3LOBA

Crystal structure of flock house virus calcium mutant
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
340
structure length
312
Chain Sequence
TAPVPQQTRLSQPGLAFLKCAFAPPDFNTDPGKGIPDRFEGKVVSRKDVLNQSISFTAGQDTFILIAPTPGVAYWSASVPAGTFPTSATTFNPVNYPGFTSMFGTTSTSRSNQVSSFRYASMNVGIYPTSNLMQFAGSITVWKCPVKLSTVQFPVATDPATSSLVHTLVGLNGVLAVGPDNFSESFIKGVFSQSACNEPNFQFNDILQGIQTLPPANVSLGSTGQPFTMDSGAEATSGVVGWGNMDTIVIRVSAPEGAVNSAILKAWSCIEYRPNPNAMLYQFGHDSPPLDEVALQEYRTVARSLPVAVIAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords Coat protein beta
publication title Structure and function of a genetically engineered mimic of a nonenveloped virus entry intermediate.
pubmed doi rcsb
source organism Flock house virus
total genus 51
structure length 312
sequence length 340
chains with identical sequence B, C
ec nomenclature ec 3.4.23.44: Nodavirus endopeptidase.
pdb deposition date 2010-02-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3lobA00
4WM7B 4Z92B 1ASJ1 2R061 1ND3B 4QPIA 3VBHC 4CDQC 4BCUA 1VBB3 1A6CA 4Q4W3 1AR63 5C9AC 3JBG2 4CDXC 2R043 5FMOL 1QJY3 2WZR1 1R1A1 3CJIA 5C4WC 4JGZC 1PO12 4RQPA 2RS32 1ND3C 2ZZQA 2X5IB 4GH4C 1EAH3 1F8VA 1ND2C 1C8M3 1BEV2 4Y4YA 2R073 2HWE2 5D8AC 1EV12 1R093 1RVF2 1COV1 1FPN1 1TMF2 4Q4Y2 1AR81 1FOD3 1OOPB 3JB4C 3TN93 5L7OA 1PIV3 1V9U2 1AL23 1RHI1 1HXS1 2RS53 1AR61 2WLPA 1AYN2 3VBFA 3JD71 4YVSB 4GMP3 2PLV1 1QJU1 1AR93 1Z7S2 3ZFFB 1VBD2 5FOJB 4CDUB 1RUC2 1EAH1 2RS31 4Q4X2 1POV1 2RM22 1PVC3 4GB33 3VBUA 1BEV1 4N53B 1MQTB 1NA1B 2HWE1 1IHMA 5A33A 3ZFGB 4YVWC 1EV11 1RVF1 2Y26A 1H8TB 4Q4Y1 4RR3A 1NCRB 1V9U1 1VBA2 2MEV3 4CDUC 1BMV2 1PGL1 4Y5Z0 1VBE1 5J96B 1AYN1 2WFF3 4N43A 1D4M1 4N53C 1MEC2 4PDWB 1MQTC 1NA1C 2HWB3 3ZFGC 3VBOB 1X36A 1NCQB 1TME2 3VBSC 1K5MB 2RMU3 1NCRC 1Z7S1 1VBD1 5CFDA 1RUC1 3DPRB 2RM21 1ASJ3 2BPA2 2HWD3 2R063 1RUD2 1OPOA 1QQP2 1QJX2 5J98B 1AUYA 2WS91 1HRI2 1HQNA 1RUF2 1K5MC 1ZBE2 3J8F1 1VBA1 2WZR3 1OHFA 1R1A3 5K0UA 1BBT2 1VRH1 1NOVA 2FZ1A 1NY71 2XBO2 3VBRC 4IV1A 4QPGA 1COV3 1FPN3 1AR83 1FMD2 2HWD1 1RHI3 1HXS3 4RHV1 5AC91 2DF7A 4Q4V2 3NAPA 5CFCA 4AEDA 5BNNA 5C8CA 1RUH2 5DDJ2 3JD73 1HRI1 1RUE1 5BNOA 2GSYA 4WM7C 2PLV3 2RS12 1QJU3 2RR12 1BBT1 2GH8A 2RS33 1POV3 5LK7B 4RS5A 1R082 2R042 1AYM2 3ZFEA 1VB4A 4JGYA 1QJY2 1X33A 1BEV3 3VBUB 2HWE3 3FBMA 1EV13 1RVF3 4WM8B 3VBHA 4CDQA 4Q4Y3 1FMD1 5A32A 4RR3B 1V9U3 2X5IC 5C9AA 4CDXA 1VBE3 1AYN3 3JBG1 1W39A 1RUJ2 5C4WA 4N43B 1D4M3 5DDJ1 4JGZA 3TN92 1PIV2 1AL0G 1OOPC 2RS52 1ND3A 2RS11 4WM8C 1PO11 2RR11 4GH4A 1ND2A 4CEYB 1Z7S3 1VBD3 1RUC3 5CFDB 1VBC2 1RUI2 5D8AA 2RM23 4YVSC 4IV3B 4CDWB 5ABJB 3LOBA 2BUKA 1AYM1 5JZGB 1TMF1 3ZFFC 2WS93 1ZBA2 4CEYC 1PVC2 4GB32 3J8F3 1VBA3 1B35B 3VDDB 2IZWA 5GKAC 2VQ0A 1CD3G 4IV3C 4CDWC 5ABJC 1VRH3 5K0UB 1DDLA 5JZGC 4CEWB 1RMU2 1H8TC 1MEC3 1HRV2 2MEV2 5BNPB 2FZ2A 4Q4X1 2WFF2 1B35C 4QPGB 3VDDC 4SBVA 1VBC1 1RUI1 2HWB2 4YVWA 4PDWC 4QPIB 4RHV3 5AC93 2HWC2 2BBVA 4CEWC 3NAPB 3VBOC 1NCQC 5CFCB 4CDUA 4AEDB 5BNNB 1RUG2 1BMV1 1HRI3 1ZBA1 5BNPC 4FTEA 1RUE3 1PO22 1ASJ2 3CJIB 3DPRC 4FTSA 4N53A 2R062 1NA1A 5ACA2 4RQPB 3ZFGA 1MEC1 1BBT3 4QPIC 2WWSA 3VBSA 1RMU1 1WCDJ 1NCRA 1TME1 5CFCC 1R1A2 2HWF2 1AR72 4GMP0 3CJIC 4NWVA 5L7OB 4RFT0 3VBHB 4CDQB 1FMD3 4RQPC 1RUD1 1QQP1 1QJX1 2HWC1 1K5MA 3VBFB 4CDXB 3JBG3 3M8LA 1RUF1 1ZBE1 1COV2 1FPN2 5DDJ3 5C4WB 1AR82 1RUG1 4LLFA 4JGZB 1RHI2 1C8NA 1HXS2 1VBB2 1PO21 5L7OC 4Q4W2 2RS13 1AR62 1PO13 2RR13 5ACA1 4GH4B 1ND2B 2XBO1 3JD72 3VBRA 1R083 2BFUL 5D8AB 3VBFC 4NWWA 2PLV2 1AYM3 1QJU2 5A33B 1TMF3 2HWF1 1PGW2 1AR71 1EAH2 1C8M2 2ZAHA 4Q4V1 1RB8G 2R072 1R092 1RUH1 4WM7A 1FOD2 3IDEA 3VBUC 2BFUS 2TBVA 1AL22 1RUJ3 5FMOS 1SMVA 1VBB1 4RR3C 2ZTNA 1PGL2 4Q4W1 1VBE2 1E57A 4Q4X3 1R081 2R041 1D4M2 1VBC3 1RUI3 4N43C 1AR92 1QJY1 4YVWB 3ZXAC 1VB2A 3JB8A 2X5IA 1PGW1 1CJDA 1C8M1 1QJZA 1ZBA3 1VAKA 5CFDC 2XPJA 2R071 1R091 1RUJ1 1OOPA 1FOD1 3TN91 4WM8A 1PIV1 1AL21 2WS92 2RS51 4FTBA 1RMU3 3VBSB 1TME3 3J8F2 1HRV3 3HAGA 4IV1B 4YVSA 1VRH2 4GMP1 5K0UC 4FSJA 1AR91 1RUD3 2RMU2 3ZFFA 1NY72 1HX6A 1QQP3 1QJX3 2HWC3 1POV0 5C8CB 4CEYA 1RUF3 1ZBE3 1PVC1 4GB31 5BNOB 4IV1C 1RUG3 4QPGC 2HWD2 4IV3A 4CDWA 5ABJA 1MQTA 4RHV2 1PO23 5AC92 5JZGA 1H8TA 5ACA3 2QQPA 3NAPC 4RS5B 1HRV1 2MEV1 2XBO3 4AEDC 5BNNC 5C8CC 2WZR2 3ZFEB 4JGYB 3VBRB 1RUE2 1B35A 1GFF2 3VDDA 1NG0A 2WFF1 5BNOC 2HWF3 4PDWA 1AR73 5A32B 4EJRA 2HWB1 4CEWA 3VBOA 1NCQA 4Q4V3 1F2NA 1M06G 5C9AB 2RMU1 4RS5C 3S6PA 5BNPA 1RUH3 3DPRA 3ZFEC 4JGYC
chains in the Genus database with same CATH superfamily
4WM7B 1STMA 1S4CA 1LHWA 3MF6A 5JIUA 2BEOA 5LZ6A 4XFBA 5L36A 3VBHC 4CDQC 4HKLA 3ZYRA 1VBB3 1A6CA 4TZDA 1AR63 4IEQA 5AVPA 3USUB 3JBG2 1PVXA 4LOSA 3HNYM 3BUCA 1QOOA 3R4SA 3AJYA 4FPYA 4JC1A 4PF1A 1AJKA 3RZLA 2A75A 3CJIA 2XVGA 4HKWA 4E4HA 2OUJA 1SLAA 3WW2A 5F5QA 2Z4FA 4AL9A 4AE2A 1ND3C 4P02B 4DZGA 4D7YA 2X5IB 4GH4C 5FAXA 1EAH3 1GWKA 2GH2A 1C8M3 2QZ2A 3SMHA 5EYXA 4YGDA 4Y4YA 4QXKA 1UO9A 2AUYA 3GHNA 1R093 3WQ7A 1FPN1 2JDKA 4R4XA 1QXPA 1H0BA 1FV2A 3AP7A 3MUZ1 3KM5A 3NJZA 1Y7BA 3OSDA 3O1RA 3RYRA 1WD4A 5EYYA 4NO4A 3I2HA 4M3CE 4YNIA 1YI7A 4UI9L 2WLPA 4FXKB 1IPSA 1AYN2 1BXHA 4I0BA 2Q4SA 1ZYBA 2NN8A 1EUTA 4NAMA 2VD7A 2PHRA 2G9ZA 4YVSB 2C5DA 3LA2A 4Q2FA 3SCHA 2VG9A 2V73A 4OZXA 4OVEA 4FXGB 4IGQA 4LLOA 5JCTA 4KL1A 2JKBA 4DOUA 1Z7S2 5C8WA 2TUNA 3UGGA 1JN2P 2C9KA 3P3PA 4CDUB 5FOJB 4A6OA 4LUMA 1ZRRA 2VXJA 4QDSA 3I54A 4Y4RA 5CVRA 3CIHA 3HIFA 5HV4A 1SFYA 4BDVB 1W6QB 2PXJA 1CAWA 2SBAA 2WNVA 5IVYA 3MBWA 3WG2A 4UFLA 4XIKA 3MHZA 4BLIA 4N53B 3D0SA 1UXZA 1AXYA 1MQTB 1LR5A 3AB0A 4M00A 3VLBB 3I4IA 2XL7A 3OBZA 5HV0A 1W9TA 2Y26A 1RVF1 2OIIA 1ODNA 4Q4Y1 3RYKA 2ZMNA 3J7NA 5FYZA 3ZPYA 2O0OA 1UCXA 5IK7A 3WT3A 4HT1T 3S5AA 3UL2A 3K46A 1REEA 1F31A 2ZHMA 3B94A 3MLKA 1GNHA 1URXA 1PGL1 5J96B 5DUUA 5E89A 4MGZE 2QUOA 4B8EA 4AHYA 4XMIA 4JKMA 2E6VA 2ZKLA 2FCVA 1HV0A 1OF3A 2LS6A 4GAZA 3H8RA 1HDKA 3VBOB 2ZMLA 1WWYA 5E8AA 5FYSA 2W46A 4PQ9A 1OLME 1UOFA 1VBD1 2EIBA 2XDVA 3MIFA 3DYOA 2D6KA 3ORJA 3R0RA 3OBRA 4OI2A 2RM21 3MYXA 2J1EA 2VCMA 3JCIA 4MSVA 2BPA2 4IE4A 4LULA 2R063 2D3PA 1OPOA 2SLIA 4XIOA 2JG9A 3WHUA 2BGCA 5J98B 1OH4A 3APBA 2VZPA 4AZZA 1Q8OA 1OFNA 1RUF2 1ZBE2 4MXWA 4RD7A 5E6HA 1JOJA 5GLUA 4A7KA 4AHXA 3M70A 1R1A3 2KM2A 2VUCA 1V6KA 1ZZ6A 5K0UA 3VB9A 4COZA 1VRH1 4FP3A 1CAXB 1OA3A 3VZJA 5FQ0B 4XACA 3ZN6B 2WWJA 3MEPA 1NOVA 1OA2A 3LA7A 5K7PA 2OA2A 3AP5A 3Q8CA 1JYTA 4EZHA 4OI1A 1DLCA 2JD9A 2RV9A 1W9FA 1OQDA 2P3YA 3QBQA 1GOGA 4CVUA 5C33A 3BPSA 1AR83 1FMD2 2HWD1 3E1F1 2D5FA 4XHBA 3DUIA 2IXLA 1G9CA 3K3OA 4QX1A 1IPKA 2R16A 1E5HA 3HEIA 3NAPA 2Q1MA 1YQ5A 2JIJA 3UGFA 4XUPA 5FYYA 1WUVA 5F5AA 4AEDA 1RUH2 1DQ0A 4AW7A 5BNOA 3H0OA 4WM7C 4Y1XA 3UNPA 3PTYA 2RR12 4WBBA 5CG8A 3ZSJA 2RJ2A 1KS5A 3FHQA 2XJUA 5FK7A 5CISA 2JEMA 4QGNA 4S2HA 2OQ6A 4FPCA 2RS33 1POV3 4RS5A 2D43A 5KXBA 5EHDA 1AYM2 3C3VA 2VECA 4X6RB 3MI8A 3B69A 3VBUB 3R05A 2EICA 3G7DA 3FBMA 2IXKA 1W6PA 3ACGA 4CUAA 3WINE 3LSDA 5I8SA 2OZ6A 4AVVA 4K40A 1V9U3 2YBSA 3GALA 4NRQA 5JR7B 2X5IC 2AYHA 3D82A 5C9AA 5JXJA 4Y24A 2ZGUA 2ZGOA 1QMJA 1W2OA 2D44A 2DVAA 2EVXA 1XBFA 4XW3A 3WXPA 3WNKA 3ZM8A 4CDXA 3JBG1 1ULPA 5FUIA 3BKZA 1D4VB 3SQOA 1RUJ2 5C4WA 1D4M3 3MZHA 3ES4A 4DY5A 1A8MA 3POSA 4XJ9A 2IC1A 4XUOA 4PLOA 4XHXA 2RS11 3O0WA 4HL0A 4WM8C 4PT6A 3WQ0A 5F37A 3K4DA 1ND2A 2C26A 4O7XA 5FZFA 2WL1A 5FP8A 5FR3A 1YQCA 1RUI2 4K9SA 3PVBB 4DFSA 4YVSC 2D93A 2QDNA 3GBGA 4QKNA 4XF1A 2BGOA 3O1SA 4S2FA 2RG4A 5JZGB 2JICA 2W47A 2XR4A 4HONA 4HK8A 3DXUA 1N1TA 5FZLA 5GALA 4XYXA 4GD4A 4B7KA 5IK4A 3N7JA 2GNMA 2MPFA 2WYSA 4CU9A 1SCSA 1S0CA 1OVSA 2E51A 4LBLA 1KGYA 4PLNA 5FP4A 5LY2A 1BK0A 5FZOA 2W95A 1CD3G 3HD8B 4TLFA 4IV3C 4UXAA 2HKXA 1U5IA 2LM3A 4IL7A 4XDPA 1ULOA 3WDXA 5A3PA 2YC0A 4CXWA 2H6BA 3GZAA 4EWAA 2H0VA 5C70A 1NYWA 4LHSA 4UFHA 2YXSA 4FAGA 3I2OA 5C5UA 4XURA 1XOYA 4EV0A 3J7HA 3E6CC 2FZ2A 2YBPA 3MIEA 4MGYE 3CMGA 3SKJE 2NP0A 3CJXA 2VZVA 1VBC1 2XKOA 4OHXA 2CNAA 4IGPA 4Q0QA 1MS0A 4RHV3 4NRMA 4W6WA 5A3LA 3OUHA 2ZEXA 1DGRN 5F3EA 1W2AX 2PHDA 5C5TA 3VBOC 3WSOA 5FYUA 3IB3A 2DVBA 5CFCB 1UD1A 2VZUA 4CDUA 5A80A 2D6NA 1LKNA 4DEQA 4CUBA 3N4MA 2A70A 3I2FA 1RUG2 1SHWB 4WZFA 5SV8A 1PO22 3D0JA 4FTSA 3FX3A 3GNEA 5FP9A 2G9GA 1OD5A 2R062 1ST8A 3H50A 3IWZA 4N53A 4AFMA 5JOZA 1DGRA 2UY9A 3PUHA 1UW8A 3QOPA 4QPIC 4ISQA 3I3QA 3LKJA 2GALA 2PMWB 2YB7A 4IXLA 5DPNA 3U37A 2CGPA 4DUXA 1XE0A 4DXTA 3CQOA 2P3IA 1VMJA 3AVRA 1RGSA 4B4PA 5JDBA 3SNMA 3PVOA 1R1A2 5DMYA 2DCTA 2HWF2 4GZ9A 4AGVA 4Q1PA 1IG0A 4RA0A 5J48A 5L7OB 4Y1ZA 3ZPOA 1SEFA 2ZGPA 2Q8DA 2FMDA 4W6YA 4RFT0 2Y34A 5JUVA 2YG0A 4RQPC 1QDOA 3LOIA 3MW4A 3T30A 4L11A 2VNOA 1LHUA 1G6NA 2WZ8A 1VJ2A 4QX5A 4L2NA 1EPWA 3LFMA 3M8LA 5CIRA 5L9BA 3VBFB 4AFCA 3R4UA 1RUF1 4W8JA 1ZBE1 5HCBA 1Q56A 4QQOA 3LSEA 3RWNA 5DDJ3 1AR82 3EB7A 4LLFA 4JGZB 2P34A 1QNYA 4NVPA 4LKFA 4R4ZA 4YW7A 2A6VA 2WA3A 4QMAA 1H6YA 4IERA 5ACA1 4NPRA 5B2GB 5EJZB 2KR2A 2XUMA 4RFRB 1WMEA 4YM1A 5IVBA 5EWSA 3U78A 1UIKA 1JOBA 3DEMA 2YY1A 3NSTA 4OLLA 2J1SA 4XVHA 1YI9A 1H1IA 1HV1A 4XAAA 4A44A 5D8AB 5A7PA 4NWWA 5KC6A 1N3PA 2ATFA 2H6CA 3VDCA 1AJOA 1W0PA 2VQTA 5A33B 1ULCA 1CAVB 1TMF3 2VL4A 5FXXA 1UZVA 1VMFA 1CAXA 4JAAA 5B4NA 1J83A 2BVBA 5IVFA 3GJAA 4LBJA 4ATEA 3P6BA 4CP1A 3OY8B 5EV7A 3PIJA 4CXYA 2Q8CA 2WWUA 4Z07A 1RUH1 3CLPA 5FY7A 4E9KA 3BOWA 3VBUC 1O3SA 1OXCA 2TBVA 3IDCB 3K3NA 4ISRA 1AL22 2BWCA 4LTAA 3A0KA 4YZ4A 4FPFA 1W28A 3VDBA 1SMVA 1D7PM 1RTVA 1T6GC 2B9UA 2WUHA 1VBB1 2ZTNA 5F7UA 1DCSA 2XJQA 4NPLA 5DAWA 4C0HA 2BRTA 1NZIA 3POGA 1BYHA 1LU2A 2PYTA 1E57A 2WDBA 3BN6A 4CCNA 1MPXA 5GLVA 1EY2A 1D4M2 4XZPA 1QWRA 5F3IA 5F8PA 3E6DA 4C1WA 1RUOA 1WGPA 2Y6GA 2VVEA 1AR92 3KQ4B 5M0TA 5LRSA 4NHXA 5JXIA 3VKOA 3O1VA 4YVWB 1UPSA 1E5SA 1WD3A 3HT1A 2MHFA 3IZOA 1QIQA 4JRLA 4LPLA 3POBA 1PGW1 4QB6A 2GAUA 4HVRA 2VZSA 1C8M1 1ZZ9A 2AC1A 1JUIA 1ZBA3 4N7IA 2BP6A 1LGBA 1S2EA 5CKQA 2XPJA 1APNA 3MW2A 5JOYA 1AX2A 2NMOA 5A3UA 1W8HA 1R091 1Q8SA 1RUJ1 1IQDC 1H4HA 1HKDA 1OOPA 1XE7A 2VC9A 1PMHX 3KB5A 4FPEA 2IVJA 2DCYA 4HPKB 1Q8VA 5EJ1B 1UYPA 4JZRA 2P2KA 4QX8A 1RMU3 2KD7A 2WNOA 4X8PA 5F5IA 3LDRA 3NV2A 3TWIA 4FTBA 2QQLA 4ZU5A 1G9DA 1MVEA 1GQGA 2I2SA 5DAVA 2XJRA 2P3KA 3I8TA 4JHTA 5LATA 3ZYJB 1BVP1 2BZDA 1AF9A 4OUSA 3WVJA 1LB2A 2A3XA 1W04A 2RMU2 1QQP3 2HYKA 1QJX3 4PQQA 4EN0A 2QNKA 4COVA 4IEUA 5JI7A 4CUCA 2ZOEB 2VNVA 2YUEA 4NOTA 3WG4A 1UOJA 4HOOA 5I8TA 1Y9GA 3TEWA 3PDQA 4BA6A 3WQ1A 1I9RA 4RHV2 1DGWX 3HBKA 5K4LA 5JZGA 1S2BA 5FZBA 3RVHA 3U14A 4BZ4A 1CAUB 1POQA 4LK7A 1UZZA 3M3CA 5A3MA 1OFSA 1MZ6A 4R8HA 3ZXEA 1YYNA 5T5PA 2XBO3 4B4QA 2PFWA 3AJZA 1W0NA 3NNMA 3ZYGA 3KT4A 1R1ZA 5C8CC 2D98A 3V56A 5KXDA 1OSGA 2ZX4A 1GFF2 4KQ7A 4E4SA 4LBKA 4Y5TA 4JX0A 1LHVA 3THTA 4LIUA 5KC5A 1NLSA 1S55A 3DKQA 2ZACA 4MH0E 2E7TA 2JJ6A 4GIQA 2UWBA 4LORA 5CNAA 4W6XA 5F32A 5A32B 2R1BA 3LDKA 3B01A 4AR2A 3IIIA 2IWGB 4GKXA 5F6LB 4UW6A 3RGBA 3ZDVA 3S6PA 2A73B 3ME2A 2ZAAA 3VHNA 5FWEA 3K75B 1W6MB 1W05A 3FFQA 1SBFA 4C91A 2NPIA 4YZ2A 4YWAA 4D8MA 2CAVA 2VZOA 2WKKA 1YHFA 1JYXA 5A3TA 2R061 1ND3B 4FQ4A 3W5MA 2OXBA 4BCUA 1HQWA 4YFWA 2R30A 1YIFA 5KHGA 2HEWF 1MR5A 4Q4W3 4PBPA 3ZYPA 2ZHLA 3H7YA 3OGJA 3DXTA 3ABZA 3UJOA 2KXLA 2YPDA 5A7SA 4EN7B 5DZEA 1V6JA 1QJY3 3E5QA 1R1A1 5EJ3A 2WIIB 3UESA 3KCCA 4MOAA 5APAA 1S0EA 4ZHNA 4JGZC 3PU3A 3MIBA 3H1MA 1UQXA 5C3OA 4PBOA 4ZPIA 1ZX5A 3K51A 1QDCA 3K4ZA 1OPMA 5I8YA 5LY1A 4D7TA 1O4YA 4IETA 1XQNA 4UWDA 2X29A 4ITCA 2WNUB 4XF4A 2DVDA 2XHNA 3IDAA 4FO9A 5I0TA 2ARCA 2R073 5FJHA 2OYZA 1PMIA 1J3PA 5D8AC 1D0HA 3WDYA 1JODA 1XNCA 4MGTA 1RVF2 3KLSA 1TMF2 4Q4Y2 4P9IA 2VU9A 1AR81 1FOD3 3W20A 4QXCA 3TN93 2BYVE 5L7OA 4QHZA 2MNGA 5B4XA 1WMFA 3TYJA 1CN1A 5H9QA 1DYKA 2O14A 4L9BA 4P9YA 3P3NA 3WW4A 3B7MA 3ZR6A 2R1DA 3ZR5A 2NYYA 3KZ4C 3GCXA 1T2XA 1A8DA 2FQPA 5CADA 2P5BA 3VBFA 3OEAA 3GJBA 4Y22B 2LRPA 1G7YA 2ZBJA 3ENRA 4V2WA 4XC9A 3BIWE 2RJLA 3ZIWA 2W5FA 3OPTA 3ACIA 4GMP3 5HXVA 2J1UA 3D6EA 2BERA 2CDOA 4H14A 4BXSV 1VBD2 1W0OA 2B7YA 2DCZA 3ZYFA 4FCAA 1YFYA 2R6QA 2RS31 1POV1 2RM22 2WR9A 4L8QA 3AP9A 1HB3A 2E33A 1PVC3 4GB33 3TEZA 1NAEA 4M4RA 5DXDA 3SXWA 4ZZ5A 1YO8A 2Z79A 2K2SA 2WT2A 3U11A 5A33A 2CDPA 2PHUA 4YVWC 1G86A 1TG7A 1H8TB 3WDUA 3EBRA 4NIGA 3VV1A 2OX0A 1V9U1 1QXRA 2FDKA 3LB9A 1GU3A 4L0PA 1BMV2 4AHWA 4ZS3A 5FK8A 4AEKA 5JVVA 2VNGA 1C1LA 3ES1A 2GP5A 4UYBA 1G9BA 2EA7A 1GZTA 4XF3A 3HBZA 4U2AA 4CP9A 4DO0A 1BKZA 1D4M1 1GKBA 2DTYA 5L9RA 2R49A 1RC6A 1PZ8A 2Z42A 3NL1A 3SH3A 5CAZA 1L7RA 2VPVA 3WCSA 3ZFGC 4FAHA 1NCQB 1WBFA 4K20A 3I3DA 2D6PA 4AWDA 4D69A 3BPZA 2B9VA 5GLZA 5LEJA 5CFDA 4FPKA 4Q26A 1W8NA 3LPGA 2P6CA 4OHWA 2JXAA 2ID4A 2VMIA 1WW5A 4XF9A 3T1LA 3M3EA 1Y4WA 3WX5A 1SLTA 1ZA4A 4LBMA 1J1LA 1DHKB 4XE9A 4NMIA 1H2NA 2D6OX 1QQP2 1QJX2 5FZEA 3THCA 1LGNA 2GMMA 3KGZA 3LEGA 4KU8A 3M4FA 5DG1A 1JZ4A 2ARBA 1JYVA 2EAAA 3EXUA 3DECA 1VAMA 4X8NA 4DMIA 1OHFA 5I0DA 1ZRCA 2VW2A 4P14A 4HN1A 2IXHA 1C28A 1KXGA 3V0AB 4O61A 2ZGKA 3AMQA 2XBO2 2VJXA 3DYPA 2AREA 1V6LA 3NJYA 4KWKA 3N9LA 4KWLA 4KMQA 1H2MA 2UWCA 4K1YA 1VP6A 2GNDA 3T3YA 3LDBA 5HCAA 4LBQD 2E63A 4KG0A 2JG8B 4SLIA 5DZGA 3ZYIB 2XWBB 2RDRA 4LITA 5DAQA 3WNXA 3I2IA 5CYYA 2QFEA 1WCKA 1COV3 2J1RA 3VL9A 1FAYA 1GZ9A 2J7MA 3VD5A 5HBAA 1GNZA 2WNEA 1KDMA 2Q5TA 5FZIA 1RHI3 1HXS3 3A4UA 4KGQA 3GHMA 4RHV1 2DF7A 1JYNA 5FXVA 4A42A 2LALA 1PX3A 3I59B 4Q8LA 1ZZCA 5BNNA 2LTNA 1BQPA 3BTAA 1UU6A 3JD73 4RN5A 4CCKA 4YLZA 1GR3A 4HLTA 4LKSA 5D2AA 2VTXA 4LO8A 1REDA 3AYEA 2PLV3 4TXWA 1UYYA 2RS12 2YMZA 3PMSA 1QJU3 5JPNB 2O8OA 4IEYA 4K8RB 4FFFA 3WV6A 1ENXA 4Z2AA 3VDAA 3OBAA 1QU0A 3GZEA 4LT5A 5ERLA 5GZEA 2LROA 1PM7A 3DN7A 4P5HA 1CAUA 4QGMA 4I2OA 3VKNA 2VGDA 2IXJA 4AVSA 4K3UA 3W5NA 2ZZJA 1P8JA 5A7WB 4W4ZA 1R082 4YW4A 2BVVA 3O1OA 5LA2A 4NIDA 1JU3A 1QJY2 1BEV3 2ZGNA 2VBDA 3Q8AA 3H7JA 1W9WA 5A3OA 1KRIA 1W6OA 2HWE3 3HQUA 5EZWA 3UKNA 5SV5A 4FI9A 5FDBA 1K45A 1EV13 5H9SA 4WM8B 4A3ZA 3VBHA 4UW5A 2BWAA 2JB4A 4CDQA 4F3JA 3K48A 1JBCA 5A32A 2PHFA 4RR3B 1KFXL 2YU1A 2F4PA 4HVQA 1CZTA 2YZ4A 2QQMA 2A1XA 2WNUC 1Q8QA 4MHUA 1RJ7A 3ZXLA 1O3RA 1VBE3 1CX1A 1D0GA 5FPXA 2XQRA 2JDZA 1I6XA 5CZKA 5BXXA 4N43B 2BV4A 5DDJ1 1NQJA 4H7MA 3OTFA 1S0JA 3ECQA 2X05A 3TN92 3WNLA 1ONAA 1UX6A 2W68A 3UKVA 3KGLA 3INAA 2P6HA 2EXIA 1ND3A 2ORZA 1CZVA 1LOAA 4GH4A 2VMHA 2W87A 1I5ZA 3AP4A 1RUC3 1VBC2 3JQXA 1YFWA 5GZGA 4I0AA 4XFFA 2YFUA 4IV3B 3ZSMA 3WNPA 4ONUA 3SEEA 3LOBA 4D94A 5EPAA 2VMDA 1A34A 4OHVA 4K8FA 3CZUA 1GSLA 2W9XA 3VKFC 1TMF1 3IMMA 2LUWA 5FYBA 2DBIA 4BYYA 1SLIA 2VO5A 1VMHA 1TQ5A 5D21A 2B39A 2ZPXA 3PUIA 4CU7A 2JE9A 1SPPA 3A21A 2HJIA 3URFA 3VHRA 3VZMA 2F4LA 3CZJA 4KNCA 1PGSA 1U5YA 5FZAA 4B4RA 4CEYC 1PVC2 4GB32 3J8F3 1VBA3 4DRVA 5FLHA 3I2DA 4A7YA 3WHTA 3AKTA 5KR7A 1G9FA 1SBDA 3OGVA 4OMDA 2P37A 4XQDA 4DNYA 2YGLA 1TZOA 4CDWC 5FP3A 5ABJC 1F5FA 3AP6A 1KJRA 1LODA 1LECA 5T55A 1JI6A 4LHKA 3LEIA 2Y60A 3H1YA 1H8TC 1H8VA 4DUVA 1MEC3 2JDYA 3UJQA 2ZCWA 4Y1VA 1XNAA 1RXFA 4I0WB 5LCWL 1I5PA 5A3WA 3T2TA 1YFUA 1V6OA 2YBKA 1US2A 3POYA 1ZM1A 3B93A 1UKRA 4CCDA 1B35C 4QPGB 3WDWA 4Y22A 1NZCA 2W1QA 2I45A 4QXHA 4E8CA 2EALA 1DZTA 2VZTA 4RSUA 4YFZA 3VD7A 1F15A 3T2OA 4QDQA 4QPIB 4COYA 5KXEA 4JRAA 4E2SA 1GOHA 5FY9A 1HJGA 4OHZA 5T50A 1NCQC 5BYNA 1BHGA 3MPBA 5HI0A 3MDPA 1BMV1 1HRI3 1ZBA1 5BNPC 3N3HA 5FY4A 4PJYA 1X7NA 4UBHA 4Z8BA 1PMJX 2QTWB 2W1UA 4F8AA 1NXD1 4LO6B 5ACA2 4RQPB 4R52A 3OOXA 1BBT3 1YJKA 1X82A 1WMXA 3KV5A 4NE9A 1IOAA 2WWSA 3W9AA 2V5DA 5IAVA 1C3HA 1RMU1 5LB6A 1ZRFA 1XXNA 1AX1A 1SBEA 1MS8A 3LAGA 1XC6A 2UWAA 4HVOA 3T09A 4FVVA 3UETA 3M1HA 2EIDA 4Q0SA 2PQSA 3ZXKA 4QKBA 2XXZA 1YQ2A 2RE9A 2CAUA 4J6GA 4R9BA 4I3GA 3AM2A 3B00A 2IXCA 5IFPA 2C0ZA 2BNOA 1O5UA 1QQP1 1GP4A 1QJX1 2VBPA 2J1VA 2VZQA 4UF0B 2IUWA 2K9ZA 4HXCA 1OKOA 4UFKA 4DXZA 2PN5A 5A6YA 5FPUA 3X29B 1S0FA 2JG8C 1O6UA 1COV2 1JZ8A 3MIDA 4FPHA 1DQ4A 3QD6A 3U10A 5GZDA 2CGNA 4BHPA 1RHI2 1C8NA 1HXS2 1ULGA 1VBB2 2B5HA 4OCTA 1W8FA 5JSRA 5IFTA 1RXGA 4KBZA 4YZ1A 5CA6A 1AR62 2VM9A 4XJWA 4A7ZA 3PVNA 4UFJA 5FFOC 4AI9A 5CBLA 2BTVC 2XBO1 3JD72 1MS9A 3WEZA 1YJLA 5I0SA 2VR4A 4CXXA 4D0QA 2PLV2 4PF5A 2I07B 3VKMA 3AYCA 3OG2A 1QJU2 1XNBA 4M0NA 3THDA 2QQVA 3LPFA 1R64A 5GZCA 4H55A 3ZXGA 1PGW2 4XJZA 1EAH2 1C8M2 4YGCA 3V0AA 4KBBA 5FZ3A 2NM1A 2VBBA 2A6XA 3H3LA 3TEXA 3ZSLA 1H9WA 1IG3A 1UOGA 3FN9A 4GALA 4N9HA 1CESA 4CE8A 1R092 2XWJB 2PAMA 3EYPA 1KITA 4WM7A 3WDVA 3IDEA 4AAXA 1IS3A 2WT1A 5LASA 3T2PA 5D1IA 1GP5A 1CONA 2YU2A 4YW6A 2D6MA 5J3UA 4XUQA 2ZEWA 3O7OA 2EXKA 4XZUG 1XB9A 2VAUA 3MPPG 1IZ3A 4JQRA 3T2QA 4RR3C 4A4AA 4YG6A 2VZ3A 5IVVA 1HQLA 4CCLA 4Q4W1 4Y33A 3USUA 3AMPA 3RJ2X 1VBE2 3POFA 1DYOA 4IDZA 1XNDA 5L19A 1R081 1YCIA 1NKGA 1NT0A 2DWRA 1YLLA 1L7QA 3O0VA 3GGLA 4N43C 4DIQA 1QJY1 1VRBA 4Q0PA 4BH9A 3WQBA 3WNOA 3AZVA 3OPWA 3I2GA 4GWMA 2X5IA 2OZJA 2WC2A 1SCRA 1MZEA 4MGQA 5JR2A 4FPOB 2QQWA 5ANNA 2UYBA 3ACHA 1CX4A 4LKEA 1X8MA 2R071 2JDNA 4IQPA 1CJPA 3QH6A 4QB1A 4RGGA 5CKNA 4ZZ8A 1OC1A 3MW3A 4E2GA 1MZ5A 3OYWB 5FO7B 1FOD1 5I0UA 3TN91 3WLUA 4WM8A 3U0ZA 4O65A 4HN0A 4W65A 2VH9A 3B02A 1H1AA 3VBSB 4M3CF 3J8F2 5A1FA 1HRV3 4FPGA 4AGGA 3GZUC 4YVSA 4I3PA 1XSQA 4AEJA 2UY8A 4S2GA 4QHOA 1LOGA 4GMP1 3LD8A 1J1TA 4FSJA 4NIIA 3ZXJA 1RUD3 1NY72 1XSRA 1HX6A 1OVPA 1LOFA 5FPAA 1LJ7A 1CPNA 1O5LA 3M3OA 2HWC3 4MVTA 4TYSA 4AI8A 5C8CB 2HEYF 5FPLA 1AXKA 3M2MA 4WV8A 2VMEA 1ZA7A 1W6QA 3ZYHA 3FC0A 5A1LA 2EXJA 1PVC1 4GB31 2EAKA 4IV1C 4QPGC 1US3A 4FFGA 4G3YC 2XH6A 4IV3A 1MQTA 2QDRA 4YW5A 3I2KA 3BB6A 4LE4A 5AFEA 5I0RA 3ATGA 2E32A 3ZVXA 4J25A 3WD5A 1MZFA 2QQPA 3WP5A 1PZ7A 1IS5A 4DB5A 5HPOA 5FREA 3SEPA 1W3VA 1C57A 4M4PA 2WINB 1UY1A 2PHTA 5F3GA 4XJ8A 3VBRB 3HJRA 2XQXA 3J7LA 1BVVA 1GP6A 4I01A 2K46A 2Y0OA 4Y1UA 1F5JA 3PVEA 2WZPP 3K4AA 4IEPA 2Y6HA 5FYCA 3C2UA 3CEWA 1GOFA 4A41A 1PK6C 3N9OA 5GM0A 1UPIA 1AR73 4KWJA 1TE1B 1UZYA 4OUMA 3VBOA 2DFCA 2ET1A 1AVBA 2AZ5A 4Q4V3 1M06G 1S2KA 4AYUA 4EN9B 1VE0A 2QCSB 3L2HA 2GC1A 3PJQA 5BUVA 3AVSA 3EHKA 4H2AA 4URAA 2WLQA 5F6KA 4YZ5A 3ZFEC 4JGYC 2CV6A 1TNFA 4WVWA 2XJVA 5DUWA 4Z92B 2WBKA 5J1XA 1OUXA 4NIHA 5IVCA 4QPIA 2ZA9A 5FBJA 1KQRA 2G19A 3BU7A 2OUHA 1LULA 3S7IA 3AZYA 1JU4A 1JW6A 1W2UA 2WT0A 3H9AA 3IPVB 5DUVA 3RYPA 1QH6A 4CP2A 5FMOL 3U1XA 3NW4A 2DCJA 2JD4A 3DV8A 4QT6A 2BDRA 5BNQA 2Q8OA 5FV3A 5DABA 4JV4A 2XMLA 4QM9A 2E26A 5FQ0A 3IMNA 4RQPA 3ZN6A 4NUBA 1GQPA 1RINA 2RS32 4EZ4A 3E97A 5JI9A 5F5CA 3RI8A 3MLJA 4BLJA 1Y9MA 4XOGA 3OEBA 2TEPA 4ASKA 5FXZA 1W8WA 2VVDA 2W91A 4QQ2A 1COV1 1OH3A 2V09A 3JB4C 4XFCA 5FZ8A 2GU9A 2GNTA 3RG0A 4BM8A 3VD4A 1PIV3 1V9U2 5FYHA 1RHI1 1HXS1 2Y6FA 4HSLA 3WDTA 2EXHA 1QJFA 1AR61 1XYOA 1HB4A 4YRDA 3ZMNA 4Y3OA 3NNGA 4UF0A 1UF2C 2TNFA 1UMIA 4L97A 2OPKA 2QZ3A 5FO8B 3JD71 4ASLA 3WG1A 4CRQA 5FZKA 4G9SB 2PLV1 4QD2A 4R9AA 3UYJA 1RUNA 1GZWB 1QJU1 3BYWA 4AQSA 1WA4A 4ET7A 1N1VA 2ETEA 4E4ZA 1W6NB 1FNZA 1UNBA 3ZFFB 1EAH1 2FDIA 3KVAA 1W8TA 1XU2A 5FMCA 1DLLA 4UFMA 5C71A 2XOMA 1UY3A 1W3XA 1ZZBA 3EMRA 3VBUA 1Z0HA 4PHZA 1BEV1 1PNGA 2VCBA 4N9IA 2GMEA 2XUEA 3N9NA 4XFAA 2HWE1 4Z1VA 1C1FA 3ZFGB 4ZONA 1EV11 1DYPA 1DQ1A 5T5JA 2WQZC 2BGPA 3FBYA 3LZZA 4MZUA 3CBNA 3OBTA 2CY6A 1V6NA 1OQ1A 1SFNA 1CR7A 1UAIA 3ZOIA 2FDHA 4Y5Z0 2DTWA 1VBE1 4LQRA 4P9JA 4CCCA 4MV2A 3IDBB 4BU2A 1DF0A 5EQUA 4XXAA 1JH5A 2G1MA 2X8KA 2ZKNA 3M7AA 3W59A 4P08A 4PDWB 3ZN5A 1NA1C 2B8MA 2HWB3 3AX4A 4LO5B 3H42B 4CUGA 1NQDA 3VL8A 1X36A 5FZMA 5KBFA 2CU5A 2GNBA 3BIEA 3OCPA 2VUAA 3VBSC 3N36A 1NCRC 1O59A 2XLFA 4L92A 4I30A 1W8UA 3CDZB 1RUC1 2VZ1A 1OURA 1J84A 3Q8BA 2VMCA 4XFHA 5T54A 3DPRB 4C8DA 4IE0A 3OF1A 4MGKE 1QKQA 1ASJ3 1EPZA 1SDWA 4M3CB 1DBNA 1ULEA 2RHPA 2HWD3 3WW3A 1RUD2 3TNPB 2CSGA 1F9KA 3CO2A 3AMHA 1UZWA 3BGAA 2VCAA 3SKVA 4KI5M 1YWKA 2WZEA 1AUYA 2OS2A 2D97A 1HQNA 1H9PA 5HCHA 2B42B 1K5MC 1SDDB 2QBXA 5FXWA 1XE8A 2VVFA 3J8F1 1U0AA 1VBA1 3H3UA 3OGGA 4JTOA 1ZVFA 3NJXA 1U5ZA 2WZR3 1UY0A 3LEMA 1XPWA 4ORFA 1QOTA 4JDOA 3THPA 2V5YA 4EN6B 3U4XA 4Y26A 1EUUA 1UU5A 5T5LA 1LEMA 2HBTA 1VALA 2EIEA 5FBZA 5A6QA 2C9AA 3B9IA 4XJAA 3SITA 2QVSB 2FZ1A 2PQQA 1NY71 2DVFA 2R0FA 2DYCA 5FZ9A 4AQTA 4D7SA 3P1IA 1LHOA 1HB1A 2W3JA 3VBRC 3H8OA 1W8ZA 4XBLA 4CPBA 1HIXA 2XKPA 3LEKA 5DAPA 4MHRA 5JMOA 4PLMA 4Q4V2 3NKTA 4DUWA 1S0GA 3C7GA 3NWKA 5CFCA 4NHMA 1WLDA 3ZN4A 2BQPA 3SLIA 4H7LA 5J7MA 1O3QA 5C8CA 5EXOA 4XEZA 4IEOA 3RZGA 2W0XA 3C7EA 3I3EA 3PL0A 2E31A 5DDJ2 2ADEA 1HRI1 4DRRA 4OFGA 4B7EA 1XYPA 2GSYA 3LCPA 1XJAA 4UFIA 3R6SA 3OUJA 1OA4A 3HN3A 4B1LA 1MS3A 4KWUA 3NV3A 5F39A 1BBT1 2GH8A 2W94A 2WO1A 3M3QA 3AZZA 4RGKA 4URTA 4AVTA 5FUPA 3J4UH 4GKYA 3DF0A 4AGRA 1W99A 4XQ4A 1JTZX 1VB4A 1CAWB 2WNVB 5IUQA 1VLNA 2N7GA 1ACCA 4B29A 2A3WA 4Y5SA 1DFQA 3LQCA 4Q0VA 3GYDA 2QJVA 1ZZ7A 4YW3A 3SISA 3MO4A 4NN0A 3OPZA 1QXJA 5T5OA 4A6SA 4AI0A 4NIAA 1DQ2A 5F3CA 2EIGA 5FZ0A 1UZ0A 4BMBA 1L3JA 2YGMA 2PA7A 4LA2A 1AYN3 5FZ4A 1W39A 5KHHA 4NHLA 5FZ6A 4CA9A 2Y6JA 4JGZA 2A6WA 5C6CA 3O1MA 1PIV2 2YC4A 5L73A 1AL0G 4JHZA 1GBGA 4QQHA 3MF9A 3LGRA 2JE8A 5CEHA 3UV9A 2VOWA 1RYYA 1WW6A 2YC2A 4OI0A 3NV4A 4CEYB 1Z7S3 5IW0A 1UOBA 2PHLA 5DQ0A 4CCEA 2GDFA 2XGXA 1SLCA 2ZHKA 5FLJA 3CHXA 2GP3A 4LE3A 5D8AA 4CDWB 5ABJB 3AKPA 3U75A 2BUKA 2P1BA 1W2TA 2Y0IA 4A45A 4AHZA 4AVAA 4WVMB 1CAVA 4L99A 5CB7A 4GA9A 1PNFA 2A6YA 4N8MA 4P9XA 3O5SA 3ZFFC 2V72A 2JG9B 2VE1A 1JHNA 2WS93 2ZX2A 3OY8A 4FFIA 1ZBA2 2W52A 1REFA 1J58A 2PHXA 4OZOA 1FT9A 4EROA 4MXWB 1B35B 3KV6A 5E88A 1ULFA 4DEVA 2G9FA 2RDQA 3NJVA 4IEVA 5ANQA 4HKOA 3KD4A 1BLZA 1WMDA 2BJSA 3ZLIA 5K0UB 5HCFA 1RMU2 1Y3TA 4ARYA 4WVZA 1TVGA 3ON7A 4I02A 1XYNA 4XETA 4QU2A 1DGLA 3WF0A 5H9PA 2W39A 3AL5A 1CQ9A 3N7MA 4AQ2A 3HQRA 1KS4A 2ZEYA 4KH9A 3MV01 4R9CA 4K1ZA 5BNPB 5FZGA 2EF6A 1U5XA 1PM4A 4QDRA 1KDKA 3KT7A 3VDDC 5FZ1A 1W9YA 4SBVA 1QOSA 2WAOA 5FMBA 5IAXA 2A5ZA 2HWB2 4LBNA 4YVWA 4PDWC 1FATA 1D2SA 2JDHA 2JWPA 4BQ5A 5AC93 1GZWA 3T0DA 4IE6A 3E6BA 4GWNA 4CEWC 3NAPB 1W6NA 3A23A 1UL9A 5IYYA 1XRUA 3FMGA 2A6ZA 4NR1A 4AEDB 5CU1A 3T0AA 2ADDA 4KG8A 4MX3A 5EP9A 1PHMA 1JZ3A 3ZKUA 5JIAA 1RUE3 2QQIA 4FOYA 4GJZA 1TNRA 3DPRC 1ASJ2 1LEDA 4QX7A 4BJ0A 5JPMB 5H9RA 1J59A 1CIWA 4BB3A 3O0XA 1SFPA 1WKYA 4HPKA 4XDQA 4YM2A 4YW2A 3ZFGA 1AXZA 1S1AA 3ZXFA 3AMMA 1YEWA 2DFBA 4XTPA 2Q30A 3ZIXA 3ZDSA 1WCDJ 2IFRA 2Y64A 1FYUA 1QGLA 3FLPA 1LOCA 4HMZA 1KEXA 4WVVA 1JYIA 1CVNA 1K5JA 2OQ7A 4XDOA 4QKDA 3CU7A 1S0BA 2G4IA 3RRDA 5FWJA 3T08A 3CJIC 2F6BA 2ZHNA 1O3TA 1JZ6A 2E53A 4ZXEA 1IGOA 1GNYA 2HLEA 1FMD3 4YM3A 4E4DX 1RUD1 4P9WA 2QKDA 1FXZA 4J1XA 3D4KA 5T52A 3F2ZA 4DS0A 4X6QB 2E7AA 2HWC1 3FLTA 4XABA 4GJYA 4AI2A 4CDXB 4OYUA 4MYEA 4XFIA 5C7GA 2DV9A 2Y6LA 3ASIA 3FE5A 4BQYA 2GN7A 1Q8PA 5IHRA 1B09A 5C4WB 2K0GA 4MUVA 2B45X 2AENA 4LBQB 4YZ3A 2LW8A 4GXLA 4M3CA 4YYOA 1YUDA 2V4AA 4Q0UA 4Q4W2 3BU0A 1PO13 2RR13 3WF4A 1DQ5A 3WF2A 1ND2B 1I3HA 4BXFA 5HXMA 4K7JA 3F95A 4IE7A 2C24A 3HPNA 3H8XA 2QQNA 3M3IA 1AYM3 1QNWA 2P4EA 2XJSA 1UU4A 4XCBA 4YM0A 4DXSA 2HBUA 4M0HA 4AF9A 1OD3A 4UW4A 1N47A 1AR71 1XU1A 1UMZA 3FFZA 2VMFA 2JIGA 2VTFA 3KT1A 1WCQA 4Q4V1 3GDBA 1ULDA 2FHRA 3KV4A 5FTTC 2R072 2WSUA 4CP0A 5DAXA 3ILNA 5FY5A 1W6MA 4YGEA 5LEKA 3I97A 2WNVC 4PI0A 1FOD2 4JCKA 4TWTA 5FZOB 4QQLA 1CWPA 1GQHA 2BFUS 5A7QA 2J22A 4KU7A 2Y33A 3KF5A 1RUJ3 3B5LB 1UY4A 5JMCA 4COUA 5FPZA 2BOJA 3A7QA 4CU6A 1MACA 3UK9A 1WLCA 2O8QA 4IEZA 2QE3A 4Q4X3 4BQ3A 1HLCA 4ZS2A 1PX4A 4DPNA 1UWWA 1HW5A 1HN0A 2P17A 4K21A 1RUI3 4CCJA 3HR9A 3ALQA 5LA9A 2JDMA 3IAQA 4EQVA 3AZXA 3WR0A 4IUGA 5KHJA 3DGTA 5LBFA 1ZRIA 5FY8A 3RI9A 3ZXAC 1VB2A 2CWMA 1Y9QA 4QX0A 3RWKX 1OLMA 2ZJCA 2VW1A 4NROA 3AZWA 2OPWA 3NNFA 2WNUA 2JDAA 3PUAA 4E2QA 3PTRB 4Q27A 1UYXA 4CTEA 3SH4A 4D3WA 4TSVA 3ZKYA 3MV11 1Q3EA 1JZ5A 3W21A 1G8WA 4NHYA 4XTMA 4PIYA 4BE3A 4HBNA 5AFBA 4B1MA 2QQUA 1PIV1 1FI2A 1QY4A 2WS92 2DCKA 3I49A 1X8EA 2ERFA 2QQOA 4AFDA 4C90A 4LJHA 2JG9C 4AI1A 1TME3 5LWBA 1N3QA 2WA4A 4FT8A 4EE2A 4HANA 1OMIA 1IPJA 3PUQA 5FOBB 4Z2WA 2XJTA 1FX5A 4IV1B 3ZSKA 4XUNA 2YDEA 1PZ9A 1QH7A 5A1AA 4MG2A 1GZCA 3CF6E 5GJ6A 2ZX1A 1N1YA 4IESA 5K0UC 2ZX3A 1QEXA 5LBCA 5IK5A 3RQ0A 1QJEA 1YIPA 1CIYA 2JX9A 4P9GA 3D8CA 1POV0 5BY5A 5FLIA 2FDFA 4Y1YA 4CEYA 2PELA 2ILMA 3Q9OA 4ZXKA 3AL6A 4ZU7A 3IN9A 1RUG3 4WZCA 3KQRA 1PK6B 4Y20B 4Q29A 3RNSA 4CDWA 5ABJA 5LA1A 1SACA 2DDUA 1PO23 2VULA 4WVMA 4XXPA 5FYIA 5AC92 1H8TA 3QCWA 1W03A 1D2QA 1UX7A 5FP7A 3NAPC 3ZX7A 1SQ4A 2VUJA 3PU8A 4AEDC 1ODMA 1WBLA 2XB6C 4FBFA 3ZFEB 4JGYB 2QQJA 1RUE2 4QPWA 1B35A 3TBDA 4E27A 4JQTA 2W1WA 1NG0A 1JUHA 4A3XA 5BNOC 1UY2A 3N7LA 2HWF3 2WYFA 1TEIA 4AVCA 1GYKA 4EJRA 5KXCA 2HWB1 2GC2A 3TRSB 4AI3A 5DUXA 3BI3A 1NCQA 1RJ8A 1F2NA 1EP0A 4XJUA 3VKLA 1OF4A 3KS7A 3TNQA 4RS5C 2R7EB 3QLQA 5BNPA 4N90A 2OW4A 2Y38A 2Z5WA 4FQZA 3RMYA 2NZ9A 1W8OA 3I3BA 1ASJ1 5DZFA 4B3NA 1G9AA 4AOCA 3FHIB 4LNVA 1YRZA 2VTXJ 5A7OA 4BIFA 4ZY9A 4XMAA 3OD4A 5C9AC 1SZBA 3C7HA 1V6IA 2R043 2NMNA 2YPJA 4CDXC 5FUNA 5JSOA 1KFUL 1RIRA 3MIHA 3RMXA 3WCRA 5KHIA 2D3RA 2WZR1 4G4FA 4MLOA 5C4WC 1C4RA 3VGIA 4PIXA 4XFGA 1BJQA 5FRAA 3LE0A 1PO12 2FMYA 5FKCA 3ZYBA 4LR4A 1OBNA 2DBNA 3JZVA 2ZZQA 1F8VA 2Y6KA 1ND2C 3GZTB 3KHCA 4JKKA 1BEV2 1DZRA 4XUTA 2JG8A 4E8DA 3H3ZA 3POWA 4DXRA 2HWE2 2J42A 2Y8KA 2UURA 1EV12 2VW0A 4AAPA 4FOWA 1ZNPA 1OOPB 1AL23 1U12A 4HG6B 2RS53 5F2SA 2X09A 3I59A 3V0BB 1OI6A 1OLQA 1E5IA 4QX2A 3AYAA 4QKFA 2WSVA 4NJ4A 3HQXA 4FFHA 4LHNA 3FHAA 4EYUA 2IFWA 4XBNA 3VD9A 1QHDA 3AKRA 2WJSA 1MVQA 5CKMA 3VZKA 4LBQA 4JKLA 1AR93 3BTXA 4NRPA 1ENRA 4OMCA 1DGWA 1DQ6A 4QU1A 1RUC2 2AGSA 1F4HA 5LA0A 1X50A 4M01A 3BVCA 3C7OA 1KD7A 1VR3A 3BOPA 4Q4X2 5A7WA 3C8XA 4ZU4A 1UYZA 1CZSA 2XLGA 2HH9A 3JU9A 3J7MA 2DU0A 2E7QA 1HB2A 3VN4A 3VZOA 2VOKA 4QHBA 4LA3A 5FO9B 2AH2A 4Z82A 3ILFA 5JXHA 1NA1B 2BU9A 4JDNA 4P5YA 5L9VA 1IHMA 2W08A 1GANA 3IBMA 4OHYA 2CTVA 3ST7A 5AVAA 4BPZA 1SG3A 4RR3A 4XQWA 2XHKA 1GUIA 1NCRB 1J3QA 3IAPA 1VBA2 2ZGTA 3NNJA 2MEV3 1LOEA 1LOFC 2XL9A 3NKGA 4CDUC 4CPBD 3ETPA 4ES8A 2F17A 2ZXQA 3WP4A 1IS4A 2UU8A 3ETQA 2AEYA 1AYN1 3Q8FA 4LO7A 4Q5OA 3RSJA 3WOGA 2WFF3 2A7AA 4N43A 5K8SA 1LOBA 1WLWA 3W58A 3IKWA 1MEC2 4N53C 3VZNA 1MQTC 1V00A 2GN3A 4LUKA 2GMPA 3CKHA 5EFUA 3PJYA 3OD0A 1JHJA 1TME2 2DVGA 2VOTA 1K42A 2FBEA 4QQPA 1UN1A 1K5MB 1LU1A 1NX9A 2RMU3 4CSWA 5DN2A 1Z7S1 4MGSA 4CCMA 4META 3I3MA 5LW9A 2WO2A 1C5IA 2HYXA 4MADA 3FLRA 5C3SA 5FYTA 3WG3A 3GCWA 4EWEA 5IVJA 3T1MA 3IM0A 5IK8A 2Z2SB 2BNMA 1W06A 1XNTA 2JDUA 1GMMA 3POEA 5LK5A 1F35A 2JDPA 4AFAA 5FIXA 3NV1A 3KMHA 2WS91 2XVLA 2WN3A 3UT0A 1HRI2 3ACLA 3WNNA 3ZMOA 5F9TA 3KSCA 1KJLA 3HWJA 3BTZA 3Q8EA 3CNAA 3WW1A 3HOBA 5IJRA 1O4TA 2VCCA 4XILA 2NLRA 3S30A 2QQKA 3WF3A 1BBT2 5F1RA 4EN8B 2NQYA 3U4SA 4V2VA 3AFGA 2YROA 2Z69A 2CGOA 3C7FA 2H0BA 4AG4A 1H6XA 3NMBA 4C0BA 5FMDA 3SCFA 4R9DA 4IV1A 4QPGA 4CYDA 2D5HA 4JTNA 1OKQA 1FPN3 5BPXA 2WO3A 1E5RA 4F7ZA 4LKDA 3TAYA 3HVDA 3O14A 4W50A 2WO7A 2BBAA 3HMYA 4UBGA 1YQ8A 2XJPA 1LHNA 5AC91 2FDJA 1O4ZA 3DL3A 5FY1A 2RDNA 3S7EA 4XPVA 3HNMA 1IKPA 4MXVA 3POIA 3AMNA 3EO6A 4QAWA 3T4VA 4D6RA 3RZKA 2VNRA 3VUOA 1OT5A 3EQEA 1LCLA 1O91A 2VY0A 4P9LA 3KWVA 5FZDA 1K12A 1ENQA 5JOWA 5FPVA 2VZRA 1ZREA 1RUE1 1Y43B 5K9YA 3PNAA 1WZXA 4Y20A 1PK6A 3WP3A 5I93A 4LEJA 5JOXA 5JAXA 3FL7A 3VZLA 3SCGA 2B4KA 1RL3A 4K6BA 2OKXA 1WLTA 1YQ6A 3QACA 1NE4A 1LNSA 5LK7B 2R042 3ZSEA 1IQAA 4OQ9A 2J1TA 2VQUA 4JGYA 3ZFEA 2JE7A 4GWIA 1X33A 4INDA 3RZZA 5JSPA 4LO4B 2L9LA 3J9SA 3LFIA 1RVF3 1XNKA 2PHWA 5KHKA 4Q4Y3 1FMD1 2P3JA 1SLLA 4BK4A 1O8SA 4IEWA 3RFRA 5IWFA 5A7NA 1YFXA 3NO8A 4DY3A 4CZSA 1H1MA 5C3QA 4TTGA 5C3PA 4LOTA 4XAEA 3RZJA 2ZS6B 3FWEA 3MGUA 2C6SA 3DKWA 1A78A 3UGHA 4CP9B 3WP6A 1ALYA 1WA6X 4QB2A 5FPBA 1OOPC 2RS52 4RGAA 4ZKTB 1H4GA 2IXIA 1PO11 4F83A 2RR11 1T6BX 1SLBA 2Q0AA 2ZMKA 3UKTA 4AEMA 3AYDA 4KGGA 2R0HA 4IW3A 4YG0A 1MS1A 1VBD3 3O1UA 2WQ8A 3I2JA 3ELNA 3SHRA 5CFDB 2RM23 3O1PA 4ATFA 3RZHA 1YXWA 4PI2A 1VIWB 1AYM1 4FOVA 4PIZA 5FYMA 3SC7X 5J37A 1YC61 4S2DA 3WUCA 4MGIE 3GXUA 3ZO0B 3N9PA 1H30A 3MLLA 3N35A 4D6QA 5LRRA 2D7FA 1UIJA 2GC0A 4QX3A 3ZXDA 4EWDA 1C5HA 5JLVA 2CHHA 4LK6A 3DYMA 3N9MA 1NLRA 1DP0A 3LWCA 2IZWA 4JVAA 3VDDB 1FV3A 2WRAA 5GKAC 2VQ0A 3PHMA 4FP2A 4AFBA 4LMFA 3DCQA 1M4WA 4UOJA 2B46X 1LAJA 1VRH3 3OUIA 5EIYB 3E5UA 5JWPA 3E5XA 1OQEA 3IIAA 3MFAA 1N1SA 5JZGC 1DDLA 4Q1RA 4V1PA 5G05L 2JKXA 3WY6A 4BQWA 4CEWB 2E9QA 4O9GA 2XONA 2ENRA 2RJKA 1HRV2 2MEV2 1ENSA 4D6SA 5IATA 4TLGA 3V0BA 2D3SA 3QH7A 1JOPA 4AVBA 4OULA 4Q4X1 1WCUA 2FCTA 2WFF2 3PIGA 4C1XA 4NPMA 1YNAA 2D6LX 1RUI1 1IS6A 3WZ1A 3B3QE 5A70A 1AX0A 5FCCA 4LBOA 1OLRA 1Q43A 5E1RA 5FZHA 1X9TA 3TEYA 1BZWA 2HWC2 2X10A 2BBVA 2Q1FA 1BCXA 3BODA 5TSWA 1LESA 4QPYA 1ZZ8A 2BOIA 3ROUA 4FPJA 1MS4A 5BNNB 2VQAA 5J36A 4HSJA 4XF0A 2XG3A 3AXDA 4FTEA 3BTYA 3RDIA 3CJIB 2OVUA 3V64A 3ACFA 3P5BA 4BIOA 4YPJA 2J1AA 4A2UA 3OYWA 4IE5A 5A6XA 1NA1A 3I7DA 1LGCA 5LBBA 4BISA 2DUQA 1MEC1 4LHLA 2O1QA 4LXLA 3VBSA 1NCRA 2IVIB 1QF3A 1TME1 2DUPA 4BK5A 2ZGLA 2JECA 5CFCC 5E16A 1W9SA 1JZ2A 4ES9A 5G04L 4U36A 4FPLA 2AR6A 5LBEA 4CU8A 5J09A 1AR72 1O7FA 3KVBA 4GMP0 1W6OB 2ORXA 4NWVA 3D5OA 1DZQA 1HN1A 4UAPA 3VBHB 3H8UA 3K77A 4BQXA 4CDQB 5IT6A 3KF3A 1S0IA 1GICA 1L7LA 2W1SA 2JENA 2FDGA 2A71A 1K5MA 2D40A 3JBG3 4FOQA 4AK3A 1FPN2 4PCRA 2V4VA 3LF7A 1I1EA 1RUG1 3KCXA 4Q8KA 1WCSA 3MUY1 3CL1A 4YW1A 3RJRA 5ISLA 2DU1A 1PO21 1NUKA 2A3YA 5L7OC 5A3NA 2RS13 2ZGSA 1HJFA 4MO3M 4BQ1A 3GF6A 3OGRA 4GH4B 2WFPA 4RYDA 5FJKA 1K3IA 1Z78A 3HT2A 2RVAA 2AEZA 3RZMA 2CL2A 3L2YA 3VBRA 4QGLA 5FYVA 3MFCA 5T3NA 1R083 2BFUL 3VBFC 3AKQA 2I74A 3LA3A 2ZEZA 3OJBA 4QM8A 3KCYA 5GLWA 1IKQA 1DIWA 1DU3D 1UKGA 1H2LA 5DG2A 2HWF1 2WN2A 3GBWA 3D3AA 1JYCA 3MIGA 5FKBA 4OI4A 3BALA 3N7KA 4QXBA 4CCOA 3R4DB 3S5QA 3K2OA 4BQ2A 2ZAHA 1AHSA 1SPPB 2XLAA 3BCWA 3OGSA 1W90A 4LIVA 5C3RA 4I09A 1RB8G 4YG3A 4J1WA 4BOWA 2ES3A 4BQ4A 4UT5A 2ZGMA 4RL7A 3PUSA 1JYWA 2W92A 2ARAA 3T4HB 3U07A 2GZWA 5FMOS 5FZCA 4HFSA 4YARA 1DG6A 3GBFA 3AC0A 1V70A 1WW4A 4NAOA 3A0NA 4IEXA 2YFZA 2VXRA 2PTMA 1PGL2 4AXOA 1MS5A 1CGPA 2ET7A 3IPVA 3VHPA 1NXMA 3H1WA 2R041 4OQ8A 3EJKA 4N7UA 1VBC3 5FY0A 1V0AA 4GWJA 1H2KA 3S57A 1UXXX 4HZFA 1Q5OA 5GZFA 4COWA 1V6MA 2VOVA 3JB8A 3NVCA 3WNMA 2ZABA 4HETA 3B9CA 1WW7A 4JDMA 2UYAA 5BV6A 1CJDA 2PAKA 4XCAA 2FCUA 1QJZA 3PURA 1VAKA 2JB8A 3RPQA 4DQAA 1NLQA 3NQHA 5CFDC 3FJSA 4IGOA 1NE6A 1S0DA 2OT7A 2KA3A 1N3OA 3HNBM 3KV9A 3AXEA 3OB8A 4H3WA 2AACA 5IVEA 2VOXA 2ARXA 1VPHA 2CWSA 1LTEA 3FZ3A 3SH5A 1AL21 2YYOA 2RS51 3PLQA 2YHJA 2BW8A 2VUDA 2FD8A 4ARXA 4YSFA 3HAGA 2ZX0A 4TN7A 2Q8EA 2W2IA 3JXSA 1LRHA 2CYFA 3HN1A 3TB0A 5FZ7A 2X53S 1VRH2 3G6JB 4AQ6A 1GV9A 2WABA 2ZGQA 3AKSA 3KHBA 4NHKA 3LIGA 4OUEA 1F4AA 1AR91 3JQWA 1X9PA 2GC3A 3IT8A 4XBQA 3ZFFA 3ILRA 3WUDA 4BWOA 3T0BA 2YV8A 5KWRA 4ASMB 5I91A 3GM8A 2PAEA 5GLTA 1RITA 1RUF3 1ZBE3 3FUOA 1VAVA 4QWNA 3TOJA 3MICA 5BNOB 2BNNA 2DURA 3A22A 2HWD2 1AZDA 3J26N 3RS6A 3NRUA 4HK9A 1JZ7A 3AK0A 1OUSA 3O12A 3JUUA 2WQ4A 1EYBA 1UMHA 2ZGRA 1CPMA 4BMEA 1ZRDA 1A3KA 1GWMA 3VD3A 1JXNA 5ACA3 1J3RA 2DUOA 3USSA 2C4XA 3LIHA 4RS5B 4P00B 1HRV1 2MEV1 3L9JT 1GLHA 4UW3A 5BNNC 2WZR2 4O9EA 2VMGA 3V65A 3VDDA 1BK1A 1GWLA 2WFF1 4YGBA 2WAAA 3FUQA 3O1TA 1W6PB 2Q1ZB 4PDWA 3WF1A 4DINB 1FNYA 3POJA 5JXGA 4CEWA 3NNLA 2R32A 2HEVF 5C9AB 4GQ7A 5A6ZA 2C1FA 2RMU1 1W2NA 5CG9A 1JS9A 1LENA 3N9QA 3AFKA 2RDSA 3VHOA 4GULA 1O8PA 5F2WA 1JMUB 3S0MA 3ITQA 3PMEA 1RUH3 3DPRA 2XVKA
chains in the Genus database with same CATH topology
4WM7B 5JIUA 1LHWA 3MF6A 2BEOA 4XFBA 5L36A 3VBHC 4CDQC 4HKLA 3ZYRA 1VBB3 1A6CA 4TZDA 1AR63 4IEQA 5AVPA 3USUB 3JBG2 1PVXA 1QOOA 3R4SA 3AJYA 4FPYA 4JC1A 1AJKA 2A75A 3CJIA 2XVGA 4HKWA 2OUJA 1SLAA 3WW2A 5F5QA 4AE2A 1ND3C 4DZGA 4D7YA 2X5IB 4GH4C 5FAXA 1EAH3 2GH2A 1C8M3 2QZ2A 3SMHA 5EYXA 4YGDA 4Y4YA 4QXKA 2AUYA 3GHNA 1R093 3WQ7A 1FPN1 4R4XA 1QXPA 1H0BA 1FV2A 3AP7A 3KM5A 3NJZA 1Y7BA 3RYRA 1WD4A 5EYYA 4NO4A 4M3CE 4YNIA 1YI7A 2WLPA 4FXKB 1AYN2 1BXHA 4I0BA 2Q4SA 1ZYBA 2NN8A 2PHRA 4YVSB 2C5DA 3LA2A 4Q2FA 3SCHA 2VG9A 2V73A 4OZXA 4OVEA 4FXGB 4LLOA 5JCTA 4KL1A 2JKBA 4DOUA 1Z7S2 5C8WA 2TUNA 1JN2P 3P3PA 4CDUB 5FOJB 4LUMA 1ZRRA 3I54A 5CVRA 3HIFA 1SFYA 1W6QB 1CAWA 2SBAA 2WNVA 3WG2A 4XIKA 4BLIA 4N53B 3D0SA 1AXYA 1MQTB 1LR5A 3AB0A 4M00A 3VLBB 3I4IA 2XL7A 2Y26A 1RVF1 2OIIA 4Q4Y1 3RYKA 2ZMNA 3ZPYA 2O0OA 1UCXA 5IK7A 3WT3A 4HT1T 3UL2A 1REEA 1F31A 2ZHMA 3B94A 3MLKA 1GNHA 1URXA 1PGL1 5J96B 5DUUA 5E89A 4MGZE 2QUOA 4B8EA 4AHYA 4XMIA 2E6VA 2ZKLA 1HV0A 1HDKA 3VBOB 2ZMLA 5E8AA 4PQ9A 1VBD1 3MIFA 2D6KA 3R0RA 3OBRA 4OI2A 2RM21 3MYXA 3JCIA 4MSVA 2BPA2 4LULA 2R063 2D3PA 1OPOA 2SLIA 4XIOA 2JG9A 3WHUA 2BGCA 5J98B 3APBA 1Q8OA 1OFNA 1RUF2 1ZBE2 4MXWA 4RD7A 1JOJA 5GLUA 4A7KA 4AHXA 3M70A 1R1A3 2KM2A 1V6KA 1ZZ6A 5K0UA 4COZA 1VRH1 4FP3A 1CAXB 1OA3A 3VZJA 5FQ0B 3ZN6B 3MEPA 1NOVA 1OA2A 3LA7A 5K7PA 2OA2A 3AP5A 4OI1A 5C33A 1OQDA 3QBQA 1AR83 1FMD2 2HWD1 4XHBA 2D5FA 1G9CA 3DUIA 2IXLA 1IPKA 2R16A 3NAPA 2Q1MA 1WUVA 4AEDA 1RUH2 1DQ0A 4AW7A 5BNOA 3H0OA 4WM7C 4Y1XA 3PTYA 2RR12 4WBBA 5CG8A 3ZSJA 1KS5A 2XJUA 2JEMA 4QGNA 4S2HA 4FPCA 2RS33 1POV3 4RS5A 2D43A 5KXBA 1AYM2 3C3VA 2VECA 4X6RB 3MI8A 3B69A 3VBUB 3R05A 3G7DA 3FBMA 2IXKA 1W6PA 3WINE 3LSDA 5I8SA 2OZ6A 4AVVA 4K40A 1V9U3 3GALA 5JR7B 2X5IC 2AYHA 3D82A 5C9AA 4Y24A 2ZGUA 2ZGOA 1QMJA 2D44A 2DVAA 2EVXA 3WXPA 4XW3A 4CDXA 3JBG1 1D4VB 1RUJ2 5C4WA 1D4M3 3MZHA 3ES4A 4DY5A 1A8MA 3POSA 4XJ9A 2IC1A 4PLOA 4XHXA 2RS11 3O0WA 4HL0A 4WM8C 3WQ0A 1ND2A 2WL1A 1RUI2 4K9SA 3PVBB 4DFSA 4YVSC 2D93A 2QDNA 3GBGA 4XF1A 4S2FA 5JZGB 2JICA 4HK8A 1N1TA 5GALA 4XYXA 4B7KA 5IK4A 3N7JA 2GNMA 2MPFA 1SCSA 1S0CA 2E51A 4LBLA 4PLNA 1CD3G 3HD8B 4TLFA 4IV3C 4UXAA 2HKXA 1U5IA 2LM3A 4IL7A 3WDXA 2YC0A 2H6BA 3GZAA 4EWAA 2H0VA 1NYWA 2YXSA 4FAGA 4EV0A 3E6CC 2FZ2A 3MIEA 4MGYE 2NP0A 3CJXA 1VBC1 2XKOA 4OHXA 2CNAA 4Q0QA 1MS0A 4RHV3 4W6WA 5A3LA 1DGRN 2PHDA 3VBOC 2DVBA 5CFCB 1UD1A 4CDUA 2D6NA 1LKNA 3N4MA 2A70A 1RUG2 4WZFA 5SV8A 1PO22 3D0JA 4FTSA 3FX3A 3GNEA 2G9GA 1OD5A 2R062 3H50A 4N53A 3IWZA 4AFMA 5JOZA 1DGRA 2UY9A 1UW8A 3QOPA 4QPIC 4ISQA 3LKJA 2GALA 4IXLA 2CGPA 2P3IA 1RGSA 4B4PA 5JDBA 3SNMA 3PVOA 1R1A2 2DCTA 2HWF2 4AGVA 4Q1PA 4RA0A 5J48A 5L7OB 4Y1ZA 1SEFA 2ZGPA 2FMDA 4W6YA 4RFT0 4RQPC 1QDOA 3LOIA 3MW4A 4L11A 2VNOA 1LHUA 1G6NA 1VJ2A 4QX5A 4L2NA 1EPWA 5CIRA 3M8LA 3VBFB 4AFCA 4AFAA 5FOBB 3R4UA 1RUF1 1ZBE1 5HCBA 1Q56A 4QQOA 3LSEA 3RWNA 5DDJ3 1AR82 4LLFA 4JGZB 2P34A 1QNYA 4NVPA 4R4ZA 2A6VA 2WA3A 4QMAA 4IERA 5ACA1 4NPRA 5B2GB 2XUMA 1WMEA 4YM1A 5EWSA 1UIKA 3NSTA 2YY1A 4OLLA 5KC6A 1YI9A 1H1IA 1HV1A 5D8AB 4NWWA 1N3PA 2ATFA 2H6CA 1AJOA 1W0PA 5A33B 1ULCA 1CAVB 1TMF3 1CAXA 4JAAA 2BVBA 4LBJA 4ATEA 4CP1A 3OY8B 5EV7A 4Z07A 1RUH1 3CLPA 4E9KA 3BOWA 3VBUC 3IDCB 2TBVA 4ISRA 4LTAA 1AL22 2BWCA 3A0KA 4YZ4A 4FPFA 1SMVA 1RTVA 1T6GC 2B9UA 1VBB1 2ZTNA 2XJQA 4C0HA 1BYHA 1LU2A 2PYTA 1E57A 5GLVA 1EY2A 1D4M2 4XZPA 1QWRA 4C1WA 3E6DA 1RUOA 1WGPA 5LRSA 2VVEA 1AR92 3VKOA 4YVWB 1UPSA 1WD3A 3HT1A 2MHFA 4JRLA 1PGW1 2GAUA 4HVRA 1C8M1 1ZZ9A 4N7IA 1JUIA 1ZBA3 1LGBA 2XPJA 1APNA 3MW2A 5JOYA 1AX2A 2NMOA 1R091 1Q8SA 1RUJ1 1HKDA 1H4HA 1OOPA 1XE7A 3KB5A 4FPEA 2DCYA 4HPKB 1Q8VA 2P2KA 4X8PA 1RMU3 4ZKTB 4FTBA 3TWIA 3NV2A 4ZU5A 1G9DA 1MVEA 1GQGA 2I2SA 2XJRA 2P3KA 3I8TA 3ZYJB 1BVP1 1AF9A 4OUSA 1LB2A 2A3XA 2RMU2 1QQP3 2HYKA 1QJX3 4EN0A 2QNKA 4COVA 4IEUA 5JI7A 2ZOEB 2YUEA 4NOTA 3WG4A 5I8TA 4BA6A 3WQ1A 1I9RA 4RHV2 1DGWX 5JZGA 1S2BA 4BZ4A 1CAUB 1UZZA 3M3CA 5A3MA 1OFSA 1MZ6A 4R8HA 3ZXEA 1YYNA 5T5PA 2XBO3 4B4QA 2PFWA 3AJZA 3ZYGA 5KXDA 5C8CC 3KT4A 1R1ZA 2D98A 3V56A 1OSGA 2ZX4A 1GFF2 4KQ7A 4E4SA 4LBKA 1LHVA 3THTA 5KC5A 1NLSA 1S55A 2ZACA 4MH0E 2E7TA 2JJ6A 4GIQA 2UWBA 5CNAA 5A32B 4W6XA 2R1BA 3B01A 2IWGB 4GKXA 5F6LB 4UW6A 3S6PA 2A73B 3ME2A 2ZAAA 3VHNA 1W6MB 3FFQA 1SBFA 4C91A 2NPIA 4YZ2A 2CAVA 2WKKA 1YHFA 2R061 1ND3B 4FQ4A 4BCUA 1HQWA 4YFWA 2R30A 1YIFA 5KHGA 2HEWF 1MR5A 4Q4W3 4PBPA 3ZYPA 2ZHLA 3H7YA 3OGJA 3UJOA 2KXLA 4EN7B 5DZEA 1V6JA 1QJY3 3E5QA 1R1A1 5EJ3A 2WIIB 3KCCA 1S0EA 4JGZC 3MIBA 3H1MA 4PBOA 1ZX5A 3K51A 1QDCA 1OPMA 5I8YA 4D7TA 1O4YA 4IETA 1XQNA 4XF4A 2X29A 4ITCA 2WNUB 2DVDA 4FO9A 5I0TA 2R073 2OYZA 1PMIA 1J3PA 5D8AC 1D0HA 3WDYA 1XNCA 1RVF2 3KLSA 1TMF2 4Q4Y2 4P9IA 2VU9A 1AR81 1FOD3 3TN93 2BYVE 5L7OA 2MNGA 1WMFA 3TYJA 1CN1A 5H9QA 1DYKA 4L9BA 4P9YA 3P3NA 3WW4A 3B7MA 2R1DA 2NYYA 3KZ4C 1A8DA 2FQPA 5CADA 3VBFA 4Y22B 1G7YA 2ZBJA 3ENRA 3BIWE 2RJLA 3ZIWA 4GMP3 5HXVA 3D6EA 4H14A 1VBD2 1W0OA 2B7YA 2DCZA 4FCAA 1YFYA 2R6QA 2RS31 1POV1 2RM22 4L8QA 3AP9A 1PVC3 4GB33 5DXDA 3SXWA 1YO8A 2Z79A 2K2SA 2WT2A 3U11A 5A33A 2PHUA 4YVWC 1G86A 1H8TB 3WDUA 3EBRA 3VV1A 1V9U1 1QXRA 3LB9A 1BMV2 4AHWA 4AEKA 5JVVA 2VNGA 1C1LA 3ES1A 1G9BA 2EA7A 4XF3A 3HBZA 4U2AA 1BKZA 1D4M1 1GKBA 2DTYA 2R49A 1RC6A 1PZ8A 2Z42A 3NL1A 3SH3A 5CAZA 2VPVA 3WCSA 3ZFGC 4FAHA 1NCQB 1WBFA 4K20A 2D6PA 4AWDA 4D69A 3BPZA 5GLZA 5LEJA 5CFDA 4FPKA 4Q26A 4OHWA 2JXAA 2VMIA 4XF9A 1WW5A 3T1LA 3M3EA 3WX5A 1SLTA 1ZA4A 4LBMA 1J1LA 1DHKB 4XE9A 1H2NA 2D6OX 1QQP2 1QJX2 1LGNA 2GMMA 3KGZA 4KU8A 5DG1A 3M4FA 2ARBA 2EAAA 3EXUA 1VAMA 4X8NA 4DMIA 1OHFA 1ZRCA 2VW2A 4P14A 4HN1A 2IXHA 1C28A 1KXGA 3V0AB 2ZGKA 3AMQA 2XBO2 2AREA 1V6LA 4KWKA 4KWLA 1H2MA 2UWCA 4K1YA 1VP6A 2GNDA 5HCAA 4LBQD 2E63A 4KG0A 2JG8B 4SLIA 5DZGA 3ZYIB 2XWBB 3WNXA 2QFEA 1WCKA 1COV3 3VL9A 1FAYA 1GZ9A 5HBAA 1GNZA 2WNEA 1KDMA 2Q5TA 1RHI3 1HXS3 3A4UA 4KGQA 3GHMA 4RHV1 2DF7A 2LALA 3I59B 4Q8LA 1ZZCA 5BNNA 2LTNA 1BQPA 3BTAA 1UU6A 3JD73 4YLZA 1GR3A 4HLTA 4LO8A 1REDA 3AYEA 2PLV3 2RS12 2YMZA 3PMSA 1QJU3 5JPNB 2O8OA 4IEYA 3WV6A 1ENXA 1QU0A 4LT5A 5GZEA 1PM7A 3DN7A 4P5HA 1CAUA 4QGMA 4I2OA 3VKNA 2VGDA 2IXJA 4AVSA 4K3UA 2ZZJA 1R082 4YW4A 2BVVA 1QJY2 1BEV3 2ZGNA 1KRIA 3H7JA 1W6OA 2HWE3 5EZWA 3UKNA 5SV5A 5FDBA 1EV13 5H9SA 4WM8B 4F3JA 3VBHA 4UW5A 2BWAA 4CDQA 3K48A 1JBCA 5A32A 2PHFA 4RR3B 1KFXL 4HVQA 2F4PA 2YZ4A 2WNUC 1Q8QA 3ZXLA 1RJ7A 1O3RA 1VBE3 1D0GA 5FPXA 2JDZA 1I6XA 5BXXA 4N43B 5DDJ1 1NQJA 4H7MA 3OTFA 1S0JA 3ECQA 3TN92 1ONAA 1UX6A 2W68A 3UKVA 3KGLA 3INAA 2EXIA 1ND3A 4GH4A 1LOAA 2VMHA 1I5ZA 3AP4A 1RUC3 1VBC2 3JQXA 1YFWA 5GZGA 4I0AA 4XFFA 4IV3B 3ZSMA 3LOBA 4ONUA 4D94A 4OHVA 4K8FA 3VKFC 1GSLA 1TMF1 2LUWA 4BYYA 1SLIA 1TQ5A 2B39A 2ZPXA 4OHYA 2JE9A 3VHRA 3URFA 2HJIA 3VZMA 4KNCA 1PGSA 1U5YA 4B4RA 4DRVA 4CEYC 1PVC2 4GB32 3J8F3 1VBA3 5FLHA 3I2DA 4A7YA 3WHTA 3AKTA 1G9FA 1SBDA 2P37A 4XQDA 4DNYA 2YGLA 4CDWC 5ABJC 1F5FA 3AP6A 1KJRA 1LODA 1LECA 5T55A 4LHKA 3H1YA 1H8TC 1H8VA 1MEC3 3UJQA 2ZCWA 4Y1VA 4I0WB 3T2TA 1YFUA 1V6OA 3POYA 1ZM1A 3B93A 1UKRA 1B35C 4QPGB 3WDWA 4Y22A 1NZCA 2I45A 2EALA 1DZTA 4RSUA 4YFZA 5KXEA 4QPIB 4JRAA 4E2SA 4OHZA 5T50A 1NCQC 5BYNA 3MPBA 5HI0A 3MDPA 1BMV1 1HRI3 1ZBA1 5BNPC 3N3HA 4PJYA 1X7NA 4UBHA 4Z8BA 4F8AA 1NXD1 4LO6B 5ACA2 4RQPB 4R52A 1BBT3 1YJKA 1X82A 1IOAA 2WWSA 3W9AA 1C3HA 1RMU1 1ZRFA 1XXNA 1AX1A 1SBEA 1MS8A 3LAGA 2UWAA 4HVOA 4FVVA 3M1HA 4Q0SA 3ZXKA 2RE9A 4J6GA 2CAUA 4R9BA 4I3GA 3AM2A 3B00A 2IXCA 2C0ZA 2BNOA 1O5UA 1QQP1 1QJX1 2K9ZA 4DXZA 2PN5A 3X29B 1S0FA 2JG8C 1COV2 3MIDA 4FPHA 1DQ4A 3QD6A 3U10A 5GZDA 2CGNA 4BHPA 1RHI2 1C8NA 1HXS2 1ULGA 1VBB2 2B5HA 5JSRA 5CA6A 4YZ1A 1AR62 4XJWA 4A7ZA 3PVNA 5FFOC 5CBLA 2BTVC 2XBO1 3JD72 1MS9A 1YJLA 5I0SA 2PLV2 4PF5A 2I07B 3VKMA 3AYCA 1QJU2 1XNBA 4M0NA 5GZCA 4H55A 3ZXGA 1PGW2 4XJZA 1EAH2 1C8M2 4YGCA 3V0AA 4KBBA 2NM1A 3ZSLA 2A6XA 1H9WA 4GALA 4N9HA 1CESA 1R092 2XWJB 2PAMA 1KITA 4WM7A 3WDVA 3IDEA 1IS3A 2WT1A 5D1IA 1CONA 2D6MA 5J3UA 3O7OA 2EXKA 3MPPG 4JQRA 1IZ3A 4RR3C 4YG6A 1HQLA 4Q4W1 3USUA 3AMPA 3RJ2X 1VBE2 1XNDA 5L19A 1R081 1YCIA 2DWRA 1YLLA 3O0VA 4N43C 1QJY1 4Q0PA 4BH9A 3AZVA 4GWMA 2X5IA 2OZJA 2WC2A 1SCRA 1MZEA 4FPOB 2UYBA 1CX4A 1X8MA 2R071 4IQPA 1CJPA 3QH6A 4RGGA 3MW3A 4E2GA 1MZ5A 3OYWB 5FO7B 1FOD1 5I0UA 3TN91 3WLUA 4WM8A 3U0ZA 4W65A 4HN0A 2VH9A 3B02A 1H1AA 3VBSB 4M3CF 3J8F2 1HRV3 4FPGA 4AGGA 3GZUC 4YVSA 4I3PA 4AEJA 2UY8A 4S2GA 1LOGA 4GMP1 1J1TA 4FSJA 3ZXJA 1RUD3 1NY72 1HX6A 1LOFA 1LJ7A 1CPNA 1O5LA 3M3OA 2HWC3 4MVTA 4TYSA 4AI8A 5C8CB 2HEYF 1AXKA 3M2MA 4WV8A 1W6QA 3FC0A 2EXJA 1PVC1 4GB31 2EAKA 4IV1C 4QPGC 4G3YC 2XH6A 4IV3A 1MQTA 2QDRA 4YW5A 3BB6A 4LE4A 5AFEA 5I0RA 3ATGA 3ZVXA 3WD5A 1MZFA 2QQPA 3WP5A 1PZ7A 1IS5A 5FREA 1C57A 2WINB 2PHTA 3VBRB 4XJ8A 4I01A 1BVVA 2Y0OA 4Y1UA 1F5JA 3PVEA 2WZPP 4IEPA 3C2UA 3CEWA 1PK6C 5GM0A 1UPIA 1AR73 4KWJA 1TE1B 1UZYA 4OUMA 3VBOA 2DFCA 2ET1A 1AVBA 2AZ5A 4Q4V3 1M06G 1S2KA 4AYUA 4EN9B 2QCSB 3L2HA 3PJQA 2GC1A 5BUVA 3EHKA 2WLQA 5F6KA 4YZ5A 3ZFEC 4JGYC 2CV6A 1TNFA 4WVWA 2XJVA 5DUWA 4Z92B 4QPIA 2ZA9A 1KQRA 3BU7A 2OUHA 1LULA 3S7IA 3AZYA 1JW6A 1W2UA 2WT0A 3H9AA 3IPVB 5DUVA 3RYPA 1QH6A 4CP2A 5FMOL 3NW4A 2DCJA 2JD4A 3DV8A 4QT6A 5BNQA 2Q8OA 4JV4A 4QM9A 5FQ0A 3IMNA 4RQPA 3ZN6A 1RINA 2RS32 3E97A 5JI9A 3RI8A 3MLJA 4BLJA 4XOGA 2TEPA 2VVDA 4QQ2A 1COV1 2V09A 3JB4C 4XFCA 3RG0A 2GU9A 2GNTA 4BM8A 1PIV3 1V9U2 1RHI1 1HXS1 4HSLA 3WDTA 2EXHA 1AR61 1XYOA 4YRDA 3ZMNA 1UF2C 2TNFA 4L97A 2OPKA 2QZ3A 5FO8B 3JD71 4ASLA 3WG1A 4CRQA 4G9SB 2PLV1 4QD2A 4R9AA 1RUNA 1GZWB 1QJU1 4AQSA 1WA4A 1N1VA 2ETEA 4E4ZA 1W6NB 1FNZA 3ZFFB 1EAH1 1XU2A 1DLLA 1ZZBA 3VBUA 1Z0HA 1BEV1 1PNGA 4N9IA 2GMEA 4Z1VA 4XFAA 2HWE1 1C1FA 3ZFGB 1EV11 1DYPA 1DQ1A 5T5JA 2WQZC 3FBYA 3LZZA 4MZUA 3OBTA 2CY6A 1V6NA 1OQ1A 1SFNA 1CR7A 1UAIA 4Y5Z0 2DTWA 1VBE1 4P9JA 4MV2A 3IDBB 1DF0A 4XXAA 1JH5A 2X8KA 2ZKNA 3M7AA 3W59A 4PDWB 3ZN5A 1NA1C 2B8MA 2HWB3 3AX4A 4LO5B 1NQDA 3VL8A 1X36A 5KBFA 2GNBA 3OCPA 2VUAA 3VBSC 3N36A 1NCRC 2XLFA 4L92A 4I30A 1RUC1 4XFHA 5T54A 3DPRB 3OF1A 4MGKE 1QKQA 1ASJ3 1EPZA 1SDWA 4M3CB 1DBNA 1ULEA 2RHPA 2HWD3 3WW3A 1RUD2 3TNPB 1F9KA 3CO2A 3AMHA 1YWKA 1AUYA 2D97A 1HQNA 1H9PA 2B42B 1K5MC 1XE8A 2VVFA 3J8F1 1U0AA 1VBA1 3H3UA 3OGGA 4JTOA 1ZVFA 1U5ZA 2WZR3 4ORFA 3THPA 1QOTA 4JDOA 2V5YA 4EN6B 3U4XA 4Y26A 1UU5A 5T5LA 1LEMA 1VALA 5FBZA 2C9AA 3B9IA 4XJAA 3SITA 2QVSB 2FZ1A 2PQQA 1NY71 2DVFA 2R0FA 2DYCA 4D7SA 4AQTA 1LHOA 3VBRC 4XBLA 1HIXA 2XKPA 4PLMA 4Q4V2 3NKTA 1S0GA 3NWKA 5CFCA 4NHMA 1WLDA 3ZN4A 2BQPA 3SLIA