3DV8A

Crystal structure of a putative transcriptional regulator of the crp/fnr family (eubrec_1222) from eubacterium rectale atcc 33656 at 2.55 a resolution
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
216
structure length
216
Chain Sequence
ENYFPLWNDLNTAQKKLISDNLITQHVKKGTIIHNGNMDCTGLLLVKSGQLRTYILSDEGREITLYRLFDMDMCLLSASCIMRSIQFEVTIEAEKDTDLWIIPAEIYKGIMKDSAPVANYTNELMATRFSDVMWLIEQIMWKSLDKRVASFLLEETSIEGTNELKITHETIANHLGSHREVITRMLRYFQVEGLVKLSRGKITILDSKRLETLQRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords transcriptional regulator, Crp/Fnr family
publication title Crystal structure of transcriptional regulator, Crp/Fnr family (RER070207001219) from Eubacterium rectale at 2.55 A resolution
rcsb
source organism Eubacterium rectale atcc 33656
total genus 63
structure length 216
sequence length 216
ec nomenclature
pdb deposition date 2008-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3dv8A02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3dv8A01
1D8KA 2ISYA 4I98B 2DQLA 3BPXA 2VQAA 1K7AA 2EA7A 1O3TA 2XVCA 4L9VA 5K5QA 2PHLA 4A0ZA 4M9SA 2O1QA 3RZZA 5E1RA 4ENNA 2ESNA 3E97A 3E6BA 1BN5A 4EROA 1EP0A 5ILVA 3WTWC 2P6TA 5L3GA 3GYHX 3ST7A 3C3WA 3DL3A 3KETA 3QOPA 1QXRA 1RL3A 2A68F 1ZZBA 3DXJF 2Z33A 1LB2A 4L11A 3V8KA 3SFZA 4QGNA 4HX8A 1K79A 4ESJA 1ZX5A 2PAEA 2PJPA 2YU3A 1UW8A 1FYLA 4BXUA 2UWMA 3GF2A 2MC3A 1JGSA 5E8IA 2VBZA 4AIJA 4JV4A 1QZZA 4ENJA 2XL7A 4AVBA 2WC2A 4AWXB 2OPKA 4E2QA 3IIAA 1KYZA 2LKPA 3CUOA 4YYOA 3K0LA 3RKYA 1FBUA 3I0TA 1USTA 4LULA 2QVOA 3COAC 3CUQC 1S7OA 5HVQC 1XCVA 1J59A 2KJBA 5F64A 2UYAA 1DGRA 4KIFA 2CO5A 2QLZA 1B9MA 1KA8A 3PVBB 2DW4A 1J5YA 3F8CA 1B1BA 4A2UA 2MA3A 2EB7A 1I27A 3WTSC 1LJ9A 1XMAA 3T8TA 4QM8A 2ZJ2A 3TGNA 2OYZA 4RGXA 1RGSA 1LRHA 5CJ9A 1H1IA 2NAZA 2PYTA 4XFIA 2GU9A 1FYMA 4LK0F 2OAZA 1CAUA 1LR5A 3GFJA 4MV2A 5L3FA 3H50A 4FT8A 4LK1F 1XE8A 3KFWX 4HF1A 3RJPA 1D3YA 3KLOA 4F7ZA 1O7LA 3FMQA 4PDKA 1LDDA 3HRUA 1BIAA 3F3XA 4KT5C 4UXNA 4KICA 3MAJA 4FAGA 2STWA 3OF1A 2XASA 3RPUA 2XLFA 2EA2A 2XV4S 1IN4A 5HDNA 1DZTA 3Q9SA 3Q9VA 4OINF 2HJIA 4P96A 4UBGA 5JR7B 2P7VB 4AVPA 3ROUA 3CO7C 5FPXA 4IERA 5E16A 4XF4A 1YWKA 2Q8KA 4CDGA 3VFZA 4LFUA 2Q2EA 3BP8A 5D6FA 1R00A 2VBYA 4L9NA 3ERED 4JQFA 5E18F 1G3SA 5CVUA 2F4PA 4IEYA 5F6FA 2ZBKA 5BUVA 3KGLA 3R0JA 4KN7X 4A0YA 2Y48A 3ACLA 1J3QA 5LRSA 3DPLC 1O4TA 3JW4A 2ZKLA 1NHAA 1HSTA 2VOPA 4EWDA 1BIBA 3GFIA 4KFCA 1FOKA 1IZ1A 5H6RA 3ZN1A 4S04A 4LMYA 1HW2A 2XKOA 1ZZ6A 3WE2A 1O7FA 4EWEA 3BROA 4B09A 3USSA 2BEOA 1OI6A 1UB9A 3MQ0A 5ERIA 4HF2A 2FA5A 3E5QA 5FDBA 1YLFA 5KHGA 2NRAC 1ZVFA 3L2HA 5LGNA 3TKYA 4EVIA 5C6CA 1S6LA 2GIVA 4O6JA 5D5UB 3IKTA 4WXCA 3WU1B 1O3RA 1CAXA 5LHHA 3RI4A 1DPUA 1E2XA 3QPHA 2MPFA 2IXJA 3SXYA 3I71A 1VJ2A 1B59A 4ZZLA 1Y3TA 2Z2SB 4EM1A 1FSHA 1L3LA 4G7HF 1YLLA 3SZPA 4RAYA 1Z6RA 3O2PE 3OTFA 3TOAA 4N9IA 1ZZCA 2VBXA 2NYXA 4L5IA 3WODF 2ZXJA 3WTUC 2FSWA 1IN8A 3P7NA 4RGUA 3LAGA 1GXPA 4IETA 5J8FA 3U2RA 3R0AA 4CYDA 1LDJA 5DUIA 1B4AA 1ZNPA 3S2WA 1FWZA 2A61A 5FLHA 1YIOA 2P5VA 3FZVA 4M6YA 5I0RA 4L0ZB 4O9EA 4YIIA 2Z9OA 3V8LA 1XGSA 3EQLF 3D82A 1Q1HA 1YYVA 4HSJA 3RYRA 3KP3A 2XRNA 2ZMEA 5A2QZ 2HTJA 2ZO4A 4LB6B 4AVCA 4GGGA 4WWCA 3MCZA 3R61A 3K1NA 4YG2F 2FBIA 3ML6A 3UKVA 1WRJA 1FZPB 1X7NA 3S7IA 1TNSA 1IUYA 4Q48A 3WW3A 4HLTA 2DCTA 5LLQA 3J80Z 1U5TC 2J5PA 3WU0A 5FO5A 5JR3A 3U1DA 1K78B 1EPZA 1P2FA 5FLXZ 1J75A 4LD5A 2O61A 4P9FA 4G9YA 5I93A 3D0JA 4Q0UA 1D8JA 1O57A 5DD8A 2GWRA 4HDVA 3F8BA 3E6DA 3E3VA 2UY9A 5CLSA 1PP7U 2ISZA 3DFGA 4EGYA 2PLYA 2L02A 4CO8A 1OKRA 1IRGA 2OZUA 2MH9A 5I91A 4Q0VA 1W5SA 1F1ZA 3WTTC 5AVPA 5K8SA 5CVIA 3F21A 1LDKB 2YX4A 2G7HA 1Z9CA 4YSFA 4HW0A 2DK5A 2ADUA 1YFUA 4G7ZF 1U5TB 2XLGA 3ULQB 1JXSA 1ZZ7A 2BGCA 5ICFA 1R7JA 1UIJA 4KWLA 4F8AA 2RDPA 2TDXA 2F2EA 1SFUA 1VR3A 4G8XA 1IW7F 4AXOA 1G3YA 5LGUA 1J9IA 3F72A 5HLHA 2NS0A 4PZJA 2IA1A 1FP1D 2G9WA 2HYFA 3HHGA 3B02A 1IF1A 4QGLA 4PGGA 4KMFA 2H0VA 4OLLA 2OA4A 2EFPA 4EJTA 3WGHA 5DEQA 3RPQA 5DCMB 3TOBA 2FEZA 4Q4ZF 4UBHA 4RAZA 3HT1A 2PEXA 1XSVA 5KHHA 1WLTA 2XAQA 4IEOA 5KHJA 2W24A 2Q4SA 2KJCA 1ZHFA 2HTSA 3E5UA 4CGZA 1ZARA 1MGTA 2GXGA 1T38A 1ODDA 2WTEA 4P9UA 1YFWA 2EWNA 3OV8A 1UD1A 2PQ8A 5E1ZB 3FMRA 1XDSA 5BMZA 3ABUA 1ZH5A 4YNIA 4RGRA 1JHHA 5JSOA 3LSTA 5EEHA 2K27A 2VE8A 4L2NA 5FGMA 3JZVA 1H0MA 5FD5A 3PQKA 3FXQA 1TQIA 2PAKA 3M8EA 3T5XA 3H1WA 2CSOA 2IXCA 5EFUA 2PHDA 4MZUA 5ILSA 2K4BA 2P8TA 5J3UA 3LA7A 5D6EA 2MLGA 3V7SA 4CHUA 2E7XA 4IEXA 4YRDA 3HOSA 1ZRCA 2GQQA 4UVBA 1YO5C 4EJVA 1QNTA 3LAPA 1S29A 2A07F 2XUBA 1LQ1A 3ZP5A 5FCCA 2HOEA 3EUHA 2QCSB 3LFKA 2HYGD 3CUQA 4DINB 4QGMA 2PQQA 4X6QB 3QRFF 3QU6A 4ZU5A 2CYYA 4M9XA 4ENKA 2XL9A 3GX4X 3J7AO 2PTMA 5AONA 4XF9A 4ENMA 1HKQA 4HV6A 2LF8A 1XRUA 1HXDA 3L2CA 3LOIA 5F1RA 4Q0QA 3ZDSA 1Z6TA 5KBFA 4ONUA 1YS6A 1B9NA 3MWMA 2ESHA 2FF4A 4O9GA 1WWXA 1ZG1A 2W84A 4Z07A 4GYGA 4LUMA 4M72A 1JUHA 2VE9A 2EK5A 1O5LA 2M87A 4GXOA 4LA3A 4YFXF 2VC0A 2OU2A 1RIOH 2EFWA 4KU7A 3TO6A 3CJXA 4MGRA 3BOQA 4EJUA 4MNUA 2Q1ZB 4UUVA 4XFCA 1MZBA 3GZ6A 2VOOA 2H6CA 4KIBA 2A3SA 5CVRA 1BC7C 2P5LC 4DQ2A 4B8XA 2IXKA 1L3JA 4R8HA 5DDGA 4PGHA 5FLIA 3U10A 5KHIA 1IN5A 3OD0A 4WF2A 1Z05A 4OIOF 4UVCA 2IXHA 3CO2A 1OR7A 3TO9A 3BCWA 1X8EA 3FFQA 2AS5F 2QM3A 4XSZF 2E9QA 4M73A 2WFPA 3EJKA 4KWJA 4NB5A 4HVQA 2YPRA 2BNMA 4RS8A 3PQJA 1T0FA 5L3BA 4BAYA 1BI3A 5LEKA 6PAXA 2N7GA 3C3VA 4A0XA 1PUEE 3CLOA 2EAAA 4CZZA 3WTVC 5I0SA 5J8CA 3J81K 2P7CB 2KIUA 2M1BA 4UV9A 3TDZC 2W85A 4OIRF 4QMAA 1F5TA 2J5OA 4IJAA 4LUKA 3K9TA 4I3PA 4J1XA 4N0BA 3F6OA 1PP8F 3H1YA 1XDUA 4K8FA 2STTA 2DLLA 2O8XA 1XSDA 4UHTA 4NVPA 1IRFA 2LSOA 1DPRA 1GXQA 3MFKA 2D40A 4EJOA 2Z5UA 5DUKA 2V9VA 1WQ2A 4BHBA 3QP5A 3EBRA 1BOAA 2MNGA 3JTGA 2XHKA 1R5HA 1YFYA 4I09A 4R79A 4L5JA 1U2WA 4HBLA 2DPUA 1CAVA 2MBFA 4A12A 3DPTA 2BBYA 3LA3A 3U0ZA 5J7MA 1EY2A 1MJBA 1P6RA 3IC7A 1EV7A 3M70A 2KIFA 1Q43A 4Y17A 1YS7A 3KCCA 3L00A 3LAJA 1EYBA 2QQAA 3ELKA 2EFOA 3LWFA 1J1LA 4MHGA 1J3PA 2IP2A 5BOXA 2GA1A 1I1GA 3ECOA 4R52A 3HUGA 3MPBA 4A6DA 4IHTA 2ZNZA 4QLCU 2A6HF 3HHHA 2LDUA 2XKPA 1H9GA 3EHKA 3V7RA 3E6CC 4IPAA 1U5TA 4HX4A 3JAMK 4QM9A 4CICA 1MDMB 4A5MA 1FPQA 5FQ0B 2M5WA 3N4MA 4EGZA 4XF3A 1V4RA 4PCQA 3KGZA 2OQRA 5JSPA 2IC1A 4P55A 1FP2A 3WW2A 2Q30A 3HSRA 2UXXA 2D2WA 2QQ9A 3T0YA 2CQKA 2GZWA 1H1MA 3CTAA 2QNKA 4HMZA 2JZYA 1SMYF 5DYMA 2IJLA 5IT3A 3GLXA 2KXLA 1SD5A 3H7YA 3O14A 5T3NA 1ZGJA 3U9GA 4BHCA 2M30A 2FQPA 1GQHA 2VBWA 5ICEA 2L54A 1WI9A 1XD7A 2X0LA 3TQNA 1DZRA 4Z82A 2PN6A 4EV0A 4HQEA 4AIHA 4U7BA 1ZLKA 4MX3A 2PMUA 1KGSA 3SQNA 3WG9A 4KUMA 4HF0A 3R6SA 4N9HA 2IT0A 2XLAA 1OYYA 5D8LB 2VXZA 4MTDA 2C6YA 3KP5A 3LQRA 1CF7B 2QBYB 1ULYA 2VN2A 1J58A 3WGIA 4B29A 2IXLA 3MYXA 1CGPA 2B5HA 4ZH4F 1MKMA 2VT2A 5BPDA 4GYIA 4A5NA 1DUXC 4UNOA 1YUDA 2KKOA 5LBQA 1MJ9A 4EM2A 2IXIA 2YSRA 4ORFA 4EWAA 2L4MA 5D8KB 4H7LA 1OMIA 2QYOA 1G3TA 1ZYRF 4AIKA 4KU8A 2E1NA 4MGIE 2O6GE 3HRMA 2W25A 3HQXA 3L09A 1IN6A 2F5EA 1XMKA 5LGTA 2EA4A 1HSJA 3TDUC 4KMUX 2DQRA 1W5TA 1TW3A 1EH8A 2JSCA 3AAFA 3M9AA 2IA2A 4EM0B 5LEJA 3NW4A 2DO7A 1FYKA 1YW8A 1U8RA 1H9TA 3OCPA 2P6SA 4KL1A 4WXDA 4WCGA 4RB0A 3R4KA 2ETEA 2VC1A 4HLYA 3NL1A 2DI3A 3TO7A 4D0PA 5BS6A 2NNYA 1IPKA 3ETQA 4IRGA 2HKXA 1KQ9A 1R1VA 5H6QA 3FE5A 2EV0A 4LG0A 1CAWA 4MGZE 4HVOA 1XSXA 4ON0A 4IRHA 4E2GA 2RV8A 3KSCA 3HIFA 2L3DA 2KRFA 2EV5A 1E17A 4OMYA 5BPXA 5C8WA 2CG4A 2P5KA 4HX7A 4TLFA 1OPCA 1I1SA 2MLKA 1X3UA 3LWCA 1ZAOA 2M45A 2HGCA 2B9UA 2EVXA 2K02A 4ZU4A 1R22A 4M71A 3IBMA 2PBIA 3U11A 2MH2A 1IPJA 3V4GA 3ZMVA 3IWFA 5I8SA 2K4JA 3L9FA 1YG2A 5FD6A 2QWWA 2ZKZA 5EZWA 2UZKA 3HRTA 2GA2A 2C0ZA 2PA7A 4FHTA 2IA0A 1KQ0A 2RN7A 1YHFA 3H1MA 3ISPA 4XETA 2HS5A 3E6MA 5CADA 4M6XA 2D45A 3JSOA 4YFNF 5ILUA 3JTHA 1W7PD 3IRQA 2OD5A 5BY5A 2LNBA 2FNAA 2Z3YA 1IXRC 4RD7A 3DKWA 2RGVA 3C1DA 2O8QA 2QDRA 1YFXA 3BY6A 3EETA 4U88A 3SMHA 4OMZA 1FC3A 1ON2A 2Q0AA 4MGKE 4PIYA 3RKWA 3OGJA 4UV8A 3GVAA 2XAFA 1X82A 4FAHA 3SHFA 1KU7A 3H8UA 3CL1A 3WGGA 4OU0A 4M74A 4QWQA 1YW7A 4OFGA 4IESA 3J81Z 1IN7A 3OOPA 3M3IA 1UHMA 1HKTA 3WTZA 2GC1A 1XB4A 1XN7A 4CXFA 1I6XA 1S8NA 1REPC 3HTUA 5HLIA 1O5UA 2V1XA 1SQ4A 3I64A 2XIGA 2JPCA 4XFFA 3TNQA 3RTRA 2OQGA 4XBFA 5IT9K 3KP7A 2PFWA 3QU3A 5L3EA 4U0WA 1FXZA 5HS7A 4KA4A 5E8GA 5FB2A 1IXSB 4XFBA 4L0YB 2ETHA 5TJJA 2VPVA 5BPIA 1QWRA 3I54A 3P9CA 2ATFA 5CYVA 1QO0D 1J0RA 2DAOA 3BJAA 2FRHA 3GYDA 4META 3KE2A 3FJSA 5AIPA 1C0WA 4D7SA 3HYIA 5JSRA 2IW5A 4HLXA 3ZPLA 2YR2A 3BJOA 4WX9A 2CW0F 1OD5A 1XGMA 4WVZA 1IAWA 5L3CA 3M1EA 5JVTA 3QACA 1R23A 3Q5FA 3H9AA 2DFIA 4WK8F 1TW2A 2PMHA 1ZN2A 5A2QK 4QXKA 1BBYA 2V6CA 5BQTA 4I7HA 4O5VA 1MDMA 2UYBA 5FQ0A 3C7JA 2M8EA 1J2XA 2Z69A 4IEVA 3MEXA 3ZMZA 2DU9A 1G3WA 5LHIA 5E17F 4IEZA 1J3RA 3J80K 3VODA 5DD4A 3QP6A 4HSLA 2H27A 5JHUA 1KU9A 4IEUA 3PFIA 1QZYA 1R1TA 3KLNA 2PFBA 3BPVA 1QQIA 2CAUA 3F8MA 1CX4A 3EO6A 3PNAA 4XLNF 3MZYA 4E70A 5JI6A 4HN1A 2BE5F 3ZMDA 2K9ZA 4PJYA 3UKNA 3IKVA 4L18B 1PDNC 3T1BA 3FXRA 1T39A 3KZZA 1ZRDA 4KNYA 3WTXC 5D1IA 1B6AA 2VONA 4I0AA 1CF7A 4BH9A 5K1YA 2QBYA 1BI0A 1MJAA 2CFXA 1MD0A 4ASNA 4UVAA 2FMLA 4Z2YA 3H3ZA 1ON1A 1Y0UA 2R3SA 3ZMTA 2FOKA 3NSTA 2RKHA 4P5OA 1RTVA 1EH7A 4IXAA 5CU1A 2F5CA 4I02A 4RB2C 2FE3A 4IEPA 2XAGA 1F4KA 3MZHA 1K6OA 2HDCA 4Q0SA 2B0LA 5TRDA 1TTYA 2Q0OA 1TQPA 3NKTA 2D93A 2O0YA 2UXNA 4LGWA 2KIMA 1LEAA 1RUOA 3BJ6A 4WZCA 1P92A 3I53A 3DF8A 1V70A 1WGPA 1HBXG 5K5RA 1UHWA 5HS9A 4MGYE 1SFEA 1RI7A 2L4AA 3KP6A 2FMYA 3IL2A 3DP7A 3ES1A 3B73A 1WSUA 5ICCA 4XEZA 2BNNA 2PI0A 4KYWA 1U3EM 5I8TA 4IHSA 2H6BA 3K69A 1ZZ8A 1UCRA 2PG4A 4BIFA 5J48A 2UY8A 5E20A 4Q29A 2A5YB 4GULA 1Z91A 2L01A 1KU3A 2ET1A 3REOA 4JK1X 1W7PB 3KEOA 1K78A 4U7DA 3W6JB 2LF7A 1RUNA 2QENA 1AOYA 1T6SA 3HSEA 4IF4A 3SZTA 4LB5A 3ELNA 3SHRA 3VHRA 1P4AA 2RC4A 3BZ6A 3GFMA 1XGOA 4AVAA 4FX4A 2HR3A 4HV5A 4E2SA 4AD9A 4IEWA 4IEQA 1T98A 5FFXA 4JVAA 2COMA 2QZ8A 1XE7A 5D5XB 1XGNA 2GC2A 2ZCWA 2ZFWA 3I59B 1BI1A 4XLPF 4X6RB 1EH6A 4YIFA 4OOIA 2D1VA 4Q5SF 1R5GA 2EV6A 3KP2A 2FNPA 3V7CA 3KEQA 4S05A 1SD6A 2O3FA 3GBFA 2EJRA 3LZZA 1GVJA 4XF0A 1S3JA 5D5VB 2H09A 4XSXF 3SCGA 3BB6A 5J6XA 3FM5A 3CUQB 4DNCA 1AWCA 3F23A 1Z1DA 2HQRA 3VOEA 2FBHA 4I2OA 3UKTA 1SFNA 3H3UA 4LLOA 1J7KA 1GHCA 3FZ3A 2CWEA 3LA2A 3WE3A 4BHPA 3DEUA 5LHGA 4HYEA 4G94A 1ZGAA 1ZG3A 1HKSA 2Y75A 3DQVC 1HW5A 3FM3A 4L9JA 1NZCA 2CAVA 3GUDA 2HQNA 1BC8C 4HZFA 3NRVA 5DCMA 4OIQF 2K86A 1L0OC 5H20A 2O03A 3K1MA 1NXMA 1U6GA 5AIQA 3IHUA 1U78A 2X4HA 4FX0A 3DV8A 2E7WA 3CDHA 3O3KA 4I01A 2XAHA 3BDDA 2DT5A 3GW2A 4LLNA 1NYWA 1VTNC 4M9ZA 2XROA 3FX3A 4I0BA 3O6BB 2EFQA 1LEBA 5D5WB 3ABTA 1R36A 3R60A 3T8RA 4LEJA 1GQGA 2CGPA 4MTEA 2OBPA 3HOTA 3NJZA 2G7UA 4AQ2A 1G6NA 2JTVA 1P4XA 5L3DA 4MH0E 4GO1A 2HWVA 4YARA 2B8MA 2D1HA 1BJAA 3ZMSA 2CV6A 1YW9A 3SCHA 4ZU7A 2MHFA 3G3ZA 4NHJA 2AXLA 2HZTA 5IT9Z 3L7WA 5FLJA 3RKXA 5EEGA 1ZG5A 1U12A 1OYIA 2DTRA 4HDUA 1ZREA 1BM9A 2MD5A 2GAUA 2BYVE 3JSPA 1LVAA 2VT3A 5E1WA 3EDPA 3IDCB 3ECHA 3DN7A 3G7DA 4NQWA 5KK1A 2OZJA 1QXJA 2RQPA 4LLGF 4ETSA 2QJVA 5DCFA 2GC0A 2PAMA 3RNSA 2IVMA 3BWGA 2F5DA 4A6EA 4P9GA 2XAJA 4D7TA 4EMSA 1ZRRA 2EFNA 1KQ8A 1O3SA 5HDKA 5JCTA 3IWZA 3HRSA 5FFZA 4XFHA 3EQEA 3QAHA 4XFGA 2FBKA 1NE4A 5FPZA 1UIKA 1QBJA 1Y9QA 1G4DA 2V09A 4QX5A 5BV6A 5D4SA 3NVCA 2FQ3A 1UFMA 3WW1A 5HI0A 3FF5A 3H92A 5KHKA 3GXOA 1QGPA 3F8FA 2ET7A 4G6DA 4ESFA 1D5VA 5ED4A 2QVSB 3I5UA 3H7JA 2V79A 1OFNA 3MDPA 2DK8A 4FBFA 1TBXA 4JTOA 5KVRA 3I4PA 1CAVB 5CVVA 1T2KA 1LKNA 1FT9A 1A04A 2W57A 3RIRA 4EQQA 3EYIA 1USSA 1LNWA 1RC6A 3WTYC 2ELHA 1CAUB 4HVRA 2V1DA 3SCFA 3CF6E 4MQ9F 2ACJA 2HKOA 1PMIA 3QPTA 3P9IA 1QY4A 4RB1A 1I5ZA 1YFHA 1TNTA 1Z7UA 3E5XA 3M7GA 1YQAA 4RB3C 4EJWA 4KWKA 4J1WA 2F5FA 3PLQA 1F9NA 3I7DA 3BALA 2JPBA 1ONVA 4ZYGA 2QQBA 2NNNA 1R1UA 4XRFA 4LJZF 4ESBA 4Q47A 1XCBA 1KU2A 4MUVA 1HW1A 3N97A 3VEPA 4RGSA 1S7AA 5JFRA 2Z99A 2JRTA 3F8NA 2R7DA 5HDGA 4JTNA 3ES4A 2RVCA 1YTYA 1ZZ9A 2A6EF 3FMSA 3GFLA 1JE8A 2V1UA 4LTAA 4HAMA 1QPMA 3FXUA 4PIZA 2A69F 5DV5A 1DP7P 1JHFA 1BI2A 2QUFA 3S0MA 1FBSA 4HQMA 3ZN0A 2E1CA 2HEOA 5I8YA 3G73A 3P9KA 4YFKF 1X8MA 1P4WA 1FX7A 1STZA 3FWEA 5HOOA 3BPZA 3RDIA 3W6KB 2P17A 4BNCA 1RNLA 4TV7A 3HT2A 1FBQA 3HSFA 3KZYA 2D5FA 2OZ6A 3S7EA 1W7PA 1SFXA 3CJNA 1KYWA 4HBNA 3CO6C 4Y13A 4KDPA 3I58A 4BYYA 1WA4A 1Q3EA 4MEXF 1CAXB 3F22A 5CVJA 1FNNA 3GO5A 3HTSB 2H94A 4Q0PA 4H0EA 2FXAA 5I0UA 1Q5OA 3WW4A 5JAXA 2WV0A 2JT1A 1OYWA 2GXBA 2GC3A 3K2ZA 2Y0OA 3NEUA 2IRFG 4OIPF 3IRRA 3TNPB 1PM7A 3KP4A 2IPQX 3I59A 5LRRA 3FHZA 2K0GA 1TQ5A 1SMTA 4LLLA 4U0YA 3GEZA 4ZYDA 3IDBB 2I45A 2FU4A 2HFHA 2DPDA 2ZNYA 4K2EA 1ZRFA 3CLPA 2P4WA 4UXAA 1NE6A 1TQMA 3BU7A 4L9TA 3LQQA 1HQCA 3D5LA 3GZ5A 3D0SA 1W4MA 1FLIA 1SAXA 4Y15A 2ZMEB 3JAMZ 1ZLJA 4XFAA 4ZYEA 4AQ6A 2DBBA 3RYKA 4JBAA 1UPIA 4HA8A 1SEFA 1FY7A 1SD7A 4MQVA 4U0VA 4O3MA 2OA2A 2R7FA 5FLXK 5E1XA 2GH2A 1R58A 4R1HA 4BQAA 1V3FA 4WXHA 5HLGA 3ZQ7A 4LG0B 1CAWB 4HN0A 1TLHB 4KN4X 2BNOA 3FHIB 3V8JA 5HS8A 3K1PA 3C18A 2BV6A 2VECA 4LA2A 1RZ4A 4HOBA 1IXCA 4GCVA 3RYPA 3ZMUA 2WWYA 2VODA 1DDNA 2XGXA 1FSEA 4IVNA 2D5HA 5ICGA 3M8FA 3EYYA 3GWZA 1FI2A 4ZYHA 3VB2A 3CEWA 3F6VA 3KMHA 4KIGA 2YX7A 4G6QA 5I0TA 5BXXA 5D4RA 4XF1A 4G7OF 2Y0MA 1SD4A 3NQOA 5K5OA 1DGWA 4IRIA 1VP6A 1O3QA 4PIXA 3SXWA 2RNJA 1UCXA 4WBBA 4MEYF 4ZZDA 1WKMA 2K7LA
chains in the Genus database with same CATH superfamily
2ISYA 1IRXA 2ZBJA 1WFXA 5D2AA 3VYUB 1CIWA 3ORJA 3TMOA 2X51A 4IGPA 1D0HA 1KGYA 1O3TA 5JR2A 3A01A 4C3JJ 5IFTA 4AFAA 3D1NI 1Q56A 2VVFA 3OYIA 4M9SA 2CFOA 1W2NA 5FKMA 1JYXA 3FHNA 4XMYA 1YRNB 1D0XA 5ILVA 4FOYA 5FKBA 5L3GA 3OYBA 4G6TB 3T0BA 2RV9A 4Y20B 4NRMA 3T3YA 1ZKGA 3C3WA 1XNDA 4L9BA 1QF3A 1XPXA 4WM8C 5A1LA 3VLBB 1W6MB 5J1UA 4G3YC 2LLKA 3HN1A 2Z33A 3KYLA 2RNGA 3SFZA 2XB0X 4ESJA 1KJRA 2FQ4A 1FYLA 2UWMA 3IB3A 4GXLA 2ZOEB 2EZKA 2QQKA 3THTA 1W6NA 4YGBA 4ENJA 4LBKA 4AVBA 2JG9C 2IS2A 1JJ8C 2P3IA 1ETKA 2WWJA 1UOJA 4DBQA 3IIAA 3ZKUA 4CDQC 2X5IA 1D4VB 4OVEA 2LBFB 3VBOA 3LSMA 4E7SA 1PZ9A 3K0LA 3RKYA 3MFCA 3I0TA 3AK0A 4Y1UA 1RPWA 1K42A 2RQQA 4OI2A 4A42A 1UY4A 1PGL2 5C3EJ 3AL0C 4QXBA 4LKEA 1UO9A 3HPHA 5FMOS 5K7HA 2DW4A 4IL7A 3ZXAC 5CNAA 4AUXA 4CPBA 2MA3A 2A6VA 3JCIA 3WTSC 5FZMA 2HWF1 2ZJ2A 2I74A 3KCYA 3PVOA 4RGXA 5CJ9A 2XB6C 3ASNH 4XFIA 2Y6JA 2RS11 4CP2A 1ZR2A 5FZBA 2F6BA 3KB5A 4MV2A 1OC1A 1C3HA 4HF1A 2C6SA 2J1AA 3LPFA 4XLFA 1MSEC 4BK4A 1EJ9A 5B66C 2QQPA 1ZK8A 4KICA 3MAJA 2STWA 3AG1H 1MS0A 2BGOA 3QLQA 2XLFA 2ZEXA 1AA7A 2XV4S 5DABA 2LM3A 3Q9VA 2XJVA 5JR7B 1OLMA 2DU1A 2P7VB 4OMCA 2DWRA 4IERA 4XF4A 5GZDA 1YWKA 4FTSA 3WNNA 5FTTC 3VFZA 5D6FA 3ETPA 1L7LA 1RVF1 3ERED 3CCJI 3ZDVA 4JQFA 3RKQA 5FP8A 4N43A 3C7OA 5F6FA 1WLDA 5IYCJ 2HWB3 3PUQA 5A3PA 1MR5A 4KWUA 2ARAA 1YRZA 2DBNA 2ZKLA 3PVEA 2LRPA 3K4CA 1NHAA 1HSTA 2PJRB 1QOSA 4EWDA 2WA4A 1BIBA 4KFCA 4BPZA 1FOKA 3L2WA 1IZ1A 1ZBE1 3ZN1A 4DZGA 2WT2A 4EWEA 2BEOA 1UB9A 5IYBJ 5AFBA 2VMDA 2TUNA 1PO21 3O1TA 3CJIC 3E5QA 5FDBA 1YLFA 3VN4A 2CV1A 3RZLA 4IHYA 4C0BA 3TKYA 2X5IC 1ENXA 2JENA 3OYGA 3VBOC 1T2XA 1JI8A 2R7UA 3IKTA 4WXCA 2RE9A 1W8TA 1GUUA 5LHHA 3THPA 3W5NA 1NCQA 4CXWA 1XNTA 1FSHA 2B45X 1S2KA 1ETOA 1YLLA 1JTXA 1SVMA 2BBAA 2NVUB 2KHMA 3WTUC 2FSWA 2TCTA 3HEIA 5DTDA 4A4AA 1B4AA 2LTNA 3S2WA 2ZMLA 1FWZA 1YIOA 3TP3A 3FZVA 4M6YA 4L0ZB 3V8LA 3EQLF 3D82A 1Q1HA 2JK3A 3OBRA 2L7ZA 4LB6B 4GGGA 4WWCA 3MCZA 2KA3A 4YG2F 4W6YA 3UKVA 4FPCA 1Z7S1 4BDZA 1JT0A 5CKTA 5CBLA 1SANA 1U5TC 2V9KA 4IGQA 5FO5A 2VQTA 4QKNA 1HXS3 1P2FA 2HU9A 3TN92 4CDUB 5I93A 3D0JA 1W8NA 3A21A 1D8JA 2ZJQF 5F27A 1OJLA 4XRMA 1A6IA 5DD8A 1EUTA 3V42A 4HDVA 1K45A 5EF6A 5B2GB 4N43C 1VNDA 1PJRA 2KRHA 2ISZA 4EGYA 2R7QA 3SEZA 1DFQA 3ZSEA 1UG2A 1W5SA 1F1ZA 3HUGB 2WO1A 3RZDJ 3ZFFA 1IPSA 5CVIA 3F21A 3BTXA 5FZFA 3WG2A 4YSFA 2ADUA 2DA7A 5IJRA 3S1RJ 4CH7A 4F8AA 2RDPA 2ZJCA 3QPSA 1JW6A 4Y5TA 3T4VA 1YX5A 2LC2A 5HLHA 2NS0A 4GB31 2EIDA 2IA1A 4BXXJ 2EH3A 5K4LA 1B8IB 3KWVA 2HYKA 2VZVA 5DS9A 1AR71 3K3NA 3HHGA 2KZVA 3T2PA 4YG0A 5CFDB 3UL2A 2H0VA 5FUPA 4C30A 4EJTA 4FISA 3WGHA 5IVCA 3OUIA 5DCMB 3IAPA 3KS7A 2IFRA 3POYA 2PEXA 2D3SA 1WLTA 2XAQA 2R5YA 1IDZA 2W24A 4FPYA 5F08A 1UWWA 2HTSA 3NV3A 5FYTA 3E5UA 3ZGKA 2VL4A 1MGTA 1PYVA 3ZCOA 1FMWA 1T38A 1ODDA 1ETYA 1OOPB 2R061 5JOYA 5EG0B 4HG2A 2YV8A 1AZDA 3OV8A 2WAQN 3RG0A 1ZGWA 3FLRA 2L9SA 3M7AA 2ARXA 4URAA 1JUPA 5BMZA 4Z1VA 4JRAA 4ZDLA 1ZH5A 4YNIA 4CU6A 1JMUB 3GNEA 4UT5A 5JSOA 1NA1A 3K7AJ 2VE8A 4FTHA 2R5ZA 2WIIB 3T5XA 2BOIA 2CSOA 2IXCA 2D6KA 2BERA 5EFUA 3BTCA 4MZUA 5ILSA 2P8TA 2DA4A 3OWTA 3GBWA 5C4WA 5J3UA 3O0VA 3MIEA 2JD9A 3O1RA 1QZEA 3NV1A 2G4IA 3I55I 1ZRCA 3CCQI 3DBHB 1QNTA 3LAPA 2EIBA 3M3OA 4XOPA 2QCSB 1GFF2 3CUQA 4DINB 4QGMA 2PQQA 3QU6A 4ENKA 3OPZA 3S57A 1UX7A 1W6QA 3J7AO 1KS5A 1W6OB 2PTMA 2B63J 3ZSLA 4ENMA 3ABZA 1XRUA 2R041 3CC2I 1S0DA 2HEVF 4QX3A 1AL22 3POSA 1HXDA 3L2CA 3ZVXA 1UXXX 1AYN1 2ZEZA 4LO5B 3ZDSA 2VNRA 1D4M1 5KBFA 1VE0A 3O8GA 3O8HA 4XAEA 4LK7A 5FMDA 2ESHA 2O8KA 1RUC3 3I4NJ 1VQ5I 5GZEA 2DOEA 2W84A 2O9LA 2M8GX 2WAFA 3LFIA 4LUMA 4M72A 2YBKA 1A6QA 2BW3A 4LA3A 3S93A 2Y33A 1QH6A 3GCMA 5C5UA 2VC0A 2DURA 2HEWF 2EFWA 5A3MA 2VXJA 4KU7A 1OPOA 2BHZA 2CUJA 2FDFA 4P00B 9ANTA 1C4RA 1DQ5A 4EJUA 3R4SA 5C4JJ 2Q1ZB 4COVA 3ZQGA 3Q8EA 4GIQA 1MZBA 2D97A 5CVRA 4DQ2A 4QXCA 2HWE2 3EMRA 1X1DA 3B93A 3IAM2 1ULCA 1RUH2 3B01A 3URFA 5KHIA 1APNA 1V5EA 3OD0A 1BZWA 2L9RA 1SZBA 1MMDA 2IXHA 3TO9A 2AS5F 2E9QA 1NA1C 4G9SB 3VL9A 4Q4V2 2W1QA 3EJKA 5CG9A 2BNMA 1H1AA 4JYKA 1JKQC 3IKWA 5KXBA 4GAZA 1N1TA 1BI3A 5LEKA 2AUYA 4R4ZA 3C3VA 3B3QE 3P3NA 2W94A 5I0SA 4UW5A 5J8CA 3J81K 3CCVI 3CC7I 1V9U2 3WHTA 3TDZC 2RMU3 4QKDA 1V6JA 2WNEA 2QF7A 1WJFA 2VGDA 2H1KA 4OHXA 3U78A 1W2TA 4QQOA 1T95A 4UHTA 2HI3A 5IOZA 1JT6A 3JRCA 3UNGC 5FPAA 1XNAA 4Z8BA 2O8OA 2W08A 2M4GA 4BUPA 4BQOA 3O5SA 1ST8A 3L2VA 4EJOA 5ABJA 4KMQA 3HGGA 2K9NA 1XB9A 2TNFA 4GALA 1BOAA 5LCWL 2YFZA 1R5HA 4I09A 4R79A 1UY0A 1PNGA 3FDYA 2EIEA 2Y38A 4HBLA 5D8AB 1CAVA 4FPEA 3DPTA 4M3EA 3LA3A 1HDKA 5B5EC 2Y6GA 5G04L 2HWC1 2E19A 5F3CA 1G9AA 4BA6A 1Q43A 4JGZA 2DCEA 3CCMI 3LL7A 4RHV3 3H1CA 1YS7A 3L00A 2LY1A 2OF7A 3SQOA 3A0BC 4AAXA 4MHGA 1J3PA 3D4KA 1JS9A 5K0UA 4IE0A 4KNCA 4NHLA 2GA1A 2R93J 3IM0A 4IHTA 4QLCU 3HHHA 1PIV3 1V6KA 2LDUA 3EHKA 1UMZA 4AFMA 4ASMB 1N3QA 2X6WA 2RS31 4D5FA 4LBQA 4HX4A 1PGW1 4Q4X2 4A44A 1IUFA 1MDMB 2M5WA 3N4MA 3HN3A 2LUWA 4BQ1A 1X4PA 1V4RA 2OQRA 1JXNA 1Y1VJ 2IC1A 4P55A 2W47A 5GPAA 2KT0A 5F3IA 3WW2A 1ND3C 3HOBA 2UXXA 2DJNA 3CDIA 2W39A 3OGRA 3HDDA 2CQKA 4Y22A 4BE1A 3QPLA 2B4KA 1SMYF 2IJLA 4ZYAA 3GLXA 4AI0A 4F92B 5IVYA 1PM4A 2ZHLA 2X05A 2LP0A 3WQ0A 2M30A 2FQPA 4IE6A 1N78A 2L54A 1ZA7A 3MMYB 1WI9A 1XPWA 2X0LA 1NQDA 2JDAA 4EV0A 1F35A 4AIHA 1ZLKA 3BR5A 2PMUA 1EAH1 4KUMA 5DAXA 1EV13 3VYRB 2CUEA 2IT0A 5D8LB 1Y56A 3LQRA 1CF7B 2QBYB 2CMPA 1J58A 3WGIA 3ZFEB 3ERMA 4ZJZA 3PM1A 2IXLA 3KEYA 5FLMJ 1CGPA 2VT2A 2DYSH 1DQ0A 2Y2ZA 4A5NA 2VU9A 1YUDA 4NO4A 2KKOA 2IXIA 4JC1A 2L4MA 5ABJC 5DM6F 1OMIA 1G3TA 1OLRA 4AIKA 1SEUA 1WMFA 5GALA 2KLOA 2E1NA 2O6GE 2OXBA 3GTPJ 3UKGA 1IN6A 1VQNI 3G4SI 3LMMA 2EILH 1AHDP 1HSJA 2VNGA 4YIRX 5JZGB 3FBIB 1TW3A 3U14A 4JGZC 3VBSC 3IAS2 3AAFA 3M9AA 2IA2A 3NW4A 1FYKA 1U8RA 3CZUA 1H9TA 3OCPA 2P6SA 2YS9A 3KCXA 5K0UC 4WXDA 3R4KA 4W8JA 4NC6A 3CZJA 2BDRA 3TO7A 3Q3SA 3V0AB 3WDYA 4AHWA 2BXZA 1KQ9A 1R091 3FISA 2A3XA 1UYPA 2EV0A 4LG0A 2FMDA 4MGZE 1I6HJ 1LENA 1Y8RB 2RV8A 4IGOA 3RFRA 1SVOA 3AX4A 3HIFA 5L36A 2L3DA 4WV8A 4I99C 1FPN2 2KRFA 4OAYA 4FTEA 1GWKA 2KP6A 4MGTA 1D2QA 1HC8A 5C8WA 4HX7A 4HNUA 5G05L 2ZHMA 5FO7B 1ASJ1 4NUBA 1UOFA 4RQPA 4XKVA 1AR82 2AYHA 2MLKA 1X3UA 4IO9F 3LWCA 1ZAOA 1SDWA 1H9WA 4YG6A 1X50A 2BJSA 3IBMA 3AP5A 2HDWA 3BR1A 4CDWB 2MH2A 3V4GA 2ORXA 1MQTB 4XZPA 3C7FA 2K4JA 1PVC2 4AYBA 5FD6A 1UZWA 2UURA 3GJBA 2C0ZA 2HS5A 3E6MA 1MACA 3V0BA 1HQWA 3K48A 4B7EA 2JA5J 5FZ0A 4V2VA 1JZ6A 4DYRA 4W97A 1NG0A 5FY9A 4OAZA 1IXRC 4RD7A 1SVLA 3C1DA 3CU7A 1YFXA 3WDTA 5FXZA 3CQZJ 2ZJRF 2GNMA 3O1OA 5LWBA 5JXIA 3AC0A 2AHQA 3WNLA 1MW7A 3DYPA 4FAHA 4LO7A 2EPFA 1KU7A 4UY8I 5FJ8J 3H8UA 3RZGA 1MNDA 3WGGA 3O1SA 2E26A 1LULA 3MD2A 4XPVA 3G1MA 3J81Z 3M3IA 2JDZA 1POV3 3GBGA 2GC1A 5T5PA 1X1AA 2UWBA 3K4LA 3VSLA 2WZ8A 3OUHA 2M4KA 3HTUA 2SLIA 2VOTA 2EICA 4AVTA 3FL7A 2HH9A 1OA2A 2G1MA 1LFBA 2K46A 4XFFA 3KZIC 1V54H 4EZ4A 4COWA 4JGYB 4NHKA 1WCUA 5IT9K 2XPVA 5L3EA 3DTEA 3BG7A 1FXZA 5HS7A 1IXSB 5BNNA 1ENRA 2DYRH 3MLJA 3WP5A 1RUI2 4BWOA 1QJY1 2Y64A 2DAOA 2PX9A 1OKOA 3FJSA 1C0WA 2HWD2 4FFGA 1OXCA 4RQPC 5JSRA 1MH3A 2VIXA 3LSIA 3T2OA 1YHQI 3I3EA 4M0NA 1NAEA 4WX9A 2AXTC 2AENA 2KM2A 1O6UA 1XGMA 4D5CA 1IAWA 5L3CA 4FPHA 3M1EA 1S0FA 4BDVB 4XVHA 4C0HA 1RJ8A 2WNVB 4WK8F 1Y43B 2PMHA 1ZN2A 4QXKA 3AMPA 1YOVB 4I7HA 4PF5A 3TEWA 2UYBA 5FQ0A 2Y0SA 2Z69A 3MEXA 5LHIA 2Y9ZA 5E17F 2KZGA 3CCRI 1TMF2 3LSRA 4RYDA 3QP6A 2H27A 3BIWE 1KU9A 4Q4Y3 2VY0A 3PTRB 3Q8AA 3VL8A 3PFIA 1LE8A 1QQP3 5FZ1A 1VBE1 3ABMH 1DF0A 4AYUA 4NR1A 2IEKA 4XLNF 2WUHA 4FQ4A 4OI0A 2CQ7A 3ZMDA 2DU0A 2BFUL 3N7MA 3G71I 4R9DA 3T1BA 4AOCA 1KDKA 1H2LA 3KZZA 3MW3A 1GNYA 3AZZA 1AXKA 3SEQA 4FPGA 4Z6YA 4LHKA 4RAGA 5IP7J 5EYXA 1H9PA 5D1IA 3H5NA 3OIQA 2VONA 5IK5A 2ZABA 2VOKA 1BI0A 2E34A 3KVBA 4ITCA 4Y1YA 2FMLA 4Z2AA 2QQNA 5DAQA 3A02A 3MV01 4OI4A 4IXAA 3OUJA 5CU1A 4HKLA 1VBB1 4FASD 1AR93 2KRCA 1SLTA 2FE3A 4TYSA 3NJXA 4YVWB 3VBRA 2XAGA 1F4KA 3FMGA 1K6OA 4PSXA 2L0KA 4CPBD 4SBVA 2R49A 5EWSA 3SEPA 1XYNA 4NOTA 4YZ4A 1OISA 5BNNC 4XM3A 4ZS3A 1LEAA 2PMWB 5IP6A 1P92A 5JIUA 1V70A 1JYNA 5JLWA 5IT6A 5K5RA 1QH7A 2A05A 3GZAA 4QDSA 3S2DJ 4NHMA 3KP6A 2XF5A 5ICCA 1LECA 5D21A 3N7KA 2A5WA 4W65A 4Y5Z0 1R083 4ATFA 4LBMA 1O8SA 4IHSA 1DU3D 3K69A 1UCRA 4QPQA 1SFPA 5J48A 5E20A 4Q4W2 2A5YB 4GULA 1Z91A 2NM1A 2KISA 3PIPF 1KU3A 4P5YA 3REOA 1TWCJ 3KEOA 3MIGA 4U7DA 4NPLA 2LF7A 3T2QA 3VKFC 1YO8A 4WM8B 2VVEA 1OBNA 1P4AA 5B1BH 1KQRA 2PMZA 3OOXA 4HV5A 3K4MA 3I4IA 4EZHA 1DU0A 1IV8A 4IEWA 3H35A 4QAWA 1BR1A 4D7NA 1VQOI 5BNOA 2JA7J 3S3NA 2X6OA 1SHWB 2XPUA 2LRDA 3I59B 2R7RA 3S1MJ 3DKQA 2JG9B 1U9NA 3WNKA 5TISC 1R5GA 2DA5A 3V7CA 4CDQB 3KEQA 1ZA4A 4FPKA 1GVJA 4AK3A 4UUTA 4XBLA 5KR7A 2H09A 4XSXF 2G19A 3BB6A 2VJ5A 1CWPA 2VOXA 1QKQA 5FO9B 3VOEA 2JB4A 2W4SA 2FBHA 4UOJA 2WT1A 3UKTA 5DG2A 3AL0B 2E36A 2VTXJ 4LLOA 2W1OA 1MMNA 2FX0A 4BHPA 1DGWY 4G94A 2Y75A 3DQVC 1EPWA 2CAVA 3VBRC 4WVVA 3NRVA 1Q8PA 3KV9A 4PJNA 1L0OC 4MSVA 2O03A 1NXMA 1U6GA 5AIQA 2X4HA 4M3CB 4FX0A 3DV8A 2E7WA 3CDHA 1MVQA 3O3KA 4NHXA 5JVVA 4I01A 2JIJA 2ZPXA 1YEWA 5FZ7A 3U75A 5FFOC 2HWB1 3CCYA 3O6BB 4AQTA 3NV4A 3OBZA 1ZBA3 2EFQA 4CUAA 3KV6A 1R36A 3R60A 4LEJA 3T0DA 1GQGA 2ZX4A 1QHHD 2CGPA 1BK1A 4E8CA 4I0WB 2P6CA 5FY0A 2PHRA 3N7JA 2E6VA 1G6NA 1P4XA 1FEXA 1ZBE2 1R1ZA 4YARA 2D1HA 3PVNA 1BJAA 2F4OB 2CV6A 3SCHA 4ZU7A 3OSFA 2MHFA 5IT9Z 1W6PA 3K77A 2XF7A 1PO22 3JB4C 5IP9J 2C26A 2MD5A 5HV0A 1JTZX 3EDPA 3JRIA 4NRQA 3G7DA 3TL4X 3G6JB 4IXLA 2D7FA 2RQPA 4LLGF 2CW8A 2FDHA 1NOVA 2VTFA 1W8WA 5BNOC 4N4OB 3BWGA 3CP2A 5FMBA 4P9GA 1VAMA 3VYTB 1ZRRA 1W6NB 3CIHA 3CJIB 2EFNA 3KF5A 5HDKA 2W1WA 3IWZA 1BXHA 5FWEA 3LEIA 4U2AA 2X5IB 4CSWA 5FPZA 3VBOB 2V09A 1Y9QA 3OGVA 2R30A 1Y1WJ 1UFMA 2AQEA 2K9LA 3GXOA 2W7NA 3WUDA 3I49A 2QBXA 5J3LA 5F3GA 4FXGB 5C8CA 1HB3A 1F4HA 1K4TA 2MEV3 2YGMA 1OFNA 2DK8A 2A73B 4FBFA 1K12A 4JTOA 4H2AA 5L7OA 2HYJA 5A3WA 1RUJ3 1W05A 1FT9A 5GAEJ 1WD3A 1U5XA 3RIRA 4CEWC 4P5HA 1HXS1 1CVNA 1MEC3 2B9VA 2R7SA 5ISLA 1LNWA 5IVFA 1HJFA 4A7YA 5HNHA 3POFA 1L7QA 4JOMA 3P9IA 4XW3A 2VASA 1QY4A 3UYJA 4PI2A 2X6YA 3J7LA 2VUCA 1YQAA 4W6XA 5C3QA 4KWKA 1GVDA 3A0NA 4J1WA 2F5FA 3ZLIA 4E4DX 3LGRA 4RBOA 3CD6I 2A3YA 4ZYGA 1H30A 1RR7A 4LJZF 4H14A 1KU2A 1HW1A 2UV1A 3VEPA 3OSDA 5JVGF 3MPPG 2IS4A 3PUAA 5HCAA 3ES4A 2BY2A 3AMNA 5IVBA 2RVCA 4N43B 2DMQA 3N35A 3ABLH 2Y34A 3FMSA 4IOCF 3U4SA 4X0GA 4PBPA 2R7TA 4CE8A 3AMQA 2E7AA 2V5YA 3IDEA 5K7PA 4I30A 1BI2A 1AR72 2WAEA 3BLYA 4AI9A 2ZXWH 4DNYA 2HEOA 3AFKA 1OQEA 3G73A 3BVCA 3W3CA 1P4WA 4C9YA 1FX7A 5HOOA 3N9LA 2P17A 4B4CA 1F31A 3C7EA 1RNLA 5IAVA 5GLVA 3HT2A 2ZGKA 1FBQA 4FP3A 3GHMA 5JIAA 1W7PA 3CJNA 2X10A 3LDRA 3CO6C 4Y13A 1MS1A 1RUG2 5IW0A 3I58A 5GKAC 5FO8B 4LBJA 4MLOA 1N1SA 1VRH3 1X9TA 1FNNA 1EUUA 4E4ZA 4Q0PA 3ZKYA 2CUFA 4XLEA 2WFF3 4A3MJ 1Q5OA 3LSKA 5C8CC 3KZ4C 2GC3A 4XMIA 2NVYJ 1QNYA 1AUYA 1P7IA 4ZZ5A 2VI6A 3TNPB 1PM7A 3HOWJ 5L7OC 1LHWA 1OA3A 2AO9A 1D2SA 1SMTA 4LLLA 3WY6A 4ZYDA 3PL0A 3JU9A 2FU4A 1IG3A 4GMP0 4GJYA 4F93B 2V26A 2KQRA 1ZM1A 1GOFA 5T5OA 4H4KC 3GZ5A 3AMHA 2WSUA 2CWMA 1SAXA 3JAMZ 3I9V2 4NIGA 4EN7B 2DXIA 2YROA 3RYKA 1LKXA 1UPSA 1V6NA 1FOD2 4ES8A 2GH2A 1R58A 4R1HA 4BQAA 1EA3A 4YVSA 2WN2A 2VZPA 4IHWA 4HN0A 1YE9A 4ZPIA 3FLTA 1I3AA 4KN4X 3DU5A 2M7AA 4RLFA 2JA2A 3GTQJ 1HOMA 2BV6A 2OUHA 2VTXA 2CY6A 2XGXA 4IVNA 1QJX2 3JQXA 5B4NA 3HPNA 3GWZA 4A3JJ 4ZYHA 1FI2A 4RDUA 3F6VA 3KMHA 5F7UA 1D4M2 2PLV3 2DUOA 1RUC1 2YX7A 1GV2A 3NARA 3OL3A 4BQ4A 2GNDA 4XF1A 4G7OF 1I39A 1DGWA 3MKLA 1LOEA 2RNJA 2ME0A 4WBBA 4DUXA 2ME6A 2PHXA 4ZZDA 1WKMA 2E53A 5J1RA 2QA4I 1X1CA 3M3CA 4F3QA 3BPXA 1DZQA 4NE9A 1YJLA 3FXJA 2EA7A 3VUOA 5C9AC 2XVCA 4L9VA 3GCWA 4V1PA 4CZCA 3VZNA 4NHYA 1NUKA 4A3EJ 1BEV1 1HX6A 4A3FJ 3E97A 3E6BA 4UB8C 5CFCA 2KPMA 1WCKA 2HZDA 3VHNA 3NRUA 2XPJA 3ST7A 4IKFA 4QIWN 4MG2A 3QOPA 2V4AA 5GLTA 1YI7A 1QXRA 1RL3A 2E2JJ 1ZZBA 3DXJF 2RVAA 1NK2P 1LJ7A 4OHVA 3A7QA 2WNUA 5FKOA 1BCXA 2MC3A 1JGSA 2R5YB 3HOYJ 1Z67A 4JV4A 3G2BA 5AC91 4QPGC 4CU8A 4LBQD 3VZOA 5I0DA 3LSEA 4D94A 2LKPA 2RMU1 1S9HA 4UW4A 4YZ5A 4WVMA 3CUOA 2AACA 3NNJA 3J7HA 3EUHC 4NROA 4LULA 1NA1B 5EZGA 2ZGLA 1BR2A 2CWSA 1S7OA 3GZUC 5HVQC 1XCVA 5KNLA 2FDKA 1J59A 2R5ZB 2UYAA 2CO5A 1N1VA 4XOTA 3I3LA 2DMNA 3F8CA 4XRSA 3PNTA 2EB7A 2DJIA 4YVSC 4EN8B 2RS13 1X3WB 1WHUA 3OIOA 1LRHA 3OOUA 1AX0A 1XOYA 2GU9A 1Z0XA 1OH4A 1LR5A 2DOFA 1XE0A 2VMIA 3H50A 2HYXA 3W2WA 4LK1F 1BYHA 5AFEA 4LK6A 4F7ZA 1E3OC 4PDKA 2WA3A 3I2HA 4AFBA 2HPIA 2FDGA 2JJ6A 4AYBN 3NNLA 1W6QB 1WJBA 5CAZA 3JRBA 1IN4A 1F43A 4CUGA 2EIMH 1CD3G 5IFPA 1UX6A 2HJIA 4P96A 2VBBA 1PIV1 4QDQA 4AVPA 3J26N 3ROUA 3CO7C 5FPXA 5FYUA 3MVPA 3OYNA 4Y52J 4LFUA 4FI9A 3BP8A 3WQBA 1H0BA 2RS32 1VF9A 4L9NA 3AMMA 2QSHX 1B09A 1VALA 3BTYA 5ACA3 5T52A 5LBEA 5E18F 4CXYA 1G3SA 3I97A 5CVUA 4DW6A 2QQIA 3LDBA 2ZBKA 3J7MA 4YW5A 5CFCC 2A71A 3KGLA 3R0JA 4KN7X 2A6ZA 3BG5A 2Y48A 1NX9A 3DPLC 3I2DA 1O4TA 5TGTA 1IRZA 3OGGA 3JW4A 2KR2A 2VNVA 2VOPA 5FMCA 3NNMA 4IDZA 4S04A 4XN0A 2QSFX 3PO2J 2XKOA 2WNUC 1O7FA 1FIPA 5JOWA 1OI6A 3IH3A 2WLPA 3MQ0A 4ZXKA 2O5RA 5ERIA 4HF2A 3NMBA 4CXXA 5KHGA 2NRAC 4D1QA 1ZVFA 5BNQA 5C3OA 1EV11 1ND3B 4LG3A 2WS93 2GIVA 3CDLA 1VBA2 1O3RA 1DPUA 2QCOA 2J1EA 5LY1A 3QPHA 3ZYRA 2K3PA 5JXHA 3I71A 5EJ3A 2Z2SB 1Y3TA 3IMNA 1JOBA 2QQUA 4UW6A 4II2A 2ZX2A 3OTFA 3TOAA 1AR62 2VBXA 2NYXA 3WODF 5GPCA 4RGUA 3TN93 5L19A 3LAGA 1GXPA 1A36A 4B3XA 5J8FA 4CYDA 1LDJA 4LE4A 1AF9A 4DXRA 2H8WA 1CONA 1VMHA 5FLHA 2P5VA 4IE7A 4AGGA 3FBNB 4CVUA 3EUAA 1CIYA 1BQPA 2ZGSA 3EPZA 1XGSA 3S15J 3RYRA 3KP3A 2ZMEA 2HTJA 3WDVA 4DXSA 1CESA 1WJCA 1E5RA 2W5FA 3WHUA 1PO13 1HDDC 1B72A 1FZPB 4OUSA 1TNSA 5ABJB 3VDDA 2JRMA 4HLTA 2DCTA 5LLQA 5JPNB 2PHWA 3J80Z 1MBKA 4AI1A 2DYCA 4LOTA 2Y0SN 1K78B 1EPZA 5HODA 4IE4A 4BKXA 1Q8QA 4EATA 3TEYA 1CR7A 4P9FA 3ZQCA 2I8DA 1O57A 5EIYB 2JD4A 1I3QJ 2GWRA 5LBFA 4TZDA 4PF1A 4GH4C 4JGZB 3VBSB 2LK2A 4LBNA 2G9FA 4OHZA 1ULOA 3DF0A 5CLSA 3WINE 1MNEA 2PLYA 4CO8A 5K0UB 1ASJ2 1PVEA 5I91A 3BTAA 4Q0VA 2O7OA 5HXMA 1LDKB 2DFEA 1Z9CA 3F9KA 5LBCA 2DK5A 3AZYA 2O0OA 5C70A 4KH9A 1ZZ7A 5ICFA 1R7JA 2XONA 2IUWA 3MKZA 3WDXA 1NY72 2XQXA 2Z1DA 1VR3A 4RM2A 4AXOA 3F72A 4Q1RA 4AGRA 4PZJA 3WDUA 3IPVA 1W3VA 4Y22B 1DQ2A 3B02A 4CEYC 4RL7A 2C1FA 4RFRB 2J22A 4PQQA 3ZXEA 1PHMA 3PUIA 1W28A 3TOBA 3GLLA 2Y31A 2OT7A 3B9CA 3VDCA 4RAZA 3AKRA 1P7JA 3HT1A 1S0EA 5KHHA 5KHJA 4RAFA 1ZARA 1SPPA 1TE1B 1G9FA 2VUJA 2JUGA 3J7YJ 4GKYA 2EWNA 2PQ8A 5E1ZB 1AVBA 3FMRA 2JG8A 2XAUA 3H5AA 4FQGA 3C7GA 1B35A 2F5VA 3U4XA 3BG6A 1NT0A 1POV1 4HT1T 4RGRA 1JHHA 2ZSHB 3C8XA 5EEHA 1UYXA 2ZMEC 3JZVA 5H9SA 3IH2A 1X2MA 3PQKA 1VQPI 1S0GA 1F4AA 5C7GA 2PHDA 4Z92B 3VDDC 4P02B 2JVHA 3LA7A 1TZLA 3VSKA 3V7SA 2YUEA 2XQRA 2IS1A 2PMZN 1GZCA 3HOSA 2ZGNA 2GQQA 2OCCH 4UVBA 1YO5C 4RGKA 3ILNA 2BVVA 2XUBA 4P9JA 3M3QA 4NQWB 1QJY2 5FCCA 2BQPA 1YXWA 4U36A 3A23A 2CYYA 2VW1A 4XL9A 3ZIWA 1D1CA 3GX4X 3PSIA 1AYN3 4LORA 4FPJA 2JE8A 1C28A 4LOSA 1JHJA 3IDAA 1PMHX 4DS0A 3J8F3 3PURA 5EYRA 4Q0QA 3PIGA 5FZGA 3CZ6A 4ONUA 3BC8A 1RUH3 4NIAA 3T0AA 4P9LA 3MWMA 1D7PM 4O9GA 1QVTA 4RQPB 3KIOA 4HSRA 3OGSA 5FMOL 1O5LA 2VE9A 2EK5A 2ZGQA 4Q4Y1 2M87A 1TG7A 2IXSA 4XJWA 5M5YJ 4UFKA 4DUWA 4M3BA 1QQP1 3RQ4A 2UUZA 3S16J 2WAOA 3ZN5A 2WINB 1ETVA 3TO6A 4BQ5A 5ANNA 1ODNA 1VBE2 1COV3 3BOQA 3QH6A 2VOOA 2P1BA 2A3SA 1V9U3 1BC7C 2P5LC 4UW3A 4B8XA 1YQCA 3V0BB 3U10A 4M01A 2Z5WA 2YMZA 2JG8C 4EEFG 4OIOF 5FZAA 5FZOA 3U37A 1B35C 5F37A 1WVRA 1X8EA 3FFQA 2QM3A 4NB5A 3ABKH 4Q26A 1S2EA 3PQJA 2EAKA 5CA6A 2BP6A 5L3BA 1ND2A 5FUIA 1JJ6C 6PAXA 2M9HA 2W48A 1DGLA 1IHMA 4CCOA 2OPWA 3HZJA 2VJ4A 3H36A 4CZZA 2P7CB 5L9VA 1K5MC 2RR11 2W85A 4OIRF 4QMAA 1CQTA 5DZFA 2J5OA 4YM0A 3K9TA 3AZVA 5F39A 1PP8F 3H1YA 1KFXL 5HPOA 2O8XA 1FOYA 3I56I 3WG4A 4TLGA 1IRFA 4H7MA 4L8QA 3J7NA 2BHYA 3MFKA 3LEKA 2XDVA 1KD7A 2DVAA 4QB1A 3CCSI 4ZONA 1R081 4DQAA 4P9XA 5DUKA 3K4NA 2X09A 1MH4A 3APBA 4BHBA 2DFCA 3JTGA 4XDOA 5BNNB 4L5JA 1U2WA 2RJ2A 2DPUA 2PXJA 1DYOA 3HKZA 5J7MA 1EY2A 3L9JT 5E3LA 2R7OA 3JRFA 1OLTA 5C4XJ 1MJBA 5A6XA 1EV7A 3ZSKA 2QQ8A 2DDUA 1JUMA 1EYBA 3LAJA 3BOWA 3R0RA 4LITA 3BUCA 3ELKA 3LWFA 5IK7A 5A3TA 1H8TC 1O4XA 2BTVC 5E8AA 5T5LA 3IN9A 1DYPA 3WCSA 2VW0A 2V7FA 4DZPA 3NV2A 4FP2A 3V7RA 2K5CA 3E6CC 2ZX3A 1OLQA 2XB5A 4XHBA 5JMOA 2N8GA 4CUCA 1ITYA 4XC9A 2JIGA 5FQ0B 4X1EA 4EGZA 3BN6A 3OPTA 4PCQA 1QJFA 3QYEA 4JX0A 1ULDA 2D2WA 4LOCA 1H1MA 1LE8B 3SH4A 1KS4A 5FBJA 2JZYA 1SDDB 4QX8A 1SD5A 3H7YA 1Y0NA 3O14A 4AEKA 1NLRA 3U9GA 4BHCA 1ND2C 4UUSB 1GQHA 2VBWA 4YG3A 4HONA 4B4RA 4FCAA 3TQNA 4J19A 4CCDA 4Z82A 5GZCA 2COBA 5FXXA 2PN6A 4HQEA 3U1KA 1ZQ3P 4MX3A 2EZLA 1FV3A 3WG9A 3ZXFA 1RMU2 3SLIA 4ZTFA 1S55A 2W95A 5A3LA 3R6SA 4N9HA 1OYYA 1X2NA 4MHRA 2VXZA 2VMGA 3WD5A 4QT6A 3RSNA 3CMEI 2A1XA 2YHJA 4CDXA 2IGKA 4XCBA 1I1EA 2B5HA 3CMYA 1ZBA1 1MKMA 4AQSA 2OUJA 1PUFA 2ZGOA 1W8UA 1DUXC 3VBRB 5LBQA 4LO6B 3BQYA 3LSHA 2YSRA 4EWAA 4YFZA 1LU2A 3DCFA 4ZS2A 3ENRA 2G9ZA 1BA5A 4MGIE 1BW5A 1AHSA 2R7VA 3WHBA 1W5CC 5M3MJ 5FKCA 1XMKA 1FPN3 4JX4A 5A6YA 5LGTA 3CLQA 2DQRA 1C5HA 1AR83 1CZVA 5IK4A 4EM0B 4ARXA 5FUNA 2M3AA 2DO7A 4PI0A 3VBFA 1WBFA 4V2WA 4KL1A 1WJDA 4BY7J 4BLJA 4RB0A 2VC1A 4HLYA 2DI3A 5JLXA 5GM0A 5BS6A 1PVC3 3RZJA 1OQ1A 1OVPA 2R7XA 4XQ4A 4HNVA 4YM3A 1IPKA 4XN3A 5FOBB 5KXCA 2CDOA 1CAWA 2VO5A 4HVOA 3GTJJ 4ON0A 4IRHA 4ZTJA 1AXZA 1D0GA 4DRRA 4C90A 3GTMJ 5JI9A 4UI9L 4B44A 3ZN6B 5BPXA 1Z7LA 2XJUA 2JJ7A 4IZZA 3OEAA 2E7TA 1OPCA 4AG4A 1Z21A 2LFBA 3E0JB 3HOZJ 2K02A 1ODMA 2AREA 1RHI2 1RUF3 2PBIA 5CPRB 5BNOB 3KYDB 3GTLJ 3U11A 3TEDA 3UESA 2MEV1 1TC3C 2W2IA 2ZEYA 1AU7A 1RUJ1 5DAVA 1QVUA 2GA2A 1VBD2 1MEC1 2IA0A 3UK9A 4JX5A 2HOTA 4J6GA 4M6XA 2D45A 2OTJI 4AHZA 3JSOA 2DFFA 5ILUA 1W7PD 3IRQA 5BY5A 3CF5F 1OHFA 2XVGA 1UG0A 2WABA 5F6KA 1YRNA 2RGVA 4YRVA 1GOHA 4XJZA 1R49A 2J1RA 3SMHA 2X8KA 4MGKE 4PIYA 5FYSA 1W6MA 4KISA 4XHXA 4CEWB 2Q2EB 4OZXA 4UV8A 3GVAA 3LEMA 4HK8A 3S1QJ 5FZIA 3N36A 3OG2A 2R0FA 3S5QA 3SHFA 1QJZA 3CL1A 1IS5A 4BBRJ 5DDJ1 4M74A 4P14A 1YW7A 1XSRA 2XSJC 3BCAA 3OMYA 4OFGA 4UFLA 4IESA 2LVSA 3OYEA 2DODA 1IN7A 4L97A 3JD72 1HKTA 3WTZA 3RRDA 2LBFA 1XB4A 1WMXA 1JTYA 4B7KA 1UYZA 1U8BA 3P1IA 3S8PA 1HRV3 1O5UA 3KT1A 3VBFC 3J9SA 1Z78A 1HRI2 4DMIA 2B9SA 4XFBA 4L0YB 2ETHA 5TJJA 4XK4A 4BLIA 1NQJA 3RMYA 1MS9A 1QHDA 1W6PB 5CYVA 3I2FA 3K4AA 3S3MA 2VZUA 1QO0D 1G9CA 1GUIA 1TMF3 2X53S 4MGQA 3GYDA 1VRH1 2OIIA 3ZPLA 2FZ2A 3ZYJB 2RG4A 3OL4A 2YR2A 3O0WA 3BR0A 1OD5A 1F5FA 5J09A 2WFF1 3W59A 2OQ6A 5JVTA 3QACA 5FYHA 2VBDA 1A8MA 3I2IA 2YGLA 5A1AA 4BQWA 2DFIA 4UFIA 3FKIJ 2VUMJ 3HM5A 2M34A 2V6CA 2W87A 4NC8A 2WWSA 1RC9A 4DXTA 1J2XA 2VZ1A 3ZMZA 4F83A 2R7ZJ 2OJED 4DEQA 3RJRA 1XQNA 1FAYA 4AEMA 1YI2I 3KLNA 4TSVA 2PFBA 5C8CB 3BPVA 3UETA 2YPJA 2ZHNA 2HBUA 3EO6A 1H6YA 1W36D 1IGOA 3C2BA 5L7OB 2YC0A 5F5AA 3OS1A 4E70A 3H42B 4XBNA 1HCRA 2BE5F 2K9ZA 3UKNA 2QTWB 4M3CE 5KXDA 2VOVA 4CTEA 2GALA 2DCJA 3WTXC 3R4DB 3JCUC 2AZ5A 2LW8A 4I0AA 4NC7A 3LOBA 3K4DA 2PLV1 4P1WA 1IQDC 2CFXA 1MD0A 4ASNA 1G59A 1ON1A 1Y0UA 2R3SA 4E27A 2FOKA 1OQDA 2RKHA 2F5CA 3CKHA 1VQ8I 2WL1A 1LGNA 3FKJA 4QQLA 1UKGA 3QQAA 5FYBA 4Q0SA 2A6TA 1OSGA 2A75A 2NS8A 3GXUA 3M4OJ 4Q4W3 4QU1A 5TRDA 3OYMA 4ZZ8A 2O0YA 3B5LB 4CP9B 2YG0A 1K3IA 3DKYA 2ZX0A 5LB6A 2E71A 2D6OX 2BOJA 2XWJB 1HBXG 4N7IA 3MIFA 4MGYE 2Z42A 1RI7A 2L4AA 4PDWC 2ECBA 5GAGJ 1IG0A 3IL2A 2L7MP 2DUPA 5DUUA 1NG7A 4QHBA 1PGL1 1WSUA 4XEZA 4Q1PA 3WF0A 4KYWA 4I3GA 5C9AB 5A6ZA 1XYPA 3ACHA 4CCJA 3TB0A 2CSGA 2XVLA 2R072 1LCLA 5GZFA 1H8VA 2ORZA 2DA3A 5FK7A 5T5JA 4I6ZA 1G2HA 2L01A 2ZXIA 2ET1A 4JK1X 1W7PB 3W6JB 5FKKA 1SCSA 5A7WA 2RHPA 1KZHA 1BK0A 2RMU2 3SZTA 3ELNA 3VHRA 2JUCA 3C2HA 4JQRA 4FOWA 3BZ6A 1XGOA 2HR3A 4C3HJ 3A22A 4AD9A 1FMD2 1PVXA 1QRYA 4JVAA 2COMA 2QZ8A 3Q0WA 3I8TA 1RUD2 4E7ZA 4QPGB 1LFUP 1WLCA 4L5EA 1VLNA 2EV6A 3WNMA 2FNPA 4N53C 4S05A 2O3FA 2R16A 3FXLA 2W91A 2VC9A 3SCGA 4WM7A 4JDNA 2CHHA 5IPAA 2CH0A 1AWCA 4XIKA 3F23A 2E2HJ 4DUVA 1Z1DA 1TP4A 2HQRA 4DFSA 5KCMA 4RHV2 1B8IA 1OLME 3WP6A 2GH8A 4JCKA 4Y24A 4PFOA 1GHCA 1DGRM 2CWEA 3LA2A 3WE3A 4YVSB 1OCTC 4HYEA 2AH2A 3FM3A 4L9JA 3HGYA 1NZCA 5FYIA 3HNYM 2HOSA 4HZFA 5DCMA 3VD3A 2K86A 4RS5A 1JI6A 3K1MA 4OZOA 1TT5B 3IHUA 2BPA2 3FXOA 1GZTA 1US2A 2YB7A 5ACA1 1IKQA 5K7FA 2XAHA 1RYYA 2J7MA 1ETQA 1C8M2 3BCBA 2LR8A 4OQ8A 4LLNA 1VTNC 4E9KA 2KDOA 3SKJE 2RDRA 1A31A 3ABTA 1D5YA 1W1WE 4DY3A 2JDYA 4OWRB 4MTEA 3KD4A 2OBPA 2QDNA 3H0DA 4FXKB 3NJZA 5H9QA 4M0HA 2P5BA 1REEA 3IV5A 2B8MA 5EYYA 3ZMSA 4QSHA 4XUOA 3KV5A 4IEJA 3G3ZA 2AXLA 2HZTA 3S14J 1HA8A 5CFCB 5FLJA 3RKXA 2DTRA 2WS91 4HDUA 4ZC3A 3FXKA 1ZREA 5M5XJ 1EV12 3OR2C 1LOFA 3LEGA 2GAUA 3K4KA 2BYVE 3OY8A 2BWCA 2E1OA 1XBFA 1LVAA 5E1WA 4QKFA 3IDCB 4NIHA 3LPGA 2MYSA 2XSDC 2WNUB 4AEDA 2GC0A 3LOCA 2PAMA 3RNSA 4BS9A 4Y1XA 2VZSA 4JRLA 2CUZA 2VCBA 4YWAA 4EMSA 1GZWA 3C7HA 3ZQIA 1KQ8A 3TN91 5DMYA 2P2KA 2O14A 4BGDA 1H8AC 4XFHA 4A3IJ 1W39A 4XFGA 1W2OA 5A33A 3KT7A 4WVMB 1M06G 4OQ9A 4GWNA 1G4DA 1PZ8A 5FXVA 1W9SA 4KT6A 2FBEA 3WW1A 4WM7C 5HI0A 3H92A 3HJEA 3PSFA 4G6DA 4ESFA 1KONA 1D5VA 2ZAHA 3I5UA 3AYAA 4BQ2A 3MW4A 5LD2C 3H7JA 3ZR5A 5JOZA 1PO11 2V79A 3MDPA 1XSQA 5KVRA 1JBCA 5FRNA 3I4PA 5A70A 1RJ7A 1T56A 1JGGA 1LPQA 4MXWA 3J7ZI 4HRIA 3AJYA 3NQHA 2VJXA 1RC6A 3WTYC 3PUFA 4RS5C 1MZFA 3CP8A 5FP3A 4PQ9A 3DWLE 2XWBB 5EZHA 1GWMA 2ACJA 1PMIA 2XGDA 1JYCA 3QPTA 1F2NA 1URXA 5J40A 4RB1A 2W82A 1BJZA 1I5ZA 2VZOA 4BDYA 3A4CA 1Z7UA 3E5XA 3M7GA 1Q1VA 3DYOA 4RB3C 3AP9A 2HVQA 5T54A 1BLZA 1UJ8A 2RAEA 3AXDA 3I7DA 3BALA 2JPBA 1ONVA 5H2FC 2QQBA 1R1UA 4XRFA 4XICA 3BTIA 3K75B 2D98A 4B8EA 2DA2A 1S7AA 2E5ZA 1GKBA 2RDQA 1K6YA 2Y30A 3ZSMA 1WCSA 3F8NA 2R7DA 1GZ9A 1LVKA 4GH4B 4IUGA 2EZIA 2BV4A 1RUG3 2ZACA 3OEBA 5F0CA 4HXCA 1NCRA 1U9OA 1OPMA 2L2OA 3AG4H 1JE8A 1NCQC 3FXUA 1LOFC 4B1LA 1IJWC 1M4WA 2E32A 1RRJA 2JDUA 1X8MA 4AEDC 3UV9A 1S5LC 1STZA 3CNAA 3FWEA 3BPZA 3VKLA 3OJBA 4YLZA 3DEMA 1N77A 4BJ5C 1US3A 3HSFA 3KZYA 2D5FA 1OA4A 1SFXA 4X6AJ 4DB5A 4KDPA 3CJQB 1XU2A 1WA4A 5FZ4A 4MEXF 2DVBA 2V4JC 4CEYB 3HWJA 2BZTA 5L9RA 4HSTA 5CVJA 3HTSB 2HDDA 2VG9A 2H94A 2KDZA 1UZ0A 4H0EA 2FXAA 4XQWA 3BG9A 3OYDA 3VHOA 2JT1A 1OYWA 3FBYA 4A7ZA 2Y0OA 2Q5TA 4BISA 3LIGA 3HD8B 3HKZN 3ME2A 2BRTA 2IPQX 5LRRA 2IZWA 2I45A 2ZNYA 4PHZA 2YUSA 2GN7A 2G9GA 4JHTA 2ADEA 2WBKA 1GLHA 1XC5A 4S2DA 4UXAA 3BU7A 3S2HJ 3VZLA 3D0SA 1FIAA 4Y15A 2ZMEB 3WQ7A 3JB8A 4AQ6A 4Y33A 2YFUA 1W03A 2YU2A 4QWNA 5A32A 3ZFFC 2ES3A 3BQZA 3V64A 4AI8A 2XJPA 5FLXK 4XUTA 3VDDB 5E1XA 4WXHA 5HLGA 4XLHA 2DTZA 1AKHB 5F5CA 1XXNA 3RSJA 2BNOA 3EB7A 3WP4A 1DDLA 3VDAA 3K1PA 3MF9A 1ETWA 1LOBA 4HOBA 1S0CA 3J8F1 4E6KG 3E1SA 4PLOA 1DDNA 1FSEA 2D5HA 5ICGA 3THDA 3M8FA 1ULEA 3SEEA 2JA6J 4NAOA 3RGBA 3VB2A 1RUH1 1NCRC 1OF4A 2ADDA 4S0HB 3F0CA 4B47A 5FZ3A 5A3UA 1SD4A 5J36A 5K5OA 2M2EA 1VP6A 1O3QA 5IUQA 4O65A 2EQRA 3N7LA 3SXWA 1LHNA 3JUUA 1JUIA 4C91A 1TME2 4Q4Y2 2BY3A 5C3SA 1W8HA 2VQAA 4D6SA 1COV1 2Y8KA 4IL6C 5F9TA 1BEV3 5IVJA 4ZKTB 1TNFA 2PHLA 4MFDA 1HIXA 1QDOA 3ZXGA 3SJMA 1DP0A 1V9U1 5FP4A 2EXHA 3AG3H 2ESNA 4XIOA 1WWYA 1BN5A 3WV6A 1AXYA 4NWWA 3IPVB 3WTWC 2P6TA 3MV11 3UNPA 2JKXA 5TSWA 3GYHX 2DDAA 3DL3A 3KETA 1J84A 5APAA 4QPIA 2A68F 4C8DA 4CU9A 5JZGA 4BE2A 2LS6A 4JQTA 3V8KA 4HX8A 1ZX5A 2TBVA 2PJPA 1YNAA 3BYWA 5AC93 5GZGA 4HFSA 4CP0A 5C4WC 3M1HA 4L99A 2VMEA 5CEHA 5E3OA 1DQ6A 1AR92 5FZKA 2XL7A 4CA9A 2WC2A 1H2NA 4AWXB 3H0GJ 5JOXA 2WZEA 1KYZA 1C57A 4CP1A 2JDNA 4GKXA 2JG8B 5BNPA 4TWTA 1X36A 1B35B 1W8OA 1USTA 3MGUA 3R4UA 2QVOA 3COAC 1XNBA 3KYCB 3CUQC 1SACA 5EXOA 2NMNA 4UF0A 3NWTA 1MBHA 2ZZJA 5FZ8A 2KJBA 3ZR8X 5F64A 1JOPA 1UMQA 5FYMA 4KIFA 1IGNA 2QLZA 1B9MA 3WF3A 1LUJB 2IS6A 1KA8A 4BB3A 3PVBB 2V73A 2LKSA 2ZKNA 4MO7A 3PUHA 1B1BA 4A2UA 2RS52 1I27A 1LJ9A 1XMAA 3T8TA 4QM8A 1HKDA 1K5MB 2XRLA 1RGSA 1ULPA 1H1IA 5FKNA 2NAZA 4GA9A 2XJRA 3MI8A 2OAZA 1NTCA 1MZ6A 4XR6A 3GFJA 4RLQA 3BGAA 3ATGA 3KLOA 1O7LA 3FMQA 2WO2A 1W99A 1YCIA 4J01A 2GBYA 1LDDA 3RJ2X 1BIAA 4KT5C 2VCAA 5DZGA 4A69C 2MABA 2QQMA 1UY2A 2XASA 3RPUA 3PJYA 2J1VA 5HDNA 3KM5A 4PT6A 3GZTB 1YQ2A 1FYUA 1GNZA 4PJ0C 3ZPOA 5E16A 3FHAA 2YYOA 2VXDA 4E4HA 1JN2P 3CCUI 3LFUA 3USUA 4RMNA 1T8IA 1OUXA 2R92J 2V4VA 4IEYA 4ZXEA 2HLEA 3MUZ1 4QQPA 1VMFA 1VBA3 2OC6A 4D6QA 4OCTA 3ZR6A 5F2SA 4A0YA 1H8TB 1J3QA 5LRSA 3UGFA 2R32A 3J4UH 1CPNA 1C1LA 3OYFA 4QPIC 4KGQA 1JZ3A 5A3NA 3WQ1A 5H6RA 3FFZA 4D9JA 2GSYA 4LMYA 1ZZ6A 2MW8A 4YW4A 5FK8A 3PL8A 3H3LA 4YW3A 4KQ7A 1MBGA 4ASLA 3HOXJ 1KITA 4JGYA 3JRAA 2BXYA 4LQRA 2OKXA 5LGNA 4QD2A 4EVIA 5C6CA 1S6LA 3LF7A 4O6JA 4PBOA 1GR3A 2DCKA 1DU6A 1TL8A 3I2KA 5BNPC 1DQ4A 4G12A 2WJSA 1CAXA 3DLAA 3M2MA 2F48A 2VKHA 2IXJA 1JKRC 4TN7A 3SXYA 5EPAA 2QQWA 1IOAA 3D5SC 1B59A 1VJ2A 4ZZLA 3RWKX 4EM1A 4G7HF 1JUSA 5E3NA 1ND2B 3SZPA 1Z6RA 3O2PE 4L5IA 2JWPA 2ZXJA 1G8XA 3P7NA 1WCMJ 2LMDA 1YQ5A 4IETA 4QKBA 2H0BA 3H9QA 2BY1A 2A61A 1SLAA 2GP5A 4O9EA 4YIIA 1FPN1 3PUSA 3DU6A 2K3FA 1YYVA 4HSJA 2XRNA 1AR81 1RUE3 5A2QZ 2ZO4A 2VULA 3U21A 1KDMA 3R61A 3K1NA 2FBIA 1ENQA 3S7IA 4DGWB 1IUYA 4Q48A 3WU0A 1P9QC 5JR3A 4A3BJ 4IW3A 4P9IA 1PVC1 2WT0A 1UNBA 4Q5OA 5FLXZ 1R71A 1J75A 4V2FA 4LD5A 1MNMC 4Y7NJ 2O61A 1DQ1A 4G9YA 4ZDOA 4Q0UA 4WZFA 3DLLF 5DXDA 1MPXA 2WZR2 3DKXA 2VXRA 4HK9A 1IG7A 5F1JA 2VKVA 5LA1A 5FPLA 3SKVA 2UY9A 3I2JA 3CQOA 3GM8A 3ILRA 3JBG3 1OKRA 5DAWA 1IRGA 3HQUA 2MH9A 2OUMA 1F5JA 4HG6B 4XQDA 1RUF1 3KVAA 2UU8A 4AFCA 5K8SA 2YX4A 2G7HA 2MFZA 3CMMA 2ZS6B 3T08A 1QOOA 2JICA 1W8FA 1JXSA 1EKEA 2BGCA 3D5RC 1UIJA 1GQPA 2W9XA 4YVWA 5HNFA 4RN5A 3MN2A 2F2EA 3F2ZA 1SFUA 1YJKA 2WQ8A 3SFIA 1J9IA 1D0ZA 3BOPA 3PU3A 3OYLA 1FP1D 5FY8A 3T2TA 2H1LA 2CTVA 1KEXA 2G9WA 2HYFA 3IT8A 5J1XA 4QGLA 1Z3YA 4PGGA 4KMFA 3OYCA 2JX9A 3AFGA 2EFPA 4K3UA 5DEQA 3RPQA 1OT5A 1YQ6A 5F04A 4FETA 2JXAA 1XX5A 3MKYB 1T33A 4Q4ZF 4UBHA 1XSVA 2K9QA 1WBLA 2Q4SA 2KJCA 3VB9A 4E7KA 2JDHA 4M00A 1ZHFA 4CGZA 2GXGA 2WTEA 4P9UA 1DCSA 1RUI1 1CQ9A 5C5TA 3CF2A 3O7OA 2LROA 1UN1A 4AGVA 3ABUA 2HBTA 2IFWA 4I76A 4H55A 4XUQA 3LSTA 1TWFJ 2J1SA 1V5GA 4WM8A 3EXUA 5FD5A 1TQIA 1PUFB 3M8EA 1HRV1 3H1WA 3R05A 2LD5A 2K4BA 1NH3A 1UOGA 1ZTRA 4D7YA 2ICWG 5D6EA 2D5VA 4ES9A 3MO4A 3T1LA 4OI1A 4CU7A 4IEXA 4YRDA 3AVSA 4CDQA 4FCYA 1K5JA 3JR9A 2DFHA 1VBC3 1TMF1 2A07F 1T6GC 1LQ1A 2B46X 1VAVA 3VBFB 3GGLA 1WCQA 1VRH2 3QRFF 4ZU5A 4M9XA 2XL9A 1HDPA 1AYM2 3MICA 1HKQA 1LEMA 1H6XA 2ARCA 1XNCA 2P4EA 1PMJX 1JYTA 3LOIA 1S0BA 5F1RA 4XJ9A 2HOAA 3K46A 1Z6TA 4LR4A 5FXWA 2QEXI 1SFYA 2IVJA 1YS6A 1B9NA 1OFCX 2E31A 3G1OA 3N3HA 3I4MJ 2A6WA 1ZG1A 3HBZA 1X1BA 3DUIA 1MS8A 4GYGA 2PQSA 4DIQA 2P3KA 1JUHA 4GXOA 1WPKA 5FPBA 2CGOA 4CRQA 3D8CA 2OU2A 2ZTNA 3ZFGA 3WNXA 2CQXA 4QX7A 1VMJA 1BBT2 1MBFA 1S72I 3M4FA 3SDGA 4UUVA 2OQ7A 1U5IA 4XFCA 2ENRA 4IX7A 4XDPA 4DO0A 2GMEA 3FN9A 1W0OA 2Y60A 1WKYA 3MHZA 1JH5A 1L3JA 4R8HA 5GTHC 1BW6A 4PGHA 1Z3XA 1IN5A 1CX1A 3ESWB 4WF2A 4BE0A 4UVCA 1O4ZA 2P6HA 3BCWA 2PLV2 1XTAA 4XSZF 1X58A 4M73A 2WFPA 2YPRA 3I2GA 4RS8A 1RESA 1ONAA 3HBLA 4BAYA 3L2QA 4LKSA 3AKSA 5LK7B 2RR13 2CJJA 4A0XA 3PO3J 4C1WA 2WR9A 3CLOA 2RM23 2EAAA 4Q4W1 3OYWA 4FOVA 2D6PA 2KIUA 2VJIA 1KJLA 4UV9A 2ZZQA 5SV5A 3MIBA 1LGCA 2WYSA 2P34A 4IJAA 3CJIA 4I3PA 4HETA 5FJHA 5EJCA 3F6OA 2E33A 4A6OA 4CZSA 4K8FA 2STTA 2M7BA 3M8LA 5E3MA 1Z0HA 4NVPA 2OW4A 2LSOA 1V00A 5IYDJ 3AVRA 4CUBA 1UQXA 1VQ4I 2R0HA 4AU7A 3WG3A 4MGSA 3QOEA 5FJKA 4BOWA 2XOMA 1R4MB 3EBRA 1YFYA 4Y1ZA 5GAHJ 1LHOA 2CYFA 2BY0A 2MBFA 3BZKA 3O12A 2BBYA 3U0ZA 3DBLB 4OUEA 2WRAA 1P6RA 3IC7A 4JHZA 4Z2WA 2HXOA 4PDWB 3KCCA 2A70A 5IAXA 4IQPA 1H4HA 2EFOA 1J1LA 2IP2A 1UAIA 4A3DJ 2MD0A 3ECOA 4XTMA 3MPBA 2B7YA 3ZFGC 2XBO3 3L2YA 1U5ZA 2XKPA 1JKPC 1H9GA 4CCLA 3WCRA 2VOWA 1U5TA 3PNVA 3QYBA 1WCDJ 2HWF2 2JDKA 3JAMK 4BIOA 3VBHA 1K61A 3N9NA 4QM9A 1FTTA 4A5MA 2RS12 1FPQA 1RMU3 4XF3A 4YFWA 3KGZA 4FPFA 2VQGA 5JSPA 3M1CA 1E57A 2W1UA 1ACCA 3Q8FA 3CJTB 3W58A 4COUA 1UHSA 2QQ9A 2GZWA 3TOJA 3CTAA 4DRVA 5CQGA 3VBUA 2QNKA 3BKZA 1VQLI 5DYMA 3JQWA 4M6VA 1VQ6I 5JI7A 5EDNA 5DUVA 5T3NA 3AP6A 1MZEA 5DUXA 5J96B 3O1PA 5EP9A 2DT6A 5F6LB 1Y39A 1I9RA 4N53B 3I3MA 5GLWA 3GDBA 1Z77A 2XMLA 1NKGA 1E0EA 1RVF2 3LCPA 4U7BA 1KGSA 2WO7A 1J1TA 4BEHA 3O0XA 3NNGA 4NAMA 1SAUA 3ZQHA 5LASA 2K85A 4LNVA 4MTDA 2C6YA 3KP5A 3TEXA 5ACA2 3AG2H 2OCEA 3MYXA 1FOXA 1Q8SA 4GQ7A 5EJ1B 3ZQFA 1VQ9I 3A01B 4ATEA 5CG8A 1IKPA 4HKOA 1MJ9A 4EM2A 3K10A 4ORFA 3TW7A 1POGA 5D8KB 1TWGJ 2HQ5A 2QYOA 1G8WA 4RA0A 1ZYRF 3VD5A 4KU8A 3PHMA 1IC8A 3HRMA 2W25A 3A0KA 3L09A 2F5EA 1BKZA 3ZX7A 3T30A 2EA4A 3HR9A 1VFCA 1W5TA 2H8RA 1W0TA 2JSCA 4HL0A 4XRSG 2GNTA 5LEJA 2WS92 3FC0A 1RHI3 3WEZA 2WQ4A 1ULFA 1V6OA 3B94A 5HCHA 1JYIA 4Y26A 2HNHA