2WS91

Equine rhinitis a virus at low ph
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
246
structure length
246
Chain Sequence
VTNVGEDGEPGETEPRHALSPVDMHVHTDVSFLLDRFFDVETLELSNLTGSPATHVLDPFGSTAQLAWARLLNTCTYFFSDLELSIQFKFTTTPSSVGEGFVWVKWFPVGAPTKTTDAWQLEGGGNSVRIQQLAVAGMSPTVVFKIAGSRSQACGFSVPYTSMWRVVPVFYNGWGAPTKEKATYNWLPGAHFGSILLTSDAHDKGGCYLRYRFPRANMYCPRPIPPAFTRPADKTRHKFPTNINKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords P1
publication title Equine Rhinitis a Virus and its Low Ph Empty Particle: Clues Towards an Aphthovirus Entry Mechanism?
pubmed doi rcsb
molecule tags Virus
total genus 32
structure length 246
sequence length 246
ec nomenclature
pdb deposition date 2009-09-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2ws9100
1RUD1 2RMU3 2BPA2 2HWD3 1ND2C 5AC92 1QJY2 5C4WA 4Q4Y1 5ACA3 1VBD2 5AC91 1AR62 1CJDA 1QJY1 1RUH3 2HWE2 3ZFGA 3ZFFA 1VBE1 1EAH3 4FTBA 1ZBA1 1RUC1 4IV1C 2FZ2A 1AL0G 1PIV3 2RS12 3ZXAC 5ACA1 1OHFA 2RS11 1RUH1 1EV12 1F8VA 3VBRA 1EAH1 4CDUB 2R073 4YVSC 1RUI3 4AEDC 1VBA3 1K5MC 1NA1A 2HWB3 4CDWB 4WM7A 3VBSC 5ABJA 1POV3 1PIV1 3VBHC 1R092 1RUF2 4QPGB 4CDQB 1RUI2 1RUF1 1RVF3 1BBT2 3J8F3 1ZBE3 4IV3B 1MQTC 1RUI1 1RHI3 3JD72 1HRI2 2R063 4CEYB 1ASJ2 1GFF2 2HWB1 1RMU2 3JD71 3CJIB 1POV1 1RMU1 1AR83 1RVF2 3J8F2 1HX6A 1NCRC 5BNPA 1RVF1 3J8F1 1BEV3 1D4M2 1RHI1 1FPN3 1VBB2 2R061 4CDWA 5BNNC 2MEV2 4YVWB 5D8AB 3ZFGC 1VBB1 4NWWA 1M06G 2X5IA 1OOPB 3DPRB 1AR72 2RM23 1AR71 5DDJ3 4GMP0 1B35A 4RHV3 2WFF3 1FMD2 1QJX3 1ND3B 1Z7S3 3M8LA 5C8CB 1VBC2 4JGYA 5JZGB 3VBFB 1VBC1 1X33A 5DDJ1 1QJX2 1V9U3 4RHV1 5ABJC 5K0UB 5CFCA 1RUG3 1QJX1 2RS53 1R082 5D8AA 2WWSA 3LOBA 1R1A2 4PDWB 1K5MA 1AYN2 3VBSA 1AYN1 1H8TA 4Q4W3 2FZ1A 2RS52 1BMV2 1V9U1 2XBO3 4RQPB 3VBHA 3ZFEB 5BNOA 1NCQB 2RS51 1BMV1 4GH4B 4EJRA 5FMOL 5BNPC 3VBFA 1VB4A 1AL22 1HRV3 4CDWC 1QJZA 4RR3B 1AL21 1C8NA 1PVC3 1AR93 4N53B 1RUD2 2X5IC 2WLPA 4Y4YA 3JB4C 4Q4Y2 4RS5B 1B35C 5A33A 1MEC3 1VBE2 5BNNA 1COV3 1RUJ2 1HRV1 3JBG3 1ZBA2 1RUC2 2Y26A 3CJIC 1RUJ1 5CFDB 2BFUL 1PVC1 2WS93 1AR91 2RMU2 4JGYC 2HWD2 5GKAC 2RMU1 4QPIA 3S6PA 2HWD1 5ACA2 4GMP3 3VBOB 1MEC1 1RUH2 1QJU3 5CFCC 2R043 1EAH2 1TME3 1WCDJ 5D8AC 4CDXB 1HXS3 4FSJA 1NG0A 4WM8B 4GB33 1VRH3 2XPJA 1X36A 4LLFA 1PIV2 1H8TC 1TME2 4Q4X3 1TME1 2R072 5BNOC 1HXS1 1VBA2 1NY72 1TMF3 4SBVA 2R071 1VBA1 1PO23 1NY71 3VBFC 1PO13 5C9AB 3VDDB 2HWB2 2HWF3 5A32B 1C8M3 3HAGA 5K0UC 4CEWB 4CDUA 4Q4X1 1ZBE2 1PO22 1RHI2 1ZBE1 3NAPB 4PDWC 2R062 1PO21 1PO11 1C8M2 5L7OB 1C8M1 1ND2B 1AR82 4QPGA 2BUKA 4CDQA 1AR81 1VAKA 1BEV2 4IV3A 1BEV1 1FPN2 4QPIC 4CEYA 2WZR3 1FPN1 1AUYA 4RR3C 4CEWA 3CJIA 2RM22 4N53C 2RM21 5DDJ2 2BBVA 4N43B 4RHV2 4RS5C 5FOJB 1VB2A 2WFF2 2QQPA 1RUE3 4YVSB 2IZWA 4AEDB 1FOD3 2WFF1 4YVWA 2WZR1 1Z7S2 5J98B 1OOPA 2RR13 1E57A 1Z7S1 3DPRA 4Q4V3 3VBUB 2TBVA 2RS33 1V9U2 4NWVA 3TN93 1RUG2 1MQTB 1FOD1 1ND3A 1RUG1 2PLV3 4CDXC 4FTSA 4CDUC 1NOVA 5C8CA 5JZGA 1NCRB 4Q4W2 2XBO2 3TN91 5K0UA 2PLV2 4JGZB 4Q4W1 4FTEA 2XBO1 5C4WB 2ZTNA 4QPGC 4CDQC 2PLV1 1QQP3 1PGL1 2HWC3 3ZFFB 4IV3C 4PDWA 3VDDC 1HRV2 4CEYC 5FMOS 4RQPA 1PVC2 4CEWC 1AR92 3ZFEA 1DDLA 1NCQA 5AC93 4GH4A 1QJY3 4BCUA 1QQP1 1VBD3 1HQNA 1AR63 2HWE3 3NAPC 1MEC2 4RFT0 3VBRB 1CD3G 1COV2 3JBG2 1OPOA 4RR3A 5L7OC 4YVWC 1COV1 4JGZA 3JBG1 2WS92 1NA1B 4N53A 4WM7B 1IHMA 1OOPC 3DPRC 5ABJB 5LK7B 2WS91 2RS13 1VBD1 4RS5A 1AR61 2HWE1 1EV13 1A6CA 2BFUS 1QJU2 2R042 4GMP1 1HXS2 1QJU1 1ND3C 2R041 4GB32 5CFDA 1F2NA 5C8CC 1VRH2 4GB31 5JZGC 4N43C 1R093 1RUF3 1VRH1 3VBOA 1EV11 5BNPB 1BBT3 4Q4X2 4CDXA 3JD73 1TMF2 1HRI3 1RB8G 4WM8A 1ASJ3 1PO12 1RMU3 1TMF1 3VBUC 2X5IB 2HWF2 1R091 2HWF1 4RQPC 1BBT1 1B35B 3ZFEC 1D4M3 1NCQC 4Z92B 4GH4C 5J96B 1HRI1 1VBB3 2GSYA 2MEV3 1ASJ1 5C9AA 3VDDA 3IDEA 5A32A 1AR73 4JGYB 4IV1B 4JGZC 5C4WC 1D4M1 1PGW2 5CFCB 1FMD3 3ZFFC 3NAPA 1PGW1 2DF7A 2MEV1 3FBMA 1W39A 1AYM3 2WZR2 1VBC3 5L7OA 1K5MB 1ND2A 5CFDC 3VBSB 1H8TB 3VBHB 1FMD1 5BNOB 1R083 1RUE2 1AYM2 1FOD2 3VBRC 2VQ0A 3VBOC 1RUE1 1AYM1 4IV1A 1R1A3 2ZZQA 2RR12 1AYN3 1NA1C 1POV0 4WM7C 4Q4V2 4WM8C 2RR11 4Q4V1 2RS32 4N43A 3TN92 4YVSA 1R081 4AEDA 2RS31 1SMVA 1R1A1 1PGL2 5A33B 5BNNB 3JB8A 1AL23 3ZFGB 3VBUA 5C9AC 1RUD3 1MQTA 2ZAHA 4Q4Y3 4QPIB 1QQP2 2HWC2 2GH8A 1VBE3 1RUJ3 2HWC1 1ZBA3 1RUC3 1NCRA 4Y5Z0
chains in the Genus database with same CATH superfamily
4AQ6A 2RMU3 4QXBA 2BPA2 3LPFA 3TRSB 5AC92 4MOAA 1K42A 4PQQA 1RYYA 1WMFA 2A71A 1U0AA 2YY1A 1RUH3 3ON7A 2K0GA 4XJ8A 1BLZA 3B02A 1CZSA 2OUHA 3DF0A 4TN7A 4L11A 5JOYA 1OKQA 1X7NA 2JG8B 5A70A 5L36A 3LE0A 5A7WB 1UAIA 4XACA 2PHRA 2RDSA 3H1YA 1IS4A 4GA9A 4KNCA 1AL0G 1MZ6A 1PIV3 1XSQA 2D6KA 5DUVA 3RVHA 4XJUA 3ZXAC 4CSWA 3HN3A 5ACA1 1U5ZA 2E53A 2P6CA 2VZ3A 2QQJA 4CDUB 3RZJA 5JPMB 3L9JT 2IUWA 4XCAA 2WAOA 4D3WA 5F3EA 5J3UA 5FYBA 4M4RA 2B39A 4JHTA 2WN2A 2ZGTA 4U36A 1BVVA 4XJ9A 4D0QA 5ABJA 4RGAA 4E2QA 3HNYM 3ZR5A 2D6OX 1V6JA 4Q27A 3ETQA 3VBHC 2X05A 2WO7A 2DUPA 3M1HA 4CDQB 5FY7A 3VB9A 1YUDA 3J8F3 1D0GA 1JBCA 1RUI1 3O0XA 2GALA 1RHI3 3POBA 3JD72 4QDSA 2R063 4BLJA 1N47A 1YFUA 2VULA 1GFF2 4JZRA 4LT5A 3B01A 5SV8A 4HSJA 2P37A 4WVZA 4BDVB 2W95A 1POV1 5T52A 5HI0A 5DUXA 4Q8LA 2PHWA 1RVF2 1HX6A 2ES3A 4AI3A 5JUVA 3U11A 2XH6A 1Q43A 3J26N 5FWJA 4IEUA 1JZ5A 4ATFA 5FMBA 4IGQA 4OVEA 4IEYA 1WMDA 3WNNA 2D40A 2VOKA 3AJYA 4KL1A 5FZ7A 1VBB2 5LK5A 4AF9A 2R0HA 5DAVA 1VLNA 3MUZ1 2MEV2 3AKTA 3SCGA 4E4ZA 5BNNC 5D8AB 2VVDA 1MZEA 1LB2A 2DCKA 1AR72 1J83A 2CWMA 2RM23 3MDPA 3LCPA 5H9RA 5DAQA 3N7KA 2NP0A 1JOBA 2ZHKA 3GZAA 3ZSEA 4X6QB 5IAVA 4DEVA 4RHV3 1ENXA 3UT0A 2WFF3 2DVDA 1FMD2 1N1VA 4OULA 2ZA9A 1KITA 4RD7A 5C3QA 1V6LA 3PTRB 5FWEA 3G7DA 5EJZB 3WQ7A 3ZXKA 4NHYA 1JXNA 4A44A 1HLCA 2B5HA 4DFSA 1LGBA 1VBC2 4IEZA 1PK6A 4BIOA 4XF9A 2GC1A 1X33A 4AQ2A 4UFHA 4HLTA 5A3UA 1V9U3 5FLJA 3UL2A 5CFCA 5CKQA 1QJX1 5FXZA 3SITA 2A6YA 1RGSA 4KMQA 1R1A2 2B8MA 3H9AA 2A6VA 5I8SA 4CVUA 3OG2A 3P6BA 3UKVA 3LEKA 2N7GA 4ET7A 1F31A 1AYN1 4H7MA 2AR6A 4Q4W3 2FZ1A 1I5PA 4XAEA 4XHXA 1BMV2 1QJEA 5JXGA 3CMGA 1WWYA 2XR4A 5FZHA 1XYNA 2IWGB 2H0BA 2RS51 4AFMA 4Z8BA 1M4WA 3H3LA 4GH4B 4LBLA 1ENSA 1X8MA 3POFA 4M3CF 5JWPA 3V0BA 2EVXA 3VV1A 3VBFA 2DU0A 3D6EA 3WLUA 2WT0A 4DRRA 2WZ8A 1GANA 1ST8A 1AL22 3ZMNA 1JW6A 5E88A 3WD5A 1CZVA 3K3OA 3SKJE 3RFRA 3U1XA 5LW9A 2P3YA 4DS0A 5IVBA 4N53B 2E63A 2CGOA 1IGOA 1RUD2 2X5IC 1NKGA 3PVEA 3LDKA 3N35A 3I2IA 5A7PA 2Y33A 3NRUA 1CX1A 3N7JA 2J1RA 1FNYA 3AYEA 2XUEA 3NNMA 3V56A 4Q4Y2 1DLLA 4ASLA 5CU1A 1BCXA 2XDVA 3LA7A 1W8FA 4UI9L 1WBFA 3M7AA 1VBE2 4NE9A 3ZXLA 4RGKA 1GOHA 4JRAA 4YWAA 5LY2A 1HRV1 2VD7A 1RUC2 2Y26A 1U12A 4Y3OA 4B3NA 1EUTA 1MS9A 2R1BA 1IS5A 4SLIA 5CFDB 5G05L 4EN0A 5JSOA 3M4FA 4ZU7A 1JYVA 2RMU2 1HKDA 2VG9A 3SH4A 3BTZA 3RZMA 2J1TA 1UQXA 4HOOA 5GKAC 2CY6A 4EYUA 1SLCA 3WUCA 4PLNA 2WT2A 1RUH2 1Q8PA 1H6XA 1XU1A 3JQWA 4OCTA 2Y6HA 1PX3A 3T0AA 1C57A 2W5FA 2GN3A 4IEXA 1PZ9A 4MGZE 2Q4SA 5APAA 4H3WA 4QM8A 3KT1A 4XF3A 3ST7A 2QVSB 5HBAA 2E33A 4Y22B 2BVVA 5IYYA 1A3KA 2JICA 3C2UA 1JMUB 1NQDA 4IGPA 2W9XA 1PIV2 1ZZCA 2JKBA 1Q3EA 1F35A 5C6CA 4CCLA 5IAXA 2K2SA 2BVBA 4YW7A 4QQHA 2YMZA 3RZLA 1UIKA 4FPFA 3BPSA 3NNJA 4NHXA 4D7TA 2WWJA 3D0JA 5GM0A 1JOJA 2XQXA 3AMMA 3KWVA 4IEWA 4XDOA 2JG8A 3PHMA 1GZCA 3I54A 1PO23 1NY71 5A7WA 4QQLA 4AEMA 1WW7A 2YXSA 4ZXEA 2P3KA 2HWF3 2QBXA 4D6RA 4S2DA 3URFA 4P08A 3SQOA 4OI4A 5K0UC 4CEWB 3GCXA 4BMEA 2C9KA 1JZ7A 1TEIA 4BOWA 4DB5A 4E27A 3KCCA 3IMMA 4M3CB 4CA9A 2YU2A 4CDUA 3KM5A 1OKOA 4P5YA 5LASA 5KXCA 3RZKA 1O8PA 5DPNA 5FLHA 1UOJA 1N1TA 1RHI2 4JV4A 1ZBE1 4IEVA 4QX0A 4PDWC 2R062 2W39A 3RYPA 4AVBA 1JYWA 1WKYA 1UOGA 3Q8EA 3USSA 2ENRA 3NV2A 4PJYA 3RJ2X 3N9PA 3W59A 1C8M1 3GGLA 3WOGA 4PF5A 1QOSA 5FY0A 3EHKA 1UOBA 2PN5A 1S55A 1SLBA 1W6QB 3IT8A 3KQRA 4CDQA 1GICA 1OD3A 2VPVA 1VAKA 5FUNA 4FPKA 5FZ3A 3ZN4A 2OA2A 4LBKA 4DEQA 1JUIA 1BEV1 3LSEA 5CAZA 4PQ9A 2RDNA 2F4PA 2WYSA 2WZR3 1FPN1 1AUYA 4WVWA 2XOMA 4RR3C 1OQEA 3AMNA 4HSLA 3KSCA 4YM0A 3WP3A 2RM22 1WCSA 2XL9A 4LKEA 2ZX3A 1OVPA 2PHLA 2XLFA 3AXEA 2BBVA 5JOZA 1UKGA 4RHV2 1ZX5A 4RS5C 1VB2A 2WFF2 1C5IA 4CZSA 4MYEA 1IG3A 1KFUL 3H3UA 2YBPA 3N9OA 4QGMA 4WVVA 2R30A 4KG8A 3M3QA 3B3QE 2F17A 4DUXA 3PUAA 1E5RA 4H14A 5JXJA 4LIVA 2ZS6B 3JXSA 1REFA 2NM1A 4M0HA 3S57A 2A1XA 1IPJA 3I3DA 1LOCA 2TBVA 2ZBJA 3MIHA 1V9U2 4UT5A 5FBJA 3TN93 3QCWA 5FPVA 4ASMB 1PNFA 3N3HA 3QLQA 3MFCA 3O0WA 4KBZA 2ATFA 4BK5A 2X09A 1QOOA 1W03A 5GZDA 3WDWA 3TEXA 3M3OA 2ZPXA 2ZOEB 3WF3A 1GU3A 2Y6GA 5FPUA 4HXCA 5ANQA 4QD2A 2UYAA 1LHWA 4URAA 2CAUA 4MGSA 5GALA 1J3PA 1S4CA 2PAMA 2RG4A 4Q4W2 2YGMA 4W8JA 2AGSA 4YARA 4RL7A 4C8DA 2O1QA 2WQ4A 1XE8A 1PZ8A 2DYCA 5FXVA 2Q30A 1GKBA 2V73A 4BPZA 4FTEA 2XBO1 3W58A 2Q1ZB 1NT0A 4CCJA 1LOFC 4LLOA 1BXHA 4XBNA 2LW8A 1PGL1 2WA4A 4IV3C 5A6XA 1US3A 5FY8A 3VDDC 2R49A 4CEYC 4BQ4A 3BKZA 5FMOS 1H30A 1ZRDA 4QU1A 1QXPA 1GNHA 4Q0QA 1YFWA 2VCCA 3AL6A 3QOPA 4K20A 5CZKA 4GH4A 2ZGSA 4YFZA 2XUMA 1QQP1 1VBD3 1W9FA 2HWE3 2VCMA 1WLTA 2OZ6A 1XBFA 3POWA 1Y43B 4GQ7A 4LKFA 3A0KA 4FOQA 3A23A 2ZX2A 4A45A 4ES8A 2Y34A 3POEA 5IFPA 4JGZA 5A3LA 2VXRA 2QQUA 4CU7A 4N53A 4WM7B 5EYYA 1OOPC 4DY3A 1V6MA 3RMXA 1W2UA 2WS91 1PNGA 3ILNA 3ROUA 4Q26A 1H2NA 4PLMA 4ASKA 2XB6C 4Q1RA 1J84A 2C26A 1EV13 2IXJA 3GNEA 3WW4A 1A6CA 3FBYA 1AX1A 2JJ6A 3DYOA 1REDA 4Y33A 1DCSA 5CB7A 1NLQA 2RHPA 3MEPA 3SH5A 1ND3C 1FV3A 2QNKA 1UYXA 2C6SA 1UZVA 5CFDA 3MI8A 4ZZ8A 5C8CC 4CCEA 1JH5A 1W2NA 2X53S 4I09A 5F37A 2XL7A 3FMGA 1VRH1 1C28A 1ZRIA 1OQ1A 3AP9A 4NRPA 4XF0A 1APNA 5FXXA 3O1RA 2D3PA 1O4YA 5FZKA 4NMIA 5K4LA 2ZZJA 2J1SA 1BVP1 1W05A 2C4XA 4I01A 3VDAA 1HRI3 1XNKA 4C1XA 4OMDA 1GV9A 4CP9B 4JHZA 4Y22A 4QB2A 1NZIA 3I2HA 2X5IB 2HWF2 1OT5A 1O4TA 1ENQA 1Q8OA 1G8WA 1R091 2XKPA 3IB3A 5JI9A 5KHKA 2G19A 2EF6A 2Y6FA 4N8MA 4RQPC 3LEMA 4R4ZA 3ZFEC 1IQAA 1D4M3 3VD3A 2AZ5A 2QQOA 4Z92B 2XJPA 5J96B 1W8HA 3Q8BA 4XEZA 1MS4A 2QQIA 5FP7A 3WDYA 1ASJ1 3ACFA 4MLOA 2ID4A 3S7IA 3HOBA 5A7OA 3F95A 3DYPA 1NXD1 3TEYA 4LO8A 3WF4A 2EXIA 3IAQA 3O7OA 1XU2A 1JS9A 2VE1A 2H6CA 4HK8A 3WUDA 4EN9B 1DQ6A 1E5SA 1S0CA 1ZZ9A 2WFPA 5C4WC 4IESA 4M3CA 5A7QA 2GU9A 2P17A 4AQTA 3UJOA 4CE8A 5KC6A 2D43A 4QDQA 4OZOA 4Q5OA 2A70A 5L9RA 3ZFFC 3LIHA 4AEJA 3Q8FA 1AYM3 1YWKA 2A6XA 2WZR2 5IVYA 4EE2A 4GWMA 4MSVA 1UCXA 5H9QA 2JDYA 3MZHA 4Y24A 1K5MB 4Y1XA 1F15A 2C5DA 2EAKA 1AXYA 3IPVB 5ERLA 5F8PA 4AGVA 1W6QA 3RNSA 3VBSB 4FQZA 2FDGA 1W6NB 1DQ5A 1VALA 4H7LA 1WLCA 3SHRA 3RG0A 4XFHA 4RSUA 2XHKA 4XXAA 4FBFA 3VBRC 2XVKA 4KGQA 2WIIB 5BUVA 1DU3D 1YJLA 5JXIA 2I74A 3AP4A 3THPA 2HEVF 1CIWA 2ZZQA 4KWLA 4NHLA 1F5JA 1GP4A 3OGRA 2XJUA 1AYN3 1NA1C 2AUYA 2XGXA 4PBPA 2Y6KA 1HIXA 4ZXKA 1L3JA 2RR11 4N90A 2XXZA 4IE4A 3HQUA 5FY5A 4NAMA 3TN92 2WSUA 2YC2A 2OIIA 1H0BA 4XABA 1JZ6A 3WCSA 1L7RA 1ZZ6A 3BIEA 1H1AA 1J3RA 3IKWA 4JCKA 1RJ7A 2WRAA 1LTEA 4DO0A 1QXRA 4EWAA 5A33B 2FDKA 1OF4A 2Q0AA 4BE3A 3R6SA 2JDKA 3M2MA 2W08A 2GP5A 4PIZA 2KR2A 4NRMA 1KQRA 1LULA 2D3RA 1VIWB 2R6QA 3POYA 4Q0UA 1PM7A 5C9AC 1UD1A 3IAPA 2J1VA 3PUQA 1BQPA 3A0NA 5DABA 2PFWA 3DYMA 4ES9A 2V72A 3C7EA 5K7PA 5EWSA 4PBOA 4FFGA 1ODMA 1UMIA 1ZRRA 5FQ0B 3I49A 1VP6A 1OLMA 1IKQA 5F3CA 4O7XA 2XJTA 3ECQA 3SH3A 3BUCA 3VHOA 3SKVA 2DWRA 2A75A 1WZXA 3VZLA 4KI5M 3AK0A 2VNGA 4X6RB 1WLWA 3AXDA 3O12A 1PGSA 5FK8A 4DINB 5JSPA 3BVCA 4JQRA 1VBD2 3WNXA 5L9VA 1CJDA 1QJY1 2QCSB 3WP6A 2HWE2 2VOVA 5KWRA 1YCIA 1EAH3 3VL9A 5JXHA 1HB4A 2ET7A 2ZMNA 1CWPA 1ZBA1 4ZS3A 2VCAA 4I0BA 3PIGA 1DYKA 2VNVA 4BISA 1QU0A 4BB3A 4IV1C 1JYCA 5F3IA 2FZ2A 5F2WA 4D6SA 4E4SA 2ZGMA 5DZFA 2UY9A 1JUHA 4LBQD 1S2KA 4UWDA 4XIOA 3NJXA 3AP7A 3MGUA 1UIJA 3PVBB 1JYTA 5FYMA 3U75A 1ACCA 4S2GA 2WDBA 2RJKA 4HETA 4ZONA 1EV12 3ZN6B 1F8VA 3D5OA 2VMCA 3WR0A 5EJ1B 3GZTB 3RI9A 3B9IA 3GJBA 3IDAA 1WLDA 2HWB3 4MGYE 4AE2A 4WM7A 4XDQA 4CDWB 3FZ3A 3KS7A 1J3QA 3KD4A 1ONAA 5FMCA 5KHJA 5F39A 2VMHA 1OUXA 3AKRA 1RUI2 3OGSA 2VUAA 1RUF1 1W0PA 2CSGA 1RVF3 1S1AA 3U4XA 1ZBE3 4IV3B 4TLGA 3DKQA 1G9CA 4CYDA 1XNCA 3H8RA 1ODNA 2C24A 4B4QA 1HRI2 2OW4A 1OC1A 1GYKA 5FBZA 4CEYB 4RGGA 2P34A 4AI8A 5HCAA 2B46X 2ZGKA 1V6OA 2XWBB 4QKBA 1PX4A 1RMU1 3C3VA 5CVRA 5FZCA 1GSLA 2R1DA 4QWNA 3H8XA 1BEV3 1MACA 2WC2A 1K45A 1D4M2 3EMRA 4LA3A 3KV9A 1ZZBA 1W6MB 3RI8A 1FPN3 5LATA 1GQPA 1U5IA 2W3JA 3ACHA 3BIWE 4FPJA 3VKLA 4UW6A 2AEZA 4UFMA 3W5NA 3ACIA 4TSVA 4NWWA 4TTGA 4O65A 2X5IA 1OOPB 5D1IA 2E7QA 1FT9A 5FRAA 5FAXA 4META 1QGLA 2W87A 3ZYJB 5DDJ3 3RWKX 4CUBA 2GNMA 2Y38A 4N7UA 4ZKTB 3KV5A 3WNLA 1DBNA 1JHJA 3KV4A 3POJA 4DNYA 1LU1A 1ND3B 1UPSA 5DUUA 2UU8A 3OY8B 1LNSA 2ZX4A 4NOTA 4WZFA 4E2GA 5C8CB 4FCAA 4MH0E 2DFBA 1FI2A 3KMHA 1IS3A 3VBFB 1A34A 3CLPA 3VKFC 1ULPA 2GNBA 3GCWA 4M00A 2BGPA 3TEWA 1QJX2 5M0TA 2ILMA 2FBEA 3MV11 4XUNA 1WA6X 1XQNA 4BM8A 1Z78A 3N7MA 2SBAA 3L2YA 5J09A 1QJFA 2QE3A 3BU0A 5FYSA 4I3PA 3KF5A 4EQVA 3ORJA 1NE4A 2PELA 1SG3A 2ARCA 2JENA 1K5MA 1AYN2 1PM4A 1UZ0A 2WT1A 3V64A 3W20A 2OT7A 3B93A 3VBSA 1GP5A 3GHNA 3WINE 2RS52 4KH9A 4BA6A 4RQPB 2XBO3 1G9DA 1W6NA 4P00B 3ZFEB 2WBKA 3IWZA 4QAWA 5HXVA 1VRBA 2VVEA 3UKNA 4BIFA 2VW2A 4OMCA 4AWDA 5FMOL 5B2GB 4EWDA 4UW5A 5BNPC 3X29B 4UXAA 3GYDA 3I2OA 3T4HB 4URTA 4J6GA 1VB4A 3O5SA 4W6XA 2PHFA 5E8AA 1KDKA 2V4AA 3JCIA 4Y5TA 1X8EA 1C8NA 3PIJA 1PVC3 5LRRA 4A7ZA 1AR93 4ATEA 4IEPA 3K4DA 2XLAA 2WLPA 3BN6A 2Y64A 2BRTA 3O1VA 3L2HA 2BJSA 2W1QA 5AVPA 3MIBA 1J58A 2VL4A 4Z07A 5A33A 3EB7A 3AMHA 3VKMA 2W52A 4L9BA 3CJIC 3HN1A 1RUJ1 3CL1A 1XB9A 2D98A 2WS93 5DG1A 4CXWA 5AVAA 2G4IA 3T2OA 4XUPA 1CAWB 2JE8A 2YZ4A 3M70A 2BV4A 3S6PA 2O0OA 4I02A 4D7SA 2ZGQA 2ZGPA 3NSTA 5FZEA 1Z0HA 1MEC1 2OPWA 5FQ0A 5LRSA 3ZYFA 1EAH2 4GJZA 1WCQA 4CDXB 4A6SA 4BQ2A 2Q1FA 4FQ4A 5EIYB 3OPZA 5JMCA 4FSJA 3ZDSA 1A8DA 1DZRA 2CHHA 4YGEA 2PHXA 1VRH3 3MPBA 5IVJA 2JDUA 5CNAA 4AGGA 4MXWB 4LLFA 5AFBA 1XYOA 4JAAA 3PLQA 1YLLA 3ZM8A 3KCYA 5EV7A 2X10A 5JMOA 1W8OA 2D5HA 2LALA 3AKQA 1OH3A 4JX0A 4Q4X3 1TME1 2YFZA 1YO8A 1HXS1 4XZUG 1NY72 3NQHA 1TG7A 4SBVA 2DUQA 1DQ1A 2DBNA 1ZNPA 1PO13 5C9AB 2HWB2 4UFIA 1IKPA 1STMA 4OHYA 2XWJB 1DGWA 3JZVA 1G9BA 3OBAA 4QQOA 1IQDC 3APBA 3AZZA 1GQGA 3HAGA 3OTFA 1GMMA 1LEDA 4XTMA 3ILRA 4Y26A 3T3YA 5J7MA 3RWNA 2GC0A 3HBZA 3ZN6A 4Q2FA 4AGRA 1KS4A 2Y6JA 1ZBE2 4OHVA 1CAVB 4J1XA 1OA4A 1SFYA 2HBUA 4LJHA 2JE7A 3USUB 1YC61 4GWNA 4A3XA 5F5AA 1C8M2 4C91A 1KRIA 3OUJA 4OUEA 4AYUA 2WO3A 5L7OB 1H1IA 1YEWA 4PI0A 3MLKA 1DG6A 1H4HA 4QX3A 1LOFA 3O1TA 1UXZA 5FK7A 5JIAA 5JIUA 2E7AA 1AR81 3WP5A 1BEV2 1QIQA 5EHDA 4IV3A 1X82A 4MGIE 5IUQA 4GKXA 5LBFA 2DU1A 3HD8B 1FPN2 4QPIC 2D97A 3AKPA 3T30A 4CEYA 4CPBA 2HYXA 5JLVA 1K5JA 1XJAA 1O5UA 3KB5A 1W9TA 1H6YA 1CONA 2W0XA 3RZHA 3PU3A 2AC1A 5BV6A 1S0JA 5DDJ2 2TUNA 5FPZA 4N43B 4OZXA 3WNPA 1S0DA 5FOJB 1D0HA 2QQPA 2A6WA 4Y1UA 2IZWA 1W6MA 2WYFA 3H1WA 3JU9A 4QKNA 1MZ5A 1IOAA 4XMAA 5KBFA 2B9VA 1UZWA 4XJWA 1QXJA 1OOPA 2RR13 1UN1A 4OHWA 5A3TA 3HVDA 5CADA 4UW4A 3WNKA 1QDOA 3OBZA 3P1IA 1V00A 2VOTA 3AZYA 3B7MA 4GZ9A 2VMFA 3VZKA 3I3QA 2RV9A 1FOD1 5B4NA 2PAKA 4HPKB 4K21A 2EIDA 2WZEA 3KHCA 3BOWA 3LA2A 1ND3A 2CTVA 3OY8A 1LOGA 2X8KA 3I7DA 3GZUC 1NOVA 1UF2C 4R4XA 5C8CA 4LUMA 3K75B 5I0RA 1FATA 4V1PA 5FO7B 3HEIA 3RJRA 2QQMA 2P5BA 4FPHA 5CEHA 4QB1A 3CU7A 2XBO2 2C0ZA 2VTXJ 3UETA 2CNAA 1DYOA 5A3PA 4JGZB 2EXKA 3BCWA 3RS6A 5IVCA 5DZEA 1A8MA 4O9GA 2PLV1 4LO7A 4KU8A 4OQ9A 3K77A 3VDBA 3O1SA 3AMPA 2B45X 2Q8EA 3ZYBA 2QDNA 2JD9A 2JXAA 4JRLA 5FZ6A 4ITCA 1O59A 3RYRA 2XJRA 4LNVA 5HV4A 4UFJA 3VD4A 5LA0A 4XFGA 2W68A 1SQ4A 1UW8A 3A22A 3DKWA 3ZXJA 4BQYA 4RQPA 1PVC2 5BPXA 3SXWA 1UY0A 4X8PA 1AR92 3ZFEA 2O14A 5JDBA 4L2NA 1DDLA 3WQBA 2A3WA 1QJY3 4XPVA 2AENA 2W92A 4LO4B 4FPLA 1S2BA 1HQNA 1AR63 3S7EA 3NAPC 4QMAA 1SFPA 1L7LA 1AZDA 1PMHX 4UAPA 1ENRA 2YHJA 3J7HA 1UX6A 4GKYA 3WW2A 2VJXA 3ZYRA 3JBG1 2IVJA 2WS92 5F5IA 4AHZA 4E2SA 3WHTA 3LOIA 4QT6A 4IERA 5I0TA 1HB2A 2JDZA 5LA2A 3CHXA 4BQXA 1DGRA 2GMPA 3ATGA 5EQUA 1G9AA 2VECA 3SEEA 2KA3A 1YJKA 3B94A 2QZ2A 3QH6A 1T2XA 1SLLA 4U2AA 3WQ0A 2R041 2VC9A 1QH6A 4XIKA 3WW3A 4CUCA 3BTAA 3TAYA 1H9WA 2GAUA 1IZ3A 1JI6A 1VRH2 1HB3A 2J1EA 2L9LA 3FE5A 3KLSA 4GB31 4CCDA 5F6LB 4N9HA 3K48A 2OQ7A 3NO8A 1CAWA 4OYUA 1RUF3 3BTXA 3LZZA 4JDNA 1QEXA 2OZJA 1NAEA 5BNPB 1GWMA 4YM2A 1PMIA 2ZX0A 4QKDA 1BBT3 4A42A 3N9QA 4JDMA 4Q4X2 2OS2A 4CDXA 4M0NA 1O3SA 4LBOA 4W65A 1V6IA 1W8NA 1JZ2A 4L92A 1DGLA 1PO12 1RMU3 3I2GA 3R4SA 1DYPA 2BW8A 3MPPG 3VBUC 3ZYGA 3WF2A 4MXWA 1V70A 2A73B 2EALA 2WNUC 2KM2A 4CU6A 3OSDA 2YGLA 2DCTA 3CO2A 1UY3A 1VAMA 2XKOA 3ZPOA 5CG9A 1Q56A 1N3PA 1NCQC 1NE6A 1NUKA 1NLSA 1PZ7A 1ZZ7A 3PUHA 2LTNA 5FYTA 5FY1A 4FXGB 4IDZA 1GZWB 2VBDA 1VMFA 2I07B 3GDBA 5FUIA 1J1TA 1CX4A 3ZYHA 4MVTA 3J7LA 4DXRA 5C9AA 1BHGA 2PHDA 4H55A 4W6YA 2FCVA 2WO2A 3S0MA 4NN0A 3NWKA 4ZY9A 1LOEA 4E8CA 1EY2A 4FO9A 4KU7A 1O4ZA 4P9LA 5T5LA 4HVOA 3LA3A 3ZN5A 4MGQA 1CAVA 2LM3A 3T0BA 3UV9A 3TBDA 4AZZA 2CDPA 1PGW1 3USUA 2MEV1 4AAXA 3D4KA 3SCHA 1TQ5A 3IIIA 2EICA 1CPMA 2DVBA 2NMNA 4HMZA 5FKCA 5L7OA 3O1PA 5F2SA 4YGBA 3POGA 5FP8A 3IBMA 4KQ7A 4YGCA 1UOFA 3UNPA 4LHLA 2VZVA 1FV2A 1YNAA 4XFAA 3VBHB 2OYZA 1FMD1 2YG0A 1R083 2TEPA 4JKMA 4AOCA 4GAZA 3LFMA 1H4GA 3NW4A 2VXJA 3QD6A 3VBOC 4CDWA 3N9LA 4YZ1A 4YZ3A 5FV3A 1K12A 4IV1A 2BNMA 3CBNA 3I3MA 3E6BA 4CUAA 5I91A 2RR12 3ZDVA 4CCCA 5I8YA 5KC5A 1POV0 2HLEA 4HG6B 5C71A 3RZGA 3DN7A 5IT6A 4L0PA 4NAOA 4A7YA 2ZKNA 4Q4V1 5AFEA 4QPYA 4N43A 1LGCA 5KXBA 2VOXA 3U10A 2WNEA 2NMOA 2WNOA 1RJ8A 3HJRA 4HZFA 4Z82A 1OUSA 5FR3A 5IK4A 1SMVA 2Z69A 4JKLA 1R1A1 3C8XA 3AVSA 3P3PA 1GNZA 5BNNB 2RE9A 2DCZA 3EYPA 5C3RA 4DZGA 1DQ2A 4HKOA 5FO8B 2ZXQA 2VY0A 4LQRA 2R0FA 1O8SA 5DMYA 3N9NA 3THCA 1HDKA 2E7TA 1ALYA 1ZYBA 2WJSA 3CJXA 4HPKA 3D8CA 4FFFA 2DBIA 4QPIB 1RXGA 1NLRA 1YXWA 2UWCA 3ELNA 1WW5A 3WDUA 1EP0A 2XVGA 2GH8A 3GBFA 2VVFA 4NHKA 4BH9A 1RUOA 5GLWA 4NO4A 1RUJ3 1W8ZA 2EIBA 5LEKA 2HWC1 3TNPB 1JODA 1NZCA 3T0DA 4E8DA 4AI9A 1O3RA 3CF6E 2BOIA 1RUD1 3U78A 3VL8A 4AL9A 3WV6A 3KV6A 1DF0A 1QJY2 1F9KA 1UL9A 3BB6A 4UFKA 1RTVA 3INAA 4Q4Y1 3DV8A 5FJHA 4K7JA 1NX9A 2VUCA 5ACA3 4PLOA 1REEA 4YYOA 2PMWB 5LCWL 1AR62 4IQPA 1VBE1 2DV9A 5IVEA 2IVIB 2J1UA 4I3GA 1RUC1 3I97A 4XFBA 3U07A 3WDXA 1YQ2A 5GLTA 4M01A 5HCFA 2VGDA 3FJSA 4XAAA 4DUWA 1WW6A 3AL5A 2R16A 4PF1A 1BJQA 4OFGA 2PYTA 4TZDA 5FYYA 1ZA7A 4Q0VA 1OHFA 4HONA 4IE7A 1T6BX 1RUH1 2RS11 2ZHLA 2ZGRA 2ET1A 2EIEA 4YVSC 1RUI3 4K9SA 4AEDC 5CIRA 4E4HA 4LE3A 3MUY1 2BQPA 4HKLA 4LO5B 3NVCA 2BNNA 1CQ9A 5DAXA 1OBNA 5C3SA 3D3AA 1SDDB 3DGTA 2ORXA 5HCBA 2VZSA 3AYDA 3K4ZA 5FZGA 1POV3 1PIV1 3C7FA 3LDBA 3HT2A 1RUF2 5TSWA 1KDMA 2D6MA 1BBT2 4R9CA 1IG0A 1UX7A 4FFIA 2GZWA 1Y9GA 1KFXL 1MQTC 4AFDA 1YIFA 1UY1A 4L97A 4D94A 4XXPA 4INDA 2D6PA 2Y8KA 1W9WA 1RMU2 2DUOA 2Q8DA 3HQRA 4FAGA 2Q5TA 2VTXA 3AYAA 4ISRA 2QQWA 1AR83 3ZSMA 2ZGLA 1QKQA 4PHZA 1NCRC 5FZ8A 5BNPA 2VM9A 4GJYA 3J8F1 5F7UA 3DL3A 5I0SA 1S0FA 2WL1A 1MS3A 1RHI1 4RN5A 2JWPA 2VCBA 5A1LA 3IM0A 3LWCA 2R061 3G6JB 2CGPA 4YG6A 2AREA 2V09A 1OVSA 1S0GA 4JVAA 2VZPA 2AEYA 2PHUA 3H42B 4QXKA 4YRDA 3ZFGC 1M06G 1IPSA 1TNFA 3H3ZA 1LECA 3RPQA 4AI0A 2F6BA 2BGCA 4QX8A 1J1LA 3MIEA 4F7ZA 4YG0A 4XCBA 4XFCA 5EYXA 4F8AA 4AQSA 5FPXA 1DQ0A 2OPKA 4KWKA 4JQTA 3A21A 1ULEA 1JYXA 1QJX3 2W94A 3GBWA 1JN2P 1GZWA 2D3SA 2QDRA 3AM2A 3IIAA 4W50A 5FZIA 4TYSA 4Z2WA 5KHIA 3POSA 2VTFA 2YDEA 1HW5A 3WSOA 3M8LA 2CV6A 2EXJA 2QFEA 1SHWB 4K3UA 2MNGA 3PJYA 5C3PA 2BYVE 3S30A 4LMFA 3VDCA 2VBBA 2E6VA 3O14A 3CEWA 4RHV1 5K0UB 4BHPA 3E6CC 4LOSA 4FPCA 2RS53 1R082 3PNAA 2WWSA 2J22A 2HJIA 3LOBA 4UF0B 2J1AA 4NIHA 1SPPB 2K9ZA 4PDWB 4K8RB 3SCFA 3MF9A 5GZCA 3R4DB 1WW4A 2WNUB 1WD4A 4KG0A 4M4PA 4DIQA 4K1ZA 4TXWA 1V9U1 3VBHA 2NQYA 5C5TA 4LHSA 4XFFA 1GQHA 5FPAA 4AHXA 1NCQB 1VMJA 2YBSA 1FX5A 2JDPA 2BU9A 4HN0A 4LKSA 3UGHA 4EJRA 5T55A 1OFSA 1O5LA 4PT6A 3LGRA 3PL0A 1FAYA 4O9EA 4OHZA 4LBJA 5CG8A 3P3NA 1ULFA 5DXDA 2WINB 3K51A 4M3CE 2IFRA 3UJQA 1HRV3 2W2IA 4XQWA 1T6GC 2ARAA 4RR3B 1R1ZA 2YYOA 4DRVA 3T2TA 5G04L 4R9BA 1W2OA 1BYHA 5KXDA 2OX0A 4LULA 4ARYA 3FFQA 5JI7A 5IHRA 3JB4C 1Y9QA 3NMBA 3NV1A 4XQ4A 2XLGA 1OXCA 1HJGA 5C70A 1JZ8A 1VMHA 2VZTA 4RS5B 1UMZA 1ZA4A 5FYCA 3LPGA 1B35C 4P5HA 3ZKYA 1YRZA 2ZGUA 2FHRA 3AFKA 4FAHA 3H7JA 5BNNA 1RUJ2 1WD3A 1OQDA 3Q9OA 3JBG3 5E89A 4AFAA 5C8WA 1LESA 3K46A 3WDVA 3POIA 1AJOA 2D44A 2E32A 2QQKA 4DXZA 2B7YA 4JGYC 1EYBA 2VW1A 1LHOA 1CAUB 4ORFA 4QPIA 2HWD1 4Y1VA 3VBOB 5ACA2 3LFIA 3I2FA 5JOWA 1N1SA 1XNBA 3T09A 4XJZA 3DXUA 3UYJA 2WQ8A 3NV4A 1N3OA 2JDAA 1SEFA 2R043 1WCDJ 2UY8A 4IE0A 5D8AC 3UKTA 5J48A 3B69A 1HV1A 3VD9A 4GB33 3ZIWA 5C33A 1F4AA 3WZ1A 1CN1A 1JHNA 2BWCA 4JTOA 4BJ0A 5J36A 1TE1B 4NJ4A 1X36A 2ZKLA 2XPJA 3FUOA 1Q8VA 3NNLA 1RXFA 3AZXA 1V0AA 5A7SA 3VD7A 1H8TC 1TME2 3ES1A 3IMNA 2QQLA 2G9FA 3ZR6A 2HH9A 3UGFA 5BNOC 1AXZA 4LBNA 4FOWA 4Q0SA 2YROA 1AX2A 4XTPA 1WMXA 4A2UA 2R071 1VBA1 1OLRA 1Y9MA 3ZIXA 1DGWX 1KJRA 2IXIA 3CZUA 2IXCA 3VDDB 1Y7BA 3AYCA 3KVBA 4YG3A 5A32B 1HJFA 4YM3A 5H9SA 1OLME 2NYYA 3WP4A 1C8M3 2ZEXA 5GZEA 2GP3A 4LK6A 3K4AA 4JTNA 2JDNA 1W8UA 1DLCA 1LHVA 1UO9A 4ONUA 3PJQA 3U0ZA 1V6KA 3LSDA 1S0IA 2BERA 4A41A 3OOXA 1D2SA 5JCTA 1PO21 2C9AA 2NZ9A 4FPYA 5FYIA 1W2AX 4XOGA 2G9ZA 2VZQA 1H2KA 3OYWB 4IE5A 4GALA 4HKWA 4BQ3A 3I2DA 5A6YA 2ZACA 2GMEA 1AR82 3CKHA 4ISQA 1YQ6A 5FLIA 5GLVA 4OI1A 3T08A 4FPEA 5F5QA 1KXGA 3HIFA 2BDRA 2ZCWA 2BTVC 4V2VA 2VMEA 3OBTA 5L9BA 2JG9C 4Z2AA 2VBPA 3VZNA 3OBRA 2VAUA 2YPJA 2DVAA 1HQLA 2W46A 2QUOA 3KT7A 3WG2A 3W5MA 1SBFA 4RYDA 5T5PA 3MIDA 3O1UA 3ACLA 1HN0A 2V5YA 4MHRA 2NLRA 5IW0A 1VE0A 4N53C 4P9WA 4QHZA 4NIIA 4IL7A 2WO1A 2XONA 3J9SA 3Q8CA 5F32A 1ZRCA 4Q0PA 4FP2A 2P1BA 1UU5A 2ZEYA 4YVSB 3ZSLA 4K6BA 3WG3A 4AEDB 1W28A 2CL2A 3H0OA 1F5FA 2WR9A 2LRPA 1KS5A 3WVJA 4P9IA 2WZR1 1YFXA 1JYNA 3ILFA 2JE9A 3LDRA 2JECA 4ARXA 5A6ZA 5DQ0A 4CCOA 1Z7S1 3OB8A 5T5JA 5A1FA 3BPZA 3C7GA 4Q4V3 1WBLA 5IK8A 5IATA 5LEJA 1LRHA 3ABZA 3MIFA 1O3TA 4NUBA 4Q29A 3VZJA 3C7OA 2BBAA 4G3YC 3ALQA 3H8UA 1MQTB 3HMYA 1EPZA 1POQA 4QU2A 2ZGOA 2ZMLA 1RUG1 1ULGA 3S5AA 3D0SA 4FTSA 1I6XA 5KHGA 2Q8CA 3FC0A 5K8SA 2ARXA 5T5OA 1CPNA 2KD7A 1RUNA 1LKNA 2QZ3A 2ARBA 4YW3A 4LBMA 5A3WA 2YPDA 2VH9A 3OGVA 3CIHA 1NCRB 2VW0A 3TN91 1I1EA 5K0UA 3E97A 4PI2A 3SNMA 2FDJA 2PLV2 4LIUA 4XF1A 4YM1A 5C5UA 3IDBB 5C4WB 2ZTNA 4QGNA 1JU4A 4UF0A 1I3HA 4QPGC 1QQP3 4XDPA 4HL0A 1LAJA 1SPPA 2HWC3 1Y3TA 3ZFFB 1BKZA 2VMGA 1S2EA 1US2A 4PDWA 1HRV2 1XE7A 2ZEZA 2WNUA 3ME2A 1UMHA 5I0UA 4CRQA 4QX1A 4P9JA 4CEWC 3ZOIA 1NCQA 2ZEWA 4AFBA 5JVVA 5T54A 4NVPA 2Z4FA 4BCUA 4A4AA 2FCUA 4RFT0 3VBRB 5CYYA 1D4VB 3IZOA 3N36A 4LR4A 5FTTC 1XNDA 1H2LA 4LHKA 2VQTA 3FLRA 3JBG2 1OPOA 4RR3A 4GIQA 1DZQA 1COV1 4YVWC 5FZLA 4BYYA 4MGKE 1NA1B 1NYWA 2CU5A 1SLAA 1C5HA 1FXZA 1XC6A 1IHMA 1UNBA 3DPRC 1DGRN 1VJ2A 3GALA 3HR9A 2RS13 3ES4A 2JKXA 4FI9A 3WX5A 3VZMA 3I2JA 2Y0OA 5DUWA 1VBD1 4K1YA 4RS5A 5FYUA 5FZBA 2HWE1 2A5ZA 3ZMOA 2BFUS 1HQWA 4ZS2A 3GZEA 1SBEA 3WW1A 1W6PB 2GDFA 2R042 4GMP1 3NV3A 4J1WA 4LOTA 3GM8A 1UWWA 4AVVA 4BZ4A 2NN8A 1QJU1 4FP3A 5IFTA 1OI6A 4GB32 2PTMA 1ULOA 1F2NA 5CKNA 2DCYA 4OLLA 2DFCA 3RGBA 5IWFA 1DQ4A 5JZGC 3OD0A 2JDHA 2WA3A 5DN2A 5FZFA 1R093 1CAUA 4E4DX 3UGGA 3E6DA 2ZABA 2WNVC 3VBOA 3E5QA 4LE4A 1EV11 1D2QA 1DZTA 1RL3A 4JDOA 2ETEA 3BTYA 2LROA 3LIGA 1FYUA 2OQ6A 4LXLA 5FXWA 3AP5A 3J7NA 1RB8G 3CZJA 2VZUA 3K3NA 1ASJ3 3WG4A 1TMF1 2BOJA 1HV0A 2VZ1A 1GUIA 5DAWA 2LUWA 3O1MA 3ZVXA 2A3XA 2YC0A 3N9MA 2HBTA 3R4UA 3NNFA 1U5XA 3EJKA 1OLQA 1B35B 4G4FA 4KWJA 4P14A 1LODA 3ZXFA 3U37A 4L8QA 3ZXGA 4BMBA 4TLFA 2G1MA 3OF1A 1HRI1 2P3JA 3DCQA 4BK4A 2A7AA 3MYXA 3VDDA 1QNYA 4Y1ZA 5A32A 1UKRA 2O8OA 4QKFA 4JGYB 4IV1B 4UOJA 4YNIA 1WGPA 2IFWA 5FKBA 2IXKA 5FO9B 4P9YA 2YV8A 4GXLA 4CP1A 4XFIA 4Q1PA 4DQAA 2VUJA 1QDCA 1VR3A 2DVFA 1FNZA 4B4PA 1CVNA 4FOVA 1D4M1 3VKOA 1PGW2 4LPLA 3KGZA 5F1RA 1CJPA 2A3YA 5A3OA 2E31A 4P9XA 4MHUA 3RRDA 3FN9A 4FPGA 4QGLA 3WNMA 1OMIA 3DECA 3OPTA 4XF4A 1CGPA 3OYWA 1UY2A 4AXOA 3WHUA 3CNAA 4YGDA 5FFOC 1EPWA 1UYYA 4CCKA 4N7IA 4Y1YA 2W1SA 3Q8AA 1N3QA 4XETA 1H8TB 3MW4A 4OUMA 3LD8A 1VPHA 4AG4A 1G86A 3B00A 3LAGA 4K40A 3PU8A 2HKXA 4IEQA 5BNOB 4XMIA 4OUSA 3O0VA 4AFCA 3ZSJA 1RUE1 4WVMB 1LGNA 4FT8A 1AYM1 4B29A 5CA6A 1W6OB 5HPOA 4HVQA 4O61A 3PVNA 3ZSKA 4NIDA 4WM7C 4Q4V2 4WM8C 5FZMA 3MF6A 3QH7A 3WEZA 2HEYF 3PUSA 1X9PA 1WMEA 2R32A 4YVSA 1SCSA 4AVCA 4UW3A 4DXSA 4AEDA 4DMIA 1E5HA 2RS31 4IE6A 5HXMA 5F3GA 1GP6A 3OPWA 3BYWA 2DDUA 4IEOA 1PGL2 1YYNA 2DTYA 1DFQA 4Q8KA 3JB8A 2Y0IA 3C7HA 2RDRA 1MVQA 4WV8A 3VD5A 4B7KA 3PMSA 4I0AA 1OURA 2GN7A 5JAXA 1MPXA 4YLZA 1MQTA 2HEWF 5H9PA 4QXCA 4FVVA 2JG9B 1W04A 4YZ4A 3V65A 1LU2A 2PAEA 3OJBA 1QQP2 4IXLA 1XE0A 5JR2A 3AZWA 4XHBA 2HWC2 3M3CA 3GF6A 1K3IA 2B4KA 4BXSV 4LK7A 1GNYA 4MGTA 1ZBA3 1E5IA 1UU4A 4XILA 2P4EA 3K2OA 1ZREA 1LHNA 5BNQA 1NCRA 2VUDA 5LB6A 3S5QA 4YZ5A 4ZU4A 4ZZ5A 1ULCA 4AHYA 2JB4A 2HWD3 1ND2C 5C4WA 4CPBD 2HYKA 1HN1A 3AB0A 1GWLA 3OEAA 5FYZA 3IDCB 5AC91 3SEPA 3MV01 3ZFGA 1LJ7A 1JOPA 1YQCA 3ZFFA 5ANNA 1O91A 2Q1MA 3MBWA 5F5CA 5F9TA 1ZM1A 4FTBA 4X8NA 5EXOA 5EFUA 4XJAA 4IUGA 2ADEA 4LHNA 4AI1A 1AF9A 1Q8QA 4CCNA 2GH2A 4MX3A 1R64A 4UBGA 1Y4WA 2OUJA 1NXMA 2P2KA 2RS12 3DUIA 4F3JA 5I93A 1C3HA 1C4RA 2EXHA 3NKTA 1W99A 3VBRA 1GWKA 1EAH1 2R073 4L99A 5L73A 1DP0A 1VBA3 4CXXA 2UWBA 4UBHA 1BK0A 2JDMA 5KHHA 3J4UH 3HWJA 1MS5A 4NIAA 1SDWA 1BZWA 1K5MC 2A6ZA 2XVLA 3FHAA 4XYXA 5IK7A 1NA1A 1G6NA 4DUVA 3VBSC 2XHNA 4KBBA 4BXFA 2GNDA 4D69A 1LHUA 4LEJA 1G7YA 3H50A 1GLHA 1R092 3CQOA 5GLUA 4QPGB 2DURA 5DG2A 3ENRA 1UZZA 5CBLA 1GOGA 1W6PA 2JIGA 1QH7A 3OD4A 3I59B 3W21A 3FFZA 4TWTA 5JR7B 2PA7A 5FPBA 4MO3M 1ASJ2 2WABA 4COVA 2HWB1 3JD71 3ZKUA 1XNAA 5LA1A 1LOBA 3CJIB 3OUHA 3R05A 3EBRA 2BZDA 3P5BA 5F6KA 2RJLA 3J8F2 1KEXA 5FZOB 3LKJA 3PDQA 1ZVFA 3JUUA 4H2AA 5BYNA 1RVF1 2ZX1A 4KGGA 3WCRA 1UXXX 3KHBA 2BNOA 2D6LX 4LBQB 3EXUA 4ZPIA 2FDIA 2WSVA 3AVRA 3VGIA 3BALA 3RYKA 1YI9A 1WCUA 3KVAA 2JX9A 4YVWB 4LO6B 2Y60A 3ZYIB 1VBB1 4XBQA 3T1MA 1YIPA 2CGNA 3DPRB 3GBGA 4R52A 1O7FA 4XE9A 5GJ6A 2MPFA 3WDTA 5A7NA 4QQ2A 2Q8OA 1AR71 2FMYA 2C1FA 4GMP0 4IGOA 1B35A 4HN1A 5FZ9A 4K8FA 4LTAA 2WQZC 2W1UA 3MFAA 1OA2A 1SBDA 1SZBA 1OH4A 2ZMKA 3NJYA 3ZPYA 1Z7S3 5C7GA 5E1RA 3JQXA 5EZWA 1QMJA 2KXLA 3DEMA 3VHPA 4JGYA 3VUOA 2IC1A 1AVBA 3NKGA 5JZGB 2DTWA 3ZO0B 1CESA 3RSJA 1VBC1 5DDJ1 2WNVB 1W3XA 3BU7A 3I3BA 3KCXA 2XQRA 1RUG3 5ABJC 5FCCA 5D8AA 2CAVA 4COUA 1QOTA 5BY5A 4COYA 2DCJA 2UWAA 3HNBM 1DIWA 3HQXA 3UESA 1UPIA 4JC1A 5LBBA 4QB6A 4EN7B 2YU1A 1CIYA 1RC6A 1OPMA 4Y5SA 3WG1A 5GZGA 1RIRA 3KQ4B 3ACGA 1ULDA 4C0HA 4HFSA 5FDBA 3J7MA 1H8TA 3LEIA 2VNOA 4YW1A 1RITA 5CISA 5BNOA 4HT1T 1BMV1 4S2FA 1YI7A 4F83A 2EAAA 3KF3A 4PIXA 4WVMA 5FP4A 1N1YA 1W6OA 4S2HA 1W9SA 2B42B 5A6QA 4XQDA 4CDWC 2ZHMA 2UYBA 1QJZA 3H8OA 3TOJA 1AL21 4NPRA 4HK9A 2O8QA 5I0DA 1UU6A 4J25A 4Y4YA 2V5DA 1GR3A 3WXPA 3ITQA 3CDZB 4ZHNA 1OF3A 5A80A 2FDFA 1LCLA 1SLTA 1MEC3 1GOFA 4D7YA 3WY6A 5K9YA 3PURA 1COV3 3THDA 3H1MA 5BXXA 1ZBA2 3WF1A 2J42A 2WAAA 2BFUL 1PVC1 5J1XA 4LUKA 1JYIA 1AR91 4P9GA 1W8TA 2HWD2 3MLJA 1CAXB 1PK6C 5A3NA 2WN3A 4QX5A 2JG9A 2RMU1 1SCRA 1YQ8A 2EA7A 2GNTA 4QHOA 5FMDA 4GMP3 2B9UA 3TB0A 1XYPA 4B8EA 4BLIA 3NNGA 1U5YA 1QJU3 2Y6LA 2WUHA 1JZ4A 4BQ1A 5CFCC 1TME3 4W4ZA 1HXS3 3WF0A 3ZXDA 3M3IA 2IXHA 4AAPA 4DPNA 1NG0A 4WM8B 5FYHA 4NROA 1S0EA 5T3NA 3FL7A 1XRUA 4FOYA 3MW2A 4QPWA 2F4LA 5FP3A 4NPMA 2WKKA 3ETPA 2E26A 5EJ3A 5JPNB 2FCTA 4LORA 2Z79A 2MHFA 2R072 2QQNA 3FUQA 3FHQA 1VBA2 1TMF3 1J59A 2VZRA 4EWEA 4GWJA 1CZTA 3VBFC 3MIGA 2JB8A 1H9PA 4DXTA 1JZ3A 3LF7A 2ZHNA 4XBLA 4D6QA 4PCRA 1XSRA 3FX3A 3I8TA 2OVUA 5E16A 4AEKA 4MXVA 4COWA 2GC3A 4I0WB 5LBCA 5I8TA 3WNOA 2RDQA 2QTWB 4Q4X1 3TWIA 3OGJA 1PO22 1ZZ8A 5LBEA 4QDRA 4A6OA 3NAPB 1O6UA 1WUVA 3BGAA 3PVOA 4FFHA 2BWAA 1PO11 3KGLA 5HCHA 3I3EA 2UURA 4Y20B 1QF3A 2VR4A 4OI0A 4AK3A 1ND2B 4AR2A 5JOXA 2WZPP 3HBKA 4HVRA 4QPGA 2BUKA 3VZOA 4WZCA 1TNRA 4DY5A 3M3EA 5T50A 3DXTA 2ZJCA 4CUGA 3I59A 4NHMA 3KZ4C 3I2KA 1B09A 1SLIA 4QX2A 3D82A 3T2PA 4C90A 4GULA 5D21A 4DOUA 3AX4A 4CEWA 3CJIA 1BK1A 3WT3A 3FWEA 3PUIA 4I2OA 4NR1A 2IXLA 5FZOA 2RM21 3V0AB 2LS6A 2R7EB 4UFLA 1XPWA 5DAPA 2XJQA 3RZZA 4BU2A 5HV0A 5C3OA 2YFUA 5FYVA 3SC7X 1RUE3 3H7YA 3OCPA 1FOD3 4LBQA 2WFF1 3HT1A 1PVXA 4YVWA 1QY4A 1Z7S2 3KT4A 5J98B 4R8HA 1LEMA 4OQ8A 5EPAA 4C0BA 3DPRA 1E57A 2CDOA 2W1WA 3GHMA 2JG8C 4Y4RA 1WCKA 4XUOA 3VBUB 1NQJA 5KR7A 4CP0A 3NJZA 5FY9A 2RS33 2FMDA 3HNMA 1AX0A 4NWVA 5FJKA 1RUG2 2VOWA 2Z2SB 3ASIA 3NJVA 4COZA 1Q8SA 1JU3A 2RVAA 2PLV3 5FY4A 3SISA 4CDXC 2D7FA 2VNRA 4AVSA 4CDUC 3ZX7A 4A3ZA 1KJLA 2ZAAA 1KGYA 5JZGA 1OFNA 3I4IA 5FOBB 3BODA 4AHWA 1JTZX 4FXKB 2WNVA 3QBQA 1YHFA 3B5LB 4CP2A 2VO5A 1UYPA 2CYFA 3LB9A 1QNWA 4P02B 4Q4W1 3O1OA 3GXUA 4YFWA 2JIJA 2JEMA 4CDQC 2JD4A 5FUPA 1W3VA 1P8JA 4NPLA 4QHBA 3W9AA 4C1WA 3SLIA 4AW7A 2OXBA 2QQVA 4GWIA 1AHSA 4CU9A 1H1MA 1LR5A 5SV5A 2GMMA 1YQ5A 4HANA 4XW3A 5A1AA 1H8VA 4YZ2A 3RDIA 1AJKA 5LWBA 3RQ0A 3N7LA 4MADA 1MVEA 3VN4A 4YW4A 2WWUA 5ISLA 3IN9A 3EO6A 1D7PM 1MS0A 2RJ2A 4A7KA 5J37A 4CCMA 2D5FA 5AC93 4XZPA 1Q5OA 2PQSA 4PIYA 3OUIA 4V2WA 1MEC2 1CD3G 2G9GA 2X29A 5IVFA 1TZOA 4LA2A 1COV2 5B4XA 2K46A 2EIGA 3ZXEA 4EV0A 1W9YA 1ZRFA 5L7OC 2NPIA 1CR7A 3LQCA 4LKDA 3VHRA 2D6NA 2YUEA 2BGOA 4MUVA 3THTA 4BQ5A 5EP9A 5ABJB 3PTYA 5LK7B 5IK5A 4B1MA 2AH2A 2QJVA 2I2SA 4AVAA 3WQ1A 1AR61 1QJU2 2D93A 2FQPA 1OSGA 5KXEA 1HXS2 1I9RA 1W2TA 3NL1A 1G9FA 4GD4A 4BWOA 3AMQA 1AXKA 1X9TA 2PHTA 2ERFA 1TVGA 1URXA 4EROA 4OI2A 4YW2A 5FZ1A 4R9AA 2AACA 5FPLA 1IS6A 2P3IA 3QACA 4JKKA 3SMHA 1CAXA 3AFGA 5DZGA 4N43C 4XC9A 4MG2A 2ADDA 1QHDA 5E6HA 1LOAA 5JSRA 5LA9A 1A78A 1C1FA 4MZUA 1GZTA 3HPNA 3TYJA 1PMJX 4FPOB 3JD73 1TMF2 1S0BA 1O3QA 4WM8A 2H6BA 3EQEA 1C1LA 4CXYA 2E9QA 2P6HA 2FD8A 4XUTA 4B7EA 1GZ9A 3BOPA 5D2AA 2OKXA 4Z1VA 3T4VA 3BI3A 4RFRB 5FIXA 2SLIA 4CTEA 3UK9A 2HWF1 3MICA 4W6WA 4CU8A 4ZU5A 1BBT1 1XOYA 3AJZA 1EUUA 4MV2A 3RMYA 2YB7A 4GH4C 2BEOA 1VBB3 4EZ4A 1W06A 3PMEA 2GSYA 4R9DA 2MEV3 4E9KA 5FZAA 3T1LA 3ZLIA 3MLLA 1RINA 2ORZA 3IDEA 4AI2A 2DVGA 1AR73 2BP6A 4EZHA 1PHMA 1PK6B 2VMDA 1WA4A 1XXNA 4JGZC 5IJRA 3LEGA 4QX7A 3AKSA 4YPJA 5LY1A 5FZ0A 3ZYPA 1FMD3 1LENA 4CP9A 1SACA 5CFCB 5IVVA 1OA3A 3NAPA 1W0OA 2DF7A 1W0NA 3MO4A 3FBMA 1W39A 2AYHA 2XG3A 3FHIB 4G9SB 2XJSA 5FREA 3VKNA 1I5ZA 3GJAA 3MW3A 1VBC3 4Y20A 1VAVA 4XVHA 1ND2A 1UY4A 5CFDC 4IW3A 2QKDA 1SFNA 2XJVA 3VHNA 1MZFA 1YFYA 1RUE2 2YC4A 2ZGNA 1QWRA 1AYM2 1FOD2 3OGGA 3R0RA 2VQ0A 4AVTA 4KWUA 3U4SA 3V0BB 4HBNA 3AZVA 4D8MA 4IETA 4EN8B 1R1A3 1DHKB 3A4UA 1MS8A 5FZ4A 2FDHA 4N9IA 1MR5A 1UZYA 5GLZA 4BQWA 4WBBA 4XUQA 2V4VA 4UYBA 2W47A 1MS1A 2TNFA 3V0AA 5GZFA 4QXHA 1HB1A 2I45A 2RS32 2VMIA 3MHZA 5CKMA 4B4RA 4EN6B 1R081 1X50A 3AP6A 4QM9A 3VLBB 1W8WA 4RA0A 5FP9A 5LZ6A 2VZOA 2E51A 3IPVA 4QQPA 1F4HA 1W90A 3B9CA 3AC0A 1IPKA 4XURA 2W91A 1KD7A 3E5XA 4YSFA 1AL23 1L7QA 3FLTA 3F2ZA 3VBUA 3ZFGB 3N4MA 2PXJA 2CWSA 2YBKA 4YW6A 2Z5WA 3E1F1 2GC2A 2H0VA 1RUD3 1H2MA 4LITA 3TNQA 3TEZA 5A3MA 4B1LA 2PQQA 2ZAHA 4Q4Y3 2VQAA 4YW5A 3E5UA 1V6NA 2Z42A 1GBGA 3U14A 1OD5A 1VBE3 2WLQA 3FLPA 4OHXA 1XNTA 2VU9A 4NIGA 1UYZA 3OEBA 5L19A 1RUC3 2VQUA 2XMLA 4I30A 4Y5Z0 4NRQA 5FZDA 2J7MA 3T2QA 3A7QA
chains in the Genus database with same CATH topology
4AQ6A 2RMU3 2BPA2 3TRSB 5AC92 1WMFA 2A71A 1U0AA 2YY1A 1RUH3 2K0GA 4XJ8A 3B02A 2OUHA 3DF0A 5JOYA 4L11A 1OKQA 1X7NA 2JG8B 5L36A 1UAIA 2PHRA 4GA9A 3H1YA 1IS4A 4KNCA 1AL0G 1MZ6A 1PIV3 5DUVA 2D6KA 3ZXAC 4XJUA 5ACA1 1U5ZA 2E53A 4CDUB 5JPMB 3L9JT 4D3WA 5J3UA 2B39A 4U36A 4XJ9A 2ZGTA 1BVVA 5ABJA 4RGAA 4E2QA 2D6OX 1V6JA 4Q27A 3ETQA 3VBHC 2DUPA 3M1HA 4CDQB 1YUDA 3J8F3 1D0GA 1JBCA 1RUI1 3O0XA 2GALA 1RHI3 3JD72 2R063 4BLJA 1N47A 1YFUA 2VULA 1GFF2 4LT5A 3B01A 5SV8A 4HSJA 2P37A 4WVZA 1POV1 5T52A 5HI0A 5DUXA 4Q8LA 2PHWA 1RVF2 1HX6A 2ES3A 4AI3A 3U11A 2XH6A 1Q43A 3J26N 4IEUA 4ATFA 4OVEA 4IEYA 1WMDA 2D40A 2VOKA 3AJYA 4KL1A 5LK5A 1VBB2 4AF9A 4CDWA 2R0HA 3SCGA 1VLNA 4E4ZA 2MEV2 3AKTA 5BNNC 5D8AB 2VVDA 1MZEA 1LB2A 2DCKA 1AR72 2CWMA 2RM23 3MDPA 3LCPA 5H9RA 3N7KA 2NP0A 2ZHKA 3GZAA 3ZSEA 4X6QB 4RHV3 1ENXA 2WFF3 2DVDA 1FMD2 1N1VA 4OULA 2ZA9A 1KITA 4RD7A 1V6LA 3G7DA 3WQ7A 3ZXKA 1JXNA 1HLCA 2B5HA 4DFSA 1LGBA 1VBC2 4IEZA 1PK6A 4BIOA 4XF9A 2GC1A 1X33A 4AQ2A 4HLTA 1V9U3 5FLJA 3UL2A 5CFCA 1QJX1 3SITA 2A6YA 1RGSA 1R1A2 2B8MA 3H9AA 2A6VA 5I8SA 3UKVA 2N7GA 1F31A 1AYN1 4H7MA 2AR6A 4Q4W3 2FZ1A 1BMV2 4XHXA 1XYNA 2IWGB 2H0BA 2RS51 4AFMA 4Z8BA 1M4WA 4GH4B 4LBLA 1ENSA 1X8MA 4M3CF 5JWPA 3V0BA 2EVXA 3VV1A 3VBFA 2DU0A 3D6EA 3WLUA 2WT0A 4DRRA 1GANA 1AL22 3ZMNA 1JW6A 5E88A 3WD5A 4DS0A 4N53B 2E63A 2CGOA 1IGOA 1RUD2 2X5IC 3PVEA 3N35A 3N7JA 1FNYA 3AYEA 3V56A 4Q4Y2 1DLLA 4ASLA 5CU1A 1BCXA 3LA7A 1WBFA 3M7AA 1VBE2 3ZXLA 4JRAA 1HRV1 1RUC2 2Y26A 1U12A 4B3NA 4SLIA 1MS9A 2R1BA 1IS5A 5CFDB 5JSOA 4EN0A 3M4FA 4ZU7A 2RMU2 1HKDA 2VG9A 3SH4A 5GKAC 2CY6A 1SLCA 3WUCA 4PLNA 2WT2A 1RUH2 1Q8PA 1XU1A 3JQWA 1C57A 2GN3A 4IEXA 1PZ9A 4MGZE 2Q4SA 4H3WA 4QM8A 3KT1A 4XF3A 3ST7A 2QVSB 5HBAA 4Y22B 2BVVA 1A3KA 2JICA 3C2UA 1NQDA 1PIV2 1ZZCA 2JKBA 1Q3EA 5C6CA 2K2SA 2BVBA 4QQHA 2YMZA 1UIKA 4FPFA 4D7TA 3D0JA 5GM0A 1JOJA 3AMMA 4IEWA 2JG8A 3PHMA 1GZCA 3I54A 1PO23 1NY71 4QQLA 4AEMA 1WW7A 2YXSA 2P3KA 2HWF3 4S2DA 3URFA 4OI4A 5K0UC 4CEWB 4BMEA 1TEIA 4BOWA 4DB5A 4E27A 3KCCA 4M3CB 4CDUA 3KM5A 5KXCA 5FLHA 1N1TA 1RHI2 4JV4A 1ZBE1 4IEVA 4PDWC 2R062 2W39A 3RYPA 4AVBA 3USSA 2ENRA 3NV2A 4PJYA 3RJ2X 3W59A 1C8M1 3WOGA 4PF5A 1QOSA 3EHKA 3IT8A 2PN5A 1S55A 1SLBA 1W6QB 3KQRA 4CDQA 1GICA 2VPVA 1VAKA 4FPKA 3ZN4A 2OA2A 4LBKA 1JUIA 1BEV1 3LSEA 5CAZA 4PQ9A 2F4PA 2WZR3 1FPN1 1AUYA 4WVWA 4RR3C 1OQEA 3AMNA 4HSLA 3KSCA 4YM0A 3WP3A 2RM22 1WCSA 2XL9A 2ZX3A 2PHLA 2XLFA 3AXEA 2BBVA 5JOZA 1UKGA 4RHV2 1ZX5A 4RS5C 1VB2A 2WFF2 1C5IA 4CZSA 4MYEA 1KFUL 3H3UA 4QGMA 4WVVA 2R30A 4KG8A 3M3QA 3B3QE 4H14A 2ZS6B 1REFA 2NM1A 4M0HA 3MIHA 1IPJA 1LOCA 2TBVA 2ZBJA 1V9U2 3TN93 3QCWA 4ASMB 1PNFA 3N3HA 3QLQA 3MFCA 3O0WA 2ATFA 1QOOA 5GZDA 3WDWA 3M3OA 2ZPXA 2ZOEB 4QD2A 2UYAA 1LHWA 2CAUA 5GALA 1J3PA 2PAMA 4Q4W2 2YGMA 2AGSA 4YARA 4RL7A 2WQ4A 2O1QA 1XE8A 1PZ8A 2DYCA 2Q30A 1GKBA 2V73A 4BPZA 4FTEA 2XBO1 3W58A 2Q1ZB 1LOFC 4LLOA 1BXHA 4XBNA 1PGL1 2WA4A 4IV3C 3VDDC 2R49A 4CEYC 5FMOS 1H30A 1ZRDA 1QXPA 1GNHA 4Q0QA 1YFWA 3QOPA 4K20A 4GH4A 2ZGSA 4YFZA 2XUMA 1QQP1 1VBD3 2HWE3 1WLTA 2OZ6A 3POWA 1Y43B 4GQ7A 3A0KA 4FOQA 2ZX2A 4ES8A 4JGZA 5A3LA 2VXRA 4N53A 4WM7B 5EYYA 1OOPC 4DY3A 1V6MA 3RMXA 1W2UA 2WS91 1PNGA 3ILNA 3ROUA 4Q26A 1H2NA 4PLMA 2XB6C 4Q1RA 3WW4A 3GNEA 1EV13 2IXJA 1A6CA 3FBYA 1AX1A 2JJ6A 1REDA 5CB7A 2RHPA 3MEPA 3SH5A 1ND3C 1FV3A 2QNKA 5CFDA 3MI8A 5C8CC 1JH5A 2X53S 4I09A 2XL7A 3FMGA 1VRH1 1C28A 4XF0A 1OQ1A 3AP9A 1APNA 2D3PA 1O4YA 2ZZJA 1BVP1 4I01A 1HRI3 1XNKA 4C1XA 1GV9A 4Y22A 2X5IB 2HWF2 1Q8OA 1O4TA 1ENQA 1G8WA 1R091 2XKPA 5JI9A 5KHKA 2EF6A 4RQPC 4R4ZA 3ZFEC 1IQAA 1D4M3 2AZ5A 4Z92B 2XJPA 5J96B 4XEZA 1MS4A 3WDYA 1ASJ1 4MLOA 3S7IA 1NXD1 4LO8A 2EXIA 3O7OA 1XU2A 2H6CA 4HK8A 3WUDA 4EN9B 1DQ6A 1ZZ9A 1S0CA 2WFPA 5C4WC 4IESA 4M3CA 4AQTA 2GU9A 2P17A 5KC6A 3UJOA 2D43A 2A70A 3ZFFC 4AEJA 1AYM3 1YWKA 2A6XA 2WZR2 4GWMA 4MSVA 1UCXA 5H9QA 3MZHA 4Y24A 1K5MB 4Y1XA 2C5DA 2EAKA 1AXYA 3IPVB 4AGVA 1W6QA 3RNSA 3VBSB 4FQZA 1W6NB 1DQ5A 1VALA 4H7LA 1WLCA 3SHRA 3RG0A 4XFHA 4RSUA 2XHKA 4XXAA 4FBFA 3VBRC 2XVKA 4KGQA 2WIIB 5BUVA 1DU3D 1YJLA 2I74A 3AP4A 3THPA 2HEVF 1CIWA 2ZZQA 4KWLA 4NHLA 1F5JA 2XJUA 1AYN3 1NA1C 2AUYA 2XGXA 4PBPA 1HIXA 4ZXKA 1L3JA 2RR11 4N90A 3TN92 2WSUA 2OIIA 1H0BA 3WCSA 1ZZ6A 1H1AA 1J3RA 3IKWA 4JCKA 1RJ7A 1LTEA 4EWAA 1QXRA 5A33B 2Q0AA 4BE3A 3R6SA 3M2MA 2W08A 4PIZA 1KQRA 1LULA 2D3RA 1VIWB 2R6QA 3POYA 4Q0UA 1PM7A 5C9AC 1UD1A 1BQPA 3A0NA 4ES9A 2PFWA 5K7PA 5EWSA 4PBOA 1ZRRA 5FQ0B 1VP6A 1IKQA 2XJTA 3ECQA 3SH3A 3VHOA 2DWRA 2A75A 3VZLA 3AK0A 2VNGA 4X6RB 1WLWA 3AXDA 3O12A 1PGSA 4DINB 5JSPA 4JQRA 1VBD2 3WNXA 1CJDA 1QJY1 2QCSB 3WP6A 2HWE2 2VOVA 5KWRA 1YCIA 1EAH3 3VL9A 2ET7A 2ZMNA 1ZBA1 4I0BA 1DYKA 1QU0A 4IV1C 1JYCA 2FZ2A 4E4SA 2ZGMA 5DZFA 2UY9A 1JUHA 4LBQD 1S2KA 4XIOA 3PVBB 3AP7A 3MGUA 1UIJA 4S2GA 2RJKA 4HETA 1EV12 3ZN6B 1F8VA 3D5OA 3WR0A 3GZTB 3RI9A 3B9IA 1WLDA 2HWB3 4MGYE 4AE2A 4WM7A 4XDQA 4CDWB 3FZ3A 3KS7A 1J3QA 3KD4A 1ONAA 5KHJA 2VMHA 3AKRA 1RUI2 2VUAA 1RUF1 1W0PA 1RVF3 1S1AA 3U4XA 1ZBE3 4IV3B 1G9CA 4CYDA 1XNCA 4B4QA 1HRI2 2OW4A 4CEYB 1GYKA 5FBZA 4RGGA 2P34A 4AI8A 5HCAA 2B46X 2ZGKA 1V6OA 2XWBB 1RMU1 3C3VA 5CVRA 1GSLA 2R1DA 1BEV3 1MACA 2WC2A 1D4M2 4LA3A 1ZZBA 1W6MB 3RI8A 1FPN3 1U5IA 3BIWE 4FPJA 3VKLA 4UW6A 4TSVA 4NWWA 2X5IA 1OOPB 5D1IA 2E7QA 1FT9A 5FRAA 5FAXA 4META 1QGLA 3ZYJB 5DDJ3 2GNMA 2Y38A 4N7UA 4ZKTB 1DBNA 4DNYA 1LU1A 1ND3B 1UPSA 5DUUA 2UU8A 3OY8B 2ZX4A 4NOTA 4WZFA 4E2GA 5C8CB 4FCAA 4MH0E 2DFBA 1FI2A 3KMHA 1IS3A 3VBFB 3CLPA 3VKFC 2GNBA 4M00A 1QJX2 2ILMA 2FBEA 1XQNA 4BM8A 1Z78A 3N7MA 2SBAA 3L2YA 5J09A 2QE3A 4I3PA 1NE4A 2PELA 2JENA 1K5MA 1AYN2 2WT1A 3V64A 3B93A 3VBSA 3GHNA 3WINE 2RS52 4KH9A 4BA6A 4RQPB 2XBO3 1G9DA 1W6NA 3ZFEB 3IWZA 5HXVA 2VVEA 3UKNA 4BIFA 2VW2A 4AWDA 5B2GB 5FMOL 4EWDA 4UW5A 5BNPC 3X29B 4UXAA 3GYDA 4URTA 4J6GA 1VB4A 3O5SA 4W6XA 2PHFA 5E8AA 1KDKA 3JCIA 1X8EA 1C8NA 5LRRA 1PVC3 4A7ZA 1AR93 4ATEA 4IEPA 2XLAA 2WLPA 3L2HA 5AVPA 3MIBA 1J58A 4Z07A 5A33A 3AMHA 3VKMA 2W52A 4L9BA 3CJIC 3HN1A 1RUJ1 3CL1A 2D98A 2WS93 5DG1A 5AVAA 2G4IA 1CAWB 2YZ4A 3M70A 3S6PA 2O0OA 4I02A 4D7SA 2ZGQA 2ZGPA 3NSTA 5FQ0A 1Z0HA 1MEC1 5LRSA 1EAH2 4CDXB 4FSJA 4FQ4A 3OPZA 5JMCA 3ZDSA 1A8DA 1DZRA 4YGEA 2PHXA 1VRH3 3MPBA 5CNAA 4AGGA 4MXWB 4LLFA 5AFBA 1XYOA 4JAAA 3PLQA 1YLLA 3KCYA 5EV7A 2D5HA 2LALA 3AKQA 4Q4X3 1TME1 1YO8A 1HXS1 1NY72 4SBVA 2DUQA 1DQ1A 1ZNPA 1PO13 5C9AB 2HWB2 1IKPA 4OHYA 2XWJB 1DGWA 3JZVA 1G9BA 4QQOA 3APBA 3AZZA 1GQGA 3HAGA 3OTFA 4XTMA 1LEDA 3ILRA 4Y26A 5J7MA 3RWNA 2GC0A 3HBZA 3ZN6A 4Q2FA 4AGRA 1KS4A 1ZBE2 4OHVA 1CAVB 4J1XA 1OA4A 1SFYA 2JE7A 3USUB 4GWNA 4A3XA 1C8M2 4C91A 1KRIA 4AYUA 5L7OB 1H1IA 3MLKA 1DG6A 1H4HA 1LOFA 5JIAA 5JIUA 2E7AA 1AR81 3WP5A 1BEV2 4IV3A 1X82A 4MGIE 5IUQA 4GKXA 2DU1A 3HD8B 1FPN2 4QPIC 2D97A 3AKPA 5JLVA 4CEYA 1O5UA 3KB5A 1CONA 2W0XA 5BV6A 1S0JA 5DDJ2 2TUNA 5FPZA 4N43B 4OZXA 5FOJB 1S0DA 1D0HA 2QQPA 2A6WA 4Y1UA 2IZWA 1W6MA 3H1WA 3JU9A 1MZ5A 1IOAA 4XMAA 5KBFA 4XJWA 1QXJA 1OOPA 2RR13 1UN1A 4OHWA 5CADA 4UW4A 1QDOA 1V00A 3AZYA 3B7MA 3VZKA 1FOD1 2PAKA 4HPKB 4K21A 3BOWA 3LA2A 1ND3A 2CTVA 3OY8A 1LOGA 2X8KA 3I7DA 3GZUC 1NOVA 1UF2C 4R4XA 5C8CA 4LUMA 5I0RA 1FATA 4V1PA 5FO7B 3RJRA 4FPHA 3CU7A 2XBO2 2C0ZA 2CNAA 4JGZB 2EXKA 3BCWA 3RS6A 5DZEA 1A8MA 4O9GA 2PLV1 4LO7A 4KU8A 3AMPA 2B45X 2QDNA 2JXAA 4JRLA 4ITCA 3RYRA 2XJRA 4LNVA 4XFGA 2W68A 1SQ4A 1UW8A 3DKWA 3ZXJA 4RQPA 1PVC2 5BPXA 3SXWA 4X8PA 1AR92 3ZFEA 5JDBA 4L2NA 1DDLA 2A3WA 1QJY3 4XPVA 2AENA 4LO4B 4FPLA 1S2BA 1HQNA 1AR63 3S7EA 3NAPC 4QMAA 1AZDA 1ENRA 2YHJA 1UX6A 4GKYA 3WW2A 3ZYRA 3JBG1 4E2SA 2WS92 4AHZA 3WHTA 3LOIA 4QT6A 4IERA 5I0TA 2JDZA 1DGRA 2GMPA 3ATGA 1G9AA 2VECA 2KA3A 1YJKA 3B94A 2QZ2A 3QH6A 1SLLA 4U2AA 3WQ0A 2R041 4XIKA 1QH6A 3WW3A 3BTAA 3TAYA 1H9WA 2GAUA 1IZ3A 3FE5A 1VRH2 3KLSA 4GB31 5F6LB 4N9HA 3K48A 3NO8A 1CAWA 1RUF3 3LZZA 4JDNA 2OZJA 5BNPB 4YM2A 1PMIA 2ZX0A 1BBT3 4JDMA 4Q4X2 4CDXA 4M0NA 1O3SA 4LBOA 4W65A 1V6IA 4L92A 1DGLA 1PO12 1RMU3 3VBUC 3R4SA 1DYPA 2BW8A 3MPPG 3ZYGA 4MXWA 1V70A 2A73B 2EALA 2WNUC 2KM2A 2YGLA 2DCTA 3CO2A 2XKOA 1VAMA 5CG9A 1Q56A 1N3PA 1NCQC 1NE6A 1ZZ7A 1NLSA 1PZ7A 2LTNA 4FXGB 1GZWB 2I07B 1J1TA 1CX4A 5C9AA 4MVTA 2PHDA 4H55A 4W6YA 3S0MA 4NN0A 3NWKA 1LOEA 1EY2A 4FO9A 4KU7A 1O4ZA 4P9LA 5T5LA 4HVOA 3LA3A 3ZN5A 1CAVA 2LM3A 3UV9A 3TBDA 1PGW1 3USUA 2MEV1 3D4KA 3SCHA 1TQ5A 1CPMA 2DVBA 2NMNA 4HMZA 5L7OA 4YGBA 3IBMA 4KQ7A 4YGCA 4LHLA 1FV2A 1YNAA 4XFAA 3VBHB 2OYZA 1FMD1 1R083 2TEPA 1H4GA 3NW4A 3QD6A 3VBOC 4YZ1A 4YZ3A 4IV1A 2BNMA 3E6BA 5I91A 2RR12 5I8YA 5KC5A 1POV0 3DN7A 5IT6A 4A7YA 2ZKNA 4Q4V1 5AFEA 4QPYA 4N43A 1LGCA 5KXBA 2VOXA 3U10A 2WNEA 2NMOA 1RJ8A 4HZFA 4Z82A 5IK4A 1SMVA 2Z69A 1R1A1 3P3PA 1GNZA 5BNNB 2RE9A 2DCZA 4DZGA 1DQ2A 4HKOA 5FO8B 2VY0A 2R0FA 1HDKA 2E7TA 1ALYA 1ZYBA 2WJSA 3CJXA 4HPKA 3D8CA 4QPIB 1NLRA 1YXWA 2UWCA 3ELNA 1WW5A 3WDUA 1EP0A 2XVGA 2GH8A 3GBFA 2VVFA 4NHKA 4BH9A 1RUOA 5GLWA 4NO4A 1RUJ3 5LEKA 2HWC1 3TNPB 1NZCA 1O3RA 3CF6E 1RUD1 3VL8A 3WV6A 1DF0A 1QJY2 1F9KA 1UL9A 3BB6A 1RTVA 3INAA 4Q4Y1 3DV8A 4K7JA 5ACA3 4PLOA 1REEA 4YYOA 1AR62 4IQPA 1VBE1 2DV9A 4I3GA 1RUC1 3U07A 4XFBA 3WDXA 5GLTA 4M01A 5HCFA 2VGDA 3FJSA 4TZDA 1WW6A 2R16A 1BJQA 4OFGA 2PYTA 4Q0VA 1OHFA 2RS11 1RUH1 2ZHLA 2ZGRA 2ET1A 4YVSC 1RUI3 4K9SA 4AEDC 5CIRA 4LE3A 2BQPA 4HKLA 4LO5B 3NVCA 2BNNA 1CQ9A 3DGTA 5HCBA 3AYDA 1POV3 1PIV1 3HT2A 1RUF2 5TSWA 1KDMA 2D6MA 1BBT2 4R9CA 2GZWA 1KFXL 1MQTC 4AFDA 1YIFA 4L97A 4D94A 4XXPA 4INDA 2D6PA 1RMU2 2DUOA 4FAGA 2Q5TA 3AYAA 4ISRA 1AR83 3ZSMA 2ZGLA 1QKQA 1NCRC 5BNPA 3J8F1 3DL3A 5I0SA 1S0FA 2WL1A 1MS3A 1RHI1 3IM0A 3LWCA 2R061 3G6JB 2CGPA 4YG6A 2AREA 2V09A 1S0GA 4JVAA 4QXKA 4YRDA 2PHUA 3ZFGC 1M06G 1TNFA 3H3ZA 1LECA 3RPQA 4AI0A 2F6BA 2BGCA 1J1LA 3MIEA 4F7ZA 4YG0A 5EYXA 4XFCA 4F8AA 4AQSA 5FPXA 1DQ0A 2OPKA 4KWKA 1ULEA 1QJX3 3GBWA 1JN2P 1GZWA 2D3SA 2QDRA 3AM2A 3IIAA 4Z2WA 5KHIA 4TYSA 3POSA 2YDEA 1HW5A 3M8LA 2CV6A 2EXJA 2QFEA 4K3UA 2MNGA 3PJYA 2BYVE 3S30A 2E6VA 3O14A 3CEWA 4RHV1 5K0UB 4BHPA 3E6CC 4FPCA 2RS53 1R082 3PNAA 2WWSA 3LOBA 2HJIA 2K9ZA 4PDWB 3SCFA 3MF9A 5GZCA 3R4DB 1WW4A 2WNUB 1WD4A 4KG0A 4K1ZA 1V9U1 3VBHA 2NQYA 4XFFA 4AHXA 1GQHA 1NCQB 4HN0A 1FX5A 4EJRA 5T55A 1OFSA 1O5LA 3LGRA 1FAYA 4O9EA 4OHZA 4LBJA 5CG8A 3P3NA 1ULFA 5DXDA 2WINB 3K51A 4M3CE 2IFRA 3UJQA 1HRV3 4XQWA 1T6GC 4RR3B 1R1ZA 2YYOA 4DRVA 3T2TA 4R9BA 1BYHA 5KXDA 4LULA 3FFQA 5JI7A 3JB4C 1Y9QA 3NV1A 4XQ4A 2XLGA 4RS5B 1UMZA 1ZA4A 1B35C 4P5HA 1YRZA 2ZGUA 2FHRA 3AFKA 4FAHA 3H7JA 5BNNA 1RUJ2 1WD3A 1OQDA 3Q9OA 3JBG3 5E89A 4AFAA 5C8WA 1LESA 3WDVA 1AJOA 2D44A