3DV8A

Crystal structure of a putative transcriptional regulator of the crp/fnr family (eubrec_1222) from eubacterium rectale atcc 33656 at 2.55 a resolution
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
216
structure length
216
Chain Sequence
ENYFPLWNDLNTAQKKLISDNLITQHVKKGTIIHNGNMDCTGLLLVKSGQLRTYILSDEGREITLYRLFDMDMCLLSASCIMRSIQFEVTIEAEKDTDLWIIPAEIYKGIMKDSAPVANYTNELMATRFSDVMWLIEQIMWKSLDKRVASFLLEETSIEGTNELKITHETIANHLGSHREVITRMLRYFQVEGLVKLSRGKITILDSKRLETLQRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of transcriptional regulator, Crp/Fnr family (RER070207001219) from Eubacterium rectale at 2.55 A resolution
rcsb
source organism Eubacterium rectale atcc 33656
molecule tags Transcription
molecule keywords transcriptional regulator, Crp/Fnr family
total genus 63
structure length 216
sequence length 216
ec nomenclature
pdb deposition date 2008-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3dv8A02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3dv8A01
3L00A 4LULA 4ZYDA 4P55A 2NNNA 5IT9Z 1Q3EA 1V3FA 2P7VB 1FI2A 4XSZF 3D0SA 3P9KA 3ES4A 5J48A 1KQ0A 3I59B 1HKQA 2HQNA 4GYIA 2HS5A 3QPTA 2QENA 2VOOA 2XLFA 4WF2A 5K1YA 3VHRA 1A04A 4XFCA 4J1WA 5I0UA 1O3RA 1O7FA 3NJZA 1DUXC 4WBBA 3QOPA 3IC7A 4O3MA 3O14A 3SMHA 1TNTA 2NNYA 4RAZA 5L3BA 1S7AA 1B9MA 3H1MA 2DQLA 5BY5A 5LRSA 3RZZA 3BJAA 1ZAOA 4XFAA 3ETQA 3BY6A 1IAWA 4XSXF 3KZZA 4OLLA 1DGRA 1CGPA 4HQMA 2M87A 4PGHA 1XE7A 3UKVA 5HLIA 4IEWA 4BNCA 2VOPA 1USSA 4BAYA 1XGMA 3GW2A 1SD4A 3H3UA 5HS7A 3SHRA 4OFGA 2HR3A 2RNJA 4Y15A 1FOKA 1XGNA 4XLPF 1SQ4A 1MZBA 4IPAA 1Y0UA 1SMTA 2GAUA 4ENKA 3OGJA 1FP2A 2CG4A 2LF7A 4XF9A 3FM5A 2FBKA 2ESNA 4JVAA 2O0YA 1LR5A 5CVIA 5ICGA 2EV5A 4OIPF 2BEOA 3RTRA 5EFUA 1HKSA 3KLNA 1ZLKA 4UVCA 4WXHA 1FSHA 2PQQA 3TO9A 1FBUA 1ZG1A 1O3QA 2IVMA 3I54A 1JXSA 1LJ9A 1Z6TA 4S04A 3S7IA 2DT5A 4IVNA 4RGXA 2Z9OA 3ZN1A 4LLNA 1R7JA 2F5FA 4O6JA 4QM8A 4KMUX 1H1IA 4EWEA 1T39A 3WTVC 5ILSA 3I53A 4CO8A 2UY8A 1XDSA 2Z2SB 4LG0A 3SXYA 4KNYA 1HKTA 4S05A 4FX4A 1EYBA 3RJPA 1H0MA 5AIQA 5FLIA 2O03A 3C18A 4KUMA 2DCTA 2JPBA 1ONVA 2MA3A 4LGWA 3GYHX 3EDPA 5H6RA 2H6BA 1IPKA 2Y0OA 4LUMA 4L0YB 2A61A 1BI0A 2HYGD 5BPXA 1QZYA 4XF0A 3RPUA 1L3JA 2LDUA 1JHFA 3F8BA 4X6RB 5F1RA 5ILUA 5E20A 2D5HA 1R1VA 2XRNA 2OZJA 2ZKLA 2IXKA 4XFIA 2PAEA 4KICA 1R23A 2EFPA 1C0WA 1RUOA 3PLQA 1LDKB 2CYYA 2DK8A 1SD7A 3ZDSA 1B4AA 4Q29A 1HQCA 3WG9A 1CAWA 1BOAA 4HF0A 1J9IA 2B5HA 5ED4A 3NL1A 1ZNPA 1LDJA 1MJ9A 4Z07A 3KLOA 1Z9CA 4YFXF 5E1WA 2QM3A 2DK5A 4WCGA 2JZYA 3RYRA 2CO5A 4MHGA 2E9QA 2QDRA 3V7CA 4L9NA 4A6DA 3HHHA 3H1WA 2Z33A 1E2XA 3NQOA 2R7DA 1R58A 2VPVA 3H7JA 5JI6A 4AVCA 2GC0A 2GQQA 1RUNA 4LG0B 4Q0QA 4KWJA 2MH9A 3U0ZA 1Z91A 4Q5SF 4XF3A 3PFIA 1I1SA 2BYVE 1RIOH 1FBSA 1FSEA 4YRDA 1XE8A 1Z1DA 3KEQA 1DPUA 2HQRA 3L2CA 3F21A 4IRHA 3BDDA 3HTSB 2P7CB 4RB1A 1F1ZA 2JPCA 4NVPA 4QM9A 4META 1GVJA 3ZP5A 2G7UA 2P17A 2D5FA 2OU2A 3O2PE 3V7RA 2PEXA 5ERIA 3N97A 4Q0SA 3JAMZ 3HT2A 1TW3A 2DO7A 2V1DA 3BB6A 3JTHA 4MV2A 1Z7UA 4Q0UA 4QX5A 2FOKA 4AQ2A 5HOOA 4CGZA 1YUDA 4UBHA 4HZFA 3USSA 2EVXA 5FDBA 2V6CA 5DEQA 2XAGA 4LD5A 4YNIA 4FX0A 1BIBA 3O6BB 5JSPA 3FZ3A 3TKYA 1J3RA 2Z69A 5D4RA 2PHLA 1FYMA 3SZTA 1SEFA 2QQBA 4MTDA 1IN8A 4WXDA 1HW1A 3WTXC 4FAGA 3M9AA 4HLYA 4JV4A 2P6TA 1UIJA 3RI4A 1FY7A 5FQ0A 2KIUA 3EUHA 3BALA 5HLHA 3IDCB 3ELKA 4MZUA 4BHBA 3ERED 1WI9A 5HDKA 4HA8A 1FP1D 2BV6A 3F8CA 3D82A 3ZPLA 3VEPA 4AWXB 2L4AA 4H0EA 4FAHA 2XAJA 5E1XA 3KGLA 5FCCA 3N4MA 2PLYA 2K4BA 2FBIA 3FX3A 1G3YA 3HUGA 3DPTA 3LAGA 2WWYA 1KU7A 4G6QA 1U12A 1FNNA 4A5NA 3PVBB 2DTRA 1ZN2A 1GXPA 1K6OA 3CLPA 3HOSA 4IEXA 5J8FA 3WGGA 2C0ZA 4A0YA 4GXOA 5JCTA 4KN4X 4L9VA 4L11A 3M7GA 4EVIA 4NB5A 1D8JA 3COAC 2OPKA 1SAXA 5JSRA 2IRFG 5E18F 2Y0MA 3GO5A 2JTVA 2V1UA 2HKOA 1ZRFA 3FJSA 2EA7A 3C3WA 4OOIA 1XSXA 2EFWA 2WFPA 1PM7A 5E1RA 2VC1A 2EB7A 2L4MA 5DUKA 2QBYA 3G3ZA 3EQEA 2PBIA 4TLFA 1CAXA 3ZMZA 1S3JA 5D5VB 1PUEE 4LB5A 2XAHA 5T3NA 4ENJA 3RKWA 2PI0A 4PGGA 4LB6B 3EYIA 1TQPA 3NKTA 2DFIA 2YX4A 5LGNA 2COMA 1Q43A 3HOTA 1VP6A 4E2GA 3DKWA 1S6LA 4MGIE 4IF4A 3ES1A 2P5VA 4IERA 3REOA 4MGZE 3F6VA 1MGTA 2VBWA 3GEZA 6PAXA 4HBNA 2ACJA 1LKNA 2XHKA 2A5YB 3JW4A 1XMKA 2XV4S 1EPZA 3WTTC 3OD0A 1IPJA 1YWKA 4GGGA 1RC6A 4CDGA 4YYOA 4OIQF 1DDNA 2DBBA 1EV7A 3RDIA 4IRIA 2QVOA 5K5QA 4KWKA 1LRHA 4D7TA 3NEUA 2W85A 3QACA 3E5QA 3DL3A 3ZMUA 5I0RA 3D5LA 4U0WA 2F2EA 3G7DA 2VBZA 4U7BA 4HMZA 1KGSA 4IEQA 3MEXA 2J5OA 4EJUA 4PIXA 5DD4A 4ENNA 2UZKA 4QGMA 2ZMEA 5IT3A 2QBYB 1QGPA 5A2QK 3FWEA 3C1DA 3UKNA 2HYFA 1YIOA 4JK1X 1Q1HA 1W7PB 3RYPA 1LQ1A 3H9AA 4HVOA 2IXHA 2HTSA 4QLCU 2KXLA 2ETEA 2YPRA 5FLXZ 3HQXA 4KN7X 1KA8A 4FT8A 3I4PA 1NXMA 1X82A 2LSOA 1Y3TA 1DPRA 2QCSB 4XLNF 2NYXA 5DUIA 2BNMA 3KETA 4XRFA 2CFXA 1J0RA 1TQMA 5HDGA 3EBRA 2OQRA 1HSJA 1K78A 4DINB 1ZG5A 3FXRA 4EM2A 2HFHA 2VQAA 1SFNA 2IC1A 2KIFA 5I8TA 1MDMA 1J2XA 4KL1A 5CVJA 2CWEA 1AOYA 4LA3A 2B8MA 2HDCA 2JSCA 1FYLA 1K78B 1ZVFA 4MQVA 3ZMSA 1O3TA 1QWRA 5FB2A 3KEOA 1GQGA 4YFKF 3ZN0A 1OPCA 2MLGA 2F5DA 3K0LA 1UHMA 2JRTA 1CAWB 1ZZ8A 1ZRCA 4CZZA 1J3QA 3GYDA 1YFUA 5HVQC 5LEKA 1X8MA 2FNPA 2KRFA 1Y9QA 1R5GA 3SZPA 5BOXA 1MKMA 5FLHA 5F64A 1G6NA 2LKPA 1KQ9A 4KDPA 2PN6A 5J6XA 3WGIA 3LAPA 3HRUA 1X3UA 3E97A 2CAUA 3EETA 2IW5A 4XFGA 1QPMA 2Z3YA 5L3EA 1ZRRA 1MD0A 4MGRA 4G7HF 2VBYA 3F23A 2LNBA 1WSUA 3WTWC 3WGHA 3I7DA 2O61A 1J5YA 1JUHA 3CF6E 5AVPA 5KBFA 5FD5A 3ISPA 4GCVA 4R1HA 4A12A 1OYYA 3AAFA 2YSRA 4G6DA 2VODA 3TGNA 2KJCA 3M8FA 5DYMA 3K1PA 4UVBA 4AIKA 4A0ZA 3S0MA 1W4MA 3F6OA 3J81K 3KMHA 3ML6A 2ISYA 2F5EA 1L3LA 2RKHA 3MZYA 1RNLA 5BS6A 4BH9A 3HRMA 3CUQC 1ZHFA 3FHIB 3B02A 1K79A 2F4PA 3WODF 2PHDA 4LLLA 1W7PD 3CUQB 4XEZA 3V8JA 1XSDA 3HSRA 5LGUA 4M6YA 1NZCA 5BPDA 2BNNA 2DU9A 3Q5FA 4ONUA 3EYYA 3IHUA 4XBFA 4QXKA 3C7JA 3DV8A 4I7HA 1B6AA 1PMIA 3SCFA 2IXLA 1DGWA 2MNGA 3HTUA 2R7FA 4M71A 1BIAA 3KP7A 4HDUA 3LQQA 4LLOA 2MHFA 1S8NA 2MD5A 3TOAA 2ELHA 3SXWA 1XCVA 2Z5UA 3QAHA 1WWXA 1AWCA 3NRVA 1D5VA 3KZYA 3RIRA 3L09A 5LHGA 4I3PA 5E1ZB 5D6EA 3CO7C 3GVAA 2TDXA 4M6XA 3CEWA 2ZBKA 4G8XA 2EA4A 4K2EA 2CAVA 4RGUA 1TLHB 3I0TA 3T8TA 3EO6A 2ISZA 3KP3A 1YHFA 1IF1A 3K1NA 5FFXA 3J81Z 3C3VA 5I8SA 2ZKZA 2ET1A 2O8QA 2DPDA 2K0GA 3GLXA 2XLAA 4IEZA 4M72A 5DCMB 5I93A 3ABUA 1LNWA 1DZRA 2CV6A 1O5UA 4UXNA 2HJIA 1H9TA 1HW2A 3P9IA 5LGTA 3BROA 2OAZA 5DDGA 2RV8A 2HGCA 4ORFA 4UHTA 3E3VA 4PZJA 1BI1A 1ZZCA 2B9UA 4CHUA 5I0SA 5FO5A 4P5OA 3IKTA 2K7LA 2KKOA 2XROA 4EM1A 4RD7A 3JZVA 3IRRA 5I91A 2QYOA 4ZH4F 2IXIA 2M1BA 4M9ZA 4R52A 4HSLA 4HBLA 5EEHA 4IEOA 1V70A 1WKMA 2GZWA 2QQ9A 2MH2A 3JSPA 3KP6A 2ETHA 2Q0AA 2FE3A 2VE8A 4XFHA 3KGZA 2VBXA 4IHTA 3FMSA 4ZU5A 3LSTA 2K9ZA 4HAMA 3LWCA 5CYVA 4KT5C 2V09A 3DFGA 2QJVA 5C6CA 3JTGA 2IT0A 2O8XA 2A68F 4WWCA 2Q0OA 3RPQA 4F8AA 2PA7A 1F9NA 2VC0A 2GA1A 3MCZA 5K5RA 1ZZ6A 2YX7A 2W84A 2OA4A 2W25A 1LDDA 1R22A 2QVSB 5CVRA 4QGLA 3WW1A 1CAUB 3KE2A 3J80Z 2WV0A 1LEAA 3TO6A 5FFZA 3S2WA 2FQPA 2H94A 4OINF 3IKVA 3WE3A 4LJZF 2L54A 2PMUA 3NW4A 4ENMA 2E7XA 2UYAA 1LB2A 1HSTA 1J1LA 2ZMEB 1L0OC 4L2NA 5J3UA 3TNQA 1XN7A 3MPBA 3T5XA 3GFIA 1FC3A 1G3SA 2MBFA 2PMHA 3BPXA 5FPXA 3I58A 1ZYRF 2A6EF 1SFXA 2KJBA 3HHGA 2XL7A 1CX4A 1UD1A 1MJAA 2EV6A 4I02A 3ROUA 3WTYC 2AXLA 2HZTA 2XASA 3E6CC 3D0JA 1ZX5A 5EEGA 4G9YA 4KIFA 3F3XA 1BBYA 1I5ZA 4AIJA 2PG4A 1NE4A 4HOBA 3TOBA 3I64A 2GXBA 2XKOA 1YS7A 1ZZ7A 3I71A 1EH7A 3J7AO 2FMYA 3VOEA 2PYTA 5CADA 3S7EA 2BE5F 2GA2A 3G73A 4BYYA 3ECOA 4OMYA 4LFUA 1KU2A 3WU1B 3F8MA 1KYZA 5CU1A 1JE8A 1OYWA 1YO5C 4GULA 4ZU4A 1R1TA 4HQEA 4CICA 3CTAA 1U5TB 2IXJA 4I09A 1SD5A 2PFBA 3VODA 3RNSA 1J75A 2WTEA 3DQVC 4Y13A 5KHJA 4YFNF 4MTEA 1RI7A 2D45A 1JHHA 2PFWA 4HVRA 4HLXA 1ODDA 1USTA 2NAZA 1T0FA 2P4WA 2DPUA 4KMFA 5J8CA 2UXXA 3FXQA 1QXRA 4H7LA 1YW9A 1MDMB 1IXRC 3MWMA 2K27A 3KP5A 2HKXA 4BIFA 5AONA 5I8YA 1J59A 2M8EA 1XSVA 3WTUC 2ZCWA 4WXCA 3M1EA 1T98A 2X4HA 3TNPB 2CGPA 3HYIA 1ZREA 5F6FA 5ICEA 2YU3A 1IW7F 4HX7A 3GZ5A 5LLQA 2OZ6A 4GO1A 5H6QA 2L3DA 3KCCA 3EHKA 1U3EM 3KSCA 4L5IA 2PAKA 4EWDA 1RZ4A 2K02A 1ZGJA 4MGKE 2IP2A 4RB3C 2ZFWA 1TQ5A 1FWZA 1I27A 4TV7A 1IN6A 3QRFF 3BU7A 3MFKA 4L18B 1WA4A 2Q30A 4IRGA 2KIMA 2ZO4A 4UV9A 2EJRA 4IETA 1HBXG 3V8KA 2Y48A 3FMRA 3K2ZA 3FM3A 4Q4ZF 4LK0F 4D7SA 1O7LA 2X0LA 3E5XA 2R3SA 2RDPA 1RTVA 2Q1ZB 2DLLA 4KYWA 4XETA 1UB9A 4YSFA 1TNSA 4Z82A 3BPVA 3R0JA 2GC3A 2DI3A 1TBXA 3V4GA 5FLXK 4QMAA 2D2WA 1BC8C 5HDNA 2GU9A 2M5WA 3BWGA 4ETSA 1QNTA 3GBFA 4Q0PA 2E1CA 3PQJA 4L0ZB 4HVQA 3SCGA 3FHZA 3UKTA 2L02A 2V9VA 4YARA 5K8SA 3BJ6A 4UBGA 3M3IA 4KFCA 4LUKA 4MNUA 2EK5A 5E8IA 3L2HA 3VB2A 2QNKA 5DCFA 3BJOA 2D40A 2G9WA 4HV6A 2VT3A 3GFJA 1F5TA 4PDKA 4LK1F 1P4AA 3H7YA 3FXUA 3WTSC 3DXJF 4UV8A 4L5JA 2Q8KA 3F72A 1BI2A 4HDVA 3DP7A 1XGOA 4EV0A 3ECHA 3HIFA 1IN7A 3IRQA 2ESHA 3MQ0A 5JAXA 3DF8A 3BZ6A 2GH2A 2STTA 3NVCA 4AIHA 4ON0A 2P5LC 3DEUA 3O3KA 3LA2A 1IN4A 4L9JA 2H0VA 1TQIA 2RQPA 2VT2A 2D93A 3M8EA 4R79A 2VE9A 2QUFA 1IRFA 4AXOA 2BGCA 2OQGA 4OMZA 1PDNC 3KP4A 1XMAA 4LTAA 2GC2A 3F22A 3ULQB 1SFEA 4B29A 2XL9A 1ZARA 2K86A 2UY9A 3LFKA 3QP5A 1OYIA 2EV0A 2PAMA 3QPHA 4AD9A 1CAXB 2QLZA 3U9GA 4RGRA 4MUVA 4KIBA 2OA2A 3LWFA 1VTNC 3EQLF 3FE5A 3SQNA 1XCBA 3F8FA 3RKYA 3IWZA 1ZZ9A 1ULYA 3JSOA 1YFYA 4OU0A 3U11A 3LA3A 1BJAA 1G4DA 3VFZA 1PP8F 4OIRF 4Q47A 1IN5A 3Q9SA 1K7AA 5L3FA 3HT1A 4XFFA 2HOEA 3HSEA 4HF2A 4IEVA 3LQRA 3BPZA 3CUOA 1YLFA 4P9GA 1IRGA 4ZU7A 5TRDA 1Z6RA 3GFLA 4P9UA 4KWLA 1XGSA 1UHWA 1F4KA 3ELNA 2PQ8A 3M70A 3R61A 4QWQA 2Q4SA 3MDPA 1R1UA 1ZZBA 2D1HA 4AVPA 2Q2EA 2E1NA 1H9GA 3H3ZA 5FGMA 3ZQ7A 5L3CA 5DD8A 1OI6A 2FMLA 2XAFA 3IL2A 1SFUA 3SCHA 5BPIA 3R4KA 2F5CA 4P9FA 1EH8A 1UPIA 5D8LB 4G7ZF 1ZRDA 3FF5A 2VECA 1R36A 3RYKA 3GWZA 4A6EA 5CVVA 4YG2F 1DZTA 5FPZA 4I0BA 4L9TA 3GXOA 5HS8A 3K69A 4B8XA 1HXDA 2H6CA 1BM9A 3IWFA 2ADUA 1OKRA 1B9NA 2ZXJA 2GC1A 1UIKA 3ACLA 5KHGA 2A07F 4RGSA 1YFWA 2L01A 1XB4A 1OFNA 2QQAA 2V1XA 3GF2A 5JR7B 5D5WB 5JSOA 5K5OA 4NHJA 2ZNZA 3IDBB 1SMYF 3K9TA 4E2SA 1KQ8A 4HN0A 3H8UA 4EM0B 1U6GA 5H20A 5E17F 1MJBA 4IEUA 1EH6A 1FT9A 4EJOA 4EJVA 4E2QA 4EQQA 1KYWA 1U78A 3T0YA 3WTZA 5CJ9A 2VXZA 4QGNA 5FD6A 4WZCA 3MZHA 5BXXA 2FQ3A 3FFQA 4RAYA 4AVAA 2FNAA 4N9IA 2D1VA 4G94A 5E8GA 2UXNA 1QZZA 5D5XB 5KHHA 3T8RA 4RB2C 4MEXF 3TDUC 4A2UA 5LEJA 4HF1A 4ASNA 1W5SA 4BQAA 2ATFA 1WRJA 4Q48A 4M9SA 4FHTA 2G7HA 1S7OA 4ZYHA 3OV8A 3E6BA 4JQFA 3WW4A 1I6XA 1ZLJA 5LRRA 3H92A 2H27A 1T6SA 1QBJA 1FBQA 5BQTA 4MH0E 3TO7A 1TW2A 3LOIA 4U7DA 4RB0A 3FZVA 3WW2A 1D8KA 2GIVA 2EWNA 1NE6A 4M9XA 3R6SA 4M74A 5I0TA 3PNAA 1ZG3A 3H50A 2QZ8A 4MEYF 1J7KA 5BV6A 1G3WA 4EJTA 1FPQA 3U10A 4N0BA 3NSTA 1U5TA 4CYDA 1FXZA 1QO0D 2OBPA 4UUVA 4BHCA 4ZZLA 3QP6A 2A69F 2PJPA 2O3FA 3ST7A 3E6DA 3GZ6A 4U88A 1B1BA 4CXFA 4DQ2A 4A5MA 3I5UA 1STZA 5FLJA 4EGYA 5C8WA 4BXUA 1JGSA 5CVUA 5ICFA 1IUYA 2EAAA 4UNOA 4EGZA 2ZNYA 2EA2A 1X8EA 2OYZA 1PP7U 4KIGA 4HW0A 5JR3A 2FSWA 5DCMA 1DP7P 1O57A 5IT9K 1J58A 4PCQA 2O1QA 1YQAA 2XKPA 5D8KB 4M73A 1XDUA 1UCRA 2V79A 3BCWA 1CAVA 4IEPA 4X6QB 4A0XA 2FF4A 5HS9A 4DNCA 4HLTA 2IA1A 1EP0A 2NS0A 3T1BA 3QU6A 4EMSA 2IA0A 4Y17A 1O4TA 1UFMA 1E17A 1B59A 4B09A 1UW8A 1ZH5A 3EJKA 1VR3A 2STWA 2FRHA 5D4SA 3WE2A 1XD7A 2UWMA 3DPLC 3TDZC 1P6RA 2MLKA 3MAJA 3BOQA 2XGXA 4LEJA 2H09A 2A3SA 2FXAA 2P6SA 3LA7A 5LHHA 2VONA 1OD5A 1YFXA 3I59A 2N7GA 1P4XA 1GQHA 1H1MA 5E16A 1WLTA 5ILVA 2P5KA 2HEOA 4HYEA 1RL3A 1Z05A 5JFRA 1ON1A 1YW8A 3R60A 4XF1A 4KU7A 2C6YA 2W57A 4RS8A 1ZGAA 4LA2A 3RKXA 1W7PA 5L3DA 3OOPA 4UXAA 3MYXA 2BNOA 5J7MA 1U5TC 1U2WA 1OMIA 2GXGA 1CAUA 3B73A 1R00A 3QU3A 3OF1A 5HLGA 4JTNA 2WC2A 1P92A 1FZPB 5EZWA 2OZUA 1LEBA 3CL1A 2PTMA 5KHIA 1IXCA 1XRUA 4D0PA 3CLOA 3K1MA 5CLSA 2XVCA 1FLIA 1X7NA 3V8LA 3CO2A 1UCXA 4HSJA 1LVAA 3FMQA 2HWVA 3TQNA 3E5UA 3P7NA 4BHPA 3W6KB 4XF4A 4PIZA 1RGSA 3L9FA 2XLGA 2M45A 4UVAA 1WGPA 4KU8A 3U1DA 5TJJA 1FX7A 5DV5A 2FBHA 5D1IA 1VJ2A 2A6HF 2K4JA 3R0AA 4P96A 2CW0F 3ZMTA 3WU0A 4LLGF 5LHIA 3KFWX 5L3GA 2J5PA 1BC7C 2IJLA 5BUVA 4LMYA 3J80K 2EFNA 4O9EA 3BP8A 3ZMDA 2UYBA 1IXSB 3U2RA 1HW5A 5HI0A 4U0VA 4I01A 3SHFA 1WQ2A 4OIOF 1YTYA 4PIYA 4Q0VA 1W5TA 2DW4A 2RC4A 1YG2A 2E7WA 1CF7A 4FBFA 4Z2YA 2FEZA 4I0AA 2EFOA 4N9HA 3GUDA 1Q5OA 4KA4A 1IZ1A 5JHUA 1D3YA 4E70A 1T2KA 3IBMA 4MX3A 1P2FA 4YIIA 2IA2A 1YS6A 4EJWA 1R5HA 5KVRA 4HV5A 3E6MA 1O3SA 2AS5F 4O5VA 4EROA 3JAMK 1CF7B 4I98B 1O5LA 1BN5A 4O9GA 4IJAA 3HRSA 2EFQA 2ET7A 4K8FA 4J1XA 2B0LA 4JTOA 4YIFA 1QQIA 1QXJA 4PJYA 2GWRA 3CDHA 4WX9A 2CSOA 2QWWA 1YW7A 2YR2A 1T38A 4ZYGA 4F7ZA 1U8RA 4IHSA 2FU4A 3DN7A 2CQKA 4HX8A 1BI3A 4G7OF 1YYVA 2IPQX 2I45A 4JBAA 1YLLA 1G3TA 3Q9VA 2DQRA 3LAJA 3LZZA 2IXCA 1P4WA 2Y75A 3IIAA 1FYKA 2ZJ2A 3SFZA 1ON2A 3L7WA 2VN2A 5AIPA 3ABTA 4U0YA 4ESBA 4WK8F 2M30A 5JVTA 3H1YA 4ESFA 5FQ0B 4NQWA 1REPC 3PQKA 4IXAA 2FA5A 5KHKA 3CO6C 1GXQA 3HSFA 4ESJA 4IEYA 3HRTA 5BMZA 5ICCA 2RVCA 1NHAA 4MQ9F 2RGVA 5D5UB 2XUBA 1KU3A 2OD5A 2MPFA 5KK1A 1OR7A 4MGYE 3ZMVA 1V4RA 4AQ6A 1NYWA 3CJNA 1TTYA 3GFMA 2MC3A 3OTFA 1SD6A 1QY4A 2Z99A 2XIGA 4EWAA 3W6JB 3P9CA 1S29A 2P8TA 5A2QZ 3KP2A 2W24A 2BBYA 1GHCA 5D6FA 4WVZA 1J3PA 1CAVB 2O6GE 1EY2A 4HX4A 4ZZDA 3CUQA 4ZYEA 1KU9A 2XAQA 2JT1A 2RN7A 4IESA 3V7SA 2LF8A 3OCPA 3WW3A 2DAOA 4I2OA 1YFHA 1I1GA 2NRAC 2HTJA 4HN1A 4R8HA 4XFBA 4GYGA 5LBQA 4AVBA 3CJXA 3GX4X 3F8NA
chains in the Genus database with same CATH superfamily
1AHSA 4ZYDA 3CCUI 2BZDA 4JAAA 1ONAA 4E6KG 3MFCA 3VD3A 1V3FA 2P7VB 4RAFA 3ZFEC 3RGBA 2K9QA 1PGSA 4D3WA 4M3FA 3DF0A 3ES4A 1AX0A 2KR2A 3I59B 1HKQA 3R4UA 2ZGRA 5JXJA 3O1UA 1A36A 3VHRA 1VBB3 1DQ6A 2XJSA 5J4YA 4WBBA 3QOPA 3POGA 5GZDA 3I3EA 4O3MA 5FYMA 2NNYA 1XOYA 1LGBA 1B9MA 4N4NB 4NR1A 1X33A 1OA3A 2YB7A 5FZ7A 3BJAA 1ZAOA 3AG4H 1MSFC 4Q4X2 2V9KA 3ETQA 3BY6A 2LFBA 1IAWA 3HQUA 3O1MA 4ASLA 2A75A 4BWOA 4OLLA 4JGZA 3ZM8A 1IS4A 1XE7A 3GTQJ 1PMHX 2QDNA 2CY6A 4NRQA 3H3UA 2FQ4A 3M1HA 1FOKA 4PJ0C 3PVEA 4XLPF 1MZBA 4IPAA 4S2GA 3W59A 2GAUA 4ENKA 1FP2A 5K0UC 2LF7A 4XF9A 1DYPA 1L7QA 1NK2P 2YFZA 5FFOC 5CVIA 3LPFA 3LPGA 2BEOA 5EFUA 2WYSA 5FO9B 1GP4A 2UWAA 4W6YA 2X48A 1ZLKA 4UVCA 4ZS3A 3RI8A 3TO9A 4RM2A 3HWJA 1BR2A 3AKPA 4S04A 3S7IA 4RGXA 3FIWA 4W97A 3ZN1A 1S0IA 2F5FA 3VBSC 1B72A 3VPRA 4QM8A 1JXNA 1XC5A 4CPBD 4GKYA 1DIWA 3RWKX 2ZHLA 2NVXJ 3U4XA 4RMNA 1YJ9I 5F5IA 4O65A 4CEWB 4P08A 5K9YA 4IHXA 5E3OA 2XB0X 4UFIA 4FX4A 4QPGC 3DXTA 1NCRC 5FLIA 3C18A 4KUMA 2DCTA 4E7HA 3EDPA 2H6BA 2Q8OA 1IPKA 2TEPA 2FX0A 2R16A 2H0BA 1BI0A 2A6WA 3RPUA 2BBAA 4H4KC 3GZUC 4CUCA 2LTPA 3BCBA 2H1KA 2WS91 2R7QA 5C44J 2ZMKA 3ZXKA 4KICA 2YPDA 1R23A 2EFPA 2TCTA 1C0WA 5EWSA 2IGOA 3J7ZI 3VLBB 3KZIC 2GN7A 2BWAA 1YE9A 5LK7B 4JP0A 3B94A 1HQCA 4HF0A 5EYRA 1ZNPA 5HV0A 3C2GA 1TMF3 3T2TA 5CB7A 2OF7A 4I3GA 4B7EA 2HVRA 5EJ1B 5DDJ3 4A6DA 1ASJ2 2WJSA 1T8IA 2Z33A 2R7DA 2KQRA 1ZR4A 4AEMA 3FBNB 2Z4FA 2VJXA 1R58A 1ST8A 2GC0A 1H9WA 3BR1A 5A3PA 4OHZA 1XXNA 3AVRA 3AP9A 4Q5SF 3PFIA 1OHFA 2VOKA 1Z1DA 4FASD 2E33A 4EN8B 3F21A 3BDDA 3D5RC 2P7CB 2WAFA 1TEIA 3R4SA 4LOTA 4AZZA 3FFZA 1E5SA 2P17A 2BY3A 1QOOA 5ERIA 2J1EA 3AMHA 2V4JC 2F5VA 2M8GX 1WUVA 5AC91 1TW3A 2A7AA 2MYSA 4MV2A 4QX5A 1OCTC 2A3XA 1OC1A 2E5NA 5FYYA 1YUDA 2DT6A 4B44A 5DM6F 2WZR3 1JUIA 4FX0A 4AGVA 1ZGWA 2BY0A 1OCOH 2W7NA 1FYMA 1RUH1 2JDAA 4LK6A 1BR1A 1IN8A 4WXDA 1S2KA 2XAUA 3RI4A 3PIOF 3ATGA 1HB3A 4QAWA 3ABLH 1UOJA 4MZUA 3RI9A 4BHBA 3LB9A 3ERED 4HA8A 2BV6A 3D82A 4XDPA 3ZPLA 1U5IA 4OHVA 2GNDA 3FX3A 2XPVA 1APLC 1GP5A 4G9SB 1U12A 4A5NA 4NUBA 3BODA 1F15A 3ACGA 3J7HA 4F3JA 5FWJA 2CW8A 4L11A 2ZEWA 3Q0WA 4EVIA 4NB5A 1D8JA 4A3FJ 1SAXA 3VKNA 4YGCA 5FYBA 4CCMA 1MIJA 2Y0MA 2DU0A 3GO5A 2WN2A 1ZRFA 4JGYC 1BHGA 3OUJA 3PU3A 2D6PA 5HV4A 4OOIA 2EFWA 1D7PM 5E1RA 4J6GA 4DXZA 2EB7A 2L4MA 3K4KA 5DUKA 2XF7A 2QBYA 3EQEA 2PBIA 1Z3YA 4GWNA 4ENJA 1W9YA 3EYIA 5LGNA 4Y1YA 3PSFA 4M3CF 2E31A 1OXCA 1Q43A 1XC6A 1U9NA 1SEUA 4XKBA 2L7FP 3DKWA 4MGIE 2L0KA 3ES1A 1NCRB 4IERA 4MGZE 1MGTA 2BW3B 3GEZA 1LKNA 3CQZJ 2RHPA 1XMKA 3KYLA 2XV4S 2VCAA 1EPZA 2R063 3JUUA 5FXXA 1IPJA 1YWKA 1UMHA 3S6PA 4MFDA 3W20A 4NROA 1A6CA 1GZ9A 2YU9J 4KWKA 4XXAA 2W52A 2W9XA 2WAEA 4YVWC 3QACA 3E5QA 3BTXA 4LBKA 4CP0A 3B69A 3KF3A 2A71A 3G7DA 2ME0A 2XB6C 4HMZA 5FZOA 1A34A 3MEXA 4YW2A 4MYEA 3MIEA 4EJUA 3C7EA 2CV2A 3PNYA 1RPWA 3HNMA 5J98B 5GZEA 2UZKA 2DXIA 3URFA 2ZMEA 5IT3A 3LDBA 2QBYB 4RR3A 3FWEA 3C1DA 1NA1C 3S1RJ 4JK1X 2B39A 1BQPA 3C7OA 1IKPA 1B72B 4CH7A 1WJ5A 2XDVA 4RHV1 3Q8CA 3QOEA 2HTSA 5C3PA 5FRAA 2MSYA 4NBQA 4LNVA 5FLXZ 3AJYA 3D6EA 2J1RA 3ASNH 4QB2A 1X82A 3D1NI 1QGLA 4XDOA 4LKSA 1C8M3 4XRFA 3KETA 1A5JA 4FPEA 2OQRA 1K78A 5DG1A 4CZSA 4DINB 1ZG5A 3FXRA 4XLHA 1SFNA 2IC1A 2E2IJ 4Q1PA 2LRDA 5IVEA 5HCHA 5CVJA 3K4NA 2M4GA 2B8MA 2HDCA 1YIFA 1WZ2A 3OIQA 4UOJA 4MQVA 4BE3A 5FB2A 1YRZA 3KEOA 1S55A 3PO3J 4K1ZA 3TMOA 4YFKF 2MLGA 1TWFJ 5CEHA 2JKBA 2VQLA 4RR3B 1DQ1A 1ZRCA 2BP6A 1IV8A 3JXSA 2YXSA 2W1QA 2FNPA 3M4OJ 1JKPC 1CJDA 3WUCA 1SCRA 2DVFA 2Z79A 3SZPA 3WG2A 4X0GA 4YW7A 3D8CA 5FLHA 5F64A 5ACA1 5CAZA 1KS4A 3OYLA 1KQ9A 4KDPA 2PN6A 5J6XA 3LAPA 4XTPA 1QJY1 3JD72 3DLLF 1HOMA 4QPGA 3U37A 4IXLA 1QKQA 5CBLA 5T54A 5C9AA 4XFGA 2VUDA 2Z3YA 2IGMA 1W2TA 3S32A 2ZXIA 3IH4A 2VNGA 3B3QE 2LNBA 4HPQA 3WTWC 1WCKA 3WOGA 4KGQA 4AG4A 3CF6E 3IH2A 3HZJA 5FD5A 1A6QA 4QQOA 3AFHA 1OYYA 1AKHB 5K7FA 3QQAA 2VODA 3M8FA 1FOD2 4AHZA 3K1PA 2HVSA 3JRBA 1DQ5A 3F6OA 1SVMA 4LHLA 4BK4A 3J81K 3JRDA 2X5IB 3KMHA 3TAYA 2BXYA 1HN1A 1VBA3 1L3LA 4ITCA 3MZYA 1RNLA 3LL7A 4BH9A 2L9RA 2ZGKA 1ACIA 1NH3A 4XORA 2JA2A 1R092 2F4PA 3OYBA 2JG9A 1W7PD 3THDA 4N7UA 5KC5A 5LGUA 4M6YA 5BPDA 4Y1ZA 1JUPA 3W5MA 3EYYA 3KB5A 3ZSLA 5BNQA 1Q1VA 4I7HA 3PUFA 4DEQA 4CCDA 2IXLA 5D8AB 3HTUA 1S1AA 2R7FA 2E1OA 4M71A 3MZ8A 4GRIA 1S8NA 5CFCC 1FOD3 2MD5A 3TOAA 2BPA2 4M3DA 4XUPA 2Z5UA 1AWCA 3NRVA 3H8OA 5LHGA 1IV6A 1NCQC 5D6EA 1PO21 3CO7C 3WZ1A 3ZQIA 2YUSA 4G8XA 4K2EA 4JYKA 1VQ9I 4NIIA 2XF6A 4RGUA 3EO6A 3I0TA 3K4CA 3M3EA 2I10A 2GNMA 2GSYA 4NWVA 1T08B 1S0JA 4HKOA 3C3VA 5I8SA 3JD73 1EF4A 1UELB 4NE9A 2CHHA 2WV1A 3G6EI 1X19A 1HRV1 1IDYA 3AC0A 4P9YA 2LR8A 1Y8RB 3ABUA 4GH4C 2EZLA 4AFMA 1AR91 5LGTA 4W8JA 3G6JB 1ZZCA 1HC8A 3TN93 5FO5A 1LVKA 4YM2A 2KKOA 4EM1A 4CEYA 4C0HA 2WZR2 1SFPA 2VMIA 3ENRA 4FTEA 3FKIJ 1KFUL 2UWCA 2V7FA 2E51A 3ILFA 2ZGNA 4LMFA 3P5BA 1V70A 1WKMA 4BBRJ 2QF7A 2QQ9A 2DTZA 3KP6A 4B48A 1WW6A 4C9YA 4CDUA 2VBXA 3FMSA 5DAXA 4FFFA 1RITA 4LHSA 4HAMA 3FUQA 4N43B 4KT5C 4UB6C 4XLCA 2NYYA 3A23A 3VKMA 1H2KA 5J4VA 4WWCA 1C8M2 2LBFA 1D2SA 4DXSA 4DZGA 5M5XJ 4PJMA 1JW6A 5FOJB 5IYBJ 1W6MB 1VQOI 3OYHA 2YGMA 2VC0A 3VB9A 1X3ZB 2E63A 2COBA 2XR4A 3ZFFC 2W94A 5DM7F 2W84A 4FOVA 2JICA 2BW8A 4CEWC 1R22A 4QGLA 3I2DA 3DTEA 1JU4A 2WV0A 1LEAA 4E7SA 1JZ6A 2HU9A 2FQPA 3UGFA 2H94A 4PF5A 3IKVA 2KD7A 4H2AA 2L54A 2HPMA 1AJOA 4PLMA 4ENMA 2X85A 2E7XA 3J7MA 1J1LA 1LOFC 4Y1UA 3INAA 4W6WA 1KJRA 5C8CC 1LODA 1R4NB 1RIRA 5A7SA 3T1LA 1VBE2 5E8AA 2FMDA 4K8RB 3GFIA 4QHZA 2F6BA 2WT0A 1V6IA 4FOQA 1OA4A 2KFDA 2D6KA 4FFIA 3K10A 4R4ZA 4IHVA 2A6EF 5JVVA 2PHTA 2KJBA 4XJWA 4IV1B 2WY7Q 1UD1A 1D0GA 4A3JJ 2VQ0A 4E7IA 3ROUA 4CXWA 4F52A 4G9YA 4BXSV 4PDWA 1VBB1 1A6IA 4F83A 1BBYA 4AYBN 4Q27A 1N1SA 1LFUP 2PG4A 1NE4A 1MMDA 1YS7A 4Q4Y3 3K4ZA 3UJQA 3NQHA 2FMYA 1D1BA 5E88A 2DDAA 4D9JA 4CVUA 2BHZA 3WNNA 3VBFB 4BY1J 5APAA 1VBE1 3WU1B 2ZACA 1S5LC 3B9IA 3CNAA 2HVQA 3FHAA 3OS0A 1OYWA 2ILMA 1GWMA 2VJ5A 1SMVA 3BC8A 1IUFA 4HQEA 4EJRA 2IXJA 2WN3A 1SD5A 2C9KA 3RNSA 1J84A 2BGPA 1SCSA 3OD4A 1Y8QB 5IWFA 4LBOA 4MTEA 4M3CA 1IHMA 2PFWA 2JUCA 4E7JA 4YVSC 1LOAA 1USTA 1GV9A 1WW7A 3WHBA 1IKQA 4H7LA 1IXRC 2K27A 4K21A 3I2FA 1Q8SA 3H5RA 4BIFA 4C0BA 3WCSA 5I8YA 2Y6LA 1J59A 5A6QA 1JI8A 2VNVA 2JXAA 2Y0SA 1T98A 5C70A 2HPIA 3N7KA 5IAVA 1SLBA 4HKWA 2OZ6A 1OBNA 4RQPC 2WRAA 3KSCA 2PAKA 4EWDA 3OY8B 3M3CA 3T30A 3T3YA 2K02A 1ZGJA 1GU3A 3JCIA 4CUBA 2IP2A 2IVJA 3NNJA 2W1WA 4AK3A 4PDWC 4UYBA 5FMOL 5F7UA 4FXGB 5FYTA 5IJRA 4FQGA 1NG7A 1OLRA 1UY4A 3E1SA 3KCYA 2G9GA 2PQSA 5FKMA 4QHOA 5CZKA 4EZHA 1K4SA 1PO23 3PTYA 2Q1ZB 2RS52 3SJMA 1FATA 1SC7A 3WX5A 3THPA 1XQNA 3NJVA 1CN1A 1MQTA 4AEDA 4Z82A 5EGOB 2VY0A 2DI3A 3V4GA 4QMAA 3C7HA 3PHMA 5DZGA 3PIJA 4BACA 1W36D 5HDNA 2GU9A 3BWGA 4Q0PA 4JRAA 3PQJA 2IXSA 2EXHA 4BEHA 2L02A 3O1OA 1K12A 4XBNA 1SDWA 3FL7A 3RMXA 2X53S 3QBQA 1RUJ2 1S0FA 5FXWA 3L2HA 2BVVA 3AJZA 2D40A 4C3IJ 2O5RA 2VT3A 2B9VA 4LPLA 5A3NA 4FCAA 3H7YA 3FXUA 1JUSA 1L7LA 5LA0A 3DXJF 4UV8A 3VN4A 4IE6A 1BXHA 3SLIA 2GP3A 3ECHA 1JTYA 2P3IA 1NCRA 3GM8A 3IRQA 2ESHA 1RHI1 1BJZA 3BZ6A 3CU7A 1NA1A 4C91A 2L7ZA 4IUGA 1UNBA 4JKLA 3DPRA 3CKHA 1TQIA 2R073 2IEKA 1PO13 2D93A 1AXYA 4K20A 2QUFA 4XC9A 1D1AA 4W6XA 3GTKJ 4AXOA 3U1XA 1I3AA 2OQGA 3QYEA 3KHCA 4OMZA 1PDNC 3DKXA 3BG5A 2VPRA 4ISRA 3MIHA 4LTAA 1SBEA 1QHDA 3BLYA 3APBA 1Z0XA 2K86A 2M4KA 2WYFA 5T50A 2PAMA 4C2TA 3VBFC 3K2OA 1CAXB 3ZXFA 2XVLA 2HZDA 1OQYA 4KIBA 3IV5A 1SLTA 2JB4A 3SQNA 3F8FA 1OKOA 3IWZA 5FZ4A 3JSOA 1V6LA 3NMBA 5F0CA 3HPNA 4B1RA 1BCXA 1G4DA 1S2BA 1ALYA 1PP8F 5FZ9A 3LDRA 2DCKA 1MZ5A 1V9U1 1DLLA 2A6YA 4XFFA 3Q8FA 2RDNA 1AL21 1RRJA 2WLPA 2OS2A 5LBCA 1HN0A 1MH4A 3RFRA 2VZVA 4P9GA 1IRGA 3OYIA 4BIOA 2DMNA 1X50A 1QH6A 1XGSA 1UHWA 4B4PA 4BBSJ 1MS9A 3ELNA 4YZ1A 3IAM2 1Y4WA 3MDPA 1ZZBA 4MHRA 4BQ2A 1W36C 3L2YA 3OYWA 2VOVA 1PVC2 4OAYA 1W39A 5L3CA 3W21A 2XBO1 4K3UA 3IAQA 2XAFA 3SCHA 1EH8A 3GHNA 3WDYA 4MXVA 4G7ZF 3KX2A 2VXRA 4NC7A 4IV1A 5ABJB 3BTLA 1KQRA 4HPKA 5DUXA 1T0FC 4Q4W2 5FPZA 4L9TA 3W5NA 3GXOA 1V9U2 1T6BX 4BCUA 4XRSA 4SLIA 4A3GJ 1BM9A 3OUHA 2ZXJA 4PDWB 5IYYA 2QQNA 2L01A 2Y34A 2V1XA 3I3QA 1BBT1 4BISA 2ZNZA 1BJQA 3K9TA 3A21A 5FWEA 2DBNA 1DYKA 3H8UA 4EM0B 2JDNA 2OJED 2XQRA 4QXBA 4EQQA 4D0QA 4QGNA 3MZHA 5BXXA 2X5IA 4ZXEA 4CU9A 4N9IA 1PO22 1R49A 5E8GA 2Y31A 1ETWA 3B6CA 4PJNA 3W2WA 4MG2A 2OCCH 4QT6A 4ASNA 4AI3A 5BNNC 4M9SA 4FHTA 3QH7A 2G7HA 1PK6B 3OV8A 3J7NA 4ZONA 3PMSA 2H1LA 4X1EA 2DVAA 2Y6HA 4ASKA 1HRV2 1EAH2 3M7AA 1WJFA 2CV1A 3NAUA 1D8KA 3PUSA 2DVDA 4CDWB 4M9XA 5BNNA 4AHXA 5I0TA 3BR6A 1ZG3A 1FYUA 1VFCA 3DGTA 2EIJH 4XNFA 5BV6A 1G3WA 5IVBA 5FY8A 1FPQA 2EQRA 3VDXA 1W2UA 1S0CA 2DUQA 1ND2B 1QO0D 3SDBA 5F8PA 4ZZLA 4I6ZA 3PUBA 2A69F 2PJPA 4FETA 4BK5A 3GZ6A 5C4WA 4CXFA 4DQ2A 3MKWB 1IPSA 3C2HA 4A5MA 2R5YA 1ODMA 2KT0A 2FCVA 4EGYA 1JGSA 5LBFA 2JE8A 3X2QH 4YM0A 1CPMA 4UNOA 4EGZA 3WDUA 5CFDA 1UAAA 4KIGA 2ZB9A 4HW0A 5T52A 2FSWA 2JE7A 2LG4A 1DP7P 1O57A 2QGUA 3FHNA 4CCJA 3W6VA 2O1QA 5GJ6A 1OISA 2IZWA 4CDQB 2NP0A 3D4KA 1AR63 2XKPA 2MD0A 1UCRA 1QQP1 2VW1A 1CAVA 1W8UA 5DZEA 3ZQHA 1PVC3 2FF4A 5EJCA 2IA1A 1EP0A 2BERA 1WMXA 2JDPA 1Q8QA 1R9TJ 4DRVA 1JU3A 2YHJA 5IP6A 3ZN6A 4OAZA 3S30A 2FRHA 5D4SA 5A7QA 3WE2A 1NUKA 3DPLC 1STMA 3I2GA 3TDZC 3ZDVA 4YW6A 3J8F3 2D98A 4JDOA 4HNTA 5LHHA 1YFXA 3I59A 3WQ7A 1MZEA 5FZFA 3RMYA 3BG9A 2HEOA 1VPHA 4BPZA 2YBSA 1HDKA 1Z05A 4XACA 1YW8A 3O0XA 2E26A 1E5IA 2LUWA 3GZTB 1QQP2 5FY0A 1W7PA 1GLNA 3OOPA 3ZYRA 5J7MA 3H0OA 1CONA 2JDHA 5F39A 2L9SA 1VBB2 2L7KA 3QU3A 3OF1A 1VF9A 2JSPA 1P92A 1RUD1 5EZWA 2VCMA 2PTMA 3QH6A 1IXCA 2YPJA 3CLOA 1JUMA 2HWVA 3E5UA 2AZ5A 4CDWC 3NV1A 2HOTA 4NHYA 3JR9A 1WGPA 4KU8A 3U1DA 2ELJA 5TJJA 2FZ1A 5DV5A 2RE9A 1VJ2A 2A6HF 4ANJA 4CCLA 2W48A 5IPAA 2IFRA 1EA3A 4MXWB 4LLGF 4B7KA 4EZ4A 5L3GA 3J26N 2E1MB 3PUIA 1GYKA 2VUJA 1LHUA 2IJLA 4Z2AA 5BUVA 2EFNA 4YG3A 2UYBA 3KZ4C 1GP6A 2ELKA 1UZZA 4XE9A 4A69C 5JXGA 4K1YA 3L2RA 3SHFA 4XOGA 1WQ2A 1WKYA 3BG3A 3SFIA 4OIOF 4PIYA 2DW4A 5GP9A 4L99A 2FEZA 2NS8A 2JA8J 1Q5OA 3TP3A 2WT1A 1UY1A 1IZ1A 5JHUA 2FCUA 3I2IA 1GR3A 4EJWA 1YS6A 1ZBE2 1KXGA 4UW5A 2R49A 1JYNA 1UPSA 3DECA 2HEWF 4J19A 2HDDA 4A6OA 3AG2H 4O5VA 2A1XA 2FDKA 2XONA 2ID4A 3I8TA 4LG3A 2WWUA 4RBOA 3D3AA 4O9GA 3A02A 3AKTA 1C1FA 2WWSA 2D3SA 3KVBA 3HRSA 4M4RA 1G9FA 2EFQA 4PJLA 2W1OA 3OYMA 2CW7A 1FMD2 4LE3A 5FMCA 1MBJA 3LSGA 2GWRA 4WX9A 2QWWA 5FZDA 1SLAA 1T38A 5B4XA 3LSMA 1ZYBA 4IHSA 1UKRA 4JKMA 1X4PA 4HX8A 2WAAA 2Y8KA 4KBBA 4UFMA 1YLLA 5JWPA 2DUPA 2IXCA 3K6GA 3VV1A 4E7KA 5AFBA 2A6VA 3DUIA 1WD4A 3O5SA 1ON2A 2Y2ZA 3ZCOA 4ESBA 4AW7A 2SBAA 3K51A 3FXLA 2QQWA 4DY3A 4ESJA 5C8CB 1C4RA 3HPGA 2ZOEB 2YZ4A 2DA4A 5F2SA 5J1UA 5C3OA 2VOWA 1XPWA 1LTEA 5ABJA 1NHAA 1B8IB 5DUWA 1E3HA 2V1NA 2XUBA 4RN5A 2YU2A 2DA1A 1XBFA 2VI6A 3AXDA 3DEMA 3LIHA 1DLCA 1IS3A 3LSKA 2FZ2A 3P5JA 2XOMA 2X6OA 1RESA 1JYXA 4GFBA 2G9ZA 1UU6A 1YQ2A 3GFMA 4URAA 3I9V2 3ESWB 2E6VA 4EWAA 4MO7A 5HCFA 3P9CA 1S29A 3POFA 2P8TA 2W47A 4WVMA 1ENQA 4AHWA 4C1XA 3CUQA 4ZYEA 1PZ8A 1PIV2 5LWBA 1KU9A 2XAQA 2RN7A 4IESA 2BXZA 4KGGA 4RL7A 1UN1A 4FQZA 4PQQA 1XU1A 4Y33A 4LHNA 5FREA 4I2OA 1YFHA 5IK5A 4LITA 4R8HA 4IE5A 4GYGA 1WH7A 4AVBA 3CJXA 3GX4X 3POEA 3VZMA 2YROA 3L00A 4LULA 3P3NA 5EDNA 2NNNA 4YEJA 3IAS2 5IT9Z 3ECQA 2OUJA 2DJIA 3VUOA 5EYXA 3HBLA 2VMEA 5J48A 2HS5A 4F92B 2HNHA 4WF2A 5K1YA 3N05A 4HG6B 4XFCA 2CU7A 3LEGA 3VZNA 5FKLA 2R5ZB 2EXJA 3NJZA 1DUXC 4QX0A 3SMHA 2WNUA 4XLEA 2VPLA 2YDEA 4RAZA 1WCMJ 3CCYA 3H1MA 3S2DJ 5BY5A 2XRLA 5C4WB 1VBE3 1AL22 1LHWA 1D4M1 5T5OA 1RUG3 1KDKA 1BW5A 4UF0B 2CV0A 3O0VA 2YC2A 1TT0A 5A3WA 2P4EA 5FYIA 5A7OA 2RV9A 4BNCA 2VOPA 1WCDJ 1RUC1 1DYOA 3ZN5A 3GW2A 1GZTA 1NA1B 3BGAA 2RNJA 3K70D 4QPYA 1XGNA 2EAKA 3LSDA 2DJNA 1QHGA 1ENSA 2M3AA 1VNDA 2OUHA 1CVNA 3ETPA 2VQTA 2DYCA 2VTXA 4D69A 2DN0A 3FM5A 2ESNA 4KITB 3FISA 5ICGA 2EV5A 1X1DA 4ABZA 3RRDA 3RTRA 1HKSA 1ASJ3 5A32A 1HKDA 2AEZA 2ECBA 4WXHA 3HOUJ 1FSHA 2JRMA 3D5OA 1O3QA 3FXKA 3G2BA 2KA3A 1Z6TA 2IAIA 3HMYA 4M0NA 5F6LB 4DEVA 3ZRGA 3MKZA 4NPMA 4YG6A 1D0YA 2J1SA 5FXZA 5LASA 1X4OA 4A3EJ 5IYDJ 1ENXA 2VZQA 5LY2A 2VKVA 4EWEA 3WY6A 4QX7A 1F5JA 3N9MA 1DU3D 1XDSA 4LG0A 4EN7B 4B47A 4AI8A 1HKTA 4TXWA 5KXEA 2V5YA 2DFHA 1Y1WJ 3VDDC 2RR12 2JPBA 4LGWA 2JB8A 5FZOB 5H6RA 2Y0OA 4LUMA 3A2KA 2R7EB 4HFSA 5SV8A 2PHXA 1L3JA 4LQRA 4X6RB 5FAXA 5F1RA 3OYWB 2O8OA 2AQFA 1SDDB 2D5HA 1BKZA 2VZ3A 3R4DB 1R1VA 2IXKA 1RUG2 1DQ2A 1RVF2 1H2LA 4FP2A 3NV3A 4IHWA 3T2OA 3WP4A 3MIBA 2DK8A 2X8KA 2YY1A 3I2JA 4Q29A 1BOAA 4A7ZA 3CESA 5B1BH 1HDDC 1LDJA 1FEXA 1MJ9A 2ORXA 4Z07A 3KLOA 5FZGA 4D6RA 1Z9CA 4YFXF 5E1WA 1FPN1 1DQUA 1AXKA 1AR93 3BYWA 2H8WA 2ZKNA 2GLOA 3LFIA 3DLAA 3AZYA 3WDVA 4CDXA 4AVSA 3MO4A 1PK6A 2R0QC 2XPUA 3ZYGA 4K40A 4P5YA 2K3FA 3H7JA 4LG0B 5HXMA 2DURA 3OY8A 3U0ZA 4GIQA 3VKLA 1FBSA 2B7EA 5TISC 2W46A 4YRDA 3HJRA 1XE8A 5SV5A 2HQRA 1H8VA 5CISA 3L2CA 3WG1A 1XNAA 2R93J 5LK5A 4CRQA 3M3QA 3HTSB 4GWJA 4AEDC 5JPNB 1F1ZA 2JPCA 1Z3XA 4NVPA 4META 1CPNA 3ZP5A 3O2PE 2ZPXA 3SH4A 4Q0SA 2RMU3 3HT2A 1W04A 2R042 1WLWA 3CLQA 1PGL2 4LBLA 3VDDA 5HOOA 1Z77A 5F9TA 4CDWA 4UT5A 3EB7A 5FP8A 4UY8I 2V6CA 1AX2A 3WCRA 2M2EA 4YNIA 5FYCA 3P3PA 4HONA 1BIBA 1S0BA 5JSPA 2W68A 5D4RA 2PHLA 2ZX2A 1T33A 2ZXHA 1SEFA 3MLJA 4MTDA 5B1AH 3MLLA 1HW1A 4AFAA 4CA9A 2D6NA 4AR2A 1FY7A 2KIUA 3BALA 4OHYA 2QQLA 2Q8CA 4RS5B 3F8CA 3N7LA 1PO11 1LULA 2GDFA 3VEPA 4AWXB 3CP8A 5E1XA 3KGLA 3CF2A 2K4BA 2PLYA 2FBIA 3V64A 2CQNA 5HCAA 3FBMA 1QEXA 1KU7A 1F2NA 4G6QA 5GPAA 3PVBB 2DTRA 2X9DA 3HOSA 3ZPYA 5J8FA 3DYMA 4GH4B 3WGGA 2C0ZA 1XJAA 4A0YA 4L9VA 4WM7C 2FHRA 3POJA 1XX5A 1YJNI 5D2AA 3COAC 1BLZA 3FXOA 3L1PA 2XB5A 1W1WE 5E18F 4AFDA 4LKEA 2IWGB 3BTIA 1W0OA 1HLCA 2X29A 1W28A 4XAEA 3K75B 2O9LA 3C3WA 1XSXA 2DCJA 3WP6A 4QKFA 1UOGA 1CAXA 5D5VB 1PUEE 1TNRA 5JUVA 2WUHA 2VR4A 4FSJA 4PGGA 1ULGA 3C7FA 1VP6A 3J7LA 2CDOA 4QKDA 2P5VA 3REOA 3WV6A 4PK4A 3F6VA 2VBWA 2WNVB 5C33A 2QSGX 1PX4A 3JW4A 3B00A 3ACHA 2IFWA 4GGGA 1RC6A 1MS3A 1TZOA 1DDNA 2DBBA 1EV7A 3I56I 4XYXA 2BDRA 1MBKA 5K5QA 1PM4A 4U87A 3AKZA 2RAEA 3NEUA 4Y4YA 4CXXA 2QBXA 2W85A 2YBPA 3D5LA 2VBZA 3AL6A 1QVTA 1UX6A 2RMU2 1KZHA 4QQ2A 4Q4V2 2KZGA 2XMLA 2VXDA 1ZA7A 4HETA 5DD4A 1N78A 1VB4A 5TGTA 5LA2A 1RB8G 4PFPA 1QJX1 1QGPA 2JG8C 3UKNA 3TW7A 3RZOJ 4Z8BA 2B4KA 4AAXA 1H88C 1ULDA 4N90A 3V0BA 4CCKA 1LQ1A 4QLCU 5FO7B 2OQ7A 2ETEA 2WNVA 2R1DA 4MGSA 2X6YA 2AREA 3MMYB 1W6PA 1KDMA 3LSRA 1H6YA 4B4RA 5HDGA 2EIDA 2J1TA 1HSJA 2XQXA 3K48A 4EM2A 4FQ4A 2VQAA 1YIJI 1JZ4A 4UI9L 1MDMA 2HEVF 4KL1A 2EICA 1H4GA 4BUPA 5FJHA 2V5DA 4A3MJ 1FMVA 5L7OB 4IDZA 4AVZA 1K78B 1ZVFA 4JKKA 1CQTA 2VH9A 3AXEA 1I50J 5FMOS 3OBRA 2RM22 3ZN0A 1OPCA 2JRTA 4AWDA 1AR73 4D5FA 1ZZ8A 3FXJA 3WHUA 2RR13 4XIKA 2Y9YA 1J3QA 1HA8A 4XURA 5HVQC 2LC2A 1X8MA 2LOOA 5BOXA 1UU4A 2ZX0A 4NHKA 3WXPA 2LREA 4XKVA 1X1BA 4CDUC 1PGW1 3HRUA 1X3UA 3E97A 3PJQA 3SEZA 2XJTA 5K7ZA 5FLMJ 4DXRA 1QPMA 5JOXA 4MGRA 4BE1A 1FPN3 3KVAA 2RG4A 5FYVA 4S2FA 5DXDA 5IK4A 2VZSA 2O61A 1UMQA 2VU9A 1TMF2 1JUHA 2B63J 5KBFA 1OVSA 3GTMJ 4R1HA 2FBEA 1HCRA 4HEA2 2YSRA 4G6DA 5GZFA 2KJCA 3AKQA 5DYMA 4QXHA 4AIKA 1W8NA 3RPUD 4A0ZA 3CMGA 1NTCA 3WNOA 2M7BA 2Y26A 4BQOA 5KWRA 5KXDA 3ML6A 4P9JA 1DP3A 2ZEYA 2F5EA 2ZHMA 2RKHA 5BS6A 5M5WJ 4FPKA 3HRMA 4RFT0 1RUC2 1YCIA 2F4MB 4DB5A 3Q8EA 5FP7A 3WODF 5IATA 2VB6A 1G7YA 3JBG3 1XSDA 3HSRA 1DCSA 1YQCA 1NZCA 2V6EA 2WA4A 2QEXI 2P5BA 4RYDA 2XJPA 4QXKA 2MNGA 5GLUA 1K5MC 1PNGA 4GA9A 4LLOA 3AL0B 2MHFA 1OLME 3NWKA 4BLIA 3RS6A 2DYRH 1XCVA 1WWXA 1D5VA 3RIRA 3A4CA 4COYA 1MNEA 4R9BA 1SANA 1D0HA 4CCNA 3CEWA 3JRFA 4N53C 3ZYFA 2EA4A 2ISZA 4OUMA 3K1NA 1HV0A 1OLQA 3IMNA 2KDZA 4QPOA 1HXS1 5FFXA 3UK9A 2ZKZA 3MF6A 2XLAA 3AKRA 3KWVA 5DCMB 2HBTA 1GOGA 5I93A 2HJIA 2HWC2 1H9TA 3FK6A 3OBZA 5DDGA 4Y24A 4ORFA 3E3VA 3DU5A 2B9UA 1TNFA 5JHFA 4P5OA 1MQTC 3IKTA 2K7LA 3HJEA 3DPRC 2QA4I 2KIQA 2XROA 3GZAA 4RD7A 3JZVA 1X3WB 1LEMA 3UKGA 1DBNA 1POV3 2IXIA 4N43A 5FPVA 3ZYJB 3GTGJ 4HSLA 2GZWA 1RUE3 1V00A 2KHMA 2VUCA 1HF0A 1UZWA 2Q0AA 4JQTA 3OEBA 1JS9A 3ZFGB 3AYAA 4IHTA 2JENA 3CF5F 4ZU5A 2BVLA 3LSTA 1BBT3 4DXTA 2VNRA 4KI5M 4KNCA 3BR2A 3LWCA 1W5CC 1EUTA 1CX1A 2A6ZA 4XDQA 1VLNA 4NO4A 5C6CA 3JTGA 2O8XA 1QQP3 3RPQA 4F8AA 5F27A 1MS4A 1IQDC 3BR5A 4Y5SA 5K4LA 5JR2A 3LSJA 5JDBA 3NWSA 2HQ5A 4BMEA 3MCZA 1BK0A 5K5RA 1BVVA 2YX7A 5DAQA 3NRUA 1VAMA 1VBC2 5CVRA 3CCQI 3WW1A 4K6BA 2EALA 5A70A 1CAUB 3QODA 3KE2A 1YITI 2L5QA 3TO6A 3SDGA 1DFQA 4MGTA 2KISA 3S2WA 2K9MA 2K5CA 4L92A 4LJZF 2PMUA 3NW4A 5B2GB 2HWB1 2RS32 2OUMA 2XGEA 3ZQFA 2UYAA 4AUXA 1QRYA 2TUNA 1GOHA 1HSTA 5IT6A 4E9KA 4URTA 4L2NA 3NNLA 5J3UA 3TNQA 4TTGA 3MPBA 3T5XA 2XWBB 5KAIC 2JA7J 1FC3A 5A1LA 2XWJB 4B3NA 3AB0A 5FROA 5GKAC 1PJRA 1ETXA 4O7XA 5FPXA 2ZX4A 4A3LJ 2RDSA 1W99A 5B4NA 3HHGA 3JREA 4AC0A 3ZKYA 3M1CA 2ZAHA 2EV6A 4I02A 2XGDA 3SEPA 2FDIA 3WTYC 2AXLA 4RAGA 3E0JB 1N1YA 5LATA 1ZX5A 5EEGA 3FMGA 1ODNA 1K6YA 4A6SA 4KIFA 3F3XA 3QD6A 4NAOA 3A01A 1YJWI 4OI0A 1F35A 1MEC3 2GXBA 4P02B 5IVYA 1EH7A 1TWAJ 1XNCA 2VOTA 4IV3C 3E1F1 4UUSB 5CADA 1PYVA 3HEIA 2BE5F 3ASOH 2GA2A 2HWD1 2VCCA 3BT9A 4OMYA 4LFUA 1HQLA 4FPJA 1UQXA 1V6OA 2YBKA 5LBEA 3R05A 4M3CB 3HBZA 2MGQA 1H8TB 4AYBA 1YO5C 3ZSMA 3AL5A 4ZU4A 3VYSB 5FZIA 1U5TB 4I09A 4AI2A 2BOIA 1R5ID 5FUIA 3AL0C 3DQVC 1W6PB 1IG7A 1F8VA 3CHXA 1OUSA 3O1TA 1ODDA 3SC7X 1T0FA 2ZC2A 5J8CA 2ZGLA 2F6CA 5A33A 3I4NJ 1QXRA 4UFHA 1MDMB 2WO3A 4UUTA 3MWMA 1QXPA 2JG9B 5L7OA 5AONA 3WTUC 2XSDC 4NRMA 2X4HA 3RVHA 4J25A 3UETA 4PF1A 5D8AA 3O7OA 1A3KA 4HX7A 5LLQA 1WI3A 3KCCA 3OYFA 3IB3A 4DJAA 3PM1A 4A7YA 2QE3A 1REEA 5I0DA 1COV1 1DG6A 4MGKE 5DTDA 4RB3C 4ZKTB 1FWZA 2G0EA 3G71I 2GN3A 3QRFF 1R1ZA 4N53B 3VHPA 3BU7A 1WA4A 3WDWA 2KIMA 3RCOA 2EJRA 4IETA 3MKYB 3K2ZA 1W2OA 4LK0F 4BXXJ 4D7SA 1VQ8I 3AYCA 2WFF2 4BDYA 2RDPA 3THTA 1KEXA 2QUOA 4HK9A 3BUCA 1UB9A 3WEZA 1N1VA 4YSFA 1OOPB 3ZSKA 3TRSB 1JZ8A 3K4LA 3BPVA 3R0JA 1CJPA 2GC3A 2X1DA 3ZFGC 5T55A 5FLXK 3GTOJ 4HKLA 3H36A 1BC8C 3BTYA 2M5WA 1QNTA 2BQPA 1NY72 4L0ZB 3WF4A 4EATA 3UKTA 5J96B 2V9VA 5JPMB 3BJ6A 1NG6A 2DOAA 4KFCA 2ZSHB 4MNUA 3O8HA 2HH9A 1MBFA 3OEAA 5L19A 3VB2A 2UV1A 3LEKA 4BXFA 4QX3A 2VZ1A 4HV6A 2WFF1 1F5TA 3IPVB 4LK1F 3G1LA 2V4VA 3WTSC 4PI0A 1QPIA 3F72A 4BQYA 4HDVA 3KT7A 4LLFA 1QDCA 3I97A 1CQ9A 4YLZA 3RKQA 4KWUA 2HWE1 2GH2A 3NVCA 2Y6GA 1X58A 1IN4A 4L9JA 3TB0A 1WJEA 2VT2A 1W8WA 1NY71 4LO4B 1NKGA 1PX3A 3ZKUA 1IRFA 1WLCA 1UOFA 2D97A 5GLWA 1ZBA2 4DUWA 2BGCA 1I39A 3UGGA 1E3OC 2FDGA 2ZJQF 2LVSA 2KPMA 2WDBA 4NRPA 4QU2A 2L2OA 4E8DA 3KHBA 2LY9A 1RXFA 1ZARA 1QJZA 3OGSA 2HBUA 4AD9A 3K70C 2NZ9A 2W00A 5FP3A 2QLZA 4MUVA 4QQLA 5FZ0A 1H9PA 2HXIA 1W6NA 5CKNA 1ENHA 1YQ8A 1PUFB 1ZZ9A 2VKHA 1QDOA 4TYSA 3BTJA 4OQ8A 1EKEA 4WM7B 1AYN3 4KJZA 1H6XA 4Q47A 1ETKA 4LO8A 4RQPA 2XHNA 3S1MJ 5L3FA 3FXMA 4XBQA 3VGIA 1VRBA 4HF2A 4QB6A 2D43A 3QPSA 5IVJA 3CUOA 4YGDA 1YLFA 1Y56A 3WQ0A 1Z6RA 3GFLA 4KWLA 3I2OA 2Y0IA 2H8RA 1AR81 3ZIXA 1TC3C 3D5SC 1R1UA 4AI9A 4K9SA 1B35C 4QX1A 3CJQB 3OPWA 1YRNB 2C4XA 5EZGA 3KT1A 3LKJA 3CBNA 4MXWA 2E1NA 1QNWA 4KH9A 2E60A 3NJYA 2FMLA 3U75A 2YMZA 4L0PA 2F5CA 4P9FA 4XCBA 1UPIA 5D8LB 1ZRDA 1WCUA 5CVVA 4HNUA 4YG2F 4I0BA 2F4OB 4EN0A 4HSRA 1VB2A 1HXDA 2MEV2 4YG0A 2M9HA 3IWFA 2KRHA 3WLUA 1UIKA 5KHGA 4PQ9A 1YFWA 2C5DA 5HNHA 2W82A 4YW4A 5JSOA 2DMTA 2CMPA 1SMYF 3JB8A 1DGRN 5F32A 1MPXA 4UUSA 4RQPB 3RG0A 1RUI2 1YIPA 1U6GA 3CC2I 4EJOA 5LA9A 5FMDA 3MKLA 2A3WA 3RZMA 1U78A 3RWNA 4BY7J 3T0YA 1QZEA 2WLQA 4OUSA 2F48A 4RAYA 4AVAA 2FNAA 4ZYAA 4G94A 1O4XA 1QZZA 1V6MA 5LY1A 2XPWA 2ZEZA 4HF1A 1YRNA 3DBRB 5GAGJ 1W5SA 5L36A 2B7YA 5ACA3 5GLTA 3LSPA 1S7OA 1HXS2 3E6BA 3WW4A 4D7MA 1UU5A 1ZLJA 3BR0A 1T6SA 2ENRA 2QZ3A 1FBQA 5BQTA 4MH0E 3VYUB 2Z42A 1YQ5A 3H5AA 3FZVA 3WW2A 1KRIA 2GIVA 2ZGQA 5EPAA 3R6SA 4AOCA 3PNAA 4L8QA 1J7KA 3JQXA 3IN9A 1RMU2 1U5TA 4CYDA 2JDMA 2PHWA 4UUVA 4JHTA 3R0RA 2EF6A 3L2QA 2O3FA 2C26A 3ST7A 5FRNA 3SKJE 4U88A 3PU8A 1B1BA 1VQ4I 2BVMA 2FDHA 1RUF1 1Z7S3 1GANA 1ASJ1 5ABJC 3I55I 3P1IA 4MGQA 4XONA 4OHWA 4ZDLA 3MI8A 4BXUA 2WS93 4RSUA 2VMHA 2EAAA 2EA2A 2OYZA 3USUB 1PP7U 1MR5A 1D0XA 1KGYA 2BY2A 1W9WA 5DCMA 5IT9K 4PCQA 1X1PA 5LZ6A 3V56A 4IE7A 4ASMB 1Y43B 5CNAA 4M73A 1XDUA 2RNGA 1QJU1 3BCAA 1K3IA 5JZGA 1OVPA 4X6QB 5F5AA 4A0XA 3OR1C 1S72I 1WBLA 4C2UA 3WQ1A 4NN0A 4JC1A 1B59A 5HXVA 4AEJA 1ZH5A 4JOMA 3EUAA 3Q0UA 2A5ZA 2AC1A 1W0NA 1WH5A 3OIPA 1GWKA 3Q3SA 2ARAA 1N75A 2QQ8A 2HWB2 5KXBA 3PNTA 3LMMA 3BOQA 2H09A 2A3SA 1OD5A 1O4YA 2VVFA 2V26A 1P4XA 5E16A 2P5KA 4HYEA 1RL3A 5JFRA 1UHSA 4WV8A 1U9OA 2W57A 3DEEA 3S1NJ 1W0UA 3ZYIB 3PIGA 4LA2A 1M06G 2VTFA 4G4FA 3LFMA 3KQ4B 4XJ9A 3ZSJA 2J1AA 1QJU3 2BNOA 1U2WA 4CP9A 5FLVA 3LFUA 1CAUA 4HT1T 4NIDA 2OVUA 2E7TA 4UW4A 2XC7A 1I5PA 2Y33A 2Y0SN 1FZPB 5KHIA 1YI9A 2Z1DA 3K1MA 5CLSA 4F55A 2LROA 5BYNA 2QTWB 3V8LA 3PL0A 3CO2A 1UCXA 4HSJA 4B3AA 1AR71 1D2QA 4LT5A 3H0DA 4PIZA 2XLGA 1LKXA 2M45A 4UVAA 1VQPI 1R081 2K9SA 1Z7S1 2FBHA 5D1IA 1V9U3 1OA2A 1VMFA 1ITYA 1WGXA 5HLTA 5FPLA 2J5PA 2CH0A 5IVFA 4XOPA 4LMYA 5FRMA 5E6HA 1G8WA 4O9EA 5BNPA 1H4HA 3ZMDA 3DTIA 1IXSB 4AF9A 3BIWE 3K7AJ 1HW5A 1W9FA 4YW1A 2IS2A 4U0VA 4I01A 1YTYA 4IGPA 1YJKA 3OPZA 1Z0HA 1GLHA 3S5QA 2RC4A 3HAGA 1YG2A 1CF7A 2BU9A 3A0BC 1SFYA 3GUDA 4KA4A 5C3SA 4E70A 4FISA 3IBMA 2CQXA 4XJUA 5EV7A 4YIIA 2X09A 2CUFA 5KVRA 2CJJA 2P2KA 4XXPA 1VMHA 3MFAA 3NNMA 4EROA 4JDMA 3A01B 1UY0A 1W6QB 1BOBA 2BFUS 4IJAA 3V0AA 1OURA 3VYTB 3BN6A 2PJRA 3HNYM 3ASIA 4I0WB 1DGWX 1HQWA 3BU0A 2YGLA 4JTOA 1QQIA 3GF6A 2CSOA 1YW7A 2WAQA 3GZEA 5ISLA 3OS2A 5FZLA 3A1YA 1BI3A 4G7OF 3HXLA 4DBQA 2DQRA 1SBDA 1P4WA 3ZXDA 2Y75A 1WCQA 5DN2A 2N8GA 5IYCJ 5J47A 3JBG2 1HJGA 1MACA 4II2A 4U0YA 3I3DA 4WK8F 4NQWA 2JA6J 1URXA 3MHZA 3WNKA 3ZPOA 4GWMA 3CO6C 1K5MA 1MEC2 2LALA 4XZPA 4YZ5A 1JZ3A 3HSFA 3VYRB 2D44A 3HRTA 1WFXA 4G12A 2R7SA 2PX9A 2RVCA 3C2BA 2RGVA 2LH9A 3A7QA 3OBTA 2CUEA 3PDQA 2OTJI 5KK1A 4FTSA 1OR7A 3WNMA 3ZMVA 4AQ6A 1NYWA 3CJNA 4D5CA 3M3YJ 2Q1MA 2MC3A 3KYDB 4XKWA 2J42A 3OTFA 1SD6A 1QY4A 3AZVA 2LKSA 3AYEA 3ZR8X 4AVVA 4ZDPA 4RR3C 3WP3A 3X29B 3KP2A 4QPIC 2W24A 3AX4A 1GHCA 5FY7A 1J3PA 4DGWB 1CAVB 4HX4A 3AMPA 5G04L 2JT1A 1SLCA 4AYUA 2BVBA 3OCPA 3WQBA 3WW3A 1OFSA 2K9LA 4CYCB 2W92A 2NRAC 4HN1A 2ZSIB 3ZQLA 1CZVA 5LBQA 5CG8A 1F9KA 1V54H 5KC6A 3KV5A 3VBSA 1ULOA 3ACIA 1W6OA 3OGGA 1FI2A 1FIPA 5GZGA 1A31A 2ZGOA 4BJTA 4QIWN 1XTAA 3JD71 1KQ0A 3DKYA 4GYIA 3QPTA 1O6UA 2QENA 2VOOA 2XLFA 1A04A 5I0UA 1MBHA 1RMU3 1O3RA 2IS4A 1O7FA 2UURA 2WB1A 3ZFEB 1K5JA 2OXBA 4P9LA 1GNZA 2VZRA 3IC7A 5DAWA 3O14A 3WG3A 1TNTA 1V5EA 3LSEA 2AXTC 5A7NA 4FVVA 2Y38A 5L3BA 3ME2A 2IVIB 4CXYA 1NXD1 3GCMA 1J83A 2WNVC 2E19A 2VMGA 3KEYA 4XFAA 1OCPA 2P6CA 5K0UB 4QDQA 2DMUA 4XSXF 3KZZA 3LOBA 1C5HA 1DGRA 2ZA9A 1U5ZA 1MS8A 2M87A 4PGHA 5IVCA 1T56A 1USSA 1SD4A 5HS7A 2G19A 3SHRA 4OFGA 1RUD3 1W90A 1FX5A 4Y15A 5EGOA 3ABMH 1Y0NA 1Y0UA 1FNYA 1RR7A 2JG8B 4GB31 5J3LA 5JXIA 2CG4A 5M0TA 5JZGB 2FBKA 1G86A 3WHTA 2PMWB 3CZUA 5KCMA 4XRSG 3VD4A 1YO8A 3NAPA 2M0CA 1SBFA 2DDUA 2GOXB 4OIPF 3WT3A 4YFZA 5A7WB 5F6KA 2PQQA 4C3JJ 4QDSA 2XUEA 1ZG1A 2WNOA 2E36A 2Y6KA 3LSHA 2WS92 4R9CA 2WA0A 4F91B 3N36A 4KMUX 4P5HA 4RLQA 1H1IA 4QPIB 2VAUA 1XYOA 3PIPF 1T39A 2ZGTA 5ILSA 3I53A 4XN3A 1R4MB 3ZVXA 4CO8A 4YPJA 4BDVB 3H3VK 4A3XA 1JTXA 1NOVA 1ND3A 3CJIC 4KNYA 2M34A 4TWTA 1TWCJ 1EYBA 3HBKA 3B9CA 1U8BA 3RJPA 1AR92 2XVGA 4GMP0 1H0MA 5AIQA 1F4AA 2JA5J 3GYHX 2ZMNA 1BYHA 1NCQB 1W6MA 4A44A 3O12A 1DU6A 2A61A 2HYGD 1QZYA 4XF0A 3FC0A 3N9QA 5BNPB 2WZR1 2IS1A 2LDUA 4PLNA 1JHFA 3F8BA 5F2WA 1HQNA 5FY4A 4JGYA 3CJTB 1LEDA 4LO6B 1IGOA 5ILUA 3ZXJA 3JRIA 4ES8A 5DS9A 2OZJA 2ZKLA 4Q4X3 4XFIA 2JECA 5A3LA 5FV3A 2QQOA 1RUOA 3PLQA 4RA0A 2CYYA 4AAPA 1SD7A 1ZA4A 3WR0A 2DT7B 3MW3A 2B5HA 3NL1A 3MV11 2QM3A 4X6AJ 1QA6A 4KG8A 1WLDA 2JZYA 2CO5A 5AC92 1BEV1 4L9NA 3SEQA 3NQOA 2EXIA 3VDAA 4XIDA 3IT8A 5JI6A 3V42A 5FXVA 1WMFA 2GQQA 4GB33 4L5EA 4HXCA 3KD4A 5EEAA 1Z91A 4XF3A 2BYVE 4WM8B 3AP7A 3GCWA 1RIOH 3TEYA 1FSEA 5CQGA 4IOCF 2X5IC 1ULFA 2YYOA 2CSGA 4COVA 1MZ6A 1RUH2 1DPUA 2PHFA 3JCUC 4IRHA 5IOZA 4H55A 5JIAA 2JUGA 1OOPC 5H9SA 4GJZA 1PMJX 5GALA 2IBDA 4QM9A 3CZJA 3ZQGA 2G7UA 1FV2A 2D5FA 3S17J 2D6MA 1H2MA 1NQDA 3H8XA 3JAMZ 3RSNA 4XQWA 3WNXA 1K5MB 2VMDA 3VL8A 5AC93 3VSKA 2DO7A 1W3VA 3BB6A 2E5ZA 4Q0UA 1R6RA 2LS6A 5LB6A 4AQ2A 1OUXA 1D1CA 2OQ6A 1UO9A 4Y7NJ 5HBAA 4HZFA 3VBOB 1MMNA 5FDBA 5DEQA 4LD5A 4WVWA 5FKKA 4CCEA 1G9BA 4QQPA 2P34A 1HJFA 5JI7A 1NZIA 1WW4A 1YHQI 3TKYA 2Z69A 4GKXA 1RXGA 3SZTA 5IW0A 3WSOA 2RS13 4ZXKA 4FAGA 3J4UH 4HLYA 4JV4A 4YM3A 1DQ0A 2JEMA 1PVEA 1V6NA 4JRLA 1UIJA 4ITVA 1Y1VJ 3EUHA 4RGAA 1P7JA 5HLHA 2BW3A 3IDCB 3I3MA 3ELKA 4EYUA 1WPKA 4FOYA 1WI9A 5HDKA 4IX7A 1VQ7I 1QIQA 1FP1D 1FOWA 3WDTA 2L4AA 4UW6A 4FAHA 2XAJA 3UESA 5IVVA 1Z7LA 2LY2A 3N4MA 5DQ0A 1RC9A 3MN2A 3HUGA 3AFKA 3LAGA 4AGGA 4GALA 4EN6B 2WWYA 1ZN2A 4UF0A 1K6OA 3H0GJ 1YXWA 3CLPA 4IEXA 1IRZA 1MNMC 3BOWA 3MIDA 4GXOA 3RJRA 4KN4X 3M7GA 1R082 2NVQJ 5GLZA 4OI2A 1Z7S2 2OPKA 4CDUB 1AVBA 4R4XA 1E3PA 2Y9ZA 4OI4A 2JTVA 2ZHNA 2HKOA 5A3OA 2A6TA 2WSVA 4GZ9A 4ZS2A 1KONA 2WFPA 3U21A 2VC1A 3BPSA 1JZ5A 1LU2A 4BU2A 1O8SA 1T2XA 2R7OA 4TLFA 2LMDA 4CEYB 3CJRB 1OR7C 2XAHA 4LB5A 2R6QA 5JMCA 1UL9A 3RKWA 2PI0A 4LB6B 4FCYA 1TQPA 3MIFA 3NKTA 2YX4A 1MZFA 2COMA 3U78A 4Y5TA 2HOSA 4E2GA 2AH2A 4CDXC 2LD5A 4IF4A 1FIAA 3POWA 2DTWA 6PAXA 4HBNA 1W6OB 3OS1A 2CU5A 2E35A 1UZYA 1QJX3 1U0AA 3VZLA 4BZ4A 3KQRA 3TEZA 4FOWA 4ZZ5A 3WTTC 1I3HA 3OD0A 1UX7A 4YZ3A 3HC7A 4CDGA 5C5UA 3AYDA 1WVRA 1H89C 3DBHB 3K3OA 4Z2WA 2VJ4A 4D7TA 4NMIA 3DU6A 2VUMJ 3ZMUA 4YGBA 1J09A 5I0RA 2ZMEC 4KG0A 5EJ3A 1I9RA 2OTLI 1KGSA 2W39A 4IEQA 2E34A 1YX3A 3O1VA 3K4JA 3S3NA 3H9GA 1Y9GA 1X2MA 4ENNA 3OIOA 3CMEI 4QGMA 3RZLA 4TN7A 4MFEA 3JBG1 1Y39A 2I5UA 3TN91 3DEWA 1YIOA 4NHLA 1Q1HA 1W7PB 1ZR2A 1IG0A 1G8XA 4YVSA 4IV3B 1IJWC 3RYPA 1MEC1 4HVOA 5FZHA 1W9SA 3CMAI 3T4HB 2ZX1A 2HWD3 4LOCA 4QTRA 2YPRA 4B3XA 3HQXA 4KN7X 4MSVA 2JDUA 3Q0VA 4FT8A 3I4PA 3PUHA 1RUH3 2W08A 3OBAA 2LSOA 1Y3TA 4DUXA 1DPRA 2QCSB 4P1WA 5DUIA 2BNMA 1QU0A 1ENRA 1IC8A 2CFXA 3EBRA 3MVPA 1NAEA 4BQNA 2HFHA 4XUTA 4QXCA 1AKHA 5EG0B 5I8TA 3TN92 2RQQA 1AOYA 1IGNA 4XABA 2LLKA 3NARA 4LA3A 4OULA 2JSCA 4NQWB 1FYLA 5IK7A 1VQ6I 5FYSA 2ZEXA 3MLKA 4RHV2 1O3TA 2CWMA 3B7MA 4G6TB 4DRRA 2OC6A 1GNHA 5GLVA 3BTZA 2F5DA 1UHMA 4B43A 3AMNA 1QOTA 1NCQA 4GMP1 1YFUA 4HNVA 1UG2A 2AHQA 5LEKA 1EPWA 4YZ2A 2VNOA 2FJ1A 2KRFA 1R5GA 2A5WA 2NXNB 4BE2A 1XB9A 3AK0A 2LKPA 1CR7A 2EPFA 2J22A 2A70A 2WBMA 4YW3A 3OL3A 5L3EA 1LFBA 1WSUA 5HNFA 1LJ7A 3CIHA 1BR4A 3I7DA 1TT5B 3HOVJ 4GCVA 4LBQD 4UVBA 3CCRI 4Q4X1 1G59A 4A41A 4PLOA 3SKVA 3OL4A 2ZZQA 3VHNA 2ISYA 1RR8C 2X1EA 1DDLA 5C5TA 2GMPA 3CUQC 1NQJA 1QJY2 2HWF3 4JZRA 3SH3A 1ZHFA 1V0AA 2MFZA 3FHIB 3B02A 1K79A 2PHDA 4XK4A 4XEZA 2PLV3 2X05A 1CESA 5A1AA 1OCRH 2BNNA 1TWHJ 3Q5FA 3ZO0B 1AR61 4ONUA 4XBFA 3DV8A 1Y6IA 1B6AA 1PMIA 4AU7A 4BLJA 1DGWA 1BIAA 3KP7A 3HD8B 2WZ8A 4HDUA 3LQQA 1H2NA 3BI3A 1E0EA 1FOD1 4QKBA 2WFF3 1X1CA 2JKXA 3DPUA 3VD9A 3KZYA 1Q56A 4NOTA 4ZTJA 3L09A 4ZZ8A 3HQRA 5A3UA 3GVAA 2TDXA 2JIGA 4M6XA 5JOZA 2ZBKA 4FI9A 1RHI3 3NWTA 1S2EA 3T8TA 1RUE2 1GOFA 2FUG2 1IF1A 4CCCA 3J81Z 2D6OX 5JLXA 2O8QA 2P81A 2QQJA 2DPDA 2BTVC 3RQ4A 4A45A 3OG2A 4P9IA 4FPGA 4IEZA 3OOUA 4CU6A 3POBA 1LNWA 1DZRA 3NAPB 2CV6A 2LRPA 4OUEA 1HW2A 2EILH 3BROA 1YYNA 4CDQA 2OAZA 4FPYA 2RV8A 4UHTA 1BI1A 4CHUA 3S1QJ 3MICA 5CKTA 3H8RA 1GKBA 3S14J 3H9QA 2QYOA 2JWTA 1I6HJ 3ABKH 2C1FA 4B4QA 2M1BA 2K2SA 4R52A 5EEHA 4CTEA 2JG8A 1RUE1 1X9TA 1SVLA 3FDYA 2YS9A 3AVSA 3L2VA 3DXUA 1GMMA 4XICA 2K9ZA 5CYVA 3IPVA 2V09A 4Q1RA 3JU9A 3DFGA 2PELA 1DF0A 5CQEA 1LHVA 2QJVA 1N47A 1ZM1A 1MSEC 2IT0A 5J40A 1R71A 2VW0A 5L9RA 3ILNA 5FK8A 4NPLA 1F9NA 4Z92B 1N1TA 3NV4A 1OPMA 5FKBA 1R1A2 2BRTA 4BQ3A 2OA4A 4ES9A 4NIAA 2W25A 2W3JA 2YFUA 2D6LX 2XSJC 5H9QA 3V0AB 4CZCA 3J80Z 1FJLA 5F5QA 1K83J 4IEJA 4BJ0A 3VBUC 5FFZA 5GAHJ 1GV2A 4Y22A 2VC9A 3WE3A 4NAMA 1HX6A 2HWE3 1D4M3 3LCPA 2ZMEB 2W87A 5D8AC 2WADA 1L0OC 2QQIA 4V19K 2BHYA 4LO7A 3DYOA 4LHKA 5FO8B 1G3SA 4Q4W3 2PMHA 3BPXA 5BNOC 5A6ZA 1C8M1 3I58A 1R093 2EH3A 3IAPA 1SFXA 2XL7A 3LGRA 2BJSA 3J9SA 1R1A1 1KJLA 3M07A 2FD8A 5F0HA 3ZN4A 2HZTA 1JHJA 2ZJCA 3D0JA 3OYDA 3OYCA 1PZ9A 1UMZA 4XTMA 1I5ZA 1W0PA 1OQ1A 4XBLA 4AIJA 2VMCA 2NQYA 4HOBA 5FP9A 3TOBA 3I64A 2CWSA 1WWYA 1ZZ7A 1VQ5I 3ZQQA 2QQMA 5C3EJ 1BK1A 2PYTA 3S7EA 4M3EA 2V73A 3G73A 3HOBA 3ECOA 4YVSB 1EUUA 1U0JA 2ZGUA 3O0WA 3F8MA 3JB4C 4DPNA 1KYZA 3ZYPA 5CU1A 2AUYA 1JE8A 1VRH2 4GULA 3VBHC 2ZXWH 1R1TA 2OW4A 4CPBA 4GAZA 2OCEA 1J75A 4XW3A 5KHJA