2VOKA

Murine trim21
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
186
structure length
186
Chain Sequence
AHHHHHHMVHITLDRNTANSWLIISKDRRQVRMGDTHQNVSDNKERFSNYPMVLGAQRFSSGKMYWEVDVTQKEAWDLGVCRDSVQRKGQFSLSPENGFWTIWLWQDSYEAGTSPQTTLHIQVPPCQIGIFVDYEAGVVSFYNITDHGSLIYTFSECVFAGPLRPFFNVGFNYSGGNAAPLKLCPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 52 KDA RO PROTEIN
publication title Trim21 is an Igg Receptor that is Structurally, Thermodynamically, and Kinetically Conserved.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 52
structure length 186
sequence length 186
chains with identical sequence B
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2008-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00622 SPRY SPRY domain
A PF13765 PRY SPRY-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.920 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2vokA00
5F6LB 5F6KA 3ZO0B 2LM3A 2IWGB 2FBEA 5JI7A 2YYOA 2YUEA 4B3NA 2VOKA 4QT6A 3TOJA 2E63A 4XW3A 5JI9A 4P9LA 4WVMA 4B8EA 4KG0A 4WVMB 4X8PA 5JIAA 4X8NA 4N7IA 4V1PA 2WL1A 4P9IA 5JIUA 5C33A 3KB5A 4P9JA 3UV9A 4N7UA
chains in the Genus database with same CATH superfamily
2XUEA 2P3IA 5AFBA 1F8VA 2C4XA 3OD0A 1LOFC 1VBD3 4OI4A 2P3KA 4LBJA 4XQDA 5CFDB 1W2NA 4Q4Y3 2D44A 5DMYA 1W8NA 1VBB1 4KWLA 3V64A 2RV9A 1SACA 5C3RA 4FPGA 3RZGA 5FP7A 3I3DA 4RD7A 2ZEXA 3B02A 1SLAA 3BGAA 3VBSC 4I0AA 1HN1A 2I07B 1VLNA 3LOBA 3FLRA 3GCWA 1GOHA 3TN92 2RM21 4I3PA 2PHRA 4LBMA 4DXTA 3VHPA 3ZXGA 4LBQB 4IE4A 3TEYA 4QHBA 4A7YA 5F39A 5JOXA 1GYKA 1NCQC 3BODA 1NQJA 5IAXA 1V6JA 4N9IA 4Y22A 1OMIA 1T2XA 4LKFA 1CX1A 4S2GA 3ETQA 4LHSA 1V9U2 1Q43A 4OI1A 2CAUA 1IQAA 3B01A 4LBKA 1F31A 5FYUA 5JOWA 1JUIA 2E63A 1W6PB 5A3LA 2AEYA 2GC0A 1W2TA 4A7ZA 4FPLA 3KCCA 3MIGA 4CCMA 2J1AA 1GP4A 2W1WA 3MIFA 3NQHA 4DXZA 4CEWB 3WD5A 5FPVA 2A6ZA 4BU2A 4QB1A 3WDYA 3BTAA 3R4UA 5FP8A 5IUQA 3TN91 1HQWA 1WLTA 4KU8A 3S7IA 2VQ0A 5FY8A 1YQ6A 4D6RA 5DAXA 1RB8G 3LQCA 1UPIA 2VR4A 3EBRA 4XC9A 2GNMA 2BBAA 4AAXA 4CDWA 2AZ5A 5EIYB 2Y6KA 1Y9MA 2MPFA 5FO9B 4FAHA 3AXDA 1NYWA 3I97A 3SC7X 5C5TA 2V73A 5CA6A 1V9U1 2RR12 3CDZB 3N35A 2ZMKA 1CAXB 1NG0A 3PIJA 2D3SA 1AYN2 1BK0A 3FHQA 4XW3A 1X36A 1FAYA 2E7TA 2NM1A 2ZX1A 2VMGA 3JQWA 1GICA 4GJYA 2Q5TA 3K3OA 2XHNA 2WUHA 4FAGA 5IFPA 1R1ZA 1TME3 3C7GA 3MICA 4KWKA 3D5OA 1LCLA 3HQRA 2BZDA 4IXLA 4EV0A 4CCDA 1G7YA 4YYOA 1V00A 1D2SA 1S0GA 1AR92 2I2SA 2YB7A 1ZVFA 3B9CA 3DN7A 4IE7A 4NPLA 2A71A 3MPBA 3KZ4C 1E5SA 3MIEA 3JD71 2K2SA 1YFUA 4Q0VA 1QDOA 1SFPA 3ZXJA 1ENXA 4LT5A 1FNZA 1RHI2 1DYPA 1I3HA 2RJ2A 1HW5A 2XJUA 4LOTA 4P5YA 1OPOA 3VDDA 4BQWA 1XB9A 5JMOA 2V4AA 1LULA 4W6WA 3WNPA 2UY9A 1U5IA 3AZXA 3DL3A 3I3MA 1ENQA 4Y20B 4DNYA 1REDA 1ZRCA 3OGRA 1AXZA 5ANNA 4FOYA 4FP2A 1H8TB 2DF7A 2WA4A 3WG3A 4CDUA 2QVSB 3AKRA 4BMEA 4LBNA 5FYBA 5T5JA 2PQQA 4META 4RGKA 3RS6A 1HV1A 2OUJA 1XE8A 2WBKA 3P3PA 4BQ4A 4HN0A 5A7NA 1XJAA 5JIUA 4XFCA 5KXEA 4M01A 3K75B 4QQLA 4DB5A 5ERLA 4JDMA 3SMHA 2AR6A 1YXWA 3UETA 5IK8A 1AR91 1H6YA 1QJX2 2WRAA 5GLZA 5HBAA 1WD4A 1SEFA 2JG8A 2W94A 5AC92 1UOGA 1OD5A 1DCSA 1YLLA 4RR3C 1RHI1 4MGQA 2YYOA 4MGYE 1QNWA 2GP5A 1GNZA 3I4IA 3JUUA 2B5HA 5FXXA 2WNVA 1LESA 3H3UA 3MW2A 3EJKA 5I0UA 2BU9A 1J1TA 3I2FA 3RGBA 4QPGC 5FY1A 1W03A 3WNXA 5CU1A 3O1MA 2WT1A 4LJHA 2QFEA 2VM9A 4P9WA 1LKNA 2I74A 4Q4V1 2FDKA 3U75A 4Q4X2 1XNAA 3M3CA 4QB2A 1TQ5A 3USSA 4I3GA 1POV1 5BV6A 1JODA 1YQ8A 3O1UA 1GWLA 2ZGQA 1ODMA 2L9LA 5L36A 3V0BB 3MIDA 5LBEA 1QJX1 2DYCA 3KCYA 2O8OA 4XFHA 2VVEA 3ZFGB 4CEYC 4XZUG 4MXVA 1OF4A 3OB8A 1ASJ2 2BUKA 2QDRA 2PELA 1U0AA 1UY4A 2VUCA 1LU1A 1DQ2A 4IDZA 4IV1B 4LUMA 4QPWA 4W6XA 3HVDA 5CFDA 3ST7A 4MG2A 3T30A 2HWD1 4YM1A 1ZRIA 4FTSA 4E4ZA 5LASA 1HXS2 2XL7A 2ZMLA 3J7LA 4QX2A 3AZZA 1OLRA 3NJXA 4W65A 4V1PA 1LEMA 1QWRA 3PIGA 4XPVA 1CPNA 1RUI2 5EJ3A 5ACA1 1X50A 1X7NA 3B94A 3N7MA 3VZLA 5IAVA 2WZEA 2JDYA 1PNGA 3MIBA 4LBQA 4QPIB 5B4XA 2X05A 3LEGA 4AR2A 1JZ2A 2X29A 1O4TA 3MDPA 4D69A 4IEYA 3FL7A 2EIDA 2LTNA 2WAOA 5F3GA 1IPSA 1PK6C 3JBG3 2LROA 2TBVA 4FPYA 5A80A 2ARBA 2VECA 4S2FA 1SCSA 4BXFA 3AP9A 1UZVA 1PVC1 5C71A 1RVF3 1K3IA 2Y34A 3ZKUA 2IXCA 1MVEA 2WQ8A 3OG2A 1ZZBA 2JIGA 1W6PA 4S2DA 1J3RA 2ZABA 5T5PA 2BYVE 5C3PA 2HH9A 1HXS1 3EXUA 3J4UH 2OX0A 4NIDA 4NHMA 4NAOA 3A4UA 3NWKA 4CEWA 3WNNA 1VRH3 4YG0A 1FMD2 3AJZA 3Q9OA 3VKMA 4XEZA 3A21A 4LXLA 2WFF3 2MNGA 4YVWC 1BXHA 1JI6A 4C0HA 1HDKA 1GOGA 3AKQA 4IV3A 4LNVA 5L73A 2BW8A 4NIAA 2VZOA 4PHZA 4WM7B 3WEZA 1W0PA 1O3RA 1R1A2 2W92A 2Y6JA 4UFKA 2Q8OA 4CUAA 2IFWA 3AMNA 4RFT0 3TYJA 1FYUA 3I3BA 5FZ7A 3SLIA 2PHTA 1OC1A 1N1TA 1ZZ8A 2D93A 3DYPA 4QX7A 2WIIB 3C8XA 2GMEA 3KT1A 4ZXEA 4B4PA 3RZJA 3T2TA 4XQ4A 4QWNA 3ME2A 1S2EA 3AB0A 2BGCA 2V72A 1LENA 4R8HA 3ZYBA 3N9QA 1GWKA 3FBMA 3SEEA 3BYWA 4E4DX 2ZZQA 1JU4A 4XVHA 3VBFC 4XJAA 1W8OA 2EXKA 1B09A 1D7PM 3LA2A 4MHUA 4RFRB 4C90A 4M00A 5CADA 4P14A 3VBHC 3W21A 3ZMOA 5C3SA 3H7YA 3ECQA 1ACCA 2NMNA 4G9SB 3W5NA 1YQCA 3AK0A 1FV3A 5HI0A 2LW8A 2VZPA 3E5XA 5FRAA 5A3PA 4Y20A 4EROA 4RYDA 1AR83 4AVCA 1H8TA 1SLTA 2YG0A 1PO13 3M3EA 3WW2A 1N3QA 1N1YA 1UWWA 1O8SA 4CP2A 2VY0A 5F2SA 5AFEA 1QIQA 1S4CA 1GMMA 2HKXA 4G4FA 4I01A 4LITA 1YI9A 2BP6A 1FPN2 2RS51 3BU7A 5FYCA 3B69A 3ZX7A 1QOSA 5DAQA 2BQPA 2W91A 3LF7A 1W90A 4HK8A 1UZ0A 4AI9A 2Q30A 3ZDVA 4F8AA 4NPRA 4LA2A 2W2IA 3M3QA 1VBE3 3PJYA 5FYYA 1JH5A 2ZEWA 3H50A 4XFAA 2WQZC 3KWVA 4H2AA 5BYNA 1UPSA 1W9SA 3KVAA 4N43B 3AL6A 2A6YA 1BEV2 1PGW2 1DP0A 4LQRA 4XETA 2GNBA 3U4XA 1D4M1 4AI1A 4ARYA 2DVBA 2W08A 4PI2A 4PLOA 1ND2C 1TNRA 3POEA 2BFUS 4Q0QA 2QJVA 2GN7A 5BPXA 4CXWA 4ZHNA 4YVSC 2P37A 1QY4A 2BWAA 2XJQA 3BU0A 3L9JT 2D98A 2VUAA 5JLVA 4CCLA 3ZFGA 2EALA 1RUG2 4D0QA 2W1SA 4BH9A 2R062 4N53B 3K4AA 2ETEA 2FBEA 3HT1A 5FP4A 4TXWA 1X8MA 2G9GA 4BQXA 3HNMA 5FJHA 2ZX3A 4IV1A 4R4ZA 5A6QA 2WR9A 3DV8A 5BXXA 5DDJ3 4S2HA 3WF4A 1G9AA 3FE5A 1IS6A 1YUDA 2RS31 2WYSA 4WV8A 5FREA 4AG4A 3UYJA 1OOPC 1H1IA 2ZGNA 1ZZCA 4KQ7A 4WM7C 1QKQA 4Q2FA 1PX4A 1NX9A 1X9PA 5GJ6A 2WNUB 3BPSA 1OH4A 2P3YA 3GJBA 4HKWA 1XNDA 1RXFA 1JYCA 1AL23 2HWB3 5FZIA 3AYCA 3ZMNA 1X8EA 4E4SA 3RMXA 5ISLA 3BB6A 3B5LB 4V2VA 3CO2A 4QPIA 2VNOA 4I0WB 5LA9A 4DFSA 4NAMA 4YM3A 2C9KA 4H55A 1LJ7A 3LFMA 1RUG1 5L19A 1IKQA 2DBNA 3PVOA 4FQ4A 4GH4C 2FMDA 1U5XA 4R9DA 3WP3A 1AR62 1DQ1A 1W2UA 1JZ6A 3AP5A 4YGCA 2ZA9A 4R9CA 4UI9L 4A2UA 2VZ1A 1ND3C 3M7AA 5GLUA 2D3PA 1TVGA 1UYXA 2ZGLA 5F5CA 3MF6A 4JKMA 4Z82A 2DVGA 5KXBA 3UJOA 3I2OA 4IL7A 4UAPA 3T1MA 4EN7B 1DGRN 2D6OX 2Q1FA 5A3UA 2PAKA 3M70A 1RMU2 3AYDA 3CHXA 4XJWA 5DZGA 4CP1A 5CZKA 1PO23 4NVPA 4F83A 1W06A 2DVDA 4LIVA 4KU7A 3URFA 5C6CA 3RZKA 5KHIA 5EHDA 2EIGA 1RUC1 4WVWA 3FLTA 2LM3A 2CWSA 2P6CA 3AFKA 1AR61 4DEQA 1GKBA 2IXIA 3VBUB 1ULPA 4AFAA 2DCZA 3J7NA 5A3OA 1W8WA 4X6RB 3I59B 1JHNA 4B29A 3MHZA 4GWNA 2ORXA 2Q4SA 2OA2A 2XG3A 5DAVA 2VMCA 1S2BA 4XXPA 2R071 3I3EA 4MGTA 1FOD2 5EQUA 4LUKA 4AEDA 1RIRA 2D97A 2QUOA 4COUA 4XHBA 4MSVA 5FZMA 1PVXA 1EPZA 2V4VA 5KXDA 4Z2AA 2HWE3 3H8RA 2WNEA 3APBA 1DZTA 3VDCA 4U2AA 2OPWA 1MZ5A 2DUQA 2R1DA 3FJSA 2A6XA 4XDPA 3WP5A 4AFMA 5D21A 1GQPA 3AYAA 3PMEA 3MLKA 3AC0A 3I2GA 3H3LA 2JKBA 5L7OB 1Q5OA 2GC3A 4LHLA 1Z7S2 4RS5C 3I54A 5FWJA 1I1EA 2ZJCA 2ZHKA 1C8M2 2WYFA 4UW4A 5EXOA 3RMYA 5JZGC 2WSVA 3GZUC 2MEV3 4K6BA 4NHYA 1RUF1 4ZONA 3USUB 1KXGA 4GD4A 4JAAA 1FOD1 3NJVA 2ZCWA 5FZ6A 4MXWA 5A1AA 2EIBA 1XSRA 1E5HA 1RXGA 1GQHA 3H42B 4FVVA 3N9PA 5T3NA 2HBTA 2GZWA 3VBRB 2RMU1 1WGPA 2ZHNA 3MO4A 4HETA 1ZX5A 4QQ2A 3VKLA 4GKXA 4P5HA 3PVEA 1UOFA 5FZ3A 4RHV2 4HPKB 3RQ0A 4CCEA 3W59A 1AYM2 3POIA 3LD8A 4YM0A 2E7AA 1V70A 4CVUA 1Z7S1 1COV3 5A3WA 3CQOA 4FTEA 2FMYA 2Q1MA 5FBZA 3HR9A 4LBOA 4CCJA 4L9BA 4WVMA 3W5MA 4FPCA 1OQEA 2OUHA 2R1BA 2YC4A 1LRHA 4AEKA 1NA1C 1IS5A 4GA9A 2Q8CA 2QZ3A 2NYYA 3MZHA 4NPMA 4XBNA 4IGOA 2W68A 3L2HA 1G9BA 4ZS2A 5C9AC 2EXHA 1T6GC 1VBC1 1R083 2FZ1A 2VMFA 4RHV1 2HWC1 1W9FA 4XUPA 3ROUA 1AYM1 1V6KA 1PGL1 1U12A 5IVFA 1VBD2 1VAKA 2ZZJA 4P9GA 3IPVB 3IN9A 4XIKA 4Q4Y2 1WCQA 1IG3A 4PIYA 2ZXQA 2WO1A 4WZCA 3BOPA 3ZPYA 3KHBA 4SLIA 1A3KA 1AL0G 1AVBA 3T1LA 5A33A 4CXXA 2WNUA 1K12A 3M8LA 1PIV3 4X8NA 1W8UA 4MOAA 5E16A 3ACIA 3ZYFA 2J1RA 3SKJE 4DY3A 5JWPA 4XJ8A 2BPA2 1X82A 3ZXDA 3FLPA 3KB5A 1SBDA 1V6MA 3K2OA 2QQPA 2XHKA 4FOWA 2PLV1 4ASKA 5CEHA 2XBO3 4TN7A 2DUOA 1YC61 1S2KA 3BTZA 4IEXA 2VL4A 3IZOA 3P5BA 1J58A 3PUHA 4M3CE 5LK5A 3OBAA 4ES9A 3BPZA 4D6QA 4ORFA 1KFUL 5HCFA 1OH3A 1FNYA 1QJY1 2J1VA 4Y24A 4F7ZA 1RUJ1 3RNSA 5FK7A 4EN6B 5BNOC 1K42A 1GZWA 4FXKB 1Y9QA 4OZOA 1A34A 2WN2A 2EXJA 4BA6A 3GZEA 1XOYA 1DIWA 1TMF3 2KR2A 4JZRA 1AX2A 4AFBA 5BNNA 3HAGA 1WW4A 2Y33A 2YFZA 4NRPA 2PHDA 4UWDA 5FPAA 1XNCA 3UL2A 5IFTA 2TUNA 4Y4RA 2VCCA 3WP4A 4CPBA 5EWSA 2CYFA 2YZ4A 5C8CA 3MFCA 2OIIA 3SCGA 4ZPIA 2DTWA 4JX0A 3WHUA 2VUDA 2PHUA 5F6LB 3C7EA 2UYBA 4MVTA 4MZUA 1OA3A 3UESA 3I3QA 2XJVA 2UWCA 1APNA 4CUGA 3VBUA 4H3WA 3LEKA 4EN9B 4Q27A 1HB3A 3I59A 4AL9A 2RG4A 4N90A 2CSGA 4K7JA 3UGGA 1FT9A 2RJLA 2WC2A 1G9FA 1TME2 1V6LA 2XJPA 3K4ZA 4P9IA 3VUOA 1ULFA 4N8MA 5LATA 4FP3A 2WA3A 1UKRA 1NUKA 2VUJA 3BIWE 1MR5A 3KLSA 1NXD1 5C8WA 3WHTA 3MIHA 2WZR1 2BJSA 3AYEA 3GALA 4SBVA 1MS1A 1ZBE1 4HOOA 4CDWB 4BXSV 3C7FA 3AJYA 1OT5A 1MS4A 2FHRA 4HVRA 4QXKA 1HN0A 3THCA 4QAWA 5L7OA 2P2KA 1UAIA 1ST8A 1W0OA 1ZBA3 1A8DA 1MEC1 3CNAA 2C0ZA 5HPOA 4GMP1 3UGFA 1DQ0A 1SLBA 1QQP1 3FZ3A 3POWA 5IVYA 4PCRA 4XE9A 3E1F1 3USUA 1DQ5A 4BB3A 2YFUA 2A5ZA 3OUIA 2OYZA 1SQ4A 2VMEA 1TME1 1S0IA 3NL1A 2PN5A 3S5QA 5KHJA 4B7KA 5G05L 1NZCA 4LO4B 4UFIA 3VBRA 1VB4A 4GKYA 4O65A 3J8F1 4KH9A 4HVOA 4YGEA 4JTNA 1C57A 4RSUA 4HPKA 1UMHA 4COWA 1ZRFA 2VU9A 3RFRA 3Q8FA 2XQXA 2O0OA 3VD9A 2SLIA 1YCIA 1FXZA 2JB4A 3WG2A 3AZYA 1HQNA 4XUQA 1DLCA 5FBJA 3VDDB 4XMIA 3FMGA 3KF5A 3KMHA 4Q8LA 3SH3A 5LWBA 3VZMA 2C9AA 1SHWB 4IW3A 3CJIA 5F5QA 4DZGA 1YYNA 3VD7A 3ZYHA 4KBZA 4COZA 1S0JA 1Y9GA 5FOJB 5JXHA 3OD4A 2W0XA 4GWMA 3PVNA 2NPIA 2ORZA 3H1YA 4BQ1A 2VMDA 5IT6A 2UYAA 4I02A 4QHZA 1YFYA 4DY5A 4HVQA 2X8KA 3JU9A 4HSJA 1UL9A 4JGZB 2C6SA 4UBGA 4BDVB 1CPMA 2HJIA 4HONA 3N9OA 5DN2A 1RUE2 2XMLA 1TNFA 2MHFA 5JCTA 3K3NA 3VLBB 4XF4A 1OLME 1XNTA 4J25A 2RJKA 1OFNA 2G1MA 3F2ZA 4N9HA 3VBOA 2BRTA 5FPBA 1WA6X 1CESA 1F5JA 1PM4A 2E26A 1NCRB 3C2UA 2EICA 5FWEA 5GLVA 5T50A 5FZHA 1HJGA 5A6YA 4ARXA 3WDWA 5DG1A 1W2OA 3ES4A 4GMP0 4QGMA 2VCMA 2EAKA 2VNRA 2IVJA 3ILRA 1QH6A 2XONA 1DLLA 2OPKA 4KNCA 5A7SA 4AI2A 4Z92B 1ULOA 3H8XA 1KD7A 2O1QA 4PBPA 4WM8C 3A0KA 1U5YA 3VD3A 2YGLA 1RUE1 1RVF2 1SFNA 3AKTA 3ZYRA 4KL1A 1ULEA 1J3PA 3EQEA 5I0RA 2ZKLA 3MLLA 4Z2WA 1LGCA 5FYMA 4Y1XA 3KV4A 2C1FA 5FPUA 1CAVA 1F4AA 2DFCA 4A41A 3JXSA 3NVCA 2QDNA 2ZGTA 4FOVA 5SV8A 3TBDA 3UGHA 3NRUA 5KHHA 4AQTA 4E4HA 2XPJA 1VAMA 5L9BA 2CDPA 1VRH2 4H7MA 3I2JA 3WW3A 4DPNA 4BYYA 3RI8A 2WFF2 3VZOA 4YZ1A 1R64A 3LAGA 3SHRA 2AH2A 2D3RA 1CD3G 3LIGA 4YG3A 4XTPA 4LO7A 3L2YA 4HLTA 3VD4A 3ZN4A 3R05A 4HK9A 3ZSMA 3WX5A 3ZFEA 3GCXA 1AF9A 3ZLIA 3DPRB 1X33A 3NV1A 2VCAA 4P08A 3S30A 3R6SA 5JSRA 1MACA 4BE3A 4OUSA 3S5AA 2AACA 4BMBA 1LGBA 1NLSA 1OA2A 3WDVA 1K5JA 2P17A 2WO2A 1F35A 4LLFA 1O5UA 3POSA 3LA3A 4XFIA 4YFWA 5DZFA 4CDXB 3VDDC 1NZIA 4HKOA 1K5MC 2WFF1 4J1WA 1WW7A 4UF0B 2VJXA 3WV6A 2PYTA 5C7GA 2R16A 1P8JA 1F9KA 1TE1B 4IV3B 4KWJA 5LEKA 2E6VA 5F3CA 2B39A 4HANA 2V09A 1L7QA 4CDUC 4HFSA 3O0VA 1EYBA 3O1PA 3H0OA 3OEAA 1HX6A 5KHKA 4OHVA 1WBFA 1LGNA 3POFA 2B46X 3N7LA 3N9LA 1WLDA 4NHKA 5FP3A 1LU2A 5KXCA 1BVVA 4CCKA 3LIHA 1AR82 3I7DA 1KDMA 2JDZA 2ET1A 2VZVA 5EZWA 1ZM1A 1HRV3 1PO12 2JG8C 1CX4A 2VXJA 4PQQA 3O0XA 4B7EA 1W8HA 2IXKA 5CAZA 2GALA 1XU2A 2Z5WA 2RS13 1OUXA 3OY8A 3BI3A 2YMZA 3QLQA 4QDSA 4E8DA 2W87A 2HYKA 1RC6A 5A3MA 3IIAA 2JE9A 2QBXA 2WNVC 5C4WA 2WFPA 1GZ9A 2WLPA 5IVVA 3PUSA 4NOTA 2J1TA 1KGYA 2JECA 3ACHA 4IGQA 4XCBA 4E9KA 1UOBA 1YHFA 1CJDA 4YW2A 5APAA 3VZJA 1YFXA 2C5DA 1MZEA 3IKWA 1VBE2 4LE3A 1SDWA 3U37A 1CZTA 2RR11 4CP0A 1SG3A 3NAPB 5A32B 2R043 3N7JA 1Q56A 1XQNA 2Y8KA 1AYN1 5CISA 2AC1A 1DQ4A 3AP6A 4FI9A 3JB4C 1QNYA 3WDXA 5FPXA 4Q0UA 1GANA 1AX0A 5FZDA 5EPAA 3OTFA 2BTVC 4AVTA 4IUGA 3WF3A 5BNPA 1YNAA 1WUVA 5CFDC 2VG9A 1H2KA 2QQNA 4TYSA 5A7WB 3ZYIB 5JPNB 3BTYA 4RQPB 3WP6A 4QXHA 1CAUB 5D8AB 4D8MA 4NHXA 3H9AA 4K8RB 1BK1A 4JGZA 3WDTA 2GSYA 1UY2A 5J96B 3P1IA 2VBDA 2XOMA 3MLJA 1W05A 3INAA 5GZFA 4P9YA 4AFDA 2XDVA 4HSLA 4LULA 4AQ6A 4QU2A 5DDJ2 2B9VA 3LZZA 2J1UA 3MI8A 5IK5A 2OQ6A 1J3QA 3IT8A 1BKZA 2WN3A 3QACA 4IEVA 1HJFA 1QH7A 1JYIA 2VULA 3J26N 3T4VA 1T6BX 2VNVA 5JZGA 1F2NA 5LCWL 2HWB2 1AL22 1NCRA 1C5HA 4ITCA 4XABA 3WQBA 1WWYA 2R0HA 2QQLA 2AENA 3THTA 1GZCA 2VNGA 4L8QA 4JHZA 5K0UB 1AR73 2G4IA 1OBNA 3C7OA 1RUOA 4MO3M 3ZSLA 5AC91 2H0VA 4ISQA 3ZXEA 5FYZA 4CEWC 1W39A 1FATA 4OMDA 4ZU4A 2G19A 4R52A 2XJRA 3ILFA 5DDJ1 1CZVA 4IV3C 3HQXA 2PAMA 3CMGA 2VPVA 3LEIA 5FYHA 2IC1A 4L2NA 4CTEA 2HEYF 3UKTA 4ATEA 2OT7A 4PLMA 4UXAA 2JDAA 3KM5A 4OI2A 5A70A 1NOVA 2D6PA 1R093 1SPPB 3ABZA 4HZFA 4Q4X1 1H2MA 2A6WA 3DF0A 4YZ5A 2D5HA 1PO22 1V6IA 3ACFA 4OHYA 1WCDJ 1TG7A 2A7AA 1ZYBA 4KWUA 3DPRA 2P1BA 1W9TA 4IEWA 1ASJ1 1H30A 1E5RA 1HKDA 1UYPA 4ASLA 5DPNA 4IERA 2RDNA 4AGVA 4D6SA 3HMYA 4XYXA 4MLOA 1U5ZA 2WQ4A 4K1ZA 4ZY9A 4D7SA 5D2AA 2UU8A 4G3YC 5CB7A 3Q8BA 1PNFA 4TTGA 4UOJA 1CVNA 2ZAHA 2RM23 2AREA 4Q4W3 4CDXA 5J37A 4YG6A 1RUI1 1H2LA 2CWMA 2HWE2 3KV9A 1ULGA 4IEZA 4UF0A 2DU0A 3PUIA 1OSGA 5GLTA 2GH2A 1HB2A 2DCJA 2Z69A 3ETPA 4QXBA 3FUOA 1OA4A 1UU6A 3U4SA 5F2WA 5FDBA 1H8TC 3RZHA 2YBKA 1GZTA 3U14A 1Q8PA 2ZEZA 4XXAA 3E97A 2O8QA 4IEUA 4JHTA 3POGA 3ENRA 2R6QA 2J7MA 1G86A 2ZMNA 2HEVF 2MEV2 1POV0 1XPWA 4L11A 4AAPA 4AVSA 2XH6A 3GNEA 4V2WA 4AEDB 3PLQA 2DU1A 1FMD1 2ZGRA 3KT7A 3WOGA 2UWAA 5E89A 1BLZA 4DUVA 3WNLA 1ZZ6A 4OHWA 1LOGA 1SLIA 5TSWA 3M3OA 1W0NA 2JXAA 4IEOA 3U07A 4GULA 4A42A 1R1A1 5F3EA 2GH8A 3J9SA 3BKZA 1QOTA 5FTTC 3KGLA 4EJRA 4TWTA 2UY8A 1COV2 2GP3A 4M3CB 3WQ7A 3NAPA 5A32A 4NIIA 3POBA 4JVAA 3SH4A 3J7HA 4BLIA 1I6XA 1NXMA 3IDCB 3MPPG 1JN2P 1UMZA 2VW2A 4JRLA 3ZYPA 3THPA 3ZFGC 2MEV1 4OVEA 3BIEA 5FZBA 4H14A 2ERFA 5ABJB 5DUXA 5FMOL 3ZR5A 5IVEA 2BDRA 3DEMA 4MXWB 4IV1C 1AXKA 1REFA 4OFGA 4NMIA 1WMEA 2A3WA 1GBGA 2C26A 3VHRA 1JHJA 5FZ4A 2J1EA 4RQPA 3TNQA 3PURA 1CAUA 5FZ0A 4A4AA 5KR7A 1W04A 1VBA2 3JD73 1WMFA 2XJTA 3N9NA 5D8AA 1N1VA 1R082 5A1LA 1RUH3 1G6NA 3KV5A 1GFF2 1A6CA 4XF0A 4W50A 1UF2C 5FMCA 1HRI3 1V6NA 5FZAA 1COV1 2W9XA 3GF6A 1XYPA 5B2GB 4QPIC 1UIKA 4XMAA 1WKYA 4KI5M 4Y1ZA 3T2OA 2P34A 2B45X 4WVMB 2BGOA 4PDWB 3TEXA 3ZXLA 1PIV2 1QXPA 1UNBA 4OULA 2K9ZA 4B1MA 3K77A 4QB6A 4JRAA 3A23A 1DBNA 2JIJA 3ZSKA 2XVKA 3OJBA 1IZ3A 1AR93 1G8WA 1UIJA 1FPN1 2EA7A 4KGGA 1LAJA 3UKVA 3O14A 4YGBA 2XBO2 3A0NA 1VBA1 4XJUA 5GLWA 5K0UA 5LA2A 5SV5A 3GBWA 3AFGA 1JZ4A 1R081 3VV1A 5IWFA 3WF0A 4GIQA 1XNBA 3ELNA 1QJU3 2HBUA 5FMBA 2QE3A 1WW6A 4RL7A 3VBHA 4LR4A 5T54A 3A7QA 5B4NA 3IM0A 5CFCB 2BOIA 2JD4A 1J1LA 2JG9B 3R0RA 1TMF2 4Q4V3 1BEV1 1PGW1 5A33B 4LKSA 3TWIA 3BOWA 4R4XA 1Q8QA 3P3NA 2BVVA 2FCTA 2WINB 2ZX0A 3NSTA 5CIRA 1F5FA 3TEZA 5CVRA 4YGDA 1PMJX 1GP5A 1SPPA 5EFUA 2HYXA 3IDEA 1S55A 3MV11 1QJX3 2V5DA 4QD2A 3EHKA 2XBO1 1MVQA 3JB8A 5BNQA 1GOFA 3CJXA 5GZCA 4Q29A 4E2GA 1PHMA 2PTMA 3HIFA 3IBMA 3DUIA 2FDFA 2R061 1DYKA 2D6MA 2PXJA 2HWD3 5EJ1B 2F17A 1UY0A 1SBFA 1JOBA 3KD4A 2SBAA 3OPWA 5LBFA 2BVBA 3NNGA 1GZWB 1UYYA 2WWSA 5FZLA 3S7EA 1AX1A 4WVVA 5FYVA 3T0AA 4Y4YA 4JGYB 5LEJA 2WT2A 5ACA3 5BNNB 5GZGA 3WQ0A 4COVA 4QQPA 1ZRDA 5KHGA 1OURA 1JXNA 3T0BA 5LBCA 2DCYA 1KS4A 1WCUA 2VW1A 3D8CA 3T4HB 5C8CB 2RHPA 5F7UA 2FCUA 1JZ5A 1XE7A 3GZTB 1LR5A 1D0HA 2E32A 2P3JA 1O4YA 2XGXA 2PHLA 2D43A 3HT2A 1I5PA 1PVC3 4JQTA 4A6SA 2VOXA 1ZBA2 3FFQA 4YVSA 4DUWA 1J59A 3EMRA 3ALQA 2A73B 4AF9A 1LECA 3NKTA 1UKGA 4CDQB 2JKXA 3WR0A 3GXUA 5F5IA 4UFHA 3KQ4B 5JOZA 1C1FA 1GNHA 1TEIA 4JTOA 4KGQA 4YZ3A 3GDBA 2YY1A 4F3JA 1LTEA 4N7UA 2Y0OA 1W6QB 1RMU1 1NE4A 4AQ2A 4N43C 2YPJA 4L92A 2XVLA 4ZXKA 3DECA 4Q8KA 5F37A 4LBLA 2Y0IA 2ZOEB 5K9YA 2VTXJ 1JBCA 3WF2A 5EYYA 4A6OA 2X5IB 2DTYA 4M3CA 5A3TA 5FZ9A 1HQLA 3FN9A 3T08A 5FYIA 3T3YA 5I0DA 1L7RA 4TZDA 1IPJA 3PTRB 5IK7A 3U78A 3ZYJB 5FV3A 3WQ1A 5IW0A 3VL9A 1BMV2 4X8PA 5ABJA 1KQRA 1QOOA 4FPHA 4N53C 4TSVA 4Y5Z0 4AOCA 2OZJA 3Q8AA 3HWJA 4JKLA 4XUOA 4YM2A 3VKOA 5M0TA 4GWIA 1BMV1 1JMUB 4FCAA 1JYNA 2QQKA 5A7PA 3ZOIA 3K4DA 1Y43B 4XIOA 3KGZA 2CL2A 1A78A 2ATFA 2G9ZA 3VD5A 2WNUC 3I2KA 5HCBA 5JI7A 4I2OA 3RG0A 4LORA 3MF9A 1UX7A 1BZWA 4LBQD 1IS4A 1CJPA 2B8MA 3O1TA 3OYWA 4Q1RA 4C1WA 1UU4A 4RGAA 1C8M1 5JR7B 5F1RA 2LALA 1IS3A 4AEJA 2B4KA 2VZSA 1O59A 1RINA 2LRPA 4PDWA 1KJLA 1Z0HA 2B42B 2QNKA 3CJIB 3I2IA 4FXGB 4D3WA 2Y6HA 1SLCA 2RS53 1EUUA 1RUD3 3AXEA 3D0SA 3O12A 1AJKA 2R30A 4IETA 2XUMA 2FDIA 3VHOA 1CWPA 3V0AB 1WCSA 1RJ7A 2O14A 1VIWB 4BOWA 2JDMA 2RVAA 3VZKA 1VPHA 2Z42A 1WD3A 1LOBA 5JMCA 5F6KA 1JZ8A 4IEPA 2GC1A 5GZDA 5FYSA 4ZZ5A 3SISA 4CUCA 5BNNC 4LKEA 3OGJA 2CAVA 2IVIB 5FK8A 1DZQA 4XF1A 3BN6A 1W6MB 1KDKA 2CGOA 3GBGA 2ADEA 4BIOA 3G7DA 4YW1A 4GXLA 4YZ4A 3O1VA 5CFCA 4LOSA 2VQUA 1D4M3 2JG9A 4IE0A 4Q0PA 3JCIA 5JXIA 5CG8A 1B35B 2E9QA 1UZYA 2ZS6B 3M2MA 3P6BA 4CXYA 1PZ9A 3ZXAC 4XZPA 3VBOB 1YJLA 3OCPA 3VBUC 1DHKB 3RWNA 3ZFFB 2ARAA 4YW6A 2Y64A 3S0MA 3IIIA 2FDHA 2NZ9A 1IPKA 2FQPA 4YW5A 5FO7B 5CG9A 4ONUA 3FFZA 4YSFA 2XB6C 2ZACA 5C5UA 1S0FA 5I93A 4B1LA 4D7TA 1OF3A 5FYTA 1MS0A 2HLEA 1US3A 1QXJA 5LK7B 1LOEA 1BHGA 1VBD1 4J1XA 2RS33 3B3QE 5A6ZA 4Q4Y1 5FCCA 5J98B 4XJZA 4PBOA 4Y3OA 3VB9A 2WJSA 1VMFA 4JGYA 5FLHA 1CAVB 1H9PA 4Y1UA 4EZ4A 4DUXA 1IGOA 1LHOA 3FUQA 5F3IA 3ACGA 5LB6A 4E2QA 3MFAA 2R32A 5L7OC 1DQ6A 1QHDA 1H9WA 5KC6A 1PZ8A 1N1SA 3FHAA 2QTWB 3OEBA 3BUCA 2ADDA 4K9SA 1AHSA 2WSUA 4XTMA 1CR7A 1W9YA 3FHIB 2VD7A 1VB2A 4OUEA 4OHXA 4IEQA 3ZFEB 3LA7A 3MEPA 1UXZA 4TLGA 4QDQA 1LNSA 4EZHA 4NROA 4UFJA 2WABA 3CLPA 3VBRC 5HXMA 1OD3A 3AM2A 4CDQA 3S6PA 2CGNA 5HCAA 1V6OA 2A3XA 2DCKA 4Q26A 1OLMA 1HRV2 4Y1VA 5G04L 2RS12 3KF3A 3RYKA 2ZX4A 1YJKA 1XU1A 2CV6A 4UT5A 1ZZ7A 4JC1A 4AHZA 1KFXL 1W6QA 5FZ1A 2PQSA 4PJYA 4I0BA 5I8YA 5JUVA 1RUC3 3AP4A 4BWOA 4HL0A 4HMZA 1AR63 1Y7BA 1MQTB 3CJIC 4QQHA 3LSEA 2X5IA 3FX3A 4FFHA 4MADA 4QGNA 1DU3D 1W8ZA 2PHXA 4XACA 4YW3A 2R042 4WBBA 4FOQA 2DUPA 2R073 1QGLA 3MYXA 4QM9A 2EXIA 2D6NA 1C28A 5FZGA 2IZWA 4HG6B 2F4PA 4KBBA 3LB9A 4NRMA 5JDBA 1NE6A 4RGGA 2WO3A 3HEIA 1JOJA 3OY8B 2VBBA 1JYVA 4FPEA 5L9VA 2PMWB 1YWKA 3R4SA 4XFBA 5C4WB 1W6OA 3NNLA 2ZGMA 4EYUA 3O5SA 3VBOC 2NP0A 5CKQA 4DXSA 2TEPA 4ES8A 2GC2A 2DWRA 2VOKA 2A1XA 4LA3A 5FZFA 1NQDA 3QD6A 1GWMA 4XCAA 2Z79A 3AVRA 1NCQB 1AZDA 3S57A 1RUF3 3HQUA 4FT8A 1WA4A 2VQTA 3RRDA 3B7MA 4GB33 4PF1A 1XYNA 3GHMA 4NIGA 3THDA 4LPLA 1UW8A 3VL8A 2TNFA 2RMU3 5D1IA 5FQ0B 2BOJA 5BNPB 2A6VA 3V0AA 5E8AA 1JOPA 4LIUA 3AKSA 1MS8A 2VGDA 4I09A 3PJQA 1TZOA 1AR72 1MS5A 1XSQA 1DF0A 3UK9A 4DMIA 1IOAA 3CU7A 3LGRA 1RYYA 4EWAA 2UWBA 3IDAA 2W52A 2FCVA 1QU0A 2GU9A 1IKPA 1W6MA 2Y6LA 1YFWA 4BQYA 1Z78A 4CA9A 5C3QA 4OCTA 4XFFA 4P9LA 4AGRA 4QPYA 1H1AA 1OFSA 1B35A 3ZN6B 2ZKNA 3CZUA 5KBFA 2VZQA 3CIHA 1BYHA 3HJRA 1YRZA 3NW4A 3ZFEC 1MPXA 3SQOA 5JAXA 3WINE 2VOWA 3ATGA 2JICA 3ZFFA 2CY6A 2KA3A 3BVCA 3E5UA 3OBRA 3WVJA 2BGPA 1R092 1VBC3 4QX0A 5FMDA 4EE2A 1GLHA 2GDFA 3I8TA 3OPZA 2ES3A 4YARA 4Z1VA 5IHRA 2N7GA 2XXZA 1UMIA 2HWC3 4A3ZA 1SFYA 2EF6A 4JV4A 3WG4A 4ASMB 3K48A 3JBG2 5LZ6A 2ENRA 2QQJA 2YHJA 1W8FA 4COYA 3D82A 4YPJA 3UNPA 4O9GA 3LSDA 2Y26A 2LS6A 4L0PA 3OF1A 4QM8A 4CDWC 3VKFC 4AVVA 2YC0A 1K45A 2BWCA 1YIFA 4O9EA 2RM22 4NO4A 4Q4W2 2YDEA 3ES1A 1EY2A 2NLRA 2PLV3 3O0WA 3ZYGA 4BLJA 2PHWA 1DZRA 1IHMA 4URAA 2QQMA 2VTXA 2W39A 2OW4A 2VVFA 2W5FA 4XQWA 1QJY3 3PU8A 1W8TA 1RUJ3 1XC6A 2F4LA 3JBG1 3I49A 2VH9A 2X09A 1EPWA 1RVF1 3MUY1 4CCNA 5CBLA 3ZSEA 2WDBA 2PFWA 5C4WC 2H6CA 1O8PA 4AHXA 1PM7A 4PLNA 1KRIA 5AVPA 5JIAA 2RDRA 3NV3A 4HBNA 4RR3B 2QKDA 4LMFA 3V65A 4ATFA 3MV01 1BCXA 5I91A 1VRH1 4Q4W1 1F4HA 2ZBJA 4QQOA 5HXVA 2PA7A 5HCHA 5L9RA 4GZ9A 5JOYA 3DCQA 5F8PA 3H7JA 2Q0AA 4QPGB 4CUBA 4YRDA 1JZ7A 1MQTA 3JQXA 3MW4A 4BQ3A 4JDNA 2PAEA 2VOVA 1OPMA 3RYPA 4AE2A 3QH7A 5BNPC 1A8MA 3NNMA 2WS93 3NV4A 5FP9A 3Q8EA 2VOTA 3AMQA 5AVAA 1BBT3 3SNMA 2A70A 2DV9A 3TB0A 4WM8A 4CZSA 2K46A 2XLAA 4RN5A 2WO7A 4BK4A 4CEYB 3RZMA 3ZM8A 4JGZC 4CE8A 1LOFA 4ISRA 3ZKYA 3UJQA 3ACLA 1GR3A 3OPTA 4P9XA 1L7LA 2Z4FA 2YBPA 3WW1A 1VMHA 4FTBA 2WZR3 5FKBA 4QKDA 3ZSJA 3B00A 1ZBE3 2AYHA 5K7PA 4AW7A 5FJKA 3SITA 3JD72 3MBWA 4E8CA 2I45A 2ZGOA 1RUH2 2HWF3 5K4LA 2BV4A 2YV8A 3PDQA 1MEC3 1OQ1A 4L97A 5IATA 1LHUA 4GMP3 5EYXA 4CCCA 1PZ7A 1NCRC 1HRI2 1QQP3 4NUBA 1YEWA 3G6JB 3NNJA 3TEWA 4FPOB 1ENSA 1HB4A 1ENRA 1NCQA 3FBYA 3LPFA 4EN0A 1LHVA 1Y4WA 4AFCA 1AR81 1PK6B 3IMNA 3PU3A 4A44A 1PO11 4INDA 3AL5A 5FQ0A 2H0BA 2ID4A 5FY0A 3J8F3 1WLWA 5FPLA 4D94A 1EP0A 4I30A 5C70A 2JDUA 1EAH3 4J6GA 2YBSA 1JS9A 3H8OA 4FO9A 5EP9A 4MGSA 1NKGA 4Q5OA 3GJAA 3NJZA 1RTVA 5FY5A 1RUH1 4CPBD 4ZS3A 1UN1A 4LK7A 1O6UA 1DFQA 3JZVA 1K5MA 4BIFA 2W47A 1QJU2 1HRI1 3AMPA 4YVWB 4AXOA 1VBE1 4NWWA 3HN1A 4OMCA 4W8JA 2CU5A 4JCKA 3LDKA 1CN1A 2ARCA 2NN8A 4NE9A 3ZN6A 4B8EA 3LWCA 4Q4V2 4GQ7A 5LRRA 2JWPA 3KV6A 1W6NB 2E51A 3CEWA 1NAEA 3DPRC 5DXDA 4LHNA 1KEXA 5C33A 3W58A 4AZZA 2JENA 4MGIE 2OKXA 1EV13 2OZ6A 3IWZA 1H4HA 3LEMA 3EB7A 1UXXX 4BISA 1O3TA 2BEOA 3GHNA 3SCFA 1UX6A 2DBIA 3VBFB 4LTAA 1MS3A 4OUMA 1QJU1 2HWD2 2AEZA 2QCSB 3CBNA 4CDXC 3B93A 4YWAA 4A45A 3VBSA 2X53S 3HBZA 3RJ2X 4Y26A 1MZFA 1SMVA 4Y1YA 3VBHB 3AMHA 3LCPA 3TAYA 3DYOA 4AK3A 5E1RA 4ET7A 4OQ9A 2Y6GA 5ACA2 4JDOA 1SZBA 5FLJA 5FZCA 4LE4A 3IB3A 1Q8OA 1AL21 2HWB1 3U10A 4LKDA 2VCBA 4AYUA 2W95A 3LPGA 3M3IA 3WW4A 5CKNA 3HNBM 5A6XA 1RJ8A 1O7FA 5C3OA 1CIWA 1PVC2 1RUE3 1BVP1 4M0HA 3T2PA 2Y38A 3K46A 2VMIA 4OLLA 5FZ8A 2ZTNA 4B3NA 4AHWA 1G9DA 2FDGA 1JYTA 4XDOA 1ONAA 3V56A 2D6KA 1VBB3 2VZ3A 2JDPA 3LOIA 3KVBA 4XFGA 2JE7A 1LHNA 3AVSA 2QQOA 2W1QA 1OKOA 3AP7A 4AEMA 4RR3A 1QF3A 3WNOA 1UY1A 1VALA 1D2QA 5LA1A 1GQGA 3Q8CA 3QH6A 4AVAA 3WLUA 3VKNA 2D6LX 2Q1ZB 1O3SA 4IGPA 1UZWA 4XDQA 3NAPC 1S0EA 1PMIA 3OUHA 2RE9A 1ZA7A 4QPGA 1PO21 4XBQA 2QQIA 1DGWX 2IWGB 3RZZA 1ND2B 2LUWA 1VJ2A 1CAWB 4K3UA 1NLQA 5I8TA 5FZOB 3OBTA 4YVSB 4UW3A 3O1SA 2BBVA 4MGKE 3DGTA 2WNOA 2C24A 1LOCA 2E33A 1ULDA 4C0BA 3M4FA 4RQPC 3NJYA 1QJFA 5D8AC 4CEYA 2H6BA 3RYRA 3H8UA 4Y5TA 4BHPA 4OQ8A 2BNMA 4L99A 2VTFA 3QCWA 3TN93 4DIQA 5I0SA 3SXWA 2HWE1 4QU1A 1OLQA 4XILA 1OOPB 3EO6A 1UYZA 1HIXA 3OBZA 4XUTA 5I0TA 5A7WA 1M4WA 4JQRA 5J48A 2NQYA 4QDRA 2WAAA 2YU1A 3BTXA 1V9U3 1CAXA 1XE0A 1RGSA 1WMXA 3WSOA 3X29B 3PUAA 4XURA 4QMAA 5IJRA 3NMBA 3W9AA 2VE1A 3ORJA 1XXNA 3LFIA 5K0UC 1PK6A 2WWUA 4GH4B 2PHFA 1XBFA 5LW9A 1UZZA 3PNAA 5I8SA 1ODNA 1UQXA 2RS52 1GP6A 3KSCA 2ZGPA 1RUD2 4K21A 2VXRA 1V0AA 4NHLA 3WZ1A 1ND3B 3IAQA 5GALA 5A1FA 1E57A 1XNKA 1WZXA 3RI9A 5EJZB 2GNTA 5JR2A 2VMHA 3VDBA 4LO6B 2YGMA 2IXHA 2YPDA 3D4KA 5LY2A 4GJZA 3ZIWA 2RR13 2JE8A 5LRSA 1J84A 4YVWA 1O4ZA 2BFUL 1NY72 4YW4A 1AYN3 2ZGKA 3OYWB 4B4QA 3TNPB 1Q8VA 4U36A 3DXTA 5FPZA 3E5QA 4LO5B 3RJRA 1D4M2 1HB1A 4Z8BA 1YIPA 4EWEA 1W6NA 4E27A 4DQAA 5FO8B 4NIHA 4AVBA 4XAEA 3IMMA 3RVHA 4AHYA 1RUD1 3BALA 3OSDA 4LEJA 4CU9A 2VZUA 5EV7A 1H2NA 2W46A 5FAXA 2IFRA 3RDIA 3FC0A 4GALA 3WDUA 4BZ4A 5FLIA 4YFZA 2ZPXA 3PTYA 2E53A 5FMOS 2DVFA 3POJA 1RHI3 4DRVA 1JYWA 3VBFA 3E6DA 1S1AA 2Q8EA 1OKQA 2Q8DA 5A7QA 3KT4A 1DGLA 1NY71 1L3JA 2DVAA 2RS32 5T55A 2QZ2A 3E6CC 2VVDA 2XQRA 4XUNA 5F32A 1YO8A 5J1XA 4CU8A 1XRUA 4CP9B 3TRSB 1PX3A 1KS5A 3FWEA 1PIV1 4RS5B 3RSJA 2OVUA 4RA0A 1POV3 3ZPOA 1VE0A 2JJ6A 4H7LA 2D5FA 3V0BA 5JZGB 4XHXA 2XJSA 4Q0SA 2GMMA 4HT1T 1S0CA 1QEXA 5GZEA 3ZO0B 5AC93 2QQUA 3AX4A 3O1RA 3DXUA 3IAPA 3SCHA 5DAPA 3W20A 4AEDC 3BCWA 2GNDA 4YW7A 5T5OA 2GMPA 2QQWA 1OHFA 1ZRRA 3MW3A 3HD8B 1LEDA 3VGIA 4OYUA 1N3PA 1PGSA 4IQPA 1YI7A 1DYOA 2Y6FA 4M3CF 2XKOA 4MYEA 4UW5A 1TMF1 3WCSA 1ALYA 4HKLA 2D7FA 3MUZ1 4Q4X3 4MUVA 1C5IA 2DURA 2YXSA 4A7KA 3PUQA 5IVBA 4FQZA 4NJ4A 1RUC2 1JUHA 2GN3A 2W3JA 3N7KA 3OUJA 4MX3A 5JVVA 5IVCA 3U1XA 1ASJ3 1N47A 1ND2A 1NA1B 5ABJC 1CAWA 1WW5A 2RDQA 5FZOA 1ZREA 3K51A 4M4PA 1LB2A 2R49A 1IG0A 1VRBA 4XJ9A 5BY5A 3F95A 5C9AB 2R072 3SH5A 1HXS3 2DDUA 2FDJA 3AMMA 4MHRA 3D3AA 4DOUA 5J09A 4PF5A 2B7YA 3ON7A 2ET7A 2J1SA 4UFLA 4P02B 4R9BA 1H4GA 1UU5A 5T52A 3ZIXA 1RUI3 3I2DA 4UW6A 3DKQA 3O1OA 1O3QA 1UO9A 4P9JA 4PQ9A 2NMOA 1D4VB 1FX5A 4QX5A 1OOPA 4WM7A 1GSLA 2A75A 3NV2A 5GM0A 4PDWC 1H6XA 2ZHLA 4FSJA 4XF3A 2YUEA 4YZ2A 1ZBA1 3CL1A 1H0BA 3NKGA 2WLQA 4QHOA 3OGGA 1S0BA 5H9QA 5ANQA 5FXZA 4NR1A 2KXLA 4LK6A 2AUYA 1RUF2 1SDDB 3GBFA 4GH4A 2XL9A 4ZU5A 3VZNA 3H1WA 4GB32 2CTVA 1FMD3 2QQVA 5J7MA 2RMU2 1ND3A 3GYDA 5BNOB 3SEPA 5KC5A 1VP6A 2B9UA 2XKPA 2EIEA 2ZX2A 1CIYA 5E88A 1ULCA 5H9PA 4DS0A 4AI3A 5CFCC 2JG9C 1R1A3 2DFBA 1W6OB 2F6BA 2W1UA 4W4ZA 1CZSA 4QXCA 5J36A 3PHMA 5HV0A 3GM8A 3ZVXA 3LE0A 2YU2A 5DABA 3WF1A 4HN1A 2ZGSA 4EQVA 1W28A 1I5ZA 1OVPA 1OQDA 5KWRA 5A3NA 3OOXA 2D40A 1UY3A 2VC9A 2Y60A 1CQ9A 3QBQA 4UBHA 2P5BA 5FKCA 3M1HA 1SCRA 5CYYA 2JX9A 1QXRA 1QJEA 2J42A 4GB31 4R9AA 3KCXA 3PL0A 5DQ0A 1RL3A 1ZNPA 5H9SA 4AGGA 5DUWA 1W3XA 3OGSA 3QOPA 4UYBA 4Z07A 4A3XA 2XLFA 3UV9A 2CDOA 2R7EB 4QKNA 4QX1A 1VBC2 1S0DA 4ZZ8A 4AI8A 4AWDA 2HWC2 4JKKA 1PGL2 1F15A 4JGYC 2J22A 2ZHMA 3PVBB 4YLZA 3UT0A 3RPQA 5FY7A 3WG1A 1E5IA 4HXCA 4XOGA 4AQSA 2JDHA 4O61A 4BM8A 3D6EA 1NT0A 1LOAA 1BJQA 3ZXFA 4N43A 4QGLA 4BJ0A 5C8CC 2ARXA 4YNIA 5JI9A 4URTA 5JSOA 4KMQA 1CONA 4CP9A 4ZKTB 2BNNA 3E6BA 5DUUA 4P00B 2WL1A 4RS5A 3ZN5A 3U11A 2VQAA 1FPN3 1J83A 2OXBA 4BK5A 4LLOA 3U0ZA 2PLV2 4KG8A 2WZPP 5JSPA 3IDBB 1VBA3 2DCTA 2E7QA 2BERA 5FY4A 3A22A 4BCUA 2JEMA 1UD1A 3HOBA 1Q3EA 4QX3A 2JB8A 3VHNA 4FPKA 5FY9A 3WNKA 1VAVA 2R0FA 2ZAAA 4FFFA 3B9IA 4N53A 4OHZA 2UURA 1JU3A 1QJY2 5FUNA 5GKAC 4DEVA 4CU7A 1RUJ2 1JYXA 3KHCA 3N4MA 4AI0A 1FV2A 1SLLA 4QT6A 4NN0A 5FZEA 5FR3A 4IE5A 1GV9A 3EYPA 5CKMA 1LODA 4WZFA 4LHKA 3H1MA 5IK4A 1BEV3 3DYMA 5FUIA 3ZR6A 1W9WA 3D0JA 3GZAA 2WKKA 1BQPA 2E31A 5E6HA 2EAAA 4FFGA 5LBBA 1HLCA 2JD9A 4DINB 1ZA4A 2X5IC 3OGVA 2FZ2A 2WT0A 1G9CA 3T2QA 3WUDA 5HV4A 3MGUA 3ZXKA 1US2A 2P4EA 1M06G 1RUG3 3HN3A 4FBFA 4XF9A 4TLFA 2R063 4MV2A 4B4RA 1OXCA 1NA1A 2HEWF 3WY6A 1WCKA 4K8FA 3DKWA 3N36A 3AKPA 4X6QB 2WS92 1REEA 4CU6A 2CHHA 5FXVA 1W99A 4MH0E 5C9AA 1QJZA 2KM2A 2JDNA 1BBT2 4OZXA 3WCRA 3LKJA 2G9FA 5DAWA 4W6YA 1QDCA 2OS2A 3N9MA 1UCXA 2IXJA 5IYYA 1WLCA 5FIXA 1JZ3A 4XBLA 1Y3TA 1HV0A 3CKHA 3WXPA 5IVJA 1GNYA 2WZR2 4MGZE 2CGPA 5BUVA 3LDRA 1ZBE2 2K0GA 2XVGA 3KQRA 4K20A 1STMA 2CNAA 5F5AA 4DRRA 5FFOC 5H9RA 1KITA 2HWF2 4Y22B 1MEC2 3C3VA 2YROA 3KS7A 4C91A 4C8DA 2FD8A 3R4DB 2IUWA 1URXA 3I2HA 1QQP2 3O7OA 4GWJA 3WUCA 4BQ5A 3PMSA 2WS91 2P6HA 3RWKX 2IXLA 4K40A 3CF6E 1MS9A 1I9RA 1JW6A 3N3HA 3T09A 1BBT1 1D0GA 4PIZA 4KG0A 2XWJB 2ZGUA 4WM8B 1DG6A 5JXGA 4NRQA 1HRV1 1O5LA 1ZZ9A 1NLRA 4NWVA 4DO0A 5DG2A 3ASIA 3HNYM 5FUPA 2RS11 5BNOA 1RUNA 3AZVA 4OI0A 1RMU3 2XR4A 3H3ZA 1RITA 3J8F2 2KD7A 4FFIA 5LY1A 3HPNA 2WZ8A 1EAH2 1W2AX 1POQA 2XWBB 3ILNA 1LHWA 1VR3A 1B35C 1FI2A 4UFMA 2RDSA 1YQ5A 2HWF1 2Z2SB 5T5LA 1GU3A 4O7XA 1AUYA 3C7HA 2VO5A 3LDBA 3NNFA 4BQ2A 3ZFFC 4CRQA 4PIXA 3TOJA 1XYOA 3CZJA 4WVZA 3VDAA 2R041 1KJRA 1DGWA 1H1MA 1C3HA 1C4RA 4QKFA 5JPMB 4E2SA 1EUTA 1FOD3 1CGPA 3HBKA 2VZRA 4N7IA 3ZDSA 4QKBA 5K8SA 3SKVA 5FOBB 1N3OA 3RZLA 5DZEA 1EV12 4CSWA 1X9TA 1QMJA 2BNOA 1EAH1 2XLGA 3T0DA 4EWDA 3WT3A 1WBLA 3VN4A 4CCOA 1MZ6A 1VMJA 1C1LA 4XAAA 3AZWA 2X10A 1W3VA 2VBPA 1Z7S3 4FPJA 2JDKA 5J3UA 1Q8SA 1K5MB 1WMDA 4BPZA 1C8M3 2A3YA 5F9TA 3NO8A 5FZKA 1H8VA 4DXRA 1SBEA 4K1YA 1IQDC 4M4RA 4CDUB 1AJOA 4IE6A 4GAZA 2VAUA 1EV11 1OUSA 1UOJA 4FPFA 1JTZX 4IESA 3ITQA 2YC2A 4RHV3 2JG8B 4M0NA 1AR71 1AYM3 1DGRA 4PT6A 1YQ2A 3GGLA 1OVSA 3IPVA 5CNAA 4EN8B 4PI0A 4CYDA 5JXJA 1DDLA 1C8NA 2GAUA 1VBB2 2VZTA 2WNVB 2ZEYA 4Q1PA 3J7MA 4CDQC 1PMHX 3VBSB 2WWJA 4ZU7A 4LO8A 4Y5SA 2V5YA 3UKNA 3WNMA 2ILMA 1AXYA 5DUVA 5A7OA 4C1XA 1GUIA 5LA0A 1MQTC 3POYA 2VW0A 4QX8A 1OI6A 5FXWA 2AGSA 1O91A 2OQ7A 4D7YA 1R091 2EVXA 4Y33A
chains in the Genus database with same CATH topology
2P3IA 5AFBA 1F8VA 3OD0A 1LOFC 1VBD3 4OI4A 2P3KA 4LBJA 4XQDA 5CFDB 4Q4Y3 2D44A 1VBB1 4KWLA 3V64A 1SACA 4FPGA 4RD7A 3B02A 1SLAA 4I0AA 2I07B 1VLNA 3LOBA 3FLRA 3TN92 2RM21 4I3PA 2PHRA 4LBMA 3VHPA 3ZXGA 4LBQB 4QHBA 4A7YA 5JOXA 1GYKA 1NCQC 3BODA 1NQJA 1V6JA 4N9IA 4Y22A 1OMIA 4S2GA 3ETQA 1V9U2 1Q43A 4OI1A 2CAUA 1IQAA 3B01A 4LBKA 1F31A 5JOWA 1JUIA 2E63A 1W6PB 5A3LA 2GC0A 4A7ZA 4FPLA 3KCCA 3MIGA 4DXZA 3MIFA 4CEWB 3WD5A 2A6ZA 3WDYA 3BTAA 3R4UA 5IUQA 3TN91 1HQWA 1WLTA 4KU8A 3S7IA 2VQ0A 1RB8G 1UPIA 3EBRA 4CDWA 2GNMA 2AZ5A 2MPFA 4FAHA 3AXDA 1NYWA 5CA6A 2V73A 1V9U1 2RR12 3N35A 2ZMKA 1CAXB 1NG0A 2D3SA 1AYN2 4XW3A 1X36A 1FAYA 2E7TA 2NM1A 2ZX1A 2VMGA 3JQWA 1GICA 2Q5TA 4FAGA 1R1ZA 1TME3 3MICA 4KWKA 3D5OA 1LCLA 4IXLA 4EV0A 1G7YA 4YYOA 1V00A 1D2SA 1S0GA 1AR92 2I2SA 3B9CA 1ZVFA 3DN7A 3VBSC 2A71A 3MPBA 3KZ4C 3MIEA 3JD71 2K2SA 1YFUA 4Q0VA 1QDOA 3ZXJA 1ENXA 4LT5A 1FNZA 1RHI2 1DYPA 1I3HA 1HW5A 2XJUA 3VDDA 1OPOA 4W6WA 1LULA 2UY9A 1U5IA 3AZXA 3DL3A 1ENQA 4Y20B 4DNYA 1REDA 1ZRCA 1AXZA 4FOYA 4FP2A 1H8TB 2DF7A 2WA4A 3WG3A 4CDUA 2QVSB 3AKRA 4BMEA 4LBNA 5T5JA 2PQQA 4META 3RS6A 1HV1A 2OUJA 1XE8A 3P3PA 5JIUA 4HN0A 5KXEA 4XFCA 4M01A 4QQLA 4DB5A 4JDMA 3SMHA 2AR6A 1YXWA 5IK8A 1AR91 1QJX2 5GLZA 5HBAA 1WD4A 1SEFA 2JG8A 5AC92 1OD5A 1YLLA 4RR3C 1RHI1 2YYOA 4MGYE 1QNWA 1GNZA 3I4IA 3JUUA 2B5HA 2WNVA 1LESA 3H3UA 3MW2A 3EJKA 5I0UA 1J1TA 4QPGC 3WNXA 5CU1A 2WT1A 2QFEA 4P9WA 1LKNA 2I74A 4Q4V1 4Q4X2 3M3CA 1TQ5A 3USSA 4I3GA 1POV1 5BV6A 2ZGQA 5L36A 3V0BB 3MIDA 3ZFGB 1QJX1 2DYCA 3KCYA 2O8OA 4XFHA 2VVEA 4CEYC 4MXVA 1ASJ2 2BUKA 2QDRA 2PELA 1U0AA 4LUMA 1LU1A 1DQ2A 4IV1B 4W6XA 5CFDA 3ST7A 2HWD1 4YM1A 4FTSA 4E4ZA 1HXS2 2XL7A 2ZMLA 3AZZA 1OLRA 4W65A 4V1PA 1LEMA 1QWRA 4XPVA 1CPNA 1RUI2 5EJ3A 5ACA1 1X50A 1X7NA 3B94A 3N7MA 3VZLA 1PNGA 3MIBA 4LBQA 4QPIB 2X29A 1O4TA 3MDPA 4D69A 4IEYA 2LTNA 1PK6C 3JBG3 2TBVA 4FPYA 2ARBA 2VECA 4S2FA 1SCSA 3AP9A 1PVC1 1RVF3 2IXCA 1MVEA 1ZZBA 1W6PA 4S2DA 1J3RA 2ZABA 5T5PA 2BYVE 1HXS1 3EXUA 3J4UH 4NHMA 3A4UA 3NWKA 4CEWA 1VRH3 4YG0A 1FMD2 3AJZA 3Q9OA 3VKMA 4XEZA 2WFF3 2MNGA 4YVWC 1BXHA 4C0HA 1HDKA 4IV3A 3AKQA 4LNVA 5L73A 2BW8A 4WM7B 1W0PA 1O3RA 1R1A2 2Q8OA 2IFWA 3AMNA 4RFT0 3TYJA 1FYUA 3SLIA 2PHTA 1N1TA 1ZZ8A 2D93A 2WIIB 2GMEA 3KT1A 4B4PA 3T2TA 4XQ4A 3ME2A 3AB0A 2BGCA 1LENA 4R8HA 3FBMA 4E4DX 2ZZQA 3VBFC 4XJAA 2EXKA 1B09A 3LA2A 4C90A 5CADA 4M00A 4P14A 3VBHC 3ZMOA 3H7YA 3ECQA 2NMNA 4G9SB 3AK0A 1FV3A 5HI0A 3E5XA 5FRAA 4Y20A 4EROA 1AR83 4AVCA 1H8TA 1SLTA 1PO13 3M3EA 3WW2A 1N3QA 1N1YA 4CP2A 2VY0A 5AFEA 2HKXA 4G4FA 4I01A 5FO9B 1YI9A 2RS51 1FPN2 3BU7A 3B69A 3ZX7A 1QOSA 2BQPA 4HK8A 2Q30A 4F8AA 4NPRA 4LA2A 3M3QA 1VBE3 3PJYA 1JH5A 3H50A 4XFAA 2WQZC 5BYNA 1UPSA 4N43B 2A6YA 1BEV2 1PGW2 4XETA 3U4XA 2GNBA 1D4M1 4AI1A 2DVBA 2W08A 4PLOA 1ND2C 1TNRA 2BFUS 4Q0QA 2QJVA 2GN7A 5BPXA 4YVSC 2P37A 1QY4A 2BWAA 2XJQA 3L9JT 2VUAA 2D98A 5JLVA 3ZFGA 2EALA 1RUG2 4BH9A 2R062 4N53B 2ETEA 2FBEA 3HT1A 1X8MA 2G9GA 2ZX3A 4IV1A 4R4ZA 3DV8A 5BXXA 5DDJ3 4S2HA 1G9AA 3FE5A 1IS6A 1YUDA 2RS31 4WV8A 5FREA 4AG4A 1OOPC 1H1IA 2ZGNA 1ZZCA 4KQ7A 4WM7C 1QKQA 4Q2FA 5GJ6A 2WNUB 4HKWA 1XNDA 4E4SA 1JYCA 1AL23 2HWB3 3AYCA 3ZMNA 1X8EA 3RMXA 3BB6A 3B5LB 3CO2A 4QPIA 2VNOA 4I0WB 4YM3A 4DFSA 4H55A 1LJ7A 1RUG1 5L19A 1IKQA 3PVOA 4FQ4A 4GH4C 4R9DA 2FMDA 1U5XA 3WP3A 1AR62 1DQ1A 1W2UA 3AP5A 4YGCA 2ZA9A 4R9CA 4A2UA 1ND3C 3M7AA 5GLUA 2D3PA 2ZGLA 3MF6A 4Z82A 2DVGA 5KXBA 3UJOA 4IL7A 3T1MA 4EN7B 1DGRN 2D6OX 2PAKA 3M70A 1RMU2 3AYDA 4XJWA 5DZGA 4CP1A 1PO23 4NVPA 4F83A 2DVDA 3URFA 4KU7A 5C6CA 5KHIA 2EIGA 1RUC1 4WVWA 3FLTA 2LM3A 2CWSA 3AFKA 1AR61 1GKBA 2IXIA 3VBUB 4AFAA 2DCZA 4X6RB 3I59B 1JHNA 4B29A 4GWNA 2Q4SA 2OA2A 2XG3A 1S2BA 4XXPA 2R071 1FOD2 4LUKA 4AEDA 1RIRA 2D97A 2QUOA 4COUA 4XHBA 4MSVA 1PVXA 1EPZA 5KXDA 2HWE3 2WNEA 3APBA 1DZTA 4U2AA 1MZ5A 2DUQA 2R1DA 3FJSA 2A6XA 3WP5A 4AFMA 3AYAA 3PMEA 3MLKA 5L7OB 2JKBA 1Q5OA 2GC3A 4LHLA 1Z7S2 4RS5C 3I54A 1I1EA 2ZJCA 2ZHKA 1C8M2 4UW4A 5EXOA 3RMYA 5JZGC 2WSVA 3GZUC 2MEV3 4K6BA 1RUF1 3USUB 1KXGA 4JAAA 1FOD1 2ZCWA 4MXWA 1GQHA 4FVVA 5T3NA 2GZWA 3VBRB 2RMU1 1WGPA 2ZHNA 4HETA 4QQ2A 1ZX5A 3VKLA 3ZSLA 4GKXA 4P5HA 3PVEA 4RHV2 4HPKB 3RQ0A 3W59A 1AYM2 4YM0A 2E7AA 1V70A 1Z7S1 1COV3 4FTEA 2FMYA 2Q1MA 5FBZA 3HR9A 4LBOA 4L9BA 4WVMA 4FPCA 1OQEA 2OUHA 2R1BA 1LRHA 4AEKA 1NA1C 1IS5A 4GA9A 2QZ3A 2NYYA 3MZHA 4XBNA 2W68A 3L2HA 1G9BA 5C9AC 2EXHA 1T6GC 1VBC1 1R083 2FZ1A 4RHV1 2HWC1 1PGL1 1AYM1 1V6KA 1U12A 1VBD2 1VAKA 2ZZJA 4P9GA 3IPVB 3IN9A 4XIKA 4Q4Y2 4WZCA 4PIYA 3ZPYA 3BOPA 4SLIA 1A3KA 1AL0G 1AVBA 3T1LA 5A33A 2WNUA 3M8LA 1PIV3 4X8NA 5E16A 4DY3A 2BPA2 5JWPA 4XJ8A 1X82A 3ZXDA 3FLPA 3KB5A 1SBDA 1V6MA 2QQPA 2XHKA 4FOWA 2PLV1 2XBO3 2DUOA 1S2KA 4IEXA 4M3CE 1J58A 5LK5A 4ES9A 3BPZA 4ORFA 1KFUL 5HCFA 4Y24A 1FNYA 1QJY1 4F7ZA 1RUJ1 3RNSA 4EN6B 5BNOC 1GZWA 4FXKB 1Y9QA 4BA6A 2EXJA 1DIWA 1TMF3 1AX2A 4AFBA 5BNNA 3HAGA 1WW4A 3UL2A 2PHDA 1XNCA 2TUNA 3WP4A 5EWSA 2CYFA 2YZ4A 5C8CA 3MFCA 2OIIA 3SCGA 2DTWA 3WHUA 2PHUA 5F6LB 2UYBA 4MVTA 4MZUA 1OA3A 2XJVA 2UWCA 1APNA 3VBUA 4H3WA 4EN9B 4Q27A 3I59A 4N90A 4K7JA 1FT9A 2RJLA 2WC2A 1G9FA 1TME2 1V6LA 2XJPA 3VUOA 4P9IA 1ULFA 4FP3A 2WA3A 1UKRA 2VUJA 3BIWE 1MR5A 3KLSA 1NXD1 5C8WA 3WHTA 3MIHA 2WZR1 4SBVA 3AYEA 3GALA 1MS1A 1ZBE1 4CDWB 3AJYA 1MS4A 2FHRA 4HVRA 4QXKA 5L7OA 2P2KA 1UAIA 1W0OA 1ZBA3 1A8DA 1MEC1 3CNAA 2C0ZA 4GMP1 1DQ0A 1SLBA 1QQP1 3FZ3A 3POWA 4PCRA 4XE9A 3USUA 1DQ5A 2A5ZA 2OYZA 1SQ4A 1TME1 1S0IA 3NL1A 2PN5A 5KHJA 4B7KA 1NZCA 4LO4B 3VBRA 1VB4A 4GKYA 3J8F1 4KH9A 4HVOA 4YGEA 4JTNA 1C57A 4RSUA 4HPKA 4COWA 1ZRFA 2VU9A 2O0OA 2SLIA 1YCIA 1FXZA 3WG2A 3AZYA 1HQNA 3VDDB 4XMIA 3FMGA 3KMHA 4Q8LA 3SH3A 3VZMA 2C9AA 3CJIA 5F5QA 4DZGA 1YYNA 4COZA 1S0JA 5FOJB 3OD4A 2W0XA 4GWMA 3PVNA 2NPIA 3H1YA 4BQ1A 5IT6A 2UYAA 4I02A 1YFYA 4DY5A 4HVQA 2X8KA 3JU9A 4HSJA 1UL9A 4JGZB 4UBGA 1CPMA 2HJIA 1RUE2 1TNFA 2MHFA 5JCTA 3VLBB 4XF4A 2RJKA 1OFNA 4N9HA 3VBOA 1CESA 1F5JA 3C2UA 1NCRB 5GLVA 5T50A 3WDWA 5DG1A 3ES4A 4GMP0 4QGMA 2VNRA 2EAKA 3ILRA 4KNCA 1QH6A 4Z92B 1DLLA 2OPKA 4AI2A 1KD7A 2O1QA 4PBPA 4WM8C 3A0KA 1U5YA 2YGLA 1RUE1 1RVF2 1SFNA 3AKTA 3ZYRA 4KL1A 1ULEA 1J3PA 3EQEA 5I0RA 2ZKLA 3MLLA 4Z2WA 1LGCA 4Y1XA 2C1FA 1CAVA 2DFCA 4FOVA 3NVCA 2QDNA 2ZGTA 5SV8A 3TBDA 4AQTA 2XPJA 5KHHA 1VAMA 1VRH2 4H7MA 3WW3A 4DPNA 4BYYA 3RI8A 2WFF2 3VZOA 4YZ1A 3LAGA 3SHRA 2AH2A 2D3RA 1CD3G 4YG3A 4XTPA 4LO7A 3L2YA 4HLTA 3ZN4A 3R05A 4HK9A 3ZSMA 3WX5A 3ZFEA 1AF9A 3DPRB 1X33A 3NV1A 3S30A 3R6SA 5JSRA 1MACA 4BE3A 4OUSA 4BMBA 1LGBA 1NLSA 1OA2A 3WDVA 2P17A 4LLFA 1O5UA 3POSA 3LA3A 4XFIA 4YFWA 5DZFA 4CDXB 3VDDC 4HKOA 1K5MC 2WFF1 4J1WA 1WW7A 3WV6A 2PYTA 2R16A 1F9KA 1TE1B 4IV3B 4KWJA 5LEKA 2E6VA 2B39A 4HANA 2V09A 4CDUC 4HFSA 3O0VA 1EYBA 3H0OA 1HX6A 5KHKA 4OHVA 1WBFA 1LGNA 2B46X 3N7LA 1WLDA 4NHKA 1LU2A 5KXCA 1BVVA 1AR82 3I7DA 1KDMA 2JDZA 2ET1A 5B2GB 5EZWA 1ZM1A 1HRV3 1PO12 2JG8C 1CX4A 4B7EA 3O0XA 2IXKA 5CAZA 2GALA 1XU2A 2Z5WA 2RS13 3OY8A 2YMZA 3QLQA 2HYKA 1RC6A 5A3MA 3IIAA 2JE9A 2WNVC 5C4WA 2WFPA 1GZ9A 2WLPA 4NOTA 2JECA 4E9KA 1YHFA 1CJDA 4YW2A 3VZJA 1YFXA 2C5DA 1MZEA 3IKWA 1VBE2 4LE3A 1SDWA 2RR11 4CP0A 3NAPB 5A32B 2R043 3N7JA 1Q56A 1XQNA 1AYN1 1DQ4A 3AP6A 3WDXA 3JB4C 1QNYA 5FPXA 4Q0UA 1GANA 1AX0A 3OTFA 2BTVC 4AVTA 5BNPA 1YNAA 1WUVA 5CFDC 2VG9A 1H2KA 4TYSA 3ZYIB 5JPNB 4RQPB 3WP6A 1CAUB 5D8AB 3H9AA 1BK1A 4JGZA 3WDTA 2GSYA 5J96B 3MLJA 3INAA 5GZFA 4P9YA 4AFDA 4HSLA 4LULA 4AQ6A 4QU2A 5DDJ2 3LZZA 3MI8A 5IK5A 3IT8A 1J3QA 1BKZA 4IEVA 3QACA 1JYIA 1QH7A 2VULA 3J26N 1F2NA 2HWB2 1AL22 1NCRA 1C5HA 4ITCA 2R0HA 2AENA 3THTA 1GZCA 2VNGA 4L8QA 5K0UB 1AR73 2G4IA 1RUOA 5AC91 2H0VA 4ISQA 3ZXEA 4CEWC 1W39A 1FATA 4ZU4A 4R52A 2XJRA 3ILFA 5DDJ1 4IV3C 3HQXA 2PAMA 2VPVA 2IC1A 4L2NA 4CTEA 2HEYF 3UKTA 4ATEA 4PLMA 4UXAA 3KM5A 4OI2A 1NOVA 2D6PA 1R093 4Q4X1 4HZFA 1H2MA 2A6WA 3DF0A 4YZ5A 2D5HA 1PO22 1V6IA 4OHYA 1WCDJ 2A7AA 1ZYBA 3DPRA 4IEWA 1ASJ1 1H30A 1HKDA 4ASLA 4IERA 4AGVA 3HMYA 4XYXA 4MLOA 1U5ZA 2WQ4A 4K1ZA 4D7SA 5CB7A 2UU8A 4G3YC 1PNFA 1CVNA 2ZAHA 2RM23 2AREA 4Q4W3 4CDXA 5J37A 4YG6A 1RUI1 1H2LA 2CWMA 2HWE2 4IEZA 1ULGA 2DU0A 1OSGA 5GLTA 2GH2A 2DCJA 2Z69A 5FDBA 3FUOA 1OA4A 1UU6A 1H8TC 1Q8PA 4XXAA 3E97A 2O8QA 4IEUA 3ENRA 2R6QA 1G86A 2ZMNA 2HEVF 2MEV2 1POV0 4L11A 4AVSA 2XH6A 3GNEA 4AEDB 3PLQA 2DU1A 1FMD1 2ZGRA 3KT7A 3WOGA 2UWAA 5E89A 1ZZ6A 4OHWA 1LOGA 1SLIA 5TSWA 3M3OA 2JXAA 4IEOA 3U07A 4GULA 1R1A1 2GH8A 3J9SA 1QOTA 5FTTC 3KGLA 4EJRA 4TWTA 2UY8A 1COV2 4M3CB 3WQ7A 3NAPA 5A32A 4JVAA 3SH4A 4BLIA 1I6XA 1NXMA 3IDCB 3MPPG 1JN2P 1UMZA 2VW2A 4JRLA 3ZYPA 3THPA 3ZFGC 2MEV1 4OVEA 4H14A 2ERFA 5ABJB 5DUXA 5FMOL 4MXWB 4IV1C 1AXKA 1REFA 4OFGA 1WMEA 2A3WA 1GBGA 3VHRA 4RQPA 3TNQA 1CAUA 5D8AA 1VBA2 3JD73 1WMFA 2XJTA 1N1VA 1R082 1RUH3 1G6NA 4XF0A 1GFF2 1A6CA 1UF2C 1HRI3 1V6NA 1COV1 3GF6A 1XYPA 4QPIC 1UIKA 4XMAA 4Y1ZA 2P34A 2B45X 4WVMB 4PDWB 3ZXLA 1PIV2 1QXPA 4OULA 2K9ZA 4JRAA 1DBNA 3ZSKA 2XVKA 3OJBA 1IZ3A 1AR93 1G8WA 1UIJA 1FPN1 2EA7A 4KGGA 3UKVA 3O14A 4YGBA 2XBO2 3A0NA 1VBA1 4XJUA 5GLWA 5K0UA 5SV5A 3GBWA 3AFGA 1R081 3VV1A 4GIQA 1XNBA 3ELNA 1QJU3 2QE3A 1WW6A 4RL7A 3VBHA 4LR4A 5T54A 3IM0A 5CFCB 2JG9B 2JD4A 1J1LA 3R0RA 1TMF2 4Q4V3 1BEV1 1PGW1 5A33B 3TWIA 3BOWA 4R4XA 1Q8QA 3P3NA 2BVVA 2ZX0A 2WINB 3NSTA 5CIRA 1F5FA 5CVRA 4YGDA 5EFUA 3IDEA 1S55A 1QJX3 4QD2A 3EHKA 2XBO1 1MVQA 3JB8A 5BNQA 3CJXA 5GZCA 4Q29A 4E2GA 1PHMA 2PTMA 3HIFA 3IBMA 3DUIA 2R061 1DYKA 2D6MA 2HWD3 1SBFA 3KD4A 2SBAA 2BVBA 1GZWB 2WWSA 3S7EA 1AX1A 4WVVA 4Y4YA 4JGYB 5LEJA 2WT2A 5ACA3 5BNNB 5GZGA 3WQ0A 4COVA 4QQPA 1ZRDA 5KHGA 1JXNA 2DCYA 1KS4A 2VW1A 5C8CB 3D8CA 2RHPA 1XE7A 3GZTB 1LR5A 1D0HA 2P3JA 1O4YA 2XGXA 2PHLA 2D43A 3HT2A 1PVC3 2VOXA 1ZBA2 3FFQA 4YVSA 1J59A 3ALQA 2A73B 4AF9A 1LECA 3NKTA 1UKGA 4CDQB 3WR0A 5JOZA 1C1FA 1GNHA 1TEIA 4JTOA 4KGQA 4YZ3A 2YY1A 4F3JA 1LTEA 4N7UA 2Y0OA 1W6QB 1RMU1 1NE4A 4AQ2A 4N43C 2YPJA 4L92A 2XVLA 4ZXKA 4Q8KA 4LBLA 2Y0IA 2ZOEB 5K9YA 1JBCA 5EYYA 2X5IB 2DTYA 4M3CA 1HQLA 4TZDA 1IPJA 5IK7A 3ZYJB 3WQ1A 3VL9A 1BMV2 4X8PA 5ABJA 1KQRA 1QOOA 4FPHA 4N53C 4TSVA 4Y5Z0 2OZJA 3HWJA 4YM2A 3VKOA 4FCAA 1Y43B 4XIOA 3KGZA 2CL2A 1A78A 2ATFA 2WNUC 5HCBA 5JI7A 4I2OA 3RG0A 3MF9A 1BZWA 4LBQD 1IS4A 1CJPA 2B8MA 3OYWA 4Q1RA 4C1WA 1UU4A 4RGAA 1C8M1 5JR7B 5F1RA 2LALA 1IS3A 4AEJA 1RINA 4PDWA 1KJLA 1Z0HA 2B42B 2QNKA 3CJIB 4FXGB 4D3WA 1SLCA 2RS53 1RUD3 3AXEA 3D0SA 3O12A 1AJKA 2R30A 4IETA 2XUMA 3VHOA 3V0AB 1WCSA 1RJ7A 4BOWA 1VIWB 3VZKA 2Z42A 1WD3A 1LOBA 5JMCA 5F6KA 4IEPA 2GC1A 5GZDA 3SISA 5BNNC 3OGJA 2CAVA 1DZQA 4XF1A 1W6MB 1KDKA 2CGOA 3GBGA 4BIOA 3G7DA 4YW1A 4GXLA 4YZ4A 5CFCA 1D4M3 2JG9A 4Q0PA 5CG8A 3JCIA 1B35B 2E9QA 1UZYA 2ZS6B 3M2MA 1PZ9A 3ZXAC 4XZPA 3VBOB 1YJLA 3OCPA 3VBUC 1DHKB 3RWNA 3ZFFB 3S0MA 2NZ9A 1IPKA 2FQPA 4YW5A 5FO7B 5CG9A 4ONUA 3FFZA 4YSFA 2XB6C 2ZACA 1S0FA 5I93A 4D7TA 1MS0A 1QXJA 1LOEA 1VBD1 4J1XA 2RS33 3B3QE 4Q4Y1 5FCCA 5J98B 4XJZA 4PBOA 2WJSA 4JGYA 5FLHA 1CAVB 1H9PA 4Y1UA 1IGOA 1LHOA 3FUQA 4E2QA 5L7OC 3MFAA 2R32A 1DQ6A 1QHDA 1H9WA 5KC6A 1PZ8A 1N1SA 4K9SA 1AHSA 2WSUA 4XTMA 1CR7A 3FHIB 1VB2A 4OHXA 4IEQA 3ZFEB 3LA7A 3MEPA 3CLPA 3VBRC 3AM2A 4CDQA 3S6PA 2CGNA 5HCAA 1V6OA 2A3XA 2DCKA 4Q26A 4Y1VA 1HRV2 2RS12 3RYKA 2ZX4A 1YJKA 1XU1A 2CV6A 1ZZ7A 4JC1A 4AHZA 1KFXL 1W6QA 4PJYA 4I0BA 5I8YA 1RUC3 3AP4A 4BWOA 4HL0A 4HMZA 1AR63 1Y7BA 1MQTB 3CJIC 4QQHA 3LSEA 2X5IA 3FX3A 4QGNA 1DU3D 2PHXA 4YW3A 2R042 4WBBA 4FOQA 2DUPA 2R073 1QGLA 3MYXA 4QM9A 2EXIA 2D6NA 1C28A 2IZWA 2F4PA 4KBBA 3LB9A 5JDBA 1NE6A 4RGGA 1JOJA 3OY8B 4FPEA 1YWKA 3R4SA 4XFBA 5C4WB 1W6OA 2ZGMA 3O5SA 3VBOC 2NP0A 2TEPA 4ES8A 2GC2A 2DWRA 2VOKA 4LA3A 1NQDA 3QD6A 2Z79A 1NCQB 1AZDA 1RUF3 4FT8A 1WA4A 3RRDA 3B7MA 4GB33 1XYNA 3GHMA 1UW8A 3VL8A 2TNFA 2RMU3 5D1IA 5FQ0B 5BNPB 2A6VA 3V0AA 5E8AA 3AKSA 1MS8A 2VGDA 4I09A 3PJQA 1AR72 1MS5A 1DF0A 3UK9A 4DMIA 1IOAA 3CU7A 3LGRA 4EWAA 2UWBA 2W52A 1QU0A 2GU9A 1IKPA 1W6MA 1YFWA 1Z78A 4XFFA 4P9LA 4AGRA 4QPYA 1H1AA 1OFSA 1B35A 3ZN6B 2ZKNA 5KBFA 1BYHA 3ZFEC 1YRZA 3NW4A 5JAXA 3WINE 2VOWA 3ATGA 2JICA 3ZFFA 2CY6A 2KA3A 3E5UA 3OBRA 3WVJA 1R092 1VBC3 1GLHA 2GDFA 3I8TA 3OPZA 2ES3A 4YARA 4Z1VA 2N7GA 2HWC3 1SFYA 2EF6A 4JV4A 3WG4A 4ASMB 3K48A 3JBG2 2ENRA 2YHJA 4COYA 3D82A 4O9GA 3LSDA 2Y26A 3OF1A 4QM8A 4CDWC 3VKFC 4AVVA 2YC0A 2BWCA 1YIFA 4O9EA 2RM22 4NO4A 4Q4W2 2YDEA 3ES1A 1EY2A 2NLRA 2PLV3 3O0WA 3ZYGA 4BLJA 2PHWA 1DZRA 1IHMA 2W39A 2OW4A 2VVFA 4XQWA 1QJY3 3JBG1 1RUJ3 2VH9A 1EPWA 1RVF1 5CBLA 3ZSEA 2PFWA 5C4WC 2H6CA 4AHXA 1PM7A 4PLNA 1KRIA 5AVPA 5JIAA 3NV3A 4HBNA 4RR3B 2QKDA 3V65A 4ATFA 1BCXA 5I91A 1VRH1 4Q4W1 2ZBJA 5HXVA 4QQOA 2PA7A 5JOYA 3H7JA 2Q0AA 4QPGB 4YRDA 1MQTA 3JQXA 3MW4A 4JDNA 2PAEA 2VOVA 1OPMA 3RYPA 4AE2A 3QH7A 5BNPC 1A8MA 2WS93 3NV4A 3AMQA 5AVAA 1BBT3 3SNMA 2A70A 2DV9A 3TB0A 4WM8A 4CZSA 2XLAA 4CEYB 4JGZC 1LOFA 4ISRA 3UJQA 3ACLA 1GR3A 4P9XA 3WW1A 4FTBA 2WZR3 3ZSJA 3B00A 1ZBE3 2AYHA 5K7PA 4AW7A 3SITA 3JD72 2I45A 2ZGOA 1RUH2 2HWF3 2YV8A 1MEC3 1OQ1A 4L97A 1LHUA 4GMP3 5EYXA 1PZ7A 1NCRC 1HRI2 1QQP3 3G6JB 4FPOB 1ENSA 1ENRA 1NCQA 3FBYA 4EN0A 1LHVA 4AFCA 1AR81 1PK6B 3IMNA 1PO11 4INDA 5FQ0A 2H0BA 3J8F3 1WLWA 4D94A 1EP0A 4I30A 1EAH3 4J6GA 4FO9A 3NJZA 1RTVA 1RUH1 1UN1A 1DFQA 3JZVA 1K5MA 4BIFA 1QJU2 1HRI1 3AMPA 4YVWB 4AXOA 1VBE1 4NWWA 3HN1A 4JCKA 1CN1A 2NN8A 4B8EA 3ZN6A 3LWCA 4Q4V2 4GQ7A 5LRRA 1W6NB 2E51A 3CEWA 3DPRC 5DXDA 4LHNA 5C33A 3W58A 2JENA 4MGIE 1EV13 2OZ6A 3IWZA 1H4HA 1O3TA 2BEOA 3GHNA 3SCFA 1UX6A 3VBFB 4LTAA 1MS3A 4OUMA 1QJU1 2HWD2 2QCSB 4CDXC 3B93A 3VBSA 2X53S 3HBZA 3RJ2X 4Y26A 1MZFA 1SMVA 4Y1YA 3VBHB 3AMHA 3LCPA 3TAYA 4AK3A 5E1RA 5ACA2 4JDOA 5FLJA 4LE4A 1Q8OA 1AL21 2HWB1 3U10A 4AYUA 3M3IA 3WW4A 1RJ8A 1O7FA 1CIWA 1PVC2 1RUE3 1BVP1 4M0HA 2Y38A 4OLLA 2VMIA 4B3NA 1G9DA 2ZTNA 4AHWA 1ONAA 3V56A 2D6KA 1VBB3 </