2WS91

Equine rhinitis a virus at low ph
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
246
structure length
246
Chain Sequence
VTNVGEDGEPGETEPRHALSPVDMHVHTDVSFLLDRFFDVETLELSNLTGSPATHVLDPFGSTAQLAWARLLNTCTYFFSDLELSIQFKFTTTPSSVGEGFVWVKWFPVGAPTKTTDAWQLEGGGNSVRIQQLAVAGMSPTVVFKIAGSRSQACGFSVPYTSMWRVVPVFYNGWGAPTKEKATYNWLPGAHFGSILLTSDAHDKGGCYLRYRFPRANMYCPRPIPPAFTRPADKTRHKFPTNINKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords P1
publication title Equine Rhinitis a Virus and its Low Ph Empty Particle: Clues Towards an Aphthovirus Entry Mechanism?
pubmed doi rcsb
total genus 32
structure length 246
sequence length 246
ec nomenclature
pdb deposition date 2009-09-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2ws9100
2Y26A 1RB8G 2BPA2 1AR71 1RMU1 4CDQA 1RUI3 1PIV3 4QPIC 5J98B 2WFF3 4JGYC 1K5MB 2RR12 1B35C 1RUI1 1RUC3 1FMD2 3M8LA 2XBO3 2BFUL 1NCRB 3ZFFC 2WFF1 2RMU2 5BNNA 4CDXA 1R1A3 4YVSB 1RVF1 1VB2A 4PDWB 1QJY3 1MEC1 1PO23 1R1A1 4CDWB 5LK7B 1AYN3 5K0UB 1QJY1 1BBT3 1X36A 4IV1A 3LOBA 1PO21 5ABJC 4AEDA 1BBT1 3ZFEB 2ZZQA 1FOD3 1RUE1 5C4WA 1R091 2DF7A 3J8F1 1RUF1 4RR3C 1AR62 1FOD1 3VDDC 4Y5Z0 1OOPA 5CFDA 4Q4Y2 5L7OC 2R061 4N43B 2HWB3 2PLV3 1HRV3 4LLFA 4QPGC 5CFCB 3IDEA 4QPIA 4RS5B 1ASJ1 4JGYA 2QQPA 1B35A 1HRV1 4JGZB 1RUJ3 2HWF3 5BNPB 1TMF2 1RUG2 3ZFFA 2WLPA 1OHFA 1PO12 2R042 5ACA2 3JD71 1RUJ1 2HWC2 1NCQB 1GFF2 3VBRB 2BBVA 1K5MC 1D4M1 3JB4C 1ZBE2 1BMV1 3JBG2 3JB8A 1BEV3 1NCRC 2RS53 2RM22 1BEV1 1Z7S2 1HRI3 5A32A 2RS51 4YVWB 2MEV3 5A33A 4CDWC 1QJU3 1AL21 4RR3A 5K0UC 3VDDA 1ND2B 1VBB2 4Q4V3 1V9U3 2HWD2 5JZGB 5L7OA 2R073 1QJU1 4QPGA 5AC91 3ZFEC 1EV12 1QJZA 2R071 5D8AB 1QJX3 1POV1 1M06G 1R081 3DPRB 2RS33 1QJX1 4CDUB 4WM8C 4N43C 3VBOB 2IZWA 1AR91 4GB32 1AYM2 5CFCC 2RS31 1F8VA 4RS5C 1QQP3 1PVC1 4BCUA 4JGZC 5C8CB 1AR73 1FPN2 5BNPC 1NCRA 1QQP1 1NA1C 1VB4A 1VRH2 4Q4X1 1POV0 1MQTB 5BNOB 1NCQC 1TME2 3VBFB 2GSYA 1ND3B 3VBRC 4CDWA 1RMU2 5DDJ3 2RS11 1HX6A 1RVF3 1RUH3 4RQPB 2XPJA 1MEC3 4GH4B 2RR13 5DDJ1 1ZBA2 1RUI2 1RUH1 1PIV2 3VBSB 5C9AB 5FOJB 2RMU3 1VBA3 1H8TB 1HXS2 1VBC2 2RR11 1FMD1 1RUC2 2XBO2 2RMU1 1VBA1 1PGL1 1ND2C 5JZGC 4IV3B 4WM8A 1RUE3 4N43A 1R093 4CEYB 3ZFGC 2WS92 3J8F3 1RUF3 1QJY2 2FZ1A 1PO22 1RUD2 4RS5A 5D8AC 1AYN2 4JGZA 2R063 1VBE2 1EAH2 5BNPA 4RHV2 1AR83 3DPRC 1NA1A 1VBD3 1ASJ3 4CDUC 3VBUB 3VBOC 1FOD2 5BNNB 1AR81 4Q4Y3 1NCQA 1VBD1 3CJIC 1AR61 5C8CC 3JD73 4Q4Y1 1RHI3 2HWB2 2PLV2 1VAKA 1D4M3 1RUG3 1MQTC 4FTSA 4FSJA 5BNOC 1RHI1 2R043 3VBFC 3VBHB 1RUJ2 1TMF1 2HWF2 1RUG1 4RQPC 5C4WB 1PO11 2R041 3ZXAC 2HWC1 4GH4C 1NOVA 1PGW1 2X5IB 3ZFGA 5ABJA 4YVSC 3VBSC 5C9AC 1ZBE3 1AL23 4PDWC 5CFDB 5GKAC 1H8TC 5D8AA 4N53B 1W39A 1C8M3 1ZBE1 3JBG1 4QPIB 1CJDA 1HQNA 1Z7S3 1BEV2 5AC93 4GMP1 1B35B 2RM21 4IV3C 1C8M1 4CEYC 4CDUA 4FTBA 3VBOA 1Z7S1 1POV3 1WCDJ 1VBB3 1HRI2 2BUKA 2MEV2 1R083 3CJIA 4CEWB 5C8CA 1VBB1 4Q4V2 1EV13 2HWD1 1AR93 1V9U2 1E57A 1IHMA 3VBUC 1PVC3 1EV11 5BNOA 4GMP0 3VBFA 2HWE3 1K5MA 5A32B 4Q4X3 4RQPA 1C8NA 2RS32 4WM7B 2HWE1 5A33B 2GH8A 2VQ0A 4RR3B 1NY72 2ZTNA 4GH4A 3VDDB 4GB31 3TN92 4YVSA 2WZR3 5C9AA 4PDWA 1COV3 1X33A 2RS13 4Q4W3 5L7OB 1H8TA 1VRH3 4QPGB 2WZR1 3VBHC 4Z92B 1AR72 5K0UA 1COV1 4Q4W1 1VRH1 4IV3A 4CEYA 2X5IC 1FMD3 3ZFEA 1TME1 2WFF2 1F2NA 4YVWC 4N53C 1ZBA3 5DDJ2 1RUH2 1RVF2 1VBC3 1HXS3 1MEC2 1ZBA1 1PIV1 1R1A2 3VBUA 1VBC1 1HXS1 1NG0A 1VBA2 3NAPB 1PGL2 1CD3G 5CFCA 1RUC1 4CDQB 2XBO1 4CEWC 2WS93 1BBT2 5FMOS 1RUD3 1RUE2 1R092 2WS91 1VBE3 3FBMA 1AR63 1EAH3 1RUF2 3J8F2 4RHV3 1RUD1 4FTEA 4CDXB 1AYN1 1VBE1 2R062 3VBHA 1EAH1 3VBRA 4RHV1 4Y4YA 2WWSA 1AR82 4WM7C 1VBD2 1ASJ2 2X5IA 1HRV2 3HAGA 4IV1B 1TMF3 1DDLA 4WM8B 1PO13 4YVWA 4N53A 4AEDB 5ACA3 1ND3C 2HWC3 3JD72 1AL0G 4NWWA 4Q4W2 1ND2A 2HWB1 1RHI2 2PLV1 5ACA1 5JZGA 1D4M2 1SMVA 1OOPB 3JBG3 1NA1B 1BMV2 4GMP3 2HWF1 1PGW2 2RM23 4CEWA 1A6CA 2BFUS 4JGYB 2RS52 3DPRA 3S6PA 4EJRA 1AL22 3ZFFB 3NAPC 4RFT0 2FZ2A 2HWD3 1C8M2 1AUYA 1OPOA 1QJU2 4CDQC 5J96B 5AC92 4WM7A 2R072 5FMOL 1HRI1 2MEV1 1MQTA 4SBVA 5BNNC 4CDXC 1R082 3ZFGB 5ABJB 1QJX2 2TBVA 1ND3A 4Q4V1 4GB33 1V9U1 1AYM3 1AR92 4NWVA 1PVC2 4IV1C 1AYM1 1FPN3 3VBSA 1QQP2 2HWE2 3TN93 4AEDC 2ZAHA 1FPN1 4Q4X2 5C4WC 3CJIB 1NY71 1TME3 3TN91 2WZR2 1RMU3 1COV2 2RS12 1OOPC 5CFDC 3NAPA
chains in the Genus database with same CATH superfamily
4WVZA 1M4WA 1UU5A 2NM1A 1SFYA 3GZEA 4WZFA 4LBQD 1EP0A 4UW6A 1GU3A 1KD7A 3ETQA 4XJWA 2CL2A 1WMXA 4XQWA 4M00A 4XF0A 1GP6A 2WFF3 3AM2A 4LLOA 1K5MB 3VD3A 1B35C 4XQ4A 3VZMA 4JRLA 1W6QB 4NUBA 1SFPA 3D5OA 3OPZA 3IDBB 1RXFA 2BFUL 1NCRB 3AKQA 3NJZA 4LHLA 4M4PA 5FY8A 3WF4A 3BTYA 3ZPYA 4EYUA 3VD5A 1W2TA 4FXGB 1KEXA 3SMHA 1SLAA 1VB2A 2CV6A 2LS6A 4YW1A 2PHLA 2VOTA 1G9AA 2EXHA 3TB0A 3PDQA 1HLCA 2QJVA 1GQGA 4H55A 1PO23 1CIYA 1YWKA 3N36A 5GM0A 2DDUA 1W6PA 4Q27A 5K0UB 1ALYA 1QJY1 1IQAA 1BBT3 1QDOA 1UF2C 3LOBA 1NT0A 1F4HA 2QE3A 2GZWA 4BK5A 1UY2A 5FPXA 3PLQA 1CAVB 2PQQA 3OY8A 5CB7A 2A70A 4J6GA 3ZOIA 2JWPA 4XFBA 2W52A 4GA9A 4NE9A 2XWJB 4OVEA 1R091 4XMIA 5L19A 3VGIA 2KM2A 5JR7B 4YGDA 4OMCA 2GMEA 2D5HA 3JUUA 3PIGA 1FOD1 3VDDC 3C7OA 3ZX7A 1AX1A 3WDXA 1Q56A 5CFDA 4Q4Y2 2MHFA 3P1IA 5L7OC 3H8XA 1LGBA 2AENA 2HWB3 4ASKA 3VB9A 4LLFA 2WZPP 3VV1A 5KR7A 3NNLA 1GP4A 1XB9A 1UWWA 5HV0A 1B35A 1DQ1A 1VIWB 4FBFA 1C5HA 2JE9A 4GWJA 5FR3A 2DCYA 3N7MA 4PHZA 3VD7A 2Q1FA 5F9TA 2EVXA 1PO12 1YNAA 4NHYA 1OLMA 3WW4A 4AW7A 2J1SA 1RUJ1 5KXCA 4CP1A 1VJ2A 2I74A 1G9CA 4FPGA 5L9VA 1GFF2 2ZGRA 5LBBA 3RQ0A 1W8WA 3SITA 3VBRB 2AR6A 1IS5A 1K5MC 3MPPG 2OUJA 1DLCA 3ZYHA 2G9ZA 4HT1T 4QMAA 3JBG2 4XBLA 5K4LA 1BEV3 1NQJA 1NCRC 5GLWA 5A7PA 3WNPA 4IETA 1NYWA 2VH9A 4K8RB 5C3OA 3AZYA 2XG3A 2XJTA 5KC6A 2XQRA 4AQTA 3IZOA 2GNBA 2YBKA 2NYYA 1S0IA 4FFGA 2J7MA 4IE0A 1UOGA 2MEV3 3UT0A 1KITA 4LR4A 5A33A 1H9WA 1JOBA 5K0UC 2WL1A 1QNWA 3PTYA 3VDDA 1Y9MA 1VBB2 4NRMA 3WG1A 1MR5A 1UYPA 1V9U3 3K4AA 4EN9B 5L7OA 2R073 1PHMA 5FZOA 5LA0A 1CWPA 2B39A 2GH2A 4RFRB 3KGZA 4DB5A 2Z4FA 5KXEA 2AC1A 3H42B 1ENSA 2P2KA 3ALQA 4YZ5A 4CPBA 3PJQA 1C1FA 3AXDA 1SQ4A 4IEZA 4XUTA 5D8AB 4OZXA 4FPOB 1WMDA 1IG0A 4QXBA 1OI6A 1QJX3 4Q8KA 3I3BA 2JDMA 3RZHA 4PI0A 1GMMA 2RG4A 3HR9A 1ZA4A 1UCXA 2ETEA 2RS33 4MO3M 4BJ0A 5F7UA 1O3QA 3CO2A 4NJ4A 1LOBA 4O61A 3WCSA 3NNGA 4BQ3A 1Q5OA 1AR91 1AYM2 1I5PA 4WVWA 1WW5A 1QH6A 1W05A 3AYCA 1PMJX 3BCWA 5JWPA 1Q43A 1F8VA 3KT1A 4I01A 4Q2FA 1OD5A 4LE3A 4LO5B 3KGLA 3POWA 3ES4A 1YFXA 2Q8EA 1J59A 1QJEA 4MXWB 2RE9A 4BCUA 1YYNA 3QH7A 4IUGA 4ZS3A 3VKMA 4B29A 4BYYA 5A3PA 1W6OB 2CGNA 4GALA 1U12A 5FRAA 2YY1A 1NCRA 1DF0A 1GZWA 5FMDA 1DZTA 2PAKA 1D2QA 4LO6B 1AF9A 1VB4A 4N9IA 1POV0 4FI9A 1KRIA 1MQTB 3F2ZA 3I2FA 4CCLA 3KV5A 4K1ZA 3OG2A 4IE7A 4KWJA 5FV3A 1S0FA 2Z5WA 3VBFB 4UXAA 3VBRC 1C57A 4D69A 5LBCA 4V2VA 4RQPB 4WV8A 2A6ZA 2FMYA 2NLRA 2XPJA 4C0BA 1XU2A 2D6NA 3GCWA 2X8KA 1EUTA 1Y43B 1YRZA 2RR13 5DDJ1 5IVCA 2DCJA 1CAVA 1PIV2 4XOGA 2P3KA 5LRRA 4D6SA 1VBA3 1VBC2 3T2TA 4AVVA 1ULDA 1TEIA 2C26A 1V6OA 2A6WA 1WZXA 2GP5A 2VOVA 4BHPA 3DXUA 1CPNA 2RMU1 2BGPA 1PGL1 2AUYA 4ES9A 3HBZA 4E4SA 3FFQA 1R093 3P6BA 1Q8VA 4JRAA 4LITA 3R6SA 1SLIA 2RVAA 3ZFGC 5HI0A 5I0DA 5IVJA 2WLQA 1QJY2 4CCCA 2QQNA 3K75B 3LCPA 4RYDA 4NHLA 2VBBA 4TN7A 5D8AC 2YU2A 1AYN2 3CLPA 3FE5A 4DEVA 1VBE2 1X9PA 1JYXA 2YROA 1EAH2 2JDKA 3AXEA 4R9AA 1Q3EA 5TSWA 2WWUA 5GJ6A 4DINB 2X09A 4UBGA 5DPNA 4HPKB 1VLNA 4V1PA 5G04L 5A3MA 3B69A 1VRBA 5C6CA 3DN7A 5IK4A 3PIJA 2B45X 1CZTA 1FOD2 5CG9A 1L7RA 1HKDA 3WHUA 4XFCA 1XE0A 2YPDA 1VBD1 4K9SA 2XKPA 5IW0A 2H6BA 1UIKA 4WZCA 2RDSA 1WUVA 4HVRA 1OLRA 2QQMA 1T6BX 4QX7A 4OI4A 1JZ3A 2FBEA 4MOAA 1CAXB 1U5XA 1XNAA 2AZ5A 2V5DA 3LIHA 4Q0QA 4B8EA 1CESA 3DYOA 1WA6X 4E8CA 2OUHA 2XH6A 2H0VA 1DU3D 3DGTA 3H8RA 1RUG3 3POFA 1MQTC 5A6ZA 5FPUA 3BB6A 4LUKA 2R043 4KMQA 3VBFC 4QKDA 2UWBA 4YW2A 4Y1ZA 1OD3A 1BCXA 1RUJ2 4INDA 4XFFA 5F5IA 4ORFA 5L9BA 4RQPC 5C4WB 4N8MA 1G9BA 5GZFA 2CYFA 3WX5A 1NOVA 3ZFGA 5C33A 2YB7A 4YVSC 5F2SA 4PDWC 3N7KA 2NMOA 2FCVA 3SCHA 2QVSB 4COWA 5DABA 5D8AA 4A3ZA 1W39A 2O1QA 4PQ9A 2YXSA 1OSGA 2ZKLA 5JIUA 3POSA 4QX2A 1LECA 2WKKA 4HVOA 4GMP1 2VMEA 3FX3A 5C3QA 2ZHKA 4AAXA 5FYVA 3JXSA 5GLVA 1UOJA 2BUKA 4HFSA 2JE8A 1ZVFA 4AHZA 1VALA 3NNMA 2D7FA 3IWZA 5JAXA 3Q8BA 5IVYA 1WW4A 4NVPA 3VKLA 3ZXDA 1QNYA 4CP9B 2Y34A 1W99A 1S2EA 3JQWA 1GSLA 5GLTA 1EV13 2HWD1 1AR93 3N9NA 4PBPA 2KA3A 4L92A 4Z1VA 2A6VA 3GALA 4DOUA 1VP6A 1O59A 1IHMA 3NNFA 4LIUA 5IVEA 2QQJA 2VUDA 4KQ7A 4BMEA 4TZDA 4OI1A 5A7QA 1F5FA 1S4CA 5C7GA 3K2OA 1W6MA 2XJPA 3VBFA 4OUSA 3ATGA 1PX4A 3MIBA 1REDA 4XJ8A 1UZ0A 2PMWB 2WDBA 3T2PA 3A0NA 4G9SB 4RQPA 3BIEA 1CJPA 4WM7B 4TLGA 1IPSA 3UV9A 3V56A 4QWNA 1WMFA 4C1WA 4A4AA 1N1SA 2VQ0A 4D7SA 2OPWA 2YMZA 4GB31 5FZFA 4YVSA 5LASA 2WZR3 4AEMA 2BQPA 4PDWA 4R9BA 1KDKA 3AMQA 2ZOEB 3PJYA 5C71A 3W21A 1VRH3 2G19A 2G4IA 1Q8QA 4Z92B 1UNBA 2VZPA 2RJ2A 5T5PA 5HPOA 4QM8A 2IFRA 1CZVA 4HONA 3TOJA 1UY1A 4K40A 2JKXA 4I0BA 1WA4A 5FP4A 1HJFA 4AI8A 2DVDA 5KHJA 2J42A 3DF0A 3KD4A 4Z82A 4BK4A 3MF9A 3N9MA 3WW1A 3NO8A 4D7YA 1SEFA 2BNNA 3EHKA 2K9ZA 5DDJ2 4KBBA 1GLHA 3B7MA 1QDCA 1V6JA 5EFUA 1LCLA 4PIXA 3ZYIB 4DFSA 5C5TA 4XCBA 2ZEWA 3ZN4A 3ZKYA 4YG3A 2B4KA 4OULA 1MEC2 3H8OA 4YNIA 1S2BA 4A41A 4YW6A 1R1A2 2XB6C 2GMPA 5IVFA 1XU1A 2JB4A 2QFEA 1NZIA 5AVAA 1WCKA 2ZACA 2V73A 4BMBA 2EALA 1PGL2 4UF0B 4UFKA 1Z0HA 3OBTA 4W50A 1RUC1 1HV0A 5FO8B 3WQ1A 2XBO1 3SH4A 5JOWA 1ULEA 1X82A 4AR2A 2AEYA 5JXJA 2A3XA 2A3WA 1W2AX 4FP2A 2OA2A 3K46A 5FZCA 2P4EA 3ON7A 5FPAA 3WDTA 5A80A 4CYDA 3DECA 2WS91 3N7JA 2Y38A 1GP5A 1UY3A 1PGSA 4CU6A 3THTA 4CDXB 2D6KA 1A3KA 5HCFA 5T52A 3X29B 5IATA 3H3UA 4G3YC 2V4AA 5LB6A 4ZXEA 4Y4YA 2BV4A 1MS8A 2CNAA 5JI9A 4YW4A 2WQ8A 4WM7C 4UT5A 1VBD2 1OMIA 2WIIB 1ASJ2 3I2IA 1UD1A 2J1RA 2YBSA 3MZHA 2N7GA 3IPVB 4XZUG 3TBDA 5LY1A 2YGLA 3JU9A 5DAXA 2Y64A 4E4DX 3OPTA 1ZX5A 4BZ4A 5A1FA 3FN9A 5FZGA 1L3JA 3RWNA 3M4FA 3O5SA 3ZSEA 1JUHA 3JD72 1TVGA 2ZBJA 4NWWA 3URFA 1IQDC 1ND2A 2ARXA 2GN3A 2YGMA 2PLV1 4UWDA 4AG4A 1DGWA 5DMYA 5JZGA 2JDAA 5LY2A 4MG2A 2PFWA 4XAEA 2JDUA 5FZ8A 3VUOA 2VNRA 5T50A 3KSCA 1AX0A 5FK7A 2HYXA 5DAVA 1Y9GA 3UGGA 4GMP3 3T08A 1JZ4A 1H2NA 1I9RA 2HWF1 2X29A 2YDEA 4GWNA 4LBNA 4CP9A 1H4GA 4UFHA 2Z42A 1SBFA 4LO4B 4ASMB 2VZUA 2BFUS 4JGYB 4Q8LA 4QB2A 2EXIA 2ZGSA 1RITA 4M4RA 3S6PA 2A6YA 4IEUA 3ZDSA 3EXUA 5GZDA 2ZGLA 2GNMA 1ST8A 2E63A 4JHTA 2EIEA 4AEKA 3ZYPA 4L2NA 3AL6A 2HWD3 5FJHA 4K3UA 3ITQA 2WR9A 1OPOA 1ZRRA 4XHBA 2UYBA 3OBRA 4RGKA 5EIYB 1Y7BA 5J7MA 1IS3A 1YFWA 3RYPA 1WWYA 3V64A 1W6NB 4WM7A 3UK9A 4COVA 2BNOA 2PHWA 1IS4A 5FP3A 3ZPOA 2ARAA 4PCRA 4RN5A 4U36A 1J83A 3LFMA 3PUSA 5LA2A 2I07B 3ROUA 1L7QA 4P5HA 1CAUB 1VMFA 2R1BA 2VVDA 3QBQA 3PUIA 4I3PA 4CDXC 4YM3A 5ABJB 1D7PM 2D98A 4HETA 4M3CA 4MVTA 4KNCA 4DXRA 3OGRA 2PQSA 4GB33 3AK0A 5EWSA 1KDMA 2PYTA 2DCZA 2WO1A 3WG3A 5FOBB 2WRAA 2VGDA 3WF1A 2ADEA 1PZ9A 3NV4A 4LBOA 1U5IA 3B02A 5AVPA 4W6WA 4X6RB 1CX4A 1QQP2 3UGFA 4J1XA 2LALA 2JG9B 4TSVA 2ERFA 3IAPA 3L2HA 1BVVA 4I02A 1FPN1 3KT7A 5B4XA 1XNKA 3DEMA 1ZZ7A 1KS4A 2YPJA 3D0JA 3V0AA 4QQOA 3WNOA 4BQ5A 3CJIB 1NY71 3MW3A 2WZ8A 3TN91 1W04A 2VCCA 4G4FA 3I2KA 4I0AA 2QZ3A 2B42B 2YZ4A 4KU7A 3HQUA 2JD4A 4JTOA 1JW6A 1HB2A 4D0QA 4JAAA 4QXHA 1RMU1 4LJHA 3WY6A 1PMHX 4Y1YA 3J9SA 1XC6A 3OEAA 3CHXA 4IESA 3SKVA 4XZPA 3VHRA 1XBFA 4JGYC 3SEEA 3NNJA 1QKQA 4LBMA 4Y22A 1YQ6A 2VMIA 3M3IA 3NJVA 4MGSA 4MGYE 1RUC3 5EJZB 4LO7A 1FMD2 1UL9A 3KVAA 2Q4SA 2XBO3 3OJBA 4NHXA 2A73B 5ANQA 4AOCA 2WFF1 1UYYA 4XEZA 1W0NA 5K7PA 4CDXA 2DUQA 3HQRA 3WT3A 1N3OA 4ZHNA 1JMUB 1RVF1 2D3RA 1DQ5A 1DCSA 3SHRA 3VL9A 1UPSA 5GZEA 2Q5TA 3LOIA 4QQHA 4A7ZA 4IE4A 5T5OA 4COYA 1S2KA 2CY6A 3PU3A 3U14A 3O0VA 5CADA 4JQRA 1WMEA 2HKXA 1X36A 3IPVA 4QU2A 4P9GA 2YC4A 1PO21 3MO4A 2VUAA 3NMBA 4X8PA 4XTPA 1F15A 1ULOA 5ABJC 1V0AA 2IXKA 3IDAA 1BBT1 4XE9A 3ZFEB 4B7EA 4UBHA 3T0DA 3SQOA 1XSRA 2Y6JA 2Q1MA 1S0JA 1YO8A 1IZ3A 5FYIA 1SLBA 1JUIA 1W3VA 2PELA 3M2MA 5C8WA 3J8F1 1RUF1 4RR3C 1AR62 4JC1A 3U4SA 4B7KA 4Y5Z0 1RL3A 5FO7B 1UX6A 1W8ZA 1X8EA 3ZR6A 4A2UA 4NIIA 4LBQB 2B7YA 2OZJA 2QQWA 1O4ZA 1JS9A 2JG9C 2PLV3 3WUDA 1HRV3 4QPGC 4OUMA 2BRTA 2QBXA 1FNZA 2JICA 5DAPA 4IEQA 2WNUA 3WF3A 5B2GB 1KQRA 4I09A 1LJ7A 4JGYA 3GGLA 3W20A 1W8OA 2SLIA 4CP0A 3POYA 3BALA 2TEPA 3V0BA 4F3JA 1LOGA 2HWF3 5LRSA 3MUZ1 4E9KA 4UW5A 5FZ0A 1JHJA 1ODMA 2WQ4A 5JMCA 1OHFA 4ZY9A 1YXWA 2JDZA 4YFWA 2XVGA 3S7EA 4XMAA 2HWC2 2RDRA 2XL7A 4EZHA 1NQDA 1EY2A 4Q0PA 1MVEA 1UOBA 2BDRA 1O8SA 1NCQB 1WLCA 4FPJA 1O7FA 2C5DA 3ZIXA 2W1UA 2BBVA 4DPNA 2WFPA 1ZBE2 2D6PA 4Y3OA 3RJRA 3JB8A 3WDUA 5GLZA 4BQXA 4XJUA 2CAUA 1VE0A 3ZLIA 5JSRA 2JDHA 2RS53 3OYWB 1CAUA 4JCKA 3WD5A 4XFGA 5DUVA 1V70A 2BOJA 3BTAA 2DFCA 2RM22 2ZGOA 3HBKA 3J7LA 1FAYA 3O0XA 1C3HA 1BEV1 1Z7S2 4FPYA 3SXWA 1LHUA 5HXVA 3BTXA 3FBYA 5EV7A 4KG0A 4CXWA 1S0EA 4CU8A 1ENRA 1SPPB 3HN1A 2VM9A 1HB3A 1QJU3 4XF1A 4RR3A 4MADA 2DVGA 4OQ8A 2KD7A 3LSDA 1OVSA 4B1MA 3N4MA 4BQ2A 1H1IA 3KQRA 3BKZA 4OMDA 3PVNA 5D1IA 3GZUC 1O5LA 4QPGA 4AWDA 5CKMA 3ZFEC 1KS5A 5JLVA 4P14A 4DQAA 2Y6KA 1O3RA 3LDKA 1QJZA 1LHVA 2W46A 2R071 2VUCA 5F3IA 3KV4A 3B9CA 1J1TA 1POV1 3RRDA 3ZXGA 3QH6A 2ZX2A 4O65A 4NAOA 5I8SA 1TG7A 4LPLA 4UW4A 3E5UA 3FUOA 2A3YA 3N3HA 5FY7A 1QJX1 2WSVA 2CDOA 1DZQA 3I2JA 4ITCA 2IZWA 1GANA 5FYYA 5FZMA 1VMJA 4WVMB 2VZVA 4CCOA 4XUNA 1S55A 1VPHA 2RS31 5HCAA 4W4ZA 2QUOA 2W95A 2WJSA 2XOMA 1EUUA 1JTZX 3U10A 3HPNA 5KXDA 1MS4A 3KHCA 1PVC1 2CSGA 3GZAA 2R1DA 4FQZA 4QQLA 1FPN2 1MS3A 2OT7A 4HLTA 3U37A 3EJKA 1TNFA 5FFOC 2CHHA 2XJSA 1OA2A 3N9OA 3IBMA 3NWKA 4GWMA 4HMZA 4Q4X1 4QB6A 4QXKA 4N7IA 2IXHA 4LBLA 3H3LA 2WINB 1NCQC 2DCKA 4UFMA 5CKQA 1TME2 1ZM1A 1S0BA 5FXZA 1ND3B 2VW2A 4H7MA 1RMU2 5DQ0A 4F8AA 2RS11 2OS2A 1HX6A 4AGVA 3U0ZA 1RVF3 2Z2SB 3IMMA 4KWUA 2K46A 4XIKA 2JDNA 4Y5SA 1ZBA2 5IYYA 3VBSB 3D4KA 3MV11 3SH5A 2BTVC 2ZZJA 4JDNA 4CE8A 2JD9A 4S2DA 2JG8B 1HXS2 2BNMA 5CKNA 2RR11 2FDJA 1TQ5A 3AMNA 2O8QA 2V09A 4QT6A 4AVTA 4K6BA 5DZGA 1UZVA 1XYOA 3C2UA 3KV6A 5LZ6A 3O1VA 1VBA1 2NMNA 2VR4A 3IN9A 2GALA 3DYMA 4IV3B 4CEYB 2ILMA 3PNAA 4R4ZA 4WVVA 1JZ2A 2W47A 1RUF3 3J8F3 5DZEA 3LIGA 4YARA 1E5SA 1JXNA 1PO22 1RUD2 2ZEXA 3BODA 4P9IA 1GZTA 2ARBA 3R4DB 4UYBA 4W6XA 4DRVA 5BNQA 1YQ5A 4AGRA 2RDQA 1EYBA 3O1OA 2ZEZA 4RHV2 2G1MA 1US2A 3O12A 4LHSA 3AVRA 5A3UA 4AI2A 4NRPA 4E4ZA 3POEA 1J3PA 3K48A 3RGBA 1GNZA 2GC1A 4RD7A 2O14A 4Q0SA 5BNNB 1D0HA 1ODNA 1NCQA 2DU1A 2A7AA 4Q4Y3 2IC1A 1UW8A 3RJ2X 2UWAA 4N90A 2GC3A 3ST7A 5J09A 3UJQA 1H2KA 3AX4A 3U4XA 3AZZA 4EN7B 2D97A 5JOZA 3OUHA 3OYWA 1RHI3 2HWB2 2VOKA 3EQEA 5F3EA 4AHXA 5FIXA 1VAKA 5A3TA 2PHXA 3RWKX 5EJ3A 3NV1A 3T0BA 1BXHA 2VW1A 4HG6B 5FYHA 1F5JA 4FTSA 1FT9A 2VZTA 3R4SA 4Q0VA 2O8OA 5FKCA 1MS5A 4QDRA 1SPPA 5DN2A 3VBHB 2A71A 1GNYA 2LW8A 3AKTA 1TMF1 2NP0A 1DQ2A 1RUG1 1ZZ8A 2E7QA 2RDNA 2VQAA 1AXZA 4FVVA 2R041 2VECA 4FQ4A 3ZXAC 4XXPA 3GZTB 4OUEA 2J22A 3BIWE 4D8MA 1QMJA 3WP6A 1PGW1 4FOQA 1DZRA 1XNCA 2QKDA 3VBSC 4I3GA 5FZ7A 3LGRA 3OUJA 4LBJA 1NZCA 4PQQA 4XUOA 2VU9A 3U11A 2JG8C 5FWEA 1OFNA 4MGTA 4N53B 5FZ4A 3SISA 3RYRA 2YFUA 3M3CA 4QPIB 2F4PA 5SV8A 2OYZA 1OLME 1BEV2 3PVEA 1WLTA 3R0RA 1I5ZA 3B3QE 3H1MA 3LA7A 2XVLA 1UPIA 2ZPXA 1A78A 2TNFA 4IV3C 5F37A 4CEYC 4LA3A 4GZ9A 1RUOA 1VR3A 1SCSA 1POV3 2VOWA 4B3NA 3QD6A 3WG4A 1VBB3 4WVMA 4MSVA 4CTEA 2MEV2 4HKOA 3FJSA 3QOPA 4GKYA 4FOWA 4CEWB 2VCBA 4ZPIA 2ZCWA 3H8UA 3PUHA 4EN0A 1YFYA 1WCQA 1V9U2 2R16A 2VTXJ 5E1RA 5H9QA 3O1PA 4LBQA 1QJFA 2ZHMA 2JECA 4KH9A 4NPMA 5E89A 2VAUA 3GCXA 1PVC3 2IWGB 1EV11 4LOSA 3N9LA 1XRUA 4AVBA 4ISRA 2FHRA 1N47A 4ZZ5A 2HWE3 4LA2A 1R64A 2V4VA 4Q0UA 3RMXA 5FY5A 4DUVA 1K5MA 1OBNA 5A32B 4EWAA 3AZWA 4Q4X3 1W6QA 3VD4A 4HSJA 4YG0A 2C0ZA 2RS32 2GNDA 4RGAA 2GH8A 4XXAA 2ZTNA 3WW2A 2ZX1A 1UKRA 5FUIA 2H0BA 2DU0A 1UXXX 1X33A 2RS13 3D0SA 4Q4W3 2ZAAA 3MW2A 2W2IA 2JG8A 5FBJA 5A7SA 4PF1A 2LM3A 2PHTA 3QLQA 3G6JB 4Y20B 2WZR1 4XFIA 3VBHC 1ZRDA 4XJ9A 2WN3A 4ES8A 4YM1A 5K0UA 4CVUA 2CGPA 3I2DA 1GV9A 5FKBA 4HZFA 4E2SA 1JBCA 1G7YA 5G05L 2PAEA 4A44A 1JH5A 1VRH1 1W2OA 1X8MA 2OPKA 4YZ4A 4IV3A 4CCJA 4CEYA 2P3IA 3OBAA 1WKYA 3B5LB 2QDNA 2E26A 2VJXA 3N35A 4KBZA 1BZWA 1RGSA 3BTZA 2ZGPA 5K8SA 1UYXA 4JKMA 2E6VA 1KFXL 4N53C 5A7NA 3BGAA 3ZIWA 3LE0A 4N9HA 1LTEA 3VLBB 2WUHA 1VBC3 4OFGA 1HN0A 1PM7A 3T1LA 2WQZC 3EO6A 1LGNA 5FZ9A 2F17A 3LA2A 4F83A 1CVNA 2OXBA 1QOOA 4MGKE 3RZZA 1E5RA 5A70A 1VBA2 3NAPB 2XUMA 1Y3TA 2QQOA 3AKRA 1NKGA 1SHWB 2GNTA 3DUIA 3VKOA 2ZGKA 1WCUA 4M01A 1HDKA 2VNOA 4CEWC 4XBQA 1PX3A 2BOIA 2BZDA 2VMGA 1JOPA 2ZGMA 4LKFA 4MGIE 1QH7A 1R092 3J4UH 1VBE3 4LE4A 3FBMA 2C24A 1EAH3 3WNMA 5FREA 4BH9A 1JN2P 2PTMA 5F2WA 3NKTA 1UXZA 1H1AA 3VBHA 3VBRA 4AI9A 3T4HB 4UFIA 5FZLA 1SG3A 5H9SA 1OVPA 3DKWA 2WWSA 4TYSA 4D3WA 1T2XA 5EZWA 3WP4A 1JYNA 2VNGA 5FYBA 4PF5A 1CZSA 2VO5A 3INAA 2XKOA 2YG0A 3VKNA 2PHUA 3RYKA 2BWAA 1TMF3 2P6CA 1Y9QA 3EBRA 2HEWF 4WM8B 1LNSA 2W87A 5H9RA 3GDBA 4L11A 1SBDA 4N53A 4AEDB 5ACA3 2A75A 4N7UA 1ZREA 4IEYA 1AL0G 4BOWA 2W5FA 1A34A 4MUVA 2VCMA 1J84A 1PK6B 1DYPA 1WD4A 2HBTA 2WNOA 3HNYM 1C28A 2GMMA 2WZEA 3P5BA 4BM8A 3S7IA 3PU8A 2D43A 1OOPB 2ZXQA 3CNAA 3H7YA 1NA1B 1BMV2 3LEMA 2FCTA 3WXPA 2Y6FA 5KHIA 4LBKA 5FXXA 5E16A 1PGW2 4CEWA 4GULA 2P37A 2YC2A 4LQRA 1SBEA 5CBLA 2L9LA 4XABA 5CYYA 4XTMA 2PHFA 3LZZA 1NUKA 1XNTA 3O1SA 4XHXA 3MUY1 1OURA 3D3AA 3NAPC 3IIAA 1XYNA 2FZ2A 2BP6A 1BK1A 4TLFA 2JDYA 3V65A 1NAEA 4Z2AA 3MYXA 1GKBA 2EICA 2ORXA 4KGQA 3CF6E 4MXWA 2WT0A 3IMNA 1W6OA 1E5HA 2ZEYA 3WSOA 3NV2A 3QCWA 3U07A 1IPJA 1WBLA 3QACA 3TYJA 5IFTA 5FMOL 4BPZA 1HRI1 2XL9A 3M3QA 4FPLA 4L97A 4L99A 3ACGA 5FDBA 2OZ6A 1MQTA 4SBVA 2VTXA 4YZ1A 4FPKA 3WP3A 3K3OA 2TBVA 2DTWA 2QQVA 4K20A 2VXJA 2D5FA 4Y20A 4JTNA 5FYZA 2OKXA 4Q4V1 5L9RA 3FMGA 1AR92 1W8UA 1NLRA 4AEJA 1LOFC 5DUUA 5IAVA 1PM4A 2UU8A 1J58A 2ORZA 4NHKA 4LO8A 3RZMA 5FUNA 2IFWA 1H2MA 4ZKTB 1W2NA 4AEDC 4LHKA 2WNVB 3NQHA 3MIHA 1DGRN 4OHWA 5C4WC 3CMGA 1LEMA 2B5HA 2D40A 1JYWA 4SLIA 2FDHA 2WZR2 4C90A 1BKZA 1QOSA 5FZBA 4A3XA 2BWCA 1N1YA 4Y4RA 5JPMB 1OOPC 2D3SA 1JHNA 3HT1A 4QGMA 3ILRA 1DFQA 3NAPA 3IB3A 2ZGUA 3J7HA 4IEXA 5T5LA 4AFDA 1PNFA 1AR71 4HSLA 5A3LA 3I49A 4FAHA 1Q8OA 1RUI3 4D6RA 5EXOA 5IJRA 3HJRA 2ES3A 5A7WB 3O1TA 5F5QA 1I6XA 3F95A 3ORJA 4IDZA 1QU0A 1UX7A 4UW3A 5JIAA 1O8PA 2YYOA 4HPKA 4EWEA 5M0TA 1WW6A 3E1F1 2B8MA 2WABA 1URXA 2W0XA 4OHVA 2XDVA 4QX8A 2RMU2 3OBZA 4JV4A 3VZLA 4AE2A 4TXWA 3W5NA 3AP7A 1R1A3 4H7LA 1L7LA 4Q1RA 2J1UA 1UO9A 2WT1A 4NPLA 3AZXA 3OD4A 3E6DA 1MZEA 4R4XA 3O1MA 1CAXA 2AGSA 1LOFA 2F4LA 4CDWB 5LK7B 1JZ8A 4FPCA 1X50A 2Y6HA 3THDA 1C4RA 4NN0A 2VG9A 1A8DA 3T09A 5HV4A 4IEPA 2IUWA 4QGNA 1BQPA 2DTYA 2XHNA 4IGPA 5FPZA 4QX1A 3LD8A 3LSEA 1FYUA 4AEDA 1Z78A 2ZZQA 1ZZBA 1YIFA 3MLKA 2JKBA 1BVP1 1RUE1 5C4WA 2QZ2A 3H1YA 3CJXA 3ZYFA 3POJA 2DF7A 4L0PA 1UU6A 3ZXJA 5I93A 5KHGA 2VMDA 3TWIA 1OOPA 5FZHA 1S1AA 2XXZA 2LTNA 4AQ6A 2C9AA 2R061 4N43B 4LORA 3AFKA 4CXXA 3IT8A 1LB2A 2ET7A 5CFCB 5CIRA 4QKNA 3Q8FA 4LK6A 3A22A 1GZ9A 2QQPA 1JU3A 1H30A 3ZO0B 3FL7A 2FDGA 1HRV1 1Y4WA 5EQUA 1HJGA 1VAVA 5LWBA 3CBNA 3LEKA 2Q8DA 5BNPB 1GWMA 4CUBA 2ID4A 2C9KA 2W92A 2WLPA 3AL5A 1X9TA 4I30A 4I0WB 3U1XA 5FYUA 4NHMA 4IERA 5FPVA 4EE2A 3BYWA 3ECQA 3GBWA 3WNKA 5D2AA 4COZA 1JODA 2P34A 4UOJA 1W8NA 5IK8A 3HQXA 1YQ2A 4NAMA 1D4M1 2KR2A 4XBNA 4EZ4A 4Y1VA 1GR3A 4LIVA 5AFEA 2DBIA 3GM8A 1CN1A 3H7JA 1YIPA 2ZGTA 3ACLA 3PVBB 1MS1A 4M0NA 3U75A 1RYYA 1NXD1 1HRI3 2VULA 4H2AA 2JJ6A 2RS51 4O9GA 4YVWB 1GUIA 2E32A 1FATA 5E8AA 3ETPA 5JXGA 4CDWC 2ARCA 1AL21 3AP9A 3LQCA 1WLWA 3FLRA 4XILA 3HEIA 4Q4V3 4AL9A 4BLIA 4HOOA 3MF6A 4AFMA 2ZKNA 1CR7A 2HWD2 1ACCA 2ZMLA 5FAXA 2FCUA 2G9FA 1QJU1 2Q1ZB 2VBPA 3E6BA 4META 5KBFA 4YW5A 5AC91 4A45A 3SCFA 2IVIB 3LFIA 5FZEA 4BWOA 5JXHA 3BU0A 3ZSJA 2AREA 3A4UA 3DKQA 4R9DA 4NRQA 4KU8A 4AFBA 3CZJA 2W94A 1DGLA 1JYVA 5CA6A 3LA3A 1R081 3DPRB 5EPAA 3W58A 3KF5A 2UWCA 3N7LA 4CDUB 4R52A 4N43C 3M7AA 4NIHA 4KGGA 2PAMA 3A21A 4GB32 3I2HA 1GWKA 4B4QA 2NN8A 2E7TA 4QX3A 4P00B 5A7WA 3WNNA 5CFCC 1OH3A 1QQP3 1W8HA 2VC9A 3RG0A 2XLFA 3NV3A 1YC61 5C8CB 3Q9OA 4H3WA 4CCDA 4CA9A 1AR73 2UURA 1DP0A 4YZ2A 5BNPC 2JEMA 4M3CE 4XJAA 2HBUA 2XLAA 1JZ6A 1C5IA 4DRRA 4UF0A 4AVCA 3ACHA 2KXLA 1XE7A 2IXCA 2Y0OA 3Q8AA 3C7FA 4RA0A 5FBZA 2P3YA 2NPIA 2ZHLA 5BNOB 3ZSMA 1GBGA 2CU5A 2R32A 2GSYA 2XONA 2A5ZA 4IXLA 4CDWA 5LA9A 5SV5A 5I91A 1RUH3 1YEWA 4MHUA 4JVAA 2ZMKA 3JQXA 3LF7A 5FCCA 4S2GA 1GQHA 3RVHA 5C9AB 4W65A 5FOJB 4QQPA 2O0OA 1NXMA 3FUQA 3R05A 3VKFC 4LMFA 2EXJA 2VW0A 3I59B 4XACA 4YFZA 3OCPA 4QD2A 1RUC2 3IM0A 4XQDA 5A3OA 2XBO2 3ZMOA 1YLLA 2WNEA 3E6CC 3MEPA 1RUE3 1TZOA 1H2LA 2VCAA 4N43A 4YZ3A 5FLHA 3SH3A 1XE8A 4IQPA 2XJUA 2D6LX 2WS92 4F7ZA 4KWKA 4HBNA 4AI0A 2CGOA 2D3PA 4LUMA 3A23A 1FNYA 1LU1A 2YFZA 3RZGA 1YQCA 3ACFA 3MFAA 3CEWA 2R063 1ULFA 5FLIA 3M1HA 5BNPA 3I4IA 4XIOA 1U5YA 4OQ9A 5GZCA 1AR83 2A1XA 3DPRC 5FPBA 4AK3A 2XUEA 1T6GC 4CDUC 3VBUB 3WEZA 4YYOA 2VZOA 3CZUA 1SLLA 1V6IA 2QQLA 5LW9A 1MZ6A 2JX9A 2ZS6B 3CDZB 2BGOA 1BJQA 1XNBA 3D8CA 3CJIC 1XXNA 3ZMNA 4AYUA 4NR1A 3HT2A 5C8CC 4AXOA 5EHDA 3BI3A 1OC1A 1YHFA 1HIXA 3KWVA 4Q4Y1 3S30A 4AZZA 1AX2A 4AHYA 4AI3A 1FXZA 1W6PB 3K4DA 2VXRA 5IWFA 3IIIA 2VPVA 3MLJA 3NW4A 2BERA 1A8MA 2PLV2 3OGVA 4A42A 1YFUA 4GXLA 1D4M3 3PMEA 4ZU5A 3VD9A 1VMHA 3E97A 5BNOC 1RHI1 4COUA 2YU1A 4IGOA 1W6NA 1KGYA 1KJRA 3UESA 3EMRA 3ZKUA 5JSPA 2HWF2 5LEJA 2OQ7A 4Y26A 1LGCA 2ADDA 1PO11 2XJRA 5I0TA 1PZ8A 2OIIA 4HK9A 5ABJA 3CQOA 4OZOA 5CVRA 5C9AC 1ZBE3 1AL23 3EB7A 5CFDB 1UY4A 1RINA 2CAVA 4UI9L 4XJZA 2CWMA 2AYHA 4YSFA 4DZGA 2I45A 4FAGA 1C8M3 5A7OA 1HW5A 3JBG1 1D0GA 1HB1A 1HQNA 1Z7S3 3OSDA 2DYCA 2Y60A 5AC93 3OEBA 4P9LA 5FMCA 3KMHA 1B35B 3HOBA 2DUOA 1O6UA 4CDUA 1UOFA 1U0AA 3WP5A 3UYJA 2JG9A 4FTBA 3LPGA 4ARXA 4Y1UA 2PHRA 3M3OA 1PMIA 3VL8A 1R083 5JXIA 3CJIA 5GLUA 5C3PA 3TEWA 3O1UA 4EROA 1D2SA 3A0KA 1DQ4A 1VBB1 2DBNA 2R0FA 3JZVA 5GALA 5KHHA 5C8CA 3AP4A 4X8NA 2Q8CA 3I3DA 4P02B 5EYYA 2DVAA 4QB1A 4FXKB 3BN6A 2AACA 2C1FA 3TEXA 3UGHA 4NPRA 3NJYA 4RSUA 4XDQA 2K0GA 4MH0E 3VBUC 4CSWA 2W08A 3WINE 1N1TA 1SLCA 4YWAA 1FV2A 2DV9A 3UL2A 5BNOA 1JZ5A 1YJKA 2ZHNA 2DUPA 4IGQA 4YLZA 5A3NA 1HN1A 2GP3A 2VL4A 1US3A 1N3QA 2DURA 4UAPA 4XDOA 1K3IA 1GWLA 1BHGA 1KXGA 2HWE1 4K8FA 5A33B 2UY9A 2DFBA 3WDWA 1NY72 3BOPA 3VDDB 3TN92 4XUQA 5KWRA 1R1ZA 5C9AA 3L2YA 1H9PA 1COV3 4Q26A 5L7OB 3VZJA 5B4NA 1MACA 3LEGA 4QX0A 5K9YA 1ULCA 3HVDA 2BJSA 5FYSA 5FYMA 4MYEA 2UYAA 4Q4W1 3S57A 2Y0IA 3MLLA 4CPBD 2YHJA 3NRUA 1W8TA 5FZKA 3MFCA 4PLOA 1OQ1A 4DXSA 3DL3A 5CU1A 4QU1A 3ZFEA 5KHKA 2WFF2 4CRQA 3NSTA 1CX1A 2ENRA 4OLLA 1SDWA 1ZBA3 1S0CA 1NX9A 1HQLA 1W06A 1UZWA 1W3XA 3ABZA 3FLTA 1RVF2 2CWSA 2LROA 3MIDA 4S2HA 5FY9A 4ZONA 3OGSA 1WD3A 4O7XA 3OF1A 1HXS3 5FZIA 5FMBA 4QHOA 4XDPA 2EIGA 1PIV1 3T2OA 4O9EA 1V6KA 4S2FA 3VBUA 4XVHA 4JKKA 3ZN5A 1GZWB 1NG0A 1VBC1 2B9UA 4XC9A 3SC7X 4V2WA 3EYPA 1ZYBA 5HXMA 4CDQB 1OT5A 3TNQA 4GJYA 4BXSV 1JU4A 2WT2A 2X53S 1BBT2 5FMOS 2ATFA 3B00A 3ZSKA 1IPKA 4C1XA 1RUD3 2A6XA 5A6YA 4HN1A 1LOCA 2GC2A 5F8PA 4IL7A 2X10A 4MXVA 3OGGA 3J8F2 1RUF2 4P5YA 4AHWA 4RHV3 4LK7A 4FTEA 1LEDA 5FQ0B 2VQUA 1AYN1 2QQIA 4Z8BA 1VBE1 1UN1A 4DIQA 5HCHA 1EAH1 2Z79A 1E5IA 5FY0A 4QPWA 1QOTA 3T3YA 2EIDA 1HV1A 3MHZA 5A3WA 1P8JA 4AQSA 3MICA 1UZYA 4HANA 1DYKA 3SNMA 4FO9A 2R6QA 3HAGA 4IV1B 5DG1A 3K51A 3J7MA 1W2UA 1DDLA 2RHPA 4EV0A 5F39A 1S0GA 4OCTA 1PO13 4GWIA 3DXTA 1GZCA 2VMHA 2DWRA 4XUPA 2ET1A 1ND3C 4L9BA 3WV6A 1PNGA 3FHQA 4MZUA 5IT6A 4P9WA 1OPMA 3MDPA 1F35A 1POQA 2WSUA 5BY5A 1RHI2 2IXLA 5ACA1 3AJYA 1DG6A 1WGPA 3N9QA 2VZ3A 4IEOA 4E4HA 2W1WA 2E53A 2QTWB 3ACIA 2PHDA 5DXDA 1SMVA 5FK8A 1XPWA 2SBAA 4QKFA 4IE5A 3JBG3 3UKVA 5A6XA 3RFRA 3ILNA 4Y5TA 1QIQA 5D21A 4Z2WA 4E2QA 4UFJA 2EAAA 4Y24A 2CDPA 3I2GA 1UMZA 4ARYA 5FO9B 1F4AA 2WYSA 2DVBA 1A6CA 3LEIA 1JYIA 4YM0A 3AMPA 3E5XA 4LOTA 1LODA 5CEHA 2YUEA 2BVBA 2Q0AA 1D4VB 1N1VA 2HYKA 3ZFFB 3MI8A 1WLDA 4BDVB 5FXWA 1RXGA 1UYZA 2ZA9A 3MBWA 4RFT0 4BA6A 3PURA 2XR4A 4AAPA 5DUXA 2BW8A 1RJ8A 1DLLA 1V6MA 4NO4A 4CDQC 1XJAA 1JZ7A 1NLQA 2J1VA 1AJOA 5J96B 5LCWL 5FZ6A 3SLIA 1BYHA 2C4XA 2R072 3C8XA 5I8TA 3RPQA 3K4ZA 4DEQA 3HNMA 1AXKA 1XNDA 1CQ9A 2WYFA 3AYAA 5A6QA 5BNNC 2V72A 2Y33A 4GAZA 1B09A 1F9KA 2QQUA 1QJX2 1W8FA 1OQEA 3T1MA 3ZFGB 4B4PA 1MS9A 1ND3A 4LT5A 3OGJA 1YI9A 2GN7A 1AYM3 3O1RA 4CCKA 1PZ7A 4FP3A 4NWVA 1H8VA 2JXAA 3FHIB 3DV8A 5BXXA 1I1EA 3PUAA 1MS0A 3PL0A 4AQ2A 5F32A 1PVC2 2VOXA 1UMHA 4IV1C 3VBSA 3ASIA 2V5YA 3AVSA 2LRPA 5APAA 4A7KA 1BMV1 4DNYA 2HWE2 4PIYA 3HN3A 2OW4A 1QWRA 3H1WA 1CAWB 1XSQA 2VUJA 3NL1A 3FC0A 4Q4X2 1OA3A 3ZYJB 5FUPA 2DCTA 5T54A 1RUNA 4U2AA 1QGLA 1GICA 4QAWA 1F31A 2Y6GA 3A7QA 2D6MA 2RS12 3CU7A 4HXCA 4LKDA 4Q4W2 4CXYA 4ATEA 2Y26A 1RB8G 3OTFA 3UNPA 2BPA2 4NROA 3FLPA 4NIGA 4CDQA 1K12A 3MW4A 1DQ0A 4YG6A 1PIV3 1AVBA 2EF6A 4GIQA 4QPIC 1FV3A 1W6MB 3I3QA 5J98B 4JHZA 2RR12 1RUI1 4NIDA 5EJ1B 3Q8CA 3M8LA 3W9AA 5J3UA 3ZFFC 1OQDA 4P9XA 1RC6A 4BISA 5BNNA 1GYKA 2FQPA 2XMLA 2ZGQA 5FQ0A 3DYPA 4YVSB 3GJBA 2Z69A 5IK5A 4PDWB 1MZFA 5ERLA 1H6YA 1I3HA 1QJY3 2HEYF 4QHZA 1MEC1 1IGOA 3LWCA 1ZRFA 3RI9A 1R1A1 4QKBA 5F3CA 3H3ZA 1AYN3 1V6LA 3AZVA 3B9IA 5JPNB 4YRDA 3HNBM 3N9PA 4IV1A 4EWDA 5A1LA 4A7YA 3VZOA 5FPLA 3AYEA 3TNPB 4OHYA 3TAYA 4QXCA 4AFCA 2PN5A 4NIAA 1FOD3 2JDPA 5DG2A 4XFHA 1J1LA 4JZRA 1TE1B 3S0MA 2JB8A 4PIZA 3AYDA 2ZJCA 2BEOA 3S5AA 1AZDA 4CZSA 1IG3A 5ANNA 4BXFA 5JSOA 4HKLA 2RV9A 2RJKA 4AF9A 4ZZ8A 3OOXA 3KV9A 3HIFA 2W68A 2PA7A 4EQVA 3IDEA 4QPIA 4DO0A 4RS5B 3NJXA 5EYXA 1ASJ1 3ES1A 1EPWA 3MV01 4PI2A 3IKWA 4JGZB 3LDRA 4ONUA 2E51A 1REFA 1RUJ3 3C7EA 1W0OA 3I7DA 4GKXA 4IEWA 1TMF2 3OD0A 1RUG2 1W9YA 4FFIA 4IEVA 3WDYA 3WHTA 3ZFFA 3VDAA 3MIEA 2R042 5F5AA 5ACA2 2WBKA 1LKNA 3JD71 4A6OA 4ATFA 2WAOA 2BVVA 4HKWA 1IKPA 2UY8A 4PJYA 5FWJA 2G9GA 4B4RA 1NE4A 3KCYA 3KS7A 1XOYA 3JB4C 5FP7A 3K77A 4XURA 4MX3A 3NKGA 4BU2A 4KWLA 5JOYA 2TUNA 3O7OA 1W9WA 4QDQA 3U78A 5C3RA 1W03A 1FI2A 3RZKA 2HLEA 4EN6B 3L9JT 3GBGA 3MIFA 2VVEA 4NMIA 4AI1A 5FTTC 1O4TA 1MVQA 4ISQA 4QQ2A 5A32A 5C5UA 4Q1PA 1UIJA 1OH4A 1K5JA 1JI6A 1OF3A 2NZ9A 2IVJA 2QQKA 1KFUL 4LNVA 4BQWA 2VZ1A 3H0OA 1ND2B 2D93A 2I2SA 2VZSA 2ZGNA 4BE3A 3UJOA 2ZABA 4XAAA 1IS6A 3AFGA 5JZGB 2GAUA 4LXLA 2XVKA 4ZS2A 4JDOA 4XF9A 1OXCA 3RNSA 5LA1A 1CAWA 1W9TA 3LKJA 5CAZA 2VMFA 3I3MA 1EV12 1UY0A 3WR0A 4K21A 4DUXA 4CUGA 4C91A 1DGRA 1M06G 1NLSA 4KG8A 5AFBA 4XW3A 2F6BA 3C7HA 1RTVA 2X05A 1W90A 1ZNPA 4WM8C 1G6NA 1WCSA 5BPXA 3VBOB 4XF4A 1ZRCA 4LHNA 1REEA 2EIBA 5JDBA 3WVJA 4RS5C 3UKTA 3CKHA 1PK6C 2W9XA 4JGZC 2GU9A 4JQTA 4YGCA 5F5CA 2VMCA 1UQXA 3VHNA 3GJAA 5LATA 1RJ7A 1QQP1 3IDCB 1NA1C 5GZGA 1BLZA 2GDFA 3BVCA 1VRH2 2XHKA 4K7JA 4L8QA 5FP8A 4PBOA 4DXTA 3VDBA 5FZDA 1LULA 2JIJA 5I8YA 3W59A 2B9VA 2IXIA 5FZ3A 4PLMA 4BQYA 5I0SA 4M3CB 1ZZ9A 2VZQA 5DDJ3 3NVCA 3HD8B 3B94A 3CIHA 1G9DA 1SLTA 5E88A 1MEC3 5BYNA 4GH4B 3KQ4B 1ULPA 4DY5A 1RUI2 1RUH1 2VQTA 4JX0A 2NQYA 2RMU3 1H8TB 2HJIA 2VNVA 3KB5A 3Q8EA 4ZXKA 3VN4A 3WQBA 1KJLA 4GQ7A 4MV2A 1W0PA 1FMD1 3USSA 1O4YA 4AFAA 3WF0A 4D7TA 2XJQA 3V0AB 3T2QA 3UKNA 3VZKA 1ND2C 4XF3A 3GHNA 3GXUA 5JVVA 3ZVXA 5JZGC 4MLOA 2VVFA 2E33A 1LHWA 1GOGA 1BK0A 4WM8A 2HEVF 3ZN6B 4B1LA 4BQ1A 5BV6A 5CZKA 2W3JA 2WO2A 2ZX4A 1DHKB 1AHSA 2FZ1A 2J1AA 3H9AA 3OUIA 1QXRA 5FJKA 5FP9A 2W1QA 3MGUA 4RS5A 4W8JA 3T0AA 4FPFA 5BUVA 1X7NA 1PK6A 2FDFA 4JGZA 1PVXA 5E6HA 3OB8A 3LB9A 4YPJA 4BIOA 3I54A 4J25A 5CNAA 4BB3A 3AP5A 5L36A 1OKOA 4Y22B 2ZX3A 3W5MA 5HCBA 1NA1A 5IK7A 5EP9A 1VBD3 1ASJ3 2P3JA 1HQWA 3VBOC 3PTRB 4E27A 2WNVC 2QCSB 4DS0A 1AR81 5F1RA 3BUCA 1GQPA 4NOTA 1MPXA 1H1MA 5J1XA 2R0HA 1AR61 2OVUA 1RIRA 2W91A 3AP6A 3ME2A 5FYCA 4AVSA 5JCTA 2VZRA 4HN0A 3JD73 3AMHA 1MZ5A 3CL1A 2BBAA 2CTVA 4R8HA 1O3SA 2MPFA 1OKQA 3T30A 1ZZCA 1STMA 3M3EA 1APNA 4E2GA 4M3CF 3J26N 4FSJA 3RZLA 2WWJA 3O0WA 1Q8SA 3P3NA 1O5UA 4D6QA 5IVBA 1LU2A 1YQ8A 3B93A 4OHZA 2HH9A 2J1EA 2H6CA 2ZX0A 1LESA 2Q30A 4HL0A 1LHOA 1SFNA 4ZU7A 2HWC1 4GH4C 2X5IB 3WNLA 1CIWA 3ILFA 3AC0A 3VDCA 3G7DA 5IHRA 2E9QA 5GKAC 2VBDA 4CCEA 5JUVA 1H8TC 4A6SA 1ZRIA 1LOEA 5F6KA 1G86A 4H14A 1ZBE1 4URAA 1UMIA 1CJDA 2Y8KA 3KZ4C 2WNUB 2P6HA 1H0BA 3ZR5A 4XFAA 1JYCA 1JOJA 4K1YA 4QX5A 4YW7A 3ZYBA 2RM21 3V0BB 2C6SA 1C8M1 3VBOA 1Z7S1 4QPYA 5JR2A 2XGXA 1WCDJ 2WNVA 1HRI2 5KXBA 3LAGA 1J3RA 4FOYA 4AGGA 2JIGA 3BPZA 1UAIA 3MPBA 1EPZA 3S5QA 1DGWX 3KF3A 4GD4A 2VTFA 2BYVE 1ENXA 4Q4V2 3AKPA 3WW3A 2FDIA 2E7AA 3HMYA 1SCRA 5DUWA 1E57A 5ISLA 4DUWA 5L73A 1NE6A 3DCQA 4PT6A 5LBEA 1UZZA 4I2OA 3APBA 3H50A 5CG8A 5J37A 1HB4A 4YGBA 1G9FA 1DQ6A 3PUQA 4GMP0 4XCAA 3POGA 1O3TA 3TEYA 5JMOA 2XJVA 2AEZA 4KI5M 2WA4A 3ZXKA 1TNRA 3KCXA 1IOAA 4CU9A 1QY4A 3K3NA 1C8NA 4LKSA 1GNHA 2BGCA 2J1TA 3LPFA 4RR3B 4GH4A 5T55A 1SDDB 5FZ1A 1XYPA 2WC2A 3WOGA 3SEPA 2AH2A 2R30A 5IUQA 4XETA 2GC0A 3FWEA 1H8TA 2MNGA 4FFHA 3SKJE 5I0RA 1V00A 5HBAA 1AJKA 4XPVA 3BOWA 4QPGB 3T4VA 4MGZE 2PXJA 3KM5A 1K42A 1AR72 3GNEA 3KVBA 1H6XA 4ET7A 1COV1 3OPWA 2Q8OA 3C7GA 1ULGA 4Y1XA 3I2OA 5I0UA 3WG2A 3I8TA 3PMSA 1SACA 1QEXA 2P17A 3D82A 4KL1A 3ZN6A 3RS6A 2X5IC 4WBBA 1OLQA 2OQ6A 4JKLA 2WA3A 1FMD3 4C8DA 4PLNA 1TME1 1U5ZA 4W6YA 5IVVA 2D44A 1F2NA 3WZ1A 4YVWC 2JE7A 3IAQA 4ASLA 1RUH2 5DAWA 5FY4A 3USUB 2WNUC 4FCAA 3RI8A 1K45A 3O14A 3BPSA 1GOFA 3RSJA 1OA4A 4LTAA 4LEJA 1QF3A 1ZBA1 3MIGA 3POBA 4BIFA 1ENQA 4AVAA 3ZXLA 3KLSA 3WCRA 4FPEA 4CUCA 5FY1A 1HXS1 3SCGA 4DY3A 1CD3G 5CFCA 4OHXA 2E31A 4BLJA 1H4HA 1UU4A 1O91A 3I97A 1ONAA 2WS93 4TTGA 2OX0A 4OI0A 3VZNA 5F6LB 5FYTA 1OUXA 4FPHA 3THPA 3ZYGA 1RUE2 4IW3A 5F3GA 1AR63 3GHMA 1JYTA 5A1AA 1QXJA 1UKGA 1RUD1 5T5JA 3KT4A 3C3VA 3THCA 1XQNA 2P1BA 1V6NA 2R062 3B01A 3GF6A 4X6QB 4YM2A 3ZXFA 3J7NA 3FHAA 4RHV1 4P9JA 2RJLA 3AKSA 1AR82 4Y33A 5KC5A 3M70A 3KHBA 2R49A 4UFLA 2X5IA 1HRV2 3WQ7A 4D94A 2EXKA 2DVFA 1DIWA 1LRHA 1YCIA 4RL7A 3LDBA 4YVWA 5FZAA 3ZXEA 5J36A 3WUCA 1Q8PA 3KCCA 3OY8B 1LOAA 1W9FA 2HWC3 3BU7A 4MHRA 3RDIA 4FFFA 1YJLA 3TEZA 1AXYA 4LKEA 4J1WA 5J48A 2WAAA 3I3EA 2HWB1 1QXPA 5JI7A 1LR5A 4DMIA 1YI7A 5DZFA 2D6OX 4FT8A 1LAJA 1D4M2 1OUSA 2ZMNA 4CU7A 5CISA 5JOXA 4QGLA 3JCIA 4E8DA 4MGQA 4YGEA 2W39A 2EAKA 4Q29A 3WDVA 4HK8A 2VY0A 2FMDA 5FLJA 2R7EB 1OFSA 1VAMA 2RM23 5DAQA 4M0HA 3VHPA 4BQ4A 1J3QA 4QM9A 3GYDA 1ZZ6A 2XWBB 2FDKA 2YBPA 4JDMA 2RS52 3DPRA 2B46X 2LUWA 5FXVA 4OYUA 1CGPA 4YW3A 5C3SA 2P5BA 4EJRA 1AL22 2VD7A 3E5QA 3AB0A 3ZYRA 5LEKA 2W1SA 1C8M2 1AUYA 1QJU2 2YC0A 3ZSLA 1LENA 4LULA 4CUAA 2FD8A 1FX5A 2EA7A 4TWTA 5AC92 2K2SA 3VHOA 3TRSB 4QHBA 3ELNA 1GOHA 2WO3A 4GJZA 2VE1A 1LHNA 5IAXA 3PVOA 3HWJA 3WQ0A 4R9CA 1CPMA 1DBNA 1ZA7A 1WBFA 1CONA 2WO7A 3ENRA 2MEV1 5T3NA 5LBFA 5C70A 1IKQA 4CCNA 1R082 4FOVA 1C1LA 3GBFA 1QHDA 5IFPA 3AJZA 1V9U1 5LK5A 2JENA 3POIA 4URTA 4HVQA 3WNXA 1W9SA 2XLGA 3D6EA 3PHMA 4Z07A 1OF4A 3ZDVA 5H9PA 3FZ3A 1DYOA 1AYM1 3RMYA 2XQXA 1FPN3 4EN8B 1S0DA 3RZJA 3UETA 3ZM8A 5FZOB 3AMMA 2WN2A 4Q5OA 1WW7A 3P3PA 3FFZA 4IE6A 3TN93 4QDSA 2ZAHA 3I59A 4XYXA 3WLUA 1G8WA 2QDRA 3WF2A 1SZBA 3USUA 4DXZA 4P08A 3R4UA 1N3PA 4CP2A 1TME3 1YUDA 4OI2A 4C0HA 1W28A 2BU9A 4RGGA 4P9YA 1RMU3 2Y6LA 4ZU4A 1COV2 2IXJA 2YV8A 4CCMA 5CFDC 2QNKA
chains in the Genus database with same CATH topology
4WVZA 1M4WA 1UU5A 2NM1A 1SFYA 4WZFA 4LBQD 1EP0A 4UW6A 1KD7A 3ETQA 4XJWA 2CL2A 4XQWA 4M00A 4XF0A 2WFF3 3AM2A 4LLOA 1K5MB 1B35C 4XQ4A 3VZMA 4JRLA 1W6QB 3D5OA 3OPZA 3IDBB 3NJZA 2BFUL 1NCRB 3AKQA 4LHLA 4CP1A 3ZPYA 4FXGB 3SMHA 1SLAA 1VB2A 2CV6A 4YW1A 2PHLA 1G9AA 2EXHA 3TB0A 1HLCA 2QJVA 1GQGA 4H55A 1PO23 1YWKA 3N36A 5GM0A 1W6PA 4Q27A 5K0UB 1ALYA 1QJY1 1IQAA 1BBT3 1QDOA 1UF2C 3LOBA 2QE3A 2GZWA 3PLQA 1CAVB 2PQQA 3OY8A 5CB7A 2A70A 4J6GA 4XFBA 2W52A 4GA9A 4OVEA 2XWJB 4XMIA 1R091 5L19A 3VGIA 2KM2A 5JR7B 4YGDA 2GMEA 2D5HA 3JUUA 1FOD1 3VDDC 3ZX7A 1AX1A 3WDXA 1Q56A 5CFDA 4Q4Y2 2MHFA 5L7OC 1LGBA 2AENA 2HWB3 4LLFA 2WZPP 3VV1A 1B35A 1DQ1A 1VIWB 4FBFA 1C5HA 2JE9A 2DCYA 3N7MA 5F9TA 2EVXA 1PO12 1YNAA 3WW4A 4AW7A 1RUJ1 5KXCA 1VJ2A 2I74A 1G9CA 4FPGA 1GFF2 2ZGRA 3RQ0A 3SITA 3VBRB 2AR6A 1IS5A 1K5MC 3MPPG 2OUJA 4HT1T 4QMAA 4XBLA 3JBG2 1BMV1 1BEV3 1NQJA 1NCRC 5GLWA 4IETA 1NYWA 2VH9A 3AZYA 2XG3A 2XJTA 5KC6A 4AQTA 2GNBA 2NYYA 1S0IA 2MEV3 1KITA 4LR4A 5A33A 1H9WA 5K0UC 2WL1A 1QNWA 3PTYA 3VDDA 1VBB2 3WG1A 1MR5A 1V9U3 4EN9B 5L7OA 2R073 1PHMA 2B39A 2GH2A 3KGZA 4DB5A 5KXEA 1ENSA 2P2KA 3ALQA 4YZ5A 3PJQA 1C1FA 3AXDA 1SQ4A 4IEZA 5D8AB 4OZXA 4FPOB 1WMDA 1OI6A 1QJX3 4Q8KA 3HR9A 1ZA4A 1UCXA 2ETEA 2RS33 1O3QA 3CO2A 1LOBA 3WCSA 1Q5OA 1AR91 1AYM2 4WVWA 1WW5A 1QH6A 3AYCA 3BCWA 5JWPA 1F8VA 1Q43A 3KT1A 4I01A 4Q2FA 1OD5A 4LE3A 4LO5B 3KGLA 3POWA 3ES4A 1YFXA 1J59A 4MXWB 4BCUA 2RE9A 4BYYA 1YYNA 3QH7A 3VKMA 4B29A 1W6OB 2CGNA 4GALA 1U12A 5FRAA 2YY1A 1NCRA 1DF0A 1GZWA 1DZTA 2PAKA 1D2QA 4LO6B 1AF9A 1VB4A 4N9IA 1POV0 1KRIA 1MQTB 4K1ZA 4KWJA 1S0FA 2Z5WA 3VBFB 4UXAA 3VBRC 1C57A 4D69A 4RQPB 4WV8A 2A6ZA 2FMYA 2NLRA 2XPJA 4C0BA 1XU2A 2D6NA 2X8KA 1Y43B 2RR13 1YRZA 5DDJ1 2DCJA 1CAVA 1PIV2 4XOGA 2P3KA 5LRRA 1VBA3 1VBC2 3T2TA 4AVVA 1ULDA 1TEIA 1V6OA 2A6WA 2VOVA 4BHPA 1CPNA 2RMU1 1PGL1 2AUYA 4ES9A 3HBZA 4E4SA 3FFQA 1R093 1Q8VA 4JRAA 3R6SA 3ZFGC 1SLIA 2WLQA 1QJY2 3LCPA 4NHLA 5D8AC 3FE5A 1AYN2 3CLPA 1VBE2 2YROA 1EAH2 4R9AA 3AXEA 5TSWA 1Q3EA 4DINB 5GJ6A 4UBGA 4HPKB 1VLNA 4V1PA 5A3MA 5C6CA 3B69A 3DN7A 5IK4A 2B45X 5CG9A 1FOD2 1HKDA 3WHUA 4XFCA 1VBD1 4K9SA 2XKPA 2H6BA 1UIKA 4WZCA 1WUVA 4HVRA 1OLRA 4OI4A 2FBEA 1CAXB 1U5XA 2AZ5A 4Q0QA 4B8EA 1CESA 2OUHA 2XH6A 2H0VA 1DU3D 3DGTA 1RUG3 1MQTC 3BB6A 4LUKA 2R043 3VBFC 2UWBA 4YW2A 4Y1ZA 1BCXA 1RUJ2 4INDA 4XFFA 4ORFA 4RQPC 5C4WB 1G9BA 5GZFA 2CYFA 3WX5A 1NOVA 3ZFGA 5C33A 4YVSC 4PDWC 3N7KA 2NMOA 3SCHA 2QVSB 4COWA 5D8AA 1W39A 2O1QA 4PQ9A 2YXSA 1OSGA 2ZKLA 5JIUA 3POSA 1LECA 2WKKA 4HVOA 4GMP1 3FX3A 2ZHKA 5GLVA 2BUKA 4HFSA 1ZVFA 4AHZA 1VALA 2D7FA 3IWZA 5JAXA 1WW4A 4NVPA 3VKLA 3ZXDA 1QNYA 3JQWA 1GSLA 5GLTA 1EV13 2HWD1 1AR93 4PBPA 2KA3A 4L92A 4Z1VA 2A6VA 3GALA 4DOUA 1VP6A 1IHMA 4KQ7A 4BMEA 4TZDA 4OI1A 1F5FA 1W6MA 2XJPA 3VBFA 4OUSA 3ATGA 3MIBA 1REDA 4XJ8A 3A0NA 4G9SB 4RQPA 1CJPA 4WM7B 3V56A 3UV9A 4C1WA 1WMFA 1N1SA 2VQ0A 4D7SA 2YMZA 4GB31 4AEMA 4YVSA 2WZR3 2BQPA 4PDWA 4R9BA 1KDKA 3AMQA 2ZOEB 3PJYA 1VRH3 2G4IA 1Q8QA 4Z92B 5T5PA 4QM8A 2IFRA 3TOJA 4K40A 4I0BA 1WA4A 4AI8A 2DVDA 5KHJA 3DF0A 3KD4A 4Z82A 3MF9A 3WW1A 3NO8A 4D7YA 1SEFA 2BNNA 3EHKA 2K9ZA 5DDJ2 4KBBA 1GLHA 3B7MA 1QDCA 1V6JA 5EFUA 1LCLA 4PIXA 3ZYIB 4DFSA 3ZN4A 4YG3A 4OULA 1MEC2 4YNIA 1S2BA 1R1A2 2XB6C 2GMPA 1XU1A 2QFEA 5AVAA 1WCKA 2ZACA 2V73A 4BMBA 2EALA 1PGL2 1Z0HA 3OBTA 1RUC1 1HV0A 5FO8B 3WQ1A 2XBO1 3SH4A 5JOWA 1ULEA 1X82A 2A3XA 2A3WA 4FP2A 2OA2A 3WDTA 4CYDA 2WS91 3N7JA 2Y38A 1PGSA 3THTA 4CDXB 2D6KA 1A3KA 5HCFA 5T52A 3X29B 3H3UA 4G3YC 4Y4YA 1MS8A 2CNAA 5JI9A 4YW4A 4WM7C 1VBD2 1OMIA 2WIIB 1ASJ2 1UD1A 3MZHA 2N7GA 3IPVB 3TBDA 2YGLA 3JU9A 4E4DX 1ZX5A 4BZ4A 3RWNA 1L3JA 3M4FA 3O5SA 3ZSEA 1JUHA 3JD72 2ZBJA 4NWWA 3URFA 1ND2A 2YGMA 2ARXA 2GN3A 2PLV1 4AG4A 1DGWA 5JZGA 2PFWA 3VUOA 2VNRA 5T50A 3KSCA 1AX0A 4GMP3 1H2NA 1I9RA 2HWF1 2X29A 2YDEA 4GWNA 4LBNA 1H4GA 2Z42A 1SBFA 4LO4B 4ASMB 2BFUS 4JGYB 4Q8LA 2EXIA 2ZGSA 1RITA 3S6PA 3ZDSA 2A6YA 4IEUA 3EXUA 5GZDA 2ZGLA 2GNMA 2E63A 4AEKA 3ZYPA 4L2NA 2HWD3 4K3UA 1OPOA 1ZRRA 4XHBA 2UYBA 3OBRA 5J7MA 1Y7BA 1IS3A 1YFWA 3RYPA 3V64A 1W6NB 4WM7A 3UK9A 4COVA 2BNOA 2PHWA 1IS4A 4PCRA 4U36A 2I07B 3ROUA 4P5HA 1CAUB 2R1BA 2VVDA 3QBQA 4CDXC 4I3PA 4YM3A 5ABJB 2D98A 4M3CA 4HETA 4MVTA 4KNCA 4GB33 3AK0A 5EWSA 1KDMA 2PYTA 2DCZA 3WG3A 5FOBB 2VGDA 1PZ9A 3NV4A 4LBOA 1U5IA 3B02A 5AVPA 4W6WA 4X6RB 1CX4A 1QQP2 4J1XA 2LALA 2JG9B 4TSVA 2ERFA 3L2HA 1BVVA 4I02A 1FPN1 3KT7A 1XNKA 1ZZ7A 1KS4A 2YPJA 3D0JA 3V0AA 4QQOA 3CJIB 1NY71 3MW3A 3TN91 4G4FA 4I0AA 2QZ3A 2B42B 2YZ4A 4KU7A 2JD4A 4JTOA 1JW6A 4JAAA 1RMU1 3WY6A 4Y1YA 3J9SA 3VHRA 4IESA 4XZPA 4JGYC 1QKQA 4LBMA 4Y22A 2VMIA 3M3IA 4MGYE 1RUC3 4LO7A 1FMD2 1UL9A 2Q4SA 2XBO3 3OJBA 2A73B 2WFF1 4XEZA 5K7PA 4CDXA 2DUQA 3WT3A 1N3OA 1RVF1 2D3RA 1DQ5A 3SHRA 3VL9A 1UPSA 5GZEA 2Q5TA 3LOIA 4QQHA 4A7ZA 5T5OA 4COYA 1S2KA 2CY6A 5CADA 3O0VA 4JQRA 1WMEA 2HKXA 1X36A 3IPVA 4QU2A 4P9GA 1PO21 2VUAA 4X8PA 4XTPA 5ABJC 2IXKA 1BBT1 4XE9A 3ZFEB 4B7EA 4UBHA 2Q1MA 1S0JA 1YO8A 1IZ3A 1SLBA 1JUIA 2PELA 5C8WA 3M2MA 3J8F1 1RUF1 4RR3C 1AR62 4JC1A 4B7KA 4Y5Z0 1RL3A 5FO7B 1UX6A 1X8EA 4A2UA 4LBQB 2B7YA 2OZJA 1O4ZA 2JG9C 2PLV3 3WUDA 1HRV3 4QPGC 4OUMA 1FNZA 2JICA 4IEQA 2WNUA 5B2GB 1KQRA 4I09A 1LJ7A 4JGYA 4CP0A 2SLIA 3POYA 3BALA 2TEPA 3V0BA 4F3JA 1LOGA 2HWF3 5LRSA 4E9KA 4UW5A 2WQ4A 5JMCA 1OHFA 1YXWA 2JDZA 4YFWA 2XVGA 3S7EA 4XMAA 2HWC2 2XL7A 1NQDA 1EY2A 4Q0PA 1MVEA 1NCQB 1WLCA 4FPJA 1O7FA 2C5DA 3ZIXA 2BBVA 4DPNA 2WFPA 1ZBE2 2D6PA 3RJRA 3WDUA 3JB8A 5GLZA 4XJUA 2CAUA 5JSRA 2RS53 3OYWB 4JCKA 1CAUA 3WD5A 4XFGA 5DUVA 1V70A 3BTAA 2DFCA 2RM22 2ZGOA 3O0XA 1FAYA 4FPYA 1C3HA 1BEV1 1Z7S2 3SXWA 1LHUA 5HXVA 3FBYA 5EV7A 4KG0A 1S0EA 1ENRA 3HN1A 1QJU3 4XF1A 4RR3A 2DVGA 3LSDA 1H1IA 3KQRA 3PVNA 5D1IA 3GZUC 1O5LA 4QPGA 4AWDA 3ZFEC 1KS5A 5JLVA 4P14A 4DQAA 1O3RA 1QJZA 1LHVA 2R071 3B9CA 1J1TA 1POV1 3RRDA 3ZXGA 3QH6A 2ZX2A 5I8SA 4UW4A 3E5UA 3FUOA 2A3YA 3N3HA 1QJX1 2WSVA 1DZQA 4ITCA 2IZWA 1GANA 4WVMB 1S55A 2RS31 5HCAA 2QUOA 2WJSA 3U10A 1JTZX 5KXDA 1MS4A 1PVC1 3GZAA 4FQZA 2R1DA 4QQLA 1FPN2 1MS3A 4HLTA 3EJKA 1TNFA 5FFOC 2XJSA 1OA2A 3NWKA 3IBMA 4GWMA 4HMZA 4Q4X1 4QXKA 4N7IA 2IXHA 4LBLA 2WINB 1NCQC 2DCKA 1TME2 1ZM1A 1S0BA 1ND3B 2VW2A 4H7MA 1RMU2 4F8AA 3U0ZA 2RS11 1HX6A 4AGVA 1RVF3 2Z2SB 4XIKA 1ZBA2 3VBSB 3D4KA 3SH5A 2BTVC 2ZZJA 4JDNA 4S2DA 2JG8B 1HXS2 2BNMA 2RR11 1TQ5A 3AMNA 2O8QA 2V09A 4QT6A 4AVTA 4K6BA 5DZGA 1XYOA 3C2UA 1VBA1 2NMNA 3IN9A 2GALA 4IV3B 4CEYB 2ILMA 3PNAA 4R4ZA 4WVVA 3J8F3 1RUF3 5DZEA 4YARA 1PO22 1JXNA 1RUD2 3BODA 4P9IA 2ARBA 3R4DB 4W6XA 4DRVA 5BNQA 4AGRA 1EYBA 4RHV2 3O12A 4AI2A 4E4ZA 1J3PA 3K48A 1GNZA 2GC1A 4RD7A 4Q0SA 5BNNB 1D0HA 4Q4Y3 1NCQA 2DU1A 2A7AA 2IC1A 1UW8A 3RJ2X 2UWAA 4N90A 2GC3A 3ST7A 5J09A 3UJQA 1H2KA 3AX4A 3U4XA 3AZZA 4EN7B 2D97A 5JOZA 3OYWA 1RHI3 2HWB2 2VOKA 3EQEA 4AHXA 1VAKA 2PHXA 5EJ3A 3NV1A 1BXHA 2VW1A 1F5JA 4FTSA 1FT9A 3R4SA 4Q0VA 2O8OA 5HI0A 1MS5A 2NP0A 3VBHB 2A71A 3AKTA 1TMF1 1DQ2A 1RUG1 1ZZ8A 2E7QA 2VQAA 1AXZA 4FVVA 2R041 2VECA 4FQ4A 3ZXAC 4XXPA 3GZTB 3BIWE 1QMJA 3WP6A 1PGW1 4FOQA 1DZRA 1XNCA 2QKDA 3VBSC 4I3GA 3LGRA 4LBJA 1NZCA 2VU9A 3U11A 2JG8C 1OFNA 4N53B 3SISA 3RYRA 3M3CA 4QPIB 2F4PA 5SV8A 2OYZA 1BEV2 3PVEA 1WLTA 3R0RA 1I5ZA 3B3QE 3H1MA 3LA7A 2XVLA 1UPIA 2ZPXA 1A78A 2TNFA 4IV3C 4CEYC 4LA3A 1RUOA 1VR3A 1SCSA 1POV3 2VOWA 4B3NA 3QD6A 3WG4A 1VBB3 4WVMA 4MSVA 4CTEA 2MEV2 4HKOA 3FJSA 3QOPA 4GKYA 4FOWA 4CEWB 2ZCWA 3H8UA 4EN0A 1YFYA 5H9QA 1V9U2 2R16A 5E1RA 4LBQA 2ZHMA 2JECA 4KH9A 5E89A 1PVC3 2IWGB 1EV11 1XRUA 4AVBA 4ISRA 2FHRA 1N47A 2HWE3 4LA2A 3RMXA 4Q0UA 1K5MA 5A32B 4EWAA 3AZWA 4Q4X3 1W6QA 4HSJA 4YG0A 2C0ZA 2RS32 2GNDA 4RGAA 2GH8A 4XXAA 2ZTNA 3WW2A 2ZX1A 1UKRA 2H0BA 2DU0A 2RS13 1X33A 3D0SA 4Q4W3 2ZAAA 3MW2A 2JG8A 2LM3A 2PHTA 3QLQA 3G6JB 4Y20B 2WZR1 4XFIA 3VBHC 1ZRDA 4XJ9A 4ES8A 4YM1A 5K0UA 2CGPA 3I2DA 1GV9A 4HZFA 4E2SA 1JBCA 1G7YA 2PAEA 1JH5A 1VRH1 1X8MA 2OPKA 4YZ4A 4IV3A 4CEYA 2P3IA 3B5LB 2QDNA 3N35A 1BZWA 1RGSA 2ZGPA 5K8SA 2E6VA 1KFXL 4N53C 3ZIWA 4N9HA 1LTEA 3VLBB 1VBC3 4OFGA 1PM7A 3T1LA 2WQZC 3EO6A 1LGNA 3LA2A 4F83A 1CVNA 1QOOA 4MGKE 3RZZA 1VBA2 3NAPB 2XUMA 1Y3TA 3AKRA 2GNTA 3DUIA 3VKOA 2ZGKA 4M01A 1HDKA 2VNOA 4CEWC 4XBQA 2VMGA 2ZGMA 4MGIE 1QH7A 1R092 3J4UH 1VBE3 4LE4A 3FBMA 1EAH3 5FREA 4BH9A 1JN2P 2PTMA 3NKTA 1H1AA 3VBHA 3VBRA 5H9SA 3DKWA 2WWSA 4TYSA 4D3WA 5EZWA 3WP4A 2VNGA 4PF5A 3INAA 2XKOA 3VKNA 2PHUA 3RYKA 2BWAA 1TMF3 1Y9QA 3EBRA 2HEWF 4WM8B 5H9RA 4N53A 4L11A 1SBDA 4AEDB 5ACA3 1ZREA 2A75A 4N7UA 4IEYA 1AL0G 4BOWA 4MUVA 1PK6B 1DYPA 1WD4A 1C28A 2GMMA 4BM8A 3S7IA 2D43A 1OOPB 3CNAA 3H7YA 1NA1B 1BMV2 3WXPA 5KHIA 4LBKA 5E16A 1PGW2 4CEWA 4GULA 2P37A 1SBEA 5CBLA 4XTMA 2PHFA 3LZZA 4XHXA 3NAPC 3IIAA 1XYNA 2FZ2A 1BK1A 4TLFA 3V65A 3MYXA 1GKBA 4MXWA 4KGQA 3CF6E 2WT0A 3IMNA 1W6OA 3NV2A 3QCWA 3U07A 1IPJA 1WBLA 3QACA 3TYJA 5FMOL 4BPZA 1HRI1 2XL9A 3M3QA 4FPLA 4L97A 4L99A 5FDBA 2OZ6A 1MQTA 4SBVA 4YZ1A 4FPKA 3WP3A 2TBVA 2DTWA 4K20A 4DMIA 4Y20A 2D5FA 4JTNA 4Q4V1 3FMGA 1AR92 4AEJA 1NLRA 1LOFC 5DUUA 2UU8A 1J58A 4NHKA 4LO8A 2IFWA 1H2MA 4AEDC 4LHKA 2WNVB 3MIHA 1DGRN 4OHWA 5C4WC 1LEMA 2B5HA 2D40A 4SLIA 2WZR2 4C90A 1BKZA 1QOSA 4A3XA 2BWCA 1N1YA 5JPMB 1OOPC 2D3SA 1JHNA 3HT1A 4QGMA 3ILRA 1DFQA 3NAPA 4IEXA 2ZGUA 5T5LA 4AFDA 1PNFA 1AR71 4HSLA 5A3LA 4FAHA 1Q8OA 1RUI3 5EXOA 2ES3A 5F5QA 1I6XA 1QU0A 4UW3A 5JIAA 2YYOA 4HPKA 4EWEA 1WW6A 2B8MA 1URXA 2W0XA 4OHVA 3VZLA 4AE2A 2RMU2 4JV4A 3AP7A 1R1A3 4H7LA 4Q1RA 2WT1A 3AZXA 3OD4A 3E6DA 1MZEA 4R4XA 1CAXA 2AGSA 1LOFA 4CDWB 5LK7B 4FPCA 1X50A 1C4RA 4NN0A 2VG9A 1A8DA 4IEPA 4QGNA 1BQPA 2DTYA 5FPZA 3LSEA 1FYUA 4AEDA 1Z78A 2ZZQA 1ZZBA 1YIFA 3MLKA 2JKBA 1BVP1 1RUE1 5C4WA 2QZ2A 3H1YA 3CJXA 2DF7A 1UU6A 3ZXJA 5I93A 5KHGA 3TWIA 1OOPA 1S1AA 2LTNA 4AQ6A 2C9AA 2R061 4N43B 3AFKA 3IT8A 1LB2A 2ET7A 5CFCB 5CIRA 1GZ9A 2QQPA 1H30A 3ZO0B 1HRV1 1VAVA 5BNPB 2WLPA 4I30A 4I0WB 4NHMA 4IERA 3ECQA 3GBWA 4COZA 2P34A 5IK8A 3HQXA 1D4M1 4XBNA 4Y1VA 1GR3A 5AFEA 1CN1A 3H7JA 1YIPA 2ZGTA 3ACLA 3PVBB 1MS1A 4M0NA 1NXD1 1HRI3 2VULA 2JJ6A 2RS51 4O9GA 4YVWB 5E8AA 1FATA 4CDWC 1AL21 3AP9A 1WLWA 3FLRA 4XILA 4BLIA 4Q4V3 3MF6A 4AFMA 2ZKNA 1CR7A 2HWD2 5FAXA 2ZMLA 2G9FA 1QJU1 2Q1ZB 5KBFA 3E6BA 4META 4YW5A 5AC91 3SCFA 4BWOA 3ZSJA 2AREA 3A4UA 4R9DA 4AFBA 4KU8A 1DGLA 5CA6A 3LA3A 1R081 3DPRB 3W58A 2UWCA 3N7LA 4CDUB 4R52A 4N43C 3M7AA 4KGGA 2PAMA 4GB32 4B4QA 5CFCC 2NN8A 2E7TA 3RG0A 1QQP3 2XLFA 3NV3A 5C8CB 3Q9OA 4H3WA 1AR73 2UURA 4YZ2A 5BNPC 2JEMA 4M3CE 4XJAA 2XLAA 1C5IA 4DRRA 4AVCA 2KXLA 1XE7A 2IXCA 2Y0OA 4RA0A 5FBZA 2NPIA 2ZHLA