3DV8A

Crystal structure of a putative transcriptional regulator of the crp/fnr family (eubrec_1222) from eubacterium rectale atcc 33656 at 2.55 a resolution
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
216
structure length
216
Chain Sequence
ENYFPLWNDLNTAQKKLISDNLITQHVKKGTIIHNGNMDCTGLLLVKSGQLRTYILSDEGREITLYRLFDMDMCLLSASCIMRSIQFEVTIEAEKDTDLWIIPAEIYKGIMKDSAPVANYTNELMATRFSDVMWLIEQIMWKSLDKRVASFLLEETSIEGTNELKITHETIANHLGSHREVITRMLRYFQVEGLVKLSRGKITILDSKRLETLQRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of transcriptional regulator, Crp/Fnr family (RER070207001219) from Eubacterium rectale at 2.55 A resolution
rcsb
source organism Eubacterium rectale atcc 33656
molecule tags Transcription
molecule keywords transcriptional regulator, Crp/Fnr family
total genus 63
structure length 216
sequence length 216
ec nomenclature
pdb deposition date 2008-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3dv8A02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3dv8A01
5FLXK 1TW2A 5JVTA 4HN0A 2MA3A 1IF1A 3CTAA 3CO7C 3GXOA 3K1PA 5JSPA 3GO5A 4GCVA 2PTMA 1GQGA 2OPKA 4KIGA 2VBYA 3EUHA 2QNKA 3EQLF 1IZ1A 1VJ2A 3FMRA 1LEAA 4IPAA 4P55A 1U12A 1ZYRF 3HRUA 1D8JA 4GYGA 2ETEA 1S8NA 5K8SA 4ON0A 4RD7A 1MZBA 3T8RA 2VOPA 1USSA 3E5XA 1OYYA 3HUGA 2ZKLA 1RGSA 4R79A 3BOQA 2VE8A 4XF0A 2VQAA 5F6FA 3LAGA 3RI4A 5H6QA 3F23A 1FP2A 2HTSA 4MUVA 1O5UA 4KN4X 1W7PB 2B5HA 1CAXB 2YPRA 3PQJA 2EV0A 2H09A 4XFCA 2FOKA 3PNAA 3ELKA 3TOBA 3CJXA 1YS6A 3BP8A 4YFNF 1FSHA 1QXRA 1FYMA 5FFZA 5TJJA 5IT9K 2A69F 3HT1A 2FA5A 2QVOA 4ZYGA 3BPVA 3REOA 5F64A 3T1BA 5LHIA 3EDPA 2ZMEB 3VB2A 3H3ZA 3ETQA 3DN7A 1TQIA 3M3IA 3H92A 3CLOA 4OLLA 4M9SA 4EGZA 2ESHA 3IWZA 4JBAA 1ZN2A 2L02A 2RGVA 5E8GA 1BI0A 2VPVA 5LGUA 4KNYA 1DZRA 4QGMA 1DGWA 5KHIA 3WE3A 2EV6A 3I53A 1SEFA 4M71A 2BNOA 2D5HA 5HS7A 4Q0QA 2RC4A 1HW2A 4IERA 3GYDA 4Z82A 4HAMA 2GC2A 1MJAA 3DL3A 4BAYA 1V3FA 2QBYA 4A5NA 3NW4A 2PI0A 3RPQA 3FHZA 4ESBA 1GXPA 2QQ9A 2V1DA 5J7MA 4MNUA 1H9GA 4U88A 3D0JA 2FNAA 4YRDA 1FI2A 1IRFA 2K86A 4AVAA 2FMLA 4AVBA 4LB6B 4IRHA 3BALA 1GXQA 1J3PA 4GXOA 2OZUA 1KYZA 2XAFA 4RGRA 4A5MA 4NB5A 1F4KA 2HWVA 2IP2A 3VHRA 2B8MA 1T38A 2ETHA 2FXAA 4PGHA 3OTFA 2AXLA 2PQ8A 3RZZA 3D0SA 2D45A 3J81K 4X6RB 3SXWA 3CEWA 2ADUA 3ERED 1CAXA 5ICFA 2XRNA 4D7TA 1J75A 1D8KA 2QENA 3TDUC 1REPC 2MHFA 2XLAA 2KIUA 4A6EA 3C1DA 4QXKA 1R1UA 3K0LA 5LBQA 4H0EA 4PDKA 5H6RA 4LUKA 1SQ4A 3LOIA 1MGTA 2P6TA 3M70A 4G7OF 2IT0A 3Q9SA 1JHFA 2KJBA 4G7HF 3OV8A 3FHIB 5CVJA 2HGCA 2OZJA 1LRHA 1ZG1A 2FMYA 2Z5UA 2VC1A 3T5XA 1ZZ6A 4M9XA 1J2XA 4BIFA 5BUVA 5CJ9A 4OFGA 3KETA 2GC3A 1LJ9A 4BXUA 1O3TA 3FFQA 1JGSA 1O7LA 2J5OA 1ZLJA 1TTYA 4EM2A 5CVIA 2I45A 3L7WA 3J80K 5JAXA 2KRFA 4EJWA 2ISYA 4OINF 1WQ2A 2XKOA 2Q30A 1B4AA 1RZ4A 2PFWA 4ORFA 2G7UA 1KU3A 2CSOA 1FBQA 3KE2A 3KGZA 4L0ZB 1TLHB 4MGYE 1EH8A 4Y17A 1S3JA 1BC7C 3KLOA 1B6AA 3LQQA 2IC1A 4ZYEA 4MHGA 4ZH4F 2UY8A 2HYFA 3TO7A 4L11A 3HRTA 3E6BA 2VODA 3L2HA 4LJZF 1S6LA 2G9WA 5ICGA 4HF1A 3E97A 3H8UA 1FYKA 3MCZA 1FBSA 1E2XA 4LMYA 3V4GA 3O6BB 2Q1ZB 1O3SA 3NVCA 2P5VA 5FPZA 1CAVB 1S29A 4ENJA 3O3KA 4HQMA 2UXXA 1L0OC 2E1NA 5KVRA 4BYYA 5JSRA 1H0MA 4Q29A 1OR7A 3BB6A 5FLIA 1Q5OA 4KWKA 4CHUA 5IT9Z 3MPBA 1IN4A 1OYIA 2UY9A 3F8BA 4H7LA 3R61A 4E70A 4YIIA 2IA0A 5LGTA 1SD7A 2NYXA 4OMZA 5DUKA 2OBPA 3N4MA 4HSLA 2ELHA 5L3GA 1P4WA 1Q1HA 2PFBA 3I54A 1B1BA 2XVCA 3HSFA 2VECA 4Q0UA 4A0ZA 3S7EA 3RJPA 4IRGA 2VXZA 4JV4A 2ZCWA 5FDBA 3WW2A 3G7DA 2Q4SA 3KLNA 2W85A 1LKNA 4XF9A 3MYXA 5KHHA 3F72A 4XETA 5A2QK 3SCHA 2EFQA 1QGPA 5CADA 2STTA 1ZZCA 4ASNA 4EM0B 4CO8A 1LR5A 5HDNA 2EVXA 5EFUA 3WW4A 3U2RA 5HVQC 4AQ2A 4L5JA 4ZZLA 2P7VB 1J58A 1R1VA 2K7LA 1P92A 2CO5A 5I8TA 3Q9VA 3EHKA 3WTWC 3TDZC 1O57A 4O3MA 1MD0A 4G94A 4AD9A 5AONA 2CFXA 3CUQA 5D4SA 4QM9A 3IHUA 5JSOA 3FM5A 3KGLA 1ZZ9A 1ZZ8A 4LUMA 2QQAA 2BV6A 3C3WA 2OA2A 3WTVC 3TO9A 3LA7A 2A3SA 4LK0F 3EBRA 1SD5A 4AVPA 1J59A 5LEJA 1ZZBA 3I0TA 2DFIA 5JR3A 2ZO4A 3QP5A 4XF3A 1K7AA 2QWWA 3RNSA 5EEGA 2A61A 2IPQX 3GZ6A 1ZG5A 1T2KA 4Q0SA 2CW0F 3DQVC 2F5DA 5D5UB 4FHTA 4MGZE 3CO6C 4I09A 5EEHA 2ESNA 1FBUA 4L9TA 2WFPA 1OMIA 3TKYA 2HFHA 4YSFA 2L54A 1J3RA 1P4AA 2RN7A 3B73A 3RYKA 1WWXA 4GGGA 1D3YA 1WRJA 2PG4A 4KIBA 3DKWA 4IEQA 3V8KA 4MZUA 5I8SA 2EJRA 1W7PD 2ATFA 2K0GA 2BGCA 2QLZA 3BY6A 3C18A 3HHGA 1Q3EA 1ZAOA 2RQPA 4PIXA 4MQ9F 1FXZA 3GW2A 1I5ZA 1YFWA 2PLYA 4RGXA 4HA8A 4EROA 3JZVA 2MH9A 3E6CC 3HSEA 2MNGA 1BN5A 2XAGA 2IXCA 4OIRF 3FE5A 2CAUA 1P4XA 3WU1B 1XMAA 3H50A 4K8FA 4RGSA 5I0UA 5JI6A 3KEQA 1ZVFA 5E1ZB 3P9KA 2JT1A 4MEYF 2O1QA 3QRFF 4A0YA 1CAUA 4MH0E 1J5YA 1EP0A 4CYDA 2WV0A 2XLFA 2W84A 1PUEE 4P9GA 3TGNA 3WGIA 3GYHX 4UBGA 3KP5A 4PIYA 4HBNA 1XE7A 2W57A 4JTOA 4L9JA 5TRDA 3CUOA 5BPIA 3U0ZA 2A68F 3OD0A 3SHRA 3HIFA 4UVCA 4Y15A 4FAGA 2XLGA 4G6QA 2K9ZA 3FXUA 4HX7A 1SMTA 3R60A 4ZZDA 1R00A 2MLGA 3IC7A 2PA7A 2VBWA 1IN5A 3GVAA 1YYVA 2BE5F 3NKTA 4HN1A 5ILSA 1YFUA 4O5VA 4J1XA 2FEZA 1ZRDA 1UPIA 4I2OA 1E17A 1F5TA 3KP3A 4YIFA 2W24A 1YLFA 2DQLA 5A2QZ 1KGSA 2XKPA 2ZNYA 1USTA 3K2ZA 1FLIA 2BEOA 3NQOA 4U0WA 3H1WA 2FBIA 1X3UA 3FXQA 5LRRA 2CGPA 1B9MA 4U7DA 4MV2A 1ONVA 4EV0A 4X6QB 3KCCA 4YFXF 4UNOA 4G8XA 5ED4A 5J48A 5LHGA 3ABTA 5FFXA 2E9QA 4ZYHA 1U5TC 2QYOA 1BOAA 2CV6A 1RI7A 5I0RA 3ZQ7A 4MGIE 1WSUA 5AIQA 1ZARA 2FE3A 2D2WA 3RTRA 5F1RA 1Y9QA 5BPXA 1UHWA 2JPBA 3JAMK 4Y13A 4HW0A 2DBBA 2FQPA 1TQ5A 4WK8F 3QPHA 1XDSA 3RYRA 5E20A 1NE4A 3PLQA 3G73A 4B8XA 2BNNA 5D6EA 2EFPA 5JR7B 4KMUX 1Y3TA 4RB2C 5KBFA 5HLIA 1T6SA 2P8TA 4S05A 4KA4A 5D8KB 2JSCA 1HXDA 1BIBA 2Z99A 3U9GA 2O0YA 1SD4A 2LF7A 1P2FA 1YW7A 1OFNA 2ZJ2A 1FX7A 2GZWA 1LNWA 2KXLA 1UB9A 4IEZA 2EAAA 3Q5FA 4LA3A 4L0YB 5JFRA 1ZX5A 2OA4A 2M45A 3SHFA 4HX8A 4EJUA 5ILVA 4JQFA 1V70A 5KHGA 4QWQA 4NVPA 4Q0PA 4HVRA 2MBFA 5HDGA 3B02A 2IA2A 1B9NA 4MTEA 2XROA 1R23A 3KP2A 1DUXC 3SZTA 1XMKA 2Y0OA 2RNJA 4ONUA 2F4PA 2ZMEA 3ZMZA 1LVAA 1SFEA 1YO5C 3ELNA 1OI6A 2ZBKA 1TQMA 4P9FA 2WTEA 2B9UA 1FP1D 3DF8A 4OMYA 1H1IA 3F8CA 1U8RA 4I98B 1I6XA 4KL1A 2KKOA 3O2PE 1QNTA 3ZPLA 3BJ6A 4S04A 4FBFA 2CYYA 1Z6TA 5K5OA 4WF2A 3IIAA 4M6XA 4EM1A 3PFIA 1FC3A 1DP7P 3I58A 4F7ZA 4M74A 5DCMB 5CYVA 1R58A 1XB4A 2B0LA 1X82A 5HS8A 2YU3A 3DFGA 3HTUA 3JW4A 5DCFA 1CGPA 3CUQB 1CAWA 4E2QA 2EFNA 4Q4ZF 2VT2A 4IEWA 3GZ5A 3HYIA 1X7NA 3RPUA 2OAZA 4EWAA 3WU0A 3UKVA 1XN7A 4TV7A 3L9FA 3QU6A 4OOIA 4EMSA 1K78B 1O3RA 5ERIA 4G9YA 1G3WA 1KU7A 5BXXA 3WTYC 3H1YA 3LQRA 1BJAA 1OYWA 2D93A 2V09A 4IEYA 3FWEA 1ON2A 2FBKA 3P7NA 3QP6A 1HKQA 3TO6A 3OGJA 4XFBA 1EPZA 4KYWA 3VODA 2HS5A 3WE2A 2FF4A 3EYYA 4CZZA 5BV6A 1YTYA 2H6BA 1FZPB 3S0MA 1WI9A 1FYLA 1FSEA 1JXSA 3IRRA 3WTXC 3SXYA 3JSPA 4RB1A 2O3FA 4IHTA 4ZU4A 4IESA 1XGSA 3D5LA 3ZN1A 3GEZA 2F2EA 1XSVA 1V4RA 2GH2A 3ZN0A 2HQRA 3PVBB 2HEOA 2PN6A 3WGHA 2VN2A 2FRHA 2O03A 2O8QA 1EH6A 3SFZA 3BCWA 4WXDA 4FX4A 1SFUA 1LEBA 1QZYA 1S7AA 4META 5D5XB 2QUFA 2OZ6A 1NXMA 3QOPA 1AWCA 2EV5A 2EA2A 5CVUA 2L4MA 4HSJA 1BIAA 2ET7A 4DINB 5HS9A 2XAHA 5C8WA 5E8IA 5D1IA 1J7KA 4Z07A 4ENMA 1HQCA 2ZNZA 3SCFA 1KU9A 5BMZA 3JAMZ 3M9AA 3DXJF 4LD5A 5J8CA 3SQNA 4XLPF 3NJZA 2F5EA 3CF6E 5J8FA 2GXGA 4L5IA 3BZ6A 1Z91A 4IXAA 2O8XA 1ON1A 2V9VA 2XAJA 2H27A 2VONA 2GQQA 2PBIA 3LFKA 1HKTA 4LA2A 3M7GA 4BHBA 4M9ZA 2K4BA 3I59B 2EA7A 4HZFA 1T98A 2Z2SB 4UVBA 3RKXA 3C3VA 1U5TA 4AWXB 4AQ6A 3TNPB 4LG0B 3IWFA 1FT9A 1UCRA 1O3QA 4R8HA 1WA4A 1I1SA 4Q47A 4A0XA 1CF7A 1TW3A 4QLCU 2Y48A 4RGUA 1FY7A 2P5LC 1C0WA 3WODF 5E1XA 4BH9A 3WW1A 3K1MA 3P9CA 4ENNA 4I01A 1R22A 1XD7A 4XRFA 1K79A 4XBFA 2YX4A 2RKHA 5J3UA 1MJBA 4MGRA 5BQTA 2VBZA 4LLNA 4XSZF 5E17F 3EO6A 3QACA 2PEXA 1GHCA 3MWMA 1ZLKA 2P17A 3FJSA 1ZRRA 3H3UA 2NNYA 3F3XA 2DK8A 3LWFA 4WVZA 3BJOA 1L3JA 4ETSA 2KIMA 4AIHA 2D1HA 2UYBA 4EJOA 4UV9A 4RB3C 1SMYF 3KMHA 2Q8KA 1Z7UA 3U1DA 1RUOA 3GF2A 5EZWA 4HQEA 3M8EA 5KHKA 6PAXA 4XSXF 2DQRA 3ACLA 5L3BA 3F8NA 3K69A 3CLPA 4WBBA 2QVSB 5CU1A 4LTAA 3S7IA 3IBMA 3VFZA 2A6EF 5FB2A 2VE9A 2PAEA 1ZHFA 5L3FA 2P5KA 1CAUB 2UXNA 2QDRA 4HVQA 4IHSA 3LAJA 2PQQA 1OD5A 2MPFA 2Z3YA 2HKXA 3FZ3A 4KUMA 4PGGA 2QBYB 3GWZA 5HI0A 1IN7A 1G3YA 1UIKA 4YYOA 1BBYA 4D7SA 5L3CA 3USSA 4L9NA 2LNBA 3HOSA 5I93A 3O14A 2CG4A 5D4RA 1WLTA 1K6OA 3RKYA 1YHFA 1KQ0A 1STZA 2V79A 3JSOA 3LZZA 3BDDA 1UFMA 3LAPA 2YSRA 2IW5A 1O5LA 1R7JA 4MEXF 4I0BA 3RIRA 2PYTA 3UKTA 1S7OA 3ML6A 3EQEA 2VT3A 2K02A 5DYMA 4HBLA 4ZYDA 1XE8A 2IXHA 5FQ0A 1J0RA 5ICCA 1QZZA 4EVIA 3JTHA 5AIPA 1NE6A 2O6GE 1AOYA 2CAVA 3WG9A 5DV5A 3FZVA 3I64A 5D5WB 2Y75A 1FNNA 3E6MA 2ET1A 3WTSC 4YG2F 4KN7X 1IN8A 2D1VA 4KIFA 5E18F 3H9AA 4CICA 4QGNA 3F8FA 4HMZA 1U6GA 4LULA 1BI1A 2M87A 1PDNC 1GVJA 2Z69A 4XF4A 4BQAA 3KZYA 4E2SA 3NSTA 3J80Z 4BHPA 3F21A 4P9UA 4HLYA 3FXRA 3MAJA 3EYIA 4RS8A 2HTJA 1U3EM 1Z9CA 1G4DA 2JPCA 2FNPA 2UYAA 2P4WA 4UUVA 2VOOA 3J7AO 2DK5A 3GX4X 2GC0A 3E3VA 4L2NA 5J6XA 1UW8A 2P6SA 2Q0OA 3V8LA 4O6JA 3F8MA 4KT5C 5E1RA 1W4MA 2N7GA 3L2CA 1BI3A 5FLHA 3ZP5A 1XRUA 3QAHA 3E6DA 3ECOA 2M30A 4GYIA 5T3NA 4N9HA 5DUIA 1ZRCA 2COMA 4RAYA 1QY4A 3HT2A 4HF2A 1ULYA 4KWLA 3N97A 1W7PA 4EJVA 2M1BA 3ST7A 5LEKA 2OU2A 4HV5A 2LDUA 2A6HF 1J1LA 4K2EA 4LLLA 1GQHA 5FD6A 1PM7A 4EGYA 1X8MA 3KP7A 4OIQF 1EV7A 4FAHA 2QM3A 4A2UA 3NEUA 2DLLA 2LSOA 2V1XA 4UVAA 1YWKA 2XGXA 1NZCA 4B29A 1CF7B 3W6JB 1HKSA 3EJKA 2IXKA 1VR3A 4ESFA 3DPTA 4LG0A 2A07F 2ISZA 1DGRA 1Z1DA 3GFLA 2R7FA 1YQAA 1YG2A 2XHKA 4LLGF 4MGKE 1DDNA 2NRAC 1EY2A 1CAVA 4AXOA 3KEOA 1BM9A 4QGLA 3ES4A 3H7YA 2OQRA 4CGZA 2C6YA 2FQ3A 3IDBB 4MQVA 4HX4A 4XFIA 4KU8A 2IJLA 4HDUA 5HOOA 1FPQA 2GA1A 1DPRA 4MTDA 1TNSA 3MQ0A 2XL7A 4Z2YA 1JHHA 2IXJA 2EB7A 2XV4S 3R0JA 1IW7F 5D6FA 2BBYA 1BC8C 2D40A 3QU3A 2X0LA 5DD8A 4UV8A 4JK1X 2DPUA 4OIOF 3MFKA 3BU7A 1SAXA 4KWJA 3IDCB 2GWRA 5CVVA 2C0ZA 3OOPA 3ZDSA 1ZGAA 2L01A 3ABUA 4KICA 2MC3A 5IT3A 2HDCA 2GA2A 4YFKF 1X8EA 2EK5A 2LF8A 3WGGA 3VOEA 4LB5A 2L3DA 1ZG3A 3IKVA 2HZTA 3FX3A 1YW9A 5ILUA 1ODDA 2H94A 1WKMA 2DW4A 3ULQB 2X4HA 1XSXA 2Q0AA 1ZZ7A 5BY5A 1MDMB 1LDJA 1IUYA 4HV6A 4M72A 4O9EA 1ZH5A 2G7HA 1CAWB 1HBXG 2R7DA 2STWA 3KP4A 1WGPA 2XIGA 4UXNA 3IL2A 1ZGJA 4Q48A 4LK1F 2IXIA 4WZCA 5E16A 2PJPA 1QBJA 4D0PA 1YLLA 2DTRA 4I7HA 3G3ZA 3E5QA 5AVPA 2QQBA 5HLHA 2UZKA 1A04A 2FSWA 4LFUA 4NQWA 3FF5A 3HRSA 2DU9A 3ECHA 3MZYA 4HLXA 3MZHA 2XAQA 3U10A 5DD4A 4Q5SF 1UHMA 1KYWA 2QCSB 4MX3A 2UWMA 4HF0A 3F22A 3M1EA 2BNMA 3IRQA 1ZNPA 2MLKA 4U0VA 1IAWA 4ZU5A 4CDGA 1HW5A 5FO5A 4IETA 2HYGD 2E7WA 3U11A 3C7JA 3RDIA 2GXBA 3FMQA 3SZPA 5LHHA 1SFNA 1XCBA 4L9VA 1IPJA 3V7RA 3I71A 4WXCA 1RIOH 4HLTA 4UBHA 2FU4A 2DO7A 1QO0D 1DZTA 1T39A 3DP7A 1IXRC 4QM8A 2E1CA 5D5VB 1JE8A 5FPXA 1QXJA 5JHUA 2XL9A 3DV8A 3SCGA 3WW3A 2F5FA 5FQ0B 2V6CA 4IEXA 2ACJA 3COAC 2PAKA 1FWZA 1LDDA 2DT5A 3KSCA 1D5VA 1LQ1A 1YFYA 4AIKA 4FT8A 2HQNA 1MKMA 1RNLA 5HLGA 4XEZA 3L09A 5FLXZ 2H6CA 1ZREA 3DEUA 3WTUC 1O4TA 1KQ8A 4HYEA 3NL1A 1HSTA 3LA3A 5LRSA 5I0SA 2IRFG 2HKOA 2P7CB 4KMFA 1KA8A 1DPUA 2VBXA 5FGMA 4RAZA 2J5PA 4GULA 3KFWX 3BROA 4CXFA 4PZJA 4WXHA 3K9TA 1QWRA 4IEVA 4E2GA 1U2WA 4NHJA 2YR2A 3MDPA 5BPDA 2QJVA 3V7CA 4G7ZF 3V7SA 1R5HA 4R52A 3SMHA 4ENKA 2DAOA 2PAMA 1IN6A 4DQ2A 4B09A 1O7FA 1MJ9A 2A5YB 3RKWA 2IXLA 4I02A 1YFHA 4A6DA 2OD5A 1W5TA 5FCCA 4WX9A 1UIJA 2V1UA 1UCXA 3TNQA 3M8FA 2GAUA 4Q0VA 1CX4A 4PCQA 1B59A 5K1YA 1FOKA 4R1HA 2RV8A 2EWNA 4XFAA 2KJCA 1U78A 1LB2A 2EA4A 2GIVA 3BJAA 2M8EA 3ZMTA 1T0FA 5L3DA 1J9IA 1XGOA 1IXCA 5DEQA 2R3SA 5BS6A 1EYBA 2RDPA 5D8LB 5H20A 2ZFWA 3CDHA 1EH7A 1PP7U 3H7JA 4WWCA 5K5RA 4BNCA 1QQIA 3OCPA 4XFGA 4QMAA 4FX0A 4U7BA 2MH2A 1XGNA 5HDKA 1TQPA 4I3PA 4IF4A 1YS7A 4OU0A 1I27A 3CJNA 1J3QA 3K1NA 1R5GA 3ISPA 1SFXA 3HRMA 4G6DA 5L3EA 2FBHA 3I59A 3GFJA 3R0AA 5CVRA 1VP6A 1VTNC 1YFXA 3BPZA 3KP6A 1G3SA 1RTVA 2JRTA 5LGNA 4M73A 2Z9OA 1SD6A 4EJTA 3CO2A 2NAZA 2EFOA 3T8TA 5JCTA 3VEPA 1G6NA 1IXSB 2DPDA 5I0TA 3HOTA 5ICEA 3GFIA 2NS0A 4AIJA 4AVCA 1BI2A 4O9GA 2K4JA 2CWEA 1L3LA 2PMHA 2ZKZA 1LDKB 1NYWA 3P9IA 4EWEA 4IEOA 1I1GA 3LSTA 1Q43A 5I91A 1XDUA 2DI3A 4L18B 3D82A 2Z33A 1UD1A 1H9TA 3W6KB 3MEXA 4I0AA 4JTNA 3JTGA 3F6OA 3TOAA 1RUNA 4LGWA 2EFWA 5KHJA 2L4AA 5KK1A 4PIZA 3I4PA 4RB0A 3PQKA 4EQQA 3ZMDA 2XUBA 4XF1A 3OF1A 2JTVA 5FLJA 1HSJA 2KIFA 5I8YA 3LA2A 3I7DA 1XGMA 4IEUA 4KDPA 3CUQC 1IRGA 1KQ9A 4N9IA 2M5WA 4DNCA 5LLQA 4UXAA 4F8AA 2HOEA 1RL3A 2F5CA 4ZU7A 4JVAA 3FM3A 4HDVA 1Y0UA 2HJIA 2Y0MA 3T0YA 3HSRA 1OKRA 1TNTA 3FMSA 1F1ZA 3LWCA 3IKTA 3AAFA 1PMIA 1PP8F 3V8JA 1K78A 2Q2EA 4YNIA 2LKPA 3E5UA 3HTSB 4XLNF 2ZXJA 1OPCA 1Z05A 5K5QA 3ZMUA 4IEPA 5CLSA 3GFMA 2TDXA 2OYZA 4A12A 2AS5F 3BPXA 4J1WA 1YIOA 1MDMA 4UHTA 4YARA 2GU9A 3BWGA 5DCMA 4HOBA 3GUDA 1R36A 3WTZA 2NNNA 2W25A 3UKNA 3HHHA 1IPKA 2WWYA 1TBXA 1ZRFA 2PMUA 2GC1A 2IVMA 4WCGA 4KU7A 4PJYA 2QZ8A 4XFHA 1P6RA 1Z6RA 1XCVA 2K27A 3I5UA 4IJAA 4HVOA 2WC2A 1U5TB 5FD5A 3RYPA 1YW8A 3ZMVA 4P5OA 2MD5A 3R4KA 2JZYA 2CQKA 5C6CA 1JUHA 4N0BA 2D5FA 4LEJA 4ESJA 2H0VA 3J81Z 1HW1A 2DCTA 1F9NA 3QPTA 4IVNA 1H1MA 2OQGA 4U0YA 3EETA 1NHAA 4IRIA 2E7XA 1W5SA 2PHLA 3H1MA 3ZMSA 1YUDA 3NRVA 3ES1A 4M6YA 2HR3A 5E1WA 1XSDA 4EWDA 3F6VA 1R1TA 2XASA 5BOXA 4TLFA 2BYVE 3DPLC 3CL1A 3WTTC 2YX7A 5DDGA 3R6SA 2RVCA 3ROUA 4XFFA 3L00A 2VC0A 1QPMA 3GLXA 1RC6A 2IA1A 3KZZA 4P96A 4LLOA 4QX5A 3GBFA 4OIPF 3TQNA 1KU2A 2O61A 4GO1A 4KFCA 3HQXA 1G3TA 4BHCA 3S2WA 2PHDA
chains in the Genus database with same CATH superfamily
1U8BA 5JVTA 4WVMA 3OS0A 4DBRA 1Y9MA 5C9AC 2BGOA 4QDSA 3OR1C 3W2WA 2KDZA 3C2GA 3GXOA 5FYIA 1E3OC 1ST8A 3K1PA 1YIFA 3GO5A 2VQUA 3FBIB 1MACA 2JK3A 2EIMH 4HG2A 3PUQA 3AP9A 1IZ1A 2QUOA 1VJ2A 2DUOA 4CXYA 4PBOA 5K8SA 4MGTA 3T8RA 4YGBA 2HWC2 2GP3A 2XVGA 1OYYA 1HB1A 1ZBE3 4M3GA 3LCPA 3OUHA 3ZYFA 4Z2WA 2XOMA 2VQAA 4JGZB 4IV1B 1ODMA 2OS2A 3F23A 3JU9A 2VTFA 4MUVA 1O4YA 4KN4X 3ZN5A 2BERA 4F92B 4XZUG 3PQJA 2WNVB 3LSHA 5EGOA 1ENXA 1J09A 2FOKA 4XICA 1RIRA 1MQTA 2P3JA 1ND2C 1YS6A 4QXBA 3J8F2 5EZHA 3AJYA 3S8PA 1W6MB 4ZDLA 1AYN3 3LFMA 1RUC1 2DVBA 5J96B 4YG0A 2FA5A 2QVOA 4AYBA 3V0BA 2RS52 3BPVA 3P6BA 4E7LA 1OCCH 5JXGA 2Y6GA 4FOYA 1STMA 1NZIA 3DF0A 3T1BA 1DG6A 1WGXA 3EDPA 3VB2A 1WBLA 2JDAA 1TQIA 4EGZA 2ZJRF 3GF6A 4IQJA 1VBE2 4Q4V1 4F3QA 1UO9A 2X6XA 2K46A 3IH3A 5IK5A 1QDOA 1XPXA 5E8GA 1BI0A 1TVGA 2VPVA 3WNNA 5LGUA 3QQAA 4JHZA 4QGMA 5KHIA 3FHNA 1W3XA 3WE3A 1JKRC 1SEFA 4M71A 5HS7A 4CZCA 4K1ZA 3GYDA 2R0FA 4Z82A 4GWNA 1UU4A 2GC2A 1LHNA 3CCUI 3H0DA 3DTIA 1WW7A 1ZKGA 1V3FA 2QBYA 3RPQA 3DLAA 3FHZA 2DDUA 2NLRA 5A7NA 3BQYA 1H9GA 1PIV3 2FNAA 5HPOA 2E71A 1IRFA 4V2FA 2SLIA 3QPSA 2YU9J 3W3CA 2HNHA 1J3PA 2OZUA 4A5MA 3C2HA 4W6XA 3H3LA 2HWVA 1H30A 1PVC1 4OHYA 3VHRA 2Y33A 4YW1A 4XZPA 2FXAA 1A5JA 1AX0A 4AQTA 2PQ8A 1WLWA 4QX7A 3RZZA 3J81K 4X6RB 3CEWA 2ZGRA 3P5JA 2KD7A 2R0HA 2G0EA 1VLNA 2LH9A 2O7OA 2E7AA 4D7TA 1BEV1 2YFZA 1CONA 1OLMA 5DTDA 1KEXA 2MHFA 1DU0A 3IIIA 1AF9A 1PZ7A 1G7YA 1R1UA 3NNMA 1VBA2 2VUCA 4PDKA 1C4RA 2W3JA 5H6RA 4LUKA 2GXAA 5GJ6A 4Q4W3 5CNAA 1VBC1 1R093 1Y7BA 1HN0A 1UKGA 2Y0SA 1ETYA 5CVJA 1HB4A 5GM0A 3CLQA 1X19A 5LA1A 2V4AA 5AC93 3LDKA 2ZJQF 4K7JA 4ZPIA 5J1RA 5JHFA 4BIFA 2KL4A 5T54A 5FREA 3KETA 1H8TB 2HYXA 4P9XA 4C0BA 2GNTA 4EM2A 2ZXHA 4LBMA 3KVAA 3JCIA 3WP6A 2O0OA 2W52A 3VSLA 3RPUD 2OQ6A 1CX1A 5GAEJ 5ACA2 4LO6B 1ENQA 1ETVA 4K8RB 3FXMA 3UNGC 4ORFA 4W50A 5IVCA 3KE2A 1F5FA 3KGZA 1MZFA 2XBO1 4L0ZB 3E1F1 3I2OA 1EH8A 1S3JA 3KLOA 2IC1A 4ZYEA 3KM5A 2HYFA 2XGDA 4NHYA 4LJZF 5ICGA 2W7NA 1MVQA 1D2SA 4HF1A 4G12A 3E97A 4CPBD 1FYKA 1E2XA 4FOVA 3GJBA 1R1ZA 4PDWC 2AH2A 1W0UA 1OISA 1EV12 1AL23 2W68A 1GZ9A 3O3KA 4HQMA 3VBFC 5KVRA 1WZ2A 4BYYA 4FPLA 3ENRA 4LBNA 1H0MA 4NOTA 4Q29A 2HXOA 4GJZA 3MFAA 3Q0UA 1IN4A 2UY9A 2XQRA 5HCBA 2WDBA 2MFZA 3R61A 1W9FA 2I5UA 4CU7A 1X9TA 4CDXA 2NYXA 1JI6A 1LOBA 1VB4A 3KWVA 4XC9A 1R092 4HSLA 2ELHA 1Q1HA 2G1MA 3RS6A 4OHVA 3MF9A 1B1BA 3MV01 3WDTA 4DUWA 3RJPA 5ACA1 3PSFA 2RE9A 2ZCWA 3PNYA 4CP0A 3TEYA 4ZZ8A 2WQZC 2W85A 1P7IA 3WVJA 2LY2A 5JWPA 1RVF1 1GOFA 3MYXA 4W8JA 3CJIB 3SCHA 4Q8LA 5CADA 1QGPA 2STTA 5B3SH 3UGHA 3H0GJ 1LR5A 3IDAA 4COZA 1K45A 3LEMA 5HVQC 1R9TJ 1RKTA 5F8PA 4D0QA 1J58A 2K7LA 2CO5A 2GLOA 5I8TA 1JHJA 1BW6A 2ZA9A 2RDSA 4C8DA 5EJCA 5FJHA 4G94A 4RQPB 5AONA 2CFXA 5D4SA 2EICA 3IHUA 4U2AA 1EPWA 5JSOA 3GLLA 4Q1PA 2GMPA 3RSNA 2GH8A 2VMEA 1UHSA 2CY6A 1ZZ9A 2DYCA 3MIHA 1UOBA 1Z7S3 3EBRA 3LEGA 2OIIA 5JR3A 2ZO4A 1K7AA 3PU8A 2QWWA 4HKWA 2RJLA 5ISLA 1HX6A 3M07A 1OCPA 2WWJA 2EZKA 3PUBA 4MGZE 3CO6C 3WXPA 3MICA 4I09A 2NMOA 2HWC1 3M3QA 2ESNA 4V2WA 4L9TA 2LALA 2ZZQA 4XKWA 3PUHA 2BFUS 1Y1WJ 2KZVA 5BNOC 3VD4A 2HFHA 4YSFA 2X09A 2L54A 1J3RA 2RN7A 1A8DA 1WWXA 4GGGA 2VQHA 1WRJA 1OOPC 4KIBA 2TEPA 2VUDA 4XJ9A 1ZBA2 4Z2AA 1XMXA 2ATFA 2B46X 4PSXA 1LJ7A 2BGCA 1FNZA 3HHGA 3C18A 3ACGA 1QEXA 3VKLA 1E3PA 4M3CB 1I5ZA 3F9KA 1H4GA 3E6CC 4I3GA 1C1LA 2XAGA 1PM4A 2JG9C 3QYBA 3FLPA 3ZQCA 3PUFA 5D2AA 4FTBA 4ZY9A 3ZOBA 5LBEA 1NCRA 4PK4A 3LEIA 5BNNB 4B7KA 3I2FA 4X0GA 1ZVFA 2K40A 1PUFA 2XAUA 5FP4A 1ULPA 1L7LA 5FROA 2W84A 2KR2A 4AK3A 4XACA 1FPN2 3K6GA 3KP5A 3QCWA 1AYM1 1H8AC 2VNRA 1LU1A 3BG9A 2ZXWH 2W57A 4JTOA 5FO9B 1V9U3 3RZJA 4CUCA 5BPIA 3AG4H 3H8OA 4YZ4A 3U0ZA 3HIFA 2MABA 4XJAA 3NJVA 1YYNA 4RFRB 4HX7A 4BCUA 1QOSA 2VIXA 3T4HB 1X1DA 3R60A 5FZ1A 3UESA 5DPNA 3IC7A 3I3EA 4F52A 3NKTA 1BCXA 1HF0A 3CQZJ 4I2OA 3KP3A 4YIFA 1TZLA 4ZS2A 2BW3B 3OY8B 2HXIA 3MW4A 4FXGB 2IGMA 2XKPA 2XWJB 5IPAA 3VBUA 1FLIA 1HB3A 2VQTA 3BKZA 1G59A 2FBIA 3WQ1A 3GNEA 2QEXI 1KRIA 4CPBA 4COUA 1COV1 5J48A 5EZGA 5LHGA 3AKZA 2E9QA 3ZR5A 1U5TC 2QKLB 3OBAA 4V2GA 2YC4A 2BY2A 1ZARA 4M3EA 2AZ5A 1LKXA 4Y13A 5LBBA 2DBBA 4AHZA 4MIMA 1ETQA 1CN1A 3OUJA 1NE4A 3VB9A 1HCRA 1ZBE2 2VU9A 2EFPA 2PHUA 2UWAA 4LOSA 4YVWC 4DXZA 1POV1 1QNYA 5HLIA 1XYNA 5D8KB 1BIBA 3U9GA 4B3XA 3N9MA 2O0YA 2LF7A 2W39A 5LW9A 1YW7A 3POSA 2GZWA 3KCXA 4NBQA 5M3FJ 1LNWA 1WW5A 4CP2A 2PLV2 4OZOA 2QQ8A 1UB9A 3ITQA 2R7TA 4L0YB 1VQOI 3VPRA 3GTLJ 1X3WB 1FV3A 2R043 5ILVA 1V70A 5KHGA 3TL4X 4OI1A 2MBFA 4YW4A 5HDGA 4MTEA 1R23A 4JRAA 5IW0A 2A1XA 3SZTA 2ZGLA 5EXOA 1XMKA 2Y0OA 4ONUA 2ZMEA 4XKBA 4Y5SA 5FIXA 1SFEA 1OLME 1YO5C 3ELNA 1TQMA 4ARYA 4OMYA 3DF8A 4BM8A 1H1IA 1CESA 4KL1A 3O2PE 2V1NA 3BJ6A 3JRBA 2WZR1 3SITA 4GB33 2CYYA 4IE4A 1X58A 1Z77A 3IIAA 3I2GA 3FBYA 3O8GA 2JEMA 3S1QJ 3M1HA 3ME2A 5FKLA 1I5PA 5GP9A 4OYUA 1D1BA 2YU3A 5A3TA 1JHNA 2VL8A 3HTUA 1QNWA 3U07A 2GSYA 3LFUA 3CUQB 3QBQA 4A93J 2VT2A 2KZGA 3HYIA 3B3QE 4WVWA 4RA2A 3ZXKA 3UKVA 1OA4A 1XN7A 2M2EA 4TV7A 1B72A 2DFHA 3L9FA 2VD7A 4H2AA 4QU2A 1X33A 2EZHA 2DMQA 2V09A 3PFYA 4D1QA 2FBKA 3QP6A 1DZQA 1NK2P 3TO6A 3OGJA 4CXXA 4JGYB 3WE2A 3P3PA 3EYYA 4EN0A 1CWPA 4BBSJ 3S0MA 2MSYA 5FZOA 2GALA 4AFMA 2W87A 3WTXC 5EF6A 1XC6A 3SXYA 4XMYA 4ZU4A 4JQRA 3A0BC 4QQOA 3GEZA 1XSVA 4XN0A 3ZXDA 3K2AA 3ZN0A 3PVBB 5A3NA 3ZXGA 1KGYA 3MV11 4JDNA 2HEOA 3CMGA 1MH4A 1N77A 2R071 5IOYA 2VN2A 1UMQA 2LFBA 2JRMA 3SFZA 3BCWA 1G9BA 3HR9A 4CDXB 3WF3A 5FZEA 3LDRA 3DKQA 1SFUA 4IE5A 1LEBA 2DA6A 4ZTFA 1VNDA 5D5XB 3JR9A 3S57A 1NXMA 2P81A 3H1CA 2EV5A 2EA2A 2VUMJ 5CVUA 2L7ZA 1BIAA 3I49A 2W47A 4PQ9A 4DINB 5HS9A 5D1IA 5FKKA 5JOYA 2ZNZA 1VE0A 2CDPA 5GZEA 3JAMZ 5FP9A 2F5EA 2VCMA 2W5FA 1LGCA 1RHI1 3ACFA 4L5IA 2VBBA 5TSWA 3ZFEB 4IXAA 2UURA 1MMAA 1VRH3 1ON1A 1VMHA 2V9VA 2VONA 1LOCA 3LFKA 4LA2A 4CEWC 2C6SA 2BVBA 1JUMA 2DODA 2K4BA 2Z2SB 1DIWA 4DNYA 4UVBA 5K0UA 4AQ6A 3TNPB 1FNYA 1UOGA 4XJZA 2HWE2 1UCRA 3HOVJ 2VOXA 5ERLA 1IDYA 3J7YJ 2DCEA 2YYOA 1JUIA 1I1SA 4Q47A 1CF7A 1TW3A 3MGUA 3WNXA 3BN6A 3ZIWA 3ZRGA 5E1XA 2R041 4ENNA 4I01A 2RS13 1ETWA 4RLFA 4E4HA 1MS9A 1TMF2 2PLV1 1MJBA 5BQTA 4I6ZA 4LHNA 2WFF1 4IV3A 3H3UA 4LK7A 2N8GA 4LBLA 1G9DA 4K1YA 4DGWB 2Y30A 2NVTJ 2DK8A 3LWFA 3CMEI 4ETSA 2KIMA 1DQ6A 1FPN1 2BW8A 4EJOA 1W6NB 4RB3C 2LRDA 4XURA 2VZSA 2VE1A 3U1DA 4IE7A 1RUOA 1MR5A 2WAQA 3M8EA 3PVEA 4F55A 6PAXA 3ZFFA 4XSXF 1PO13 3ACLA 4DUVA 1GNZA 3F8NA 4WBBA 2ECCA 4LTAA 2QGUA 2BQPA 3IBMA 4IQPA 5F7UA 4WM8C 2A6EF 1ZHFA 4IKFA 3ECQA 2BGPA 4N7IA 5FJ8J 3LAJA 4NC8A 3FZ3A 3CF5F 2D3SA 4QPGC 1QJX3 1JXNA 2W2IA 1MBKA 5K4LA 2GP5A 1BBYA 4D7SA 1Z0XA 1GUIA 3O14A 2K3PA 3IZOA 3LSJA 2X29A 2LYCA 3RKYA 1KQ0A 3JSOA 2WWSA 1QJY3 3LAPA 5F04A 1WMXA 4NAOA 1WA6X 3FUQA 4ZHNA 4MEXF 2DA5A 4I0BA 2FOWA 3EQEA 1NCQA 2A05A 1XE8A 3KCYA 4AI8A 4A3EJ 4YZ5A 1QZZA 4UW3A 3JTHA 5AIPA 1NE6A 1AOYA 2WZEA 2MW8A 1REFA 4NO4A 2Y75A 1FNNA 3E6MA 1OH4A 2XPJA 5JR2A 2NVXJ 4XUOA 4KIFA 3ZGKA 4P9LA 5FK7A 2CRGA 5E18F 5CFCA 4XN3A 4QGNA 1U6GA 1PDNC 1GVJA 1WJCA 2XB5A 2OV7A 4M3BA 3NSTA 3CDLA 4BHPA 3F21A 1W36C 1APNA 1C8NA 4P9UA 3G2BA 3V65A 5F9TA 4HSTA 2JA2A 3EYIA 3A2KA 1U3EM 1V5GA 1H8VA 2WABA 1C8M3 4JGYC 2R5YA 2GC0A 1OXCA 2Q0OA 4QSHA 1TL8A 3ZYBA 3KYCB 1W4MA 1REDA 3BTAA 2KIQA 2R0QC 1W05A 3OD4A 2W48A 3ZO0B 4YZ1A 4GYIA 1WJFA 4KH9A 3ZFFC 4EN8B 1ZRCA 2COMA 4RAYA 1QY4A 4KWLA 1W7PA 4MO7A 1EKEA 2OU2A 2YBPA 2A6HF 4CDUA 1VQ7I 1PM7A 4SLIA 4P9YA 2BHYA 3THCA 4EGYA 4RR3B 3G1LA 4V19K 1W03A 4RSUA 4Y26A 1ZYBA 2ID3A 2MEV2 4YW5A 1YWKA 3I3QA 4YRVA 2HWB2 2R6QA 1N47A 1E3HA 5CFDB 3I3LA 2K9NA 3HD8B 4LG0A 2A07F 1Q8PA 3GFLA 1A78A 1UG2A 5FZ6A 4CEYC 2XHKA 4CVUA 1T56A 1DDNA 2NRAC 5CZKA 3DYOA 1G8WA 2OX0A 3H7YA 5E3LA 2R7SA 3LNQA 5DDJ2 1FATA 2BWAA 1SEUA 4O61A 4XFIA 1S4CA 5HODA 2WBKA 1W0OA 4FPJA 1FPQA 2GA1A 4FPOB 5B2GB 4Z2YA 4B1LA 4QIWN 2XJSA 3OR2C 1C3HA 2PJRB 1JHHA 4DYRA 1HN1A 2K9SA 5T5JA 1PVEA 4RQPC 2X0LA 1TZOA 4XTPA 1POV0 4QPWA 4KWJA 3IDCB 3OYBA 2C0ZA 2L01A 1W6OB 3ZX7A 2GA2A 1UOJA 1X8EA 1LPQA 2LF8A 5C3QA 1PO22 1UX6A 5IAVA 4BA6A 2NP0A 4LB5A 1CZSA 1PO11 3FX3A 4M3DA 3CJIC 2VAUA 1MZ5A 1ONAA 2XH6A 3QPLA 3I2IA 2AHQA 2Q0AA 5B1AH 2JIJA 3TEWA 5BY5A 1MDMB 4YEJA 4AFBA 1ZH5A 1HBXG 4EE2A 1BHGA 1M1EB 2RS31 1KZHA 1BA5A 3N05A 1QQP1 2IXIA 4D8MA 2PJPA 2BV4A 4XKVA 1UL9A 2DA7A 2ZGSA 1YLLA 4FPCA 2X48A 5G04L 2W94A 3G3ZA 4OMCA 1GYKA 2FSWA 1IKPA 3CDZB 3CC2I 1D4M3 5FOJB 2EIGA 2CGNA 3LFIA 3ECHA 4E8DA 2VCBA 1Z78A 1VBB1 3OOXA 3WDXA 5D8AA 1SDDB 5CQEA 4OZXA 1MMNA 4RR3C 1IS3A 1KFXL 3F22A 1IAWA 2YC2A 1Z21A 1RUD1 1HKDA 5A7WA 5FO5A 4XJUA 1F4HA 1LNSA 1OUXA 3FMQA 4G3YC 4NHLA 2DFEA 2Z5WA 1SFNA 1XCBA 4QXHA 4L9VA 1IPJA 2DMTA 1D4VB 1EAH3 3OGGA 4TSVA 4XDOA 1QO0D 4S0HB 1DZTA 3DP7A 1IXRC 4Q26A 3HBLA 2RS32 5CISA 2ZMLA 3INAA 4Y1ZA 4EN7B 2ADEA 1QXJA 5KXDA 3EYPA 2XJTA 1LHOA 2ZEXA 3SH3A 1A36A 1OCZH 5F27A 2WINB 1H2MA 4CDQB 1FWZA 2X05A 2DT5A 4BB3A 2IUWA 3UJQA 1PO23 2ZKNA 4FT8A 3DEMA 3UGGA 4CP1A 1ACCA 3UT0A 5JLVA 4FFFA 1ZREA 1B35A 1CVNA 1G9CA 2E36A 1VAMA 3A1YA 3LA3A 2P2KA 1DPUA 4KMFA 5EJ3A 3J7LA 2F4IA 1YX3A 1D0ZA 3KFWX 3BROA 1Z7LA 4WXHA 3ZQIA 2YR2A 1A6IA 2DTWA 4G7ZF 4DOUA 2OTJI 3NV1A 3ZYJB 2YU2A 2PAMA 2VNVA 2I10A 1GFF2 3RKWA 2DMUA 4QPIC 1SANA 2DFCA 4A6DA 1OF3A 2R30A 3GCWA 5FCCA 5FYMA 1UZZA 2V1UA 3I3DA 3VD9A 5K7ZA 1MIJA 4UWDA 2NZ9A 2IEKA 1B59A 4R1HA 4LOTA 2RV8A 1S0EA 2R7EB 1LB2A 2M8EA 1WVRA 1SLBA 1JYCA 2WYSA 5L3DA 4JAAA 4M4PA 5DEQA 5FZLA 1GKBA 1XX5A 1EYBA 2CTVA 1QJU2 4QPOA 5TGTA 1JU3A 3IAM2 5EIYB 2R49A 2M9HA 2ZFWA 3CDHA 1HRI1 1NA1A 4FFGA 1R4MB 3DKYA 3AMNA 2CQQA 3ESWB 1QQIA 2JWPA 2HQAA 4N53B 4QMAA 4U7BA 2BJSA 4P08A 3FMGA 1OFSA 1TQPA 4PI0A 5LD2C 2NOJB 1I27A 4XTMA 2F4OB 1SFXA 5L3EA 4O7XA 3AL0B 3MLLA 3R0AA 1VP6A 1RMU2 1VTNC 1MEC1 3K3OA 1RTVA 3CO2A 3NJYA 4M73A 4AAPA 3MKWB 1W8WA 3VKFC 2FMDA 5IP9J 3HOTA 2LUWA 3GFIA 1BI2A 1TG7A 5LA9A 4GFBA 5IOZA 1W36D 2ZPXA 4GA9A 4BQ3A 2ZKZA 2PMHA 3N9NA 3MKYB 1LDKB 2DDBA 3OYLA 3AMPA 2RS33 3OEBA 1T33A 4IEOA 2IVJA 1W8ZA 3OMYA 2RS11 2XONA 3D82A 1O4ZA 2RM22 5C70A 1N78A 2IZWA 3OSDA 1BVP1 2ZHKA 3MEXA 3HOBA 2QQUA 3VZNA 4I0AA 3JTGA 3TOAA 1RUNA 3S1NJ 5KHJA 5KK1A 4PIZA 3I4PA 2WLQA 1XU1A 3PQKA 5FMBA 4Q27A 3I55I 5FWJA 4P1WA 4DZGA 4XF1A 2QQJA 1V5FA 3KS7A 3ALQA 2O8KA 2WB1N 4RGAA 3I7DA 1FYUA 4S2DA 4IEUA 3WNLA 4Y24A 2GNBA 3GBWA 1KQ9A 2RDQA 4F8AA 2M3AA 2F5CA 3W58A 4HDVA 1Y0UA 2HJIA 2Y0MA 1OKRA 3THTA 1TNTA 3AL5A 3M4OJ 2XB0X 3V8JA 2Q2EA 4LQRA 3OYHA 4PCRA 1F2NA 3O0VA 4XLEA 1W6PB 5AFBA 3HTSB 1JZ5A 5K5QA 4D6RA 2JDHA 4AI1A 4WM8B 2VMGA 2P3YA 5GZFA 2AS5F 4MSVA 4J1WA 4C90A 4UHTA 3JUUA 1OBNA 3ACIA 1SAUA 3BWGA 2DFBA 3GHMA 3RQIA 2J22A 5DZEA 4NRMA 4FTHA 1W9SA 4ZJZA 3HHHA 1LEDA 1BLZA 3O1UA 1TBXA 1AHDP 1NAEA 4D7NA 3POWA 2ES3A 4DPNA 1MBFA 2WAEA 5JI9A 1F8VA 4IJAA 4HNUA 2BBVA 4YM2A 3N9LA 3CD6I 3P5BA 4LHKA 1XQNA 2JE9A 2CNAA 1X4OA 2A71A 1PMHX 2HU9A 4BDZA 3R4KA 1A6CA 1GT0C 4PJMA 4N0BA 3I9V2 1AXKA 1S0IA 2DCTA 2H0VA 3FXOA 3S30A 4FCYA 5FYVA 1CPMA 3FDYA 5E3OA 3IT8A 4OWRB 2V9PA 4U0YA 5M5XJ 3M3OA 1NHAA 4Y4RA 2EAKA 4IRIA 3I2JA 3VN4A 3FK6A 1E5IA 2JIGA 1RUH3 4AR2A 5FZ7A 3PIOF 4Y20A 3NWSA 2HR3A 4LKFA 2E2IJ 2ZGMA 5BOXA 1LTEA 1W5CC 2YG0A 4RFT0 4YIRX 4XDPA 5DDGA 4BJTA 2GN3A 3K48A 2BOLA 1X4PA 1RUG3 2A6TA 3KZZA 1UF2C 4QX5A 3GBFA 4OIPF 1KU2A 1QU0A 4KFCA 3JRIA 3S2WA 2PHDA 2A75A 5FLXK 4RS5A 3ZQQA 5LK7B 4NPLA 2QF7A 3CTAA 2BBAA 5JSPA 2JENA 4GCVA 3WY6A 3DPRC 5CKNA 4CCEA 2OPKA 4MO3M 2QNKA 4CDWC 5C71A 2Y34A 2HWD2 5KHDA 3FMRA 1F36A 1LEAA 4IPAA 1U12A 2WS92 4GALA 1D8JA 3HRUA 2ZACA 3KEYA 2F5VA 4ON0A 4E6KG 3V42A 4UUTA 3CCRI 5IK7A 5H9QA 4AUXA 4UFLA 5HLTA 3HUGA 1RGSA 4WV8A 2R5YB 5DM6F 2RS12 3KV6A 4XF0A 1MNEA 2DFFA 5F6FA 1ITYA 1LGNA 2M8GX 4PJ0C 1V6OA 1FP2A 4OI2A 2ZHMA 1GV9A 3E0JB 1RUG2 1W7PB 3MMYB 1W6PA 1PK6C 1WPKA 3WU2C 2VQ0A 3PNAA 3ELKA 1AHSA 4CU8A 3OYKA 5IFPA 4HT1T 1HB2A 3B69A 1W8UA 4LHSA 3O1SA 3LDBA 2I07B 1FSHA 4KI5M 1FYMA 3HT1A 1NY72 4YW2A 4RBOA 4IHVA 2Y6KA 1UMZA 3LF7A 2VH9A 3REOA 2JJ7A 1RUC3 2FBEA 5LHIA 1Y8QB 3HDDA 3NRUA 2PMZA 3DN7A 2CUFA 2VXDA 1PGW2 3H92A 4M9SA 5A3PA 2DOAA 1BMV1 1MPXA 5FK8A 1VB2A 1W8TA 3O12A 3CCJI 4NC7A 5DAVA 1NX9A 3DCFA 3RCOA 1AZDA 1DGWA 3HXLA 1YHQI 3WDWA 4A69C 2E31A 2EV6A 3TN93 1X1CA 2D5HA 1AL22 4R4ZA 3ZSJA 5L73A 5F0CA 3Q8FA 2LY1A 4HAMA 1MJAA 3VL9A 4BAYA 3DCQA 3LSIA 4JKKA 2W46A 3SKJE 4A5NA 2PI0A 4BQNA 2R7OA 4ESBA 2V1DA 3D0JA 2X1DA 4U88A 4YRDA 3WDYA 1FI2A 5KC6A 4AVBA 4IRHA 4XDQA 3ZIXA 3ZSKA 1JTZX 2GNMA 1GXQA 3CZ6A 4D5CA 1PK6A 5D21A 1ZR2A 3H5NA 3VDDC 4NB5A 1LCLA 3WDVA 1MEC2 1O8PA 3KF5A 2IP2A 1OHFA 1RUF3 2HWF1 5FZCA 5FY4A 3D0SA 3SXWA 3I4MJ 3IAPA 3HJRA 3PVNA 2EH3A 3Q3SA 1CAXA 2R061 1P8JA 5ICFA 2R93J 1ORKA 4XONA 4QPGB 4TTGA 3S2HJ 1FJLA 1D8KA 1VQ9I 3T0DA 3ZXAC 3HGYA 4UAPA 1FTTA 5DAXA 3K4JA 1F15A 1I39A 4HK9A 3ACHA 2P6TA 3M70A 1B09A 1JTYA 3WF4A 3OIOA 3LOBA 3ZKYA 4A3JJ 2OZJA 4GH4A 3AKQA 1Y56A 2FMYA 2Z5UA 4DO0A 4BMBA 5ABJC 1SFPA 1DGLA 4M9XA 4ES8A 1RB8G 4XLFA 5CJ9A 2DMPA 3JCUC 2GC3A 1LJ9A 5CA6A 4P00B 5KC5A 2DTYA 4CDQC 4QPIB 2J5OA 1TTYA 2W1SA 5CVIA 2I45A 1E0EA 2D6KA 1JOBA 1BR4A 5KAFC 3HN1A 3NARA 3I8TA 2R7WA 2GN7A 2ZTNA 3S3MA 4GXLA 2XF6A 2JDKA 3N7KA 4DB5A 4A3BJ 3RVHA 5DUUA 2PFWA 5H9PA 2G7UA 3A4UA 5FZ0A 3VBFB 4L0PA 4EJRA 1QJU1 4CE8A 1TLHB 4D94A 4LKDA 1A8MA 4PJNA 3RWKX 2XHNA 5GLUA 3BVCA 3TO7A 2ARXA 3E6BA 2VODA 3L2HA 1BW5A 1W2NA 1S6LA 1O4XA 5JZGC 4HANA 5GLTA 2MEV3 1BVVA 3K77A 1WJ5A 4R9BA 2HYKA 4XRSA 4BZ4A 3H8UA 3S17J 4HPQA 5C5TA 2QZ2A 4YELA 3MCZA 1FBSA 1AR93 3RZHA 5LASA 1MZ6A 3NVCA 1DYKA 5FPZA 1MW7A 1CAVB 3NO8A 1PVXA 2UXXA 2WT1A 4TZDA 2E1NA 4DZPA 3NQHA 5J36A 3KV4A 4KITB 1GWKA 1OR7A 3BB6A 3HEFA 1U5XA 4KWKA 2E51A 3T1MA 3F8BA 4H7LA 4E70A 1VQMI 2LBFA 4YIIA 2IA0A 2GMEA 4OMZA 5DUKA 2OBPA 3N4MA 3HKZN 5L3GA 2OPWA 1P4WA 2WL1A 4CU6A 3SQOA 2BXYA 4FQ4A 3HSFA 2XVCA 2VECA 1QHDA 4DXTA 5FDBA 3WW2A 4NIIA 1VZ0A 3MHZA 1WCUA 3G7DA 2F4MB 3KLNA 1SLLA 3F72A 4JQTA 2EPFA 5FXZA 3BCAA 4JGYA 1DDLA 4BWOA 2YFUA 1ZTRA 1XYOA 1ZZCA 5FWEA 4Q4X1 1QQP3 4XABA 5AFEA 5EFUA 3WW4A 3UK9A 3U2RA 4AQ2A 4L5JA 4UYBA 2WNUC 1W0PA 3ZN6A 3N9QA 4XUQA 2VVDA 3WTWC 1YE9A 1HQLA 1O57A 1X9PA 3VBSA 1P7JA 3CUQA 3KLSA 1H0BA 3ZMOA 3MIGA 3LIHA 1I50J 2ZGNA 1S0DA 3KGLA 2WY7Q 2X1EA 1N3PA 4LUMA 4E7ZA 2BV6A 3C3WA 2C9KA 2XF5A 5HXMA 1J59A 3CKHA 2Y2ZA 5LEJA 4BE3A 1SHWB 4HG6B 2VVFA 4N43A 3DKXA 1S1AA 3QYEA 4AHYA 3ZYPA 5EEGA 2A61A 1LOEA 3GZ6A 1T2KA 3SJMA 1VMFA 4GB32 1SMVA 2F5DA 2C1FA 2GBYA 3MVPA 1OR7C 4NHXA 2WFPA 3O1TA 1LODA 1S0CA 1OMIA 1AR92 1T2XA 4YVSA 2VULA 4AAXA 1VBC2 3B73A 1LEMA 3K4BA 1RUJ2 2ZGPA 3W2AA 2PG4A 5C3EJ 2WYFA 5KWRA 5IP6A 5K9YA 5I8SA 1HRV1 4FQZA 3L2UA 4W4ZA 2QLZA 3BY6A 3RQ4A 2NVUB 3HOYJ 1K3IA 1Y0NA 1YFWA 2YDEA 2RS51 2GMMA 4KISA 4U87A 3TW7A 3SFIA 4OIRF 4IL7A 2ZABA 4DYCA 3WU1B 2VMFA 1XMAA 2H0BA 2XR4A 1DGWX 4L99A 4AF9A 5IUQA 5E8AA 2TBVA 1SVMA 2JT1A 1B8IB 2R5ZB 2AYHA 2O1QA 3QRFF 5LA0A 3IMMA 3WG1A 5IVVA 3OYIA 2VJXA 2XLFA 3TGNA 3WGIA 3GYHX 4IO9F 4AOCA 5C9AA 3R4SA 4HXCA 1QDCA 4PIYA 4HBNA 1XE7A 4Q4V2 3VBUB 4JX5A 2QKMB 4L9JA 3CUOA 1W0TA 2X10A 1IV6A 4LE4A 2AO9A 1AVBA 4Y15A 4G6QA 1AXYA 2VNGA 2K9ZA 4HPKA 1OPMA 1R00A 2WNVA 1VAVA 1YYVA 2BE5F 2QSHX 3AYAA 3GBGA 3MLJA 1ZRDA 5FYCA 4IGQA 1OD3A 2IWGB 2W91A 2R063 2AENA 1CD3G 3L9JT 1H2LA 2ZNYA 4AZZA 4Y22A 2W1OA 1UU6A 2BEOA 3NQOA 3L2RA 2WA3A 3FXQA 5LRRA 2WA4A 2XJQA 4BXFA 1B9MA 2HQ5A 4UNOA 5ED4A 2A6WA 2QCOA 1PUFB 1ZR4A 5FKNA 2W1WA 3WG2A 3QYFA 4W97A 4CA9A 1RI7A 1AYM2 3ZQ7A 4MGIE 3T30A 2QQLA 2D2WA 2FE3A 2HWD3 1W2AX 1Y9QA 1CZTA 1UHWA 2JPBA 2MG4A 1JYIA 4C0HA 3HNMA 1TQ5A 2O14A 5C7GA 4Q5OA 3QPHA 3WG7H 5L19A 2D6LX 4XQFA 2UV1A 4AEMA 4RHV2 5T5OA 4LJHA 5D6EA 3ABMH 4G4FA 2HWE1 4RB2C 5BNOB 1TWAJ 1GU3A 3WSOA 3RGBA 1I1EA 3NAPB 2B9SA 2VZOA 3USUB 2VMHA 5FKBA 1HXDA 1GZWB 4AI3A 1GP5A 3J7ZI 1OFNA 1W6QB 2ZJ2A 5A7QA 3T4VA 2J1TA 1FX7A 1ULDA 3HOWJ 2D44A 2FCTA 3Q8BA 1SZBA 2CQXA 3Q5FA 2Y9ZA 2OA4A 4P9JA 1BKZA 5IFTA 3VBOB 4UW4A 4QWQA 3H36A 4E7HA 1JZ2A 4QDQA 3B02A 2IA2A 3RMYA 2Q8CA 5FZFA 1HV1A 5K7PA 1DUXC 4X6AJ 3GCXA 3R0RA 1OSGA 1K5MA 3BZCA 2RNJA 2ZMNA 3VDXA 2Y6FA 3ZMZA 1XJAA 5JIAA 3OG2A 1OI6A 2ZEZA 3KZ4C 1FP1D 4Y33A 4N53C 3KD4A 1SCRA 1C8M1 2JA7J 4QPYA 3F8CA 1S0GA 1I6XA 1XNTA 4PDWA 1OLQA 4YLZA 3ZXSA 1K42A 4R9CA 5CKQA 1N1YA 4WF2A 3J4UH 1SLIA 2A6YA 3BR6A 5KXCA 1LUJB 3PFIA 1FC3A 1J1TA 1W9YA 4FPGA 1QHGA 4F7ZA 3KYLA 3S1RJ 5CYVA 1R58A 1HRV2 4QT6A 4BLJA 5HS8A 5C8CC 3CJIA 5FRAA 3JW4A 2X6OA 3Q8CA 4C2UA 3T2OA 4E2QA 4B48A 4IEWA 4XNFA 2G9FA 1X7NA 2OAZA 2FD5A 4AQSA 4SBVA 4EMSA 3H8RA 4G9YA 5BYNA 1G3WA 2BXZA 2AREA 1OYWA 4WM7A 4UB6C 3P7NA 3ZXFA 1JOPA 4Q4Y2 4H4KC 1AUYA 1KFUL 4MHUA 4XFBA 1EPZA 4JX0A 4KYWA 3VODA 1FV2A 1YTYA 2H6BA 5AC92 3S93A 4YM0A 5M3MJ 2DV9A 3DPRA 2JWTA 1FYLA 1FSEA 3TRSB 5GZGA 4IHTA 4BU2A 2VJ5A 1NK3P 1XGSA 3D5LA 5E79C 4PJLA 2HOSA 1NA1C 2WNUA 1V4RA 2X5IC 3LEKA 2GH2A 1K5MB 5JOZA 2QQKA 1Q8OA 3Q0WA 1U9OA 4JRLA 3WNMA 1XS9A 3BC8A 2PN6A 4QXCA 3ZFEA 3ZXLA 3J9SA 2O03A 2NYYA 2O8QA 4W65A 5JOWA 5IVYA 3AG3H 3N7JA 3B5LB 5DUVA 2ARCA 1QIQA 3MI8A 2R4GA 1ETXA 4JHTA 3LSEA 4II3A 4LIUA 2ET7A 1N1TA 5C8WA 2WLPA 5E8IA 3KHBA 3CCSI 3AXDA 3PVOA 2LY9A 2VCCA 1HQCA 5FO7B 2QDNA 2W1QA 1W8OA 4EATA 3OYWB 1IG0A 2QBXA 3M9AA 3A03A 4GJYA 4J6GA 4XLPF 1T95A 2VKHA 5BNOA 2NVQJ 4GWIA 5J8FA 1MNDA 4CCJA 3JREA 1MMSA 2OXBA 2XAJA 3ZXJA 4KBZA 1HKTA 2B45X 5IYYA 4BHBA 4M9ZA 1C1FA 3FXLA 1XB9A 3CCVI 2EA7A 4HZFA 3GM8A 1OKOA 1HIXA 4IGOA 5IT6A 5EP9A 4Y52J 5FRMA 5L7OA 3CCLI 5CG9A 1O3QA 4R8HA 1VIWB 3FBNB 3JB4C 4E7JA 1QOOA 3DBHB 2DTZA 3MKZA 1MS0A 4BH9A 3WW1A 3K1MA 3P9CA 3HOZJ 2Q8EA 1R22A 3WR0A 2HOTA 4XBFA 3MBWA 2WO2A 1QJU3 2D3RA 5DDJ1 5E17F 5C3SA 3MWMA 4HNVA 1ZLKA 2P17A 1OLTA 1RHI3 1SLAA 4AE2A 2ZGQA 4A45A 2NNYA 3JD71 2EIJH 4XK4A 1L3JA 2HVSA 5FYBA 4NDLA 4AIHA 1OCOH 5ABJB 1G2HA 2VCAA 2M0CA 4UV9A 2JICA 1F31A 3A02A 3KMHA 2R1BA 5C4WC 5EV7A 5IHRA 2IBDA 1V6LA 4AM3A 4XHBA 4FO9A 1S2EA 1PK6B 2DQRA 2OKXA 5L3BA 3PTRB 1TWCJ 2XBO3 1ZBA3 4QX2A 2MC4A 5HV0A 4A44A 1RUE2 2DXIA 1YJWI 4B47A 5JOXA 3RMXA 3VFZA 4JDOA 1CAUB 2QDRA 5DM7F 5J40A 2D7FA 1RJ8A 2MPFA 3POJA 2KA3A 3VGIA 3UV9A 4GDFA 1UG0A 1UIKA 4YYOA 4L8QA 3WF0A 1GNYA 2ORZA 4GKYA 3FKJA 3BR1A 5D4RA 1YHFA 2V79A 4NR1A 5FXWA 2XG3A 3BDDA 5CG8A 4BQQA 1UZYA 3MD2A 4QKNA 1OA2A 4A3FJ 5JI7A 4CDQA 5DYMA 2VO5A 4HBLA 4ZYDA 2IXHA 4IV3C 4Q4Y1 3WP4A 1HA8A 4ZXKA 2O6GE 4D6QA 3IN9A 5DV5A 4KT6A 5E3NA 1QVUA 2MGQA 2DCZA 3I64A 2XB6C 2VB6A 2AEYA 4YG2F 5A80A 3HAGA 4HONA 2OC6A 4HMZA 4IE6A 3OB8A 3VBRB 3MUZ1 5FLVA 1LHUA 4XR6A 2D43A 2FDGA 3D1NI 5TISC 1U5IA 3AVRA 5ABJA 1I3QJ 2L7KA 3U14A 4NHMA 4DRVA 4K40A 1MS3A 1JYXA 2EXKA 4UFMA 4LE3A 5CEHA 4QKFA 2B63J 4QQPA 3ZN4A 1YJKA 2ZAHA 3WQ7A 4HFSA 2LLKA 2HTJA 2HZDA 3JQXA 2XWBB 1RKWA 2FNPA 5A1FA 3KV5A 2XMLA 1YQ5A 2COBA 1W8HA 4UUVA 2D6PA 1X36A 3GX4X 3HPNA 3EXUA 3ZFGA 4XQ4A 1UW8A 1RMU1 4Z1VA 3OY8A 1HJFA 4QX3A 2RR13 4A3GJ 5FXXA 1D0GA 2JVGA 1UELB 4AG4A 4KG8A 3QAHA 3ECOA 3BGAA 1RUF2 1HC8A 5L7OB 4HF2A 2F17A 3OJBA 1C5IA 1BL0A 4EJVA 4B4QA 2M1BA 1Y1VJ 1WFXA 5LEKA 3QODA 2EIBA 3ILNA 4L9BA 2RNGA 2VZ3A 1US3A 3GMEA 4MADA 4LLLA 4YW6A 5FD6A 3KP7A 4OIQF 5F3CA 2NOGA 2QM3A 5HV4A 1GBGA 2DLLA 3T08A 2V1XA 4Q4V3 5B66C 2ZGKA 2R7RA 5A33B 4LHLA 3I3MA 3FN9A 4XHXA 4CCKA 1IV8A 4Q4X2 5FKCA 3VBHB 1HXS3 4DEQA 3OYWA 3DWLE 3O7OA 2ISZA 2R7FA 1YQAA 1T6BX 1JH5A 2J1SA 2OUMA 1CAVA 4AXOA 4CZSA 3KEOA 1BM9A 3PSIA 4QGLA 3ES4A 3AJZA 2C6YA 2FQ3A 3OGVA 1RUI1 4HX4A 4KU8A 2IJLA 2HYJA 5HOOA 1YEWA 3S1MJ 2A6XA 4AEKA 4YW7A 3MQ0A 1DYOA 2HWC3 2XL7A 4XAEA 4ZKTB 2Y6LA 1XSQA 4YFZA 1OQYA 5JLXA 2IXJA 1KITA 1FMVA 3NJXA 1CQTA 4XVHA 1IW7F 5DD8A 2BRTA 4OVEA 1JT0A 4OIOF 5FBZA 2GWRA 5EG0B 2YZ4A 3RWNA 4DYQA 1ZGAA 2R072 3GXUA 1HRI2 3ABUA 4KICA 2HDCA 2DN0A 2AC1A 1TME2 2EK5A 3WGGA 5F37A 3VOEA 4I99C 2IFWA 3BU0A 1SLTA 5K7HA 1D0XA 1ZG3A 3A4CA 3IKVA 1K12A 5JVVA 4LLFA 5ILUA 4NPRA 1JZ4A 5DG2A 2DURA 3CZJA 2DW4A 1FOWA 2X4HA 1EF4A 4A7YA 4UFIA 1VPHA 1IUYA 4XPVA 2EXHA 2QKDA 2CQ7A 1MS1A 1NCQC 2CU5A 3OYEA 1N25A 2R7DA 2STWA 4CCCA 3JBG3 2XIGA 1CIWA 4XQWA 4BJ5C 3IL2A 4Q48A 3OYGA 1H9PA 2LOOA 1H1AA 3BR3A 3VHNA 1QBJA 4FVVA 3FISA 4G9SB 3T0BA 3CCEI 3PO3J 5AVPA 3ZYGA 5M0TA 2NVYJ 2VBDA 4Q4X3 3RKQA 1UZVA 4LFUA 1SACA 4NQWA 3FF5A 2DU9A 1XNKA 3WHUA 1SDWA 4HLXA 4PDWB 3KT4A 2WZR2 4E7KA 2E19A 1AJOA 4N4OB 1AL0G 3GZTB 3POGA 1JZ3A 5HXVA 4U0VA 2VXJA 5H9SA 4LITA 3WCRA 4IETA 2YGMA 2E7WA 1YIPA 3C7JA 5FY8A 2XPVA 1FMD1 3AMHA 3AZXA 2PHRA 3FHAA 1RIOH 3MPPG 4UBHA 1G9FA 2FU4A 2VW1A 2OCEA 4CYCB 3OY9A 1T39A 5FPLA 5FZGA 5D5VB 1X1AA 3H9GA 5FPXA 2L0KA 3VBRC 2XL9A 2CS3A 1GUUA 4XLCA 5FQ0B 3USUA 2ACJA 2VMCA 4MXWB 1LDDA 2ZFUA 2HWF2 4Y1UA 4AIKA 1W2OA 5FZ3A 2X1CA 3EMRA 4QQLA 2V4JC 3WQBA 3L09A 2DCKA 4ABZA 1I3AA 2E1MB 1JU4A 3AM2A 1WLDA 4OHWA 3POBA 5I0SA 2CSGA 5LRSA 3OPZA 2IRFG 4Y1XA 1KA8A 4RAZA 2J5PA 3S5QA 4RHV1 1E5RA 3AL6A 1UY2A 2VZ1A 4PZJA 2C9AA 1QWRA 1JOJA 1GLHA 1N3QA 2VQLA 3NKGA 3POYA 1TMF3 2QJVA 3NV3A 1R5HA 3SMHA 5JZGA 3APBA 4LNVA 4ENKA 3AFKA 2DAOA 1IN6A 4DQ2A 4B09A 4OHZA 4JC1A 1O7FA 1MJ9A 2E34A 2VGDA 2X5IA 1YFHA 5LBCA 3UETA 3ZYHA 3T2QA 5F6KA 1H8TA 3M8FA 2CYFA 1A6QA 5GZDA 4PCQA 2BDRA 2WNVC 3W20A 3KQ4B 1FOKA 1K5JA 1R1A3 5B5EC 2EWNA 2RM21 2KJCA 4MFDA 4IV3B 2GIVA 3BJAA 1QJZA 2DVGA 3ZMTA 3FXJA 4XLHA 1OLRA 1J9IA 4TLGA 2LR8A 3T0AA 2YUEA 5D8LB 2HOAA 5H20A 1W28A 4NWWA 1EH7A 4U36A 1PP7U 3I3BA 4BNCA 1XOYA 2AUYA 4FX0A 4BY7J 1YITI 2JN6A 4EZHA 2WQ4A 1ERDA 4LKSA 1D7PM 1NXD1 3K1NA 1R5GA 1NOVA 1EUTA 2VASA 2CWMA 3GFJA 3UYJA 2L5QA 1VQ6I 4IOCF 4GMP1 3DEWA 1W2UA 5LGNA 1FEXA 4M3CF 3B6AA 1G9AA 2QTWB 4RHV3 2DPDA 1OQ1A 5I0TA 1MS4A 3V56A 4XUTA 1OQDA 4AIJA 4UFJA 2WS91 4M0NA 3SYTA 4O9GA 3JRDA 3SH4A 5BNPB 4RMNA 4AI2A 3A0KA 2R92J 3HNBM 3P9IA 2KPMA 4EWEA 3ZQGA 1VBA1 1XDUA 2GDFA 1W9TA 1ENRA 2Y6HA 5FZ4A 4GIQA 3OUIA 1ASJ3 2OUJA 4Y20B 3BTCA 1TT0A 3U78A 3ZYRA 3X29B 3GTQJ 2E5ZA 1D4M1 4JTNA 3BIEA 1DQ4A 1S55A 2ZXIA 2JA5J 3SISA 1MZEA 5M5WJ 3ZSMA 1KD7A 3BR5A 5LCWL 3NMBA 1HSJA 2KIFA 2J1VA 2RVAA 5E88A 4KDPA 3CUQC 3IPVB 3Q8EA 3OYNA 4N9IA 2M5WA 4DNCA 5LLQA 3CCYA 1HDPA 4AGGA 1ZGWA 1KS4A 1RL3A 3OS1A 3TMOA 4ZU7A 4JCKA 4NWVA 3OL3A 3T0YA 2WO7A 3O1MA 1XE0A 3CJRB 1CJDA 3LWCA 1ND2B 3ILFA 2CH0A 3AAFA 1N3OA 2HBTA 1QKQA 2OQ7A 3D6EA 1QMJA 4CEYA 1VBE1 1RR8C 3E5UA 1OPCA 3LGRA 5FYTA 1M06G 3I56I 2FCUA 5IY5H 2TDXA 1L7RA 4Q2FA 2OYZA 3FKIJ 2QQIA 3BPXA 4IV1A 5A3LA 1MDMA 3CF2A 3J8F3 2VOVA 5GADJ 4YARA 1PO21 1TME3 4YG3A 1VBD2 2Q2EB 4XLAA 1R36A 2NNNA 2W25A 1ZQ3P 1IPKA 2WWYA 2WRAA 2ZXQA 3VD7A 2EF6A 2B7EA 2PMUA 2IVMA 1LECA 1W2TA 2LBFB 1P6RA 1Z6RA 3OSGA 1UMHA 3VUOA 4UW6A 4HVOA 1U5TB 2VKEA 5FD5A 4COWA 1YW8A 1QQP2 1Q56A 4ITVA 3QOEA 1TMF1 5LWBA 1JUHA 3RI9A 3DXUA 1HW1A 3J81Z 1F9NA 1COV2 4YZ3A 4ES9A 2AR6A 3N9OA 1R71A 5IVBA 1Z7S1 1DQUA 3KX2A 3NRVA 3H9JA 2R7ZJ 1AYN2 5DDJ3 4NJ4A 1R081 1XSDA 4EWDA 1R1TA 4TLFA 1NLQA 5GLWA 3WTTC 2M7AA 3VBFA 1DP3A 3VV1A 2CWSA 1ZBE1 4F93B 4XFFA 4FTSA 3VYUB 5IVEA 3Q9OA 2ZHNA 2P3KA 3IDEA 1QPMA 3GLXA 4LG3A 3GTPJ 3BG6A 2KMUA 4P96A 1W90A 2ZSHB 2HEVF 4K9SA 3DU6A 5FBJA 3HQXA 4BHCA 2CV0A 3IUOA 1ETKA 3N36A 4HN0A 1IF1A 2QSFX 1MMGA 4UF0B 4KWUA 1YJNI 5FY0A 1Z0HA 2BVLA 3UGFA 1TNFA 3AKPA 2PTMA 4KIGA 4GH4C 1GMMA 5LY1A 3EQLF 3VHPA 2JG8A 1UZ0A 4XBLA 4A4AA 4P55A 2DJNA 3R4UA 1IKQA 2KRCA 2D5VA 4Q4W2 3T1LA 4AW7A 3WQ0A 4YGCA 3LSKA 2VOPA 1USSA 2VUAA 1IC8A 1VBD3 2ZKLA 4R79A 2E2JJ 3HB9A 5EYXA 1KQRA 2X6WA 4AU7A 1GSLA 1YJ9I 1KXGA 2HTSA 3I97A 1D5YA 1RUJ1 2WQ8A 1OFCX 1CAXB 1M4WA 2YPRA 4ISQA 1UXXX 2ELKA 3VKNA 4XFCA 1QH6A 1S0JA 3TOBA 1AYM3 5C44J 3PMEA 4UFHA 3CJXA 3K4DA 4S2FA 3WNPA 4D7MA 1V9U1 4CCLA 1DLLA 5FR3A 4JZRA 5TJJA 2LREA 2MD0A 5CQGA 4ZYGA 5CFDC 3S32A 2ORXA 4CCDA 5IK4A 5K7FA 4A7KA 4MXVA 2G4IA 5GPCA 3M3IA 1S2BA 1HOMA 4EZ4A 2PXJA 1Q1VA 2ESHA 3TAYA 3SEZA 3IWZA 4IHYA 4OUSA 4JBAA 3LSMA 4M3CE 2L02A 2M4KA 2RGVA 1REEA 4CEWA 1RYYA 4KNYA 1DZRA 3OYCA 4C91A 1WCKA 5H9RA 1FOYA 2RDNA 2FDKA 2YBKA 1XTAA 3I53A 1ND3B 2RAEA 4B4RA 2RC4A 1HW2A 4IERA 5KCMA 1EV13 2K85A 1Y9GA 4UUSB 3DL3A 1RUE3 2YMZA 1F5JA 4YW3A 3NW4A 1F43A 2VMIA 4BACA 2IS2A 1GXPA 1SPPA 5J7MA 4MNUA 1K61A 2R7XA 3J8F1 4CXWA 2ZMKA 2G9GA 2K86A 4L5EA 1SCSA 3H9QA 2P5BA 2FMLA 3ZFEC 4XJ8A 4LB6B 4XIDA 5HBAA 1U9NA 2MYSA 4AL9A 1OPOA 1TWFJ 1KYZA 2XAFA 1ULOA 4M4RA 4NPMA 5FPAA 1DHKB 5DQ0A 4BQXA 1F4KA 2JE7A 2B8MA 1K6YA 2E35A 3URFA 2ETHA 3O1OA 3SC7X 5A7PA 1W6NA 3OTFA 2D45A 2V5YA 5FZHA 3G6EI 1PVC3 1NG0A 1GZTA 2GNDA 4ZYAA 3ERED 3M3YJ 2HWB3 5BNPC 2XRNA 1ZA7A 4J19A 1TE1B 4PLNA 1J75A 2HDDA 1VQ5I 2WT0A 3WINE 2QE3A 4RGGA 1VBC3 2XLAA 2KIUA 4A6EA 4QXKA 3OGSA 1VI0A 4H0EA 2IXSA 3HPGA 5GTIC 4I30A 4LO4B 3R4DB 4FFIA 3GTKJ 1GNHA 1MGTA 1PIV1 2X9DA 1D1AA 4CTEA 5E3MA 1RMU3 2IT0A 4ASKA 1JHFA 1LOFA 4QPQA 4G7HF 3OV8A 3EUHC 1WMFA 1LRHA 1ZG1A 5K0UB 5CKTA 3T5XA 1J84A 4HPKB 1J2XA 5BUVA 4UF0A 4P5HA 4BXUA 5IAXA 3AZZA 1JGSA 1O7LA 2VKVA 3L7WA 2KRFA 3AB0A 2ISYA 4OINF 1OCRH 9ANTA 4ZDPA 2E1MC 2X53S 1PVC2 4NHKA 2XKOA 3TP3A 1B8IA 2Q30A 1NH3A 3U4XA 5LY2A 1B4AA 1RZ4A 1LOFC 1XBFA 3VZOA 2CSOA 2XVLA 3KB5A 4MGYE 3G1MA 5A6QA 2VL4A 2DVFA 1BC7C 4RL7A 1C57A 1YI9A 4MHGA 4H3WA 2UY8A 3CMAI 4L11A 4RS5B 4IGPA 1ACIA 1JYTA 2OUHA 2LC2A 5GAHJ 2C24A 2CUJA 3H5AA 2EIDA 4BIOA 5IVFA 1BBT3 1RUI3 4BE0A 5A6ZA 5GKAC 4LMYA 3V4GA 2JECA 1OH3A 4L97A 2P5VA 2VPLA 2CUZA 1S29A 4ENJA 4RM2A 1PMJX 2EXJA 5B4NA 5JSRA 1G8XA 5FLIA 1Q5OA 5LA2A 1W39A 5IT9Z 2L9LA 2R073 1OYIA 1V5EA 3PNVA 4C2TA 5LGTA 1SD7A 3NV2A 2R7QA 3ZQLA 3THPA 3GZUC 4XQDA 2XJPA 3W5MA 2VLAA 2VZRA 5EQUA 1AKHB 2FZ1A 4UOJA 3TBIA 4A0ZA 4FETA 1VQ8I 3RI8A 2VXZA 1XG1A 1EA3A 4OULA 2LMDA 2P1BA 2ZGUA 1JN2P 2Q4SA 2OT7A 5AVAA 2CL2A 3O1VA 3HZJA 3VDCA 4XF9A 5SV8A 5A2QK 1PNGA 3ZKUA 4GD4A 3TOJA 3PUAA 2EFQA 3ZN6B 2WAQN 2KRHA 3G6JB 4CO8A 1DGWY 1Z67A 4PSWA 2EVXA 3J7HA 1BK0A 3KT7A 3D3AA 4ZZLA 2LROA 4MYEA 2C5DA 2TNFA 1R1VA 1P92A 1VMJA 1FOD3 5JXHA 3TDZC 2VPRA 2WADA 2LRPA 4N8MA 3WEZA 3GTMJ 3BOWA 1YQ2A 2FJ1A 2OPTA 1PGL2 3GJAA 3TP0A 2WO3A 2UWCA 1ZZ8A 3ZVXA 5CBLA 2QQAA 4PLOA 3WTVC 2A3SA 4AVPA 3AP7A 4ASMB 2B39A 1ZZBA 3GTOJ 2DFIA 3QP5A 1DP0A 1ND2A 2IGOA 2HEWF 1VQPI 4LMFA 3RNSA 3FXKA 2IPQX 2K9LA 3VYRB 4Q0SA 3DQVC 5D5UB 4DZJA 3L1PA 1FBUA 1RJ7A 1OVPA 1WJEA 1XC5A 5FKOA 2UU8A 2Y0IA 1JJ8C 1P4AA 3RYKA 1UPSA 1D3YA 1NCQB 1XNAA 2NMNA 3DKWA 4DBQA 1H88C 1OJLA 4MZUA 3TEZA 5T5PA 4DXRA 1ZAOA 4PIXA 4AVSA 2BP6A 1FXZA 3GW2A 2PLYA 1X3ZB 4RGXA 4EROA 3JZVA 4NMIA 4BEHB 2MNGA 3MIBA 4RA0A 3QWLA 2PELA 3FE5A 1NG6A 2CAUA 3M2MA 3VZKA 1Y4WA 4ARXA 3H50A 4K8FA 3ZDVA 3BG5A 1US2A 5I0UA 5JI6A 3KEQA 3VYTB 3L2WA 3A21A 5E1ZB 1A35A 4MEYF 5E89A 4A0YA 1CAUA 4BQWA 3ASNH 4UW5A 1EP0A 2WV0A 1U5ZA 4P9GA 3BI3A 3V0BB 2JB8A 1FOD1 4CCNA 4YVWB 1H2KA 2VZPA 3VDDB 5LATA 2VM9A 1MBHA 2A68F 3KQRA 3K75B 4UVCA 2BOIA 2KM2A 4GZ9A 2XLGA 1PNFA 4BK5A 3FXUA 1X1BA 1SMTA 3FUOA 2ZAAA 2VBWA 3VWBA 1IN5A 5M5YJ 5A3UA 3ZSEA 4B43A 1F4AA 4LBQB 4HN1A 3VD3A 4AGRA 1YFUA 1UPIA 4BUPA 1NA1B 1R1A1 1OF4A 1WJAA 3CU7A 2W24A 3MIEA 1YLFA 2V4VA 5A2QZ 2BZDA 1KGSA 3K2ZA 2PHWA 3HJEA 3VSKA 4XILA 4CCMA 1FIAA 4MV2A 1ONVA 1H6YA 3PDQA 1WCQA 1GWLA 3PUSA 5FFXA 2JDYA 4P9IA 3K4NA 1TWHJ 4NIGA 4QAWA 2CV6A 2YV8A 5BNNA 1WSUA 5F1RA 3RTRA 5BPXA 3B01A 4HW0A 3OYMA 4ZTJA 3GALA 1XDSA 3RYRA 1YI2I 3VLBB 1SG3A 4COVA 4Y7NJ 3WUCA 4B44A 2BNNA 5SV5A 3WLUA 4NIDA 1Y3TA 5A6YA 3AYDA 2O5RA 5KBFA 3T3YA 1CPNA 1GV5A 4MXWA 1XPWA 2JB4A 1LU2A 3PMSA 3LPFA 1JBCA 2LK2A 1UNBA 3H35A 1HXS1 3RSJA 2YY1A 4N90A 1AR62 4AIDA 2IS1A 1NY71 2KXLA 4IEZA 2WAOA 3NAUA 4LA3A 1DQ5A 5JFRA 1QH7A 4HX8A 4EJUA 4JQFA 2IVIB 5A32B 2ZB9A 4HVRA 1D0YA 3VHOA 2XROA 4TYSA 4A3MJ 3AMQA 4HOOA 5KXEA 1LVAA 2DA4A 2ZBKA 4P9FA 1PYVA 3JRCA 2WZR3 2B9UA 1RUF1 1W0NA 4P14A 2DVDA 2E5NA 4QU1A 2V7FA 5D8AB 5AC91 3DPRB 3VZJA 4E4SA 2KKOA 4C3IJ 5IWFA 4S04A 2B7YA 2XRLA 3H0OA 1ASJ2 5GZCA 1Z6TA 1ZM1A 2D6OX 4EM1A 2VXRA 3D4KA 3NNFA 1DP7P 1IJWC 1W99A 5A7WB 4CP9A 1B72B 3I4NJ 4M74A 5DCMB 1SFOJ 3LQCA 1XB4A 2B0LA 1QPIA 1X82A 3B9IA 2R32A 3DFGA 5DCFA 1CGPA 4BL0B 3U37A 3HGGA 2EFNA 1ZK8A 2Q8DA 3GZ5A 4A3IJ 3WU0A 4DOZA 2ZX2A 4F91B 3DLLF 3F0CA 3SNMA 3QU6A 1BK1A 1K78B 1O3RA 5ERIA 4PJJA 3D8CA 2LTNA 3J7MA 1G86A 3LQRA 3TEXA 2DA2A 1BJAA 4IEYA 3FWEA 1HKQA 1CIYA 1BEV3 1KONA 2IGKA 4CZZA 5BV6A 1FZPB 5KR7A 2VW0A 4Y3OA 3IAS2 5EG0A 2VZQA 1JXSA 2F6BA 3JSPA 4RB1A 2HDWA 2O3FA 1OA3A 1IS6A 4QQHA 2Y0SN 2OJED 3ORJA 2RREA 2F2EA 3OS2A 2HQRA 1TNRA 1UAIA 4NN0A 4XM3A 2R042 3LPGA 2DOEA 4CUAA 3WGHA 3BR2A 2FRHA 4QKDA 4WXDA 4NAMA 1W1WE 3N3HA 4W6YA 2ICWG 1S7AA 4FE4A 3T09A 1JODA 4META 2QUFA 2OZ6A 3QOPA 1AWCA 5F0FA 3JD72 2ZX3A 2L4MA 4HSJA 4PF5A 3RZLA 1V6JA 2ILMA 4RDUA 1LVKA 1J7KA 4Z07A 2BY0A 4ENMA