2VOKA

Murine trim21
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
186
structure length
186
Chain Sequence
AHHHHHHMVHITLDRNTANSWLIISKDRRQVRMGDTHQNVSDNKERFSNYPMVLGAQRFSSGKMYWEVDVTQKEAWDLGVCRDSVQRKGQFSLSPENGFWTIWLWQDSYEAGTSPQTTLHIQVPPCQIGIFVDYEAGVVSFYNITDHGSLIYTFSECVFAGPLRPFFNVGFNYSGGNAAPLKLCPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 52 KDA RO PROTEIN
publication title Trim21 is an Igg Receptor that is Structurally, Thermodynamically, and Kinetically Conserved.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 52
structure length 186
sequence length 186
chains with identical sequence B
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2008-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00622 SPRY SPRY domain
A PF13765 PRY SPRY-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.920 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2vokA00
4V1PA 4WVMA 4B8EA 4QT6A 5C33A 4N7IA 5JI7A 5JI9A 4P9JA 4X8NA 2YUEA 4P9LA 5JIUA 4N7UA 2VOKA 4WVMB 3UV9A 3ZO0B 2E63A 4XW3A 3KB5A 5JIAA 2YYOA 3TOJA 2WL1A 5F6LB 4P9IA 5F6KA 2LM3A 2IWGB 4X8PA 4B3NA 2FBEA 4KG0A
chains in the Genus database with same CATH superfamily
4JHTA 1XE0A 3R0RA 3FC0A 1AL21 2W1WA 3J8F1 1AHSA 3DN7A 3R4DB 1YFUA 4NPMA 2ZHLA 2WBKA 1ZZ8A 5AC93 5JAXA 3HEIA 1UXZA 4OFGA 2WNUB 1LULA 3EJKA 2J1AA 4N7UA 1G9AA 1LU2A 1V6KA 4QQLA 2ZACA 4BZ4A 4N43B 2B9UA 2BNOA 2DCZA 3MUY1 1RVF2 3R6SA 1OBNA 1PIV2 1W6OB 3MF9A 2VXJA 2V4VA 4XFAA 1Y4WA 3RVHA 1IS3A 1RTVA 2CDPA 4IE6A 5DDJ1 1H9WA 2VVDA 4COUA 5L7OC 3G6JB 4P9IA 5FBJA 2I45A 4YSFA 2PYTA 2XLAA 3ES4A 3PLQA 4IE7A 2LROA 4BLIA 2G9ZA 3VZJA 4QGLA 4M4RA 3ZIWA 4YZ5A 3RZZA 1WLWA 2E33A 1AR81 4Q4Y3 4CDXC 4NO4A 4AL9A 2UWBA 1YRZA 1OF3A 4NWWA 2R6QA 1LCLA 4BLJA 3LE0A 2ORZA 3WDUA 1DGRA 1N1SA 2Y0IA 3FFZA 4CP0A 5A33B 2AREA 5FYCA 3O1PA 3W59A 4NJ4A 4UFLA 2A5ZA 2VZTA 2NP0A 3ZIXA 4XBLA 4G3YC 5T52A 2VAUA 4UXAA 1ENSA 2CGNA 2VL4A 4HPKA 1MZEA 1O4TA 1VBD2 2YG0A 3KM5A 3MLJA 1QH7A 2IWGB 2LM3A 4AI9A 1HN0A 2VOTA 1PGSA 4FP2A 1NA1B 1X33A 5FP3A 3U1XA 3BTAA 4B7KA 1VBE3 2PMWB 2YPJA 3LB9A 4IV3B 3VBRA 5FPUA 4LBMA 5B2GB 2C4XA 2WR9A 2ZKLA 5CFDB 4YW7A 4Z8BA 5CFCC 4XJZA 4TLGA 1AYM2 5GLVA 2RMU2 4DXSA 5FK8A 2EXJA 4RS5B 2ZHKA 2WDBA 2D5FA 2YROA 5FCCA 2AZ5A 2WZR3 1EP0A 5CEHA 1G9FA 2RS53 4LR4A 1JU3A 4K8RB 4XF1A 4NIIA 2VZQA 1DYOA 1V6MA 4OCTA 3PL0A 4A42A 3KVBA 3E6DA 2WLQA 4PDWC 4CVUA 2JD9A 3N7KA 3AL5A 3RYKA 4F3JA 1KDKA 2VNRA 5B4XA 4AI3A 2LTNA 2C5DA 3HMYA 3BPSA 5K8SA 1DZQA 1MS4A 1OLRA 2GN3A 2HKXA 1TEIA 5D8AB 4RR3B 1AL22 1NUKA 1UOFA 3J8F2 4KWKA 4A41A 1CAVB 2VOXA 2G1MA 3WF0A 1FXZA 1MACA 4P9XA 4YGBA 4XF0A 4FPCA 5FZHA 3SKVA 5FYVA 2VH9A 1OFSA 2W91A 4Q0PA 3KT7A 3BOPA 3ZPYA 4NN0A 4UYBA 5A3LA 2E7AA 5FFOC 3KV5A 3AYAA 5DDJ2 1G9CA 2I2SA 4MXWA 3VL8A 5FAXA 3VD7A 3DPRB 1SACA 2ZX2A 4CCOA 3AXEA 1OI6A 1BQPA 5JR2A 1NY71 1UOJA 4Y1VA 5FRAA 4LOTA 1ULOA 2HWC3 2LS6A 1AR82 1N47A 1SG3A 4GMP1 1HV1A 1HB3A 1ULPA 1YXWA 1HQWA 5D1IA 2WT2A 3PVBB 5J98B 2DYCA 2VC9A 4WVWA 4XE9A 4K21A 1OURA 4XQDA 1VMJA 3WF1A 2GMPA 4PHZA 1DLLA 1AR93 2AUYA 2GH2A 5EWSA 3BN6A 4GKXA 2J1VA 2VM9A 1K45A 4XACA 4ZXEA 2VZOA 2WNUA 2WNOA 4K20A 3VBHB 4ARYA 4C91A 2BVBA 3DEMA 4FFFA 5CB7A 4Q5OA 4FOWA 5CKMA 4N43A 2TEPA 3WP4A 3VZLA 2A1XA 4LNVA 4A6SA 1NOVA 1QJU3 1GV9A 1I5ZA 1W6OA 1J3PA 1OA2A 2W3JA 1HJFA 1OQ1A 3HIFA 4K3UA 3ZOIA 4C90A 2QFEA 2R073 1UMIA 2E26A 1PHMA 1YLLA 3GYDA 3PHMA 3OOXA 4WZCA 3NL1A 2VE1A 3IDCB 3AFGA 4E4SA 1C5HA 3BB6A 1UKGA 1RINA 3N9QA 4FTSA 1HXS3 3MPBA 5F2SA 2B42B 3KS7A 3N9OA 2Y34A 3PMEA 3ZKYA 4ARXA 3USSA 1S2KA 1XU2A 1RUE3 3MDPA 5LBFA 5HBAA 5FO7B 3D82A 3POIA 2CHHA 5JZGC 4RGGA 5FLJA 5K4LA 1NG0A 3NW4A 3PUAA 2VZRA 2C1FA 5A7SA 1LGNA 5C3SA 2P2KA 4FSJA 3B00A 3PU3A 3BVCA 5A33A 1F9KA 3UK9A 5ANNA 4EWDA 1JHJA 4YGDA 1O3RA 2FDIA 2X53S 4A7KA 3MLLA 3ES1A 3T30A 3KHBA 4Q0UA 5GZFA 4EN7B 1ASJ1 3MFAA 3ATGA 5FLHA 5F7UA 3H8XA 1XYNA 4BOWA 1ND2C 1FOD1 2Z69A 5IAXA 4AAPA 4HKWA 1AXZA 2VMDA 1K5MC 1RUD1 3J9SA 3UJOA 3PDQA 3WDYA 1NA1A 4L99A 4C8DA 1VAVA 1XOYA 1NCQB 1IHMA 2HWE1 4IV3A 2ARCA 2CTVA 3AZZA 1MPXA 3HWJA 4MGZE 1JZ2A 4PDWB 4ZS3A 4Q1RA 2VQ0A 1WMXA 1Y3TA 5CFDA 4Y5SA 5FWEA 3T3YA 3THPA 5A1FA 4W65A 1AF9A 1JYCA 4RS5A 3RWKX 3ORJA 4GWMA 4SBVA 1QIQA 4GWJA 1RUF3 1MR5A 3WP5A 3H1YA 3F2ZA 3V0BB 1UZYA 5F3GA 2AEZA 4ZXKA 1NY72 2B8MA 4XUPA 3SITA 2QZ2A 2VD7A 2VOKA 3DKQA 4QHZA 4CU9A 2E32A 4XIKA 4NR1A 1D4M1 3CU7A 3ZXDA 3IM0A 2A71A 2SLIA 3GALA 5FZ4A 2YC4A 3PVNA 3KZ4C 3LEKA 5KXCA 2ZEZA 3F95A 2V72A 3VGIA 3TNQA 1W04A 5A1AA 5D8AA 4RR3A 2V5YA 2ZMLA 5GZEA 2OW4A 4URAA 4CP1A 2XLFA 1CAVA 4CDQC 4FAHA 3EB7A 1WA6X 1A3KA 2CWSA 3ABZA 1QJX1 4Q0VA 4XZPA 1YJKA 2P37A 1JYVA 4MGYE 1R1A3 1N3OA 2OVUA 1QY4A 4URTA 5CNAA 3ZXJA 2YC2A 4I0WB 4Q4V1 4FPEA 3ZX7A 5AFEA 2WWJA 5F5QA 1UW8A 2NMNA 3DUIA 5F3EA 2VUDA 1VR3A 5G05L 4GZ9A 5KXEA 3OD4A 3T1LA 1NT0A 1ND3C 1AX0A 1LOFC 1GWLA 3AXDA 1OFNA 3OUJA 4FPFA 5FZ7A 3DPRA 1BZWA 1PMIA 2EXKA 3Q8CA 1W2NA 2OQ6A 4EN0A 1POV1 1QNYA 2XG3A 3KCXA 2UURA 3MIDA 1HRI1 2YFZA 5A7PA 3RI9A 2A6XA 3POYA 2FDHA 2Q8DA 4M0NA 1RB8G 1ONAA 4LKSA 4QAWA 1UU4A 5I0TA 3VZKA 1GZCA 3OUHA 5C9AB 1SLLA 1AYN1 1FV2A 5KHIA 4QQHA 3POWA 3VUOA 2B39A 4YRDA 5B4NA 5JDBA 1V9U3 1NCRB 1OQEA 2A6ZA 2IXJA 3C7GA 4JTOA 4I3GA 2GALA 3RJ2X 3N7JA 3J7HA 4QGMA 3ST7A 2DCKA 3WW2A 4E2GA 1UY2A 4XF4A 3M1HA 3WW1A 3PIJA 5FXWA 1ASJ2 2VBPA 2GSYA 4UWDA 2ZGPA 1FOD2 3S30A 4QX2A 5IT6A 3VBHA 5BNPA 3S57A 2HEYF 1UO9A 1RUD2 1W39A 2P6CA 1IQDC 2HWE2 2C24A 4M0HA 4WM8B 2W52A 1GFF2 3RS6A 2RJKA 4A3ZA 3RZHA 5FMOS 2GZWA 1OT5A 5FO8B 3AL6A 3T2TA 1VBC3 4BH9A 1LECA 5EPAA 1J59A 1PO21 4LHKA 3WCSA 4B1LA 1YFYA 2ES3A 4I0BA 2AACA 4QXCA 2FMDA 2JG8B 2YHJA 3ZMNA 1NLSA 3B01A 3R4SA 4I0AA 1EPZA 1C8NA 2BFUL 3OEBA 3Q8EA 5GLZA 5I0RA 2IFWA 3S5AA 1FV3A 1K5MB 4Q1PA 1D4M2 1XXNA 3FBYA 1Q43A 1VALA 2D3PA 3S5QA 1UCXA 2GH8A 2WNVB 3FFQA 3TBDA 1HB2A 3A7QA 1OMIA 2XUMA 1B09A 1RXGA 2VR4A 3AP5A 2VZ3A 1OVPA 2WYSA 3LDBA 3VKNA 5L9BA 1O8PA 4JC1A 2WAAA 4FPLA 5EJ3A 5FZBA 5IVFA 2DFBA 1WW7A 3DV8A 1QJX2 4NVPA 4AYUA 2WQ8A 4Y33A 1MVEA 1FYUA 4CDWB 5BNQA 3OY8B 3WY6A 1NCQA 3MEPA 4NWVA 4BMBA 4Q4V2 1FNYA 1RL3A 3VZNA 1W9FA 4QWNA 5A3OA 2XQXA 5A3UA 2OZJA 2IUWA 1LHVA 3N9LA 2NYYA 4L8QA 4NAMA 3VV1A 2CY6A 4AFDA 4INDA 5ACA3 3BOWA 1WMEA 2JIJA 2OYZA 2CWMA 2WQZC 3JD73 4P9WA 4E4DX 3V0BA 1WLTA 1S1AA 3OBAA 1OPMA 1HRI2 2NN8A 5HCFA 4AVTA 4CYDA 3ACFA 5A6QA 3O1SA 2XGXA 4ASKA 3ZPOA 3WNNA 1LESA 1KS5A 5FPXA 1AYN2 4JDOA 4LKEA 4MZUA 2HLEA 1WW6A 3P6BA 2WABA 4KGGA 3TYJA 2ENRA 2WLPA 5SV5A 1QDOA 2W1UA 4DINB 2H6BA 4XF9A 1ND3B 1MQTB 5FMCA 3UESA 2ARAA 3AJZA 5JR7B 3IAPA 4TN7A 2EICA 5CU1A 1YQ2A 5EZWA 4Y5Z0 1R091 2P6HA 4P5HA 2MEV1 5IHRA 5I8TA 5FMBA 1G86A 2YMZA 1S0IA 3WDVA 4P9GA 3A23A 1QQP3 1TG7A 2DBNA 3H42B 5IVCA 3RI8A 2D6OX 4TWTA 4FCAA 1PO22 3WXPA 2R30A 1J1TA 2WNEA 3GBGA 3I2IA 1DGWX 3WF3A 3KGZA 1BVP1 1GP6A 1JUHA 2W92A 3NWKA 1XE7A 2ZMKA 1NXD1 4AFAA 2UY9A 4ZY9A 3WP3A 4HL0A 2QJVA 1UY4A 2ZGLA 1RIRA 3AVRA 3OB8A 5F8PA 4A7YA 3DYPA 1F5FA 4COZA 1QOTA 1ZX5A 4TTGA 2GNDA 3MV11 5HCBA 5FXZA 3WLUA 1MEC3 5JMOA 5C9AA 5HXMA 4ONUA 3NV2A 2UWAA 4CA9A 3VZOA 4CCEA 4JGZB 5FXVA 1OHFA 4M00A 3RJRA 1NCRA 2Q1FA 5K0UA 4EZ4A 4Y4RA 2D98A 2GAUA 4B4PA 5KHJA 1YWKA 2WS91 3J7MA 3NRUA 1QEXA 1PVXA 1O4YA 4QT6A 3VKMA 4QX7A 2WIIB 1H30A 1UZ0A 1I5PA 4CUCA 2F4LA 2OUJA 5CIRA 5C3QA 5FR3A 5CG9A 5A3NA 3NNGA 3O0VA 2XUEA 1EYBA 3ZO0B 1H4HA 4LPLA 3LA3A 3VBRC 4AXOA 4AVAA 2ZGOA 2YBPA 4ZKTB 1H6XA 2DU1A 2PLV1 3W5MA 2DF7A 4JRLA 4JDMA 5IVJA 2QQMA 3NQHA 1LHOA 4QKBA 1FX5A 4PF5A 4QPIC 4WM8A 1UOBA 3SQOA 4E9KA 5LCWL 3WP6A 1PO13 1TNRA 3ZYJB 3ZDVA 2GU9A 2QE3A 4P08A 3T2QA 3WHTA 1ZRCA 4IEXA 4YZ2A 3UKNA 2ZX0A 5A3MA 5KC5A 2ZEXA 3O1RA 2JG8A 4BJ0A 3NV1A 4BQWA 1PZ9A 1YQCA 4XUNA 3ZXKA 4NIHA 5GJ6A 1HKDA 2W95A 3TEZA 1OC1A 4LMFA 1QJY1 4N7IA 3RDIA 2D3SA 1KD7A 4AW7A 2Y6HA 2VOWA 1COV1 4ZU5A 4WZFA 4AGRA 2JDNA 1CJPA 1AR63 2Q8EA 4V2WA 3FLRA 5JXHA 1YO8A 2WNVA 2UYAA 1Y9MA 3VD9A 3BIWE 2BYVE 4LA3A 4JGYA 1OH3A 3ACGA 5J96B 1T2XA 1ZRFA 3ZR5A 1CGPA 1F31A 4IE5A 2DWRA 3OPTA 4ITCA 3SNMA 2BOIA 1PNGA 4DZGA 3UGGA 3Q9OA 1LODA 2Y33A 2VZ1A 2VQUA 4LO7A 3UT0A 4CDWA 4UFHA 3OY8A 1R092 2YB7A 5JSOA 2MEV2 2R1DA 3IMMA 2J7MA 5LY2A 1RMU3 4GIQA 3NV3A 4DY3A 2DVFA 4GQ7A 1UX7A 4LBQB 3UGFA 3HNMA 4B7EA 2VU9A 4AQ2A 3RSJA 4YPJA 4IGOA 5CG8A 1LENA 4NOTA 4ZU4A 2Y0OA 2W0XA 3AKTA 4WVZA 3ZSLA 4BQ4A 2WSVA 3VD5A 2QQKA 4AEDB 2BDRA 3NNJA 1I1EA 4AEJA 4BMEA 4B4QA 4YW3A 5HPOA 1GNYA 1IPJA 3H7JA 3UGHA 2R043 5CAZA 4UOJA 2JE8A 3BGAA 1AJOA 1KRIA 1RUJ3 2VG9A 2IVIB 5E89A 2O8OA 3HJRA 3WQ1A 1RUG1 4CEWB 5IK7A 4YM2A 3ROUA 4HMZA 4YYOA 2A6VA 3D3AA 4DXRA 4M4PA 4NHKA 1HRV1 4CU8A 3ETPA 2WS92 2E7TA 1XRUA 2VW1A 1MQTA 2WNUC 5BUVA 5C71A 5IK8A 3O1TA 5FYZA 5KXDA 1J84A 2XQRA 2RDSA 2XBO1 2QQNA 4XBNA 5A70A 3HPNA 3USUB 4QQ2A 1MZ6A 1TME1 1AUYA 1SDWA 2ARXA 2DCJA 3KCYA 3WX5A 2VECA 4LO5B 2PLV2 2G9GA 1LOEA 1D7PM 4LA2A 1OVSA 2EF6A 1H2MA 2QQVA 3NMBA 2D6PA 5F5CA 3ZFGB 4FBFA 4HKOA 2UWCA 3MIBA 3PNAA 5FPAA 5JOZA 1X82A 4F83A 5LBCA 2ZA9A 2BOJA 2IFRA 3IIIA 3FZ3A 2KM2A 2VGDA 3CBNA 3WQ0A 3RZGA 3RGBA 1PX4A 4OLLA 1JODA 1QJY2 5EIYB 3ZSMA 2ZAHA 4EZHA 1G9BA 1H1AA 4AEKA 1YQ5A 3AP7A 1COV2 1GQHA 4YW1A 1OLMA 4MH0E 3RFRA 5KXBA 2D6NA 4JGZA 3LPFA 4QPIB 2RS13 3JZVA 3FHAA 2ERFA 3KWVA 2XJRA 1JOBA 1BJQA 1N1TA 5IVYA 3DXUA 3EMRA 4OHZA 4OI0A 2CAUA 2DUOA 4PBPA 4LHLA 1NA1C 2B4KA 1U5XA 2DVDA 2VUJA 2TBVA 2WO7A 3IZOA 4QQOA 3N35A 3RWNA 4D0QA 5LEJA 1ZRRA 4IV3C 3U37A 2VMGA 4IEUA 4AI0A 2DVAA 5C6CA 3K3NA 3ILFA 2QCSB 3T09A 1H8VA 4AF9A 5CFDC 4UFMA 4YNIA 5FZOB 4Q4X3 1WMDA 2RV9A 3RZLA 2GC2A 2ZGQA 4WVMB 4RS5C 3LOIA 2XJTA 3AP6A 3HN3A 1JH5A 3M3OA 1UIJA 4QXKA 4GB33 4EE2A 2BP6A 4OI1A 4EV0A 5IFTA 3VN4A 3H8OA 1VRH3 2ZGSA 1WGPA 4UBHA 1SLTA 4X8PA 3AYCA 1XB9A 3UJQA 5LY1A 3FUQA 5H9PA 3JXSA 5FLIA 2W68A 4QM8A 4CXYA 3LDRA 1POQA 2V73A 3I2FA 3M7AA 3IT8A 5FZ8A 1RUG2 4AHXA 2YPDA 4BM8A 5D8AC 5HV0A 4CXXA 4RR3C 1ENXA 1H8TB 1OXCA 1ZBA3 4LUMA 3M8LA 4MXWB 1QKQA 1HRV2 2VZUA 3HVDA 4YLZA 5DUVA 2V5DA 5FY9A 3OG2A 4IEVA 4JDNA 4LO4B 4QU2A 1R1ZA 2QQUA 4KQ7A 4PQQA 3GDBA 3AMPA 3RZMA 2XBO2 2DFCA 3D6EA 1JTZX 5A7NA 1AVBA 2RG4A 5AFBA 2QQJA 5APAA 1TME2 4OHVA 4S2FA 1VAMA 2O0OA 1VAKA 3I54A 3JBG3 4HZFA 2C9KA 4YGEA 2VTFA 5G04L 4XAAA 3N4MA 3O5SA 4AR2A 2WA3A 1CQ9A 2J1UA 2VMHA 1PK6B 5BXXA 2QQPA 5A7WB 4U2AA 1WA4A 3DPRC 3R05A 4JQTA 4LBQA 4XBQA 4B4RA 5BNPB 1O3TA 3O0WA 2OX0A 5IJRA 1WUVA 4A7ZA 3AC0A 5JI7A 3S7IA 1V6LA 4AEDA 2HYXA 1ZVFA 3K3OA 5DAVA 4JTNA 2XKOA 4HONA 3V56A 5BY5A 4IGQA 5LA9A 5T50A 3T1MA 2IXCA 4AI1A 5CKNA 1US3A 2JDKA 5EV7A 3KHCA 3VKLA 3ITQA 4OVEA 4GA9A 4CEYB 1W8TA 2J1RA 4IEQA 4O7XA 4CEWA 2ZHMA 3KV9A 2HWF3 2JDPA 1NE6A 1D0HA 2CGOA 1UX6A 2RS33 4I01A 5LA2A 3O1VA 2HWD1 1OOPC 1UYYA 2LRPA 3HBZA 1RUI3 4H3WA 5L73A 1WW5A 1SLIA 2DDUA 1R083 3VBHC 3VBSB 2O1QA 5BNPC 5JOXA 1CN1A 2BGOA 5IVBA 2WO2A 3DCQA 3PIGA 1C3HA 4O65A 3USUA 1C28A 1CIWA 1CPNA 1U5YA 4MHUA 3WUCA 4YZ3A 4FOVA 4IEZA 1UPIA 5HCHA 3IDBB 1UU6A 2EA7A 1D2SA 1CONA 3NNMA 4FTBA 2VULA 3ZFGA 2XXZA 1BBT3 2VO5A 3FE5A 2HWB1 5JOYA 1CZSA 3GM8A 3LSDA 1C1FA 4HSJA 1E57A 2ID4A 4JX0A 3BTZA 3HD8B 3AMMA 2CSGA 1EY2A 1AR61 2OPKA 1APNA 1ODNA 2P4EA 1VBA3 3KMHA 5CYYA 1EV13 2CGPA 4H14A 2DUPA 3AZXA 2Z5WA 1JYIA 3OEAA 1U5IA 1TNFA 1GKBA 4X8NA 2CU5A 2RDRA 5LK5A 4AQSA 4QPIA 1LTEA 4LO8A 1AXYA 1YI9A 2JXAA 2D3RA 3H8RA 1URXA 1UY1A 3QACA 1NCQC 4D6SA 2DTYA 1ENQA 3AB0A 4HN1A 2XHNA 1MS5A 4AEMA 4MO3M 3VKFC 5FZOA 5IK4A 1VLNA 3INAA 1QMJA 5EP9A 4PQ9A 4WVMA 2OUHA 1YIPA 3NNFA 3CKHA 1DGWA 4AOCA 3B7MA 5JPMB 3O1OA 3WCRA 2VW2A 3K77A 4MGIE 4GXLA 3T0DA 1Y7BA 1H0BA 1W03A 5FZEA 1FT9A 3WG3A 3Q8BA 2WC2A 4H7LA 2PHTA 3KLSA 2Q8CA 2VQAA 1DF0A 2RM21 4GKYA 5FPLA 2R0HA 3PUHA 1VBB1 1F8VA 2E53A 3PMSA 4JCKA 4LLFA 4RL7A 4W6YA 5L36A 1RUH1 1H8TA 1Z7S1 3LEMA 5E88A 4DFSA 4XCAA 2FDGA 1RHI1 2HWD2 3AP9A 4P00B 2CV6A 3H3UA 4N53B 1SLCA 3VHPA 1Q8QA 3VL9A 2OIIA 1SCRA 1TMF1 2NQYA 4MADA 3WG4A 4AGGA 4Z82A 4NIGA 4E2QA 4HN0A 1V6IA 3B9IA 4LE3A 4GMP0 4QDRA 1WBLA 1NKGA 4YWAA 4FPGA 3E1F1 2QQLA 2D43A 4PI2A 4XTMA 5F32A 3AMHA 2GNMA 1Z0HA 1PK6A 2A75A 5A7WA 3ZMOA 3L9JT 2ETEA 4XURA 3TEWA 4XFHA 1AL0G 2A3YA 3AYEA 3K2OA 2HWB2 4QKFA 3N7MA 3ZXFA 3BI3A 3ZYFA 4P14A 4IV1B 5KBFA 3HT2A 3VBUB 1OOPB 1LJ7A 4Y3OA 3IDAA 3FL7A 1AR62 4P9YA 2RS11 5J7MA 1LOAA 1W99A 1ZBE1 4EN8B 2W94A 3POJA 4IERA 3D4KA 3WG2A 3HN1A 3L2YA 5C9AC 1DLCA 3FUOA 2ZGTA 1AX2A 4K1ZA 1BKZA 4P9JA 3Q8AA 3VKOA 1NCRC 2PHWA 3EO6A 4X6QB 3WT3A 2R16A 5K0UC 1FNZA 2JWPA 2XJSA 1LAJA 1GLHA 4LE4A 1B35C 1DGRN 3P3PA 4BB3A 4YW5A 2B46X 1UY3A 5A7OA 3GGLA 4ASMB 2XHKA 3VBSA 3MI8A 1W8HA 3UKVA 2A3XA 4WM7B 1GNHA 3SH4A 5C8CB 4MV2A 2R7EB 4IESA 1XU1A 4WM8C 1ULGA 2RJ2A 2XB6C 5KR7A 3DGTA 1JS9A 4IUGA 2JDUA 5DZEA 5FREA 1US2A 4YW2A 4KBBA 3U11A 5HV4A 3W5NA 5CBLA 5FP7A 1N1YA 4H2AA 5F3CA 4ZS2A 5DAQA 1X9PA 2GC1A 2VXRA 4AVSA 2JG8C 4FO9A 2F6BA 4CP9B 1S0BA 1IPSA 1NQJA 2Y64A 3NVCA 2PHFA 3MHZA 5LA0A 3ZYBA 4JZRA 4CCJA 3MUZ1 3QH6A 1PMJX 1RUC3 1J3RA 1MS8A 1V0AA 4QB1A 5A3WA 4AWDA 3P3NA 3J4UH 1GICA 4ZONA 4PJYA 2ATFA 5A80A 2RM22 1DQ5A 3KSCA 4PLMA 4UAPA 2BWAA 4AI2A 4ET7A 2WNVC 5EYYA 1REFA 1VBB2 1EAH1 2YDEA 4YVWB 5ERLA 3WDWA 1NLQA 4YFZA 4JGYC 1PVC3 2V4AA 2YU2A 1RUH2 2RHPA 1Z7S2 4ZU7A 4XUTA 3GZEA 3TN91 1RHI2 5FK7A 3N36A 1FMD3 3LSEA 4DXTA 1CIYA 3U10A 1AR73 4W4ZA 4QX5A 4CDWC 4R9AA 4H55A 4XMIA 2GDFA 1TMF2 3OGSA 1YUDA 1UWWA 1DQ0A 3GXUA 4JV4A 1JZ4A 1S0EA 2P3YA 2ILMA 3NJYA 1C57A 1PNFA 2XOMA 3BODA 4R52A 2FZ2A 5AC91 3MW2A 1GZWA 1O4ZA 2CAVA 2PAMA 1AZDA 5T3NA 1JHNA 1HDKA 1PX3A 3N9PA 3VBFB 3WHUA 4UFJA 3IMNA 3BTYA 5FOBB 1DG6A 3WV6A 1BK0A 3I8TA 4AK3A 2EXIA 3OYWB 2Y38A 3WR0A 2HH9A 2ARBA 4QX8A 1U12A 1XNKA 3ZYPA 3OD0A 2RS12 5FYMA 1S4CA 1ZBE2 5GALA 1JYXA 5LZ6A 3LCPA 2E7QA 1RGSA 4Q27A 4YM1A 1IS6A 3U78A 1MS9A 1DBNA 1S0FA 2XLGA 3DYMA 3FHQA 3K4DA 4Q4Y1 1UZZA 1MQTC 4G9SB 4XF3A 5EYXA 4L2NA 4CU7A 2VQTA 1YQ8A 3APBA 2BZDA 2WWSA 3ON7A 3MIFA 4N53A 4GWNA 5FKCA 1POV0 4U36A 2ZGUA 3M3EA 3O1UA 2HBUA 4A45A 4DS0A 3BU0A 2ZZJA 1BEV3 2Y6FA 4L92A 2VCAA 4HVQA 2I07B 5C4WA 2ZHNA 1EUUA 5FJHA 1C8M3 1DGLA 4Q0SA 1H1MA 4YW6A 2BV4A 1WBFA 1VBE1 4LIVA 1DHKB 1B35B 1W9WA 1JN2P 4D69A 3I49A 4IEPA 3RNSA 4IV1A 2VVFA 4Q0QA 3VBUA 1OOPA 5E8AA 2FHRA 4Q4W3 1FPN3 3GZUC 3SLIA 2JJ6A 4RHV3 1NZCA 4FQZA 2WZR1 1A6CA 3WNKA 1O5UA 2RS51 1ULCA 4JGZC 5JWPA 4NUBA 1QOOA 1RUNA 3HQRA 1EAH2 1NLRA 1Q8SA 2JG9B 5ABJB 1YYNA 3OCPA 4JKLA 2X5IB 4HANA 2P1BA 1JYTA 3TN92 3N9NA 2R063 4YVSB 2ZX1A 2B7YA 1YFXA 1W05A 2OT7A 3AKRA 3PUQA 5FYIA 3SISA 1ZZ9A 1J3QA 4OQ8A 1W3XA 4WM7A 3VBOB 2BJSA 2JB4A 3NV4A 5F5AA 5C8CA 4N9IA 4XIOA 2X05A 1UQXA 1IS4A 1IZ3A 1K5JA 4I30A 4XABA 1WWYA 4BA6A 4DB5A 3OF1A 4LKDA 1PMHX 2MHFA 5CZKA 4HFSA 3BPZA 3ZYGA 5AC92 5BNOA 5ISLA 1T6BX 2WFF3 1SZBA 4B3NA 4Z2WA 3MW4A 1BVVA 5DXDA 1DYKA 4JVAA 1H4GA 3T0BA 3H3LA 1TQ5A 3O7OA 4JGYB 4S2DA 3I7DA 3DF0A 4CP9A 5C33A 5F5IA 2FDKA 1PGL1 3I2OA 1LEDA 4XXPA 2D7FA 3IN9A 1KXGA 3U07A 4BU2A 1S0JA 3HAGA 2VTXJ 2D6KA 3KGLA 4JHZA 4PT6A 4XETA 3VB9A 4YVWA 4XHBA 3C8XA 2BEOA 4JKKA 2EIEA 3ZR6A 2HWC1 1OF4A 4IL7A 4Q4Y2 3CHXA 4PIXA 4Y22B 3AVSA 3FHIB 3SEPA 4OZXA 4DRRA 2NLRA 1RVF3 1G7YA 4NHYA 1OPOA 3O1MA 3LFMA 1HW5A 1PIV3 4D94A 4H7MA 4Q8LA 1YQ6A 1QHDA 5FOJB 2J1EA 3QOPA 1JBCA 3BYWA 1AR91 5J36A 4UFKA 2WO1A 5DN2A 2B5HA 5FY0A 4D6QA 5DG1A 1ACCA 1PZ8A 1ZRIA 3QBQA 4IE0A 1ODMA 1GNZA 1IKQA 3VBFA 2SBAA 3UKTA 5CISA 2ZBJA 5FY8A 4XW3A 4XZUG 2JEMA 4AEDC 1VBE2 2W9XA 2FQPA 3H7YA 2UY8A 4J6GA 1QJU1 2VTXA 5BNNA 3E5QA 5F6LB 3OYWA 1H6YA 2R071 2VBDA 4COWA 2NMOA 1KITA 3T2PA 2BWCA 4FPOB 4C1WA 1UZWA 2P34A 3A0KA 4CEWC 2WZR2 2GP3A 5JSRA 5J37A 2RS52 1XSRA 2CL2A 4XDOA 1HXS1 3FBMA 3IAQA 3PUSA 1VBD3 1RUE1 3WOGA 3WW4A 4KWLA 3ZVXA 3I2GA 4PBOA 4HKLA 5DUXA 4FQ4A 4IDZA 4NROA 3K75B 5FZ6A 3VZMA 3IKWA 4RGKA 3C7EA 1WCDJ 3I2JA 2VNVA 1AYM3 2RMU3 4PLNA 4WBBA 5C3RA 5KWRA 3WNPA 2JICA 3Q8FA 1CVNA 4QPGB 3ZFEB 3ACIA 5BYNA 5F1RA 4LBOA 3ZFGC 4GH4B 1L3JA 2ADEA 1GOGA 4ZPIA 3JB8A 1ZZBA 1ZRDA 5FJKA 1DCSA 5JXGA 1G6NA 2BTVC 3AZYA 2WJSA 4IEOA 1B35A 3ZN6B 3U0ZA 2JDZA 1WZXA 2FCVA 1H9PA 2DU0A 1PGL2 1OUSA 2YGLA 2O14A 4LTAA 4AAXA 3OPZA 2PXJA 1RJ7A 2KR2A 2VW0A 3B93A 1LOCA 4CPBA 5C5TA 3EBRA 3LEGA 4O61A 3SH5A 4R9CA 1F4HA 1MZFA 5DQ0A 4A44A 1AL23 3VDCA 3ZN5A 2Q4SA 3J8F3 1RUF1 4N9HA 5IYYA 1ALYA 5T55A 3MIEA 2ZGKA 1OD3A 3SH3A 3N7LA 1ENRA 2OXBA 4CE8A 5GLWA 1D2QA 4RYDA 3D8CA 2HWC2 2JG9A 3J7NA 3PURA 4QX1A 4DO0A 5ABJA 4RA0A 2FZ1A 4YG6A 4YW4A 2X5IA 3ENRA 1O6UA 3GBFA 4AVBA 1JZ7A 3WG1A 4YVSA 4LULA 1VP6A 3TRSB 3ZXLA 3VBOA 2VMIA 4NMIA 1UF2C 5JI9A 3LA7A 1HIXA 5DDJ3 1AR92 4EROA 3MO4A 2H6CA 2W46A 2XONA 3I3BA 3LIHA 3MV01 4FFIA 4X6RB 1ULDA 3URFA 1QWRA 4W6WA 4BE3A 5HI0A 2Y6LA 4DNYA 1R1A1 1YFWA 3ASIA 3WNXA 4LITA 1AR83 1KGYA 5H9RA 1QJU2 4M3CE 1GANA 4LXLA 5C3OA 3EXUA 2P17A 3FLPA 4KG0A 2R072 3ZFFB 1QJEA 3OGJA 5J48A 2VNOA 2BNMA 4L9BA 1W6PB 2L9LA 1O91A 2W1QA 3OGGA 4QDSA 5JXIA 5FBZA 1N1VA 1H8TC 3POFA 4LORA 4NPRA 1HXS2 1W8UA 2BGCA 1JZ3A 2ZKNA 2WA4A 1UXXX 4UBGA 4ORFA 1UN1A 1RUE2 5JXJA 1RYYA 2RR13 4N90A 2D44A 4S2HA 4Y22A 5LB6A 3WD5A 1K42A 1LU1A 1OD5A 1ZYBA 3IDEA 1S0CA 3DECA 3E6BA 3JQWA 4IGPA 3TEYA 1V9U1 2EIBA 1H2LA 1WD4A 5IATA 2WN2A 3K4AA 5ANQA 3NJZA 1J1LA 1PK6C 4XFFA 1QXRA 2QQOA 2PAEA 4YARA 1VMHA 4M01A 3POSA 3LGRA 5C70A 1IOAA 4AVCA 1GP4A 3ZN4A 4ZZ5A 4YM3A 2W08A 4FI9A 4Q29A 2W2IA 3A22A 2G4IA 5F39A 5FY1A 3OPWA 1RC6A 4KGQA 2XH6A 3KB5A 3ZXAC 1VBC1 2ORXA 5FZ0A 1CD3G 3AKSA 4CEYC 4IXLA 1GP5A 1OH4A 2YYOA 4HK8A 2YBSA 2RDQA 3J26N 4BXFA 1RUF2 3HNBM 4E8CA 1O3SA 1HN1A 1SFYA 4QXBA 3CJIB 2XR4A 4R9DA 1EPWA 5L19A 1IPKA 3H1MA 3VBSC 3JB4C 5LA1A 4AFCA 4BWOA 3ETQA 1LHWA 2DTWA 1REDA 1WLDA 1K3IA 3VDDB 3CDZB 4YM0A 3QCWA 2QQWA 4C0BA 3ZXEA 1VJ2A 4UW4A 2QDNA 1JI6A 3RZKA 1V6JA 5E16A 2PQQA 3ZFEA 4QPGA 3P1IA 4A6OA 3DXTA 1YC61 1BYHA 4Y1ZA 4GH4A 4KU8A 1CESA 4GWIA 5JVVA 2JENA 4I2OA 5A6YA 4UFIA 4QMAA 1MZ5A 3MW3A 1R1A2 2GC3A 5E6HA 4GMP3 1SBEA 3ZN6A 1GZ9A 1OQDA 1OLQA 4XUQA 4IEWA 2Y6GA 4LHSA 1W0OA 4RGAA 1Q8VA 3E97A 4OYUA 4DY5A 3ELNA 3CMGA 4UT5A 5FP8A 4EYUA 1UIKA 3ZKUA 5ACA1 1ULEA 2JDYA 2QTWB 3AX4A 5T5PA 1BHGA 5FYYA 3TAYA 1RJ8A 1WCKA 3JD71 4KH9A 4L97A 5T54A 5LRSA 2AC1A 4O9GA 4QHBA 4EJRA 5DZGA 5FZGA 5FPBA 2IXHA 1O7FA 4S2GA 2DURA 5DPNA 3K48A 4GAZA 4L11A 1QOSA 5F6KA 1QU0A 2GMMA 2P3IA 3POEA 1YI7A 1V9U2 3ALQA 2A6WA 3OUIA 1SCSA 2PHUA 4PF1A 4V1PA 5DMYA 3NSTA 3AZWA 2VZVA 2WFPA 4LK6A 4Z07A 3WEZA 1C4RA 3OBRA 4W50A 4ZZ8A 3SCHA 1XNAA 4CUAA 3THDA 1V00A 3U4XA 3R4UA 5F9TA 4JKMA 2H0BA 3FJSA 1W2UA 5FY7A 1HJGA 1RUOA 1QQP1 1H1IA 2MPFA 4BCUA 5K7PA 1JXNA 4YFWA 1C1LA 2FCUA 3DL3A 5FZFA 1DQ6A 1VBC2 3ZFFA 1A34A 3LOBA 5FZCA 3WNOA 1X8EA 2Z79A 1W6PA 3BU7A 1CX4A 4O9EA 1UYZA 1D0GA 4TSVA 3UYJA 1W2OA 4FPYA 1IS5A 2PQSA 3GHNA 3KF5A 1MS3A 5I91A 1ASJ3 3PUIA 2TNFA 2BPA2 2DCYA 3CO2A 4R4XA 1FOD3 1OUXA 2UU8A 1DDLA 1RUD3 4HVOA 4XAEA 2ZABA 2RVAA 4N53C 5F2WA 1CAXB 1MEC1 4GULA 2HWE3 3GNEA 1N3PA 4HT1T 1T6GC 4D3WA 1X50A 4CCNA 1E5IA 2TUNA 3ZYHA 5CA6A 3LAGA 3MZHA 3QLQA 1M06G 3KV6A 1BK1A 1V6OA 4HLTA 3I59B 2VZPA 4LBKA 4AHYA 5C4WC 4XHXA 2J22A 3B3QE 3C7FA 3MIHA 5FIXA 5JOWA 2VNGA 3PTRB 2E31A 4DMIA 3VHRA 5JCTA 5GLTA 3HBKA 2FCTA 1WLCA 1KDMA 4IV1C 2VBBA 3T4VA 3VBUC 3WINE 1D4M3 5IK5A 2OPWA 1IGOA 1UZVA 2O8QA 2Q0AA 3T2OA 1WCQA 1PO11 1YIFA 2JECA 1UPSA 5A1LA 1Q8OA 1O5LA 3LZZA 3TWIA 4CCMA 1UNBA 4EN9B 4MGSA 5ACA2 3NJVA 1U5ZA 3KF3A 3C7OA 1SPPB 3A4UA 4MUVA 3JD72 1BMV1 4D7TA 2Y26A 3CJIA 1QJX3 4B29A 5LEKA 3NAPB 1CPMA 4FXKB 3CZUA 1FAYA 3IBMA 3W9AA 1G8WA 4TLFA 3LF7A 4WM7C 5I8SA 4Q4V3 5C8CC 4LBJA 3RG0A 5KHGA 4J1WA 3VDDA 1NYWA 2MNGA 3I2HA 1TZOA 2FD8A 4I09A 3ACLA 3M70A 2PFWA 1P8JA 4GJZA 2A3WA 5L9VA 3B9CA 4BDVB 5BNOC 2VUAA 1MS1A 5IAVA 4KWUA 2K2SA 3ILNA 4ATEA 2YZ4A 3D5OA 1SHWB 1E5RA 1POV3 1UL9A 3SKJE 2G19A 1W90A 1XNTA 4XJAA 4QHOA 1DQ1A 1HRI3 2IVJA 2VCCA 2HYKA 3ZYRA 3AZVA 4QGNA 3I2KA 4AE2A 3WQ7A 1RMU1 2BU9A 1LB2A 4OUMA 2JX9A 3DKWA 1JYWA 1GWMA 1AYN3 1QQP2 4FPJA 4I02A 2LUWA 2CYFA 1ZZ6A 2RR11 1O3QA 2XJUA 3H1WA 4RQPB 4YVWC 1L7LA 3C3VA 3VD3A 1W8OA 4XJUA 1TE1B 1GZWB 2WKKA 4HETA 1KJLA 4NRQA 1HB1A 2R041 4W6XA 1UD1A 5AVPA 5FZKA 3ZLIA 4XVHA 2ZZQA 3GZTB 3SEEA 4BPZA 1JYNA 1RUJ1 2B9VA 1ZA7A 3EHKA 1MEC2 2CDOA 5DAPA 2LALA 2WSUA 1LEMA 4XTPA 4AGVA 1SEFA 4AZZA 1W8ZA 2LW8A 3KQRA 1IG3A 1UMHA 1PO23 3VBFC 2Z4FA 5KC6A 3I2DA 2PELA 4LLOA 5F37A 2OS2A 3IPVB 1LKNA 3RRDA 3WW3A 2Z2SB 4Q2FA 4DUWA 4MG2A 5FZ3A 3OBZA 5FDBA 4DIQA 4M3CF 3I4IA 2BQPA 2ZGMA 2J1TA 5FZ1A 3VLBB 5BNNC 4TZDA 2AH2A 4ATFA 2E9QA 5J1XA 1G9DA 2W87A 4OMDA 3OGRA 1IQAA 2DV9A 2NM1A 1WCUA 1HX6A 4OULA 1QDCA 1PO12 3CF6E 4NHLA 4A2UA 1F4AA 5LBEA 2ZJCA 5C4WB 3KCCA 1UKRA 1KS4A 4CDUB 3NNLA 4NIDA 4UI9L 4GD4A 5GLUA 1BMV2 2PHXA 3VHNA 2VCBA 5LASA 4JRAA 4XMAA 1DZRA 5SV8A 1CZVA 2BFUS 2WO3A 5D2AA 1CAXA 3IIAA 1DZTA 5FUPA 5FUNA 2DVBA 2WT1A 3PVEA 4CSWA 2D6LX 4W8JA 4NHXA 2ADDA 2VCMA 1RXFA 3WNLA 5CADA 3I59A 4AFMA 2QNKA 3SCGA 1Q3EA 4QX0A 3N9MA 3K46A 4QM9A 5GZCA 3LIGA 5I0SA 2DVGA 1WW4A 3O12A 3CL1A 3PVOA 2X29A 4QX3A 4Q4X1 2YC0A 1YCIA 3RMXA 5L7OB 1RMU2 3GCWA 3I97A 2VMCA 4C0HA 3NKTA 1LR5A 4D7SA 2JE7A 4QXHA 1V6NA 3A0NA 2JKBA 2KD7A 1BXHA 5DABA 2RR12 4XJ8A 4TXWA 4A3XA 4GB31 4OQ9A 3WF2A 4ZHNA 1NX9A 5FZDA 2JDAA 3NJXA 4CDXB 3KV4A 1UY0A 2XKPA 3LKJA 2JG9C 1SPPA 5BNOB 3BUCA 5ABJC 4FVVA 3LA2A 4E8DA 2X5IC 4LIUA 1VRH1 1GOHA 1HQLA 2R042 5TSWA 4Z2AA 3NAPA 2PHDA 3D0SA 4YVSC 3U4SA 1RUJ2 2VPVA 4MLOA 1R093 3J7LA 3MGUA 1ZNPA 4Z1VA 3VBOC 2MEV3 4BXSV 2EALA 5GM0A 4BHPA 1AX1A 3AKPA 3KVAA 4DUVA 1ZBA1 4YGCA 4DXZA 5KHKA 3CLPA 5FTTC 1CR7A 1W28A 2XWJB 5F3IA 4D6RA 3HT1A 3RPQA 1Q5OA 2DBIA 4LBNA 2WZ8A 4QB6A 5DZFA 2G9FA 3UETA 4HBNA 4OHYA 4QD2A 4L0PA 1UMZA 3U14A 2WYFA 4AQ6A 3AK0A 3KT1A 5CFCB 2QDRA 3TB0A 3JBG1 4LHNA 4DQAA 5IVVA 5A6XA 4D8MA 2IXKA 2OZ6A 5FZMA 2RE9A 1CAUB 5M0TA 4MX3A 3V64A 1AXKA 4FFHA 1HV0A 4RQPA 2WS93 5FYHA 4GALA 3MBWA 4ISRA 4NHMA 4OI2A 2DCTA 4OUSA 4MSVA 1VPHA 2PHRA 4FXGB 5EQUA 1XQNA 4XDQA 2F17A 2NZ9A 2D5HA 4MGTA 1YEWA 1Y9GA 5FP9A 4J25A 2VZSA 4WV8A 4N8MA 5BNNB 5A3PA 4UW5A 2PLV3 3AJYA 4XPVA 2HWF1 3GCXA 3SXWA 2R32A 2WQ4A 3OJBA 1GSLA 4Y5TA 2RS31 3VDBA 2J1SA 4UW3A 3A21A 2FDFA 1RUI1 2X10A 1R081 4FPHA 2E63A 3WVJA 4P02B 1HQNA 2VUCA 5JIAA 1XJAA 3IPVA 4MGKE 4NRPA 2J42A 2Y6KA 1QJZA 4BISA 1GQGA 4LUKA 4K8FA 4HXCA 1OSGA 1KFUL 1SFNA 1GQPA 1CJDA 1XSQA 3AMQA 3E5XA 2Z42A 3FWEA 4OHWA 1QJY3 4OZOA 3CEWA 4QKNA 5FYBA 4Q4X2 4FT8A 4CU6A 3M3IA 4DUXA 1CAWB 3LWCA 4EQVA 3QH7A 4IETA 1QXPA 1COV3 2ZX3A 2BBAA 1UOGA 3S6PA 1BBT1 1JOJA 5K9YA 3TEXA 4TYSA 3CNAA 4Y20B 4GB32 4CXWA 3AMNA 4CCKA 2A73B 4UF0B 2OKXA 2ZEWA 3ECQA 4BIOA 4CDUA 4IEYA 4HOOA 4COYA 4RSUA 4J1XA 5I8YA 1DU3D 1VRH2 1Y43B 2YGMA 2YV8A 1VBA1 2QBXA 2ZXQA 1W0NA 2D40A 1EV11 1V70A 1XNDA 1XNCA 2YY1A 1X7NA 3LEIA 3M3QA 4GJYA 4IW3A 5DG2A 5BV6A 4FOQA 4BQ2A 2ZCWA 1GUIA 2I74A 4BQYA 3MPPG 4KG8A 1ZBA2 4AHZA 1UYPA 5CVRA 5JSPA 3ZFEC 4QPGC 4NIAA 4GH4C 1CZTA 2KA3A 4JAAA 1W6QB 2YFUA 3WUDA 2F4PA 2H0VA 2UYBA 5FZAA 1DQ4A 4K7JA 4MOAA 5FZIA 2XVKA 2PA7A 1WCSA 3V0AB 1SBDA 1Q56A 2GP5A 2C9AA 1CX1A 3H0OA 5FPVA 1O59A 4CEYA 2EAAA 4CRQA 2ZEYA 3JBG2 1ZREA 3OSDA 4XEZA 4CUGA 5L7OA 3FLTA 1GZTA 3KT4A 1WKYA 4C1XA 3CJXA 1OKOA 3WZ1A 1RUG3 1NQDA 2X09A 3MYXA 3FMGA 1J58A 2EXHA 1W9SA 3H50A 2WT0A 3HR9A 4PLOA 2Y6JA 1QF3A 4HK9A 1HRV3 1OA4A 3M2MA 2XJVA 3M4FA 4KNCA 4LBLA 3SHRA 5H9QA 4CDXA 3B5LB 4BK4A 2KXLA 3I3EA 5JZGB 4Y1XA 2XVGA 5I0UA 3TNPB 3U75A 4QKDA 1U0AA 2XBO3 3ZXGA 4ASLA 4EWAA 4XXAA 5E1RA 1TME3 2CNAA 2PN5A 4QDQA 5FPZA 5IW0A 2ZTNA 1HB4A 1K12A 1XBFA 4OHXA 4B8EA 4B1MA 5GZDA 2VMFA 3EQEA 4R9BA 3EYPA 3I3DA 4XFBA 1W6MB 2XPJA 2HWF2 5C5UA 1JZ8A 1JMUB 3POGA 4BQ5A 1ND2B 1GBGA 2RS32 1QXJA 1RUI2 3B94A 3OBTA 1R082 2E51A 3BALA 2W5FA 2IXIA 4LOSA 1S2BA 5FQ0B 3CIHA 3I3QA 4BQ3A 1JZ6A 1ST8A 4PI0A 5CFCA 1OKQA 2XVLA 2PTMA 3ZFFC 2BVVA 2ZX4A 4WVVA 3THTA 1CAUA 4XFIA 5IWFA 1GMMA 3GZAA 1BBT2 1VMFA 5GZGA 2NPIA 4Y1YA 3ILRA 3ZSEA 1JUIA 2VY0A 5FY5A 4AQTA 4G4FA 3OTFA 5EHDA 2BGPA 4AG4A 1LRHA 2JE9A 4BIFA 3AP4A 4PDWA 4PIZA 1REEA 3T08A 4XCBA 5FXXA 3T4HB 1ZM1A 3W58A 1I9RA 1VBA2 3E5UA 1NZIA 4COVA 1EV12 3MF6A 4DEQA 5JMCA 5DUWA 5A3TA 4AVVA 1BCXA 1YHFA 3H9AA 2GMEA 4CDQB 1D4VB 2PHLA 4KI5M 3B02A 4MVTA 3RYPA 1W9TA 3AM2A 3K51A 3POBA 2IZWA 2ZAAA 2HJIA 3JQXA 3MIGA 4A4AA 3K4ZA 1PZ7A 1KFXL 1ULFA 1YNAA 4P9LA 1XYPA 5FO9B 3ACHA 1S2EA 1A8DA 4KBZA 1XC6A 3PU8A 2JB8A 3O14A 2D6MA 4FOYA 5FKBA 3WF4A 2BERA 4DEVA 2OQ7A 1W3VA 3NO8A 2C0ZA 4XYXA 2Q5TA 1TVGA 1CAWA 2YU1A 3HQUA 1GU3A 3FN9A 3MLKA 5DUUA 2Q8OA 3TOJA 4BYYA 1UYXA 1ZA4A 2C26A 2IC1A 5LK7B 2VOVA 5FWJA 4NE9A 1C5IA 3ZM8A 4Y20A 1A8MA 3CJIC 1GOFA 3JU9A 4HSLA 4UF0A 3O0XA 4XJWA 1PM7A 1RUC1 2Y8KA 5LWBA 2HEVF 1I3HA 1VB2A 4QPWA 2GNBA 1JW6A 1DP0A 1HLCA 4FP3A 4ES8A 4FAGA 1E5HA 4KU7A 5HCAA 1XE8A 2EIDA 5J09A 3VDDC 1IG0A 4XJ9A 5FZLA 5A7QA 4BQXA 5A6ZA 1W0PA 2AEYA 1PVC1 2QZ3A 2XL7A 4RD7A 4M3CB 1S0DA 2R49A 4LBQD 1E5SA 1W6NB 1VIWB 5T5OA 1SFPA 2W47A 1FMD1 3DYOA 2X8KA 1W6QA 1W8NA 1SDDB 1LOGA 2D93A 4META 4ISQA 3AYDA 1AR71 3D0JA 3G7DA 3LDKA 3S7EA 2XJQA 4Y1UA 4DOUA 3V0AA 4XILA 2WRAA 1S55A 3VD4A 4QQPA 5H9SA 3ZSJA 3KD4A 4XOGA 4LKFA 5K0UB 2ZGNA 3ME2A 1A78A 4LEJA 5C8WA 1ZZ7A 3HQXA 5CKQA 2DUQA 4Z92B 4Y24A 5EJZB 3VDAA 1NE4A 4HG6B 1F2NA 2BNNA 4P5YA 1PGW1 4LT5A 3V65A 1RITA 4XQ4A 2HWD3 3UL2A 2E6VA 1UAIA 3P5BA 3LFIA 4CP2A 5JZGA 3H3ZA 5I0DA 3VHOA 3GBWA 2AENA 5I93A 1IKPA 3THCA 3FX3A 4NRMA 3RMYA 1F15A 2IXLA 2C6SA 4K6BA 3H8UA 4BK5A 3OGVA 4FFGA 4AI8A 3RZJA 1OA3A 2JDMA 2FBEA 2Q1ZB 1AJKA 1W8FA 4DRVA 2WN3A 5IUQA 5JLVA 1W6MA 5A32B 1WMFA 4OMCA 1ND2A 4XDPA 1DFQA 4LK7A 2GNTA 5D21A 1K5MA 2HWB3 1VE0A 1OLME 4IE4A 4NAOA 4R8HA 2BRTA 1JZ5A 5FZ9A 1N3QA 1FATA 2AR6A 1DYPA 3UV9A 4D7YA 1L7QA 3JCIA 2P3JA 3ZSKA 5FQ0A 1PM4A 4XFCA 4Q8KA 3WDTA 4EN6B 2K9ZA 4XUOA 1BEV1 4QB2A 3WQBA 5LATA 3GJAA 2P3KA 5FMOL 3AKQA 1F35A 4K40A 4F7ZA 3BKZA 1C8M1 1R64A 2XJPA 1Y9QA 2RDNA 3W20A 5FYSA 3WDXA 3T0AA 2QKDA 2YBKA 1LNSA 5LBBA 3KQ4B 1XNBA 2VJXA 1SLBA 3PTYA 2EAKA 2VVEA 3C7HA 2BW8A 4Q4W1 1FPN1 1LOBA 1RUC2 5LW9A 1SLAA 1XPWA 4RN5A 4RHV1 5LRRA 2YXSA 1W06A 2R1BA 2JD4A 4CCLA 4F8AA 5JIUA 4MXVA 2WUHA 4LJHA 1SBFA 4MHRA 3CZJA 1SQ4A 5EFUA 2EVXA 4NPLA 3LPGA 1X36A 2WINB 2BBVA 3QD6A 1PVC2 1S0GA 4CDQA 4HVRA 5FYTA 5DAWA 4UW6A 5FP4A 1CWPA 2WL1A 1X8MA 3HNYM 3PJYA 2R061 1FMD2 5L9RA 2WZPP 3I3MA 1JU4A 3ZDSA 5T5LA 4PCRA 1AR72 3BIEA 4I3PA 2A70A 1Q8PA 3C2UA 2JKXA 2ZOEB 2FDJA 4CCDA 4CTEA 3NKGA 4Y26A 3SCFA 2RM23 1KEXA 1H2NA 1ND3A 1O8SA 5EJ1B 4Q26A 1LOFA 4MGQA 5GKAC 2WFF1 1VBB3 1XYOA 5KHHA 4N43C 4K1YA 3WSOA 4CUBA 3LD8A 5EXOA 1RUH3 5JUVA 3MFCA 1PGW2 1Z7S3 3GF6A 3GJBA 4YZ1A 2JDHA 4OUEA 4PIYA 1RHI3 1QGLA 1W9YA 2W39A 5J3UA 4CCCA 2V09A 5FUIA 2GC0A 1NXMA 3CQOA 3NAPC 3BTXA 2EIGA 5JPNB 1JOPA 1QJFA 4R4ZA 1GYKA 1UU5A 1X9TA 5FYUA 2ZPXA 1TMF3 2ZGRA 2Q30A 3UNPA 2W1SA 2R0FA 1KJRA 1Z78A 3PJQA 4HPKB 4KL1A 3E6CC 1FI2A 4SLIA 2ET1A 4M3CA 2JIGA 4E4ZA 1W6NA 2N7GA 3MICA 4YG0A 2FMYA 1RVF1 3VBRB 2HEWF 1PIV1 2XMLA 3W21A 1I6XA 4E4HA 1NAEA 3HOBA 3BCWA 1W2AX 3AFKA 1J83A 3S0MA 1ZBE3 1MVQA 2Y60A 1BEV2 4YG3A 1DIWA 2QVSB 4E27A 1L7RA 4RFT0 2A7AA 1C8M2 2WAOA 5T5JA 5DAXA 4CZSA 4KMQA 4RQPC 1BLZA 4AHWA 1W2TA 3RYRA 4RFRB 1M4WA 2D97A 5AVAA 5FV3A 4OI4A 5FY4A 1STMA 3JUUA 2AYHA 3ZYIB 3RQ0A 4Q4W2 1FPN2 1KQRA 2QQIA 4XFGA 1SMVA 1WD3A 2Q1MA 1EUTA 4QPYA 5IVEA 3IWZA 4RHV2 2WZEA 2ZMNA 3IB3A 1ZZCA 1MS0A 4JQRA 4KWJA 1LGCA 4XQWA 2OA2A 4CPBD 1VBD1 1VRBA 4K9SA 5A32A 4EWEA 5BPXA 3LQCA 4ES9A 2QUOA 1VB4A 4AFBA 3WNMA 2R062 2XL9A 4YZ4A 1YJLA 4DPNA 4V2VA 2WWUA 2XWBB 4IQPA 3SMHA 5C3PA 3L2HA 1AYM1 2PAKA 2RJLA 2RMU1 4FPKA 2GN7A 2XDVA 2P5BA 1LGBA 2VMEA 2YUEA 4LO6B 3N3HA 4Y4YA 5IFPA 2A6YA 1F5JA 2AGSA 4E2SA 4LQRA 2WFF2 5HXVA 1DQ2A 1EAH3 3SC7X 3B69A 1QNWA 2HBTA 1GWKA 3GHMA 1LHNA 4CDUC 3X29B 1QH6A 4QU1A 2ET7A 2K46A 2ZS6B 3TN93 4BQ1A 2K0GA 2B45X 1LHUA 2BUKA 4FTEA 1GR3A 1H2KA 4MYEA 5FMDA 3M3CA 4XC9A 5C7GA 1W8WA
chains in the Genus database with same CATH topology
3R0RA 3FC0A 1AL21 3J8F1 1AHSA 3DN7A 3R4DB 1YFUA 2ZHLA 1ZZ8A 5AC93 5JAXA 4OFGA 2WNUB 1LULA 3EJKA 4N7UA 1G9AA 1LU2A 1V6KA 4QQLA 2ZACA 4BZ4A 4N43B 2B9UA 2BNOA 2DCZA 1RVF2 3R6SA 1PIV2 1W6OB 3MF9A 4XFAA 1IS3A 1RTVA 5DDJ1 1H9WA 2VVDA 4COUA 5L7OC 3G6JB 4P9IA 2I45A 4YSFA 2PYTA 2XLAA 3ES4A 3PLQA 4BLIA 3VZJA 4QGLA 3ZIWA 4YZ5A 3RZZA 1WLWA 1AR81 4Q4Y3 4CDXC 4NO4A 2UWBA 1YRZA 4NWWA 2R6QA 1LCLA 4BLJA 3WDUA 1DGRA 1N1SA 2Y0IA 3FFZA 4CP0A 5A33B 2AREA 3W59A 2A5ZA 2NP0A 3ZIXA 4XBLA 4G3YC 5T52A 4UXAA 1ENSA 2CGNA 4HPKA 1MZEA 1O4TA 1VBD2 3MLJA 3KM5A 1QH7A 2IWGB 2LM3A 4BCUA 1PGSA 4FP2A 1NA1B 1X33A 3BTAA 4B7KA 1VBE3 2YPJA 3LB9A 4IV3B 3VBRA 4LBMA 5B2GB 2ZKLA 5CFDB 4Z8BA 5CFCC 4XJZA 1AYM2 5GLVA 2RMU2 2EXJA 4RS5B 2ZHKA 2D5FA 2YROA 5FCCA 2AZ5A 2WZR3 1EP0A 1G9FA 2RS53 4LR4A 4XF1A 1V6MA 3E6DA 2WLQA 4PDWC 3N7KA 4F3JA 1KDKA 2VNRA 4AI3A 2LTNA 2C5DA 3HMYA 5K8SA 1DZQA 1MS4A 1OLRA 2GN3A 2HKXA 1TEIA 5D8AB 4RR3B 1AL22 3J8F2 4KWKA 1CAVB 2VOXA 1FXZA 1MACA 4P9XA 4YGBA 4XF0A 4FPCA 2VH9A 1OFSA 4Q0PA 3KT7A 3BOPA 3ZPYA 4NN0A 5A3LA 2E7AA 5FFOC 3AYAA 5DDJ2 1G9CA 2I2SA 4MXWA 3VL8A 5FAXA 3DPRB 1SACA 2ZX2A 3AXEA 1OI6A 1BQPA 1NY71 4Y1VA 5FRAA 2HWC3 1AR82 1N47A 4GMP1 1HV1A 1YXWA 1HQWA 5D1IA 2WT2A 3PVBB 5J98B 2DYCA 4WVWA 4XE9A 4K21A 4XQDA 2GMPA 1DLLA 1AR93 2AUYA 2GH2A 5EWSA 4GKXA 3VBHB 5BNPB 2WNUA 4K20A 4C91A 2BVBA 5CB7A 4FOWA 4N43A 2TEPA 3WP4A 3VZLA 4LNVA 1NOVA 1QJU3 1GV9A 1I5ZA 1W6OA 1J3PA 1OA2A 3HIFA 1OQ1A 4HKLA 4K3UA 4LBQD 4C90A 2QFEA 2R073 1PHMA 1YLLA 3GYDA 3PHMA 4WZCA 3NL1A 3IDCB 3AFGA 4E4SA 1C5HA 3BB6A 1UKGA 1RINA 4FTSA 1HXS3 3MPBA 2B42B 3KS7A 3PMEA 3USSA 1S2KA 1XU2A 1RUE3 3MDPA 5HBAA 5FO7B 3D82A 5JZGC 4RGGA 5FLJA 1NG0A 3NW4A 2C1FA 1LGNA 2P2KA 4FSJA 3B00A 5A33A 1F9KA 3UK9A 4EWDA 4YGDA 1O3RA 2X53S 4A7KA 3MLLA 3ES1A 5GZFA 4Q0UA 4EN7B 1ASJ1 3MFAA 3ATGA 5FLHA 1XYNA 4BOWA 1ND2C 1FOD1 2Z69A 4HKWA 1AXZA 3J9SA 1K5MC 1RUD1 3UJOA 3WDYA 1NA1A 4L99A 1VAVA 1NCQB 1IHMA 2HWE1 4IV3A 2CTVA 3AZZA 3HWJA 4MGZE 4PDWB 4Q1RA 2VQ0A 5CFDA 1Y3TA 3THPA 4W65A 1AF9A 1JYCA 4RS5A 4GWMA 4SBVA 1RUF3 1MR5A 3WP5A 3H1YA 3V0BB 1UZYA 4ZXKA 1NY72 2B8MA 3SITA 2QZ2A 2VOKA 4XIKA 4NR1A 1D4M1 3CU7A 3ZXDA 3IM0A 2A71A 2SLIA 3GALA 3PVNA 3KZ4C 5KXCA 3VGIA 3TNQA 5D8AA 4RR3A 2V5YA 2ZMLA 5GZEA 2OW4A 4CP1A 2XLFA 1CAVA 4CDQC 4FAHA 1A3KA 2CWSA 1QJX1 4Q0VA 4XZPA 1YJKA 2P37A 4MGYE 1R1A3 1N3OA 2OVUA 1QY4A 4URTA 5CNAA 3ZXJA 4I0WB 4Q4V1 3ZX7A 4FPEA 5AFEA 5F5QA 1UW8A 2NMNA 3DUIA 5KXEA 1VR3A 3OD4A 3T1LA 1ND3C 1AX0A 1LOFC 3AXDA 1OFNA 4FPFA 3DPRA 1BZWA 1PMIA 2EXKA 4EN0A 1POV1 1QNYA 2XG3A 3KCXA 2UURA 3MIDA 1HRI1 3RI9A 2A6XA 3POYA 4M0NA 1RB8G 1ONAA 1UU4A 5I0TA 3VZKA 1GZCA 5KHIA 5C9AB 1SLLA 1AYN1 1FV2A 3VUOA 4QQHA 3POWA 2B39A 4YRDA 5JDBA 1V9U3 1NCRB 1OQEA 2A6ZA 2IXJA 4JTOA 4I3GA 3RYKA 2GALA 3RJ2X 3N7JA 4QGMA 3ST7A 3WW2A 2DCKA 5C6CA 4E2GA 4XF4A 3M1HA 3WW1A 1ASJ2 2GSYA 2ZGPA 1FOD2 3S30A 5IT6A 3VBHA 5BNPA 2HEYF 1RUD2 1W39A 2HWE2 4M0HA 4WM8B 2W52A 1GFF2 3RS6A 2RJKA 5FMOS 2GZWA 5FO8B 3T2TA 1VBC3 4BH9A 1LECA 1J59A 1PO21 4LHKA 3WCSA 1YFYA 2ES3A 4I0BA 2FMDA 2YHJA 2JG8B 3ZMNA 1NLSA 3B01A 3R4SA 4I0AA 1EPZA 1C8NA 2BFUL 5GLZA 5I0RA 2IFWA 1FV3A 1K5MB 4Q1PA 1D4M2 1XXNA 3FBYA 1Q43A 1VALA 2D3PA 1UCXA 2GH8A 2WNVB 3FFQA 3TBDA 1OMIA 2XUMA 1B09A 3AP5A 3VKNA 4JC1A 5EJ3A 4FPLA 2DFBA 1WW7A 3DV8A 1QJX2 4NVPA 4AYUA 1MVEA 1FYUA 4CDWB 5BNQA 3OY8B 3WY6A 1NCQA 3MEPA 4NWVA 4BMBA 4Q4V2 1FNYA 1RL3A 3VZNA 2OZJA 4L8QA 1LHVA 3VV1A 2NYYA 2CY6A 4AFDA 4INDA 5ACA3 3BOWA 1WMEA 2OYZA 3V0BA 2CWMA 2WQZC 3JD73 4P9WA 4E4DX 1WLTA 1S1AA 1OPMA 1HRI2 2NN8A 5HCFA 4AVTA 4CYDA 2XGXA 1LESA 1KS5A 5FPXA 1AYN2 4JDOA 4MZUA 1WW6A 3TYJA 4KGGA 2ENRA 2WLPA 5SV5A 1QDOA 4DINB 2H6BA 4XF9A 1ND3B 1MQTB 3AJZA 5JR7B 5CU1A 5EZWA 4Y5Z0 1R091 4P5HA 2MEV1 5I8TA 1G86A 2YMZA 1S0IA 3WDVA 1QQP3 3RI8A 2D6OX 4TWTA 4FCAA 1PO22 3WXPA 2R30A 1J1TA 2WNEA 3GBGA 1DGWX 3KGZA 1BVP1 1JUHA 3NWKA 1XE7A 2ZMKA 1NXD1 4AFAA 2UY9A 3WP3A 4HL0A 2QJVA 2ZGLA 1RIRA 4A7YA 1F5FA 4COZA 1QOTA 1ZX5A 2GNDA 5HCBA 3WLUA 1MEC3 5C9AA 4ONUA 3NV2A 2UWAA 3VZOA 4JGZB 1OHFA 4M00A 3RJRA 1NCRA 5K0UA 2D98A 2GAUA 4B4PA 5KHJA 1YWKA 2WS91 1PVXA 1O4YA 4QT6A 3VKMA 2WIIB 1H30A 2OUJA 5CIRA 5CG9A 3O0VA 3ZO0B 4AVAA 1EYBA 1H4HA 3VBRC 3LA3A 4AXOA 2ZGOA 4ZKTB 2DU1A 2PLV1 2DF7A 4JRLA 4JDMA 4WM8A 4QPIC 1LHOA 1FX5A 4PF5A 4E9KA 3WP6A 1PO13 1TNRA 3ZYJB 2GU9A 2QE3A 3WHTA 1ZRCA 4IEXA 4YZ2A 3UKNA 2ZX0A 5A3MA 5KC5A 2JG8A 3NV1A 1PZ9A 3ZXKA 5GJ6A 1HKDA 4N7IA 1QJY1 3RDIA 2D3SA 1KD7A 4AW7A 2VOWA 1COV1 4ZU5A 4WZFA 4AGRA 1CJPA 1AR63 3FLRA 1YO8A 2WNVA 2UYAA 3BIWE 2BYVE 4LA3A 4JGYA 5J96B 1ZRFA 1CGPA 1F31A 2DWRA 3SNMA 4ITCA 4DZGA 1PNGA 3Q9OA 1LODA 4LO7A 4CDWA 3OY8A 1R092 5JSOA 2MEV2 2R1DA 1RMU3 4GIQA 3NV3A 4DY3A 2DVFA 4GQ7A 4LBQB 4B7EA 2VU9A 4AQ2A 3RSJA 5CG8A 1LENA 4NOTA 4ZU4A 2Y0OA 2W0XA 3AKTA 4WVZA 3ZSLA 1I1EA 2WSVA 4AEDB 4AEJA 4BMEA 4B4QA 4YW3A 3H7JA 1IPJA 2R043 5CAZA 1AJOA 1KRIA 1RUJ3 2VG9A 5E89A 2O8OA 3WQ1A 1RUG1 4CEWB 5IK7A 4YM2A 3ROUA 4HMZA 4YYOA 2A6VA 4NHKA 1HRV1 2WS92 2E7TA 1XRUA 2VW1A 1MQTA 2WNUC 5BUVA 5IK8A 5KXDA 4XBNA 2XBO1 3USUB 4QQ2A 1MZ6A 1TME1 1AUYA 1SDWA 2ARXA 2DCJA 3KCYA 3WX5A 2VECA 4LO5B 2PLV2 2G9GA 4LA2A 2EF6A 1H2MA 2D6PA 3ZFGB 4FBFA 4HKOA 2UWCA 3MIBA 3PNAA 5JOZA 1X82A 4F83A 2ZA9A 2IFRA 3FZ3A 2KM2A 2VGDA 3WQ0A 4OLLA 1QJY2 3ZSMA 2ZAHA 1G9BA 1H1AA 4AEKA 3AP7A 1COV2 1GQHA 4YW1A 5KXBA 4MH0E 2D6NA 4JGZA 4QPIB 2RS13 3JZVA 2ERFA 2XJRA 1BJQA 1N1TA 4OHZA 4OI0A 2CAUA 2DUOA 4PBPA 4LHLA 1NA1C 2VUJA 1U5XA 2DVDA 4QQOA 2TBVA 3N35A 3RWNA 5LEJA 1ZRRA 4IV3C 2VMGA 4IEUA 4AI0A 2DVAA 3ILFA 2QCSB 1H8VA 4AF9A 5CFDC 4YNIA 4Q4X3 1WMDA 2GC2A 2ZGQA 4WVMB 4RS5C 3LOIA 2XJTA 3AP6A 1JH5A 3M3OA 1UIJA 4QXKA 4GB33 4OI1A 4EV0A 3VN4A 1VRH3 2ZGSA 1WGPA 4UBHA 1SLTA 4X8PA 3AYCA 3UJQA 3FUQA 5H9PA 5FLIA 2W68A 4QM8A 3M7AA 2V73A 4AHXA 4BM8A 3IT8A 1RUG2 5D8AC 4RR3C 1ENXA 1H8TB 1ZBA3 4LUMA 3M8LA 4MXWB 1QKQA 1HRV2 4YLZA 5DUVA 4LO4B 4IEVA 4JDNA 4QU2A 1R1ZA 4KQ7A 3AMPA 2XBO2 2DFCA 3D6EA 1JTZX 5AFBA 1AVBA 1TME2 4OHVA 4S2FA 1VAMA 2O0OA 1VAKA 3I54A 3JBG3 4HZFA 4YGEA 3N4MA 3O5SA 2WA3A 1CQ9A 2VMHA 1PK6B 5BXXA 2QQPA 4U2AA 1WA4A 3DPRC 3R05A 4LBQA 4B4RA 4XBQA 1O3TA 1M06G 3O0WA 1WUVA 4A7ZA 5JI7A 3S7IA 1V6LA 4AEDA 1ZVFA 4JTNA 2XKOA 3V56A 5BY5A 5T50A 3T1MA 2IXCA 4AI1A 5EV7A 3VKLA 4OVEA 4GA9A 4CEYB 4IEQA 4CEWA 2ZHMA 2HWF3 1NE6A 1D0HA 2CGOA 1UX6A 2RS33 4I01A 2HWD1 1OOPC 3HBZA 4H3WA 5L73A 1RUI3 1WW5A 1SLIA 3VBHC 1R083 3VBSB 5BNPC 2O1QA 5JOXA 1CN1A 1C3HA 3USUA 1C28A 1CIWA 1CPNA 1U5YA 3WUCA 4YZ3A 4FOVA 4IEZA 1UPIA 3IDBB 1UU6A 2EA7A 1D2SA 1CONA 4FTBA 2VULA 3ZFGA 1BBT3 3FE5A 2HWB1 5JOYA 3LSDA 4HSJA 1C1FA 1E57A 3HD8B 3AMMA 1EY2A 1AR61 2OPKA 1APNA 1VBA3 3KMHA 1EV13 2CGPA 4H14A 2DUPA 3AZXA 2Z5WA 1JYIA 1U5IA 1TNFA 1GKBA 4X8NA 5LK5A 4AQSA 4QPIA 1LTEA 4LO8A 1AXYA 1YI9A 2JXAA 2D3RA 1URXA 3QACA 1NCQC 2DTYA 1ENQA 3AB0A 4HN1A 1MS5A 4AEMA 3VKFC 5IK4A 1VLNA 3INAA 1QMJA 4PQ9A 4WVMA 2OUHA 1YIPA 1DGWA 3B7MA 5JPMB 3WCRA 2VW2A 4MGIE 4GXLA 1Y7BA 1H0BA 1FT9A 3WG3A 2WC2A 4H7LA 2PHTA 3KLSA 2VQAA 1DF0A 2RM21 4GKYA 2R0HA 1F8VA 1VBB1 2E53A 3PMSA 4JCKA 4LLFA 4RL7A 4W6YA 5L36A 1RUH1 1H8TA 1Z7S1 5E88A 4DFSA 1RHI1 2HWD2 3AP9A 2CV6A 3H3UA 4N53B 1SLCA 3VHPA 1Q8QA 3VL9A 2OIIA 1SCRA 1TMF1 2NQYA 3WG4A 4AGGA 4Z82A 4E2QA 4HN0A 1V6IA 3B9IA 4LE3A 4GMP0 1WBLA 4FPGA 2D43A 4XTMA 3AMHA 2GNMA 1Z0HA 1PK6A 2A75A 3ZMOA 3L9JT 2ETEA 4XFHA 1AL0G 2A3YA 3AYEA 2HWB2 3ZXFA 3N7MA 4P14A 4IV1B 5KBFA 3HT2A 3VBUB 1OOPB 1LJ7A 1AR62 4P9YA 2RS11 5J7MA 1LOAA 1ZBE1 4EN8B 4IERA 3D4KA 3WG2A 3HN1A 3L2YA 5C9AC 3FUOA 2ZGTA 1AX2A 4K1ZA 1BKZA 4P9JA 3VKOA 4CEYA 1NCRC 2PHWA 3EO6A 4X6QB 3WT3A 2R16A 5K0UC 1FNZA 2XJSA 1GLHA 4LE4A 1B35C 1DGRN 3P3PA 4YW5A 2B46X 4ASMB 2XHKA 3VBSA 3MI8A 3UKVA 2A3XA 4WM7B 1GNHA 3SH4A 5C8CB 4MV2A 4IESA 1XU1A 4WM8C 1ULGA 2XB6C 3DGTA 5DZEA 5FREA 4YW2A 4KBBA 3U11A 5CBLA 1N1YA 2GC1A 2VXRA 4AVSA 2JG8C 4FO9A 2F6BA 1S0BA 1NQJA 3NVCA 2PHFA 1LB2A 3QH6A 4AWDA 1RUC3 1J3RA 1MS8A 3P3NA 3J4UH 1GICA 4PJYA 2ATFA 2RM22 1DQ5A 3KSCA 4PLMA 4AI2A 2BWAA 2WNVC 5EYYA 1REFA 1VBB2 1EAH1 2YDEA 4YVWB 3WDWA 4YFZA 4JGYC 1PVC3 1RUH2 2RHPA 1Z7S2 4ZU7A 3TN91 1RHI2 3N36A 1FMD3 3LSEA 3U10A 1AR73 4CDWC 4QX5A 4R9AA 4H55A 4XMIA 2GDFA 1TMF2 1YUDA 4JV4A 1DQ0A 1S0EA 2ILMA 4R52A 1C57A 1PNFA 3BODA 2FZ2A 5AC91 3MW2A 1GZWA 2PAMA 1O4ZA 2CAVA 1AZDA 5T3NA 1JHNA 1HDKA 3VBFB 3WHUA 4EJRA 3IMNA 5FOBB 1DG6A 3WV6A 3I8TA 4AK3A 2EXIA 3OYWB 2Y38A 3WR0A 2ARBA 1U12A 1XNKA 3ZYPA 3OD0A 2RS12 1ZBE2 5GALA 3LCPA 2E7QA 1RGSA 4Q27A 4YM1A 1IS6A 1MS9A 1DBNA 1S0FA 2XLGA 4Q4Y1 1UZZA 1MQTC 4G9SB 4XF3A 5EYXA 4L2NA 3APBA 2WWSA 3MIFA 4N53A 4GWNA 1POV0 4U36A 2ZGUA 3M3EA 4DS0A 2ZZJA 1BEV3 4HVQA 4L92A 2I07B 5C4WA 2ZHNA 1C8M3 1DGLA 4Q0SA 1H1MA 1WBFA 1VBE1 1DHKB 1B35B 1JN2P 4D69A 4IEPA 3RNSA 4IV1A 2VVFA 4Q0QA 3VBUA 1OOPA 5E8AA 2FHRA 4Q4W3 1FPN3 3GZUC 3SLIA 2JJ6A 4RHV3 1NZCA 4FQZA 2WZR1 1A6CA 1O5UA 2RS51 1ULCA 4JGZC 5JWPA 1QOOA 1RUNA 1EAH2 1NLRA 1Q8SA 2JG9B 5ABJB 1YYNA 3OCPA 2X5IB 4HANA 3TN92 2R063 4YVSB 2ZX1A 2B7YA 1YFXA 3AKRA 3SISA 1ZZ9A 1J3QA 4WM7A 3VBOB 3NV4A 5C8CA 4N9IA 4XIOA 1IS4A 1IZ3A 4I30A 4BA6A 4DB5A 3OF1A 2MHFA 3ZYGA 5AC92 4HFSA 3BPZA 5BNOA 2WFF3 4B3NA 4Z2WA 3MW4A 1BVVA 5DXDA 1DYKA 4JVAA 1H4GA 1TQ5A 3O7OA 4JGYB 4S2DA 3I7DA 3DF0A 5C33A 1PGL1 1LEDA 4XXPA 2D7FA 3IN9A 1KXGA 3U07A 1S0JA 3HAGA 2D6KA 3KGLA 4XETA 4YVWA 4XHBA 2BEOA 2HWC1 4IL7A 4Q4Y2 4PIXA 4Y22B 3FHIB 4OZXA 4DRRA 2NLRA 1RVF3 1G7YA 1OPOA 1HW5A 1PIV3 4D94A 4H7MA 4Q8LA 1QHDA 5FOJB 3QOPA 1JBCA 5J36A 1AR91 2B5HA 5DG1A 1PZ8A 3QBQA 1GNZA 1IKQA 3VBFA 2SBAA 3UKTA 2ZBJA 4XW3A 2JEMA 4AEDC 1VBE2 2FQPA 3H7YA 2UY8A 4J6GA 1QJU1 5BNNA 3E5QA 5F6LB 3OYWA 2R071 4COWA 2NMOA 1KITA 2BWCA 4FPOB 4C1WA 2P34A 3A0KA 4CEWC 2WZR2 5JSRA 5J37A 2RS52 2CL2A 1HXS1 3FBMA 1VBD3 1RUE1 3WOGA 3WW4A 4KWLA 3ZVXA 4PBOA 5DUXA 4FQ4A 3VZMA 3IKWA 1WCDJ 1AYM3 2RMU3 4PLNA 4WBBA 5KWRA 2JICA 3ZFEB 1CVNA 4QPGB 5BYNA 5F1RA 4LBOA 3ZFGC 4GH4B 1L3JA 3JB8A 1ZZBA 1ZRDA 1G6NA 2BTVC 3AZYA 2WJSA 4IEOA 1B35A 3ZN6B 3U0ZA 2JDZA 1H9PA 2DU0A 1PGL2 2YGLA 4LTAA 3OPZA 1RJ7A 2VW0A 3B93A 1LOCA 3EBRA 3SH5A 4R9CA 1MZFA 1AL23 3ZN5A 2Q4SA 3J8F3 1RUF1 4N9HA 1ALYA 5T55A 3MIEA 2ZGKA 3SH3A 3N7LA 1ENRA 5GLWA 1D2QA 3D8CA 2HWC2 2JG9A 5ABJA 4RA0A 2FZ1A 4YG6A 4YW4A 2X5IA 3ENRA 3GBFA 4AVBA 3WG1A 4YVSA 4LULA 1VP6A 3TRSB 3ZXLA 3VBOA 2VMIA 1UF2C 5JI9A 3LA7A 1HIXA 5DDJ3 1AR92 4EROA 2H6CA 4X6RB 3URFA 1ULDA 1QWRA 4W6WA 4BE3A 5HI0A 4DNYA 1R1A1 1YFWA 3ASIA 3WNXA 1AR83 5H9RA 1QJU2 4M3CE 1GANA 3EXUA 2P17A 3FLPA 4KG0A 2R072 3ZFFB 5J48A 3OGJA 2VNOA 2BNMA 4L9BA 1W6PB 3OGGA 1O91A 5FBZA 1N1VA 1H8TC 4NPRA 1HXS2 2BGCA 2ZKNA 2WA4A 4UBGA 4ORFA 1UN1A 1RUE2 4S2HA 2RR13 4N90A 2D44A 3WD5A 4Y22A 1LU1A 1OD5A 1ZYBA 3IDEA 1S0CA 3E6BA 3JQWA 1V9U1 1H2LA 1WD4A 3NJZA 1J1LA 1PK6C 4XFFA 1QXRA 4YARA 2PAEA 4M01A 3POSA 3LGRA 1IOAA 4AVCA 3ZN4A 4YM3A 2W08A 4Q29A 2G4IA 1RC6A 4KGQA 2XH6A 3KB5A 3ZXAC 1VBC1 1CD3G 3AKSA 4CEYC 4IXLA 2YYOA 4HK8A 3J26N 1RUF2 1O3SA 1SFYA 4R9DA 3CJIB 1EPWA 5L19A 1IPKA 3H1MA 3VBSC 3JB4C 4AFCA 4BWOA 3ETQA 1LHWA 2DTWA 1REDA 1WLDA 3VDDB 4YM0A 3QCWA 4C0BA 3ZXEA 1VJ2A 4UW4A 2QDNA 1V6JA 5E16A 2PQQA 3ZFEA 4QPGA 1BYHA 4Y1ZA 4GH4A 4KU8A 1CESA 5JVVA 2JENA 4I2OA 4QMAA 1MZ5A 3MW3A 1R1A2 2GC3A 4GMP3 1SBEA 3ZN6A 1GZ9A 1OQDA 1OLQA 4IEWA 1W0OA 4RGAA 1Q8VA 3E97A 4DY5A 3ELNA 1UIKA 5ACA1 1ULEA 3AX4A 5T5PA 3TAYA 1RJ8A 1WCKA 3JD71 4KH9A 4L97A 5T54A 5LRSA 4O9GA 4QHBA 5DZGA 2IXHA 1O7FA 4S2GA 2DURA 3K48A 4L11A 1QOSA 5F6KA 1QU0A 2GMMA 2P3IA 1YI7A 1V9U2 3ALQA 2A6WA 1SCSA 2PHUA 4V1PA 3NSTA 3AZWA 4Z07A 2WFPA 1C4RA 3OBRA 3SCHA 1V00A 3U4XA 3R4UA 5F9TA 2H0BA 3FJSA 1W2UA 1RUOA 1QQP1 1H1IA 2MPFA 5K7PA 1JXNA 4YFWA 1C1LA 3ZFFA 3DL3A 1DQ6A 1VBC2 3LOBA 1X8EA 2Z79A 1W6PA 3BU7A 1CX4A 4O9EA 4TSVA 1D0GA 4FPYA 1IS5A 3GHNA 1MS3A 5I91A 1ASJ3 2BPA2 2TNFA 2DCYA 3CO2A 4R4XA 1FOD3 2UU8A 1DDLA 1RUD3 4HVOA 2ZABA 4N53C 1CAXB 1MEC1 4GULA 2HWE3 3GNEA 1N3PA 4HT1T 1T6GC 4D3WA 1X50A 5CA6A 2TUNA 3LAGA 3MZHA 3QLQA 4HLTA 1BK1A 1V6OA 4LBKA 3I59B 4AHYA 5C4WC 4XHXA 3B3QE 3MIHA 5JOWA 2VNGA 4DMIA 3VHRA 5JCTA 5GLTA 1WLCA 1KDMA 4IV1C 3VBUC 3WINE 1D4M3 5IK5A 1IGOA 2O8QA 2Q0AA 1PO11 1YIFA 2JECA 1UPSA 1Q8OA 1O5LA 3LZZA 3TWIA 4EN9B 5ACA2 1U5ZA 3A4UA 4MUVA 3JD72 1BMV1 4D7TA 2Y26A 3CJIA 1QJX3 4B29A 5LEKA 3NAPB 1CPMA 4FXKB 1FAYA 3IBMA 3W9AA 1G8WA 4TLFA 4WM7C 5I8SA 4Q4V3 5C8CC 4LBJA 3RG0A 5KHGA 4J1WA 3VDDA 1NYWA 2MNGA 4I09A 3ACLA 3M70A 2PFWA 2A3WA 3B9CA 5BNOC 2VUAA 1MS1A 2K2SA 3ILNA 4ATEA 2YZ4A 3D5OA 1POV3 1UL9A 4XJAA 1DQ1A 1HRI3 2HYKA 3ZYRA 3AZVA 4QGNA 4AE2A 3WQ7A 1RMU1 4OUMA 2JX9A 3DKWA 1QQP2 1AYN3 4FPJA 4I02A 2LUWA 2CYFA 1ZZ6A 2RR11 1O3QA 2XJUA 3H1WA 4RQPB 4YVWC 3C3VA 4XJUA 1TE1B 1GZWB 2WKKA 4HETA 1KJLA 4W6XA 2R041 1UD1A 5AVPA 2ZZQA 3GZTB 4BPZA 1RUJ1 3EHKA 1MEC2 2LALA 2WSUA 1LEMA 4XTPA 4AGVA 1SEFA 3KQRA 1PO23 3VBFC 5KC6A 3I2DA 2PELA 4LLOA 3IPVB 1LKNA 3RRDA 3WW3A 2Z2SB 4Q2FA 5FDBA 4M3CF 3I4IA 2BQPA 2ZGMA 3VLBB 5BNNC 4TZDA 2AH2A 4ATFA 2E9QA 1G9DA 1IQAA 2DV9A 2NM1A 1HX6A 4OULA 1QDCA 1PO12 3CF6E 4NHLA 4A2UA 2ZJCA 5C4WB 3KCCA 1UKRA 1KS4A 4CDUB 5GLUA 1BMV2 2PHXA 3VHNA 4JRAA 4XMAA 1DZRA 5SV8A 2BFUS 1CAXA 3IIAA 1DZTA 2DVBA 2WT1A 3PVEA 2D6LX 5CADA 3I59A 4AFMA 2QNKA 3SCGA 1Q3EA 4QM9A 5GZCA 5I0SA 2DVGA 1WW4A 3O12A 3CL1A 3PVOA 2X29A 4Q4X1 2YC0A 1YCIA 3RMXA 5L7OB 1RMU2 4C0HA 3NKTA 1LR5A 4D7SA 2JE7A 1V6NA 3A0NA 2JKBA 1BXHA 2RR12 4XJ8A 4A3XA 4GB31 4CDXB 2XKPA 3LKJA 2JG9C 5BNOB 5ABJC 4FVVA 3LA2A 2X5IC 1VRH1 2R042 1HQLA 5TSWA 3NAPA 2PHDA 3D0SA 4YVSC 1RUJ2 2VPVA 4MLOA 1R093 3MGUA 1ZNPA 4Z1VA 3VBOC 2MEV3 2EALA 5GM0A 4BHPA 1AX1A 3AKPA 1ZBA1 4YGCA 4DXZA 5KHKA 3CLPA 5FTTC 1CR7A 2XWJB 3HT1A 3RPQA 1Q5OA 4LBNA 5DZFA 2G9FA 4HBNA 4OHYA 4QD2A 1UMZA 4AQ6A 3AK0A 3KT1A 5CFCB 2QDRA 3TB0A 3JBG1 4LHNA 4DQAA </