3DV8A

Crystal structure of a putative transcriptional regulator of the crp/fnr family (eubrec_1222) from eubacterium rectale atcc 33656 at 2.55 a resolution
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
216
structure length
216
Chain Sequence
ENYFPLWNDLNTAQKKLISDNLITQHVKKGTIIHNGNMDCTGLLLVKSGQLRTYILSDEGREITLYRLFDMDMCLLSASCIMRSIQFEVTIEAEKDTDLWIIPAEIYKGIMKDSAPVANYTNELMATRFSDVMWLIEQIMWKSLDKRVASFLLEETSIEGTNELKITHETIANHLGSHREVITRMLRYFQVEGLVKLSRGKITILDSKRLETLQRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of transcriptional regulator, Crp/Fnr family (RER070207001219) from Eubacterium rectale at 2.55 A resolution
rcsb
source organism Eubacterium rectale atcc 33656
molecule tags Transcription
molecule keywords transcriptional regulator, Crp/Fnr family
total genus 63
structure length 216
sequence length 216
ec nomenclature
pdb deposition date 2008-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3dv8A02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3dv8A01
4UXNA 1IN7A 2A3SA 1H1MA 2A69F 4P9FA 3H7JA 4B29A 3VOEA 1IN5A 5FLXK 4GYGA 2KIMA 3F3XA 3LFKA 5TJJA 5JR3A 3T5XA 1CAVB 1UB9A 3I59A 2VQAA 2ZKLA 2DW4A 2IA2A 2Z5UA 3I59B 1OD5A 1ULYA 3SCGA 4WWCA 3SCHA 4XFIA 4IHSA 4AIJA 2EA2A 1RIOH 3GLXA 3GYHX 1HBXG 1FSEA 1D5VA 3NL1A 4MNUA 4L5JA 3DKWA 4O3MA 2GU9A 4LFUA 2IXIA 2FBKA 1OFNA 4L5IA 1FBSA 5D4SA 4P5OA 1I1SA 2FNAA 1MJ9A 5FB2A 2B5HA 4U0YA 2ET7A 1P4AA 4LLGF 4J1WA 3DPLC 2F5EA 3GZ6A 2V9VA 2R7FA 2XUBA 4ASNA 4MHGA 4BHBA 1YHFA 2VN2A 4EWDA 1SD6A 5H6QA 4LK1F 1YS6A 3ZQ7A 4ETSA 3RJPA 4JV4A 2EV6A 1NE6A 4TLFA 3M3IA 3GFMA 1ZN2A 2D40A 2ETEA 4LG0A 3IRRA 3E6BA 5FPXA 1BBYA 5FGMA 4M6XA 3WTZA 3M8FA 3HTUA 5HOOA 5HVQC 2QCSB 5FCCA 3KP5A 1R36A 4MQ9F 1Z91A 1QZYA 1QY4A 2QBYB 4ORFA 4HV5A 2WWYA 4KWLA 4RAYA 3IL2A 1XD7A 2PHLA 2QVSB 2IP2A 4GYIA 3H7YA 3KSCA 4XF3A 3WG9A 1K7AA 3WW2A 2QZ8A 2LSOA 1SFEA 2EB7A 2H6BA 1YIOA 5DUIA 2F4PA 3J7AO 2FBIA 2YX7A 3BZ6A 3LWFA 3K1NA 5JHUA 4Q0QA 1D8JA 5E1WA 2VOOA 4WCGA 1STZA 2MC3A 3MZYA 5K5RA 4IRIA 2VOPA 1YO5C 1TQ5A 4L9JA 5LGUA 5I0TA 1EH6A 3CL1A 1CAWA 1QPMA 3TO9A 3TQNA 5DYMA 5LEKA 2FNPA 3OV8A 2WC2A 2VE8A 2OZJA 1KU7A 2PFWA 1IAWA 3HOTA 1W7PD 1ZZ8A 3PVBB 5H6RA 2EAAA 4HVRA 3NEUA 3SZPA 3GX4X 3HQXA 1YG2A 3V8JA 1U12A 2O3FA 1OYYA 2IA1A 2NYXA 1YFUA 4PJYA 4UHTA 3FX3A 2OZUA 1OYIA 3MWMA 2CAUA 1X8EA 4Z82A 2OQGA 4XFCA 4S05A 3JSOA 1R1TA 5E17F 2EV0A 2DQLA 3J80Z 3BJ6A 3E3VA 1DZTA 2FU4A 1XMAA 3D5LA 3HT2A 1GXQA 5D8KB 1EY2A 2LF7A 1AOYA 2QUFA 5F1RA 2L3DA 4KNYA 2O0YA 3ZP5A 4E70A 1J59A 3WTSC 3I5UA 3HUGA 1CGPA 4KL1A 2PG4A 3LZZA 2MLGA 1ZZCA 4I7HA 3Q9VA 4CICA 4GCVA 3CUOA 4R8HA 5DUKA 3OTFA 4AQ6A 3NRVA 2K9ZA 1HQCA 1JE8A 2Q0OA 5C6CA 1I6XA 2XASA 1XGSA 2ESHA 2E1NA 1B1BA 1J58A 4EWEA 2IVMA 4U0WA 5K1YA 2EA4A 4O9EA 4IEYA 1XB4A 2M30A 1ZZ6A 3P7NA 3I4PA 3HSFA 3HRSA 4PGGA 1K6OA 2DQRA 5K8SA 4U0VA 1SFNA 2FSWA 1USSA 1FP2A 3L00A 2XAQA 1FPQA 1ZHFA 3DV8A 3TO6A 3BROA 2EK5A 2R7DA 4BIFA 1IN4A 2Z3YA 1MDMA 1YYVA 5DD8A 1RUNA 3V7RA 2L01A 3SXYA 4UUVA 3WODF 4KWKA 3U10A 1O5UA 2UYBA 3OOPA 5CLSA 2E7WA 3WW3A 2DK8A 2P6TA 1LJ9A 4JVAA 1OI6A 2X4HA 1FBQA 1IN8A 2K4JA 2KIUA 4I01A 1HSJA 4ESBA 5BPXA 4BYYA 4UBHA 5HI0A 2DI3A 4KN4X 4IEQA 2YU3A 1U6GA 3R60A 5KHJA 2PHDA 4IERA 1XN7A 4A2UA 3J81K 2CWEA 2WFPA 4YFNF 1IW7F 4RGUA 2KJBA 1IUYA 2FOKA 3RDIA 2IPQX 3VB2A 1ZLKA 4NHJA 4ZH4F 1RGSA 1KQ0A 3T8RA 2L4AA 1WA4A 2EFQA 5H20A 2Z2SB 1OPCA 3KEQA 2H0VA 1P4WA 5FPZA 2HOEA 1EH7A 3OD0A 1G6NA 4RGXA 2H6CA 3RPQA 1GHCA 5D6EA 1IF1A 1KGSA 3V7SA 5FDBA 1RL3A 4Q5SF 4BNCA 1CAXA 1Z1DA 2ZNYA 2GC1A 4Z2YA 1Q43A 3PNAA 4JBAA 1ZG1A 4PIZA 3H9AA 3ELKA 4FHTA 3CLPA 5BMZA 3IWFA 3DFGA 5HS8A 2EJRA 2BV6A 2JRTA 4UV9A 3IIAA 1KYZA 1B4AA 1SD4A 1C0WA 1NE4A 4IEWA 3MYXA 5CU1A 2O03A 4HDVA 4EGYA 2ZFWA 2GIVA 2AXLA 4YG2F 1IXCA 5EZWA 4LG0B 1YW9A 1EPZA 3CTAA 4QWQA 4HBNA 4M72A 2OA2A 3KP2A 2V1DA 1R5HA 3IHUA 3TNPB 5D5VB 2G9WA 1RUOA 2STWA 2B8MA 4YFXF 1JHHA 3BCWA 3E6DA 4EJVA 1WGPA 4YRDA 3K1PA 5DV5A 1J3QA 2DPUA 1NXMA 4JQFA 3S7EA 2COMA 2QM3A 2RNJA 1T0FA 3BDDA 2MA3A 4I0BA 2FBHA 3BWGA 2A6EF 1EH8A 2VBXA 2Y75A 3E5QA 2W84A 2EFWA 2P7CB 2ADUA 5ICGA 1V4RA 1Z6TA 3KLOA 2VECA 4ZYHA 4WXHA 4GO1A 4OIQF 1S7AA 1J2XA 1HW2A 3ERED 4NB5A 1ZRCA 3LA3A 1LVAA 1XDUA 1USTA 4L9NA 1MKMA 1WQ2A 1J5YA 1XSXA 1L3LA 4F8AA 1O57A 1FXZA 3BOQA 5E1ZB 4LK0F 2XLAA 4KU7A 2VXZA 3W6KB 1O7LA 1NHAA 1YFYA 1ODDA 2VBYA 5HLGA 3S2WA 4IEOA 2M8EA 2JPCA 5D4RA 2Z69A 4WXCA 3SFZA 2O8XA 3NJZA 2CG4A 3BALA 3BJOA 3ABUA 1CAWB 4XFBA 2UXNA 4QGLA 4XETA 2D5FA 1YS7A 4Z07A 4YSFA 3B73A 1BI1A 2J5OA 3KP7A 1J3PA 2K02A 3E6MA 1CX4A 2HDCA 1CAUA 2IA0A 2DCTA 2HKOA 2VODA 2CGPA 1F4KA 2XAJA 2NNYA 6PAXA 1R1VA 2V6CA 1O3QA 4KYWA 2GC0A 2XLFA 4EJUA 1I27A 3MDPA 4MGIE 1ZREA 2QBYA 1TTYA 3DPTA 5FQ0B 1IXRC 2NRAC 2HYGD 3FZVA 1XMKA 1ZAOA 4HSJA 4MTEA 4YIIA 4A6DA 3C3WA 3DN7A 4R52A 2OYZA 5JVTA 3WTTC 3RKXA 1G3TA 4HQMA 4OIRF 1F1ZA 2Q1ZB 5EEGA 1IPKA 3IKVA 4HSLA 2DK5A 5EFUA 3ECHA 4WXDA 1ZLJA 4P55A 3N97A 5JI6A 3E6CC 1YFWA 2KKOA 3TNQA 3LAPA 3KE2A 3RIRA 5K5OA 2O6GE 1FSHA 2XGXA 1PUEE 4HVQA 1X7NA 2DAOA 1QXJA 4M73A 2Z9OA 1GXPA 1WKMA 4PIXA 1UHWA 1F9NA 3HSEA 3J80K 4RD7A 1SQ4A 5ILUA 1OKRA 3VODA 1NYWA 1GQHA 2ZMEB 4X6QB 1JGSA 1FNNA 2MD5A 2IXJA 4Y17A 2HQRA 1R5GA 2HZTA 4G6DA 3HOSA 1J1LA 3EUHA 4ENMA 3HHHA 2H94A 4HZFA 1ZZ9A 3K0LA 2XAFA 3H1WA 2XKPA 5HS9A 3KLNA 1U2WA 4YYOA 2YPRA 4HLYA 2OU2A 1ZH5A 2GH2A 2CQKA 4LUMA 2XRNA 2EA7A 3FWEA 3C3VA 3IC7A 3G7DA 1P4XA 1O5LA 3F8MA 5I91A 3HRTA 2O1QA 1U3EM 4FT8A 5IT9Z 3EHKA 3GFJA 1H1IA 4EJWA 4OMYA 4H7LA 4RGRA 3NQOA 3R6SA 1Z7UA 1PP8F 2A6HF 4JTNA 2F5DA 1D8KA 3F21A 2JSCA 1UD1A 1G3WA 5DCMB 2PI0A 1YW8A 4MGZE 3F6OA 2MNGA 4QMAA 4XLPF 3E97A 4R1HA 1XE7A 2DT5A 1UPIA 5TRDA 3GF2A 3ZMSA 2MPFA 4MZUA 1UCRA 5BY5A 1TW2A 1WLTA 4H0EA 1O7FA 5JSRA 1P6RA 3Q5FA 2O61A 4Y15A 4AD9A 1JHFA 1UIJA 1QGPA 2GC3A 3F22A 2FMYA 1OYWA 4QM9A 4ZZLA 4K8FA 4P9UA 1Z05A 1B59A 1LRHA 3H1YA 4XSZF 3OGJA 1RC6A 2W25A 3G3ZA 3JW4A 3F6VA 4AVBA 2QJVA 5FQ0A 2K27A 5EEHA 1RZ4A 3IDBB 2KJCA 3S0MA 4L18B 3W6JB 2DBBA 4L2NA 2PN6A 3ZDSA 4G6QA 1J0RA 1FT9A 3DL3A 4L0YB 4ZU5A 2M5WA 1GVJA 2IXKA 3KP4A 4QGNA 1REPC 5A2QZ 2BYVE 3FMSA 1U5TB 3KGZA 3QOPA 3GO5A 1CAUB 2ZBKA 3KZYA 1S29A 1RNLA 3TKYA 5C8WA 3CO7C 5KBFA 3SZTA 3I0TA 2AS5F 3I64A 4QM8A 2FE3A 2P17A 4GULA 3M8EA 3U2RA 4Q48A 4IEZA 1XCVA 4XFGA 1I5ZA 1B9NA 4I2OA 1LDJA 3RNSA 5CADA 1ZGAA 1QZZA 1XSDA 4KA4A 4IEPA 3H1MA 1W4MA 1BI3A 2GXBA 4L11A 2V79A 5ERIA 3MEXA 1SMTA 4KMUX 4EWAA 4AVAA 3TDUC 2A68F 4UVCA 3R0JA 2FXAA 3J81Z 4KICA 3RYPA 4A6EA 5BS6A 2K4BA 2IXCA 2XROA 3DEUA 4XFHA 2TDXA 3K1MA 3LAJA 4ENJA 4LA3A 4K2EA 4HF1A 2Q8KA 4Q0UA 2BBYA 1DUXC 4N9IA 4XFFA 1BOAA 2ETHA 3FZ3A 5HLHA 3I53A 1XRUA 2XL7A 2MBFA 2HJIA 3HYIA 5FFXA 3WTVC 3JSPA 1K78B 5D5XB 4DNCA 4PDKA 2QYOA 1J7KA 4LMYA 2ZKZA 2ZO4A 1TQMA 5LHGA 4JTOA 1X3UA 5D5UB 1XCBA 5F64A 2GAUA 5I0SA 3FM3A 5BV6A 2YX4A 1W7PA 3VEPA 3TOAA 1G3SA 3KFWX 1R00A 5A2QK 5LEJA 5D6FA 2HYFA 3FF5A 3H92A 2R3SA 2FF4A 2OA4A 2VT3A 2Z33A 2RQPA 1PM7A 4LEJA 1G3YA 1LKNA 4ZYGA 3I71A 1FLIA 1UHMA 4CO8A 4AWXB 5JSOA 3ML6A 3ES4A 3FM5A 1PDNC 3D0SA 5J48A 1MZBA 1XGNA 4ZYEA 2ISZA 4M6YA 2P5LC 2HQNA 5FO5A 2LF8A 1DPUA 2Y0MA 5J8CA 4LLNA 4RS8A 2D45A 1BJAA 3IKTA 3CF6E 4EVIA 4IRHA 4XBFA 4RB3C 2A07F 4KMFA 4BQAA 3EDPA 4M9SA 3ZMTA 2FQPA 4OU0A 3HT1A 1AWCA 2D93A 3RI4A 3M70A 2EWNA 4MEXF 5JCTA 3I58A 2MHFA 1I1GA 4IETA 4NQWA 1XDSA 2CO5A 3TO7A 3M1EA 4OIPF 5D5WB 2BNMA 3QAHA 2E7XA 3QPHA 3DQVC 3AAFA 1SAXA 2GA2A 1FC3A 3GVAA 5AONA 1K79A 3WGGA 2N7GA 2PAEA 2PQQA 3NVCA 4MX3A 4O9GA 4ENKA 4ZYDA 5FD6A 3WU0A 2EFPA 4YIFA 1R58A 4AVCA 3EYIA 2IW5A 4CYDA 4MEYF 2PAKA 1ZRRA 4UXAA 4LB6B 2ZNZA 4AIHA 2K7LA 3SXWA 1VJ2A 5ICFA 3ISPA 1OMIA 5KHGA 1ZRDA 4LD5A 2W24A 4B8XA 1HW5A 2DFIA 1MDMB 2IT0A 1R23A 1BC8C 2KXLA 1S6LA 1IZ1A 4E2GA 2FQ3A 3E5XA 4LLOA 1WSUA 4QXKA 4BAYA 1JXSA 2UZKA 3L2HA 1Y3TA 4EJTA 4UBGA 1LEBA 4ENNA 3RZZA 4BHCA 5JAXA 4I0AA 2ZJ2A 3CLOA 2VC0A 5LHIA 4IF4A 1ZGJA 1ZG3A 1DP7P 2FMLA 2GWRA 5CVVA 3IDCB 1KQ8A 3LSTA 2C0ZA 1E2XA 5CVUA 1ZYRF 2PLYA 3GWZA 5I8YA 5L3GA 4HDUA 3F72A 2E1CA 4E2QA 4Y13A 4R79A 1D3YA 3CDHA 4CDGA 2PTMA 1OR7A 4HA8A 1FOKA 5CVJA 5CVIA 3SQNA 2VPVA 3JAMZ 1SFUA 3PQKA 2Y0OA 1IXSB 2JZYA 4B09A 4M71A 4QX5A 2D2WA 3K69A 1TNSA 5E20A 1IN6A 3JZVA 3BP8A 2CW0F 3QU6A 1HW1A 2D5HA 3KP6A 3LA7A 4FX0A 5HDKA 4RGSA 4XF9A 1FBUA 3FE5A 3HRUA 3TGNA 3CEWA 4HN1A 3BJAA 1HSTA 5IT9K 4UVBA 4KFCA 2CFXA 3TOBA 1HKTA 2HR3A 4KDPA 5E1RA 1GQGA 3WTXC 1H9TA 1X8MA 5E1XA 5E18F 1KU2A 1HKQA 1YLLA 1YQAA 3D82A 2W85A 4U7DA 2JPBA 1SD5A 4A0ZA 1YLFA 3TDZC 5HS7A 3BB6A 1QXRA 5CVRA 3ABTA 3REOA 4PZJA 4M9ZA 2CAVA 4EM1A 2VONA 4HLXA 5CYVA 2MLKA 1DDNA 3LQQA 1PMIA 4HMZA 1U78A 1TLHB 4G7ZF 3R0AA 2UWMA 3R61A 2QDRA 2BEOA 1J9IA 2HKXA 2M45A 1SD7A 1LB2A 4A12A 5F6FA 4META 2DU9A 4XLNF 1YTYA 3GW2A 4P96A 2EV5A 2V09A 1DGRA 1ZG5A 4UVAA 5DCFA 4OFGA 2XVCA 4I09A 4XRFA 1E17A 1XE8A 3EJKA 4OOIA 3ZMVA 2L02A 4TV7A 4BHPA 2JTVA 5KVRA 5BXXA 3PLQA 3FHZA 3GUDA 4G7HF 2IC1A 3F23A 1FWZA 4Q47A 2F5CA 3RYRA 3GFIA 3NKTA 2IXHA 4FAHA 2RGVA 5E8IA 3CUQB 2J5PA 4EQQA 1ZX5A 4IESA 1Y0UA 2VT2A 1R22A 3HRMA 3NW4A 4ZU7A 5BPDA 4MH0E 2P5VA 3WTUC 2QNKA 3DF8A 3GYDA 1PP7U 3LWCA 4LLLA 5BPIA 1FYKA 4XF0A 1Q1HA 4HV6A 1VR3A 4MV2A 4BXUA 2ACJA 5ICCA 4ESFA 1DZRA 3I54A 2P6SA 3CUQA 5DDGA 2A61A 5I8TA 1MJBA 2V1XA 3MFKA 5CJ9A 2C6YA 3QP5A 1J75A 1T39A 1Z6RA 3FXUA 3RKYA 5I0UA 5HLIA 1LDDA 3ACLA 3H3ZA 1FYMA 4G8XA 3L7WA 3F8NA 2M1BA 5KHIA 2F2EA 4KIFA 2RDPA 2QLZA 4LB5A 4JK1X 3I7DA 1S7OA 3U9GA 1SFXA 2FA5A 3FFQA 1L0OC 1IRFA 3IWZA 1TNTA 3WGHA 3MCZA 1T38A 2I45A 2NS0A 3SHRA 3O14A 4G7OF 3O2PE 4HYEA 2MH2A 1IPJA 5LHHA 4A0YA 4KUMA 1YWKA 5LRSA 3WW1A 3QACA 2B0LA 2KRFA 1T98A 4D0PA 3U0ZA 3KP3A 4HQEA 2HTJA 4CGZA 1HKSA 4X6RB 3F8BA 1Z9CA 3PQJA 1ZZ7A 3BPZA 5HDGA 3QP6A 3KEOA 2QENA 2XIGA 3QPTA 4AIKA 1W5TA 5JR7B 3GZ5A 3P9IA 4EM2A 3H8UA 4GGGA 4UNOA 5L3DA 4QLCU 4HLTA 4MUVA 3WE2A 5HDNA 3WE3A 2K0GA 4FAGA 4XEZA 2L54A 3QU3A 5E16A 2DTRA 5FLXZ 1EV7A 5LRRA 1FYLA 4XFAA 1V3FA 3WU1B 3EO6A 1T2KA 4HVOA 2YSRA 2PMUA 1TQIA 1XGMA 4OMZA 5L3FA 1U5TA 4RB0A 5AIQA 4HF2A 3LOIA 4DQ2A 4HF0A 3N4MA 3EBRA 5JSPA 1CAXB 1F5TA 1O4TA 4Q0PA 1BC7C 2EFNA 2OQRA 4CHUA 3K9TA 4O5VA 3CUQC 2DPDA 3RKWA 3KCCA 4AXOA 4D7TA 1IRGA 2VBWA 2WV0A 2B9UA 1ZVFA 1SMYF 2HFHA 3B02A 3L9FA 1VTNC 3SCFA 3JTHA 3E5UA 1MJAA 4EJOA 1MGTA 4HAMA 4LGWA 2P5KA 3V7CA 3G73A 2PQ8A 5L3CA 1ON2A 5BQTA 4DINB 3LA2A 2VC1A 3BPVA 4AVPA 3H50A 2X0LA 1FP1D 2XKOA 4OINF 4ZZDA 1ZARA 2G7UA 1R7JA 3MPBA 3FXRA 2XAHA 1H0MA 4E2SA 3UKNA 3EYYA 3MAJA 4AQ2A 1UCXA 4N0BA 3V8LA 3GFLA 2UY9A 1RTVA 3C18A 3KMHA 3GEZA 2A5YB 4IRGA 2FRHA 4KIGA 4KWJA 3SHFA 2QWWA 2VBZA 2G7HA 4I02A 3O3KA 2RV8A 1BIAA 5J8FA 4MGYE 5D8LB 1S8NA 2NAZA 3SMHA 2E9QA 1R1UA 4ESJA 5LLQA 1UIKA 2F5FA 3KGLA 2QQ9A 4PGHA 3PFIA 3EQLF 4RAZA 1ON1A 2LDUA 1Y9QA 4LULA 3ZMUA 1Q3EA 4KIBA 5AVPA 5KHKA 2QVOA 1TW3A 3FXQA 2D1HA 1BN5A 3V8KA 5L3BA 4P9GA 3RYKA 3P9KA 2GZWA 3GBFA 1DPRA 1NZCA 1U5TC 1XSVA 2EVXA 2PAMA 3T1BA 1T6SA 4S04A 1H9GA 2UXXA 4HBLA 5ICEA 1LEAA 2ESNA 1RI7A 2RVCA 4U7BA 2BNNA 2H27A 1O3SA 4XSXF 5BUVA 4IPAA 5FFZA 5L3EA 5FLJA 4WK8F 2LKPA 2WTEA 1K78A 4ZU4A 1KQ9A 5DCMA 1QO0D 4OIOF 2D1VA 5LGNA 4YNIA 3D0JA 3ELNA 1X82A 2GA1A 5LBQA 3QRFF 2ET1A 1LQ1A 2V1UA 4WF2A 1UFMA 1WRJA 1UW8A 3UKVA 3FMRA 2PJPA 1Q5OA 1LNWA 4IXAA 4CZZA 2P7VB 4G94A 4BH9A 1QQIA 4LA2A 1DGWA 3JAMK 2GXGA 1QBJA 4J1XA 2GC2A 3HTSB 1LR5A 1BI2A 3LQRA 4GXOA 1P92A 2OPKA 3T0YA 4EGZA 4WBBA 2L4MA 2HTSA 2XHKA 4KU8A 3U1DA 4N9HA 3FMQA 2OAZA 4ONUA 2ZCWA 5ILSA 1KU9A 3EQEA 2OZ6A 4EMSA 2XAGA 3H3UA 3OF1A 3RTRA 2ZMEA 2DO7A 4F7ZA 3FJSA 1FX7A 1TBXA 1YW7A 4XF4A 2PBIA 1L3JA 3WTYC 5AIPA 4XF1A 1W7PB 2FEZA 1KYWA 1O3RA 2LNBA 4A5MA 4LJZF 3V4GA 4IVNA 3CJXA 3MZHA 3L09A 3VFZA 2Z99A 5I8SA 2OD5A 4U88A 3HHGA 2IXLA 5K5QA 1ZNPA 3HIFA 4MQVA 1QWRA 4LTAA 3ECOA 4IEXA 1BIBA 5FLIA 4Q4ZF 5IT3A 2PMHA 1U8RA 1CAVA 1V70A 3IRQA 3T8TA 4WZCA 2IRFG 1TQPA 4M74A 2RN7A 5I93A 1SEFA 1G4DA 3BY6A 4EV0A 1FY7A 3CO6C 3ZN0A 1ONVA 3KETA 1CF7A 3CJNA 4QGMA 4WVZA 4RB2C 3P9CA 4Q0VA 5LGTA 1VP6A 5ILVA 2W57A 2XLGA 2OBPA 3K2ZA 1B9MA 2P8TA 3L2CA 1W5SA 2M87A 1YFHA 3S7IA 3C1DA 2HWVA 2KIFA 2Y48A 3GXOA 4MTDA 4Q29A 2PFBA 5KK1A 4I3PA 2RKHA 4HX4A 2GQQA 4ON0A 2ELHA 1BI0A 3FHIB 2PEXA 4MGRA 4CXFA 4I98B 1O3TA 3DXJF 3BU7A 2UYAA 2ZXJA 3UKTA 4L0ZB 1LDKB 1BM9A 4IHTA 5DEQA 5DD4A 4HW0A 2ISYA 2IJLA 4KT5C 4M9XA 3LAGA 1A04A 3RPUA 3O6BB 3VHRA 5FLHA 4YFKF 1ZRFA 3R4KA 5J3UA 1JUHA 3F8CA 4IJAA 4HX7A 2BGCA 4WX9A 5J6XA 3ES1A 4EROA 2UY8A 3M9AA 4G9YA 1ZZBA 2YR2A 5ED4A 3ZN1A 2HS5A 2Q0AA 4NVPA 4HX8A 1WI9A 2O8QA 4OLLA 1FZPB 3F8FA 4UV8A 1EP0A 1QNTA 1J3RA 2ATFA 1XGOA 2PYTA 4YARA 2PA7A 3EETA 2CV6A 3IBMA 5E8GA 4L9TA 4EM0B 3USSA 3JTGA 3KZZA 5I0RA 4IEUA 5D1IA 2DLLA 3COAC 4PCQA 3NSTA 1WWXA 5KHHA 3ZPLA 2BE5F 2EFOA 2K86A 3ULQB 2H09A 1EYBA 4D7SA 1CF7B 1FI2A 1P2FA 4FBFA 3U11A 4Q0SA 1KA8A 2JT1A 4IEVA 4MGKE 2XV4S 2QQBA 4KN7X 5T3NA 2VE9A 5BOXA 3DP7A 3ST7A 3HSRA 2NNNA 4FX4A 5J7MA 2P4WA 1S3JA 2MH9A 4L9VA 4LUKA 3ROUA 1KU3A 2HEOA 1YUDA 2CSOA 2RC4A 2QQAA 4HOBA 2HGCA 3MQ0A 4RB1A 1YFXA 2CYYA 4O6JA 3Q9SA 3BPXA 1HXDA 3ETQA 2BNOA 4A5NA 2STTA 3ZMZA 4HN0A 4PIYA 3WGIA 1B6AA 3WTWC 1MD0A 2Q4SA 3C7JA 2Q30A 2XL9A 3OCPA 3M7GA 4A0XA 3ZMDA 3CO2A 5FD5A 3WW4A 5JFRA 2Q2EA
chains in the Genus database with same CATH superfamily
4BCUA 2I5UA 3MIGA 1H1MA 1I3QJ 2YFZA 2DTYA 1CPMA 2WNVA 4UI9L 2ZEZA 4PDWA 1ND3C 3LFKA 2J1EA 5TJJA 1WUVA 4AFDA 3I59A 5GZCA 2Z5UA 2D3RA 1ULYA 4LLFA 3LDKA 2A3WA 1SAUA 2B45X 3KHCA 4YM1A 3GLXA 3FIWA 3GYHX 4LO6B 3I2KA 2YHJA 3BG5A 3DKWA 2OCCH 4LFUA 2IXIA 2CH0A 1K83J 4L5IA 5D4SA 2Z5WA 1ULDA 1HF0A 4CYCA 4XRSA 4BZ4A 4MHUA 2R0HA 2XOMA 2O5RA 2GXAA 2V9VA 1VQ7I 2Y9ZA 3ZX7A 2VZVA 2GM4A 4QX8A 2VN2A 1ONAA 2I74A 3N7JA 4BE3A 4LK1F 2AGSA 3THPA 4ETSA 3RJPA 1PO22 4JV4A 2A6TA 3AP6A 2YZ4A 3FMGA 4IGQA 3ZFFB 3KQRA 3L2YA 3MKLA 2D40A 2ETEA 4HG6B 3C8XA 5FGMA 1Y4WA 1GWLA 4M6XA 5EG0A 1BK1A 4LHSA 5HVQC 2XGCA 4DNYA 1BBT1 2BQPA 4D6RA 3Q8EA 4HV5A 2IP2A 4GYIA 2Q1MA 2L9LA 1ZYBA 2W82A 4XF3A 3WG9A 2X8KA 2QZ8A 1QDCA 5GZDA 2LSOA 4D8MA 4BXXJ 1N1SA 4GWJA 4NMIA 3KVBA 3HL2A 2FBIA 3BZ6A 3LWFA 4FTBA 3K1NA 5E1WA 1R091 3HAGA 5T5LA 5C3PA 4WCGA 4FETA 1STZA 2MC3A 4IRIA 1TQ5A 4Y24A 3G6EI 5A1LA 4AIDA 1NG6A 3BIWE 2GOMA 3KF5A 5F04A 5DYMA 5LEKA 4YGDA 5CG9A 3HUGB 1V6JA 1YI7A 2VE8A 2OZJA 5A3UA 3HOTA 1ZZ8A 2HWE1 3OGGA 1GVDA 1K3IA 3U1XA 5IP7J 2EAAA 4D5FA 3OY9A 2P4EA 2FD8A 3NEUA 1EKEA 3TEXA 1W8OA 1YG2A 2B63J 4FPLA 4ASKA 1ND2B 2ELJA 1SFKA 2CQXA 2IA1A 1ZQ3P 2NYXA 1H9WA 4UHTA 2R0FA 3ZRGA 4CXWA 4Z82A 2OQGA 1Z67A 3LSMA 3M3QA 1X1PA 4Y3OA 2PLV2 2WZR1 1W0NA 2WQ8A 1N3PA 3BJ6A 1XPXA 3AP4A 1T2XA 1B72B 1NA1B 2JE9A 3D5LA 3O12A 5FZBA 2CW8A 5D8KB 1VRBA 2LF7A 3J9SA 5A32A 1QMJA 4AGRA 4YZ1A 4BEHA 2ME0A 5H9RA 3ZYRA 3H8XA 5F1RA 4E4ZA 4PLMA 2ERFA 1LFPA 1J59A 3I5UA 3ZFEB 4RS5B 3AG4H 5DZGA 4BMBA 2V6EA 4ZYAA 3WQ7A 2XBO1 5FKOA 3IV5A 4AQ6A 1HQCA 4J01A 1TWFJ 2VUAA 3Q8BA 5FKMA 2Q0OA 5C6CA 4AI0A 1I6XA 1FMD1 1QOOA 1JHNA 1CZSA 2V4AA 4W6WA 5BNOA 1J58A 4PQQA 4EWEA 3JCIA 3M7AA 4HPKB 3BIEA 1XB4A 1MBKA 2NVXJ 2N8GA 2GBYA 1FPN2 2W1SA 3I4PA 3WVJA 4GKYA 4PGGA 2QQ8A 5FXZA 4U0VA 4PJMA 2FSWA 5C70A 1COV2 2ECBA 2CWMA 5B4XA 3MW3A 2XAQA 1PO12 3OYBA 1RHI3 1BA5A 1IN4A 2Z3YA 1W6PA 1RHI1 5DD8A 1SBFA 3MO4A 3SXYA 4UUVA 2DFCA 4FFGA 1N3QA 2KRHA 3SZGA 3LL7A 1DHKB 1DQ4A 4F91B 4FFFA 4XPVA 4M4PA 4ZTJA 3DU5A 4H4KC 2IS6A 1DQ5A 3URFA 1LJ9A 3KIOA 4CUGA 4JVAA 4HPQA 4XICA 1I6HJ 5G05L 2ZEYA 4I01A 4XJWA 1MBJA 4UBHA 5BPXA 4CYCB 3R60A 5KHJA 3J81K 5CEHA 3CESA 3KYCB 2WFPA 3WF4A 3O1TA 1IW7F 3HC7A 1ITYA 2FQ4A 1AKHB 3HBZA 1W8ZA 1ZLKA 1OH3A 4GMP0 2RAEA 4YVWA 2FDHA 1G8WA 2Z2SB 1UY3A 2H0VA 5FTTC 5FPZA 2ME6A 2H6CA 5D6EA 5CFDB 2BFUL 3BTZA 2QZ2A 5F3GA 2WBKA 1R6RA 4IQJA 2ZZQA 4MVTA 4Q5SF 4BNCA 2GC1A 1Z1DA 4LBKA 4WM8A 4CDUA 5TSWA 4XCBA 2OKXA 3SLIA 3PNAA 2JG9B 1ZG1A 4XOPA 4A4AA 4ET7A 2ZABA 4KT6A 1IQDC 3CLPA 5HS8A 4UV9A 1KYZA 5F2SA 1B4AA 5E3MA 3ZMOA 3WHBA 3ZXGA 4Q1PA 4IEWA 5A3TA 5CU1A 2XSJC 3ZXDA 3ZN5A 1ZBA3 3PVNA 3CJIA 2LY9A 4K21A 4YG2F 1IXCA 2WA0A 4A3ZA 1VRH2 4QWQA 1H4HA 4XC9A 1R5HA 1N75A 2G9WA 1RUOA 2STWA 1PIV3 1HOMA 2A3XA 5T55A 3BCWA 4EJVA 3W5NA 5DUUA 3BPSA 4JQFA 3S7EA 2AEYA 2COMA 2QM3A 1M1EB 2VY0A 2MA3A 4DZJA 1RUH2 3BWGA 3IAPA 1NY72 3N9NA 4QU1A 3E5QA 2EFWA 1LOAA 1YQ5A 2ADUA 5ICGA 2RM21 5GPCA 1V4RA 2B7YA 1UZCA 4WXHA 4BJTA 1NA1A 3NARA 1S7AA 2RM23 4UW4A 1GUUA 3FXJA 5GLUA 5DDJ2 3PFYA 2A05A 4UUTA 4B4CA 3MGUA 1O57A 4XMYA 4KU7A 5KXDA 1O7LA 3PL0A 3LEMA 1XNDA 1C8M3 1Y39A 2VBYA 1UZZA 4RHV2 3MI8A 2ARXA 3N3HA 4IEOA 1YIPA 2HWB1 1TWAJ 1QF3A 2EZKA 5D4RA 1QHGA 2WN3A 2VMHA 1K4SA 3ABUA 3RG0A 1WW4A 4DXZA 1SBDA 4M3CE 1Y43B 2B9VA 3RMXA 4XRSG 1UYXA 4YSFA 3B73A 4LG3A 1JGGA 1D1CA 4BMEA 3H8OA 4W97A 2IA0A 2HKOA 2LKSA 2V5YA 3QYBA 4RGGA 1UKGA 3WG1A 3UKGA 2R7WA 4ZKTB 2GC0A 4EJUA 2RMU3 2H0BA 3ZFGA 1UWWA 5FFOC 4LNVA 1VQMI 4QPIB 1RKWA 2E26A 2NRAC 2CSGA 1WJCA 4G4FA 4BJ5C 2VNVA 1XMKA 1APLC 2JDMA 2FDKA 4MTEA 1RYYA 4I3GA 4G6TB 4V2FA 4R52A 1BMV1 2LK2A 4HQMA 2DCJA 1F1ZA 3VDAA 3B9IA 4FQ4A 4HSLA 2DK5A 5EFUA 3J26N 3ZR8X 4AVSA 4WXDA 2EIJH 1ND3A 2MG4A 4DQAA 1DP3A 4LR4A 4D9JA 3GTJJ 4JDMA 3H42B 3TNQA 2WS92 3DEWA 2R7ZJ 2IEKA 4BE0A 1WKMA 3CF2A 2WNEA 4P1WA 1F9NA 2RS12 1UOFA 5B2GB 1S1AA 4C0HA 1K12A 4J00A 1OKRA 3TEYA 1NYWA 2X05A 3OR2C 3HDDA 1JMUB 1FNNA 3BKZA 4XJUA 4Y17A 4EZHA 4IKFA 2HQRA 1R5GA 1D0GA 2E6VA 3PUSA 2VMEA 4Z2WA 2HWC3 2X6YA 1VE0A 3EUHA 1JI8A 1OFSA 4PJNA 4HZFA 1ZZ9A 2C9KA 5GTHC 5HS9A 2V5DA 1AVBA 2DCZA 4AR2A 3BQYA 3K4LA 1W6OA 2WNVB 2XRNA 3FKIJ 3VBHA 3G7DA 2WLPA 3K4DA 1IJWC 2VVEA 5LB6A 3HRTA 5EJ1B 1YITI 5FZHA 1U3EM 3NAPC 3EHKA 4YW1A 4EJWA 2RVAA 3B9CA 1L7QA 1Z7UA 2X1DA 2A6HF 2DA7A 2WADA 2W2IA 1L7RA 2DA1A 4Q4W1 2DVBA 4LK6A 1W0OA 2HVSA 1RKTA 3J7MA 2DFBA 3A21A 4MGZE 1JKRC 3F6OA 1NT0A 1REFA 1UMIA 5TRDA 5FZOB 2JG8A 2MPFA 1WLTA 1N78A 1AHDP 1DZQA 2HNHA 1P6RA 3N7MA 4P9LA 3F95A 1X4PA 3LSIA 2ELKA 1UIJA 4XDQA 2R7QA 5F7UA 2DVFA 3F22A 2FMYA 2ZC2A 4NNJA 5DAPA 2NVYJ 1WW7A 1NOVA 3FLRA 1G9CA 3OGJA 1RC6A 1X4OA 5FZ9A 2Q8DA 4C90A 1EPWA 3G3ZA 2GOXB 1FMD3 3PMSA 1JUPA 2PMZN 5DABA 4CCEA 3F6VA 4LO4B 2WIIB 1RZ4A 2KJCA 3S0MA 4JOMA 2CYFA 2X9DA 2DBBA 2PN6A 2W4SA 1J0RA 1JTXA 4TN7A 4ZU5A 2M5WA 1GVJA 2IXKA 4QGNA 1REPC 5JVGF 3I56I 1U5TB 2G9GA 3QOPA 3I2DA 3GO5A 1RUE1 1RUD3 3QODA 3W2WA 1RUE3 1KD7A 5G04L 1VQ8I 1ETXA 2YBKA 1G59A 1YRNA 3I0TA 5FZIA 5JOYA 3I64A 4QM8A 3AKSA 5GPAA 2A6XA 1UX7A 3VDCA 3VB9A 4XFGA 5DMYA 1I5ZA 4FPEA 1B9NA 4I2OA 1BEV2 1LDJA 3WDVA 2DVDA 4LXLA 3WSOA 2GXBA 1GWMA 5ERIA 5F6KA 3PIJA 4KMUX 4BE2A 4DXRA 2X53S 3VBFA 4FOWA 1UHSA 2M4GA 5JLVA 4IHYA 3RYPA 3R4UA 4QB6A 3VDDB 2K4BA 5I0DA 5KXCA 2IXCA 1HRV2 5F5AA 2XROA 4GFBA 1JS9A 5HV4A 2WNOA 3LAJA 5FPUA 4ENJA 4K2EA 4HF1A 2Q8KA 5HCFA 2FDGA 3VSKA 2BBYA 3NNJA 4XFFA 3T30A 1BOAA 2WY7Q 5FY1A 2Q5TA 3J8F2 2XL7A 1ZTRA 4AE2A 5L7OC 3W20A 3A2KA 5EJZB 3Q8AA 4GMP1 3WTVC 5T50A 4XMIA 5HCBA 3IIIA 3IMMA 3RJ2X 2GN3A 3TN91 5IUQA 3D5RC 2VPRA 1LESA 1YI9A 2ZO4A 3A01A 2HOAA 3CDLA 3CJIC 1JZ4A 5D5UB 2ZS6B 5F64A 1W3XA 2E2JJ 2YS9A 3FM3A 4BACA 2BGPA 5C8CC 1R00A 3H9GA 1LHVA 2M2EA 1KDMA 2HYFA 1WD4A 2HEWF 5IHRA 2GMEA 4IV1C 1NCRB 5IY5H 3DCFA 5FYBA 3I71A 1FLIA 3FM5A 5AVAA 4EN6B 1LEMA 4AI8A 2ISZA 3RSNA 3A0BC 3WG2A 1VBD2 2VCAA 4RS8A 3W6VA 2A71A 3CF6E 5L9BA 2RMU2 4GZ9A 2A07F 1TVGA 5LCWL 1RUF2 4UUSA 3R4SA 4M9SA 3ZMTA 4MG2A 3RZKA 2HQ5A 4KG8A 1H9PA 2D93A 3LOBA 1JXNA 1GLHA 1F43A 2EWNA 5IW0A 1XTAA 4IETA 4NQWA 1UYPA 3M1EA 2QA4I 3BZCA 2QKDA 4FPHA 3G6JB 3QPHA 4CCMA 5C5UA 3VKNA 4A3JJ 1S0FA 1K5MA 4YW4A 3WGGA 2N7GA 3NVCA 3I2JA 1AR63 2XVLA 2EFPA 5IAXA 2NMNA 4YIFA 1R58A 4CYDA 4FVVA 1ETWA 3GHNA 4UXAA 1PK6B 2WSVA 2ZNZA 2VMGA 3KV5A 4PJJA 5D8AA 1ND3B 3WF3A 3WG4A 4K20A 3ISPA 1ZRDA 1IS6A 1POV3 4B8XA 3D5SC 1MDMB 1RMU2 3M8LA 1BC8C 1WJEA 4JYKA 4IV3A 2A7AA 4CDQB 4RQPA 3ALQA 4YWAA 3B6AA 4BAYA 3AVSA 2WO3A 1W8TA 4EJTA 2W1QA 3DCQA 2VPLA 3DPRC 4Z2AA 4QQPA 4LOSA 4CCOA 3FISA 1SEUA 4RAFA 5LHIA 2EIDA 4IF4A 4CA9A 4XXPA 1XPWA 1OURA 3IN9A 1DP7P 2Y6JA 2EALA 3N7KA 2JA2A 2YC2A 2VZUA 2C0ZA 3LSTA 3OMYA 5BNPA 2VLAA 4LE3A 3SC7X 3HJEA 3HN1A 5LD2C 5KR7A 5LBCA 2VIXA 2ID4A 5I8YA 3JU9A 3F72A 2YDEA 1OXCA 1BR4A 4E2QA 1JKOC 4Y13A 3HN3A 2Y6LA 3VD9A 2MYSA 1VAVA 3CNAA 2OXBA 1ZBA2 5DAVA 4P9IA 4YVWC 3DTIA 3JAMZ 3PQKA 1QJEA 3M2MA 3AYAA 1IXSB 5A33A 3ZFFC 1GV9A 4QX5A 1OOPA 1S0DA 1IKPA 3UL2A 3GDBA 2LALA 4MOAA 1MS5A 2AQEA 5HDKA 2FZ2A 4XF9A 1WHUA 3TGNA 1PK6A 1R082 3EUHC 1TC3C 1U9NA 5IT9K 2CFXA 1IG3A 2HR3A 3BTLA 4PHZA 3TW7A 3I3BA 3D4KA 5EF6A 1W0TA 1S0BA 2WS93 1OA2A 5E6HA 3M07A 5E1XA 3I4NJ 4OMDA 5C3EJ 2R062 3SKVA 4YGCA 4E7ZA 3KT1A 3VBSC 5EYXA 4CDXA 4A0ZA 3PJYA 1C8NA 2WQ4A 3OBAA 5HXVA 4M9ZA 3R4DB 1GSLA 2Y31A 3AM2A 3M3OA 3HGYA 5ISLA 1DGRM 4LBOA 3QD6A 2QDRA 1Q8SA 3MMYB 3B94A 4META 4XLNF 5CPRB 5B1BH 3GW2A 1RHI2 2ES3A 1ZG5A 5J4YA 3RZLA 4UVAA 5K0UA 1XSRA 5LATA 4QPOA 3EJKA 2DMNA 1W9YA 2X85A 1V6IA 2WUHA 3S1MJ 1S0IA 2JD9A 3J7ZI 1O4YA 1IQAA 2E31A 5FP3A 4BHPA 2JTVA 2L2OA 5KVRA 3PLQA 2JA6J 5ABJA 1WCKA 3CQOA 2IC1A 3U07A 1QRYA 2VCMA 4Q47A 1VQ9I 3RYRA 2J1VA 2J42A 4FAHA 3AFKA 5FUPA 2VT2A 2DWRA 5BPDA 3ZM8A 4MH0E 3K2OA 3S16J 1FOXA 3ZIWA 3SDBA 3CU7A 1FNYA 5FZAA 4CEWA 3TP3A 4S2GA 4URAA 2KRCA 4ZDOA 1NLRA 2V72A 1G2HA 2DBIA 2OPWA 3WOGA 3VZKA 5EQUA 5BNOC 3POBA 2P6SA 1Q1VA 1GV2A 2CV1A 2A61A 4F3JA 5F9TA 3ZCOA 3C2GA 2EZLA 2WT1A 1T39A 1H2MA 3RKYA 3WLUA 5I0UA 5LBFA 3VDXA 4B1RA 1JYXA 3ZSKA 3H3ZA 4Q4Y1 1FYMA 2PLV1 3T0BA 2RDPA 4LB5A 4JK1X 2K3PA 3I7DA 3MUZ1 1S7OA 1SFXA 1DYPA 2FA5A 5JXIA 1W8FA 1UOJA 1L0OC 5A7QA 1YQ8A 2VI6A 1T38A 2BVLA 2NS0A 3E0JB 1R4NB 2EQRA 5LHHA 4A0YA 1DGWY 2TEPA 2HEVF 3BYWA 1AR93 2CY6A 1GP5A 2B0LA 1T98A 4D0PA 4B7EA 2HOTA 4BJ0A 5EP9A 3JRIA 1HKSA 4A7YA 3S1RJ 4Z6YA 3WHCA 1SLCA 4AK3A 3ZSJA 4EM2A 4HLTA 3PUHA 2DTRA 1FYLA 1HA8A 1PM4A 1EF4A 4BB3A 4CDQA 2VKVA 3K10A 2ARCA 1XGMA 3LOIA 2VUCA 3EBRA 5JSPA 1CAXB 4Q0PA 4UFKA 1UQXA 2A73B 4O5VA 4NHXA 5A7WA 4W8JA 3RKWA 1NG7A 4RM2A 3NAPA 1OF3A 4D7TA 4XN3A 5SV5A 5FRAA 1SMYF 3ESWB 2EBIA 4ARYA 3PNVA 3B02A 3L9FA 1R71A 1D0YA 3SCFA 2NS8A 2M7AA 4XQWA 4QIWN 3O1RA 2P5KA 3OGSA 5L3CA 1ON2A 4AEKA 2Q8CA 2X0LA 4DY3A 5GLWA 2XKOA 4XJ8A 4OINF 2DUPA 3U1KA 3VKOA 5L7OA 3EYYA 3MAJA 4BQXA 3VBUC 4N0BA 1RTVA 2ZGOA 1DG6A 3AK0A 3SHFA 4DYQA 1MQTB 2G7HA 2RR11 3PJRA 3ZXEA 1F2NA 3VL8A 1LJ7A 2RR13 2FUG2 4MGYE 2HBTA 1R1UA 4ESJA 5LLQA 3KGLA 3LPFA 1MMAA 1H89C 3PFIA 3EQLF 1Q3EA 3G1OA 5AVPA 5KHKA 3SYTA 5A7PA 4EJRA 2VXRA 3QOEA 4SLIA 3TN92 4FPCA 1S2BA 1SCSA 4QPGB 3PUFA 2PAMA 1T6SA 4TXWA 2UXXA 1FOD3 4A93J 5ICEA 2ESNA 2Y30A 4DUXA 5HNHA 4U7BA 2R7OA 2DYRH 1Z78A 4BIOA 3LSRA 1O3SA 2DOAA 3A22A 1GBGA 1ASJ1 5L3EA 5FLJA 4MGTA 1I3AA 4WK8F 3DYPA 3WCSA 1LHUA 4HRIA 4TTGA 1YO8A 2VCBA 4ZU4A 1KQ9A 5DCMA 3Q9OA 4COVA 1UG0A 4OIOF 4IXLA 3FKJA 5IP6A 3M3YJ 1B35C 3QRFF 1WRJA 2GIZA 3UKVA 4QB1A 1WGXA 2PJPA 1Q5OA 4IXAA 4ASLA 2QE3A 3DLLF 2P7VB 1Z21A 3CCLI 3HOYJ 3NJVA 3FDYA 1PGL2 5DM6F 5C4WA 4LA2A 2P6CA 3VBRA 3ZFGB 4BWOA 4J1XA 2CQNA 3HTSB 1PNGA 1P92A 4X1EA 1VFCA 3EB7A 4FQGA 5FMDA 3T0DA 1WCSA 4YELA 2XHKA 2OPTA 3FMQA 1R64A 2YG0A 3BTIA 3OBTA 3HNYM 3H0DA 2JB4A 2ZCWA 3EQEA 2OZ6A 4OULA 2P3YA 1POV1 3OF1A 1T33A 2ZMEA 2L9NA 1FX7A 1TBXA 5CKTA 2XH6A 2ZGSA 4XF4A 1NK3P 5AIPA 3LSJA 5C9AC 5C4WC 1KYWA 2LNBA 3V4GA 4IVNA 2PN5A 3EMRA 2Z99A 5I8SA 3S5AA 2B7EA 5SV8A 3DLAA 4XIKA 2IXLA 4OAYA 4AEMA 2L0KA 3N9PA 2RDRA 2JXAA 3FFZA 4IEXA 1QJX2 2WZR2 2PMHA 2VJIA 4XXAA 3OYFA 1CAVA 3FUOA 4DIQA 4E4HA 1TQPA 3OS2A 2XONA 4EV0A 2BTVC 1B35A 2GP3A 3ZN0A 1ONVA 3KETA 1VQ4I 2WB1A 2VQUA 4GJZA 1RINA 1CF7A 2JIJA 4IE5A 4QGMA 3SFIA 3WQ1A 3P9CA 2VULA 5LGTA 5ILVA 4GH4B 4QX3A 2W57A 2OBPA 5B1AH 2LOOA 4UOJA 5DTDA 3WQ0A 2DA3A 3TP0A 3S7IA 2HWVA 2VL4A 1UYZA 4C2UA 3QCWA 3ASNH 5KK1A 3ACHA 4XQDA 2RKHA 2Z16A 1RUC2 2F4OB 4CXFA 5EYYA 3WHTA 3BU7A 3QH7A 4LHNA 3UKTA 2JDNA 1LDKB 1BM9A 2LR8A 4IHTA 3WD5A 3SEEA 2IJLA 2WZ8A 3J7YJ 4QKBA 2Z79A 5IFPA 3LAGA 2LY2A 2YUSA 4LE4A 4MADA 4JZRA 5IPAA 3DBHB 5J3UA 1OJLA 2XPVA 3F8CA 3NAUA 5IVEA 2RHPA 2BHZA 3S3OA 5IATA 1S0JA 1E0EA 4OI2A 1A78A 2W1UA 3ZN1A 1WD3A 3Q0WA 2W95A 5EXOA 1QKQA 1FZPB 2A3YA 1US2A 3U78A 5CA6A 2KPMA 5DAXA 1EP0A 2D6MA 1F4HA 2ZJQF 1AZDA 3GTOJ 4DS0A 3ZN6B 1C3HA 2KMUA 1ZA7A 2DLLA 3WEZA 5FPVA 4UF0A 1AYN3 1WWXA 1G9AA 1MH3A 1T56A 3H8RA 2BE5F 4KH9A 1EYBA 4D7SA 1AR92 3PNTA 1RUF3 1P2FA 2K9MA 4X6AJ 5A3LA 5CNAA 4XR6A 3U11A 4INDA 1QQP3 3OYCA 5BOXA 3DP7A 3ST7A 3ZN4A 2D44A 1V6MA 2ZOEB 1S3JA 3K51A 4L9VA 4LUKA 3CCMI 3B7MA 4E7JA 5JLXA 2HGCA 3MQ0A 4RB1A 2CYYA 1HXDA 3A02A 1WCMJ 5AC93 3ETQA 2KT0A 5JMOA 3DBLB 1PZ8A 3WGIA 5FPLA 1MVQA 1MD0A 1F5JA 3V0AA 4A0XA 3CO2A 3WW4A 4CSWA 3VDBA 1ULFA 2E5ZA 5FY5A 2A69F 1IO2A 2NMOA 3PTRB 4GYGA 2KIMA 4QKDA 3T5XA 1CAVB 1MMNA 1YQ2A 2IA2A 4ZZ5A 3I59B 1OD5A 3MFAA 1ZK8A 3CF5F 4UW6A 1BBT3 2CQ7A 3WP6A 3SCHA 1WLWA 2ZJRF 2JDPA 4XFIA 2VW0A 9ANTA 3I3MA 4AIJA 1ULEA 2L7ZA 1RIOH 4QHZA 4TSVA 3BTCA 4MNUA 4L5JA 4O3MA 5FZCA 3LSKA 2GU9A 3KEYA 3VBOA 1AR62 1W2AX 1UXXX 2XJVA 3S8PA 3NKGA 1FBSA 4P5OA 1AU7A 1Z7S2 1R092 1XMXA 3CCYA 2B5HA 4JX5A 4IE4A 4LLGF 4J1WA 3DPLC 1V6OA 1MS0A 1ZKGA 2R7FA 3VBUB 1FNZA 3K4BA 1YHFA 1LE8B 1W36C 4NWWA 4EWDA 1YQCA 3WU2C 3ZKYA 1O6UA 5FPBA 2NPIA 1CQTA 1NE6A 2XGEA 5J36A 4NHYA 3D1NI 2ADDA 1ZN2A 4CUCA 1LFBA 1SFYA 5FO7B 4UFJA 3PIOF 2R7XA 2W48A 1RUJ2 2W1WA 5HOOA 1UL9A 4CU9A 2R071 1QZYA 5J1RA 1WBFA 4RAYA 3IL2A 2QVSB 3V0AB 3DYMA 1JYNA 3RQIA 1LKXA 3H0OA 3LIHA 3EYPA 2P81A 1ETKA 4B47A 3S32A 2HWF3 3I9V2 1GZWA 1XOYA 4YG0A 2E1MC 3LFIA 4COYA 2D3SA 2H6BA 2F4PA 3J7AO 4CDWA 2V1NA 4XM3A 2OQ6A 2VOOA 1QEXA 5K5RA 2VQ0A 5FY4A 3GMEA 1YO5C 4L9JA 5LGUA 2QSHX 1H8VA 2WR9A 4FFHA 3CL1A 4Q2FA 3ZQHA 3BR2A 3TQNA 3VWBA 2FMDA 2HPMA 4XCAA 1JTYA 5M0TA 3K70D 2WC2A 2JX9A 1KU7A 3KLSA 1W7PD 3VSLA 1PO21 4NIAA 2CRGA 3AXEA 2ZXQA 2E2IJ 3KVAA 4HKLA 2R061 2F6CA 5FKLA 3GX4X 3HQXA 5EJ3A 1DU6A 1U12A 5FYVA 1W6MB 1JYCA 3CCUI 4CDWB 3V0BB 5KCMA 2CAUA 1AF9A 4LOCA 3JSOA 1R1TA 2ZGMA 1YI2I 4BDYA 2EV0A 2DQLA 1HXS2 4YW7A 1U5XA 3HMYA 1AX1A 3HT2A 1GXQA 4EN7B 1EY2A 1Q56A 1AOYA 3VBRB 1MMDA 1VMJA 3GM8A 4ISQA 2L3DA 3SQOA 5GALA 4KNYA 4E70A 2HVQA 4P08A 5JZGA 3WTSC 3BG7A 2BRTA 1URXA 1RVF1 4V2VA 4KL1A 2YUEA 2MLGA 4I7HA 1LGBA 4R8HA 5DUKA 2UURA 3TEDA 5T5OA 1PMHX 1OPOA 4QB2A 5FZ8A 3D6EA 2I10A 1XGSA 2ESHA 1B1BA 2DVGA 1CPNA 4CP0A 1QDOA 4NRQA 5K1YA 4LBQD 2HH9A 1UMQA 1OQYA 3K48A 2RS53 4IEYA 2M30A 2J7MA 1ZZ6A 1JZ3A 3P7NA 2RS51 1MSEC 1SFNA 4W4ZA 1FPQA 4MSVA 4FSJA 3DV8A 1TEIA 2R7DA 4BIFA 2A1XA 5IP9J 1YYVA 1RUNA 2VBPA 3PU3A 2LTNA 3WODF 1PX4A 5BNQA 2JRMA 4KWKA 3U10A 5D21A 4CCDA 1HV0A 4XQ4A 3WY6A 5CLSA 2VU9A 1HRV3 2DJIA 4LT5A 5DN2A 2CTVA 2P6TA 2DURA 1ND2A 5CISA 1FBQA 5DS9A 1GP6A 2AYHA 2W47A 2KIUA 2G19A 1HSJA 1S2KA 4BYYA 2DI3A 4IEQA 3ACFA 1U6GA 1C1FA 3DBRB 2PHDA 3L9JT 1IUFA 3S17J 2LD5A 2MFZA 4BQNA 3T3YA 1IUYA 2IPQX 3VB2A 4BDZA 1RGSA 2WZEA 3LF7A 5ACA3 2YPJA 1OPCA 4XTPA 2F4MB 2QEXI 1B72A 1JT0A 2E7AA 1P4WA 2HOEA 4IQPA 1G6NA 4RGXA 1WLDA 1GHCA 5TISC 1IF1A 5FZEA 2ID3A 1VRH1 1KGSA 3LEIA 5FDBA 2JDUA 3NWSA 4IW3A 4P9XA 3H9AA 4S2FA 2Q2EB 4CCJA 1X9TA 4LBNA 2EJRA 3WV6A 4K1ZA 4E7IA 3WDXA 1SD4A 5J96B 5IYBJ 4FE7A 3CZ6A 4IX7A 2D7FA 1HRI2 2FCVA 4LQRA 4Z92B 4FE4A 3KV4A 2AXLA 5GLVA 4LG0B 1EPZA 1JOBA 1WJFA 5A6XA 3KP2A 2V1DA 4P5HA 3IHUA 3O0WA 5EZHA 3ZLIA 3OSFA 1EA3A 3AJZA 1NAEA 3E6DA 1HB4A 4YRDA 4KQ7A 4CEWC 3K1PA 2DYSH 1R1A3 1HX6A 5DV5A 2DPUA 1OCPA 4A7KA 2RNJA 4I0BA 2FBHA 4Q5OA 2A6EF 5A70A 5L9VA 4AUXA 3C7FA 4BEHB 1MEC3 2Q8EA 5E88A 4P00B 4GQ7A 4BJ6C 2W84A 1AX0A 1X1CA 1P7IA 2BVVA 2P7CB 1COV3 2XQRA 4XVHA 5K0UB 4QX7A 4XBNA 3ETPA 3KLOA 4M6VA 4BS9A 3MLKA 1TT0A 4YFWA 3LA3A 1XDUA 2FDFA 4XUPA 4D0QA 4L9NA 1L3LA 3IH3A 1DU0A 4F8AA 1WCDJ 1MACA 1FXZA 1H8TC 2W0XA 1JN2P 1YFYA 5JXGA 5JHFA 3B93A 2V4VA 5HLGA 3S2WA 3KYDB 2M8EA 2ZAAA 2FBEA 1CR7A 4WXCA 3MZ8A 2CG4A 5FYHA 4HNVA 3B3QE 4XFBA 3D8CA 3ZQLA 3VLBB 2QSFX 1Z7S3 2Y6FA 2ZHKA 5CBLA 4Y4RA 2XWBB 1BI1A 4B1LA 1OH4A 2J5OA 3KP7A 4RHV3 2K02A 3FBNB 1CX1A 2CW7A 1CAUA 1OLQA 3WNXA 3PIGA 1QJY1 2BZTA 2JE7A 1F4KA 1A31A 4L9BA 4A6SA 1W2UA 2JUCA 2M0CA 1UY4A 4AEDB 3T09A 2DYCA 4DBQA 2VL8A 1ZREA 3ZXSA 2ZB9A 3NNGA 5FQ0B 1IXRC 2HYGD 1HLCA 1H88C 1YOVB 1RITA 1W3VA 4RR3C 4YIIA 5F39A 3C3WA 4ZXKA 3RZJA 4YGBA 3RKXA 2ZXIA 2NVQJ 2W5FA 1AYM2 2P0WA 3ECHA 1ZLJA 4P55A 3N97A 1XU2A 3V0BA 2P37A 3E6CC 1PGW1 3I8TA 4Q26A 3K6GA 5K5OA 1W6MA 2OC6A 1FSHA 1RUC3 3ZIXA 4HVQA 3AZWA 2QQJA 1VPHA 3AKRA 3FN9A 2DAOA 4JGYB 4H55A 4Q4Y2 3VPRA 4JGZB 3HSEA 1S5LC 3J80K 3GJAA 5ILUA 4CDXB 5FK7A 3CBNA 1JGSA 3WUCA 2GLOA 1W0PA 4Y33A 4HETA 4G6DA 4UF0B 3PVOA 4BQ2A 4IV3B 2XF6A 4EYUA 1ENRA 4CCLA 4GB32 3RWNA 5CFCC 1IG0A 4IGPA 2XB0X 3AC0A 3HHHA 4E9KA 2XAFA 1YIJI 1TMF3 1A34A 3KLNA 4YYOA 2YU9J 3NV4A 3PSIA 1DQ2A 1ZH5A 2L9VA 1ZELA 2XVKA 1C8M2 3O0VA 1F5FA 3TW6A 1PO23 1S4CA 4ZTFA 1JYWA 3C3VA 4A42A 2XB6C 2R063 4JQRA 2Y0SA 2ZMLA 4WM7B 1CIYA 3F8MA 4KGGA 4X8NA 5I91A 1XBFA 4XYXA 1K5MB 4FT8A 4JC1A 1ETYA 5IT9Z 3GFJA 3MVPA 1H1IA 1VLNA 1WMEA 1OCOH 3H3VK 4UFLA 3GZNB 4OMYA 1MMSA 4H7LA 3CP2A 4FPGA 3R6SA 4CEYC 2VOXA 3PJQA 1D8KA 2JSCA 1UD1A 2W9XA 4N7UA 2E60A 4QDSA 3BZKA 3IM0A 4AHZA 4LO5B 2WB1N 3PUIA 2DT5A 2Y6GA 2BERA 2R5ZA 4P9WA 4AVTA 4LHLA 5FMCA 4XZUG 4MZUA 4XJAA 1JZ5A 1TW2A 3O1MA 4B44A 2NP0A 1E5IA 3VBUA 4H0EA 5BNGA 1O7FA 1XXNA 5A1FA 3Q5FA 3CQZJ 3MIDA 4N53C 4ZY9A 5T5PA 3AZXA 4N43A 2GC3A 4SBVA 4BQ4A 1D0ZA 1OYWA 2RDSA 4QM9A 3AMQA 3O8HA 4P9UA 1WMFA 2OT7A 3DU6A 1B59A 3K75B 1LRHA 4EE2A 3LSGA 2ZEXA 1OLME 1NLSA 4IQ4A 3DTEA 1YX5A 4ASMB 2JQ7A 5FQ0A 5EEHA 3B69A 4F3QA 1OA3A 2XAUA 3W6JB 5F3EA 4L2NA 5C3SA 1FT9A 1H30A 3IPVA 3DL3A 1MIJA 1OCRH 3TBIA 2JDZA 1D1BA 3KP4A 2LH9A 5JUVA 5H9QA 2BV4A 3FMSA 3NRUA 3KGZA 1SVOA 1LE8A 1OD3A 2BWAA 1CAUB 3BR5A 4CA0A 2ZBKA 2P2KA 5TGTA 3SZTA 2XSDC 2EXIA 1HQWA 1GNHA 1MS4A 2R042 1W8WA 4AEJA 2P17A 5FKKA 2BWCA 1WJAA 3SH3A 2GN7A 3U2RA 4Q48A 1S0CA 3JUUA 4AGVA 1QOSA 3RNSA 2JMWA 5CADA 1ZGAA 1QZZA 4RLQA 1XSDA 3P5JA 4NO4A 1HB1A 2DV9A 1O4XA 3H1MA 4S2DA 2V79A 4YFZA 2RS32 3PDQA 1ODNA 1FTTA 4Y5Z0 2FXAA 3WP5A 1X3WB 3J81Z 1F9KA 4UW5A 3CCRI 5FROA 4KITB 3VKFC 2TDXA 4LA3A 4NPMA 1WPKA 3FHAA 4N9IA 5HLHA 5FY8A 2VZTA 1ORKA 2JK3A 2HZDA 4NRPA 1K78B 5D5XB 4DNCA 4PSXA 1JU3A 3OYKA 2L7FP 4AYBN 1J84A 3MIEA 4LMYA 4BQOA 1TQMA 1KRIA 2NXNB 2RDNA 5I0SA 5FMOS 1W7PA 4P9YA 5DG2A 3VEPA 3TOAA 3KFWX 2EILH 5A2QK 5D6FA 1MBEA 2FF4A 2OA4A 1X1DA 2VT3A 4LEJA 3ERMA 2KHMA 1G3YA 1AR61 4RGAA 4CO8A 3ZYBA 4AWXB 1W99A 3ES4A 4GWNA 1PDNC 3MKZA 1UO9A 1VIWB 4F83A 1XGNA 3POSA 1S55A 5F27A 4M6YA 2P5LC 1DPUA 5ABJC 3ZR6A 3OS0A 2E36A 1JUMA 2JWTA 2CU5A 4NPLA 4URTA 2RREA 1EAH3 3IKTA 4BOWA 4EVIA 4IRHA 3K4ZA 4LKEA 1I5PA 4BQAA 3EDPA 3PUQA 4ES9A 4BQQA 2E63A 2JIGA 2FQPA 2OW4A 1RUI1 4S2HA 2GALA 3PO2J 4DOZA 1QVUA 3RI4A 2P34A 4BISA 4Q8LA 2AENA 4MEXF 5JCTA 1Y9MA 1RXFA 1I1GA 1VMHA 3AFHA 3TO7A 1KQRA 2WJSA 3BODA 3U4SA 2BNMA 2TNFA 3DQVC 3JBG3 4F93B 2RMU1 4OUSA 4GIQA 1JZ6A 1SAXA 2VNOA 4XAEA 3HOBA 2FCTA 2Y34A 3JBG1 4XHXA 1BQPA 2P3JA 2PQQA 5AONA 1K79A 1XU1A 4LBQA 3IUOA 4XNFA 5FD6A 3JD71 4YZ3A 3OY8B 4QPWA 3VBHB 1N1TA 3IH2A 1UF2C 3A03A 3ZXKA 3KT4A 1HV1A 2FDIA 4MO7A 2O8OA 3SEPA 3SXWA 5LFAA 5ICFA 4JDNA 1H2LA 1MW7A 1R23A 4D7MA 2FD5A 2VVFA 2K5CA 2QQWA 1WSUA 2Y69H 4BK5A 3RZMA 2CU7A 4QXKA 3UT0A 4AZZA 2WV1A 3L2HA 2KL4A 3LFUA 3MV01 5A80A 2X6WA 1RPWA 2WYFA 2L7KA 5B4NA 3DYOA 4BHCA 4I0AA 2ZJ2A 5IK4A 1XYPA 2V9KA 3WDYA 3PL8A 2VC0A 2HDDA 3ZGKA 4N43B 2JENA 4JDOA 2BW3B 3U75A 3CCEI 3FBYA 1R093 1GKBA 5C71A 2HYJA 2FMLA 2BGOA 2GWRA 1Y1WJ 5CVVA 4C91A 2MGQA 1KGYA 1UELB 4DRVA 4UYBA 4R79A 5JR2A 1D3YA 3CDHA 2PTMA 2HWE3 2IGKA 3SQNA 2VPVA 4BBRJ 1YRNB 2Y0OA 3FXKA 5GZEA 2JZYA 1CVNA 4GWMA 4FPYA 2IZWA 3SNMA 5E20A 5F3CA 3P3NA 2VJXA 1RUC1 2V73A 2RDQA 1VB2A 1K61A 1ZR4A 1GANA 3H1CA 3KP6A 3LA7A 2NOJB 1K4TA 1FBUA 2A6ZA 3HRUA 3CEWA 2ZGKA 3UGFA 4Y22A 3QQAA 3A4UA 5C4WB 2ILMA 2ZJCA 1HRI3 1RR7A 3TOBA 2WWSA 2D6PA 4XE9A 4KDPA 4AQSA 1HRI1 3AL0B 2E1MB 3BG6A 1GQPA 4HKWA 4DJAA 1R083 1KU2A 4YZ5A 1TMF1 3WCRA 3D82A 4RSUA 4K8RB 4IDZA 1PVC1 1YLFA 2WAFA 3TDZC 5HS7A 1LNSA 1WCUA 1GYKA 1W6QA 3REOA 3ABTA 1MQTA 1ULOA 5FWEA 5BNNC 4HLXA 5CYVA 3DEMA 3TBDA 3WZ1A 3OBZA 3NV1A 1U0JA 2DU1A 4HMZA 4CUBA 1U78A 1TLHB 3R61A 2BEOA 3O1UA 4HNTA 2M45A 4A12A 2R1DA 2WFF3 1ULCA 1PZ9A 2DMUA 2OX0A 3K3OA 4NQWB 3JRAA 1AX2A 3HD8B 3AKQA 4FOYA 5FZ1A 4IO9F 1IS5A 4OFGA 2XVCA 4I09A 1E17A 1UNBA 1WMDA 2L02A 4F55A 4NIHA 3AXDA 5J37A 3FHZA 3GUDA 3KHBA 2HPIA 4R9DA 1F35A 1T08B 1CESA 4N53B 4BQ3A 3CUQB 2J5PA 3ILNA 2X5IC 1CD3G 5IT6A 1R22A 3QPSA 4LIUA 3NW4A 4YVSA 3V64A 1VNDA 1VQLI 2E1OA 3WTUC 2QNKA 3DF8A 3GYDA 4OI0A 4RFRB 4LLLA 5E3OA 4KMQA 1FYKA 4HV6A 2DUOA 1VR3A 2WAAA 4ZS2A 2JKBA 2YU1A 2RS33 4DPNA 2GMPA 1LUJB 3I54A 1KITA 5DDGA 1OCCH 4CP9B 2E35A 3UGGA 5I8TA 1MJBA 3CCQI 2V4JC 4FTHA 2VUMJ 3DXUA 1RMU3 1XJAA 3QP5A 2R16A 1Z6RA 4NOTA 4UFMA 4QPYA 3BT9A 3ACLA 1MZEA 4M3EA 4Y1XA 3C2HA 3F8NA 2M1BA 2NOGA 5KHIA 3K4MA 2EIGA 2HI3A 3ASIA 3UV9A 3ME2A 3BR1A 1OOPB 3WX5A 2VE1A 1UAIA 2R32A 3VHPA 3PURA 1UOBA 3IWZA 3PO3J 4H7MA 3WGHA 2ICWG 3MCZA 2I45A 5IFTA 3O14A 3O2PE 3M4FA 3S5QA 4JGZA 1IPSA 3OPTA 2KFDA 2VUJA 1YWKA 2EXHA 3NJYA 1R49A 3QACA 5DXDA 2ZGPA 3BU0A 4FOVA 4C0BA 3U0ZA 5GZFA 3S14J 2ORZA 2HTJA 4CGZA 4X6RB 3ZPOA 2EICA 4XN0A 1ZZ7A 2OUHA 3ABLH 1DLCA 1QOTA 4FPJA 3AKZA 3AP9A 2XIGA 4AIKA 1YXWA 2WN2A 3K4AA 2WWJA 4QAWA 4GGGA 4BXFA 5FPAA 5KWRA 3THDA 4MUVA 2KM2A 3HXLA 2WT2A 4FAGA 4NPRA 1X58A 3JB8A 4XEZA 4JRAA 3OJBA 4XFAA 1IGOA 1UJ8A 1JZ8A 5FZGA 3I4MJ 4HVOA 1FPN1 2PMUA 4PLOA 1BZWA 4WM7A 1TQIA 1MEC2 4OMZA 5L3FA 3GF6A 2E34A 4HF2A 1PJRA 1UOGA 1O4TA 3V56A 4QSHA 3PIPF 3K9TA 2DFEA 3RMYA 3CUQC 2DPDA 1ENXA 2VBWA 2WV0A 3C7HA 1GZCA 1SLIA 1EUTA 1C5HA 2P3KA 2CGOA 5CZKA 4EJOA 1DF0A 5JLWA 4LGWA 1SLAA 3V7CA 3G73A 3IMNA 5BQTA 4DINB 1AXYA 3BPVA 2XJTA 3H50A 3X29B 4ZZDA 4Y20A 2DUQA 2GNTA 1R7JA 3T1LA 4AQ2A 3V8LA 3GFLA 5KHDA 3IZOA 3KMHA 1V00A 3VHOA 3ASOH 3H36A 3N9OA 2VBZA 2XVGA 3BOPA 3DKXA 3CZJA 4L8QA 4IE0A 5J8FA 3BQZA 2R30A 2K85A 1S8NA 4NIDA 1UIKA 2VOVA 2F5FA 4PGHA 3A0NA 3KPHA 4RAZA 1F15A 5A3NA 1YRZA 2QVOA 2D1HA 5L3BA 1VQ5I 2AR6A 4PUSA 3P9KA 1PGSA 1NCRA 2GZWA 2JDYA 3GCWA 2EVXA 2ZEWA 4AEDA 5FZMA 1VZ0A 1VQPI 4RQPC 2M7BA 1RI7A 4FPOB 2RVCA 3POFA 4Y7NJ 2FZ1A 2B42B 4H2AA 1BW6A 4IPAA 2EIKH 5FFZA 4YW3A 3WQBA 5EGOA 4NHMA 1I39A 1AKHA 3ILFA 3R05A 3WNKA 2D1VA 3THCA 2YFUA 2JVGA 2ZA9A 5DUXA 5B66C 3MW4A 4FFIA 1UFMA 3KV9A 4PCRA 2D97A 2ZTNA 1P9QC 2VUDA 4BH9A 1QQIA 4IOCF 1SDWA 2PHRA 4WM8B 4CDUB 5M5WJ 2GC2A 1UZWA 5FRNA 2Z4FA 4GXOA 1S9HA 4EGZA 5CYYA 4WBBA 4KU8A 2VB6A 4N9HA 3DPUA 3POYA 2XB5A 2IGMA 4EMSA 5FAXA 3H3UA 4COUA 3FJSA 3VD5A 3FC0A 3D5OA 3GTKJ 4GDFA 2PBIA 3APBA 1VB4A 3J7LA 4XW3A 3AYDA 3MZHA 4JKMA 4HSRA 2WAQN 1O8PA 3GTLJ 1JYVA 5K5QA 5K7PA 4TWTA 1ZNPA 4MQVA 1W9WA 4MGQA 4RL7A 3ECOA 4B3NA 2HWC1 5FLIA 4W50A 4MXVA 3S1QJ 1W6PB 3HZJA 1W90A 1U8RA 2XUMA 3IRQA 3MUY1 2XJSA 3T8TA 2PELA 2RN7A 2HYXA 3BY6A 4NRMA 3CO6C 5C7GA 2JA7J 1CQ9A 2W87A 3AZYA 4XACA 1DU3D 4YVSC 5K7FA 1LHOA 4WVZA 1DYOA 2G4IA 1GT0C 1VAKA 2A5WA 4A69C 1G86A 5LBBA 3K4JA 3K2ZA 1B9MA 2W3JA 5EG0B 5GAHJ 3C1DA 3F9KA 2Y2ZA 1NCQC 1QJX1 2PFBA 1OPMA 4I3PA 1T8IA 2GQQA 1BI0A 1QJU2 4I98B 3U14A 1RUJ1 5FZOA 3PU8A 2UYAA 3T2PA 3NNLA 3OYMA 2ISYA 3S6PA 3NJXA 5F6LB 5LA1A 4UT5A 4M9XA 2VTXJ 2DOEA 3AG1H 3RPUA 4E4DX 4XOTA 4E8DA 2BY3A 4NJ4A 1G9BA 1ZRFA 1N1VA 3R4KA 2KP6A 1JUHA 4IJAA 1AL23 1W05A 1HKDA 1PNFA 4WX9A 5J6XA 2JJ6A 1AL21 3VZOA 3M9AA 3OUIA 2YR2A 4GB33 3VBOB 3H9JA 2BJSA 2Q0AA 4FTSA 3WR0A 5IVVA 4ATFA 2WL1A 4GB31 3F8FA 4UV8A 2ATFA 2DCEA 1XGOA 3BLYA 4YARA 4J6GA 2ZBJA 1RUH1 2D3PA 2CV6A 4OHWA 2XRLA 4L9TA 4JQTA 3QLQA 3JTGA 5HLTA 3COAC 3FHNA 2XMLA 2ZX2A 5CKMA 1CZTA 5JVVA 5B3SH 4DUVA 4AF9A 1B09A 1EJ9A 2A70A 2LY1A 1RMU1 1W9TA 5FMOL 4P5YA 1JZ7A 1AL22 4LJHA 2I2SA 3POWA 1FAYA 3P6BA 2JICA 1KA8A 2JT1A 4IEVA 4MGKE 2XV4S 2CGNA 1OA4A 2QQBA 4WZFA 1WJDA 5IAVA 2C5DA 3IDEA 3GZUC 1BVVA 4J25A 3HSRA 5J7MA 1UZYA 4EN9B 3VYSB 3ROUA 1MQTC 1YUDA 2RC4A 2QQAA 4HOBA 1UY2A 4O6JA 4TYSA 1A8DA 3Q9SA 5FZFA 2R7SA 4XLCA 3CMEI 4A5NA 2STTA 2JG9C 5LK5A 4HN0A 4PIYA 1DFQA 1B6AA 3WTWC 3WP3A 2Q30A 4FCYA 5HNFA 3M7GA 3ZMDA 5JZGB 1IRXA 3MPPG 1R4MB 2Q2EA 3OG2A 2TBVA 2J1SA 4L97A 1JKPC 4E6KG 2A3SA 1L7LA 3MD2A 4P9FA 4D1QA 2RS31 5HCAA 3VOEA 4OI4A 4V2GA 3TRSB 2ZGUA 2C9AA 5JR3A 4ES8A 3ZN6A 2RS52 1Z7LA 2ZKLA 2DW4A 4RBOA 2KZGA 4L92A 5DPNA 2FHRA 5FR3A 1WJ5A 3SCGA 3WDTA 4WWCA 1UX6A 3I49A 1WZXA 4ZDPA 2EA2A 1PIV2 2PJRA 3IKWA 1VBA1 4GJYA 1K6YA 1HBXG 3NNFA 1D5VA 3NL1A 1NK2P 3HR9A 1YJWI 1WJBA 4A3BJ 4S0HB 4OUMA 3FBIB 3WXPA 2R7UA 4Z8BA 3H5AA 4JP0A 1MJ9A 1V5EA 3G4SI 5FB2A 4LKFA 2R7RA 1MPXA 4U0YA 3T1MA 4UFHA 1P4AA 1OHFA 5H9PA 3OYLA 4ASNA 4G3YC 4BHBA 2WO2A 1X3ZB 1SD6A 2DU0A 1OQ1A 5H6QA 2D43A 1OT5A 3E1SA 1FEXA 2EXKA 3ZQ7A 3ZOBA 5C3QA 2EV6A 2Y6HA 3M3IA 3U4XA 4II2A 3GFMA 5HV0A 3IRRA 2ZMNA 3K70C 5FPXA 2V9PA 3WTZA 3M8FA 3PTYA 2QCSB 5FCCA 2LREA 3KP5A 2RQQA 1JOPA 3K77A 1Z91A 3Q3SA 4Q4X2 5FUIA 4FISA 1QY4A 2Y9YA 2QBYB 4R4ZA 1WCQA 4KWLA 2PHLA 4PF1A 3N9QA 1RETA 1K7AA 1AR71 3WW2A 3LOCA 1SFEA 2O0OA 2IGNA 5FYYA 1EAH2 1E5RA 1W04A 2VOKA 2BVMA 1BLZA 2VNRA 2YX7A 4OMCA 1D8JA 1SBEA 5JXJA 4HEA2 1K42A 3HOZJ 1BEV3 3MZYA 4QPQA 3BI3A 2VOPA 3I3LA 2XDVA 3AG2H 1CAWA 2AREA 3TO9A 3HQUA 2FNPA 2CFOA 2BVBA 1DYKA 5IVFA 1LCLA 2ZSHB 3POGA 4DO0A 1RUE2 2PFWA 1IAWA 4YG6A 5DG1A 4BQWA 3CJRB 1OOPC 5K4LA 2M3AA 2IXSA 3V8JA 1ND2C 1OYYA 5HCHA 2CUJA 5JPNB 1W6OB 3FX3A 2OZUA 1OYIA 2PHTA 1X8EA 2CUFA 3VZLA 5E17F 1V0AA 2FJ1A 3J80Z 2VXJA 1DZTA 2XQXA 4ZPIA 4DEVA 1KDKA 3ABMH 2D5VA 5EPAA 4HK8A 4WVMA 2E2HJ 1FATA 3D3AA 2R93J 4Y1YA 5FP7A 3CMYA 5GZGA 3LSHA 5FREA 5EV7A 2DMQA 5EZGA 3HPGA 4NAMA 5DDJ3 4LBLA 3L2UA 2PG4A 3IAS2 2VNGA 1QA6A 2ZKNA 1ZZCA 3Q9VA 1KZHA 4GCVA 3CUOA 3OTFA 3NWKA 1VAMA 3AKTA 1JE8A 4RA0A 1KS5A 3WNLA 4XQFA 2J1RA 1OVPA 2R7VA 5C9AA 2XASA 2ARAA 2PHFA 1RVF2 4AHWA 4LK7A 2WY8Q 2PX9A 2IVMA 4U0WA 2EA4A 4O9EA 2WAEA 4G12A 2ZGNA 3OIOA 1A3KA 1ACCA 1RESA 4F92B 1MBHA 5ACA1 1K6OA 4D3WA 2DQRA 3I2FA 5K8SA 3OIPA 3HOUJ 3UYJA 1EV13 3L00A 1IV6A 1W39A 3TO6A 3BROA 2EK5A 3W2AA 1MDMA 4XKWA 2G1MA 4IUGA 2CUZA 2QQUA 1RC9A 3JRFA 1OCZH 1BK0A 3OOPA 1UMHA 3WW3A 3TWIA 3CCJI 2BXYA 3W3CA 3K3NA 4OAZA 5A3PA 3OYNA 2YROA 2X4HA 5FZDA 2AO9A 2K4JA 4KG0A 3J8F1 4KN4X 1QQP2 4IL7A 4PBOA 5JZGC 3LSDA 2CWEA 2ZFUA 4YZ4A 4YW6A 4QDQA 4RGUA 1UY0A 1HQNA 4NHJA 1VBE3 2BY0A 1AYN1 3I2OA 2R5YA 1FMD2 3T8RA 1JKQC 2EFQA 5H20A 4CTEA 3KEQA 3MF6A 3T08A 1EH7A 4XORA 5FMBA 1BJZA 1QQP1 3CJIB 3AYEA 3V7SA 2K9QA 3KZIC 1COV1 1CAXA 2ZNYA 1Q8OA 1S0GA 1GV5A 3NV3A 4JBAA 1CJDA 3S2HJ 3ZYIB 5LA0A 4FHTA 5KAFC 3DFGA 4FP3A 2BV6A 3IIAA 4AEDC 1D5YA 1C0WA 3UJQA 2JG9A 1YIFA 1J09A 1X33A 4E7SA 2O03A 5AFEA 4EGYA 2ZFWA 1YW9A 1VQKI 1VQ6I 4IGOA 3VZMA 3CTAA 1NX9A 2OA2A 3UNPA 5FYCA 4XURA 3VDDC 4XOGA 2QQMA 4RYDA 1T6GC 2XBO2 5LA9A 2MD0A 1QNYA 3VBOC 2DBNA 1RUJ3 1J3QA 1GLNA 3NMBA 1Z7S1 5FYMA 2GMMA 1T0FA 1A36A 1EH8A 2Z42A 2VBXA 2P5BA 4DY5A 2Y75A 2K9NA 1YJLA 4KNCA 3KT7A 2VECA 4FPFA 3ZSMA 3WNMA 3S3NA 2AXTC 4OIQF 2DXIA 4B3AA 1J2XA 3ERED 4NB5A 4DW6A 2XF7A 2VOWA 2F6BA 3NO8A 3BTAA 1XSXA 5C3RA 1NCQB 3VBFB 5E1ZB 4LK0F 1AYM1 5JIUA 2VXZA 4BXSV 1NHAA 2W52A 3N36A 1HB2A 1ODDA 1BBT2 3GHMA 4D6SA 3H5NA 1H8AC 3AL0C 3HOVJ 2JPCA 3U37A 2Z69A 2WNUB 3SFZA 1SLTA 4Q4W2 1W2NA 2V26A 3NJZA 4CEWB 4QGLA 1HN0A 4XETA 5F5IA 3GJBA 1OLMA 1YS7A 4CXXA 1VBC1 4M3CA 3WNOA 3E6MA 2HDCA 3PMEA 2WWUA 2OF7A 5A7WB 3NNMA 1ZBE2 2WYSA 5J1YA 4MYEA 5C44J 2VODA 5FYSA 2XAJA 2NNYA 1OSGA 1ETQA 2R0QC 2M4KA 6PAXA 5FYUA 1O3QA 4KYWA 2XLFA 1I27A 4KISA 5IVJA 2QBYA 2J1TA 3C7OA 3CMMA 3GCMA 1TTYA 4FP2A 4QPGA 5T5JA 3N7LA 4R9AA 3FZVA 2BUKA 2DCKA 2DA6A 4YW5A 2KDZA 5FYTA 4Y1UA 2B46X 2XF5A 3T2QA 3FK7A 3DF0A 1OQEA 2OYZA 3PNYA 1AJOA 2Q1ZB 5EEGA 2XHNA 1IPKA 4A3GJ 1JW6A 1ENHA 4XKVA 5F0HA 1YFWA 3VBSB 2KKOA 4Q27A 3ITQA 3RIRA 2PMZA 2XGXA 4LITA 2X1EA 2VJ5A 4PIXA 5FZ6A 3ZFEA 1UHWA 1HDDC 4PJLA 2AC1A 2CDOA 4GD4A 1AR73 4CDWC 2KQRA 1G9DA 1B8IB 3MEPA 1REDA 3EUKL 1VMFA 3I3EA 3SEQA 1Q8QA 4GWIA 4A6OA 5A32B 3HOSA 3WDWA 1J1LA 1Z0XA 3KYLA 1C4RA 3WF2A 4PSWA 2QZ3A 2H94A 2ZXWH 3H1WA 2XKPA 4OYUA 3TL4X 2YPRA 3LD8A 2YXSA 3POIA 4A3KJ 2HWD2 2X5IA 2GH2A 2CQKA 2GSYA 4LUMA 3FWEA 5EYRA 4II3A 2Y64A 2C6SA 3J4UH 3QBQA 3IC7A 2WNUC 1JJ8C 5FXXA 5BNPC 2YYOA 5FZ4A 3CLQA 4UFIA 3GTQJ 3AL5A 5B5EC 2WAOA 4AVZA 4I0WB 5IK5A 1N77A 4UWDA 1W8HA 1YNAA 2VH9A 3R0RA 3VKLA 4RGRA 4I6ZA 2UU8A 5APAA 3NQOA 1PP8F 1GICA 5C8CB 2K9LA 1POV0 1G3WA 2AACA 3VBFC 1YW8A 4A3DJ 2CUEA 4QMAA 4R1HA 1XE7A 1K45A 2VQLA 4OI1A 4YG3A 1UCRA 5BY5A 1POQA 2M34A 4CRQA 3G71I 1NXD1 1WA6X 5JSRA 1OKOA 4Y15A 3MKWB 1JHFA 4NHKA 3S93A 4NBQA 1XC6A 3AG3H 3VN4A 3OGRA 4BPZA 3W21A 2NYYA 4XSZF 2DFFA 2W25A 4YM3A 3CP8A 1BR2A 1RIRA 5L19A 3JW4A 3ZPYA 2K27A 3AMNA 4LBJA 5EWSA 1WLCA 2IAIA 3T2TA 4YLZA 3ZDSA 4AAPA 4WM8C 4CDUC 3MIFA 4L0YB 2MW8A 1W8UA 3PM1A 2C1FA 4MO3M 5FP4A 2BYVE 2R5YB 5F0CA 4AQTA 2LC2A 4E8CA 3KZYA 1EV11 5CQEA 3OEBA 5KBFA 2XGDA 5FLMJ 1QJU3 1MZ6A 5LBEA 1QJU1 2FE3A 1F4AA 3N9MA 1ZBE3 5DUWA 4GULA 4A3MJ 3M8EA 4IEZA 4QQHA 1XCVA 4WM7C 4CEYB 3ZXJA 2W7NA 3OSGA 2J1UA 4B4QA 3W59A 4KA4A 3CCSI 5CB7A 1W4MA 1BI3A 4BM8A 3MEXA 3T4HB 1YX3A 1V54H 1RJ7A 5A3WA 3TDUC 3UETA 4H14A 3BR3A 4UVCA 4UUSB 1E3HA 3CC7I 2HWE2 4A6EA 2HWD1 4HG2A 4EZ4A 2YBSA 3DWLE 4XBLA 2W91A 3S2DJ 5K7ZA 3DEUA 3HBLA 3BTYA 5A33B 1RUF1 1UZVA 5JPMB 4D7NA 4Q0UA 3GCXA 1DUXC 1WFXA 4AU7A 5J98B 1XNTA 1XRUA 2JSPA 1LECA 1V5FA 2O8KA 2MBFA 3VGIA 2DMTA 5LA2A 3HYIA 2LUWA 3USUB 1H8TA 3H35A 4LHKA 4PDKA 4YVSB 2Y33A 5BNPB 1J7KA 2F48A 2TCTA 2ZKZA 1SPPA 4P14A 5FBJA 2PHWA 2D6NA 5LHGA 1UG2A 1QH6A 1XCBA 2GAUA 5BV6A 2YX4A 3F2ZA 1IHMA 3OYEA 1G3SA 1U5YA 3FF5A 2R3SA 2Z33A 2ZX1A 1PM7A 2H8RA 1LKNA 1MMGA 3JD73 1UHMA 2B4KA 2QQNA 5FKCA 2DODA 3ML6A 4Q8KA 5C4JJ 5J48A 4XLEA 5HODA 4ZYEA 5DZFA 3KX2A 4FTEA 1WI3A 5FO5A 2LF8A 1UYYA 2EZHA 4V2WA 2RS13 1UU4A 2D45A 4XBFA 1Z77A