3DV8A

Crystal structure of a putative transcriptional regulator of the crp/fnr family (eubrec_1222) from eubacterium rectale atcc 33656 at 2.55 a resolution
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
216
structure length
216
Chain Sequence
ENYFPLWNDLNTAQKKLISDNLITQHVKKGTIIHNGNMDCTGLLLVKSGQLRTYILSDEGREITLYRLFDMDMCLLSASCIMRSIQFEVTIEAEKDTDLWIIPAEIYKGIMKDSAPVANYTNELMATRFSDVMWLIEQIMWKSLDKRVASFLLEETSIEGTNELKITHETIANHLGSHREVITRMLRYFQVEGLVKLSRGKITILDSKRLETLQRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords transcriptional regulator, Crp/Fnr family
publication title Crystal structure of transcriptional regulator, Crp/Fnr family (RER070207001219) from Eubacterium rectale at 2.55 A resolution
rcsb
source organism Eubacterium rectale atcc 33656
molecule tags Transcription
total genus 63
structure length 216
sequence length 216
ec nomenclature
pdb deposition date 2008-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3dv8A02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3dv8A01
5K5OA 5BQTA 4WXCA 2K0GA 5J48A 4KIGA 2QNKA 3HT1A 1U5TB 1MGTA 4MUVA 2RDPA 3NRVA 2FSWA 3NEUA 4ZU7A 2ZNYA 1H9GA 1UIKA 4LTAA 5D6FA 3RNSA 1CAWA 5IT9K 3RKWA 4Q0QA 2VC1A 2ZKZA 2ZXJA 2P6SA 3E6BA 3LFKA 3FX3A 3LA2A 2IJLA 1O3TA 3KP4A 4KN7X 2ETHA 1J75A 2PFBA 2N7GA 3KE2A 1K6OA 4B29A 1YTYA 1BI0A 1EY2A 4KYWA 3I71A 3TOAA 1K78A 3DP7A 2BNMA 2L01A 5A2QZ 3GFLA 3QACA 3SQNA 2F4PA 1FXZA 2O8XA 2Q8KA 3KGZA 3EO6A 1B59A 3ZMVA 3SXWA 2A6EF 4QLCU 4AVAA 1Y9QA 2RGVA 4CICA 3WW4A 3HT2A 1U5TA 1X8MA 4UVBA 3R0AA 1FSEA 1S29A 2A07F 4M72A 4LLGF 1HKTA 4GULA 4KMUX 3S7EA 3C3WA 1O5UA 3FM3A 2KIFA 4E2GA 5JVTA 5BY5A 1UIJA 4XFHA 4YFXF 3LWFA 2VBXA 5HI0A 3HUGA 4GGGA 2KJBA 3IWFA 4EJVA 4EWAA 5LEKA 2VECA 1U78A 3I0TA 5JHUA 4K2EA 5JFRA 1Q3EA 5HLGA 1UFMA 3FE5A 1QO0D 3S7IA 3QP5A 5LBQA 3TDUC 2WC2A 3RTRA 2FU4A 4HX4A 2HYFA 4D7SA 2V79A 1UW8A 4IRIA 4N9IA 4PGHA 1LVAA 3GW2A 5HDNA 5ICFA 3OOPA 3JSOA 4Q0PA 4ZYHA 1SFXA 4MQVA 3W6KB 4CXFA 3JAMK 1GVJA 4LK1F 4XFGA 1Y3TA 4Y15A 1GXQA 3ZMTA 5BV6A 5JI6A 1Z05A 4IEYA 1TNTA 3GX4X 2IA0A 2VONA 2H09A 1QY4A 5FO5A 2DQRA 1ZARA 2GU9A 5CLSA 1ONVA 2XKOA 3KCCA 3BROA 2ACJA 4Q0SA 1QNTA 2Z3YA 2XAHA 1ZGJA 5EEGA 1FYLA 4I98B 3FJSA 2XAFA 4RB0A 3KP3A 3WG9A 4IETA 1S6LA 3HYIA 3C3VA 2R3SA 4F7ZA 1U5TC 4GYGA 1B1BA 4M74A 4FX4A 1BN5A 5ERIA 4I0BA 2EK5A 3PQKA 4KU8A 1VTNC 3H1WA 3QOPA 2BV6A 2D5HA 4L2NA 3LAPA 1ZH5A 5JR3A 2RQPA 3E5QA 3M7GA 4HX7A 2D2WA 4UUVA 4PJYA 3F72A 2OQGA 3DF8A 1YLLA 1CAUB 3K2ZA 4IRHA 1VJ2A 2GA2A 3P9CA 2YU3A 4BHBA 2IA1A 4KFCA 2UY9A 2MH9A 4UVCA 1PP7U 2G7HA 4BAYA 2K4JA 1CAXA 1JXSA 1FC3A 2IXHA 3GWZA 1J59A 1K7AA 3LOIA 3VB2A 1FZPB 1CX4A 1XSXA 2EFOA 2Q30A 1W7PD 1SD4A 2VBWA 5DUIA 2VE8A 3FHIB 4S04A 3K9TA 4HF2A 2QVOA 1XGNA 2EFPA 1XB4A 3MYXA 1YW7A 5TRDA 2JTVA 1NZCA 2D40A 1T6SA 3WU0A 3LSTA 1GQHA 4MGIE 1FP2A 4CDGA 3ECHA 2CWEA 1MJAA 3I4PA 3ZN0A 4Z82A 1S7OA 2PMUA 4ZH4F 3E5UA 1RUOA 4BIFA 1YW9A 5KHKA 1ZRFA 5I0SA 2ZFWA 1Q5OA 4KWLA 2I45A 1IXSB 4HW0A 1CGPA 5BPDA 4A5MA 1QZYA 4AD9A 3D5LA 2XL7A 2HYGD 1CAVA 1BIBA 3IDBB 5E1RA 5HDGA 5T3NA 2XV4S 4K8FA 1OR7A 1KQ0A 1XRUA 4A2UA 2EJRA 4U7DA 2W84A 4GCVA 3K69A 4G6DA 3MZYA 4IEWA 1LKNA 3MZHA 4QM8A 3WTTC 2Z5UA 4I2OA 2KJCA 3CLPA 2LF8A 4KL1A 1XSVA 3GLXA 2DLLA 4ESJA 4EGYA 2FNAA 1GHCA 1J9IA 4YG2F 4MGKE 4AXOA 3IL2A 4Y17A 3V8LA 3SHFA 2CQKA 4EWDA 1XSDA 4JTOA 4WK8F 2MHFA 2PAEA 4X6QB 2XROA 5F6FA 4XEZA 5D5XB 2W24A 3CDHA 1R1VA 4J1WA 4EWEA 5ICGA 3IDCB 2IA2A 1ZRDA 2J5PA 3IRRA 1ZX5A 4EJWA 3GZ5A 5E1ZB 1SMTA 3H8UA 4META 4B8XA 2WWYA 5I8YA 1B9NA 3S0MA 3O14A 1YW8A 1BI1A 3CJNA 4BQAA 4WXHA 2YSRA 4P9UA 1I27A 1NXMA 1Z1DA 2VT2A 4U0YA 3H3UA 5KVRA 4G7ZF 4LMYA 2K86A 1F9NA 4ZYGA 2QVSB 1DP7P 4YIFA 4LFUA 5DCMA 1BC7C 4UBGA 3FXRA 1SFUA 3ACLA 1QQIA 2EFNA 2P17A 1IN4A 1OKRA 4OLLA 4MGYE 1U2WA 1BOAA 1X8EA 1X82A 2A61A 5D8LB 4XFIA 3R0JA 4RAZA 4IRGA 1T38A 4ENMA 2FBIA 3BJ6A 4ZYDA 1DZRA 4NVPA 1K79A 1IN7A 4HA8A 5AIPA 1HKQA 3P9IA 5BUVA 3EYYA 2M1BA 2PA7A 3QPTA 2PAMA 3PFIA 4LUKA 4A0XA 4U88A 1WA4A 4Q4ZF 4P5OA 1D3YA 5L3GA 3LA3A 4HLYA 1CF7B 3CO7C 2UWMA 4I3PA 3QAHA 1ULYA 4XFCA 4WZCA 2IRFG 1YFUA 5DD4A 2L4AA 2WFPA 2FXAA 1O7FA 2GIVA 4EJOA 2JRTA 2EAAA 3G73A 1GXPA 1B9MA 2PMHA 3H3ZA 2D1HA 2PG4A 3BP8A 2QCSB 4HOBA 1XGOA 2IC1A 2A3SA 4JK1X 5DEQA 4Q29A 3KLNA 4J1XA 2ETEA 4JQFA 4OOIA 2W25A 3J80K 2VT3A 3TO6A 4QX5A 2GH2A 2P5VA 2PHLA 1ZG5A 4UXNA 1O4TA 4L0YB 3WGHA 1IRFA 1NE4A 2RVCA 3WGGA 1DPRA 4HF1A 3PNAA 2XASA 2F5EA 3HIFA 4XF9A 4NHJA 3GF2A 2Y0OA 4Q47A 1ZLKA 1P4XA 2DK5A 1QBJA 1P6RA 1YFWA 1KU7A 3T0YA 2JPCA 3KP5A 2Y0MA 3FZVA 2GXBA 2LKPA 3G3ZA 4ZU5A 1TBXA 5DCFA 2V6CA 2NNYA 5H20A 1WKMA 1Q1HA 1KQ8A 2DBBA 5C8WA 4CZZA 1F4KA 3B02A 4AIHA 2GC0A 5LGUA 1HQCA 5D5UB 4A0YA 2CSOA 2PQQA 3DN7A 4BYYA 4LGWA 4IPAA 5CVVA 2M45A 3CTAA 3RIRA 4KIFA 4P9FA 3GFJA 5LRRA 3ECOA 4ZZDA 1CAWB 1USSA 5ILUA 1UD1A 2XLFA 1ZGAA 5ED4A 3JTHA 5DYMA 1BJAA 2FBHA 2NNNA 4HLXA 5E1XA 2EWNA 3TOBA 5LRSA 5DV5A 1BC8C 1YO5C 2MLGA 3SCGA 1FPQA 4LUMA 3D0JA 5LEJA 2HKXA 2FQ3A 3U10A 3RPQA 1U12A 2BE5F 2ZNZA 4GYIA 1STZA 1K78B 3GXOA 2ZKLA 4ZYEA 1FI2A 2P4WA 2F5DA 4XFFA 1X3UA 4TLFA 3I54A 4ZU4A 2LDUA 1YG2A 3T8RA 2OD5A 2IXJA 5J8CA 2OYZA 2XGXA 5I8TA 1SMYF 3R4KA 1TW2A 2W57A 2W85A 4I09A 2HOEA 4AVPA 1TQMA 3UKTA 4Z2YA 3CUQA 1RUNA 4PDKA 1I1SA 4OIRF 3S2WA 4WF2A 1H0MA 3NKTA 4MQ9F 2G9WA 1Z6RA 2JT1A 3KSCA 4QM9A 1JGSA 5IT9Z 4JTNA 3SCHA 3N4MA 1T98A 5I0UA 2Q0OA 3WTUC 3BY6A 4O3MA 4YFKF 2Z69A 3NJZA 3ELNA 1R1UA 2UXNA 2DAOA 2EV6A 1DZTA 2L02A 4I02A 3J81K 4YSFA 4HSLA 2M5WA 3ML6A 2FF4A 2F5CA 2XKPA 3E6MA 3HTSB 2RV8A 1Q43A 3DQVC 1RL3A 1R5HA 3DL3A 2PEXA 5FD6A 1LQ1A 3E97A 1BIAA 5FLJA 1LEBA 3IHUA 5ILSA 1LDDA 4CGZA 2VBZA 5D5VB 3UKVA 5FLIA 2P7VB 5I0TA 3TNQA 4MV2A 1SFEA 3K1PA 1PDNC 4MGRA 3GVAA 2DT5A 4E2SA 3KZZA 2DQLA 4AIKA 1OPCA 1ZG1A 2K7LA 1JHFA 3G7DA 2K27A 2VPVA 3ULQB 3CEWA 5I0RA 3BJAA 1R36A 2K9ZA 1S8NA 1P92A 4L5JA 2OBPA 4IEOA 3LAGA 3TDZC 2E7XA 1FLIA 5HVQC 5D4RA 1ZLJA 4S05A 2DFIA 2XVCA 1IPJA 3DEUA 2AXLA 3JSPA 2BEOA 4AVCA 2E9QA 4RD7A 1ODDA 2D45A 4JVAA 1BBYA 4XLNF 1UHMA 4UXAA 3QU6A 3H92A 1FBSA 5E16A 4XBFA 4MTDA 1SD7A 3B73A 1SD6A 1VR3A 3VODA 3CUQC 3JAMZ 1Y0UA 1RZ4A 3EQLF 2R7FA 5D8KB 3M70A 4QXKA 4ETSA 4G9YA 3WU1B 5L3FA 4ORFA 1QZZA 1IZ1A 4E2QA 1ZRRA 4G8XA 3HOTA 2DPUA 3RJPA 4XF1A 2O0YA 2YX7A 3HSRA 1PP8F 4WX9A 5DUKA 3F8MA 4EJTA 1CAXB 3LA7A 2KXLA 4XFAA 5D6EA 1XMKA 2P5LC 3CF6E 1RNLA 2IXLA 1ZZBA 5FLHA 1OMIA 4IF4A 2FNPA 2J5OA 2DPDA 3O6BB 4QGMA 5LGTA 2Z2SB 1XGMA 1KYZA 1W5TA 3E6DA 3ETQA 3KP2A 3HSFA 2GQQA 3U2RA 3EYIA 4FAGA 1BM9A 3V7RA 4ONUA 4XF3A 3F6VA 3MCZA 3VHRA 5FB2A 2EB7A 4ESFA 1WGPA 3TO9A 1KYWA 1KU3A 4M71A 1XE7A 2UXXA 3Q9SA 1SFNA 4U0WA 1CAVB 2HQRA 2DI3A 3WW3A 4A5NA 4ENNA 4HMZA 4RGSA 1ZRCA 1R23A 1IN6A 5L3BA 3I64A 1PMIA 1FX7A 3QU3A 4LLNA 3ZQ7A 1NE6A 3L09A 2HDCA 1E17A 3BALA 3RZZA 1S7AA 4EGZA 1HW1A 1L3JA 2EA2A 1O57A 3EJKA 3KP6A 2V09A 4HDUA 3ZPLA 4L9JA 5L3DA 1HW2A 3BOQA 3BCWA 2QUFA 4KIBA 2FEZA 4L18B 1W4MA 4EM2A 3F8FA 3NL1A 2XLAA 3KFWX 3U0ZA 3M3IA 4WVZA 3DPTA 2EV0A 4KA4A 2K4BA 2GC2A 2HKOA 1EH6A 4O5VA 2FOKA 4IHSA 2BBYA 5E8IA 3TGNA 1FOKA 4IVNA 5F1RA 2Q2EA 2TDXA 4NQWA 3SCFA 1D8KA 1FP1D 5CADA 1IW7F 3U9GA 3CLOA 3F3XA 1YFHA 2OA4A 3FF5A 3REOA 2XIGA 3ZN1A 3OGJA 1HSJA 4ESBA 5FQ0A 4RGXA 1OD5A 3V4GA 2LSOA 3J7AO 3HRMA 4MHGA 4AQ6A 1YQAA 3Q9VA 5I91A 2D1VA 5DCMB 2P6TA 2IXCA 2ADUA 2WTEA 1J7KA 3EETA 2F2EA 2MBFA 1SQ4A 4FAHA 4UV9A 1J2XA 3O2PE 1V3FA 1IAWA 2FA5A 1R22A 3I59B 4XF0A 1MKMA 4JBAA 3LWCA 1RC6A 4MNUA 3I53A 2PBIA 2A6HF 2HFHA 4XFBA 1ZREA 1AWCA 4IEUA 1WQ2A 1UB9A 4XETA 2QWWA 4G94A 3M1EA 5BPXA 4M6XA 4NB5A 1D5VA 2STTA 2XAGA 4ZZLA 1HXDA 2CAVA 2VBYA 2EA7A 4QGNA 1FT9A 3P9KA 5LHGA 4UBHA 4WBBA 1J3PA 1WSUA 2L4MA 3C7JA 1FBUA 1G3SA 2V9VA 3O3KA 3RKXA 4HVRA 5FLXK 2CG4A 3MQ0A 4LG0B 2EV5A 1PM7A 1IRGA 2EVXA 2GA1A 1FSHA 1IXRC 3P7NA 5ICEA 3V8KA 3MWMA 2OZJA 4MX3A 2NYXA 5CVJA 1OI6A 5EFUA 4F8AA 3ES1A 1SEFA 2ZJ2A 3I59A 3EHKA 1XDUA 4WXDA 1O7LA 5KHJA 1WRJA 3QPHA 5AVPA 4A6EA 1QWRA 1LB2A 4YRDA 2ESHA 4DNCA 3GBFA 3WW1A 3C18A 4PCQA 5LHIA 1Z6TA 3ST7A 4M9SA 3H1YA 4WCGA 2GAUA 2YR2A 4A12A 1HW5A 2RC4A 5FPZA 5FDBA 2IP2A 1ZNPA 4O9EA 2M8EA 5ILVA 1X7NA 3QRFF 2O6GE 2ATFA 3OTFA 2LF7A 4HX8A 4CHUA 3E5XA 3IWZA 1YIOA 4LG0A 2ET7A 4RGUA 2HZTA 1I1GA 2E1CA 1SAXA 2GC1A 3COAC 2B9UA 1Z9CA 1XE8A 3SXYA 4XLPF 1PUEE 2FMLA 2QENA 4QWQA 2MPFA 3WW2A 5HS7A 2IT0A 4IJAA 2A5YB 2OU2A 2KIUA 3IRQA 2V1DA 3J80Z 2IVMA 1I6XA 4M73A 2CV6A 3MPBA 3LAJA 1AOYA 1T2KA 4YARA 2FBKA 4X6RB 1KGSA 2V1XA 3W6JB 3DXJF 5IT3A 1P4WA 1IPKA 3SZTA 3HQXA 5JR7B 4A6DA 2CFXA 4TV7A 3RKYA 4R8HA 2H0VA 2DCTA 1XDSA 4G7OF 2EFWA 2C0ZA 3C1DA 5JSPA 3HOSA 3KETA 3NVCA 1G3TA 2NAZA 4H7LA 1T0FA 2ISZA 3OV8A 1QPMA 3F23A 5LHHA 1UPIA 1T39A 5CYVA 1QGPA 1R58A 5DD8A 1J5YA 3WTXC 1HBXG 3NQOA 4L9VA 2DW4A 1DGWA 1QXJA 4ASNA 3V7CA 4LLLA 1B6AA 3WTWC 2IXKA 4LJZF 4N0BA 4EQQA 3R60A 1KQ9A 1XCBA 2QYOA 3EUHA 4KNYA 3WTVC 2VE9A 3M9AA 3CO6C 5FCCA 1TQ5A 5BMZA 1YS7A 5J6XA 3DV8A 3CUQB 5E18F 4U0VA 1V70A 1OYYA 3FMSA 2Z33A 4O6JA 2KRFA 4R79A 1FNNA 1USTA 1JUHA 3V7SA 5JAXA 2MD5A 4PIZA 4GXOA 3BZ6A 3EBRA 2XLGA 1XD7A 4YIIA 1YLFA 3F6OA 5AONA 2QQ9A 4R1HA 2HR3A 4EVIA 1FY7A 2XRNA 4BHCA 4HBNA 4RS8A 4QMAA 2PN6A 4WWCA 5HS8A 3QP6A 2R7DA 5E1WA 3ZMZA 2CW0F 2NRAC 4RB2C 1MDMA 3KZYA 1L3LA 3FXUA 1DPUA 3UKNA 4HF0A 2Q1ZB 2YX4A 4FX0A 4ON0A 3MEXA 2M30A 2VOOA 3KMHA 4PGGA 4HN1A 2V1UA 1U3EM 4MEYF 4BHPA 1QXRA 1ZN2A 1TW3A 3IBMA 4Q0UA 2Z99A 3LZZA 3D82A 1TQPA 3L7WA 5D4SA 1R7JA 1EPZA 2HS5A 3MAJA 1IN8A 3T8TA 3WTZA 4L9TA 4RAYA 1ZYRF 3VOEA 1LDKB 2QLZA 5DDGA 3KLOA 6PAXA 1ON1A 2A69F 4B09A 4BH9A 3M8EA 3OF1A 3J81Z 4I01A 3GFMA 3FZ3A 1YS6A 3K1MA 4EM0B 1TQIA 5J8FA 1VP6A 1XN7A 4KT5C 4OMZA 1F5TA 5A2QK 2QBYB 4LLOA 4MZUA 4EROA 3TQNA 2HTSA 4HVOA 3BWGA 1J3RA 3FWEA 3IC7A 3FFQA 2KIMA 3F8CA 4HBLA 5CJ9A 3ABUA 1XGSA 4ENJA 4L0ZB 2OZ6A 1UCRA 1IUYA 1W5SA 3ZMDA 2Q0AA 2VODA 4XSXF 1MJBA 5CVRA 4FHTA 4IHTA 1H1MA 3LQRA 4M6YA 1W7PB 5J7MA 3ZP5A 1Z91A 3H50A 1ZZ8A 5HLHA 4G7HF 2BNOA 1O3QA 2AS5F 5C6CA 3F8BA 1G4DA 1SD5A 3T5XA 2Y75A 2VN2A 4D7TA 2GC3A 3CL1A 2EFQA 5AIQA 5E17F 1DGRA 1FWZA 1Z7UA 1LEAA 3EQEA 2QBYA 1R00A 3U1DA 1U8RA 4JV4A 2ISYA 3BB6A 1HSTA 3NSTA 3SFZA 2XAJA 2H6CA 4HV5A 1YFYA 5LGNA 3D0SA 2JPBA 4Y13A 2CO5A 5E20A 1G6NA 1IF1A 1W7PA 5E8GA 1DUXC 2O1QA 2D5FA 3BDDA 1TTYA 2ZBKA 3KP7A 4G6QA 3GYDA 1XMAA 4I0AA 2UYAA 3GEZA 1MD0A 2DK8A 3BPXA 4OU0A 3WGIA 2ZCWA 3OD0A 4LD5A 2IPQX 1J0RA 3E3VA 5L3CA 2X0LA 4Q5SF 2CAUA 2ESNA 1U6GA 2HGCA 1EH8A 4XF4A 5I93A 4A0ZA 4EMSA 4HV6A 1R5GA 3DPLC 2WV0A 1TNSA 3WE3A 3IKVA 4OIPF 4PIYA 3HSEA 4KN4X 1F1ZA 3USSA 1R1TA 2IXIA 5CVUA 5K1YA 3JZVA 2H6BA 3HRUA 1EH7A 4IEXA 1TLHB 3GZ6A 2DU9A 3TO7A 1ZZ7A 2PFWA 2STWA 4ENKA 1KU2A 3SZPA 4MGZE 2UZKA 2GXGA 5JSOA 5ICCA 2A68F 2E7WA 3BU7A 4HN0A 3NW4A 3ZDSA 4LK0F 1H9TA 2MLKA 4HQEA 1LR5A 5BOXA 1RIOH 3HHHA 5FGMA 3ERED 1RI7A 4IEQA 5FQ0B 4KWKA 4BNCA 3TKYA 2O61A 1P4AA 5BS6A 3RYPA 2UYBA 2CYYA 4YFNF 5EEHA 4OIOF 5KBFA 5LLQA 4LA2A 3SHRA 2ZMEB 1NYWA 2F5FA 3DFGA 4AVBA 3RYKA 2ET1A 2O3FA 2MNGA 5H6QA 2K02A 2DO7A 3KGLA 1ZG3A 3FM5A 5K5RA 3GO5A 4PZJA 3HRSA 3HRTA 2YPRA 3BJOA 5KHIA 3IKTA 1EYBA 1OFNA 4LULA 1ZAOA 2PI0A 1RGSA 4RGRA 3CUOA 4QGLA 5K5QA 2JZYA 4MEXF 1I5ZA 5D1IA 2Y48A 5J3UA 4N9HA 4AQ2A 4Z07A 2OAZA 2QM3A 2HQNA 4KDPA 1CAUA 2LNBA 1B4AA 5KHHA 2DTRA 1REPC 1O5LA 3F8NA 2L54A 3FMQA 2QJVA 1WLTA 5KK1A 2ZMEA 2VXZA 5K8SA 1WWXA 1ZVFA 3I5UA 2M87A 5I8SA 2Q4SA 3WE2A 3ROUA 1J1LA 1H1IA 2PLYA 1YUDA 5JCTA 2MA3A 1G3WA 2PJPA 2PAKA 4MTEA 4L11A 3AAFA 2FMYA 3RPUA 4I7HA 4OFGA 4XSZF 5JSRA 2GZWA 3WODF 1EP0A 4EV0A 3RI4A 2COMA 2RKHA 4L9NA 3GUDA 1FBQA 1JE8A 1J3QA 1UCXA 3GYHX 1MJ9A 4FBFA 2VC0A 1YWKA 1E2XA 1OYIA 4UNOA 3RYRA 2RNJA 3M8FA 1IN5A 1ZZCA 4KUMA 5HS9A 1ZZ6A 2CGPA 2MH2A 1ON2A 1MZBA 2JSCA 4FT8A 4PIXA 1LRHA 3F21A 2FE3A 5HDKA 5FLXZ 3BPVA 1S3JA 5CU1A 4H0EA 3T1BA 3L9FA 4HDVA 1L0OC 1DDNA 3WTSC 4CO8A 4HSJA 3DKWA 3VFZA 1WI9A 4M9XA 2EA4A 2NS0A 4KU7A 2H94A 3PQJA 3WTYC 4LB6B 3VEPA 1O3SA 5EZWA 5FFXA 3SMHA 4AWXB 3MDPA 2HWVA 5D5WB 2HJIA 4KICA 3ZMSA 4EM1A 4D0PA 2OZUA 2UY8A 4P9GA 2HTJA 3ES4A 1EV7A 2FQPA 4U7BA 1P2FA 3ABTA 3FMRA 2OPKA 3EDPA 3L2CA 3PLQA 1LJ9A 2GWRA 4LA3A 5CVIA 4O9GA 4AIJA 3HTUA 2PHDA 4IEVA 1YHFA 2RN7A 5H6RA 2XUBA 4R52A 4L5IA 2H27A 1C0WA 5F64A 1ZZ9A 1HKSA 1FYKA 3CO2A 4DINB 1XCVA 2BNNA 2OA2A 4HYEA 5HLIA 3E6CC 4KWJA 4LEJA 4OINF 2QQAA 3K0LA 3I58A 1O3RA 4IXAA 3HHGA 4P55A 3IIAA 3ELKA 4IESA 2D93A 3RDIA 4UHTA 3FHZA 1OYWA 5FPXA 5FFZA 3H7JA 2XHKA 4XRFA 4Q48A 2B5HA 2P8TA 1NHAA 5FD5A 3TNPB 4IEPA 3L2HA 3R61A 4IERA 5KHGA 2HEOA 1V4RA 5TJJA 4Q0VA 2FRHA 4RB1A 2XL9A 3I7DA 3H9AA 1CF7A 5L3EA 2KKOA 2Z9OA 2VOPA 3BPZA 4M9ZA 2P5KA 3PVBB 1LNWA 2BYVE 4YNIA 2O8QA 1YYVA 3OCPA 5BPIA 2PTMA 4E70A 4P96A 1A04A 4RB3C 1IXCA 1MDMB 3K1NA 3L00A 1RTVA 5HOOA 4HZFA 4UV8A 2XAQA 3LQQA 3JTGA 2E1NA 5BXXA 1D8JA 4MH0E 2X4HA 1KU9A 2O03A 4HAMA 2QZ8A 3F22A 3H7YA 3ISPA 4HVQA 1FYMA 3KEOA 3ZMUA 2L3DA 2ELHA 2P7CB 1G3YA 2VQAA 2G7UA 4OMYA 3U11A 1BI3A 2MC3A 2BGCA 4CYDA 3JW4A 1BI2A 1JHHA 2C6YA 3GFIA 2ZO4A 1ZHFA 4HLTA 2B0LA 4EJUA 4IEZA 2OQRA 2PYTA 1UHWA 2QQBA 4UVAA 3V8JA 4OIQF 1GQGA 3MFKA 4KMFA 2B8MA 2QDRA 1YFXA 3FXQA 4DQ2A 3N97A 4GO1A 1LDJA 3KEQA 2PQ8A 2IW5A 4HQMA 1J58A 4BXUA 1KA8A 4YYOA 4LB5A 3R6SA 3CJXA 3H1MA 3Q5FA
chains in the Genus database with same CATH superfamily
5K5OA 5BQTA 3I2OA 3ZR5A 2BFUS 5J48A 3VBUC 2XGEA 1LULA 2X51A 4MUVA 3NRVA 5F5IA 1E3HA 4ZU7A 2YG0A 2ZNYA 5LA0A 2L9NA 3MGUA 2RHPA 5F8PA 5FK7A 1SLTA 3R4UA 4LTAA 4GD4A 2OUJA 5DAWA 1QGLA 5D6FA 1IZ3A 4GIQA 1Y1WJ 3RKWA 1PUFA 4OUSA 1E0EA 2BY3A 3LFKA 5EJZB 2IJLA 2R7OA 4U2AA 1R092 2BWAA 4QDSA 2D3SA 2OTLI 2ZPXA 1S4CA 2E63A 2GP3A 1VIWB 4QTRA 2BNMA 2DA3A 3JXSA 4GAZA 3S30A 3QACA 1VQOI 1DCSA 3A23A 2Q8KA 3G6EI 5CIRA 4CE8A 1B59A 3ZMVA 2Z5WA 1XG1A 1L7RA 4YGEA 4AVAA 1IKPA 4M01A 1U5TA 2QQLA 2A07F 3K4CA 4I6ZA 1HKTA 4GULA 2M7BA 3OS2A 3ALQA 3C3WA 2ZSIB 4YG3A 3I97A 1W6MA 3WQ0A 4XFHA 3LWFA 2LALA 2E71A 5HI0A 4GGGA 2KJBA 1FPN2 5LEKA 3OYDA 2VECA 1VBE3 5CPRB 1JU3A 1RUI2 5JFRA 2RDQA 5EEAA 3SZGA 1VQ9I 3S7IA 3QP5A 5LBQA 2J1EA 2HNHA 4HK8A 3TDUC 2WC2A 3TMOA 3RTRA 4DUXA 1IDYA 2DJNA 4J01A 4A3KJ 2ES3A 3LCPA 4B3AA 1ODMA 3OUIA 3GW2A 5ICFA 5FZDA 4LBQD 4MQVA 4FXGB 4CXFA 3JAMK 4LK1F 4XFGA 2A6ZA 1S0JA 2R7TA 4DBQA 5CFDB 4JX5A 5F3EA 3GX4X 5GADJ 3HEFA 4Z1VA 1X19A 1ZARA 3PIGA 1RC9A 4QHZA 1V55H 3MIFA 5CLSA 1ONVA 5FO7B 3CCSI 1JI8A 1H4HA 2Z3YA 5FKNA 2FDJA 3CMMA 5EEGA 2A3YA 1RIRA 3KF5A 3T2TA 2MG4A 2X53S 3S17J 4RB0A 2EICA 5FRNA 3HYIA 3MHZA 3C3VA 2R3SA 1BA5A 5D8AA 3RZJA 2DBNA 4NIAA 5ERIA 1RR7A 2EK5A 3PQKA 3H1WA 4NIGA 4CCLA 2D5HA 3LAPA 1POV1 3E1SA 1PO11 2VZPA 4HX7A 2OQGA 3DF8A 1YLLA 5GPAA 1BXHA 1RUH1 5L19A 4A3BJ 4BB3A 4UVCA 1CAXA 1FC3A 3D1NI 5F6LB 1N1VA 1MEC1 1VQNI 3CCEI 1GOHA 3JD71 1FZPB 3O0VA 2K3FA 1FTTA 3QLQA 3MIDA 5A1FA 1NQDA 5FLMJ 2VE8A 5EP9A 3VBFA 2E5ZA 2LRPA 1WLCA 4S04A 4HF2A 1CX1A 5FYSA 1XGNA 1XB4A 3VBHA 1A3KA 3VPRA 5TRDA 2Y6KA 1NZCA 1T6SA 4CDGA 3MN2A 3ECHA 3S1MJ 3I4PA 4II3A 3K4BA 1YIJI 1OURA 2PMUA 1GWKA 3E5UA 1RUOA 1PIV1 4BIFA 4K6BA 3DU5A 3UJQA 2ZX3A 3SEQA 2I45A 1MSEC 3OGVA 4HW0A 2K3PA 2UWCA 1QZYA 1EV13 2Z4FA 5ACA1 2XL7A 3I3EA 1J09A 1BIBA 2IFWA 3IDBB 4Y20A 4H2AA 3FBIB 1KQ0A 1Z7S2 1VZ0A 4U7DA 5A3TA 4G6DA 1LKNA 2XRLA 3THDA 2BXZA 3WTTC 1QJU2 4QM8A 2Z5UA 3AKQA 2KJCA 5JVVA 3NMBA 3CLPA 3ZYRA 1OLQA 3VDDB 3ZCOA 5AVAA 1GHCA 2FNAA 1OCZH 5DM7F 4YG2F 2ENRA 3BTYA 2BOIA 1R5ID 4BE2A 3V8LA 3SHFA 4Q1PA 5GZEA 2KZGA 4JTOA 2DA2A 4WK8F 1UO9A 2MHFA 2XROA 1YITI 3CDHA 2JB4A 1WH5A 2EAKA 2WLPA 2ZJCA 1DP3A 3AP9A 2XDVA 1LKXA 5CFDC 2DVDA 5CB7A 1R1VA 3VZMA 5IVFA 2BBAA 2HWE3 4EWEA 3IDCB 1CJDA 3TEYA 3ZIWA 1ZRDA 2J5PA 3KV4A 3M4OJ 3S3MA 2Y9YA 2V4AA 4C3JJ 1SMTA 3H8UA 1B9NA 1S9HA 2R7ZJ 3MLJA 3OY8A 3AXDA 3DXUA 3IMNA 3NO8A 2D6NA 3FHQA 3BZCA 3CJNA 4BQAA 4WXHA 2YSRA 5A6XA 2BZTA 4I0WB 2VT2A 4OQ8A 4YLZA 1CZVA 3H3UA 4G7ZF 3ERMA 1F9NA 1PGW1 1RUE1 1KQRA 1ND2A 4O7XA 1S2EA 4FPGA 4UFLA 2OV7A 1JYTA 2QGUA 3DGTA 3K70C 1X8EA 1X82A 2VW0A 4B7EA 5IP7J 3P5JA 2Q1FA 2R1BA 1T38A 2FBIA 4ZYDA 1DZRA 1L7QA 4HA8A 3EYYA 1LAJA 3RPUD 1MH3A 1OR7C 2PMZA 1WBFA 3LA3A 3RGBA 3G1OA 4FPCA 4G9SB 4QAWA 5A7QA 4XFCA 4Q4W1 4XJ8A 1WJEA 4DJAA 5LATA 1HRI2 1CR7A 2FXAA 1O7FA 3IPVA 1GNYA 2PMHA 1Y9GA 3GZAA 2D1HA 2GMEA 2GXAA 4HOBA 1XGOA 1WKYA 2XJQA 4TTGA 5FY1A 3KLNA 2VMIA 1N25A 3W2WA 3BR3A 4OOIA 3V0AB 3TO6A 4QX5A 4A3LJ 2XR4A 3O1OA 4D69A 3ZXSA 3WGHA 5F3GA 1IRFA 3THCA 1COV1 2J1AA 2JX9A 1DPRA 4AFBA 4EE2A 4CU6A 2JDMA 4Q47A 3HL2A 4IV3B 3BG5A 1QBJA 4OAYA 1F5JA 3VDDC 1UYYA 3FFZA 4ASMB 1RHI3 3GALA 3EUKL 4CDXC 2LKPA 3G3ZA 4ZU5A 1TBXA 1NT0A 5DCFA 4AFMA 1LHOA 3CDLA 1R64A 2VASA 5FZAA 1Q1HA 1KQ8A 2DBBA 5C8WA 1UQXA 3B02A 4AIHA 1ENQA 1CJPA 3A1YA 2GC0A 5LGUA 5D5UB 1AR61 1OPMA 1W99A 2C9KA 3AK0A 3AP7A 4XIKA 2YY1A 4NNJA 4RGAA 1VAMA 1I3QJ 4LGWA 2C5DA 2E51A 1GZWB 1UZ0A 1HXS1 3J4UH 4D3WA 1V6MA 2M45A 3PSIA 3RIRA 4XMYA 3WXPA 1ZGAA 5A1LA 5ED4A 2OW4A 2R4GA 2RAEA 5K0UB 2CHHA 3TOBA 4DZGA 2L7ZA 1Y8RB 1D2SA 4HXCA 2HKXA 3U10A 2XHNA 2BE5F 2L2OA 1D7PM 2E34A 1REFA 5HLTA 4FPFA 3H8OA 2WAQA 5AFEA 2HVRA 4BDVB 1STZA 3GXOA 2ZKLA 4XW3A 1N3PA 4QPGC 3EB7A 5DXDA 3PURA 1H30A 2F5DA 4D0QA 2IUWA 1X3UA 3IT8A 3FLPA 3KHBA 1ZA7A 1W39A 2WS93 5B1AH 3T8RA 3H0GJ 2IXJA 1TT5B 1Y4WA 1RVF2 2J1VA 4Z2YA 5CQEA 1DZQA 4PDKA 1RJ7A 3JBG2 4LMFA 3MV01 2HOSA 4WV8A 2RMU3 2JT1A 1LPQA 5BNPB 4FOWA 1T98A 4HANA 5J36A 2XVGA 3BTCA 3AP5A 1MS0A 2E33A 3CCUI 1RMU3 3DECA 3NJZA 3ELNA 4DNYA 1AXZA 1R1UA 5CKMA 4UOJA 2CSGA 2GLOA 1QOSA 4UFJA 1DZTA 3TRSB 1WW4A 1F43A 3J81K 1RXGA 3TEWA 4HSLA 1LTEA 2DMNA 3ML6A 1T2XA 3FL7A 2F5CA 3I2DA 1AYN3 2RV8A 4DBRA 1UKGA 4ZTJA 5FD6A 3NV3A 5DDJ1 5GLZA 2CH0A 4YVSB 1BIAA 5FLJA 3KF3A 3IHUA 3RZGA 4DB5A 2GNDA 4M3BA 4RHV3 4A69C 3UKVA 3FK7A 2RS11 4PF5A 4MV2A 4MGRA 4IV3C 3GVAA 2DT5A 3TBIA 3NKGA 3THTA 1BR4A 1VBC2 4YM1A 1TNRA 5F5CA 1MNMC 2W3JA 4MVTA 5I0RA 2DF7A 1S8NA 2NZ9A 1OLMA 1AHSA 4AHXA 3PUQA 3GXUA 5A3UA 5E3OA 3TDZC 4CXXA 2E2JJ 3MIHA 1OLRA 2DFIA 4L0PA 2R071 1T95A 3H5AA 1FMD2 2HVSA 3KCYA 4UXAA 1NAEA 4RLFA 5E16A 4XBFA 4MTDA 4ZHNA 4BLIA 3OUJA 2VCBA 4B1RA 1XSRA 3FXKA 1Y0UA 3K3NA 1RZ4A 5D8KB 1BLZA 4AEDC 1EUUA 4QXKA 2YBSA 1EKEA 3WU1B 5K0UC 3VB9A 1QZZA 4E2QA 4G8XA 3RJPA 2ZHKA 1FMVA 4W6YA 4XFAA 2KXLA 1XMKA 2IXLA 1UY1A 1ZZBA 5FLHA 2IBDA 2J5OA 2VZUA 2JE9A 3Q0VA 2MEV3 1H9PA 2VCMA 5LGTA 4Q27A 1XGMA 1W5TA 3E6DA 4ZTFA 2KM2A 3WNNA 1R1A3 3HSFA 3U2RA 1W6QB 3EYIA 3NJVA 1UOGA 3HR9A 3U37A 1CN1A 4DXRA 4YW4A 2HEWF 2RS32 4AAPA 1KYWA 1U5YA 1KU3A 4XUTA 1TWFJ 5BNPC 2R7VA 4M71A 1HF0A 5M5XJ 1SFNA 1POV0 1LESA 4OULA 2CW7A 1KXGA 4BE1A 4W97A 4HMZA 3H3LA 1R23A 4DEQA 1FV3A 2R7EB 3NNMA 4CEYA 3ZQ7A 2XUMA 1W2TA 4QQHA 3RZZA 4XQWA 1S7AA 1FNZA 4EGZA 2EA2A 2M0MA 3KP6A 2V09A 3ZPLA 3MF6A 4L9JA 2P1BA 1HW2A 3BCWA 1WCDJ 4IDZA 4QKBA 2P34A 4YVSC 1AF9A 5CKTA 4CP2A 3H5RA 3F8FA 3POGA 2LTNA 3U0ZA 1JBCA 3DPTA 3GZEA 2CY6A 1UN1A 2GC2A 1ENXA 2FOKA 2XJRA 4MOAA 3LIHA 3TGNA 5H9QA 1EJ9A 4IZZA 3I8TA 4FFHA 3R05A 2TDXA 2DWRA 4XHXA 5CADA 3F3XA 4CYCB 2VMGA 3REOA 5KAIC 3B00A 1R71A 3ZN1A 4KWUA 4LNVA 1QJY2 5FXVA 4ZJZA 4C9YA 3WDUA 1KZHA 1IS5A 1REEA 2XSJC 3WF4A 3H3VK 4ZXEA 5DCMB 3BR0A 3GZNB 4FQGA 3WSOA 1Z0HA 1NOVA 1ULFA 2F2EA 3AG1H 4M3DA 1S55A 3O2PE 1DU0A 2DUQA 2DN0A 3RWNA 5ABJC 3QH6A 1MBGA 2A6HF 3UJOA 1ZREA 4DRVA 3I56I 1WQ2A 1UB9A 1POGA 2COBA 2QWWA 3AG3H 2AHQA 4NB5A 2WZR1 1D5VA 2VOWA 4RN5A 1WMFA 2STTA 2XAGA 1R4NB 2VBYA 3K10A 3ZMNA 3CF5F 2EA7A 1YI7A 5EGOB 4N7UA 4CDQC 1NCQB 3VV1A 3K70D 5KAFC 4LO5B 3C7JA 1RUG1 5BNQA 1FBUA 2V9VA 3RKXA 4BE3A 4HVRA 5EZGA 2XB0X 3OMYA 1IG3A 1Q8OA 2VXDA 2GA1A 3P7NA 5EJ1B 4HKLA 3CC2I 2NYXA 4E7JA 4R9BA 3ILFA 5F04A 2R063 5EFUA 4F8AA 2B7EA 1AL22 2CU5A 1H2KA 2ZEWA 5FJHA 2ZJ2A 5C4XJ 2VZQA 3EHKA 3SEZA 3THPA 1OC1A 4F3QA 5JOXA 3QPHA 2J7MA 4A6EA 5GPCA 4GRIA 3OEAA 3IH4A 2ZHMA 2W48A 4PCQA 3OUHA 2OTJI 3ZYBA 1BK0A 3WG1A 4WCGA 1TME2 2GAUA 4CCCA 3VBOA 1HW5A 4OMCA 1X4OA 4O9EA 1ND3A 3ZFGB 1H6YA 2B9SA 1X7NA 3WEZA 2BY2A 3QRFF 1WCQA 1VFCA 3ZSEA 1F5FA 1G9FA 4HX8A 4LG0A 1W03A 2HZTA 1I1GA 2SLIA 4F92B 2VW2A 2NOJB 1PUEE 4RQPB 2OU2A 4XAAA 2BXYA 5DZFA 1I6XA 3DPRC 3MPBA 2QA4I 2ZJRF 4QQPA 1AOYA 4I3GA 1LGBA 2QSHX 4YARA 4OHYA 4X6RB 3N9NA 2EXJA 3WNXA 3WHCA 2HWD3 2VZRA 3J7HA 1RUF2 1MMNA 1WGXA 3IMMA 5C3SA 1IPKA 2E60A 3SZTA 4E7KA 1NG7A 3HQXA 3W6VA 2CFXA 4CCEA 1W9SA 5BNGA 4R8HA 2B45X 3OGGA 3NVCA 3BOWA 1VBD1 2VBDA 1T0FA 2Z16A 4CEWA 4QPOA 3F95A 1V6LA 5FZ9A 1T39A 1QGPA 5A33A 4D7YA 3TN91 4DRRA 1DQ2A 1K4SA 1J5YA 1CQ9A 3OS1A 5GP9A 4OCTA 4QU2A 2EXIA 4ASNA 3V7CA 3K4MA 4LLLA 4EQQA 1WMDA 1KQ9A 1XCBA 3PHMA 1JODA 1WCKA 3CO6C 4URTA 4YW1A 2ZA9A 1LU2A 1TQ5A 5J6XA 2UU8A 4OWRB 1K5MA 3CUQB 2DVGA 4P9IA 1GICA 3H35A 1OYYA 2Z33A 1NCQC 2VULA 3DXTA 2L7MP 3LE0A 3ZDVA 2VKHA 5C44J 3V7SA 3ZXKA 2R49A 2AQEA 4YFWA 5IVVA 1A35A 5JAXA 2HU9A 1BW5A 2JSPA 1V0AA 2LS6A 1E3OC 5DAPA 2WY7Q 2FMDA 2XLGA 5BNNA 1X58A 1YLFA 2PLV1 2W1WA 2V73A 3ZFEC 2HR3A 2VVDA 4DZPA 4QMAA 2OC6A 3ECQA 1J83A 2QQPA 1VB2A 4F3JA 2W39A 1OQDA 5E1WA 4AI0A 3ZMZA 4RS5B 4K7JA 4NRQA 2NRAC 5HNFA 3VKFC 2LR8A 2P3KA 3FXUA 3UKNA 1JYIA 3MEXA 2M30A 3ZQGA 3AZVA 4HN1A 1JJ8C 4KI5M 4BHPA 1UKRA 3ZFGC 3OEBA 1V9U1 2DT6A 3QWLA 5D4SA 3DEEA 4HPQA 1R7JA 4B4PA 5JIAA 5CFCB 1EPZA 1IN8A 1MW7A 3WF3A 3CP2A 6PAXA 5DDGA 2FD8A 4XDPA 1FOD2 2WNEA 3ZIXA 3IAQA 4ZZ8A 4BS9A 1YJNI 5KCMA 2LKSA 3NAPB 5IYDJ 1RUJ3 3I55I 1EAH2 2E32A 3OOXA 3LEIA 5J8FA 4M3CE 1R081 1VP6A 4LBQA 4J00A 3G4SI 1GP6A 5A2QK 3CHXA 1VBA2 4HVOA 1JYVA 3BWGA 4D9JA 4BUPA 1GMMA 3WD5A 3FFQA 2KIMA 4Y1VA 2G9FA 2XH6A 3VKLA 4FOQA 4UWDA 4ANJA 1IUYA 2Q0AA 1W5SA 4XSXF 3U14A 1HB1A 4L99A 2VY0A 4FHTA 4DEVA 1RKTA 3BTZA 5C4WA 3NQHA 3CF2A 1X3WB 1Z91A 3H50A 3AKSA 3NWSA 2L9RA 4AHYA 1Z78A 3PO2J 4MO7A 1NKGA 1UZZA 2WO2A 3T2PA 1HRV2 1CQTA 2VN2A 4D7TA 3S8PA 3BCBA 4XOGA 2ARXA 3RFRA 1UZWA 2EFQA 3AMHA 4V2VA 2W82A 4OUMA 3LEKA 1Z7UA 3JRHA 3BKZA 2VMEA 2YBKA 1AR91 4FQ4A 1OA3A 3U1DA 1HB2A 2QQOA 1U8RA 4JV4A 3BB6A 2VVEA 3G2BA 1TE1B 3JREA 3PMEA 4IW3A 2H6CA 4NC8A 2JA8J 1SHWB 4NR1A 2VMHA 1W3XA 1AX0A 2CO5A 3JU9A 1G6NA 3MIGA 3VN4A 4E4HA 1A5JA 3NNGA 1ASJ2 4Y22B 2O1QA 4IE0A 1RITA 1W0UA 3ON7A 3BDDA 2HLEA 4G6QA 3GYDA 3GEZA 1MD0A 3USUA 2JQ7A 4OMDA 3HMYA 1MPXA 3M3EA 1K6YA 4Q5SF 1WD4A 2CAUA 4RS5C 1W90A 4GH4C 2KRCA 4NHYA 2KRHA 2KHMA 4HV6A 3IKVA 4QX1A 2JA6J 1F1ZA 1D0HA 5A3NA 3L2YA 3WNPA 1OOPA 4DY5A 3JZVA 4IEXA 5F32A 2PFWA 3J8F1 2R5ZA 1MNDA 4MGZE 2UZKA 2E7WA 3BU7A 1H9TA 2W68A 3LDKA 1RIOH 4WVMA 3HHHA 3ERED 1RESA 4CUBA 4IO9F 4ITVA 4YFNF 1Q8SA 5EEHA 5KBFA 3SHRA 4KH9A 2F5FA 2R7WA 4AVBA 2RM22 3MFCA 2O8OA 1YQ6A 4IUGA 2MNGA 2CQXA 1RINA 1RUH3 2ADEA 4CUCA 1WLDA 2BWCA 3FM5A 4YZ4A 3H36A 4PZJA 3HRSA 4XABA 4KJZA 1MEC3 4AUXA 1MNEA 2EPFA 1EYBA 4ASKA 3JD73 3ZXFA 2PI0A 1HQNA 4QGLA 2KZVA 4UUTA 3H8XA 2OQ6A 2P6HA 1E5HA 2Y48A 2OAZA 3H9QA 4BQWA 2HQNA 1NLSA 1NUKA 5FAXA 2LNBA 1SBEA 2DTRA 2XWJB 2Q8OA 1OVPA 4BU2A 2JRMA 5KK1A 2XPJA 2YUEA 2VKVA 2ZGKA 5FRMA 3K2OA 2M87A 3WDTA 5I8SA 4CU8A 2VZSA 3WE2A 4LORA 4XJ9A 1YE9A 4KBBA 1JYCA 2ID4A 2KPMA 2PJPA 1Z77A 3LOCA 4IXLA 1GYKA 1ST8A 3RPUA 3LEMA 4I7HA 4PT6A 2NP0A 4RBOA 3WODF 3RI4A 4M3GA 1UCXA 1RUD3 1HB4A 2P37A 2MD0A 2RNJA 4XR6A 5BNOA 5IK7A 3M07A 2XQRA 4PIXA 3F21A 2FE3A 2V5YA 2JE8A 3HD8B 3V42A 4H0EA 2FDIA 5K7HA 4HDVA 1UAAA 1YXWA 5FZ0A 5FMOL 2WB1A 4CO8A 4HSJA 3DKWA 2NS0A 2D6KA 4OZXA 4UF0B 5EZWA 5FFXA 3SMHA 3WCSA 5D5WB 1Y9MA 3ZMSA 4EM1A 3ZN5A 4YWAA 1W28A 1GV9A 4E7SA 2E1MC 5FXXA 1MMGA 4V2FA 3K2AA 1FV2A 1Y43B 3FMRA 4LO4B 5FMBA 4QHBA 4YIRX 1BHGA 4OZOA 4LA3A 5CVIA 1CD3G 3OYWA 3GJBA 1GLHA 2ZGRA 3WQ1A 4AIJA 3URFA 2JUGA 3HTUA 4IEVA 3N7JA 1YHFA 3VYRB 2XUBA 1JW6A 1A78A 2XJUA 1ZZ9A 3OG2A 1J1TA 1HKSA 4JHTA 3SNMA 2VI6A 2BNNA 3E6CC 4KWJA 4LEJA 1EPWA 1OSGA 4Q2FA 4OINF 4LKFA 1VRH3 4YW3A 1B09A 1U0AA 4P55A 5A7SA 2R92J 1RETA 1LOBA 4BPZA 2JKBA 1PNFA 3N35A 4Q4W3 3CLQA 4UHTA 5FUNA 1F4HA 4AFAA 1WW5A 3H7JA 2YU9J 2F48A 4QWNA 2P8TA 4QX8A 1CZSA 3RZKA 3VBUA 1W5CC 1C8M1 1DHKB 4IERA 2M4KA 5J98B 4X6AJ 5TJJA 4Q0VA 2V9PA 1US2A 4A3CJ 2XL9A 4S2DA 2FZ1A 2Q5TA 2W47A 4C2TA 5GAGJ 1DQ5A 2YGMA 2BYVE 5IP9J 1IV6A 3CDIA 3D8CA 5BPIA 2Y6LA 5JPMB 4E70A 4RB3C 1F9KA 3FN9A 1T08B 3CJIA 2VW1A 3QODA 5IAXA 5HOOA 3W20A 4UV8A 1UY4A 4LLFA 3JTGA 1S0FA 3T0DA 2D6LX 5FXZA 3O8HA 5KWRA 4V19K 4BLJA 2E2IJ 2X4HA 1PVC2 3JRBA 3SC7X 4AZZA 3ESWB 2AENA 4QD2A 1MSFC 3KEOA 2RS52 1H8AC 1LGCA 1G3YA 3V56A 1ZBE2 3UK9A 4JHZA 5IAVA 2M7AA 2CV1A 2V72A 4PF1A 4L92A 5FZHA 1BI2A 1JHHA 1HQWA 3KM5A 2HWB1 3WLUA 1G7YA 2ZO4A 1ZHFA 1E5IA 4HLTA 3ZYIB 2B0LA 1GNHA 1HXS3 2PYTA 3V8JA 2Y6HA 3O1VA 4A93J 1GQGA 5E3LA 3P3NA 1QQP3 2CWSA 3LFIA 4DQ2A 1BYHA 1LDJA 5EWSA 3LIGA 5JXGA 1P7IA 2VQUA 1KA8A 5AC92 2L0KA 4M6VA 2HYJA 4KIGA 3HT1A 2NS8A 1MGTA 1H9GA 2JIJA 1RB8G 1D0ZA 2Q8CA 1CAWA 3MKLA 2ZKZA 4K20A 1XYPA 3E6BA 3ACHA 4DOZA 3KT7A 2GIZA 2JDYA 4KN7X 2ETHA 3O5SA 2DU0A 2LG4A 4B29A 4PQ9A 2EXKA 3HPHA 1HLCA 2K85A 4HSRA 2DUPA 4QPIB 2VUAA 3ZR6A 3GFLA 2F4PA 4CP9A 3EO6A 1GZTA 1HN1A 3SXWA 1YO8A 4QLCU 2B39A 2RGVA 4E8DA 3HT2A 2XF5A 3WY6A 3R0AA 4M72A 4KMUX 1ACCA 1VALA 1LFUP 3QBQA 2M34A 2SBAA 4ZS2A 4RL7A 1IG7A 3HUGA 4AGRA 5FZ6A 4Z2WA 2W1QA 3I2FA 2JK3A 4IQPA 5LW9A 1U78A 3I0TA 2D6PA 2X10A 3DKQA 2RS13 2W95A 3M4FA 1Q3EA 2DCZA 5A32B 3KVAA 4ISQA 1S0GA 1XX5A 2A3WA 1SLAA 3JQWA 4N4OB 1NLRA 2M0CA 3BG6A 1V6OA 2HYFA 2Q1MA 2G9ZA 5HPOA 4XE9A 1W6OB 5HDNA 3JSOA 1UWWA 4RLQA 4FPJA 1JZ3A 5T5JA 1GKBA 1Y3TA 3POEA 1PO21 4R9CA 3OD4A 2OCEA 3ZMTA 5BV6A 5JI6A 4CXWA 3HAGA 3RZMA 1NXD1 4YZ5A 1QY4A 2IA0A 2EH3A 1DLCA 5EF6A 4C91A 4JDNA 5FO5A 5K7ZA 1QA6A 4PJ0C 2JD4A 3MKYB 4MXWB 3DKXA 2DXIA 2GU9A 4PJJA 4QPQA 3KCCA 4Q0SA 1QNTA 1SPPB 5G04L 2XAHA 1ZGJA 4I98B 2NMOA 3WF0A 3KP3A 3WG9A 2QQVA 1S6LA 1IOAA 4PHZA 4QKDA 3E0JB 1STMA 5FJKA 3BU0A 2PQSA 1Q8VA 2MYSA 3T1MA 1B1BA 4M74A 1ZK8A 1QVUA 2VTXJ 2Z1DA 4KU8A 3QOPA 5JXJA 4AI9A 2BV6A 1ULCA 4WVWA 5HNHA 4PLMA 5CFDA 3KQ4B 3PO3J 3K51A 4IRHA 1SAUA 4BHBA 1PP7U 2G7HA 4BAYA 2FCTA 4DOUA 2K4JA 2HYXA 3H9GA 2IXHA 4XAEA 4EN8B 1K7AA 4FPEA 4GB31 4QPIC 2Q30A 3RQIA 3FISA 4N53B 1PGL2 2PJRB 2DOEA 2YFZA 1PMHX 3WU0A 2ZTNA 4LIUA 2MC4A 1OCCH 2CDPA 2CWEA 1TT0A 4V1PA 5A7WB 3TBDA 4LHSA 1QH7A 3WQBA 2CNAA 3ZN0A 5HXMA 2JDKA 2VPRA 4F93B 4Z82A 4YGBA 1S7OA 4XC9A 2DTWA 4ZH4F 3W2VA 4GDFA 1ZRFA 1VBE2 2ZGSA 5I0SA 2ZFWA 4KWLA 4BL0B 4JRLA 2PHFA 3DTKA 1N47A 2LYCA 4AD9A 4YRVA 3W5NA 3POFA 1TWGJ 2ZOEB 4BXSV 5HDGA 3KV9A 1H2MA 2XV4S 2AO9A 4K8FA 1OR7A 3OYKA 3LMMA 4GMP1 2EJRA 4GCVA 2OUHA 1W9FA 4OQ9A 3MZHA 1ZYBA 1X9PA 2J1TA 4KL1A 4EGYA 4W50A 4ZYAA 1VQMI 2HOAA 2YGLA 2BW8A 4C8DA 2PAEA 4X6QB 3OGSA 2ADDA 2YU1A 2VCAA 1GWMA 4NC6A 5ICGA 2YU2A 2VUMJ 2ZZQA 1E5RA 1ZX5A 4B3NA 3T08A 5E1ZB 1VBB2 2JDPA 2ZACA 3ZSLA 2WWYA 3RMYA 2DURA 1UY0A 3BR6A 2JDUA 3O8GA 2JG8B 4P9UA 4G12A 5C3RA 1I27A 1NXMA 3VDDA 2QE3A 4FP2A 2Q8DA 1HC8A 2K86A 3EPZA 2WZR3 4ZYGA 3M1CA 1JUPA 2IXSA 4CDXA 1BBT3 4UBGA 3FXRA 1SFUA 2HQAA 1OKRA 4OLLA 2WV1A 1BOAA 2WQZC 2LVSA 1WPKA 2A61A 4FOVA 4MIMA 3S57A 4AYBN 2DCKA 4NVPA 1K79A 1W04A 1IN7A 1ZR2A 5T5OA 5AIPA 1HKQA 2WN2A 4XCAA 2M1BA 3KWVA 4PI0A 4C0BA 3POWA 2XF7A 3QPTA 1AR81 3BLYA 4A0XA 4U88A 1WA4A 1NG6A 4Q4ZF 3ZQIA 2AYHA 4CDWC 4HOOA 1B8IB 3LDRA 1JZ6A 1CF7B 2BVVA 5F08A 2UWMA 3CMYA 2JMWA 4CCDA 3QAHA 3HJRA 1EF4A 4WZCA 3S15J 3LNQA 1FEXA 2EAAA 2VQCA 1GXPA 3S16J 1B9MA 1EV12 1VBA1 1XC5A 3BODA 4GKXA 4QPGA 1R093 4AIDA 5DEQA 2DFCA 1ERDA 2FDKA 1QVTA 3J80K 2OT7A 2D97A 2GH2A 4JYKA 1GVDA 1JUMA 1O4TA 3GZTB 4L0YB 4WM8C 1AU7A 1RHI1 2RVCA 5FYTA 2E35A 2JG9B 4XF9A 3VZOA 1QU3A 1A6CA 3MLLA 1OFCX 1P4XA 2DK5A 3KIOA 1W6PB 1DQ1A 3H8RA 1P6RA 1S5LC 1KU7A 1YFWA 2JICA 1JT0A 1YQ5A 2Y0MA 4PI2A 2GXBA 2IGMA 2HWE2 4IE5A 4FISA 3MIEA 4K1ZA 2NNYA 1HN0A 4L9BA 3K4KA 1XOYA 4RFRB 5J47A 3BTLA 3ONQA 2FCVA 1O91A 3V0AA 4E4SA 2EIBA 1HQCA 3UNPA 2CSOA 3QPSA 4BIOA 3TN93 2ECBA 9ANTA 4HNVA 3N05A 3M3CA 1W0OA 4ET7A 4JQRA 5CVVA 4KIFA 3DCQA 3GFJA 2FCUA 4ZZDA 2VD7A 1USSA 3HN3A 3TYJA 2JG8C 2XLFA 4IV3A 1PUFB 1BJAA 2K2SA 1SACA 1X1PA 4HLXA 5E1XA 3CC7I 2EWNA 4IGOA 3WUDA 3IM0A 1NCRB 1NLQA 4KITB 1ACIA 5DV5A 3HZJA 1BR2A 2WAQN 1YO5C 3SCGA 4LUMA 4EATA 5LEJA 3ZQLA 2FQ3A 1K45A 2YBPA 2ZNZA 3E1F1 3GCMA 4PLNA 4XACA 1URXA 4ZYEA 1V5FA 2I74A 1FI2A 2WNVC 2WSUA 3APBA 2P4WA 4XICA 3N9QA 3ZX7A 4ZU4A 5DAXA 4PFPA 5DUVA 1D1BA 5DS9A 3P1IA 1MS4A 2LDUA 2RMU1 2OD5A 3W21A 5J8CA 2XGXA 4GJYA 2XG3A 2LC2A 2PLV3 3CU7A 1GZWA 1RMU1 1QU0A 2W85A 4H3WA 3UKTA 1HOMA 1I1SA 3S2WA 1H0MA 1W6MB 3AZWA 1A34A 3I4IA 4AEDA 4LO6B 2G9WA 4MHRA 4M0HA 1XU1A 5IT9Z 5K0UA 4N4NB 3OYIA 2CW8A 2ID3A 2HXOA 5I0UA 4LKDA 3WTUC 4O3MA 1AYN1 1CVNA 5FZ7A 2WSVA 2UXNA 2EV6A 3ITQA 1XMXA 3RZLA 5C3EJ 1A6QA 1IJWC 3I2IA 2FF4A 1WD3A 2XKPA 3DF0A 3E6MA 2Y9ZA 2YPJA 1RL3A 1LQ1A 1W0TA 3J7YJ 3KCXA 3PU3A 4R4ZA 1LEBA 2WA3A 1LDDA 3TEZA 4COYA 3AVRA 4UY8I 1X50A 3OBAA 1SFEA 1DGRM 2KT0A 2DA1A 4Y5TA 5BNPA 5M5YJ 4BCUA 3G7DA 2K27A 4AE2A 2TEPA 5LBFA 3ULQB 3RJRA 4UFHA 1QH6A 1P92A 2NMNA 3L2QA 2OBPA 4IEOA 4P5YA 3SH3A 3BG3A 3OYMA 3LAGA 1ENSA 1ZLJA 1IPJA 3JSPA 3S1QJ 4BM8A 1Z7S3 4RD7A 1NZIA 2D45A 4Q4Y1 1BBYA 4BBRJ 4FTSA 1F31A 5HBAA 4XLNF 1UHMA 5FZKA 1UAIA 4HSTA 4YVSA 1QJU3 1UPSA 5C9AB 1V6JA 3U75A 4BY7J 4XLHA 5IVBA 1VR3A 3VODA 3TEXA 3K48A 3PVNA 5GLVA 2R7FA 3H1CA 1XC6A 4TSVA 4Y52J 1QIQA 5L3FA 1WCMJ 4QQOA 1IZ1A 1NCRC 1OT5A 2O0YA 2YX7A 1R1A1 4WX9A 5DUKA 1AR93 5KNLA 4EJTA 1CAXB 3QH7A 2P5LC 4GWIA 1RNLA 1OMIA 1H1AA 2WS92 2FNPA 2DPDA 1SBDA 1LFPA 1MQTC 3VBFB 5J1XA 1KYZA 1OKOA 2CL2A 2ZGOA 3ETQA 3GDBA 1S7EA 3KP2A 3ZFFC 3VSKA 2R93J 2ZGUA 1OD3A 3DU6A 3V7RA 4ONUA 5E3NA 1SLLA 3PFYA 3WZ1A 2EB7A 2RDRA 3AZXA 3FBNB 3WU2C 1U5XA 2IVJA 3W59A 5ABJA 4C1WA 2VNRA 4COWA 4EN0A 1PHMA 1XE7A 2NN8A 2UXXA 4DGWB 1F35A 3N7LA 2L9SA 4BGDA 3WW3A 4NQWB 1OXCA 4ENNA 5T52A 1PMIA 4LLNA 2Y38A 1NE6A 3O1UA 4CDQA 1OVSA 2HDCA 3W3CA 4Y24A 1WMXA 5FOJB 4FO9A 4RHV2 3WG3A 4HDUA 3J8F3 2K5CA 5L3DA 1W6QA 5F5QA 4KIBA 3ZN4A 4AL9A 1DYOA 5T54A 3KLSA 3M3IA 4WVZA 2EV0A 2K4BA 5K7PA 2ZEXA 1QPIA 1EH6A 1H2NA 2DMUA 1AR71 2BBYA 4QT6A 4Y3OA 4IVNA 3GTQJ 4UB8C 3NNLA 2Q2EA 2QQMA 3I4MJ 4JKKA 2W46A 3K4ZA 3WT3A 4JKMA 1GNZA 1IW7F 3U9GA 1UG0A 2PHTA 5GTIC 2OA4A 2QQUA 4CDUB 2W94A 3BG7A 2QQJA 2XIGA 3BVCA 4Y1UA 2CUZA 3OGJA 3H5NA 4XJUA 5FQ0A 3ZXLA 2P3IA 2X8KA 3LSJA 1D2QA 3V4GA 1WMEA 3JUUA 4NBQA 3ZOBA 1H8TB 1G9AA 1YQAA 3Q9VA 2D1VA 2HVQA 2IXCA 5C9AC 3EETA 4DPNA 1JUSA 1MBKA 2JENA 2MBFA 1T56A 3BTJA 4UV9A 3ZQHA 5B66C 1V3FA 1IAWA 4UW6A 2MW8A 3I59B 4JBAA 4IV1B 4C0HA 4YW7A 2ZABA 1RC6A 4H55A 4MNUA 3I53A 5DUWA 1XPWA 3K6GA 5CEHA 1AWCA 3A01A 4IEUA 1WVRA 2CDOA 3HN1A 4G94A 1N1YA 1BMV2 4LO8A 5EJ3A 3JRCA 2GN7A 4UFIA 1FT9A 3P9KA 4CYCA 1YRNB 2A6YA 1J3PA 4CP1A 2L4MA 3O3KA 4RFT0 4W6WA 2EIEA 2A05A 5J09A 3MQ0A 3A03A 4A3GJ 1PM7A 2EVXA 3UESA 3V64A 1FSHA 3KB5A 4B1MA 1XNDA 3V8KA 1H88C 1AJKA 4NN0A 4CZSA 3R4DB 3MWMA 4DYQA 4MX3A 5CVJA 1HJFA 2K40A 1OI6A 3JQXA 1A31A 5ANNA 3OS0A 4A7KA 3ZQCA 2X9DA 4P14A 3OYBA 4B48A 2AACA 4DNCA 4LOTA 1ETVA 2YROA 2ZGMA 3H1YA 2Q8EA 1F36A 4MLOA 4UW3A 2G0EA 5EGOA 4F83A 5FDBA 1NCQA 1ZNPA 2ZS6B 2M8EA 4QQLA 2ATFA 5KXBA 2WA4A 1RVF3 2OKXA 3U21A 3A4UA 1VPHA 2ET7A 3JBG3 4YZ1A 2E1CA 4NWWA 1IQAA 2B9UA 4E9KA 5TGTA 1KEXA 2JEMA 3ZFEA 1JYNA 1QMJA 2EIMH 4XLPF 3A0KA 2FMLA 2QENA 1LU1A 4B43A 2O8KA 3WW2A 5HS7A 4IJAA 3HG9A 4M0NA 5DPNA 2A5YB 2OXBA 4IHXA 1V6KA 5CNAA 3LKJA 1T2KA 2Y31A 3FKJA 2WZEA 2XOMA 1XBFA 3OR2C 3QYEA 4CPBD 2V1XA 3T0BA 3W6JB 4YM2A 1YI9A 4DFSA 1IRXA 4CDUC 5EIYB 2VJ4A 3AL6A 2IS2A 4A6DA 5C33A 1YIPA 4IOCF 4HEA2 1LCLA 3ZFGA 2DCTA 1DYPA 3C1DA 5JSPA 1WW7A 1GOGA 3KETA 1G3TA 1H8TC 3H9JA 5FWJA 5E8AA 2VZTA 2RE9A 3OV8A 3F23A 1R58A 2R042 3N7KA 5T5PA 1VBC3 4Y1YA 4L9VA 4IV1C 1QXJA 2LK2A 1C8M3 4P9JA 1YEWA 1I6HJ 2IXKA 4RR3B 4A6SA 5JZGB 4KMQA 4C2UA 2PX9A 3EUHA 4KNYA 3HPGA 2VE9A 1C28A 2GN3A 3DV8A 1GDTA 4K1YA 5E18F 5IVCA 2D98A 1V70A 4FPOB 4R4XA 3LDBA 2QZ3A 2UV1A 2KRFA 4Q8KA 4NC7A 1TZOA 2YUSA 4XZUG 2R062 2WFF1 2B46X 2MD5A 5A1AA 3PSFA 1XS9A 4Q4X1 5TSWA 3EYPA 1BVP1 5J3LA 3FHNA 4EN9B 1TMF1 4EVIA 4BHCA 2GALA 3AFKA 4HBNA 1V6IA 4ZONA 3MD2A 1UU6A 4WWCA 3VD4A 5HS8A 2R7DA 1UMHA 4XL9A 5JR2A 1B35B 3KZYA 1Y0NA 2Q1ZB 5CG8A 4ON0A 3KMHA 1WHUA 1PYVA 2VZ3A 3ZXDA 1ITYA 2Z99A 2Y60A 1OPOA 3D82A 5FO9B 1MMAA 2LFBA 1RUJ1 1Z3YA 1Y1VJ 3SKVA 2RS33 2DOFA 3RZHA 1XJAA 5DZGA 3KLOA 4CA0A 3ZYGA 1HCRA 4FQZA 1D4M1 3OF1A 5E88A 4I01A 2BTVC 2WAFA 3BCAA 4MGSA 4XLEA 4ASLA 2HWD2 3TWIA 4EM0B 1TQIA 3VLBB 4RS5A 5JPNB 4UUSB 3OL4A 4GH4A 3CJIC 4Q4V1 3N9OA 4MHUA 1U5IA 4KT5C 4OMZA 2QBYB 4MZUA 3AYAA 3TQNA 2HTSA 3MI8A 2WL1A 2QBXA 3PNYA 4D8MA 5D21A 3FWEA 4HBLA 2K46A 5EZHA 3RQ4A 2ZJQF 4L0ZB 2OZ6A 3ZMDA 1MJBA 5JDBA 3B9IA 3TL4X 5M0TA 1NH3A 4IL7A 2FJ1A 3WDVA 2RV9A 1Z21A 1W6NA 1W7PB 1QJX2 3J7AY 2WT1A 1W8FA 2BNOA 2W9XA 4IE4A 5FP4A 5FMDA 3C2GA 3CZUA 5C6CA 3OYEA 1G4DA 2ZXIA 3HVDA 2WUHA 3NAPA 3ZYFA 1RUC1 2Y75A 1MR5A 4M3CF 2GC3A 2HWC1 1OLME 3FXOA 3PUSA 4RR3C 3CL1A 5AIQA 5JZGC 4N7IA 5FLVA 3G1MA 1DGRA 1G9CA 1GANA 2YS9A 5SV5A 5LK5A 3KYDB 1NY71 4XIOA 2VUDA 1QNWA 1Z3XA 2ARAA 2TBVA 5EG0B 2ZGQA 2VJXA 4QDQA 1I3AA 5F2SA 2WT2A 2XAJA 3CCYA 1X1BA 2VL4A 2NOGA 4AW7A 2F5VA 2JPBA 4Y13A 5E20A 1IF1A 1S0DA 5E8GA 1DUXC 5DTDA 1GP5A 3K46A 3KP7A 1HDKA 5FZ8A 4BJ0A 2VGDA 3PJYA 1FIAA 2X1DA 2J1SA 1GV5A 3BPXA 3O12A 3OD0A 1J0RA 2R32A 5LY1A 3VBSB 3E3VA 1L7LA 5FYCA 2X0LA 3NAUA 4GZ9A 4ZXKA 1ETYA 2XVKA 3IDEA 1PO23 3F9KA 1GUIA 1GU3A 2HGCA 4XF4A 4BBSJ 4XIDA 2ZX4A 4GWNA 2XVLA 3DPLC 2WV0A 1ZM1A 4OIPF 3WE3A 1SMVA 3HSEA 2XMLA 4NOTA 2JVGA 3VHPA 3S3OA 4FTEA 2IXIA 5CVUA 2VMCA 2KLOA 3F2ZA 5FOBB 2VKEA 1AYM1 3G1LA 1LEMA 3GZ6A 1AL23 5GLWA 1ZZ7A 2STWA 1IRZA 1N1TA 4LJHA 1ETKA 5JSOA 4Y22A 3NW4A 3ZDSA 3WF2A 3B5LB 3KD4A 2XBO1 1RI7A 4BNCA 3TKYA 1P4AA 4LXLA 3B7MA 2UYBA 5F3CA 4NIDA 2CYYA 2HH9A 3VL9A 4LA2A 5JMCA 4HG2A 2ZEZA 4PFOA 1YJKA 1EA3A 3K4AA 3WG4A 2C26A 4XKWA 1OA4A 2WDBA 3BOPA 4WZFA 3RYKA 2ET1A 2F4MB 3POYA 2K02A 4A7YA 3WF1A 3KGLA 2I8DA 4B3XA 1ZG3A 3T2OA 3GO5A 4HONA 2J1UA 3SYTA 2ZC2A 2Y64A 5KHIA 3CCVI 1AKHB 2ZMNA 1OFNA 4GB33 3CUOA 1JKPC 2Y2ZA 4NAMA 2Y33A 2QQWA 5J3UA 1W1WE 3MBWA 4AK3A 2QM3A 2L5QA 1CAUA 2CV2A 3NWKA 1B4AA 2M8GX 3T3YA 5FZBA 5GKAC 4NDLA 1TVGA 3RI8A 1VMJA 2VXZA 5K8SA 1ULEA 1ZVFA 2KISA 2X5IB 4MGTA 1W8OA 1NG0A 2Q4SA 4IGPA 1RUD1 4A3ZA 1H1IA 1J1LA 1YNAA 2PLYA 1YUDA 5JCTA 4IE6A 4MXVA 2PAKA 4RSUA 3GTKJ 3RSNA 3AAFA 2LY9A 1SLBA 4GMP3 1DU6A 2GZWA 4XRMA 2OIIA 1YQ8A 4EV0A 2WAEA 3GUDA 1JE8A 4FBFA 2VC0A 1MZ6A 1D0GA 1E2XA 4D6QA 5A3LA 1MBEA 2CU7A 3RYRA 3M8FA 1IN5A 1ZZCA 4KUMA 1ND3B 4XORA 1I5PA 3HBLA 2MH2A 1ON2A 4IX7A 1MZBA 3ZOIA 1PZ9A 3LPFA 3PL0A 4FE7A 5FLXZ 3F0CA 3UYJA 1Y56A 2WB1N 1S3JA 4RGKA 5CU1A 1OUXA 5T55A 3MPPG 4LG3A 3AYDA 1XTAA 2ERFA 1DDNA 4LT5A 2VUJA 3GF6A 1QJFA 2ZAHA 3T1LA 2RDNA 5FZEA 2E31A 2E7QA 4KU7A 2H94A 5CISA 3WTYC 3VEPA 2P5BA 3AG2H 1OH4A 3MDPA 2CYFA 2JVHA 2JDAA 3O0WA 1EV7A 1UXXX 2FQPA 2I10A 1MBHA 4U7BA 5K7FA 4A7ZA 1PO12 2QQKA 1IQDC 3KEYA 2CRGA 4AG4A 2MSYA 2VU9A 4B4RA 2DOAA 4AYBA 1RUH2 1G8WA 4P08A 3SFIA 2VNGA 4CEWB 2JE7A 1VRH1 2RN7A 1MEC2 2H8WA 4R52A 2WYSA 3JD72 1M4WA 4XURA 2BW3B 3HWJA 1MS8A 1KGYA 4A44A 5LZ6A 1FYKA 2R0HA 1R4MB 1XCVA 2JA5J 2OA2A 2MFZA 5HLIA 3RQ0A 1AR83 3LPGA 4UF0A 2VOXA 4IXAA 1XU2A 3LFMA 2BP6A 1RRJA 3IIAA 1OUSA 2D93A 3O1MA 1PIV2 2DA5A 1OYWA 5APAA 2AZ5A 4JGZB 2BGOA 4XRFA 3HDDA 1W2UA 3PIPF 2B5HA 4JGYB 4IEPA 3R61A 1VQ7I 1VBA3 2Z79A 5ACA2 1VI0A 2O7OA 1UJ8A 4UW4A 2TUNA 2X5IC 1U9OA 3H9AA 4L97A 2IGOA 4XBLA 4Z6YA 2C24A 2KKOA 1A36A 3CCQI 4M9ZA 1REDA 2VJIA 1SCRA 4IQ4A 1LNWA 4YNIA 1FNYA 3CCMI 1SDWA 1SFOJ 3VYTB 3VHNA 1IXCA 4QKNA 4AFDA 3HC7A 1OFSA 2XAQA 3LQQA 2E1NA 1D8JA 4R9AA 4MH0E 2NQYA 2ECCA 1KU9A 2O03A 1FIPA 3F22A 3H7YA 3GTMJ 4XJZA 1AZDA 4DY3A 2L3DA 1UX7A 4NWVA 2PHXA 2VQAA 2G7UA 2MC3A 3CBNA 2BGCA 1QQP1 3WHUA 2XPWA 4EQVA 3JW4A 2L7KA 1BEV1 1V6NA 4E8CA 1QHGA 5KXEA 3JR9A 2KFDA 4DYRA 1Q56A 3VD5A 3P5BA 4LBLA 2QQBA 3X2QH 3D3AA 1PGW2 1RUE2 3DBRB 3DLAA 2QDRA 4XCBA 3FXQA 4Y7NJ 1R9TJ 2VZVA 3IIIA 1JHJA 1M1EB 4UT5A 4HQMA 3GTLJ 3C7GA 5DABA 4YYOA 1SDDB 4LB5A 3R6SA 4BEHA 3H1MA 1E5SA 4Q1RA 4WXCA 2H1KA 2QNKA 4YW5A 1G59A 2M4GA 1QRYA 4NHMA 1LHNA 2RDPA 5EHDA 2GM4A 2FSWA 2EALA 5C4WB 1HV1A 1UIKA 2B63J 4QB6A 1ZBA1 1V5EA 1GWLA 1IO2A 2ZGLA 1OJLA 2RVAA 3AL0B 2WABA 3LA2A 1VAKA 1J75A 2IWGB 4Q4W2 2J1RA 3S6PA 2LH9A 1A8DA 1EY2A 1MZFA 4KYWA 5IP6A 3I71A 2C4XA 1K78A 1PX4A 4NAOA 2I2SA 3O1RA 3SQNA 3PMSA 1FXZA 2O8XA 4JGZC 3KGZA 4JGYC 1JOPA 3O7OA 2LP0A 4CICA 3VZKA 3WW4A 4ABZA 4OUEA 1X8MA 4UVBA 1FSEA 1S29A 2E2HJ 1JTZX 2Y0SA 5D2AA 4M4RA 4DW6A 2DT7B 1O5UA 5IVEA 1COV2 3FM3A 5JVTA 3HOXJ 1UHSA 1UIJA 4YFXF 3VSLA 2VBXA 5IHRA 3AB0A 3ETPA 5C3QA 4XNFA 2Y0IA 4D5FA 3FXMA 3B9CA 4D94A 4J6GA 1WZXA 1R49A 2QKDA 5FZCA 4AWDA 5LASA 3VKOA 3J7MA 2HWF1 3FE5A 4QPIA 1QO0D 1ULPA 1MVQA 1YQ2A 1GP4A 4AI2A 2PHRA 4WM7B 4HX4A 3PJRA 5IUQA 1UW8A 3FDYA 2B9VA 2BVLA 4D7SA 2LY2A 4N9IA 4PGHA 1LVAA 1AR62 1YQCA 4O61A 4ZYHA 1SFXA 4HFSA 4INDA 2ORXA 2YC0A 3W6KB 1X2MA 1HXS2 4Y15A 1WJAA 4A3FJ 2P81A 5FP3A 3PTYA 1OBNA 2OJED 1BZWA 4IEYA 4Q4Y3 4CA9A 2VONA 2H09A 2IGNA 2FX0A 1X4PA 1Y39A 4C30A 1PZ8A 2CUEA 1FAYA 1GV2A 3UL2A 2ACJA 1XNBA 5FWEA 5A32A 4BQ3A 1IS3A 4BQYA 5LBBA 2RQQA 2OPWA 4XLAA 3ZXEA 1NA1B 4GYGA 4FX4A 2KDZA 1BN5A 3EUAA 4I0BA 1X36A 1SG3A 1VTNC 1BW6A 1MZEA 4H14A 1LFBA 3M7GA 1UMIA 2D2WA 1UX6A 3AL0C 5L73A 5B4NA 3K2ZA 1VJ2A 3P9CA 1IPSA 1BL0A 2UY9A 2MH9A 4LK6A 5C3PA 1GSLA 4ITCA 3HPNA 4MXWA 1W05A 2M3AA 3MKWB 3GWZA 1J59A 2LBFB 3D4KA 4AQTA 3U4XA 1W7PD 1SD4A 2VBWA 4XJWA 5DUIA 3RCOA 2W4SA 3CJQB 1IS4A 4D6SA 3FHIB 1JH5A 3K9TA 2VL8A 1ZRIA 2E53A 3OYCA 4H4KC 3LSTA 2RR11 1FP2A 2P6CA 2ZJPF 1MJAA 2RJ2A 5DDJ2 2ZAAA 3T2QA 1V5GA 3NNJA 3VUOA 1TP4A 2EIGA 1LODA 3VZLA 4N8MA 2JD9A 2RS12 2NVYJ 1CGPA 5BPDA 4A5MA 5FMOS 2JDHA 4Y1XA 3U1KA 4YW6A 1OH3A 1X1AA 3WQ7A 1TWAJ 1CAVA 5JWPA 1H6XA 1JKRC 1FYUA 4XM3A 4A2UA 4CDWA 1CZTA 3WNLA 2W84A 3HQRA 2XJPA 1AR73 3MZYA 4IEWA 3L9JT 4I2OA 3HNMA 2LF8A 1JMUB 5LBEA 2DLLA 2ZGNA 4ESJA 2IGKA 3INAA 3DYMA 3M3QA 5CA6A 2R072 4J19A 5A7WA 3A7QA 3ASNH 4EWDA 1XSDA 3QOEA 2QQNA 3I49A 2CUJA 3Q0UA 3JRGA 4BE0A 1S72I 4J1WA 2EXHA 2AEYA 4RGGA 3GMEA 3DEMA 2OF7A 4WM8A 4B1LA 2XPUA 1TEIA 3VHOA 1QXPA 4A3IJ 5J40A 3GLLA 4META 4B8XA 2HXIA 1BBT1 2ZXHA 5KC5A 2LY1A 4YG6A 1PVC3 1RKWA 2BV4A 4K21A 5DZEA 4LOSA 3O14A 1G2HA 4JC1A 1YW8A 1BI1A 3OBTA 1PX3A 5FROA 2FZ2A 2RS53 1ZBE3 5KVRA 4LMYA 3UKGA 4LBJA 1OCRH 3PUIA 1TC3C 2DU1A 1QNYA 1NA1C 4LFUA 1BC7C 4CPBA 2ZGTA 1QQIA 3ACLA 4GWJA 5FKLA 4YFZA 1U2WA 3PJQA 4UB6C 5D8LB 2ORZA 3K75B 4XFIA 2X6XA 4NPRA 3SH4A 3R0JA 4RAZA 4ENMA 1KRIA 2VC9A 5EQUA 5LA9A 4XXAA 3P9IA 3VBUB 1IV8A 2W1OA 2PAMA 1DQ4A 4LUKA 4ZDLA 1APNA 3IZOA 2PN5A 4DXZA 3VD3A 1WW6A 1D3YA 5L3GA 3L1PA 3DEWA 1IC8A 3ABKH 1PGSA 4DMIA 5E6HA 4HPKA 3CO7C 2K9LA 4I3PA 2A1XA 2JG8A 1R091 5LK7B 1S2BA 2WO1A 3U07A 5FZGA 2VQHA 1SLCA 1XYNA 2GIVA 3S93A 4EJOA 2PG4A 4IHYA 5LD2C 3BP8A 2QCSB 3QYBA 2IC1A 4JK1X 3WNOA 2WNVA 5HV4A 1SC7A 5DQ0A 1X1CA 2VT3A 1ZG5A 4UXNA 2KMUA 5M5WJ 3CCRI 4B4QA 3WGGA 4MYEA 2OPTA 4HF1A 2C1FA 2K9SA 5LA1A 1JTYA 3HIFA 2DUOA 4NHJA 4I76A 2BGPA 2XJSA 1IHMA 2Y0OA 1FPN1 2I07B 5LFAA 2A6XA 2G19A 1P8JA 2JPCA 3KP5A 1NK2P 3ZVXA 1RUI1 3FZVA 3C7HA 3CDZB 3FLRA 4KG8A 2V6CA 3AM2A 5H20A 1WKMA 4RAFA 4BQOA 4COUA 4XUOA 1WCUA 4CZZA 3LSHA 1ZQ3P 4PJLA 5BYNA 4A0YA 2YC4A 2QZ2A 4XKBA 5FYHA 2CQ7A 1HQLA 2PQQA 3IUOA 3DN7A 4BYYA 1D1AA 2W1UA 4OHWA 4W8JA 4Y1ZA 4IPAA 4K40A 4P9FA 1NX9A 4YVWB 2YYOA 5ANQA 1PJRA 2R30A 4JX0A 1CAWB 3TW7A 4DXSA 5JVGF 4X8NA 2FBHA 1W6PA 5K9YA 1K61A 1LVKA 1LOEA 1RUG2 5LRSA 3NV2A 5LCWL 3RPQA 1U12A 2ZHLA 4GYIA 4XDQA 2XGCA 1S0IA 4M3CB 3OIOA 3VD9A 3HJEA 3MUY1 2QDNA 1JGGA 2WFF3 4TLFA 3I54A 1C8NA 3BN6A 4PBPA 2D6MA 1K5JA 3CQOA 3K3OA 2OYZA 1JN2P 2AC1A 4Q4X3 5I8TA 4CXYA 1ENHA 1TW2A 2W57A 1RJ8A 4I09A 1TMF3 1K83J 1JXNA 3C7OA 5H9PA 1Y7BA 4AVPA 1TQMA 4OIRF 4WF2A 1WH7A 2ME6A 1VNDA 1Z6RA 1JGSA 3HUGB 4Z2AA 3N4MA 1NCRA 2WWJA 3QQAA 3OBZA 3ORJA 3Q8EA 4YFKF 2Z69A 1I9RA 1OA2A 4FPHA 3OGRA 2ZKNA 3B01A 2L02A 2CV0A 1YIFA 4KQ7A 3H0OA 2QFEA 1MQTA 3AL5A 4DUVA 4YSFA 4AM3A 2M5WA 4RQPC 1IG0A 1O4ZA 3ZFFA 3FXLA 3NRUA 3OSFA 3DQVC 1R5HA 3DL3A 2EQRA 2PEXA 2C6SA 1OCOH 4BMEA 3EUHC 5FPUA 1D4M3 5A6QA 3G71I 4FVVA 2VBZA 3PVEA 4KNCA 3TP0A 4ATFA 5JLWA 5FLIA 3TNQA 3LSDA 4Q26A 2DYCA 3KZZA 5EXOA 2DQLA 5A3MA 4Q4V3 1OPCA 1ZG1A 1JHFA 2VPVA 1W8TA 1Z7S1 3CEWA 4FFIA 5FZ1A 1VBD2 3BJAA 1R36A 2K9ZA 4CCNA 2ZXQA 4L5EA 2OCCH 2VJ5A 4S2HA 1QJU1 5C3OA 3A2KA 3TN92 2C9AA 1FLIA 2R5YB 5D4RA 1UXZA 4S05A 2XVCA 3DEUA 3GM8A 4AVCA 2E9QA 2BOJA 5IYYA 1ODDA 1JU4A 4JVAA 3G6JB 3K4DA 4Q8LA 2EZIA 2X1CA 3QU6A 2CQNA 2A5WA 2BJSA 1C1FA 1YJWI 1FBSA 3B73A 3CP8A 3CUQC 4YVWC 1CIYA 1RUC3 3J7NA 5HCHA 3JAMZ 3EQLF 3M70A 2HWC3 5ERLA 1IGOA 2WQ4A 5AFBA 2BERA 1WJCA 4EEFG 4XF1A 1SFKA 3RSJA 3HSRA 4A3XA 2DTZA 3F8MA 2W08A 3CF6E 2FDFA 4QXBA 1LHVA 1LJ7A 4CTEA 3ILNA 4ZZ5A 1W9WA 2L9LA 1XNCA 3RZDJ 3CIHA 2PLV2 2ZFUA 2Y69H 3OY9A 1VBB3 1ULGA 2CWMA 2GQQA 5LBCA 3TAYA 3IDAA 1BM9A 5A70A 4XF3A 3F6VA 2J42A 5C9AA 3K77A 1A8MA 5CG9A 4AF9A 3RJ2X 4FPLA 5JOZA 4ESFA 1WGPA 2IAIA 3TO9A 1O59A 5DG2A 2ZBJA 2JKXA 1DQ6A 3M2MA 3V65A 3FHAA 3PIJA 1DIWA 5CFCC 1V9U2 3NV4A 3IP4B 3UV9A 4XMIA 3VKMA 2DI3A 1B72B 1MS5A 1SCSA 4NHXA 3VDBA 4HRIA 1WCSA 5L3BA 5B1BH 2A6VA 5FRAA 2NYYA 3QU3A 1CPMA 3O1SA 5DAVA 5IFTA 3BALA 3NAPC 1AYM3 3MF9A 5FPLA 5L7OB 3CJTB 2GMMA 4K9SA 2EBIA 1O57A 1HRI1 4BJ6C 3BOQA 4A3MJ 2FEZA 1TZLA 4HKWA 5FZOB 3M3OA 3AZZA 4EM2A 5FKOA 1R082 4LKEA 3W9AA 3NL1A 2XBO3 2VPLA 4BQ2A 3BTIA 5EPAA 2MGQA 1WJBA 2NVTJ 3L2WA 3GBWA 2VBBA 3ENRA 3R4SA 2V4JC 2JWTA 5F1RA 2DODA 5J1RA 1UZVA 1SANA 5DM6F 4NQWA 2ZMKA 1D8KA 4XRSA 2JA2A 1W06A 1FP1D 1QJEA 4OI0A 3CLOA 3S5AA 4SBVA 3UT0A 2VUCA 4ES9A 3CESA 2VTXA 5L9BA 3FF5A 4AHWA 2DDBA 4ESBA 3M3YJ 4RGXA 4P1WA 5GALA 5FP8A 3SEEA 1MZ5A 3J7AO 2ZX0A 4AQ6A 1JKOC 2VB6A 3FBMA 2CMPA 1LOAA 4YM3A 1OF3A 3KZIC 4CDXB 2ADUA 1J7KA 2V5DA 1I50J 4RM2A 2E26A 4FAHA 1W8NA 2FA5A 1R22A 4GKYA