2ZGQA

Crystal structure of aal mutant l33a in p1 spacegroup
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
167
structure length
167
Chain Sequence
MQGVNIYNISAGTSVDLAAPVTTGDIVTFFSSAANLNAGAGNPNNTTLNLFAENGAYLLHIAFRLQENVIIFNSRQPDGPWLVEQRVSDVANQFAGIDGKAMVTVFDHGDKYQVVINEKTVIQYTKQISGLTSSLSYNATEETSIFSTVVEAVTYTGLALEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Anti-tumor lectin
publication title Structural basis for the tumor cell apoptosis-inducing activity of an antitumor lectin from the edible mushroom Agrocybe aegerita
pubmed doi rcsb
source organism Agrocybe aegerita
molecule tags Hydrolase
total genus 40
structure length 167
sequence length 167
chains with identical sequence B
ec nomenclature ec 3.1.21.-:
pdb deposition date 2008-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2zgqA00
2A3YA 4LBQA 4F83A 2OVUA 1VAVA 2A3XA 3VKOA 3AJZA 3VKNA 1BKZA 1LOBA 4P9XA 1Z78A 1YO8A 1X50A 4GKYA 2KM2A 4YG3A 1WW5A 1LU1A 1APNA 1WCSA 1JXNA 3GALA 2YY1A 1KQRA 2AUYA 4M00A 3BTAA 5DG1A 3FUQA 2ARXA 3PVNA 1AF9A 2D3SA 2E7QA 1S0GA 1DIWA 1SLLA 3AX4A 2DTYA 3VKLA 2ZGOA 1MS4A 5HCFA 1LHUA 4FOWA 1S0IA 1HLCA 4ITCA 1VIWB 1JOJA 3FBYA 4M3CA 3T1LA 3N7KA 3KM5A 2R0HA 4K20A 1LESA 4BQ1A 2CWMA 2GMPA 2ZGNA 3WDTA 4YM1A 1IKQA 2WSVA 3H0OA 2EXIA 5E88A 1G7YA 5JVVA 3HR9A 1ULEA 4AGVA 2GALA 2A6ZA 3BODA 4XMAA 2UURA 2W52A 1C1LA 4XTMA 3LCPA 2ERFA 2P3JA 1U0AA 1LCLA 2EF6A 1QU0A 4FPHA 4ATFA 1S0JA 1OFSA 1W6MB 4FQZA 2ZMKA 3D5OA 4PCRA 4CZSA 5IT6A 2XG3A 1S0CA 2C5DA 1DLLA 1UL9A 4BMBA 2CWSA 1XQNA 3MW4A 3PVOA 3ZVXA 5BYNA 3A0NA 4GA9A 2VH9A 4YGEA 4Q8KA 4YGCA 2WT2A 3WG1A 1S0DA 4AVVA 3WHUA 3ASIA 1IOAA 4BMEA 3PVEA 3CNAA 2DTWA 1WD4A 3AZZA 1W6PB 3C2UA 4YZ1A 1N47A 5GALA 2ZHKA 1S0BA 4XJZA 3USUB 1JUIA 2W39A 4AGRA 1AXYA 1FX5A 2LALA 4Q2FA 2P34A 1C57A 4P9YA 1MVQA 3WUCA 1SLTA 4PBPA 3B3QE 1UPSA 4YGDA 2A6XA 5JOXA 1FV2A 1GV9A 5DZFA 1WW4A 4AYUA 3RRDA 3WVJA 1QMJA 1F9KA 2CTVA 2YXSA 3IPVB 3MW2A 4XOGA 1QNWA 3IN9A 4FPFA 5JLVA 3AP9A 1A78A 1UZYA 4XTPA 3WDVA 5JDBA 1YXWA 4WVWA 2ZGKA 1IKPA 5IK5A 2EXJA 3ZSJA 1CN1A 3N35A 2ZA9A 2A71A 2EXKA 1DHKB 1YI7A 1LOFA 1KDKA 1QOTA 2Z42A 4L8QA 1KDMA 3VV1A 1F31A 3ZXKA 3VUOA 3VKFC 3ATGA 4DPNA 1DQ0A 3WDUA 3AZXA 3W58A 1RIRA 4Q27A 5JOZA 1DQ1A 3NV1A 1W6OB 1FNZA 1A8DA 3ZXFA 3M3OA 2DU1A 3A4UA 2OUHA 2YV8A 3HMYA 3WUDA 1HDKA 1BJQA 4K21A 1MZ6A 1Q8SA 4P9WA 3OY8B 1G9CA 3O0XA 1GNHA 3D6EA 4XBNA 1DQ6A 4YM2A 4H55A 4BLJA 2EIGA 1V00A 1ONAA 2P3IA 1GZCA 2XB6C 4GWMA 2AREA 4LBNA 4OZXA 4RL7A 3ZSMA 1N3QA 3MEPA 3POWA 4Y24A 2GNTA 4I30A 1YIFA 2P3KA 2W68A 1QNYA 1LHVA 3OBTA 4LBLA 3SH5A 2PHWA 5DUXA 1HKDA 1W6MA 4Q8LA 4PQ9A 4YG0A 1N1VA 1YYNA 4SLIA 2A3WA 2D6MA 1MR5A 1O4ZA 1PZ9A 1SLIA 5GZDA 1JBCA 3RSJA 2D7FA 3INAA 3T1MA 3M3CA 1WLCA 4YW2A 1W6QB 5GLVA 2EALA 4XJWA 2PHFA 1SLBA 2TEPA 2WLQA 1SBEA 1WD3A 4YLZA 1AJKA 1ULDA 1S0FA 3Q9OA 1N3PA 4M01A 4M3CE 4BLIA 1V6IA 2JD4A 3M3EA 1UX6A 2GMEA 3W59A 3WG4A 2WT0A 1DZQA 3PJQA 4KBBA 1V6JA 1W6PA 4YM0A 2GN7A 1CIWA 1LOCA 3OGGA 5L73A 4AVSA 1G8WA 2R16A 2V5YA 3FFZA 3KQRA 3OYWB 5T5JA 3QLQA 3WLUA 2A6WA 2ZHNA 3AZVA 4BM8A 1KJLA 4XYXA 3M3QA 2VY0A 1QDOA 3RMYA 1NLSA 1KJRA 3B01A 3T2TA 3WG2A 2NN8A 5EXOA 5KXBA 2A6YA 1VLNA 3SLIA 1FYUA 1DFQA 3DGTA 4FPYA 2JE7A 4C1WA 4FPJA 1PZ8A 2VW1A 4LBMA 5T54A 2DVDA 5DUWA 2G4IA 3OPZA 2ZGUA 1DGLA 4GWNA 4YGBA 2ZGLA 1DYPA 5IUQA 3JU9A 2WKKA 3SH4A 1GLHA 1FV3A 3AFKA 4WVVA 4BOWA 3POSA 4GKXA 2UWBA 2D43A 4AVTA 4Y20A 5DZGA 2FMDA 1HQWA 1V6LA 1AJOA 2DVAA 2ZGSA 1QF3A 2NYYA 3AP6A 2DYCA 2E51A 1ENRA 1RINA 3O0VA 4UW4A 2ZBJA 2PHUA 2ZMNA 3N3HA 3R05A 4GALA 3AYDA 4DRVA 1W6OA 2PHTA 1MZ5A 5JMCA 1Q8VA 2ZACA 1SBDA 2NMNA 2UU8A 3WOGA 1JYCA 2DWRA 2A6VA 4NO4A 1LOEA 1N1SA 4ZXKA 1I3HA 2WNEA 4YM3A 3B9CA 1ULCA 1LULA 1PZ7A 2ZKNA 5GZCA 4XDQA 2ZZJA 3NV4A 3OY8A 4NOTA 1MS8A 1JW6A 5IK8A 4XIOA 3V0AB 3IKWA 3I8TA 4LBQB 3ILRA 2WJSA 4LBJA 5E89A 4YZ5A 1QOOA 2JECA 1MS0A 1VALA 3IMNA 1MS9A 3MW3A 1MS3A 1CONA 2D6OX 1GANA 1QGLA 1SBFA 2D6KA 4FVVA 3R4UA 2A5ZA 1N3OA 2YZ4A 3FUOA 1BXHA 1AX0A 1CESA 5IK7A 1LOGA 4YW5A 1ZA4A 2A7AA 2EAKA 1IS5A 3ZYPA 2DVBA 2RHPA 3RG0A 3WDXA 3O5SA 1W6QA 1WBLA 2BQPA 2ZABA 1QOSA 3N7JA 2R49A 1IS3A 4XMIA 4YW3A 4W65A 5EYYA 1YRZA 4Y1YA 2AYHA 3MPPG 1GZ9A 3N7LA 1DQ4A 3FLTA 1LGNA 2OUJA 4YW4A 1AX1A 1SCSA 2OW4A 2VU9A 3O12A 1D2SA 1B09A 2R0FA 4M3CF 3RMXA 3VKMA 4PF5A 2SLIA 3OYWA 1SACA 1WLWA 2E53A 1LECA 5H9RA 4FP3A 4AWDA 1MS1A 4R9CA 4XBLA 5CB7A 1Q56A 2CY6A 1MACA 2Q5TA 2ZGTA 3LSEA 2HYKA 4XHBA 4DS0A 2AGSA 1LJ7A 1GNZA 1JN2P 1W6NB 3AYEA 3AZWA 5T50A 3QCWA 1Q8OA 2AH2A 1S0EA 2D6LX 4XZPA 4PBOA 3V65A 5GZGA 2DUQA 1H9PA 2ZGPA 1LGCA 2LTNA 3U4XA 2DU0A 3TAYA 4FP2A 3WDWA 4UW6A 3ZPYA 1GKBA 1V6KA 1TEIA 2C9AA 2D44A 1WLDA 3AYAA 1LHNA 1I1EA 1IS4A 4DQAA 2D3PA 5H9PA 2D3RA 1LTEA 5H9QA 2VXRA 3M1HA 3ZXEA 5CAZA 4FPEA 1LENA 5KXCA 2AR6A 4DFSA 1W0PA 2GNBA 5GLTA 4YZ2A 3A0KA 1AXKA 2WSUA 4C1XA 3R4SA 2A70A 4Y22B 1Q8QA 1LEMA 1BZWA 3SH3A 4YFZA 1AXZA 4FPOB 4FOYA 1V6MA 1G9AA 1V6OA 4ZKTB 1A3KA 1D0HA 4IQPA 1AVBA 1F5FA 2NM1A 4YW1A 2VW2A 1LHWA 5FRAA 1FAYA 1Z0HA 4YFWA 2PELA 4CTEA 1LGBA 4FPCA 5EYXA 2DVGA 1HQLA 4K1ZA 3USUA 3V0AA 1ULFA 4R9DA 1ULGA 1DBNA 2SBAA 5DUVA 4XXAA 1BYHA 2ZAAA 1QKQA 4Y1VA 4D69A 3ILFA 4XHXA 1EPWA 2WT1A 4XJUA 3AP5A 3AYCA 3ZSLA 1BQPA 2ZGMA 4CRQA 1NXD1 1LEDA 3OBRA 3V64A 3WNXA 1FNYA 2ZMLA 2EXHA 3IPVA 3N7MA 2ARBA 3DUIA 2NMOA 4Y1XA 3WZ1A 1SLAA 3ZXJA 3SITA 3HN1A 1G9DA 4XJ8A 1SLCA 1WW7A 2CL2A 2DURA 4Q1PA 1R1ZA 1ENQA 1LODA 2YROA 4XXPA 3SISA 3V0BB 2GN3A 5T55A 1Q8PA 5GLWA 1MVEA 2UWAA 1VAMA 5SV8A 2W08A 1CVNA 1LHOA 1AX2A 3FLRA 3GNEA 1W0OA 2V73A 4XBQA 1CPMA 1O4YA 1Y7BA 2PHRA 5GM0A 3RS6A 5DUUA 3B00A 3UL2A 4R9BA 4ASMB 4YG6A 5E8AA 3UK9A 3WCRA 1KITA 3AJYA 4Q1RA 2FHRA 5HCAA 3N36A 1G9FA 1UKGA 1RITA 1GICA 5GZFA 1GZWB 2GDFA 5T5LA 2AENA 3AK0A 2H0BA 1UZZA 2I2SA 3SNMA 1CQ9A 4RA0A 4BPZA 1UN1A 1LU2A 1CPNA 2JE9A 4XIKA 1SFYA 1W6NA 1WBFA 2DV9A 2ENRA 2P2KA 1DQ2A 2E6VA 1FATA 1N1YA 4YZ4A 3BOPA 3RQ0A 4DRRA 4TZDA 1ENSA 5T52A 2A75A 4P14A 5F9TA 5KXEA 2B7YA 1URXA 4UW5A 4MYEA 3JUUA 1C1FA 1GYKA 2VUAA 4UW3A 1G9BA 2JJ6A 4XE9A 2ZHMA 4TYSA 4Z8BA 3APBA 1C4RA 1WUVA 4FPGA 3TB0A 5CBLA 1LOAA 3WDYA 5F5QA 1CR7A 5JOWA 4M3CB 1QDCA 4Y22A 3BIWE 4FPKA 1H30A 2JDZA 5FREA 3WG3A 1OKQA 4WV8A 3WCSA 1S1AA 2ES3A 3OJBA 5DXDA 1N1TA 2PHXA 2R1BA 3NV3A 1JHNA 2E7TA 2JKBA 4FOVA 4LBQD 4ATEA 3O0WA 3WHTA 3AXEA 3WV6A 5IK4A 4JRAA 3UJQA 2P37A 3ZSKA 3LSDA 3NWKA 5DZEA 1CJPA 1J1TA 1V6NA 2R1DA 3B69A 3ZYRA 2D6NA 1GSLA 5H9SA 5GLZA 4XILA 3POYA 4HL0A 5CNAA 5GZEA 4U2AA 1G86A 4Y20B 3D4KA 4Y1UA 2VW0A 4AGGA 2ZHLA 4U36A 1UMZA 4JC1A 2D6PA 5EWSA 2GNDA 3AZYA 5GLUA 2GNMA 4FOQA 4GXLA 5DG2A 3IM0A 2DUPA 2NZ9A 4LBOA 2DUOA 3ILNA 5LK5A 3V0BA 4YZ3A 1ZM1A 5T5OA 3NV2A 3M2MA 5AVAA 4Y1ZA 4K1YA 2CNAA 3PMEA 4Y26A 5HCBA 1JYIA 1DQ5A 1MS5A 1OQ1A 1KRIA 2WQZC 4FQ4A 1SCRA 2YMZA 3L2YA 4ISQA 4R9AA 3ENRA 4LBKA 2CYFA 4XJ9A 5JOYA 3FLPA 1GBGA 4HANA 3AXDA 1H9WA 1WW6A 3I4IA 2DVFA 4Q26A 4ISRA 1LOFC 5KXDA 1AZDA 2NP0A 4WZFA 3AP4A 4JCKA 1GZWA 1IS6A 4FPLA 4XJAA 1UAIA 1DYKA 5GJ6A 3ZXLA 2ZGQA 5T5PA 3UJOA 2UWCA 5CA6A 2ZGRA 2GMMA 3AP7A
chains in the Genus database with same CATH superfamily
1AYN2 1AYM3 4AEKA 1ZBE1 3AJZA 3VKNA 3WNOA 1W05A 4HOOA 4CCDA 1Z78A 1VBA1 1YO8A 4A2UA 1JMUB 3GZUC 3ECQA 1JXNA 1QQP3 3GJBA 2HEWF 4W6YA 5BPXA 4IL7A 3DYPA 4Q4Y2 3BYWA 2HEYF 1VMJA 1WA6X 2WAAA 4GZ9A 1AYN1 1S0GA 5A6YA 1SLLA 3ROUA 3VKLA 3K75B 2YBKA 1ENXA 1LHUA 2W92A 3LDRA 1S0IA 3THPA 4AOCA 5I8YA 4FSJA 5L9BA 3ZDSA 4CCMA 2OS2A 5LZ6A 4DY3A 1W90A 3KF5A 5L36A 4K20A 3VZKA 4EQVA 4B8EA 4I09A 1VBD3 4PLNA 3UYJA 2HWB2 3NJYA 3RJ2X 1DGWX 2VE1A 4QGMA 4YM1A 4G4FA 1DCSA 1IGOA 2QTWB 5EHDA 2WSVA 5F3EA 3H0OA 2EXIA 3HOBA 1JTZX 1ULEA 2W46A 1GWKA 5EJZB 2IXKA 3AKQA 5FYMA 1UY2A 4YVWC 1TG7A 3OF1A 3T0BA 2W52A 3ZMOA 1C1LA 3ZKUA 3LCPA 2ERFA 4FFFA 5IAVA 4AQSA 5AFEA 1LCLA 1I5PA 4ZZ8A 4HPKA 5EZWA 1U5YA 1BMV2 4IEXA 2F4PA 2W1UA 5FK8A 1D4VB 2JKXA 4CP2A 4DXTA 5HXMA 5IT6A 1AUYA 2C5DA 3HNBM 1JYWA 2C24A 1UL9A 2YYOA 3RDIA 2VMGA 3ES1A 4J25A 4QX7A 1FPN2 3PVOA 3BN6A 3VD3A 1NA1C 4GA9A 4Q0VA 4Q8KA 4YGCA 2WT2A 1BMV1 4KGQA 1KFXL 2F17A 3WG1A 4AVVA 1Z7S2 5FFOC 4HMZA 1LB2A 1GWMA 3J7HA 1TMF3 3HBKA 4RHV3 2D5FA 4QQPA 1PVC2 5LEJA 3PVEA 5F6KA 2DTWA 3DXTA 4UT5A 1N47A 2RDRA 3EXUA 1J3PA 1RUE2 1ND3A 2W39A 4META 5L9RA 2OT7A 1BLZA 2PAMA 4BH9A 1SLTA 5FZHA 4ASKA 1POV3 1UPSA 2VR4A 2XLFA 3JXSA 1CAWB 4IEVA 4HVRA 4RQPB 4YGDA 1PVC1 1UU5A 1WW4A 4Y33A 4AYUA 4GH4A 4OI2A 2W1QA 5JCTA 3EO6A 4JGYA 2BVBA 1RUE1 1QJEA 4NJ4A 3IN9A 5FMOS 3BGAA 3WQBA 3MLJA 1U5ZA 4KWLA 1XXNA 3J8F3 3WDVA 2AC1A 4Z92B 4BK4A 2IFWA 1XNKA 3OPWA 3N35A 1OLQA 4DOUA 1RUG1 2BWAA 5FZKA 2QKDA 2YC4A 2WFF2 2EXKA 4XCAA 5E16A 1L7RA 3H1MA 1KDKA 4ZS2A 2Z42A 3VKFC 3ATGA 1UYZA 1PVXA 1DQ0A 2UY8A 2XKPA 2H6BA 4PI0A 3WDUA 3K51A 2J22A 3MO4A 1O7FA 1F8VA 1HJFA 4Q27A 1C8NA 3O7OA 2VPVA 1Y9GA 3NV1A 1W6OB 5A7WA 1UOBA 4LE3A 5D21A 2WFF1 1W8OA 2WC2A 1LNSA 1ZBA3 4QKBA 5BNPB 1HDKA 1BJQA 2WA3A 1H8TB 1MPXA 2Z5WA 1QXPA 3IDCB 4AQTA 5AC92 4EZ4A 5LA2A 2EIGA 1HB1A 3CO2A 1H4GA 1OOPB 1RVF2 2AREA 3ZSMA 3LA2A 4AEMA 5LA1A 3T09A 5C3QA 3HT1A 1NAEA 5IVCA 2P3KA 1O8PA 4K3UA 5K4LA 4K9SA 3RYPA 4I02A 3J7NA 1H6YA 5AC91 1W6MA 4PQ9A 2FDIA 2ORXA 4HBNA 1YYNA 2FCVA 4Q4W2 2JG8A 1RVF1 5FY9A 2AZ5A 1PZ9A 1JBCA 3PUIA 2WZEA 1GP5A 4XJWA 3ZN4A 1SLBA 2B9VA 3KZ4C 1C5HA 4CEWB 4MXWB 1O3SA 2BWCA 4M01A 2PAKA 4CPBD 3W59A 1AR62 4JGZC 1RUF1 4Q4W1 1PO12 3S0MA 4HONA 1W6PA 1QJX3 3GM8A 1G8WA 2R16A 1PNGA 3ELNA 5FWEA 1VBC3 2TNFA 1KJLA 4L0PA 1RJ7A 2P6HA 4BXSV 3AM2A 5C9AB 3RMYA 1NLSA 3T2TA 2JEMA 1PO11 3TYJA 3VL8A 1Y43B 2R062 1NA1A 4E4DX 2ZTNA 5JZGA 1DFQA 1Q5OA 3C7EA 1OVSA 2JE7A 4FPYA 4XFGA 4HK8A 4Y5TA 5BNQA 2Y6HA 5T54A 3PU8A 4YW6A 2G4IA 2WS91 1UOGA 2ZGUA 2ZX4A 4P9GA 1YWKA 3ZX7A 2RJ2A 2ZGLA 3MUZ1 1PHMA 3FHQA 5DAXA 4CSWA 2QQOA 5DPNA 1FV3A 3NAPB 4WVVA 3POSA 2CAUA 3O1RA 5JI9A 4QPIC 1W06A 1YQ6A 2R061 2RMU2 2PAEA 4HLTA 4QPGB 4E4ZA 4ET7A 4CP1A 5KBFA 1UY3A 3AP6A 1ZZ8A 4IUGA 3T2QA 4N8MA 2EIBA 4XFHA 1LRHA 2Q1FA 3T2PA 3WNPA 3ZFEB 1HQNA 3BTYA 5DQ0A 4DINB 3KT4A 5BUVA 1SDDB 1SEFA 5DMYA 1NG0A 1Q8VA 2UU8A 3THTA 2JDHA 4K7JA 4DXRA 2PHLA 2Y8KA 4AEDC 3QH6A 4RS5C 5CFCB 1JZ6A 2QJVA 2R042 4F3JA 1ULCA 1PGW2 2DCYA 1X7NA 3GJAA 4KWUA 3V0AB 1RUG3 2WJSA 1NUKA 1UOFA 2ZZQA 5E89A 5CKNA 1MS0A 3FE5A 2HBUA 1NE6A 5CYYA 1ZZ6A 2XVKA 2Y33A 4COVA 2K9ZA 1OKOA 4WM8C 1CONA 1UYYA 2HWE2 2R041 3RZZA 5A3PA 2D6OX 5JPNB 1NQDA 1PGW1 5KHJA 4QQLA 2D6KA 4FVVA 1Q3EA 2LW8A 3R4UA 2YZ4A 5C3PA 4QHOA 1QIQA 1POQA 1AX0A 4QMAA 5IK7A 2PYTA 2RS31 4CCJA 4KGGA 4YW5A 2EAKA 4GMP0 2HWE1 3KHBA 2E26A 3O5SA 2UY9A 4MUVA 1W6QA 4AI9A 2YHJA 1VBE2 4NWVA 1US2A 1QOSA 3N7JA 2R49A 1IS3A 2IVJA 4D6SA 5EYYA 1YRZA 3QOPA 3B02A 4W50A 5LA9A 5I0DA 2XLGA 3MUY1 1O5LA 3K4ZA 3FLTA 1XNTA 2VUDA 3B94A 3OG2A 5LATA 4A41A 4M3CF 2PHDA 3SC7X 4IEWA 5H9RA 1VBE1 4AWDA 2IXCA 1IG3A 3ZO0B 4R9CA 3AMQA 1MACA 2O8OA 3DPRB 1WCKA 2HYKA 3IIAA 5J96B 1GP4A 5IAXA 4NIIA 3AVSA 2AGSA 4DS0A 2YBSA 2BU9A 4S2HA 3TBDA 3QCWA 1QXRA 5GZGA 2DUQA 4NPRA 3GBGA 1H9PA 2VQUA 4V2WA 5J48A 4N53C 3W5MA 4JGZA 5EV7A 5IVBA 3U4XA 2DU0A 3PU3A 1GKBA 1RUF3 2JB8A 1HRV3 2C9AA 3I3BA 2WO7A 4IV3C 4NAMA 4CDQB 4TXWA 4N7IA 3R0RA 1I1EA 2ZKLA 1DGRA 4LIUA 4DQAA 4EE2A 4IDZA 4P9LA 4GD4A 3M1HA 4CUBA 4FPEA 5EIYB 1DU3D 5FYHA 2D5HA 4YZ2A 5FWJA 2QCSB 2WSUA 4CEYB 4UWDA 2A70A 3O1UA 3CL1A 1K5MB 1Q8QA 1ZNPA 3P3PA 3KVBA 5FZFA 4YFZA 3U11A 5JXHA 1J3QA 4IE7A 1G9AA 4ZKTB 2WS93 1HB2A 1F5FA 1A6CA 1CAVB 2VBDA 5A3UA 2BEOA 1G6NA 4QPIA 4YFWA 1W2UA 2JG9C 4PDWA 4CTEA 3VBOB 1MQTC 2BW8A 4K1ZA 4MGYE 1DZRA 4OYUA 5LWBA 1ULFA 2VTXJ 2MNGA 1YJKA 2SBAA 2VZVA 3Q8FA 4XXAA 1BYHA 3VZJA 1QKQA 2XJVA 1DGRN 3ILFA 1FT9A 1EPWA 5LRRA 3WF0A 4D69A 1CAWA 2ADDA 3I3EA 3LD8A 2WT1A 4XJUA 1KEXA 3CEWA 2R6QA 3GHNA 1UO9A 1BQPA 2Q8DA 4W6WA 3LWCA 3OBRA 4NAOA 3V64A 3WNXA 3WF2A 2ARBA 4XF1A 4Y1XA 4RS5A 2GU9A 3MGUA 3WZ1A 1O3QA 1IHMA 4LHKA 2WNVB 4E4HA 1PO23 4P5YA 5FUPA 2CL2A 4NIHA 2LUWA 2MPFA 3VL9A 3F2ZA 2MHFA 2R7EB 1Q8PA 5GLWA 1YQ5A 5CG9A 3M4FA 1TVGA 1VAMA 5FY8A 3WP5A 4D7YA 1O5UA 4I0AA 3U0ZA 2VG9A 1E5SA 1UD1A 3WW2A 1W8HA 2HWD3 4OHYA 4WM8A 3FHIB 3UL2A 2IXIA 3LKJA 4LKSA 3UK9A 3KCXA 3MBWA 2JDYA 3AJYA 1OD5A 1J84A 1G9FA 3D8CA 1YEWA 3NKTA 1OH3A 4B4QA 3PLQA 1GZWB 4COZA 1ZZCA 4EWEA 2LROA 5BNPA 3AK0A 5AVPA 3ORJA 3VBFB 2RS33 1OI6A 3K4AA 2CU5A 3KQ4B 1CPNA 1H8TA 1SFYA 4D7SA 3H8OA 5IYYA 2XLAA 3E5XA 4Z07A 1NX9A 2ENRA 2VZTA 4HK9A 4LO7A 4NHKA 1DQ2A 5FYUA 4TTGA 1OOPA 1BVP1 1FATA 1N1YA 4B4PA 1DDLA 5EQUA 3SMHA 3NO8A 1HIXA 3GGLA 2A75A 4W8JA 2RVAA 1URXA 3KV9A 4C90A 3JUUA 1G9BA 1UY0A 3S5QA 3ZFFC 2J1RA 2QZ2A 1NE4A 3R4DB 4QX5A 1RB8G 4I01A 3LE0A 4BQ3A 1PM4A 1RUC2 2FMYA 3JBG3 1FOD3 3TB0A 4AK3A 5CBLA 4I2OA 4JKKA 1CR7A 3POIA 5JOWA 2XGXA 3VHNA 3BI3A 5IW0A 3WXPA 4CEWA 4EN6B 3U37A 3OPTA 4MXWA 3T4HB 4HZFA 3HN3A 1W3XA 1S2KA 2W87A 4FPKA 4UFHA 2QQPA 3WG3A 4ZU4A 2YU1A 5K0UC 2R1BA 4Q4X2 4X8PA 1RUC1 1CD3G 1JHNA 2E7TA 2JKBA 2FDGA 4COYA 1CZSA 3O0WA 4CCCA 3QACA 4O9GA 2R1DA 1J1TA 2F6BA 4JX0A 4A4AA 5C9AA 4MGSA 4AL9A 3POYA 3ZYGA 4Y20B 2Q8OA 4Q4X1 4EN7B 2XVLA 1U5XA 3PUAA 4AAXA 1UMZA 2WAOA 3BPZA 5EWSA 3AZYA 3WP6A 5FP9A 3ETPA 2WNUA 1W3VA 3A22A 1W9FA 1PIV1 2VD7A 3LA3A 1F4HA 2BPA2 2DUOA 1W8UA 2Q1ZB 3HT2A 1HN1A 2DCZA 1AR93 4PHZA 4YZ3A 3FJSA 2C4XA 4CDWC 5F2WA 2E9QA 4QPGA 1KS4A 1BK1A 5HCBA 1NLRA 4M4RA 1AR72 5A3OA 2G9ZA 2VNOA 2WQZC 2VZUA 3FHAA 4FQ4A 4LULA 3K3OA 4ISQA 5FZ6A 3VDAA 2C1FA 3FLPA 3A7QA 3OOXA 1EAH1 2VVEA 4E2SA 1WW6A 4Q26A 4Q29A 1AZDA 2QE3A 1DGWA 2KR2A 2X8KA 2CV6A 4RN5A 5BY5A 4BQWA 2G9FA 5FZEA 4GH4B 3FZ3A 4AF9A 2O1QA 2ZGQA 5ANNA 1RUI1 3CZJA 5CA6A 4URAA 2ZCWA 5DDJ2 3W21A 2G1MA 1STMA 4CCOA 1COV2 1ZREA 4F83A 1T2XA 1VAVA 4C0HA 1B35C 1L7LA 3VKOA 5FO9B 2WYFA 3N9OA 1BKZA 1LOBA 2WN3A 2PFWA 4IE0A 2A1XA 4KI5M 3JB4C 1OPOA 1X50A 3I2FA 3WW1A 3ZIWA 4CDXA 1W8ZA 4AQ2A 3SHRA 1APNA 3HAGA 3GALA 4QKNA 2ZXQA 3VHPA 5DDJ1 3BTAA 5DG1A 1COV1 1UQXA 4QX3A 1DIWA 1L3JA 4HFSA 1L7QA 3TNQA 4I0BA 4L99A 5FY5A 2BUKA 4FOWA 1ZZ7A 4OI0A 2OZJA 3RZMA 5DAWA 1ASJ2 3KB5A 2QZ3A 4OULA 2JE8A 1QH7A 3FBYA 2OKXA 3T1LA 3N7KA 4GB31 1YIPA 4FAGA 1LESA 3GHMA 5KC5A 3H3ZA 1F5JA 4BQ1A 4LXLA 3T0DA 1PK6C 3ACLA 1FXZA 3Q8AA 1OLMA 3NJXA 3VD5A 2MEV1 3M8LA 4R8HA 1G7YA 3VZNA 3HR9A 4QDSA 3LAGA 2XWBB 4LKDA 4XQWA 3ZFFA 3BODA 2UURA 4A3XA 4MH0E 3KS7A 3DPRA 1BEV2 3ZDVA 1V9U2 4LUKA 3AB0A 3UT0A 1U0AA 4HVQA 4KH9A 1R093 5FV3A 4NPLA 1W6MB 1IG0A 1OFSA 4AVSA 3PIJA 2QDRA 2ZMKA 5LBEA 4N9HA 2JG8B 1XOYA 1Y9MA 3D5OA 3QH7A 4V2VA 4CUAA 2XG3A 1WKYA 3HIFA 1JZ7A 3RZGA 2Z79A 1YQCA 1DLLA 3P5BA 4BMBA 1ACCA 3QD6A 5FYYA 1XQNA 1BEV1 4R52A 3TRSB 1R082 1V9U1 1WCQA 2VH9A 3LEGA 3JCIA 1H2LA 4BIFA 4FXKB 4YVWB 2WA4A 2FCTA 4CDQA 4Q4V3 4CCEA 3RZLA 1IOAA 5FO7B 2VBPA 3AL5A 3CNAA 4CPBA 2Q8CA 3HQXA 1W6PB 4YZ1A 1AR82 5DN2A 5LB6A 1H4HA 4CP9B 4AGRA 1UZ0A 2QFEA 2P34A 5IATA 1C57A 4S2FA 2BOIA 2XBO2 3GYDA 4PBPA 5JLVA 3B3QE 1K5MA 2A6XA 5JOXA 1UIJA 3WT3A 1VPHA 1FV2A 1W8WA 3AKTA 1W9TA 5DZFA 1NA1B 1PIV3 2ZAHA 3RRDA 1CAVA 4O7XA 4LTAA 2YXSA 3IPVB 3I54A 4MZUA 1OA2A 4N43A 3K3NA 1QNWA 4FPFA 5JI7A 3VBOA 1OF4A 4KWKA 3AP9A 1PNFA 1A78A 1MZFA 1UZYA 4Q0SA 4XF3A 3K4DA 4XTPA 4XF0A 2PMWB 4A6OA 4LO5B 5IK5A 2JX9A 3URFA 3PTRB 5LRSA 1YI7A 1UMIA 4XACA 1QOTA 2X5IC 4CDUC 1EAH3 3CKHA 3T08A 3BU0A 1OLRA 2Y0IA 5FXZA 2Q8EA 1XSQA 2WNVA 3AZXA 5CKMA 1RIRA 2YGLA 1HJGA 3W58A 4CU6A 4ZU7A 3UKNA 2BTVC 2Z69A 1RUI3 1A8DA 1XNBA 3EHKA 1HB4A 2DU1A 3A4UA 2XJUA 3M3OA 3CZUA 2XVGA 1B35A 2OUHA 3WP3A 3WX5A 2VCCA 5C4WC 3HMYA 4QM9A 4H2AA 1O3RA 4BDVB 4LUMA 1MZ6A 1PMIA 1KXGA 1OQDA 4RR3C 4YM2A 1DQ6A 3S57A 5A1LA 2N7GA 1GOGA 1V00A 1GZCA 2OQ6A 5C8WA 1CX1A 2JENA 5FY0A 5C5UA 1N3QA 4NR1A 4LHNA 3NJVA 4A6SA 2DCTA 5KHIA 5FMBA 2VMIA 3VBFA 4I30A 4QGLA 1YIFA 4FFHA 5FLHA 1BBT3 2W47A 1C8M2 5FPLA 5A33A 4QDRA 3PUQA 2XWJB 2E32A 2ZX0A 1BHGA 3N9LA 5L19A 2OZ6A 4AFMA 5F1RA 5F37A 4GB33 5GZDA 3Q8CA 3RSJA 2D7FA 3INAA 5FPVA 4DEVA 2RM23 3VD4A 1U12A 4YW2A 1W6QB 4IEOA 4AI8A 5A6QA 5HV4A 5I0SA 5HPOA 2WLQA 1SBEA 1TQ5A 3O1SA 1ULDA 2MEV3 3Q9OA 1N3PA 1UMHA 4BLIA 3A21A 4I0WB 2GMEA 1ND2C 4F8AA 2GC1A 1MEC2 1DZQA 3PJQA 1GP6A 1POV0 3WG4A 2RR12 1LOCA 4HVOA 4XETA 4XUTA 4P9JA 5L73A 2V5YA 1OLME 3KQRA 5T5JA 1V70A 5JXGA 3QLQA 3WLUA 2A6WA 2ZHNA 1RMU2 2VJXA 5HXVA 1NZCA 4XYXA 2BERA 2P1BA 4Q4Y1 1GOFA 5BNNA 4XFCA 3B01A 1KJRA 1XU2A 4IXLA 3PUSA 1SQ4A 1OXCA 4OMDA 4NUBA 4QPYA 2ZJCA 4IE6A 2RR11 2GC3A 3KCCA 2BNOA 4LOSA 4XPVA 1K12A 1UX7A 1FYUA 3H9AA 1RL3A 2VW1A 3POGA 4IEPA 4JGZB 4P08A 4GWNA 5BNNC 3ZFGC 4NHMA 4A7ZA 3DV8A 2WKKA 3SH4A 2EA7A 2HWB1 2UYAA 5FO8B 2V09A 2XHNA 2D43A 4Y20A 5DZGA 1K3IA 2FMDA 1HQWA 1V6LA 1AJOA 3I2KA 4IGQA 2XH6A 2ZGSA 2BGPA 3K2OA 2DYCA 2E51A 2QQUA 2OPKA 4MSVA 1ENRA 1RINA 1YJLA 4WZCA 5C8CC 1CZVA 5A80A 2QDNA 4PIZA 3O1OA 4ONUA 2PHUA 3RI9A 5ISLA 1RUH3 4GALA 3AYDA 4QQOA 4NPMA 5LBCA 1QHDA 3WOGA 3S6PA 3OBAA 3IWZA 1IPJA 4ZXKA 4YM3A 1I3HA 2WNEA 2I74A 3I2IA 1PZ7A 2VVDA 4QPIB 3NV4A 3OY8A 4PDWB 1YUDA 1E5HA 1FPN1 4UAPA 4XIOA 4LBQB 3I8TA 3ZM8A 2X5IA 3DXUA 2VZOA 1HXS3 4CDUA 1ALYA 4YZ5A 1QEXA 3PNAA 1VALA 1DF0A 1XC6A 3IMNA 4MLOA 1Z7S1 4UXAA 5LCWL 4JVAA 3OGSA 1MS3A 4A45A 2GP3A 3LEIA 4FI9A 4MHRA 5FP8A 4M4PA 5HBAA 1PGL2 1CX4A 1N3OA 4AEDB 3T2OA 2RE9A 1BXHA 4LOTA 4RS5B 4Z2AA 4RD7A 5C4WA 1LOGA 4QDQA 5A7SA 1ZA4A 5FY1A 2HBTA 3H1YA 1EV12 4QX0A 2DVBA 5FZ8A 3ZYPA 1WBLA 2Z4FA 1PGL1 5FZ1A 2HH9A 4Y1YA 4IEYA 2AYHA 3MPPG 4O9EA 4AVAA 3H1WA 4WM8B 5FYVA 1RUD2 1DQ4A 1NCRA 2WZR3 2YB7A 3DECA 3IAPA 1AX1A 2DCJA 2OW4A 2VU9A 4YW4A 1EV11 3O12A 3S7EA 2R0FA 1B09A 3VKMA 4PF5A 1VJ2A 2QQLA 1WLWA 2SLIA 1LECA 4FP3A 3IBMA 1MS1A 4FBFA 2ATFA 4CVUA 5HI0A 1QXJA 3AFGA 2PLV2 4XQDA 3B93A 1RUD1 1ZBE3 2B45X 1LJ7A 1GNZA 1P8JA 5FKCA 4GAZA 2VMDA 1VBB2 3ZR6A 4NIAA 1JN2P 1TME2 5A32A 3AZWA 2PTMA 5IHRA 1H8VA 1VBA3 2AH2A 1S0EA 2VOXA 3H50A 4XUQA 3MI8A 4OI4A 4AHYA 2Y6KA 3N9NA 1LGCA 2LTNA 3UV9A 4BE3A 1AYN3 3WDWA 4GJYA 5FPBA 4CE8A 4ORFA 1FMD2 1GR3A 4XF4A 1HX6A 1GMMA 1JHJA 3AC0A 2X53S 3AYAA 5BNOC 1PX4A 3MFAA 2D3PA 3ZKYA 4Q4Y3 5KHHA 3ZXEA 2VZPA 2P17A 1AL22 2AR6A 3ZXGA 4DFSA 1W0PA 5GLTA 5ACA2 2Y60A 1FMD1 3GBWA 3NMBA 3DKWA 5ABJC 3I59A 4NN0A 1BZWA 4YVWA 3SH3A 5A1AA 1AXZA 3J26N 3B7MA 4FPOB 2AEYA 4V1PA 3UGFA 1UKRA 4IQPA 1AVBA 2NM1A 2VW2A 4GWJA 1LHWA 1I6XA 3X29B 1AL21 2PELA 4IV3B 3DF0A 5FY4A 2HWB3 4FPCA 5FZ0A 1NY72 2DVGA 3HEIA 3P6BA 4CP9A 1DBNA 5DUVA 4CXXA 1UYXA 2ZAAA 4MV2A 3NNGA 1PMJX 1VR3A 3JQWA 1ZRCA 1YFUA 2QVSB 1QJU2 1AR61 2VXJA 3LA7A 4Y4YA 4EWDA 3IZOA 4BB3A 4QT6A 3NSTA 2RS12 4CRQA 4CU7A 2XMLA 4YARA 5FBZA 1FNYA 2EXHA 1CAUB 1XYPA 1YFWA 2O8QA 3EBRA 3IPVA 2LRPA 3N7MA 3SCGA 3I2OA 1UCXA 1JYNA 1SLAA 2WNUB 5IVEA 3GCWA 5IJRA 1G9DA 5FZOA 4OHXA 3SCFA 4CU8A 3OD4A 1R1ZA 3MIFA 1QJU1 4EROA 1SFNA 2JG9B 2RDNA 4D7TA 5JUVA 4BA6A 1MVEA 1J58A 2RS11 4K6BA 4UYBA 5B4NA 2UWAA 1FPN3 5SV8A 1OURA 4D6QA 3POBA 4DUVA 1AX2A 1J59A 3FLRA 1JZ5A 2V73A 1HW5A 4JQRA 1W9YA 4DIQA 5GM0A 1Z7S3 4GJZA 3DCQA 4R9BA 4SBVA 5DUUA 5FLIA 3VD7A 3KF3A 3EQEA 4CP0A 1PVC3 4EN0A 1KITA 4LITA 2CSGA 2RMU1 1ZYBA 4OHVA 1RITA 1ZRIA 1DP0A 2Q1MA 4GMP1 1K5JA 1RUE3 4A7YA 2BVVA 2GDFA 5T5LA 1H0BA 2VM9A 2H0BA 1E5IA 2I2SA 4Y5Z0 2VQTA 4IESA 4Q0QA 4ZY9A 4B7EA 1UN1A 1O8SA 2O14A 1YLLA 5JSRA 1XYNA 2DCKA 2VO5A 4PJYA 1WBFA 1WMEA 2DV9A 3P1IA 1NCQC 5G04L 4BIOA 1OC1A 1WMDA 5CADA 5DAVA 4AFCA 4J6GA 5FTTC 2ID4A 4RQPC 2HWF2 5FLJA 4QX2A 3BOPA 5D2AA 4OHZA 4CDXB 2WINB 2FDHA 2DBNA 1XNDA 4TZDA 1ENSA 5T52A 4EN8B 2J1EA 2CAVA 4UW5A 1GYKA 1ZRDA 3EYPA 2JJ6A 4XE9A 2WFF3 3S7IA 3VBSC 3PIGA 4KG8A 4TYSA 1VB2A 3APBA 1C4RA 1YFYA 4Z8BA 1X9TA 4NVPA 2HWF1 3AL6A 4FPGA 2XHKA 2E63A 2QUOA 3WDYA 2XJRA 1D7PM 3LQCA 3U4SA 2EAAA 2VZRA 1GQPA 3M70A 3VLBB 4XQ4A 3SKVA 4XDOA 1CAXA 2ZX2A 4Y22A 3ZPOA 3FWEA 4UF0A 5FREA 2CGPA 4EWAA 3THCA 3C3VA 3OJBA 3HNMA 1H2KA 4LHLA 2RDSA 5FP3A 3CBNA 4HT1T 4ATEA 3OCPA 3WHTA 3ZFFB 5IK4A 4JRAA 1WLTA 2ZX1A 4LIVA 3UJQA 1RYYA 3ZSKA 1JYVA 3DL3A 3LSDA 5M0TA 4AHXA 5AC93 3T0AA 1JYXA 4Y4RA 3B69A 3U14A 4ASLA 3AMMA 2VMCA 1RVF3 2KXLA 3OGVA 4HL0A 5CNAA 4LEJA 5GZEA 1G86A 4JHZA 2VGDA 4IETA 3TEXA 3CJXA 1YNAA 3D4KA 4Y1UA 2W0XA 1VB4A 2ZHLA 4U36A 4AHZA 2BGOA 1UYPA 3ACFA 3ES4A 4JC1A 1GQGA 5ABJA 2WYSA 5FPXA 2QQJA 3UGGA 1XRUA 4GXLA 5DG2A 4JAAA 5I0RA 2NZ9A 4LBOA 5K0UB 3AMPA 3RZKA 3LFIA 4Q4W3 1D4M2 3WNMA 4LO6B 3E1F1 1ZM1A 1UPIA 3M2MA 5AVAA 4DUXA 4Y1ZA 1TE1B 3O14A 4Y26A 2XOMA 1ZX5A 1JYIA 1OQ1A 2B42B 2WUHA 5F3CA 2HLEA 1SCRA 2GZWA 1S4CA 2YMZA 3L2YA 3ENRA 1W0NA 1AR63 1PO13 4BQYA 4CYDA 3AXDA 5KHGA 1H9WA 2DVFA 4WZFA 4IGOA 2VZ1A 3AP4A 4LPLA 5CFDC 4FPLA 1IS6A 4KL1A 5FZLA 3C7HA 1DYKA 5T5PA 4BK5A 2UWCA 3AP7A 3GZAA 5JSOA 2NPIA 4XVHA 4N43B 4ZPIA 5L7OC 3BIEA 2A3YA 4LBQA 2OVUA 2R063 3E5UA 1VRH2 4GIQA 3OUIA 4LNVA 1F4AA 4P9XA 2CHHA 2VUCA 2KM2A 3MIGA 4FCAA 4YG3A 1LU1A 1WCSA 2WO2A 3RNSA 2JDKA 2YY1A 1KQRA 5KR7A 4M00A 4B3NA 2Z2SB 4HG6B 3FUQA 3PVNA 2D3SA 4AEDA 1HRI2 2IVIB 2RMU3 1VRH1 1WMFA 3AX4A 2DTYA 3VBHC 1UY4A 2ADEA 2ZGOA 4QXKA 5HCFA 1GNYA 4D6RA 3NAPC 1ULPA 4GWIA 1HB3A 1UZVA 4JV4A 5JR7B 4ITCA 1LR5A 4EZHA 1B35B 1JOJA 1VIWB 2RS52 4M3CA 4LO4B 3JD72 4FTBA 2R0HA 2CWMA 2GH2A 2BV4A 2O0OA 3UKTA 1QH6A 2JB4A 4LKEA 1IKQA 5A7PA 3ZFEC 2R043 3KD4A 1CWPA 4IEQA 4OLLA 5JVVA 4G9SB 5C70A 1VRBA 1BCXA 2A6ZA 2V4VA 4XMAA 5CFCC 1VMFA 4XTMA 4BJ0A 2D40A 2HJIA 2P3JA 4LK7A 5CISA 2EF6A 5A33B 1QU0A 4FPHA 4MO3M 2HWE3 1S0JA 4OUEA 4XUPA 4FQZA 3AKSA 4YYOA 1IPSA 1JUHA 3D0SA 4GULA 4PCRA 2L9LA 4CZSA 4Z1VA 1PK6B 2BYVE 4MGKE 4X6RB 3ZYIB 5FMOL 4C91A 4L2NA 5A3TA 2R072 4LQRA 2VULA 2ZS6B 1OMIA 2QQIA 2HWC2 2PXJA 4QB6A 3G6JB 4M0HA 1RHI2 1S0DA 3WHUA 1VBE3 2RV9A 3ST7A 1OA4A 2NLRA 4H14A 1QJY2 5I0UA 3V56A 5GALA 2OX0A 1S0BA 4XJZA 3USUB 2R071 4FTEA 4Q2FA 3NKGA 3CJIC 3SQOA 4P9YA 3TN92 1MVQA 3LF7A 4N53A 1RHI1 3K77A 4IV1C 4QXBA 2A73B 1QJY1 4WVMA 2CTVA 3ACIA 1H2NA 3MW2A 4IV3A 1ZRRA 2WNOA 4BHPA 3MPBA 3TN91 3HWJA 4TN7A 5JDBA 5FZMA 1UW8A 2IZWA 2WBKA 4KU7A 1CIYA 4WVWA 2ZGKA 3WQ7A 2K2SA 3KSCA 2EXJA 3ZSJA 4XFBA 5JIAA 2A71A 2Y0OA 5D8AC 1DHKB 2XJTA 1NQJA 2YC2A 3VV1A 5HCHA 3ZXKA 4NWWA 1CAUA 3ZXAC 1UF2C 3OGRA 3U78A 3VDDC 1K45A 5C3SA 1J83A 2YFUA 4AVCA 4QAWA 1R1A2 2C0ZA 1Q43A 1DQ1A 2JG9A 1MQTA 4JRLA 1ZRFA 2PA7A 2BRTA 3RVHA 3ALQA 1EYBA 3VBUC 3NW4A 4AFAA 1OT5A 4DEQA 2XXZA 4K21A 3CIHA 1ODNA 4M0NA 2C6SA 3VBRC 1ZZ9A 3OY8B 1R1A1 4COUA 3I2GA 3O0XA 1GNHA 3D6EA 3BU7A 4XBNA 2X05A 2X5IB 4CDUB 5J36A 1YFXA 2W3JA 4DNYA 4OZXA 1S55A 5FKBA 3ZYJB 4EV0A 3MEPA 1ZVFA 1AR71 3SCHA 4C0BA 3I7DA 1T6GC 3KMHA 3POWA 3WF3A 2BP6A 2GNTA 4Y24A 4E27A 4YVSC 4EN9B 2B4KA 5FUNA 1LHVA 4AEJA 3OBTA 4LBLA 3SH5A 5C4WB 3FL7A 2XONA 3LFMA 4SLIA 2A3WA 3Q8EA 4UFJA 1MR5A 1W2NA 4UFLA 1O4ZA 5I93A 4MG2A 1SLIA 3T1MA 2ET7A 3QBQA 4RR3B 2VVFA 3PHMA 2WL1A 5CVRA 5F6LB 3MLKA 5F3IA 1O91A 2PHFA 4J1WA 5FPZA 4QX1A 3T4VA 1O6UA 4YLZA 1R64A 1AJKA 5SV5A 1S0FA 4M3CE 3WW4A 1Y3TA 1V6IA 2JD4A 2P3YA 1OPMA 1NCRB 1UX6A 2Y64A 3M3EA 4WM7C 4KBBA 4BXFA 4YM0A 4R4XA 5BV6A 4ZXEA 3OGGA 4BQ4A 3POFA 3BALA 1KFUL 1REFA 2JIJA 2VNRA 3AZVA 4CCLA 1RUJ2 3ACGA 1QDOA 1REDA 2W91A 3UKVA 3WG2A 4D94A 5KXBA 4DZGA 1XB9A 5LY1A 1VLNA 1AYM2 2Q4SA 1H6XA 3J9SA 3DGTA 4C1WA 4FPJA 1WA4A 1ASJ1 2QQKA 4LBMA 2JD9A 2VCAA 3OPZA 1RUJ1 3TNPB 3WD5A 1QQP2 3C7OA 3MDPA 1I9RA 1GLHA 1UZWA 4BOWA 2GH8A 4GKXA 2QBXA 3KV5A 1AYM1 4B4RA 3CJIA 2V5DA 2DVAA 4CU9A 2VZQA 2NYYA 1WMXA 1UU4A 3H7YA 2WLPA 5C3OA 2ZBJA 2K46A 1QQP1 5K0UA 2ZMNA 4MX3A 4Q0UA 4IEUA 3R05A 1VMHA 2Y38A 1MZ5A 3D82A 5FYCA 1VBD2 1RUC3 1SBDA 2JDAA 4INDA 3C7GA 2QQWA 1NT0A 1YI9A 1JYCA 3I59B 4OHWA 2A6VA 4Q0PA 1W2TA 5LASA 5BNNB 3GBFA 2ZOEB 3BPSA 2E31A 2ZKNA 1LULA 1SPPA 4XDQA 3U10A 3IDEA 2ZZJA 1MS8A 5D8AA 3ZSEA 3N4MA 1R081 4A7KA 3IKWA 2EIDA 2VCBA 3E97A 4XFFA 2BNNA 2Y34A 4Q4X3 1VBD1 4LBJA 2ZPXA 1QOOA 2JECA 2JXAA 2FCUA 3DYMA 5C8CB 3I3MA 1MS9A 4TLGA 3RWNA 4QQ2A 4RGKA 1IQDC 3J7MA 1AR81 1CZTA 3LIGA 4XZUG 4CDWA 2A5ZA 5C3RA 5K9YA 3VHOA 2JDPA 5FZOB 2XBO1 5C33A 1RUOA 2A7AA 1YQ2A 4L92A 3GCXA 4ARYA 3KGLA 1OH4A 3DN7A 4RHV2 1TMF2 2BQPA 5A1FA 2XR4A 2ZABA 2WQ4A 5GKAC 4XMIA 2W94A 1W04A 4D0QA 1SG3A 4QGNA 3AMNA 2YFZA 2G9GA 1DYOA 2YPJA 2IC1A 5J7MA 2B39A 2VMHA 4N90A 2XL9A 4NRQA 4MGIE 1AR73 5IVJA 2CDPA 4MHUA 1D2SA 3RMXA 2RG4A 1DG6A 3OYWA 1SACA 2E53A 2WZ8A 4RHV1 3RGBA 4RFRB 4QB1A 5FJHA 1SMVA 2AEZA 3WEZA 3SXWA 3BUCA 1RC6A 3LSEA 4JQTA 4RGAA 1GZTA 5FYBA 4WBBA 4AE2A 1UY1A 2EVXA 4AAPA 1PGSA 3H7JA 3AYEA 3HQRA 1ND3C 3J8F2 1Q8OA 4JKLA 2D6LX 2IXHA 4XZPA 1POV1 3V65A 5JR2A 4QHZA 1UOJA 3KT1A 4QB2A 5DDJ3 1ZZBA 2XQXA 1COV3 4XW3A 4UW6A 5FJKA 4GH4C 4NRMA 5LY2A 5HV0A 1TEIA 2ILMA 1XYOA 4JGYC 2WWUA 4HXCA 4UBHA 3FBMA 2WZPP 3H8RA 5JMOA 1XE8A 2JIGA 5FZ7A 1BVVA 4BYYA 3NNLA 1LHNA 1NZIA 1IS4A 5F7UA 4OMCA 2IXLA 5H9PA 4B29A 2D3RA 1LTEA 5H9QA 3I49A 1PK6A 1LENA 5EPAA 4E4SA 1ZBA2 2WO1A 2OXBA 2ARCA 3PMSA 3A0KA 5FZ9A 1C8M1 1CAXB 3OSDA 1UU6A 4JKMA 3WY6A 4Y22B 4IE5A 4UF0B 3E5QA 5C7GA 4NIDA 1ASJ3 4Z82A 3ZLIA 1V6MA 4X8NA 1V6OA 1XBFA 3LPGA 5FDBA 2ORZA 5FRAA 1Z0HA 1K42A 5EYXA 3USUA 1HQLA 1TNRA 5BNOB 5FR3A 3HNYM 4R9DA 2WWSA 4I3GA 1VE0A 4Y1VA 3KVAA 2ZEWA 2ZEZA 4XHXA 2OPWA 3D3AA 4QHBA 5J37A 2JDUA 3MIEA 3OTFA 1MEC1 4XFIA 4COWA 1S2BA 2BNMA 3R6SA 3EB7A 1RXFA 2P5BA 2ZGMA 3CF6E 3KCYA 1NXD1 5FYIA 1BEV3 3VN4A 1V9U3 2ZMLA 4QU1A 5ABJB 4KU8A 5F8PA 5FK7A 3MZHA 2PQQA 3ZXJA 1RMU1 3SITA 3HN1A 2WABA 1GU3A 4XJ8A 1SLCA 3MF9A 4AI0A 1V0AA 1JS9A 4Q1PA 3SISA 1ENQA 1EUUA 1LODA 2YROA 2GN3A 2WQ8A 4BISA 4ZZ5A 2EIEA 1XPWA 4CUGA 3ZXDA 2H6CA 3M3IA 4LO8A 2VTXA 1R083 2W08A 1CVNA 1LHOA 3POJA 5A7QA 3GNEA 1QJX2 1W0OA 2JG8C 1OA3A 4XBQA 1CPMA 2WR9A 4YWAA 5F32A 1O4YA 4LLOA 4ZU5A 1ODMA 3RS6A 3ZN6B 3B00A 5F39A 4ASMB 4YG6A 4CA9A 1VBC2 3U1XA 4Q1RA 4TSVA 1D0GA 5HCAA 1A34A 3JZVA 1AR83 1J3RA 4G3YC 1ZA7A 3BKZA 5GZFA 3CHXA 5IFPA 3GZTB 1QJX1 1VP6A 1UZZA 3SNMA 5DAPA 3T30A 2XBO3 3T3YA 2Q30A 4RA0A 4AG4A 4BPZA 5A6ZA 1LU2A 5F5AA 4CXYA 1VBC1 2B8MA 3ABZA 4XIKA 1W6NA 1W03A 4P00B 2PN5A 2D93A 3E6DA 3NNFA 4OZOA 2E6VA 4YZ4A 3RQ0A 2OQ7A 4UFKA 2BOJA 1US3A 4QKFA 5FZDA 5JZGC 5FZIA 2VMEA 1PX3A 3TEYA 3O1TA 5KXEA 2B7YA 3E6BA 2BBVA 4MYEA 4UW3A 4N9IA 4IGPA 1W9SA 2ZHMA 1UWWA 2B46X 4UBGA 3W9AA 2H0VA 4PQQA 2QQVA 1CGPA 5A70A 5ERLA 2DF7A 2CGOA 5F5IA 4RR3A 5FCCA 3ITQA 1NCQB 5F5QA 1D2QA 2PQSA 5FXVA 3TEZA 1UNBA 1W9WA 2JDNA 3HPNA 4M3CB 4H7MA 5FUIA 3WNNA 1QDCA 3ACHA 5JXIA 4B1MA 3WSOA 3BIWE 1H30A 2JDZA 1JU4A 5A7NA 1OKQA 4WV8A 3WCSA 4QD2A 5EJ1B 1RUG2 3OB8A 5DXDA 1N1TA 2PHXA 4HKWA 4P02B 5FQ0B 4UOJA 4DB5A 2D97A 3NQHA 3AXEA 3VBSB 3JB8A 3S30A 4KMQA 3NWKA 5DZEA 5FZ4A 1CJPA 1V6NA 3N9QA 2W9XA 1GSLA 3WINE 5GLZA 1OQEA 4XILA 4YNIA 5TSWA 1VAKA 4U2AA 3A23A 4FAHA 2VW0A 4PT6A 2D6PA 4D8MA 5K7PA 1C8M3 1WCDJ 1SHWB 2LS6A 5GLUA 4LMFA 1ND2A 2BBAA 3PDQA 4FOQA 1JYTA 2DUPA 2XKOA 5CEHA 2PLV1 4X6QB 1PM7A 1YC61 5LK5A 3IB3A 3V0BA 2ET1A 2RJKA 5T5OA 1VBB1 1F15A 1TME1 2J7MA 4K1YA 2C9KA 1KGYA 1OSGA 2TBVA 3PMEA 3THDA 4OCTA 4DY5A 2TUNA 4HSLA 2BFUL 2XUEA 2AACA 3B5LB 3SEEA 4R9AA 4XJ9A 5FMDA 2CYFA 1OD3A 2W1SA 1JODA 3KV4A 5JOYA 2VCMA 1MEC3 5FAXA 2FZ1A 4HANA 3I4IA 2NP0A 5KXDA 2RR13 4ISRA 1LOFC 4LHSA 2HKXA 4N53B 2WO3A 4JCKA 2J1TA 2FZ2A 3ZFGA 5F5CA 4XUOA 4H7LA 1RMU3 1UAIA 1YQ8A 4XC9A 5GJ6A 3G7DA 3ZXLA 3FN9A 4WVMB 3H3UA 4YRDA 5DABA 2W5FA 3OGJA 4QU2A 1JOBA 4LJHA 5ACA1 1S2EA 2A3XA 5FXWA 1RUF2 1OUXA 4XURA 1IQAA 3SEPA 1HRV2 5C8CA 4YW7A 4RFT0 4GKYA 4AQ6A 3NJZA 4H3WA 5C5TA 1JZ3A 1WW5A 2WWJA 1W8FA 2AUYA 3KT7A 4JHTA 2R32A 3DYOA 4PF1A 5ANQA 1NY71 2ARXA 4OUMA 1AF9A 3MF6A 5DAQA 5CFDB 4I3PA 3BVCA 2E7QA 2K0GA 1JZ8A 1C28A 1HRV1 1NOVA 1MS4A 2ARAA 3BTXA 3MIHA 1HLCA 3SKJE 5L7OB 1MQTB 3MIBA 5LBFA 2FDFA 2XQRA 2XUMA 3RZHA 1A8MA 2WS92 3KM5A 2OA2A 1HN0A 3ZMNA 2J1AA 2GMPA 2ZGNA 2KD7A 3WDTA 3OEAA 3Q8BA 2Q0AA 2WIIB 3AVRA 5E88A 1QJZA 4AGVA 2GALA 4JDMA 1QWRA 4XF9A 4FFIA 3VBHB 4WVZA 3K46A 4QXHA 5FYZA 4W4ZA 3OBZA 2F4LA 1XU1A 2JDMA 3LEMA 3OD0A 4JTOA 4PDWC 5A7OA 3VDCA 1OBNA 1OUSA 3ZN5A 4AFDA 4ATFA 4ZONA 1PO22 3FC0A 2B5HA 3WQ1A 1S0CA 1Y4WA 3O1PA 5A32B 4BQXA 2YGMA 4NE9A 2CWSA 5FP7A 4XAAA 3H8UA 4KQ7A 3MW4A 3BB6A 3ZVXA 5BYNA 3A0NA 4XUNA 4YGEA 4RYDA 4FXGB 3VZOA 2HWD2 4D3WA 1EV13 2B9UA 1PO21 1KD7A 4PIYA 4MGQA 4AVBA 3ASIA 4HN0A 5EJ3A 4IERA 4BMEA 5JWPA 3AZZA 1WD4A 3C2UA 3CMGA 4NMIA 2VECA 2ZHKA 2W1WA 4LORA 4Y3OA 2IFRA 1JUIA 1LKNA 1RUD3 1AXYA 1FX5A 2LALA 5KWRA 2HWD1 3WUCA 4CUCA 2W2IA 2RS32 1AHSA 4AI2A 4HKOA 3MV01 1JH5A 1WCUA 1GV9A 1AL0G 1RXGA 3FFQA 3WVJA 4BCUA 2PLV3 1QMJA 1F9KA 1T6BX 2J1UA 2J42A 2VZ3A 5CKQA 4OUSA 4E8CA 4XOGA 5FZGA 1VBB3 2VZSA 1TME3 2FDJA 5BNOA 2HYXA 3USSA 2E7AA 1YXWA 5BNPC 2UYBA 1TNFA 4DO0A 1IKPA 2YPDA 1LAJA 2I45A 1NYWA 4AFBA 3CU7A 1CN1A 2ZA9A 3F95A 1X9PA 1H8TC 1MZEA 3CJIB 4FO9A 4BZ4A 1C3HA 1I5ZA 1LOFA 4L8QA 1QY4A 3PTYA 1KDMA 2XDVA 1F31A 2Y6GA 1XJAA 1C5IA 3VUOA 3JBG2 1FMD3 4IV1B 1FOD2 4DPNA 1OOPC 3WP4A 3I97A 3EJKA 5FBJA 2E33A 4KG0A 5JOZA 4QQHA 1DLCA 1FNZA 1X8EA 4NRPA 3ZXFA 1AL23 3C7FA 4QM8A 1J1LA 5IFTA 2YV8A 3OEBA 4K8FA 5KHKA 3JBG1 4ES8A 2DFBA 4KWJA 1FOD1 2VQAA 4L11A 1SPPB 5IVYA 3U07A 3WUDA 4Z2WA 3M7AA 1GFF2 1Q8SA 4P9WA 5J98B 3ZN6A 3LDBA 2HEVF 3LZZA 5D8AB 4AI3A 1G9CA 3ZIXA 3DEMA 4H55A 1D4M1 3UGHA 4BLJA 4BWOA 4Q5OA 4CEWC 1ONAA 2P3IA 2XB6C 4GWMA 3IDBB 3VDDB 4LBNA 3GXUA 3RWKX 1JOPA 3LDKA 4NHXA 4RL7A 5FP4A 4AW7A 3HD8B 4A42A 1W39A 4F7ZA 1UXZA 4YSFA 2W68A 1QNYA 1E5RA 4ZHNA 4CDWB 1QJU3 5FYSA 2PHWA 4HN1A 5DUXA 1HKDA 4JDOA 3VBUB 4Q8LA 3HBZA 3LGRA 4YG0A 1N1VA 2RS13 3FX3A 3H8XA 2D6MA 3D0JA 1AR92 3VBRB 1XSRA 2G19A 1O4TA 2KA3A 3CDZB 5C9AC 2P4EA 1WLCA 3M3CA 4L9BA 5T3NA 4E9KA 5AFBA 5GLVA 3LOBA 2EALA 2IWGB 5F3GA 4B1LA 2TEPA 4N7UA 1WD3A 4GQ7A 4KNCA 4LLFA 1EY2A 2GAUA 2WNUC 4GMP3 2WT0A 1AR91 2DFCA 2P6CA 3U75A 4YVSB 3TEWA 1V6JA 2GN7A 1CIWA 3NNMA 3L9JT 2V4AA 4S2GA 2FBEA 3OYWB 3VZMA 3FFZA 1NCQA 4QPGC 3K48A 4BM8A 3PUHA 4Y5SA 3ZYFA 3LOIA 1BK0A 3M3QA 2VY0A 1H1IA 1HRI1 1RJ8A 4C8DA 4RQPA 3ZYHA 5A3LA 2NN8A 5EXOA 2VOTA 1E57A 5B4XA 2A6YA 1Y9QA 3SLIA 4E2GA 2NQYA 5FQ0A 1WWYA 3RYRA 4AZZA 5I91A 1PZ8A 2DVDA 4WM7B 5DUWA 2RS51 3KLSA 3LB9A 4XABA 3VBSA 1DGLA 3JD71 4UFMA 2EICA 4YGBA 3CLPA 1DYPA 5IUQA 3JU9A 2W95A 3AFKA 3TWIA 2UWBA 4ARXA 2HWF3 4AVTA 4MOAA 3PURA 1X8MA 4A44A 3KWVA 3MFCA 3WF1A 4DXSA 1QF3A 1X36A 1W28A 1JU3A 3RJRA 3O0VA 1OVPA 1W2OA 5FOJB 3J4UH 1O3TA 4UW4A 1QJFA 4CDXC 3MHZA 3N3HA 4DRVA 1W6OA 2PHTA 5JMCA 2ZACA 3J7LA 2NMNA 2Y6FA 3IAQA 2GP5A 3VD9A 2DWRA 4NO4A 3FMGA 1LOEA 5I8TA 2XJPA 1HV1A 1N1SA 3ME2A 2RDQA 3MIDA 3B9CA 5GZCA 1H1AA 2I07B 4NOTA 3WR0A 3LEKA 1JW6A 1ST8A 5IK8A 1DZTA 2IUWA 4NROA 1YCIA 3ILRA 4XCBA 5FZCA 3WNKA 1M06G 4OQ8A 2HWC1 4JZRA 5JPMB 5CG8A 2WN2A 5LA0A 4B7KA 2ZX3A 2VMFA 3MW3A 1KS5A 1R092 3GF6A 1GANA 1QGLA 2FQPA 3NL1A 1XE0A 1IZ3A 1SBFA 5FIXA 5I0TA 4LA2A 2YUEA 1FI2A 3W5NA 4QWNA 3FUOA 5FPUA 2CGNA 1CESA 1HV0A 1XNCA 3N9PA 5J3UA 2R30A 3DPRC 5G05L 1IS5A 2VUJA 1OHFA 3VGIA 1R091 2WFPA 2RHPA 1EPZA 3RG0A 1TZOA 3WDXA 4AR2A 4Q4V2 4NHLA 4YW3A 4W65A 1D4M3 5IWFA 1GZ9A 2Y26A 3N7LA 5CFDA 5D1IA 3AMHA 1LGNA 2OUJA 1SCSA 3AKRA 5FZBA 3WNLA 3C8XA 5L7OA 4LKFA 4Q4V1 1H2MA 3EMRA 4XBLA 5LBBA 5CB7A 4CDQC 4K40A 1Q56A 2CY6A 1PIV2 2Q5TA 2ZGTA 4IE4A 4FT8A 4LA3A 4XHBA 4KBZA 5FMCA 5FPAA 2JWPA 4CCNA 4MVTA 3HQUA 4IEZA 3IIIA 4HPKB 3RI8A 2FD8A 1W6NB 5T50A 2LM3A 2OYZA 4AXOA 2YBPA 4PBOA 1PMHX 4AHWA 4CEYC 1UXXX 1NXMA 2ZGPA 1K5MC 3AKPA 3DKQA 5FY7A 3VBHA 4E8DA 1EUTA 3TAYA 4FP2A 5FOBB 3ZPYA 3NRUA 1VRH3 1V6KA 3KGZA 1EAH2 3NAPA 2D44A 1U5IA 4IW3A 4N43C 3VBOC 4OQ9A 1WLDA 3I2DA 5CZKA 4PIXA 5LEKA 5JAXA 4QKDA 1XE7A 1RUI2 2VXRA 5F2SA 5CAZA 1HRI3 2JICA 3RPQA 4UI9L 3VZLA 1ND3B 5A3WA 3ZFEA 3B9IA 4BU2A 5KXCA 2GNBA 4P9IA 5JIUA 4NHYA 2X09A 1AXKA 2VL4A 4C1XA 1SFPA 3R4SA 5EP9A 4OVEA 1LEMA 4OFGA 2FDKA 1W2AX 4FOYA 5CFCA 3P3NA 4FFGA 1A3KA 2RS53 1GOHA 1D0HA 2WNVC 4JGYB 2WRAA 3JD73 4ZS3A 4YW1A 3HJRA 3O1VA 3ETQA 1FAYA 1F35A 2VBBA 1LGBA 3VB9A 3HVDA 2BGCA 4QXCA 3PJYA 2X29A 3PL0A 3V0AA 2VOKA 5EFUA 5ACA3 1ULGA 3WW3A 5KC6A 5A3NA 1OFNA 1BBT2 5LK7B 3PVBB 4JDNA 1XNAA 4NIGA 1SZBA 4BQ2A 3AP5A 3AYCA 4BQ5A 5LW9A 1WZXA 3ZSLA 2Y6JA 4QX8A 1LEDA 2BFUS 4XDPA 4AI1A 4GB32 5FZ3A 3DUIA 2NMOA 2IXJA 2RM22 1ND2B 1WGPA 5BXXA 3VDBA 3BTZA 4HSJA 3WF4A 1W99A 1BBT1 2DURA 1WW7A 3OUJA 3NVCA 4XXPA 5A7WB 3VBFC 3V0BB 1IPKA 2MEV2 3MYXA 1X82A 2ETEA 4L97A 5T55A 3RFRA 3E6CC 3KV6A 2J1VA 2VQ0A 2GC2A 5J1XA 4MADA 2R073 4R4ZA 5FZAA 3GZEA 4W6XA 4FTSA 2GC0A 2ZEYA 2HWC3 2RM21 3VHRA 4LE4A 4IV1A 4DXZA 3I2JA 3OUHA 1Y7BA 2PHRA 3LIHA 1RHI3 4TWTA 4DUWA 5E1RA 5E8AA 1REEA 3WCRA 2V72A 1OF3A 4MXVA 2FHRA 1M4WA 1QJY3 3N36A 5FXXA 1UKGA 3IT8A 4O65A 1GICA 4HETA 1RUNA 3ZFGB 2QQNA 3ZYBA 3S5AA 1GUIA 2AENA 1EP0A 3TN93 1RTVA 1JZ2A 1CQ9A 2VNVA 1GQHA 4XAEA 2BJSA 2JE9A 3MLLA 1H1MA 3N9MA 2YG0A 4O61A 2BDRA 5L9VA 4YPJA 2P2KA 3H42B 2QNKA 3VDDA 1UIKA 5CU1A 4DRRA 2C26A 4JTNA 4CCKA 5CIRA 1NKGA 4P14A 5F9TA 3UNPA 5APAA 1YHFA 1C1FA 2VUAA 5JSPA 3VBUA 4MGTA 1X33A 1RGSA 4PLOA 5A6XA 1O59A 2RJLA 1RUH2 1WUVA 3UESA 3VBRA 1F2NA 2VNGA 1NLQA 4RSUA 5A3MA 2BZDA 1LOAA 4UFIA 2CDOA 4LK6A 1R1A3 3IMMA 4E2QA 4LR4A 4K8RB 2DBIA 4CEYA 4TLFA 5I8SA 5K8SA 4CXWA 5E6HA 3IDAA 4S2DA 2J1SA 1JI6A 1RUH1 1S1AA 2ES3A 2ZEXA 4HKLA 4QPWA 1HXS2 3NV3A 4YVSA 3L2HA 5JZGB 4LBQD 4FOVA 1JZ4A 1TMF1 4URTA 3WV6A 2XPJA 5FYTA 4EJRA 1ULOA 2P37A 3GDBA 3WQ0A 3ZYRA 3H3LA 3CQOA 2D6NA 3NNJA 5H9SA 4MGZE 3RYKA 2VOVA 2YC0A 1HXS1 2D98A 3ZOIA 4RGGA 2WDBA 3JQXA 3LPFA 4XFAA 4AGGA 2OIIA 4PLMA 3O1MA 2GNDA 4WM7A 4XEZA 2GNMA 2Y6LA 3UETA 5B2GB 3IM0A 4ES9A 3KHCA 3BOWA 5JXJA 3ILNA 4LT5A 5IVFA 2YDEA 3I2HA 4PI2A 4A3ZA 3NV2A 4P5HA 2X10A 3J8F1 2CNAA 2WZR2 3W20A 1DQ5A 1W8NA 1MS5A 2VAUA 2XL7A 3MV11 3RZJA 1KRIA 2VTFA 2YU2A 3I3DA 1W8TA 2XJQA 4J1XA 4OI1A 3TOJA 1CJDA 2QQMA 2VC9A 4LBKA 2VOWA 1GBGA 4DMIA 3I3QA 5J09A 2XJSA 1ZBE2 3ON7A 3ZR5A 2WZR1 1GWLA 4EYUA 1SDWA 1GZWA 5C6CA 4XJAA 5IVVA 1NCRC 1VBA2 3BCWA 2DDUA 1RUJ3 5C71A 3UJOA 2ZGRA 2GMMA 3POEA 1ZBA1 3MICA 2GSYA
chains in the Genus database with same CATH topology
1AYN2 1AYM3 4AEKA 1ZBE1 3AJZA 3VKNA 1Z78A 1VBA1 1YO8A 4A2UA 3GZUC 3ECQA 1JXNA 1QQP3 2HEWF 4W6YA 5BPXA 4IL7A 4Q4Y2 2HEYF 1AYN1 1S0GA 1SLLA 3ROUA 3VKLA 1ENXA 1LHUA 3THPA 1S0IA 4FSJA 5I8YA 3ZDSA 4DY3A 5L36A 4K20A 3VZKA 4B8EA 4I09A 1VBD3 4PLNA 2HWB2 3RJ2X 1DGWX 4QGMA 4YM1A 4G4FA 1IGOA 2WSVA 3H0OA 2EXIA 1JTZX 1ULEA 2IXKA 3AKQA 4YVWC 3OF1A 2W52A 3ZMOA 1C1LA 3LCPA 2ERFA 4AQSA 5AFEA 1LCLA 4HPKA 5EZWA 1U5YA 1BMV2 4IEXA 2F4PA 1D4VB 4CP2A 5IT6A 1AUYA 2C5DA 1UL9A 2YYOA 3RDIA 2VMGA 3ES1A 1FPN2 3PVOA 1NA1C 4GA9A 4Q0VA 4Q8KA 4YGCA 2WT2A 1BMV1 4KGQA 1KFXL 3WG1A 4AVVA 1Z7S2 5FFOC 4HMZA 1LB2A 4RHV3 1TMF3 5LEJA 2D5FA 4QQPA 1PVC2 3PVEA 5F6KA 2DTWA 1N47A 3EXUA 1J3PA 1RUE2 1ND3A 2W39A 4META 2PAMA 4BH9A 1SLTA 1POV3 1UPSA 2XLFA 4IEVA 1CAWB 4RQPB 4HVRA 4YGDA 1PVC1 1UU5A 1WW4A 4AYUA 4GH4A 4OI2A 5JCTA 3EO6A 4JGYA 2BVBA 1RUE1 3IN9A 5FMOS 3MLJA 1U5ZA 4KWLA 1XXNA 3J8F3 3WDVA 4Z92B 2IFWA 1XNKA 3N35A 1OLQA 4DOUA 1RUG1 2BWAA 2QKDA 2WFF2 2EXKA 5E16A 3H1MA 1KDKA 2Z42A 3VKFC 3ATGA 1PVXA 1DQ0A 2UY8A 2XKPA 2H6BA 3WDUA 3K51A 1O7FA 1F8VA 4Q27A 1C8NA 3O7OA 2VPVA 3NV1A 1W6OB 4LE3A 2WFF1 2WC2A 1ZBA3 5BNPB 1HDKA 1BJQA 2WA3A 1H8TB 2Z5WA 1QXPA 3IDCB 4AQTA 5AC92 2EIGA 3CO2A 1H4GA 1OOPB 1RVF2 2AREA 3ZSMA 3LA2A 4AEMA 3HT1A 2P3KA 4K3UA 4K9SA 3RYPA 4I02A 5AC91 1W6MA 4PQ9A 4HBNA 1YYNA 4Q4W2 2JG8A 1RVF1 2AZ5A 1PZ9A 1JBCA 4XJWA 3ZN4A 1SLBA 3KZ4C 4CEWB 1C5HA 4MXWB 1O3SA 2BWCA 4M01A 2PAKA 3W59A 1AR62 4JGZC 1RUF1 4Q4W1 1PO12 3S0MA 1W6PA 1QJX3 1G8WA 2R16A 1PNGA 3ELNA 1VBC3 2TNFA 1KJLA 1RJ7A 3AM2A 5C9AB 3RMYA 1NLSA 3T2TA 2JEMA 1PO11 3TYJA 3VL8A 1Y43B 2R062 1NA1A 4E4DX 2ZTNA 5JZGA 1DFQA 1Q5OA 4FPYA 2JE7A 4XFGA 4HK8A 5BNQA 5T54A 2G4IA 2WS91 4P9GA 2ZGUA 2ZX4A 3ZX7A 1YWKA 2ZGLA 1PHMA 1FV3A 3NAPB 4WVVA 3POSA 2CAUA 5JI9A 4QPIC 2R061 2RMU2 4E4ZA 4HLTA 2PAEA 4QPGB 4CP1A 5KBFA 3AP6A 1ZZ8A 4XFHA 1LRHA 3ZFEB 1HQNA 4DINB 3KT4A 5BUVA 1SEFA 1NG0A 1Q8VA 2UU8A 3THTA 4K7JA 2PHLA 4AEDC 3QH6A 4RS5C 5CFCB 2QJVA 2R042 4F3JA 1ULCA 1PGW2 2DCYA 1X7NA 3V0AB 1RUG3 2WJSA 5E89A 2ZZQA 1MS0A 3FE5A 1NE6A 1ZZ6A 2XVKA 4COVA 2K9ZA 4WM8C 1CONA 2R041 2HWE2 3RZZA 5JPNB 2D6OX 1NQDA 1PGW1 5KHJA 4QQLA 2D6KA 4FVVA 1Q3EA 3R4UA 2YZ4A 1AX0A 4QMAA 5IK7A 2PYTA 2RS31 4KGGA 4YW5A 2EAKA 4GMP0 2HWE1 3O5SA 4MUVA 2UY9A 1W6QA 2YHJA 1VBE2 4NWVA 1QOSA 3N7JA 2R49A 1IS3A 5EYYA 1YRZA 3QOPA 3B02A 2XLGA 1O5LA 3FLTA 3B94A 4M3CF 2PHDA 4IEWA 5H9RA 1VBE1 4AWDA 2IXCA 3ZO0B 4R9CA 3AMQA 1MACA 2O8OA 3DPRB 1WCKA 2HYKA 3IIAA 5J96B 4DS0A 2AGSA 4S2HA 3TBDA 3QCWA 1QXRA 5GZGA 2DUQA 4NPRA 3GBGA 1H9PA 5J48A 4N53C 4JGZA 5EV7A 3U4XA 2DU0A 1GKBA 1RUF3 1HRV3 2C9AA 4IV3C 4CDQB 4N7IA 3R0RA 1I1EA 2ZKLA 1DGRA 4DQAA 4P9LA 3M1HA 4FPEA 1DU3D 2D5HA 4YZ2A 2QCSB 2WSUA 4CEYB 2A70A 3CL1A 1K5MB 1Q8QA 1ZNPA 3P3PA 4YFZA 3U11A 1J3QA 1G9AA 4ZKTB 2WS93 1F5FA 1A6CA 1CAVB 2BEOA 1G6NA 4QPIA 4YFWA 1W2UA 2JG9C 4PDWA 4CTEA 3VBOB 1MQTC 2BW8A 4K1ZA 4MGYE 1DZRA 1ULFA 2MNGA 1YJKA 2SBAA 4XXAA 1BYHA 3VZJA 1QKQA 2XJVA 1DGRN 3ILFA 1FT9A 1EPWA 5LRRA 4D69A 1CAWA 2WT1A 4XJUA 3CEWA 2R6QA 3GHNA 1BQPA 4W6WA 3LWCA 3OBRA 3V64A 3WNXA 2ARBA 4XF1A 4Y1XA 4RS5A 2GU9A 3MGUA 3WZ1A 1O3QA 1IHMA 4LHKA 2WNVB 1PO23 2CL2A 2LUWA 2MPFA 3VL9A 2MHFA 1Q8PA 5GLWA 5CG9A 3M4FA 1VAMA 3WP5A 4D7YA 1O5UA 4I0AA 3U0ZA 2VG9A 1UD1A 3WW2A 2HWD3 4OHYA 4WM8A 3FHIB 3UL2A 2IXIA 3LKJA 3UK9A 3KCXA 3AJYA 1OD5A 1G9FA 3D8CA 3NKTA 4B4QA 3PLQA 1GZWB 4COZA 1ZZCA 4EWEA 5BNPA 3AK0A 5AVPA 3VBFB 2RS33 1OI6A 1CPNA 1H8TA 1SFYA 4D7SA 2XLAA 3E5XA 4Z07A 2ENRA 4HK9A 4LO7A 4NHKA 1DQ2A 1OOPA 1BVP1 1FATA 1N1YA 4B4PA 1DDLA 3SMHA 3NO8A 1HIXA 2A75A 1URXA 4C90A 3JUUA 1G9BA 3ZFFC 2QZ2A 1NE4A 3R4DB 4QX5A 1RB8G 4I01A 3JBG3 1RUC2 2FMYA 3TB0A 1FOD3 5CBLA 4AK3A 4I2OA 1CR7A 5JOWA 2XGXA 3VHNA 3WXPA 4CEWA 4EN6B 4MXWA 4HZFA 1S2KA 2QQPA 4FPKA 3WG3A 4ZU4A 5K0UC 2R1BA 4Q4X2 4X8PA 1RUC1 1CD3G 1JHNA 2E7TA 2JKBA 4COYA 3O0WA 3QACA 4O9GA 2R1DA 1J1TA 2F6BA 5C9AA 3POYA 3ZYGA 4Y20B 2Q8OA 4Q4X1 4EN7B 2XVLA 1U5XA 1UMZA 3BPZA 5EWSA 3AZYA 3WP6A 2WNUA 1PIV1 3LA3A 2BPA2 2DUOA 2Q1ZB 3HT2A 2DCZA 1AR93 4YZ3A 3FJSA 4CDWC 2E9QA 4QPGA 1KS4A 1BK1A 5HCBA 1NLRA 1AR72 2VNOA 2WQZC 4FQ4A 4LULA 4ISQA 2C1FA 3FLPA 1EAH1 2VVEA 4E2SA 1WW6A 4Q26A 4Q29A 1AZDA 2QE3A 1DGWA 2X8KA 2CV6A 5BY5A 2G9FA 4GH4B 3FZ3A 4AF9A 2O1QA 2ZGQA 5CA6A 1RUI1 2ZCWA 5DDJ2 1COV2 1ZREA 4F83A 1VAVA 4C0HA 5FO9B 1B35C 3VKOA 1BKZA 1LOBA 2PFWA 3ZIWA 3WW1A 3JB4C 1OPOA 1X50A 4CDXA 4AQ2A 3SHRA 1APNA 3HAGA 3GALA 3VHPA 5DDJ1 3BTAA 5DG1A 1COV1 1DIWA 1L3JA 4HFSA 3TNQA 4I0BA 4L99A 2BUKA 4FOWA 1ZZ7A 4OI0A 2OZJA 1ASJ2 3KB5A 2QZ3A 4OULA 1QH7A 3FBYA 3T1LA 3N7KA 4GB31 1YIPA 4FAGA 1LESA 3GHMA 5KC5A 3H3ZA 1F5JA 4BQ1A 1PK6C 3ACLA 1FXZA 2MEV1 3M8LA 4R8HA 1G7YA 3VZNA 3HR9A 4XQWA 3LAGA 2XWBB 3ZFFA 3BODA 2UURA 4A3XA 4MH0E 3KS7A 3DPRA 1BEV2 1V9U2 4LUKA 3AB0A 1U0AA 4HVQA 4KH9A 1R093 1W6MB 1OFSA 2QDRA 2ZMKA 4N9HA 2JG8B 3D5OA 3QH7A 2XG3A 3HIFA 2Z79A 1DLLA 4BMBA 3QD6A 1XQNA 1BEV1 4R52A 3TRSB 1R082 1V9U1 2VH9A 3JCIA 1H2LA 4BIFA 4FXKB 4YVWB 2WA4A 4CDQA 4Q4V3 1IOAA 5FO7B 3CNAA 3HQXA 1W6PB 4YZ1A 1AR82 1H4HA 4AGRA 2QFEA 2P34A 1C57A 4S2FA 2XBO2 3GYDA 4PBPA 3B3QE 1K5MA 2A6XA 5JOXA 1UIJA 3WT3A 1FV2A 3AKTA 5DZFA 1NA1B 1PIV3 2ZAHA 3RRDA 1CAVA 4LTAA 2YXSA 3IPVB 3I54A 4MZUA 1OA2A 4N43A 1QNWA 4FPFA 5JI7A 3VBOA 5JLVA 4KWKA 3AP9A 1PNFA 1A78A 1MZFA 1UZYA 4Q0SA 4XF3A 4XTPA 4XF0A 4LO5B 5IK5A 2JX9A 3URFA 5LRSA 1YI7A 1QOTA 2X5IC 4CDUC 1EAH3 1OLRA 2Y0IA 2WNVA 3AZXA 3W58A 1RIRA 2YGLA 4ZU7A 3UKNA 2BTVC 2Z69A 1RUI3 1A8DA 1XNBA 3EHKA 2DU1A 3A4UA 3M3OA 2XJUA 3WP3A 3WX5A 2XVGA 1B35A 2OUHA 5C4WC 3HMYA 4QM9A 1O3RA 4LUMA 1MZ6A 1PMIA 1KXGA 1OQDA 4RR3C 4YM2A 1DQ6A 2N7GA 1V00A 1GZCA 5C8WA 2JENA 1N3QA 4NR1A 4LHNA 2DCTA 5KHIA 2VMIA 3VBFA 4I30A 4QGLA 1YIFA 5FLHA 1BBT3 5A33A 1C8M2 2XWJB 2ZX0A 5L19A 2OZ6A 4AFMA 5F1RA 4GB33 5GZDA 3RSJA 2D7FA 3INAA 2RM23 1U12A 4YW2A 1W6QB 4IEOA 4AI8A 5I0SA 2WLQA 1SBEA 1TQ5A 1ULDA 2MEV3 3Q9OA 1N3PA 4BLIA 4I0WB 2GMEA 1ND2C 4F8AA 2GC1A 1MEC2 1DZQA 3PJQA 1POV0 3WG4A 2RR12 1LOCA 4HVOA 4XETA 5L73A 4P9JA 4AVSA 2V5YA 3KQRA 5T5JA 1V70A 3QLQA 3WLUA 2A6WA 2ZHNA 1RMU2 5HXVA 1NZCA 4XYXA 4Q4Y1 4XFCA 3B01A 1KJRA 1XU2A 4IXLA 1SQ4A 4QPYA 2ZJCA 4XPVA 2RR11 2GC3A 3KCCA 2BNOA 1FYUA 3H9AA 1RL3A 2VW1A 4IEPA 4JGZB 4GWNA 5BNNC 3ZFGC 4NHMA 4A7ZA 3DV8A 2WKKA 3SH4A 2EA7A 2HWB1 2UYAA 5FO8B 2V09A 2D43A 4Y20A 5DZGA 2FMDA 1HQWA 1V6LA 1AJOA 2XH6A 2ZGSA 2DYCA 2E51A 4MSVA 2OPKA 4WZCA 1ENRA 1RINA 1YJLA 5C8CC 2QDNA 4PIZA 4ONUA 2PHUA 3RI9A 1RUH3 4GALA 3AYDA 4QQOA 1QHDA 3WOGA 3S6PA 3IWZA 1IPJA 4ZXKA 4YM3A 1I3HA 2WNEA 2I74A 1PZ7A 2VVDA 4QPIB 3NV4A 3OY8A 4PDWB 1YUDA 1FPN1 4XIOA 4LBQB 3I8TA 2X5IA 1HXS3 4CDUA 1ALYA 4YZ5A 3PNAA 1VALA 1DF0A 4UXAA 3IMNA 4MLOA 1Z7S1 4JVAA 1MS3A 5HBAA 1PGL2 1CX4A 1N3OA 4AEDB 2RE9A 1BXHA 4RS5B 4RD7A 5C4WA 1LOGA 1ZA4A 3H1YA 1EV12 3ZYPA 2DVBA 1WBLA 1PGL1 4Y1YA 4IEYA 2AYHA 3MPPG 4O9EA 4AVAA 3H1WA 4WM8B 1RUD2 1DQ4A 1NCRA 2WZR3 4YW4A 1AX1A 2DCJA 2OW4A 2VU9A 1EV11 3O12A 3S7EA 2R0FA 1B09A 3VKMA 4PF5A 1VJ2A 2SLIA 1WLWA 1LECA 4FP3A 3IBMA 1MS1A 4FBFA 2ATFA 1QXJA 3AFGA 2PLV2 4XQDA 3B93A 1RUD1 1ZBE3 2B45X 1LJ7A 1GNZA 4AVCA 1VBB2 1JN2P 1TME2 3AZWA 2PTMA 1H8VA 1VBA3 2AH2A 1S0EA 2VOXA 3H50A 3MI8A 4OI4A 4AHYA 1LGCA 2LTNA 3UV9A 4BE3A 1AYN3 3WDWA 4ORFA 1FMD2 1GR3A 4XF4A 1HX6A 2X53S 3AYAA 5BNOC 3MFAA 2D3PA 4Q4Y3 5KHHA 3ZXEA 2P17A 1AL22 2AR6A 3ZXGA 4DFSA 1W0PA 5GLTA 5ACA2 3GBWA 1FMD1 3DKWA 5ABJC 3I59A 4NN0A 1BZWA 4YVWA 3SH3A 5BNNA 1AXZA 3J26N 3B7MA 4FPOB 4V1PA 1UKRA 4IQPA 1AVBA 2NM1A 2VW2A 1LHWA 1I6XA 3X29B 1AL21 2PELA 4IV3B 3DF0A 2HWB3 4FPCA 1NY72 2DVGA 1DBNA 5DUVA 2ZAAA 4MV2A 1ZRCA 1VR3A 3JQWA 1YFUA 2QVSB 1QJU2 1AR61 3LA7A 4Y4YA 4EWDA 4QT6A 3NSTA 2RS12 4CRQA 4YARA 5FBZA 1FNYA 2EXHA 1CAUB 1XYPA 1YFWA 2O8QA 3EBRA 3IPVA 3N7MA