2VOKA

Murine trim21
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
186
structure length
186
Chain Sequence
b'AHHHHHHMVHITLDRNTANSWLIISKDRRQVRMGDTHQNVSDNKERFSNYPMVLGAQRFSSGKMYWEVDVTQKEAWDLGVCRDSVQRKGQFSLSPENGFWTIWLWQDSYEAGTSPQTTLHIQVPPCQIGIFVDYEAGVVSFYNITDHGSLIYTFSECVFAGPLRPFFNVGFNYSGGNAAPLKLCPL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 52 KDA RO PROTEIN
molecule tags Immune system
source organism Mus musculus
publication title Trim21 is an Igg Receptor that is Structurally, Thermodynamically, and Kinetically Conserved.
pubmed doi rcsb
total genus 52
structure length 186
sequence length 186
chains with identical sequence B
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2008-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00622 SPRY SPRY domain
A PF13765 PRY SPRY-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.920 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2vokA00
4X8PA 5C33A 5JI7A 4P9LA 3ZO0B 4B8EA 4P9IA 2IWGB 5F6KA 3TOJA 5JI9A 4WVMB 4V1PA 4KG0A 4WVMA 4QT6A 5F6LB 2LM3A 3KB5A 4N7UA 2VOKA 2WL1A 2YYOA 4P9JA 4XW3A 4N7IA 4X8NA 5JIUA 4B3NA 3UV9A 5JIAA 2FBEA 2E63A 2YUEA
chains in the Genus database with same CATH superfamily
3QCWA 3THDA 2D6KA 4Q4W1 3WCSA 4LO4B 3MZHA 1PM7A 1QJX2 1AR62 3Q8CA 4P9LA 4D6SA 2GC2A 1NQJA 3K3OA 4NHXA 3POSA 3U10A 4CUCA 2VGDA 5J3UA 1AVBA 3WNPA 2LROA 4EWAA 1IOAA 3LEMA 2ARAA 4GIQA 1XXNA 5FZKA 5KHJA 1V6OA 2PHWA 2R7EB 4WM8C 4AVTA 3MIBA 3X29B 2XONA 3D4KA 3BOPA 4R4ZA 4XFBA 3AL5A 1R082 3AP4A 3NQHA 2VCBA 2XVLA 3THPA 4KWLA 4K6BA 1AXKA 4Q4W2 1TMF3 4L0PA 4R9BA 2R6QA 4A45A 2ARXA 1F35A 3DEMA 5FLJA 3M8LA 5F2WA 2YBSA 4FXKB 4NWVA 3ACHA 1I3HA 1G9CA 3T2PA 4JGZB 2BU9A 4SLIA 5LATA 1D0HA 1TME1 2AACA 2Y60A 2BBVA 3TOJA 4ASLA 1MQTB 4C91A 2ZX1A 2VY0A 2V09A 3IKWA 2WFF3 2XBO1 1O6UA 2L9LA 3U07A 2RM21 5KHHA 1T6BX 2VECA 3SMHA 1OC1A 1J3QA 3OYWB 1CESA 1F2NA 4Y1YA 5FZOA 1BBT3 1SLIA 1W28A 2G9ZA 3HQRA 3IIAA 4E4SA 2W5FA 1W8TA 4ES9A 5K4LA 3VBRB 4AAPA 3QACA 5SV5A 1I5PA 5F8PA 4JRAA 2YGLA 3I3DA 4WZFA 3D3AA 4PF1A 4DUWA 2SLIA 2VQAA 3OGRA 3HNBM 4FPHA 4XDOA 5DAWA 3T2TA 2EIDA 4CDXC 5JMOA 2ZGKA 4CU6A 2XBO2 5F7UA 1DGWX 3QH6A 1YQ8A 1S0FA 4LBQB 5FY8A 4W50A 1QXPA 2IXLA 3BCWA 3J8F1 2XDVA 3EMRA 4EN8B 1JHNA 4XJWA 3ZYJB 3IPVA 1BEV3 1CZVA 2RJKA 5APAA 3VBOA 1S4CA 5FYUA 2ZGNA 3KHBA 2W2IA 1US3A 2EIGA 2PHTA 3PVNA 4RGGA 4XILA 1OT5A 3HAGA 5FYIA 3ROUA 2F6BA 1CQ9A 4CCKA 4BLIA 3RQ0A 2HWE2 3NKGA 1AHSA 2RS51 1FNYA 1UIJA 1YLLA 4FP3A 1HRV2 3ZOIA 2W46A 4F3JA 1HRI1 4CYDA 2B9VA 1V70A 2NM1A 1Y4WA 3B02A 1NCRB 2PHRA 4OUEA 4COVA 4FPKA 3H9AA 3ZSJA 4Z2WA 1JUHA 3S57A 1VBE1 1LU2A 1JZ6A 1POQA 4XZPA 4RHV2 1K42A 2DUQA 3M3EA 4CDXB 1LTEA 1DZRA 4FTSA 1V0AA 3N9QA 3FHIB 4XFAA 4CDWA 2XGXA 4DXZA 2FDKA 2VMGA 4QB1A 1HB1A 3S6PA 2RS52 1GFF2 3P3PA 5LA9A 1HX6A 2BGPA 2R32A 2Z2SB 4GWJA 1O91A 3LFIA 1H8VA 2Q1MA 2OPKA 1GYKA 1R1A3 3E6CC 4XUPA 4AFDA 5J7MA 4G3YC 2GN7A 4O65A 1KGYA 1ZA4A 5I8SA 1QKQA 2CU5A 1HQWA 2Y6LA 3NSTA 1UYZA 4RHV1 4GB32 4XJZA 1V6KA 4XXAA 2YV8A 3RS6A 4CDUB 5FPXA 5JIUA 5CFDA 2Y8KA 3POWA 2B39A 3C7OA 3OGVA 4IUGA 4Q5OA 4QWNA 4Y3OA 4I09A 4NHMA 1GZWA 1VAVA 4YFWA 1H2MA 2IXIA 3SISA 3TAYA 5LK5A 2TBVA 1H30A 4DZGA 1CPNA 4RD7A 4Z82A 5FWJA 5LK7B 2ZKLA 2CGPA 1ZRIA 4LBMA 3VDDC 3NV1A 4IV3C 4P08A 1YI7A 3CBNA 3VUOA 2B5HA 1JYCA 1ULEA 3J26N 5C3SA 2P3JA 4UF0A 2A73B 1GQPA 2A5ZA 2W08A 4I0BA 5LASA 3U37A 1GP6A 5AC91 2G9FA 2JG8B 1B35B 3D0SA 1RUC1 2IXCA 1QU0A 4LEJA 1WUVA 2BNNA 1GZTA 2WSUA 4YNIA 5EXOA 1V6IA 3V0BB 5EIYB 4S2HA 3OD4A 1QH7A 2OIIA 3LDRA 5K0UB 1LGNA 4ITCA 3C2UA 5C5UA 1KJRA 4B1LA 2GU9A 2Q8OA 1PVC1 5FPBA 5L9VA 3FFZA 3H3ZA 3VZMA 1RXFA 5FXXA 2BEOA 3VHPA 1WCDJ 4ORFA 4YARA 4YG0A 3P6BA 3JQXA 3PUIA 1C4RA 2EF6A 1UZ0A 4LTAA 5KWRA 1RVF3 1G7YA 1ASJ2 2ORXA 5CNAA 4XIKA 4K9SA 4HOOA 1W3VA 1H8TA 3WDTA 4IEVA 1F15A 2VVFA 1VBB3 1SLTA 3S0MA 1NLSA 5AFEA 4MHUA 2ZHNA 3A21A 4ZHNA 2ZBJA 3KV4A 1N3QA 4J1XA 3AKSA 4AG4A 3I3EA 1GNHA 4OZXA 1UNBA 3FMGA 1POV1 1PIV3 1E5IA 5FKBA 4EQVA 2JDHA 3ZSEA 1F8VA 4CDUC 2HLEA 4LKDA 3B5LB 2D44A 1OOPC 4FFFA 3MW2A 4HVQA 2Q30A 2JD9A 4GXLA 4IW3A 3RZKA 4JDNA 4L99A 5T50A 3NV4A 2X09A 3N3HA 4QXKA 4YW7A 1H2LA 4IQPA 1QJU3 4I2OA 2E31A 3EO6A 3VZNA 1PHMA 2OYZA 1WW4A 4TN7A 1LESA 3KV5A 1P8JA 3A22A 5HV0A 3ZXJA 4YZ5A 1OPMA 1OPOA 1DIWA 3J4UH 5EJZB 3V65A 2RS32 5FOJB 4IV3B 1COV2 1VB2A 3KHCA 5T52A 4MVTA 1O3SA 5FXWA 4K7JA 1WLTA 4HK8A 3VD4A 1IQDC 1RC6A 3I2DA 4FT8A 4UXAA 1K45A 4WVMB 4EWDA 4WM7A 1HXS2 5FMBA 3ZYIB 1B35C 2JG8C 2UYBA 2BP6A 1V6NA 4YW5A 2O14A 1O3QA 3DKQA 2GAUA 2ARBA 3MF6A 3WW3A 2J1VA 4B7EA 1W6NB 3GM8A 2JDKA 3BU7A 5IWFA 2BJSA 1NX9A 2FMYA 3PUQA 1COV1 4OLLA 5JOXA 2VZTA 3ZR5A 2YU2A 3APBA 5DXDA 3BOWA 5FZ7A 3IMNA 4B7KA 1GANA 3WX5A 5GJ6A 2VCMA 3GCXA 2GZWA 4MLOA 4QPIB 3PTRB 1TVGA 4QXBA 5HCFA 1R092 1NQDA 1YO8A 3AP5A 4CRQA 3HIFA 2ZX0A 3POEA 1DG6A 1HB2A 1IS6A 3P5BA 3F2ZA 1VBC2 5FZBA 2DTWA 4Y20B 2P6HA 1J3PA 4A6OA 2YY1A 5IUQA 5IK7A 3NNGA 5IYYA 1RUI2 3SCHA 5DAVA 3UGGA 3NV2A 1RUF2 3MV11 5K7PA 3WP6A 5BNOC 2DWRA 2XHNA 1KEXA 4MZUA 2WIIB 3I54A 4YZ4A 1RGSA 2AGSA 4XACA 4XDPA 2HWE3 3H7YA 2A6VA 1J1TA 1ZZBA 4KL1A 2DVFA 2PXJA 1R091 4INDA 1UU6A 2WNUA 2CNAA 4WVVA 2R1BA 5C8CC 1RTVA 5M0TA 5FJHA 1E5RA 1H6YA 2VUCA 3HMYA 3BTYA 4OUMA 2IC1A 2IXKA 3NL1A 2EAKA 3I8TA 1JHJA 3ZMOA 1U0AA 3N9LA 1C5IA 5C7GA 4Q0VA 1UYXA 3JBG2 3ZXKA 1W6NA 5LRSA 2VCAA 2EIBA 1Z7S2 1OHFA 1CN1A 3T3YA 1PX4A 4JCKA 4EN0A 3FJSA 2ORZA 1W8UA 1KQRA 1YFYA 3OGGA 1DP0A 4JHTA 1VE0A 2GC1A 2P1BA 3CKHA 5KC6A 4QKFA 4ZU7A 4R8HA 1J1LA 2J1RA 2R063 1G8WA 4W4ZA 5F3IA 5FZGA 4NAMA 2ET7A 4DB5A 3MYXA 3U4XA 1S0EA 4AFMA 3EBRA 3AVSA 2C26A 4AYUA 1K5MA 4CXYA 3SQOA 4ISRA 2V4AA 4NPLA 2VZ1A 3TEZA 4IERA 2BQPA 3O1SA 3U11A 2PMWB 1LKNA 3L2HA 3OEBA 1AJOA 3AXEA 4LOTA 2I45A 4QM9A 4XQWA 4YG3A 3ZSKA 5CADA 3ZIXA 4CCCA 2GH2A 5FZ9A 5FXZA 2D5FA 3LDBA 1HDKA 1QNYA 1WMFA 3M3CA 1KDKA 3CNAA 3N7JA 4NN0A 4Q4V3 3O1UA 4AGVA 3UL2A 4IEUA 2CDPA 3MW3A 4KU8A 4GWIA 4J25A 2VR4A 4AQ6A 1O4ZA 3R4DB 3BODA 3B00A 5L73A 5AVAA 4IESA 3ZFGB 1HRI3 4AEMA 2DCJA 2DCKA 3W59A 2Y6HA 4OZOA 2HWB3 4UI9L 4I0AA 2CWSA 4OHZA 1X8MA 2DDUA 1XJAA 4BWOA 2JKXA 4QKBA 2ZEYA 2W68A 4BQ4A 2WLQA 1OD5A 1O7FA 2WA3A 2HWC3 3BPSA 3I2FA 2RS11 1QWRA 2ZMLA 2ZJCA 2AR6A 5JWPA 5A3MA 2VQ0A 1WD4A 4A2UA 4IE7A 2W94A 1KJLA 4FOVA 4PI2A 1V6LA 2CGNA 4FXGB 5E6HA 2Z42A 3ILFA 1MS1A 4M3CE 4XCAA 3O0XA 3PNAA 1RUOA 3KF5A 1EYBA 2A3YA 2WQZC 2P34A 4DUVA 3PVBB 4FPOB 5KC5A 3UJOA 1GOGA 4KGQA 1J84A 4Q1RA 2CDOA 5J37A 1SDWA 2Y34A 3J7NA 4LXLA 3ZX7A 3FLRA 3O1VA 4Y1VA 5FZ6A 3I3QA 2WUHA 4HSLA 3WG1A 1CAUB 1LEMA 2WJSA 4ARXA 4HT1T 1QHDA 1W99A 5K0UC 5FP4A 5BYNA 5AC93 1RUE3 3ZMNA 4YZ1A 4O9EA 1BHGA 2JDMA 4EN6B 4ISQA 5E1RA 3EJKA 3G7DA 5FLIA 3WG4A 2O1QA 3ZN4A 1APNA 4PLMA 4CDWC 5FYYA 3HOBA 4XJ8A 3WDVA 2LTNA 4I01A 5FZHA 3VBHB 1JYVA 4FTEA 2OXBA 3ABZA 3AYEA 1PMIA 2DV9A 1JODA 1QXRA 3NWKA 5JVVA 4DEVA 4FFIA 4QQHA 3VBUA 1SFYA 4E2GA 4LQRA 4IEWA 1MPXA 3JU9A 2QQIA 5EHDA 2Q8EA 1SFPA 3GZEA 2P6CA 3FBYA 3O7OA 4HKWA 4Q8KA 4NR1A 3K3NA 1MVQA 4DFSA 1JH5A 4FP2A 1OLMA 1NE6A 1UYPA 2EICA 2VQTA 3DUIA 2DFCA 5C71A 2A6XA 1AR72 5CIRA 1RMU3 1UY1A 5EWSA 1TE1B 3A23A 1OH3A 1W2NA 1V00A 1H4HA 2D6LX 1W9TA 1AYM3 2DCZA 3TN92 4NOTA 4CDQA 5FP3A 3VZLA 1EPZA 3WNKA 4YLZA 1GZ9A 4CP1A 5FYTA 1W2AX 4E2SA 1Q8VA 4CU7A 5L7OA 2F17A 4E8DA 1BEV1 5IVJA 3LKJA 1BK1A 4M3CF 2UY8A 1RUF3 1ND2C 3LSDA 1VMJA 4IGOA 4LITA 4QT6A 2Y6GA 3AYAA 1W0OA 2FCUA 4AI8A 3C8XA 1W9SA 3N7MA 1EP0A 3PTYA 4XQDA 1G9BA 1UY4A 3Q8AA 4XDQA 1RUJ1 2W1QA 4BLJA 4JX0A 4CVUA 5A32A 5F3EA 1SLLA 2QE3A 4LO6B 3N9OA 1BEV2 3MLLA 4RS5C 4AI0A 1D7PM 1UY0A 2WLPA 4HONA 3DL3A 4M0NA 1FV2A 4XVHA 3RWKX 2WQ4A 2GNMA 1JZ2A 1NCRC 2VTXJ 3K4ZA 4ATEA 4D94A 5C3OA 5FP8A 2YDEA 5FPUA 1RJ7A 4PT6A 5DDJ3 4FI9A 1OVPA 2WYSA 1UX6A 3JB8A 4H7MA 4JQRA 4DPNA 4C0HA 1W2TA 2JJ6A 2Q4SA 3IDCB 4URTA 4XABA 1OQEA 2I07B 2WAAA 1Q8OA 1GWMA 3ZYGA 4BQXA 4FPFA 5FZ4A 1IPJA 5IVEA 2P5BA 4OMCA 1MZFA 1CAVA 1DFQA 1RUD3 1UW8A 2WO1A 2XUMA 2YU1A 3U75A 3MO4A 4QX2A 3GXUA 4Z07A 4NAOA 3NO8A 1SDDB 2CWMA 4L92A 3M3OA 4YW6A 3N36A 2XHKA 5F3CA 1AX2A 4LBQD 3K51A 1PMJX 1RUC2 4HLTA 3J9SA 4CUBA 2R062 5A7QA 3I3MA 2OQ7A 1Q8QA 5A1FA 1GP4A 2BDRA 4EN9B 3O1TA 3VV1A 3KV9A 1XPWA 3OGSA 2QQNA 2OT7A 2ZGRA 4FVVA 1LJ7A 4UW3A 5D8AA 5FZMA 3VBOB 5C9AA 1A8MA 3VBRC 1K3IA 1OURA 1SLAA 3JXSA 1UOBA 2LM3A 2WNUB 2WBKA 3ETQA 3G6JB 3MEPA 5FP7A 1S2EA 2RS33 1UAIA 1ZZCA 3D82A 4O61A 1D2QA 4OMDA 1B35A 1WZXA 2JG8A 1VBD2 5C4WB 1DU3D 1AL22 1MVEA 4DY5A 1LOFC 5A1AA 2QJVA 4Q0UA 1YQ6A 1QJU2 4UFMA 2EVXA 2BW8A 5DPNA 5A6YA 4MXWA 5CFCA 4WM7B 4ZXKA 3T09A 2BFUL 3WCRA 3KB5A 4AFCA 1LOBA 1YHFA 2G9GA 4Y20A 2BFUS 2ZTNA 4KQ7A 5FO8B 3N4MA 1JU3A 2VBDA 4EE2A 2E6VA 4YZ2A 4Q29A 4QKDA 1JOJA 3SH3A 5FBZA 1AYM2 3TN93 4LE4A 1C28A 4LMFA 5JSRA 1HQLA 2J22A 2X10A 3R4SA 1O4TA 1OBNA 1T2XA 4BPZA 4CP9B 2R071 4FOYA 1QEXA 4XPVA 3BTXA 2QQLA 3D0JA 5ISLA 1LHWA 2R0FA 4ZXEA 4GH4B 1JOBA 3PUSA 4RQPA 2BGCA 4N43B 3D8CA 4QHZA 1MS3A 3I3BA 4MADA 4A7YA 5B2GB 1AYM1 1UOGA 4GALA 3IZOA 4FQZA 2VXJA 5A7OA 4UFIA 3AJZA 4A3XA 4AW7A 2RMU1 4MXWB 3SH5A 4D7TA 5CFCB 4A42A 1UX7A 1H8TC 1US2A 3VL9A 4BQ5A 2ZGSA 3WUDA 1OMIA 1M06G 1UOFA 3A7QA 4BXSV 3PDQA 1R081 1F9KA 4LK6A 1V6MA 3CJXA 1W6OA 4FPEA 4GJZA 1IQAA 2WWJA 4CEYA 2A6ZA 2Y33A 4LE3A 3ZFEC 5FY4A 1SBEA 3GALA 1GSLA 4MV2A 2W1SA 5IK8A 3POJA 1NE4A 2OVUA 3DKWA 5IW0A 4CUGA 1OXCA 4MOAA 1QOTA 2EXJA 3FC0A 2ADDA 2D98A 1Z7S3 2W1UA 3IDEA 3ILNA 1HN0A 2FBEA 4CCNA 1AZDA 2QZ3A 4Y24A 4AHWA 4CEYC 2YUEA 4IE4A 3QOPA 4D7SA 4DRVA 2D5HA 2Q1FA 4META 1UU4A 1OFSA 5HCAA 2JICA 4E4HA 1D4VB 4D8MA 2CV6A 2Y6FA 3VHNA 4XAAA 1OLRA 1R64A 2D6PA 3EQEA 3WINE 3S5AA 1W6MB 5DZFA 2Q0AA 2O8QA 4Q4Y2 4RGAA 5FO7B 1WBFA 3RFRA 3S7IA 4HETA 3WG2A 5I91A 4JC1A 1RUE2 1COV3 5FKCA 4NIAA 3O12A 2VNOA 1MACA 2Z69A 1MZ5A 3CZUA 4IE6A 2V5YA 4JTNA 1RL3A 5LRRA 3UESA 4PQ9A 3VDDA 3T08A 1QQP3 3POGA 5A3PA 2XJRA 3ZYFA 1WBLA 4XHXA 3HBKA 4WM8B 2YPJA 3LQCA 1EY2A 3BALA 3RYPA 5CKMA 4QGMA 5A70A 2PQSA 2HWC2 4Q4Y1 4A3ZA 2NQYA 2X5IA 1H2KA 4CEYB 1HW5A 4QXCA 1RUE1 4YM1A 3DF0A 4HFSA 3UT0A 2MHFA 5I8TA 3ORJA 2BOJA 3AK0A 3VBHA 4HZFA 5J98B 2GALA 1X82A 1PMHX 4PDWC 5DABA 4FAHA 2RDNA 3NNFA 4NHYA 5GALA 1CIWA 1T6GC 4BYYA 3ZVXA 5C8CA 5EYXA 2IUWA 5A3UA 1SMVA 1D4M2 1UU5A 2J1TA 1NXD1 3C7GA 1LEDA 2WFF2 1REDA 1CAWB 4C8DA 2WA4A 4QAWA 1UXXX 1LOGA 2KA3A 3ZKUA 5EPAA 5G05L 3WY6A 4AI3A 1VBA3 3FN9A 3VDCA 2VOXA 2ZZJA 3VBRA 3EHKA 4ASMB 4CP9A 4E27A 3KT4A 4XUNA 4MH0E 1QJY3 2HWD3 3AKTA 4URAA 3PIJA 2DURA 2P3IA 4PBPA 2R043 1X7NA 3I2JA 3H3LA 4Z1VA 4OFGA 2WFF1 4IV1B 4CU9A 3TEYA 1JYIA 3RGBA 1XSRA 2VZPA 2ZX4A 3RJRA 3CJIA 3RNSA 1AR81 1V9U3 1L7RA 4LLOA 2WWUA 1UL9A 1PX3A 2FDHA 4BE3A 2BBAA 4XJUA 1NXMA 4BM8A 1W6OB 3AZVA 2HEVF 5IVYA 4XFFA 2PLV1 5DUVA 4FFHA 2WQ8A 1HLCA 1CD3G 2FQPA 3HEIA 1F31A 2D93A 1NCRA 4XUOA 3GCWA 4KG0A 2NP0A 5FZIA 1O8SA 1HN1A 1W03A 3SKVA 5A32B 1GICA 3T1LA 2WO7A 3LF7A 1UOJA 2VNRA 1KD7A 2VXRA 4RS5A 1O5LA 1AR63 1QJX3 1R083 2RVAA 3AKPA 4FPGA 4KNCA 4WZCA 2VUDA 3AYDA 4HBNA 2YYOA 1ENQA 5T54A 1BLZA 4N7IA 3ECQA 5FY7A 2OUHA 1FV3A 1QF3A 4EROA 3V0BA 1ZZ8A 4XF0A 3PJQA 1U5YA 1UXZA 2YG0A 2QDNA 3ZXLA 5B4NA 1PZ9A 1FOD3 4L9BA 4Y5Z0 1FPN2 2DUPA 3BIWE 3OB8A 1ST8A 4JQTA 5A3OA 2ZAHA 1PNFA 2Y0OA 3GBGA 1OA2A 4ZPIA 4QB6A 4RA0A 2O0OA 1Y9MA 2BV4A 1EAH1 3LB9A 2VQUA 3AZYA 3OG2A 3T2OA 2VNVA 4AVSA 4BMEA 3WT3A 3LA2A 4MGKE 3ZFEB 2ZAAA 5EFUA 3T1MA 3HT2A 2ET1A 3AP6A 2A7AA 2JWPA 1YQ2A 2DVGA 4L8QA 2BERA 4IE0A 5LB6A 1IZ3A 2ZACA 3JQWA 4CU8A 1I9RA 2E9QA 2CY6A 4C0BA 3I4IA 2VM9A 1OSGA 2X53S 5J96B 2QQKA 2ZOEB 1FPN1 3PLQA 4XMIA 1QQP1 3O14A 3QD6A 1Y9GA 5IHRA 2D6NA 1VMHA 1NG0A 2VO5A 1EAH2 2TEPA 3C3VA 3CQOA 3RMYA 5HI0A 5T3NA 3HPNA 1KS5A 1RIRA 1Y43B 5GZCA 5FPZA 5L19A 3T4HB 1BVVA 4YYOA 1D0GA 4BXFA 3FL7A 5EP9A 1H2NA 1UY3A 1QOOA 5GM0A 3KZ4C 4BQ3A 1QGLA 4GMP1 2GNDA 5C3QA 4K20A 5DUWA 5FRAA 1AX1A 5F5AA 5FZCA 1RUC3 5IVFA 1NCQA 4O9GA 3GJAA 4CXWA 1GWLA 2PA7A 2ZGMA 4LHLA 4PIYA 4QU2A 5FZFA 1KXGA 5BPXA 3AC0A 3TN91 3AKRA 5FYSA 3SEEA 5CU1A 4AZZA 3MF9A 4FFGA 3H8OA 4B1MA 4MXVA 1BBT1 3LIHA 3RDIA 3HN1A 1IG0A 3ZFGC 2WR9A 5F5QA 3IDAA 4XF9A 1H0BA 4D0QA 5C4WC 4YSFA 3ZXFA 1AXYA 3H1WA 2HEWF 3ZYRA 4XHBA 5FMDA 5BNOB 1QJZA 2VMIA 1SLBA 3H8XA 1VAMA 4J6GA 2NMOA 1DQ0A 2AZ5A 4BQWA 2VMEA 3B9CA 4OHWA 4AVVA 1BMV1 3UYJA 1VBC1 2DBIA 2R1DA 2PELA 4OYUA 2ID4A 2BZDA 1O5UA 3T4VA 1RUI1 2VAUA 3RI8A 2OQ6A 1RUF1 1ZA7A 4B4RA 3TEWA 1DDLA 1XOYA 4BA6A 4ZZ8A 3IMMA 2CAUA 4EZHA 3BYWA 1GOFA 5ANNA 1NLRA 1H9WA 3B9IA 3KS7A 4BB3A 5L9RA 1JZ4A 4Y22B 3TNPB 2Q1ZB 1S0DA 3T0BA 2BWAA 4UT5A 1XB9A 2XJQA 4QHBA 5FZEA 1A3KA 3SKJE 2XWJB 1KFXL 1S0GA 3K77A 3OPTA 3ZN6B 5FYZA 4GH4A 1EUTA 1OA3A 1C57A 2UY9A 2WRAA 3WP4A 1VBE3 1H8TB 2VNGA 5FREA 4XFHA 4AQTA 3POYA 5I0RA 5D21A 2Y0IA 1SLCA 3HN3A 4KBBA 4QPGC 3ZSLA 1TG7A 1YEWA 4A6SA 3S30A 2PHDA 4AHZA 2ZGUA 1NA1A 3C7EA 4NMIA 1FOD1 3CO2A 4RN5A 3ZYBA 3OY8B 2DVAA 3RG0A 4DEQA 4XC9A 4IEOA 3VBHC 1RUD1 2VOWA 4FQ4A 5EV7A 2R16A 4CDXA 1OF4A 3RZJA 3DPRB 2YZ4A 4BZ4A 5DZEA 1CPMA 5J48A 2HWF3 4AVAA 3DYOA 5F32A 1AR92 2YBKA 1UMZA 2R042 1TZOA 2OZ6A 2CAVA 3UGHA 2UURA 3OPWA 2JXAA 3TYJA 1AL21 1W8ZA 2ERFA 1S0CA 4HANA 1ULDA 1XC6A 3FUOA 4HL0A 3GHMA 4Q4X1 4P9GA 1Y7BA 2B8MA 1N1YA 1VBA2 4YM3A 3UGFA 1XU1A 1RUD2 4Q4Y3 4F8AA 4KWJA 1ZBA1 3T0DA 2R0HA 5T5LA 2WS92 2OUJA 3KT1A 2QTWB 2XL7A 1W9WA 3VB9A 1N3PA 3L9JT 2QZ2A 3K75B 5JZGC 3ZDSA 2Z5WA 2CGOA 1J58A 1PGW2 2XLGA 3DCQA 5FPAA 2QFEA 4LKFA 4RR3A 1TMF1 2JB8A 4HKOA 2E32A 3BUCA 2WNUC 4OHYA 1OKQA 3NAPA 1C1FA 5JZGB 1RUH1 1UPSA 4CCMA 2OX0A 1ZREA 4CEWC 5L36A 1VBA1 2E7QA 4YW2A 1OVSA 2QBXA 3PVOA 1YCIA 4HVOA 3AMQA 4UWDA 3KCYA 1HJFA 3Q9OA 4YW3A 4Y1XA 1IG3A 2WS91 2ZMNA 4U36A 3HNYM 3GJBA 5BY5A 5FZ1A 4H7LA 1O3RA 1WLWA 2QQJA 2A6WA 2JD4A 4A41A 2X8KA 3OF1A 2ZCWA 1TMF2 2JB4A 4DNYA 2OPWA 4YW1A 1UQXA 5KHIA 2NYYA 3I2GA 2RMU2 3DYPA 5FDBA 4QQOA 4OI2A 4Z2AA 1IS3A 3V56A 5JOYA 5HCHA 1CAXA 1GLHA 2DCTA 5HXVA 3P3NA 3L2YA 4DUXA 4RYDA 4Q1PA 1CR7A 2FCVA 4KI5M 1HIXA 4CCOA 1ND3B 2C6SA 2V4VA 4YW4A 4S2GA 5I0UA 3TEXA 1Q5OA 4RQPC 5F2SA 5GLZA 4YVWB 2WZR1 3NV3A 1VRH3 1PK6A 4UFKA 2WNVC 1NLQA 4IDZA 4WM7C 1XE0A 4CCDA 1O3TA 1RUI3 1BYHA 3OPZA 4NPRA 5AVPA 3RPQA 4CXXA 2VZSA 4XQ4A 1PIV1 2R49A 3E97A 1UPIA 5FPLA 1YC61 2GN3A 4ATFA 1UKRA 3ZPYA 5C6CA 3O5SA 1Q8PA 3CJIB 3LEKA 3GGLA 2MPFA 5FY5A 3MUY1 4NRMA 5C8WA 1YQ5A 3S7EA 1FT9A 4AI9A 3MBWA 3BB6A 4P9JA 1KRIA 2BVBA 4X8NA 4COWA 4HMZA 1GKBA 1JZ7A 5I8YA 1JYXA 1GU3A 1N47A 3KLSA 3WW4A 1Z78A 4PIZA 4BIFA 4MGSA 4UYBA 1YNAA 5FOBB 1PIV2 1OOPA 3KCXA 5HBAA 5FK8A 4AE2A 3K48A 3KGZA 3POFA 4BH9A 4CDUA 3GZUC 3LPFA 1AR93 4V2WA 3HQXA 4V1PA 2HWC1 1XNAA 5GZDA 2VW1A 4Q27A 5F5CA 2E51A 4DMIA 5GZGA 5T5JA 4AGGA 2DBNA 4N7UA 1WLDA 2ZEXA 2H6BA 5J09A 2PQQA 3CMGA 4RHV3 1RVF2 3H8UA 5FY0A 4CDWB 1LRHA 3BIEA 2JX9A 2XMLA 5DAXA 1O8PA 2BRTA 2WFPA 2FZ2A 4FO9A 3WDXA 3DXTA 3J8F2 2ADEA 4P9YA 5F5IA 3N9NA 4OI1A 1LGCA 3VBFB 1FPN3 2YXSA 1RB8G 4RS5B 4EYUA 4NIHA 2JIGA 3MLJA 2HYKA 1Y3TA 5L9BA 1NZCA 4QPIA 3GDBA 3ZFFA 5KHKA 3AB0A 5I0SA 1POV0 2HWE1 4LBKA 1ACCA 2BOIA 3VZOA 1HRI2 1ENXA 1W3XA 4LJHA 1TNRA 4OHVA 3WZ1A 4ES8A 2Z4FA 2OS2A 1FXZA 3FWEA 3VZKA 4CEWA 3IPVB 4AXOA 1VBE2 1LCLA 2J1UA 1WD3A 4A4AA 2C9KA 4RR3C 1O59A 4ONUA 2IXJA 2ZABA 4RFRB 4LNVA 5D2AA 5BUVA 2WNVB 2GNBA 2VW0A 3WSOA 4LBLA 3RZGA 1SEFA 4Q26A 1IS5A 4KBZA 4AEKA 4EN7B 1VLNA 2QQMA 4PBOA 4KH9A 4P9IA 3GF6A 4MUVA 3OOXA 3DV8A 4JKKA 1YYNA 4QQ2A 5E8AA 1HXS3 2JDYA 2I2SA 4XEZA 4D69A 4PHZA 3IIIA 2FD8A 1QJFA 5F3GA 3K2OA 4ASKA 4CA9A 4W8JA 2BNOA 3OSDA 1VBB1 5FY1A 4JGYA 1NUKA 4AWDA 3KVBA 3W9AA 4GKXA 1ODNA 3PMSA 3WW1A 2R061 3AL6A 3R6SA 1NCQB 2XWBB 4IEYA 1SFNA 1WMXA 3LDKA 5T5OA 1S2KA 1DBNA 3AMMA 4I3PA 5DZGA 4ZZ5A 1MS4A 2XKOA 4YZ3A 5GLUA 5A7WB 3A0NA 1SPPA 4TYSA 3USUA 2MEV2 4QHOA 3MHZA 2RR12 1ZZ9A 3FX3A 4FPYA 4NROA 4HVRA 4UAPA 2HWF2 3UK9A 4UBHA 5CBLA 5FZ0A 3VKLA 3CL1A 2XJSA 4LIUA 1VRH1 1VBB2 3J7LA 5ABJC 1HB3A 4OI0A 5KR7A 2UYAA 1AR61 1QJX1 3GZAA 1G9DA 1UCXA 5I93A 3M7AA 2WL1A 3B7MA 1RINA 2JE8A 1J3RA 4YVWA 1ONAA 2WT1A 3UKTA 4YWAA 1RUJ3 1OH4A 1B09A 4TLGA 1RHI3 4YRDA 5JLVA 5FO9B 1GV9A 2V5DA 3VBUC 2DYCA 5FUIA 4R9CA 1JXNA 4RQPB 2QQUA 3U0ZA 2EXKA 1MZEA 1ZNPA 4QX1A 1DHKB 1NY71 1IGOA 1XE8A 3KT7A 5ABJA 5C5TA 3UKNA 1Q8SA 1W2OA 2C5DA 2GMPA 3FBMA 5JAXA 2W95A 3WNXA 3JBG3 2R072 4IV1A 2YHJA 1LOEA 4XUQA 4MGIE 1FMD3 1I5ZA 3ZLIA 1TME2 1YRZA 3Q8EA 5JPMB 1UMIA 3H8RA 3WQBA 4NIDA 5K0UA 2JIJA 1RUG3 4PJYA 5A6XA 2GC3A 3CLPA 1FX5A 2R30A 3WW2A 5F1RA 4BCUA 3SLIA 3I49A 1ULOA 3MPBA 3IAPA 5BNPA 2PAMA 2YC0A 2ZGQA 2Q8DA 4I02A 1JYNA 3ZFGA 3ILRA 2B7YA 1QMJA 4BQ1A 4EZ4A 4CEWB 4P00B 1AYN3 2QQVA 4DXSA 2FZ1A 1QY4A 2EXHA 2GH8A 5JXJA 1G9AA 3RYRA 4QPWA 2A71A 4DXRA 3E6DA 1BCXA 1I1EA 2RJLA 2NN8A 2PAEA 1E5SA 5LA2A 3AKQA 3PUAA 4GMP3 1R093 2GDFA 3DPRA 5IK4A 3MIDA 5L7OB 4N53C 3VBSC 4IL7A 2RS31 5IAXA 5JPNB 5JR2A 3KSCA 2VPVA 4TTGA 5FMOS 2JDNA 3JD71 2NLRA 3AYCA 4HXCA 1PZ8A 3DECA 4GWMA 4S2DA 3UJQA 1MS0A 3O1OA 5GLWA 1XNDA 3JZVA 2E63A 4J1WA 4QB2A 4JKMA 4WM8A 3CHXA 1YJLA 1CWPA 4AGRA 4Y1ZA 3WOGA 3OBZA 1YIPA 1EV11 1EPWA 2VMHA 3ON7A 4GKYA 1URXA 4P14A 4QPIC 1JYWA 4R9DA 2XG3A 5BV6A 2C1FA 4P9XA 1S2BA 3P1IA 3RZMA 4S2FA 4NO4A 5F37A 5FXVA 3WDWA 3E6BA 3FUQA 1W6MA 4QDRA 4COZA 1W90A 3J7HA 5LY1A 1PO12 5F9TA 2JECA 3RI9A 3VHRA 4XTMA 2HKXA 3N9MA 4YM0A 4BQ2A 1EV12 1CAWA 2WZEA 5F39A 2VW2A 3FFQA 4DOUA 1HQNA 3HJRA 3ITQA 3BI3A 3ASIA 3H50A 4N90A 5EJ1B 5CB7A 5C70A 2WWSA 3RZZA 4Q4V1 1D2SA 4FCAA 3MV01 3VD7A 1TNFA 5LBEA 1G86A 2VOTA 4CDQB 3ATGA 3KGLA 4XBQA 5DDJ2 3WHTA 1WCUA 3T0AA 4AVCA 1UF2C 1D4M1 5JSOA 2VL4A 1GUIA 3RZHA 3RZLA 3HBZA 2XQXA 2NPIA 5DUXA 4QDSA 4FOQA 1TEIA 4DRRA 2Z79A 4XFGA 4AQSA 1A78A 1MEC3 2CSGA 4YGCA 5SV8A 2XH6A 4F7ZA 2XKPA 2XLAA 4NVPA 5CA6A 5JXGA 1ZZ6A 3BTZA 5DAPA 1UZWA 3OBTA 3RMXA 3OCPA 1LOCA 1DGRN 1Z7S1 4QXHA 2IXHA 1AR91 2PHLA 5LWBA 5DDJ1 5CFCC 3FHAA 1BK0A 3O1MA 2VVDA 3R4UA 1M4WA 3LAGA 4NPMA 1XQNA 4OHXA 1UO9A 5FZAA 3WF2A 3BGAA 2KM2A 4BK4A 1VAKA 4UFJA 3N7KA 1BKZA 1QXJA 1X9PA 4HPKA 4QX0A 2RE9A 2TUNA 2VOVA 2KR2A 1W6QA 3MIFA 2H0BA 3PMEA 2WT0A 1FYUA 5A33A 2LS6A 5IK5A 5C9AC 2B4KA 1CVNA 2A6YA 2VZVA 5FTTC 3N35A 1YQCA 2RV9A 1G9FA 2WO2A 1RMU2 5LW9A 1C8M1 2PLV2 1ASJ1 2LRPA 3K46A 3MPPG 4DS0A 1W9FA 1UYYA 2ZMKA 4Y4YA 1AXZA 1BZWA 4XMAA 4X8PA 1N1SA 3VKOA 4XE9A 1ZBA3 2XR4A 3HNMA 1GOHA 4E9KA 2J1SA 4Y22A 2W87A 4AI2A 5JMCA 4XFCA 2LW8A 2DU1A 3KWVA 1KFUL 1F4HA 3B01A 1PGL2 5F6LB 4DIQA 1XNTA 3ZKYA 1C8M2 1VB4A 1BQPA 1YXWA 1ZBE2 1CZTA 5A6ZA 3U14A 3USUB 4BMBA 1PNGA 3A4UA 4QQPA 1QH6A 2VJXA 2YPDA 2IFRA 4UFLA 4QKNA 1L7QA 4CE8A 3ZYPA 1QDOA 2FCTA 3ACGA 5JIAA 2WS93 3R05A 2W39A 2X29A 4AAXA 1W8NA 1LECA 2IFWA 3LIGA 3NJZA 5FQ0A 4GD4A 2QQOA 3WD5A 2Y64A 2G1MA 2MNGA 2XBO3 4M0HA 3OY8A 1MZ6A 2MEV3 4K3UA 5HCBA 4ZS3A 1F5FA 2H6CA 4MGZE 4BJ0A 1OFNA 4GMP0 1NKGA 2W91A 1W8HA 5EJ3A 3QH7A 2VZRA 4ZY9A 4LHSA 5GLTA 4AHYA 5JUVA 2J1EA 4QM8A 2AEYA 2PHXA 3PURA 2E26A 2AUYA 2HH9A 5L7OC 1X8EA 1CX4A 3ZN6A 4HN1A 4N9HA 4TXWA 3V0AA 2WZR3 5E88A 2RMU3 4XXPA 3RWNA 4CDQC 1YFWA 4LO7A 4QGLA 1ZZ7A 5H9PA 5A7PA 4QU1A 3WQ7A 5B4XA 4B8EA 1NA1C 5HV4A 4AQ2A 5HPOA 3MLKA 1ZVFA 5LBCA 4BIOA 4Y5TA 2E7TA 1LULA 3AFGA 4C90A 3AVRA 4RR3B 5C9AB 5J1XA 1QIQA 4BK5A 4COYA 2X5IB 1D4M3 4Y26A 2W47A 4BDVB 2YMZA 3ZN5A 1RUG2 2B45X 3BN6A 3RVHA 3O1PA 5KXEA 1OQDA 2XVGA 1GWKA 2A70A 4NRQA 4IEXA 1OD3A 3ZFEA 2HEYF 2AC1A 1W0PA 1H1AA 2VMFA 1Q43A 3GZTB 1BBT2 1CAVB 3TB0A 1WWYA 3ZSMA 3JUUA 4NUBA 5CEHA 5A33B 2ES3A 5LZ6A 3FE5A 1FMD1 4UOJA 4X6RB 4DINB 1WGPA 1UD1A 2K46A 3GNEA 4IGPA 1ZRFA 3DPRC 4LO8A 4R4XA 1RUG1 4KWKA 2WKKA 3SC7X 2ZKNA 4A7ZA 1W05A 1BMV2 2P17A 1PO13 3WLUA 2RR13 1DQ1A 5LCWL 4LBNA 2ZGOA 4PF5A 1WKYA 2W9XA 4IXLA 3WP5A 2QKDA 3ALQA 2P37A 5FYVA 3INAA 3WV6A 4QDQA 2RDSA 3H3UA 3T30A 5CFDC 2DU0A 2WT2A 3C7FA 3MFCA 1MR5A 3I2OA 2D40A 2WZPP 1GQHA 1H4GA 1QJY2 5CAZA 5HXMA 2JE9A 4GQ7A 5H9RA 4B4PA 4E4ZA 1AYN1 4QMAA 1W6PB 4HK9A 3SEPA 1R1A2 1NCQC 1GNYA 2QQPA 5BNNC 1A34A 1MS5A 3OEAA 3J7MA 2VG9A 1Q3EA 1VPHA 1O4YA 2DTYA 4OULA 1LOFA 1DLLA 1IKQA 3M70A 1HRV3 3Q8FA 4I0WB 4LORA 4RFT0 1CIYA 4N8MA 1UWWA 4U2AA 4LBQA 4N9IA 3VKFC 1IKPA 2UWBA 2Y6KA 3JD73 4P5YA 1QJY1 5CKQA 1FOD2 2I74A 3OGJA 3VD5A 4YVSA 2EXIA 5FUNA 4YVWC 1H9PA 1LHVA 1Q56A 1REEA 5D8AC 4HSJA 2FDIA 3VD3A 3MI8A 5D1IA 2GMEA 2OW4A 3VKNA 3MUZ1 2MEV1 2WABA 1RITA 2R073 3ACFA 3HT1A 2XJUA 2D6OX 3KCCA 4H2AA 4PI0A 1XNCA 4LHNA 3WQ0A 4Z8BA 1DF0A 2VTFA 2ZS6B 4YG6A 5C3RA 1DYKA 1ALYA 4LKEA 5JXIA 3DN7A 5FQ0B 4LK7A 4O7XA 3OUJA 2RJ2A 2P4EA 4IEQA 1W6PA 3E5QA 4JVAA 4QGNA 1SHWB 3LGRA 5C3PA 3WNLA 2K9ZA 2PFWA 4QX3A 2B9UA 3WF3A 3PHMA 4GJYA 1VBC3 3AX4A 5FAXA 3VDAA 3WVJA 5J36A 3OBAA 2IVJA 4EJRA 4P02B 2RHPA 3DYMA 5GKAC 3T2QA 3IB3A 3NJXA 3NJYA 3LOBA 2Y38A 2YFUA 2PLV3 2E53A 1PGW1 1VBD1 2WN2A 2PTMA 2QUOA 1LNSA 3PUHA 4XIOA 2YC4A 2CHHA 5A6QA 3TRSB 3THCA 3V64A 2LALA 4LPLA 4MGQA 1QJU1 1ZYBA 1RUH2 2VVEA 3I59B 4XTPA 3W20A 3WQ1A 3EXUA 4AI1A 4BHPA 2XPJA 1FAYA 4FOWA 4TWTA 4AEDC 3MGUA 3I2IA 2VMCA 5I0DA 1QNWA 2EA7A 4LT5A 2VC9A 3HQUA 3ES1A 4XW3A 3CF6E 2UWAA 2VUAA 5BNQA 4JDMA 4HG6B 5CKNA 4AEDA 3WHUA 3O0WA 3TWIA 5JOZA 3KD4A 3VDDB 4QX5A 5IVCA 3JB4C 4QPYA 3NNJA 1L3JA 3GYDA 3MDPA 1TQ5A 4M4RA 1W2UA 1LAJA 4JZRA 2XVKA 4XCBA 1DQ2A 3R0RA 1ODMA 5FZ3A 2J42A 3ACIA 4M01A 2W92A 5TSWA 4FPLA 1QDCA 4Y33A 3SNMA 3QLQA 1SCRA 2WO3A 4JV4A 1DZTA 2E7AA 4LHKA 3UKVA 2ZX3A 1PGSA 1S0BA 1ZBE3 4XF4A 5ERLA 2RM22 3VN4A 3ZFFC 1XRUA 3VGIA 4CP0A 4N53B 3VBSB 1JU4A 3DXUA 2VMDA 3ZXDA 4AFBA 5FZ8A 3NVCA 3CJIC 2WZR2 2ENRA 2Y26A 3KQRA 1JZ8A 3UV9A 3H1MA 4GA9A 1SBFA 4IE5A 1AR71 2P3YA 3FLPA 5ACA2 4EV0A 2W1WA 4JGZA 4QD2A 3USSA 5FP9A 4XF1A 1WMDA 2LUWA 3ZO0B 2HBTA 1SG3A 4BQYA 1HV1A 1W8FA 3CDZB 5IAVA 3WNNA 4XJAA 4TSVA 4K8FA 3IBMA 2VBBA 2VE1A 3GBWA 2DF7A 4XZUG 1CJPA 1ND3C 4YVSC 2JDAA 3EB7A 3B3QE 1YUDA 3IAQA 4XYXA 3KV6A 5I0TA 5FUPA 2IVIB 2ZGTA 1PM4A 4R9AA 5FBJA 4OQ9A 2XUEA 4LA2A 1SBDA 4LKSA 4C1XA 3WF0A 3VD9A 4QQLA 5BNNA 3I2HA 3NW4A 2A3WA 1GQGA 4OQ8A 1W39A 2HJIA 2JG9C 5FMOL 4PDWA 2PHUA 1HRV1 3IWZA 2HWD1 1AL0G 2D6MA 1ZRRA 1ZX5A 4D7YA 2JG9B 2ZGLA 3VBFC 3AMPA 4B4QA 1Z0HA 4ZS2A 5A3WA 1N3OA 2B46X 1ZRDA 4PLOA 4Q4V2 5CG9A 1RVF1 3E5XA 3TBDA 4ZU4A 5K9YA 1C1LA 1ENRA 1PZ7A 1AR83 4IETA 3NMBA 2AREA 1HJGA 2ETEA 2C0ZA 5FYMA 3SITA 1YJKA 3ES4A 1BXHA 2WNVA 1PK6C 2HWD2 2BGOA 3LD8A 3POBA 4WVZA 5FR3A 3PL0A 3ZPOA 4A7KA 1XU2A 4M3CB 2GP3A 4LO5B 5DG2A 3I59A 5LA0A 5ABJB 4BOWA 3WXPA 4GB31 3MICA 2PN5A 2WNOA 4TLFA 4AFAA 5A1LA 1V9U2 4UF0B 3TNQA 1QJEA 1WA6X 1U12A 3CU7A 2GP5A 3CZJA 1WCSA 3ZXEA 4P9WA 4E2QA 3NNMA 1MEC1 5JSPA 3AZZA 1DQ5A 1NT0A 4ZONA 1C8NA 1DGWA 2ZXQA 4JAAA 4XUTA 3O1RA 3W21A 4FBFA 3PU8A 1DYPA 2EAAA 1ULPA 4NJ4A 1GR3A 1CAXB 5AC92 1J83A 4CCLA 1ENSA 4Y5SA 2FDFA 2SBAA 5T55A 3M2MA 2HWB1 1UIKA 3OBRA 3N9PA 4YM2A 2GNTA 2RDRA 2H0VA 2RS13 2VZOA 5EYYA 4AHXA 4CZSA 1SPPB 2XL9A 4N43C 2OKXA 1MEC2 4HKLA 1YFXA 3CEWA 3ST7A 2BYVE 2XJVA 4N53A 3VBSA 3C7HA 1PVC2 5IT6A 2D3RA 2YROA 4L2NA 4XBNA 5ACA3 2C4XA 1C3HA 4HN0A 1GBGA 2QVSB 4QX7A 4R52A 2Q8CA 5FLHA 3VLBB 3H0OA 1W8OA 4YGEA 2ARCA 1W9YA 5EQUA 3U1XA 5A3NA 1DQ4A 2HWB2 3ZR6A 2BTVC 1K5MC 5DUUA 2VULA 4A44A 1ZBE1 3NAPB 1HKDA 2RR11 5IFTA 4CPBD 5ANQA 2HWF1 3JCIA 4LLFA 3LA3A 5BNPC 1AJKA 3LEIA 1VRH2 1UKGA 1VALA 2W52A 2VZUA 2ZHMA 4H3WA 4K1YA 3GHNA 1XYOA 3NJVA 1WW7A 3H1YA 3ME2A 4Q4W3 4Q4X3 4W6WA 4FTBA 5JOWA 3K4DA 1U5ZA 3A0KA 4NRPA 3SCFA 3WEZA 3AM2A 1VIWB 1ZM1A 4OVEA 1CJDA 3KMHA 4PCRA 4CCEA 1YIFA 1MS8A 1FATA 1PK6B 4IV1C 1HV0A 2ZHLA 4MYEA 4CPBA 3MFAA 5JXHA 1LODA 3OD0A 3AP9A 5KHGA 2C9AA 1NY72 4QPGA 3FHQA 1PO21 3OYWA 4GAZA 5FZOB 4LUKA 2DCYA 3WP3A 1OLME 1RUH3 5A7NA 2TNFA 5BNOA 2ZGPA 4DXTA 5T5PA 2O8OA 1ND3A 2YB7A 5GZFA 2AYHA 4LULA 1OUSA 1NZIA 1WLCA 1SCSA 5IATA 3LFMA 4GH4C 2WZ8A 4CCJA 2JENA 1VRBA 1EUUA 1W6QB 2JDUA 4MX3A 4AVBA 5FWEA 5H9QA 3UETA 4D6RA 1KITA 2AH2A 4K1ZA 1RJ8A 5BNNB 4PIXA 2VOKA 3LEGA 1HXS1 1H1IA 1PO22 2OA2A 1XYPA 4PDWB 5IFPA 4X6QB 5FYBA 4TZDA 4JDOA 3PVEA 1ND2B 2BWCA 1CZSA 2JDZA 3LE0A 4LUMA 1UZZA 4I30A 4NWWA 4IEZA 4MGYE 4D3WA 4AL9A 1AX0A 4LBJA 3ZIWA 2VUJA 4LIVA 3PIGA 1JW6A 1W04A 1W0NA 2G19A 2VD7A 4IGQA 2JE7A 4I3GA 3WNMA 5A7WA 4UBGA 5CISA 2YC2A 3D5OA 1N1VA 4QPGB 3S5QA 1WCQA 1AUYA 1S0IA 4YGBA 2HBUA 4JGYC 2J7MA 1GP5A 1RHI2 3ZDVA 1LENA 3QBQA 4KWUA 3BU0A 2JEMA 5C4WA 2WSVA 3AJYA 3H7JA 1BJQA 3JD72 4XF3A 3BKZA 1G6NA 2ILMA 3DGTA 2RG4A 2UU8A 4M3CA 3SXWA 1XSQA 1JYTA 3THTA 4PLNA 4XOGA 5LY2A 5D8AB 4NHLA 1IS4A 4LA3A 1HB4A 1J59A 2XOMA 1E5HA 1V6JA 3LSEA 4OI4A 1VR3A 4K21A 1IPSA 2W3JA 4FSJA 5IVBA 4IEPA 1RHI1 1IHMA 2K0GA 3B94A 1LB2A 1ND2A 4L97A 1DQ6A 4JKLA 1IPKA 1OI6A 1LHOA 1STMA 2YBPA 1UZYA 2XLFA 4ET7A 4XAEA 1PO11 3WF4A 4WVWA 1XNKA 1X50A 2FDJA 3JBG1 4K8RB 3MIHA 3ENRA 1F4AA 3RYKA 2BVVA 3VZJA 1NYWA 2WN3A 4D6QA 4Q0PA 4KMQA 4LBOA 1AYN2 2V73A 1AL23 1AR73 2YGMA 5CZKA 4NE9A 4YFZA 1YI9A 4UFHA 4DY3A 1R1A1 2EALA 2Q5TA 2AENA 4KU7A 4Y4RA 1U5IA 4AR2A 4B29A 1OLQA 1AR82 4XFIA 4CTEA 5IVVA 1NAEA 1ULGA 1WMEA 3MIEA 1XE7A 1GZWB 2A1XA 3LZZA 1CAUA 1H6XA 5KXCA 2QCSB 2PAKA 1REFA 3LPGA 4AF9A 1BVP1 3ETPA 1LHUA 2C24A 3I2KA 1OUXA 3GBFA 3NNLA 2DVBA 3SCGA 4KGGA 1SQ4A 1YWKA 3AXDA 4DQAA 5FZDA 3WUCA 1FI2A 1K5MB 4CSWA 4CP2A 3D6EA 3KVAA 3LCPA 4JGYB 5FPVA 3BVCA 3ELNA 4AOCA 1YFUA 4OCTA 4W65A 1JOPA 4C1WA 4G9SB 5KXDA 2QNKA 4BISA 2XB6C 3WNOA 4RGKA 4FPCA 4H14A 3VDBA 1PO23 1K5JA 5C33A 3V0AB 5JI7A 2FMDA 1GNZA 2WAOA 1UZVA 4IV3A 2RM23 2IWGB 5A7SA 3ZYHA 2ZZQA 1CONA 1OF3A 1PVC3 2P2KA 5LBFA 1ZRCA 4H55A 2BPA2 1DYOA 2KXLA 1TME3 4WBBA 4ZU5A 1XBFA 4W6YA 5LEJA 1OKOA 1RMU1 2A3XA 2OZJA 4M4PA 2R041 2RS12 2F4LA 4JRLA 3VKMA 1JTZX 1I6XA 2VH9A 3EYPA 1K12A 4AEDB 4MO3M 1LOAA 4AK3A 1E57A 4DO0A 4W6XA 4UW5A 3N7LA 1UN1A 2VBPA 4NHKA 4Q0QA 3ZXAC 4BU2A 3J8F3 2ZA9A 2BUKA 1VBD3 4G4FA 1PGL1 3FZ3A 4Q2FA 1QQP2 2WNEA 4MHRA 4L11A 4GB33 3LA7A 4Z92B 5LBBA 3ZFFB 2VU9A 2YFZA 3I7DA 1VJ2A 3OTFA 1DCSA 2RS53 5CYYA 1DZQA 3LWCA 5DQ0A 2F4PA 2WDBA 3M3IA 3MIGA 1X36A 3I97A 1Y9QA 2ZX2A 3IT8A 1CGPA 2ZEWA 1RUNA 3HWJA 5KXBA 1L7LA 4F83A 2D97A 1X33A 5FYCA 4E8CA 1PVXA 3BTAA 2IZWA 3W5NA 2BNMA 3M3QA 4COUA 3VBOC 4UW6A 5E16A 5FFOC 5BNPB 1H1MA 5DN2A 1RXGA 1JBCA 1MS9A 3B69A 3NAPC 4V2VA 5JI9A 4GZ9A 4HPKB 5ACA1 1A6CA 3K4AA 2J1AA 1LGBA 4WVMA 4AEJA 5JZGA 2VTXA 5FYHA 4FAGA 3O0VA 1WW6A 4EWEA 5JCTA 1EAH3 1UY2A 3OUIA 4MSVA 3W58A 1F5JA 1W06A 2GMMA 5DG1A 5FV3A 4OUSA 4XETA 3E5UA 5K8SA 2X5IC 4RL7A 4GULA 1S0JA 2GC0A 5FIXA 5EZWA 4LOSA 1WA4A 3POIA 4ZKTB 1XNBA 1SZBA 2VZ3A 3E1F1 5FY9A 1ASJ3 2DFBA 1XYNA 5IJRA 2WYFA 3WDUA 3LOIA 2ATFA 4SBVA 1JN2P 2RDQA 5FCCA 3IM0A 5FZLA 5A80A 1C5HA 3URFA 4XBLA 5LA1A 5F6KA 3ZM8A 5CFDB 1FNZA 1UMHA 1DLCA 1SACA 4JTOA 3ZXGA 4E4DX 1X9TA 3SH4A 4M00A 4P5HA 5AFBA 2FHRA 1JS9A 2K2SA 2NZ9A 3VL8A 4RSUA 3RSJA 1CX1A 1S1AA 2PHFA 1JZ5A 2G4IA 3KQ4B 5FJKA 1JUIA 3IN9A 2XQRA 1AF9A 2PYTA 4N43A 1WCKA 2FDGA 4MGTA 1U5XA 2B42B 2D43A 3AZXA 4B3NA 3PU3A 4WV8A 1NA1B 2DVDA 1RUJ2 1JMUB 1FMD2 4XURA 1ULFA 1EV13 5LEKA 2CYFA 3B93A 3F95A 5E89A 3W5MA 1JZ3A 4Q8LA 3NRUA 5CVRA 5GLVA 4FPJA 2XJTA 2A75A 4YPJA 1DGRA 2NMNA 5H9SA 5KBFA 3OJBA 3HVDA 1LHNA 2VCCA 1V9U1 5FMCA 4LR4A 1R1ZA 2CL2A 3KF3A 1QOSA 5DAQA 2WINB 1OOPB 3Q8BA 2P3KA 1KS4A 3BPZA 1MQTC 1GMMA 1RYYA 2QQWA 4YVSB 1OQ1A 5G04L 2Y6JA 1POV3 5A3LA 4NIIA 2WC2A 4K40A 3AMHA 3M4FA 3U78A 3UNPA 4YGDA 1N1TA 3OUHA 5C8CB 3AP7A 2ZEZA 3ACLA 1VP6A 5JDBA 2UWCA 4GWNA 3WDYA 1VMFA 4Q4X2 2D7FA 1ULCA 4ARYA 1GZCA 3WF1A 4JHZA 2D3PA 1W8WA 5GZEA 1KDMA 1JI6A 1ZBA2 2V72A 1LR5A 2E33A 2W0XA 3VBFA 2AEZA 4QX8A 2DUOA 4XJ9A 3AMNA 1A8DA 5CG8A 5JR7B 2D3SA 4Y1UA 3RRDA 2JG9A 3FLTA 3H42B 4PQQA 3WR0A 2CTVA 2ZPXA 3M1HA 3WG3A 3CIHA 2XXZA 4NIGA 1WW5A 3AZWA 4KG8A 3HD8B 3VBUB 4MG2A 3AFKA 2QDRA 5BXXA 3RJ2X 2N7GA 2HYXA 3KM5A 3MW4A 3PJYA 3NKTA 3IDBB 3VHOA 1LU1A 4Q0SA 2XJPA 2ZHKA 2JDPA 4CUAA 1C8M3 1MQTA 1S55A 2GSYA 2VZQA 3HR9A 4UW4A 2JKBA 5FK7A 5DMYA 1NOVA 2X05A 3U4SA 5A3TA 4JGZC 1OA4A 3SHRA 2EIEA 1DGLA 2KD7A
chains in the Genus database with same CATH topology
3QCWA 2D6KA 4Q4W1 3WCSA 4LO4B 3MZHA 1PM7A 1QJX2 1AR62 4P9LA 2GC2A 1NQJA 3U10A 3POSA 5J3UA 2VGDA 1AVBA 4EWAA 1IOAA 4GIQA 1XXNA 5KHJA 1V6OA 2PHWA 4WM8C 4AVTA 3MIBA 3X29B 3D4KA 3BOPA 4R4ZA 4XFBA 3AP4A 1R082 2XVLA 3THPA 4KWLA 4K6BA 1AXKA 4Q4W2 1TMF3 4R9BA 2R6QA 2ARXA 5FLJA 3M8LA 4FXKB 4NWVA 1I3HA 1G9CA 4JGZB 4SLIA 2BBVA 1D0HA 1TME1 3TOJA 4ASLA 1MQTB 4C91A 2ZX1A 2VY0A 2V09A 3IKWA 2WFF3 2XBO1 3U07A 2RM21 5KHHA 3SMHA 2VECA 1J3QA 3OYWB 1CESA 1F2NA 4Y1YA 1BBT3 1SLIA 3IIAA 4E4SA 4ES9A 3VBRB 3QACA 5SV5A 4JRAA 2YGLA 4WZFA 2SLIA 2VQAA 4FPHA 3T2TA 4CDXC 2ZGKA 2XBO2 1DGWX 3QH6A 4LBQB 1S0FA 1QXPA 2IXLA 3BCWA 3J8F1 4EN8B 1JHNA 4XJWA 3ZYJB 3IPVA 1BEV3 2RJKA 3VBOA 2ZGNA 3PVNA 2EIGA 2PHTA 4RGGA 4XILA 3ROUA 3HAGA 5KHGA 2F6BA 1CQ9A 4BLIA 3RQ0A 2HWE2 3NKGA 1AHSA 2RS51 1FNYA 1UIJA 1YLLA 4FP3A 1HRV2 4F3JA 1HRI1 4CYDA 1V70A 2NM1A 3B02A 4COVA 1NCRB 2PHRA 4FPKA 3H9AA 3ZSJA 4Z2WA 1JUHA 1VBE1 1LU2A 4XZPA 4RHV2 2DUQA 3M3EA 4CDXB 1LTEA 1DZRA 4FTSA 3FHIB 4XFAA 4CDWA 2XGXA 4DXZA 2VMGA 3S6PA 2RS52 1GFF2 3P3PA 1HX6A 2R32A 2Z2SB 1O91A 1H8VA 2Q1MA 2OPKA 1GYKA 1R1A3 3E6CC 4AFDA 5J7MA 4G3YC 2GN7A 1ZA4A 5I8SA 1QKQA 4XXAA 1HQWA 3NSTA 4RHV1 3RS6A 4GB32 4XJZA 1V6KA 4CDUB 2YV8A 5FPXA 5JIUA 5CFDA 3POWA 2B39A 4I09A 4NHMA 1GZWA 1VAVA 4YFWA 1H2MA 2IXIA 3SISA 3TAYA 5LK5A 2TBVA 1H30A 4DZGA 1CPNA 4RD7A 4Z82A 5LK7B 2ZKLA 2CGPA 4LBMA 3VDDC 3NV1A 4IV3C 3VUOA 1YI7A 2B5HA 1JYCA 1ULEA 3J26N 2P3JA 2A73B 2A5ZA 2W08A 4I0BA 5AC91 2G9FA 1B35B 2JG8B 3D0SA 1RUC1 2IXCA 1QU0A 4LEJA 1WUVA 2BNNA 2WSUA 4YNIA 5EXOA 1V6IA 3V0BB 4S2HA 3OD4A 1QH7A 2OIIA 5K0UB 1LGNA 4ITCA 3C2UA 1KJRA 2GU9A 2Q8OA 1PVC1 3FFZA 3H3ZA 3VZMA 2BEOA 3VHPA 1WCDJ 4ORFA 4YARA 4YG0A 3JQXA 1C4RA 2EF6A 4LTAA 5KWRA 1RVF3 1G7YA 1ASJ2 5CNAA 4XIKA 4K9SA 3WDTA 1H8TA 4IEVA 2VVFA 1VBB3 1SLTA 3S0MA 1NLSA 5AFEA 2ZHNA 2ZBJA 1N3QA 4J1XA 3AKSA 4AG4A 4OZXA 1GNHA 3FMGA 1POV1 1PIV3 1F8VA 3ZSEA 4CDUC 3B5LB 2D44A 1OOPC 3MW2A 4HVQA 2Q30A 4GXLA 4JDNA 4L99A 5T50A 3NV4A 3N3HA 4QXKA 1H2LA 4IQPA 1QJU3 4I2OA 3EO6A 3VZNA 1PHMA 2OYZA 1WW4A 1LESA 3ZXJA 4YZ5A 1OPMA 1OPOA 1DIWA 3J4UH 3V65A 5FOJB 2RS32 4IV3B 1COV2 1VB2A 5T52A 4MVTA 1O3SA 4K7JA 1WLTA 4HK8A 1RC6A 3I2DA 4FT8A 4UXAA 4WVMB 4EWDA 4WM7A 1HXS2 3ZYIB 1B35C 2JG8C 2UYBA 1V6NA 4YW5A 1O3QA 2GAUA 2ARBA 3MF6A 3WW3A 4B7EA 1W6NB 3BU7A 2FMYA 1COV1 4OLLA 5JOXA 3APBA 5DXDA 3BOWA 3IMNA 4B7KA 1GANA 3WX5A 5GJ6A 4MLOA 2GZWA 4QPIB 5HCFA 1R092 1NQDA 1YO8A 3AP5A 3HIFA 2ZX0A 1DG6A 1IS6A 1VBC2 2DTWA 4Y20B 5IK7A 1J3PA 2YY1A 5IUQA 1RUI2 3SCHA 3NV2A 1RUF2 5K7PA 3WP6A 5BNOC 2DWRA 4MZUA 2WIIB 3I54A 4YZ4A 1RGSA 2AGSA 2HWE3 3H7YA 2A6VA 1J1TA 1ZZBA 4KL1A 2DVFA 1R091 4INDA 1UU6A 2WNUA 2CNAA 4WVVA 2R1BA 5C8CC 1RTVA 3HMYA 4OUMA 2IC1A 2IXKA 3NL1A 2EAKA 3I8TA 3ZMOA 1U0AA 1C5IA 4Q0VA 3JBG2 3ZXKA 1W6NA 5LRSA 1Z7S2 1OHFA 1CN1A 4JCKA 4EN0A 3FJSA 1KQRA 1YFYA 3OGGA 2GC1A 5KC6A 4ZU7A 4R8HA 1J1LA 2R063 1G8WA 2ET7A 4DB5A 3MYXA 3U4XA 1S0EA 4AFMA 3EBRA 4AYUA 1K5MA 4ISRA 4IERA 2BQPA 3U11A 1LKNA 3L2HA 4QM9A 1AJOA 3AXEA 4YG3A 2I45A 4XQWA 3ZSKA 5CADA 3ZIXA 2GH2A 2D5FA 1HDKA 1QNYA 1WMFA 3M3CA 1KDKA 3CNAA 3N7JA 4NN0A 4Q4V3 4AGVA 3UL2A 4IEUA 3MW3A 4KU8A 4AQ6A 1O4ZA 3R4DB 3BODA 3B00A 5L73A 5AVAA 4IESA 3ZFGB 1HRI3 4AEMA 2DCJA 2DCKA 3W59A 2HWB3 4I0AA 2CWSA 4OHZA 1X8MA 4BWOA 2W68A 2WLQA 1OD5A 1O7FA 2WA3A 2HWC3 2RS11 1QWRA 2ZMLA 2ZJCA 2AR6A 5JWPA 5A3MA 2VQ0A 1WD4A 4A2UA 1KJLA 4FOVA 1V6LA 2CGNA 4FXGB 2Z42A 3ILFA 1MS1A 4M3CE 3O0XA 3PNAA 1RUOA 1EYBA 2A3YA 2WQZC 2P34A 3PVBB 4FPOB 5KC5A 3UJOA 4KGQA 4Q1RA 5J37A 1SDWA 3ZX7A 3FLRA 4Y1VA 3WG1A 4HSLA 1CAUB 1LEMA 2WJSA 5K0UC 4HT1T 1QHDA 5BYNA 5AC93 1RUE3 3ZMNA 4YZ1A 4O9EA 4EN6B 4ISQA 5E1RA 3EJKA 3G7DA 5FLIA 3WG4A 2O1QA 3ZN4A 1APNA 4PLMA 4CDWC 4XJ8A 3WDVA 2LTNA 4I01A 3VBHB 4FTEA 3AYEA 1PMIA 2DV9A 1QXRA 3NWKA 5JVVA 4QQHA 3VBUA 1SFYA 4E2GA 4IEWA 3JU9A 3FBYA 3O7OA 4HKWA 4Q8KA 4NR1A 1MVQA 4DFSA 1JH5A 4FP2A 1NE6A 3DUIA 2DFCA 2A6XA 1AR72 5CIRA 1RMU3 5EWSA 1TE1B 1V00A 1H4HA 2D6LX 1AYM3 2DCZA 3TN92 4NOTA 4CDQA 3VZLA 1EPZA 4YLZA 1GZ9A 4CP1A 4E2SA 1Q8VA 5L7OA 1BEV1 3LKJA 1BK1A 4M3CF 2UY8A 1RUF3 1ND2C 3LSDA 4QT6A 4AI8A 3AYAA 1W0OA 3N7MA 1EP0A 3PTYA 4XQDA 1G9BA 4XDQA 1RUJ1 4BLJA 5A32A 1SLLA 2QE3A 4LO6B 1BEV2 3MLLA 4RS5C 4AI0A 2WLPA 3DL3A 4M0NA 1FV2A 2WQ4A 2GNMA 1NCRC 4ATEA 4D94A 2YDEA 1RJ7A 5DDJ3 4JQRA 3JB8A 4DPNA 1UX6A 4H7MA 4C0HA 2JJ6A 3IDCB 2Q4SA 4URTA 1OQEA 2I07B 1Q8OA 3ZYGA 4FPFA 1IPJA 3V0BA 1MZFA 1CAVA 1DFQA 1RUD3 1UW8A 2XUMA 4Z07A 3NO8A 2CWMA 4L92A 3M3OA 3N36A 2XHKA 1AX2A 4LBQD 3K51A 1RUC2 4HLTA 3J9SA 2R062 1Q8QA 4EN9B 3VV1A 4FVVA 5D8AA 2ZGRA 3VBOB 1LJ7A 4UW3A 5C9AA 1A8MA 3VBRC 1SLAA 3MEPA 2LM3A 2WNUB 3G6JB 3ETQA 4AQSA 2RS33 1UAIA 1ZZCA 3D82A 1D2QA 1B35A 2JG8A 5C4WB 1VBD2 1DU3D 1AL22 1MVEA 4DY5A 1LOFC 2QJVA 4Q0UA 1QJU2 2EVXA 2BW8A 4MXWA 5CFCA 4WM7B 4ZXKA 2BFUL 3WCRA 3KB5A 4AFCA 1LOBA 1YHFA 2G9GA 4Y20A 2BFUS 2ZTNA 4KQ7A 5FO8B 3N4MA 2E6VA 4YZ2A 4Q29A 1JOJA 3SH3A 5FBZA 1AYM2 3TN93 4LE4A 1C28A 5JSRA 1HQLA 3R4SA 1O4TA 4BPZA 2R071 4FOYA 4XPVA 3D0JA 1LHWA 2R0FA 4GH4B 4RQPA 2BGCA 4N43B 3D8CA 1MS3A 4A7YA 5B2GB 1AYM1 4GALA 4FQZA 4A3XA 3AJZA 4AW7A 4D7TA 2RMU1 4MXWB 3SH5A 5CFCB 3VL9A 1H8TC 2ZGSA 3WUDA 1OMIA 1M06G 1R081 1F9KA 1V6MA 3CJXA 1W6OA 4FPEA 4CEYA 1IQAA 2A6ZA 4LE3A 3ZFEC 1SBEA 3GALA 1GSLA 4MV2A 5IK8A 1NE4A 2OVUA 3DKWA 1QOTA 2EXJA 3FC0A 2D98A 1Z7S3 3IDEA 3ILNA 2FBEA 1AZDA 2QZ3A 4Y24A 4AHWA 4CEYC 2YUEA 4DRVA 3QOPA 4D7SA 2D5HA 4META 1UU4A 1OFSA 5HCAA 2JICA 1D4VB 2CV6A 3VHNA 1OLRA 2D6PA 3EQEA 3WINE 1W6MB 5DZFA 2Q0AA 2O8QA 4Q4Y2 4RGAA 5FO7B 1WBFA 3S7IA 4HETA 3WG2A 5I91A 4JC1A 1RUE2 1COV3 3O12A 2VNOA 1MACA 2Z69A 1MZ5A 4JTNA 2V5YA 5LRRA 1RL3A 3VDDA 4PQ9A 1QQP3 2XJRA 1WBLA 4XHXA 4WM8B 2YPJA 1EY2A 3BALA 3RYPA 4QGMA 2HWC2 4Q4Y1 2NQYA 2X5IA 1H2KA 4CEYB 1HW5A 4YM1A 1RUE1 3DF0A 4HFSA 2MHFA 5I8TA 3AK0A 3VBHA 4HZFA 5J98B 2GALA 1X82A 4PDWC 4FAHA 4BYYA 5GALA 1CIWA 1T6GC 3ZVXA 5C8CA 5EYXA 1SMVA 1D4M2 1UU5A 1NXD1 1LEDA 2WFF2 1REDA 1CAWB 2WA4A 1LOGA 2KA3A 3WY6A 4AI3A 1VBA3 4ASMB 2VOXA 2ZZJA 3VBRA 3EHKA 4E27A 3KT4A 4MH0E 1QJY3 2HWD3 3AKTA 2DURA 2P3IA 4PBPA 2R043 1X7NA 4Z1VA 4OFGA 2WFF1 4IV1B 1JYIA 2ZX4A 3RJRA 3CJIA 3RNSA 1AR81 1V9U3 4LLOA 1UL9A 4BE3A 4XJUA 1NXMA 4BM8A 1W6OB 3AZVA 2HEVF 4XFFA 2PLV1 5DUVA 1HLCA 1CD3G 2FQPA 1F31A 2D93A 1NCRA 2NP0A 4KG0A 3T1LA 5A32B 1GICA 2VNRA 1KD7A 2VXRA 4RS5A 1O5LA 1AR63 1QJX3 1R083 3AKPA 4FPGA 4KNCA 4WZCA 3AYDA 4HBNA 2YYOA 1ENQA 5T54A 4N7IA 3ECQA 2OUHA 1FV3A 1QF3A 4EROA 1ZZ8A 4XF0A 3PJQA 1U5YA 2QDNA 3ZXLA 1PZ9A 1FOD3 4L9BA 4Y5Z0 1FPN2 2DUPA 3BIWE 2ZAHA 1PNFA 2Y0OA 3GBGA 1OA2A 4RA0A 2O0OA 3LB9A 1EAH1 3AZYA 4AVSA 4CDWB 4BMEA 3WT3A 3LA2A 4MGKE 3ZFEB 2ZAAA 5EFUA 3T1MA 3HT2A 2ET1A 3AP6A 2A7AA 2DVGA 4L8QA 1IZ3A 2ZACA 3JQWA 1I9RA 2E9QA 2CY6A 4C0BA 3I4IA 2X53S 1OSGA 5J96B 2ZOEB 1FPN1 3PLQA 4XMIA 1QQP1 3O14A 3QD6A 2D6NA 1NG0A 5HI0A 3C3VA 1EAH2 2TEPA 3RMYA 5T3NA 1KS5A 1RIRA 1Y43B 5GZCA 5FPZA 5L19A 1BVVA 4YYOA 1D0GA 1H2NA 1QOOA 5GM0A 3KZ4C 1QGLA 4GMP1 2GNDA 4K20A 5DUWA 5FRAA 1AX1A 1RUC3 1NCQA 4O9GA 2PA7A 2ZGMA 4LHLA 4PIYA 4QU2A 1KXGA 5BPXA 3TN91 3AKRA 5CU1A 3MF9A 4MXVA 1BBT1 3RDIA 3HN1A 3ZFGC 5F5QA 4XF9A 1H0BA 5C4WC 4YSFA 3ZXFA 1AXYA 3H1WA 2HEWF 3ZYRA 4XHBA 5BNOB 1QJZA 2VMIA 1SLBA 1VAMA 4J6GA 2NMOA 1DQ0A 2AZ5A 3B9CA 4AVVA 4OHWA 1BMV1 1VBC1 2R1DA 2PELA 1O5UA 1RUI1 3RI8A 1RUF1 4B4RA 1DDLA 4BA6A 2CAUA 1NLRA 1H9WA 3B9IA 3KS7A 4Y22B 3TNPB 2Q1ZB 1S0DA 2BWAA 2XJQA 4QHBA 1A3KA 2XWJB 1KFXL 1S0GA 3ZN6B 4GH4A 1OA3A 1C57A 2UY9A 3WP4A 1VBE3 1H8TB 2VNGA 5FREA 4XFHA 4AQTA 3POYA 5I0RA 2Y0IA 1SLCA 4KBBA 4QPGC 3ZSLA 3S30A 2PHDA 4AHZA 2ZGUA 1NA1A 1FOD1 3CO2A 3OY8B 2DVAA 3RG0A 4IEOA 3VBHC 1RUD1 2VOWA 4FQ4A 5EV7A 2R16A 4CDXA 3DPRB 2YZ4A 4BZ4A 5DZEA 1CPMA 5J48A 2HWF3 4AVAA 1AR92 1UMZA 2R042 2OZ6A 2CAVA 2UURA 3TYJA 2JXAA 1AL21 2ERFA 1S0CA 4HANA 1ULDA 3FUOA 4HL0A 3GHMA 4Q4X1 4P9GA 1Y7BA 2B8MA 1N1YA 1VBA2 4YM3A 1XU1A 1RUD2 4Q4Y3 4F8AA 4KWJA 1ZBA1 2R0HA 5T5LA 2WS92 2OUJA 3KT1A 2XL7A 1N3PA 3L9JT 2QZ2A 5JZGC 3ZDSA 2Z5WA 2CGOA 1J58A 1PGW2 2XLGA 2QFEA 4RR3A 1TMF1 4HKOA 2WNUC 4OHYA 1OKQA 3NAPA 1C1FA 5JZGB 1RUH1 1UPSA 1ZREA 4CEWC 5L36A 1VBA1 2E7QA 4YW2A 3PVOA 1YCIA 4HVOA 3AMQA 3KCYA 3Q9OA 4YW3A 4Y1XA 2WS91 2ZMNA 4U36A 5BY5A 4H7LA 1O3RA 1WLWA 2A6WA 2JD4A 2X8KA 3OF1A 2ZCWA 1TMF2 4DNYA 4YW1A 5KHIA 2NYYA 2RMU2 5FDBA 4QQOA 4OI2A 5JOYA 1IS3A 3V56A 1CAXA 1GLHA 2DCTA 5HXVA 3P3NA 3L2YA 4Q1PA 1CR7A 1HIXA 1ND3B 4YW4A 5I0UA 4S2GA 1Q5OA 4RQPC 5GLZA 4YVWB 2WZR1 3NV3A 1VRH3 1PK6A 2WNVC 4WM7C 1O3TA 1RUI3 1BYHA 3OPZA 4NPRA 5AVPA 3RPQA 4XQ4A 1PIV1 2R49A 3E97A 1UPIA 2GN3A 4ATFA 1UKRA 3ZPYA 5C6CA 3O5SA 1Q8PA 3CJIB 2MPFA 5C8WA 3S7EA 1FT9A 4P9JA 3BB6A 1KRIA 2BVBA 4X8NA 4COWA 4HMZA 1GKBA 5I8YA 1N47A 3KLSA 3WW4A 1Z78A 4PIZA 4BIFA 5FOBB 1YNAA 1PIV2 1OOPA 3KCXA 5HBAA 4AE2A 3K48A 3KGZA 4BH9A 4CDUA 3GZUC 1AR93 3HQXA 4V1PA 2HWC1 5GZDA 2VW1A 4Q27A 2E51A 4DMIA 5GZGA 5T5JA 4AGGA 4N7UA 1WLDA 2H6BA 5J09A 2PQQA 4RHV3 1RVF2 3H8UA 1LRHA 2JX9A 2FZ2A 2WFPA 4FO9A 3WDXA 3J8F2 4OI1A 4P9YA 1LGCA 3VBFB 1FPN3 2YXSA 1RB8G 4RS5B 3MLJA 2HYKA 1Y3TA 1NZCA 4QPIA 3ZFFA 5KHKA 3AB0A 5I0SA 1POV0 2HWE1 4LBKA 3VZOA 1HRI2 1ENXA 1TNRA 4OHVA 3WZ1A 4ES8A 4CEWA 3VZKA 1FXZA 3FWEA 3IPVB 4AXOA 1VBE2 1LCLA 1WD3A 4RR3C 4ONUA 2IXJA 2ZABA 5BUVA 4LNVA 2WNVB 2GNBA 2VW0A 4LBLA 1SEFA 4Q26A 1IS5A 4AEKA 4EN7B 1VLNA 4PBOA 4KH9A 4P9IA 3GF6A 4MUVA 3DV8A 4QQ2A 1YYNA 5E8AA 1HXS3 4D69A 2I2SA 4XEZA 2BNOA 1VBB1 4JGYA 4AWDA 3W9AA 4GKXA 3PMSA 3WW1A 2R061 3R6SA 1NCQB 2XWBB 4IEYA 1SFNA 5T5OA 1S2KA 1DBNA 3AMMA 4I3PA 5DZGA 1MS4A 2XKOA 4YZ3A 5GLUA 3A0NA 4TYSA 3USUA 2MEV2 2RR12 1ZZ9A 3FX3A 4FPYA 4HVRA 3UK9A 2HWF2 4UBHA 5CBLA 3VKLA 3CL1A 2XJSA 5ABJC 1VRH1 1VBB2 4OI0A 2UYAA 1AR61 1QJX1 3GZAA 1G9DA 1UCXA 5I93A 3M7AA 2WL1A 3B7MA 1RINA 4YVWA 1J3RA 1ONAA 2WT1A 3UKTA 1RUJ3 1B09A 4YRDA 1RHI3 5JLVA 5FO9B 1GV9A 3VBUC 2DYCA 4R9CA 1JXNA 4RQPB 3U0ZA 2EXKA 1MZEA 1ZNPA 1DHKB 1NY71 1IGOA 1XE8A 3KT7A 5ABJA 3UKNA 1Q8SA 2C5DA 2GMPA 3FBMA 5JAXA 3WNXA 3JBG3 2R072 4IV1A 2YHJA 1LOEA 4MGIE 1FMD3 1I5ZA 5JPMB 1TME2 1YRZA 5K0UA 1RUG3 4PJYA 2GC3A 3CLPA 1FX5A 2R30A 3WW2A 5F1RA 4BCUA 3SLIA 3MPBA 5BNPA 2PAMA 2YC0A 2ZGQA 4I02A 3ZFGA 3ILRA 2B7YA 1QMJA 4BQ1A 4CEWB 1AYN3 2FZ1A 1QY4A 2EXHA 2GH8A 1G9AA 3RYRA 2A71A 3E6DA 1BCXA 1I1EA 2RJLA 2NN8A 2PAEA 3AKQA 4GMP3 3DPRA 1R093 2GDFA 5IK4A 3MIDA 5L7OB 4N53C 3VBSC 4IL7A 2RS31 5JPNB 3KSCA 2VPVA 5FMOS 3JD71 2NLRA 3AYCA 1PZ8A 4GWMA 4S2DA 3UJQA 1MS0A 5GLWA 1XNDA 3JZVA 2E63A 4J1WA 4WM8A 1YJLA 4AGRA 4Y1ZA 3WOGA 1YIPA 1EV11 1EPWA 2VMHA 4GKYA 1URXA 4P14A 4QPIC 4R9DA 2XG3A 5BV6A 2C1FA 4P9XA 1S2BA 4S2FA 4NO4A 3WDWA 3E6BA 3FUQA 1W6MA 4COZA 1PO12 5F9TA 2JECA 3RI9A 3VHRA 4XTMA 2HKXA 4YM0A 1EV12 1CAWA 2VW2A 3FFQA 4DOUA 1HQNA 3ASIA 3H50A 4N90A 5CB7A 2WWSA 3RZZA 4Q4V1 1D2SA 4FCAA 1TNFA 1G86A 4CDQB 3ATGA 3KGLA 4XBQA 5DDJ2 3WHTA 4AVCA 1UF2C 1D4M1 5JSOA 3HBZA 2NPIA 5DUXA 4FOQA 1TEIA 4DRRA 2Z79A 4XFGA 1A78A 1MEC3 5SV8A 4YGCA 2XH6A 4F7ZA 2XKPA 2XLAA 4NVPA 5CA6A 1ZZ6A 3OBTA 3RMXA 3OCPA 1LOCA 1DGRN 1Z7S1 2IXHA 1AR91 2PHLA 5DDJ1 5CFCC 2VVDA 3R4UA 1M4WA 3LAGA 1XQNA 4OHXA 2KM2A 1VAKA 3N7KA 1BKZA 1QXJA 4HPKA 2RE9A 2TUNA 2VOVA 1W6QA 3MIFA 2H0BA 3PMEA 2WT0A 1FYUA 5A33A 5IK5A 5C9AC 1CVNA 2A6YA 5FTTC 3N35A 1G9FA 1RMU2 1C8M1 2PLV2 1ASJ1 3MPPG 4DS0A 2ZMKA 4Y4YA 1AXZA 1BZWA 4XMAA 4X8PA 1N1SA 3VKOA 4XE9A 1ZBA3 4E9KA 4Y22A 4AI2A 5JMCA 4XFCA 2DU1A 1KFUL 3B01A 1PGL2 5F6LB 1C8M2 1VB4A 1BQPA 1YXWA 1ZBE2 3USUB 4BMBA 1PNGA 3A4UA 4QQPA 1QH6A 2IFRA 3ZYPA 1QDOA 5JIAA 2WS93 3R05A 2W39A 2X29A 1LECA 2IFWA 3NJZA 5FQ0A 3WD5A 2MNGA 2XBO3 4M0HA 3OY8A 1MZ6A 2MEV3 4K3UA 5HCBA 1F5FA 2H6CA 4MGZE 1OFNA 4GMP0 5EJ3A 3QH7A 5GLTA 4AHYA 4QM8A 2PHXA 2AUYA 5L7OC 1X8EA 1CX4A 3ZN6A 4HN1A 4N9HA 3V0AA 2WZR3 5E88A 2RMU3 4XXPA 3RWNA 4CDQC 1YFWA 4LO7A 4QGLA 1ZZ7A 5H9PA 3WQ7A 4B8EA 1NA1C 4AQ2A 3MLKA 1ZVFA 4BIOA 2E7TA 1LULA 3AFGA 4C90A 5C9AB 4RR3B 4COYA 2X5IB 1D4M3 4Y26A 2YMZA 3ZN5A 1RUG2 2B45X 5KXEA 1OQDA 2XVGA 2A70A 4IEXA 3ZFEA 2HEYF 1W0PA 1H1AA 3ZSMA 1Q43A 3GZTB 1BBT2 1CAVB 3TB0A 3JUUA 5A33B 2ES3A 3FE5A 1FMD1 4X6RB 4DINB 1WGPA 1UD1A 3GNEA 1ZRFA 3DPRC 4LO8A 4R4XA 1RUG1 4KWKA 2WKKA 2ZKNA 4A7ZA 1BMV2 2P17A 1PO13 3WLUA 2RR13 1DQ1A 4LBNA 2ZGOA 4PF5A 4IXLA 3WP5A 2QKDA 3ALQA 2P37A 3WV6A 3INAA 3H3UA 5CFDC 2DU0A 2WT2A 3MFCA 1MR5A 2D40A 2WZPP 1GQHA 1H4GA 1QJY2 5CAZA 2JE9A 4GQ7A 5H9RA 4B4PA 4E4ZA 1AYN1 4QMAA 1W6PB 4HK9A 1R1A2 1NCQC 2QQPA 5BNNC 1MS5A 2VG9A 1Q3EA 1O4YA 2DTYA 4OULA 1LOFA 1DLLA 1IKQA 3M70A 1HRV3 4I0WB 4U2AA 4RFT0 4LBQA 4N9IA 3VKFC 2UWBA 1IKPA 3JD73 1QJY1 1FOD2 2I74A 3OGJA 4YVSA 2EXIA 4YVWC 1H9PA 1LHVA 1Q56A 1REEA 5D8AC 4HSJA 3MI8A 5D1IA 2GMEA 2OW4A 3VKNA 2MEV1 1RITA 2R073 3HT1A 2XJUA 2D6OX 3KCCA 1XNCA 4LHNA 3WQ0A 4Z8BA 1DF0A 2ZS6B 4YG6A 1DYKA 1ALYA 3DN7A 5FQ0B 4IEQA 1W6PA 3E5QA 4JVAA 4QGNA 3LGRA 2K9ZA 2PFWA 2B9UA 3PHMA 1VBC3 3AX4A 5FAXA 3WVJA 5J36A 4EJRA 2RHPA 5GKAC 3LOBA 2Y38A 2PLV3 1PGW1 2E53A 1VBD1 4FSJA 2PTMA 2QUOA 4XIOA 3TRSB 3V64A 2LALA 3WQ1A 1QJU1 1ZYBA 1RUH2 2VVEA 3I59B 4XTPA 4AI1A 4BHPA 3EXUA 2XPJA 1FAYA 4FOWA 4TWTA 4AEDC 3MGUA 1QNWA 2EA7A 4LT5A 3ES1A 4XW3A 3CF6E 2UWAA 2VUAA 5BNQA 4JDMA 4AEDA 3WHUA 3O0WA 3TWIA 5JOZA 3KD4A 3VDDB 4QX5A 3JB4C 4QPYA 1L3JA 3GYDA 3MDPA 1TQ5A 1W2UA 2XVKA 1DQ2A 3R0RA 4M01A 5TSWA 4FPLA 1QDCA 3SNMA 3QLQA 1SCRA 4JV4A 1DZTA 2E7AA 4LHKA 3UKVA 2ZX3A 1PGSA 1S0BA 1ZBE3 4XF4A 3VN4A 2RM22 3ZFFC 1XRUA 3VGIA 4CP0A 4N53B 3VBSB 3ZXDA 4AFBA 3NVCA 3CJIC 2WZR2 2ENRA 2Y26A 3KQRA 3UV9A 3H1MA 4GA9A 1SBFA 1AR71 3FLPA 5ACA2 4EV0A 4JGZA 4QD2A 3USSA 4XF1A 1WMDA 2LUWA 3ZO0B 1HV1A 4XJAA 4TSVA 4K8FA 3IBMA 3GBWA 4YVSC 2DF7A 1CJPA 1ND3C 3B3QE 1YUDA 4XYXA 5I0TA 2ZGTA 4R9AA 4LA2A 1SBDA 4C1XA 4QQLA 5BNNA 3NW4A 2A3WA 1GQGA 1W39A