5FZ3A

Crystal structure of the catalytic domain of human jarid1b in complex with maybridge fragment 3,6-dihydroxybenzonorbornane (n08776b) (ligand modelled based on pandda event map)
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
462
structure length
453
Chain Sequence
SMFLPPPECPVFEPSWEEFADPFAFIHKIRPIAEQTGICKVRPPPDWQPPFACDVDKLHFTPRIQRLNELEAQTRVRDYTLRTFGEMADAFKSDYFNMPVHMVPTELVEKEFWRLVSTIEEDVTVEYGADIASKEFGSGFPVRDIKLSPEEEEYLDSGWNLNNMPVMEQSVLAHITADICGMKLPWLYVGMCFSSFCWHIEDHWSYSINYLHWGEPKTWYGVPGYAAEQLENVMKKLAPELFVSQPDLLHQLVTIMNPNTLMTHEVPVYRTNQCAGEFVITFPRAYHSGFNQGFNFAEAVNFCTVDWLPLGRQCVEHYRLLHRYCVFSHDEMICKMASKADVLDVVVASTVQKDMAIMIEDEKALRETVRKLGVIDSERMDFELLPDDERQCVKCKTTCFMSAISCSCKPGLLVCLHHVKELCSCPPYKYKLRYRYTLDDLYPMMNALKLRAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords LYSINE-SPECIFIC DEMETHYLASE 5B
publication title Crystal Structure of the Catalytic Domain of Human Jarid1B in Complex with N08776B
rcsb
source organism Homo sapiens
total genus 138
structure length 453
sequence length 462
ec nomenclature ec 1.14.11.-:
pdb deposition date 2016-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF02375 JmjN jmjN domain
A PF02928 zf-C5HC2 C5HC2 zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 5fz3A01
2W2IA 4QU1A 2XDVA 5FYTA 2WWJA 2YPDA 2Q8EA 4QXCA 5A7SA 3ZPOA 3KVBA 5F3GA 5A3WA 5FZIA 5FJKA 4BU2A 5FV3A 5ANQA 5FY9A 5FP8A 3PUSA 5A1FA 3ZLIA 2VD7A 4TN7A 5FZFA 4QX8A 3AVSA 4Y3OA 2OQ7A 5FUNA 5FZHA 3KV5A 4QXBA 5FZBA 2XMLA 5FXWA 2Q8DA 3PDQA 2OX0A 5LY2A 4HONA 4D6RA 4LITA 5A80A 5FYBA 5FXZA 4ASKA 5CEHA 4DO0A 2XUEA 4D6QA 5FJHA 3AL5A 4V2VA 5FY5A 3U78A 4CSWA 5F37A 4GAZA 5A7PA 3U4SA 5FPUA 5IVJA 5F3EA 2GP5A 3KVAA 4HOOA 5A1LA 4V2WA 2XXZA 3N9QA 5F5CA 5K4LA 2YBKA 3K2OA 5A3NA 5LWBA 3NJYA 5F3IA 4AI9A 3PUQA 4Y33A 5F2SA 5FYYA 4GD4A 5FZCA 3UYJA 3PU3A 5IVVA 4AAPA 3AVRA 5FZLA 3PUAA 4Y4RA 2GP3A 4CCMA 5FP9A 5KR7A 5A7NA 5FY8A 5FZ3A 4BISA 5FPVA 3K3OA 5FZMA 5F32A 5FYSA 4QX7A 5IVYA 3AL6A 5FY4A 5FZKA 5FZGA 5E6HA 4XDPA 2OQ6A 5A3TA 5F5IA 4EZHA 5FY1A 4UF0B 4LIUA 2P5BA 5ISLA 4QXHA 4D6SA 5F39A 3K3NA 5FP7A 5FZ6A 5FZ0A 5FXVA 4CCOA 4E4HA 4IGOA 4XDOA 5FYUA 5LW9A 4NUBA 4QWNA 1VRBA 5FXXA 2OT7A 4CUGA 5IVBA 5F3CA 3N9LA 5FWEA 4CCJA 4LXLA 4UF0A 5FP3A 5FZ9A 4DIQA 4LIVA 5IW0A 5FZEA 4CCKA 4CCLA 3OPTA 5FZ7A 5FYMA 5F5AA 5A7OA 5IVCA 5A7QA 5FZDA 5FY7A 5FYCA 4IGQA 2OS2A 3RVHA 4GJYA 5IWFA 5FUPA 3LDBA 5FPAA 5FYZA 5FYIA 2WWUA 4C8DA 2YBSA 5FYVA 3OPWA 4GJZA 3KV6A 4EYUA 2PXJA 5FZOA 5FBJA 4BXFA 5FZAA 3N9NA 5FYHA 2YU2A 3PU8A 5F2WA 5A7WA 2Q8CA 3PURA 5FPBA 4EZ4A 5FZ1A 2YBPA 2YU1A 4CCNA 5IVEA 3KV4A 3LD8A 3DXUA 3N9MA 3N9OA 5FZ4A 5A3PA 5FP4A 3KV9A 5FPLA 5LY1A 4URAA 5IVFA 5FY0A 3PTRB 3N9PA 5FZOB 4IGPA 5FWJA 3DXTA 5A7WB 5FZ8A
chains in the Genus database with same CATH superfamily
1AXZA 2H0BA 1U5XA 3AKSA 3FC0A 3VDCA 5FYTA 4PI2A 2W1SA 4I0AA 3S6PA 3NV2A 5A3WA 2JDMA 5FZIA 1W2OA 1G9BA 4FCAA 2GDFA 4HT1T 2IWGB 5A33A 4ZU7A 1D4VB 3BKZA 2J22A 1EYBA 4NRQA 2WQ4A 1W6NB 1QGLA 4K8RB 3LEMA 1XQNA 3VD3A 4AZZA 5FZBA 4Y1UA 3KCCA 2HWC1 4QPIC 3I3QA 3T2OA 3THTA 5FBZA 2VZ3A 3SISA 1IS3A 2NZ9A 1UW8A 3I54A 1ZNPA 2B46X 2RS33 2VE1A 4LBMA 1J58A 3C7FA 4XABA 5IT6A 2YFZA 4W50A 5EFUA 5FYBA 2EXJA 2PHFA 2ZPXA 4FPOB 2V73A 4RR3A 1W9FA 4FAHA 4Q4X3 3MIFA 4DO0A 5FKBA 5CFCA 3URFA 4CDXB 1CX4A 4XQDA 1KGYA 2BTVC 2WFF1 1MZFA 4KG8A 1O91A 3IM0A 3WXPA 5DABA 1ZRCA 4GXLA 2VL4A 4JGZA 3FX3A 2XR4A 5A3NA 1BQPA 2FZ2A 2BYVE 2V5DA 5BNOB 1V6JA 1VRH3 4QPGC 1HN1A 1RJ7A 2VMDA 1WW7A 3IT8A 5I0DA 4FOWA 4TYSA 3VBRA 1JU4A 1VB4A 4QX5A 5E88A 3GJBA 3MIHA 2R063 1GZWA 4Y4RA 4CP2A 1V70A 2W1UA 1NQJA 3JD73 3AYCA 4RFT0 5BNNC 1DQ4A 4CU8A 4FI9A 3JBG3 1VBE1 3KLSA 2JJ6A 1E5SA 5FZMA 5DZFA 2P2KA 4NOTA 2QQIA 3MICA 2VZOA 1O4TA 4XDPA 3J7MA 1AYN1 2I07B 5C8WA 3VZKA 3T2QA 3MW4A 1UZVA 4BZ4A 2WSUA 2AREA 1S0IA 1VRH2 3GYDA 2ET1A 4IGOA 3ZX7A 4AGGA 4BHPA 1XNDA 4FFFA 5C4WB 2C0ZA 3MW3A 2YC4A 2D3SA 3ACLA 3NO8A 4RYDA 1OF3A 3TNQA 4ASMB 1ZYBA 2R062 2P6CA 3HJRA 1YFYA 2VBPA 1D0GA 3JD72 2HEYF 1PM7A 1M4WA 3KF3A 2ZEYA 3JBG2 4FXGB 3RZZA 2VCMA 4XFBA 3SC7X 4LIVA 2BJSA 3SH3A 1PZ7A 1H9PA 1LOEA 3H0OA 4XFFA 5IVCA 2X05A 4QAWA 2JE7A 5DUWA 2E6VA 3AZXA 2RDRA 1PIV1 1PGW1 3LDBA 2RS53 1PMIA 2EXHA 4C8DA 4XFAA 3ZIXA 1JYTA 2W3JA 4RGAA 4UFKA 4PBOA 2FHRA 4YNIA 4FT8A 4COUA 5KWRA 1WCKA 1Q8VA 2NN8A 4HN1A 5JIUA 3U07A 3O1PA 2D43A 1N1TA 3VBUC 3NAPB 1Z78A 1ND2C 2XHKA 4CXWA 4QD2A 4CPBD 1AR81 3A0NA 4FFHA 2BW8A 3WT3A 1NCQC 4XUQA 3JQWA 1RUJ1 1IQAA 4CEWB 1F5JA 2RM21 2GU9A 1VBD1 2VUJA 1UN1A 3ACGA 1AR73 2EVXA 3ACIA 4JHZA 1DF0A 2DUOA 3WQ0A 3CBNA 3WR0A 1H8TA 2PHTA 2RS52 5A7SA 4GA9A 1EPZA 1JZ3A 2GC3A 1OFNA 1AHSA 5E1RA 1ULPA 2LROA 4CXXA 2PHDA 2VNVA 1L3JA 1MS8A 2UURA 3DCQA 3H3ZA 3PUSA 3VKFC 4YYOA 4WBBA 4YPJA 4NAMA 4DPNA 1XU2A 3AVSA 4LHNA 2BOJA 4BQ1A 5D8AA 3WCRA 4CUBA 2VOWA 3OOXA 1MVEA 3PUIA 4X8NA 4ZU4A 2E63A 4QB6A 2Y6HA 4CE8A 2H6CA 4JCKA 2HYKA 4Y22A 4QKBA 1AR72 5CEHA 4ATFA 5C5UA 4Z2WA 2C1FA 3UK9A 3TEZA 3UNPA 1AL21 5CAZA 1PO11 1W6QA 4LKSA 3C2UA 1TZOA 4HOOA 1U0AA 3ZSLA 3ZN6A 2O8QA 2XQXA 4DS0A 3AKQA 2XVKA 3OPZA 3O5SA 3USUA 3HQUA 4A7KA 1IG3A 3LA2A 3MF9A 4HN0A 1ODNA 2CSGA 5KHGA 3ASIA 3UYJA 2EALA 4JKKA 3SEEA 4BDVB 2YC0A 1H8VA 3ZKYA 2Q8OA 1WKYA 1YQCA 2A3YA 5FP9A 4B3NA 4FAGA 3UGFA 3OG2A 5DQ0A 4JRAA 2UYBA 4NJ4A 4QKFA 4DB5A 1QJFA 2XB6C 4LHKA 2WYFA 4R4XA 4Y5SA 2MPFA 2QTWB 2E7QA 5EYYA 4ZY9A 4OI0A 1NY72 1W0PA 4GB31 4NMIA 1D7PM 2BOIA 1R091 3IAQA 2JB8A 3VBHA 4TWTA 4UBGA 2A6YA 1COV1 1HRV3 2AR6A 5C8CB 3HAGA 1YFWA 4OI2A 4YZ2A 2WO1A 4XDOA 2WWSA 3RNSA 5C70A 4YG0A 5JXIA 3M3EA 4Q27A 4M00A 1AXYA 3RYPA 3VD5A 4KNCA 4XFHA 2YV8A 5FR3A 3H8UA 1GSLA 2PYTA 3BN6A 3SMHA 1PK6C 2DVBA 2VAUA 2H6BA 1BVP1 5CFDA 2RS13 1QDOA 5FZ7A 1VBA3 1ONAA 4PT6A 1B09A 5T55A 4MXWA 1O3QA 1WD3A 2Y64A 5EV7A 3M3OA 4YGDA 1HRV2 4QPWA 4JGZC 4NHKA 4XJUA 4L11A 1GOFA 3W5NA 3AYAA 1JODA 1W6OA 4BXFA 2R1DA 4CA9A 1RINA 1B35B 4HSLA 3M4FA 4CEWA 1VR3A 4M0NA 4QT6A 1GQGA 1TNRA 3DXUA 5LRRA 4AEDB 4XURA 2JEMA 1TMF1 5IK5A 3WP4A 1AYM3 4LBKA 2ENRA 3VKOA 1HKDA 4I09A 1OBNA 1OOPC 4IGPA 5K0UB 2RS12 5JVVA 1RUF3 1RUH1 1VBA2 1WA4A 3PIGA 1F8VA 3OY8B 1WMXA 1YRZA 3RDIA 4BB3A 3LQCA 4ET7A 4CP9B 1DLCA 1KS5A 4EWEA 1QH7A 1PVC3 2HWE1 3I3EA 1CIYA 3RI9A 3E97A 4XF0A 4AXOA 3B00A 5EYXA 2Q1ZB 4S2GA 3AMMA 1IPSA 1CAUB 4JDNA 1GZCA 1JYCA 2VD7A 2HWD3 4OVEA 5FZFA 3ZYIB 4BQ5A 3WG2A 2E53A 4MGIE 5GALA 3N35A 2OQ7A 3SKJE 4YARA 4YZ1A 4MG2A 2R043 4RHV1 1XXNA 5FZHA 3ES1A 2ZGNA 3UKVA 1CJDA 2BFUL 1AYM2 3CLPA 1O7FA 4HONA 1OA2A 1MZ6A 1QOOA 2C6SA 4YW2A 1XE0A 2F4LA 3IIIA 4Q2FA 2D40A 1RUI3 3NSTA 4BIOA 4D6RA 5K7PA 1UKRA 1W8WA 3WINE 4XXPA 4K20A 1OH3A 3MYXA 1A8MA 4JDMA 2QNKA 3AL5A 2J7MA 3U78A 1PVC2 1S0EA 5F37A 1BHGA 5EIYB 1BK1A 3VBOA 3ZFGA 5C5TA 2Q0AA 4EN9B 3VV1A 5E8AA 2VTXJ 4N53A 4N7UA 3IZOA 2E26A 4BCUA 4GD4A 4OI1A 3U10A 4PCRA 3ILRA 1ZZ9A 2PLV3 2R042 4B4PA 2F17A 3HBZA 1W04A 3J8F3 3BU0A 2RDQA 2MEV1 4NVPA 3UGGA 1EY2A 1LTEA 3ZYFA 1RUI2 2WQZC 3FFQA 1VAVA 3ZYBA 2O8OA 3H7JA 1JOBA 5GZCA 3AK0A 4A7YA 3RJ2X 1W05A 3B93A 3KCYA 2CWSA 4D6SA 2W87A 1NYWA 2EXKA 3RZJA 5HBAA 2Z79A 4BJ0A 4YVSB 3AP9A 3KS7A 1NUKA 3D6EA 3SH5A 2CY6A 5F1RA 4XE9A 4Q8KA 3J8F2 1RUD1 2BV4A 2P1BA 3V0BA 2JIGA 4CDXC 2VZRA 3POGA 3OGGA 3NRUA 1OD5A 3P3PA 4AHXA 1T2XA 1RUNA 4Z2AA 3SHRA 1ZRDA 4WVWA 2OA2A 3HN3A 5CNAA 1UF2C 4YGCA 5BNOC 4CCKA 4CU6A 4ZKTB 2CL2A 2QQKA 2VOKA 2W39A 4E27A 5CKNA 3TEWA 1B35A 3K46A 1TME1 2W68A 2HWC3 3P5BA 3VZNA 1NCRA 5H9QA 2P37A 4UFLA 3GALA 3K51A 4W4ZA 2OPKA 1CAVB 5IATA 4GJZA 5K0UA 1UXXX 1LESA 4JDOA 1JZ2A 2X8KA 2YHJA 3D0JA 2WFF3 3LWCA 1C1FA 3OTFA 1NAEA 5IVEA 4FQ4A 4FP2A 3RI8A 2YMZA 4PDWA 2LW8A 2E9QA 4OQ8A 1NKGA 3AMQA 3SH4A 2DDUA 1H1IA 3NJZA 2RR11 3MIEA 5DAPA 1CAUA 4XJWA 5C4WC 2CYFA 2W2IA 3I2HA 4PF5A 2XDVA 1ULOA 4OHZA 1SFYA 2BWCA 4AHYA 1GMMA 2FDHA 1D2QA 4NR1A 1VBE3 3AFGA 5CADA 2BVVA 4LHLA 1SLBA 3K75B 5C6CA 4JZRA 3KGLA 2F4PA 2WFF2 2DCZA 1GOGA 2NMNA 4XF9A 4AI8A 1AYN3 1OUSA 3NV3A 4ISRA 3PDQA 5CZKA 4IEYA 5FKCA 1RL3A 2OX0A 3BCWA 3HMYA 2ZCWA 2BRTA 1WMEA 2Y6JA 3WOGA 5JPMB 1SQ4A 1I3HA 4IV1A 3HD8B 3J7HA 3PMEA 1YQ5A 4A7ZA 2Y0OA 2R071 3RYKA 1QOTA 4KWUA 1AL0G 2WT1A 3NAPC 1Q8QA 1VBE2 5L36A 1O3SA 5BNPB 1BKZA 4QHOA 1X8EA 4F7ZA 3EBRA 5FIXA 2W47A 5DAQA 4C0HA 2W1QA 2RJ2A 3AKPA 3W20A 4CEWC 3BVCA 4IERA 1AYN2 1N3PA 1CZSA 3I2OA 2C4XA 1IS5A 3S5QA 3AFKA 1AR92 4NHLA 4YW4A 2VOXA 2CGNA 5JMCA 5BNPA 3ZYPA 4XJAA 3FFZA 3AP7A 2VULA 3VKLA 3VZOA 2CNAA 2A73B 2B9VA 1CN1A 2ORZA 4UWDA 2EA7A 2P6HA 1ALYA 1SLIA 4RA0A 2VGDA 5E6HA 5F6LB 4Z1VA 5DUVA 3ZO0B 5FY1A 2V4VA 4Q26A 1AR83 2P5BA 2C9AA 2JG9B 4UF0B 4Z07A 3TYJA 4LO7A 1VMHA 1HIXA 1GNZA 1RUJ3 2JG8A 2RM23 4NUBA 1VBD3 4OFGA 4QB2A 3RFRA 3UETA 3ZXFA 1YUDA 1PIV2 1W99A 2R0HA 1PGW2 3KT7A 1MS4A 5FRAA 4MV2A 2GNTA 2HH9A 1UMZA 5ACA1 1UZWA 5F3CA 5JMOA 5EPAA 3WQ7A 1L7QA 3R6SA 4AG4A 3AZWA 3WZ1A 4HETA 4NRMA 2P4EA 2FDKA 2IVIB 1WCSA 1XBFA 4PJYA 4U36A 4XBNA 4XIOA 3U4XA 1AR82 3N4MA 3AXDA 1KD7A 1IS4A 4R9BA 2A75A 4QDRA 1RUJ2 1MVQA 5LZ6A 3OPWA 2B39A 1ND3B 2RM22 1VBD2 2VW2A 3VZJA 1MEC1 2ZX4A 4LPLA 2YU2A 4MGKE 3ZSJA 1NXD1 1AL23 3LPFA 1TG7A 1DFQA 1PO13 3KV4A 3N9MA 2X53S 1JUHA 5LY1A 4FPCA 4QPIA 3WF0A 4URAA 1HQWA 2VUCA 3WCSA 3V65A 5FZOB 5C8CC 5CKQA 4LBOA 4KGQA 4DEQA 4Z82A 3M3CA 1BZWA 3TEXA 2XL7A 2JXAA 3SLIA 2VMEA 2YPDA 4KMQA 3KB5A 2UU8A 1DQ6A 4HXCA 1SCRA 1VIWB 3DUIA 5J96B 1K5JA 2BDRA 4Q1RA 2A71A 1HLCA 4QHBA 3U14A 4D8MA 1NG0A 1UMHA 3SXWA 2JECA 4W8JA 4GB33 4E2SA 1C8NA 1AL22 5EXOA 1PO12 1R093 2Y0IA 4EN7B 5FUNA 1BEV1 1FMD1 1COV3 1OVSA 1VMJA 3FL7A 3HR9A 4JV4A 4H3WA 3VKNA 1WW5A 3NNGA 1KDMA 4LHSA 5I0TA 3ZSKA 3KT1A 2LALA 1K3IA 5F8PA 4CZSA 5KHKA 5I91A 2ZMNA 2ZHMA 4FXKB 1B35C 1DHKB 2JE8A 2WT0A 4AFAA 1R64A 1POV1 2WS91 3WDUA 3O12A 5A7PA 2ZKNA 4RGKA 3VKMA 3X29B 4AEDC 1HJGA 2CDOA 5F3EA 1D2SA 4CEYB 1W39A 4M3CB 4V2WA 3BPZA 2E51A 1L7LA 2W1WA 4YSFA 5K0UC 1HRI3 5SV8A 1PNGA 2VECA 4GB32 1CAXB 5L9BA 2YXSA 4AI9A 1DQ0A 1R092 1YXWA 5KBFA 2E7AA 4LNVA 3WNOA 5IVVA 3POEA 1DGLA 1COV2 4AAPA 3MHZA 1GP4A 4FPEA 2J1VA 5EZWA 4DNYA 1I6XA 3LEIA 4P08A 3HPNA 1GBGA 2JENA 1MS0A 2D98A 4P9GA 2EAAA 4PF1A 2ZGLA 3AMNA 1R1A1 3Q9OA 1CQ9A 2IXKA 1APNA 3QBQA 4YRDA 3O0WA 1CIWA 1XYOA 3VZLA 1KDKA 1ZZ8A 3RZHA 2ZX3A 1F35A 1CWPA 2QQOA 4PI0A 3UESA 4X6RB 4EZHA 1SZBA 1CPMA 4MXVA 1RUC2 3O7OA 1DIWA 2PTMA 1Y43B 4UFMA 1CONA 3JZVA 1RUH3 4Y1VA 4Y1ZA 4YGBA 4LBQB 4CCOA 5B2GB 1XNCA 1CAWA 5FYUA 3WNXA 3E5XA 4MGTA 2WNEA 4M4RA 4UFHA 2WNOA 3QLQA 4HBNA 5DZGA 5K9YA 5G05L 4BH9A 4D7YA 1VRBA 3Q8BA 3ES4A 4L92A 4DXSA 1O5LA 2HWE3 3WNMA 3WVJA 4DEVA 4A44A 3AP6A 5H9PA 3NNFA 3DL3A 3O0VA 5LBEA 1JW6A 3VBUA 3VBFB 4BK4A 1ND2A 5GZDA 3JQXA 4LXLA 2JWPA 3B7MA 1OLQA 1A8DA 1SBFA 4LO8A 4RN5A 5L73A 2VCCA 1ZZ7A 4H55A 3IAPA 4Q8LA 4HLTA 4FVVA 4RHV3 5BV6A 1O59A 2KM2A 2OS2A 4I3GA 4CDWB 1TMF2 2R32A 1T6GC 4GMP1 5FYZA 3ZXJA 4FTEA 5KHJA 2BNNA 3OSDA 3LCPA 4YWAA 5FYVA 3IN9A 4PBPA 1UYYA 1W8NA 2PHRA 1GU3A 2Y8KA 2JDZA 3CMGA 3IDAA 1FYUA 2HEVF 4LE3A 5FZOA 2PN5A 5F2WA 4DY3A 2ARCA 4N9HA 1ZBA1 2C24A 4RFRB 2HWE2 2I2SA 2YBPA 4CCNA 3BTAA 2XL9A 3WNNA 4IQPA 3HWJA 1V9U1 5FZ4A 5FP4A 1QY4A 4N7IA 4G9SB 5FPLA 3T2TA 2WO3A 3K77A 2A5ZA 1KFXL 1NOVA 3WSOA 3B01A 4NO4A 4P5HA 1OQDA 3RQ0A 4B7EA 1LGCA 4YVSC 2AZ5A 4RHV2 4Q4Y3 2OXBA 3A22A 4AFCA 4M4PA 5D1IA 4Q0QA 2D3RA 1QXPA 1QJY1 3K4AA 4BWOA 3DYMA 1W9WA 1QKQA 4BU2A 2AACA 3MEPA 4HPKB 1AXKA 3KQRA 5FK8A 5HV0A 1V6LA 3MV01 2P34A 3I2KA 1SFPA 2A1XA 5A1FA 1DZQA 1OSGA 2V72A 2UY9A 2XLGA 4L99A 4QX8A 4WVMA 3H7YA 3I2DA 5D2AA 1R1ZA 4ARXA 1Z7S1 3KV5A 2XMLA 3OB8A 4EV0A 1RJ8A 2VNGA 2VVDA 3FUQA 3HVDA 3LOIA 3EJKA 1RTVA 3Q8AA 4FPFA 4XHXA 4LBJA 4AFMA 5CVRA 1O8SA 3GBFA 3EYPA 2A6WA 2QDNA 2R7EB 1CAXA 1RUD3 3ABZA 1EUUA 3ZXGA 4NE9A 3DYOA 2MEV2 3GNEA 4MGZE 4XTPA 3UJQA 1WZXA 2DWRA 2YROA 1O5UA 3CJIB 1NX9A 2W9XA 3BTZA 4YG6A 5IVJA 5IFPA 2GP5A 3NL1A 4XYXA 1IPKA 4XUTA 5AVPA 4ZS2A 1UZYA 5BY5A 4AEMA 4PHZA 1HV0A 4YFZA 1RUE2 1W9TA 2WL1A 1YI7A 3NNJA 2K46A 3POJA 4P5YA 2GNDA 1W3XA 2GP3A 1U12A 3RMXA 5HI0A 2PMWB 2NMOA 5CYYA 2ZGUA 4NHYA 2JDPA 1S2BA 1PK6A 2R30A 4LBQA 3OYWA 1RUD2 3H8XA 5LBBA 4LKFA 4A6OA 4CP0A 2UWAA 2VMIA 4DUVA 4AGVA 2BVBA 3DYPA 1H0BA 4GQ7A 2WZR1 4JHTA 3VBFA 5JR2A 1UY4A 2VCAA 1C1LA 4XJ9A 5L9RA 3RZKA 3NV1A 5FMBA 1TME2 2D6PA 4MYEA 4F3JA 1EUTA 2KD7A 2OT7A 4OLLA 3UKTA 2BGPA 1MQTB 4GMP0 4AHWA 2G9GA 4QU2A 3F95A 3GCXA 4XW3A 4PQQA 3IPVA 4XJ8A 5L7OB 1LULA 2WKKA 2ID4A 3W21A 4CCJA 4OUEA 5EJ3A 2SLIA 4DIQA 5FLHA 1OOPA 4XDQA 4CCLA 2OYZA 2J1AA 4ASLA 1N3QA 4XACA 4K3UA 1SLLA 5FYCA 5GZEA 3BTYA 4NIIA 2JIJA 4OHYA 4QGNA 1C5IA 3B3QE 5FPAA 3ALQA 4CXYA 1SCSA 1OT5A 2RR12 2ZGPA 4ZU5A 3ZYRA 5KXCA 1AR91 2PXJA 4DUXA 4KBBA 3LKJA 4SLIA 4W6XA 4Y26A 5FBJA 2ZJCA 1H2KA 4LJHA 4NPMA 3WDWA 1JHJA 4GKYA 3BYWA 2A7AA 5CU1A 5CA6A 2R073 4Q4V1 3M70A 1N3OA 3MFCA 4ISQA 5LA0A 3SCHA 3RWKX 4AOCA 1F4HA 2WT2A 3DPRB 3ORJA 3VGIA 2GZWA 3IBMA 1XE7A 3OGJA 2JG9C 2EIGA 5D21A 2UY8A 4JAAA 3V0AA 3GHMA 1S0GA 2ZEZA 4LOTA 5FAXA 5ABJB 5FWJA 4NAOA 4LBNA 4G4FA 1TQ5A 1V6MA 1WLWA 2DFBA 1W2AX 3J7NA 2GMMA 4QU1A 1VALA 1W6PB 1D4M1 1DQ2A 5DAVA 4BYYA 3VDBA 3NJVA 1UD1A 3PMSA 4BLIA 1PX4A 4MGYE 5DXDA 4H7LA 1DQ1A 4WV8A 3FN9A 5FY9A 3H8OA 2R072 2CWMA 3EB7A 2VW1A 1MR5A 2ARXA 4LORA 1ZRRA 3OBRA 3H1WA 2VQAA 2SBAA 4NPLA 5JI7A 1NLSA 3AJYA 3FBYA 3FHIB 5I8YA 4M3CF 1HB2A 1YEWA 2LUWA 1ND3C 2LTNA 4A2UA 4EROA 5A80A 4MVTA 1PM4A 2ATFA 1FT9A 1K12A 2AUYA 4AI2A 4HL0A 4DINB 1IKQA 4EE2A 5ACA3 1W6NA 3OD4A 4I3PA 2ADDA 4GAZA 1UX6A 3U4SA 3GZTB 4AK3A 5FPUA 1XB9A 2BP6A 4R4ZA 3KVAA 1QMJA 1I5ZA 4E8DA 3POSA 3M2MA 4MGSA 4QQPA 2QQNA 2WUHA 1W8ZA 3NJYA 2DTWA 4AGRA 1LB2A 5GZGA 4XJZA 1REEA 3PUQA 4XMIA 3LA7A 1NZCA 2YB7A 5FZCA 2OZ6A 1YJKA 3ZYHA 4EN8B 1F5FA 1GOHA 3R4DB 2IFRA 3AVRA 3MPPG 5EP9A 1OI6A 4CDXA 2ARAA 4E9KA 3PLQA 4FOQA 4XF4A 4DMIA 1PZ8A 1MEC3 2VBBA 4BMBA 5DN2A 4EN0A 5BNOA 4NPRA 3BALA 4P9WA 5ACA2 4ZZ5A 1SLAA 1EAH1 5L9VA 1JH5A 1S0CA 5I8TA 4QXHA 4UFIA 3ZSMA 3ZXKA 2NM1A 5FZ0A 1UU6A 2QZ3A 4FFIA 1FPN2 1UOGA 1RIRA 1RHI1 4Y5TA 4D7TA 1UCXA 1XNKA 1MZEA 4B4RA 5FO8B 1J3QA 5FMOS 1UU5A 4ARYA 1MEC2 3O1TA 4CEYC 4LLFA 1AJKA 1AJOA 1OLMA 2IXHA 3LOBA 3F2ZA 4IEUA 3AJZA 1SBEA 2W95A 2J42A 2Y60A 1LOCA 3OPTA 4FTSA 1OD3A 2CDPA 4NIGA 1W2UA 5C4WA 1BEV3 1QXJA 4IV3B 1FMD3 2EXIA 3LSEA 3ZM8A 4AQSA 4PIZA 2JKBA 2QCSB 4ES8A 2DV9A 1GR3A 2D6LX 2GN3A 4WVZA 5FMOL 4COWA 3WF4A 2EICA 2BNOA 4MADA 4UI9L 5LA2A 4CYDA 1H1MA 1OA3A 2WS93 1POV3 3W58A 1DCSA 4WM8B 2TEPA 3CQOA 3M7AA 2CGPA 3N9OA 3WNPA 1J83A 1ZRFA 1V6IA 1CJPA 1HJFA 2WC2A 1FAYA 3VBSB 3H3UA 3U1XA 4BM8A 5T3NA 2TBVA 1RUC1 2AEYA 5A7WB 5C71A 1BEV2 1I5PA 1FMD2 4JTNA 1OHFA 1HB3A 3QH7A 1JZ4A 2WWJA 2K0GA 3W9AA 2WJSA 4I01A 3VBFC 3NAPA 1AUYA 5IYYA 2HYXA 1HV1A 2PAKA 1LOGA 3HT2A 3LF7A 2FBEA 4OULA 4XZPA 4DRRA 2DCYA 2XJVA 2WS92 4OCTA 2OKXA 1WCQA 3M3IA 2D6KA 5GM0A 1HB1A 1ZZ6A 3CZUA 1DU3D 4C1WA 2DYCA 4CDWC 2Q1FA 1W9SA 5LY2A 5TSWA 4OZXA 2X5IB 3N7MA 3PVOA 4LBLA 2A3XA 4GWNA 4Y20B 3NWKA 2BZDA 4K7JA 5FXZA 3EHKA 2VMFA 3C7OA 2ZS6B 3MUZ1 3IWZA 4N90A 4Q0UA 2XUEA 4D6QA 4LA2A 2BFUS 1ZVFA 4P00B 1X36A 1R1A2 2B5HA 4LT5A 3T0BA 3R05A 4L2NA 2GNMA 3FBMA 5JZGB 3MPBA 3B9IA 5CBLA 1X8MA 3FJSA 3CU7A 4QDSA 2WBKA 1VBB1 4GMP3 5T5JA 4TZDA 3LEKA 3N7KA 4CCMA 5BNQA 3QD6A 1EV11 2DF7A 1FNZA 1PMHX 2VMCA 4FPHA 5FPZA 5F9TA 2XKOA 4X8PA 5A6YA 1NA1B 2BGOA 1W3VA 1ZBA3 3MLKA 4MH0E 4MZUA 1ACCA 2VUDA 3HNYM 3DN7A 4QQHA 2OQ6A 1UYPA 1V9U3 1OXCA 4ZONA 5HCAA 1LOAA 4RS5B 4LIUA 5DAXA 1LHVA 2ZGTA 3CHXA 1S55A 4FP3A 3ZMOA 3CJXA 3OGRA 1Q8OA 3OBTA 1H9WA 2DVFA 3T0DA 1OFSA 1VLNA 5LA9A 1E57A 5FXXA 1QJY3 2OZJA 3RG0A 1SEFA 2JDHA 3VL8A 4E2QA 1JZ8A 1XOYA 3B69A 2BGCA 3CJIC 2ETEA 2VMHA 4FPJA 4W6WA 3J7LA 5KXEA 3DKQA 1YNAA 4YM0A 2W94A 5I0UA 5C8CA 1QJEA 1ZBA2 3SEPA 1J1LA 5T54A 3C3VA 4H7MA 2JB4A 1Z7S3 1V9U2 4YVWB 4RL7A 1PX3A 1FNYA 4YLZA 1RUE1 1A3KA 2WWUA 1KRIA 2J1EA 2QQJA 3OEAA 3POIA 4N8MA 3LDRA 1L7RA 2WSVA 4IE6A 5KHHA 2J1UA 4Q4W2 4DXTA 4MUVA 3OJBA 5FUIA 5A7WA 4AQ6A 1F9KA 1QJY2 2GSYA 3FHQA 1JUIA 1UL9A 3ST7A 2K2SA 2L9LA 2C9KA 2W0XA 1A6CA 1UWWA 3MGUA 4UOJA 1ZREA 5KXDA 2DBIA 4GULA 1GNHA 2F6BA 1NT0A 2ZMLA 3ZR6A 1SDWA 1KS4A 1JBCA 2AC1A 1G9AA 4CDQB 1Z7S2 5LATA 1UIJA 1XNTA 1ULCA 2VNOA 1BLZA 3DF0A 2VH9A 3EMRA 3PNAA 4O9EA 4RQPB 1RVF1 4QXCA 1MQTC 1U5YA 1XYPA 3I2IA 4ZS3A 4DOUA 2VQ0A 1HX6A 5F7UA 5FJKA 2TUNA 2VTXA 1XYNA 1E5RA 1K5MB 4HFSA 2GMPA 3ZDSA 4AEDA 1UU4A 5L7OC 5ANQA 5E16A 4AR2A 5I0SA 2Y6KA 5LK7B 2RHPA 1MS9A 2XJPA 2IFWA 3JB8A 4XCAA 5EWSA 4Y20A 3T09A 2B9UA 5BUVA 3LIHA 5IUQA 3ZXAC 5JAXA 5JXHA 1PGL1 3OY8A 1OPOA 1W8OA 3N7JA 1LEDA 2WA3A 1SBDA 2ZA9A 2WZR3 1ZM1A 4R9AA 2ZHLA 4BXSV 4CP9A 4JGYB 5FTTC 4MHRA 1GWMA 1OUXA 1UMIA 2RV9A 2VXRA 5FOBB 2WR9A 2A6VA 4URTA 5C3OA 5I0RA 4KU7A 3T30A 2RVAA 3VHRA 4META 1EP0A 4QX2A 3D0SA 4HKLA 1QJZA 2JD4A 4V2VA 4Z8BA 1GNYA 3PUHA 5A1AA 3DPRC 3MIDA 5A1LA 2VZVA 5A6QA 1OMIA 4WM7B 5LWBA 5ABJC 1DYOA 2CV6A 2YGLA 2ZBJA 1QEXA 4AFBA 4IEQA 4Q4X1 1XNAA 1VE0A 1YO8A 2WZR2 3TN91 5BPXA 3PUAA 1VJ2A 2WYSA 2OIIA 4OHVA 1AR93 3WW2A 3PVBB 2FMDA 4AVTA 1UZ0A 3MDPA 4P02B 2E33A 4Q4V3 2IZWA 3P6BA 4RGGA 3KHCA 1OKQA 3I49A 2J1TA 4PQ9A 2QBXA 5A3TA 2XLAA 2OUJA 2P3KA 2Y33A 3OEBA 3H9AA 1DZRA 3I2GA 3U11A 5AFEA 3N7LA 1O3RA 4GALA 1JYIA 1WLCA 4R9DA 2G4IA 3WW1A 4E2GA 4YW1A 2VM9A 1CPNA 1D4M3 1JHNA 2A6ZA 3BU7A 4GH4B 4R52A 4UAPA 4BE3A 4FSJA 1PIV3 3EO6A 5G04L 2BEOA 3NV4A 4LLOA 5FO7B 3AX4A 2ERFA 4QX1A 3WNKA 3WUDA 2R16A 1VB2A 3A23A 2DCKA 4Q4V2 1KXGA 2JX9A 4QB1A 1G6NA 5HCBA 4NIAA 1ODMA 3RRDA 2ZACA 2VQUA 4YVSA 5FY7A 3M8LA 4NHMA 5LA1A 2WAAA 4LK6A 2XBO1 3RVHA 4EQVA 4ZHNA 2ORXA 3PL0A 2D5FA 4KH9A 3AP5A 2YBSA 2ZTNA 3C7HA 3N36A 3ZFEB 4CVUA 4XXAA 2QVSB 2B8MA 5GLZA 1O8PA 3U75A 4P9LA 4Y1XA 1X82A 4IESA 4XIKA 1VPHA 1D4M2 3S0MA 3FLPA 4L8QA 5L19A 3MZHA 1ENQA 1FV2A 1S2KA 4CDQA 2VO5A 2Z4FA 1OA4A 1YJLA 3FLRA 3ZFFB 1UOFA 1US3A 2VZSA 3G7DA 3THPA 4RQPA 5FOJB 1JYNA 2GH8A 2DUQA 2PA7A 2NQYA 5GLVA 3AKRA 3N9PA 4XVHA 1QHDA 2J1SA 2V5YA 3B02A 4C1XA 1CAVA 1SLTA 5FZ8A 2ILMA 3ACFA 1GZ9A 2YFUA 1FPN1 1H4GA 1O4YA 3ACHA 2QDRA 3BGAA 3I3BA 3WQBA 1W0OA 2JE9A 3C7EA 1AZDA 3P1IA 5HCHA 2XLFA 3IMMA 3R0RA 4QKDA 1JYVA 1AX1A 3MBWA 1BYHA 2ZZQA 5J3UA 2GALA 1VP6A 2D6NA 1OKOA 1EAH3 1TNFA 1BBT1 5AC91 3TAYA 4XPVA 5LEJA 2XKPA 3OBAA 4IV3C 1G9FA 3T1LA 2DVGA 1JXNA 3WG3A 2Z2SB 3L2YA 3WDYA 3R4UA 2QJVA 1JOJA 2VUAA 1N47A 4IXLA 4BOWA 1RHI3 1RYYA 4V1PA 4XHBA 4AVCA 3ELNA 1ZBE1 4NWVA 4LEJA 4ORFA 2XPJA 4WM8C 3AYEA 4JQTA 3WP5A 2XWJB 4B8EA 3RMYA 2VVEA 1C8M1 1X9PA 4Q29A 4W65A 3THCA 4TLGA 3OGVA 4FOYA 3VBSC 1WLTA 4AYUA 2W08A 1EAH2 3IKWA 3ENRA 1UQXA 1CESA 5I8SA 2VXJA 1OURA 3T2PA 1OF4A 1PNFA 5C3RA 1NE6A 5FZLA 5FREA 3M3QA 2VMGA 4HKWA 5LASA 3RWNA 2BNMA 3I3MA 1RHI2 5C3QA 1DYPA 1UAIA 3DEMA 4BIFA 3O1SA 2QQMA 1KFUL 1NLRA 4QM9A 1WW6A 4IEWA 1H2LA 5JSRA 1W6MB 1FV3A 5ERLA 3WHUA 4NHXA 2XWBB 5APAA 2YDEA 5F5IA 4XFGA 2XVGA 3I97A 1W9YA 3OGSA 4X6QB 4XETA 1J84A 1STMA 4D69A 4YZ5A 1T6BX 4QQOA 2YC2A 1RUC3 1VBC1 2X5IC 3D8CA 1H2MA 3CZJA 2X10A 5HXVA 3T0AA 1CVNA 1FI2A 1F31A 1UXZA 2EF6A 4OMDA 3CO2A 1QDCA 1SACA 3MIBA 1LAJA 2YG0A 2PQQA 1FOD1 3A7QA 3ZMNA 2WNVB 3CIHA 3N9LA 4HMZA 3GCWA 4BQ2A 4N9IA 1LU1A 1SDDB 4UF0A 1LU2A 2JG9A 1JI6A 2R1BA 1UNBA 2R0FA 3ZFEA 1AR61 5FZEA 1PHMA 1PVXA 4ZXEA 5FYMA 5JZGC 5EJZB 2WNUB 4UYBA 1IPJA 4IEOA 2PAEA 2BBAA 2R49A 4MGQA 4XMAA 1WBFA 1BK0A 1YI9A 3IIAA 3K4ZA 5JOZA 3ZFFA 2W52A 1TMF3 2XHNA 2WZEA 3INAA 3WP6A 3WHTA 2XJSA 3RYRA 5A6XA 1WMFA 4IE4A 1LENA 4UXAA 3RPQA 4UW4A 3PTYA 4EJRA 1HXS1 3ZR5A 3IMNA 2VNRA 1F4AA 2YU1A 4OMCA 1UY0A 1Q8SA 5M0TA 1XSRA 4XUNA 5LEKA 1S4CA 1QWRA 1UY3A 3KV9A 4RS5C 5A33B 5IAXA 3HIFA 4NN0A 1W2NA 2Z69A 1WMDA 5JUVA 2CHHA 3RZMA 1ULEA 1MS1A 1QNWA 1E5IA 4XTMA 1VBB3 1ND3A 4PIYA 4P9JA 3TB0A 2P3JA 3OF1A 4BPZA 1HQNA 3JU9A 2CAVA 1EV13 3RS6A 1O6UA 4MLOA 3ON7A 5IAVA 4BMEA 4AEJA 1Q43A 2MNGA 4RR3B 3ECQA 5CFCB 2ZX0A 1R081 1YFUA 1QOSA 3MLLA 3OUHA 2GC0A 4EWAA 2WDBA 4YVWC 1XRUA 5FXWA 3BB6A 1U5ZA 3L9JT 1QJU2 3HOBA 5F5QA 3KF5A 1YHFA 1XNBA 3O1UA 1GQPA 4XBLA 3SCGA 4AF9A 1VBB2 2BERA 3VBRB 3VHPA 1H4HA 2B4KA 2HWD1 4XOGA 3O1VA 1RITA 4Q4W1 5AFBA 1GZWB 4COZA 1IHMA 1OVPA 1ST8A 4TSVA 5FJHA 5FY5A 1RMU1 2ZGMA 4HKOA 2MEV3 1EV12 4R9CA 3ZYGA 2DU1A 2ZZJA 4JX0A 3ZVXA 2JDNA 2XXZA 3CKHA 2RDNA 3KSCA 4IEZA 2V4AA 2Y6LA 4BK5A 4LUMA 4AVAA 1Y9MA 5CKMA 1UZZA 2WFPA 3AP4A 4CDQC 4A4AA 5DMYA 2QQVA 1RUE3 4Z92B 3JXSA 4RQPC 2J1RA 1QNYA 2XJTA 3MIGA 3NKTA 5KR7A 2YPJA 1BXHA 1EPWA 3JCIA 1W28A 1JOPA 1K5MC 2Z42A 2WABA 3FLTA 3K3OA 4PLNA 4CEYA 4M3CA 1WCUA 5LBCA 2TNFA 2IVJA 3DECA 1W90A 3H1MA 3W5MA 3HNBM 3LPGA 3HBKA 1MS3A 4BQ4A 3S7IA 3GBGA 2YUEA 1G86A 1UYZA 4FO9A 5K8SA 4M01A 4JGYC 4XEZA 4U2AA 2W92A 3AKTA 5B4XA 4B4QA 4K1ZA 5J1XA 2X29A 1YQ6A 3GBWA 2K9ZA 5FCCA 1WLDA 3I2FA 3PIJA 3SKVA 3O1MA 1CGPA 1TME3 3KM5A 4XAEA 1RVF3 3M1HA 2W5FA 1H30A 4P9YA 4AI1A 4O9GA 5DDJ1 3NNLA 5FWEA 3CNAA 3I3DA 5FP3A 4FTBA 1N1YA 3I2JA 2VC9A 3TBDA 3WF3A 5JXJA 1GQHA 3ME2A 4JQRA 4WM7C 1IOAA 1X50A 2ZEWA 3D82A 5LK5A 4L0PA 3ZDVA 2GAUA 1Y9QA 4GJYA 4ONUA 4HVQA 1UPSA 2GC2A 2D6OX 4OUMA 3AM2A 3POFA 2XVLA 4AL9A 5LCWL 1ASJ1 4J25A 1XJAA 3WV6A 4CPBA 2RR13 2ET7A 1CX1A 1DYKA 1ENSA 4YW3A 1RVF2 5LBFA 1H8TB 3FE5A 4CCCA 1JYXA 2YZ4A 4CP1A 1VAKA 4CDWA 5FK7A 5GJ6A 2YY1A 1LHOA 3ZYJB 2FQPA 2WLPA 2ZOEB 3CDZB 4C0BA 4DUWA 1ZA4A 4XFIA 4ASKA 1PGL2 4IETA 1FX5A 4C91A 2ARBA 5D8AB 3TN93 4GH4C 2WLQA 3SCFA 4D7SA 1SFNA 1SPPB 2EIDA 2Q1MA 5IJRA 5J37A 4GKXA 2QUOA 4Y22B 1BVVA 4AQ2A 1M06G 1S0BA 5FP8A 3BIEA 3RGBA 5IFTA 4LUKA 2WINB 1G9CA 1W6QB 3DV8A 4K8FA 3UKNA 2I74A 3ZN6B 2G9ZA 3VD7A 2RS32 1JYWA 5J36A 3USUB 3UT0A 1K42A 3BI3A 1YYNA 1OPMA 1QQP1 2UWBA 3WP3A 3E1F1 3ZFEC 4E4SA 5KXBA 4HPKA 4Q4X2 1KJLA 2OPWA 3PVNA 1GYKA 4A45A 4KI5M 4XF1A 3T1MA 3TN92 1XU1A 2P3IA 4HG6B 4A3XA 1Q56A 4OQ9A 3WF1A 2KA3A 3OCPA 3ZFFC 4RD7A 4QMAA 3PVEA 4MSVA 4AQTA 3ROUA 3D4KA 4B7KA 5K4LA 4K21A 1HW5A 3N9QA 2E7TA 1DGWX 4LA3A 3H50A 1RGSA 4JRLA 1X9TA 4TXWA 2FCUA 3VB9A 5C3PA 1KQRA 2XBO3 5FMCA 3ZXEA 3B5LB 3MO4A 2W46A 1F2NA 3HT1A 5CIRA 3VBHB 1MACA 3ETQA 3PJYA 4AHZA 4CDUB 3TEYA 5JSPA 2JDYA 2QQUA 4QGMA 2LM3A 1E5HA 3CJIA 4Y5Z0 4K40A 1WUVA 5FZ3A 1Q3EA 5FYSA 2E31A 4QXKA 3KGZA 4QQ2A 3WUCA 3E6DA 2GMEA 4HK8A 1UYXA 1CZTA 3T4VA 4AI3A 2G19A 2HBUA 1W8UA 4YZ3A 5GLUA 5ISLA 3TRSB 3CL1A 4XQWA 3H3LA 4E4ZA 3K3NA 5CFDB 2O1QA 4IEXA 4E4HA 2NP0A 2XUMA 4LBQD 4LKDA 1BMV1 1UOJA 5LW9A 4QX3A 2XBO2 2Z5WA 1FPN3 4MXWB 2WZPP 4DQAA 1LGBA 2WIIB 3EQEA 4JKMA 4CUGA 3WG4A 1J3RA 3UJOA 3T4HB 3QACA 2D93A 2NYYA 1IS6A 1RUG1 1UX7A 1W6OB 4LQRA 3C7GA 2QFEA 3ZOIA 4ZPIA 3AZZA 1ZZBA 2A6XA 4CU9A 2FCTA 1BBT3 2FD8A 5AC93 1G7YA 1OLRA 5A7OA 1GZTA 1UKGA 5FZDA 4L97A 4IGQA 3VZMA 3MFAA 2PHWA 4FFGA 3O1OA 2Y6FA 5C9AB 3AB0A 1MQTA 4BQ3A 3NVCA 4LO6B 4XUPA 3WD5A 3S5AA 3ZKUA 1BCXA 5L7OA 1ZBE3 2ZX2A 1C5HA 1LHUA 5FZAA 4D94A 2DCJA 4AVBA 5FPBA 5HV4A 5FZ1A 1DGRN 4MHUA 2WO7A 4H2AA 4CTEA 1S1AA 1C8M3 1WWYA 2A70A 1HQLA 4HANA 5A3PA 1SPPA 2P3YA 2XJRA 3CEWA 1QIQA 1ULDA 3PTRB 5BXXA 3U0ZA 1BBT2 5H9SA 3DXTA 5AC92 3K4DA 1QH6A 1CD3G 2AGSA 2G9FA 2NLRA 4FPLA 3BPSA 4YW6A 3ZPOA 4DY5A 4R8HA 3KVBA 2B7YA 2D3PA 1ZX5A 3WF2A 2WNVC 1GLHA 1NXMA 4LULA 3VN4A 2MHFA 3DPRA 5BYNA 5KC5A 1HDKA 1ZBE2 4XQ4A 3N3HA 1JMUB 1UIKA 2HWB1 2VPVA 3BOWA 3E6BA 3MLJA 4LTAA 4OHWA 1DGWA 1OH4A 4COVA 4COYA 4DXZA 5ABJA 5JOYA 2WNUC 3VL9A 3V64A 1C8M2 3KQ4B 1YCIA 3VBOB 3ZFGB 1W6PA 1DQ5A 3LEGA 1OLME 3T3YA 1VBC3 5FPXA 3RZLA 1NZIA 4GIQA 3WDTA 2VY0A 3LAGA 2GH2A 4HSJA 4N53B 1JZ7A 3WG1A 3FUOA 2ZAAA 2P17A 2B42B 4O61A 1FOD3 5JXGA 1URXA 4E8CA 3U37A 4CDUA 4B29A 3NJXA 2BUKA 3LB9A 3KMHA 1GP6A 2BWAA 1AR63 5F5CA 1R1A3 4AW7A 1OQ1A 3JUUA 3O14A 4XCBA 5F3IA 5HCFA 1YLLA 1TE1B 5DUXA 4S2FA 2OVUA 2WO2A 4A6SA 4A42A 3A21A 4YG3A 4QGLA 3IDCB 4ZZ8A 1GP5A 4WZFA 1VBC2 2ZKLA 5KC6A 4S2HA 1GANA 3O0XA 2ZEXA 4GWIA 3AZVA 4BISA 2IXIA 5F32A 4QX7A 4DFSA 1AX0A 1HRI1 1HXS3 1P8JA 4RR3C 5CFCC 3VD9A 3V0BB 5FZGA 1FOD2 2O0OA 1WGPA 2IXCA 1TVGA 3P3NA 4FPGA 4K9SA 2NPIA 3MUY1 4AEKA 3TWIA 5IHRA 2XJQA 1AR62 4GZ9A 5FP7A 2DU0A 1C57A 5FXVA 2HWF1 3HN1A 3VDDB 3FZ3A 1XPWA 4Q0SA 1PO21 4AAXA 1JZ6A 2EAKA 4QWNA 1IZ3A 1QJU1 2UWCA 1LCLA 2ZXQA 2PAMA 2PELA 5ANNA 4YW5A 3VBRC 4ATEA 1NCRB 4FOVA 3WW4A 2VU9A 5T5OA 1DZTA 3WEZA 2LRPA 1AVBA 2JKXA 2VVFA 4NRPA 4O65A 5C9AA 1PGSA 3GGLA 4AI0A 2CU5A 3JB4C 5EJ1B 1R083 4H14A 5IW0A 1HXS2 2JICA 2RDSA 2W91A 5JSOA 5F5AA 1WD4A 4L9BA 3WNLA 1GFF2 1F15A 2FZ1A 3PHMA 4PDWB 4KGGA 3ETPA 1DG6A 4KL1A 2GC1A 3NQHA 1LHNA 4Q0PA 5DUUA 1G9DA 2ZGOA 3GZEA 3ZXDA 4EYUA 5LRSA 3OUJA 1S0FA 1YQ8A 4I0BA 2BQPA 4LE4A 4LMFA 4Q4W3 1SLCA 1LOFA 4MO3M 2RMU1 1BJQA 3PURA 4INDA 3ITQA 4QHZA 1RMU3 4HVRA 1CR7A 4IE0A 3S7EA 4IV3A 3HQRA 4HVOA 1N1VA 3TOJA 1RUF2 2XQRA 2ZGKA 2ZHNA 1R082 1AF9A 3O1RA 3CF6E 4M0HA 1POQA 4J1WA 4JTOA 4O7XA 2JD9A 2QE3A 2D97A 2AYHA 1QJX1 5T52A 1FXZA 3VHOA 1Y4WA 2FDIA 1QXRA 4WM8A 2OW4A 4IDZA 4J1XA 3GXUA 3HEIA 4IV1B 5DG1A 2D44A 2D5HA 4PIXA 1DLLA 1FATA 1WA6X 2HWD2 3VBSA 2N7GA 1DBNA 2RG4A 4IE7A 5FFOC 1U5IA 4TN7A 3AXEA 4EN6B 1RMU2 4Q4Y1 1W2TA 4IUGA 2CTVA 4YM1A 1Q8PA 2C26A 4QXBA 1WW4A 3V56A 2HKXA 3GDBA 1GWLA 3QH6A 4Y24A 1GV9A 4XFCA 3BOPA 1W03A 5JDBA 2Y38A 2O14A 3LFMA 1RUOA 4KU8A 4W6YA 3WLUA 5J7MA 3BIWE 4NIHA 4P9IA 3HNMA 1H8TC 1C3HA 2PHXA 3MW2A 3KT4A 5DDJ3 4EWDA 2RJKA 1V6NA 2EIEA 4QM8A 3SNMA 3LGRA 3E6CC 4B1LA 5CB7A 4PLMA 1Q5OA 1G8WA 2X5IA 4QDQA 1XSQA 4F83A 2PLV2 2VR4A 1UPIA 1LHWA 1ENXA 4Q1PA 5F2SA 5FYYA 2DUPA 5D8AC 4QX0A 5A3UA 4A3ZA 1ASJ3 5JCTA 4K1YA 2JG8B 4FQZA 4D3WA 2Y34A 5FY8A 3NW4A 2XJUA 3VDDA 4A41A 4UW5A 2DVAA 5JZGA 1ENRA 1US2A 4N43B 2HLEA 5DDJ2 5FQ0B 2VG9A 5J48A 4UBHA 2LS6A 3VD4A 1I1EA 5F39A 1Z0HA 5FZ6A 5CISA 1JZ5A 3BTXA 3E5UA 2WQ8A 2RS31 1VMFA 2ZGRA 2RJLA 1HB4A 3I7DA 1NA1A 3ZIWA 3I8TA 5IVBA 1ASJ2 3S57A 3T08A 4UW6A 4YGEA 3S30A 4TLFA 4RS5A 1JTZX 4K6BA 5FZ9A 4XZUG 5JOWA 1MS5A 4B1MA 4XC9A 3UGHA 2ZGSA 4GWMA 2YGMA 2VZ1A 4PLOA 5FO9B 2VBDA 2HWC2 1VRH1 1TEIA 2VJXA 1O4ZA 2QQPA 2PHUA 4QPIB 4ITCA 3VBHC 2Y26A 5JI9A 4KWJA 2VZUA 4AVSA 4CDUC 4LR4A 5FYIA 4FPKA 5IK8A 2HEWF 2R061 4YW7A 1S2EA 1QQP3 5C33A 1X33A 2G1MA 4XAAA 4DZGA 1NE4A 3JD71 5JWPA 4YFWA 1WCDJ 4Q0VA 4ZXKA 5JPNB 3I59B 3JBG1 3N9NA 4IL7A 2DTYA 5DZEA 2GNBA 5F6KA 4IW3A 3ZN4A 3TNPB 3J9SA 3BODA 3LDKA 4UFJA 1PZ9A 1NLQA 3LD8A 4AFDA 4YVWA 2Q30A 1PMJX 3POWA 1HN0A 3B9CA 3WDVA 3NNMA 1UY2A 3K48A 5CFDC 4QPGB 1N1SA 4Q5OA 3MV11 2D6MA 1V6OA 1RB8G 3SQOA 3WQ1A 2Q4SA 4F8AA 4GWJA 1C28A 3LZZA 2FDJA 1KJRA 2Q8EA 1JU3A 3Q8CA 1C4RA 4KQ7A 5F3GA 5BNNB 1QQP2 5GKAC 1YQ2A 4WZCA 3ZPYA 4AE2A 3FWEA 5FV3A 5IK4A 1CZVA 4IE5A 2XH6A 2EIBA 2WN2A 3EXUA 3D5OA 2WAOA 5KHIA 5C9AC 5J98B 5A6ZA 3B94A 2ZGQA 3FMGA 2JDAA 2RS51 3ZXLA 4E4DX 1W06A 3NKGA 1JS9A 1K5MA 1IQDC 4DXRA 2YYOA 1DP0A 2GN7A 2JDUA 4IEPA 2PFWA 1ZRIA 4HK9A 5FYHA 3KZ4C 3GZAA 3MI8A 5IK7A 4DRVA 1RUG3 3HQXA 2WN3A 3IDBB 5GLWA 1ZZCA 4CUAA 4JGYA 3RJRA 3QOPA 3A4UA 4KWKA 3Q8EA 4KG0A 1LOFC 4Y33A 4MX3A 3J4UH 3RZGA 4LK7A 3PU3A 2B45X 1D0HA 3DGTA 1SG3A 1V6KA 1AR71 3IDEA 4N43A 5FQ0A 3IB3A 3H42B 1BMV2 1XE8A 1CAWB 1X7NA 5FLIA 1XC6A 2VZQA 4KWLA 3RSJA 5CG8A 2DVDA 3AL6A 5A3MA 5FY4A 2C5DA 4WM7A 2E32A 1MZ5A 2VZPA 3Q8FA 5FZKA 1OC1A 1LGNA 2IC1A 3VBUB 2XONA 1ND2B 1RUG2 4XILA 1S0JA 3VBOC 3ILNA 3OD0A 1W0NA 4UT5A 2XG3A 3ZFGC 3GZUC 2FDFA 3UV9A 3G6JB 4CCDA 1NCQB 4N53C 3LA3A 4S2DA 1LKNA 4QQLA 5JIAA 2FDGA 3ILFA 4LKEA 4YM2A 3ZN5A 4BQYA 4UW3A 4CCEA 1YC61 2XOMA 5LB6A 3VHNA 1DDLA 1AX2A 1NY71 3APBA 4OYUA 3H1YA 1OQEA 2HWB3 2RE9A 2VW0A 4FPYA 3AMPA 1V00A 1UO9A 4KBZA 4NIDA 3I59A 5GZFA 3E5QA 3C8XA 4WVVA 4CRQA 4JVAA 4GH4A 5FMDA 5IWFA 1LOBA 1GWKA 1S0DA 5FUPA 2CGOA 3KCXA 2IXJA 1UOBA 2HBTA 3LIGA 3DKWA 2V09A 4QPGA 3PU8A 2Q8CA 3WW3A 4EZ4A 2I45A 2CAUA 5A32B 2Q5TA 4QPYA 2ZX1A 2BU9A 2WRAA 3R4SA 2DURA 3THDA 2PQSA 5FDBA 1GUIA 5T50A 1LJ7A 1A78A 5BNNA 2HWB2 5IVFA 5FY0A 2VTFA 5JLVA 4I2OA 1HRV1 3VDDC 2DFCA 3A0KA 4NWWA 4WVMB 4OZOA 4RSUA 1YIPA 3PJQA 3LFIA 1LNSA 4J6GA 4OUSA 5EHDA 1SHWB 5C7GA 1NCRC 2FCVA 1H2NA 3D3AA 2ZMKA 3KWVA 2KR2A 1YIFA 5C3SA 1KITA 5HPOA 2VOVA 3OUIA 2X09A 4NROA 4OHXA 5E89A 2OUHA 2ZHKA 1H1AA 3ZLIA 1QF3A 2RS11 1LR5A 2WZ8A 5H9RA 4QKNA 4Y3OA 1NA1C 1VBA1 2Y6GA 4FBFA 2UYAA 4CU7A 5A70A 2QQWA 4PDWC 1LECA 2Q8DA 2HWF3 1MPXA 2FMYA 2VCBA 1H6XA 1PO23 1LRHA 3QCWA 1IG0A 1QJU3 1ULGA 4LITA 3GJAA 2IXLA 3POBA 1IKPA 2VOTA 1Y3TA 4CUCA 1YFXA 1RC6A 3LSDA 4CSWA 2R6QA 1RXFA 1Y9GA 5CG9A 1KEXA 1PK6B 3H8RA 1W8TA 1HRI2 3AC0A 2DBNA 3OYWB 3VLBB 2YBKA 3K2OA 4BQWA 1AYM1 2BBVA 1ZA7A 5HXMA 3BUCA 1RUF1 4I02A 2JDKA 1IGOA 4LO4B 4C90A 5A3OA 2A3WA 5B4NA 4P14A 2HWF2 5FLJA 4JGZB 1PO22 3USSA 4LOSA 4YZ4A 5DAWA 5A7NA 1Y7BA 1PVC1 2ZABA 1WBLA 3WX5A 1J59A 5FPVA 4IV1C 1NCQA 2RMU3 4LO5B 5AVAA 1VAMA 5IVYA 5J09A 4I0WB 3W59A 4IEVA 1DGRA 1JN2P 1J1TA 4G3YC 4XBQA 3AZYA 3IPVB 4XF3A 5I93A 2ADEA 2VQTA 5SV5A 3FHAA 1K45A 1RUH2 2R041 5DPNA 3UL2A 3WDXA 5DG2A 1GKBA 1OOPB 1W8FA 4BQXA 1YWKA 2QKDA 1QJX3 3J26N 5T5PA 2KXLA 4YM3A 1RUI1 2ES3A 3VUOA 2D7FA 4ES9A 1QU0A 4I30A 3ZSEA 5EQUA 1SMVA 2AENA 1W8HA 1W6MA 3KD4A 5BNPC 1REFA 1J3PA 1UY1A 2AEZA 3OBZA 1LODA 3VDAA 2IUWA 5JR7B 3AMHA 1A34A 2QQLA 3NMBA 2RMU2 4OI4A 4XUOA 3AYDA 4BA6A 4MOAA 1H6YA 5A7QA 4Y4YA 5GLTA 3GF6A 2DCTA 1GICA 5A32A 3I4IA 4Y1YA 2PLV1 2H0VA 3POYA 1I9RA 3ATGA 1RXGA 2ZAHA 3J8F1 1V0AA 4HZFA 4P9XA 4AVVA 5JOXA 4SBVA 3V0AB 3KHBA 5A3LA 2WNVA 2BPA2 2JG8C 1LEMA 3KV6A 3L2HA 1QJX2 2WA4A 2AH2A 4JKLA 4AWDA 3SITA 4JC1A 2PHLA 2VZTA 3GHNA 1POV0 3GM8A 3WY6A 2HJIA 2WNUA 3MF6A 4TTGA 4N43C 4D0QA 2QZ2A 1REDA 1NQDA 4M3CE 1ULFA 1O3TA 3LE0A 2XGXA 4BLJA 4Q4Y2 5T5LA
chains in the Genus database with same CATH topology
2W2IA 4QU1A 2XDVA 5FYTA 2WWJA 2YPDA 2Q8EA 4QXCA 5A7SA 3ZPOA 3KVBA 5F3GA 5A3WA 5FZIA 5FJKA 4BU2A 5FV3A 5ANQA 5FY9A 5FP8A 3PUSA 5A1FA 3ZLIA 2VD7A 4TN7A 5FZFA 4QX8A 3AVSA 4Y3OA 2OQ7A 5FUNA 5FZHA 3KV5A 4QXBA 5FZBA 2XMLA 5FXWA 2Q8DA 3PDQA 2OX0A 5LY2A 4HONA 4D6RA 4LITA 5A80A 5FYBA 5FXZA 4ASKA 5CEHA 4DO0A 2XUEA 4D6QA 5FJHA 3AL5A 4V2VA 5FY5A 3U78A 4CSWA 5F37A 4GAZA 5A7PA 3U4SA 5FPUA 5IVJA 5F3EA 2GP5A 3KVAA 4HOOA 5A1LA 4V2WA 2XXZA 3N9QA 5F5CA 5K4LA 2YBKA 3K2OA 5A3NA 5LWBA 3NJYA 5F3IA 4AI9A 3PUQA 4Y33A 5F2SA 5FYYA 4GD4A 5FZCA 3UYJA 3PU3A 5IVVA 4AAPA 3AVRA 5FZLA 3PUAA 4Y4RA 2GP3A 4CCMA 5FP9A 5KR7A 5A7NA 5FY8A 5FZ3A 4BISA 5FPVA 3K3OA 5FZMA 5F32A 5FYSA 4QX7A 5IVYA 3AL6A 5FY4A 5FZKA 5FZGA 5E6HA 4XDPA 2OQ6A 5A3TA 5F5IA 4EZHA 5FY1A 4UF0B 4LIUA 2P5BA 5ISLA 4QXHA 4D6SA 5F39A 3K3NA 5FP7A 5FZ6A 5FZ0A 5FXVA 4CCOA 4E4HA 4IGOA 4XDOA 5FYUA 5LW9A 4NUBA 4QWNA 1VRBA 5FXXA 2OT7A 4CUGA 5IVBA 5F3CA 3N9LA 5FWEA 4CCJA 4LXLA 4UF0A 5FP3A 5FZ9A 4DIQA 4LIVA 5IW0A 5FZEA 4CCKA 4CCLA 3OPTA 5FZ7A 5FYMA 5F5AA 5A7OA 5IVCA 5A7QA 5FZDA 5FY7A 5FYCA 4IGQA 2OS2A 3RVHA 4GJYA 5IWFA 5FUPA 3LDBA 5FPAA 5FYZA 5FYIA 2WWUA 4C8DA 2YBSA 5FYVA 3OPWA 4GJZA 3KV6A 4EYUA 2PXJA 5FZOA 5FBJA 4BXFA 5FZAA 3N9NA 5FYHA 2YU2A 3PU8A 5F2WA 5A7WA 2Q8CA 3PURA 5FPBA 4EZ4A 5FZ1A 2YBPA 2YU1A 4CCNA 5IVEA 3KV4A 3LD8A 3DXUA 3N9MA 3N9OA 5FZ4A 5A3PA 5FP4A 3KV9A 5FPLA 5LY1A 4URAA 5IVFA 5FY0A 3PTRB 3N9PA 5FZOB 4IGPA 5FWJA 3DXTA 5A7WB 5FZ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W2I A;  4QU1 A;  2XDV A;  5FYT A;  2WWJ A;  2YPD A;  2Q8E A;  4QXC A;  5A7S A;  3ZPO A;  3KVB A;  5F3G A;  5A3W A;  5FZI A;  5FJK A;  4BU2 A;  5FV3 A;  5ANQ A;  5FY9 A;  5FP8 A;  3PUS A;  5A1F A;  3ZLI A;  2VD7 A;  4TN7 A;  5FZF A;  4QX8 A;  3AVS A;  4Y3O A;  2OQ7 A;  5FUN A;  5FZH A;  3KV5 A;  4QXB A;  5FZB A;  2XML A;  5FXW A;  2Q8D A;  3PDQ A;  2OX0 A;  5LY2 A;  4HON A;  4D6R A;  4LIT A;  5A80 A;  5FYB A;  5FXZ A;  4ASK A;  5CEH A;  4DO0 A;  2XUE A;  4D6Q A;  5FJH A;  3AL5 A;  4V2V A;  5FY5 A;  3U78 A;  4CSW A;  5F37 A;  4GAZ A;  5A7P A;  3U4S A;  5FPU A;  5IVJ A;  5F3E A;  2GP5 A;  3KVA A;  4HOO A;  5A1L A;  4V2W A;  2XXZ A;  3N9Q A;  5F5C A;  5K4L A;  2YBK A;  3K2O A;  5A3N A;  5LWB A;  3NJY A;  5F3I A;  4AI9 A;  3PUQ A;  4Y33 A;  5F2S A;  5FYY A;  4GD4 A;  5FZC A;  3UYJ A;  3PU3 A;  5IVV A;  4AAP A;  3AVR A;  5FZL A;  3PUA A;  4Y4R A;  2GP3 A;  4CCM A;  5FP9 A;  5KR7 A;  5A7N A;  5FY8 A;  5FZ3 A;  4BIS A;  5FPV A;  3K3O A;  5FZM A;  5F32 A;  5FYS A;  4QX7 A;  5IVY A;  3AL6 A;  5FY4 A;  5FZK A;  5FZG A;  5E6H A;  4XDP A;  2OQ6 A;  5A3T A;  5F5I A;  4EZH A;  5FY1 A;  4UF0 B;  4LIU A;  2P5B A;  5ISL A;  4QXH A;  4D6S A;  5F39 A;  3K3N A;  5FP7 A;  5FZ6 A;  5FZ0 A;  5FXV A;  4CCO A;  4E4H A;  4IGO A;  4XDO A;  5FYU A;  5LW9 A;  4NUB A;  4QWN A;  1VRB A;  5FXX A;  2OT7 A;  4CUG A;  5IVB A;  5F3C A;  3N9L A;  5FWE A;  4CCJ A;  4LXL A;  4UF0 A;  5FP3 A;  5FZ9 A;  4DIQ A;  4LIV A;  5IW0 A;  5FZE A;  4CCK A;  4CCL A;  3OPT A;  5FZ7 A;  5FYM A;  5F5A A;  5A7O A;  5IVC A;  5A7Q A;  5FZD A;  5FY7 A;  5FYC A;  4IGQ A;  2OS2 A;  3RVH A;  4GJY A;  5IWF A;  5FUP A;  3LDB A;  5FPA A;  5FYZ A;  5FYI A;  2WWU A;  4C8D A;  2YBS A;  5FYV A;  3OPW A;  4GJZ A;  3KV6 A;  4EYU A;  2PXJ A;  5FZO A;  5FBJ A;  4BXF A;  5FZA A;  3N9N A;  5FYH A;  2YU2 A;  3PU8 A;  5F2W A;  5A7W A;  2Q8C A;  3PUR A;  5FPB A;  4EZ4 A;  5FZ1 A;  2YBP A;  2YU1 A;  4CCN A;  5IVE A;  3KV4 A;  3LD8 A;  3DXU A;  3N9M A;  3N9O A;  5FZ4 A;  5A3P A;  5FP4 A;  3KV9 A;  5FPL A;  5LY1 A;  4URA A;  5IVF A;  5FY0 A;  3PTR B;  3N9P A;  5FZO B;  4IGP A;  5FWJ A;  3DXT A;  5A7W B;  5FZ8 A; 
#chains in the Genus database with same CATH topology
 1AXZ A;  2H0B A;  1U5X A;  3AKS A;  3FC0 A;  3VDC A;  5FYT A;  4PI2 A;  2W1S A;  4I0A A;  3S6P A;  3NV2 A;  5A3W A;  2JDM A;  5FZI A;  1W2O A;  1G9B A;  4FCA A;  2GDF A;  4HT1 T;  2IWG B;  5A33 A;  4ZU7 A;  1D4V B;  3BKZ A;  2J22 A;  1EYB A;  4NRQ A;  2WQ4 A;  1W6N B;  1QGL A;  4K8R B;  3LEM A;  1XQN A;  3VD3 A;  4AZZ A;  5FZB A;  4Y1U A;  3KCC A;  2HWC 1;  4QPI C;  3I3Q A;  3T2O A;  3THT A;  5FBZ A;  2VZ3 A;  3SIS A;  1IS3 A;  2NZ9 A;  1UW8 A;  3I54 A;  1ZNP A;  2B46 X;  2RS3 3;  2VE1 A;  4LBM A;  1J58 A;  3C7F A;  4XAB A;  5IT6 A;  2YFZ A;  4W50 A;  5EFU A;  5FYB A;  2EXJ A;  2PHF A;  2ZPX A;  4FPO B;  2V73 A;  4RR3 A;  1W9F A;  4FAH A;  4Q4X 3;  3MIF A;  4DO0 A;  5FKB A;  5CFC A;  3URF A;  4CDX B;  1CX4 A;  4XQD A;  1KGY A;  2BTV C;  2WFF 1;  1MZF A;  4KG8 A;  1O91 A;  3IM0 A;  3WXP A;  5DAB A;  1ZRC A;  4GXL A;  2VL4 A;  4JGZ A;  3FX3 A;  2XR4 A;  5A3N A;  1BQP A;  2FZ2 A;  2BYV E;  2V5D A;  5BNO B;  1V6J A;  1VRH 3;  4QPG C;  1HN1 A;  1RJ7 A;  2VMD A;  1WW7 A;  3IT8 A;  5I0D A;  4FOW A;  4TYS A;  3VBR A;  1JU4 A;  1VB4 A;  4QX5 A;  5E88 A;  3GJB A;  3MIH A;  2R06 3;  1GZW A;  4Y4R A;  4CP2 A;  1V70 A;  2W1U A;  1NQJ A;  3JD7 3;  3AYC A;  4RFT 0;  5BNN C;  1DQ4 A;  4CU8 A;  4FI9 A;  3JBG 3;  1VBE 1;  3KLS A;  2JJ6 A;  1E5S A;  5FZM A;  5DZF A;  2P2K A;  4NOT A;  2QQI A;  3MIC A;  2VZO A;  1O4T A;  4XDP A;  3J7M A;  1AYN 1;  2I07 B;  5C8W A;  3VZK A;  3T2Q A;  3MW4 A;  1UZV A;  4BZ4 A;  2WSU A;  2ARE A;  1S0I A;  1VRH 2;  3GYD A;  2ET1 A;  4IGO A;  3ZX7 A;  4AGG A;  4BHP A;  1XND A;  4FFF A;  5C4W B;  2C0Z A;  3MW3 A;  2YC4 A;  2D3S A;  3ACL A;  3NO8 A;  4RYD A;  1OF3 A;  3TNQ A;  4ASM B;  1ZYB A;  2R06 2;  2P6C A;  3HJR A;  1YFY A;  2VBP A;  1D0G A;  3JD7 2;  2HEY F;  1PM7 A;  1M4W A;  3KF3 A;  2ZEY A;  3JBG 2;  4FXG B;  3RZZ A;  2VCM A;  4XFB A;  3SC7 X;  4LIV A;  2BJS A;  3SH3 A;  1PZ7 A;  1H9P A;  1LOE A;  3H0O A;  4XFF A;  5IVC A;  2X05 A;  4QAW A;  2JE7 A;  5DUW A;  2E6V A;  3AZX A;  2RDR A;  1PIV 1;  1PGW 1;  3LDB A;  2RS5 3;  1PMI A;  2EXH A;  4C8D A;  4XFA A;  3ZIX A;  1JYT A;  2W3J A;  4RGA A;  4UFK A;  4PBO A;  2FHR A;  4YNI A;  4FT8 A;  4COU A;  5KWR A;  1WCK A;  1Q8V A;  2NN8 A;  4HN1 A;  5JIU A;  3U07 A;  3O1P A;  2D43 A;  1N1T A;  3VBU C;  3NAP B;  1Z78 A;  1ND2 C;  2XHK A;  4CXW A;  4QD2 A;  4CPB D;  1AR8 1;  3A0N A;  4FFH A;  2BW8 A;  3WT3 A;  1NCQ C;  4XUQ A;  3JQW A;  1RUJ 1;  1IQA A;  4CEW B;  1F5J A;  2RM2 1;  2GU9 A;  1VBD 1;  2VUJ A;  1UN1 A;  3ACG A;  1AR7 3;  2EVX A;  3ACI A;  4JHZ A;  1DF0 A;  2DUO A;  3WQ0 A;  3CBN A;  3WR0 A;  1H8T A;  2PHT A;  2RS5 2;  5A7S A;  4GA9 A;  1EPZ A;  1JZ3 A;  2GC3 A;  1OFN A;  1AHS A;  5E1R A;  1ULP A;  2LRO A;  4CXX A;  2PHD A;  2VNV A;  1L3J A;  1MS8 A;  2UUR A;  3DCQ A;  3H3Z A;  3PUS A;  3VKF C;  4YYO A;  4WBB A;  4YPJ A;  4NAM A;  4DPN A;  1XU2 A;  3AVS A;  4LHN A;  2BOJ A;  4BQ1 A;  5D8A A;  3WCR A;  4CUB A;  2VOW A;  3OOX A;  1MVE A;  3PUI A;  4X8N A;  4ZU4 A;  2E63 A;  4QB6 A;  2Y6H A;  4CE8 A;  2H6C A;  4JCK A;  2HYK A;  4Y22 A;  4QKB A;  1AR7 2;  5CEH A;  4ATF A;  5C5U A;  4Z2W A;  2C1F A;  3UK9 A;  3TEZ A;  3UNP A;  1AL2 1;  5CAZ A;  1PO1 1;  1W6Q A;  4LKS A;  3C2U A;  1TZO A;  4HOO A;  1U0A A;  3ZSL A;  3ZN6 A;  2O8Q A;  2XQX A;  4DS0 A;  3AKQ A;  2XVK A;  3OPZ A;  3O5S A;  3USU A;  3HQU A;  4A7K A;  1IG3 A;  3LA2 A;  3MF9 A;  4HN0 A;  1ODN A;  2CSG A;  5KHG A;  3ASI A;  3UYJ A;  2EAL A;  4JKK A;  3SEE A;  4BDV B;  2YC0 A;  1H8V A;  3ZKY A;  2Q8O A;  1WKY A;  1YQC A;  2A3Y A;  5FP9 A;  4B3N A;  4FAG A;  3UGF A;  3OG2 A;  5DQ0 A;  4JRA A;  2UYB A;  4NJ4 A;  4QKF A;  4DB5 A;  1QJF A;  2XB6 C;  4LHK A;  2WYF A;  4R4X A;  4Y5S A;  2MPF A;  2QTW B;  2E7Q A;  5EYY A;  4ZY9 A;  4OI0 A;  1NY7 2;  1W0P A;  4GB3 1;  4NMI A;  1D7P M;  2BOI A;  1R09 1;  3IAQ A;  2JB8 A;  3VBH A;  4TWT A;  4UBG A;  2A6Y A;  1COV 1;  1HRV 3;  2AR6 A;  5C8C B;  3HAG A;  1YFW A;  4OI2 A;  4YZ2 A;  2WO1 A;  4XDO A;  2WWS A;  3RNS A;  5C70 A;  4YG0 A;  5JXI A;  3M3E A;  4Q27 A;  4M00 A;  1AXY A;  3RYP A;  3VD5 A;  4KNC A;  4XFH A;  2YV8 A;  5FR3 A;  3H8U A;  1GSL A;  2PYT A;  3BN6 A;  3SMH A;  1PK6 C;  2DVB A;  2VAU A;  2H6B A;  1BVP 1;  5CFD A;  2RS1 3;  1QDO A;  5FZ7 A;  1VBA 3;  1ONA A;  4PT6 A;  1B09 A;  5T55 A;  4MXW A;  1O3Q A;  1WD3 A;  2Y64 A;  5EV7 A;  3M3O A;  4YGD A;  1HRV 2;  4QPW A;  4JGZ C;  4NHK A;  4XJU A;  4L11 A;  1GOF A;  3W5N A;  3AYA A;  1JOD A;  1W6O A;  4BXF A;  2R1D A;  4CA9 A;  1RIN A;  1B35 B;  4HSL A;  3M4F A;  4CEW A;  1VR3 A;  4M0N A;  4QT6 A;  1GQG A;  1TNR A;  3DXU A;  5LRR A;  4AED B;  4XUR A;  2JEM A;  1TMF 1;  5IK5 A;  3WP4 A;  1AYM 3;  4LBK A;  2ENR A;  3VKO A;  1HKD A;  4I09 A;  1OBN A;  1OOP C;  4IGP A;  5K0U B;  2RS1 2;  5JVV A;  1RUF 3;  1RUH 1;  1VBA 2;  1WA4 A;  3PIG A;  1F8V A;  3OY8 B;  1WMX A;  1YRZ A;  3RDI A;  4BB3 A;  3LQC A;  4ET7 A;  4CP9 B;  1DLC A;  1KS5 A;  4EWE A;  1QH7 A;  1PVC 3;  2HWE 1;  3I3E A;  1CIY A;  3RI9 A;  3E97 A;  4XF0 A;  4AXO A;  3B00 A;  5EYX A;  2Q1Z B;  4S2G A;  3AMM A;  1IPS A;  1CAU B;  4JDN A;  1GZC A;  1JYC A;  2VD7 A;  2HWD 3;  4OVE A;  5FZF A;  3ZYI B;  4BQ5 A;  3WG2 A;  2E53 A;  4MGI E;  5GAL A;  3N35 A;  2OQ7 A;  3SKJ E;  4YAR A;  4YZ1 A;  4MG2 A;  2R04 3;  4RHV 1;  1XXN A;  5FZH A;  3ES1 A;  2ZGN A;  3UKV A;  1CJD A;  2BFU L;  1AYM 2;  3CLP A;  1O7F A;  4HON A;  1OA2 A;  1MZ6 A;  1QOO A;  2C6S A;  4YW2 A;  1XE0 A;  2F4L A;  3III A;  4Q2F A;  2D40 A;  1RUI 3;  3NST A;  4BIO A;  4D6R A;  5K7P A;  1UKR A;  1W8W A;  3WIN E;  4XXP A;  4K20 A;  1OH3 A;  3MYX A;  1A8M A;  4JDM A;  2QNK A;  3AL5 A;  2J7M A;  3U78 A;  1PVC 2;  1S0E A;  5F37 A;  1BHG A;  5EIY B;  1BK1 A;  3VBO A;  3ZFG A;  5C5T A;  2Q0A A;  4EN9 B;  3VV1 A;  5E8A A;  2VTX J;  4N53 A;  4N7U A;  3IZO A;  2E26 A;  4BCU A;  4GD4 A;  4OI1 A;  3U10 A;  4PCR A;  3ILR A;  1ZZ9 A;  2PLV 3;  2R04 2;  4B4P A;  2F17 A;  3HBZ A;  1W04 A;  3J8F 3;  3BU0 A;  2RDQ A;  2MEV 1;  4NVP A;  3UGG A;  1EY2 A;  1LTE A;  3ZYF A;  1RUI 2;  2WQZ C;  3FFQ A;  1VAV A;  3ZYB A;  2O8O A;  3H7J A;  1JOB A;  5GZC A;  3AK0 A;  4A7Y A;  3RJ2 X;  1W05 A;  3B93 A;  3KCY A;  2CWS A;  4D6S A;  2W87 A;  1NYW A;  2EXK A;  3RZJ A;  5HBA A;  2Z79 A;  4BJ0 A;  4YVS B;  3AP9 A;  3KS7 A;  1NUK A;  3D6E A;  3SH5 A;  2CY6 A;  5F1R A;  4XE9 A;  4Q8K A;  3J8F 2;  1RUD 1;  2BV4 A;  2P1B A;  3V0B A;  2JIG A;  4CDX C;  2VZR A;  3POG A;  3OGG A;  3NRU A;  1OD5 A;  3P3P A;  4AHX A;  1T2X A;  1RUN A;  4Z2A A;  3SHR A;  1ZRD A;  4WVW A;  2OA2 A;  3HN3 A;  5CNA A;  1UF2 C;  4YGC A;  5BNO C;  4CCK A;  4CU6 A;  4ZKT B;  2CL2 A;  2QQK A;  2VOK A;  2W39 A;  4E27 A;  5CKN A;  3TEW A;  1B35 A;  3K46 A;  1TME 1;  2W68 A;  2HWC 3;  3P5B A;  3VZN A;  1NCR A;  5H9Q A;  2P37 A;  4UFL A;  3GAL A;  3K51 A;  4W4Z A;  2OPK A;  1CAV B;  5IAT A;  4GJZ A;  5K0U A;  1UXX X;  1LES A;  4JDO A;  1JZ2 A;  2X8K A;  2YHJ A;  3D0J A;  2WFF 3;  3LWC A;  1C1F A;  3OTF A;  1NAE A;  5IVE A;  4FQ4 A;  4FP2 A;  3RI8 A;  2YMZ A;  4PDW A;  2LW8 A;  2E9Q A;  4OQ8 A;  1NKG A;  3AMQ A;  3SH4 A;  2DDU A;  1H1I A;  3NJZ A;  2RR1 1;  3MIE A;  5DAP A;  1CAU A;  4XJW A;  5C4W C;  2CYF A;  2W2I A;  3I2H A;  4PF5 A;  2XDV A;  1ULO A;  4OHZ A;  1SFY A;  2BWC A;  4AHY A;  1GMM A;  2FDH A;  1D2Q A;  4NR1 A;  1VBE 3;  3AFG A;  5CAD A;  2BVV A;  4LHL A;  1SLB A;  3K75 B;  5C6C A;  4JZR A;  3KGL A;  2F4P A;  2WFF 2;  2DCZ A;  1GOG A;  2NMN A;  4XF9 A;  4AI8 A;  1AYN 3;  1OUS A;  3NV3 A;  4ISR A;  3PDQ A;  5CZK A;  4IEY A;  5FKC A;  1RL3 A;  2OX0 A;  3BCW A;  3HMY A;  2ZCW A;  2BRT A;  1WME A;  2Y6J A;  3WOG A;  5JPM B;  1SQ4 A;  1I3H A;  4IV1 A;  3HD8 B;  3J7H A;  3PME A;  1YQ5 A;  4A7Z A;  2Y0O A;  2R07 1;  3RYK A;  1QOT A;  4KWU A;  1AL0 G;  2WT1 A;  3NAP C;  1Q8Q A;  1VBE 2;  5L36 A;  1O3S A;  5BNP B;  1BKZ A;  4QHO A;  1X8E A;  4F7Z A;  3EBR A;  5FIX A;  2W47 A;  5DAQ A;  4C0H A;  2W1Q A;  2RJ2 A;  3AKP A;  3W20 A;  4CEW C;  3BVC A;  4IER A;  1AYN 2;  1N3P A;  1CZS A;  3I2O A;  2C4X A;  1IS5 A;  3S5Q A;  3AFK A;  1AR9 2;  4NHL A;  4YW4 A;  2VOX A;  2CGN A;  5JMC A;  5BNP A;  3ZYP A;  4XJA A;  3FFZ A;  3AP7 A;  2VUL A;  3VKL A;  3VZO A;  2CNA A;  2A73 B;  2B9V A;  1CN1 A;  2ORZ A;  4UWD A;  2EA7 A;  2P6H A;  1ALY A;  1SLI A;  4RA0 A;  2VGD A;  5E6H A;  5F6L B;  4Z1V A;  5DUV A;  3ZO0 B;  5FY1 A;  2V4V A;  4Q26 A;  1AR8 3;  2P5B A;  2C9A A;  2JG9 B;  4UF0 B;  4Z07 A;  3TYJ A;  4LO7 A;  1VMH A;  1HIX A;  1GNZ A;  1RUJ 3;  2JG8 A;  2RM2 3;  4NUB A;  1VBD 3;  4OFG A;  4QB2 A;  3RFR A;  3UET A;  3ZXF A;  1YUD A;  1PIV 2;  1W99 A;  2R0H A;  1PGW 2;  3KT7 A;  1MS4 A;  5FRA A;  4MV2 A;  2GNT A;  2HH9 A;  1UMZ A;  5ACA 1;  1UZW A;  5F3C A;  5JMO A;  5EPA A;  3WQ7 A;  1L7Q A;  3R6S A;  4AG4 A;  3AZW A;  3WZ1 A;  4HET A;  4NRM A;  2P4E A;  2FDK A;  2IVI B;  1WCS A;  1XBF A;  4PJY A;  4U36 A;  4XBN A;  4XIO A;  3U4X A;  1AR8 2;  3N4M A;  3AXD A;  1KD7 A;  1IS4 A;  4R9B A;  2A75 A;  4QDR A;  1RUJ 2;  1MVQ A;  5LZ6 A;  3OPW A;  2B39 A;  1ND3 B;  2RM2 2;  1VBD 2;  2VW2 A;  3VZJ A;  1MEC 1;  2ZX4 A;  4LPL A;  2YU2 A;  4MGK E;  3ZSJ A;  1NXD 1;  1AL2 3;  3LPF A;  1TG7 A;  1DFQ A;  1PO1 3;  3KV4 A;  3N9M A;  2X53 S;  1JUH A;  5LY1 A;  4FPC A;  4QPI A;  3WF0 A;  4URA A;  1HQW A;  2VUC A;  3WCS A;  3V65 A;  5FZO B;  5C8C C;  5CKQ A;  4LBO A;  4KGQ A;  4DEQ A;  4Z82 A;  3M3C A;  1BZW A;  3TEX A;  2XL7 A;  2JXA A;  3SLI A;  2VME A;  2YPD A;  4KMQ A;  3KB5 A;  2UU8 A;  1DQ6 A;  4HXC A;  1SCR A;  1VIW B;  3DUI A;  5J96 B;  1K5J A;  2BDR A;  4Q1R A;  2A71 A;  1HLC A;  4QHB A;  3U14 A;  4D8M A;  1NG0 A;  1UMH A;  3SXW A;  2JEC A;  4W8J A;  4GB3 3;  4E2S A;  1C8N A;  1AL2 2;  5EXO A;  1PO1 2;  1R09 3;  2Y0I A;  4EN7 B;  5FUN A;  1BEV 1;  1FMD 1;  1COV 3;  1OVS A;  1VMJ A;  3FL7 A;  3HR9 A;  4JV4 A;  4H3W A;  3VKN A;  1WW5 A;  3NNG A;  1KDM A;  4LHS A;  5I0T A;  3ZSK A;  3KT1 A;  2LAL A;  1K3I A;  5F8P A;  4CZS A;  5KHK A;  5I91 A;  2ZMN A;  2ZHM A;  4FXK B;  1B35 C;  1DHK B;  2JE8 A;  2WT0 A;  4AFA A;  1R64 A;  1POV 1;  2WS9 1;  3WDU A;  3O12 A;  5A7P A;  2ZKN A;  4RGK A;  3VKM A;  3X29 B;  4AED C;  1HJG A;  2CDO A;  5F3E A;  1D2S A;  4CEY B;  1W39 A;  4M3C B;  4V2W A;  3BPZ A;  2E51 A;  1L7L A;  2W1W A;  4YSF A;  5K0U C;  1HRI 3;  5SV8 A;  1PNG A;  2VEC A;  4GB3 2;  1CAX B;  5L9B A;  2YXS A;  4AI9 A;  1DQ0 A;  1R09 2;  1YXW A;  5KBF A;  2E7A A;  4LNV A;  3WNO A;  5IVV A;  3POE A;  1DGL A;  1COV 2;  4AAP A;  3MHZ A;  1GP4 A;  4FPE A;  2J1V A;  5EZW A;  4DNY A;  1I6X A;  3LEI A;  4P08 A;  3HPN A;  1GBG A;  2JEN A;  1MS0 A;  2D98 A;  4P9G A;  2EAA A;  4PF1 A;  2ZGL A;  3AMN A;  1R1A 1;  3Q9O A;  1CQ9 A;  2IXK A;  1APN A;  3QBQ A;  4YRD A;  3O0W A;  1CIW A;  1XYO A;  3VZL A;  1KDK A;  1ZZ8 A;  3RZH A;  2ZX3 A;  1F35 A;  1CWP A;  2QQO A;  4PI0 A;  3UES A;  4X6R B;  4EZH A;  1SZB A;  1CPM A;  4MXV A;  1RUC 2;  3O7O A;  1DIW A;  2PTM A;  1Y43 B;  4UFM A;  1CON A;  3JZV A;  1RUH 3;  4Y1V A;  4Y1Z A;  4YGB A;  4LBQ B;  4CCO A;  5B2G B;  1XNC A;  1CAW A;  5FYU A;  3WNX A;  3E5X A;  4MGT A;  2WNE A;  4M4R A;  4UFH A;  2WNO A;  3QLQ A;  4HBN A;  5DZG A;  5K9Y A;  5G05 L;  4BH9 A;  4D7Y A;  1VRB A;  3Q8B A;  3ES4 A;  4L92 A;  4DXS A;  1O5L A;  2HWE 3;  3WNM A;  3WVJ A;  4DEV A;  4A44 A;  3AP6 A;  5H9P A;  3NNF A;  3DL3 A;  3O0V A;  5LBE A;  1JW6 A;  3VBU A;  3VBF B;  4BK4 A;  1ND2 A;  5GZD A;  3JQX A;  4LXL A;  2JWP A;  3B7M A;  1OLQ A;  1A8D A;  1SBF A;  4LO8 A;  4RN5 A;  5L73 A;  2VCC A;  1ZZ7 A;  4H55 A;  3IAP A;  4Q8L A;  4HLT A;  4FVV A;  4RHV 3;  5BV6 A;  1O59 A;  2KM2 A;  2OS2 A;  4I3G A;  4CDW B;  1TMF 2;  2R32 A;  1T6G C;  4GMP 1;  5FYZ A;  3ZXJ A;  4FTE A;  5KHJ A;  2BNN A;  3OSD A;  3LCP A;  4YWA A;  5FYV A;  3IN9 A;  4PBP A;  1UYY A;  1W8N A;  2PHR A;  1GU3 A;  2Y8K A;  2JDZ A;  3CMG A;  3IDA A;  1FYU A;  2HEV F;  4LE3 A;  5FZO A;  2PN5 A;  5F2W A;  4DY3 A;  2ARC A;  4N9H A;  1ZBA 1;  2C24 A;  4RFR B;  2HWE 2;  2I2S A;  2YBP A;  4CCN A;  3BTA A;  2XL9 A;  3WNN A;  4IQP A;  3HWJ A;  1V9U 1;  5FZ4 A;  5FP4 A;  1QY4 A;  4N7I A;  4G9S B;  5FPL A;  3T2T A;  2WO3 A;  3K77 A;  2A5Z A;  1KFX L;  1NOV A;  3WSO A;  3B01 A;  4NO4 A;  4P5H A;  1OQD A;  3RQ0 A;  4B7E A;  1LGC A;  4YVS C;  2AZ5 A;  4RHV 2;  4Q4Y 3;  2OXB A;  3A22 A;  4AFC A;  4M4P A;  5D1I A;  4Q0Q A;  2D3R A;  1QXP A;  1QJY 1;  3K4A A;  4BWO A;  3DYM A;  1W9W A;  1QKQ A;  4BU2 A;  2AAC A;  3MEP A;  4HPK B;  1AXK A;  3KQR A;  5FK8 A;  5HV0 A;  1V6L A;  3MV0 1;  2P34 A;  3I2K A;  1SFP A;  2A1X A;  5A1F A;  1DZQ A;  1OSG A;  2V72 A;  2UY9 A;  2XLG A;  4L99 A;  4QX8 A;  4WVM A;  3H7Y A;  3I2D A;  5D2A A;  1R1Z A;  4ARX A;  1Z7S 1;  3KV5 A;  2XML A;  3OB8 A;  4EV0 A;  1RJ8 A;  2VNG A;  2VVD A;  3FUQ A;  3HVD A;  3LOI A;  3EJK A;  1RTV A;  3Q8A A;  4FPF A;  4XHX A;  4LBJ A;  4AFM A;  5CVR A;  1O8S A;  3GBF A;  3EYP A;  2A6W A;  2QDN A;  2R7E B;  1CAX A;  1RUD 3;  3ABZ A;  1EUU A;  3ZXG A;  4NE9 A;  3DYO A;  2MEV 2;  3GNE A;  4MGZ E;  4XTP A;  3UJQ A;  1WZX A;  2DWR A;  2YRO A;  1O5U A;  3CJI B;  1NX9 A;  2W9X A;  3BTZ A;  4YG6 A;  5IVJ A;  5IFP A;  2GP5 A;  3NL1 A;  4XYX A;  1IPK A;  4XUT A;  5AVP A;  4ZS2 A;  1UZY A;  5BY5 A;  4AEM A;  4PHZ A;  1HV0 A;  4YFZ A;  1RUE 2;  1W9T A;  2WL1 A;  1YI7 A;  3NNJ A;  2K46 A;  3POJ A;  4P5Y A;  2GND A;  1W3X A;  2GP3 A;  1U12 A;  3RMX A;  5HI0 A;  2PMW B;  2NMO A;  5CYY A;  2ZGU A;  4NHY A;  2JDP A;  1S2B A;  1PK6 A;  2R30 A;  4LBQ A;  3OYW A;  1RUD 2;  3H8X A;  5LBB A;  4LKF A;  4A6O A;  4CP0 A;  2UWA A;  2VMI A;  4DUV A;  4AGV A;  2BVB A;  3DYP A;  1H0B A;  4GQ7 A;  2WZR 1;  4JHT A;  3VBF A;  5JR2 A;  1UY4 A;  2VCA A;  1C1L A;  4XJ9 A;  5L9R A;  3RZK A;  3NV1 A;  5FMB A;  1TME 2;  2D6P A;  4MYE A;  4F3J A;  1EUT A;  2KD7 A;  2OT7 A;  4OLL A;  3UKT A;  2BGP A;  1MQT B;  4GMP 0;  4AHW A;  2G9G A;  4QU2 A;  3F95 A;  3GCX A;  4XW3 A;  4PQQ A;  3IPV A;  4XJ8 A;  5L7O B;  1LUL A;  2WKK A;  2ID4 A;  3W21 A;  4CCJ A;  4OUE A;  5EJ3 A;  2SLI A;  4DIQ A;  5FLH A;  1OOP A;  4XDQ A;  4CCL A;  2OYZ A;  2J1A A;  4ASL A;  1N3Q A;  4XAC A;  4K3U A;  1SLL A;  5FYC A;  5GZE A;  3BTY A;  4NII A;  2JIJ A;  4OHY A;  4QGN A;  1C5I A;  3B3Q E;  5FPA A;  3ALQ A;  4CXY A;  1SCS A;  1OT5 A;  2RR1 2;  2ZGP A;  4ZU5 A;  3ZYR A;  5KXC A;  1AR9 1;  2PXJ A;  4DUX A;  4KBB A;  3LKJ A;  4SLI A;  4W6X A;  4Y26 A;  5FBJ A;  2ZJC A;  1H2K A;  4LJH A;  4NPM A;  3WDW A;  1JHJ A;  4GKY A;  3BYW A;  2A7A A;  5CU1 A;  5CA6 A;  2R07 3;  4Q4V 1;  3M70 A;  1N3O A;  3MFC A;  4ISQ A;  5LA0 A;  3SCH A;  3RWK X;  4AOC A;  1F4H A;  2WT2 A;  3DPR B;  3ORJ A;  3VGI A;  2GZW A;  3IBM A;  1XE7 A;  3OGJ A;  2JG9 C;  2EIG A;  5D21 A;  2UY8 A;  4JAA A;  3V0A A;  3GHM A;  1S0G A;  2ZEZ A;  4LOT A;  5FAX A;  5ABJ B;  5FWJ A;  4NAO A;  4LBN A;  4G4F A;  1TQ5 A;  1V6M A;  1WLW A;  2DFB A;  1W2A X;  3J7N A;  2GMM A;  4QU1 A;  1VAL A;  1W6P B;  1D4M 1;  1DQ2 A;  5DAV A;  4BYY A;  3VDB A;  3NJV A;  1UD1 A;  3PMS A;  4BLI A;  1PX4 A;  4MGY E;  5DXD A;  4H7L A;  1DQ1 A;  4WV8 A;  3FN9 A;  5FY9 A;  3H8O A;  2R07 2;  2CWM A;  3EB7 A;  2VW1 A;  1MR5 A;  2ARX A;  4LOR A;  1ZRR A;  3OBR A;  3H1W A;  2VQA A;  2SBA A;  4NPL A;  5JI7 A;  1NLS A;  3AJY A;  3FBY A;  3FHI B;  5I8Y A;  4M3C F;  1HB2 A;  1YEW A;  2LUW A;  1ND3 C;  2LTN A;  4A2U A;  4ERO A;  5A80 A;  4MVT A;  1PM4 A;  2ATF A;  1FT9 A;  1K12 A;  2AUY A;  4AI2 A;  4HL0 A;  4DIN B;  1IKQ A;  4EE2 A;  5ACA 3;  1W6N A;  3OD4 A;  4I3P A;  2ADD A;  4GAZ A;  1UX6 A;  3U4S A;  3GZT B;  4AK3 A;  5FPU A;  1XB9 A;  2BP6 A;  4R4Z A;  3KVA A;  1QMJ A;  1I5Z A;  4E8D A;  3POS A;  3M2M A;  4MGS A;  4QQP A;  2QQN A;  2WUH A;  1W8Z A;  3NJY A;  2DTW A;  4AGR A;  1LB2 A;  5GZG A;  4XJZ A;  1REE A;  3PUQ A;  4XMI A;  3LA7 A;  1NZC A;  2YB7 A;  5FZC A;  2OZ6 A;  1YJK A;  3ZYH A;  4EN8 B;  1F5F A;  1GOH A;  3R4D B;  2IFR A;  3AVR A;  3MPP G;  5EP9 A;  1OI6 A;  4CDX A;  2ARA A;  4E9K A;  3PLQ A;  4FOQ A;  4XF4 A;  4DMI A;  1PZ8 A;  1MEC 3;  2VBB A;  4BMB A;  5DN2 A;  4EN0 A;  5BNO A;  4NPR A;  3BAL A;  4P9W A;  5ACA 2;  4ZZ5 A;  1SLA A;  1EAH 1;  5L9V A;  1JH5 A;  1S0C A;  5I8T A;  4QXH A;  4UFI A;  3ZSM A;  3ZXK A;  2NM1 A;  5FZ0 A;  1UU6 A;  2QZ3 A;  4FFI A;  1FPN 2;  1UOG A;  1RIR A;  1RHI 1;  4Y5T A;  4D7T A;  1UCX A;  1XNK A;  1MZE A;  4B4R A;  5FO8 B;  1J3Q A;  5FMO S;  1UU5 A;  4ARY A;  1MEC 2;  3O1T A;  4CEY C;  4LLF A;  1AJK A;  1AJO A;  1OLM A;  2IXH A;  3LOB A;  3F2Z A;  4IEU A;  3AJZ A;  1SBE A;  2W95 A;  2J42 A;  2Y60 A;  1LOC A;  3OPT A;  4FTS A;  1OD3 A;  2CDP A;  4NIG A;  1W2U A;  5C4W A;  1BEV 3;  1QXJ A;  4IV3 B;  1FMD 3;  2EXI A;  3LSE A;  3ZM8 A;  4AQS A;  4PIZ A;  2JKB A;  2QCS B;  4ES8 A;  2DV9 A;  1GR3 A;  2D6L X;  2GN3 A;  4WVZ A;  5FMO L;  4COW A;  3WF4 A;  2EIC A;  2BNO A;  4MAD A;  4UI9 L;  5LA2 A;  4CYD A;  1H1M A;  1OA3 A;  2WS9 3;  1POV 3;  3W58 A;  1DCS A;  4WM8 B;  2TEP A;  3CQO A;  3M7A A;  2CGP A;  3N9O A;  3WNP A;  1J83 A;  1ZRF A;  1V6I A;  1CJP A;  1HJF A;  2WC2 A;  1FAY A;  3VBS B;  3H3U A;  3U1X A;  4BM8 A;  5T3N A;  2TBV A;  1RUC 1;  2AEY A;  5A7W B;  5C71 A;  1BEV 2;  1I5P A;  1FMD 2;  4JTN A;  1OHF A;  1HB3 A;  3QH7 A;  1JZ4 A;  2WWJ A;  2K0G A;  3W9A A;  2WJS A;  4I01 A;  3VBF C;  3NAP A;  1AUY A;  5IYY A;  2HYX A;  1HV1 A;  2PAK A;  1LOG A;  3HT2 A;  3LF7 A;  2FBE A;  4OUL A;  4XZP A;  4DRR A;  2DCY A;  2XJV A;  2WS9 2;  4OCT A;  2OKX A;  1WCQ A;  3M3I A;  2D6K A;  5GM0 A;  1HB1 A;  1ZZ6 A;  3CZU A;  1DU3 D;  4C1W A;  2DYC A;  4CDW C;  2Q1F A;  1W9S A;  5LY2 A;  5TSW A;  4OZX A;  2X5I B;  3N7M A;  3PVO A;  4LBL A;  2A3X A;  4GWN A;  4Y20 B;  3NWK A;  2BZD A;  4K7J A;  5FXZ A;  3EHK A;  2VMF A;  3C7O A;  2ZS6 B;  3MUZ 1;  3IWZ A;  4N90 A;  4Q0U A;  2XUE A;  4D6Q A;  4LA2 A;  2BFU S;  1ZVF A;  4P00 B;  1X36 A;  1R1A 2;  2B5H A;  4LT5 A;  3T0B A;  3R05 A;  4L2N A;  2GNM A;  3FBM A;  5JZG B;  3MPB A;  3B9I A;  5CBL A;  1X8M A;  3FJS A;  3CU7 A;  4QDS A;  2WBK A;  1VBB 1;  4GMP 3;  5T5J A;  4TZD A;  3LEK A;  3N7K A;  4CCM A;  5BNQ A;  3QD6 A;  1EV1 1;  2DF7 A;  1FNZ A;  1PMH X;  2VMC A;  4FPH A;  5FPZ A;  5F9T A;  2XKO A;  4X8P A;  5A6Y A;  1NA1 B;  2BGO A;  1W3V A;  1ZBA 3;  3MLK A;  4MH0 E;  4MZU A;  1ACC A;  2VUD A;  3HNY M;  3DN7 A;  4QQH A;  2OQ6 A;  1UYP A;  1V9U 3;  1OXC A;  4ZON A;  5HCA A;  1LOA A;  4RS5 B;  4LIU A;  5DAX A;  1LHV A;  2ZGT A;  3CHX A;  1S55 A;  4FP3 A;  3ZMO A;  3CJX A;  3OGR A;  1Q8O A;  3OBT A;  1H9W A;  2DVF A;  3T0D A;  1OFS A;  1VLN A;  5LA9 A;  1E57 A;  5FXX A;  1QJY 3;  2OZJ A;  3RG0 A;  1SEF A;  2JDH A;  3VL8 A;  4E2Q A;  1JZ8 A;  1XOY A;  3B69 A;  2BGC A;  3CJI C;  2ETE A;  2VMH A;  4FPJ A;  4W6W A;  3J7L A;  5KXE A;  3DKQ A;  1YNA A;  4YM0 A;  2W94 A;  5I0U A;  5C8C A;  1QJE A;  1ZBA 2;  3SEP A;  1J1L A;  5T54 A;  3C3V A;  4H7M A;  2JB4 A;  1Z7S 3;  1V9U 2;  4YVW B;  4RL7 A;  1PX3 A;  1FNY A;  4YLZ A;  1RUE 1;  1A3K A;  2WWU A;  1KRI A;  2J1E A;  2QQJ A;  3OEA A;  3POI A;  4N8M A;  3LDR A;  1L7R A;  2WSV A;  4IE6 A;  5KHH A;  2J1U A;  4Q4W 2;  4DXT A;  4MUV A;  3OJB A;  5FUI A;  5A7W A;  4AQ6 A;  1F9K A;  1QJY 2;  2GSY A;  3FHQ A;  1JUI A;  1UL9 A;  3ST7 A;  2K2S A;  2L9L A;  2C9K A;  2W0X A;  1A6C A;  1UWW A;  3MGU A;  4UOJ A;  1ZRE A;  5KXD A;  2DBI A;  4GUL A;  1GNH A;  2F6B A;  1NT0 A;  2ZML A;  3ZR6 A;  1SDW A;  1KS4 A;  1JBC A;  2AC1 A;  1G9A A;  4CDQ B;  1Z7S 2;  5LAT A;  1UIJ A;  1XNT A;  1ULC A;  2VNO A;  1BLZ A;  3DF0 A;  2VH9 A;  3EMR A;  3PNA A;  4O9E A;  4RQP B;  1RVF 1;  4QXC A;  1MQT C;  1U5Y A;  1XYP A;  3I2I A;  4ZS3 A;  4DOU A;  2VQ0 A;  1HX6 A;  5F7U A;  5FJK A;  2TUN A;  2VTX A;  1XYN A;  1E5R A;  1K5M B;  4HFS A;  2GMP A;  3ZDS A;  4AED A;  1UU4 A;  5L7O C;  5ANQ A;  5E16 A;  4AR2 A;  5I0S A;  2Y6K A;  5LK7 B;  2RHP A;  1MS9 A;  2XJP A;  2IFW A;  3JB8 A;  4XCA A;  5EWS A;  4Y20 A;  3T09 A;  2B9U A;  5BUV A;  3LIH A;  5IUQ A;  3ZXA C;  5JAX A;  5JXH A;  1PGL 1;  3OY8 A;  1OPO A;  1W8O A;  3N7J A;  1LED A;  2WA3 A;  1SBD A;  2ZA9 A;  2WZR 3;  1ZM1 A;  4R9A A;  2ZHL A;  4BXS V;  4CP9 A;  4JGY B;  5FTT C;  4MHR A;  1GWM A;  1OUX A;  1UMI A;  2RV9 A;  2VXR A;  5FOB B;  2WR9 A;  2A6V A;  4URT A;  5C3O A;  5I0R A;  4KU7 A;  3T30 A;  2RVA A;  3VHR A;  4MET A;  1EP0 A;  4QX2 A;  3D0S A;  4HKL A;  1QJZ A;  2JD4 A;  4V2V A;  4Z8B A;  1GNY A;  3PUH A;  5A1A A;  3DPR C;  3MID A;  5A1L A;  2VZV A;  5A6Q A;  1OMI A;  4WM7 B;  5LWB A;  5ABJ C;  1DYO A;  2CV6 A;  2YGL A;  2ZBJ A;  1QEX A;  4AFB A;  4IEQ A;  4Q4X 1;  1XNA A;  1VE0 A;  1YO8 A;  2WZR 2;  3TN9 1;  5BPX A;  3PUA A;  1VJ2 A;  2WYS A;  2OII A;  4OHV A;  1AR9 3;  3WW2 A;  3PVB B;  2FMD A;  4AVT A;  1UZ0 A;  3MDP A;  4P02 B;  2E33 A;  4Q4V 3;  2IZW A;  3P6B A;  4RGG A;  3KHC A;  1OKQ A;  3I49 A;  2J1T A;  4PQ9 A;  2QBX A;  5A3T A;  2XLA A;  2OUJ A;  2P3K A;  2Y33 A;  3OEB A;  3H9A A;  1DZR A;  3I2G A;  3U11 A;  5AFE A;  3N7L A;  1O3R A;  4GAL A;  1JYI A;  1WLC A;  4R9D A;  2G4I A;  3WW1 A;  4E2G A;  4YW1 A;  2VM9 A;  1CPN A;  1D4M 3;  1JHN A;  2A6Z A;  3BU7 A;  4GH4 B;  4R52 A;  4UAP A;  4BE3 A;  4FSJ A;  1PIV 3;  3EO6 A;  5G04 L;  2BEO A;  3NV4 A;  4LLO A;  5FO7 B;  3AX4 A;  2ERF A;  4QX1 A;  3WNK A;  3WUD A;  2R16 A;  1VB2 A;  3A23 A;  2DCK A;  4Q4V 2;  1KXG A;  2JX9 A;  4QB1 A;  1G6N A;  5HCB A;  4NIA A;  1ODM A;  3RRD A;  2ZAC A;  2VQU A;  4YVS A;  5FY7 A;  3M8L A;  4NHM A;  5LA1 A;  2WAA A;  4LK6 A;  2XBO 1;  3RVH A;  4EQV A;  4ZHN A;  2ORX A;  3PL0 A;  2D5F A;  4KH9 A;  3AP5 A;  2YBS A;  2ZTN A;  3C7H A;  3N36 A;  3ZFE B;  4CVU A;  4XXA A;  2QVS B;  2B8M A;  5GLZ A;  1O8P A;  3U75 A;  4P9L A;  4Y1X A;  1X82 A;  4IES A;  4XIK A;  1VPH A;  1D4M 2;  3S0M A;  3FLP A;  4L8Q A;  5L19 A;  3MZH A;  1ENQ A;  1FV2 A;  1S2K A;  4CDQ A;  2VO5 A;  2Z4F A;  1OA4 A;  1YJL A;  3FLR A;  3ZFF B;  1UOF A;  1US3 A;  2VZS A;  3G7D A;  3THP A;  4RQP A;  5FOJ B;  1JYN A;  2GH8 A;  2DUQ A;  2PA7 A;  2NQY A;  5GLV A;  3AKR A;  3N9P A;  4XVH A;  1QHD A;  2J1S A;  2V5Y A;  3B02 A;  4C1X A;  1CAV A;  1SLT A;  5FZ8 A;  2ILM A;  3ACF A;  1GZ9 A;  2YFU A;  1FPN 1;  1H4G A;  1O4Y A;  3ACH A;  2QDR A;  3BGA A;  3I3B A;  3WQB A;  1W0O A;  2JE9 A;  3C7E A;  1AZD A;  3P1I A;  5HCH A;  2XLF A;  3IMM A;  3R0R A;  4QKD A;  1JYV A;  1AX1 A;  3MBW A;  1BYH A;  2ZZQ A;  5J3U A;  2GAL A;  1VP6 A;  2D6N A;  1OKO A;  1EAH 3;  1TNF A;  1BBT 1;  5AC9 1;  3TAY A;  4XPV A;  5LEJ A;  2XKP A;  3OBA A;  4IV3 C;  1G9F A;  3T1L A;  2DVG A;  1JXN A;  3WG3 A;  2Z2S B;  3L2Y A;  3WDY A;  3R4U A;  2QJV A;  1JOJ A;  2VUA A;  1N47 A;  4IXL A;  4BOW A;  1RHI 3;  1RYY A;  4V1P A;  4XHB A;  4AVC A;  3ELN A;  1ZBE 1;  4NWV A;  4LEJ A;  4ORF A;  2XPJ A;  4WM8 C;  3AYE A;  4JQT A;  3WP5 A;  2XWJ B;  4B8E A;  3RMY A;  2VVE A;  1C8M 1;  1X9P A;  4Q29 A;  4W65 A;  3THC A;  4TLG A;  3OGV A;  4FOY A;  3VBS C;  1WLT A;  4AYU A;  2W08 A;  1EAH 2;  3IKW A;  3ENR A;  1UQX A;  1CES A;  5I8S A;  2VXJ A;  1OUR A;  3T2P A;  1OF4 A;  1PNF A;  5C3R A;  1NE6 A;  5FZL A;  5FRE A;  3M3Q A;  2VMG A;  4HKW A;  5LAS A;  3RWN A;  2BNM A;  3I3M A;  1RHI 2;  5C3Q A;  1DYP A;  1UAI A;  3DEM A;  4BIF A;  3O1S A;  2QQM A;  1KFU L;  1NLR A;  4QM9 A;  1WW6 A;  4IEW A;  1H2L A;  5JSR A;  1W6M B;  1FV3 A;  5ERL A;  3WHU A;  4NHX A;  2XWB B;  5APA A;  2YDE A;  5F5I A;  4XFG A;  2XVG A;  3I97 A;  1W9Y A;  3OGS A;  4X6Q B;  4XET A;  1J84 A;  1STM A;  4D69 A;  4YZ5 A;  1T6B X;  4QQO A;  2YC2 A;  1RUC 3;  1VBC 1;  2X5I C;  3D8C A;  1H2M A;  3CZJ A;  2X10 A;  5HXV A;  3T0A A;  1CVN A;  1FI2 A;  1F31 A;  1UXZ A;  2EF6 A;  4OMD A;  3CO2 A;  1QDC A;  1SAC A;  3MIB A;  1LAJ A;  2YG0 A;  2PQQ A;  1FOD 1;  3A7Q A;  3ZMN A;  2WNV B;  3CIH A;  3N9L A;  4HMZ A;  3GCW A;  4BQ2 A;  4N9I A;  1LU1 A;  1SDD B;  4UF0 A;  1LU2 A;  2JG9 A;  1JI6 A;  2R1B A;  1UNB A;  2R0F A;  3ZFE A;  1AR6 1;  5FZE A;  1PHM A;  1PVX A;  4ZXE A;  5FYM A;  5JZG C;  5EJZ B;  2WNU B;  4UYB A;  1IPJ A;  4IEO A;  2PAE A;  2BBA A;  2R49 A;  4MGQ A;  4XMA A;  1WBF A;  1BK0 A;  1YI9 A;  3IIA A;  3K4Z A;  5JOZ A;  3ZFF A;  2W52 A;  1TMF 3;  2XHN A;  2WZE A;  3INA A;  3WP6 A;  3WHT A;  2XJS A;  3RYR A;  5A6X A;  1WMF A;  4IE4 A;  1LEN A;  4UXA A;  3RPQ A;  4UW4 A;  3PTY A;  4EJR A;  1HXS 1;  3ZR5 A;  3IMN A;  2VNR A;  1F4A A;  2YU1 A;  4OMC A;  1UY0 A;  1Q8S A;  5M0T A;  1XSR A;  4XUN A;  5LEK A;  1S4C A;  1QWR A;  1UY3 A;  3KV9 A;  4RS5 C;  5A33 B;  5IAX A;  3HIF A;  4NN0 A;  1W2N A;  2Z69 A;  1WMD A;  5JUV A;  2CHH A;  3RZM A;  1ULE A;  1MS1 A;  1QNW A;  1E5I A;  4XTM A;  1VBB 3;  1ND3 A;  4PIY A;  4P9J A;  3TB0 A;  2P3J A;  3OF1 A;  4BPZ A;  1HQN A;  3JU9 A;  2CAV A;  1EV1 3;  3RS6 A;  1O6U A;  4MLO A;  3ON7 A;  5IAV A;  4BME A;  4AEJ A;  1Q43 A;  2MNG A;  4RR3 B;  3ECQ A;  5CFC B;  2ZX0 A;  1R08 1;  1YFU A;  1QOS A;  3MLL A;  3OUH A;  2GC0 A;  4EWA A;  2WDB A;  4YVW C;  1XRU A;  5FXW A;  3BB6 A;  1U5Z A;  3L9J T;  1QJU 2;  3HOB A;  5F5Q A;  3KF5 A;  1YHF A;  1XNB A;  3O1U A;  1GQP A;  4XBL A;  3SCG A;  4AF9 A;  1VBB 2;  2BER A;  3VBR B;  3VHP A;  1H4H A;  2B4K A;  2HWD 1;  4XOG A;  3O1V A;  1RIT A;  4Q4W 1;  5AFB A;  1GZW B;  4COZ A;  1IHM A;  1OVP A;  1ST8 A;  4TSV A;  5FJH A;  5FY5 A;  1RMU 1;  2ZGM A;  4HKO A;  2MEV 3;  1EV1 2;  4R9C A;  3ZYG A;  2DU1 A;  2ZZJ A;  4JX0 A;  3ZVX A;  2JDN A;  2XXZ A;  3CKH A;  2RDN A;  3KSC A;  4IEZ A;  2V4A A;  2Y6L A;  4BK5 A;  4LUM A;  4AVA A;  1Y9M A;  5CKM A;  1UZZ A;  2WFP A;  3AP4 A;  4CDQ C;  4A4A A;  5DMY A;  2QQV A;  1RUE 3;  4Z92 B;  3JXS A;  4RQP C;  2J1R A;  1QNY A;  2XJT A;  3MIG A;  3NKT A;  5KR7 A;  2YPJ A;  1BXH A;  1EPW A;  3JCI A;  1W28 A;  1JOP A;  1K5M C;  2Z42 A;  2WAB A;  3FLT A;  3K3O A;  4PLN A;  4CEY A;  4M3C A;  1WCU A;  5LBC A;  2TNF A;  2IVJ A;  3DEC A;  1W90 A;  3H1M A;  3W5M A;  3HNB M;  3LPG A;  3HBK A;  1MS3 A;  4BQ4 A;  3S7I A;  3GBG A;  2YUE A;  1G86 A;  1UYZ A;  4FO9 A;  5K8S A;  4M01 A;  4JGY C;  4XEZ A;  4U2A A;  2W92 A;  3AKT A;  5B4X A;  4B4Q A;  4K1Z A;  5J1X A;  2X29 A;  1YQ6 A;  3GBW A;  2K9Z A;  5FCC A;  1WLD A;  3I2F A;  3PIJ A;  3SKV A;  3O1M A;  1CGP A;  1TME 3;  3KM5 A;  4XAE A;  1RVF 3;  3M1H A;  2W5F A;  1H30 A;  4P9Y A;  4AI1 A;  4O9G A;  5DDJ 1;  3NNL A;  5FWE A;  3CNA A;  3I3D A;  5FP3 A;  4FTB A;  1N1Y A;  3I2J A;  2VC9 A;  3TBD A;  3WF3 A;  5JXJ A;  1GQH A;  3ME2 A;  4JQR A;  4WM7 C;  1IOA A;  1X50 A;  2ZEW A;  3D82 A;  5LK5 A;  4L0P A;  3ZDV A;  2GAU A;  1Y9Q A;  4GJY A;  4ONU A;  4HVQ A;  1UPS A;  2GC2 A;  2D6O X;  4OUM A;  3AM2 A;  3POF A;  2XVL A;  4AL9 A;  5LCW L;  1ASJ 1;  4J25 A;  1XJA A;  3WV6 A;  4CPB A;  2RR1 3;  2ET7 A;  1CX1 A;  1DYK A;  1ENS A;  4YW3 A;  1RVF 2;  5LBF A;  1H8T B;  3FE5 A;  4CCC A;  1JYX A;  2YZ4 A;  4CP1 A;  1VAK A;  4CDW A;  5FK7 A;  5GJ6 A;  2YY1 A;  1LHO A;  3ZYJ B;  2FQP A;  2WLP A;  2ZOE B;  3CDZ B;  4C0B A;  4DUW A;  1ZA4 A;  4XFI A;  4ASK A;  1PGL 2;  4IET A;  1FX5 A;  4C91 A;  2ARB A;  5D8A B;  3TN9 3;  4GH4 C;  2WLQ A;  3SCF A;  4D7S A;  1SFN A;  1SPP B;  2EID A;  2Q1M A;  5IJR A;  5J37 A;  4GKX A;  2QUO A;  4Y22 B;  1BVV A;  4AQ2 A;  1M06 G;  1S0B A;  5FP8 A;  3BIE A;  3RGB A;  5IFT A;  4LUK A;  2WIN B;  1G9C A;  1W6Q B;  3DV8 A;  4K8F A;  3UKN A;  2I74 A;  3ZN6 B;  2G9Z A;  3VD7 A;  2RS3 2;  1JYW A;  5J36 A;  3USU B;  3UT0 A;  1K42 A;  3BI3 A;  1YYN A;  1OPM A;  1QQP 1;  2UWB A;  3WP3 A;  3E1F 1;  3ZFE C;  4E4S A;  5KXB A;  4HPK A;  4Q4X 2;  1KJL A;  2OPW A;  3PVN A;  1GYK A;  4A45 A;  4KI5 M;  4XF1 A;  3T1M A;  3TN9 2;  1XU1 A;  2P3I A;  4HG6 B;  4A3X A;  1Q56 A;  4OQ9 A;  3WF1 A;  2KA3 A;  3OCP A;  3ZFF C;  4RD7 A;  4QMA A;  3PVE A;  4MSV A;  4AQT A;  3ROU A;  3D4K A;  4B7K A;  5K4L A;  4K21 A;  1HW5 A;  3N9Q A;  2E7T A;  1DGW X;  4LA3 A;  3H50 A;  1RGS A;  4JRL A;  1X9T A;  4TXW A;  2FCU A;  3VB9 A;  5C3P A;  1KQR A;  2XBO 3;  5FMC A;  3ZXE A;  3B5L B;  3MO4 A;  2W46 A;  1F2N A;  3HT1 A;  5CIR A;  3VBH B;  1MAC A;  3ETQ A;  3PJY A;  4AHZ A;  4CDU B;  3TEY A;  5JSP A;  2JDY A;  2QQU A;  4QGM A;  2LM3 A;  1E5H A;  3CJI A;  4Y5Z 0;  4K40 A;  1WUV A;  5FZ3 A;  1Q3E A;  5FYS A;  2E31 A;  4QXK A;  3KGZ A;  4QQ2 A;  3WUC A;  3E6D A;  2GME A;  4HK8 A;  1UYX A;  1CZT A;  3T4V A;  4AI3 A;  2G19 A;  2HBU A;  1W8U A;  4YZ3 A;  5GLU A;  5ISL A;  3TRS B;  3CL1 A;  4XQW A;  3H3L A;  4E4Z A;  3K3N A;  5CFD B;  2O1Q A;  4IEX A;  4E4H A;  2NP0 A;  2XUM A;  4LBQ D;  4LKD A;  1BMV 1;  1UOJ A;  5LW9 A;  4QX3 A;  2XBO 2;  2Z5W A;  1FPN 3;  4MXW B;  2WZP P;  4DQA A;  1LGB A;  2WII B;  3EQE A;  4JKM A;  4CUG A;  3WG4 A;  1J3R A;  3UJO A;  3T4H B;  3QAC A;  2D93 A;  2NYY A;  1IS6 A;  1RUG 1;  1UX7 A;  1W6O B;  4LQR A;  3C7G A;  2QFE A;  3ZOI A;  4ZPI A;  3AZZ A;  1ZZB A;  2A6X A;  4CU9 A;  2FCT A;  1BBT 3;  2FD8 A;  5AC9 3;  1G7Y A;  1OLR A;  5A7O A;  1GZT A;  1UKG A;  5FZD A;  4L97 A;  4IGQ A;  3VZM A;  3MFA A;  2PHW A;  4FFG A;  3O1O A;  2Y6F A;  5C9A B;  3AB0 A;  1MQT A;  4BQ3 A;  3NVC A;  4LO6 B;  4XUP A;  3WD5 A;  3S5A A;  3ZKU A;  1BCX A;  5L7O A;  1ZBE 3;  2ZX2 A;  1C5H A;  1LHU A;  5FZA A;  4D94 A;  2DCJ A;  4AVB A;  5FPB A;  5HV4 A;  5FZ1 A;  1DGR N;  4MHU A;  2WO7 A;  4H2A A;  4CTE A;  1S1A A;  1C8M 3;  1WWY A;  2A70 A;  1HQL A;  4HAN A;  5A3P A;  1SPP A;  2P3Y A;  2XJR A;  3CEW A;  1QIQ A;  1ULD A;  3PTR B;  5BXX A;  3U0Z A;  1BBT 2;  5H9S A;  3DXT A;  5AC9 2;  3K4D A;  1QH6 A;  1CD3 G;  2AGS A;  2G9F A;  2NLR A;  4FPL A;  3BPS A;  4YW6 A;  3ZPO A;  4DY5 A;  4R8H A;  3KVB A;  2B7Y A;  2D3P A;  1ZX5 A;  3WF2 A;  2WNV C;  1GLH A;  1NXM A;  4LUL A;  3VN4 A;  2MHF A;  3DPR A;  5BYN A;  5KC5 A;  1HDK A;  1ZBE 2;  4XQ4 A;  3N3H A;  1JMU B;  1UIK A;  2HWB 1;  2VPV A;  3BOW A;  3E6B A;  3MLJ A;  4LTA A;  4OHW A;  1DGW A;  1OH4 A;  4COV A;  4COY A;  4DXZ A;  5ABJ A;  5JOY A;  2WNU C;  3VL9 A;  3V64 A;  1C8M 2;  3KQ4 B;  1YCI A;  3VBO B;  3ZFG B;  1W6P A;  1DQ5 A;  3LEG A;  1OLM E;  3T3Y A;  1VBC 3;  5FPX A;  3RZL A;  1NZI A;  4GIQ A;  3WDT A;  2VY0 A;  3LAG A;  2GH2 A;  4HSJ A;  4N53 B;  1JZ7 A;  3WG1 A;  3FUO A;  2ZAA A;  2P17 A;  2B42 B;  4O61 A;  1FOD 3;  5JXG A;  1URX A;  4E8C A;  3U37 A;  4CDU A;  4B29 A;  3NJX A;  2BUK A;  3LB9 A;  3KMH A;  1GP6 A;  2BWA A;  1AR6 3;  5F5C A;  1R1A 3;  4AW7 A;  1OQ1 A;  3JUU A;  3O14 A;  4XCB A;  5F3I A;  5HCF A;  1YLL A;  1TE1 B;  5DUX A;  4S2F A;  2OVU A;  2WO2 A;  4A6S A;  4A42 A;  3A21 A;  4YG3 A;  4QGL A;  3IDC B;  4ZZ8 A;  1GP5 A;  4WZF A;  1VBC 2;  2ZKL A;  5KC6 A;  4S2H A;  1GAN A;  3O0X A;  2ZEX A;  4GWI A;  3AZV A;  4BIS A;  2IXI A;  5F32 A;  4QX7 A;  4DFS A;  1AX0 A;  1HRI 1;  1HXS 3;  1P8J A;  4RR3 C;  5CFC C;  3VD9 A;  3V0B B;  5FZG A;  1FOD 2;  2O0O A;  1WGP A;  2IXC A;  1TVG A;  3P3N A;  4FPG A;  4K9S A;  2NPI A;  3MUY 1;  4AEK A;  3TWI A;  5IHR A;  2XJQ A;  1AR6 2;  4GZ9 A;  5FP7 A;  2DU0 A;  1C57 A;  5FXV A;  2HWF 1;  3HN1 A;  3VDD B;  3FZ3 A;  1XPW A;  4Q0S A;  1PO2 1;  4AAX A;  1JZ6 A;  2EAK A;  4QWN A;  1IZ3 A;  1QJU 1;  2UWC A;  1LCL A;  2ZXQ A;  2PAM A;  2PEL A;  5ANN A;  4YW5 A;  3VBR C;  4ATE A;  1NCR B;  4FOV A;  3WW4 A;  2VU9 A;  5T5O A;  1DZT A;  3WEZ A;  2LRP A;  1AVB A;  2JKX A;  2VVF A;  4NRP A;  4O65 A;  5C9A A;  1PGS A;  3GGL A;  4AI0 A;  2CU5 A;  3JB4 C;  5EJ1 B;  1R08 3;  4H14 A;  5IW0 A;  1HXS 2;  2JIC A;  2RDS A;  2W91 A;  5JSO A;  5F5A A;  1WD4 A;  4L9B A;  3WNL A;  1GFF 2;  1F15 A;  2FZ1 A;  3PHM A;  4PDW B;  4KGG A;  3ETP A;  1DG6 A;  4KL1 A;  2GC1 A;  3NQH A;  1LHN A;  4Q0P A;  5DUU A;  1G9D A;  2ZGO A;  3GZE A;  3ZXD A;  4EYU A;  5LRS A;  3OUJ A;  1S0F A;  1YQ8 A;  4I0B A;  2BQP A;  4LE4 A;  4LMF A;  4Q4W 3;  1SLC A;  1LOF A;  4MO3 M;  2RMU 1;  1BJQ A;  3PUR A;  4IND A;  3ITQ A;  4QHZ A;  1RMU 3;  4HVR A;  1CR7 A;  4IE0 A;  3S7E A;  4IV3 A;  3HQR A;  4HVO A;  1N1V A;  3TOJ A;  1RUF 2;  2XQR A;  2ZGK A;  2ZHN A;  1R08 2;  1AF9 A;  3O1R A;  3CF6 E;  4M0H A;  1POQ A;  4J1W A;  4JTO A;  4O7X A;  2JD9 A;  2QE3 A;  2D97 A;  2AYH A;  1QJX 1;  5T52 A;  1FXZ A;  3VHO A;  1Y4W A;  2FDI A;  1QXR A;  4WM8 A;  2OW4 A;  4IDZ A;  4J1X A;  3GXU A;  3HEI A;  4IV1 B;  5DG1 A;  2D44 A;  2D5H A;  4PIX A;  1DLL A;  1FAT A;  1WA6 X;  2HWD 2;  3VBS A;  2N7G A;  1DBN A;  2RG4 A;  4IE7 A;  5FFO C;  1U5I A;  4TN7 A;  3AXE A;  4EN6 B;  1RMU 2;  4Q4Y 1;  1W2T A;  4IUG A;  2CTV A;  4YM1 A;  1Q8P A;  2C26 A;  4QXB A;  1WW4 A;  3V56 A;  2HKX A;  3GDB A;  1GWL A;  3QH6 A;  4Y24 A;  1GV9 A;  4XFC A;  3BOP A;  1W03 A;  5JDB A;  2Y38 A;  2O14 A;  3LFM A;  1RUO A;  4KU8 A;  4W6Y A;  3WLU A;  5J7M A;  3BIW E;  4NIH A;  4P9I A;  3HNM A;  1H8T C;  1C3H A;  2PHX A;  3MW2 A;  3KT4 A;  5DDJ 3;  4EWD A;  2RJK A;  1V6N A;  2EIE A;  4QM8 A;  3SNM A;  3LGR A;  3E6C C;  4B1L A;  5CB7 A;  4PLM A;  1Q5O A;  1G8W A;  2X5I A;  4QDQ A;  1XSQ A;  4F83 A;  2PLV 2;  2VR4 A;  1UPI A;  1LHW A;  1ENX A;  4Q1P A;  5F2S A;  5FYY A;  2DUP A;  5D8A C;  4QX0 A;  5A3U A;  4A3Z A;  1ASJ 3;  5JCT A;  4K1Y A;  2JG8 B;  4FQZ A;  4D3W A;  2Y34 A;  5FY8 A;  3NW4 A;  2XJU A;  3VDD A;  4A41 A;  4UW5 A;  2DVA A;  5JZG A;  1ENR A;  1US2 A;  4N43 B;  2HLE A;  5DDJ 2;  5FQ0 B;  2VG9 A;  5J48 A;  4UBH A;  2LS6 A;  3VD4 A;  1I1E A;  5F39 A;  1Z0H A;  5FZ6 A;  5CIS A;  1JZ5 A;  3BTX A;  3E5U A;  2WQ8 A;  2RS3 1;  1VMF A;  2ZGR A;  2RJL A;  1HB4 A;  3I7D A;  1NA1 A;  3ZIW A;  3I8T A;  5IVB A;  1ASJ 2;  3S57 A;  3T08 A;  4UW6 A;  4YGE A;  3S30 A;  4TLF A;  4RS5 A;  1JTZ X;  4K6B A;  5FZ9 A;  4XZU G;  5JOW A;  1MS5 A;  4B1M A;  4XC9 A;  3UGH A;  2ZGS A;  4GWM A;  2YGM A;  2VZ1 A;  4PLO A;  5FO9 B;  2VBD A;  2HWC 2;  1VRH 1;  1TEI A;  2VJX A;  1O4Z A;  2QQP A;  2PHU A;  4QPI B;  4ITC A;  3VBH C;  2Y26 A;  5JI9 A;  4KWJ A;  2VZU A;  4AVS A;  4CDU C;  4LR4 A;  5FYI A;  4FPK A;  5IK8 A;  2HEW F;  2R06 1;  4YW7 A;  1S2E A;  1QQP 3;  5C33 A;  1X33 A;  2G1M A;  4XAA A;  4DZG A;  1NE4 A;  3JD7 1;  5JWP A;  4YFW A;  1WCD J;  4Q0V A;  4ZXK A;  5JPN B;  3I59 B;  3JBG 1;  3N9N A;  4IL7 A;  2DTY A;  5DZE A;  2GNB A;  5F6K A;  4IW3 A;  3ZN4 A;  3TNP B;  3J9S A;  3BOD A;  3LDK A;  4UFJ A;  1PZ9 A;  1NLQ A;  3LD8 A;  4AFD A;  4YVW A;  2Q30 A;  1PMJ X;  3POW A;  1HN0 A;  3B9C A;  3WDV A;  3NNM A;  1UY2 A;  3K48 A;  5CFD C;  4QPG B;  1N1S A;  4Q5O A;  3MV1 1;  2D6M A;  1V6O A;  1RB8 G;  3SQO A;  3WQ1 A;  2Q4S A;  4F8A A;  4GWJ A;  1C28 A;  3LZZ A;  2FDJ A;  1KJR A;  2Q8E A;  1JU3 A;  3Q8C A;  1C4R A;  4KQ7 A;  5F3G A;  5BNN B;  1QQP 2;  5GKA C;  1YQ2 A;  4WZC A;  3ZPY A;  4AE2 A;  3FWE A;  5FV3 A;  5IK4 A;  1CZV A;  4IE5 A;  2XH6 A;  2EIB A;  2WN2 A;  3EXU A;  3D5O A;  2WAO A;  5KHI A;  5C9A C;  5J98 B;  5A6Z A;  3B94 A;  2ZGQ A;  3FMG A;  2JDA A;  2RS5 1;  3ZXL A;  4E4D X;  1W06 A;  3NKG A;  1JS9 A;  1K5M A;  1IQD C;  4DXR A;  2YYO A;  1DP0 A;  2GN7 A;  2JDU A;  4IEP A;  2PFW A;  1ZRI A;  4HK9 A;  5FYH A;  3KZ4 C;  3GZA A;  3MI8 A;  5IK7 A;  4DRV A;  1RUG 3;  3HQX A;  2WN3 A;  3IDB B;  5GLW A;  1ZZC A;  4CUA A;  4JGY A;  3RJR A;  3QOP A;  3A4U A;  4KWK A;  3Q8E A;  4KG0 A;  1LOF C;  4Y33 A;  4MX3 A;  3J4U H;  3RZG A;  4LK7 A;  3PU3 A;  2B45 X;  1D0H A;  3DGT A;  1SG3 A;  1V6K A;  1AR7 1;  3IDE A;  4N43 A;  5FQ0 A;  3IB3 A;  3H42 B;  1BMV 2;  1XE8 A;  1CAW B;  1X7N A;  5FLI A;  1XC6 A;  2VZQ A;  4KWL A;  3RSJ A;  5CG8 A;  2DVD A;  3AL6 A;  5A3M A;  5FY4 A;  2C5D A;  4WM7 A;  2E32 A;  1MZ5 A;  2VZP A;  3Q8F A;  5FZK A;  1OC1 A;  1LGN A;  2IC1 A;  3VBU B;  2XON A;  1ND2 B;  1RUG 2;  4XIL A;  1S0J A;  3VBO C;  3ILN A;  3OD0 A;  1W0N A;  4UT5 A;  2XG3 A;  3ZFG C;  3GZU C;  2FDF A;  3UV9 A;  3G6J B;  4CCD A;  1NCQ B;  4N53 C;  3LA3 A;  4S2D A;  1LKN A;  4QQL A;  5JIA A;  2FDG A;  3ILF A;  4LKE A;  4YM2 A;  3ZN5 A;  4BQY A;  4UW3 A;  4CCE A;  1YC6 1;  2XOM A;  5LB6 A;  3VHN A;  1DDL A;  1AX2 A;  1NY7 1;  3APB A;  4OYU A;  3H1Y A;  1OQE A;  2HWB 3;  2RE9 A;  2VW0 A;  4FPY A;  3AMP A;  1V00 A;  1UO9 A;  4KBZ A;  4NID A;  3I59 A;  5GZF A;  3E5Q A;  3C8X A;  4WVV A;  4CRQ A;  4JVA A;  4GH4 A;  5FMD A;  5IWF A;  1LOB A;  1GWK A;  1S0D A;  5FUP A;  2CGO A;  3KCX A;  2IXJ A;  1UOB A;  2HBT A;  3LIG A;  3DKW A;  2V09 A;  4QPG A;  3PU8 A;  2Q8C A;  3WW3 A;  4EZ4 A;  2I45 A;  2CAU A;  5A32 B;  2Q5T A;  4QPY A;  2ZX1 A;  2BU9 A;  2WRA A;  3R4S A;  2DUR A;  3THD A;  2PQS A;  5FDB A;  1GUI A;  5T50 A;  1LJ7 A;  1A78 A;  5BNN A;  2HWB 2;  5IVF A;  5FY0 A;  2VTF A;  5JLV A;  4I2O A;  1HRV 1;  3VDD C;  2DFC A;  3A0K A;  4NWW A;  4WVM B;  4OZO A;  4RSU A;  1YIP A;  3PJQ A;  3LFI A;  1LNS A;  4J6G A;  4OUS A;  5EHD A;  1SHW B;  5C7G A;  1NCR C;  2FCV A;  1H2N A;  3D3A A;  2ZMK A;  3KWV A;  2KR2 A;  1YIF A;  5C3S A;  1KIT A;  5HPO A;  2VOV A;  3OUI A;  2X09 A;  4NRO A;  4OHX A;  5E89 A;  2OUH A;  2ZHK A;  1H1A A;  3ZLI A;  1QF3 A;  2RS1 1;  1LR5 A;  2WZ8 A;  5H9R A;  4QKN A;  4Y3O A;  1NA1 C;  1VBA 1;  2Y6G A;  4FBF A;  2UYA A;  4CU7 A;  5A70 A;  2QQW A;  4PDW C;  1LEC A;  2Q8D A;  2HWF 3;  1MPX A;  2FMY A;  2VCB A;  1H6X A;  1PO2 3;  1LRH A;  3QCW A;  1IG0 A;  1QJU 3;  1ULG A;  4LIT A;  3GJA A;  2IXL A;  3POB A;  1IKP A;  2VOT A;  1Y3T A;  4CUC A;  1YFX A;  1RC6 A;  3LSD A;  4CSW A;  2R6Q A;  1RXF A;  1Y9G A;  5CG9 A;  1KEX A;  1PK6 B;  3H8R A;  1W8T A;  1HRI 2;  3AC0 A;  2DBN A;  3OYW B;  3VLB B;  2YBK A;  3K2O A;  4BQW A;  1AYM 1;  2BBV A;  1ZA7 A;  5HXM A;  3BUC A;  1RUF 1;  4I02 A;  2JDK A;  1IGO A;  4LO4 B;  4C90 A;  5A3O A;  2A3W A;  5B4N A;  4P14 A;  2HWF 2;  5FLJ A;  4JGZ B;  1PO2 2;  3USS A;  4LOS A;  4YZ4 A;  5DAW A;  5A7N A;  1Y7B A;  1PVC 1;  2ZAB A;  1WBL A;  3WX5 A;  1J59 A;  5FPV A;  4IV1 C;  1NCQ A;  2RMU 3;  4LO5 B;  5AVA A;  1VAM A;  5IVY A;  5J09 A;  4I0W B;  3W59 A;  4IEV A;  1DGR A;  1JN2 P;  1J1T A;  4G3Y C;  4XBQ A;  3AZY A;  3IPV B;  4XF3 A;  5I93 A;  2ADE A;  2VQT A;  5SV5 A;  3FHA A;  1K45 A;  1RUH 2;  2R04 1;  5DPN A;  3UL2 A;  3WDX A;  5DG2 A;  1GKB A;  1OOP B;  1W8F A;  4BQX A;  1YWK A;  2QKD A;  1QJX 3;  3J26 N;  5T5P A;  2KXL A;  4YM3 A;  1RUI 1;  2ES3 A;  3VUO A;  2D7F A;  4ES9 A;  1QU0 A;  4I30 A;  3ZSE A;  5EQU A;  1SMV A;  2AEN A;  1W8H A;  1W6M A;  3KD4 A;  5BNP C;  1REF A;  1J3P A;  1UY1 A;  2AEZ A;  3OBZ A;  1LOD A;  3VDA A;  2IUW A;  5JR7 B;  3AMH A;  1A34 A;  2QQL A;  3NMB A;  2RMU 2;  4OI4 A;  4XUO A;  3AYD A;  4BA6 A;  4MOA A;  1H6Y A;  5A7Q A;  4Y4Y A;  5GLT A;  3GF6 A;  2DCT A;  1GIC A;  5A32 A;  3I4I A;  4Y1Y A;  2PLV 1;  2H0V A;  3POY A;  1I9R A;  3ATG A;  1RXG A;  2ZAH A;  3J8F 1;  1V0A A;  4HZF A;  4P9X A;  4AVV A;  5JOX A;  4SBV A;  3V0A B;  3KHB A;  5A3L A;  2WNV A;  2BPA 2;  2JG8 C;  1LEM A;  3KV6 A;  3L2H A;  1QJX 2;  2WA4 A;  2AH2 A;  4JKL A;  4AWD A;  3SIT A;  4JC1 A;  2PHL A;  2VZT A;  3GHN A;  1POV 0;  3GM8 A;  3WY6 A;  2HJI A;  2WNU A;  3MF6 A;  4TTG A;  4N43 C;  4D0Q A;  2QZ2 A;  1RED A;  1NQD A;  4M3C E;  1ULF A;  1O3T A;  3LE0 A;  2XGX A;  4BLJ A;  4Q4Y 2;  5T5L A; 
#chains in the Genus database with same CATH homology
 2W2I A;  4QU1 A;  2XDV A;  5FYT A;  2WWJ A;  2YPD A;  2Q8E A;  4QXC A;  5A7S A;  3ZPO A;  3KVB A;  5F3G A;  5A3W A;  5FZI A;  5FJK A;  4BU2 A;  5FV3 A;  5ANQ A;  5FY9 A;  5FP8 A;  3PUS A;  5A1F A;  3ZLI A;  2VD7 A;  4TN7 A;  5FZF A;  4QX8 A;  3AVS A;  4Y3O A;  2OQ7 A;  5FUN A;  5FZH A;  3KV5 A;  4QXB A;  5FZB A;  2XML A;  5FXW A;  2Q8D A;  3PDQ A;  2OX0 A;  5LY2 A;  4HON A;  4D6R A;  4LIT A;  5A80 A;  5FYB A;  5FXZ A;  4ASK A;  5CEH A;  4DO0 A;  2XUE A;  4D6Q A;  5FJH A;  3AL5 A;  4V2V A;  5FY5 A;  3U78 A;  4CSW A;  5F37 A;  4GAZ A;  5A7P A;  3U4S A;  5FPU A;  5IVJ A;  5F3E A;  2GP5 A;  3KVA A;  4HOO A;  5A1L A;  4V2W A;  2XXZ A;  3N9Q A;  5F5C A;  5K4L A;  2YBK A;  3K2O A;  5A3N A;  5LWB A;  3NJY A;  5F3I A;  4AI9 A;  3PUQ A;  4Y33 A;  5F2S A;  5FYY A;  4GD4 A;  5FZC A;  3UYJ A;  3PU3 A;  5IVV A;  4AAP A;  3AVR A;  5FZL A;  3PUA A;  4Y4R A;  2GP3 A;  4CCM A;  5FP9 A;  5KR7 A;  5A7N A;  5FY8 A;  5FZ3 A;  4BIS A;  5FPV A;  3K3O A;  5FZM A;  5F32 A;  5FYS A;  4QX7 A;  5IVY A;  3AL6 A;  5FY4 A;  5FZK A;  5FZG A;  5E6H A;  4XDP A;  2OQ6 A;  5A3T A;  5F5I A;  4EZH A;  5FY1 A;  4UF0 B;  4LIU A;  2P5B A;  5ISL A;  4QXH A;  4D6S A;  5F39 A;  3K3N A;  5FP7 A;  5FZ6 A;  5FZ0 A;  5FXV A;  4CCO A;  4E4H A;  4IGO A;  4XDO A;  5FYU A;  5LW9 A;  4NUB A;  4QWN A;  1VRB A;  5FXX A;  2OT7 A;  4CUG A;  5IVB A;  5F3C A;  3N9L A;  5FWE A;  4CCJ A;  4LXL A;  4UF0 A;  5FP3 A;  5FZ9 A;  4DIQ A;  4LIV A;  5IW0 A;  5FZE A;  4CCK A;  4CCL A;  3OPT A;  5FZ7 A;  5FYM A;  5F5A A;  5A7O A;  5IVC A;  5A7Q A;  5FZD A;  5FY7 A;  5FYC A;  4IGQ A;  2OS2 A;  3RVH A;  4GJY A;  5IWF A;  5FUP A;  3LDB A;  5FPA A;  5FYZ A;  5FYI A;  2WWU A;  4C8D A;  2YBS A;  5FYV A;  3OPW A;  4GJZ A;  3KV6 A;  4EYU A;  2PXJ A;  5FZO A;  5FBJ A;  4BXF A;  5FZA A;  3N9N A;  5FYH A;  2YU2 A;  3PU8 A;  5F2W A;  5A7W A;  2Q8C A;  3PUR A;  5FPB A;  4EZ4 A;  5FZ1 A;  2YBP A;  2YU1 A;  4CCN A;  5IVE A;  3KV4 A;  3LD8 A;  3DXU A;  3N9M A;  3N9O A;  5FZ4 A;  5A3P A;  5FP4 A;  3KV9 A;  5FPL A;  5LY1 A;  4URA A;  5IVF A;  5FY0 A;  3PTR B;  3N9P A;  5FZO B;  4IGP A;  5FWJ A;  3DXT A;  5A7W B;  5FZ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...