3LOBA

Crystal structure of flock house virus calcium mutant
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
340
structure length
312
Chain Sequence
TAPVPQQTRLSQPGLAFLKCAFAPPDFNTDPGKGIPDRFEGKVVSRKDVLNQSISFTAGQDTFILIAPTPGVAYWSASVPAGTFPTSATTFNPVNYPGFTSMFGTTSTSRSNQVSSFRYASMNVGIYPTSNLMQFAGSITVWKCPVKLSTVQFPVATDPATSSLVHTLVGLNGVLAVGPDNFSESFIKGVFSQSACNEPNFQFNDILQGIQTLPPANVSLGSTGQPFTMDSGAEATSGVVGWGNMDTIVIRVSAPEGAVNSAILKAWSCIEYRPNPNAMLYQFGHDSPPLDEVALQEYRTVARSLPVAVIAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Coat protein beta
publication title Structure and function of a genetically engineered mimic of a nonenveloped virus entry intermediate.
pubmed doi rcsb
source organism Flock house virus
molecule tags Virus
total genus 51
structure length 312
sequence length 340
chains with identical sequence B, C
ec nomenclature ec 3.4.23.44: Nodavirus endopeptidase.
pdb deposition date 2010-02-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3lobA00
3VBHB 2ZTNA 1RUI3 2WFF3 4IV1C 1AR81 1AR82 3JD72 1H8TA 1OOPC 3JD71 5CFDA 4RFT0 5DDJ3 4QPIB 2DF7A 1RMU1 3DPRB 1V9U3 1F8VA 3VBFC 1BBT3 5JZGA 3CJIA 4BCUA 2X5IA 1NCQC 1PO13 5L7OA 4NWWA 1QJY3 3ZFEB 3LOBA 1HQNA 1CD3G 1POV0 3NAPC 2FZ2A 4CEWA 1OPOA 3FBMA 4IV1B 1HRV1 1HRV2 1VBB2 2HWD3 2R072 1K5MA 1OOPB 2R071 5GKAC 1VBC3 1FPN2 1FPN1 4WM7C 2HWF3 2HWC3 1ASJ3 4CEYC 3VBFB 4QPGA 1HRI3 4N43C 1RUJ3 1NCQB 3J8F3 1B35A 2PLV3 4YVWC 5DDJ1 1R093 1RUF2 1RUF1 1NA1C 3NAPB 1D4M1 1D4M2 5DDJ2 5BNPC 2WLPA 2MEV3 4EJRA 1TMF3 1RUG1 1RUG2 5BNOA 1BBT1 1BBT2 2R043 1RUE2 1RUE1 1MEC1 4RR3C 1PO12 2GSYA 1QJU3 1HXS3 4WM7B 1PGW2 2XBO3 2BFUL 5C4WC 4CEYB 1AYN3 4N43B 1EAH1 1EAH2 4PDWA 1RUC1 1RUC2 1ZBE3 4JGYC 1PIV3 1AL0G 4YVWB 2RM21 2RM22 1RHI3 1VBC2 3VBOC 1NA1B 5BNPB 4GH4A 4YVSB 5A33A 4JGZA 1ASJ2 1QJX2 1QJX1 3ZFFC 1VB2A 2WS93 1HRI2 5AC91 5AC92 1VRH3 4RR3B 5FMOL 1R083 1IHMA 1H8TC 1AUYA 5D8AA 3ZFGA 1PO22 1PO21 5C4WB 5CFDC 2ZAHA 1TMF2 1R1A2 1R1A1 4IV3A 4WM8B 2R042 4JGYB 5FOJB 5JZGC 3TN93 1VBE1 1VBE2 1CJDA 3VBOB 2X5IC 1AYM1 1AYM2 1HXS2 4Q4X3 3VDDA 1AL21 1AL22 3VBUA 3ZFFB 2BPA2 1TME1 1TME2 4CEWC 1BEV3 1K5MC 1H8TB 2WZR3 1RUD1 1RUD2 4GMP3 1AR93 5CFDB 4CDQA 4Y5Z0 2HWB3 5JZGB 3JB8A 4QPGC 1PVC3 3CJIB 1A6CA 2X5IB 2RS32 2RS31 1B35C 5L7OB 1AR61 1AR62 1RB8G 1RVF3 4CEWB 4CDXA 4LLFA 5BNOC 2RS13 1K5MB 1FOD3 4AEDA 1Z7S2 1Z7S1 2RS53 2R063 1VBB1 4NWVA 1VBD2 1VBD1 3ZXAC 1FMD2 1FMD1 3JBG3 5A32B 4RQPA 3VBRC 1EV11 1EV12 2RR11 2RR12 4QPGB 1MQTA 4Q4Y1 4Q4Y2 4PDWC 1DDLA 1BEV1 1BEV2 4CDUA 1RUI2 1RUI1 1B35B 1ZBA3 2WFF2 2WFF1 4CDWA 2HWB2 2HWB1 1C8M3 4JGZC 5BNOB 4IV1A 4YVSC 1V9U1 1V9U2 4FTBA 1NCRA 1AR73 1C8NA 2WWSA 1PO11 2HWE3 3JB4C 5D8AC 3VBRB 3ZFGC 1QQP3 4FTSA 1QJY2 1QJY1 1GFF2 1PGW1 3VBFA 1E57A 4IV3C 4PDWB 1POV3 1FOD2 2R061 1QJZA 2R062 4WM8C 2HWD1 2HWD2 1X36A 4GH4B 1VB4A 1VBC1 3VDDC 4RHV3 4JGZB 5A33B 3VBUC 4GB33 4RS5A 2HWF1 2HWF2 2HWC1 1ASJ1 2HWC2 5ACA3 1HRI1 1ZBA2 1PGL2 1PGL1 1RUJ2 1RUJ1 4WM7A 3ZFGB 5D8AB 3J8F2 3J8F1 1COV3 1VBA3 2PLV1 2PLV2 4Q4V3 1R091 1R092 5BNNA 1C8M2 4IV3B 4N53A 4Z92B 2MEV1 2MEV2 4Y4YA 1TMF1 1AR83 3JD73 2R041 1ND3A 3CJIC 1QJU1 1QJU2 3VDDB 3VBUB 1HXS1 5CFCA 1BMV1 1BMV2 1NOVA 2XBO2 1RMU3 2XBO1 5C9AA 5L7OC 2BFUS 3VBSA 1AYN1 1AYN2 4CDXC 2TBVA 2Y26A 1ZBE2 1ZBE1 1PIV1 1PIV2 1RHI1 1RHI2 4CDQB 1NG0A 2BUKA 4RQPC 5K0UA 1HRV3 2R073 5C8CA 2WS92 2WS91 3VBOA 2QQPA 1VRH1 1VRH2 4SBVA 5FMOS 1ND2A 1R081 1R082 4CDWC 4CDXB 5ABJA 3M8LA 4AEDB 3VBHA 1NCRC 3TN92 3TN91 1RUF3 1SMVA 4Q4W3 1D4M3 4RQPB 4Q4X2 4Q4X1 1RMU2 1RUG3 2GH8A 4QPIA 1MQTB 3DPRA 1RUE3 1MEC3 4CDUB 2RMU3 4FSJA 2WZR2 2WZR1 4GMP1 1AR91 1AR92 5J98B 3ZFEA 4CDWB 1EAH3 4GH4C 2BBVA 4RS5C 1RUC3 5LK7B 1NCRB 1PVC2 1OOPA 1PVC1 2RM23 3IDEA 3HAGA 5A32A 1QJX3 1RVF2 1RVF1 5BNNC 4N53C 5AC93 1VAKA 2RS11 2RS12 1FOD1 1NCQA 2RS52 2RS51 3S6PA 4Q4W1 1ND3C 4Q4W2 1PO23 1R1A3 2FZ1A 3NAPA 3JBG1 3JBG2 1WCDJ 5CFCC 4RS5B 5C9AC 1OHFA 3VBSC 1MEC2 1M06G 2RMU2 2RMU1 1VBE3 1HX6A 1AYM3 3VBRA 1ZBA1 1RUH3 1AL23 1NY71 1NY72 1F2NA 5BNNB 1TME3 4N53B 4CEYA 5K0UC 4N43A 1C8M1 4CDQC 5C8CC 2VQ0A 4GMP0 1ND3B 1RUD3 2XPJA 1AR71 1AR72 4YVWA 1ND2C 1NA1A 5BNPA 1W39A 5CFCB 4YVSA 2HWE2 2HWE1 5C9AB 1QQP2 1QQP1 3VBSB 5ABJC 1POV1 4RR3A 2RS33 3VBHC 1AR63 4FTEA 4AEDC 5J96B 5C4WA 5K0UB 4RHV2 4RHV1 4QPIC 4GB32 2ZZQA 4GB31 4WM8A 5C8CB 1Z7S3 3DPRC 5ACA1 5ACA2 4JGYA 2IZWA 1VBB3 1MQTC 1ND2B 1RUH2 1RUH1 1VBD3 1FMD3 4CDUC 1X33A 1EV13 1COV1 1COV2 1FPN3 1VBA1 1VBA2 3ZFEC 2RR13 4Q4V2 4Q4V1 3ZFFA 5ABJB 4Q4Y3
chains in the Genus database with same CATH superfamily
1OURA 4PI2A 3IT8A 3DYOA 5BYNA 4CCCA 2EXKA 4XAEA 3GNEA 2VZPA 1OFSA 4W65A 5EV7A 3JD72 1OOPC 3JD71 4Y22A 4E27A 4I2OA 5FDBA 3POSA 4DUVA 4URTA 3TRSB 2X09A 1XYPA 1ZRCA 2ZGKA 2PHUA 3OCPA 3WDUA 3THPA 2EIGA 2Q8DA 4NAOA 2DF7A 2IVIB 2VECA 5HXMA 3WNKA 2VVDA 2VZRA 1H30A 1WD3A 2RVAA 5JZGA 4FPLA 2Z2SB 2X5IA 1DGWA 1ZRRA 1GP5A 1WLCA 2LRPA 3ZYPA 1RTVA 2ZGSA 3O1VA 3UESA 3ZXDA 2J1TA 5CNAA 1POV0 3RYPA 5F2SA 1PHMA 4DY3A 1WA4A 2D6MA 4I02A 3ZR6A 4B7KA 3FBMA 3SC7X 4OHZA 5AC92 1VMFA 5F6LB 2YDEA 4XF4A 4QDSA 2QQVA 1K5MA 2JEMA 1YJKA 3ZVXA 4BK5A 1TEIA 3I2GA 1J58A 2SBAA 3RFRA 4CCMA 2VCCA 4IW3A 5FZKA 1FPN2 1FPN1 3ILRA 4GWIA 4P14A 3O14A 2B45X 5FKCA 5FTTC 3VKNA 5FWJA 5JOYA 4I0WB 4XTMA 2HH9A 2DVBA 1GV9A 2Y6KA 1JODA 4OULA 4QPGA 1P8JA 5L9BA 1HRI3 3B01A 4N43C 2PQSA 4QGLA 3CLPA 4CP2A 4D7TA 4HT1T 4S2FA 5JMCA 2ADDA 5FY9A 4GWMA 4EQVA 1BQPA 2TEPA 4L9BA 4BWOA 1W6QA 5DDJ1 5DDJ2 2RDRA 4FQ4A 3IZOA 2VNGA 2R30A 4OMCA 5BNPC 2MEV3 2E6VA 1CIYA 1V6KA 4D69A 1TMF3 1GWMA 2DFCA 2JJ6A 5FY5A 5EXOA 1L7RA 1BK1A 2BEOA 3HNBM 5BNOA 3T2TA 5KHHA 5KHGA 1ENSA 1UKRA 2WZPP 3ZXGA 1HB4A 4K3UA 2MNGA 3T0AA 4EZ4A 4XJWA 2XR4A 2V5YA 2XL7A 4LXLA 1PO12 3BTZA 2VW1A 3WNNA 1PK6A 1WW6A 2VW2A 3I59B 2EXJA 5CAZA 2BFUL 2W1WA 5EP9A 5A7WA 2XMLA 1AXZA 1UXXX 1RITA 4BXFA 5IATA 1RYYA 1PVXA 1W2UA 1D7PM 1ZA4A 2I45A 2VGDA 2EIEA 3LA7A 3V0BB 1H2MA 2GN7A 4TN7A 4JGYC 4YVWB 2B9VA 3LWCA 3WQ7A 1O3TA 1Y3TA 1ZVFA 2ID4A 3LIHA 4GD4A 1IG3A 2HKXA 5IVVA 1ASJ2 1VPHA 4Z07A 1VB2A 4GAZA 5FK8A 1XNBA 3RZLA 4IGOA 4RR3B 4ZPIA 4Q0QA 5K9YA 1OA2A 2EIBA 2VY0A 4V1PA 2XONA 4FOVA 2J1SA 1U12A 3TOJA 4A44A 2BOJA 3AKSA 2Q1FA 1QH7A 4FFHA 4XC9A 4XF1A 4E9KA 4ORFA 1CAXB 2VZTA 5C4WB 3AP5A 3FN9A 3WDXA 1CAWA 5I8SA 4MXWB 5DUWA 4XFGA 1SFNA 4KG8A 4BQ1A 1UNBA 3B3QE 4H14A 5F3GA 3VDAA 3WD5A 3W58A 2ZGLA 3CZJA 3C7FA 3MHZA 2JG8B 3OEAA 2VG9A 2B9UA 4Q1RA 5G05L 2LALA 5LK5A 5A6XA 3HR9A 1ZZ6A 1HXS2 1RXGA 4ONUA 5I0DA 4Q4X3 3FLRA 2ET1A 5JOZA 5ISLA 5I8TA 1AL21 1AL22 3ROUA 1K5JA 1SDDB 3VBUA 3ASIA 2BPA2 1LOFA 1RC6A 1TME1 1TME2 4MHRA 3AZZA 4U36A 3H42B 4YW2A 1W28A 2WL1A 4P5YA 3T09A 1YIFA 4XCBA 1EUTA 2Z5WA 3MV01 3A0KA 3GZUC 3K77A 3OGSA 5FZEA 3AVRA 1BEV3 3HD8B 4MLOA 4Y22B 3KT4A 5HV4A 1JYIA 2P3KA 1RUD1 1RUD2 3SH4A 1I9RA 3LDRA 3FL7A 1YFWA 2WBKA 4Y26A 1N1TA 1AZDA 3CQOA 4M3CE 1ZZ9A 2XJQA 3UKNA 2BYVE 5C33A 2GC1A 1IKPA 2XJPA 3MI8A 2AZ5A 3ZXJA 3LCPA 4QB1A 5JZGB 3MIGA 3IDBB 1PVC3 3S0MA 3APBA 4LHKA 4XHXA 2E7QA 1A6CA 3RYKA 2X5IB 5GLVA 3NW4A 1C57A 4JQRA 3WQ1A 2UYBA 4DPNA 5JSPA 2CHHA 1OQ1A 4JVAA 1OFNA 2ZGPA 1RVF3 2WUHA 3A22A 2B4KA 4Y5SA 3UKVA 1MZ5A 1JYWA 1J84A 1FV3A 5C7GA 3PVOA 2HYKA 4DMIA 4CYDA 1K5MB 1FOD3 4KH9A 4KNCA 3HN1A 5BUVA 1XSRA 2VD7A 3RDIA 2R063 4ET7A 3MPBA 1YJLA 2BDRA 5FREA 1E5SA 2WSVA 3AP7A 1VBD2 1VBD1 1YC61 3DKWA 3Q8EA 4BIOA 1ZRFA 4IGPA 1DGRN 4EWDA 4META 4YNIA 3VBRC 2QFEA 3RG0A 1SLAA 5A1AA 1PM4A 1QOTA 1I5ZA 1O4ZA 1O4TA 2RR11 2RR12 3I3BA 4QPGB 3VD3A 5EWSA 1NQDA 4OLLA 2OS2A 1DDLA 1H9WA 1VMHA 2BOIA 1RUI2 1RUI1 1ULGA 3WQ0A 3ES4A 3R4SA 2WFF2 2WFF1 1FNYA 3W5MA 2YV8A 1R1ZA 2GU9A 1W6QB 3S57A 5A70A 5A3OA 1C1FA 4IUGA 3DKQA 3WF4A 4AE2A 2VZSA 4COZA 2VBBA 4CDWA 3TEXA 3T3YA 3J4UH 2DDUA 5BNOB 1UD1A 3NJZA 5DAXA 3RZMA 1IPKA 2DU1A 2JE9A 1CIWA 2AH2A 2RG4A 4AGGA 1AR73 4TSVA 4UXAA 3PU8A 5A6YA 2QQWA 2DBIA 4R4XA 2EALA 5E8AA 1PK6B 3M70A 3ZFGC 1JYVA 5D8AC 2YPJA 3BVCA 1KQRA 2VUJA 3RS6A 1QJY2 1QJY1 1GFF2 5DMYA 1FI2A 4SLIA 5KBFA 3VKFC 1CQ9A 3S5QA 4QHZA 3U78A 1PZ8A 2D5HA 3IDAA 1UMHA 1W9TA 3AMQA 1FT9A 1QJZA 4XJ8A 5BY5A 5I0RA 3UV9A 2ZGQA 3A0NA 2VBPA 2P3IA 2ERFA 2D43A 3H7JA 2XLGA 3CJXA 3MF6A 3FHQA 1VMJA 3LB9A 4EV0A 2ZGTA 3DN7A 4FFIA 1BZWA 3HMYA 1LENA 5IFPA 1H4GA 1HW5A 4RS5A 3JQXA 2J1VA 3U0ZA 2H6BA 3U14A 5ACA3 2FDFA 4HL0A 2XUEA 1HB2A 1W06A 1ZBA2 2ZKNA 3OOXA 3WEZA 3AYEA 1RUJ2 1RUJ1 4WM7A 1O6UA 4NHLA 2LM3A 4C0HA 4AR2A 2XVKA 5FUIA 4N7IA 5ERLA 5HI0A 4AHWA 1CAWB 1KEXA 2CAUA 1C8M2 1Q8QA 5LA1A 3POBA 3PMEA 3ZPOA 4H3WA 5FP8A 1ZRDA 4GIQA 2PHXA 5F9TA 2VCBA 1GYKA 3DF0A 3H9AA 4CCJA 5FLHA 4LKFA 3JD73 1H1IA 1YRZA 1N3QA 5CU1A 3KS7A 1JBCA 2XVLA 4XFBA 4YPJA 4DZGA 1QJU1 1QJU2 3K3NA 3U11A 1W0OA 3VBUB 5FWEA 4KU7A 1BMV1 1BMV2 1HJGA 3ZYJB 2W91A 1LHVA 2ARAA 3I2DA 4OYUA 3VBSA 4Y1ZA 5BNQA 2YGLA 5F5CA 1YNAA 3ELNA 5E1RA 5GZEA 4ZZ5A 4CDXC 1Z78A 3AMHA 4OI4A 1YO8A 4LTAA 2TBVA 1JZ5A 5E89A 3WQBA 3N7KA 4PCRA 4YFWA 1OUXA 1ACCA 3KQRA 2QBXA 4K8FA 4KG0A 1LHUA 5FPZA 3CDZB 5KXEA 4X8PA 2OIIA 1LOAA 3KQ4B 5F32A 1MZEA 4RQPC 5K0UA 1U5YA 5JR2A 5KXCA 4QPWA 4LHNA 3VBOA 3GBFA 3MYXA 5JOXA 4SBVA 1YQ6A 4N90A 3VKMA 1ND2A 2VZVA 1JTZX 4KBBA 2JKBA 5E16A 4P00B 2LW8A 1ZZCA 5JXJA 1UIJA 4XETA 4PIYA 4JRLA 3RGBA 3WNOA 2PMWB 1Z0HA 2YBPA 1DBNA 2WA4A 4BQ3A 2BGPA 3LDKA 5ABJA 4I3PA 1LR5A 1O8PA 4CXXA 1YI9A 1ZZ7A 2XHKA 4NO4A 5LW9A 1WCSA 3WLUA 3R0RA 3D0SA 1NAEA 4HXCA 3ZYHA 2ZX0A 4UWDA 4IEQA 4MYEA 4Q4W3 4FP2A 1V6LA 2ZGMA 5EYYA 3VLBB 3WW4A 3FFQA 1I1EA 4LJHA 5A1LA 4QX3A 3KGZA 4QPIA 3GHNA 4YLZA 2HEVF 3LFIA 5T5LA 3WNMA 4LMFA 1I5PA 5A7OA 5LEJA 1XU2A 2PAMA 2RMU3 2VUDA 3H3LA 4JDNA 2AENA 1NQJA 3SH3A 5FPAA 3ZIXA 3H1WA 1NZCA 4Y20A 2R49A 5HBAA 4LORA 1PM7A 3MICA 4GJYA 4R9AA 4CDWB 4AVSA 2Q8OA 3TEYA 3POJA 3FHAA 2P2KA 4Q0VA 3DYPA 2PAEA 3M3OA 1OA4A 1G9DA 5LK7B 2XQXA 2ES3A 1UXZA 2JE8A 4PHZA 4ISQA 1OOPA 3B02A 5I0TA 4JTNA 1XNAA 5JXHA 3T2PA 3HAGA 5CBLA 5CZKA 2BNMA 3JU9A 1W6MA 3VD7A 3UETA 2D5FA 3AL6A 4AXOA 5BNNC 1NKGA 1I3HA 2DWRA 4NHKA 3TEWA 4GWNA 4PBPA 3TEZA 1GZWA 4XBQA 4UFKA 2VULA 4BQWA 2E31A 1O5UA 4XXPA 2FDIA 2RS11 1IS3A 2RS12 2HEWF 2YU2A 1OPMA 2Q8CA 1D0HA 4CP0A 2Q4SA 2QQUA 3BIWE 4CUAA 1W8HA 1U5IA 1MVEA 2FZ1A 4H55A 4KU8A 1WCDJ 2ENRA 3B9CA 5JSOA 4RS5B 5C9AC 4D6RA 1OHFA 1H2KA 5SV8A 5C3SA 2RJ2A 4A3ZA 5EZWA 5M0TA 1W9SA 1HX6A 1XPWA 5LBEA 2OUHA 1UYPA 1AL23 3ZN4A 1KDMA 2WO7A 1UZWA 4JX0A 2HBTA 4AK3A 5C6CA 1TME3 2B39A 1OLRA 2VW0A 3KV9A 1IS4A 1PGSA 1U5XA 3WXPA 1H4HA 4FFFA 4YW5A 4N43A 1N47A 1CPNA 4MGKE 3RZGA 2XL9A 2QQOA 2WNUC 3JCIA 4ZS3A 2WNOA 1QH6A 2DCZA 1RUD3 3C7HA 3KVAA 1JXNA 1YLLA 1PZ7A 2X10A 4NPMA 4XW3A 4BLIA 2XPJA 1OI6A 3NV2A 4LUMA 4XDPA 2YUEA 5BNPA 2V73A 3O1RA 3ZXKA 4AHYA 2WZEA 3VBSB 3IN9A 2ZS6B 4QGNA 2A3XA 3M4FA 1OQEA 4K21A 3KM5A 1POV1 2A71A 3VBHC 4O65A 2VNRA 5IVBA 1W8OA 3AFGA 2CDOA 3OPZA 5T50A 3GF6A 4XE9A 2GDFA 3ACHA 1NE4A 4NMIA 4CE8A 5K0UB 2EXHA 2ORXA 4M3CA 3U4SA 5JVVA 3R05A 4IGQA 1UO9A 2WSUA 3DPRC 2YGMA 3KCCA 3DEMA 2IZWA 2QE3A 3OUIA 4JGYA 3JUUA 4Y1XA 1ND2B 1IZ3A 3TAYA 1VBD3 1UY2A 1REEA 1M4WA 4COUA 1X33A 2CSGA 1COV1 1COV2 5FRAA 1KFUL 3NV3A 4RGGA 2IVJA 2RR13 5FBZA 3ZFEC 2BGOA 1PZ9A 2ZHKA 3VHRA 3T2QA 5ABJB 1IGOA 3I2FA 2CU5A 4OUMA 4X6RB 4UI9L 1Q8SA 1RUI3 1UX6A 3OSDA 4HPKA 3CEWA 2XDVA 2WFF3 1YYNA 2YXSA 3WT3A 4IE4A 1AHSA 2VOKA 4ZY9A 4BE3A 3N7JA 4MGZE 2VVEA 1HQLA 1OLME 1WGPA 1W6OA 3HIFA 3F95A 4FI9A 2OW4A 1QJFA 2YBSA 4QPIB 3ON7A 4ZU7A 4D3WA 2IXLA 4WVMA 2GH2A 1VRBA 5FZOA 3ZIWA 3ZM8A 4GWJA 1F8VA 5FPVA 1BBT3 2P3JA 4RYDA 3HPNA 5D21A 3H1YA 4BCUA 1V6JA 5GJ6A 2ZHLA 4Y20B 5FPUA 1NCQC 4AYUA 1FYUA 1CZSA 1TNRA 2XKPA 1WMFA 3K2OA 4NWWA 2CDPA 2WZ8A 3I97A 1NXD1 1QJY3 4P9JA 1DZRA 3FX3A 4IE5A 4XYXA 4RA0A 5FZ4A 5A3WA 3PU3A 3NAPC 5FZFA 2XLFA 3MUZ1 3S7EA 2A7AA 1W90A 3FJSA 1GQGA 1UN1A 3OB8A 4QQPA 3AKTA 2XOMA 4Y1YA 2PA7A 3N3HA 1HRV1 1HRV2 1VBB2 4LO5B 2P6CA 5FOBB 1OOPB 4XJZA 3T1MA 2R1BA 5GKAC 3OBZA 4P9GA 2WA3A 3VZJA 5IHRA 2QZ3A 1W6MB 2DFBA 3OGVA 1ULOA 4QQOA 4WM7C 5A3MA 3AKQA 4I0BA 4Q0SA 1GZWB 3PTRB 1OA3A 4GQ7A 1O8SA 3AJZA 1RUJ3 4FPGA 2ZEWA 3CU7A 2QDNA 4LPLA 3HNMA 1ODMA 4H7LA 4PLOA 3RZKA 5GZCA 1JYTA 2DCJA 2XLAA 2YROA 3OF1A 4QB2A 4EN6B 2EIDA 5FYHA 1WMEA 2WLPA 3SH5A 1LTEA 1GANA 2JDYA 4EJRA 2F4LA 5GALA 4EROA 4URAA 4XQDA 1RUE2 1RUE1 1UOJA 1MEC1 2B42B 1FNZA 1S2BA 1QJU3 2C9AA 1UOGA 3M7AA 4LHSA 5C3OA 3O1UA 4BA6A 2Q0AA 1SLIA 4CVUA 1PGW2 4BQXA 5FZGA 3KZ4C 4IETA 3N9LA 3VKLA 4DIQA 4IE7A 1J83A 1E5RA 3GBWA 2JDNA 4U2AA 4N43B 1EAH1 1EAH2 2E33A 2ZCWA 1TQ5A 4DRRA 1YXWA 2K46A 1RGSA 5K4LA 1RUC1 1RUC2 1WCUA 4LBJA 2VC9A 2WT1A 2J1UA 2XG3A 3KWVA 2BQPA 3RJRA 2V5DA 4AVVA 4L92A 3VBOC 1VBC2 4MADA 3VB9A 3Q9OA 1JU3A 3WDWA 5BNPB 4AHZA 3S7IA 5IK4A 1X82A 3SEEA 2WNVC 1QIQA 1JOJA 4D6QA 5FUPA 1QJX2 1QJX1 1MVQA 4XBLA 1HIXA 4MGIE 5DN2A 5AC91 2YC4A 5FKBA 2VCMA 5T5JA 4HBNA 1O91A 2CAVA 3H3ZA 4YGDA 2CTVA 2W2IA 1W6NA 3MPPG 3QLQA 1DGLA 3I8TA 1XJAA 1IHMA 3ZFGA 5D8AA 1GKBA 2YHJA 1PO22 1PO21 1QDOA 1UOFA 5CFDC 2ZAHA 4P9LA 3ZXLA 1JUHA 1VP6A 1DZQA 1U0AA 1W99A 4M3CB 3WP3A 1TVGA 1ZA7A 3SLIA 2R042 4KMQA 3AYDA 2A73B 3PLQA 4K7JA 3SCGA 2OUJA 4BXSV 1PMJX 2OT7A 4JGYB 4MH0E 2JB4A 5F1RA 3RI8A 1VBE1 1VBE2 1CJDA 3LEMA 2A5ZA 1UIKA 5FBJA 4NE9A 1HB1A 1W8TA 2ZA9A 5I0SA 5JOWA 4FPOB 4ARXA 5IUQA 4Y5TA 2A75A 2XQRA 5LB6A 3UJOA 3ILNA 4LIUA 1OH3A 5FP4A 5FYIA 4EYUA 2ZEYA 1N1SA 2ET7A 5C8WA 4CEWC 4HPKB 2WQZC 3NO8A 1RJ7A 1UY3A 4DB5A 2JENA 3WP6A 3I2HA 1LOGA 2OVUA 1DZTA 2A3YA 4AI9A 1OXCA 1T6GC 1MZ6A 2H6CA 4V2VA 1C4RA 3WG1A 1W6OB 4CDQA 4YW3A 2Y33A 3BU7A 5HPOA 1JYNA 4Y5Z0 4DY5A 2HWB3 1AX0A 1OC1A 4M3CF 2BWAA 4RGAA 4WVMB 5E6HA 5FZOB 4QM9A 5FZ1A 3JB8A 3POGA 4HK9A 4J25A 1ST8A 3EXUA 2E7AA 3FBYA 2BNOA 4Q29A 2Q8EA 2D97A 2PQQA 1S0GA 1GMMA 4UFIA 1RB8G 3FUQA 3OGJA 1RJ8A 2DVDA 5FLJA 4P9IA 5FZ8A 1UU6A 4KGGA 2VUCA 1SLLA 2YC0A 4CDXA 5H9RA 1WW4A 4OI1A 5IYYA 2BV4A 1W3XA 2RS13 1FATA 1DGWX 1F15A 1LJ7A 4DINB 2Z42A 4IL7A 4NRQA 4Z82A 2GP3A 1LHWA 3O0WA 3WVJA 2ZXQA 5JSRA 4UW6A 1O7FA 1QOOA 5IK7A 3ZXAC 1FMD2 1FMD1 1G9AA 4OI0A 4RQPA 2RJKA 5LATA 1EV11 1EV12 1DHKB 5APAA 4YARA 2C26A 2Y6HA 4DUWA 2V4AA 4DXTA 4NN0A 4WV8A 4Q8KA 1FV2A 1W8WA 3PUAA 4XIKA 1NX9A 3GM8A 2VCAA 3I2JA 4Q4Y1 4Q4Y2 1GWLA 2VU9A 3MFAA 3UGHA 2NM1A 5LZ6A 3W9AA 1BCXA 2TNFA 4TXWA 1LEMA 3BTXA 3G7DA 1FX5A 1KXGA 4P08A 5DZFA 2CGPA 3CIHA 4QAWA 2QZ2A 4LOSA 3ABZA 2DUPA 4RD7A 3LOIA 4LITA 4E2GA 1QKQA 2YZ4A 2FDJA 1LCLA 1UPIA 4JGZC 3K51A 4IV1A 3NNFA 1F35A 1OD3A 5CKMA 2W92A 1V9U1 1V9U2 2K2SA 1DYKA 2TUNA 1LODA 2D40A 3BPZA 1PNGA 4QKNA 1JZ8A 3LA3A 2J1RA 5FYMA 4LT5A 2G19A 1PO11 3JB4C 3ALQA 1D0GA 2OX0A 3VBRB 4ES9A 3AMPA 2WABA 4Q2FA 4UFHA 2JDMA 1AXKA 3VBFA 4F3JA 1JYCA 3W21A 2GC0A 1E57A 3AZVA 4W4ZA 4IV3C 4EZHA 2DTYA 1POV3 4B3NA 3UJQA 1ENQA 5IAXA 1YHFA 2E7TA 2ZZJA 4AI2A 4Z2AA 1NLQA 1ULFA 2JB8A 2P1BA 1H6YA 5DAQA 1X36A 2DUOA 2OZ6A 4FPHA 3HBZA 3ECQA 5JCTA 3FUOA 4CUCA 1MZFA 4FVVA 3GJBA 3U4XA 1JZ2A 1C3HA 1QDCA 1Y9GA 5DG2A 4AG4A 4ES8A 1UYYA 2HWC1 1ASJ1 2EAAA 2HWC2 2J7MA 4NRMA 4BMBA 3O1SA 3MW3A 1W6NB 2BVVA 4XZPA 5EJ1B 5BPXA 1C5IA 4RL7A 4LR4A 4MGTA 5CADA 2Y38A 3ZFGB 5AFEA 5D8AB 5FZIA 2NN8A 3AP6A 1COV3 1G7YA 2Q1MA 2PLV1 2PLV2 1GNZA 1PX3A 1GOGA 1LKNA 1W04A 3LEGA 1H8VA 5BNNA 4M0HA 2KXLA 2W46A 1GLHA 3DUIA 5EHDA 4Z92B 4Y4YA 2O14A 3U10A 3B69A 5A7PA 4NOTA 3WNLA 3R4DB 3RRDA 3SEPA 3GCXA 3WG4A 4QXKA 3TNQA 3WUCA 1VJ2A 1ZREA 1W3VA 3ACFA 3CBNA 2CY6A 4IERA 5CB7A 3DCQA 3C8XA 5F5QA 4AQSA 2C9KA 4PLNA 3H0OA 2PHDA 4FFGA 4IQPA 3WP4A 2QDRA 2Y6GA 3O7OA 3VZMA 4R52A 1HXS1 5FXWA 5C9AA 1NUKA 1G9BA 1GZTA 1V6MA 3O0XA 4ZU5A 1AYN1 1AYN2 4DXSA 3ZN5A 4BQ2A 1GZCA 3KVBA 3NQHA 4XILA 5FZCA 2Y26A 3NJXA 2RJLA 2IXCA 4H7MA 3V56A 1YFYA 1H1MA 1ZBE2 1ZBE1 2D6OX 5FYBA 2E63A 1G86A 1RHI1 1RHI2 4AFBA 3TB0A 4CDQB 1DLCA 1NG0A 1OLMA 5B2GB 5J36A 3GXUA 2VR4A 3IIIA 4LBQA 1DQ6A 3H8UA 4TWTA 4BQ5A 3AJYA 2FCTA 3ENRA 3GYDA 3I3EA 1HRV3 4G4FA 5DAVA 3TYJA 1O5LA 3ZMOA 2P34A 2WNUA 2WS92 2WS91 1S0DA 5DZEA 1VRH1 1VRH2 5FJHA 3THDA 2O0OA 3D8CA 2VMGA 5FZDA 5FMOS 4QPYA 1E5IA 1CAUA 1R081 1BLZA 1R082 2WQ8A 4FP3A 4MX3A 3WX5A 4EN8B 1DF0A 1XQNA 3V64A 1UY4A 4E4SA 5KWRA 3RZJA 4CDXB 1FAYA 3NNJA 3MW4A 2NMNA 2C4XA 2WWJA 3FLPA 3WF3A 2J42A 5FYTA 3VBHA 3GBGA 1LGBA 5A6ZA 2XUMA 4CCKA 1CONA 1NCRC 4L97A 5EQUA 3N4MA 1UZVA 1SMVA 1NXMA 1EYBA 4OVEA 2HJIA 3B9IA 5H9PA 3WNXA 3ZSJA 3SKVA 4RQPB 1RMU2 1WCKA 1KITA 1W6PA 5FLIA 1LOCA 4A42A 2NPIA 2OA2A 2GN3A 3DPRA 3LQCA 1RUE3 5AVPA 1MEC3 3ZYGA 1SPPA 1JZ4A 1GP4A 1KS5A 1BJQA 3AX4A 4JCKA 2E51A 1WCQA 2A6XA 4AVTA 3POWA 2Q1ZB 4D8MA 5JMOA 4A6SA 1IQDC 4XHBA 1AR91 1AR92 1N1VA 3NWKA 4XBNA 3OTFA 3ZFEA 2UY8A 4E2QA 1GUIA 1XE0A 2PHWA 1CGPA 3PJQA 1EAH3 5KHIA 2RDSA 1EUUA 1O3SA 3WHTA 2FCUA 3OYWA 1RUC3 3GALA 1XNDA 4XAAA 4UBGA 1IS5A 1GBGA 1MS8A 2C6SA 5FZHA 1E5HA 3OPWA 3HNYM 4MV2A 5A32A 1SBDA 5A3UA 5LWBA 4XEZA 1ZZ8A 4XF9A 1DP0A 1CPMA 1QJX3 3MEPA 3MZHA 4N53C 5AC93 5A7WB 4FPJA 5T3NA 1SFPA 1TNFA 2PELA 3BODA 2PYTA 2HYXA 1DCSA 3MIFA 1QNWA 4QX8A 1V0AA 4A6OA 4ARYA 2CYFA 3Q8FA 3HN3A 1VIWB 1NCQA 2ZX3A 3MIEA 4KWJA 1APNA 4XUOA 5K7PA 1JHNA 1PO23 2NYYA 4BISA 3LPGA 1IQAA 4AEMA 2PN5A 3RI9A 4IEUA 5F8PA 3NAPA 2WKKA 3NMBA 3JBG1 3JBG2 4HFSA 4YSFA 3OPTA 5GLUA 5CFCC 5JXGA 1PX4A 3ZN6A 2D6KA 4JKLA 4ZKTB 3L9JT 3WDYA 2B8MA 1POQA 2KD7A 2YBKA 4LO6B 2H0BA 4YM1A 4YM2A 3MLJA 1VBE3 3ZPYA 1ENRA 4ZZ8A 5FQ0A 2P5BA 5KHKA 1UYZA 3BOWA 1QU0A 5DPNA 1OVPA 3N9QA 2E9QA 1DYPA 1ZBA1 4C1XA 4COVA 1NY71 1NY72 4P9WA 4FAHA 2W1QA 1XB9A 1W9FA 1KDKA 5BNNB 4LIVA 5L9VA 3IMMA 1UU4A 3H1MA 2W39A 3VD5A 1F5JA 3DYMA 2X29A 4DNYA 2CNAA 5C5UA 1C8M1 4FQZA 5LRSA 3HEIA 4CDQC 5A7SA 5C8CC 1YIPA 3FHIB 3HQUA 5FY8A 4B29A 4GMP0 4QQ2A 3ZSMA 2DYCA 1A8DA 1RXFA 2VOTA 1XE8A 1SFYA 3D82A 4XFCA 4I3GA 2PTMA 2X8KA 3KT7A 4OCTA 1Q8PA 1YQ2A 5C9AB 1QQP2 1QQP1 3MIDA 3RWKX 3VZKA 4CPBA 1T2XA 4X8NA 3ZLIA 3M3QA 5C70A 3OD0A 4RGKA 5A3LA 2BNNA 2I2SA 2GNTA 1JN2P 1Y43B 3RZHA 5FZ6A 3LA2A 3T0DA 2BZDA 3AZXA 4XTPA 3BIEA 3HT1A 3K46A 2YY1A 2JKXA 5FY4A 4AWDA 2R0HA 2NLRA 4LBQB 4RHV2 4RHV1 1H2LA 2P3YA 4GB32 2ZZQA 3I7DA 2IC1A 4GB31 4WM8A 3SNMA 2WNUB 4LOTA 2KA3A 5F7UA 3CHXA 2VZUA 2YFUA 1AX1A 1CAUB 2OPKA 2WQ4A 3PURA 1RUH2 1RUH1 4KGQA 1HV1A 5JPMB 1FMD3 2WNVA 4NJ4A 4YW4A 3PJYA 1EV13 3MLLA 1VBA1 1FPN3 1VBA2 3H3UA 3OEBA 1JUIA 1V70A 2BBAA 3C2UA 2VAUA 4Q4V2 1XNTA 3AYCA 4Q4V1 4YGCA 4Q4Y3 3ZSKA 1ULCA 3E5XA 3VBHB 2ZTNA 4BB3A 4CCDA 5I0UA 5FY1A 4JC1A 4IV1C 5ANQA 2BRTA 2VTXJ 2Y6FA 3N36A 1GWKA 1LB2A 1XC6A 2XKOA 2OQ6A 3KGLA 4RFT0 5CFDA 4K1ZA 4AVBA 4B1MA 2VOWA 5DDJ3 2D3RA 1W6PB 1JOPA 4XABA 5IVCA 4NHXA 4MO3M 3DPRB 1V9U3 4CA9A 1GQHA 3AKRA 1SPPB 3J7NA 3VBFC 2IFRA 2NP0A 2GMMA 3E6DA 3K48A 4HKLA 1UPSA 1YFUA 1G6NA 4LUKA 2DCTA 2ZHNA 2ZMNA 1PO13 4UW4A 3UNPA 2VZOA 4IEXA 4AI0A 3ZFEB 3FLTA 3LOBA 1CD3G 1OKQA 1W8FA 3AK0A 4PQQA 2VUAA 1KFXL 1GICA 3L2YA 2WRAA 2FZ2A 2PFWA 3VGIA 1B09A 2JECA 1OPOA 4XXAA 4CEWA 2DVGA 3OYWB 3NKGA 4PF1A 2R072 2R071 3IDCB 1IOAA 4AEJA 2BTVC 2KR2A 4LBKA 1UF2C 4DFSA 3INAA 4YZ5A 4DOUA 2JG9C 2C0ZA 1UY0A 2G1MA 1IG0A 1QF3A 1ASJ3 2HWC3 3HVDA 4CEYC 3VZNA 4LKEA 1YI7A 3KMHA 5A1FA 2G4IA 4K1YA 3MIHA 1STMA 4BH9A 4OQ8A 5T55A 3V65A 1NCQB 1NYWA 1MS1A 1L3JA 4JAAA 3B5LB 2O8OA 2MPFA 2PLV3 4KWLA 1JU4A 5LRRA 4QDQA 2W9XA 4KWKA 1RUNA 3ETPA 3KF3A 1NA1C 1URXA 3NAPB 4ZXEA 2VMHA 1XYNA 3EQEA 4WBBA 2XH6A 3ZN6B 3OGRA 5IW0A 5FQ0B 4DXRA 3CL1A 4PIZA 4IEZA 2DV9A 4D7SA 2IXKA 2XJSA 4V2WA 4OUEA 1CZVA 3BI3A 1UZ0A 2OKXA 1ZRIA 1HXS3 4M4PA 4WM7B 5D2AA 2W87A 1RUOA 2ZX2A 4Y4RA 4TLFA 5CVRA 1AYN3 3SQOA 5LCWL 5TSWA 4Q0PA 2B5HA 1X8EA 5F5AA 4JTOA 1ZBE3 1QMJA 1AL0G 2NZ9A 4W8JA 2QQKA 1RHI3 3RZZA 5C5TA 4NR1A 1DYOA 4MXVA 4OUSA 4FT8A 3CZUA 4JGZA 4QT6A 5A33A 1OF4A 5LEKA 3SXWA 3SKJE 3ZFFC 3V0AA 1PMIA 3H7YA 2WS93 1W9WA 1HRI2 4MG2A 4JRAA 1TZOA 1XXNA 4H2AA 1VRH3 4CU7A 4GJZA 4QQHA 1ZYBA 5FMOL 5A3NA 4BIFA 2D6PA 4AW7A 3LKJA 2V09A 3A4UA 5FO9B 1R083 1DLLA 4WVZA 3VUOA 1H8TC 1KGYA 1DG6A 2J1EA 1V00A 3QOPA 4AL9A 2FMYA 4Z1VA 1JI6A 3EB7A 3T0BA 2A6ZA 1TMF2 4OMDA 2YYOA 1R64A 4QD2A 4XJUA 1W9YA 4IV3A 3WW2A 3B7MA 4WM8B 4NIIA 1S0FA 4CXWA 5KXDA 1IPJA 4E2SA 1KRIA 1UYXA 3NKTA 1WBFA 1LU2A 1CJPA 1YWKA 4IEVA 3GHMA 3VBOB 1JZ7A 1MR5A 2WNVB 1WA6X 1KJRA 1RL3A 2XWBB 5FP3A 4C91A 4QXCA 3AYAA 5K8SA 3EMRA 2Z4FA 1ULPA 1F31A 4JDMA 1SEFA 2L9LA 3KHCA 2ETEA 4GZ9A 3T2OA 4CCEA 1GNYA 5A7QA 4YW1A 5GLZA 3DECA 5H9QA 3M3EA 1LHNA 2FDGA 2VOXA 1AR93 5CFDB 1K42A 4AZZA 4AGRA 3BB6A 1OMIA 3GZTB 4FOYA 1MS9A 3ZXEA 1HDKA 3ZYRA 1F9KA 4E8DA 4K8RB 1GZ9A 3VL8A 2QNKA 5HCHA 1BXHA 1XYOA 3O1TA 2BGCA 3PL0A 4F83A 4TTGA 2V72A 1OF3A 5FO7B 1B35C 1Y9QA 3U1XA 5CKNA 2PHRA 4XVHA 5IVFA 1LGCA 1QWRA 4A7YA 3IPVA 4YZ4A 4CEWB 5FCCA 4A7ZA 4GKYA 4CZSA 1QY4A 1SZBA 4C90A 2PXJA 4FXKB 1Z7S2 1Z7S1 1L7QA 1VBB1 4QXBA 4C1WA 3D0JA 3UKTA 1GU3A 1ZM1A 3D5OA 4NWVA 4DXZA 3KD4A 3JBG3 1XBFA 2EF6A 3SISA 4A2UA 2XB6C 1OUSA 5IT6A 1UU5A 1CN1A 2VZ3A 3T4HB 3FWEA 4LO4B 3M3CA 1HKDA 1MQTA 4QDRA 4KQ7A 3LIGA 4PDWC 5FPBA 4EWEA 4CXYA 1BEV1 1BEV2 2GAUA 4HOOA 2H0VA 4FXGB 5FYVA 5J37A 1ZBA3 2WFPA 2XJRA 1GOHA 3UT0A 1CWPA 4OHYA 2CL2A 2VM9A 3MBWA 1C8M3 2ZBJA 4XCAA 2IFWA 4QM8A 5B4XA 2IUWA 3AL5A 5BXXA 5F3CA 4MGQA 1DQ1A 1YQ5A 4FTBA 4OI2A 1NCRA 1S55A 4LO7A 4I30A 4LLOA 4C0BA 4XF3A 2QJVA 3AP4A 3L2HA 2R16A 5DQ0A 3RMYA 1QQP3 3LEIA 4R9CA 4W6YA 3WNPA 4JKKA 2BW8A 3PUQA 1PGW1 3LDBA 3K4ZA 4AAXA 2VNOA 1N3OA 1FOD2 4RSUA 1US3A 2R061 2R062 4LK6A 3PTYA 4WM8C 4LBOA 4D94A 1BHGA 2HWD1 2HWD2 4KBZA 3H8XA 1WKYA 1H6XA 5DUXA 2VQUA 3W5NA 4AGVA 3RYRA 2HLEA 1HJFA 1VB4A 3RSJA 1VBC1 3I2OA 2JDAA 3VDDC 2ZACA 3A21A 4IEOA 4JGZB 3ILFA 4RHV3 1KD7A 2DU0A 4GB33 1VE0A 5A33B 3PVEA 3V0AB 3AZWA 4AI3A 4QQLA 2HWF1 2HWF2 4XUNA 1SLBA 4MZUA 3VZOA 4NPLA 4QWNA 2UWAA 3H8OA 4UF0A 3UYJA 1IKQA 1W03A 3E1F1 4HVRA 4NHMA 3O1PA 2AR6A 3PIJA 3ZKUA 2BWCA 2WNEA 1V6IA 3J8F2 2B7YA 3J8F1 4UFLA 1VBA3 4PJYA 4QGMA 5JI9A 1UCXA 1C5HA 4Q4V3 1L7LA 4AQ2A 1R091 1R092 2W68A 3O5SA 4GULA 4IV3B 4N53A 4CCOA 1BK0A 2LUWA 3PUSA 3HQRA 1NE6A 3AKPA 2VXJA 5SV5A 2K9ZA 3VD9A 2Z79A 2C5DA 2YB7A 2W0XA 4HLTA 2R041 5FPXA 3OGGA 2AUYA 3MIBA 2BVBA 3IBMA 5DZGA 4YYOA 2VMDA 2FCVA 4QX5A 4B4RA 3BTAA 3S30A 3U75A 4INDA 4A45A 4DEVA 3AFKA 4COYA 5CFCA 1NOVA 2XBO2 2XBO1 4BOWA 1UX7A 2ZOEB 3DGTA 3WP5A 2JDZA 2QQIA 4YW6A 1DQ2A 3MO4A 3ACGA 3IM0A 3PDQA 1NLRA 3GDBA 3N9PA 4L99A 5FZ0A 3UK9A 4AAPA 1PIV1 1PIV2 3EJKA 3KV5A 4K9SA 5CIRA 4ASLA 2N7GA 2ZAAA 4UYBA 2QUOA 4G9SB 2BUKA 4B7EA 3O12A 2Y60A 5F39A 1MS3A 2ZHMA 3X29B 3VDBA 3WCSA 1S0IA 2CWMA 1LECA 2R073 4R9DA 5C8CA 3ATGA 4XURA 4PIXA 4PT6A 2JXAA 3I2KA 3O1OA 1Q8VA 2OQ7A 2G9FA 1C1LA 2D98A 4LKSA 4BPZA 1PNFA 2R0FA 2FDKA 1V6OA 3IIAA 4BQ4A 2VVFA 4ITCA 4YZ1A 1Q56A 3ST7A 1WWYA 5JAXA 2AYHA 4S2HA 4GKXA 3IPVB 1WMDA 2WYSA 2GNBA 3MFCA 4AEKA 2J1AA 1WW7A 1CX4A 4AQTA 4FPYA 1BYHA 4BZ4A 3PVNA 4HSJA 1X50A 2WWUA 4QX1A 5JR7B 2PHFA 3DXTA 1XNCA 5DG1A 2VZ1A 1W2OA 3O0VA 5E88A 1SCRA 2DCKA 3KLSA 1J3RA 4N7UA 5IAVA 2ARCA 4PI0A 3UGFA 5HV0A 1SLCA 1MQTB 1X8MA 3LSEA 2G9GA 5FY7A 2VH9A 3U37A 1OSGA 4FPKA 1UL9A 1SBFA 2WZR1 2WZR2 2D3PA 3M1HA 5FZ3A 3RVHA 4LK7A 4LKDA 2WINB 2V4VA 4GMP1 4W6WA 4XFAA 4FO9A 1S2EA 1BVP1 2RHPA 4YWAA 1WW5A 3EO6A 4COWA 4IEYA 2RE9A 5LY1A 3GCWA 5F6KA 1ODNA 4XPVA 4BDVB 1NCRB 1CZTA 2HBUA 5F37A 2PHTA 5T5OA 2VTXA 1G8WA 4A7KA 2UU8A 1SLTA 3IDEA 3ME2A 4FOQA 4OHXA 3TWIA 3BUCA 1O3RA 1K45A 1Y9MA 2RV9A 1Y7BA 4MSVA 3WY6A 2GNDA 2PHLA 2EICA 4Q8LA 4AHXA 4BMEA 4YW7A 4YRDA 1N3PA 4HSLA 2DURA 3NVCA 3VDCA 4YGBA 2WIIB 1VAKA 4W50A 3ETQA 2RS52 2RS51 4Q4W1 1ND3C 4Q4W2 1SCSA 1MS0A 2D7FA 1S4CA 5T5PA 3WG3A 1O59A 1UMIA 2YU1A 1ULEA 3WSOA 4BM8A 3OBRA 3USSA 4LNVA 1X9TA 2JIJA 2WO1A 4B4PA 4C8DA 2VQAA 3LGRA 3CO2A 4XUQA 4TZDA 2XGXA 4AFCA 2ZJCA 5IVJA 4UF0B 2RMU2 2RMU1 3VL9A 5EYXA 1ONAA 4LA2A 2GMPA 4LQRA 3K3OA 4YZ3A 4O7XA 4HG6B 5EPAA 4LA3A 1SACA 2JG9A 4X6QB 4PBOA 3H8RA 1LESA 1AF9A 5EJZB 1F2NA 4N53B 4XQ4A 5FZ7A 4HONA 2EXIA 4L11A 2GZWA 1J1LA 3D6EA 4WZCA 4HETA 4CEYA 2FDHA 1S0EA 1UZZA 1UZYA 3FMGA 3KB5A 4AVCA 5GM0A 2IXHA 4YG3A 5A3PA 3B00A 4LBNA 2GC2A 4IXLA 1NA1A 3WF0A 1W39A 5CFCB 5J3UA 4IEWA 2HWE2 2HWE1 4YVSA 4L0PA 4FBFA 4EN9B 4D0QA 4EWAA 1O3QA 3BYWA 3HQXA 2UY9A 4P02B 2A6VA 4A41A 5DUVA 4Q26A 3T08A 1LGNA 4N9HA 4FTEA 1XNKA 1JW6A 3IB3A 1JS9A 2F17A 5FXVA 5FAXA 5J96B 2B46X 1A3KA 5JUVA 3HBKA 3IAQA 2FHRA 1SG3A 4UW5A 5DXDA 1K3IA 1QNYA 2WR9A 4XIOA 3WINE 3WF1A 3P5BA 3BPSA 5C8CB 1HN1A 1W2NA 4JHZA 1Z7S3 2DTWA 4J1WA 4K6BA 1VBB3 4YM3A 1MQTC 4M00A 4O61A 4XFHA 3KCYA 3PVBB 2C24A 5JI7A 2VO5A 4DQAA 3WDTA 4HKOA 1TE1B 1NT0A 3N9NA 4TYSA 3OBTA 4XZUG 1W0NA 4KL1A 4D7YA 2IXJA 4Z8BA 2AGSA 4JHTA 3MUY1 3URFA 3ZFFA 4WVVA 5FYSA 4EE2A 5FXXA 4CP9A 2O8QA 2J22A 4OZXA 4Y24A 1YEWA 4M0NA 4NROA 5JIAA 1AR81 1AR82 3IWZA 1REDA 2OXBA 4R9BA 3BOPA 1H8TA 2R1DA 4UW3A 4XMIA 1WLDA 4K40A 1DGRA 1DQ5A 1S0BA 5LASA 1ZNPA 2Y34A 3RJ2X 1X7NA 1JYXA 5FK7A 4CU8A 1W0PA 2JX9A 2W08A 3VV1A 3VHPA 4F7ZA 1RMU1 1UAIA 1IS6A 3H50A 3WR0A 5FO8B 3CJIA 2NMOA 3MLKA 3RQ0A 2GC3A 2QCSB 4UOJA 5FV3A 2XJTA 4GXLA 3R4UA 4S2GA 3SCHA 1YUDA 5L7OA 4ZONA 4IE6A 1WBLA 1AXYA 1HQNA 2P37A 3Q8CA 1A8MA 2CWSA 3QACA 4HVOA 4XDOA 3HWJA 1QXRA 4B1LA 5F3IA 3POFA 5FIXA 3VZLA 4ISRA 1AJKA 2ZX4A 3OD4A 4IV1B 5ANNA 1EP0A 2HWD3 3KHBA 4I0AA 1SDWA 2Z69A 4UFMA 4NPRA 3P1IA 1UQXA 4CRQA 2SLIA 1VBC3 5CG8A 3P3NA 4AFDA 1G9CA 1OBNA 5T52A 3THCA 2D3SA 4YM0A 5T54A 3POYA 1VALA 2HWF3 1LEDA 5L19A 1WMXA 5IK8A 1D2SA 3VBFB 2RDNA 3E6CC 1VAVA 2BJSA 1GOFA 2XHNA 4P9YA 3T1LA 1DU3D 1B35A 3J8F3 2WLQA 1W8ZA 4PF5A 2UURA 1H9PA 4YVWC 1R093 1RUF2 1RUF1 4MUVA 1D4M1 1D4M2 3ZR5A 4I09A 1GR3A 4L2NA 5FZLA 4CUGA 3M2MA 1AVBA 3WF2A 3ZX7A 2LROA 1RUG1 1RUG2 2JE7A 1GP6A 4MGSA 5IVYA 1BBT1 1BBT2 3JZVA 3I3DA 2R043 1H0BA 4HVQA 3USUA 4RR3C 5CG9A 2GSYA 2VXRA 2W1UA 5F3EA 1MACA 1OH4A 2JG9B 4FPCA 5HCAA 1OVSA 4Y33A 3I2IA 2XBO3 3THTA 2ZMKA 3NL1A 3C7EA 1AX2A 2VMIA 3P3PA 4CEYB 5C4WC 4D6SA 1LAJA 4PDWA 4CP1A 2OYZA 5FUNA 3KF5A 3LZZA 5L9RA 4CCNA 3D3AA 1PIV3 3ZXFA 4J6GA 2DCYA 2JG8C 2D44A 1LOBA 2RM21 2RM22 1NA1B 2VQTA 2ZKLA 5J1XA 2ZEZA 3G6JB 4GH4A 1Y4WA 2FBEA 3J9SA 4PQ9A 4YVSB 1CR7A 5GZFA 1C28A 3QH6A 4OZOA 4FPEA 2ZGNA 3WDVA 1IPSA 3MF9A 4HMZA 4YG0A 3WW1A 1Q43A 2A3WA 2VE1A 4Z2WA 2YPDA 3N7MA 3BALA 1UW8A 3NV4A 4AI8A 5C71A 1AUYA 5FP7A 3W59A 3AMNA 5FMCA 5I8YA 2R6QA 1LU1A 3B94A 1R1A2 1BVVA 1R1A1 2VMCA 3ZMNA 1YCIA 3WOGA 2Y8KA 1S0JA 2VNVA 4XFFA 3BU0A 1UKGA 4XJAA 5FOJB 5J09A 3E6BA 5JZGC 5FR3A 3AXEA 5JIUA 2X5IC 1AYM1 1AYM2 3AZYA 4J1XA 3BN6A 1JOBA 4UBHA 5IVEA 4B4QA 3VDDA 1MS5A 2JDKA 3BGAA 3ZFFB 2CV6A 5FZMA 3LE0A 4CP9B 1D4VB 5FYYA 2WC2A 3IAPA 1ULDA 3POIA 3OBAA 4CTEA 1US2A 2IWGB 3CKHA 1PMHX 2VZQA 1W2AX 2ZX1A 2WZR3 1K5MC 1H8TB 4GMP3 4HK8A 2WJSA 2YMZA 3J7MA 3GZAA 2YFZA 1OQDA 4QKDA 4XQWA 5DUUA 2DVAA 4LBQD 3ZSEA 2VL4A 1UOBA 2ATFA 5H9SA 1OD5A 4LBLA 3NJVA 1UWWA 2WT0A 1U5ZA 1REFA 2FMDA 3U07A 4EN7B 3ZYFA 4QPGC 3CJIB 4QXHA 1WLWA 3ZSLA 4BU2A 4YG6A 2UWCA 4MGYE 2IXIA 1Q8OA 2G9ZA 1Q3EA 3N7LA 2RS32 2RS31 4PLMA 3VHOA 5IK5A 4OHWA 5GLTA 5L7OB 4DO0A 1AR61 3RPQA 1AR62 1S0CA 1W8UA 4HZFA 5HXVA 5JXIA 5EIYB 4ZHNA 4TLGA 1LNSA 4IEPA 5FYCA 5FFOC 2E32A 5F5IA 1NLSA 3AB0A 1QEXA 4LLFA 4QHOA 4XOGA 4FAGA 5LA9A 2ARBA 2NQYA 1A78A 5BNOC 1YFXA 3NNMA 4AEDA 3I3MA 2RS53 3FE5A 3GGLA 3I54A 2AACA 1HN0A 5EFUA 4IE0A 2QKDA 3SCFA 3Q8AA 3BCWA 3AXDA 4LO8A 1PK6C 1W2TA 5A32B 3CF6E 5C3PA 4AF9A 5FJKA 4UT5A 2QQNA 2ZPXA 3WZ1A 4YFZA 1NZIA 5JWPA 4JDOA 4FPFA 1LHOA 2A6YA 1CVNA 2ZABA 5KC6A 2JD9A 5FMBA 4CDUA 2I74A 4HKWA 1B35B 3I3QA 2JDUA 3FFZA 5FMDA 2LS6A 3PIGA 3N9OA 2W3JA 4CU6A 4CSWA 3OG2A 3LSDA 4JKMA 2D6LX 2XVGA 5JDBA 3DV8A 1F5FA 2HWB2 2HWB1 5LBCA 4CUBA 2FD8A 2OPWA 4UAPA 4S2DA 1J3QA 4YVSC 3ORJA 5J7MA 1HB3A 1UY1A 3S5AA 3USUB 2XJUA 2CGNA 2KM2A 4LEJA 4I01A 4N8MA 2QTWB 5FYZA 2EA7A 4NUBA 1VAMA 1C8NA 3AVSA 1ENXA 4NRPA 1J3PA 2WWSA 3K75B 2AEZA 4N9IA 1DQ0A 2HWE3 1JMUB 3K4AA 4UFJA 2D93A 5CYYA 3WUDA 4OHVA 3C7OA 2ZGRA 3J7LA 4FTSA 3ACIA 1ZX5A 3TNPB 4PDWB 5IWFA 2Q30A 4O9EA 1F4AA 3ZDSA 1CESA 1VLNA 1DIWA 2WO2A 3PMSA 2Y64A 3WHUA 3P6BA 3ZO0B 4RN5A 5IFTA 3VD4A 3A23A 4JZRA 3LPFA 1J59A 4GH4B 2DUQA 4BJ0A 4QB6A 1W8NA 4HN1A 5HCFA 2WO3A 5DAWA 5FP9A 3SMHA 1WZXA 2Y0IA 3IMNA 3VBUC 1BKZA 2F4PA 1J1TA 1RINA 3J26N 5EJ3A 3WCRA 2QVSB 1LOFC 3OUJA 1SBEA 4XACA 3BTYA 3MGUA 5FZBA 5F2WA 2E26A 1A34A 1TG7A 1JH5A 1HRI1 3AC0A 2ILMA 1PGL2 1PGL1 4MOAA 5CKQA 5LBBA 2QQMA 4A4AA 1I6XA 5KC5A 2WDBA 1GQPA 4QKBA 3IKWA 3EYPA 3SHRA 2JWPA 1EY2A 2MEV1 2MEV2 1F4HA 1XSQA 4P9XA 1TMF1 5B4NA 2VJXA 4LE3A 4WVWA 5A6QA 4QU2A 1AR83 4NIGA 4MHUA 4IDZA 5KHJA 4R8HA 1ND3A 5G04L 4F8AA 2Y6LA 3T4VA 4ATEA 4DEQA 4W6XA 3CJIC 4Y1UA 3VDDB 4A3XA 3UL2A 4OQ9A 4CPBD 3R6SA 3FZ3A 1RMU3 3WW3A 4L8QA 5L7OC 4FOWA 2BFUS 3I49A 4NHYA 4XMAA 3JXSA 3C3VA 2JDPA 4QU1A 4QX2A 5CA6A 1WUVA 1K12A 3OY8A 5FY0A 1KJLA 4ASMB 4LHLA 2XJVA 3E97A 4QKFA 4LBMA 3QCWA 5FZ9A 2P4EA 1SHWB 3WG2A 5IJRA 4CCLA 3QBQA 4NIDA 2O1QA 1HV0A 5FZAA 2ZGUA 3MW2A 4JQTA 2AREA 3QH7A 5J48A 4DRVA 1QXJA 1WD4A 3E5QA 3UGGA 1JZ3A 2QQPA 3NV1A 4XUTA 3BKZA 5D1IA 3M3IA 2YG0A 1SQ4A 4NVPA 4Q27A 1CAVA 2AC1A 3PUIA 1VR3A 2ADEA 4Q5OA 4LULA 1QXPA 2A1XA 3AM2A 4ZS2A 2VOVA 4CDWC 4DS0A 5GZGA 4RFRB 3AMMA 2JDHA 2JIGA 3HOBA 3M8LA 3MV11 3VHNA 4AEDB 5C3RA 4ZU4A 5L73A 4E4ZA 2GMEA 5GLWA 3TN92 4LE4A 3LAGA 3TN91 4AVAA 4YZ2A 1RUF3 3OUHA 2GP5A 1MPXA 1D4M3 2VBDA 3KV6A 3ES1A 4WZFA 3KSCA 2K0GA 4Q4X2 4Q4X1 3POEA 5KXBA 2Q5TA 1OLQA 1RUG3 2W1SA 2GH8A 2ZGOA 5KR7A 2ORZA 3NJYA 2VTFA 2EVXA 1V6NA 3WV6A 3CMGA 4CDUB 2W5FA 2VMFA 5LA2A 3ACLA 4FSJA 1HQWA 1G9FA 1HLCA 3EHKA 1YQ8A 4BK4A 1OKOA 2XXZA 1O4YA 5GZDA 4E4DX 1UMZA 3ITQA 5J98B 2QQJA 2VMEA 2VPVA 1LULA 2X53S 2A6WA 4R4ZA 4E8CA 2RDQA 3HJRA 2W95A 4XF0A 2F6BA 4GH4C 3NNLA 2BBVA 2DBNA 4RS5C 2UWBA 1H2NA 3QD6A 4AQ6A 4BLJA 4BQYA 5A3TA 1CX1A 1YQCA 2YC2A 1W05A 3A7QA 3KT1A 1PVC2 1PVC1 2RM23 4XFIA 1XU1A 1QGLA 1X9PA 1N1YA 3D4KA 4KWUA 4QX7A 4XDQA 5FXZA 2JICA 5LY2A 5DAPA 3RWNA 5LBFA 3OJBA 4AFMA 4CU9A 5LA0A 2P6HA 4OFGA 4MVTA 3FC0A 4KI5M 4EN0A 1GSLA 1RVF2 1DQ4A 1RVF1 2FQPA 4XJ9A 3ZYBA 4Q1PA 1ALYA 3RNSA 2JD4A 3SITA 2A70A 2PAKA 2I07B 3VKOA 5I93A 1FOD1 5JPNB 1XRUA 3TBDA 3EBRA 3S6PA 2CGOA 3AP9A 3DL3A 3NNGA 4QMAA 1JZ6A 1R1A3 3CNAA 3E5UA 1Q5OA 4ZXKA 4XUPA 4AI1A 3ZYIB 5BV6A 5JLVA 5DABA 2WAAA 3JQWA 3VBSC 3LD8A 2GALA 3F2ZA 1MEC2 1FXZA 3GJAA 3N9MA 5AVAA 4P5HA 4ASKA 4E4HA 5L36A 1M06G 3RMXA 3I4IA 3K4DA 3PUHA 5CEHA 1T6BX 1AYM3 2WT2A 3KCXA 5FPLA 3ZKYA 3VBRA 1RUH3 2W52A 4JV4A 4Y1VA 3MDPA 3I59A 3PNAA 3LF7A 3B93A 3N35A 5C3QA 2AEYA 2W94A 5CISA 2HEYF 5AFBA 4FCAA 3O1MA 1EPWA 2UYAA 2Y6JA 2X05A 5K0UC 3NRUA 2E53A 3VN4A 1JHJA 2Y0OA 4NAMA 2GNMA 4AOCA 2VQ0A 3C7GA 1S2KA 1AJOA 1D2QA 1ND3B 2WN2A 4ATFA 3V0BA 1AR71 1AR72 1LOEA 2WAOA 3HT2A 1XE7A 2EAKA 4HN0A 4YVWA 1ND2C 5A7NA 5I91A 3W20A 1DFQA 2R7EB 2BERA 3TN93 4BYYA 4BHPA 1LRHA 4M4RA 2WYFA 4YGEA 2BU9A 4GA9A 2QQLA 1WLTA 5FYUA 1RIRA 3J7HA 4B8EA 4AFAA 4GALA 5ABJC 3LFMA 2DVFA 2R32A 2ZEXA 1OT5A 3OY8B 4RR3A 2RS33 4HANA 2D6NA 3GZEA 2MHFA 2C1FA 1AR63 1H1AA 4QHBA 4NIAA 3KV4A 4AEDC 2OZJA 3PHMA 4G3YC 3T30A 1CAXA 5C4WA 1ZZBA 1MS4A 4MXWA 5A80A 2ARXA 1XOYA 2W47A 4Q0UA 4QPIC 5HCBA 1QJEA 3ZOIA 1QOSA 4Y3OA 4M01A 2WN3A 2P17A 4QX0A 5ACA1 5ACA2 2LTNA 2XWJB 3ZDVA 4IESA 4O9GA 2JG8A 2ZMLA 3LEKA 3Q8BA 4CDUC 1CAVB 3NSTA 1QHDA 1GNHA 3DXUA 4K20A 4DUXA 1KS4A 4NIHA 2BP6A 1EPZA 1S1AA
chains in the Genus database with same CATH topology
3IT8A 5BYNA 2EXKA 3GNEA 1OFSA 4W65A 5EV7A 3JD72 1OOPC 3JD71 4Y22A 4E27A 4I2OA 5FDBA 3POSA 4URTA 3TRSB 1ZRCA 1XYPA 2ZGKA 2PHUA 3OCPA 3WDUA 3THPA 2EIGA 2DF7A 2VECA 2VVDA 1H30A 1WD3A 5JZGA 4FPLA 2Z2SB 2X5IA 1DGWA 1ZRRA 1WLCA 3ZYPA 1RTVA 2ZGSA 3ZXDA 5CNAA 1POV0 3RYPA 4DY3A 1PHMA 1WA4A 2D6MA 4I02A 3FBMA 4OHZA 5F6LB 2YDEA 4XF4A 1K5MA 2JEMA 1YJKA 3ZVXA 1TEIA 1J58A 2SBAA 1FPN2 1FPN1 3ILRA 4P14A 3O14A 2B45X 5FTTC 5JOYA 3VKNA 4I0WB 4XTMA 4OULA 2DVBA 1GV9A 4QPGA 4D7TA 1HRI3 3B01A 4N43C 4QGLA 4CP2A 3CLPA 5JMCA 4HT1T 4S2FA 4GWMA 1BQPA 2TEPA 4L9BA 4BWOA 1W6QA 5DDJ1 5DDJ2 4FQ4A 5BNPC 2VNGA 2R30A 2MEV3 2E6VA 1V6KA 4D69A 1TMF3 2JJ6A 2DFCA 5EXOA 1BK1A 2BEOA 5BNOA 3T2TA 5KHHA 5KHGA 1ENSA 1UKRA 2WZPP 3ZXGA 4K3UA 2MNGA 4XJWA 2V5YA 2XL7A 1PO12 2VW1A 1PK6A 1WW6A 2VW2A 3I59B 2EXJA 5CAZA 2BFUL 1AXZA 1RITA 1PVXA 1W2UA 1ZA4A 2I45A 2VGDA 3LA7A 3V0BB 1H2MA 2GN7A 4JGYC 4YVWB 3LWCA 3WQ7A 1O3TA 1Y3TA 1ZVFA 2HKXA 1ASJ2 4Z07A 1VB2A 1XNBA 4RR3B 4Q0QA 1OA2A 2VY0A 4V1PA 4FOVA 1U12A 3TOJA 3AKSA 1QH7A 4XF1A 4E9KA 4ORFA 1CAXB 5C4WB 3AP5A 3WDXA 1CAWA 5I8SA 4MXWB 5DUWA 4XFGA 1SFNA 4KG8A 4BQ1A 3B3QE 4H14A 3WD5A 3W58A 2ZGLA 3TN93 2JG8B 2VG9A 2B9UA 4Q1RA 5LK5A 2LALA 3HR9A 1ZZ6A 1HXS2 4ONUA 5JOZA 4Q4X3 3FLRA 2ET1A 5I8TA 1AL21 1AL22 3ROUA 3VBUA 3ASIA 2BPA2 1LOFA 1RC6A 1TME1 1TME2 3AZZA 4U36A 4YW2A 2WL1A 1YIFA 2Z5WA 3A0KA 3GZUC 1BEV3 3HD8B 4MLOA 4Y22B 3KT4A 1JYIA 2P3KA 1RUD1 1RUD2 3SH4A 1I9RA 1YFWA 4Y26A 1N1TA 1AZDA 4M3CE 3UKNA 1ZZ9A 2XJQA 2BYVE 5C33A 2GC1A 1IKPA 2XJPA 3MI8A 2AZ5A 3ZXJA 3LCPA 5JZGB 3MIGA 3IDBB 1PVC3 3S0MA 3APBA 4LHKA 4XHXA 2E7QA 1A6CA 3RYKA 2X5IB 5GLVA 3NW4A 1C57A 4JQRA 3WQ1A 2UYBA 4DPNA 5JSPA 1OQ1A 4JVAA 1OFNA 2ZGPA 1RVF3 3UKVA 1MZ5A 1FV3A 3PVOA 2HYKA 4DMIA 4CYDA 1K5MB 1FOD3 4KH9A 4KNCA 3HN1A 5BUVA 3RDIA 2R063 3MPBA 1YJLA 5FREA 2WSVA 3AP7A 1VBD2 1VBD1 4BIOA 3DKWA 1ZRFA 1DGRN 4EWDA 4META 4YNIA 3VBRC 2QFEA 3RG0A 1SLAA 1QOTA 1I5ZA 1O4ZA 1O4TA 2RR11 2RR12 4QPGB 5EWSA 1NQDA 4OLLA 1DDLA 1H9WA 1RUI2 1RUI1 1ULGA 3WQ0A 3ES4A 3R4SA 2WFF2 2WFF1 1FNYA 2YV8A 1R1ZA 2GU9A 1W6QB 1C1FA 4AE2A 4COZA 4CDWA 3J4UH 5BNOB 1UD1A 3NJZA 1IPKA 2DU1A 2JE9A 1CIWA 2AH2A 4AGGA 1AR73 4TSVA 4UXAA 4R4XA 2EALA 5E8AA 1PK6B 3M70A 3ZFGC 5D8AC 2YPJA 1KQRA 2VUJA 3RS6A 1QJY2 1QJY1 1GFF2 1FI2A 4SLIA 5KBFA 3VKFC 1CQ9A 1PZ8A 2D5HA 3AMQA 1FT9A 1QJZA 4XJ8A 5BY5A 5I0RA 3UV9A 2ZGQA 3A0NA 2P3IA 2ERFA 2D43A 3H7JA 2XLGA 3CJXA 3MF6A 3LB9A 4EV0A 2ZGTA 3DN7A 1BZWA 3HMYA 1LENA 1H4GA 1HW5A 4RS5A 3JQXA 3U0ZA 2H6BA 5ACA3 4HL0A 1ZBA2 2ZKNA 3AYEA 1RUJ2 1RUJ1 4WM7A 4NHLA 2LM3A 4C0HA 2XVKA 4N7IA 5HI0A 4AHWA 1CAWB 2CAUA 1C8M2 1Q8QA 3PMEA 4H3WA 1ZRDA 4GIQA 2PHXA 5F9TA 1GYKA 3DF0A 3H9AA 5FLHA 3JD73 1H1IA 1YRZA 1N3QA 5CU1A 3KS7A 1JBCA 2XVLA 4XFBA 4DZGA 1QJU1 1QJU2 3U11A 1W0OA 3VBUB 4KU7A 1BMV1 1BMV2 3ZYJB 1LHVA 3I2DA 3VBSA 4Y1ZA 5BNQA 2YGLA 1YNAA 3ELNA 5E1RA 5GZEA 4CDXC 1Z78A 3AMHA 4OI4A 1YO8A 4LTAA 2TBVA 5E89A 3N7KA 4PCRA 4YFWA 3KQRA 4K8FA 4KG0A 1LHUA 5FPZA 5KXEA 4X8PA 2OIIA 1LOAA 1MZEA 4RQPC 5K0UA 1U5YA 5KXCA 4LHNA 3VBOA 3GBFA 3MYXA 5JOXA 4SBVA 4N90A 3VKMA 1ND2A 1JTZX 4KBBA 2JKBA 5E16A 1ZZCA 1UIJA 4XETA 4PIYA 4JRLA 1Z0HA 1DBNA 2WA4A 5ABJA 4I3PA 1LR5A 1YI9A 1ZZ7A 2XHKA 4NO4A 1WCSA 3WLUA 3R0RA 3D0SA 2ZX0A 4IEQA 4MYEA 4Q4W3 4FP2A 1V6LA 2ZGMA 5EYYA 3VLBB 3WW4A 3FFQA 1I1EA 3KGZA 4QPIA 3GHNA 4YLZA 2HEVF 5T5LA 5LEJA 1XU2A 2PAMA 2RMU3 4JDNA 2AENA 1NQJA 3SH3A 3ZIXA 3H1WA 1NZCA 4Y20A 2R49A 5HBAA 1PM7A 3MICA 4R9AA 4CDWB 4AVSA 2Q8OA 4Q0VA 2P2KA 2PAEA 3M3OA 1OA4A 1G9DA 5LK7B 2ES3A 4ISQA 1OOPA 3B02A 5I0TA 4JTNA 3HAGA 5CBLA 2BNMA 3JU9A 1W6MA 2D5FA 4AXOA 5BNNC 1I3HA 2DWRA 4NHKA 4GWNA 4PBPA 1GZWA 4XBQA 2VULA 1O5UA 4XXPA 2RS11 1IS3A 2RS12 2HEWF 1OPMA 4CP0A 1D0HA 2Q4SA 3BIWE 1U5IA 1MVEA 2FZ1A 4H55A 4KU8A 1WCDJ 2ENRA 3B9CA 5JSOA 4RS5B 5C9AC 1OHFA 1H2KA 5SV8A 5EZWA 1HX6A 2OUHA 1AL23 3ZN4A 1KDMA 4AK3A 5C6CA 1TME3 2B39A 1OLRA 2VW0A 1IS4A 1PGSA 1U5XA 3WXPA 1H4HA 4YW5A 4N43A 1N47A 1CPNA 4MGKE 2XL9A 2WNUC 3JCIA 1QH6A 2DCZA 1RUD3 4BLIA 1JXNA 1YLLA 1PZ7A 4XW3A 2XPJA 1OI6A 3NV2A 4LUMA 2YUEA 5BNPA 2V73A 3ZXKA 4AHYA 3VBSB 3IN9A 2ZS6B 4QGNA 2A3XA 3M4FA 1OQEA 4K21A 3KM5A 1POV1 2A71A 3VBHC 2VNRA 3AFGA 3OPZA 5T50A 3GF6A 4XE9A 2GDFA 1NE4A 5K0UB 2EXHA 4M3CA 5JVVA 3R05A 2WSUA 3DPRC 2YGMA 3KCCA 4JGYA 2IZWA 2QE3A 3JUUA 4Y1XA 1ND2B 1IZ3A 3TAYA 1VBD3 1REEA 1M4WA 4COUA 1X33A 1COV1 1COV2 5FRAA 1KFUL 3NV3A 4RGGA 3ZFEC 2RR13 5FBZA 1PZ9A 2ZHKA 3VHRA 5ABJB 1IGOA 4OUMA 4X6RB 1Q8SA 1RUI3 1UX6A 4HPKA 3CEWA 2WFF3 1YYNA 2YXSA 3WT3A 1AHSA 2VOKA 4BE3A 3N7JA 4MGZE 2VVEA 1HQLA 1WGPA 1W6OA 3HIFA 2OW4A 4QPIB 4ZU7A 4D3WA 2IXLA 4WVMA 2GH2A 3ZIWA 1F8VA 1BBT3 2P3JA 3H1YA 4BCUA 1V6JA 5GJ6A 2ZHLA 4Y20B 1NCQC 4AYUA 1FYUA 1TNRA 2XKPA 1WMFA 4NWWA 1NXD1 1QJY3 4P9JA 1DZRA 3FX3A 4XYXA 4RA0A 3NAPC 2XLFA 3S7EA 2A7AA 4QQPA 3FJSA 1GQGA 1UN1A 3AKTA 4Y1YA 2PA7A 3N3HA 1HRV1 1HRV2 1VBB2 4LO5B 5FOBB 1OOPB 4XJZA 3T1MA 2R1BA 5GKAC 4P9GA 2WA3A 3VZJA 2QZ3A 1W6MB 2DFBA 4QQOA 4WM7C 5A3MA 3AKQA 4I0BA 4Q0SA 1GZWB 1OA3A 4GQ7A 3AJZA 1RUJ3 4FPGA 3CU7A 2QDNA 4H7LA 4PLOA 5GZCA 2DCJA 2XLAA 2YROA 3OF1A 4EN6B 1WMEA 2WLPA 3SH5A 1LTEA 1GANA 4EJRA 5GALA 4EROA 4XQDA 1RUE2 1RUE1 1MEC1 2B42B 1FNZA 1S2BA 1QJU3 2C9AA 3M7AA 4BA6A 2Q0AA 1SLIA 1PGW2 3KZ4C 4IETA 3VKLA 3GBWA 4U2AA 4N43B 1EAH1 1EAH2 2ZCWA 1TQ5A 4DRRA 1YXWA 1RGSA 1RUC1 1RUC2 4LBJA 2WT1A 2XG3A 3RJRA 4AVVA 2BQPA 4L92A 3VBOC 1VBC2 3WDWA 3Q9OA 5BNPB 4AHZA 3S7IA 5IK4A 1X82A 2WNVC 1JOJA 1QJX2 1QJX1 1MVQA 4XBLA 1HIXA 4MGIE 5AC91 5T5JA 5AC92 4HBNA 1O91A 2CAVA 3H3ZA 4YGDA 2CTVA 1W6NA 3MPPG 3QLQA 1DGLA 3I8TA 1IHMA 3ZFGA 5D8AA 1GKBA 2YHJA 1PO22 1PO21 1QDOA 5CFDC 2ZAHA 4P9LA 3ZXLA 1JUHA 1VP6A 1DZQA 1U0AA 4M3CB 3WP3A 3SLIA 2R042 3AYDA 2A73B 3PLQA 4K7JA 3SCGA 2OUJA 4JGYB 4MH0E 5F1RA 3RI8A 1VBE1 1VBE2 1CJDA 2A5ZA 1UIKA 5I0SA 2ZA9A 5JOWA 4FPOB 5IUQA 2A75A 3UJOA 3ILNA 1N1SA 2ET7A 5C8WA 4CEWC 4HPKB 2WQZC 3NO8A 1RJ7A 4DB5A 2JENA 3WP6A 1LOGA 2OVUA 1DZTA 2A3YA 1T6GC 1MZ6A 2H6CA 1C4RA 3WG1A 1W6OB 4CDQA 4YW3A 3BU7A 4Y5Z0 4DY5A 2HWB3 1AX0A 4RGAA 4M3CF 2BWAA 4WVMB 4QM9A 3JB8A 4HK9A 3EXUA 2E7AA 3FBYA 2BNOA 4Q29A 2D97A 2PQQA 1S0GA 1RB8G 3FUQA 3OGJA 1RJ8A 2DVDA 5FLJA 4P9IA 1UU6A 4KGGA 1SLLA 2YC0A 4CDXA 5H9RA 1WW4A 4OI1A 2RS13 4DINB 1FATA 1DGWX 1LJ7A 2Z42A 4IL7A 4Z82A 1LHWA 3O0WA 3WVJA 5JSRA 4UW6A 1O7FA 1QOOA 5IK7A 3ZXAC 1FMD2 1FMD1 1G9AA 4OI0A 4RQPA 2RJKA 1EV11 1EV12 1DHKB 4YARA 4NN0A 4WV8A 4Q8KA 1FV2A 4XIKA 4Q4Y1 4Q4Y2 2VU9A 3MFAA 2NM1A 3W9AA 1BCXA 2TNFA 1LEMA 3G7DA 1FX5A 1KXGA 5DZFA 2CGPA 2QZ2A 4E2GA 2DUPA 4RD7A 3LOIA 1QKQA 2YZ4A 1LCLA 1UPIA 4JGZC 3K51A 4IV1A 1V9U1 1V9U2 2K2SA 1DYKA 2TUNA 1LODA 2D40A 3BPZA 1PNGA 3LA3A 4LT5A 1PO11 3JB4C 3ALQA 1D0GA 3VBRB 4ES9A 3AMPA 4Q2FA 1AXKA 3VBFA 4F3JA 1JYCA 2GC0A 1E57A 3AZVA 4IV3C 2DTYA 1POV3 4B3NA 3UJQA 1ENQA 1YHFA 2E7TA 2ZZJA 4AI2A 1ULFA 1X36A 2DUOA 2OZ6A 4FPHA 3HBZA 3ECQA 5JCTA 3FUOA 1MZFA 4FVVA 3U4XA 1C3HA 1QDCA 5DG2A 4AG4A 4ES8A 4BMBA 2HWC1 1ASJ1 2EAAA 2HWC2 3MW3A 1W6NB 2BVVA 4XZPA 5BPXA 1C5IA 4RL7A 4LR4A 5CADA 2Y38A 3ZFGB 5AFEA 5D8AB 2NN8A 3AP6A 1COV3 1G7YA 2Q1MA 2PLV1 2PLV2 1GNZA 1LKNA 1H8VA 5BNNA 4M0HA 2KXLA 1GLHA 3DUIA 4Z92B 4Y4YA 3U10A 3B69A 4NOTA 3R4DB 3RRDA 3WG4A 4QXKA 3TNQA 3WUCA 1VJ2A 1ZREA 4IERA 4AQSA 2CY6A 5CB7A 5F5QA 4PLNA 3H0OA 2PHDA 4IQPA 3WP4A 2QDRA 3O7OA 3VZMA 4R52A 1HXS1 5C9AA 1G9BA 1V6MA 3O0XA 4ZU5A 1AYN1 1AYN2 3ZN5A 1GZCA 4XILA 2Y26A 2RJLA 2IXCA 4H7MA 3V56A 1YFYA 1H1MA 1ZBE2 1ZBE1 2D6OX 2E63A 1G86A 1RHI1 1RHI2 4AFBA 3TB0A 4CDQB 1NG0A 5B2GB 5J36A 4LBQA 1DQ6A 3H8UA 4TWTA 3AJYA 3ENRA 3GYDA 4G4FA 4B7KA 1HRV3 3TYJA 1O5LA 3ZMOA 2P34A 2WNUA 2WS92 2WS91 1S0DA 5DZEA 1VRH1 1VRH2 2O0OA 3D8CA 2VMGA 5FMOS 4QPYA 1CAUA 1R081 1R082 3WX5A 4MX3A 4FP3A 4EN8B 1DF0A 1XQNA 3V64A 4E4SA 5KWRA 4CDXB 1FAYA 3MW4A 2NMNA 3FLPA 3VBHA 3GBGA 1LGBA 2XUMA 1CONA 1NCRC 4L97A 3N4MA 1SMVA 1NXMA 1EYBA 4OVEA 2HJIA 3B9IA 5H9PA 3WNXA 3ZSJA 4RQPB 1RMU2 1WCKA 1KITA 1W6PA 5FLIA 1LOCA 2NPIA 2OA2A 2GN3A 3DPRA 1RUE3 5AVPA 1MEC3 3ZYGA 3AX4A 1KS5A 1BJQA 4JCKA 2E51A 2A6XA 4AVTA 3POWA 2Q1ZB 4XHBA 1AR91 1AR92 1N1VA 3NWKA 4XBNA 3OTFA 3ZFEA 2UY8A 4E2QA 1CGPA 2PHWA 3PJQA 1EAH3 5KHIA 1O3SA 3WHTA 3OYWA 1RUC3 3GALA 1XNDA 4UBGA 1IS5A 1GBGA 1MS8A 4MV2A 5A32A 1SBDA 4XEZA 1ZZ8A 4XF9A 1CPMA 1QJX3 3MEPA 3MZHA 4N53C 5AC93 4FPJA 5T3NA 1TNFA 3BODA 2PELA 2PYTA 3MIFA 1QNWA 2CYFA 5K7PA 1VIWB 1NCQA 2ZX3A 3MIEA 4KWJA 1APNA 1JHNA 1PO23 2NYYA 1IQAA 4AEMA 2PN5A 3RI9A 4IEUA 3NAPA 2WKKA 3JBG1 3JBG2 4HFSA 4YSFA 5CFCC 5GLUA 3ZN6A 2D6KA 4ZKTB 3L9JT 3WDYA 2B8MA 4LO6B 2H0BA 4YM1A 4YM2A 3MLJA 1VBE3 3ZPYA 1ENRA 5FQ0A 5KHKA 3BOWA 1QU0A 2E9QA 1DYPA 1ZBA1 4C1XA 4COVA 1NY71 1NY72 4P9WA 4FAHA 1KDKA 5BNNB 1UU4A 3H1MA 2W39A 1F5JA 2X29A 4DNYA 2CNAA 5LRSA 1C8M1 4FQZA 4CDQC 5C8CC 1YIPA 3FHIB 4B29A 4GMP0 4QQ2A 3ZSMA 2DYCA 1A8DA 1XE8A 1SFYA 3D82A 4XFCA 4I3GA 2PTMA 2X8KA 3KT7A 1Q8PA 5C9AB 1QQP2 1QQP1 3MIDA 3VZKA 4X8NA 3M3QA 3OD0A 5A3LA 2BNNA 2I2SA 2GNTA 1JN2P 1Y43B 3LA2A 3AZXA 4XTPA 3HT1A 2YY1A 4AWDA 2R0HA 2NLRA 4LBQB 4RHV2 4RHV1 1H2LA 4WM8A 4GB32 2ZZQA 3I7DA 2IC1A 4GB31 3SNMA 2WNUB 2KA3A 1AX1A 2WQ4A 1CAUB 2OPKA 1RUH2 1RUH1 4KGQA 1HV1A 5JPMB 1FMD3 2WNVA 4YW4A 3PJYA 1EV13 3MLLA 1VBA1 1FPN3 1VBA2 3H3UA 1JUIA 1V70A 3C2UA 4Q4V2 4Q4V1 3AYCA 4YGCA 4Q4Y3 3ZSKA 1ULCA 3E5XA 3VBHB 2ZTNA 5I0UA 4JC1A 4IV1C 3N36A 1LB2A 2XKOA 3KGLA 4RFT0 5CFDA 4K1ZA 4AVBA 2VOWA 5DDJ3 2D3RA 1W6PB 3DPRB 1V9U3 1GQHA 3AKRA 3VBFC 2IFRA 2NP0A 2GMMA 3E6DA 3K48A 4HKLA 1UPSA 1YFUA 1G6NA 4LUKA 2DCTA 2ZHNA 2ZMNA 1PO13 4UW4A 4IEXA 4AI0A 3ZFEB 3FLTA 3LOBA 1CD3G 1OKQA 3AK0A 2VUAA 1KFXL 1GICA 3L2YA 2FZ2A 2PFWA 3VGIA 1B09A 2JECA 1OPOA 4XXAA 4CEWA 2DVGA 3OYWB 3NKGA 2R072 2R071 3IDCB 1IOAA 4AEJA 2BTVC 4LBKA 1UF2C 4DFSA 3INAA 4YZ5A 4DOUA 2JG9C 2C0ZA 1QF3A 1ASJ3 2HWC3 4CEYC 3VZNA 1YI7A 3KMHA 2G4IA 4K1YA 3MIHA 4BH9A 5T55A 3V65A 1NCQB 1NYWA 1MS1A 1L3JA 4JAAA 3B5LB 2O8OA 2MPFA 2PLV3 4KWLA 5LRRA 1RUNA 4KWKA 1NA1C 1URXA 3NAPB 2VMHA 1XYNA 3EQEA 4WBBA 2XH6A 3ZN6B 5FQ0B 3CL1A 4PIZA 4IEZA 2DV9A 4D7SA 2IXKA 2XJSA 1HXS3 4WM7B 1RUOA 2ZX2A 4TLFA 5CVRA 1AYN3 5TSWA 4Q0PA 2B5HA 1X8EA 4JTOA 1ZBE3 1QMJA 1AL0G 2NZ9A 1RHI3 3RZZA 4NR1A 4MXVA 4OUSA 4FT8A 4QT6A 4JGZA 5A33A 5LEKA 3SXWA 3ZFFC 3V0AA 1PMIA 3H7YA 2WS93 1HRI2 4JRAA 1XXNA 1VRH3 4QQHA 1ZYBA 5FMOL 4BIFA 2D6PA 4AW7A 3LKJA 2V09A 3A4UA 5FO9B 1R083 1DLLA 4WVZA 3VUOA 1H8TC 1DG6A 1V00A 3QOPA 2FMYA 4Z1VA 5K9YA 2A6ZA 1TMF2 4XJUA 2YYOA 4QD2A 3WW2A 4IV3A 3B7MA 4WM8B 1KRIA 1S0FA 5KXDA