3DV8A

Crystal structure of a putative transcriptional regulator of the crp/fnr family (eubrec_1222) from eubacterium rectale atcc 33656 at 2.55 a resolution
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
216
structure length
216
Chain Sequence
b'ENYFPLWNDLNTAQKKLISDNLITQHVKKGTIIHNGNMDCTGLLLVKSGQLRTYILSDEGREITLYRLFDMDMCLLSASCIMRSIQFEVTIEAEKDTDLWIIPAEIYKGIMKDSAPVANYTNELMATRFSDVMWLIEQIMWKSLDKRVASFLLEETSIEGTNELKITHETIANHLGSHREVITRMLRYFQVEGLVKLSRGKITILDSKRLETLQRS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords transcriptional regulator, Crp/Fnr family
publication title Crystal structure of transcriptional regulator, Crp/Fnr family (RER070207001219) from Eubacterium rectale at 2.55 A resolution
rcsb
source organism Eubacterium rectale atcc 33656
molecule tags Transcription
total genus 63
structure length 216
sequence length 216
ec nomenclature
pdb deposition date 2008-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3dv8A02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3dv8A01
2A6EF 2HZTA 3GUDA 4XFHA 4KNYA 1BJAA 4RGUA 1EH8A 4EGZA 2G7UA 1XRUA 2UWMA 2EA4A 3GZ5A 3HSFA 3TKYA 1IN5A 4M9XA 1ZZ9A 4XETA 4IEOA 1IUYA 5K5OA 3HYIA 1BC8C 5JAXA 2OPKA 5I0RA 3T8TA 2ZKZA 3IKTA 2KKOA 1KGSA 1SD6A 4XF0A 1ON1A 4O9EA 4IEVA 1CAWB 3EDPA 2ZCWA 5E16A 2K9ZA 4HOBA 3IWZA 1EH7A 3ZMDA 1XMAA 2FXAA 2VPVA 2P6TA 3JZVA 4EM0B 2HTJA 4HN1A 2HGCA 4U0YA 1EY2A 1USTA 3WW3A 4UVAA 4H0EA 1V3FA 4OMYA 4K2EA 1I1SA 4G7HF 3PQKA 4M6XA 1IN7A 1YWKA 3WODF 2MPFA 1O3RA 4RGSA 5AIQA 3JSOA 2DBBA 3NKTA 4HV6A 1YFXA 3E6CC 3REOA 3HQXA 4KWKA 2FNAA 3FHZA 2VE8A 2BNOA 3GYDA 2V1DA 3USSA 1Z6RA 3HT2A 1SFNA 3O14A 3PVBB 3KP3A 2PFBA 3OV8A 1ZZ6A 5T3NA 1R1VA 1TW3A 3I53A 1FWZA 5JHUA 2UXXA 2IXJA 3KP5A 2VECA 2ESNA 2H27A 4L0ZB 3I58A 4DNCA 3GO5A 2HQNA 4QGLA 1YYVA 2DI3A 4WCGA 1VJ2A 3GBFA 3BJAA 4RAZA 4GULA 1NXMA 1QXRA 4CZZA 4ETSA 4I02A 3IRRA 4J1XA 5KK1A 1JGSA 4KDPA 3ZMTA 2EV5A 3O6BB 1YFHA 1BI1A 2W57A 5TRDA 4MZUA 2P5KA 1BC7C 4HVQA 3B02A 2PAMA 2CFXA 4RAYA 5DV5A 1JE8A 1NZCA 3WTZA 1KQ9A 3RKYA 1JHFA 3IRQA 4CGZA 2K0GA 4P9UA 4ENJA 3BU7A 2OZJA 5CLSA 2BV6A 3OF1A 2O3FA 1FYKA 2VC1A 4L9NA 3ZDSA 1FBQA 4MQ9F 4HLTA 1FNNA 3F23A 2VOOA 5A2QK 5DUKA 3MAJA 5D5VB 2XKPA 2A07F 1WLTA 1O3SA 2GA2A 3NJZA 3SZPA 1CAWA 3HSEA 2GWRA 3I59B 2BEOA 1WA4A 4EWDA 2M1BA 3HRTA 3WTYC 1Y3TA 1CF7B 5DDGA 3WTWC 2O1QA 4JQFA 1KYZA 5JFRA 5BPIA 2UZKA 4AXOA 3U2RA 3R61A 1I27A 1UCRA 1FT9A 2EWNA 2IW5A 3ABUA 1O5UA 2PAKA 3TO9A 3SCFA 5JI6A 2XV4S 4XRFA 1GQGA 3RI4A 3V4GA 3JSPA 1YFUA 1VR3A 1YQAA 4LFUA 4MGRA 3BWGA 1ZNPA 3CUQB 4LJZF 3EUHA 2BE5F 3TNQA 5I8TA 2EV6A 1CAVB 2NNNA 2XVCA 4IERA 3MEXA 3BROA 3F8BA 4DINB 2G7HA 1O3TA 3JW4A 1RUNA 3M3IA 4RS8A 2LDUA 3HTUA 1BIAA 2HS5A 5D6FA 3H3ZA 3F72A 3AAFA 3NVCA 1P6RA 2QQ9A 3E97A 3MWMA 4LUKA 1XGNA 3GYHX 2PG4A 3V7CA 1I6XA 1J1LA 1QWRA 2B8MA 2VN2A 2W85A 1J3RA 2ETHA 1STZA 2V1UA 4IHTA 4B09A 3MQ0A 2J5PA 4HLYA 1YUDA 4TLFA 5J7MA 5H6RA 5EEGA 3SQNA 2ATFA 2OZ6A 2KXLA 1TQPA 3K1MA 3P9CA 1G3YA 3R60A 2QCSB 4ZYDA 1YG2A 5CYVA 4D7SA 4YARA 5KHJA 1BI0A 2BYVE 3PFIA 4ZH4F 4NHJA 3J81K 2B0LA 1OFNA 2DPUA 1FY7A 3W6JB 4U0WA 1B9NA 2V9VA 3MZHA 3HHHA 2YR2A 4U88A 4A0XA 3I59A 4FX0A 2GC1A 1LJ9A 2FBKA 1P4WA 1CF7A 4I01A 3KSCA 2YPRA 3DFGA 2Q8KA 4ZYHA 2A6HF 2P17A 3WGIA 3P9IA 2CSOA 3K1PA 3FE5A 4O3MA 5I91A 1VTNC 1SMTA 4EWEA 1RIOH 5CVRA 1FP1D 4IETA 4OIPF 4IRHA 4G7OF 1GVJA 2ZNYA 3DN7A 4EJUA 4UV8A 1UPIA 3CDHA 4Z07A 3QPHA 2O8QA 3CUQA 1MGTA 4KWJA 1XGMA 1CAVA 5HLHA 2P4WA 4EROA 4N9HA 1KU2A 2Q0OA 4KN7X 4ZU5A 1LDDA 5D6EA 1SQ4A 2IA1A 1KYWA 2DTRA 4XF4A 2QNKA 3ZMVA 3J80K 1FP2A 2Z3YA 3RKWA 5ERIA 4L9VA 2LSOA 2IJLA 3TQNA 5CVJA 2FMYA 4AD9A 3QP6A 5EZWA 1FYMA 1YFYA 3OTFA 2E1NA 2QJVA 3WE3A 2M8EA 3E3VA 2IC1A 2L01A 3E5QA 2OBPA 4JBAA 1FYLA 4ON0A 2OA2A 4IRGA 1ZG5A 3P9KA 1UIJA 3Q5FA 2VONA 1YW7A 1FPQA 2C6YA 2DLLA 2DCTA 4IEQA 2IT0A 3GFMA 3F8FA 5BY5A 4MGZE 3JAMK 4D7TA 2DK5A 2HTSA 2L4MA 2X4HA 5F64A 2QQAA 4ZU4A 1GHCA 1IN4A 1SFUA 3HSRA 3GVAA 4A0YA 1G3TA 2CQKA 4QM9A 2RNJA 2A61A 3J80Z 3I4PA 1X3UA 2JRTA 1PP8F 2F2EA 4JVAA 1CAXB 3LAJA 1ZHFA 4O5VA 2Z33A 3GEZA 4PGHA 4FHTA 1YIOA 4EQQA 2Z2SB 1WKMA 1O5LA 5ICCA 1LNWA 4CO8A 1S6LA 3FHIB 3LOIA 5I0TA 4Q4ZF 3GZ6A 5FCCA 4HAMA 5K8SA 4R79A 1O57A 5HDNA 2D1VA 3ACLA 3LQRA 1DGRA 5CJ9A 2CAVA 2M30A 4Q48A 1O3QA 3KEOA 5FB2A 3FXRA 1QQIA 1RL3A 4NQWA 1K79A 1HW1A 3ETQA 2D40A 2HDCA 4IEZA 3FXQA 1O4TA 2EVXA 2KIMA 3L00A 3G3ZA 3V8KA 1YLFA 3TDUC 2STWA 3CUOA 4FT8A 4E70A 5BQTA 2DFIA 2FQPA 3F6OA 4R8HA 3N97A 3GX4X 2DK8A 2P7VB 2ZNZA 3SXWA 2GZWA 3I5UA 3BP8A 2E1CA 4XF1A 5HS8A 2Z99A 3ISPA 2K7LA 4YRDA 5I8YA 3KP7A 3MZYA 3H50A 4HVRA 5J6XA 3WTTC 3ECHA 3KZZA 4U7DA 4XLNF 1RGSA 2XAFA 1HBXG 1CX4A 3R4KA 3EBRA 1MZBA 4GO1A 3IDBB 1OPCA 2IPQX 2TDXA 2HJIA 3CJNA 3FM3A 4NB5A 2PYTA 2EFOA 2ZFWA 3ZMZA 3LAPA 1ZYRF 1TNSA 4XFCA 1H9GA 3ELKA 3H8UA 2ET7A 5IT3A 4N9IA 4XFFA 3KETA 5JSPA 3T8RA 1XE8A 5ILVA 3I64A 2NNYA 1XSVA 5CVIA 3VODA 3BZ6A 1CAXA 1UD1A 4KL1A 1U2WA 1HKSA 2FF4A 2O0YA 2VQAA 2IXHA 2N7GA 2K02A 4P55A 2XRNA 3CTAA 2PN6A 3FX3A 1T0FA 3IHUA 2MLKA 2FOKA 3OD0A 3M8FA 3QU3A 1R7JA 1R5HA 3ZPLA 1YW8A 2HFHA 1TBXA 5DD8A 4EJVA 3H7YA 2JTVA 2GIVA 2OA4A 5FO5A 3BB6A 5IT9K 3CJXA 2M5WA 5L3CA 5J8CA 2O6GE 2H6BA 4N0BA 1ZN2A 4YG2F 4ZYGA 2RN7A 2YX7A 1XSXA 2EK5A 2DO7A 2Q4SA 1TTYA 1YW9A 1ZZBA 2JPBA 3T0YA 1Q3EA 3HT1A 4LTAA 1ZG1A 1WQ2A 5CU1A 5D4SA 1H0MA 5LBQA 2P5LC 1ZX5A 2AS5F 4HZFA 3KE2A 1XGSA 2EFWA 4Q0SA 4E2QA 5KHIA 3FZVA 5E1WA 2FU4A 4ZYEA 3KZYA 4LULA 2OQRA 5L3GA 3N4MA 4WXCA 3VEPA 2D93A 1NYWA 1R00A 3WGHA 1O7LA 4S05A 3HRUA 4I98B 5IT9Z 3FMQA 3H1YA 4QGNA 4M9SA 5J8FA 3GFLA 2XLGA 1B9MA 2L3DA 1U8RA 3U1DA 4ESJA 4IVNA 3KCCA 1Q1HA 1LDKB 3K69A 1ZLJA 2JZYA 5FFZA 4X6QB 2XL9A 2FEZA 4QX5A 4YFNF 1MD0A 3WTSC 4BHBA 2FE3A 4HF0A 1T39A 3Q9SA 4XF9A 2DQLA 4I7HA 2A68F 2QQBA 1TLHB 2PMHA 2HQRA 3TGNA 2FNPA 1F5TA 4L2NA 3UKTA 2RC4A 4HX4A 4M71A 4G6DA 2V79A 4LMYA 5LEJA 4KWLA 2KJCA 2W84A 1HW2A 1FOKA 5J48A 1FC3A 1Z7UA 3DF8A 2STTA 1IW7F 3EHKA 1DUXC 4IHSA 1QBJA 2ZO4A 2GU9A 4Z82A 4YSFA 1B1BA 4G6QA 4XBFA 4MGYE 2ZMEB 4I2OA 3MDPA 4DQ2A 1USSA 1IPKA 5E17F 3ES1A 5KHKA 3D0SA 1IAWA 1O7FA 2BGCA 4KIBA 5ICFA 3NSTA 1ON2A 2MHFA 3V7SA 1SAXA 3H1WA 1IZ1A 2GXGA 1FBUA 1XCBA 5L3DA 3VB2A 1ZZ8A 1S8NA 3J7AO 1FSHA 4Z2YA 4GGGA 1J3QA 1IRFA 1YO5C 3D5LA 1LVAA 2OU2A 3VFZA 1ZH5A 5BOXA 3F3XA 2IA0A 1PMIA 4LGWA 3E6MA 3T5XA 4BQAA 3I71A 2IXCA 1P92A 3W6KB 3RTRA 5ILSA 1LR5A 1V4RA 4MNUA 3CL1A 5I93A 2Y0OA 4A0ZA 2CYYA 1H1MA 2F5FA 4A5MA 4M9ZA 4L5JA 5JVTA 3FWEA 2QZ8A 3IBMA 2QBYB 3FMRA 4IEXA 3BOQA 5L3EA 4EV0A 4Q0QA 3LA2A 4I0AA 3LSTA 2Y48A 4YYOA 4HBNA 1SMYF 4G94A 3K0LA 3RKXA 3L09A 2W24A 3L2HA 4LLGF 2RKHA 4KIGA 4P96A 1X8EA 2PLYA 1J3PA 4ESBA 2M87A 2O61A 1PP7U 2HEOA 1TW2A 1YFWA 5LRSA 2EFQA 2LNBA 2PEXA 3GF2A 4HX7A 3TO6A 2MH2A 4A12A 5EFUA 1T6SA 3GLXA 3S2WA 2IXIA 3QAHA 3DXJF 2F4PA 2QLZA 1FI2A 1J2XA 3QPTA 1TQMA 3FMSA 2G9WA 2K4JA 1LRHA 4ZZLA 1ZRFA 1U5TB 2ZMEA 4RB3C 1FBSA 5D1IA 3O2PE 3QU6A 3DV8A 4WBBA 5KHGA 4E2GA 2I45A 2UY9A 5KHHA 4MEXF 5F1RA 1J9IA 1GQHA 2QWWA 2D5FA 1K6OA 5CADA 1ONVA 2VBYA 1PM7A 3QOPA 2OAZA 5K1YA 1SD7A 2NRAC 1QGPA 5FD6A 1DZTA 2R3SA 4R52A 3WTUC 5HOOA 1GXPA 1Z6TA 5FDBA 1IXRC 1V70A 2NYXA 2EB7A 3CLOA 3JTHA 4QLCU 4YNIA 3C3VA 1XSDA 3LWCA 3HUGA 4GYGA 4B29A 3M8EA 3SHRA 2K27A 4FX4A 2RGVA 4BIFA 1MJ9A 2HKXA 5JCTA 3O3KA 5FPXA 1E17A 1REPC 3QP5A 1FXZA 2QBYA 2DQRA 4L5IA 2V09A 4G7ZF 3F22A 3DEUA 1T38A 4AVAA 3FFQA 2ACJA 1YS7A 1TQ5A 2M45A 2X0LA 3HRMA 5BV6A 3ZN1A 1QZYA 2CGPA 2PAEA 2JT1A 1Q5OA 3IWFA 5E1XA 2Z5UA 3KMHA 5KVRA 4BYYA 1BM9A 4Q0UA 1R58A 4JV4A 3PNAA 2UXNA 1KQ0A 3S7IA 4PIXA 1T98A 2A69F 1LEAA 2B5HA 4KT5C 2PFWA 4J1WA 1IXCA 5HVQC 5HS7A 4A6DA 4MX3A 4ESFA 3C1DA 5HS9A 2Y0MA 1U5TA 4IRIA 5FLJA 4HA8A 4P9GA 5FLIA 3H3UA 4D0PA 4KMUX 1L3JA 4PIZA 3LFKA 1JXSA 3BCWA 3HRSA 5E20A 2HYFA 2CWEA 1FZPB 4LA2A 2FA5A 5FFXA 4MGIE 3NRVA 2XAHA 1F4KA 1XDUA 2V6CA 3DPTA 2OZUA 2F5CA 3M7GA 4UNOA 4Q0VA 4HBLA 2UYBA 5HLGA 3P7NA 3ELNA 1UW8A 4LD5A 4LEJA 1ZARA 2WV0A 4RD7A 1BI2A 2RV8A 1Y0UA 3EQEA 2XUBA 2ISZA 1X8MA 2WC2A 3KGZA 3ABTA 4IEUA 2E7XA 2PHDA 3EETA 3EYYA 1WRJA 3MYXA 5JR3A 3MFKA 2EJRA 2IA2A 4IESA 2MA3A 4HX8A 4MQVA 4UVCA 3VOEA 1ZZCA 2PA7A 3RYKA 4E2SA 4EWAA 1BIBA 1LDJA 1MJAA 3UKVA 3VHRA 3SZTA 1U78A 1AWCA 5HDGA 3H7JA 2B9UA 2BNMA 3ZN0A 2PBIA 2YSRA 2MH9A 1ZG3A 1BN5A 2EA7A 2P6SA 4L9TA 4MHGA 4X6RB 3U0ZA 2KRFA 2QUFA 1OD5A 2MNGA 1ZRCA 1UHMA 2XHKA 3SCHA 1W7PA 4LUMA 2PTMA 3C3WA 4HMZA 3BJ6A 1QZZA 1G3SA 3WU1B 4U0VA 1RZ4A 4XF3A 3WG9A 1HXDA 3G7DA 3C18A 1J59A 1NE4A 4YIFA 5ED4A 4XEZA 3M70A 3CO6C 1LKNA 3F8NA 1ZRRA 2ZBKA 4UBHA 5BXXA 4OOIA 1B4AA 1F9NA 3SCGA 1FX7A 1W5TA 2OQGA 5D5UB 3F6VA 4GYIA 3ROUA 2GQQA 2OYZA 2VE9A 3BPZA 2EFNA 1QY4A 2YU3A 5E18F 4JTOA 4WK8F 1BBYA 5DCMB 4XLPF 1YTYA 1EV7A 5J3UA 1J0RA 4MTDA 3WU0A 5E1RA 4IF4A 3RPUA 3G73A 3V8LA 2CW0F 4WXDA 4HF2A 3C7JA 4YFKF 4HSJA 1LB2A 5ICEA 4AVCA 1EH6A 4PGGA 4BNCA 2IRFG 4FAHA 1KQ8A 3WW1A 1P2FA 3MCZA 3TDZC 2IXKA 1J58A 4M6YA 2PHLA 1YLLA 2E9QA 1SEFA 4KA4A 1S7AA 2K86A 2QYOA 4LA3A 1HQCA 2IVMA 3ERED 3EYIA 5BPDA 2XL7A 2O03A 4OIOF 1SD4A 1Z91A 4XSZF 3E5XA 4CXFA 1YS6A 1UHWA 3S7EA 4UVBA 4MTEA 1G3WA 3RIRA 4L11A 1I5ZA 5LHHA 2Q30A 2EFPA 2XAJA 3EQLF 1OR7A 3I0TA 2JSCA 2Q0AA 4PJYA 5K5RA 1U12A 1SFXA 3LZZA 4A2UA 1EPZA 2RDPA 3LQQA 1B6AA 1KU9A 3KP4A 3RYRA 3H9AA 3T1BA 1R36A 4BHPA 1XDSA 1Z9CA 4FAGA 2J5OA 3E5UA 5AONA 1D5VA 2QDRA 3RNSA 4MH0E 3E6BA 4NVPA 3DP7A 3DKWA 4OU0A 1Y9QA 5ILUA 4AIKA 4HSLA 2D2WA 1XB4A 4CHUA 2HR3A 3K2ZA 2FSWA 1RI7A 2HWVA 1XN7A 3ZMSA 4A6EA 1IPJA 2FRHA 2L02A 4HQMA 4XFGA 4IEWA 5JR7B 1S29A 4OLLA 4QMAA 2UY8A 2GA1A 4Y15A 3NQOA 5FGMA 5DCMA 5FQ0B 2P5VA 2V1XA 1CGPA 3KP6A 1EP0A 2D45A 3TOAA 2ETEA 4MEYF 3DPLC 1JUHA 1QNTA 4RGRA 4HV5A 4JK1X 4LLOA 5KBFA 3H1MA 4IEYA 5I0SA 4Q5SF 1P4AA 2QVSB 3ES4A 4HN0A 1I1GA 4OMZA 2NAZA 1R23A 3SMHA 2Q1ZB 1Z05A 2DT5A 3R0JA 4YFXF 2P8TA 1MKMA 1NHAA 1KU7A 3FM5A 5FLHA 4LB6B 3CUQC 1DZRA 1U3EM 3R6SA 4A5NA 2VXZA 3DQVC 3IC7A 4F8AA 1FLIA 4Y17A 2PJPA 5D5WB 4XFBA 3CO2A 2HOEA 1UFMA 3OGJA 4IXAA 2F5DA 1QXJA 1R1UA 3BJOA 4EGYA 1S7OA 4H7LA 1LEBA 3WTVC 5CVVA 3S0MA 3GXOA 2XKOA 2CO5A 4Q29A 4Q47A 3BPXA 4O9GA 2C0ZA 1XGOA 2XLFA 4RB2C 3E6DA 4PZJA 2QENA 4KN4X 1OMIA 3BY6A 5LGUA 5BUVA 1L3LA 1XD7A 1Z1DA 2R7DA 4F7ZA 1BI3A 2MLGA 3K1NA 1RTVA 1XMKA 3I54A 2WWYA 2EV0A 1G4DA 4G9YA 1P4XA 5LHIA 3KGLA 5JSRA 3V7RA 1IN6A 1MJBA 4S04A 3WE2A 2ISYA 2UYAA 1U5TC 1XCVA 3GFIA 4KU7A 5C8WA 5LLQA 5DCFA 3RJPA 2KIFA 3HOTA 1H9TA 4WX9A 1R22A 5BS6A 4EVIA 3L9FA 1SFEA 2D1HA 5FQ0A 5HI0A 5H20A 2FMLA 2DAOA 2AXLA 5LHGA 1AOYA 5F6FA 4M74A 3U10A 4QM8A 5H6QA 2QM3A 3CO7C 2XLAA 2KIUA 2CAUA 4ZU7A 2PQ8A 1A04A 2PI0A 4PIYA 2Z69A 1OI6A 4CYDA 3NEUA 1KU3A 4OIQF 4M72A 5AVPA 2GH2A 3IDCB 4GXOA 5I8SA 2GC3A 1Q43A 1RUOA 1BOAA 2LF7A 4P5OA 1L0OC 4LK0F 1QPMA 2ZXJA 5A2QZ 2DU9A 1MDMB 3SXYA 1GXQA 2VT3A 1X7NA 3WTXC 1PUEE 3M1EA 2ADUA 1DDNA 1K78B 4ONUA 1C0WA 5JSOA 5LGNA 1ZZ7A 3ST7A 4CICA 1UCXA 1TNTA 4MGKE 3FF5A 2VODA 1X82A 3CEWA 3LA3A 4PCQA 3HTSB 3M9AA 3RDIA 1HSTA 4MV2A 2XGXA 4KICA 1WGPA 2E7WA 2K4BA 3ULQB 3NL1A 3V8JA 4RB1A 1ZREA 4BXUA 3PQJA 2H6CA 2P7CB 1VP6A 2VBXA 2LF8A 2A5YB 4PDKA 2PMUA 1ODDA 4ORFA 4AWXB 2W25A 4ASNA 2R7FA 2Y75A 5TJJA 2VOPA 4OFGA 3ZP5A 2KJBA 2RQPA 2XASA 4YIIA 4UXAA 4LG0B 4IEPA 4EM1A 4UV9A 4AVPA 2RVCA 4QXKA 2DW4A 5D5XB 4HW0A 4G8XA 1HSJA 4OIRF 1RC6A 1OYYA 2HYGD 3HOSA 5DYMA 5DD4A 3OCPA 1D8KA 3FJSA 1ZAOA 1B59A 4EMSA 1QO0D 3IKVA 4HDUA 4U7BA 4UUVA 3BALA 1RNLA 2H09A 3GWZA 4AQ6A 4WXHA 3KP2A 1HKQA 1U6GA 1G6NA 1H1IA 2DPDA 4ZZDA 1OYWA 2ESHA 1UIKA 5AIPA 2O8XA 1J7KA 1HKTA 4ENMA 1IN8A 3F8MA 1W7PB 4RB0A 3J81Z 3U11A 5C6CA 4O6JA 1OKRA 4KUMA 4LLLA 4BHCA 1WWXA 3Q9VA 5I0UA 3KLOA 2COMA 1DGWA 1W5SA 2D5HA 1MDMA 1WI9A 3R0AA 5EEHA 4LB5A 5K5QA 4UXNA 3KEQA 1E2XA 4EJOA 1DPUA 5LEKA 4AVBA 4QWQA 3EO6A 5D4RA 1K78A 3RZZA 2GAUA 2EAAA 3L2CA 2HKOA 3U9GA 2Q2EA 3GW2A 3IIAA 4B8XA 1NE6A 2VBZA 3LAGA 3LWFA 2EA2A 4R1HA 2GXBA 1CAUB 4IJAA 4QGMA 2VBWA 2IP2A 2VC0A 3QRFF 4XFIA 3LA7A 3OOPA 3KFWX 3WW4A 1T2KA 1ZVFA 4ENNA 1ZGJA 4M73A 2H94A 4WWCA 5HDKA 3KLNA 4LLNA 1OYIA 5D8LB 2MC3A 1SD5A 4HVOA 3PLQA 4HQEA 1PDNC 1FSEA 1EYBA 5E8GA 5D8KB 3NW4A 4L9JA 2GC2A 3ZQ7A 6PAXA 4UHTA 2QVOA 3QACA 1ZLKA 2MBFA 1ZGAA 4LG0A 2JPCA 2IXLA 5ICGA 4RGXA 4WF2A 3HHGA 3WW2A 2FQ3A 2GC0A 4WVZA 2CG4A 4ENKA 2WTEA 3ML6A 4WZCA 3WGGA 4L0YB 3TOBA 4I09A 1WSUA 4XFAA 3D82A 1LQ1A 2ET1A 3JAMZ 3CLPA 4Q0PA 2L4AA 1JHHA 3I7DA 1IRGA 4P9FA 2CV6A 2BBYA 1DP7P 4HLXA 1D3YA 2A3SA 3RYPA 1R5GA 5DUIA 1J75A 4KIFA 3DL3A 4HDVA 1YHFA 3F8CA 4Y13A 4AIJA 4IPAA 5FLXK 5LRRA 4TV7A 1R1TA 4AIHA 2XIGA 4KU8A 1W4MA 1K7AA 4HF1A 2YX4A 4LK1F 2MD5A 2Z9OA 3B73A 4AQ2A 2FBIA 4KFCA 1DPRA 3MPBA 5E8IA 5CVUA 1CAUA 3BPVA 3COAC 1S3JA 5L3FA 3TNPB 4L18B 3ECOA 1UB9A 3FZ3A 4OINF 2ELHA 2F5EA 3HIFA 3TO7A 5FD5A 1ZRDA 4JTNA 4BAYA 4GCVA 3GFJA 4META 3EJKA 5L3BA 2BNNA 1W7PD 4I0BA 2XAGA 1IF1A 3IL2A 5BPXA 4XSXF 1IXSB 4CDGA 3JTGA 3K9TA 5BMZA 4UBGA 5LGTA 5FLXZ 3D0JA 1D8JA 4HYEA 2XROA 2VT2A 2OD5A 3F21A 5FPZA 2XAQA 4KYWA 4EM2A 2LKPA 2ZJ2A 3FXUA 4I3PA 3UKNA 2NS0A 4EJTA 5E1ZB 3RPQA 3ZMUA 4EJWA 1ULYA 4FBFA 3L7WA 3SFZA 2L54A 4BH9A 2PQQA 3BDDA 4K8FA 1KA8A 3H92A 3SHFA 1HW5A 2WFPA 2ZKLA 4KMFA 1TQIA 4MUVA 2H0VA 2FBHA 1J5YA 5HLIA 5DEQA 1F1ZA 3CF6E 1XE7A
chains in the Genus database with same CATH superfamily
2CWMA 2J1TA 1EF4A 4AFDA 4KNYA 3JRGA 3RJRA 4F55A 1BMV2 2OS2A 4JYKA 2I10A 1MVEA 1OBNA 1ZZ9A 1PO23 1OLMA 3VBUC 2Y30A 3WUDA 5CBLA 1IUYA 4BA6A 4XQ4A 3Q0VA 5JAXA 5FAXA 5A3TA 2QQMA 2ZKZA 2Y69H 4JKKA 4LKSA 1B72B 3U4XA 2ES3A 2ZCWA 1GICA 1EH7A 2VPVA 2HTJA 4UVAA 4H0EA 1XXNA 3FLRA 1E3OC 4N7IA 3O1MA 3PNYA 1I1SA 1WMDA 4G7HF 4M6XA 2BVVA 3OOUA 4JGZA 4YZ2A 3WODF 4XM3A 2D6OX 5AIQA 1U5ZA 3ABLH 2ZGSA 5FIXA 2DBBA 4HV6A 2EILH 5DM6F 1KQRA 4AFBA 3E6CC 3REOA 2FNAA 3FHZA 1UYZA 4A44A 2FDJA 2RJLA 3OUJA 2NPIA 2YYOA 2ELKA 3KHBA 1DGLA 1ERDA 2RJKA 4HPKA 2RVAA 1SFNA 5FTTC 4E4HA 3OR1C 3O14A 4JHTA 5C3SA 2GLOA 5T3NA 4CCNA 4ASMB 4RS5A 5TSWA 2UXXA 2HLEA 2VECA 2ESNA 4RAGA 2L9SA 2CUZA 4L0ZB 4QGLA 3THPA 2OCCH 3KQRA 4M6VA 2BDRA 1GVDA 1S72I 4YG3A 4RHV2 1QXRA 4NIAA 3WNMA 4GJYA 1J83A 4C2MJ 1X33A 3IDAA 4OZOA 2DMQA 4KGGA 2R5ZB 2W57A 4QPIA 5TRDA 4MZUA 2P5KA 1BC7C 3KZIC 4IO9F 4ES9A 2PAMA 3RJ2X 5JZGB 5C3EJ 2ZOEB 5GLZA 1H2MA 3WTZA 1BLZA 1JHFA 4CGZA 2YY1A 2BOJA 1TNRA 2VQTA 4FQZA 2VC1A 4L9NA 4AGGA 1JYXA 1FBQA 1BEV3 2R7EB 1Q8SA 1S0EA 2BHZA 1MMNA 4JCKA 2A07F 1O3SA 2GA2A 4NRQA 3NJZA 2LD5A 3I59B 3OY8A 4XHXA 5CKQA 2O1QA 3O1RA 2W08A 1SPPB 1KYZA 3TW7A 5JFRA 1IJWC 5LA0A 2DOAA 4UFKA 5BPIA 1E5RA 4DXSA 4AXOA 3U2RA 3R61A 3LSJA 2O9LA 3D1NI 2XBO2 2PAKA 1FOYA 3TO9A 3SCFA 1QQP1 3LGRA 1IG7A 4XN0A 1LNSA 1CIYA 1YFUA 2JDUA 4LFUA 4MGRA 4E9KA 1ZNPA 3NNLA 4PQQA 4DOZA 3CUQB 4LJZF 4CPBD 2VC9A 5I8TA 5IYCJ 4Y22B 4NIDA 2VMFA 1RB8G 3BR3A 2DCYA 4CE8A 4B3NA 2HXIA 3IIIA 3T2QA 2G7HA 4KNCA 1RJ8A 2LDUA 3ZYIB 5F3IA 1T2XA 1BW5A 3K4LA 4Y1ZA 2WB1N 4COUA 5FOJB 2YGMA 1P6RA 2QQ9A 3E97A 4XDQA 3ZX7A 3V7CA 1OQEA 5K0UC 2B8MA 2W85A 2ETHA 1STZA 2VQCA 1N78A 4IHTA 4ZKTB 4HNUA 1HA8A 3MQ0A 3TN92 2J5PA 1YUDA 2PHTA 5FZBA 4AI2A 2JWTA 5EEGA 4XLHA 3SQNA 3RI9A 3ACIA 5FZ0A 4IV1C 1TQPA 4MYEA 1G3YA 3ACFA 3CNAA 3OWTA 2EIKH 2OV7A 4ZH4F 4I6ZA 3VL8A 4JX5A 3OEBA 1GKBA 5A3OA 3W6JB 1NXD1 3MLLA 1YCIA 3NV4A 4Q4X1 2V9VA 4LK7A 3MZHA 1HIXA 4U88A 1MACA 2XF7A 2R7SA 2GC1A 5F5QA 4CDXA 1BMV1 4P5HA 1CF7A 1LVKA 3T2OA 3BQZA 2YPRA 3GTGJ 2CJJA 2A6HF 1NK2P 3P9IA 3L1PA 3Q3SA 2OKXA 3OYEA 3FE5A 3POSA 4GMP1 5I91A 2FX0A 2FDHA 3OYAA 1UU4A 5CVRA 5G04L 1FP1D 2ZABA 2YMZA 3DN7A 4EJUA 2CQ7A 2LRDA 4UV8A 3ILNA 1UPIA 2VGDA 2ZGRA 1N1VA 2XQRA 2CTVA 4M00A 5B1AH 4PBOA 4FSJA 3H9GA 4IUGA 2NS8A 5AVAA 1TC3C 5D6EA 4AFCA 2QQUA 5JXHA 1T8IA 2B7EA 2HYXA 2CV0A 2E26A 4AAXA 2QNKA 3HGYA 2Y60A 5LA1A 4L9VA 2JDZA 2ELJA 4MO7A 1UMQA 2IJLA 5JVGF 5JIAA 2VY0A 5IHRA 4ZZ5A 2OQ6A 3QP6A 5EZWA 4Y26A 3WE3A 1JUIA 1NCRA 4OHXA 5A7WA 3GCMA 1DF0A 1AYN2 2AZ5A 2QQIA 1IG3A 2QQ8A 5EYRA 5FYHA 2OJED 1YW7A 3D5SC 2ERFA 2W9XA 4IEQA 2JKXA 4P9JA 3F8FA 1BVVA 1R1A2 3GZUC 1H8VA 3LF7A 5IYBJ 2HVRA 4CP0A 2L4MA 1OXCA 2FD5A 3AL0B 5KHDA 2QQAA 1Z21A 4RHV1 1UPSA 2X1EA 3HSRA 1QF3A 4LBOA 4BE3A 1MQTB 2EINH 3B01A 2QKMB 4M4PA 1RUF2 4LHKA 2R043 3ZR8X 3I4PA 4UI9L 3AYEA 1X3UA 3CF5F 4JVAA 3ZMNA 1CAXB 3LAJA 3GEZA 2VMDA 2XHNA 2WV1A 3D8CA 3L2WA 1YIOA 2CUFA 1RUJ3 4CCKA 2R1DA 2Z2SB 2LLKA 1WKMA 5ICCA 5JOXA 5I0TA 2VZPA 4BQ5A 3GZ6A 3H5RA 4DRRA 3CZUA 5AC92 3RQ0A 4FXKB 1X1CA 5FLVA 3MIFA 3J7ZI 3AYDA 1QNWA 1QQIA 4OULA 2L2OA 4LBMA 2XBO1 2HBTA 3AK0A 4UUSB 2R92J 2EVXA 3L00A 3GBWA 3PUFA 1YLFA 2STWA 2OXBA 1W2NA 3FLTA 4AFAA 3UGFA 1PZ9A 2FQPA 4R8HA 3N97A 4FOWA 3UGGA 2ZNZA 1OOPA 4XXAA 3I5UA 3VD3A 5HS8A 1G9CA 5C4JJ 2I5UA 1KD7A 2K3FA 1FX5A 5J6XA 3P6BA 4PJ0C 1S5LC 2ZSHB 4CDWC 1MMSA 1CX4A 3R4KA 1GUIA 3EBRA 2M7AA 2BOLA 5EGOA 4K40A 4M0NA 4UW4A 3IDBB 1H1AA 3DYOA 2IPQX 4JGZB 2HJIA 5JPNB 2IS2A 5C7GA 2EFOA 2ZFWA 1TNSA 3TN91 3IMMA 2RQQA 3H8UA 5BNOC 2A5ZA 4FP3A 4N9IA 3S3OA 4XFFA 1XE8A 4Q1PA 5ILVA 1T33A 1D4M3 5FYYA 5FLMJ 4NO4A 4KL1A 5JLVA 4ES8A 1HKSA 5TISC 2VQAA 2IXHA 4QPGC 2CU7A 2VQUA 5KC5A 2PN6A 1Z3XA 3FX3A 2VULA 3N9MA 1PNGA 3M8FA 3H8XA 1MVQA 1R5HA 4KT6A 1QU3A 3HOYJ 3I3QA 4DGWB 3ZPLA 2VTXA 5EJ3A 4QDSA 5C3PA 1W6OA 4EJVA 3SEEA 3S6PA 1YRZA 2GIVA 2OA4A 4FTEA 5JI7A 3S93A 4RFT0 5IT9K 3CJXA 2MEV2 5L3CA 5J8CA 2H6BA 2ZGKA 2MD0A 2RN7A 2PELA 2EK5A 2LW8A 4BQOA 5A1AA 1YW9A 4V2FA 4X0GA 1S9HA 4E7JA 1SACA 4CA9A 1ZG1A 3NAUA 2ZGPA 1HV1A 4M3CE 1HX6A 2WT1A 1H0MA 5LBQA 1WVRA 3THDA 1HB3A 3ABKH 3KE2A 5AFEA 3P3NA 3TEZA 1XGSA 1DQ5A 1DCSA 5KHIA 4S2HA 4LULA 5C3RA 5FRMA 4WXCA 3VEPA 1V9U2 1IKQA 1IOAA 2CY6A 2AXTC 3WGHA 4S05A 1AYN1 5FWJA 3BT9A 1AHDP 2LOOA 4I98B 1V6LA 4NMIA 3FMQA 5J8FA 3GFLA 2XLGA 1IV8A 1B9MA 2GN3A 1R1A1 2PJRB 1DQ0A 3W5NA 3N9NA 5FFZA 4X6QB 2FEZA 5FZDA 3OIOA 1N77A 1MD0A 4BHBA 5GZCA 1TMF2 2R0HA 1RVF3 3MIHA 2W4SA 4HT1T 4L2NA 2VMHA 4QQHA 1REEA 1RUF1 5A33B 4IGQA 1GYKA 2FDGA 4M71A 2V79A 4A3FJ 3ZQIA 4Y33A 2KJCA 1HW2A 5J48A 4QQOA 1E5IA 4RBOA 1CR7A 2GU9A 4HOOA 2P0WA 3BOWA 1LOFA 3VBUB 4AIDA 5LBEA 4MHUA 1CPMA 2C5DA 5DDJ3 3MDPA 4YFWA 2F4OB 5E17F 1WW7A 1L7RA 2B45X 5AC91 1UYPA 3MKZA 4DUWA 3A4UA 2DURA 1ZR4A 4BDZA 1ULEA 1UY2A 3NSTA 1NCQB 2EZHA 3DKYA 3S2DJ 4YGBA 2CSGA 4CVUA 3ENRA 3JBG3 1XCBA 5L3DA 2VOVA 2W2IA 3NV1A 4OI2A 1FSHA 2HWF2 4GGGA 2D7FA 1J3QA 1ETOA 2GIZA 1VBB3 5HNFA 2JE9A 4BLJA 4AI9A 2YC0A 3T5XA 1OURA 3HNBM 4D7NA 3ZSMA 4AQSA 1W06A 4E8CA 2E1MC 2WRAA 5ILSA 1LR5A 1V4RA 4MNUA 3CL1A 2KT0A 1CWPA 2Y0OA 4NAOA 3AZXA 2E51A 2CYYA 1H1MA 2F5FA 3ZOIA 5JVTA 2QZ8A 3JRBA 3JRCA 2DFCA 3MKWB 3HOZJ 4JGYB 2I2SA 5H9QA 1C8NA 1VB2A 1RHI2 3L2HA 4LLGF 2W87A 1J3PA 2O61A 3VBFB 2HEOA 5FUPA 4QPWA 3ZN6A 1AR82 4UW3A 2AENA 2CQXA 1NCRB 3GF2A 5A7WB 5EFUA 1T6SA 3ZQGA 1K5MB 4AVZA 4O65A 2GM4A 5GAEJ 3QAHA 2DJNA 2ZX0A 1J2XA 3ZVXA 2ZJRF 5H9SA 3DPRC 1S1AA 3FMSA 2MYSA 1ZRFA 4DEVA 4UFIA 3Q8FA 4WBBA 1OQ1A 4CCEA 3FBYA 3JRFA 5F1RA 1EAH3 3C2BA 2D5FA 2DFBA 1ONVA 3MO4A 4COWA 5K1YA 5FD6A 1DZTA 2BGOA 4R52A 4L5EA 2MEV1 1LPQA 2PXJA 2VZRA 4M3EA 1WCDJ 1GXPA 1Z6TA 2R5YA 3D5RC 1LOEA 2EB7A 3CLOA 5DM7F 2XJRA 1XX5A 3VBHA 2H0BA 2YPJA 3UJQA 5K7ZA 3SHRA 1UYXA 4ARXA 4FFHA 4BIFA 5JCTA 5FZEA 4JX0A 1REPC 1E5SA 4UY8I 1FXZA 5CFCA 2DQRA 4L5IA 2V09A 3AXEA 2KHMA 4G7ZF 3G6EI 3ZFFA 1T38A 4AVAA 2ACJA 1LOGA 1WCUA 2FUG2 4K1ZA 1V9U1 1I6HJ 3HRMA 1QNYA 5C33A 1HN1A 4BBSJ 2R062 4BMBA 2JT1A 3PL0A 3IWFA 3JRAA 2FJ1A 2JD4A 2RR13 1ND2A 2CNAA 4FE4A 5KAIC 2KRHA 1OJLA 4Q0UA 1FV3A 1R58A 4DS0A 3QH6A 4XAEA 3HMYA 3MGUA 1MS9A 4TYSA 4IV1B 3CP8A 4PIXA 2A69F 4NOTA 2CYFA 4HONA 4KT5C 4LT5A 1TEIA 1HXS2 4RGGA 3HOBA 1TMF1 2LREA 4FPKA 3JRHA 5KCMA 4P9WA 4ESFA 3O5SA 5FMBA 4D8MA 3LEKA 2VUAA 4HA8A 2P81A 4RR3A 1JXSA 2K9LA 4MIMA 4L0PA 5E20A 3C7FA 1FZPB 2QQWA 2FA5A 3NRVA 2RMU3 2XAHA 5CFDC 2V6CA 2Y33A 2OZUA 4YW3A 3M7GA 4UNOA 3I49A 1STMA 3ELNA 1UW8A 4LEJA 3PIOF 1ORKA 1ZARA 4RD7A 1SLTA 4AF9A 3EQEA 2ARCA 3BOPA 3FIWA 2QDNA 5K4LA 1W36D 4E7KA 3HQRA 3EETA 4ANJA 2CDPA 3MYXA 5JR3A 3A02A 3VHPA 3CCLI 2A05A 2MA3A 2V4VA 2NYYA 3AKRA 3K75B 3Q8EA 1MR5A 1ZZCA 5ABJA 2PA7A 2HWF1 2YUSA 5C4XJ 3C2GA 3ZXJA 1LDJA 1MJAA 1SCRA 2ZGMA 3PNVA 1C1FA 2B9UA 3D4KA 2PBIA 2MH9A 4P5YA 3CCJI 3KF5A 2P6SA 4L9TA 4PJMA 1DYPA 3FHAA 2KRFA 2QUFA 2KR2A 4XLEA 4AK3A 1UHMA 2XHKA 1PZ8A 3W9AA 2A6WA 3CMMA 4LUMA 4HMZA 3RWKX 1BA5A 2IGNA 2HWD2 1G3SA 3WU1B 4U0VA 1LESA 2CH0A 3G7DA 3I2GA 1J59A 1NE4A 1RHI1 5ED4A 1UELB 2AEZA 2A3YA 2P3IA 3S30A 1LKNA 4QD2A 2ZBKA 3OG2A 1AR81 4UBHA 3OSDA 4Q4V3 1LCLA 1AX1A 4B4QA 1SLLA 3SCGA 1W5TA 3V56A 2XDVA 3OYBA 4AQTA 4BE0A 4XE9A 5D5UB 3ROUA 2R7UA 1YNAA 2GQQA 3QYEA 3U37A 5J47A 4P08A 1QY4A 1DU0A 2X09A 4IQPA 4JTOA 4WK8F 1BBYA 4E7ZA 2UWBA 1QJFA 2L9VA 1YTYA 4AR2A 1Z7S3 4D6RA 3SH4A 4BPZA 4CUCA 1YYNA 3RPUA 3KWVA 1G86A 1JOBA 3ZFGB 1IGNA 4NAMA 1MBEA 1BYHA 4HSJA 4P00B 1EH6A 1W1WE 1X1AA 1W39A 2IRFG 3WW1A 3OJBA 4K6BA 3S57A 5JOYA 3TDZC 1SLAA 1C4RA 3VZLA 4M6YA 4IKFA 1UF2C 1ZKGA 4KA4A 1XNBA 4GALA 1YIPA 5L9RA 4LA3A 3I3EA 4FCYA 4QB6A 2ILMA 4HK8A 2O03A 1OA4A 1K83J 1SD4A 4QAWA 1Z91A 4FPGA 4KG0A 1OD3A 1LHOA 4MGTA 2X5IB 4FI9A 3FC0A 4DW6A 4MTEA 2Q30A 1FPN3 4CRQA 2L7MP 2WADA 5GZFA 2Q0AA 5A7OA 3RKQA 2WWSA 5K5RA 2LBFA 1SFXA 2B39A 4JQTA 1JYVA 1R083 3ZXFA 5FY7A 4N53A 3UV9A 5JIUA 3H35A 2BV4A 3IV5A 3O12A 4CDWB 5EHDA 1CZSA 4YVSA 3T1BA 3TEXA 2JG9A 4FAGA 4C1WA 4G12A 3V0BA 2WNVA 2R061 2ZAHA 2ZX1A 3VWBA 4UFMA 3G1MA 4BB3A 2W1WA 1V0AA 2ZMEC 1DP3A 3GF6A 4CDUB 5GM0A 2KM2A 3SZGA 2ARBA 4TSVA 1XB4A 2DMNA 1DYOA 2ZGQA 1VBD3 1XN7A 1PIV2 3KV9A 1ETVA 2RDQA 1HXS1 1Y7BA 1D0GA 4QMAA 3L2RA 2IWGB 4Y15A 5FGMA 1HDDC 4Z92B 2P5VA 1CGPA 1QJX3 4JDMA 1EP0A 4ZJZA 2RDRA 3TOAA 3ZR6A 2ETEA 3DPLC 1JUHA 3QD6A 4DMIA 4LLOA 4Z1VA 1UU6A 2R49A 1VFCA 3ZLIA 1JW6A 5GZDA 4IOCF 4XUQA 3DTIA 1P4AA 4C3JJ 1Q1VA 1BBT2 2QVSB 4HN0A 1DBNA 4XRSA 1I1GA 2WN3A 2HWC2 1R23A 1TL8A 2O14A 2VUMJ 2F6CA 4IHXA 2VZUA 4QKFA 5ERLA 5FJHA 3HXLA 4LB6B 2M0CA 3AG3H 4A6OA 1U3EM 1W6QA 2Y6HA 2XJTA 4JDOA 4F8AA 2B4KA 2ZHLA 5D5WB 1DYKA 2HOEA 3OGJA 3GJAA 2XPVA 1QXJA 3BJOA 4A3XA 2XOMA 5CVVA 2KDOA 1NKGA 3S0MA 2W5FA 4Q47A 2C0ZA 4LOSA 4RB2C 3N05A 4KN4X 1L7QA 2P2KA 5LGUA 5BUVA 4YWAA 1CONA 2R7DA 1N3PA 1VQKI 2JG8A 1GT0C 1OFSA 2K9MA 1RINA 1Z0XA 5JWPA 3B9IA 2WWYA 4G9YA 3BIWE 2WDBA 1JODA 5CKTA 1P4XA 5JSRA 3VKFC 4HSTA 4QKNA 4CCJA 2W0XA 4S04A 1ALYA 1LULA 2M34A 2ISYA 1U5TC 1XCVA 2HOAA 3OGGA 3HJEA 3K6GA 1Y1VJ 2VZ3A 4KU7A 5C8WA 2HWD1 2ZGNA 4FCAA 2WN2A 1JUSA 2KIFA 3OYJA 2R7QA 1N1SA 5H2FC 2YU9J 5E3MA 1SFEA 3SJMA 5HI0A 3MIEA 2DAOA 5LHGA 5F6FA 4M74A 1W6PA 2QKLB 5DQ0A 1AR73 5F27A 1AYM2 4EN7B 2PHFA 2KIUA 2PQ8A 1NY72 3GDBA 3LFUA 4ISQA 2DJIA 4AHYA 3NEUA 4OIQF 3MBWA 2ORXA 1BVP1 2Q1MA 4FQGA 1SVOA 2F17A 1XQNA 1GZCA 5H9PA 1E3HA 1Y6IA 4BXXJ 4O7XA 4P5OA 4BJ0A 1LHWA 2VJJA 1QPMA 1NA1A 2DU9A 2VJ5A 4B44A 4I3GA 3SXYA 1MZ5A 1WH7A 1YI9A 1WH5A 2VT3A 1X7NA 5HCAA 4LBQB 1JYTA 1RUG2 3KVAA 4ONUA 1ENSA 5A3PA 1RUH2 2VXDA 4RR3B 1MS1A 5BNNC 3O0VA 2VODA 4GMP0 3WF4A 1KITA 4A3KJ 3ZMOA 1UZVA 4PCQA 3HTSB 3RDIA 1FEXA 4E4ZA 3V8JA 1TZOA 1P7IA 4A4AA 2CV1A 2H6CA 4AEKA 2LF8A 3AP7A 4PDKA 4KG8A 1MPXA 3WY6A 4M4RA 3NWSA 4UF0B 5IY5H 5FY0A 3LL7A 3ACGA 4ASNA 1U5XA 3GM8A 4XKCA 4DBRA 1DG6A 4IEPA 5FZAA 5GAHJ 5ABJB 5D5XB 3ZQCA 4G8XA 2GOMA 2HYGD 2VG9A 1GOGA 1W8FA 4XZPA 2WAOA 1Z78A 4HDUA 1BZWA 2DVBA 3BTAA 3AMHA 2LROA 1YITI 1PIV1 1OYWA 3CQOA 3MUZ1 5AIPA 4OQ8A 1AJKA 3I2FA 1J7KA 3DPRB 5J98B 1W6NA 3J81Z 3U11A 3V65A 1BL0A 5BNPA 3C8XA 4E7LA 1JYWA 4B1RA 4Q5OA 3OYCA 1MDMA 2F6BA 2WO3A 2OX0A 3T4HB 4P9YA 1TWAJ 1BBT1 5BNQA 5EWSA 3EO6A 5D4RA 3VDDC 2HWC1 4YELA 3GW2A 4B8XA 1NE6A 2VBZA 3LWFA 2HWE2 2HYJA 3I2OA 3TBIA 3BZKA 3DU6A 1CAUB 2RJ2A 4C0HA 2WYSA 4FTBA 2VBWA 2IP2A 4RN5A 3N7LA 1AR62 3OOPA 1ETYA 4DJAA 1UN1A 2YFZA 3A0HC 4M73A 3POBA 4PLMA 3OIPA 3ZYJB 3MLKA 4B3XA 3KLNA 5LK5A 3O1OA 2VMIA 4LLNA 1SD5A 3NNGA 2JUCA 3ZXGA 1EYBA 1RPWA 5E8GA 4KBZA 4L9JA 3TEYA 4I99C 4KGQA 3CJRB 2MBFA 1H2NA 1QQP3 2JPCA 3VKLA 2E7AA 4WF2A 5E88A 3HHGA 4WVMA 4A3BJ 3BGAA 3LFMA 1NT0A 4WVZA 3T2TA 2VUJA 3ASIA 2XGDA 4XTMA 5FYCA 2DVAA 3WGGA 3KV4A 3W20A 2O0OA 2Y6JA 1WSUA 1WJAA 3JAMZ 1OC1A 2B7YA 2L4AA 4BJ6C 1IRGA 3ESWB 3AC0A 2DU0A 4HLXA 2IS4A 2CQNA 2DA7A 4FOQA 1F35A 4XLFA 4OZXA 3RYPA 1R5GA 3C2UA 3OBAA 3PUSA 1SHWB 1LENA 3DL3A 4E4SA 1UY4A 4UFHA 4Y13A 2LKXA 1AYM1 1POV1 4TV7A 1MS0A 4B48A 1NY71 2WNVB 5FZCA 2YX4A 1W0NA 3FXMA 1V5GA 2RS13 3B73A 1OCZH 2FBIA 1JS9A 4CCDA 4Q26A 3P3PA 1DPRA 5E8IA 1R092 2DA1A 5CVUA 5C5TA 3OYDA 1VBA3 1B8IB 1S3JA 3INAA 2H8RA 4UAPA 3GTQJ 1RUG1 2F5EA 3HIFA 2JDYA 4Q4X3 3Q0UA 1UY3A 1A5JA 4EZ4A 4GCVA 1RUH1 1A36A 4META 1MW7A 2W82A 3FL7A 5JXGA 4LO4B 1WZ2A 1IF1A 4PHZA 2AYHA 4XSXF 1IXSB 1GLNA 4CDGA 3JTGA 2QQJA 3WHUA 1D8JA 2GMPA 1H6XA 3V0AB 5FPZA 1D0HA 5IVCA 3AMNA 5L7OA 2AQFA 3VBSC 3KYCB 1W0UA 2ZJ2A 1VZ0A 4RA0A 2C6SA 1UOJA 4BQXA 4EJTA 2ECBA 1PGW2 2EXKA 1ULYA 4FBFA 5T5OA 2VZTA 5T5JA 1ZTRA 1H89C 5FYSA 3BDDA 1J84A 1KA8A 2W48A 1HW5A 1QIQA 5GP9A 1D7PM 4KMFA 1JZ2A 3RPUD 2VVEA 2A6EF 4N90A 5C44J 1XRUA 2UWMA 3HSFA 3N7MA 2WS92 4M9XA 4XETA 4AHWA 1Q8PA 4IEOA 1OA2A 2VNOA 1I39A 5IOZA 1ZM1A 1BC8C 2OPKA 1D1CA 1KGSA 4XF0A 1RUI2 1CAWB 3EDPA 1X50A 4MHRA 5E16A 2GMMA 3IWZA 4X1EA 1LHUA 2P6TA 3JZVA 4LO6B 4RHV3 2BY0A 4HN1A 1EUUA 2VJXA 4CXWA 2COBA 1V3FA 4K2EA 4LR4A 4O61A 3PQKA 1JOPA 5A1LA 5GAGJ 4XQDA 1QJY2 1WZXA 2VB6A 4L92A 4CDQB 5F0FA 2E71A 2D6PA 5A70A 2W47A 3G6JB 2XPUA 2MPFA 2MGQA 4OHZA 5LY2A 3LSMA 2HWE1 4RQPB 2E53A 2YXSA 3HQXA 1YJWI 2VTFA 4Y52J 1JGGA 2EF6A 3BIEA 3DCFA 4K21A 1AR61 4BK5A 2V73A 3A21A 2PFBA 3OV8A 1NA1B 2IFWA 4F92B 4YW4A 4WVWA 1TW3A 4B47A 2IXJA 3O0WA 1PVC2 3ZM8A 3I58A 2W92A 4DNCA 1TT0A 3OYNA 1QVTA 3I2HA 2DI3A 1VJ2A 4GULA 2WA0A 1OVSA 1JI6A 2JB8A 1KJRA 1NXMA 1HRI2 2WNUC 3AKSA 5A7PA 2WFF2 5K7HA 5I0DA 3WU2C 4F3QA 5FREA 1ZYBA 1KDKA 4PK4A 4PJJA 5GKAC 2JVGA 3B02A 1JU3A 1AUYA 2XSJC 2CFXA 1KQ9A 4C2TA 4IV3B 4YZ1A 4XONA 3BU7A 2OZJA 4UUTA 5IK8A 2BV6A 5T52A 5FRAA 3ZR5A 1V6JA 4HLTA 4U2AA 1GZWB 3F23A 2VOOA 3VSKA 3MAJA 1WLTA 3CP2A 2ZX3A 1OKQA 5BNOA 2N8GA 1S55A 3LPGA 3SZPA 2GWRA 4EYUA 4SLIA 4EWDA 3WTYC 1RXFA 5FO7B 3SDGA 2WY7Q 5DDGA 3WTWC 1MSEC 4QPGA 4JQFA 3VD4A 3TN93 2UZKA 1W9WA 1UCRA 3EUAA 5LASA 2VCBA 4TWTA 2XV4S 4XRFA 3GTKJ 1GQGA 4KQ7A 3JSPA 2FOWA 5IP6A 1PMHX 2G9ZA 4IE6A 1SLBA 1R091 2FQ4A 3MW4A 3EUHA 4R9CA 3IH2A 1MZFA 1HV0A 2LTNA 1Y39A 4IERA 2X51A 1DLLA 3F8BA 3LDKA 5JVVA 3ZFEB 3WVJA 3JW4A 2NOGA 4QDRA 3M3IA 1BXHA 1RKWA 1BIAA 4Q27A 2HS5A 3H3ZA 5EG0A 1A35A 2WQZC 4ZC3A 3NVCA 3GYHX 5EYYA 1QWRA 2DT6A 2VN2A 2YBPA 4AEDC 4BQYA 4GH4C 5C5UA 3SFIA 3VLBB 1I50J 5J7MA 1PGW1 2GMEA 5ACA2 4Z2WA 5EQUA 1MSFC 5CQEA 4XW3A 3K1MA 1W6MB 3R60A 2QCSB 3ZQHA 2BYVE 4YG0A 3LB9A 4NHJA 3IT8A 3J81K 1W8TA 4XQFA 2B0LA 2FDKA 2CL2A 2YZ4A 3THTA 3G2BA 3HHHA 4E8DA 4A0XA 4ZS2A 1W9SA 2HVQA 2VI6A 3JQXA 2BWAA 2FBKA 4XL9A 4I01A 4A3CJ 3DFGA 4PCRA 3K3NA 2D6LX 1HRV2 2WS91 1VQ9I 4D94A 1XSRA 3RZJA 1G7YA 4AI1A 5DS9A 3KT7A 1RUI1 4S2GA 2HNHA 1S2KA 4OIPF 3JD73 1BKZA 1LEDA 1SLIA 4Z07A 3QPHA 5FY9A 1MGTA 4KWJA 1CAVA 2P4WA 2BP6A 1KU2A 2JN6A 1SQ4A 5DABA 1QJY1 2JA7J 3M8JA 1OQDA 1TME3 2GNMA 1JZ6A 2WIIB 1GWLA 2X48A 2WWJA 3RKWA 5ERIA 2YC2A 5DAXA 4F52A 3TQNA 3PL8A 3WF1A 1QH7A 3B93A 4AD9A 2BY3A 1UG0A 1SZBA 1HLCA 4N4OB 3MW2A 1HF0A 3TB0A 3OUIA 3QWLA 1FYLA 5CPRB 3KB5A 1ZG5A 2FCUA 3P9KA 2LVSA 2OQ7A 5AC93 2VZ1A 4PI2A 3AP5A 2JVHA 3TBDA 2IT0A 5FZOA 1AR92 1PVC1 3JAMK 4BJ5C 3POFA 4E27A 1D2SA 1GOHA 2HTSA 5F64A 2NMNA 1HRI1 1IN4A 3IKWA 2L5QA 5B2GB 2WFF1 1HQNA 3SH3A 2DWRA 2X6WA 4A0YA 1COV2 5FMDA 2RNJA 1B35A 2A61A 3J80Z 4URAA 2F2EA 2OIIA 5IW0A 4CEWA 1AL0G 4XQWA 1K61A 3HBKA 4PGHA 1PZ7A 3S2HJ 4FHTA 5F9TA 4EQQA 3NAPC 3OYWA 2R072 3I3MA 4CO8A 4WM7B 1S6LA 1Z67A 2QQVA 3E1SA 4KISA 5FCCA 4CEYB 2DCEA 1UY0A 3M8LA 1HB1A 3LKJA 4HAMA 4KH9A 4QB1A 1OLRA 1QXPA 3ACLA 2BXZA 5DAVA 4FFIA 5CJ9A 4PBPA 3I2IA 1O3QA 3KEOA 3KEYA 1RL3A 1HW1A 3OBRA 2IFRA 3I4MJ 3AZVA 1O4TA 1X58A 4DIQA 1DGRN 3G3ZA 3T3YA 3CUOA 4J01A 3TW6A 5FZ1A 2QQPA 2MW8A 4E70A 1AL23 2DK8A 4YVWC 3AZYA 3HEIA 2UWAA 2Z99A 3VBOC 3T09A 4MSVA 1W90A 5LW9A 1DQ6A 2ZHKA 4AE2A 3MMYB 3C7GA 4HVRA 3FXLA 2PHRA 2XAFA 5GTHC 2FMDA 5FRNA 4GO1A 1XPXA 1VB4A 2VW0A 2R0FA 2TDXA 5D8AB 4NB5A 2R0QC 1PMJX 2CHHA 2JK3A 3ZMZA 1ZYRF 3LAPA 5JUVA 1UOGA 4RYDA 1H9GA 1PK6C 2EZKA 1XYNA 1FMD2 3MUY1 3CHXA 5ACA1 3GTJJ 5CVIA 3VODA 3P5JA 4MGQA 2IBDA 3U78A 1F2NA 4P55A 1MBKA 3L2YA 5A1FA 4M0HA 1LU2A 1T0FA 3IHUA 2WQ4A 3ZSJA 3OEAA 3OL4A 4CP9B 1WLDA 2EBIA 2BFUL 5E8AA 1YRNA 3WUCA 1TBXA 5DD8A 4HK9A 4QU2A 1S7EA 1HRV1 2XJVA 2X1CA 3B3QE 1UU5A 3WXPA 1JYIA 4BM8A 2HEYF 2UURA 2CUEA 3KV5A 4D5CA 3HVDA 3VDBA 2FDIA 2YX7A 1XSXA 1ZBA3 2Q4SA 3J7MA 1ZZBA 5A6XA 1GBGA 2JPBA 3F2ZA 3VKNA 1TMF3 4PFPA 2K46A 1URXA 4M3FA 3J26N 3AP4A 4RGAA 4UB8C 4NN0A 1GWKA 2P5LC 1YQ8A 2AS5F 1XYOA 3WHCA 1JXNA 1O8PA 1S0IA 1VBC2 2D6NA 1CN1A 2EFWA 5GADJ 4E2QA 2OF7A 3H8RA 5E1WA 2FU4A 1JOJA 4MXWA 5JZGC 5L3GA 2ARXA 3LDBA 2D93A 5B4NA 3CC2I 1R00A 3KV6A 2P34A 4YM1A 4AFMA 3CDLA 2WO2A 3H1YA 4LO5B 4OHYA 1AR91 1U8RA 4Q2FA 3T1LA 3APBA 4ESJA 3NMBA 1ZLJA 2JZYA 2AREA 1PO22 4YFNF 2FE3A 3TAYA 4ABZA 1T39A 2WAEA 3Q9SA 4XF9A 5M5WJ 1GZTA 4I7HA 2KDZA 1WLWA 2K2SA 1COV1 3TGNA 2FNPA 4D7MA 1F5TA 5EG0B 3Q8AA 1YHQI 3T0AA 2HDDA 4PDWB 4W6YA 3KT1A 2ZXHA 1T56A 4G6DA 3UNPA 4LMYA 2W84A 4RLFA 5FFOC 1Z7UA 2STTA 3VHNA 1DUXC 1LHVA 2XH6A 3HJRA 5JR2A 3T0DA 3WD5A 4J00A 1LEMA 4Z82A 1B1BA 1D5YA 1X9PA 2R071 3ZGKA 2PHUA 1MH4A 4I2OA 1USSA 4LBNA 1I5PA 1G9FA 1RUC3 1IAWA 2AGSA 1O7FA 2BZDA 3BR5A 4YW7A 4ZXEA 1EV13 2BGCA 2X85A 2P3YA 3S16J 1ND3B 4R4ZA 1KZHA 1OQYA 3TYJA 1QRYA 3N9QA 2MHFA 1LE8B 3V7SA 3LSEA 4W4ZA 2OC6A 3VB2A 1AR83 1S8NA 3J7AO 4Z2YA 4IOAF 1AKHA 1IRFA 5LBFA 3D5LA 1LVAA 2OU2A 3FXOA 4XPVA 2VM9A 5FKKA 1Y9GA 3VZNA 3UKGA 5BOXA 2IA0A 1IS6A 1PMIA 3AMPA 1RIRA 1YEWA 3I71A 3RTRA 3VPRA 1NK3P 3PDQA 3N7JA 1JN2P 4A0ZA 3BYWA 3IBMA 5DTDA 5C4WB 2HBUA 3FMRA 4IEXA 3A7QA 3AZWA 2J1VA 4Q0QA 5DZFA 4NIIA 4I0AA 3LSTA 4YYOA 3RKXA 1D1BA 4GKYA 4NRPA 4BUPA 5L36A 4OAZA 1X8EA 2PLYA 4ESBA 4YW5A 1PUFB 4KWUA 2CWSA 4K8RB 3CJIC 5HXMA 1FMD1 5LRSA 2EFQA 5EIYB 3IB3A 5F0HA 4HX7A 4I76A 2BPA2 1CQTA 3GLXA 1WWYA 2WZR3 2KMUA 4A6SA 1X2MA 2FD8A 1I3AA 3DXJF 1FI2A 4DXRA 4DXTA 1BJQA 5JMCA 2J1EA 1X36A 4Z6YA 2K4JA 1OKOA 4OQ9A 4XMYA 1RUE3 2ZMEA 3H5AA 3AVSA 2DA2A 2AO9A 4MFEA 3QU6A 2Y9YA 2ZKNA 2WNEA 4E2GA 2I45A 3CCYA 1J9IA 1K6OA 2VL4A 2DT7B 3OSGA 2VBYA 4AW7A 1DGWY 2R063 2OAZA 1Y56A 1F4HA 1ZBE3 2YB7A 2NRAC 1QGPA 2P1BA 1MBHA 2Z1DA 4CEWB 4L8QA 2V72A 3K4NA 5HOOA 1XOYA 1RITA 3JXSA 1W8OA 1IXRC 1GNZA 2NYXA 3JTHA 5FR3A 3LWCA 1XSDA 3HUGA 4B29A 1UX7A 5DAPA 1QHDA 1SFPA 3H5NA 2J1RA 3M8EA 3L9JT 2K27A 4QB2A 1UZWA 4FX4A 2RGVA 1MQTC 3WP5A 4AC0A 1MJ9A 5IYYA 4AYUA 2M4KA 5DAQA 1RXGA 1E17A 3PTRB 5IK4A 1VBC1 2QBYA 5FROA 3F22A 1OSGA 2NN8A 3TOJA 2M45A 3VKMA 3AM2A 3FK7A 1UL9A 5BV6A 5JLWA 3ZN1A 3JQWA 2QSFX 4AM3A 1I3HA 5F37A 2CGPA 1DLCA 3R05A 2PHWA 3K4CA 1Q5OA 1VQNI 5FPAA 2Z5UA 5DPNA 5FWEA 3ZKUA 3SEZA 3HKZA 4BYYA 4CXXA 3BZCA 1BM9A 1W2UA 3PNAA 2UXNA 3S7IA 4S0HB 1WBFA 3U21A 5EJCA 5CKMA 1YO8A 1PO21 2PMWB 4EE2A 4BY7J 4C8DA 5HVQC 1YIJI 2RS53 1GLHA 3FHQA 4MX3A 3C1DA 5HS9A 1JYCA 2ME0A 5J3LA 1EJ9A 2E31A 2Y0MA 1U5TA 5FLJA 2B42B 1VQOI 2AQEA 5IVEA 1L3JA 3ZIXA 3PFYA 2W7NA 2GN7A 4MLOA 4GZ9A 3AL6A 5FFXA 4MGIE 2DA4A 2R32A 2F5CA 2K9NA 4HBLA 3K10A 1DHKB 4B7KA 1BI2A 2RV8A 2HWD3 2FCTA 2XUBA 1X8MA 3WLUA 3ABTA 5T5PA 2VZVA 2E7XA 4BE2A 2Z4FA 4PUSA 3JCIA 4B4CA 1V55H 2NVXJ 4DY3A 3VSLA 5F3EA 3EYYA 1MS4A 4F83A 1X19A 1QGLA 4XUNA 3MFKA 4JGZC 2EJRA 3I3BA 2WT0A 4IESA 1PX3A 5JXJA 4UVCA 5IP7J 3VOEA 2Y6KA 1SFKA 4EWAA 1BIBA 3VHRA 5GPAA 1L7LA 2K40A 4NPMA 2Q8CA 4QHZA 3WOGA 3H7JA 2AR6A 2AUYA 3ZN0A 2YSRA 4HKOA 4C30A 4U36A 3ZSEA 2VUCA 3U0ZA 2R042 4B4RA 1DU6A 1W7PA 5G05L 3BJ6A 1QZZA 4XF3A 1UX6A 3C18A 1LTEA 2W68A 4XEZA 3VDCA 1GV5A 3M70A 2ZX2A 1H9WA 3F8NA 1XNTA 2G9FA 2BBAA 4IGOA 5IAVA 3RQ4A 1GQPA 2OQGA 3F6VA 2NVTJ 4N43A 3BPZA 3NRUA 5A7SA 1AX0A 3PIGA 3BPSA 5DCMB 3NAPB 3VD7A 3MV11 3BUCA 3DBLB 4YLZA 3UNGC 4DEQA 4Y1UA 1C8M3 1MS5A 5E1RA 3S14J 2Y2ZA 3G73A 4Q1RA 5GLVA 4WXDA 4HF2A 2Q8DA 1FTZA 4JC1A 1LB2A 2O7OA 4WM8A 4X8NA 3K4ZA 3PIJA 4PGGA 4FAHA 3ZO0B 1T08B 2XONA 4FOVA 2XUEA 1H8TA 2IXKA 1KGYA 1WJDA 1J58A 4XDOA 2JWPA 2PHLA 2E9QA 4HG2A 3OBZA 5L9VA 5K9YA 1HQCA 2IVMA 3EYIA 5LA2A 1S0BA 2ME6A 2R93J 2VQLA 4CXFA 2XVLA 4D1QA 3VDDA 3DTKA 3S7EA 1TWGJ 4UVBA 1G3WA 3VBRA 2EFPA 2X05A 1DZQA 4QX2A 2LY2A 2JSCA 1A78A 1U12A 4G4FA 3H9JA 2JD9A 4W97A 1VQ7I 5EF6A 4A2UA 3GXUA 1D4M2 2M9HA 3CCUI 4Y1VA 3WDTA 4BS9A 2RM23 3O0XA 3KP4A 4UYBA 3J4UH 3RG0A 1JZ7A 1ASJ3 1GMMA 4K20A 3VZKA 4BHPA 1VQLI 1Z9CA 2J5OA 3IP4B 5AONA 3E6BA 2ZJCA 1PK6B 3Q8BA 3DKWA 4B43A 2E5ZA 4OU0A 4ZTFA 5IVYA 1IHMA 1FAYA 4CHUA 3K2ZA 3ORJA 2V5DA 3HWJA 2QQKA 3ZMSA 1IPJA 5FBZA 5A6QA 2FRHA 4XFGA 5L9BA 2G1MA 1NCQC 3H8OA 2WQ8A 3JCUC 3MD2A 2BY2A 2DYSH 3KX2A 2E60A 3AX4A 4DFSA 4MEYF 2G9GA 1PGSA 2RNGA 2VMEA 1VQ6I 5FKBA 2RDNA 1REFA 5I0SA 2LY1A 1JTYA 4RM2A 2VKEA 2NAZA 3R0JA 3G1OA 2JIGA 5IFTA 3U07A 2VBPA 1NHAA 3WG4A 3FM5A 1N3QA 1YX5A 2GXAA 2AC1A 5L19A 4QQPA 4A5NA 2BU9A 2VXZA 3DQVC 2PJPA 4XFBA 4JGYC 2IGMA 2WYFA 3MHZA 4P9LA 1A6CA 1F43A 4EGYA 4H7LA 4TZDA 4JRLA 3PU3A 3GXOA 2XKOA 3VBFC 2CO5A 4FPLA 3ASNH 3BPXA 3X29B 2XLFA 3O8GA 2W1QA 4PZJA 2QENA 1OMIA 1W36C 3HM5A 4RDUA 1L3LA 2KA3A 1IG0A 1NCRC 1XD7A 1Z1DA 2P37A 5CYYA 3K1NA 1K5MC 1FIPA 2BFUS 1XMKA 2EV0A 3LQCA 1RVF2 3IAPA 3HBLA 5FZFA 3H1CA 3WE2A 3EB7A 2R041 1SLCA 3OPZA 1F8VA 3FUQA 5A32B 3TP3A 5LLQA 1N25A 5EP9A 2X10A 1RUH3 1WPKA 3HOTA 1H9TA 3LSRA 1ULCA 3JUUA 3KHCA 5FKOA 3ATGA 2X9DA 4WX9A 1R22A 5BS6A 1VBE3 5FQ0A 5H20A 4I30A 1X3WB 5T55A 1AOYA 4QM8A 4XOPA 3ON7A 2QM3A 4FPHA 1VAKA 2RHPA 2HXOA 1S0DA 4CYDA 4BGDA 5F1JA 5AVPA 3JBG2 2HWB2 3ZCOA 4XUTA 2LTPA 2GC3A 2LF7A 3POIA 4LBJA 1L0OC 5A2QZ 4J6GA 1IKPA 3IPVB 5GZGA 1BCXA 4JQRA 3K46A 2EXIA 1N1YA 3WTXC 1K5JA 3OIQA 1K78B 1C0WA 4N7UA 5JSOA 4Y1YA 2Q2EB 1GU3A 4CCOA 5FK7A 4XJAA 4GJZA 1UCXA 4MGKE 3FF5A 2CW7A 1I3QJ 2X6YA 5FY1A 1X82A 4LIUA 2XC7A 1ENQA 3LA3A 5J4YA 3A22A 3M9AA 2DFFA 1OOPC 2E7WA 2K4BA 3ULQB 2RS33 1AA7A 3PQJA 1H0BA 1IDZA 2P7CB 4BCUA 2A5YB 4XACA 2PMUA 5A6YA 2ZSIB 4ORFA 1V5EA 1D4M1 5TJJA 3MEPA 3S3MA 4OFGA 3WV6A 3ZP5A 2KJBA 1XNDA 3MFAA 4YIIA 4AVPA 2RVCA 5FZ3A 2DW4A 4D0QA 2ZTNA 3DEMA 1R6RA 2DDAA 4XMAA 4B8EA 4A45A 3GLLA 2GALA 4YW1A 1RC6A 2B9VA 4NC6A 3HOSA 1LFUP 2ZGLA 1YQCA 4KMQA 4EMSA 1QO0D 3CJIB 3ALQA 2MFZA 1HKQA 2WNUA 4ISRA 2UUZA 2DPDA 4ZZDA 2ESHA 3AXDA 1UIKA 1CD3G 2ZZQA 1HKTA 1IN8A 2K9QA 1W7PB 3BG7A 1PYVA 2VMGA 2WWUA 4KUMA 1ENRA 3Q9VA 4XVHA 5I0UA 3KLOA 2COMA 3HNMA 1WI9A 3R0AA 5EEHA 5K5QA 4UXNA 2HDWA 4UOJA 3BTIA 1G9BA 3HKZN 1GUUA 4DYCA 5FP8A 5J37A 1OR7C 3IIAA 4IXLA 3HPNA 3LOBA 2X29A 2JDNA 5DG2A 4OHVA 3J7YJ 2GXBA 1YIFA 3MI8A 1WKYA 1K42A 3KYLA 1BJZA 3RZKA 4DO0A 3OUHA 3LA7A 2OVUA 3HL2A 1ZGJA 1JYNA 2RDSA 1G8XA 2RR12 3PLQA 5FYVA 1LKXA 3D3AA 3ZN4A 4YM3A 4OI4A 5D8KB 2XB5A 5KXEA 3ZQ7A 2D44A 4IX7A 1RUD3 2QVOA 1O4YA 1D4VB 4Y1XA 4LG0A 2TNFA 1W0PA 2X8KA 3CCQI 4RGXA 4DYQA 3NNJA 1RVF1 3WW2A 2Y64A 4QX8A 2FQ3A 2BQPA 2XJQA 2R7TA 1R093 3RGBA 1JZ4A 2CG4A 4ENKA 4V19K 4A3ZA 2WTEA 3ML6A 4UFLA 4AVVA 4AYBN 5HV4A 3TOBA 4QKDA 4XFAA 4Y20B 3VBRB 3ZFGC 1YC61 4Q0PA 4GH4A 3I7DA 4P9FA 1WMXA 2BBYA 1DP7P 5B3SH 4A42A 5LBBA 4MVTA 2XGCA 3RQIA 4D3WA 1J75A 2ZA9A 4CU6A 5FLXK 4D9JA 4DBQA 3MF6A 5LRRA 2O8KA 1R1TA 1LOFC 2XIGA 5HCHA 2EICA 2WZEA 1XTAA 3FHNA 2X5IC 2WABA 4NR1A 4C2UA 4LK1F 3JBG1 2HWB1 3A01A 3ZN5A 4M3CA 2MD5A 4NBQA 5FBJA 4RGKA 1W8WA 4KFCA 3VZOA 4UW6A 3AB0A 4GWMA 3BPVA 4M3GA 1IC8A 1JZ3A 3WQBA 4NE9A 3OS2A 1UB9A 2DA3A 1CZTA 4OINF 4LBLA 1KXGA 5FD5A 4JTNA 1Z77A 2QZ3A 4YW6A 1WA6X 3GFJA 3POWA 2ZJPF 3EJKA 2NS7A 3E0JB 1JZ8A 4COZA 1VI0A 2BNNA 4YZ4A 3RZGA 1W7PD 4I0BA 1SBDA 3R0RA 4CDUC 2WS93 3I56I 2Z79A 4HL0A 4P9XA 5FZGA 1FMVA 2NOJB 3D0JA 2J1AA 1VAVA 4HYEA 4HPKB 4INDA 2OD5A 3F21A 4W8JA 4KYWA 1RUI3 1KS5A 3HGGA 4RS5B 4I3PA 2DYRH 2NS0A 4YGCA 3K3OA 4XAAA 2J42A 3ZMUA 3HQUA 4BEHA 1U9OA 4HNVA 4AG4A 3HOUJ 5EDNA 2DYCA 4K8FA 3CZ6A 2BRTA 4ZS3A 2V5YA 4LIVA 2VNRA 1J5YA 3BQYA 4QPIB 1OCPA 1Z7S2 3J7AY 2BW3A 1A6IA 1XE7A 1FOWA 2KD7A 4V2WA 3GUDA 4XJUA 1BJAA 1EH8A 4AU7A 2EQRA 3D6EA 3T08A 4BBRJ 3TKYA 3VDXA 3AMMA 2HOTA 3OYKA 3HYIA 2O5RA 4G9SB 3UK9A 3T8TA 3IKTA 2XJPA 2KKOA 1PVC3 3OY8B 3ZMDA 2XF5A 1ETXA 2FXAA 5F0CA 3TP0A 1NZIA 1ETQA 3DBHB 4EM0B 1HRI3 2HGCA 1MEC3 3RRDA 3UYJA 5KC6A 4OMYA 3NO8A 3DBRB 2WO1A 2VZQA 1IN7A 1YWKA 1FPN2 4LKFA 3F0CA 4RA2A 4NHXA 4NIGA 2IVJA 3ZRGA 1PO13 3HB9A 2QSHX 1O3RA 1G2HA 4M3CF 3JSOA 1N3OA 3UESA 2ZFUA 1R082 1YFXA 4GWIA 4LQRA 4PJLA 2VE8A 2VKHA 1VNDA 3U1XA 1HQLA 3USSA 4CA0A 3HT2A 3GCXA 4LE3A 5FKCA 1JH5A 3KP3A 3W6VA 1ZZ6A 4OI1A 5CKNA 3HBZA 3GALA 1U5YA 3QQAA 2RR11 5C8CA 4ZONA 5EJ1B 3GO5A 2HQNA 3BJAA 1VBD2 4BZ4A 1BW6A 4YVWA 4QPOA 5KK1A 1QJU2 1JGSA 3A03A 5LK7B 3UJOA 3VGIA 3VBOA 4D5FA 1VLNA 4C9YA 2G19A 1JKRC 3GZNB 5IFPA 1BI1A 4HVQA 3ILRA 4CPBA 4RAYA 1JE8A 1POGA 3RKYA 4NNJA 5FZKA 2VQHA 4ENJA 2DCKA 4XKWA 1W2OA 2A6YA 3DXTA 2O3FA 1FYKA 1UOFA 3ME2A 3ZDSA 5FO8B 2TUNA 4MQ9F 1FNNA 3U1KA 5A2QK 3WINE 5DUKA 5IK5A 1HC8A 5D5VB 2XKPA 4JX4A 4RR3C 1YJNI 1B72A 2V4AA 4D7YA 2XJSA 3THCA 4XJWA 2BEOA 3IUOA 4CDXB 3IM0A 3HRTA 1Y3TA 1CF7B 1W99A 3M2MA 1V6KA 4A7ZA 1NX9A 3OBTA 5KWRA 3IAQA 2VW2A 1C5IA 1FT9A 2IW5A 3ABUA 1FJLA 1O5UA 5ACA3 5IK7A 5JI6A 3V4GA 4XYXA 3POJA 1VR3A 1YQAA 1WD4A 3L2QA 3ZQLA 5C3OA 3M07A 5GLWA 2BE5F 3TNQA 1MNDA 2J22A 1JT6A 2WB1A 3OSFA 2OCEA 1QZEA 4FPOB 3MEXA 5F39A 4IHYA 5ABJC 1ODMA 4L9BA 3SKVA 4PF1A 1O3TA 2ZGUA 1RUNA 4RS8A 2VJIA 4QX1A 1HRV3 1NAEA 3MWMA 4LUKA 1XGNA 2PG4A 4XJ8A 5LBCA 1ULDA 2OTJI 4CZSA 1J3RA 2V1UA 3K51A 3NJYA 5LATA 4HLYA 3S5QA 1YQ2A 4IE5A 2E2JJ 2R5ZA 4JHZA 5H6RA 4DQAA 4NC8A 1MNEA 2ATFA 1AR72 2OZ6A 1GR3A 5JZGA 3P9CA 1ENXA 2WNOA 5IAXA 1LOCA 3LEGA 1YG2A 4XBNA 3ZXEA 5IJRA 1BI0A 5CEHA 3FFZA 1OFNA 2DPUA 4KI5M 4U0WA 1B9NA 1Z7S1 3I59A 5CB7A 4FX0A 2A6XA 1LJ9A 1E57A 2K85A 3ZXSA 5GPCA 2VCCA 4ZYHA 1SPPA 3R4UA 1BK0A 2CSOA 2IXSA 3K1PA 1WCMJ 3CMAI 1VTNC 4EWEA 1VQMI 2KL4A 1TWFJ 4DZPA 4IRHA 4G7OF 1GVJA 1YX3A 2ZNYA 3RCOA 5ANQA 3PNTA 3RZHA 4XIDA 2O8QA 3CUQA 5HV0A 1XGMA 4Y22A 5HLHA 5CZKA 4EROA 4ZU5A 2Q0OA 1DU3D 4KN7X 1LDDA 1FPN1 2DTRA 4XF4A 2VVFA 1UJ8A 3ZMVA 3WHBA 2Z3YA 3PURA 1LOBA 2W39A 1AHSA 2XSDC 1R081 4XHBA 3GGLA 5H9RA 1D0XA 5B5EC 1FYMA 1OUXA 3OTFA 3S1QJ 4TLGA 1OOPB 3BI3A 2M8EA 3QPLA 3E5QA 3JRIA 2IS6A 4A41A 4LNVA 3DEWA 4ON0A 2E35A 4A3JJ 4HKLA 3BG9A 3PMSA 4ZHNA 4H7MA 2DCTA 4BWOA 3CDZB 4PLNA 2ZB9A 2YHJA 3W5MA 4CCLA 2GOXB 4MGZE 1IZ3A 1LFPA 4YVSC 5IUQA 5EGOB 3CU7A 4ZDOA 2X4HA 3S1RJ 2W91A 1VBD1 4QT6A 4FXGB 1SFUA 2WNVC 1LHNA 3GVAA 3Q9OA 2YS9A 4FOYA 1QJU1 5HXVA 1IGOA 1G3TA 3DEEA 2DBNA 2JRTA 1PP8F 4AI0A 4YM0A 4Q4Y3 1OH4A 1CESA 1VIWB 2ZMLA 3CIHA 5SV8A 1C5HA 2DU1A 1Y8RB 1O5LA 3TEDA 3WDWA 2GP3A 4BEHB 1N75A 4XCAA 2YDEA 5K8SA 4ZTJA 3LQRA 1W6OB 4IDZA 1WD3A 1OISA 2YBSA 2C1FA 1O4XA 4XNFA 1QA6A 2DUQA 5FUNA 5FB2A 3FXRA 5FZMA 3S15J 4XIOA 1FMD3 5LA9A 4LJHA 3GTPJ 2D40A 3WF2A 3PJRA 2HDCA 2KIMA 4JRAA 2NVUB 3V8KA 3ZXAC 2W1UA 3ZPOA 3T1MA 5BQTA 4NROA 2NVYJ 1RYYA 2K5CA 3BP8A 4AUXA 5K7FA 2E1CA 2EZIA 1UWWA 2K7LA 2VVDA 1ULFA 3RMYA 3B6CA 4YRDA 2A6VA 1VRH2 5I8YA 5FOBB 1OCOH 3K77A 2WR9A 3PO2J 3H50A 3WTTC 3ECHA 4U7DA 4K9SA 4CU8A 1OPCA 3AKPA 9ANTA 3CJNA 3FM3A 3DLAA 1MQTA 2CW8A 2Z5WA 3MIGA 2VE1A 3ELKA 2K9SA 2ET7A 3KETA 5JSPA 2NXNB 3WG1A 1AR71 3I64A 2NNYA 1XSVA 4LOCA 1CAXA 1UD1A 2FF4A 2O0YA 5KXCA 4F93B 2N7GA 2B63J 3NWKA 4XK4A 4FTSA 3CTAA 1NQJA 2DF7A 5C9AA 2I74A 2PHXA 4CDQC 2RS12 1VBC3 2J1UA 2FOKA 3OD0A 1PM4A 1R7JA 1IS4A 4COVA 2JRMA 4GB32 4H14A 3TWIA 4BDVB 2IAIA 1PX4A 2BW8A 4RQPC 3RWNA 1VBA2 1T6GC 3DXUA 3K7AJ 4Y5SA 2JTVA 2VXRA 3WP6A 3W2VA 2AH2A 4ASLA 3B7MA 5FYMA 4UUSA 1GOFA 2M5WA 1NA1C 2O6GE 4N0BA 3AG2H 1XNKA 4YG2F 4LMFA 3W58A 4A3DJ 2IGKA 3V64A 3CQZJ 5FZ4A 2DO7A 4BKXA 1V54H 1TTYA 3D5OA 1F36A 3T0YA 4B7EA 5EPAA 3DKXA 1Q3EA 3HT1A 5EXOA 4OYUA 3M3CA 5CU1A 5D4SA 1S0GA 3CMEI 2JA8J 1G8WA 3ACHA 1SEUA 3IDEA 1WJFA 2WL1A 4Q0SA 2EIDA 1DP0A 4YGEA 1REDA 3FZVA 4ZYEA 2OQRA 5J4VA 2VAUA 2GH8A 5JMOA 3N4MA 4IV3C 3ZKYA 1SVLA 3HRUA 2KIQA 3JREA 5IT9Z 4E7IA 4QGNA 4M9SA 1ONAA 2W95A 4OUEA 4ASKA 5CIRA 4S2DA 5FP9A 1XYPA 3U1DA 1ZR2A 1CIWA 5JDBA 3K69A 3WR0A 2ZBJA 3JU9A 4AEMA 2VMCA 3VB9A 2C24A 4HF0A 5FYIA 2DQLA 4A7YA 2BGPA 2PMHA 2HQRA 3FXKA 4GIQA 3UKTA 3ZN6B 2Q8OA 4BU2A 4QXCA 4OAYA 3E7LA 3AL5A 4KWLA 1FOKA 5EJZB 1FC3A 4AZZA 1IW7F 3EHKA 5FYBA 4IHSA 3N36A 1X9TA 2I07B 3KQ4B 1YE9A 4YSFA 1X1PA 2X6XA 4XBFA 2EIEA 5BNPC 3QOEA 2QQNA 2MG4A 3ZFEC 4DUXA 4A3EJ 4LKEA 3VD5A 5KHKA 2VKDA 4B4PA 4Q8KA 3WG7H 5FJKA 3KYDB 4KIBA 2RREA 5ICFA 1OLME 3OS0A 5FY5A 1ON2A 1CX1A 3N35A 2CDOA 1SAXA 1B09A 3H1WA 1IZ1A 3DPUA 5E3LA 3F95A 3BODA 4MG2A 2R5YB 1YO5C 1HOMA 4BQ4A 3H3VK 4OMCA 1M1EB 3BG6A 3VBHB 2JX9A 3F3XA 5FPLA 5F04A 3LSPA 4JKLA 3E6MA 4Y4YA 2PX9A 4BQAA 2IXCA 1NG0A 3LSDA 3W6KB 4LORA 2PLV3 4LOTA 4P9IA 5I93A 4ZDLA 4M9ZA 4L5JA 2E2HJ 1VRH1 2DBIA 4R9DA 5CFCB 3AYCA 1HB2A 4XRMA 3BOQA 2AACA 1V6OA 3LA2A 3ZFFB 2Y48A 3BG3A 2VBDA 2PJRA 4HBNA 3MKLA 3I8TA 4K3UA 3L09A 2W24A 5FYZA 2RKHA 3DGTA 4P96A 2M87A 1PP7U 3ZXDA 2VUDA 1ND2B 1YI7A 5IP9J 5A33A 1RMU3 1WUVA 1YJ9I 1K6YA 2LNBA 2PEXA 3MIDA 4X8PA 3TO6A 2MH2A 1UO9A 2QEXI 4OUMA 1WLCA 2M7BA 1FOD3 5DUWA 4A3GJ 1R5ID 2IXIA 3B94A 1QVUA 2F4PA 2QLZA 3KD4A 2VJ4A 2EIJH 3QPTA 2BVMA 3ZXLA 3VBUA 1LRHA 4HKWA 3PSFA 1W3XA 4ZZLA 2RS11 1VMHA 4X6AJ 2ZMNA 3S1MJ 3O2PE 1HJFA 3DV8A 4GB31 3RFRA 5KHGA 3O1UA 2ENRA 3MN2A 1VBA1 4MEXF 2HH9A 2VASA 1PM7A 5DAWA 5FY8A 1E0EA 5M3FJ 1NCQA 2C9KA 2R3SA 2XXZA 3WDUA 1XC6A 2HVSA 5M5XJ 3I2DA 5FDBA 4YIRX 3ZYPA 4D6SA 2M2EA 4QTRA 3S5AA 3AJZA 4GYGA 2NZ9A 4WZFA 1FATA 3BR0A 2VOTA 2VZOA 2I8DA 4EEFG 2HKXA 4XJZA 1APNA 1D2QA 3ZYRA 2ZEZA 1BQPA 4BQ3A 1KONA 1W03A 4IL7A 3QP5A 3WDVA 1O59A 4FPFA 4EATA 2JENA 2WT2A 3A1YA 3HC7A 3ONQA 3N7KA