQ3A 1PGW2 2QBXA 2R072 1O3TA 1NA1A 5D21A 1CPMA 4CPBD 1XXNA 5CB7A 4QM9A 2ENRA 1MEC1 2X5IC 4EWEA 2EXIA 4Y1VA 4COYA 4BZ4A 4M3CA 1VAVA 1MQTC 3WG3A 3AMMA 4O9GA 3UJOA 1PK6A 5GLTA 3SH4A 3KSCA 2V72A 2IC1A 2EIEA 3PIGA 1R1ZA 4Z1VA 2JXAA 4HOOA 4ZONA 5B4NA 2QQVA 4INDA 1DF0A 5FZ6A 1EV12 1G9CA 4LBQA 4JX0A 1CAVA 3U75A 4CEWC 3B01A 4A44A 4Y1YA 1POV1 4JQTA 3KV5A 4AE2A 3L9JT 3TNQA 2WNVA 3SKJE 4HT1T 1IPKA 1W8NA 3AZVA 4CDXC 3KCYA 1W3XA 2K0GA 1HKDA 2JG8A 1FI2A 5LA0A 4K6BA 2WO1A 3K77A 1GMMA 2HJIA 4QDSA 4A4AA 1YQ6A 2E26A 2IXLA 3M3EA 1QJU1 2AENA 2FDJA 2PTMA 4M4PA 1K5MA 3I2IA 2YXSA 4FOWA 1ZBA3 4IEUA 3WG1A 4UXAA 2CGOA 1D0HA 2WINB 5J1XA 4OLLA 2H6CA 2PXJA 2R063 1US3A 3CMGA 2Y0OA 3OBRA 4YZ1A 1PO11 2I2SA 5DAWA 5JZGA 5DAQA 2VQ0A 1UX7A 1ZBE2 2ZX3A 3ZXGA 5EIYB 4YVSC 1FOD1 3Q8BA 3MZHA 5HCAA 5HCHA 4AEKA 3ZFEA 2VCBA 2WR9A 5DABA 3UGHA 1JYVA 4CDUA 2ARXA 4PJYA 3UGFA 3WDVA 5L9VA 1ZZBA 3VZOA 1SLCA 4QHBA 2A6ZA 1N47A 2E7QA 2OYZA 5JOXA 1MZFA 4J1WA 1QH7A 2CYFA 4XQ4A 2CGNA 3U14A 2EIBA 4DUXA 3VHRA 3SCFA 2YYOA 3LD8A 2Y6GA 3EMRA 2ZHNA 5AFBA 1GZ9A 4FOYA 3USUB 2XVLA 1D4M1 1ULPA 3ZSKA 1HRI2 2ZABA 2A6WA 3MIDA 4LHSA 2G4IA 4AQTA 3PUQA 3OB8A 2ZAAA 1OSGA 5FZEA 4ZU4A 5JDBA 1ZNPA 1ZA7A 3VHOA 2VZSA 5BNQA 1Q43A 3POGA 5FWEA 2VU9A 2FMYA 1I5ZA 1R082 2WS92 4UI9L 5FZAA 2JE8A 4HKWA 3ROUA 1ZRDA 1W2OA 1C57A 2VY0A 2Q8OA 1A8DA 5FO9B 2WZEA 4YW3A 5JMCA 2RMU2 2VQAA 4XDQA 2L9LA 1J84A 1W8ZA 1KD7A 1W6QB 4WM7B 1W2NA 4C0BA 1CAUB 5LBBA 2QQUA 1UO9A 1BBT3 2C24A 2HWF1 2UU8A 2WDBA 3NV4A 3RVHA 4JZRA 4BOWA 3D6EA 1DYOA 2XBO1 4JDMA 4KGQA 5I8YA 2P37A 2BYVE 2LUWA 4EN8B 1H4GA 5J96B 3V0AA 4CU8A 1W8UA 3GJBA 4D7YA 2E33A 1EAH3 5CFDB 1QU0A 5HXVA 5L7OA 1ZRIA 2VPVA 3PVEA 3ZFFB 2E7AA 4RQPA 2BBVA 3PTRB 2IFWA 3KD4A 4TWTA 1SPPB 4BQYA 3WP5A 2JG9A 1SFYA 2RR11 5A3NA 4CU9A 1PO22 3N9PA 4FFFA 2ZZJA 1LOBA 1AX2A 4BA6A 4EN9B 2ZGOA 2W92A 3N9MA 4A7YA 4O61A 1AR91 4QKNA 2HEYF 1WLTA 4FBFA 1C8M2 3IMMA 1CVNA 2PHWA 1L7RA 1GZTA 1YNAA 5C3PA 4ISQA 2ZACA 3TN92 2QDRA 1H2LA 3DECA 1GOHA 3SQOA 4NHYA 2QCSB 2Y6LA 3ZMOA 5GZEA 3IPVA 2VZ3A 4GB32 4RHV2 3H7YA 3VDBA 4LKEA 1W90A 4XMAA 3THPA 3ZXDA 3MLJA 3T1MA 4L11A 4N43A 1SBDA 1PGW1 1S4CA 2DCTA 2R071 3T0DA 1R1A2 3I2JA 4J6GA 2W3JA 3P6BA 4D7SA 4D7TA 1H8VA 4LTAA 4NRQA 1H2MA 1UQXA 3V56A 2W2IA 5L19A 5FKCA 2SBAA 4N53C 1Q8OA 2Q1FA 1JZ2A 2BOJA 2XHNA 2YFUA 1AYM3 2RM23 4YSFA 1XNKA 1S2BA 2QKDA 3M2MA 5CFCB 5IK7A 1QOOA 2DUQA 3MPBA 3NO8A 4X6QB 2XPJA 2ZMNA 1W0PA 4D94A 1NCQB 4A2UA 1EV11 2WNOA 2BGOA 4YVWA 4K3UA 5FPLA 1FNYA 1WW4A 2WA4A 3IN9A 2CL2A 1XU1A 2R1BA 4C91A 5A6QA 1JZ4A 1J3QA 3KF3A 4FOQA 3HWJA 1NA1C 3VB9A 1OBNA 1A8MA 2ATFA 2PHTA 5DG2A 3VBUA 1V6MA 3I2FA 3HOBA 1O7FA 1QOSA 4UF0A 4A6SA 1GWMA 1F8VA 1UMIA 4JRLA 1PK6C 1C3HA 4YGCA 3ORJA 3OOXA 2CY6A 1JOJA 1O4YA 3FBMA 2G9ZA 4DRVA 3VN4A 2VBPA 1X7NA 2JDAA 1ULCA 3B9CA 4ARYA 5KXCA 1EY2A 4LBMA 4KH9A 4U2AA 4XUPA 1N1TA 3HQXA 1DU3D 2GH8A 2KD7A 4I0AA 4QX8A 3GBGA 1GWKA 4IV1C 1W2UA 1ZBE1 4IUGA 3U4SA 4TTGA 3D0SA 3WEZA 1LODA 2WNVC 2GC1A 2JD4A 1MZEA 4AI8A 3NAPA 4XF1A 4DEQA 5KHJA 2IXJA 2JG8C 4NE9A 1IPSA 5CU1A 4LPLA 2DWRA 4AWDA 5C70A 5I0DA 5A7WB 2DF7A 4D6QA 1NCQA 4BU2A 1YQ5A 1ZZ8A 5GZGA 5LEKA 2W5FA 4QM8A 2GNTA 1K5MC 2BUKA 4BYYA 5HV0A 5FFOC 3CHXA 4ES9A 3E6BA 1HRI1 1KITA 3HBZA 4PQ9A 2AZ5A 2RDQA 4CU7A 3J8F3 3I3BA 2X8KA 4WVZA 3IDCB 2XR4A 2F4LA 5JZGC 1RXGA 5KHKA 2MPFA 1RUD2 4ZU5A 4NAMA 5DXDA 4CDWB 5DUUA 1Q56A 1OURA 1R081 2WS91 4XE9A 1ND3B 4UFHA 4QMAA 3ZX7A 4IE7A 3ZFEC 3X29B 4CDUC 4NIGA 2YY1A 5KXDA 2RMU1 1JU3A 5LY2A 1WMFA 5LBEA 4R9DA 2IUWA 4CUCA 1HB4A 1UZZA 3RFRA 3NKTA 2KR2A 4QQHA 4Q1RA 2YUEA 1WMXA 3QCWA 5FYIA 5FMOL 1DHKB 1HRV2 1UOGA 4QU2A 3D3AA 4WVMB 4LITA 4QGNA 4AVTA 4CCKA 3CJXA 4L97A 1GNZA 2D3PA 5F3IA 3U0ZA 4B3NA 4AL9A 3LA3A 4F8AA 2P3JA 4DNYA 4CCEA 3WVJA 2J7MA 3ZYJB 2GC0A 1PO21 3WOGA 4B7KA 1IG0A 2VMHA 4PLMA 2VVFA 4BM8A 3VD3A 2EXHA 1AUYA 1A34A 3KGLA 3AKSA 4OZXA 2XL9A 4N8MA 1C8M1 2ZGPA 3RPQA 2E9QA 3H7JA 1S0BA 4GMP3 1IS4A 1UOBA 1QMJA 1YFWA 2WT2A 5BYNA 1PNGA 2WO3A 3MI8A 5I0TA 2RV9A 3TN91 1K12A 5J3UA 4CEYA 3K4AA 1X9TA 4URAA 3AMPA 5IFTA 4GB31 4RHV1 4LQRA 2VXJA 3GM8A 5TSWA 5L7OC 2Z4FA 4Y20A 4LO6B 2OT7A 2VOKA 4HK9A 4RQPC 4XETA 3H8OA 2WC2A 1RTVA 3HEIA 2PYTA 2ZX1A 4XC9A 2JG9C 2WAAA 4HN0A 3A7QA 3O0VA 3RWKX 1R1A1 1KDKA 1DDLA 1UNBA 1K42A 1NXMA 1WA6X 4ATFA 3WNKA 1AJOA 2FCUA 4QPWA 1Y9QA 1XC6A 2Q0AA 5EQUA 4WZFA 4IEPA 4GKXA 3SXWA 1YQCA 4CXXA 3ES1A 2BP6A 2BGCA 1S0IA 3FL7A 3DYPA 2J1EA 5IFPA 4URTA 1SG3A 1SLBA 4M01A 1ODNA 4UBGA 3SHRA 3VKLA 4E8CA 5K7PA 1J59A 2HKXA 4IE4A 2RS52 1O5UA 4N43C 3Q8EA 3N7MA 4MGKE 4E4DX 1F5JA 1RUF3 4Q0PA 1BZWA 3HNMA 1JYWA 2JE9A 3H9AA 1GR3A 4OHZA 2HEWF 1VE0A 3T2PA 1JZ6A 3CBNA 2FCVA 4MGQA 1ULOA 4TLFA 3FFQA 1N1SA 4MZUA 2C6SA 5F37A 2WZ8A 3WR0A 1GP4A 2WQ8A 4Y1ZA 1HQNA 3LDKA 1QQP2 1O6UA 3Q9OA 4NHMA 3VKMA 3MUZ1 4YFWA 2A70A 4AAXA 2I07B 3UJQA 3ZXEA 1CAWA 1CZTA 4AI9A 4LUKA 3POEA 2DFBA 4EN7B 1WMEA 5IVJA 3LSEA 4HKOA 3TAYA 5CISA 4Q29A 3RJRA 4AZZA 4DRRA 1YHFA 2J1AA 3IDEA 4QXBA 3D4KA 4D8MA 3AZYA 4YVWC 3NV3A 4CDQA 1WUVA 3JBG3 4ZKTB 1ZA4A 1QJFA 2ZHLA 4GD4A 1MZ6A 1RUC1 5LRRA 2ZTNA 1GICA 2J1TA 4G9SB 1IGOA 2WZR3 5CG8A 1KS4A 4TN7A 3VBUC 5LY1A 2VBBA 3T30A 5BNNA 1IG3A 5BNPC 4CA9A 4D3WA 2JDUA 3NJYA 1AL22 5FZ1A 4FI9A 3PURA 1W6OA 2HH9A 2QJVA 3MLLA 2Z2SB 4BWOA 4CCDA 5LBCA 3B9IA 3VZKA 3R0RA 1VBA2 2DVAA 4B1MA 2RJKA 4Q4V3 2YU2A 2B46X 3DN7A 2VTFA 4YGEA 3MFCA 4MX3A 3WINE 3EXUA 1RUD1 3VBFB 3LIHA 1NLRA 1RHI2 1UYZA 2JICA 1ZZ7A 2C26A 5IAVA 1YI7A 2RJ2A 4H55A 2A6XA 5SV8A 5DDJ2 1JXNA 4LLFA 4W8JA 3EYPA 3MIEA 5FYSA 1SQ4A 4CCCA 1HB1A 1Z7S3 1TE1B 2OQ6A 4N7UA 3ACFA 4YW4A 2YBKA 3NAPC 3LOIA 3NNMA 5DN2A 3ZXJA 1G9DA 1OC1A 4NHLA 4ZXKA 4JGZA 5APAA 1DGRA 4JC1A 4DUWA 2GDFA 2Y64A 1F15A 1HRV1 1OLRA 1GFF2 1SDWA 2JIJA 4IEVA 2BFUS 2X5IB 4L0PA 1VMHA 5A7QA 2EXKA 5F7UA 4LUMA 2EF6A 2LS6A 3ZIWA 4BQ4A 3PU8A 1MQTB 1HN1A 3ZN4A 2ZA9A 4IGPA 3KWVA 1DLLA 4NIDA 3RYKA 4FFGA 4LE4A 3BTAA 1JYTA 1UY0A 1VBC2 1G6NA 1TZOA 2WUHA 1OOPA 1KJLA 5CNAA 2Q8DA 2BPA2 1FPN2 4P5HA 3IZOA 4P14A 3RGBA 1SBEA 2BNMA 1FV2A 5A3WA 4CEWB 4DQAA 2D43A 1JZ5A 2V73A 1K3IA 1F4HA 1KQRA 2R49A 2VOWA 5JIUA 1FV3A 3GXUA 2JEMA 3NMBA 3WNNA 4CDXB 2ILMA 2OA2A 2VZQA 4YGDA 4NIIA 5ACA2 1AR82 1W6PA 1ZRCA 3J7NA 5F2WA 2Y6FA 5FZBA 3URFA 1UIKA 3UKNA 5BPXA 3OGRA 1LGCA 1YLLA 5KBFA 4W6XA 4XUNA 2R043 5FCCA 5L9RA 1JN2P 4IE0A 3OBZA 1HXS2 3M7AA 1JUHA 1S0CA 3POJA 4XZPA 2D6PA 3WLUA 1RUJ3 2ZGNA 4YVSB 1YI9A 5JWPA 2JENA 2YGMA 3Q8AA 1W9SA 1H6XA 1PGL2 2VNRA 2JDNA 4BH9A 1XU2A 1AX1A 2P6CA 3B69A 5LBFA 4CEYC 5FYHA 2W1QA 2DFCA 1Q3EA 3I2HA 4E2GA 4GAZA 3ZXKA 5BV6A 2UY9A 3PMSA 4JGYA 4XFBA 4FPEA 4YYOA 4HL0A 5A3TA 5LEJA 4H7MA 5ANNA 2JDHA 3WXPA 3NJXA 4COZA 1ZZ9A 1C8NA 4IEWA 3GF6A 2VQTA 4IEOA 4RR3A 1VRH3 2YMZA 4LORA 2DBNA 5JIAA 1C28A 1WLCA 2XLGA 1OI6A 2QQOA 3SMHA 4HXCA 4QGLA 1AXZA 1D7PM 1UMHA 3G6JB 2RS12 1ZYBA 3GZEA 3N9OA 4LKSA 1FYUA 4J1XA 1WW6A 1QQP1 4FAHA 2O1QA 4CP9A 4NPLA 3VZMA 5C8WA 2QE3A 2W0XA 3ENRA 3LKJA 1S0DA 1HB3A 2IVIB 5F32A 2E51A 5FZGA 3AVRA 3H0OA 4R8HA 4XUOA 3PMEA 4UFLA 3WQ1A 3A4UA 3OGSA 3OF1A 5LA9A 2ZGKA 3H3ZA 5DAPA 4YGBA 4XFFA 3BI3A 4L92A 2D6OX 4KQ7A 4MOAA 3I2KA 1IKPA 1MZ5A 4YM2A 5JXGA 1BLZA 1QHDA 1RUG2 3CF6E 4M0HA 5FJKA 1M4WA 1EPZA 1MS1A 3H8RA 2HYKA 2RS32 2SLIA 1TNRA 5A1FA 3WG2A 1AL21 1ODMA 5A7SA 1UPIA 1Y9MA 1VBA1 1PMJX 3P5BA 2PMWB 5CA6A 5DUVA 2ZGRA 2B9UA 1T6BX 4Q5OA 3A21A 4Q26A 5CEHA 5KWRA 2FDFA 1NUKA 3R4DB 4FVVA 1LU2A 1CIWA 4CDQC 1PX4A 5IVFA 1RHI1 1VBE3 2VM9A 3RWNA 5FPAA 3I4IA 5DDJ1 4AI3A 1AR72 3ACHA 4GWIA 4IEQA 2RHPA 2ZZQA 1NT0A 4GWJA 3FHAA 4QDQA 1XRUA 2HWC2 5BNNC 2NLRA 3I3EA 4HPKA 3K46A 2OUJA 5DZEA 2WN2A 2EAKA 3J26N 2WT0A 1W28A 4RL7A 5FDBA 2O8QA 4GZ9A 4LOSA 4XJ8A 4FPHA 3N36A 3WNXA 4MLOA 4N53B 2LRPA 1NCRA 2CDPA 5DG1A 3T2OA 3IWZA 1EPWA 1JZ7A 1GQGA 4L8QA 5ACA3 2V5YA 1RINA 4QD2A 1VBC1 3LB9A 4LO8A 2A71A 5T5JA 1FPN1 4MHUA 4HZFA 4NROA 4Y4YA 2RVAA 4DMIA 1V6KA 2Y6JA 3KVBA 2Y38A 4YW2A 1UW8A 2RDRA 1XQNA 2EVXA 3W9AA 2RJLA 4GA9A 2NQYA 5H9SA 5FYMA 1GP5A 1REDA 2OXBA 4JGZC 5GLUA 2OW4A 3MV11 1NA1B 1OF4A 3QH7A 3T2TA 5FXWA 3RRDA 1PHMA 1W9TA 4PIZA 1LOCA 1ND2A 1AR81 3N9LA 3UKTA 4YM3A 5EFUA 1X36A 3OCPA 1FXZA 1U5XA 4M3CB 4WVWA 1I3HA 3T1LA 1PK6B 3LDBA 1UZVA 1W05A 1EP0A 2ADDA 5E88A 3VKNA 2QZ2A 1XE0A 2R32A 1OVSA 3WX5A 5C7GA 4OVEA 1XPWA 3TEWA 3BOPA 3J7MA 4IESA 1OOPC 2GALA 3ZO0B 5E16A 3O1MA 2QQPA 3GJAA 4Q2FA 5CADA 2VVDA 4F83A 3KVAA 1DGRN 1BEV2 1HXS1 3FLTA 3TBDA 4LBQB 1NY72 1CAVB 4IV1B 1ALYA 3K3OA 3IAQA 1CPNA 1YJLA 4M00A 4YRDA 2WNVB 3S6PA 2VE1A 1ZBA2 3AP6A 1PGL1 2JG8B 4K9SA 1FNZA 1G9AA 3POBA 4AVAA 4I30A 2WQZC 3Q8CA 4FXGB 3I97A 4YNIA 2NYYA 2KM2A 1JYXA 3R6SA 4UW6A 1S2EA 2DTYA 1K5MB 4XURA 2VD7A 2WNUA 1OXCA 5G04L 3FHQA 1XYPA 4Q0QA 3O1TA 2WIIB 2ZHKA 3HNYM 4XFGA 1QJY2 1Z78A 4QPGA 4XABA 4S2HA 3E5QA 3OD4A 5JZGB 4ASMB 3WNLA 2Y33A 3C8XA 1OKOA 3LF7A 1NOVA 5F5IA 3LCPA 4LULA 1UYXA 4LIVA 2RS11 1X8EA 3G7DA 4Q4W2 4IV3A 4MGTA 3ZFEB 2HLEA 3VKOA 1OPMA 3O0XA 5HPOA 3RQ0A 4CDUB 1MS9A 4YLZA 2C4XA 1UU5A 3KV6A 5FYCA 3ZXFA 4YARA 4V2VA 1YC61 2X05A 2XUMA 3JB8A 5EXOA 2GNDA 2W95A 2GC2A 1DQ2A 3LZZA 3NNLA 4JGYC 4JTNA 4IV1A 1FT9A 2W52A 3HJRA 3A22A 3K4ZA 1LHOA 1GZCA 1V9U2 2QQMA 2PA7A 2ZX2A 1NQJA 3CEWA 3HNBM 3QLQA 4FPGA 3BOWA 4GALA 3MIHA 4RR3C 4ZXEA 3SH3A 4BJ0A 4E27A 4YW6A 4AXOA 5FPBA 4ET7A 1RUG1 2C0ZA 4X6RB 3N9NA 5C9AA 2RDSA 1Y3TA 5J7MA 5J98B 2PHLA 2K9ZA 2JB4A 1QEXA 2JDKA 4P9GA 2CSGA 2IVJA 1LESA 2RS31 1XYNA 4WBBA 1LJ7A 2B39A 1YFXA 4DS0A 5F39A 3RYRA 5IUQA 1WW5A 1ZRRA 2J1VA 4Q0VA 4BISA 2JKXA 4FTSA 2R16A 3MYXA 2XL7A 3ALQA 4HMZA 1UKRA 2DCJA 4YG6A 2FDIA 2BWAA 2A3YA 3VBSA 3WZ1A 1GZWA 4AGVA 1H1IA 1MS5A 4GQ7A 4P08A 4AVVA 2ZXQA 3V0AB 3R05A 1AR71 4NIHA 4A42A 3AX4A 3EJKA 1AR93 5L7OB 3H3UA 2AR6A 3IKWA 5LASA 4RQPB 5ERLA 2HWC1 5K9YA 3KQ4B 1YUDA 4P9YA 2JG9B 4LBJA 4DXTA 4CP2A 4D6RA 1WLWA 3NKGA 1H30A 2X09A 4YW1A 1OT5A 3UKVA 1UIJA 3DKWA 1DZTA 4IEZA 1JOBA 4NRMA 1S1AA 1O59A 2D5HA 2JD9A 3EQEA 3NWKA 1XNCA 1W9FA 1TMF2 4DXZA 4IE6A 3RZGA 5A7PA 1DZQA 1ZZ6A 1EUTA 2R073 4NO4A 3H3LA 4LBLA 2ZCWA 3IPVB 1MACA 2F4PA 1W06A 2XJVA 3BCWA 2B9VA 3NRUA 4J25A 4QB6A 3L2YA 4LE3A 3IDBB 4Z2WA 4N43B 5FTTC 3OPZA 5JR2A 3VBOA 3IDAA 4E8DA 5HI0A 2BNOA 1AYM2 1FATA 1Y9GA 3AP9A 3K3NA 5LWBA 3VL8A 2PAMA 4HVQA 4XTPA 4GULA 3O1SA 3BALA 4AI2A 4B29A 5BY5A 3TYJA 5HV4A 2D44A 1SMVA 3PVNA 4AFMA 2BVBA 1UKGA 4P5YA 2UWBA 4A7KA 4YM0A 4CP0A 1NCRC 4QX1A 1JZ3A 2HWE3 1QWRA 4B4QA 3HN3A 3KB5A 3AYCA 2PQQA 3D0JA 3CZJA 4PLNA 4FFHA 4AW7A 2IXHA 5FYYA 4YZ2A 1BEV1 4XJ9A 4YVWB 1OQEA 1VBB3 1RMU2 5FO8B 4ZZ5A 2JWPA 1GNYA 3H1YA 2D5FA 3O7OA 4UBHA 1LNSA 3OYWA 4XTMA 5LK7B 2MEV2 2QQJA 1SBFA 1W8FA 2D98A 4JQRA 1ZBA1 1UY3A 3BODA 2QZ3A 3VBUB 2YDEA 5A3LA 4Z82A 1ND2C 1UZ0A 4IGOA 4UF0B 4QXCA 5BNPB 1CIYA 1APNA 2QFEA 4QXKA 3UT0A 4AOCA 2F6BA 4CXYA 3B3QE 1RGSA 5HXMA 5FK7A 2D93A 1W8WA 3JD72 3KS7A 4QX5A 4XJZA 5T54A 5CG9A 1H8TA 1SACA 2VCCA 5EP9A 3VZLA 4YZ5A 3V0BB 5H9PA 3ZSJA 5M0TA 1KRIA 1QJY1 1TME3 4IQPA 4LXLA 4AVCA 1YYNA 3AKTA 3I59A 3J7HA 4PHZA 2R30A 4W6YA 4Q4Y2 4DZGA 4CSWA 3PVBB 4KWJA 1AYN3 1MPXA 2ARBA 2W68A 2RDNA 3RMXA 4DPNA 1J1LA 4DXSA 4O9EA 4Q4W1 1LRHA 4MXVA 1RUI3 2VNOA 3NAPB 3AL5A 1HRI3 3CIHA 3E97A 3HIFA 3KHCA 2P1BA 1JYCA 3N7LA 3J8F2 3N7KA 2Y6HA 4ZU7A 5BUVA 4HETA 4R9AA 4EE2A 5EPAA 1RL3A 4UFIA 3SISA 5L36A 1DLCA 1R083 2WO7A 2WS93 5KHIA 3APBA 2WNUC 1V9U1 4AVSA 3OPTA 5FV3A 2FDGA 2BV4A 5J37A 2JDZA 3M4FA 4LLOA 1RB8G 3KCCA 4C8DA 3UL2A 4QPGC 1C1FA 4AQ6A 2GU9A 4B4PA 1WCUA 5A32A 4A3ZA 5BNPA 1Y7BA 2ET1A 1HQWA 3ACGA 4LMFA 3GHMA 4PIXA 5GLVA 1HJGA 4IV3C 4QKDA 4Y4RA 3ST7A 2WQ4A 3FN9A 1DP0A 1K45A 1W3VA 4XBNA 4CVUA 4EV0A 1R093 2VTXJ 4AFCA 5JSOA 5CKQA 3V0BA 1Q8QA 1WZXA 2O0OA 3UGGA 4GH4A 5A6YA 1UX6A 2F17A 3MPPG 3WF1A 1JW6A 1CQ9A 2ZHMA 1H9WA 2XUEA 3K4DA 2ZGTA 2VZOA 1BK0A 1OKQA 4CCOA 1ACCA 1PO23 2B7YA 3MIGA 1C4RA 4RSUA 2B5HA 4FT8A 1W2TA 1IS6A 3WY6A 1WCSA 5C9AC 5IT6A 3CQOA 5EZWA 4ASLA 4MH0E 3ZKUA 1J3RA 4IE5A 4LKDA 2CHHA 2RE9A 1A78A 3PLQA 5FKBA 1UMZA 1BMV2 1SDDB 1WW7A 5FY5A 5I93A 1H0BA 1WKYA 4DY3A 1DYKA 1UU6A 5J36A 2J1SA 2Q8CA 2P3IA 2VH9A 3H8UA 4GB33 4NWVA 4RHV3 3ILFA 4W6WA 3HMYA 4RYDA 1VLNA 1XNDA 2G1MA 1TMF1 3CDZB 2VGDA 4G3YC 3IAPA 1H6YA 2A6YA 2W87A 4CEYB 3VBSC 2X29A 2VNGA 2W47A 3PL0A 3MBWA 3WQBA 2FHRA 4FTEA 4OI0A 2W94A 2WYFA 3WG4A 2Y34A 1S55A 4TZDA 4Y20B 2ETEA 2I74A 1QF3A 5C3OA 3LFIA 1UYYA 4K40A 4QPIA 1ZREA 1FMD3 2NM1A 3GZUC 3GGLA 1AYM1 1X50A 3UNPA 3DGTA 2QNKA 3KQRA 3LQCA 5JR7B 3AB0A 4UW3A 4ISRA 4N7IA 4YPJA 3WDXA 4AHYA 2BFUL 3I49A 1NZIA 1V00A 4LBQD 1TG7A 5GZDA 3DYOA 3WD5A 4C90A 1YIPA 4QQ2A 3B93A 1ONAA 2BGPA 2LW8A 3S7EA 3ZYPA 1JU4A 2XVKA 1RUF2 4Y5Z0 1LB2A 3HN1A 2XJTA 1Z0HA 4XFCA 3ZYRA 5FR3A 5FY4A 2VAUA 4FQZA 1CONA 2WLQA 3LWCA 4AK3A 2FD8A 1E5IA 3I3MA 2ET7A 2WFF2 1RMU1 2WWJA 2W1WA 1E5HA 2VMCA 4CCLA 2MEV1 3VBOC 4ASKA 1WD3A 4Q4X3 2WWSA 1GANA 4AG4A 3BU0A 4Y5SA 3NNJA 1ASJ3 2CWSA 3N4MA 3ZN5A 4ZY9A 4LK6A 4BIOA 2VJXA 1LULA 5FYTA 1POV0 1QJX3 4PBOA 5F5AA 1NLQA 2Z69A 3JD71 4EQVA 2XWBB 5FP9A 2BVVA 1VBD2 1CAWB 4FAGA 1RUC3 1MS4A 4W4ZA 4XXAA 1U5ZA 2XG3A 3GDBA 5DUXA 5FY8A 3GCWA 2WZR2 3OSDA 1YIFA 2DU0A 2WL1A 1COV3 2NN8A 3M8LA 3MW2A 2Q4SA 1W8HA 4QX3A 3M3CA 3IM0A 3PIJA 4Q4Y1 4CDQB 5FPXA 3J4UH 2MNGA 2XJQA 2EALA 1REEA 2D40A 4R9BA 4RGKA 1UWWA 1X9PA 2OZ6A 4BLJA 3AZZA 4XCBA 3A0NA 3DPRA 1DQ4A 4AFDA 1DCSA 2ID4A 5BNNB 4AVBA 3AYDA 3J8F1 4JKLA 4KU7A 3B7MA 1RUD3 3LFMA 1ZRFA 1H2NA 1VP6A 3NJZA 4FPJA 5D1IA 1W6OB 3DKQA 5FZMA 1H8TC 3HQUA 5BNOC 4IETA 3T0AA 1RUE2 5DZGA 1OUSA 1PVC3 1HB2A 2TBVA 2ZJCA 1RIRA 2D3RA 5C3QA 1JZ8A 2JIGA 4AGRA 1LAJA 5IVVA 3CL1A 3WF3A 2HWB2 1QH6A 4LO5B 1UAIA 1WCDJ 5GZFA 1W6NA 1HRV3 1MS8A 1W6MA 3ACIA 2WSVA 3SCGA 3QH6A 4CRQA 1RUH3 4OQ9A 3GHNA 5FPUA 2HWD3 4PDWA 2XH6A 2QVSB 4P9WA 5DPNA 3WP6A 5A3UA 2VW2A 3NSTA 3SH5A 4JGZB 2DVBA 4LR4A 1OUXA 4K21A 5A33A 3UK9A 3WV6A 5JXJA 1J83A 2XXZA 2QUOA 1HDKA 1CZSA 3E6DA 1F9KA 3RI9A 4B1LA 1BHGA 4ITCA 3VGIA 4PBPA 2H0VA 5IVYA 2VCAA 4PIYA 1JHJA 1UCXA 2GP5A 1HN0A 1OOPB 5DUWA 3OBAA 3WDWA 1BMV1 3N9QA 2D7FA 2OPKA 5JVVA 3TNPB 1I5PA 5KXBA 2LTNA 1A3KA 3ABZA 2P4EA 3O1OA 4FPYA 4V2WA 5C3SA 1ENRA 3CO2A 4GH4C 5B4XA 3BN6A 5IK4A 1DZRA 1W0OA 2H6BA 1XNTA 3FMGA 3ILNA 2EICA 2NZ9A 5H9QA 4HG6B 1UY2A 2GC3A 4WM8A 2WWUA 1I6XA 2Z42A 4KGGA 1W6PB 2A75A 5FJHA 1ENQA 3VD7A 1NAEA 3WUCA 5FBZA 3PNAA 1RUJ2 4EZ4A 5FP8A 2VMGA 1WBLA 3I7DA 4OCTA 1W04A 3T08A 2OX0A 3CU7A 1OA2A 3S5AA 1DBNA 2UY8A 3MF6A 2J1UA 2UWCA 4LHNA 1SCSA 3QOPA 4AGGA 5FQ0A 2LALA 1OH3A 3AJZA 2G9GA 4K20A 2NP0A 5A3MA 3WT3A 3KT7A 2XDVA 2ZX0A 3HBKA 4XILA 3AKQA 2XB6C 2K46A 3VBHA 1RUF1 1Y43B 3NV2A 3GZTB 2OUHA 2YPDA 3U07A 3CJIA 4XMIA 5JOWA 4B8EA 2VZVA 5GKAC 3WNPA 1RVF2 4CPBA 4JGYB 4NRPA 3U11A 2WFF1 3IIIA 4M3CF 2Y6KA 5KHGA 4RR3B 1LTEA 5FMOS 2HBTA 1HLCA 2QQWA 2XOMA 4HONA 4IGQA 4K8FA 4QPIC 4AFAA 4Y26A 4Z2AA 4DFSA 2XJRA 1BQPA 3POFA 3U37A 1DG6A 3V64A 4QHZA 3WNOA 3I2OA 3E6CC 3Q8FA 4PLOA 2TUNA 5FWJA 3MF9A 4BK4A 1D2SA 2A7AA 4OMCA 5FOJB 3WW4A 4CP9B 3OG2A 1HIXA 1OD5A 1U5IA 3ASIA 4G4FA 1VBD1 1AR63 2OIIA 2WRAA 5FPZA 2E7TA 4XOGA 3B00A 4AQ2A 3WW1A 2VZTA 5LB6A 2FZ2A 1AVBA 1REFA 2WZR1 5FZLA 1HV0A 3EHKA 4NJ4A 4COVA 2AREA 4OZOA 3NQHA 4XACA 3OUJA 5J09A 2JE7A 2VXRA 2QTWB 1OLMA 2YHJA 4RS5A 4UAPA 5F5CA 1FX5A 5F6LB 3ZFGA 4JHTA 4BXFA 4A45A 2ZKLA 5IVEA 4YG3A 1V6JA 3RG0A 3O1PA 2VZ1A 3KGZA 4V1PA 5LRSA 1ENXA 3ILRA 3LA2A 3USSA 4DINB 3VL9A 2W08A 5CYYA 5EHDA 3BTZA 2GP3A 2QQIA 3E5XA 1RHI3 1BK1A 1ST8A 2RS51 1VBE2 5F9TA 2JDYA 4BPZA 5DDJ3 2AUYA 1SLTA 5DQ0A 1RUE1 1UZYA 1LENA 2DVDA 4XDPA 2OKXA 2AGSA 2HWB1 1K5JA 3PJQA 2N7GA 2XJSA 4N9HA 1YQ8A 2BBAA 1RC6A 1W9WA 2O14A 2V09A 3ZYGA 4C0HA 2PFWA 3LPFA 3WDYA 3DPRC 5A3PA 1AJKA 1CJPA 4W65A 5EJ3A 2ZKNA 4OHYA 2JJ6A 5FZDA 4HFSA 3ETQA 3OY8A 4HPKB 4AEDC 1OH4A 3ES4A 3PUSA 4MGIE 4XIKA 2VL4A 2GNBA 4I01A 4MADA 4Y1UA 2JECA 4Y24A 5FY9A 3ZKYA 1VBC3 4BIFA 3MEPA 4CYDA 2PLV2 3M3QA 1LECA 2D6NA 4ZPIA 4LBKA 3B94A 1DGLA 4KWKA 1GUIA 3O5SA 4KU8A 4QWNA 3WQ0A 3H1MA 5G05L 4FQ4A 1G8WA 1NCRB 2CU5A 1E5SA 4OHWA 3DF0A 4Q0UA 2PHXA 3MW3A 1H4HA 1XE8A 2DDUA 2VVEA 2GN7A 1PIV3 4KG8A 1BXHA 4QB1A 3SNMA 1JYIA 4P9XA 5IWFA 4O7XA 1SLAA 4COWA 1QXRA 2BOIA 2VUCA 4PDWC 1B35C 3H1WA 4XFHA 1TNFA 1RUNA 1US2A 1L3JA 1XSQA 1GWLA 1NE4A 5K4LA 1JTZX 4FPOB 2GAUA 1QDOA 2P17A 3ZSLA 2XMLA 1ND2B 4S2FA 5EV7A 5EJZB 2A3XA 4Y33A 4YW7A 4AI0A 3VBRA 4KBBA 4I2OA 1YEWA 1PM4A 1RUJ1 3BIEA 4CCNA 1JODA 1POQA 2ORZA 5CAZA 4MG2A 1N1YA 4BE3A 1PZ7A 4NHKA 1NLSA 3N3HA 2YPJA 2IZWA 4FSJA 2YZ4A 4E9KA 1OMIA 5GALA 1X8MA 2AH2A 4PCRA 4LNVA 5D8AA 1NXD1 2BTVC 1OQDA 2UURA 4OUMA 2EA7A 1W39A 5FZ0A 3KZ4C 3ZN6A 5AC92 4IL7A 1H1AA 2YB7A 3ZOIA 5F6KA 4E4ZA 4ATEA 4GIQA 1YFUA 3C7GA 5F3EA 3S30A 2X53S 2KXLA 4GWNA 3E1F1 1RJ7A 2E32A 4BQ2A 1WCKA 4WM8C 4Q1PA 4XXPA 1GP6A 2HEVF 3KV9A 5L73A 1VMFA 3MV01 1BYHA 3AP7A 4FPLA 1CAXA 1RVF1 1MEC3 2Q1ZB 1BKZA 4NAOA 4A3XA 2ADEA 2H0BA 4XCAA 5H9RA 3UESA 1YWKA 2NPIA 2WNUB 3B5LB 4XPVA 2HYXA 2VZUA 2AC1A 4LHLA 5EWSA 2P3KA 4XDOA 4YZ4A 2VZRA 2D97A 4WV8A 3OGVA 4EJRA 3INAA 4QPGB 5C8CA 3ZYFA 4ZS2A 1LR5A 3WHTA 4AEMA 1LHVA 2Y8KA 3WCSA 2PQSA 3N35A 4BCUA 2GZWA 4RFRB 3R4SA 4P9LA 3POSA 4XF0A 4IV3B 4KL1A 4XHXA 3ZYBA 1POV3 5K0UC 2XJUA 4W50A 1LOFA 2IXCA 1LOEA 3VBHC 2DV9A 5FZFA 1YRZA 5I8TA 4IEYA 1XNBA 4R4ZA 3D82A 3CJIC 1UY4A 5A1AA 1XJAA 1U5YA 2BZDA 3MFAA 4C1WA 4XF3A 3T4VA 4E4SA 3O1UA 2PAKA 2YBSA 1XE7A 1YCIA 3J7LA 2RS33 5IK5A 2VR4A 1QJU3 2XGXA 1F35A 2XHKA 1W8TA 4HVOA 4NOTA 3WP3A 5AFEA 1DQ0A 3S5QA 1MS0A 4ZZ8A 4XAEA 1NE6A 2YC4A 3ZR5A 5C9AB 1KFXL 1FAYA 1QY4A 2R062 2HBUA 1PO13 2YBPA 3AXDA 3MDPA 1OVPA 2VG9A 4FPKA 1X82A 4Y22A 4LBNA 5ABJA 2EXJA 1VBE1 1FOD3 1VAMA 5E8AA 3DL3A 2XKPA 3HPNA 2ZGQA 2CDOA 2VECA 3KT1A 1SFPA 4HSLA 4RFT0 4NPMA 3AFGA 4B4RA 3LEMA 4BQ1A 1LOGA 2YROA 1VJ2A 5FZOB 1AL0G 3RSJA 2V4AA 2WFPA 5FLHA 3TEYA 3VBSB 2ZS6B 1GZWB 1OFSA 3SC7X 1DGWX 2UYAA 1TQ5A 5FZKA 4RS5C 3VHPA 3ZFGC 3VDDA 2I45A 1U0AA 2QQNA 2WBKA 1GOGA 1D4M3 1YQ2A 2WKKA 2BRTA 5FYZA 2DBIA 2W91A 2VMDA 3P3NA 4GJYA 5JLVA 3BKZA 2OQ7A 3BPZA 1W8OA 1V6LA 1J1TA 2DVFA 2G9FA 2JX9A 5ACA1 4AR2A 3NVCA 1IS5A 2AYHA 2PLV1 3RS6A 1URXA 1WLDA 1R64A 3SEPA 4Q27A 3TB0A 5HCBA 3L2HA 4QAWA 1S0JA 1O4ZA 2LM3A 2P34A 4RN5A 3ZDVA 3BTXA 1GSLA 1OD3A 2HWF3 1BBT2 2XBO3 3RMYA 1XSRA 3POYA 5F5QA 2BNNA 3T3YA 3H8XA 5CKNA 5IK8A 1EAH2 3J9SA 3VBOB 2J1RA 2PN5A 5HCFA 1MS3A 1AX0A 2A5ZA 2HWE2 1UXXX 5FZOA 3WDUA 2VULA 2VBDA 1YFYA 3MIBA 4NIAA 2DUPA 2RR13 1RYYA 2V4VA 3OD0A 2ZAHA 2E6VA 3RI8A 3RZJA 4SLIA 5JSPA 4CXWA 1BEV3 4GWMA 1OHFA 3VD9A 4FPCA 1VBB2 4HK8A 4HSJA 4X8NA 4META 1CZVA 2R1DA 2D3SA 4RGGA 4Z07A 4BB3A 2XWJB 4A6OA 1F31A 5C3RA 1QXPA 2VUJA 5FXXA 3PHMA 5JSRA 5AC91 4BDVB 1M06G 5JXHA 2CV6A 4F7ZA 3K51A 4O65A 2JKBA 3DXUA 3H50A 4XFIA 3OYWB 4LA3A 2DCZA 1KGYA 4MGZE 2OS2A 1JUIA 2AEZA 2PHDA 3AM2A 4N90A 2ZBJA 5FY0A 1QJY3 3FHIB 1TME2 1YXWA 1SEFA 2GN3A 3AKRA 2CGPA 4CUGA 1VB4A 2A1XA 3RDIA 3ZM8A 2VMEA 1IHMA 2VOVA 1N3PA 1X33A 2RG4A 3CLPA 4P00B 4XFAA 5FLIA 5GM0A 3VBRC 3U78A 1AYN2 1H8TB 2R7EB 5K8SA 4CUBA 4Q4W3 5FUPA 5BNOB 2KA3A 4MUVA 3BTYA 2RM22 2XJPA 3RJ2X 3UV9A 4OQ8A 1RUI2 2YC2A 5D8AC 2WNEA 4LKFA 1Q5OA 4JKMA 3I59B 3ECQA 3FBYA 4PF5A 4KWLA 1NQDA 5LA2A 3WCRA 1V6IA 5LA1A 1EV13 3IMNA 3ZLIA 4I09A 3ACLA 1V9U3 1N3OA 1UF2C 2PHFA 3RZHA 2XLFA 4FXKB 3VLBB 5ANQA 4RA0A 2WT1A 3PJYA 4BLIA 3OGJA 3T0BA 1XYOA 5T5OA 3ZYHA 4I0BA 1P8JA 4CCJA 1IKQA 1KFUL 1VMJA 1UZWA 1NY71 2DCYA 3AZWA 1DQ6A 3OUHA 1XBFA 1KXGA 1PZ9A 5I91A 1OPOA 1BCXA 5FZHA 5GZCA 2C5DA 3MW4A 5C6CA 5BXXA 2B42B 4ARXA 3POWA 1KEXA 1R092 4XVHA 5C8CC 2UYBA 2R061 2V5DA 3OUIA 5T5PA 3VKFC 5FZ4A 1GBGA 5A32B 5C33A 1ZX5A 2WYSA 4ORFA 3ZXLA 4H14A 2BU9A 1ZBE3 1Q8SA 2FDHA 4PF1A 3PUHA 5BNOA 1LOFC 2W9XA 3H42B 5L9BA 5T52A 3OEAA 2D6MA 2EIDA 3I3QA 5CBLA 5JCTA 1QJZA 4GH4B 4XHBA 3USUA 2Z79A 4UT5A 4XYXA 5B2GB 3RYPA 5JUVA 1VRBA 3GYDA 4GJZA 1RJ8A 5EJ1B 1XNAA 5FUNA 1VALA 4X8PA 3VHNA 4JHZA 1NZCA 1IS3A 5F8PA 4FTBA 3LOBA 1SLIA 3WDTA 2G19A 1U12A 1IPJA 4HLTA 4DY5A 3KM5A 1TMF3 1YJKA 5LK5A 1ULGA 4PQQA 1CX1A 1W6QA 1ZZCA 4WM7A 4D6SA 5ABJC 1CAUA 3MIFA 3D8CA 3VDCA 3E5UA 3KLSA 3QBQA 5D2AA 2FQPA 1JBCA 2ZMLA 4KG0A 2ZGUA 2XONA 2RMU3 4DIQA 4XUTA 4EYUA 4QKBA 5CFDA 4NUBA 3ZFFA 3OBTA 3P3PA 1MVQA 1FMD2 1S0FA 2DTWA 1BBT1 1VIWB 1SPPA 1WCQA 2W1SA 5JOZA 1CJDA 2GMPA 3VDDC 5ISLA 3M70A 3MLKA 3VD5A 4KBZA 3ZSMA 3FUOA 1EAH1 3W59A 4QPIB 4N9IA 3IT8A 2HWE1 3GZAA 4LJHA 4EROA 2WZPP 5IVBA 1LHUA 1CR7A 2DYCA 1J3PA 3K2OA 1LHNA 4Y3OA 1SCRA 2GMEA 1ENSA 1T6GC 2BEOA 2WAOA 2FDKA 1LU1A 1RMU3 1VBB1 3M3IA 3WF4A 4R52A 1C8M3 1PMIA 3IBMA 4A41A 2Q5TA 2MEV3 3FLRA 5JPNB 4MV2A 4XUQA 4CZSA 4XEZA 1O3QA 3NNFA 4MHRA 4Q4X2 5F3GA 3M3OA 2ARAA 2ZPXA 1ULDA 4H7LA 5FZ8A 1ASJ2 1EYBA 3TN93 3T09A 3UYJA 1WMDA 3DCQA 5JI9A 2DU1A 3AK0A 3FZ3A 3AP5A 3AC0A 1LHWA 2C1FA 1QJX2 4JTOA 5FXZA 5FY1A 4EWAA 3JD73 2YGLA 5GLWA 2W46A 2YU1A 2P2KA 2BJSA 3CZUA 1RUC2 4OI4A 1RXFA 4EWDA 3JZVA 1VB2A 2OVUA 3BB6A 4H3WA 1R1A3 1TME1 4AQSA 5CFCA 1COV2 3THTA 4Q8KA 4Q4Y3 5FBJA 5HBAA 1UU4A 3U4XA 4UFKA 1JH5A 1AYN1 2NMOA 1BJQA 1KDMA 1AXKA 1IQDC 1MR5A 4MSVA 5J48A 3PUIA 2RM21 4PI2A 1RUI1 3TEZA 4JCKA 2VCMA 2YV8A 4QX2A 1O5LA 5A80A 3PVOA 4NPRA 1W03A 4KMQA 1ZVFA 4EN6B 4LOTA 4KWUA 3VZJA 2IFRA 5DAVA 2OPWA 3D5OA 1QGLA 3DUIA 2CTVA 3FUQA 3S57A 4Z8BA 3DPRB 1UPSA 3VUOA 4CCMA 1QJEA 4L99A 1NG0A 2TEPA 2ZEXA 2ZMKA 1PVC2 2Q1MA 1XOYA 1CESA 1UD1A 4AEDB 5JPMB 4XJAA 5CVRA 5IATA 3HD8B 4S2GA 5CKMA 4CE8A 1DIWA 4Y1XA 2B8MA 5LW9A 5T50A 5JXIA 1V6OA 3AMQA 1GOFA 4DO0A 1PX3A 5C4WC 4MVTA 5EYYA 1RUH2 2GMMA 4XQDA 3PDQA 4B7EA 2HWD2 1R091 4IEXA 3PTYA 3HAGA 5KC6A 1W9YA 1A6CA 5DZFA 3MICA 4PI0A 1RUOA 4QB2A 2C9AA 5A7WA 1W6NB 1NYWA 1W6MB 3JBG2 4YWAA 1VAKA 4UFJA 4MYEA 1LEMA 3FJSA 4PDWB 4XJWA 3T4HB 1B35B 4BQWA 3QD6A 5LATA 3W20A 3AFKA 4XBLA 5EYXA 2EIGA 4OULA 2GSYA 1UY1A 4CU6A 2FMDA 4MO3M 5A33B 4DOUA 3CKHA 4S2DA 4CDWA 1OA3A 1TEIA 2PAEA 3RZKA 4XF4A 2JDPA 1ND3A 4NR1A 3V65A 2VOTA 4XIOA 3BIWE 2ZGMA 1V0AA 3WF2A 1WGPA 4QX0A 4Q4V2 4C1XA 4AEDA 1QOTA 4NN0A 3A0KA 5C71A 4EN0A 1GNHA 2QDNA 3AL6A 3GBFA 2W1UA 1B09A 4TYSA 3WNMA 2XQXA 2NMNA 2WA3A 4WVMA 3WW2A 1Z7S2 1PM7A 1NX9A 4UOJA 2J42A 1C5HA 3DV8A 3KHBA 4Q0SA 3EB7A 1FMD1 4WM8B 2BDRA 4TXWA 3AXEA 3ZPOA 2OZJA 5FLJA 1SZBA 3K75B 4HVRA 3S0MA 5FOBB 1HX6A 4ZS3A 1H1MA 2DUOA 3OGGA 4LA2A 1GQPA 1BVP1 1B35A 1VPHA 3AP4A 3HQRA 1F4AA 3PUAA 4L2NA 5SV5A 3JUUA 3NJVA 1G9FA 4OI2A 4UW5A 3JXSA 4BMBA 3FC0A 5I0RA 2JDMA 4WM7C 5A3OA 3LIGA 2C9KA 1E57A 2VC9A 2XVGA 1G9BA 3F95A 5FQ0B 3FWEA 3I2DA 2VW1A 2GNMA 2WFF3 4H2AA 3CNAA 3C7HA 1H9PA 4DB5A 5K0UB 2FBEA 5IYYA 3EBRA 2Y26A 5FYBA 4QXHA 5CFDC 4GMP1 5FP4A 3VBHB 3KT4A 3ZFFC 5CIRA 4Q4X1 1KJRA 3CJIB 1ASJ1 2WABA 4L9BA 4BQXA 2BQPA 5FYVA 1E5RA 1SFNA 2IWGB 4KNCA 2J22A 5I0SA 2VQUA 3GBWA 1OLQA 1LOAA 1IZ3A 1QJX1 3AVSA 4YM1A 3O1VA 3VDAA 1UOFA 3AMNA 3R4UA 3LAGA 2K2SA 2ZOEB 3MHZA 1VBD3 1AHSA 2QQLA 2TNFA 1L7LA 3AMHA 2IXIA 4UWDA 1AR62 2R042 1O3SA 5FZIA 2WO2A 3ELNA 4FCAA 2DCKA 2Y0IA 4K7JA 4OHVA 5C5TA 5FZ3A 3FE5A 1RITA 5IAXA 5F1RA 1COV1 3P1IA 4AHWA 3RZMA 3I54A 4BHPA 1AXYA 2B45X 2ZGSA 4QQPA 4MGSA 5DMYA 3FFZA 3AZXA 5FMDA 4E2SA 3MGUA 1OLME 1I9RA 4U36A 1Y4WA 3ZSEA 4RD7A 3VD4A 3ATGA 5IHRA 2VUDA 3BPSA 2ZGLA 4PT6A 2FZ1A 3W21A 4YW5A 4QQLA 3LE0A 1O8SA 4OUEA 4K1ZA 3WP4A 3AYEA 5C5UA 4OMDA 5E89A 4RS5B 5A70A 3ZFGB 1UXZA 2ES3A 5K0UA 1CX4A 2RS53 3HT1A 4AF9A 3I8TA 4FFIA 3LDRA 4JV4A 2R0HA 3ME2A 1DQ1A 3LEGA 4JDOA 3WUDA 1RUE3 2W39A 1VRH2 1HQLA 1HW5A 3AKPA 1PVC1 4KI5M 5E6HA 2VZPA 1STMA 3N7JA 4CTEA 4K1YA 1S0GA 4Q8LA 5CFCC 5FUIA 4R9CA 5I0UA 2LROA 3C7OA 2HWB3 3BVCA 3M1HA 1NCQC 2MHFA 4IXLA 5DAXA 4FPFA 4I3PA 3GCXA 1IOAA 2JB8A 2P3YA 1QQP3 2Y60A 3O0WA 4ZHNA 1N1VA 1S0EA 3ZPYA 1RUH1
chains in the Genus database with same CATH topology
4NHYA 5LBCA 4ZONA 4KBZA 5HV4A 5A3UA 4Y5TA 2G1MA 5LA9A 4IW3A 5DAPA 5IAVA 3PL0A 4NHXA 2Y34A 4XABA 2A1XA 3NNMA 2RG4A 2Y33A 4NHLA 3NNFA 4MHRA 2JIJA 2HBUA 5DAWA 3HQRA 4Q5OA 5DAQA 3NNLA 5EP9A 4XC9A 4ZPIA 5M0TA 3ITQA 5L9VA 3KT1A 2RDSA 2V4AA 2FCUA 3OUHA 2RDNA 3KT4A 5EQUA 3EMRA 4Y5SA 3NNJA 4BQXA 3OUIA 5DAVA 2OPWA 3KT7A 5EPAA 2FCTA 4UWDA 5L9BA 4MHUA 5L9RA 5C5TA 3OBZA 5IAXA 2FCVA 4NMIA 2RDRA 5LASA 5ERLA 5IATA 4NHKA 5LBBA 3MGUA 2HBTA 4NHMA 4XCBA 4JZRA 5HV0A 5LBFA 3GJBA 3W21A 2RDQA 2G19A 5C5UA 4XAAA 4BQYA 3DKQA 3HQUA 4J25A 3GJAA 5LB6A 4BQWA 5LATA 3W20A 4NAOA 5LBEA 2JIGA 4XCAA 3BVCA 4XACA 3OUJA 5DAXA 3GZEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NHY A;  5LBC A;  4ZON A;  4KBZ A;  5HV4 A;  5A3U A;  4Y5T A;  2G1M A;  5LA9 A;  4IW3 A;  5DAP A;  5IAV A;  3PL0 A;  4NHX A;  2Y34 A;  4XAB A;  2A1X A;  3NNM A;  2RG4 A;  2Y33 A;  4NHL A;  3NNF A;  4MHR A;  2JIJ A;  2HBU A;  5DAW A;  3HQR A;  4Q5O A;  5DAQ A;  3NNL A;  5EP9 A;  4XC9 A;  4ZPI A;  5M0T A;  3ITQ A;  5L9V A;  3KT1 A;  2RDS A;  2V4A A;  2FCU A;  3OUH A;  2RDN A;  3KT4 A;  5EQU A;  3EMR A;  4Y5S A;  3NNJ A;  4BQX A;  3OUI A;  5DAV A;  2OPW A;  3KT7 A;  5EPA A;  2FCT A;  4UWD A;  5L9B A;  4MHU A;  5L9R A;  5C5T A;  3OBZ A;  5IAX A;  2FCV A;  4NMI A;  2RDR A;  5LAS A;  5ERL A;  5IAT A;  4NHK A;  5LBB A;  3MGU A;  2HBT A;  4NHM A;  4XCB A;  4JZR A;  5HV0 A;  5LBF A;  3GJB A;  3W21 A;  2RDQ A;  2G19 A;  5C5U A;  4XAA A;  4BQY A;  3DKQ A;  3HQU A;  4J25 A;  3GJA A;  5LB6 A;  4BQW A;  5LAT A;  3W20 A;  4NAO A;  5LBE A;  2JIG A;  4XCA A;  3BVC A;  4XAC A;  3OUJ A;  5DAX A;  3GZE A; 
#chains in the Genus database with same CATH topology
 3NV1 A;  2HWD 1;  4LEJ A;  3LA7 A;  3OJB A;  5FMC A;  3IIA A;  1D4V B;  1OA4 A;  3WW3 A;  1BVV A;  1N3Q A;  3C7F A;  3OPW A;  4IW3 A;  4I0W B;  1MVE A;  4DEV A;  2CAU A;  3JBG 1;  4P9J A;  2X10 A;  1UOJ A;  4OFG A;  1ULE A;  1UL9 A;  2O8O A;  5FPV A;  3SEE A;  5E1R A;  3ZR6 A;  1G7Y A;  3OY8 B;  4AI1 A;  5IVC A;  4E4H A;  3DXT A;  1JI6 A;  3ZIX A;  2AEY A;  1GLH A;  5FP7 A;  3ZDS A;  4BK5 A;  5FRA A;  3RZL A;  2UWA A;  3C7E A;  1AL2 3;  1PIV 2;  3VBF A;  2WLP A;  4GXL A;  4LHK A;  4QKF A;  5A7O A;  1CGP A;  1JMU B;  1CN1 A;  2VW0 A;  4QT6 A;  4TSV A;  2WJS A;  1HJF A;  4AYU A;  4YFZ A;  1W0N A;  1VBA 3;  3ON7 A;  2DVG A;  3BGA A;  4LO7 A;  4LO4 B;  4Q4V 1;  4GKY A;  2ZEZ A;  5GJ6 A;  5GLZ A;  3I3D A;  5A1L A;  1LGN A;  1TVG A;  2R6Q A;  1OF3 A;  3WSO A;  1PZ8 A;  2B4K A;  2XLA A;  3ITQ A;  4QPY A;  2X5I A;  3VZN A;  1Z7S 1;  1MQT A;  3BU7 A;  3I2G A;  1V70 A;  1SHW B;  3U10 A;  1EUU A;  1F5F A;  1LGB A;  1UN1 A;  2WN3 A;  3POI A;  4IER A;  4XBQ A;  1DFQ A;  3TEX A;  4AHZ A;  2QQK A;  4CDW C;  1XB9 A;  2VUA A;  2IXK A;  3OTF A;  5C4W B;  1ND3 C;  2D6K A;  4JAA A;  3VBR B;  4COU A;  3SCH A;  5FXV A;  2VMF A;  4WZC A;  2XQR A;  3NW4 A;  2Q8E A;  3HT2 A;  3ZXA C;  5FZ7 A;  4AFB A;  4P02 B;  4CEW A;  4BXS V;  4D69 A;  2DUR A;  4A7Z A;  2FCT A;  4JDN A;  5FMB A;  4UYB A;  5D8A B;  1ULF A;  3ZN6 B;  4LK7 A;  1T2X A;  4CDX A;  2BER A;  1FPN 3;  3KV4 A;  3HR9 A;  4QDR A;  4XW3 A;  3LSD A;  1RVF 3;  3O14 A;  1MEC 2;  4OI1 A;  2Z5W A;  1LKN A;  4LBO A;  1PGS A;  5A7N A;  2P6H A;  3KMH A;  5T5L A;  4UW4 A;  2Q30 A;  3ZMN A;  3ZVX A;  5FYU A;  1YO8 A;  3TRS B;  4MXW B;  2VTX A;  1DQ5 A;  1CAX B;  1QKQ A;  1AR8 3;  3GAL A;  3IB3 A;  2E53 A;  4QX7 A;  2CWM A;  1OFN A;  2R0F A;  1SLL A;  5KR7 A;  2BW8 A;  4HKL A;  1L7Q A;  1UYP A;  3ZYI B;  4XAA A;  1HV1 A;  3LEI A;  5LZ6 A;  1CD3 G;  3T2Q A;  1QNY A;  4JRA A;  4YVS A;  5FK8 A;  5CZK A;  1O3R A;  3RZZ A;  1JHN A;  1AR6 1;  5C8C B;  1CWP A;  1O8P A;  1H2K A;  2R04 1;  5AVA A;  4AEJ A;  3SIT A;  2ZEW A;  3MUY 1;  1D2Q A;  5F2S A;  3C3V A;  1HXS 3;  1LED A;  4ONU A;  2P5B A;  5T3N A;  4XZU G;  4P9I A;  3WF0 A;  5C4W A;  4E2Q A;  3PU3 A;  5KXE A;  4UFM A;  1PMH X;  4LIU A;  3HVD A;  1QJU 2;  4AAP A;  1O91 A;  5FAX A;  4FOV A;  1QNW A;  2ARC A;  4TLG A;  1QIQ A;  5FP3 A;  1WD4 A;  2VO5 A;  3C2U A;  4R4X A;  1Q8V A;  3DEM A;  3F2Z A;  3O1R A;  5FO7 B;  3WHU A;  3SLI A;  4F3J A;  2PEL A;  3BYW A;  4DUV A;  1PO1 2;  5FRE A;  2VOX A;  2ZX4 A;  4QQO A;  3THC A;  1JS9 A;  3ETP A;  3JQW A;  4Y5T A;  4CP1 A;  1FOD 2;  4NWW A;  3A23 A;  4NHX A;  3S7I A;  1Q8P A;  1VRH 1;  2A73 B;  3U1X A;  4BME A;  3JCI A;  5KHH A;  1DYP A;  3KF5 A;  3TOJ A;  4MXW A;  5F3C A;  2A3W A;  2EAA A;  1GYK A;  4SBV A;  4Y22 B;  5JMO A;  5ABJ B;  2GH2 A;  3EO6 A;  3MO4 A;  1JOP A;  1O4T A;  2A6V A;  2ZEY A;  1V6N A;  2RS1 3;  3W5M A;  4MGY E;  3TWI A;  1D0G A;  5AVP A;  1C5I A;  3K48 A;  5T55 A;  3NL1 A;  2E63 A;  3NNG A;  5JI7 A;  1D4M 2;  1NKG A;  4DXR A;  3LPG A;  2XKO A;  1PVX A;  3VV1 A;  4AHX A;  5JAX A;  2YC0 A;  4FP3 A;  3LGR A;  3UET A;  4OHX A;  4CUA A;  4Z92 B;  4YZ3 A;  4I3G A;  3JQX A;  3RNS A;  1DGW A;  1IQA A;  1LCL A;  2E31 A;  1AF9 A;  2AAC A;  4XQW A;  1GQH A;  2PLV 3;  3VDD B;  2YFZ A;  1ZM1 A;  4FP2 A;  3GNE A;  4NVP A;  4QHO A;  4I02 A;  4EZH A;  4YG0 A;  4D0Q A;  3JB4 C;  3W5N A;  4XF9 A;  2CNA A;  1RUG 3;  4JKK A;  4WVV A;  2ERF A;  4HBN A;  1G86 A;  1QXJ A;  4M3C E;  2BWC A;  5FIX A;  1GU3 A;  3SKV A;  2HWF 2;  1I1E A;  3BUC A;  5JOY A;  3DYM A;  1PIV 1;  2XBO 2;  1GKB A;  4JVA A;  5FZC A;  3AYA A;  4QGM A;  3THD A;  1JYN A;  2WSU A;  2PHR A;  1GV9 A;  1J58 A;  3QAC A;  4FO9 A;  4ES8 A;  3LEK A;  4BQ5 A;  1OQ1 A;  4XJU A;  1S2K A;  1AZD A;  3W58 A;  1VR3 A;  2YG0 A;  2RR1 2;  5IJR A;  1KS5 A;  1WA4 A;  5A6Z A;  3O12 A;  3WQ7 A;  3OEB A;  3FX3 A;  2D6L X;  2PHU A;  5A6X A;  1AR7 3;  3KCX A;  5FZ9 A;  4K8R B;  1AR9 2;  4NMI A;  4GMP 0;  5FY7 A;  5I8S A;  2ORX A;  3JU9 A;  4IDZ A;  4N53 A;  2HWC 3;  4QU1 A;  2VNV A;  4LT5 A;  1W99 A;  2CAV A;  5IW0 A;  1F2N A;  1PNF A;  2VMI A;  1W2A X;  3VBF C;  4OYU A;  3B02 A;  5AC9 3;  4HN1 A;  1C1L A;  3AJY A;  4M4R A;  4RGA A;  4HAN A;  3FLP A;  4M0N A;  5LCW L;  1WWY A;  5KC5 A;  4OUS A;  1WBF A;  1QDC A;  4BQ3 A;  1PGW 2;  2QBX A;  2R07 2;  1O3T A;  1NA1 A;  5D21 A;  1CPM A;  4CPB D;  1XXN A;  5CB7 A;  4QM9 A;  2ENR A;  1MEC 1;  2X5I C;  4EWE A;  2EXI A;  4Y1V A;  4COY A;  4BZ4 A;  4M3C A;  1VAV A;  1MQT C;  3WG3 A;  3AMM A;  4O9G A;  3UJO A;  1PK6 A;  5GLT A;  3SH4 A;  3KSC A;  2V72 A;  2IC1 A;  2EIE A;  3PIG A;  1R1Z A;  4Z1V A;  2JXA A;  4HOO A;  4ZON A;  5B4N A;  2QQV A;  4IND A;  1DF0 A;  5FZ6 A;  1EV1 2;  1G9C A;  4LBQ A;  4JX0 A;  1CAV A;  3U75 A;  4CEW C;  3B01 A;  4A44 A;  4Y1Y A;  1POV 1;  4JQT A;  3KV5 A;  4AE2 A;  3L9J T;  3TNQ A;  2WNV A;  3SKJ E;  4HT1 T;  1IPK A;  1W8N A;  3AZV A;  4CDX C;  3KCY A;  1W3X A;  2K0G A;  1HKD A;  2JG8 A;  1FI2 A;  5LA0 A;  4K6B A;  2WO1 A;  3K77 A;  1GMM A;  2HJI A;  4QDS A;  4A4A A;  1YQ6 A;  2E26 A;  2IXL A;  3M3E A;  1QJU 1;  2AEN A;  2FDJ A;  2PTM A;  4M4P A;  1K5M A;  3I2I A;  2YXS A;  4FOW A;  1ZBA 3;  4IEU A;  3WG1 A;  4UXA A;  2CGO A;  1D0H A;  2WIN B;  5J1X A;  4OLL A;  2H6C A;  2PXJ A;  2R06 3;  1US3 A;  3CMG A;  2Y0O A;  3OBR A;  4YZ1 A;  1PO1 1;  2I2S A;  5DAW A;  5JZG A;  5DAQ A;  2VQ0 A;  1UX7 A;  1ZBE 2;  2ZX3 A;  3ZXG A;  5EIY B;  4YVS C;  1FOD 1;  3Q8B A;  3MZH A;  5HCA A;  5HCH A;  4AEK A;  3ZFE A;  2VCB A;  2WR9 A;  5DAB A;  3UGH A;  1JYV A;  4CDU A;  2ARX A;  4PJY A;  3UGF A;  3WDV A;  5L9V A;  1ZZB A;  3VZO A;  1SLC A;  4QHB A;  2A6Z A;  1N47 A;  2E7Q A;  2OYZ A;  5JOX A;  1MZF A;  4J1W A;  1QH7 A;  2CYF A;  4XQ4 A;  2CGN A;  3U14 A;  2EIB A;  4DUX A;  3VHR A;  3SCF A;  2YYO A;  3LD8 A;  2Y6G A;  3EMR A;  2ZHN A;  5AFB A;  1GZ9 A;  4FOY A;  3USU B;  2XVL A;  1D4M 1;  1ULP A;  3ZSK A;  1HRI 2;  2ZAB A;  2A6W A;  3MID A;  4LHS A;  2G4I A;  4AQT A;  3PUQ A;  3OB8 A;  2ZAA A;  1OSG A;  5FZE A;  4ZU4 A;  5JDB A;  1ZNP A;  1ZA7 A;  3VHO A;  2VZS A;  5BNQ A;  1Q43 A;  3POG A;  5FWE A;  2VU9 A;  2FMY A;  1I5Z A;  1R08 2;  2WS9 2;  4UI9 L;  5FZA A;  2JE8 A;  4HKW A;  3ROU A;  1ZRD A;  1W2O A;  1C57 A;  2VY0 A;  2Q8O A;  1A8D A;  5FO9 B;  2WZE A;  4YW3 A;  5JMC A;  2RMU 2;  2VQA A;  4XDQ A;  2L9L A;  1J84 A;  1W8Z A;  1KD7 A;  1W6Q B;  4WM7 B;  1W2N A;  4C0B A;  1CAU B;  5LBB A;  2QQU A;  1UO9 A;  1BBT 3;  2C24 A;  2HWF 1;  2UU8 A;  2WDB A;  3NV4 A;  3RVH A;  4JZR A;  4BOW A;  3D6E A;  1DYO A;  2XBO 1;  4JDM A;  4KGQ A;  5I8Y A;  2P37 A;  2BYV E;  2LUW A;  4EN8 B;  1H4G A;  5J96 B;  3V0A A;  4CU8 A;  1W8U A;  3GJB A;  4D7Y A;  2E33 A;  1EAH 3;  5CFD B;  1QU0 A;  5HXV A;  5L7O A;  1ZRI A;  2VPV A;  3PVE A;  3ZFF B;  2E7A A;  4RQP A;  2BBV A;  3PTR B;  2IFW A;  3KD4 A;  4TWT A;  1SPP B;  4BQY A;  3WP5 A;  2JG9 A;  1SFY A;  2RR1 1;  5A3N A;  4CU9 A;  1PO2 2;  3N9P A;  4FFF A;  2ZZJ A;  1LOB A;  1AX2 A;  4BA6 A;  4EN9 B;  2ZGO A;  2W92 A;  3N9M A;  4A7Y A;  4O61 A;  1AR9 1;  4QKN A;  2HEY F;  1WLT A;  4FBF A;  1C8M 2;  3IMM A;  1CVN A;  2PHW A;  1L7R A;  1GZT A;  1YNA A;  5C3P A;  4ISQ A;  2ZAC A;  3TN9 2;  2QDR A;  1H2L A;  3DEC A;  1GOH A;  3SQO A;  4NHY A;  2QCS B;  2Y6L A;  3ZMO A;  5GZE A;  3IPV A;  2VZ3 A;  4GB3 2;  4RHV 2;  3H7Y A;  3VDB A;  4LKE A;  1W90 A;  4XMA A;  3THP A;  3ZXD A;  3MLJ A;  3T1M A;  4L11 A;  4N43 A;  1SBD A;  1PGW 1;  1S4C A;  2DCT A;  2R07 1;  3T0D A;  1R1A 2;  3I2J A;  4J6G A;  2W3J A;  3P6B A;  4D7S A;  4D7T A;  1H8V A;  4LTA A;  4NRQ A;  1H2M A;  1UQX A;  3V56 A;  2W2I A;  5L19 A;  5FKC A;  2SBA A;  4N53 C;  1Q8O A;  2Q1F A;  1JZ2 A;  2BOJ A;  2XHN A;  2YFU A;  1AYM 3;  2RM2 3;  4YSF A;  1XNK A;  1S2B A;  2QKD A;  3M2M A;  5CFC B;  5IK7 A;  1QOO A;  2DUQ A;  3MPB A;  3NO8 A;  4X6Q B;  2XPJ A;  2ZMN A;  1W0P A;  4D94 A;  1NCQ B;  4A2U A;  1EV1 1;  2WNO A;  2BGO A;  4YVW A;  4K3U A;  5FPL A;  1FNY A;  1WW4 A;  2WA4 A;  3IN9 A;  2CL2 A;  1XU1 A;  2R1B A;  4C91 A;  5A6Q A;  1JZ4 A;  1J3Q A;  3KF3 A;  4FOQ A;  3HWJ A;  1NA1 C;  3VB9 A;  1OBN A;  1A8M A;  2ATF A;  2PHT A;  5DG2 A;  3VBU A;  1V6M A;  3I2F A;  3HOB A;  1O7F A;  1QOS A;  4UF0 A;  4A6S A;  1GWM A;  1F8V A;  1UMI A;  4JRL A;  1PK6 C;  1C3H A;  4YGC A;  3ORJ A;  3OOX A;  2CY6 A;  1JOJ A;  1O4Y A;  3FBM A;  2G9Z A;  4DRV A;  3VN4 A;  2VBP A;  1X7N A;  2JDA A;  1ULC A;  3B9C A;  4ARY A;  5KXC A;  1EY2 A;  4LBM A;  4KH9 A;  4U2A A;  4XUP A;  1N1T A;  3HQX A;  1DU3 D;  2GH8 A;  2KD7 A;  4I0A A;  4QX8 A;  3GBG A;  1GWK A;  4IV1 C;  1W2U A;  1ZBE 1;  4IUG A;  3U4S A;  4TTG A;  3D0S A;  3WEZ A;  1LOD A;  2WNV C;  2GC1 A;  2JD4 A;  1MZE A;  4AI8 A;  3NAP A;  4XF1 A;  4DEQ A;  5KHJ A;  2IXJ A;  2JG8 C;  4NE9 A;  1IPS A;  5CU1 A;  4LPL A;  2DWR A;  4AWD A;  5C70 A;  5I0D A;  5A7W B;  2DF7 A;  4D6Q A;  1NCQ A;  4BU2 A;  1YQ5 A;  1ZZ8 A;  5GZG A;  5LEK A;  2W5F A;  4QM8 A;  2GNT A;  1K5M C;  2BUK A;  4BYY A;  5HV0 A;  5FFO C;  3CHX A;  4ES9 A;  3E6B A;  1HRI 1;  1KIT A;  3HBZ A;  4PQ9 A;  2AZ5 A;  2RDQ A;  4CU7 A;  3J8F 3;  3I3B A;  2X8K A;  4WVZ A;  3IDC B;  2XR4 A;  2F4L A;  5JZG C;  1RXG A;  5KHK A;  2MPF A;  1RUD 2;  4ZU5 A;  4NAM A;  5DXD A;  4CDW B;  5DUU A;  1Q56 A;  1OUR A;  1R08 1;  2WS9 1;  4XE9 A;  1ND3 B;  4UFH A;  4QMA A;  3ZX7 A;  4IE7 A;  3ZFE C;  3X29 B;  4CDU C;  4NIG A;  2YY1 A;  5KXD A;  2RMU 1;  1JU3 A;  5LY2 A;  1WMF A;  5LBE A;  4R9D A;  2IUW A;  4CUC A;  1HB4 A;  1UZZ A;  3RFR A;  3NKT A;  2KR2 A;  4QQH A;  4Q1R A;  2YUE A;  1WMX A;  3QCW A;  5FYI A;  5FMO L;  1DHK B;  1HRV 2;  1UOG A;  4QU2 A;  3D3A A;  4WVM B;  4LIT A;  4QGN A;  4AVT A;  4CCK A;  3CJX A;  4L97 A;  1GNZ A;  2D3P A;  5F3I A;  3U0Z A;  4B3N A;  4AL9 A;  3LA3 A;  4F8A A;  2P3J A;  4DNY A;  4CCE A;  3WVJ A;  2J7M A;  3ZYJ B;  2GC0 A;  1PO2 1;  3WOG A;  4B7K A;  1IG0 A;  2VMH A;  4PLM A;  2VVF A;  4BM8 A;  3VD3 A;  2EXH A;  1AUY A;  1A34 A;  3KGL A;  3AKS A;  4OZX A;  2XL9 A;  4N8M A;  1C8M 1;  2ZGP A;  3RPQ A;  2E9Q A;  3H7J A;  1S0B A;  4GMP 3;  1IS4 A;  1UOB A;  1QMJ A;  1YFW A;  2WT2 A;  5BYN A;  1PNG A;  2WO3 A;  3MI8 A;  5I0T A;  2RV9 A;  3TN9 1;  1K12 A;  5J3U A;  4CEY A;  3K4A A;  1X9T A;  4URA A;  3AMP A;  5IFT A;  4GB3 1;  4RHV 1;  4LQR A;  2VXJ A;  3GM8 A;  5TSW A;  5L7O C;  2Z4F A;  4Y20 A;  4LO6 B;  2OT7 A;  2VOK A;  4HK9 A;  4RQP C;  4XET A;  3H8O A;  2WC2 A;  1RTV A;  3HEI A;  2PYT A;  2ZX1 A;  4XC9 A;  2JG9 C;  2WAA A;  4HN0 A;  3A7Q A;  3O0V A;  3RWK X;  1R1A 1;  1KDK A;  1DDL A;  1UNB A;  1K42 A;  1NXM A;  1WA6 X;  4ATF A;  3WNK A;  1AJO A;  2FCU A;  4QPW A;  1Y9Q A;  1XC6 A;  2Q0A A;  5EQU A;  4WZF A;  4IEP A;  4GKX A;  3SXW A;  1YQC A;  4CXX A;  3ES1 A;  2BP6 A;  2BGC A;  1S0I A;  3FL7 A;  3DYP A;  2J1E A;  5IFP A;  4URT A;  1SG3 A;  1SLB A;  4M01 A;  1ODN A;  4UBG A;  3SHR A;  3VKL A;  4E8C A;  5K7P A;  1J59 A;  2HKX A;  4IE4 A;  2RS5 2;  1O5U A;  4N43 C;  3Q8E A;  3N7M A;  4MGK E;  4E4D X;  1F5J A;  1RUF 3;  4Q0P A;  1BZW A;  3HNM A;  1JYW A;  2JE9 A;  3H9A A;  1GR3 A;  4OHZ A;  2HEW F;  1VE0 A;  3T2P A;  1JZ6 A;  3CBN A;  2FCV A;  4MGQ A;  1ULO A;  4TLF A;  3FFQ A;  1N1S A;  4MZU A;  2C6S A;  5F37 A;  2WZ8 A;  3WR0 A;  1GP4 A;  2WQ8 A;  4Y1Z A;  1HQN A;  3LDK A;  1QQP 2;  1O6U A;  3Q9O A;  4NHM A;  3VKM A;  3MUZ 1;  4YFW A;  2A70 A;  4AAX A;  2I07 B;  3UJQ A;  3ZXE A;  1CAW A;  1CZT A;  4AI9 A;  4LUK A;  3POE A;  2DFB A;  4EN7 B;  1WME A;  5IVJ A;  3LSE A;  4HKO A;  3TAY A;  5CIS A;  4Q29 A;  3RJR A;  4AZZ A;  4DRR A;  1YHF A;  2J1A A;  3IDE A;  4QXB A;  3D4K A;  4D8M A;  3AZY A;  4YVW C;  3NV3 A;  4CDQ A;  1WUV A;  3JBG 3;  4ZKT B;  1ZA4 A;  1QJF A;  2ZHL A;  4GD4 A;  1MZ6 A;  1RUC 1;  5LRR A;  2ZTN A;  1GIC A;  2J1T A;  4G9S B;  1IGO A;  2WZR 3;  5CG8 A;  1KS4 A;  4TN7 A;  3VBU C;  5LY1 A;  2VBB A;  3T30 A;  5BNN A;  1IG3 A;  5BNP C;  4CA9 A;  4D3W A;  2JDU A;  3NJY A;  1AL2 2;  5FZ1 A;  4FI9 A;  3PUR A;  1W6O A;  2HH9 A;  2QJV A;  3MLL A;  2Z2S B;  4BWO A;  4CCD A;  5LBC A;  3B9I A;  3VZK A;  3R0R A;  1VBA 2;  2DVA A;  4B1M A;  2RJK A;  4Q4V 3;  2YU2 A;  2B46 X;  3DN7 A;  2VTF A;  4YGE A;  3MFC A;  4MX3 A;  3WIN E;  3EXU A;  1RUD 1;  3VBF B;  3LIH A;  1NLR A;  1RHI 2;  1UYZ A;  2JIC A;  1ZZ7 A;  2C26 A;  5IAV A;  1YI7 A;  2RJ2 A;  4H55 A;  2A6X A;  5SV8 A;  5DDJ 2;  1JXN A;  4LLF A;  4W8J A;  3EYP A;  3MIE A;  5FYS A;  1SQ4 A;  4CCC A;  1HB1 A;  1Z7S 3;  1TE1 B;  2OQ6 A;  4N7U A;  3ACF A;  4YW4 A;  2YBK A;  3NAP C;  3LOI A;  3NNM A;  5DN2 A;  3ZXJ A;  1G9D A;  1OC1 A;  4NHL A;  4ZXK A;  4JGZ A;  5APA A;  1DGR A;  4JC1 A;  4DUW A;  2GDF A;  2Y64 A;  1F15 A;  1HRV 1;  1OLR A;  1GFF 2;  1SDW A;  2JIJ A;  4IEV A;  2BFU S;  2X5I B;  4L0P A;  1VMH A;  5A7Q A;  2EXK A;  5F7U A;  4LUM A;  2EF6 A;  2LS6 A;  3ZIW A;  4BQ4 A;  3PU8 A;  1MQT B;  1HN1 A;  3ZN4 A;  2ZA9 A;  4IGP A;  3KWV A;  1DLL A;  4NID A;  3RYK A;  4FFG A;  4LE4 A;  3BTA A;  1JYT A;  1UY0 A;  1VBC 2;  1G6N A;  1TZO A;  2WUH A;  1OOP A;  1KJL A;  5CNA A;  2Q8D A;  2BPA 2;  1FPN 2;  4P5H A;  3IZO A;  4P14 A;  3RGB A;  1SBE A;  2BNM A;  1FV2 A;  5A3W A;  4CEW B;  4DQA A;  2D43 A;  1JZ5 A;  2V73 A;  1K3I A;  1F4H A;  1KQR A;  2R49 A;  2VOW A;  5JIU A;  1FV3 A;  3GXU A;  2JEM A;  3NMB A;  3WNN A;  4CDX B;  2ILM A;  2OA2 A;  2VZQ A;  4YGD A;  4NII A;  5ACA 2;  1AR8 2;  1W6P A;  1ZRC A;  3J7N A;  5F2W A;  2Y6F A;  5FZB A;  3URF A;  1UIK A;  3UKN A;  5BPX A;  3OGR A;  1LGC A;  1YLL A;  5KBF A;  4W6X A;  4XUN A;  2R04 3;  5FCC A;  5L9R A;  1JN2 P;  4IE0 A;  3OBZ A;  1HXS 2;  3M7A A;  1JUH A;  1S0C A;  3POJ A;  4XZP A;  2D6P A;  3WLU A;  1RUJ 3;  2ZGN A;  4YVS B;  1YI9 A;  5JWP A;  2JEN A;  2YGM A;  3Q8A A;  1W9S A;  1H6X A;  1PGL 2;  2VNR A;  2JDN A;  4BH9 A;  1XU2 A;  1AX1 A;  2P6C A;  3B69 A;  5LBF A;  4CEY C;  5FYH A;  2W1Q A;  2DFC A;  1Q3E A;  3I2H A;  4E2G A;  4GAZ A;  3ZXK A;  5BV6 A;  2UY9 A;  3PMS A;  4JGY A;  4XFB A;  4FPE A;  4YYO A;  4HL0 A;  5A3T A;  5LEJ A;  4H7M A;  5ANN A;  2JDH A;  3WXP A;  3NJX A;  4COZ A;  1ZZ9 A;  1C8N A;  4IEW A;  3GF6 A;  2VQT A;  4IEO A;  4RR3 A;  1VRH 3;  2YMZ A;  4LOR A;  2DBN A;  5JIA A;  1C28 A;  1WLC A;  2XLG A;  1OI6 A;  2QQO A;  3SMH A;  4HXC A;  4QGL A;  1AXZ A;  1D7P M;  1UMH A;  3G6J B;  2RS1 2;  1ZYB A;  3GZE A;  3N9O A;  4LKS A;  1FYU A;  4J1X A;  1WW6 A;  1QQP 1;  4FAH A;  2O1Q A;  4CP9 A;  4NPL A;  3VZM A;  5C8W A;  2QE3 A;  2W0X A;  3ENR A;  3LKJ A;  1S0D A;  1HB3 A;  2IVI B;  5F32 A;  2E51 A;  5FZG A;  3AVR A;  3H0O A;  4R8H A;  4XUO A;  3PME A;  4UFL A;  3WQ1 A;  3A4U A;  3OGS A;  3OF1 A;  5LA9 A;  2ZGK A;  3H3Z A;  5DAP A;  4YGB A;  4XFF A;  3BI3 A;  4L92 A;  2D6O X;  4KQ7 A;  4MOA A;  3I2K A;  1IKP A;  1MZ5 A;  4YM2 A;  5JXG A;  1BLZ A;  1QHD A;  1RUG 2;  3CF6 E;  4M0H A;  5FJK A;  1M4W A;  1EPZ A;  1MS1 A;  3H8R A;  2HYK A;  2RS3 2;  2SLI A;  1TNR A;  5A1F A;  3WG2 A;  1AL2 1;  1ODM A;  5A7S A;  1UPI A;  1Y9M A;  1VBA 1;  1PMJ X;  3P5B A;  2PMW B;  5CA6 A;  5DUV A;  2ZGR A;  2B9U A;  1T6B X;  4Q5O A;  3A21 A;  4Q26 A;  5CEH A;  5KWR A;  2FDF A;  1NUK A;  3R4D B;  4FVV A;  1LU2 A;  1CIW A;  4CDQ C;  1PX4 A;  5IVF A;  1RHI 1;  1VBE 3;  2VM9 A;  3RWN A;  5FPA A;  3I4I A;  5DDJ 1;  4AI3 A;  1AR7 2;  3ACH A;  4GWI A;  4IEQ A;  2RHP A;  2ZZQ A;  1NT0 A;  4GWJ A;  3FHA A;  4QDQ A;  1XRU A;  2HWC 2;  5BNN C;  2NLR A;  3I3E A;  4HPK A;  3K46 A;  2OUJ A;  5DZE A;  2WN2 A;  2EAK A;  3J26 N;  2WT0 A;  1W28 A;  4RL7 A;  5FDB A;  2O8Q A;  4GZ9 A;  4LOS A;  4XJ8 A;  4FPH A;  3N36 A;  3WNX A;  4MLO A;  4N53 B;  2LRP A;  1NCR A;  2CDP A;  5DG1 A;  3T2O A;  3IWZ A;  1EPW A;  1JZ7 A;  1GQG A;  4L8Q A;  5ACA 3;  2V5Y A;  1RIN A;  4QD2 A;  1VBC 1;  3LB9 A;  4LO8 A;  2A71 A;  5T5J A;  1FPN 1;  4MHU A;  4HZF A;  4NRO A;  4Y4Y A;  2RVA A;  4DMI A;  1V6K A;  2Y6J A;  3KVB A;  2Y38 A;  4YW2 A;  1UW8 A;  2RDR A;  1XQN A;  2EVX A;  3W9A A;  2RJL A;  4GA9 A;  2NQY A;  5H9S A;  5FYM A;  1GP5 A;  1RED A;  2OXB A;  4JGZ C;  5GLU A;  2OW4 A;  3MV1 1;  1NA1 B;  1OF4 A;  3QH7 A;  3T2T A;  5FXW A;  3RRD A;  1PHM A;  1W9T A;  4PIZ A;  1LOC A;  1ND2 A;  1AR8 1;  3N9L A;  3UKT A;  4YM3 A;  5EFU A;  1X36 A;  3OCP A;  1FXZ A;  1U5X A;  4M3C B;  4WVW A;  1I3H A;  3T1L A;  1PK6 B;  3LDB A;  1UZV A;  1W05 A;  1EP0 A;  2ADD A;  5E88 A;  3VKN A;  2QZ2 A;  1XE0 A;  2R32 A;  1OVS A;  3WX5 A;  5C7G A;  4OVE A;  1XPW A;  3TEW A;  3BOP A;  3J7M A;  4IES A;  1OOP C;  2GAL A;  3ZO0 B;  5E16 A;  3O1M A;  2QQP A;  3GJA A;  4Q2F A;  5CAD A;  2VVD A;  4F83 A;  3KVA A;  1DGR N;  1BEV 2;  1HXS 1;  3FLT A;  3TBD A;  4LBQ B;  1NY7 2;  1CAV B;  4IV1 B;  1ALY A;  3K3O A;  3IAQ A;  1CPN A;  1YJL A;  4M00 A;  4YRD A;  2WNV B;  3S6P A;  2VE1 A;  1ZBA 2;  3AP6 A;  1PGL 1;  2JG8 B;  4K9S A;  1FNZ A;  1G9A A;  3POB A;  4AVA A;  4I30 A;  2WQZ C;  3Q8C A;  4FXG B;  3I97 A;  4YNI A;  2NYY A;  2KM2 A;  1JYX A;  3R6S A;  4UW6 A;  1S2E A;  2DTY A;  1K5M B;  4XUR A;  2VD7 A;  2WNU A;  1OXC A;  5G04 L;  3FHQ A;  1XYP A;  4Q0Q A;  3O1T A;  2WII B;  2ZHK A;  3HNY M;  4XFG A;  1QJY 2;  1Z78 A;  4QPG A;  4XAB A;  4S2H A;  3E5Q A;  3OD4 A;  5JZG B;  4ASM B;  3WNL A;  2Y33 A;  3C8X A;  1OKO A;  3LF7 A;  1NOV A;  5F5I A;  3LCP A;  4LUL A;  1UYX A;  4LIV A;  2RS1 1;  1X8E A;  3G7D A;  4Q4W 2;  4IV3 A;  4MGT A;  3ZFE B;  2HLE A;  3VKO A;  1OPM A;  3O0X A;  5HPO A;  3RQ0 A;  4CDU B;  1MS9 A;  4YLZ A;  2C4X A;  1UU5 A;  3KV6 A;  5FYC A;  3ZXF A;  4YAR A;  4V2V A;  1YC6 1;  2X05 A;  2XUM A;  3JB8 A;  5EXO A;  2GND A;  2W95 A;  2GC2 A;  1DQ2 A;  3LZZ A;  3NNL A;  4JGY C;  4JTN A;  4IV1 A;  1FT9 A;  2W52 A;  3HJR A;  3A22 A;  3K4Z A;  1LHO A;  1GZC A;  1V9U 2;  2QQM A;  2PA7 A;  2ZX2 A;  1NQJ A;  3CEW A;  3HNB M;  3QLQ A;  4FPG A;  3BOW A;  4GAL A;  3MIH A;  4RR3 C;  4ZXE A;  3SH3 A;  4BJ0 A;  4E27 A;  4YW6 A;  4AXO A;  5FPB A;  4ET7 A;  1RUG 1;  2C0Z A;  4X6R B;  3N9N A;  5C9A A;  2RDS A;  1Y3T A;  5J7M A;  5J98 B;  2PHL A;  2K9Z A;  2JB4 A;  1QEX A;  2JDK A;  4P9G A;  2CSG A;  2IVJ A;  1LES A;  2RS3 1;  1XYN A;  4WBB A;  1LJ7 A;  2B39 A;  1YFX A;  4DS0 A;  5F39 A;  3RYR A;  5IUQ A;  1WW5 A;  1ZRR A;  2J1V A;  4Q0V A;  4BIS A;  2JKX A;  4FTS A;  2R16 A;  3MYX A;  2XL7 A;  3ALQ A;  4HMZ A;  1UKR A;  2DCJ A;  4YG6 A;  2FDI A;  2BWA A;  2A3Y A;  3VBS A;  3WZ1 A;  1GZW A;  4AGV A;  1H1I A;  1MS5 A;  4GQ7 A;  4P08 A;  4AVV A;  2ZXQ A;  3V0A B;  3R05 A;  1AR7 1;  4NIH A;  4A42 A;  3AX4 A;  3EJK A;  1AR9 3;  5L7O B;  3H3U A;  2AR6 A;  3IKW A;  5LAS A;  4RQP B;  5ERL A;  2HWC 1;  5K9Y A;  3KQ4 B;  1YUD A;  4P9Y A;  2JG9 B;  4LBJ A;  4DXT A;  4CP2 A;  4D6R A;  1WLW A;  3NKG A;  1H30 A;  2X09 A;  4YW1 A;  1OT5 A;  3UKV A;  1UIJ A;  3DKW A;  1DZT A;  4IEZ A;  1JOB A;  4NRM A;  1S1A A;  1O59 A;  2D5H A;  2JD9 A;  3EQE A;  3NWK A;  1XNC A;  1W9F A;  1TMF 2;  4DXZ A;  4IE6 A;  3RZG A;  5A7P A;  1DZQ A;  1ZZ6 A;  1EUT A;  2R07 3;  4NO4 A;  3H3L A;  4LBL A;  2ZCW A;  3IPV B;  1MAC A;  2F4P A;  1W06 A;  2XJV A;  3BCW A;  2B9V A;  3NRU A;  4J25 A;  4QB6 A;  3L2Y A;  4LE3 A;  3IDB B;  4Z2W A;  4N43 B;  5FTT C;  3OPZ A;  5JR2 A;  3VBO A;  3IDA A;  4E8D A;  5HI0 A;  2BNO A;  1AYM 2;  1FAT A;  1Y9G A;  3AP9 A;  3K3N A;  5LWB A;  3VL8 A;  2PAM A;  4HVQ A;  4XTP A;  4GUL A;  3O1S A;  3BAL A;  4AI2 A;  4B29 A;  5BY5 A;  3TYJ A;  5HV4 A;  2D44 A;  1SMV A;  3PVN A;  4AFM A;  2BVB A;  1UKG A;  4P5Y A;  2UWB A;  4A7K A;  4YM0 A;  4CP0 A;  1NCR C;  4QX1 A;  1JZ3 A;  2HWE 3;  1QWR A;  4B4Q A;  3HN3 A;  3KB5 A;  3AYC A;  2PQQ A;  3D0J A;  3CZJ A;  4PLN A;  4FFH A;  4AW7 A;  2IXH A;  5FYY A;  4YZ2 A;  1BEV 1;  4XJ9 A;  4YVW B;  1OQE A;  1VBB 3;  1RMU 2;  5FO8 B;  4ZZ5 A;  2JWP A;  1GNY A;  3H1Y A;  2D5F A;  3O7O A;  4UBH A;  1LNS A;  3OYW A;  4XTM A;  5LK7 B;  2MEV 2;  2QQJ A;  1SBF A;  1W8F A;  2D98 A;  4JQR A;  1ZBA 1;  1UY3 A;  3BOD A;  2QZ3 A;  3VBU B;  2YDE A;  5A3L A;  4Z82 A;  1ND2 C;  1UZ0 A;  4IGO A;  4UF0 B;  4QXC A;  5BNP B;  1CIY A;  1APN A;  2QFE A;  4QXK A;  3UT0 A;  4AOC A;  2F6B A;  4CXY A;  3B3Q E;  1RGS A;  5HXM A;  5FK7 A;  2D93 A;  1W8W A;  3JD7 2;  3KS7 A;  4QX5 A;  4XJZ A;  5T54 A;  5CG9 A;  1H8T A;  1SAC A;  2VCC A;  5EP9 A;  3VZL A;  4YZ5 A;  3V0B B;  5H9P A;  3ZSJ A;  5M0T A;  1KRI A;  1QJY 1;  1TME 3;  4IQP A;  4LXL A;  4AVC A;  1YYN A;  3AKT A;  3I59 A;  3J7H A;  4PHZ A;  2R30 A;  4W6Y A;  4Q4Y 2;  4DZG A;  4CSW A;  3PVB B;  4KWJ A;  1AYN 3;  1MPX A;  2ARB A;  2W68 A;  2RDN A;  3RMX A;  4DPN A;  1J1L A;  4DXS A;  4O9E A;  4Q4W 1;  1LRH A;  4MXV A;  1RUI 3;  2VNO A;  3NAP B;  3AL5 A;  1HRI 3;  3CIH A;  3E97 A;  3HIF A;  3KHC A;  2P1B A;  1JYC A;  3N7L A;  3J8F 2;  3N7K A;  2Y6H A;  4ZU7 A;  5BUV A;  4HET A;  4R9A A;  4EE2 A;  5EPA A;  1RL3 A;  4UFI A;  3SIS A;  5L36 A;  1DLC A;  1R08 3;  2WO7 A;  2WS9 3;  5KHI A;  3APB A;  2WNU C;  1V9U 1;  4AVS A;  3OPT A;  5FV3 A;  2FDG A;  2BV4 A;  5J37 A;  2JDZ A;  3M4F A;  4LLO A;  1RB8 G;  3KCC A;  4C8D A;  3UL2 A;  4QPG C;  1C1F A;  4AQ6 A;  2GU9 A;  4B4P A;  1WCU A;  5A32 A;  4A3Z A;  5BNP A;  1Y7B A;  2ET1 A;  1HQW A;  3ACG A;  4LMF A;  3GHM A;  4PIX A;  5GLV A;  1HJG A;  4IV3 C;  4QKD A;  4Y4R A;  3ST7 A;  2WQ4 A;  3FN9 A;  1DP0 A;  1K45 A;  1W3V A;  4XBN A;  4CVU A;  4EV0 A;  1R09 3;  2VTX J;  4AFC A;  5JSO A;  5CKQ A;  3V0B A;  1Q8Q A;  1WZX A;  2O0O A;  3UGG A;  4GH4 A;  5A6Y A;  1UX6 A;  2F17 A;  3MPP G;  3WF1 A;  1JW6 A;  1CQ9 A;  2ZHM A;  1H9W A;  2XUE A;  3K4D A;  2ZGT A;  2VZO A;  1BK0 A;  1OKQ A;  4CCO A;  1ACC A;  1PO2 3;  2B7Y A;  3MIG A;  1C4R A;  4RSU A;  2B5H A;  4FT8 A;  1W2T A;  1IS6 A;  3WY6 A;  1WCS A;  5C9A C;  5IT6 A;  3CQO A;  5EZW A;  4ASL A;  4MH0 E;  3ZKU A;  1J3R A;  4IE5 A;  4LKD A;  2CHH A;  2RE9 A;  1A78 A;  3PLQ A;  5FKB A;  1UMZ A;  1BMV 2;  1SDD B;  1WW7 A;  5FY5 A;  5I93 A;  1H0B A;  1WKY A;  4DY3 A;  1DYK A;  1UU6 A;  5J36 A;  2J1S A;  2Q8C A;  2P3I A;  2VH9 A;  3H8U A;  4GB3 3;  4NWV A;  4RHV 3;  3ILF A;  4W6W A;  3HMY A;  4RYD A;  1VLN A;  1XND A;  2G1M A;  1TMF 1;  3CDZ B;  2VGD A;  4G3Y C;  3IAP A;  1H6Y A;  2A6Y A;  2W87 A;  4CEY B;  3VBS C;  2X29 A;  2VNG A;  2W47 A;  3PL0 A;  3MBW A;  3WQB A;  2FHR A;  4FTE A;  4OI0 A;  2W94 A;  2WYF A;  3WG4 A;  2Y34 A;  1S55 A;  4TZD A;  4Y20 B;  2ETE A;  2I74 A;  1QF3 A;  5C3O A;  3LFI A;  1UYY A;  4K40 A;  4QPI A;  1ZRE A;  1FMD 3;  2NM1 A;  3GZU C;  3GGL A;  1AYM 1;  1X50 A;  3UNP A;  3DGT A;  2QNK A;  3KQR A;  3LQC A;  5JR7 B;  3AB0 A;  4UW3 A;  4ISR A;  4N7I A;  4YPJ A;  3WDX A;  4AHY A;  2BFU L;  3I49 A;  1NZI A;  1V00 A;  4LBQ D;  1TG7 A;  5GZD A;  3DYO A;  3WD5 A;  4C90 A;  1YIP A;  4QQ2 A;  3B93 A;  1ONA A;  2BGP A;  2LW8 A;  3S7E A;  3ZYP A;  1JU4 A;  2XVK A;  1RUF 2;  4Y5Z 0;  1LB2 A;  3HN1 A;  2XJT A;  1Z0H A;  4XFC A;  3ZYR A;  5FR3 A;  5FY4 A;  2VAU A;  4FQZ A;  1CON A;  2WLQ A;  3LWC A;  4AK3 A;  2FD8 A;  1E5I A;  3I3M A;  2ET7 A;  2WFF 2;  1RMU 1;  2WWJ A;  2W1W A;  1E5H A;  2VMC A;  4CCL A;  2MEV 1;  3VBO C;  4ASK A;  1WD3 A;  4Q4X 3;  2WWS A;  1GAN A;  4AG4 A;  3BU0 A;  4Y5S A;  3NNJ A;  1ASJ 3;  2CWS A;  3N4M A;  3ZN5 A;  4ZY9 A;  4LK6 A;  4BIO A;  2VJX A;  1LUL A;  5FYT A;  1POV 0;  1QJX 3;  4PBO A;  5F5A A;  1NLQ A;  2Z69 A;  3JD7 1;  4EQV A;  2XWB B;  5FP9 A;  2BVV A;  1VBD 2;  1CAW B;  4FAG A;  1RUC 3;  1MS4 A;  4W4Z A;  4XXA A;  1U5Z A;  2XG3 A;  3GDB A;  5DUX A;  5FY8 A;  3GCW A;  2WZR 2;  3OSD A;  1YIF A;  2DU0 A;  2WL1 A;  1COV 3;  2NN8 A;  3M8L A;  3MW2 A;  2Q4S A;  1W8H A;  4QX3 A;  3M3C A;  3IM0 A;  3PIJ A;  4Q4Y 1;  4CDQ B;  5FPX A;  3J4U H;  2MNG A;  2XJQ A;  2EAL A;  1REE A;  2D40 A;  4R9B A;  4RGK A;  1UWW A;  1X9P A;  2OZ6 A;  4BLJ A;  3AZZ A;  4XCB A;  3A0N A;  3DPR A;  1DQ4 A;  4AFD A;  1DCS A;  2ID4 A;  5BNN B;  4AVB A;  3AYD A;  3J8F 1;  4JKL A;  4KU7 A;  3B7M A;  1RUD 3;  3LFM A;  1ZRF A;  1H2N A;  1VP6 A;  3NJZ A;  4FPJ A;  5D1I A;  1W6O B;  3DKQ A;  5FZM A;  1H8T C;  3HQU A;  5BNO C;  4IET A;  3T0A A;  1RUE 2;  5DZG A;  1OUS A;  1PVC 3;  1HB2 A;  2TBV A;  2ZJC A;  1RIR A;  2D3R A;  5C3Q A;  1JZ8 A;  2JIG A;  4AGR A;  1LAJ A;  5IVV A;  3CL1 A;  3WF3 A;  2HWB 2;  1QH6 A;  4LO5 B;  1UAI A;  1WCD J;  5GZF A;  1W6N A;  1HRV 3;  1MS8 A;  1W6M A;  3ACI A;  2WSV A;  3SCG A;  3QH6 A;  4CRQ A;  1RUH 3;  4OQ9 A;  3GHN A;  5FPU A;  2HWD 3;  4PDW A;  2XH6 A;  2QVS B;  4P9W A;  5DPN A;  3WP6 A;  5A3U A;  2VW2 A;  3NST A;  3SH5 A;  4JGZ B;  2DVB A;  4LR4 A;  1OUX A;  4K21 A;  5A33 A;  3UK9 A;  3WV6 A;  5JXJ A;  1J83 A;  2XXZ A;  2QUO A;  1HDK A;  1CZS A;  3E6D A;  1F9K A;  3RI9 A;  4B1L A;  1BHG A;  4ITC A;  3VGI A;  4PBP A;  2H0V A;  5IVY A;  2VCA A;  4PIY A;  1JHJ A;  1UCX A;  2GP5 A;  1HN0 A;  1OOP B;  5DUW A;  3OBA A;  3WDW A;  1BMV 1;  3N9Q A;  2D7F A;  2OPK A;  5JVV A;  3TNP B;  1I5P A;  5KXB A;  2LTN A;  1A3K A;  3ABZ A;  2P4E A;  3O1O A;  4FPY A;  4V2W A;  5C3S A;  1ENR A;  3CO2 A;  4GH4 C;  5B4X A;  3BN6 A;  5IK4 A;  1DZR A;  1W0O A;  2H6B A;  1XNT A;  3FMG A;  3ILN A;  2EIC A;  2NZ9 A;  5H9Q A;  4HG6 B;  1UY2 A;  2GC3 A;  4WM8 A;  2WWU A;  1I6X A;  2Z42 A;  4KGG A;  1W6P B;  2A75 A;  5FJH A;  1ENQ A;  3VD7 A;  1NAE A;  3WUC A;  5FBZ A;  3PNA A;  1RUJ 2;  4EZ4 A;  5FP8 A;  2VMG A;  1WBL A;  3I7D A;  4OCT A;  1W04 A;  3T08 A;  2OX0 A;  3CU7 A;  1OA2 A;  3S5A A;  1DBN A;  2UY8 A;  3MF6 A;  2J1U A;  2UWC A;  4LHN A;  1SCS A;  3QOP A;  4AGG A;  5FQ0 A;  2LAL A;  1OH3 A;  3AJZ A;  2G9G A;  4K20 A;  2NP0 A;  5A3M A;  3WT3 A;  3KT7 A;  2XDV A;  2ZX0 A;  3HBK A;  4XIL A;  3AKQ A;  2XB6 C;  2K46 A;  3VBH A;  1RUF 1;  1Y43 B;  3NV2 A;  3GZT B;  2OUH A;  2YPD A;  3U07 A;  3CJI A;  4XMI A;  5JOW A;  4B8E A;  2VZV A;  5GKA C;  3WNP A;  1RVF 2;  4CPB A;  4JGY B;  4NRP A;  3U11 A;  2WFF 1;  3III A;  4M3C F;  2Y6K A;  5KHG A;  4RR3 B;  1LTE A;  5FMO S;  2HBT A;  1HLC A;  2QQW A;  2XOM A;  4HON A;  4IGQ A;  4K8F A;  4QPI C;  4AFA A;  4Y26 A;  4Z2A A;  4DFS A;  2XJR A;  1BQP A;  3POF A;  3U37 A;  1DG6 A;  3V64 A;  4QHZ A;  3WNO A;  3I2O A;  3E6C C;  3Q8F A;  4PLO A;  2TUN A;  5FWJ A;  3MF9 A;  4BK4 A;  1D2S A;  2A7A A;  4OMC A;  5FOJ B;  3WW4 A;  4CP9 B;  3OG2 A;  1HIX A;  1OD5 A;  1U5I A;  3ASI A;  4G4F A;  1VBD 1;  1AR6 3;  2OII A;  2WRA A;  5FPZ A;  2E7T A;  4XOG A;  3B00 A;  4AQ2 A;  3WW1 A;  2VZT A;  5LB6 A;  2FZ2 A;  1AVB A;  1REF A;  2WZR 1;  5FZL A;  1HV0 A;  3EHK A;  4NJ4 A;  4COV A;  2ARE A;  4OZO A;  3NQH A;  4XAC A;  3OUJ A;  5J09 A;  2JE7 A;  2VXR A;  2QTW B;  1OLM A;  2YHJ A;  4RS5 A;  4UAP A;  5F5C A;  1FX5 A;  5F6L B;  3ZFG A;  4JHT A;  4BXF A;  4A45 A;  2ZKL A;  5IVE A;  4YG3 A;  1V6J A;  3RG0 A;  3O1P A;  2VZ1 A;  3KGZ A;  4V1P A;  5LRS A;  1ENX A;  3ILR A;  3LA2 A;  3USS A;  4DIN B;  3VL9 A;  2W08 A;  5CYY A;  5EHD A;  3BTZ A;  2GP3 A;  2QQI A;  3E5X A;  1RHI 3;  1BK1 A;  1ST8 A;  2RS5 1;  1VBE 2;  5F9T A;  2JDY A;  4BPZ A;  5DDJ 3;  2AUY A;  1SLT A;  5DQ0 A;  1RUE 1;  1UZY A;  1LEN A;  2DVD A;  4XDP A;  2OKX A;  2AGS A;  2HWB 1;  1K5J A;  3PJQ A;  2N7G A;  2XJS A;  4N9H A;  1YQ8 A;  2BBA A;  1RC6 A;  1W9W A;  2O14 A;  2V09 A;  3ZYG A;  4C0H A;  2PFW A;  3LPF A;  3WDY A;  3DPR C;  5A3P A;  1AJK A;  1CJP A;  4W65 A;  5EJ3 A;  2ZKN A;  4OHY A;  2JJ6 A;  5FZD A;  4HFS A;  3ETQ A;  3OY8 A;  4HPK B;  4AED C;  1OH4 A;  3ES4 A;  3PUS A;  4MGI E;  4XIK A;  2VL4 A;  2GNB A;  4I01 A;  4MAD A;  4Y1U A;  2JEC A;  4Y24 A;  5FY9 A;  3ZKY A;  1VBC 3;  4BIF A;  3MEP A;  4CYD A;  2PLV 2;  3M3Q A;  1LEC A;  2D6N A;  4ZPI A;  4LBK A;  3B94 A;  1DGL A;  4KWK A;  1GUI A;  3O5S A;  4KU8 A;  4QWN A;  3WQ0 A;  3H1M A;  5G05 L;  4FQ4 A;  1G8W A;  1NCR B;  2CU5 A;  1E5S A;  4OHW A;  3DF0 A;  4Q0U A;  2PHX A;  3MW3 A;  1H4H A;  1XE8 A;  2DDU A;  2VVE A;  2GN7 A;  1PIV 3;  4KG8 A;  1BXH A;  4QB1 A;  3SNM A;  1JYI A;  4P9X A;  5IWF A;  4O7X A;  1SLA A;  4COW A;  1QXR A;  2BOI A;  2VUC A;  4PDW C;  1B35 C;  3H1W A;  4XFH A;  1TNF A;  1RUN A;  1US2 A;  1L3J A;  1XSQ A;  1GWL A;  1NE4 A;  5K4L A;  1JTZ X;  4FPO B;  2GAU A;  1QDO A;  2P17 A;  3ZSL A;  2XML A;  1ND2 B;  4S2F A;  5EV7 A;  5EJZ B;  2A3X A;  4Y33 A;  4YW7 A;  4AI0 A;  3VBR A;  4KBB A;  4I2O A;  1YEW A;  1PM4 A;  1RUJ 1;  3BIE A;  4CCN A;  1JOD A;  1POQ A;  2ORZ A;  5CAZ A;  4MG2 A;  1N1Y A;  4BE3 A;  1PZ7 A;  4NHK A;  1NLS A;  3N3H A;  2YPJ A;  2IZW A;  4FSJ A;  2YZ4 A;  4E9K A;  1OMI A;  5GAL A;  1X8M A;  2AH2 A;  4PCR A;  4LNV A;  5D8A A;  1NXD 1;  2BTV C;  1OQD A;  2UUR A;  4OUM A;  2EA7 A;  1W39 A;  5FZ0 A;  3KZ4 C;  3ZN6 A;  5AC9 2;  4IL7 A;  1H1A A;  2YB7 A;  3ZOI A;  5F6K A;  4E4Z A;  4ATE A;  4GIQ A;  1YFU A;  3C7G A;  5F3E A;  3S30 A;  2X53 S;  2KXL A;  4GWN A;  3E1F 1;  1RJ7 A;  2E32 A;  4BQ2 A;  1WCK A;  4WM8 C;  4Q1P A;  4XXP A;  1GP6 A;  2HEV F;  3KV9 A;  5L73 A;  1VMF A;  3MV0 1;  1BYH A;  3AP7 A;  4FPL A;  1CAX A;  1RVF 1;  1MEC 3;  2Q1Z B;  1BKZ A;  4NAO A;  4A3X A;  2ADE A;  2H0B A;  4XCA A;  5H9R A;  3UES A;  1YWK A;  2NPI A;  2WNU B;  3B5L B;  4XPV A;  2HYX A;  2VZU A;  2AC1 A;  4LHL A;  5EWS A;  2P3K A;  4XDO A;  4YZ4 A;  2VZR A;  2D97 A;  4WV8 A;  3OGV A;  4EJR A;  3INA A;  4QPG B;  5C8C A;  3ZYF A;  4ZS2 A;  1LR5 A;  3WHT A;  4AEM A;  1LHV A;  2Y8K A;  3WCS A;  2PQS A;  3N35 A;  4BCU A;  2GZW A;  4RFR B;  3R4S A;  4P9L A;  3POS A;  4XF0 A;  4IV3 B;  4KL1 A;  4XHX A;  3ZYB A;  1POV 3;  5K0U C;  2XJU A;  4W50 A;  1LOF A;  2IXC A;  1LOE A;  3VBH C;  2DV9 A;  5FZF A;  1YRZ A;  5I8T A;  4IEY A;  1XNB A;  4R4Z A;  3D82 A;  3CJI C;  1UY4 A;  5A1A A;  1XJA A;  1U5Y A;  2BZD A;  3MFA A;  4C1W A;  4XF3 A;  3T4V A;  4E4S A;  3O1U A;  2PAK A;  2YBS A;  1XE7 A;  1YCI A;  3J7L A;  2RS3 3;  5IK5 A;  2VR4 A;  1QJU 3;  2XGX A;  1F35 A;  2XHK A;  1W8T A;  4HVO A;  4NOT A;  3WP3 A;  5AFE A;  1DQ0 A;  3S5Q A;  1MS0 A;  4ZZ8 A;  4XAE A;  1NE6 A;  2YC4 A;  3ZR5 A;  5C9A B;  1KFX L;  1FAY A;  1QY4 A;  2R06 2;  2HBU A;  1PO1 3;  2YBP A;  3AXD A;  3MDP A;  1OVP A;  2VG9 A;  4FPK A;  1X82 A;  4Y22 A;  4LBN A;  5ABJ A;  2EXJ A;  1VBE 1;  1FOD 3;  1VAM A;  5E8A A;  3DL3 A;  2XKP A;  3HPN A;  2ZGQ A;  2CDO A;  2VEC A;  3KT1 A;  1SFP A;  4HSL A;  4RFT 0;  4NPM A;  3AFG A;  4B4R A;  3LEM A;  4BQ1 A;  1LOG A;  2YRO A;  1VJ2 A;  5FZO B;  1AL0 G;  3RSJ A;  2V4A A;  2WFP A;  5FLH A;  3TEY A;  3VBS B;  2ZS6 B;  1GZW B;  1OFS A;  3SC7 X;  1DGW X;  2UYA A;  1TQ5 A;  5FZK A;  4RS5 C;  3VHP A;  3ZFG C;  3VDD A;  2I45 A;  1U0A A;  2QQN A;  2WBK A;  1GOG A;  1D4M 3;  1YQ2 A;  2WKK A;  2BRT A;  5FYZ A;  2DBI A;  2W91 A;  2VMD A;  3P3N A;  4GJY A;  5JLV A;  3BKZ A;  2OQ7 A;  3BPZ A;  1W8O A;  1V6L A;  1J1T A;  2DVF A;  2G9F A;  2JX9 A;  5ACA 1;  4AR2 A;  3NVC A;  1IS5 A;  2AYH A;  2PLV 1;  3RS6 A;  1URX A;  1WLD A;  1R64 A;  3SEP A;  4Q27 A;  3TB0 A;  5HCB A;  3L2H A;  4QAW A;  1S0J A;  1O4Z A;  2LM3 A;  2P34 A;  4RN5 A;  3ZDV A;  3BTX A;  1GSL A;  1OD3 A;  2HWF 3;  1BBT 2;  2XBO 3;  3RMY A;  1XSR A;  3POY A;  5F5Q A;  2BNN A;  3T3Y A;  3H8X A;  5CKN A;  5IK8 A;  1EAH 2;  3J9S A;  3VBO B;  2J1R A;  2PN5 A;  5HCF A;  1MS3 A;  1AX0 A;  2A5Z A;  2HWE 2;  1UXX X;  5FZO A;  3WDU A;  2VUL A;  2VBD A;  1YFY A;  3MIB A;  4NIA A;  2DUP A;  2RR1 3;  1RYY A;  2V4V A;  3OD0 A;  2ZAH A;  2E6V A;  3RI8 A;  3RZJ A;  4SLI A;  5JSP A;  4CXW A;  1BEV 3;  4GWM A;  1OHF A;  3VD9 A;  4FPC A;  1VBB 2;  4HK8 A;  4HSJ A;  4X8N A;  4MET A;  1CZV A;  2R1D A;  2D3S A;  4RGG A;  4Z07 A;  4BB3 A;  2XWJ B;  4A6O A;  1F31 A;  5C3R A;  1QXP A;  2VUJ A;  5FXX A;  3PHM A;  5JSR A;  5AC9 1;  4BDV B;  1M06 G;  5JXH A;  2CV6 A;  4F7Z A;  3K51 A;  4O65 A;  2JKB A;  3DXU A;  3H50 A;  4XFI A;  3OYW B;  4LA3 A;  2DCZ A;  1KGY A;  4MGZ E;  2OS2 A;  1JUI A;  2AEZ A;  2PHD A;  3AM2 A;  4N90 A;  2ZBJ A;  5FY0 A;  1QJY 3;  3FHI B;  1TME 2;  1YXW A;  1SEF A;  2GN3 A;  3AKR A;  2CGP A;  4CUG A;  1VB4 A;  2A1X A;  3RDI A;  3ZM8 A;  2VME A;  1IHM A;  2VOV A;  1N3P A;  1X33 A;  2RG4 A;  3CLP A;  4P00 B;  4XFA A;  5FLI A;  5GM0 A;  3VBR C;  3U78 A;  1AYN 2;  1H8T B;  2R7E B;  5K8S A;  4CUB A;  4Q4W 3;  5FUP A;  5BNO B;  2KA3 A;  4MUV A;  3BTY A;  2RM2 2;  2XJP A;  3RJ2 X;  3UV9 A;  4OQ8 A;  1RUI 2;  2YC2 A;  5D8A C;  2WNE A;  4LKF A;  1Q5O A;  4JKM A;  3I59 B;  3ECQ A;  3FBY A;  4PF5 A;  4KWL A;  1NQD A;  5LA2 A;  3WCR A;  1V6I A;  5LA1 A;  1EV1 3;  3IMN A;  3ZLI A;  4I09 A;  3ACL A;  1V9U 3;  1N3O A;  1UF2 C;  2PHF A;  3RZH A;  2XLF A;  4FXK B;  3VLB B;  5ANQ A;  4RA0 A;  2WT1 A;  3PJY A;  4BLI A;  3OGJ A;  3T0B A;  1XYO A;  5T5O A;  3ZYH A;  4I0B A;  1P8J A;  4CCJ A;  1IKQ A;  1KFU L;  1VMJ A;  1UZW A;  1NY7 1;  2DCY A;  3AZW A;  1DQ6 A;  3OUH A;  1XBF A;  1KXG A;  1PZ9 A;  5I91 A;  1OPO A;  1BCX A;  5FZH A;  5GZC A;  2C5D A;  3MW4 A;  5C6C A;  5BXX A;  2B42 B;  4ARX A;  3POW A;  1KEX A;  1R09 2;  4XVH A;  5C8C C;  2UYB A;  2R06 1;  2V5D A;  3OUI A;  5T5P A;  3VKF C;  5FZ4 A;  1GBG A;  5A32 B;  5C33 A;  1ZX5 A;  2WYS A;  4ORF A;  3ZXL A;  4H14 A;  2BU9 A;  1ZBE 3;  1Q8S A;  2FDH A;  4PF1 A;  3PUH A;  5BNO A;  1LOF C;  2W9X A;  3H42 B;  5L9B A;  5T52 A;  3OEA A;  2D6M A;  2EID A;  3I3Q A;  5CBL A;  5JCT A;  1QJZ A;  4GH4 B;  4XHB A;  3USU A;  2Z79 A;  4UT5 A;  4XYX A;  5B2G B;  3RYP A;  5JUV A;  1VRB A;  3GYD A;  4GJZ A;  1RJ8 A;  5EJ1 B;  1XNA A;  5FUN A;  1VAL A;  4X8P A;  3VHN A;  4JHZ A;  1NZC A;  1IS3 A;  5F8P A;  4FTB A;  3LOB A;  1SLI A;  3WDT A;  2G19 A;  1U12 A;  1IPJ A;  4HLT A;  4DY5 A;  3KM5 A;  1TMF 3;  1YJK A;  5LK5 A;  1ULG A;  4PQQ A;  1CX1 A;  1W6Q A;  1ZZC A;  4WM7 A;  4D6S A;  5ABJ C;  1CAU A;  3MIF A;  3D8C A;  3VDC A;  3E5U A;  3KLS A;  3QBQ A;  5D2A A;  2FQP A;  1JBC A;  2ZML A;  4KG0 A;  2ZGU A;  2XON A;  2RMU 3;  4DIQ A;  4XUT A;  4EYU A;  4QKB A;  5CFD A;  4NUB A;  3ZFF A;  3OBT A;  3P3P A;  1MVQ A;  1FMD 2;  1S0F A;  2DTW A;  1BBT 1;  1VIW B;  1SPP A;  1WCQ A;  2W1S A;  5JOZ A;  1CJD A;  2GMP A;  3VDD C;  5ISL A;  3M70 A;  3MLK A;  3VD5 A;  4KBZ A;  3ZSM A;  3FUO A;  1EAH 1;  3W59 A;  4QPI B;  4N9I A;  3IT8 A;  2HWE 1;  3GZA A;  4LJH A;  4ERO A;  2WZP P;  5IVB A;  1LHU A;  1CR7 A;  2DYC A;  1J3P A;  3K2O A;  1LHN A;  4Y3O A;  1SCR A;  2GME A;  1ENS A;  1T6G C;  2BEO A;  2WAO A;  2FDK A;  1LU1 A;  1RMU 3;  1VBB 1;  3M3I A;  3WF4 A;  4R52 A;  1C8M 3;  1PMI A;  3IBM A;  4A41 A;  2Q5T A;  2MEV 3;  3FLR A;  5JPN B;  4MV2 A;  4XUQ A;  4CZS A;  4XEZ A;  1O3Q A;  3NNF A;  4MHR A;  4Q4X 2;  5F3G A;  3M3O A;  2ARA A;  2ZPX A;  1ULD A;  4H7L A;  5FZ8 A;  1ASJ 2;  1EYB A;  3TN9 3;  3T09 A;  3UYJ A;  1WMD A;  3DCQ A;  5JI9 A;  2DU1 A;  3AK0 A;  3FZ3 A;  3AP5 A;  3AC0 A;  1LHW A;  2C1F A;  1QJX 2;  4JTO A;  5FXZ A;  5FY1 A;  4EWA A;  3JD7 3;  2YGL A;  5GLW A;  2W46 A;  2YU1 A;  2P2K A;  2BJS A;  3CZU A;  1RUC 2;  4OI4 A;  1RXF A;  4EWD A;  3JZV A;  1VB2 A;  2OVU A;  3BB6 A;  4H3W A;  1R1A 3;  1TME 1;  4AQS A;  5CFC A;  1COV 2;  3THT A;  4Q8K A;  4Q4Y 3;  5FBJ A;  5HBA A;  1UU4 A;  3U4X A;  4UFK A;  1JH5 A;  1AYN 1;  2NMO A;  1BJQ A;  1KDM A;  1AXK A;  1IQD C;  1MR5 A;  4MSV A;  5J48 A;  3PUI A;  2RM2 1;  4PI2 A;  1RUI 1;  3TEZ A;  4JCK A;  2VCM A;  2YV8 A;  4QX2 A;  1O5L A;  5A80 A;  3PVO A;  4NPR A;  1W03 A;  4KMQ A;  1ZVF A;  4EN6 B;  4LOT A;  4KWU A;  3VZJ A;  2IFR A;  5DAV A;  2OPW A;  3D5O A;  1QGL A;  3DUI A;  2CTV A;  3FUQ A;  3S57 A;  4Z8B A;  3DPR B;  1UPS A;  3VUO A;  4CCM A;  1QJE A;  4L99 A;  1NG0 A;  2TEP A;  2ZEX A;  2ZMK A;  1PVC 2;  2Q1M A;  1XOY A;  1CES A;  1UD1 A;  4AED B;  5JPM B;  4XJA A;  5CVR A;  5IAT A;  3HD8 B;  4S2G A;  5CKM A;  4CE8 A;  1DIW A;  4Y1X A;  2B8M A;  5LW9 A;  5T50 A;  5JXI A;  1V6O A;  3AMQ A;  1GOF A;  4DO0 A;  1PX3 A;  5C4W C;  4MVT A;  5EYY A;  1RUH 2;  2GMM A;  4XQD A;  3PDQ A;  4B7E A;  2HWD 2;  1R09 1;  4IEX A;  3PTY A;  3HAG A;  5KC6 A;  1W9Y A;  1A6C A;  5DZF A;  3MIC A;  4PI0 A;  1RUO A;  4QB2 A;  2C9A A;  5A7W A;  1W6N B;  1NYW A;  1W6M B;  3JBG 2;  4YWA A;  1VAK A;  4UFJ A;  4MYE A;  1LEM A;  3FJS A;  4PDW B;  4XJW A;  3T4H B;  1B35 B;  4BQW A;  3QD6 A;  5LAT A;  3W20 A;  3AFK A;  4XBL A;  5EYX A;  2EIG A;  4OUL A;  2GSY A;  1UY1 A;  4CU6 A;  2FMD A;  4MO3 M;  5A33 B;  4DOU A;  3CKH A;  4S2D A;  4CDW A;  1OA3 A;  1TEI A;  2PAE A;  3RZK A;  4XF4 A;  2JDP A;  1ND3 A;  4NR1 A;  3V65 A;  2VOT A;  4XIO A;  3BIW E;  2ZGM A;  1V0A A;  3WF2 A;  1WGP A;  4QX0 A;  4Q4V 2;  4C1X A;  4AED A;  1QOT A;  4NN0 A;  3A0K A;  5C71 A;  4EN0 A;  1GNH A;  2QDN A;  3AL6 A;  3GBF A;  2W1U A;  1B09 A;  4TYS A;  3WNM A;  2XQX A;  2NMN A;  2WA3 A;  4WVM A;  3WW2 A;  1Z7S 2;  1PM7 A;  1NX9 A;  4UOJ A;  2J42 A;  1C5H A;  3DV8 A;  3KHB A;  4Q0S A;  3EB7 A;  1FMD 1;  4WM8 B;  2BDR A;  4TXW A;  3AXE A;  3ZPO A;  2OZJ A;  5FLJ A;  1SZB A;  3K75 B;  4HVR A;  3S0M A;  5FOB B;  1HX6 A;  4ZS3 A;  1H1M A;  2DUO A;  3OGG A;  4LA2 A;  1GQP A;  1BVP 1;  1B35 A;  1VPH A;  3AP4 A;  3HQR A;  1F4A A;  3PUA A;  4L2N A;  5SV5 A;  3JUU A;  3NJV A;  1G9F A;  4OI2 A;  4UW5 A;  3JXS A;  4BMB A;  3FC0 A;  5I0R A;  2JDM A;  4WM7 C;  5A3O A;  3LIG A;  2C9K A;  1E57 A;  2VC9 A;  2XVG A;  1G9B A;  3F95 A;  5FQ0 B;  3FWE A;  3I2D A;  2VW1 A;  2GNM A;  2WFF 3;  4H2A A;  3CNA A;  3C7H A;  1H9P A;  4DB5 A;  5K0U B;  2FBE A;  5IYY A;  3EBR A;  2Y26 A;  5FYB A;  4QXH A;  5CFD C;  4GMP 1;  5FP4 A;  3VBH B;  3KT4 A;  3ZFF C;  5CIR A;  4Q4X 1;  1KJR A;  3CJI B;  1ASJ 1;  2WAB A;  4L9B A;  4BQX A;  2BQP A;  5FYV A;  1E5R A;  1SFN A;  2IWG B;  4KNC A;  2J22 A;  5I0S A;  2VQU A;  3GBW A;  1OLQ A;  1LOA A;  1IZ3 A;  1QJX 1;  3AVS A;  4YM1 A;  3O1V A;  3VDA A;  1UOF A;  3AMN A;  3R4U A;  3LAG A;  2K2S A;  2ZOE B;  3MHZ A;  1VBD 3;  1AHS A;  2QQL A;  2TNF A;  1L7L A;  3AMH A;  2IXI A;  4UWD A;  1AR6 2;  2R04 2;  1O3S A;  5FZI A;  2WO2 A;  3ELN A;  4FCA A;  2DCK A;  2Y0I A;  4K7J A;  4OHV A;  5C5T A;  5FZ3 A;  3FE5 A;  1RIT A;  5IAX A;  5F1R A;  1COV 1;  3P1I A;  4AHW A;  3RZM A;  3I54 A;  4BHP A;  1AXY A;  2B45 X;  2ZGS A;  4QQP A;  4MGS A;  5DMY A;  3FFZ A;  3AZX A;  5FMD A;  4E2S A;  3MGU A;  1OLM E;  1I9R A;  4U36 A;  1Y4W A;  3ZSE A;  4RD7 A;  3VD4 A;  3ATG A;  5IHR A;  2VUD A;  3BPS A;  2ZGL A;  4PT6 A;  2FZ1 A;  3W21 A;  4YW5 A;  4QQL A;  3LE0 A;  1O8S A;  4OUE A;  4K1Z A;  3WP4 A;  3AYE A;  5C5U A;  4OMD A;  5E89 A;  4RS5 B;  5A70 A;  3ZFG B;  1UXZ A;  2ES3 A;  5K0U A;  1CX4 A;  2RS5 3;  3HT1 A;  4AF9 A;  3I8T A;  4FFI A;  3LDR A;  4JV4 A;  2R0H A;  3ME2 A;  1DQ1 A;  3LEG A;  4JDO A;  3WUD A;  1RUE 3;  2W39 A;  1VRH 2;  1HQL A;  1HW5 A;  3AKP A;  1PVC 1;  4KI5 M;  5E6H A;  2VZP A;  1STM A;  3N7J A;  4CTE A;  4K1Y A;  1S0G A;  4Q8L A;  5CFC C;  5FUI A;  4R9C A;  5I0U A;  2LRO A;  3C7O A;  2HWB 3;  3BVC A;  3M1H A;  1NCQ C;  2MHF A;  4IXL A;  5DAX A;  4FPF A;  4I3P A;  3GCX A;  1IOA A;  2JB8 A;  2P3Y A;  1QQP 3;  2Y60 A;  3O0W A;  4ZHN A;  1N1V A;  1S0E A;  3ZPY A;  1RUH 1; 
#chains in the Genus database with same CATH homology
 4NHY A;  5LBC A;  4ZON A;  4KBZ A;  5HV4 A;  5A3U A;  4Y5T A;  2G1M A;  5LA9 A;  4IW3 A;  5DAP A;  5IAV A;  3PL0 A;  4NHX A;  2Y34 A;  4XAB A;  2A1X A;  3NNM A;  2RG4 A;  2Y33 A;  4NHL A;  3NNF A;  4MHR A;  2JIJ A;  2HBU A;  5DAW A;  3HQR A;  4Q5O A;  5DAQ A;  3NNL A;  5EP9 A;  4XC9 A;  4ZPI A;  5M0T A;  3ITQ A;  5L9V A;  3KT1 A;  2RDS A;  2V4A A;  2FCU A;  3OUH A;  2RDN A;  3KT4 A;  5EQU A;  3EMR A;  4Y5S A;  3NNJ A;  4BQX A;  3OUI A;  5DAV A;  2OPW A;  3KT7 A;  5EPA A;  2FCT A;  4UWD A;  5L9B A;  4MHU A;  5L9R A;  5C5T A;  3OBZ A;  5IAX A;  2FCV A;  4NMI A;  2RDR A;  5LAS A;  5ERL A;  5IAT A;  4NHK A;  5LBB A;  3MGU A;  2HBT A;  4NHM A;  4XCB A;  4JZR A;  5HV0 A;  5LBF A;  3GJB A;  3W21 A;  2RDQ A;  2G19 A;  5C5U A;  4XAA A;  4BQY A;  3DKQ A;  3HQU A;  4J25 A;  3GJA A;  5LB6 A;  4BQW A;  5LAT A;  3W20 A;  4NAO A;  5LBE A;  2JIG A;  4XCA A;  3BVC A;  4XAC A;  3OUJ A;  5DAX A;  3GZE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...