2WS91

Equine rhinitis a virus at low ph
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
246
structure length
246
Chain Sequence
VTNVGEDGEPGETEPRHALSPVDMHVHTDVSFLLDRFFDVETLELSNLTGSPATHVLDPFGSTAQLAWARLLNTCTYFFSDLELSIQFKFTTTPSSVGEGFVWVKWFPVGAPTKTTDAWQLEGGGNSVRIQQLAVAGMSPTVVFKIAGSRSQACGFSVPYTSMWRVVPVFYNGWGAPTKEKATYNWLPGAHFGSILLTSDAHDKGGCYLRYRFPRANMYCPRPIPPAFTRPADKTRHKFPTNINKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords P1
publication title Equine Rhinitis a Virus and its Low Ph Empty Particle: Clues Towards an Aphthovirus Entry Mechanism?
pubmed doi rcsb
molecule tags Virus
total genus 32
structure length 246
sequence length 246
ec nomenclature
pdb deposition date 2009-09-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2ws9100
1BEV1 1TME2 4PDWB 4CDUA 1COV1 1VBD2 1FMD1 1QQP1 4QPIA 2RMU1 5C8CA 4Q4X3 1ZBE2 4CEWC 1PO23 2R062 1MQTA 1RUI3 5BNPB 2HWB1 1VRH1 4WM7C 1K5MC 5FMOS 1VBE1 4Q4V1 4FSJA 3ZXAC 3ZFGA 4N53A 2RS13 5CFCA 1QJX3 3DPRA 1TMF3 5C4WA 1AR81 4RS5B 1HRV1 1VBA2 2RS32 4FTSA 1EV12 4QPGB 1VB4A 2WFF1 1B35A 1NA1C 4CDQC 2X5IC 1PO12 5L7OC 2RR13 2VQ0A 2HWD3 4AEDB 3CJIC 2RS52 5ACA2 1BBT1 5BNNC 4Q4W2 1PGL2 4GMP3 3ZFFA 1ZBA2 5K0UB 5C4WB 1EAH2 1HRI2 1FMD3 1FOD1 2HWC2 1QQP3 2RMU3 3VBSB 5AC91 1RUC2 1H8TB 1VBC2 3JD71 4JGYB 2HWB3 1ND3B 2BFUS 2GH8A 1PGW2 4FTBA 4CDWA 4CEWA 1Z7S1 4Q4Y1 4WM7A 1K5MA 4IV3B 1C8M1 1MEC3 1QJY1 1AR83 1HRV3 1RUE2 2WZR1 1NG0A 3VDDC 1NOVA 2WFF3 1TME1 5J96B 1VBD1 1BMV2 4CDXA 4EJRA 3VBHB 1ZBE1 5J98B 1V9U3 1NA1A 2R061 1RUG2 4PDWC 1BBT3 4CDQA 1D4M2 4CEYB 1F8VA 2FZ2A 2WWSA 1FOD3 2ZZQA 4JGZA 1RB8G 3JD73 1VBA1 2RS31 4N43A 3VBRA 1EV11 4IV1B 3VBFA 1PO11 1Z7S3 4NWWA 5DDJ2 1RUF2 4Q4Y3 2FZ1A 1HXS2 1AR62 4WM8A 2RS51 1R082 5ACA1 1QJZA 1NCQC 1QJY3 4Q4W1 1PGL1 2RM22 2WZR3 3NAPA 4AEDC 1ZBA1 2MEV2 1RHI2 4JGZB 1TME3 1EAH1 5A32A 1HRI1 1AL22 1VBD3 2HWC1 3IDEA 3VBUB 1RUC1 5K0UC 1ZBE3 5JZGC 1VBC1 2BBVA 2R063 1POV1 1QJU2 5ABJB 3JB8A 3VBSC 1PGW1 1H8TC 1NCRB 4JGYC 2WS92 3TN92 3ZFEA 1HX6A 2ZTNA 1PVC2 5CFDB 1VBA3 1RUE1 2RS33 1VBB2 1EV13 4RR3B 1CD3G 4YVSB 1AUYA 2ZAHA 1ND2A 1RVF2 1BMV1 1PO13 2TBVA 3VBOA 1M06G 1AYM2 1RUD2 2RS53 4FTEA 1RUG1 4Q4W3 1D4M1 1C8NA 2QQPA 4CDUB 2HWF3 1ZBA3 4QPIB 5C8CB 1OOPC 1EAH3 1NCQA 1HRI3 1MQTB 4Z92B 4GB32 1A6CA 2HWC3 5D8AA 1NY72 1VBC3 1POV3 5BNOC 3ZFGB 4RQPA 4N53B 4YVWC 3VBOB 1R1A3 5CFCB 2GSYA 3DPRB 5JZGA 1BEV3 5DDJ1 1RUF1 1COV3 1HXS1 1AR61 1R081 1E57A 1B35B 1RUE3 2RM21 4GH4C 1AYN2 2R042 1AR72 1VRH3 4LLFA 2MEV1 1RHI1 1VBE3 4Q4V3 1AL21 4RQPB 3ZFFB 2IZWA 5C9AC 1QJU1 2WLPA 1D4M3 1FPN2 2WS91 1GFF2 3TN91 1PVC1 1OOPA 1NCRC 3J8F2 4CDWB 4CEWB 1VBB1 2BFUL 3M8LA 1R092 2X5IA 5L7OA 4WM7B 1K5MB 3CJIA 4Y5Z0 1RVF1 1DDLA 5DDJ3 5BNNA 5BNPC 5BNOA 4YVWA 1AYM1 1HXS3 1AR63 1RUD1 4YVSC 5AC93 3LOBA 1POV0 2RM23 4GMP0 4CDXB 2MEV3 1RHI3 5A33A 1NA1B 4RS5C 1MEC2 1AL23 4GH4A 4GB31 4CDQB 1VB2A 1NY71 4QPGC 5C8CC 2HWE2 4BCUA 1C8M3 1QJU3 1F2NA 3JBG2 1MQTC 2XBO2 1RUJ2 1W39A 1RUH2 5C9AA 1V9U2 2WS93 3ZFGC 3HAGA 4N53C 4N43B 3VBRB 5CFCC 2BUKA 3VDDA 3VBFB 3DPRC 1PVC3 1HQNA 5C4WC 1AYN1 1VBB3 2R041 1AR71 5LK7B 4RHV2 4WM8B 1B35C 1RVF3 4PDWA 1SMVA 1AYM3 1ND3C 1RUD3 3NAPB 1ASJ2 1X36A 1RMU2 5A32B 1FPN1 5BNPA 3ZFFC 4IV3C 2PLV2 3FBMA 3J8F1 5ACA3 2Y26A 4RS5A 2BPA2 3S6PA 1R091 2XPJA 1WCDJ 1PIV2 4QPGA 3VBHC 1AR92 3ZFEB 1VAKA 2R072 4CDWC 4RFT0 4CEYC 4AEDA 1RUC3 1OHFA 1ND2B 5FMOL 1AYN3 2R043 1AR73 1IHMA 5K0UA 4Q4X2 1MEC1 1PO22 4IV1C 1RUI2 4CDXC 2HWE1 3VBSA 4NWVA 1H8TA 3JBG1 2XBO1 1NCQB 1FPN3 4JGYA 1RUJ1 1ND3A 2RS12 5D8AB 1QJX2 1RUH1 1V9U1 1TMF2 4IV3A 3J8F3 2HWF2 4JGZC 1RUG3 5JZGB 4N43C 3VBRC 1R093 4RHV1 3VBUC 3VBFC 2RR12 2HWD2 5ABJC 3VBHA 4WM8C 1X33A 1R1A2 1ASJ1 1RMU1 1BEV2 1CJDA 1COV2 3NAPC 1FMD2 4CEYA 1QQP2 2PLV1 2RMU2 5CFDC 1RUF3 4RR3C 2HWB2 1VRH2 2DF7A 2HWE3 1R083 1VBE2 4Q4V2 3JBG3 2XBO3 4SBVA 1PIV1 1RUJ3 4IV1A 1AR91 2R071 1RUH3 1OOPB 1AR82 4CDUC 1HRV2 3ZFEC 2X5IB 4QPIC 5L7OB 2WFF2 3CJIB 5BNNB 5BNOB 4RHV3 4YVWB 4Q4X1 1ND2C 1PO21 1BBT2 1RUI1 3TN93 3VBOC 3VBUA 1ASJ3 1RMU3 5A33B 4GH4B 5ABJA 2RS11 1QJX1 4Y4YA 1FOD2 2PLV3 1TMF1 1NCRA 1OPOA 5AC92 3JB4C 3JD72 5D8AC 1AL0G 2HWF1 5CFDA 5C9AB 4RQPC 1PIV3 1Z7S2 1AR93 4RR3A 2RR11 4YVSA 4Q4Y2 2HWD1 2R073 3VDDB 1C8M2 1QJY2 4GB33 4GMP1 5FOJB 2WZR2 1R1A1 5GKAC
chains in the Genus database with same CATH superfamily
4FI9A 3I3QA 2RDNA 1LKNA 4PDWB 2KR2A 5T50A 5T52A 4XW3A 4AVCA 2E7AA 1COV1 3D0JA 3RZZA 1FV2A 4FPLA 5FXXA 5IK8A 4QPIA 4Q4X3 3ACHA 2UWCA 3LPFA 3MF6A 3MIHA 2CTVA 1PO23 1Q56A 1MQTA 2BQPA 2QQOA 2HWB1 1S0IA 3E6DA 3KVAA 4ONUA 4QKFA 1M4WA 2LM3A 3WX5A 4CPBA 4OZXA 2A6ZA 1OPMA 2ET1A 3ZXAC 3AK0A 1KJLA 3BOWA 2VJXA 5FREA 5JOZA 2VNGA 3NSTA 4ISQA 4AQSA 5CFCA 4XJ8A 5FZDA 3MPPG 1BXHA 5FZFA 1X9PA 2YFZA 5JR2A 2A3YA 5I0DA 3OGJA 1H2MA 1X8EA 4PBOA 1HRV1 2RS32 1LNSA 4RS5B 5FLHA 3RI8A 3AZVA 2H6BA 1XE8A 3B01A 4TZDA 3FLTA 3M2MA 4CU6A 2ZEXA 1VB4A 3DF0A 2DDUA 4IE6A 5EIYB 1B35A 1EUUA 1MACA 1RJ8A 3MW2A 5FLJA 4CDQC 4N7UA 1CGPA 1A8DA 2X5IC 1PO12 4INDA 4LUMA 5L7OC 2VQ0A 3T4VA 1LGCA 1XYOA 3OUIA 2VTXA 5LA0A 5FXVA 1AXKA 3FHIB 5FAXA 1GU3A 3UT0A 5ACA2 5BNNC 3UGFA 1CPMA 2JG9B 3A22A 3FUQA 5FYCA 3RZLA 4BZ4A 1XNTA 2VZOA 4UWDA 3O0XA 1CAVB 4IE7A 5A3OA 5C4WB 2D6LX 1VLNA 4GKYA 3RG0A 5JOWA 1YJKA 1FOD1 2HWC2 3FJSA 4JQRA 5CG8A 5GJ6A 3I59A 5C3RA 1UWWA 3DYOA 1RUC2 4LMFA 3T1LA 2DUOA 3UJOA 1ULOA 3DN7A 1UCXA 2O8QA 5GLTA 2HWB3 2ARCA 3KV4A 4F83A 4XUOA 1PGW2 4AI2A 1U12A 4CEWA 2CNAA 4META 2PELA 2ZMKA 1KFUL 3CIHA 4O65A 5IWFA 4E2GA 3WNPA 4WM7A 3HWJA 2WN2A 4QAWA 2QCSB 1DG6A 2G1MA 4JKLA 4EN8B 2PN5A 4H7LA 4LBQA 1QJY1 4URAA 4G9SB 1YLLA 1CQ9A 4FPJA 1HRV3 2XLFA 1RUE2 1F4AA 2WZR1 1F35A 1NG0A 5FPZA 2D3PA 1V6MA 3RI9A 3VDDC 3CU7A 3FMGA 4Q0SA 1SFNA 2J1SA 3USSA 1O3RA 5J96B 1BMV2 4BHPA 2WT0A 4AI9A 1SQ4A 3B5LB 3AYAA 4P5HA 3VV1A 2P3YA 3UGGA 1D4VB 5A1AA 1JZ7A 2WO3A 1D4M2 3OBTA 4QX8A 4K3UA 1PK6B 2Z79A 3CQOA 4CEYB 2W08A 1OLRA 5CAZA 3RWKX 4C1WA 4W4ZA 1JHNA 1FOD3 2XLGA 1XPWA 4JGZA 3AYCA 4XQDA 3AXEA 2VZSA 2XUEA 3ECQA 3OUHA 2RS31 1N47A 3VZJA 2EALA 2VECA 2YU1A 4IV1B 3VBFA 4HKLA 5FUPA 1VE0A 5GZDA 2VOXA 3GJBA 1IKQA 3FFZA 3POEA 4OMDA 1PO11 3K4ZA 4XJAA 2VQTA 4FPYA 4LIVA 5A70A 3BUCA 4GXLA 2JECA 2FZ1A 2R32A 2Z5WA 1C4RA 3Q8EA 2OKXA 1AR62 1W6QB 5ACA1 1R082 2ZGOA 1YJLA 3T30A 1QJY3 1IPKA 4JDOA 3SH3A 3VKLA 2WZR3 2ZEZA 4CCEA 3DCQA 1YUDA 4CP1A 3UETA 5EYYA 1IS4A 4AVAA 3OBRA 1FNZA 2Y8KA 4FCAA 3SCFA 3ZKUA 3ZXJA 1IS6A 2HWC1 4PLNA 3IDEA 4KG8A 3NNFA 1RUC1 5K0UC 3NJXA 3OGVA 1OFNA 4N9IA 2ZCWA 4FPCA 1POV1 2VMIA 4E27A 1ULEA 2CGNA 2D6MA 3JB8A 2IVJA 3VBSC 1PGW1 1SZBA 4LOTA 2Y0OA 1F15A 3B02A 1NCRB 2R0HA 1UOJA 4K21A 3RZJA 3ORJA 2DVAA 2WDBA 1W2TA 2QQKA 2LS6A 2WS92 2WT2A 1G8WA 2A3XA 4K6BA 1LHOA 1SEFA 2IWGB 5GLZA 2WNEA 1DQ2A 5I0SA 1JS9A 3Q9OA 1UX7A 3RZKA 4UFKA 2R6QA 1RUE1 2RS33 1MS3A 2CDOA 3AL6A 3EMRA 1V70A 3O14A 1H6XA 2QQIA 4P14A 1AUYA 5L9VA 1S2BA 1J58A 4LIUA 1BMV1 3MBWA 1PO13 3WLUA 1OI6A 4LA2A 3LA7A 2KM2A 4AWDA 3VL9A 5LBBA 1C8NA 1D4M1 2YGMA 4URTA 1LECA 1ZM1A 3MICA 3ZX7A 1UD1A 4AVBA 1OA4A 1SPPA 2YC0A 5CIRA 5C7GA 2O14A 2JB4A 1I6XA 4FFHA 1V00A 2FDHA 1A6CA 2HWC3 5D8AA 3ZIWA 4IEQA 4WVVA 4B7EA 1GR3A 1JYVA 1UZVA 1POV3 1MS1A 4DFSA 5GM0A 4RGAA 5F6LB 1H8VA 5LB6A 3IDCB 1MVQA 2QBXA 2GSYA 5A7WB 5JZGA 1PM7A 4HN1A 1JUHA 1BEV3 2VXRA 5JSPA 4XZUG 2IVIB 4MH0E 5DG1A 1T6BX 1VAMA 4ASKA 1AR61 1GLHA 4QKDA 3WP3A 3WDWA 1UPSA 4NAOA 1R081 5JXHA 1O3SA 3O5SA 1K3IA 3U10A 1CVNA 1H1MA 1J1TA 1Z0HA 1OC1A 1RUE3 5G05L 2DURA 2R042 2WLQA 1CAXA 3KB5A 4XUPA 2DV9A 4LLFA 5FYSA 4Q4V3 1IOAA 1UMZA 1ZZ6A 3LEKA 2I2SA 3I4IA 4ISRA 4LK7A 3O0VA 4P5YA 4A4AA 1HJGA 4RQPB 5HI0A 1JI6A 2JD9A 3I7DA 5FWJA 4YYOA 2WO7A 1ZVFA 2YHJA 1D4M3 4YFZA 1BJQA 3GCXA 3GNEA 4P02B 5T5PA 1ENSA 1BHGA 4QQ2A 3KHBA 4NIHA 3OEAA 1O3QA 3AKQA 2WS91 1XSRA 4AL9A 4XUQA 2PXJA 1ULGA 2P6CA 4Q26A 3RJRA 3UGHA 5BNQA 4QX3A 1KGYA 4IDZA 3SKJE 1FATA 4NHMA 2JG8C 3T2TA 4CDWB 5EP9A 3CZJA 1SLTA 2HYKA 4HVRA 4QPWA 1UOBA 2BFUL 2X8KA 4NHLA 5GZGA 5IATA 2BVVA 1K5MB 3WP4A 2R0FA 2WRAA 2YYOA 1WLTA 2BOIA 1D0GA 4BDVB 5BYNA 1OQ1A 5F37A 1MZEA 1DDLA 5K4LA 3HR9A 2BGOA 4YVWA 4YVSC 1AR63 4Y1VA 4AHWA 1JZ8A 1W0OA 2RDQA 2DU0A 3UNPA 1W8OA 1K45A 5LASA 1RUOA 1IG0A 2VY0A 3M70A 4Y3OA 3GZUC 3SC7X 3NW4A 2ATFA 4DMIA 3CLPA 5C3PA 1LGBA 4W6YA 1D2SA 1YYNA 2J1UA 2FDGA 5A33A 1NA1B 2UY9A 3WW3A 4YFWA 5FXZA 4QPGC 2B45X 3GALA 3TB0A 4CCDA 2ZXQA 3KSCA 2ZGNA 3C7GA 4Q0VA 1VALA 5JXIA 1MQTC 1VRBA 1DQ6A 3AMMA 2FQPA 1W39A 2E9QA 5IK5A 5DN2A 1GMMA 4BXFA 4C90A 2WS93 4XAEA 4COWA 1W6OA 5CFCC 2E6VA 1POQA 4V2WA 5CEHA 2I07B 3LFMA 3SH4A 4P9XA 1UXZA 3GZTB 3URFA 1GKBA 2R041 5LK7B 1CIYA 2RG4A 4RHV2 3PURA 2DBIA 4WM8B 1B35C 1VPHA 2V73A 2JDNA 1C5IA 3CZUA 4PDWA 3SH5A 3AB0A 3MIEA 4L92A 2VR4A 1W8HA 5DMYA 4R52A 4QB2A 2Z2SB 1WBLA 1X36A 3HT2A 4H14A 3RFRA 5A3MA 5HCAA 2ORXA 1YIFA 4MXVA 5KXEA 4Y1UA 2ZGQA 2C5DA 4E8CA 3E5UA 1GQGA 5LA1A 4R9DA 5FPAA 3M3QA 3ILRA 4I02A 3JXSA 4OMCA 3WD5A 5CISA 1GWLA 3DUIA 5ANNA 3FBMA 2OPKA 2D6KA 1SDWA 3DEMA 5A7NA 4OHVA 3WHTA 2B9VA 4RS5A 2BPA2 2JICA 2XPJA 3IMNA 1H30A 1PIV2 5LBFA 1W28A 2Q1MA 2QE3A 3N9PA 2VBDA 1E5RA 3ZKYA 1GQPA 1O7FA 1XB9A 5JCTA 5J37A 2OX0A 4OQ9A 3DV8A 2AH2A 4XIOA 3OD0A 3V64A 1OLQA 5CNAA 2AC1A 1ND2B 2R043 3NV3A 4QU2A 2JG9A 2ZEWA 3LEGA 4LUKA 3SHRA 3TEXA 1SFPA 3WF0A 3UJQA 4LEJA 2YBKA 2ZGRA 2VCCA 3IB3A 1CAVA 3ZYBA 2XHNA 3H1MA 3NL1A 4QXBA 1QOSA 2WAOA 1X7NA 1ZA4A 1RUI2 5JDBA 5FZ4A 3HN1A 4Q0QA 5JMOA 1UNBA 4NWVA 1FT9A 3D6EA 4Z2WA 4MGZE 3O1SA 3CL1A 5A6YA 1RTVA 4N90A 4BLJA 4QX1A 2HJIA 3T2PA 3BVCA 2C26A 2RS12 1S0EA 3M4FA 1QJX2 3ZDSA 1IQAA 3POIA 4HK9A 2DFCA 1TMF2 2I74A 4B4PA 3IIIA 5JUVA 3OCPA 3ZN6B 5FZ1A 4YGDA 4IL7A 1ST8A 2VTXJ 2AR6A 4FQ4A 2HWF2 4JGZC 3ZPYA 4F3JA 5KHJA 1LHUA 5IVCA 3OG2A 4LORA 3NV4A 5FY9A 3MV11 3GCWA 4V2VA 4RHV1 4D6RA 4YZ2A 1QU0A 1OKQA 5FY0A 4NE9A 3VBFC 2RR12 4E8DA 4CVUA 5LRSA 2W87A 2CL2A 4ATEA 4ET7A 2IXHA 1V0AA 2JB8A 3FLRA 4EQVA 2XKPA 2J22A 4Q8KA 4LHNA 4PIZA 4XJWA 2WQ8A 4XVHA 3LZZA 5K8SA 5FWEA 4DO0A 1KDMA 1CJDA 1W8ZA 1PK6A 4CUCA 5IVFA 4CEYA 2BNOA 2RMU2 2AEZA 3ACFA 3AYDA 1LOBA 4HN0A 4MGKE 3BYWA 4UW5A 2OW4A 4UW4A 3H9AA 5CFDC 1GYKA 1RUF3 2G19A 1IG3A 5FO8B 4RR3C 4FP3A 3OGSA 4NIDA 2ID4A 4AGVA 3IDAA 1GQHA 2PHTA 2WA3A 4RSUA 1VBE2 3W21A 3LPGA 1W9TA 4JQTA 3KCCA 4BQ1A 1PIV1 1W9FA 3KQRA 4IV1A 4LT5A 1J3QA 3U07A 2FCVA 4QM9A 2ZS6B 4PIXA 2NP0A 2GP5A 4QWNA 1UZZA 1UY0A 4YZ3A 1G9FA 5JXJA 1OOPB 1A8MA 2WABA 5F32A 1UKGA 3I3DA 3E5QA 1VR3A 2ZX2A 4WBBA 1W6QA 1DQ0A 2D44A 4KG0A 3CJIB 4DIQA 3VKMA 2CU5A 4AR2A 3A0KA 3W59A 1QHDA 4RHV3 3Q8FA 3OBZA 2E51A 1PM4A 3MF9A 3NKTA 4Q0UA 2CAUA 3B9IA 2Q1ZB 1LCLA 4J25A 1HN1A 1RUI1 4UT5A 5HCBA 4QKNA 2JENA 3U14A 2XDVA 5HPOA 1LENA 1MS5A 4EWAA 4I3GA 4DUVA 5BUVA 3W5NA 1C3HA 3ZR6A 4AI3A 4YSFA 1X8MA 2W1SA 3QACA 4FXKB 1S55A 4GH4B 2BRTA 1WCUA 2RS11 3UKNA 3RDIA 1QJX1 2Y34A 3J7NA 4G4FA 1TMF1 4QXKA 1O4YA 1NCRA 5AC92 1O91A 1DIWA 3WSOA 4YW5A 3JQXA 3JB4C 5LK5A 3WV6A 3OTFA 5D8AC 3MZHA 1AL0G 2B8MA 2HWF1 3ME2A 4BOWA 3QBQA 1YNAA 5LY2A 1LB2A 4HLTA 1QH7A 4QQLA 1WCKA 1PIV3 1Z7S2 5CKQA 5DUXA 1UYPA 2NMOA 2RR11 4Q4Y2 4XFFA 2WSVA 3Q8AA 4GJYA 2EXJA 2XVGA 4IERA 4P9IA 5FYTA 4AEMA 4D6QA 1C8M2 4GMP1 3LD8A 4D8MA 1BYHA 1CAUB 1H4GA 1S0DA 1H2NA 4ASMB 4AQ6A 2H0VA 4B29A 2JD4A 3WUDA 5I93A 2IXLA 4P9WA 3LEIA 1WMEA 5C70A 1YRZA 5IVBA 2A75A 2RMU1 1H9WA 4WVMB 1ZBE2 3V0BB 2R062 3MUZ1 1RUI3 2XL9A 2P6HA 2E33A 1IS5A 4KQ7A 4XILA 4BM8A 4XZPA 2JKXA 1DFQA 1VBE1 4QX5A 3MFAA 4Y1XA 3AMQA 4BQ4A 3I2JA 2PHLA 2RE9A 3H7YA 1MPXA 2RS13 4O9EA 1N3OA 3T3YA 1QJX3 3BPZA 4A41A 1UKRA 5A7WA 1TMF3 4UFHA 1T2XA 1QH6A 4HKOA 2GAUA 2Q8DA 4I0AA 3ZXFA 3NJZA 1CIWA 1UU6A 2VE1A 2K2SA 4FPEA 4EN7B 4CA9A 2DUQA 4UBGA 5FK7A 1YO8A 4YG3A 2C4XA 1V6LA 3NV2A 2BGCA 1WGPA 2RR13 3R05A 2FD8A 1REFA 4A42A 4AEDB 4EV0A 2WZPP 4P08A 1GANA 4Q4W2 5FK8A 5F39A 4GMP3 4UYBA 1PGL2 3NNLA 4DUXA 2A7AA 1DQ5A 3BTAA 4DZGA 2OT7A 1S1AA 2GC2A 1ZBA2 4FOVA 4PLOA 1APNA 2ZZJA 5CU1A 4W65A 4HPKA 2GC0A 3MIDA 4XMAA 3RZMA 1EAH2 3KV9A 3MIBA 1GWKA 1HRI2 4JX0A 2JE9A 4AOCA 4DY5A 4YM3A 1OQEA 4KWJA 2WYSA 4YM0A 3HNMA 5EJZB 2RMU3 3UV9A 2RDSA 1Q43A 3EYPA 5GLVA 3ZR5A 2JIJA 5AC91 3K77A 4R9BA 5E89A 2XG3A 3IT8A 3ETPA 1HJFA 2LRPA 3J9SA 2ZHLA 4JGYB 3BTZA 4W8JA 1LOFC 3X29B 3BIEA 1NZIA 3AMPA 2BFUS 2GH8A 3QCWA 4CDWA 2HEVF 4ZONA 5L9RA 1BK0A 1Z7S1 2VNVA 3BPSA 4H55A 4Q4Y1 1IGOA 2PA7A 1W05A 2WNVB 1K5MA 2XHKA 1SFYA 2XLAA 4MGSA 1CESA 1C8M1 5FLIA 5FZCA 4JDMA 2G9FA 4IEWA 5GZFA 5T3NA 3SISA 3WW2A 1JOBA 3IMMA 4BK5A 5F6KA 4QX0A 4XIKA 4MVTA 5FP4A 2CY6A 4QHBA 2Y6LA 1XSQA 5DZFA 2PAMA 4OUEA 3ZYJB 4YW2A 3RRDA 4L97A 5GZCA 4LHSA 4DXSA 4KGQA 1ZBE1 1NA1A 2R061 1RUG2 4GKXA 4PDWC 4XF9A 5F5IA 5LA9A 2GU9A 3SEPA 4CXYA 1OQDA 4K20A 3O1VA 1ZRFA 3J26N 5HCFA 2WO1A 3AMNA 2F4LA 4QQHA 2HH9A 1XNDA 1UMHA 1WCSA 1HW5A 1Q8VA 3GHNA 2GN7A 2JDZA 4LHKA 5TSWA 1OBNA 3I2OA 2PTMA 1S0FA 1C1FA 4I3PA 5JI7A 3VKFC 5DAWA 3AJYA 3LSEA 4DEVA 4PF5A 4Q5OA 2OZJA 4L9BA 1W6MB 1UAIA 4A7KA 2NLRA 3AJZA 3FHAA 1YEWA 5LCWL 1Q3EA 2A6VA 5CA6A 1Z7S3 2A70A 4NWWA 4YW4A 3GZEA 4Q4Y3 3LKJA 4WM8A 4CUGA 2ET7A 3PDQA 1QJZA 1SBEA 1LULA 1NCQC 1Y43B 2DU1A 2VH9A 4Q4W1 4XE9A 4ZS3A 5F5QA 1PGL1 2RM22 3KCXA 1OA3A 1ZBA1 3CJXA 3FBYA 4KWKA 2QQVA 2XL7A 1EAH1 2YMZA 1HRI1 2BWCA 4IE4A 1ZYBA 5IVYA 3WP6A 1ZBE3 2EA7A 2WO2A 3OJBA 2ARXA 1UMIA 2R063 1QJU2 1CX1A 1LJ7A 5ABJB 5FYYA 4D7YA 4DB5A 5LZ6A 5A3LA 4K40A 4IGQA 3C7OA 2D5HA 2JDMA 3AZWA 1WA6X 4J1WA 1QXRA 4QGNA 2XQRA 4GQ7A 2AREA 5EJ1B 2SBAA 3ZOIA 1HX6A 1UOGA 3ENRA 2ZTNA 1PVC2 2BP6A 4QMAA 1W06A 3LDKA 1VBB2 2XWJB 3WNMA 3BTXA 1I3HA 1V6JA 1CD3G 1XOYA 4TTGA 5F8PA 1FNYA 3C7EA 4Q2FA 4CCJA 5FZOB 3L9JT 1ND2A 4IXLA 4NRPA 5AFBA 4S2FA 2ZMLA 5C3QA 2QZ3A 2VVDA 2TBVA 4ZPIA 5ERLA 5IJRA 3VBOA 1AXYA 1M06G 1JU3A 2WUHA 3SLIA 3GBFA 2CGPA 2E7TA 2OIIA 5F2WA 2YU2A 4XCAA 4D7SA 1RUG1 5BV6A 4XDPA 3LIHA 4Q4W3 2N7GA 4XABA 4HFSA 3MV01 4CDUB 5L73A 3RJ2X 4A45A 1ZBA3 2DYCA 1Y4WA 5C8CB 4NRQA 1XNAA 4AHXA 2FCUA 1EAH3 2ZGSA 3TYJA 1HRI3 2J1RA 2JKBA 2VOTA 2XGXA 1PK6C 1W0PA 3BN6A 4GB32 2JIGA 4AQTA 3RS6A 5I0RA 2JXAA 4LBOA 2EIGA 1UZYA 1AXZA 4AZZA 5DUWA 5AFEA 5HCHA 5BNOC 4Y5TA 3ZN6A 4IEYA 1LOGA 4N53B 1DF0A 1R1A3 4XFGA 4XTMA 3DPRB 1W04A 3B00A 1CX4A 4XACA 2VCAA 3A21A 1MZ6A 1OVPA 1COV3 4CCKA 4CTEA 4R8HA 3KM5A 2DVDA 3RZHA 3UKTA 1NLRA 3NMBA 4XUNA 3GDBA 1GUIA 2L9LA 3CF6E 1W8TA 1RINA 2RM21 4JHTA 1AYN2 1QDCA 1H0BA 4CP0A 1KJRA 3CDZB 3ZYIB 3W9AA 2BGPA 2G9GA 3IPVB 1Y9GA 5JAXA 4HT1T 5F7UA 2VW2A 4AVVA 1GNZA 3PMEA 1HDKA 2ZHKA 4Q8LA 4N8MA 4OHZA 2D3RA 3WW4A 5FP3A 1OT5A 5A6QA 1QJU1 2VMFA 5C9AC 2WLPA 4ITCA 3VD7A 3INAA 1W6NB 3ITQA 4K1ZA 2GALA 4QDSA 3OSDA 3HT1A 1Z78A 5HV4A 3U78A 4M3CF 2XJUA 3AC0A 4XDOA 4L0PA 2R49A 3TRSB 3N35A 3WT3A 5GALA 3BCWA 3I49A 4F7ZA 3WR0A 5IVEA 5JSOA 3O1OA 2WNUB 1PVC1 1OOPA 1NCRC 3WNXA 4BK4A 4UAPA 4BYYA 4E4DX 1VBB1 5C33A 2YFUA 2VAUA 4GJZA 1Y9QA 1O59A 1NUKA 4KI5M 5JMCA 3CJIA 4XQ4A 3K46A 1DGRA 5BNPC 5T54A 2I45A 3N7JA 2WQZC 1UO9A 2ZGTA 3CMGA 1HB1A 3MW3A 2FDIA 1WMXA 2BBAA 4FP2A 1I1EA 2RM23 4GMP0 4XF0A 3VHPA 4CDXB 1MS0A 4TN7A 4P9JA 4YW3A 4B1LA 1PMHX 3MIFA 1TNRA 2ZOEB 3RQ0A 1MEC2 2E32A 4GH4A 4GB31 4CDQB 2WWUA 3IM0A 2D6PA 2YG0A 2QQWA 3FLPA 3TEWA 3LDBA 1W8WA 3ACIA 4L99A 4BCUA 2BTVC 3THDA 1QJU3 1F2NA 5FPBA 2VOVA 2DTWA 4K1YA 3H8RA 3IKWA 3KD4A 4V1PA 2J1EA 2HBUA 1RUJ2 1TE1B 2GNDA 3DXTA 3POBA 4NO4A 2R16A 3E1F1 1DLCA 1W2NA 2VMGA 4JV4A 4LTAA 4KMQA 5EXOA 2WNOA 1V9U2 2UWBA 3HJRA 4P9YA 2K46A 4XF3A 2FCTA 3HAGA 4N43B 3USUB 4HVOA 5M0TA 2AYHA 4IESA 4NPMA 2BUKA 2BOJA 3HBKA 2VZTA 3PVOA 4XFBA 1PVC3 4J1XA 1BKZA 3WP5A 3O1RA 1TNFA 1AYN1 1VBB3 2EVXA 3OD4A 3RVHA 1CAUA 4YWAA 4AE2A 2GP3A 1EPZA 2QJVA 3HNBM 4ZU7A 5B4NA 3QD6A 1VAVA 2E63A 5F5AA 5B2GB 3GF6A 2PAKA 1H4HA 3SKVA 3TNPB 1SMVA 1ND3C 3B93A 2NN8A 2Y38A 5F5CA 3O1TA 3JUUA 4WVMA 3VHNA 5FR3A 3OPTA 3V0BA 1ASJ2 3AFKA 2QKDA 3KMHA 1KEXA 4XF1A 1YWKA 4XXPA 1AX1A 4IV3C 3SCHA 5JWPA 2XVKA 2CHHA 4Y26A 1IPSA 4YW7A 2W1WA 4OYUA 4BMEA 1K12A 2PHFA 5A3UA 5C5TA 2F4PA 2YROA 3N3HA 4NROA 5ACA3 1KS5A 3I2IA 4CU8A 3RMXA 2VBBA 1L3JA 1UY1A 1WW7A 2BYVE 2QDRA 1TZOA 4GAZA 4LNVA 4QXCA 3JCIA 4LOSA 3VBHC 1VAKA 3BU7A 4QD2A 2R072 4CDWC 3BKZA 1KXGA 5A7QA 1GP4A 4RFT0 2VVFA 4MXWB 1JBCA 1R1ZA 1XE7A 4XPVA 2FDJA 3OYWB 3JQWA 1RUC3 3S30A 4AEDA 5J1XA 1OHFA 5A6ZA 1GP5A 5FP7A 4QHOA 1QKQA 1VIWB 4OLLA 2JE7A 4COUA 1AYN3 2PFWA 4LBQD 3TOJA 1UQXA 4BB3A 1IHMA 1AHSA 1NZCA 1O4ZA 3D82A 3HVDA 3LWCA 4IUGA 2BWAA 3I3EA 1SBFA 4HSJA 1MEC1 5DZEA 3S5AA 2JEMA 3AX4A 3LGRA 3FL7A 1LEMA 2W91A 1VMHA 1WLDA 3OUJA 3GYDA 5G04L 3K3NA 1W2UA 5IW0A 3HQRA 4MV2A 2VMCA 4JGYA 1RUJ1 3T4HB 4A6OA 4RA0A 2UYBA 2W52A 2W68A 3THCA 4QPYA 4XJUA 5EPAA 3FZ3A 4COVA 1V9U1 3WF2A 4AF9A 3C8XA 4LKSA 3ES4A 1QWRA 2WNVA 4PQ9A 3TWIA 2R7EB 3U1XA 4LQRA 1MS8A 2W39A 3K48A 3POGA 3ZXKA 4XC9A 3P3PA 1XNKA 3BU0A 1QIQA 2FDFA 3VBUC 2VUCA 2TUNA 1PZ9A 4K8FA 3R4DB 5FPVA 1FXZA 2HWD2 5FQ0B 2YC2A 4M4RA 2B5HA 3ZXLA 3O7OA 3KCYA 4JHZA 2Y60A 4Z8BA 4WM8C 2VW0A 4D3WA 1SLAA 2FMDA 1GZWB 1ASJ1 2Q5TA 2BU9A 1GICA 1OVSA 5FMCA 4ARXA 1KDKA 2GMPA 2PHRA 4FT8A 4Q27A 5KR7A 5LEKA 2VXJA 3VDBA 1ODMA 1FMD2 3DYMA 1UYXA 1QQP2 3U4SA 4DQAA 5FOBB 1YFYA 3O1UA 1AJKA 4BQ2A 3QH7A 4UW3A 5LBCA 3K51A 3LFIA 4HSLA 4DOUA 1DHKB 1VRH2 2DF7A 3U0ZA 3NRUA 1R083 4HXCA 4BMBA 4CE8A 3F2ZA 2X09A 4A7YA 2PQSA 4I0BA 2QTWB 1RUJ3 4OHYA 2W1QA 3LA3A 4HETA 4OI4A 1W6MA 1WMFA 2RHPA 3CBNA 4XFCA 2Q8OA 2R071 2B39A 2ZGUA 4PLMA 4SLIA 3VN4A 3KS7A 4CPBD 1E5HA 2JDAA 3MEPA 4YM1A 2P5BA 2VCMA 1AR82 3PNAA 2ZGPA 1JTZX 2GZWA 4QPIC 2Y6KA 3PTYA 1SLCA 1UW8A 2WFF2 1JXNA 4ES9A 1H6YA 1Q8OA 2WKKA 3TAYA 3ZSEA 2PAEA 1JYXA 3MUY1 1ND2C 3ZO0B 1LRHA 1DLLA 3ACGA 5FMDA 1BBT2 1JOJA 2ES3A 3VBOC 2P3JA 2DCZA 4ZS2A 4E4HA 5LWBA 1UZ0A 3MIGA 4DXTA 3I2FA 1ASJ3 2GMMA 5ABJA 5JOYA 2IC1A 4PT6A 1VMFA 2BEOA 4Y4YA 2ADEA 1VJ2A 3LE0A 1KFXL 5FXWA 4AFCA 4FVVA 4ZHNA 3JD72 1WMDA 4JCKA 2ZX3A 3VB9A 3WVJA 2A5ZA 1RGSA 2BJSA 2H6CA 4QB6A 2XXZA 1GZCA 2QQJA 1BQPA 5KXBA 4M3CB 1KQRA 2HWD1 2R073 2W92A 4BQWA 4D7TA 5FZOA 4XBLA 5H9SA 3WDYA 4ATFA 3PL0A 3VLBB 1JZ3A 2HEYF 4EE2A 4Q1RA 2FBEA 2FHRA 5HXVA 1J59A 2P17A 2XJPA 3NKGA 4EZ4A 2VMDA 2P1BA 3AZXA 1CZSA 2JG8B 1UOFA 1TME2 1XE0A 3Q8BA 2PHUA 1L7LA 3MO4A 4P9GA 4XURA 4RFRB 1L7RA 4CDUA 1VBD2 1FMD1 3HQUA 1QQP1 5GLUA 3VDAA 4X6QB 5C8CA 2W1UA 1V6NA 3U11A 2O8OA 4CEWC 1ALYA 3GBWA 4KU8A 3ZMOA 2YC4A 3HEIA 3M7AA 4PI0A 3ZSMA 1VRH1 3VZMA 2W47A 4WM7C 2YUEA 5KHGA 4H3WA 4LHLA 4OVEA 4FSJA 1Q5OA 1OMIA 5A3TA 1UU5A 3ALQA 3H3ZA 4N53A 4XHXA 1CN1A 2OQ7A 5A1LA 5APAA 4RGKA 1ZA7A 1O6UA 3DPRA 5FRAA 5C4WA 3U75A 3T0DA 5DAQA 1AR81 2DTYA 4NHYA 3RYKA 5SV8A 4FTSA 4TLGA 2EICA 2PHDA 3B7MA 4QPGB 1HQWA 1MS9A 2ZKNA 1ULCA 2WFF1 2EXIA 4UBHA 1US2A 3ZLIA 1EUTA 1GV9A 4JTNA 4N7IA 2W5FA 4N9HA 5EZWA 2EAAA 2HWD3 1FYUA 1QDOA 3CJIC 3IPVA 3SQOA 2C9AA 2RS52 1BBT1 1LEDA 5KC6A 2OPWA 2XH6A 4MHUA 5K9YA 4W50A 4U36A 1B09A 1J1LA 5LA2A 2WR9A 4H7MA 4MSVA 4CCCA 4LK6A 2VBPA 2HKXA 5F1RA 5L19A 1AVBA 2OYZA 3U4XA 2JDUA 3KF5A 4P00B 1A78A 1W6NA 2JDKA 1YQCA 2W2IA 4YGEA 1ENXA 1FMD3 3NV1A 1QQP3 1AJOA 1H8TB 1ENQA 3JD71 2Y6GA 1ODNA 1RXGA 3IBMA 3FE5A 3POSA 4AYUA 4XJ9A 2WNUA 4GA9A 4FTBA 4NPLA 5I8TA 4M4PA 3NWKA 3OY8B 1HN0A 4OI1A 4AVSA 3LCPA 1LHNA 5JSRA 2UURA 1W8NA 2PHXA 1PX3A 4BIFA 5LATA 1XYPA 2X29A 3WDTA 4QDQA 4EWEA 3I3MA 3AZZA 1HV0A 1N3PA 1AR83 4KBBA 4UXAA 2JWPA 3WW1A 3WNKA 5C8WA 1CWPA 3NNMA 1YFWA 3KF3A 1R64A 1NOVA 2BW8A 1NXD1 5FZIA 4LJHA 2WFF3 5A1FA 1TME1 2VU9A 1VBD1 2YXSA 1XU1A 3WF4A 4CDXA 5IK4A 4A2UA 1ZZBA 2WINB 5CBLA 3PHMA 2RDRA 2VZ1A 3EQEA 1BBT3 4CDQA 2WZEA 4I0WB 1CAWB 2WT1A 3NJYA 4BQ5A 5JIUA 1OH4A 1ZZCA 2FZ2A 1CONA 1OF3A 3LSDA 2QVSB 3L2YA 2XJRA 5IK7A 3MHZA 3NO8A 4NRMA 3ON7A 3USUA 3JD73 4XFIA 1RB8G 4N43A 5GKAC 4EWDA 2OQ6A 3VKOA 3E5XA 4LLOA 1ULFA 4CZSA 4LE3A 4PI2A 5FYHA 4ZU4A 2ZABA 1NX9A 3RSJA 5KHHA 2Z69A 4LPLA 5GZEA 3HIFA 2RS51 2G4IA 4MZUA 1GZTA 5JPMB 1OD3A 4JC1A 5E88A 1GZ9A 4C0HA 5FPUA 3K2OA 5JLVA 4AEDC 4IEXA 4JGZB 1TME3 3KV6A 2Q30A 2WAAA 3POFA 2XKOA 1ACCA 1VBD3 2D43A 4IEPA 4OFGA 4LBLA 4YPJA 2NMNA 1MR5A 1PHMA 4Z07A 5JZGC 3ELNA 3BOPA 1DGLA 2OUJA 3PUQA 2ZKLA 3ZXEA 1RUNA 1NKGA 2MPFA 4YNIA 1WW5A 2ILMA 5FZAA 4JGYC 4QDRA 1N1SA 3PUIA 3TN92 3HD8B 1WW6A 5GLWA 3FC0A 1S0JA 4M01A 3V0AB 1LGNA 2ZACA 4GWJA 3TBDA 3EJKA 3OBAA 5ISLA 1NE4A 1TG7A 5I0UA 5CFDB 4MXWA 1ZRDA 3C7HA 2WNVC 2VZUA 4RR3B 3D3AA 1TEIA 3OYWA 3NNJA 3N36A 5CB7A 5F3GA 5FYBA 5DAVA 5HV0A 3S0MA 4R4XA 3ZN5A 2VNRA 3W5MA 1W03A 1GOGA 2OUHA 1AYM2 4DRRA 2A1XA 2ARAA 3DGTA 2RS53 4LO8A 5CADA 4FTEA 4QT6A 1CZVA 3WG1A 2QQPA 1SBDA 5L9BA 4UFLA 2Y64A 1OD5A 1W9SA 2HWF3 5FY7A 5EV7A 2WJSA 1WUVA 3AZYA 1IPJA 3DKWA 3GZAA 1UYYA 4M00A 5DQ0A 5AVPA 5FZ7A 2P3KA 5A3NA 1NY72 3AP9A 4BWOA 3PUSA 5HXMA 5FO9B 4BQ3A 3FN9A 5D1IA 2QQUA 3AVSA 1OSGA 4IQPA 3ZFGB 1QNWA 4RQPA 4YVWC 3T0AA 3TNQA 1LOAA 4GIQA 5FZBA 4AI8A 3PJYA 4LITA 1WZXA 4IGOA 3WNNA 1S2EA 4XFHA 1OLMA 4MGQA 1ZRRA 3WEZA 4DY3A 5C5UA 4IEUA 1C57A 3S5QA 4KL1A 5FQ0A 4IEOA 3AYEA 4PHZA 4NUBA 3CEWA 3H50A 4B4QA 2LROA 1AR72 5F2SA 4I09A 3QH6A 5JR7B 1JOPA 4QKBA 1VBE3 3IWZA 2JE8A 1GZWA 1XNBA 1GSLA 3WG3A 3D0SA 2Q4SA 1YCIA 3MPBA 3WDVA 2SLIA 2VMEA 3IN9A 5FY5A 3E97A 4QQOA 2GMEA 4KWLA 3ZFFB 3WOGA 1JHJA 2IZWA 3J7LA 3KT4A 4M0NA 5FP8A 2V5YA 4OCTA 4OHWA 4ZXKA 5FZLA 1FPN2 5FJKA 2UY8A 4TLFA 1NE6A 3EO6A 3P5BA 4OQ8A 1NAEA 4HOOA 5FYZA 2O0OA 1DGWA 3TN91 3MFCA 5IYYA 1LOCA 3WNOA 4COZA 2EXKA 3MYXA 4PF1A 3OPZA 4E2QA 3C3VA 3J8F2 1DCSA 4EZHA 4DRVA 2AGSA 1R092 2KA3A 1F31A 3M8LA 3NNGA 4A7ZA 4D69A 4D6SA 4Y5Z0 1TVGA 2W3JA 2A6WA 4BQXA 1PMJX 2X10A 3PVBB 2JDPA 1XQNA 3ZYFA 1AYM1 2VUJA 2D40A 3E6CC 1JH5A 5AC93 1I5ZA 5J3UA 5SV5A 3KZ4C 2BNMA 3WG2A 3WQ0A 3H8OA 1XRUA 1W6PB 2DCTA 1LESA 3PU3A 5T5OA 1P8JA 5FY8A 4Y22B 5ANQA 4Y1ZA 4DXRA 4RS5C 1UIJA 1YI9A 2ETEA 2OA2A 1OURA 1KITA 1PNFA 2OXBA 2XJQA 1VB2A 1NY71 5D2AA 3ZXGA 1A3KA 1UU4A 2HWE2 2ZJCA 5C8CC 4MGIE 3ZIXA 4U2AA 1C8M3 2AUYA 3JBG2 1JYTA 2EAKA 4BU2A 1OLME 2LALA 4WZCA 4A3ZA 3N7KA 3LAGA 1SLIA 3DXUA 2D3SA 4XOGA 1RUH2 2G9ZA 5KWRA 2MNGA 1JMUB 2QDNA 3O12A 5DXDA 5FBJA 2JG9C 4N53C 2UYAA 3VBRB 2YBSA 1LODA 4M3CA 1OXCA 4LO6B 2D7FA 4CRQA 1H1IA 3DPRC 1H2LA 1YQ6A 2WWJA 2VCBA 4AEJA 5C4WC 5JPNB 1AR71 4JDNA 3POJA 4QHZA 5FZ3A 3M3EA 2Y0IA 3UKVA 4I01A 1UY2A 1WA4A 4QU1A 1GOFA 1TQ5A 4W6WA 1XXNA 3IAPA 5FJHA 4AFMA 2DCJA 1AYM3 2CSGA 4AAPA 2Z42A 5T55A 3NAPB 4AK3A 2W0XA 4KU7A 3RMYA 2O1QA 3OOXA 3LF7A 4Q1PA 5J36A 5A32B 1FPN1 4XHBA 4LKEA 1QNYA 2IXKA 1N1VA 4ZY9A 3OF1A 3VD4A 3AP7A 5A7OA 3WDXA 1U5ZA 2Y6JA 3OB8A 4AI0A 2B7YA 4AHYA 3VGIA 4YZ4A 3BODA 5DAXA 3AMHA 1LAJA 3MLLA 1QOTA 3AP6A 4GWIA 3OPWA 4Y24A 4AI1A 3J8F1 4LO4B 2E53A 3AKSA 2RJKA 4R9AA 1UIKA 4H2AA 3VD3A 1R091 2VUDA 4UFMA 5FZMA 1HKDA 5T5JA 4NIAA 4ZKTB 4QPGA 3RGBA 3ZFEB 2YBPA 3HOBA 2WNUC 4XMIA 2P2KA 4CU9A 3I2KA 1ULDA 2QQLA 1FI2A 1U0AA 3ZSKA 4JRAA 4KWUA 5A3PA 3GJAA 1X50A 1G86A 2F6BA 1G9CA 4CEYC 4MHRA 5H9RA 5J7MA 3AFGA 5FZ0A 5IFPA 2VW1A 1OUSA 3HPNA 1AR73 1ZZ8A 5DABA 1PNGA 1ZRIA 1SLLA 4NMIA 4NVPA 3VD5A 4AFBA 4BLIA 4OI0A 4IV1C 4CDXC 5CZKA 2HWE1 3B3QE 3OEBA 4NOTA 1H8TA 1OA2A 3JBG1 4TSVA 3ZYPA 4AFAA 4NAMA 1NCQB 3RYPA 1FPN3 1XC6A 4M3CE 1HB4A 3CKHA 4AW7A 2DVGA 4DNYA 1CR7A 1RUH1 2PQQA 3T2OA 1G7YA 3D5OA 3P1IA 4LO5B 3OY8A 4CU7A 4COYA 4QXHA 1DZRA 5EFUA 2NM1A 3SCGA 4UF0B 1K42A 4OUSA 1O5LA 1YFUA 3J8F3 4C8DA 4B8EA 1RUG3 2ADDA 4ARYA 2BV4A 2ZGMA 4N43C 4ORFA 4GALA 4XFAA 1R093 4NPRA 4YG6A 3UL2A 2D93A 4XDQA 4CCMA 4FO9A 4LE4A 4MLOA 4FXGB 2W9XA 3BI3A 3AXDA 4A3XA 4WVZA 3H3UA 1RXFA 3K4AA 4B3NA 2PMWB 2CV6A 4LA3A 4XBQA 1OF4A 5FZ6A 2Y33A 5FCCA 2Q0AA 3SNMA 2F17A 2YDEA 5FIXA 5JI9A 1BEV2 5CVRA 1CAWA 1LU1A 5FDBA 5C6CA 2VGDA 2H0BA 4FPOB 4XCBA 2ZHMA 3PIGA 3IZOA 2C0ZA 2HWE3 5F3EA 2QFEA 5A7PA 2V4AA 1BK1A 3IIAA 4Q4V2 1S4CA 3JBG3 2A6XA 5CYYA 3WZ1A 3ZSJA 1GWMA 4AHZA 1W8FA 2LW8A 1N1TA 4L8QA 1RUH3 1URXA 3WQ7A 3VD9A 4IW3A 3WF1A 2YPDA 3KVBA 1HIXA 4IE0A 1JYWA 1W3VA 3ZMNA 2Y6FA 2X5IB 1MZ5A 3TEYA 5L7OB 3PU8A 1O8SA 2AENA 3M1HA 4WV8A 1MS4A 4DXZA 1W3XA 3N9LA 4S2DA 1U5YA 1UN1A 1UPIA 3ZVXA 4Y5SA 5BNNB 5BNOB 1J83A 2CWMA 4FBFA 4NJ4A 4XEZA 4BA6A 3KGZA 4YM2A 2XUMA 4CCOA 1Q8SA 3VZOA 4A6SA 1O4TA 3BALA 5A3WA 3HBZA 1Q8PA 4UFJA 1U5IA 3ILNA 2XWBB 3B94A 4KGGA 4BH9A 4YG0A 1NQJA 5FY4A 4HVQA 1XYNA 4LR4A 3EB7A 3LEMA 2C1FA 3EHKA 1SHWB 1V6KA 1OPOA 1T6GC 2V09A 3ETQA 2VOWA 2A6YA 1FAYA 1WWYA 3C2UA 2J1VA 5AVAA 3ZPOA 2OVUA 2CAVA 3LQCA 4RYDA 1C28A 3V0AA 3P6BA 4MYEA 1DZTA 2V5DA 5CFDA 5C9AB 1DP0A 1OFSA 2VZPA 3POYA 1QXPA 4RQPC 4RR3A 2D5FA 2NPIA 1E5IA 1MZFA 3OGGA 4XETA 5FZEA 3VDDB 3I97A 5I91A 4CXXA 2WA4A 5LBEA 4GB33 5JOXA 1H2KA 3H42B 4FOWA 4QX2A 4S2HA 2WQ4A 4L11A 2Q8EA 3MLKA 1JYNA 1BEV1 5FPXA 3JZVA 4XAAA 4MO3M 2XMLA 3AM2A 1W2AX 1W9WA 1WW4A 3GGLA 4FPHA 2ZHNA 4ASLA 2WBKA 4X6RB 4JAAA 4WZFA 4AVTA 1YQ8A 1I9RA 4BQYA 4HG6B 2GNBA 4ZXEA 5BNPB 4OHXA 1H9PA 1LOEA 1F5FA 3N7MA 1K5MC 1S0BA 4FFIA 5FMOS 4C91A 1J3PA 1YQ2A 3ABZA 4Q4V1 4MX3A 4Y1YA 2JX9A 3PVEA 3ZFGA 5FFOC 1YC61 2DCKA 5I8SA 4MG2A 2V4VA 1YHFA 2AACA 3JU9A 4MGYE 2CWSA 2PHWA 4E4ZA 4Q0PA 1VBA2 1UL9A 5FBZA 2IUWA 4YGCA 1PGSA 1EV12 3AVRA 2BDRA 1NYWA 4KBZA 4XTPA 3ZM8A 5DG2A 2JDYA 1NA1C 3WQBA 4B7KA 4EN0A 3O1MA 3W20A 1SCSA 2PYTA 1CJPA 1EP0A 1REDA 4YLZA 4YARA 3MGUA 1UYZA 1BZWA 1AZDA 1DYOA 4Y33A 1ONAA 2WSUA 4BXSV 1GP6A 3A7QA 2VQAA 3ZFFA 4HZFA 4XBNA 2W95A 5IHRA 1QMJA 5K0UB 1QJEA 4NHXA 3EXUA 1W99A 1JZ6A 4QB1A 1NLQA 3R4UA 3H8XA 3VBSB 1VBC2 2A71A 3PIJA 4PQQA 4JTOA 3BGAA 4OUMA 1ZZ7A 3KGLA 1ND3B 2W94A 2HBTA 2VQUA 2ZX4A 4OULA 5FYVA 1OKOA 4I30A 1F4HA 4R4ZA 1G9DA 2FMYA 2GH2A 4IV3B 1FV3A 1LHWA 5JXGA 4ZZ5A 1MEC3 4Y4RA 5FZGA 2RVAA 2NZ9A 1HQLA 4HPKB 1CZTA 5DUVA 1ZREA 3CO2A 5T5LA 4DEQA 3ILFA 4FOQA 4LXLA 1N1YA 1G9BA 4MADA 2B4KA 1D7PM 1W6PA 2BNNA 2C6SA 5I8YA 3ZDVA 4EJRA 1K5JA 3D4KA 4Y22A 3VBHB 4EN9B 5J98B 1V9U3 4AAXA 4TXWA 2OZ6A 1CPNA 3FFQA 3WQ1A 2ZAAA 3SMHA 4CSWA 4Y20B 3WUCA 1HLCA 2YPJA 1KRIA 3WY6A 2ZGKA 5LEJA 3WXPA 4DS0A 1F8VA 3GHMA 1YI7A 4FPKA 1RITA 3NJVA 5FZ8A 4E2SA 2ORZA 3B9CA 3DKQA 3THTA 3J7MA 5J09A 2WWSA 2VC9A 3N9NA 2ZZQA 1DQ4A 4CP9B 3KT7A 4HBNA 1V6IA 1WD3A 2J42A 1VBA1 2VZVA 5D21A 3ZYHA 3VBRA 1EV11 2CGOA 2ZBJA 2DBNA 3HQXA 1BLZA 3VDCA 1LU2A 2VO5A 3LOIA 3N9OA 3C7FA 2IXCA 1HV1A 1IQDC 2E26A 3M3IA 2MHFA 5DDJ2 5FY1A 1RUF2 1W0NA 2QQNA 1ENRA 1YIPA 1LOFA 1HXS2 2HYXA 4RGGA 4BPZA 1UX6A 4LBMA 4Z82A 3WHUA 4Z1VA 3GXUA 3I2HA 3A23A 4UOJA 2EIEA 3VL8A 1G9AA 4FFGA 2IXIA 3AKRA 2Z4FA 3LB9A 4NIIA 4LO7A 3NAPA 5E8AA 1WCQA 2QNKA 2CDPA 2MEV2 1RHI2 1DZQA 4WVWA 4B1MA 4YZ5A 3NQHA 4TWTA 1F9KA 1DGRN 5DPNA 5A32A 2RJ2A 1AL22 1KD7A 2WC2A 2AZ5A 2W46A 2BERA 2WN3A 4OZOA 5H9PA 3VBUB 1JU4A 4HKWA 1WLWA 1JN2P 3VKNA 4YRDA 1VBC1 2BBVA 3LIGA 2D6OX 1D0HA 1DGWX 2V72A 2XOMA 3R0RA 1PZ8A 1H8TC 2UWAA 1WBFA 3N9QA 3AL5A 1PMIA 3D8CA 5JIAA 2BZDA 4E9KA 2DFBA 4ZU5A 4QQPA 5I0TA 3ZFEA 4QGLA 2WIIB 2OS2A 4UI9L 1AX2A 1PX4A 3T08A 1VBA3 1Y9MA 2GNMA 2Y6HA 4JZRA 1UXXX 1EV13 1RJ7A 3H3LA 2ENRA 1XNCA 4YVSB 1DYKA 4EN6B 3K75B 2XONA 2D6NA 2ZAHA 4PBPA 4JKKA 1RVF2 2YV8A 4MGTA 1S2KA 3ST7A 4BISA 5F9TA 1RUD2 2Q1FA 5K7PA 4BE3A 1D2QA 3O0WA 3I3BA 4MOAA 5E6HA 4NR1A 1BCXA 2VULA 5KXDA 1VP6A 2GC1A 4QPIB 4Z2AA 1OOPC 3RZGA 1EPWA 2UU8A 2IFWA 1NCQA 4YGBA 5FUIA 1MQTB 3KT1A 4Z92B 4CUBA 4QM8A 4GZ9A 1W9YA 1WD4A 4HONA 3J4UH 5F3IA 1VBC3 2X53S 3BTYA 4LKFA 3N9MA 4EROA 5EYXA 4UF0A 3S7IA 1X9TA 3DL3A 3POWA 1RIRA 3VBOB 3VHOA 5CFCB 1ZNPA 3KV5A 3ZN4A 2XB6C 4AGGA 5BY5A 4LBNA 5DDJ1 4CXWA 1RUF1 1WLCA 4CYDA 3A4UA 3QOPA 3VZLA 2J1TA 4NIGA 1HXS1 5F3CA 1DU3D 5C3OA 1S0CA 1E57A 3NVCA 1B35B 1Y7BA 3CNAA 3I2DA 4GH4C 4FOYA 1UZWA 5A7SA 1GNHA 2QQMA 1C1LA 1HB2A 1VRH3 1Q8QA 2ZMNA 2MEV1 1RHI1 3HNYM 4JRLA 4CCLA 3A0NA 2X05A 1I5PA 1AL21 2EXHA 2QUOA 4JVAA 3G6JB 2JDHA 4MUVA 1HB3A 4RD7A 1RYYA 2LTNA 2P37A 4GWNA 3PTRB 2P4EA 2ZEYA 4UFIA 3WG4A 2VMHA 5LRRA 2GC3A 1N3QA 5JVVA 5CG9A 1PVXA 2IFRA 2HLEA 2ZPXA 4XUTA 3T09A 3I59B 2ERFA 1BVP1 3O1PA 1SG3A 5L36A 1GFF2 4NN0A 3ROUA 1NLSA 4IEVA 2GDFA 1EYBA 4AG4A 5EQUA 1ZX5A 5C71A 1QJFA 3MI8A 5KBFA 1W2OA 1RC6A 1XBFA 3I54A 4BIOA 4CEWB 3Q8CA 4C1XA 5IAXA 1QY4A 4Q29A 1VMJA 5B4XA 2Q8CA 2X5IA 5KHIA 1ZRCA 5L7OA 2A3WA 4K7JA 4WM7B 4B4RA 4FAHA 3V56A 4YW1A 5FZKA 4GWMA 1IZ3A 5BXXA 1RVF1 2XJVA 4LBQB 5DDJ3 4E4SA 5BNNA 4YW6A 5BNOA 5DAPA 1HXS3 1RUD1 1AF9A 1S0GA 3LOBA 1POV0 3J7HA 3WDUA 1YFXA 4K9SA 2MEV3 1RHI3 5C3SA 1KS4A 1AL23 4FAGA 2ZX1A 4LULA 3H1WA 3VHRA 1XU2A 2LUWA 1O5UA 1GOHA 3H8UA 3W58A 1QEXA 2XBO2 2DWRA 3MLJA 5A6XA 3MDPA 4RL7A 1IS3A 2KXLA 3H0OA 3WF3A 5FO7B 5C9AA 5FTTC 3ZFGC 2VVEA 2ZA9A 2XVLA 4AFDA 3CHXA 5E1RA 4ZZ8A 3KWVA 5FMBA 4AGRA 1RL3A 3HN3A 3PUHA 3VDDA 3VBFB 5CKNA 2XJTA 2RV9A 5FKCA 1HQNA 1V6OA 2AEYA 3K4DA 3WCSA 5KXCA 3L2HA 4PJYA 5E16A 4W6XA 1UY4A 2NYYA 3I2GA 1X82A 3DECA 4I2OA 1RVF3 1NT0A 3EBRA 3RYRA 3SXWA 3IDBB 5KHKA 2YZ4A 3F95A 1OUXA 3GM8A 1SLBA 1RUD3 5DZGA 3TEZA 4J6GA 2VTFA 2R30A 1RMU2 2WYFA 5BNPA 3LDRA 3H1YA 2VPVA 2EF6A 3ZFFC 3BIWE 1W90A 1DBNA 2CYFA 2PLV2 2QZ2A 4CP2A 2RJLA 4G3YC 4C0BA 3ASIA 4JKMA 1Y3TA 2Y26A 3VUOA 5KC5A 2D98A 4KNCA 4OI2A 5FV3A 3S6PA 2DVFA 4O9GA 1WCDJ 5IAVA 4DUWA 1SCRA 1AR92 1O8PA 2DCYA 3PLQA 4K8RB 1U5XA 4AXOA 4IETA 5IFTA 4XJZA 4XQWA 4QGMA 2YGLA 5BPXA 2VZQA 1LTEA 2VM9A 5FZ9A 3FHQA 3M3CA 2VZRA 5FYMA 1UF2C 1LHVA 4LBJA 5EJ3A 3THPA 5FMOL 1LR5A 2C24A 5IVJA 3T0BA 1QXJA 3AKPA 4P9LA 4IGPA 4X8PA 4KH9A 5FKBA 3GBGA 3VZKA 5K0UA 4Q4X2 5FUNA 5FYUA 4A44A 2VOKA 1PO22 2K0GA 3QLQA 2BVBA 4DPNA 1JZ2A 4D94A 3VBSA 4DINB 1SPPB 3R6SA 4HL0A 2VL4A 3UYJA 4FQZA 2XBO1 1C5HA 3FX3A 4XF4A 1W8UA 1MVEA 3BB6A 1WKYA 1ND3A 4CUAA 1QOOA 5D8AB 3UK9A 5LW9A 1ZZ9A 4HMZA 4IE5A 3SEEA 3KHCA 1AX0A 3T1MA 2K9ZA 2ZX0A 3E6BA 2EIDA 1JYIA 1UY3A 2DUPA 4IV3A 3KLSA 3PVNA 4O61A 5EHDA 5JZGB 3AP4A 1L7QA 4PCRA 1A34A 1SACA 1GBGA 2EIBA 3VBRC 3AKTA 1E5SA 5IT6A 3ES1A 3VZNA 3WINE 3ZYGA 3PJQA 2IXJA 5ABJC 1US3A 1CAXB 3VBHA 5HBAA 1X33A 1OH3A 1R1A2 1FX5A 2GNTA 3S57A 3RNSA 5IUQA 1RMU1 2ARBA 4FPGA 3H7JA 3ZSLA 3ZYRA 2TNFA 4Y20A 2XR4A 3ATGA 1COV2 3N7LA 1JODA 3NAPC 4UW6A 2VZ3A 2YY1A 3I8TA 5FPLA 5H9QA 2PLV1 2DVBA 4D0QA 3WNLA 1STMA 1QGLA 2R1BA 1NXMA 1H1AA 1YXWA 2HWB2 2JJ6A 1XJAA 5CKMA 3SITA 4CP9A 5DUUA 1F5JA 1SDDB 4XXAA 5FYIA 3K3OA 2XBO3 4QX7A 3APBA 2J1AA 4SBVA 2YB7A 4LKDA 3B69A 5A80A 2HEWF 2WL1A 3ZXDA 1AR91 3T2QA 1GNYA 2KD7A 3AP5A 4R9CA 4EYUA 5J48A 2NQYA 2B42B 4FFFA 5FP9A 2WFPA 2P3IA 4IEZA 5FZHA 2XQXA 4CDUC 3FUOA 1HRV2 3MW4A 3ZFEC 2R1DA 4RN5A 3UESA 4NHKA 3FWEA 3V65A 2J7MA 1NQDA 2E7QA 3R4SA 3N4MA 3RPQA 4YVWB 4LBKA 4CCNA 2B46X 4HK8A 4Q4X1 2FDKA 1J84A 1PO21 5IVVA 3P3NA 3LA2A 3TN93 3RWNA 3PMSA 1G6NA 3VBUA 2B9UA 3WCRA 2VNOA 4YZ1A 2E31A 2VD7A 4AQ2A 1RMU3 2C9KA 2TEPA 3U37A 1BVVA 2VUAA 5A33B 1O3TA 2XJSA 1J3RA 1DQ1A 3OGRA 3IAQA 4PIYA 1YQ5A 1FOD2 4BJ0A 1PZ7A 2VG9A 2PLV3 4M0HA 2ZGLA 1EY2A 2JG8A 3G7DA 4X8NA 2WZ8A 1JYCA 1ULPA 4GULA 5EWSA 2A73B 5LY1A 3ACLA 3S7EA 1JW6A 3PUAA 1IKPA 4HANA 1DYPA 1REEA 3KQ4B 1AR93 3DYPA 4YVSA 2D97A 1W6OB 3M3OA 2GN3A 4XYXA 4F8AA 2P34A 1JZ4A 4AEKA 4FPFA 1QJY2 4S2GA 4TYSA 4L2NA 1JZ5A 5FOJB 2WZR2 4ES8A 1R1A1 1QF3A 4O7XA 4GD4A 1JUIA 3HMYA
chains in the Genus database with same CATH topology
1LKNA 4PDWB 5T50A 4AVCA 5T52A 4XW3A 2E7AA 1COV1 3D0JA 3RZZA 1FV2A 4FPLA 5IK8A 4QPIA 4Q4X3 2UWCA 3MF6A 3MIHA 2CTVA 1PO23 1Q56A 1MQTA 2BQPA 3E6DA 2HWB1 1S0IA 4ONUA 3WX5A 1M4WA 2LM3A 4OZXA 2A6ZA 1OPMA 2ET1A 3ZXAC 3AK0A 1KJLA 3BOWA 5FREA 5JOZA 2VNGA 3NSTA 4ISQA 4AQSA 5CFCA 4XJ8A 3MPPG 1BXHA 2A3YA 3OGJA 1H2MA 1X8EA 4PBOA 1HRV1 2RS32 4RS5B 5FLHA 3RI8A 3AZVA 2H6BA 1XE8A 3B01A 4TZDA 3FLTA 3M2MA 3DF0A 1VB4A 1B35A 1MACA 1RJ8A 3MW2A 5FLJA 4CDQC 4N7UA 1CGPA 1A8DA 2X5IC 1PO12 4INDA 4LUMA 5L7OC 2VQ0A 1LGCA 1XYOA 1AXKA 3FHIB 5FAXA 5ACA2 5BNNC 1CPMA 2JG9B 3FUQA 4BZ4A 3O0XA 1CAVB 5C4WB 2D6LX 1VLNA 4GKYA 3RG0A 5JOWA 1YJKA 1FOD1 2HWC2 3FJSA 4JQRA 5GJ6A 3I59A 1RUC2 3T1LA 2DUOA 3UJOA 3DN7A 1UCXA 2O8QA 5GLTA 2HWB3 4F83A 1PGW2 4AI2A 1U12A 4CEWA 2CNAA 4META 2PELA 2ZMKA 1KFUL 4E2GA 4WM7A 3HWJA 2QCSB 1DG6A 4EN8B 2PN5A 4H7LA 4LBQA 1QJY1 4G9SB 1YLLA 1CQ9A 4FPJA 1HRV3 2XLFA 1RUE2 2WZR1 1NG0A 5FPZA 2D3PA 1V6MA 3RI9A 3VDDC 3CU7A 3FMGA 4Q0SA 1SFNA 3USSA 1O3RA 5J96B 1BMV2 4BHPA 2WT0A 1SQ4A 3B5LB 3AYAA 4P5HA 3VV1A 1D4VB 1D4M2 3OBTA 4K3UA 1PK6B 2Z79A 4CEYB 2W08A 1OLRA 5CAZA 4C1WA 1JHNA 1FOD3 2XLGA 4JGZA 3AYCA 4XQDA 3AXEA 3ECQA 2RS31 1N47A 3VZJA 2EALA 2VECA 4IV1B 3VBFA 4HKLA 5GZDA 2VOXA 1IKQA 3FFZA 4XJAA 1PO11 4FPYA 4GXLA 2JECA 2FZ1A 2R32A 2Z5WA 1C4RA 1AR62 1W6QB 5ACA1 1R082 2ZGOA 1YJLA 1QJY3 1IPKA 4JDOA 3SH3A 3VKLA 2WZR3 1YUDA 4CP1A 5EYYA 1IS4A 4AVAA 3OBRA 1FNZA 4FCAA 3ZXJA 3SCFA 1IS6A 2HWC1 4PLNA 3IDEA 4KG8A 1RUC1 5K0UC 4N9IA 1OFNA 2ZCWA 4FPCA 1POV1 2VMIA 4E27A 1ULEA 2CGNA 2D6MA 3JB8A 3VBSC 1PGW1 2Y0OA 3B02A 1NCRB 2R0HA 4K21A 2DVAA 2WS92 2WT2A 4K6BA 1G8WA 2A3XA 1LHOA 1SEFA 2IWGB 5GLZA 2WNEA 1DQ2A 5I0SA 3Q9OA 2R6QA 1RUE1 2RS33 1MS3A 1V70A 3O14A 4P14A 1AUYA 1S2BA 1J58A 1BMV1 3WLUA 1PO13 1OI6A 4LA2A 3LA7A 2KM2A 4AWDA 3VL9A 1C8NA 1D4M1 2YGMA 4URTA 1LECA 1ZM1A 3MICA 3ZX7A 1UD1A 4AVBA 1OA4A 2YC0A 5CIRA 1I6XA 1V00A 1A6CA 2HWC3 5D8AA 3ZIWA 4IEQA 4WVVA 4B7EA 1GR3A 1POV3 1MS1A 4DFSA 5GM0A 4RGAA 5F6LB 1H8VA 3IDCB 1MVQA 2GSYA 5JZGA 1PM7A 4HN1A 1JUHA 1BEV3 2VXRA 5JSPA 5DG1A 4MH0E 1VAMA 1AR61 1GLHA 3WP3A 3WDWA 1UPSA 1R081 1O3SA 3O5SA 3U10A 1CVNA 1H1MA 1J1TA 1Z0HA 1RUE3 2DURA 2R042 2WLQA 1CAXA 3KB5A 2DV9A 4LLFA 4Q4V3 1IOAA 1UMZA 1ZZ6A 4ISRA 2I2SA 3I4IA 3O0VA 4RQPB 5HI0A 3I7DA 4YYOA 1ZVFA 2YHJA 1D4M3 4YFZA 1BJQA 3GNEA 5T5PA 1ENSA 4QQ2A 1O3QA 3AKQA 2WS91 4Q26A 1ULGA 3RJRA 5BNQA 1FATA 4NHMA 2JG8C 3T2TA 4CDWB 1SLTA 2HYKA 4HVRA 2BFUL 2X8KA 4NHLA 2BVVA 1K5MB 3WP4A 2R0FA 2YYOA 1WLTA 1D0GA 5BYNA 1DDLA 1OQ1A 1MZEA 3HR9A 4YVWA 4YVSC 1AR63 4Y1VA 4AHWA 1W0OA 2DU0A 1RUOA 2VY0A 3M70A 3GZUC 3NW4A 2ATFA 4DMIA 3CLPA 1LGBA 4W6YA 1D2SA 1YYNA 5A33A 1NA1B 2UY9A 3WW3A 4YFWA 4QPGC 2B45X 3GALA 3TB0A 3KSCA 2ZGNA 4Q0VA 1VALA 1MQTC 1DQ6A 3AMMA 2FQPA 1W39A 2E9QA 5IK5A 4C90A 2WS93 4COWA 1W6OA 5CFCC 2E6VA 2I07B 3SH4A 4P9XA 3GZTB 3URFA 1GKBA 2R041 5LK7B 4RHV2 4WM8B 1B35C 2V73A 1C5IA 4PDWA 3SH5A 3AB0A 3MIEA 4L92A 4R52A 2Z2SB 1WBLA 1X36A 3HT2A 4H14A 5A3MA 5HCAA 1YIFA 4MXVA 5KXEA 4Y1UA 2ZGQA 2C5DA 3E5UA 1GQGA 4R9DA 3M3QA 3ILRA 4I02A 3WD5A 3DUIA 3FBMA 2OPKA 2D6KA 1SDWA 4OHVA 3WHTA 4RS5A 2BPA2 2JICA 2XPJA 3IMNA 1H30A 1PIV2 2Q1MA 2QE3A 1O7FA 5JCTA 5J37A 3DV8A 2AH2A 4XIOA 3OD0A 3V64A 1OLQA 5CNAA 1ND2B 2R043 3NV3A 4QU2A 2JG9A 4LUKA 3SHRA 3UJQA 4LEJA 2ZGRA 1CAVA 3H1MA 3NL1A 1QOSA 1X7NA 1ZA4A 1RUI2 5JDBA 3HN1A 4Q0QA 4NWVA 1FT9A 3D6EA 4Z2WA 4MGZE 3CL1A 1RTVA 4N90A 4BLJA 2HJIA 2RS12 1S0EA 3M4FA 1QJX2 3ZDSA 1IQAA 4HK9A 2DFCA 1TMF2 2I74A 4B4PA 3OCPA 3ZN6B 4YGDA 4IL7A 4FQ4A 2AR6A 4JGZC 2HWF2 3ZPYA 4F3JA 5KHJA 1LHUA 3NV4A 4RHV1 4YZ2A 1QU0A 1OKQA 3VBFC 5LRSA 2RR12 2CL2A 4ATEA 2IXHA 3FLRA 2XKPA 4Q8KA 4LHNA 4PIZA 4XJWA 3LZZA 5K8SA 1KDMA 1CJDA 1PK6A 4CEYA 2BNOA 2RMU2 4HN0A 3AYDA 1LOBA 4MGKE 4UW5A 5CFDC 2OW4A 4UW4A 3H9AA 1GYKA 1RUF3 5FO8B 4RR3C 4FP3A 4AGVA 1GQHA 2PHTA 2WA3A 4RSUA 1VBE2 3KCCA 4BQ1A 1PIV1 4IV1A 3KQRA 4LT5A 1J3QA 3U07A 4QM9A 2ZS6B 4PIXA 2NP0A 1UZZA 4YZ3A 1G9FA 1OOPB 1A8MA 1UKGA 3E5QA 1VR3A 2ZX2A 4WBBA 1W6QA 1DQ0A 2D44A 4KG0A 3CJIB 3VKMA 3A0KA 3W59A 1QHDA 4RHV3 2E51A 3MF9A 3NKTA 4Q0UA 2CAUA 3B9IA 2Q1ZB 1LCLA 5HCBA 1RUI1 2JENA 1LENA 1MS5A 4EWAA 4I3GA 5BUVA 1C3HA 4AI3A 4YSFA 1X8MA 3QACA 4FXKB 1S55A 4GH4B 2RS11 3UKNA 3RDIA 1QJX1 4G4FA 1TMF1 4QXKA 1O4YA 1NCRA 5AC92 1O91A 1DIWA 4YW5A 3JQXA 3JB4C 5LK5A 3WV6A 3OTFA 5D8AC 3MZHA 1AL0G 2B8MA 2HWF1 3ME2A 4BOWA 3QBQA 1YNAA 1LB2A 4HLTA 1QH7A 4QQLA 1WCKA 1PIV3 1Z7S2 5DUXA 2NMOA 2RR11 4Q4Y2 4XFFA 2WSVA 4IERA 2EXJA 2XVGA 4P9IA 4AEMA 1C8M2 4GMP1 1BYHA 1CAUB 1H4GA 1S0DA 1H2NA 4ASMB 4AQ6A 2H0VA 4B29A 2JD4A 3WUDA 5I93A 2IXLA 4P9WA 1WMEA 1YRZA 2A75A 2RMU1 1H9WA 4WVMB 1ZBE2 3V0BB 2R062 1RUI3 2XL9A 4BM8A 1IS5A 4KQ7A 4XILA 4XZPA 1DFQA 1VBE1 4QX5A 3MFAA 4Y1XA 3AMQA 2PHLA 2RE9A 3H7YA 2RS13 4O9EA 1N3OA 1QJX3 3BPZA 1UKRA 1TMF3 1QH6A 4HKOA 2GAUA 4I0AA 3ZXFA 3NJZA 1CIWA 1UU6A 4FPEA 2K2SA 4EN7B 2DUQA 4UBGA 1YO8A 4YG3A 1V6LA 3NV2A 2BGCA 1WGPA 2RR13 3R05A 1REFA 4AEDB 4EV0A 2WZPP 1GANA 4Q4W2 1PGL2 4GMP3 2A7AA 1DQ5A 3BTAA 4DZGA 1S1AA 2GC2A 1ZBA2 4FOVA 4PLOA 1APNA 2ZZJA 5CU1A 4W65A 4HPKA 2GC0A 3MIDA 4XMAA 1EAH2 4DY5A 3MIBA 1HRI2 4YM3A 2JE9A 1OQEA 4KWJA 4YM0A 3UV9A 2RMU3 1Q43A 5GLVA 5AC91 4R9BA 5E89A 2XG3A 3IT8A 4JGYB 3J9SA 2ZHLA 3X29B 1LOFC 3AMPA 2BFUS 2GH8A 3QCWA 4CDWA 2HEVF 1Z7S1 4H55A 4Q4Y1 1IGOA 2PA7A 2WNVB 1K5MA 2XHKA 1SFYA 2XLAA 1CESA 1C8M1 5FLIA 4JDMA 2G9FA 4IEWA 5GZFA 5T3NA 3SISA 3WW2A 5F6KA 4XIKA 4MVTA 2CY6A 4QHBA 5DZFA 2PAMA 3ZYJB 4YW2A 3RRDA 4L97A 5GZCA 4KGQA 1ZBE1 1NA1A 2R061 1RUG2 4GKXA 4PDWC 4XF9A 2GU9A 1OQDA 4K20A 1ZRFA 3J26N 5HCFA 3AMNA 4QQHA 1XNDA 1WCSA 1HW5A 1Q8VA 3GHNA 2GN7A 2JDZA 4LHKA 5TSWA 2PTMA 1S0FA 1C1FA 4I3PA 5JI7A 3VKFC 3AJYA 3LSEA 4PF5A 2OZJA 4L9BA 1W6MB 1UAIA 4A7KA 2NLRA 3AJZA 1Q3EA 2A6VA 5CA6A 1Z7S3 2A70A 4NWWA 4YW4A 4Q4Y3 3LKJA 4WM8A 2ET7A 1QJZA 1SBEA 1LULA 1NCQC 1Y43B 2DU1A 2VH9A 4Q4W1 4XE9A 5F5QA 1PGL1 2RM22 3KCXA 1OA3A 1ZBA1 3CJXA 3FBYA 4KWKA 2XL7A 1EAH1 2YMZA 1HRI1 2BWCA 3WP6A 1ZYBA 1ZBE3 2EA7A 3OJBA 2ARXA 2R063 1QJU2 1LJ7A 5ABJB 4D7YA 4DB5A 5A3LA 4K40A 2D5HA 3AZWA 4J1WA 1QXRA 4QGNA 4GQ7A 2AREA 2SBAA 1HX6A 3ENRA 2ZTNA 1PVC2 4QMAA 1VBB2 2XWJB 1I3HA 1V6JA 1CD3G 1FNYA 4Q2FA 3L9JT 1ND2A 4IXLA 5AFBA 4S2FA 2ZMLA 2QZ3A 2VVDA 2TBVA 3VBOA 1AXYA 1M06G 3SLIA 3GBFA 2CGPA 2E7TA 2OIIA 4D7SA 5BV6A 1RUG1 4Q4W3 2N7GA 4HFSA 4CDUB 5L73A 3RJ2X 1ZBA3 2DYCA 5C8CB 4AHXA 1EAH3 2ZGSA 3TYJA 1HRI3 2JKBA 2XGXA 4GB32 1PK6C 1W0PA 4AQTA 3RS6A 5I0RA 2JXAA 4LBOA 2EIGA 1UZYA 1AXZA 5DUWA 5AFEA 5BNOC 3ZN6A 4IEYA 1LOGA 4N53B 1DF0A 1R1A3 4XFGA 4XTMA 3DPRB 3B00A 1CX4A 1MZ6A 1COV3 4CTEA 4R8HA 3KM5A 2DVDA 3UKTA 1NLRA 3CF6E 1RINA 2RM21 1AYN2 1QDCA 1H0BA 4CP0A 1KJRA 3ZYIB 3W9AA 2G9GA 3IPVB 5JAXA 4HT1T 2VW2A 4AVVA 1GNZA 3PMEA 1HDKA 2ZHKA 4Q8LA 4OHZA 2D3RA 3WW4A 5C9AC 1QJU1 2WLPA 4ITCA 3INAA 1W6NB 4K1ZA 2GALA 3HT1A 1Z78A 4M3CF 2XJUA 2R49A 3TRSB 3N35A 3WT3A 5GALA 3BCWA 4F7ZA 3WR0A 5JSOA 2WNUB 1PVC1 1OOPA 1NCRC 3WNXA 4BYYA 4E4DX 1VBB1 5C33A 1Y9QA 5JMCA 3CJIA 4XQ4A 1DGRA 5BNPC 5T54A 2I45A 3N7JA 2WQZC 2ZGTA 3MW3A 4FP2A 1I1EA 2RM23 4GMP0 4XF0A 3VHPA 4CDXB 1MS0A 4P9JA 4YW3A 3MIFA 1TNRA 2ZOEB 3RQ0A 1MEC2 4GH4A 4GB31 4CDQB 3IM0A 2D6PA 3FLPA 4L99A 4BCUA 2BTVC 1QJU3 1F2NA 2VOVA 2DTWA 4K1YA 3IKWA 3KD4A 4V1PA 1RUJ2 1TE1B 2GNDA 4NO4A 5CG8A 2R16A 5EXOA 2VMGA 4JV4A 4LTAA 5H9PA 1V9U2 2UWBA 4P9YA 4XF3A 3USUB 3HAGA 4N43B 4HVOA 2AYHA 4IESA 2BUKA 3PVOA 4XFBA 1PVC3 4J1XA 1BKZA 3WP5A 1TNFA 1AYN1 1VBB3 2EVXA 3OD4A 1CAUA 4AE2A 4ZU7A 1EPZA 2QJVA 3QD6A 1VAVA 2E63A 5B2GB 3GF6A 2PAKA 1H4HA 3TNPB 1SMVA 1ND3C 3B93A 2NN8A 2Y38A 3JUUA 4WVMA 3VHNA 3V0BA 1ASJ2 3AFKA 2QKDA 3KMHA 4XF1A 1YWKA 4XXPA 1AX1A 4IV3C 3SCHA 5JWPA 2XVKA 4Y26A 4BMEA 2PHFA 2F4PA 2YROA 3N3HA 5ACA3 1KS5A 3RMXA 1L3JA 1WW7A 2BYVE 2QDRA 4LNVA 3VBHC 3JCIA 1VAKA 3BU7A 4QD2A 2R072 4CDWC 1KXGA 4RFT0 2VVFA 4MXWB 1JBCA 1R1ZA 1XE7A 4XPVA 3OYWB 3JQWA 1RUC3 3S30A 4AEDA 1OHFA 1QKQA 1VIWB 4OLLA 2JE7A 4COUA 1AYN3 2PFWA 4LBQD 3TOJA 1IHMA 1AHSA 1NZCA 1O4ZA 3D82A 3LWCA 2BWAA 4HSJA 1SBFA 5DZEA 1MEC1 2JEMA 3AX4A 3LGRA 1LEMA 1WLDA 3GYDA 1W2UA 4MV2A 4JGYA 1RUJ1 4RA0A 2UYBA 2W52A 2W68A 4QPYA 4XJUA 3FZ3A 4COVA 1V9U1 4AF9A 3ES4A 1QWRA 2WNVA 4PQ9A 3TWIA 1MS8A 2W39A 3K48A 3ZXKA 3P3PA 1XNKA 3VBUC 2TUNA 1PZ9A 4K8FA 3R4DB 1FXZA 2HWD2 5FQ0B 3ZXLA 2B5HA 3O7OA 3KCYA 4Z8BA 4WM8C 2VW0A 4D3WA 1SLAA 2FMDA 1GZWB 1ASJ1 2Q5TA 1GICA 1KDKA 2GMPA 2PHRA 4FT8A 4Q27A 5LEKA 1FMD2 4DQAA 1QQP2 5FOBB 1YFYA 1AJKA 3QH7A 4UW3A 3K51A 4DOUA 4HSLA 1DHKB 1VRH2 2DF7A 3U0ZA 4BMBA 1R083 4A7YA 4I0BA 4OHYA 1RUJ3 3LA3A 4HETA 4OI4A 1W6MA 1WMFA 2RHPA 4XFCA 2Q8OA 2R071 2B39A 2ZGUA 4PLMA 4SLIA 3VN4A 3KS7A 3MEPA 4YM1A 1AR82 3PNAA 2ZGPA 1JTZX 2GZWA 4QPIC 3PTYA 1SLCA 1UW8A 2WFF2 1JXNA 4ES9A 1Q8OA 2WKKA 3TAYA 3ZSEA 2PAEA 1ND2C 3ZO0B 1LRHA 1DLLA 1BBT2 1JOJA 2ES3A 3VBOC 2P3JA 2DCZA 3MIGA 1ASJ3 2GMMA 5ABJA 5JOYA 2IC1A 2BEOA 4Y4YA 1VJ2A 1KFXL 4AFCA 4FVVA 3JD72 1WMDA 4JCKA 2ZX3A 3WVJA 2A5ZA 1RGSA 2H6CA 1GZCA 1BQPA 5KXBA 4M3CB 1KQRA 2HWD1 2R073 4D7TA 4XBLA 5H9SA 3WDYA 4ATFA 3VLBB 2HEYF 4Q1RA 2FBEA 2FHRA 5HXVA 1J59A 2P17A 2XJPA 3NKGA 3AZXA 2JG8B 1TME2 2PHUA 4P9GA 4CDUA 1VBD2 1FMD1 1QQP1 5GLUA 4X6QB 5C8CA 1V6NA 3U11A 2O8OA 4CEWC 1ALYA 3GBWA 4KU8A 3ZMOA 3M7AA 3ZSMA 1VRH1 3VZMA 4WM7C 2YUEA 5KHGA 4H3WA 4LHLA 4OVEA 4FSJA 1Q5OA 1OMIA 1UU5A 3ALQA 3H3ZA 4N53A 4XHXA 1CN1A 5FRAA 3DPRA 5C4WA 1AR81 2DTYA 3RYKA 5SV8A 4FTSA 2PHDA 3B7MA 4QPGB 1HQWA 1MS9A 2ZKNA 1ULCA 2WFF1 2EXIA 4UBHA 1GV9A 4JTNA 4N7IA 4N9HA 5EZWA 2EAAA 2HWD3 1FYUA 1QDOA 3CJIC 3IPVA 2C9AA 2RS52 1BBT1 1LEDA 5KC6A 2XH6A 5K9YA 4U36A 1B09A 1J1LA 4MSVA 4H7MA 5F1RA 5L19A 2HKXA 1AVBA 2OYZA 3U4XA 1A78A 1W6NA 4YGEA 1ENXA 1FMD3 3NV1A 1QQP3 1AJOA 1H8TB 1ENQA 3JD71 3IBMA 3FE5A 3POSA 4AYUA 4XJ9A 2WNUA 4GA9A 4FTBA 5I8TA 3NWKA 3OY8B 4OI1A 4AVSA 5JSRA 3LCPA 1LHNA 2UURA 2PHXA 4BIFA 1XYPA 2X29A 3WDTA 4EWEA 3AZZA 1HV0A 1N3PA 1AR83 4KBBA 4UXAA 3WW1A 5C8WA 1YFWA 1NOVA 2BW8A 1NXD1 2WFF3 1TME1 2VU9A 1VBD1 2YXSA 1XU1A 4CDXA 5IK4A 4A2UA 1ZZBA 2WINB 5CBLA 3PHMA 3EQEA 1BBT3 4CDQA 4I0WB 1CAWB 2WT1A 5JIUA 1ZZCA 2FZ2A 1CONA 3LSDA 2QVSB 3L2YA 2XJRA 5IK7A 3NO8A 3USUA 1RB8G 3JD73 4XFIA 4N43A 5GKAC 4EWDA 3VKOA 3E5XA 4LLOA 1ULFA 4CZSA 4LE3A 4ZU4A 2ZABA 3RSJA 5KHHA 2Z69A 5GZEA 3HIFA 2RS51 2G4IA 4MZUA 5JPMB 4JC1A 5E88A 1GZ9A 4C0HA 5JLVA 4AEDC 4IEXA 4JGZB 1TME3 2Q30A 2XKOA 1VBD3 2D43A 4IEPA 4OFGA 4LBLA 2NMNA 1MR5A 1PHMA 4Z07A 5JZGC 3ELNA 3BOPA 1DGLA 2OUJA 2ZKLA 3ZXEA 1RUNA 2MPFA 4YNIA 1WW5A 2ILMA 4JGYC 1N1SA 3TN92 3HD8B 1WW6A