4SBVA

The refinement of southern bean mosaic virus in reciprocal space
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
199
structure length
199
Chain Sequence
b'SSMDVTILSHCELSTELAVTVTIVVTSELVMPFTVGTWLRGVAQNWSKYAWVAIRYTYLPSCPTTTSGAIHMGFQYDMADTLPVSVNQLSNLKGYVTGPVWEGQSGLCFVNNTKCPDTSRAITIALDTNEVSEKRYPFKTATDYATAVGVNANIGNILVPARLVTAMEGGSSKTAVNTGRLYASYTIRLIEPIAAALNL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SOUTHERN BEAN MOSAIC VIRUS COAT PROTEIN
publication title The Refinement of Southern Bean Mosaic Virus in Reciprocal Space
pubmed rcsb
source organism Southern bean mosaic virus
molecule tags Virus
total genus 44
structure length 199
sequence length 199
chains with identical sequence B, C
ec nomenclature
pdb deposition date 1985-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00729 Viral_coat Viral coat protein (S domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4sbvA00
1AYM2 4IV3C 4JGZA 1RVF3 1NCRA 1H8TA 1D4M3 1RUI3 1AR83 2RR13 2QQPA 1ND3B 1AYM1 3VBHA 3ZFEA 2WS93 4Q4X2 1B35A 1HRV3 4RQPA 1C8NA 5J98B 4QPGC 4Q4W3 4JGZB 1POV1 1QJX2 4Q4X1 1NCRB 1H8TB 2ZTNA 4EJRA 5ACA3 3ZFEB 4CEYA 1QJX1 3VBOA 1B35B 1FPN2 2R072 4RHV3 1HX6A 4GMP0 1R093 1RMU2 5LK7B 4YVWC 5L7OA 1TMF2 3CJIC 1FPN1 3VBRC 1RUG3 2R071 4CEYB 1RMU1 3VBOB 5BNNC 1QJZA 1AUYA 1VRH3 3JB4C 1TMF1 1IHMA 1PO23 1RHI3 1BMV2 1V9U3 2WZR3 5L7OB 3VBFC 4QPIA 5ABJC 4JGYA 3J8F3 4CDUC 1BMV1 1ZBA2 4IV1A 4CDWA 4CDXC 4Q4Y3 2R042 1NOVA 1C8M3 5C9AA 5K0UC 1ASJ3 1ZBA1 3HAGA 4QPIB 5FOJB 2R041 2XBO3 4JGYB 2WFF2 2RMU2 1FOD1 3ZFGA 4IV1B 2DF7A 4CDWB 1EAH2 1RUJ3 1VBC3 2TBVA 1CJDA 4PDWA 1NG0A 1R082 5C9AB 5BNPC 1A6CA 2RMU1 1RUD2 1PVC2 1EAH1 1K5MC 1OPOA 4AEDC 1PO12 1R081 1R1A3 1NA1C 3ZFGB 1AR93 1FMD3 1RUD1 3DPRC 1PVC1 2BFUS 1TME2 2WWSA 4RS5C 2RS11 1PO11 4PDWB 1ND2B 1SMVA 2HWF3 1TME1 1AYN3 4YVSC 1AL23 1AR72 5C8CA 1AR62 2X5IC 1X33A 4NWWA 4Z92B 2R062 1MEC2 1AR71 1RUH3 1AR61 1RUC3 5AC92 3VDDC 4Y4YA 1AL0G 2R061 5C8CB 4IV3A 1MEC1 1RUE2 5CFCC 2HWD2 5AC91 3ZXAC 2PLV2 1RUE1 2WFF3 2HWD1 4GB32 1VB4A 2HWB2 4QPGA 4IV3B 4LLFA 2PLV1 1Z7S2 1OHFA 1VBA2 1QQP2 4Q4V3 4GB31 1NCQC 2HWB1 3JD72 1Z7S1 1VBA1 2ZAHA 1QQP1 4QPGB 3JD71 4N53C 1MQTC 4YVWA 3CJIA 4CEWC 4N43C 3VBRA 1VBD3 2MEV3 5DDJ3 5FMOL 5BNNA 1POV0 4FTSA 1RB8G 1COV3 1HRI3 4SBVA 1W39A 1QJY2 4WM7C 4YVWB 3VBFA 1EV13 3CJIB 3JB8A 4CDUA 1QJY1 1ZBE3 3VBRB 1BBT3 5BNOC 3ZFFC 5BNNB 4CDXA 5D8AC 4GMP1 5K0UA 3VBHC 4RQPC 3VBFB 4BCUA 4CDUB 1OOPC 1BEV2 1QJU2 1VBB2 2RS52 4CDXB 2GH8A 1VBE2 1AYM3 5BNPA 5K0UB 1PIV2 1FOD2 4RR3A 1BEV1 1QJU1 1RUF2 1VBB1 2WLPA 2RS51 1K5MA 1NY72 1CD3G 2ZZQA 3VBSC 4AEDA 1VBE1 1NA1A 1POV3 1PIV1 1RUF1 2HWE2 3DPRA 4Q4X3 1NY71 4RS5A 2HWC2 4CDQC 1ND2A 5BNPB 2RM22 4RR3B 3TN92 1QJX3 2HWE1 2RS32 1K5MB 4YVSA 2HWC1 4AEDB 2RS12 1NA1B 2RM21 5JZGC 3TN91 3DPRB 2BPA2 2RS31 1M06G 2X5IA 4RS5B 3JBG2 5J96B 1FPN3 2R073 4FTBA 1HXS2 1RMU3 2Y26A 1RVF2 1TMF3 4YVSB 3JBG1 2XPJA 3VDDA 1D4M2 1RUI2 1AR82 2RR12 1HXS1 1GFF2 2IZWA 1RVF1 4NWVA 2WS92 2X5IB 4WM8C 5CFCA 1HRV2 2BBVA 1D4M1 1RUI1 1AR81 2RR11 3FBMA 4Q4W2 3VBUC 2WS91 1HRV1 3VDDB 1ZBA3 4Q4W1 4GH4C 4RFT0 5ACA2 2R043 5CFCB 1FOD3 1NCQA 5GKAC 4RHV2 3NAPC 5ACA1 1R092 1VB2A 2RMU3 4FSJA 1RUG2 4RHV1 3S6PA 4N53A 1EAH3 1MQTA 1R091 1VRH2 1R083 5CFDC 4CEWA 3M8LA 1PO22 1RHI2 4N43A 1NCQB 1RUD3 1RUG1 1PVC3 1V9U2 2WZR2 1PO13 1VRH1 2RS13 3J8F2 1PO21 1RHI1 5C4WC 1TME3 1V9U1 4N53B 2WZR1 1MQTB 3IDEA 4Q4Y2 4CEWB 1C8M2 2GSYA 3J8F1 4N43B 1ASJ2 5BNOA 3ZFFA 4Q4Y1 2XBO2 5D8AA 4WM7B 1C8M1 1ND3C 1AR73 1PGW2 1ASJ1 1AR63 1RUJ2 1VBC2 1E57A 5ABJA 2XBO1 2R063 1MEC3 4JGZC 1OOPA 1PGW1 5BNOB 1DDLA 3ZFFB 1NCRC 1X36A 1RUJ1 1VBC1 1H8TC 5AC93 5D8AB 1R1A2 3VBHB 1AR92 1FMD2 3ZFEC 1RUE3 1B35C 2HWD3 4RQPB 1F8VA 3VBSA 5ABJB 1R1A1 1OOPB 2BFUL 2PLV3 1AR91 1FMD1 1VAKA 2HWF2 2BUKA 1AYN2 4GB33 4CDQA 2HWB3 1Z7S3 1VBA3 1AL22 4CEYC 2HWF1 3VBOC 1QQP3 1AYN1 3VBSB 3JD73 1RUH2 1AL21 5JZGA 5L7OC 1PGL2 1RUC2 4CDQB 1RUH1 2FZ1A 1PGL1 1RUC1 5FMOS 2FZ2A 5JZGB 4WM8A 4QPIC 4JGYC 1QJY3 4IV1C 5A33A 3VBUA 4CDWC 1F2NA 4GMP3 2WFF1 4Q4V2 5C9AC 4RR3C 4GH4A 4WM8B 4Q4V1 3ZFGC 3LOBA 3VBUB 5A33B 3NAPA 4PDWC 1ND2C 5A32A 1BEV3 1QJU3 1VBD2 1VBB3 2RS53 4GH4B 2MEV2 4Y5Z0 5DDJ2 1VBE3 5CFDA 1COV2 1HRI2 1PIV3 2VQ0A 1RUF3 1VBD1 3NAPB 2MEV1 5DDJ1 1EV12 5A32B 1COV1 1HRI1 1ZBE2 2HWE3 1BBT2 5C4WA 2HWC3 5CFDB 1EV11 2RM23 5C8CC 1ZBE1 3TN93 1BBT1 2RS33 4FTEA 1ND3A 4WM7A 5C4WB 3JBG3 1HQNA 1HXS3 1WCDJ
chains in the Genus database with same CATH superfamily
4OFGA 2H6CA 5EJ3A 5FO7B 3I49A 1Q8SA 2WSVA 3ZXLA 1CN1A 4C0BA 4E2SA 2QQKA 3M3OA 3EO6A 5EYXA 4JDMA 2HEWF 1A3KA 4WVMB 3R6SA 2QFEA 3VBHA 3ZYHA 2WNUC 2WS93 1W6PB 4ES8A 4J1XA 4DXTA 2CGPA 1ONAA 5HV4A 4MADA 3V0AA 2IVJA 2D6PA 2OPKA 3TNPB 1G8WA 2A1XA 4GULA 4GWMA 1NCRB 4G3YC 2RV9A 3UKTA 2QDRA 4O9GA 5KHGA 4EJRA 1REDA 1J83A 3ZFEB 3BI3A 1W99A 1WD4A 4LBQA 1AX2A 3I2FA 4Y4RA 1Q8OA 1WCSA 2FDGA 5FYMA 2WJSA 3ECQA 5T55A 3RWKX 2R072 2BWAA 4FFGA 3WG1A 2ZGNA 3BIEA 3BOPA 2E7QA 1LTEA 4WVWA 1MACA 3X29B 4COYA 4LR4A 3RI8A 4DMIA 5LK7B 1H9WA 1OA2A 2X09A 1YNAA 5A7QA 3ZR5A 1O59A 1CAVA 4Z2WA 5JIUA 2OUHA 1GWKA 3D0JA 4XUNA 2R071 4AI8A 2YBSA 3POIA 3AKRA 3NNMA 1QDCA 1V6KA 4CEYB 5A80A 1W2AX 3JB4C 5FY8A 2ERFA 1ZNPA 1RTVA 4PHZA 4Q8KA 1BMV2 2P2KA 4P9YA 5FLIA 4LHNA 1CR7A 1UU4A 3H8UA 3OY8A 4JKMA 5L7OB 2VZUA 4D6QA 2WT1A 5ABJC 4XDOA 5A3NA 4JGYA 2EVXA 1BMV1 1G86A 4HETA 3AYAA 1KDMA 1ZBA2 2KXLA 3USUA 3OGSA 4MYEA 4OULA 3N36A 4QGNA 1S0IA 5SV8A 2OIIA 5K0UC 3IMMA 2ILMA 1ZBA1 4QKDA 3MFAA 3HAGA 3D6EA 1QMJA 2JDNA 1IPKA 1HV1A 2DCYA 2FMYA 2XBO3 3AM2A 5L9RA 1RJ7A 3WW1A 3ZXJA 5FBZA 3WT3A 1SFYA 2ZGLA 3ORJA 4AL9A 3ZFGA 4CXXA 3CQOA 4JHZA 3J7NA 4IV1B 2DF7A 4UI9L 4CDWB 4Q5OA 1EAH2 4YW6A 1RUJ3 2TBVA 1CGPA 4PDWA 4FPHA 4IEPA 2YGMA 2V5YA 1HN1A 3VKFC 1PVC2 4HMZA 1EAH1 1UWWA 4YW5A 5I8TA 1QNYA 1JOBA 1NZCA 3WNKA 3L2HA 1D2SA 1NA1C 2YBPA 4XVHA 3VHRA 4ZONA 4AVVA 1UCXA 1IS5A 1PVC1 2BFUS 2GNDA 2WWSA 1W2TA 3FX3A 1MZFA 3LKJA 4MGTA 1BK1A 1MS9A 1ND2B 3C7FA 4ITCA 1UXXX 4R52A 2P17A 5EYYA 1N3QA 4E4ZA 5IVEA 3T2QA 1CAWB 1XC6A 3AYEA 1DQ0A 3EYPA 5DG1A 1AYN3 5A3TA 1UZ0A 2YB7A 3OPZA 2B5HA 2ARBA 1W9WA 3I2DA 3RS6A 3ZYBA 2WWJA 3D82A 4LEJA 5JR7B 5LBCA 1AL23 4XAEA 5LA1A 1ODMA 1YIPA 1X33A 1IQAA 5F5IA 4LKFA 2ZHNA 4CP9B 4NWWA 1Q8PA 4CZSA 1QU0A 1HW5A 1PM4A 5CBLA 1OURA 1J58A 2VMCA 3EQEA 3SMHA 4B29A 4UWDA 3OBAA 3RGBA 2AEZA 5HXMA 4XFAA 3VDDC 3UJOA 1G7YA 2QTWB 5C8CB 3PURA 5JI7A 2JG9A 5J37A 4HVQA 5FZ1A 4NMIA 5FZ7A 4AEKA 4IE0A 4NJ4A 3K4ZA 4JTOA 5GJ6A 2HYXA 4AR2A 2DCKA 2CWMA 5FYBA 1LGNA 3TYJA 4EZHA 3H8XA 3WD5A 2WFF3 3AP7A 3GZEA 3HQRA 2JG8B 3AL5A 1DIWA 3VHPA 3ACHA 4XF0A 4QPGA 4LLFA 1OHFA 2B46X 1OLMA 4X8NA 5D1IA 2IXLA 2VCMA 1ULPA 4M4PA 5DAWA 5L19A 3KT1A 1OA4A 1JZ4A 3J7HA 5FYYA 5EFUA 5FAXA 1H2LA 4NE9A 4LBKA 4L9BA 2IWGB 3ZVXA 3AZYA 2GP3A 4OI0A 1WMDA 3LSDA 4XTPA 2Q0AA 1RXGA 3ZXDA 3A7QA 1OLQA 1O5UA 4AFDA 3WP3A 3N4MA 4MO3M 4YVWA 2Q8DA 4E27A 3CJIA 4L8QA 4P9XA 3I8TA 3NMBA 4QHZA 1ULOA 1XBFA 2LW8A 2XXZA 4ONUA 4P9GA 3OBZA 1RB8G 1V6JA 4KU7A 1YJLA 2W47A 1JOJA 3OYWA 4KBBA 2FDKA 3EXUA 1LOEA 3ATGA 1IZ3A 2YUEA 2BVBA 4A3XA 2YXSA 3VBFA 2XJQA 1XNCA 3PTYA 4I09A 1EV13 5FREA 1XB9A 3GHNA 4JHTA 2D43A 2XJSA 5A3OA 3VBRB 4CDUA 1XNTA 4XUOA 2XUMA 3LIGA 2WT0A 3O12A 4KQ7A 5KC5A 3ZFFC 5BUVA 5EZWA 1I1EA 2Q8OA 2J22A 4GMP1 3AB0A 4IEZA 2I74A 1HB4A 2JD4A 4I0BA 3MLKA 3WVJA 5F3CA 1AHSA 4A7KA 1W0PA 4P9LA 4QX8A 2GC0A 4BCUA 5JVVA 3BTXA 2VOXA 4R9BA 4OUSA 5FIXA 1L7LA 1OOPC 2LROA 2ZXQA 1T6GC 5FXWA 4AVBA 1VBB2 1ZX5A 2AC1A 2PTMA 2RS52 4XJ9A 2Y8KA 2GH8A 5FKBA 4Z1VA 2R49A 1UOFA 4QWNA 2CYFA 3C7EA 3TB0A 3KMHA 4AQSA 1VBB1 3WDUA 2RS51 2W1WA 3I59B 1CD3G 3NJVA 2ZZQA 1JYVA 3AC0A 2VZVA 2CTVA 3H3ZA 2XQRA 1W0NA 2W95A 1POV3 4ZXKA 5BY5A 4XMIA 5GZDA 4U2AA 3M70A 3NV1A 2HWC2 2A3YA 1V70A 1VRBA 3T0AA 4EE2A 1O8PA 3NJZA 3S5QA 1Q8QA 1GZWB 2CDOA 4RR3B 4IE7A 4K3UA 3HT1A 1NAEA 3DGTA 4YVSA 2HWC1 3QOPA 2RS12 5FY5A 4FFIA 4QU1A 5T50A 4LHKA 2AREA 4K6BA 4JKKA 5DAVA 2BPA2 3M3QA 1DF0A 2B42B 5JI9A 1D0HA 4RS5B 3JBG2 3OF1A 2JECA 3AVRA 3H3UA 5KXEA 1MVQA 5A7NA 5FUIA 1RMU3 2Y26A 1EUTA 4LOSA 3ES4A 1BYHA 1TMF3 3ACGA 3JBG1 5I8YA 1C1FA 1QH6A 1S0GA 3ME2A 1LHUA 5FO8B 1RUI2 5CIRA 5FK7A 5FLHA 1UYYA 2XJTA 4FQZA 1JU4A 2E26A 2VBDA 4W8JA 4D6RA 5JAXA 2W1SA 4EROA 5CFCA 5A7SA 2IFRA 2W1UA 1RUI1 3FBMA 3MHZA 3EHKA 1OVSA 4Y33A 4YWAA 4BM8A 1XSRA 4GD4A 1BLZA 1SCRA 4CCLA 3ZSLA 4DOUA 3ZYGA 4PJYA 2YPJA 4XQ4A 3WDXA 1AF9A 3T0BA 5HCFA 2C6SA 2WQ4A 2MHFA 3N9NA 3WG2A 5ACA2 2CAVA 2QZ2A 3M7AA 1WMEA 2Q8CA 3W58A 2IXJA 3ZM8A 4LBJA 2VVFA 4RHV2 4WV8A 3BTZA 3KF5A 1WLDA 5CG8A 3NAPC 5ACA1 1CZTA 2RVAA 2Q4SA 3KV4A 2G9FA 2QZ3A 1XNKA 5IYYA 4RHV1 1LODA 4AI0A 4N53A 4HVOA 2Y6LA 2YC4A 5FP7A 1MQTA 4A4AA 3V56A 1EP0A 3K4DA 5FJKA 5DUWA 3A4UA 2OZJA 3M8LA 3ZXEA 2W46A 1KJLA 5FZEA 4ZZ5A 1RUD3 2YC0A 5IAVA 2WZR2 4Q0QA 1D4VB 3PU3A 3PUQA 3OBRA 2G9GA 5CB7A 3J8F2 3THDA 4LLOA 1S55A 4NAMA 4D94A 4OHXA 2WZR1 1APNA 4ZHNA 5HCBA 5KBFA 1E5HA 3ES1A 5JPNB 2D5FA 4RD7A 3J8F1 2GSYA 1NLSA 2BGPA 4QQOA 4XQDA 3A21A 1JODA 3RZHA 1JI6A 1RC6A 4PIZA 3RZGA 4FXKB 2RJ2A 2RJKA 3S0MA 3HWJA 2VW0A 4OHZA 4DEVA 1LU2A 2IVIB 3K51A 1UYPA 5D8AA 3AKPA 3FLPA 1DGRN 1PGW2 3POBA 5FZAA 3RVHA 2ZMNA 5IT6A 4BQ5A 4XF9A 1DGWX 4KGQA 2D40A 4BQ4A 3ZPYA 5JR2A 2KA3A 1VBC2 3IBMA 2JKXA 1O8SA 3I3EA 1K12A 3MW4A 2DTYA 3SKJE 3WNLA 5FZ4A 5ABJA 2EIDA 1NT0A 1MEC3 1W05A 1PGW1 1QXRA 2RDNA 3ZIXA 1K42A 4QHOA 2YROA 3V64A 3PVBB 5BNOB 1WKYA 1X36A 2C4XA 1V6NA 1VBC1 4IUGA 2UWCA 3IKWA 4CUBA 3J26N 5J09A 1O3SA 2DVBA 1DQ2A 1MS3A 1N3PA 4KMQA 5FY4A 4ZS2A 5C8WA 2D6LX 2VCAA 2JDUA 2J1TA 1O91A 2WNVB 4XF1A 1YFYA 4RQPB 3RJRA 1F8VA 2GN7A 4JCKA 4P02B 4LORA 3VBSA 3HBZA 3CBNA 1W8FA 3AXEA 3ENRA 4QX5A 4HL0A 3WP4A 2BFUL 2CL2A 2D97A 2PLV3 3DKQA 3ETQA 1VAKA 3HQUA 4UFIA 3O1RA 4UOJA 3WNXA 2VTFA 1LU1A 5LEKA 2BTVC 2E7AA 2P3IA 1RUNA 2A5ZA 4CDQA 4N8MA 2HWB3 1W8HA 5FPZA 5FZIA 5GLZA 1OF3A 1Z7S3 5FR3A 1AXYA 3I3DA 1QQP3 2F4PA 1UYXA 2GC2A 3T1LA 3R4DB 1UPSA 3AMNA 3JD73 3A22A 1C3HA 2ZZJA 3AXDA 3K2OA 3IT8A 4QAWA 4F83A 4NUBA 3LFIA 1RUC2 5EV7A 4DEQA 3WDVA 1W9TA 3WINE 4JVAA 5K7PA 1ST8A 5APAA 1F5FA 2FZ1A 5C3QA 2BVVA 5LW9A 1ZRIA 3NSTA 1RUC1 2JENA 4RYDA 1SG3A 5FMOS 5FYVA 4GQ7A 1L3JA 4PBPA 5JZGB 1AXZA 4WM8A 4AHWA 3I2JA 4LUMA 2WYFA 4JGYC 2OQ6A 3M3CA 3SITA 5C3RA 4XC9A 1W9FA 5G05L 4IEQA 1LHVA 3WUDA 4YM1A 1MPXA 3VBUA 1JYCA 1UZZA 4BISA 1PK6B 3GALA 1F2NA 2JE8A 5JLVA 1S0DA 3MEPA 1SBFA 3N3HA 4RL7A 5FPLA 4LKSA 2DCZA 3ZSKA 3MZHA 1Y43B 4ZU4A 4RR3C 4MHRA 5FYUA 3WDTA 2BJSA 2B4KA 2EALA 2QBXA 3I2HA 3BPSA 2PHDA 3KWVA 4XXPA 2W94A 4KBZA 4CUAA 3GJBA 4FBFA 2J1AA 3ZFGC 5CKQA 4QXKA 2GC3A 1NQJA 2XGXA 2P3JA 1OKQA 1T2XA 1ENRA 4YM3A 4ZZ8A 4PDWC 2J1VA 3RYPA 2ZJCA 1ZA7A 1GV9A 2PQSA 4HONA 3OBTA 5F8PA 1CPMA 1DGLA 5FZ8A 4CCCA 2NLRA 1VBD2 4WBBA 5JMOA 4GH4B 2VO5A 2MEV2 5F3IA 2IUWA 1COV2 5F39A 1HRI2 3O0XA 2EIGA 5T54A 1VBD1 3O1SA 1IS3A 4N7UA 3N9PA 2MEV1 2VCCA 4PI0A 4BQ3A 2E9QA 3MICA 3POWA 1COV1 1WBLA 1HRI1 4H14A 4WVZA 4CPBA 1ZBE2 2ZX0A 2ARXA 4J25A 4LBOA 4XBNA 2BNOA 1W6QA 1NXD1 4OHWA 4LA3A 2P3YA 3LEKA 4LO6B 4QGMA 5CFDB 3K48A 4XYXA 3L9JT 2RM23 3HOBA 4UW6A 1FT9A 1XYPA 2DVFA 1IGOA 1YC61 1TVGA 1ZBE1 1UOBA 2AENA 2RS33 3BGAA 1US2A 3D5OA 4AVSA 1OD3A 1PVXA 2I45A 4QKFA 2NPIA 5EXOA 4ARXA 1WWYA 3INAA 5JSPA 2HJIA 2K9ZA 3LGRA 3N9LA 4WVMA 4UT5A 2VW2A 5C4WB 4NRPA 1W6PA 1WGPA 4IETA 3MLLA 2YMZA 4X8PA 4FOYA 2OPWA 2RDRA 2DURA 4AHYA 1XSQA 1WCDJ 3RWNA 2QQVA 3VDAA 3E97A 4H7MA 1DGRA 1RVF3 1G9DA 2JG9C 4UW5A 5HCAA 1NCRA 4OCTA 3EB7A 3DEMA 5F1RA 1D4M3 2RR13 2VOWA 3L2YA 1ND3B 2Q1MA 4HN1A 5KHKA 3ZFEA 1UNBA 3I97A 4LUKA 4Q4X2 1HRV3 1IPJA 4UFMA 3UJQA 2GAUA 3ZX7A 4DUVA 3T0DA 2ARAA 1C8NA 2WWUA 2EAKA 4QPGC 1RYYA 1QXJA 1TNFA 3D3AA 4HANA 4Q4X1 2Y33A 4CCOA 5JSRA 2NMOA 2PA7A 1JYWA 1H8TB 5LA2A 5GM0A 1UMZA 3N7LA 1LCLA 2ZTNA 4GA9A 1GWLA 2W91A 3W21A 3B00A 1W6NB 3EMRA 4CEYA 2ZGKA 1B35B 1OUSA 4XF4A 4V1PA 4XDPA 1EYBA 3OJBA 4A45A 1FPN2 1UPIA 3ZXGA 3SHRA 1UZWA 4C91A 1UY4A 1HJGA 1A34A 4YVWC 1L7RA 4C1XA 5L7OA 4CU9A 2ZX3A 2QQNA 3CJIC 3AJYA 4HVRA 3U75A 4D6SA 1FPN1 3AJZA 5FZ0A 1H6YA 1LULA 2PHLA 4IE4A 1MS8A 3VZOA 3I3MA 2Q1FA 1QJZA 1VRH3 1W6MB 1VAVA 4YZ5A 3LDKA 5F9TA 1JZ5A 1GUIA 5H9QA 2JEMA 4LT5A 2C9AA 2XKOA 1V9U3 2VC9A 4XJWA 3JXSA 5JDBA 3GZUC 1QHDA 3VBFC 4CCEA 4TN7A 4TWTA 2NMNA 3ACLA 4CDUC 4DNYA 2DUOA 3LEGA 5JXGA 4IV1A 1BJQA 4LBLA 4CDWA 5GZCA 4Q4Y3 1ENQA 1NOVA 2TUNA 2XVKA 4AE2A 3Q8FA 5E6HA 2R1BA 5BPXA 5CVRA 3ELNA 3NNFA 1OXCA 3PIJA 5CU1A 4EWAA 1QDOA 2BU9A 5ISLA 4QKNA 1CZVA 1PX3A 1YFWA 1J1TA 2RMU2 1FOD1 3R05A 4FXGB 2WIIB 3ZKUA 4JRLA 3UGHA 5I0DA 1S0FA 4CCNA 3LZZA 4HT1T 1PZ7A 1WMXA 5JWPA 4A6SA 4BXSV 1NG0A 3SCGA 2GNTA 1GQHA 4YZ1A 2RMU1 3PTRB 4HOOA 3VZMA 3JCIA 1CAWA 5IFTA 4EN6B 3T2PA 3GM8A 1ZRDA 4FQ4A 3WP6A 2VNGA 1DYOA 4MV2A 5C5TA 1ZZ9A 2DFBA 1UY1A 3LPGA 1R1A3 2WNEA 1UZVA 4IEOA 4O65A 5A6YA 1LESA 4JV4A 2Q5TA 2B45X 1JN2P 1TME2 4D7TA 3CU7A 4U36A 5CA6A 1V0AA 4QU2A 4AQ2A 2R1DA 3VD9A 1YWKA 2VTXJ 3O1MA 3UYJA 4CP9A 1SMVA 1RGSA 4BPZA 1LAJA 1LECA 2HWF3 1UAIA 1K5JA 4S2GA 4HSJA 1TME1 1Y7BA 4RGGA 5K4LA 3TAYA 4YVSC 2R32A 5LY1A 4JDNA 1S0JA 2ZEXA 5JXHA 2V73A 5C8CA 3CKHA 4O9EA 1AR62 1J3QA 1QNWA 1SHWB 4QDQA 1YCIA 5F3EA 2HEYF 4HXCA 4Z92B 2R062 1HIXA 3KLSA 1KRIA 1RUH3 1H2KA 4BMBA 1AR61 3E6DA 2G1MA 2PN5A 1RIRA 3WF0A 1KS4A 2JG8A 1YXWA 1AL0G 2R061 5FY7A 4HBNA 1W2NA 2D3PA 2DU0A 2D98A 1OBNA 1RUE2 5CFCC 5CKNA 2HWD2 3OSDA 2F17A 4IE5A 4XJAA 3BYWA 3ZIWA 4AI1A 3MV01 4NO4A 5EHDA 1RUE1 2ZMKA 2HWD1 4GZ9A 2DUPA 4QPYA 4Y20B 5CZKA 4GB32 1CIYA 3H8RA 2NN8A 1VB4A 4JZRA 4Z82A 4IV3B 2CV6A 3MPBA 4XURA 1OSGA 1VBA2 5HXVA 1NQDA 3NQHA 2JDAA 3H1WA 2D6KA 4PQ9A 4DXZA 3LA3A 2Y6JA 4Q4V3 1C57A 2P6CA 4GB31 4DINB 1GWMA 3B02A 1LJ7A 3IMNA 4O7XA 2VQUA 1VBA1 1OFNA 5FQ0B 1Q56A 2C0ZA 3MF9A 1DZTA 1REFA 3NO8A 4LQRA 3T30A 5A70A 2VZ3A 2X53S 5IVFA 4K7JA 4N53C 1MQTC 1AJKA 2XH6A 3RDIA 1NLRA 4YG6A 3VBRA 2ADEA 3RMYA 1VMJA 4QB1A 4PLNA 4AFBA 5DDJ3 2JJ6A 5FMOL 2HBTA 3AZZA 1W3XA 1POQA 3MIHA 5CNAA 1QJY2 4WM7C 4HK8A 2AZ5A 3RG0A 4NRMA 3VN4A 3IAPA 2WA4A 4LTAA 3FHAA 4M3CB 1GNZA 2GU9A 2BDRA 4LHSA 3JB8A 1QJY1 3B7MA 1F9KA 5GZFA 3AKQA 5BNNB 2A6VA 1H4HA 4LBNA 1TEIA 4XCBA 5D8AC 3SCFA 4LITA 4IESA 4NOTA 5DABA 4Y1VA 4AFAA 1W0OA 3HN3A 4K1YA 1W6OB 1D2QA 3FHQA 3I59A 2IXIA 4YARA 2GALA 3LDRA 4RGAA 2XDVA 2SBAA 1V00A 4D0QA 1I3HA 1CPNA 5IFPA 4FCAA 4I01A 4XZPA 3GZAA 3C3VA 3I7DA 2YZ4A 4XIOA 1NXMA 4NROA 4MOAA 5F2SA 4CDXB 5A1LA 4PLMA 2WABA 4BQYA 2WZ8A 1VBE2 1AYM3 1W8WA 3U11A 4Y1XA 3WW3A 1GZWA 2VR4A 4RR3A 1DHKB 1WA6X 3H1MA 5DAXA 4CP2A 1NY72 4NPRA 1H6XA 4URTA 3VBSC 2VOTA 1VBE1 3PMSA 1ENSA 4KWKA 3BTYA 2HWE2 5FZ6A 4P14A 1NY71 2WN3A 3MIGA 4RS5A 4DRRA 4CDQC 2BGOA 3MPPG 4COVA 3VZKA 5BNPB 4TLGA 1WCKA 4FOVA 1QJX3 2HWE1 2X29A 5IJRA 2K46A 1K5MB 4GWJA 3HQXA 4KWJA 3WCSA 4UF0B 2VAUA 3FJSA 4AEDB 2CDPA 5DPNA 5FYTA 3WNOA 3UT0A 3AZWA 1DBNA 3DPRB 1UMHA 1G9FA 4LBMA 1S1AA 3K77A 4COWA 3GBGA 4Y5SA 4FTBA 3MW3A 1REEA 3MO4A 4Y3OA 1GP5A 5F3GA 5EIYB 1ULGA 5FMBA 3IN9A 5KXBA 1YO8A 5EQUA 5HI0A 2B7YA 4L97A 4Q0SA 3LCPA 1KJRA 1GFF2 3ZN6B 3BB6A 1PM7A 3BU7A 2XR4A 4WM8C 2PAEA 2WS92 2X5IB 3IB3A 2VUAA 2YG0A 2JXAA 4I30A 5GLTA 1FAYA 2QQMA 2VVEA 4YW4A 4B1MA 4NIIA 3V65A 2BBVA 5IVYA 3VBUC 4JC1A 5A3WA 1LGBA 3K75B 1DP0A 2YFZA 2WS91 5DG2A 4YW7A 1AJOA 1DCSA 4MGQA 3DL3A 3OCPA 5TSWA 4PBOA 2ZGOA 3RYRA 2V5DA 3H1YA 3WR0A 3I2KA 1U0AA 2O8OA 2AR6A 2R043 3AX4A 2TNFA 3MV11 4MGSA 4UFHA 5LATA 5A6XA 2CGNA 4CP1A 1MZEA 4FPJA 3CJXA 5GLUA 2XB6C 1A78A 1VB2A 1LOGA 1SLIA 3UL2A 2XHNA 3TNQA 3ACIA 3U1XA 1S0BA 2J1RA 3DV8A 4ZU7A 2WBKA 4QKBA 3B93A 1V6IA 2JX9A 1YUDA 4P9JA 4UW3A 3GNEA 2J42A 1S2KA 3IWZA 4CP0A 2WN2A 4KU8A 3VD3A 1R083 3N9MA 5JOZA 1LGCA 1NCQB 4XW3A 3FMGA 3KQRA 5AVAA 2A6ZA 2VUDA 5FYHA 1PO13 1UF2C 2RS13 4GWNA 4ZKTB 1U5ZA 2FCVA 2HBUA 4S2FA 4NIAA 5E1RA 3I3BA 1S2EA 4FOQA 5GALA 1W03A 1GSLA 4CEWB 1F4HA 2EXJA 3DF0A 1GYKA 2Y6HA 3HNYM 4N43B 1OQDA 1PZ9A 4UBGA 3TWIA 3NNJA 4BQ1A 2FDFA 1JYNA 4ZXEA 5BNOA 3ZYIB 2DYCA 4EV0A 2VNOA 3ZPOA 2VZSA 1W04A 2XBO2 2DV9A 2RDQA 3WW2A 2FBEA 1AR73 3EJKA 3MUY1 3PJYA 4OHVA 4I2OA 1UKGA 1IG0A 5DAQA 2EXHA 1DZRA 2E31A 1BHGA 2WNVA 4CRQA 1H1MA 1RUOA 1RUJ2 2YU1A 4Q0VA 2JDMA 2XUEA 2PYTA 2XBO1 5A1FA 2WL1A 5K9YA 2LALA 2VZ1A 2ZOEB 3ON7A 5JUVA 2YY1A 4DUXA 1NCRC 4EN7B 1RUJ1 5AC93 4JAAA 4RGKA 3E6CC 4GXLA 3OGVA 5I0UA 3OEAA 2QQUA 1H1AA 2VBBA 2I2SA 2VCBA 3S7IA 2W1QA 5FUPA 3VBHB 2XJPA 3QLQA 2ORZA 5FWEA 3ZFEC 4V2VA 4LA2A 1VALA 4LOTA 3P6BA 4LXLA 1FV2A 3SH5A 1F35A 3SEEA 3VL8A 3PUHA 1LKNA 5DAPA 1UX6A 1LHNA 3H42B 5DN2A 2Q30A 2Y0OA 5F37A 1AYN2 3MYXA 5GZEA 4W6XA 1UW8A 2PHWA 3BCWA 1AL22 4CEYC 1CAXB 5IK7A 5C3SA 3NNLA 3AKTA 1S2BA 1AYN1 2YFUA 1CIWA 2PXJA 3WDWA 2BZDA 4PQQA 4AK3A 1G9CA 4BK5A 3O1OA 1IG3A 2VD7A 1AL21 1S0CA 3ALQA 1SFPA 3FFQA 4DXRA 5JZGA 5L7OC 1PGL2 5L9BA 2DDUA 1QEXA 2HYKA 3SXWA 3WDYA 3ZSMA 1ULCA 2VNVA 5KHJA 4CU8A 2V72A 2P3KA 1PGL1 1PK6A 1GNHA 5CYYA 3AP5A 4XPVA 1SACA 4QGLA 4E8DA 1BVVA 5LA0A 4IEWA 4R4XA 3T4HB 3ZXKA 4AW7A 1OI6A 2VXJA 4C8DA 5HV0A 4NIHA 5A6QA 3M3IA 4IEXA 4MZUA 2DVGA 2NZ9A 4XBQA 3VHOA 4IV1C 4CDWC 1LRHA 3PLQA 2WT2A 1JYXA 2WFF1 2HLEA 5A3LA 1UIJA 5F5CA 3LE0A 4ZY9A 4GH4A 1L7QA 1ALYA 3AMHA 5A7OA 2J1SA 1X9TA 5JIAA 1XXNA 3H7YA 4L11A 1MS4A 3POFA 1NE4A 3ETPA 5IVJA 3LOBA 3KCYA 4BIFA 1YI7A 1ZVFA 5CKMA 3JU9A 1YQ8A 2K2SA 1PMHX 3SNMA 3WF3A 2W87A 1ND2C 5GLVA 1W28A 1N1SA 4XABA 1BEV3 1QJU3 2ZMLA 2VMEA 2QNKA 3I2OA 5JOYA 2OQ7A 3AMPA 4QQHA 5FWJA 4D7YA 2FCUA 5CFDA 4LMFA 1GLHA 1ZYBA 1PIV3 2VQ0A 1RUF3 5H9PA 1EPZA 2PMWB 2P5BA 3I54A 4NHKA 4XIKA 4OUMA 2DWRA 2ZS6B 1QKQA 1UOJA 2IC1A 3FUQA 4GIQA 1EV12 2AEYA 4LKEA 5A32B 4Q27A 4OQ9A 4E2QA 1O7FA 5FV3A 5C4WA 1O3TA 4YGCA 1UN1A 1XRUA 3BTAA 4LO4B 4Q1RA 1LOBA 2VJXA 5DUXA 1EV11 3ZKYA 2Z5WA 1E5IA 1LHOA 1JUIA 5C8CC 3TN93 3P5BA 1Y3TA 3WNNA 3DUIA 4MG2A 2ZKLA 3H50A 2WR9A 3UESA 2CAUA 1QXPA 1LOFA 5A3MA 1YQ2A 3ILNA 4YZ3A 1ND3A 4WM7A 2P6HA 2DVDA 2A3XA 5FYCA 3TEYA 1KFXL 3KT4A 5FPAA 1KEXA 5HPOA 5IW0A 3NW4A 1O4TA 1Q8VA 2JG8C 2YHJA 1OH3A 1QJEA 1HXS3 3T2TA 4AQTA 2UYBA 3WQBA 2SLIA 3DXTA 1IOAA 1H8TA 5LWBA 3R0RA 1DFQA 4YPJA 1AR83 4K20A 2H0VA 4XUQA 1UL9A 4LE3A 5FPUA 2QQPA 1W6NA 2CY6A 1JBCA 4PIYA 1PMJX 4EWDA 3WSOA 5F7UA 1KQRA 1B35A 3IAQA 2ZEWA 4K9SA 3WLUA 4XJZA 2WUHA 5J98B 5FY1A 4Q4W3 4JGZB 1JYTA 4QD2A 2YYOA 1POV1 4XTMA 3LEIA 4EWEA 1I5PA 1XE8A 1GR3A 1W2UA 4G9SB 1DG6A 2FHRA 2ZBJA 1G9AA 4DPNA 4BLJA 5FLJA 1VR3A 4CA9A 2OVUA 4XFFA 2W9XA 1W6MA 1LENA 2DU1A 2GC1A 3KHBA 2JWPA 3WUCA 3K3OA 4CE8A 2FMDA 1CX1A 3FLTA 2B39A 4KGGA 1MZ6A 3R4SA 1WLTA 1R093 1RMU2 2ATFA 4XHBA 3GXUA 4S2DA 4QDSA 2ET7A 4WZFA 4TTGA 1TMF2 3POYA 4LIUA 1HJFA 1ULFA 5FXXA 3VBRC 1RUG3 5FMDA 5FXVA 2KR2A 3URFA 2IXHA 1UMIA 3BALA 1RMU1 3GDBA 3NJXA 3VBOB 4RA0A 1TMF1 1IHMA 1WCUA 3HT2A 1PO23 1RHI3 5IVBA 1S0EA 2XLGA 3NWKA 3O1VA 2E53A 1MS5A 1NZIA 2WYSA 3U14A 1JZ7A 3D4KA 3HPNA 3RJ2X 3HJRA 3ILFA 4C0HA 1Z78A 2QCSB 5JXJA 5BV6A 3UGFA 1HKDA 2D6OX 4QPWA 1SPPB 2HEVF 3KV6A 2R0HA 1ZZ8A 3C7HA 4YLZA 3VV1A 4AI2A 1WW6A 4OVEA 1YFXA 3BKZA 2J7MA 1BK0A 4CXWA 1XE7A 1C8M3 5I93A 5LBEA 2BRTA 4E4SA 4P9WA 1ASJ3 4MGIE 2GMPA 1QWRA 3SKVA 5JCTA 3T3YA 4LJHA 4EN0A 4QPIB 3POGA 2Y34A 3B5LB 4BDVB 3RSJA 4W50A 1TNRA 1DLCA 3DYMA 3THCA 1EPWA 3GZTB 3ZYPA 4B8EA 4QQ2A 2JB8A 3VD4A 3KF3A 4KG8A 1OA3A 2ZEYA 1CJDA 1JHNA 1GQPA 1WA4A 5C9AB 1A6CA 2BNNA 1RUD2 3TOJA 3VDCA 4B4QA 1HV0A 1OPOA 3DYOA 1IS4A 4NPMA 4A6OA 3C8XA 2R16A 2PAKA 2A6WA 1KITA 1OD5A 2QKDA 1AR93 1FMD3 3HD8B 1OVPA 1RUD1 2QVSB 2UWAA 5CEHA 4RS5C 2ARCA 3HEIA 5J7MA 5JXIA 4FPKA 4YNIA 3OTFA 4XXAA 2JDYA 1UXZA 4GJYA 2ZX4A 3IDBB 2XJUA 4QX1A 1R64A 1XNDA 3DYPA 2VOVA 5DZEA 5FXZA 4QMAA 5JMCA 2CU5A 2ZGSA 3CDZB 2A6YA 3ZYFA 2VULA 3MIDA 4PCRA 2BBAA 4MGYE 3OOXA 4AEJA 3O5SA 4H2AA 4OMDA 4AAXA 4F8AA 1JZ2A 3UKVA 1AX1A 2ADDA 4DS0A 2BP6A 2DTWA 3DECA 5E89A 2KD7A 4BQXA 3MIFA 4JX0A 1MEC2 1XPWA 1T6BX 1ZZBA 2BEOA 4XETA 4ES9A 4QX3A 5FZHA 4Y20A 4XUTA 1NLQA 2F4LA 4IL7A 2ET1A 3WEZA 4RN5A 1JYIA 4IV3A 1MEC1 3H9AA 1W3VA 3LQCA 1LEMA 1W8OA 4CCDA 4ATEA 3VD7A 3VZJA 2VZRA 2GMMA 2B8MA 4UAPA 2O14A 1VPHA 2H6BA 4N9IA 3WCRA 1SLAA 2OW4A 2PLV2 4HG6B 4INDA 5FQ0A 3BODA 5LK5A 1A8MA 3ITQA 3B01A 1HB3A 3OUIA 4YG0A 3S57A 3CEWA 4XACA 2HWB2 3ZOIA 4Q26A 3BUCA 1X8MA 1Z7S2 1FNYA 2PLV1 4A41A 2RG4A 5KXDA 2PQQA 4YW1A 1D7PM 4YYOA 1QQP2 1ZZ6A 2VMGA 3VB9A 2PHTA 4YGDA 1YIFA 2JDPA 4IEYA 2ZHKA 4K8RB 2HWB1 2JD9A 3JD72 3NJYA 1UKRA 4HKOA 3LB9A 1Z7S1 2WNUB 4DY3A 2AACA 1IPSA 5LBBA 4DFSA 1O4YA 1QQP1 1UQXA 4F3JA 4KWUA 1ODNA 3PUIA 4QB6A 1DLLA 3JD71 2Z2SB 2OKXA 4ASLA 4XF3A 1WCQA 2IXCA 1WW7A 3ROUA 4FFFA 4M3CA 4H55A 2X05A 3EBRA 3POSA 4C90A 1CX4A 2CHHA 4CU6A 5BNNA 5T5PA 1W9YA 3MIBA 1VE0A 4AZZA 4XMAA 2H0BA 2Q8EA 3IIIA 2GZWA 1S4CA 2BERA 4LK7A 1W6OA 2C1FA 1X9PA 3WNPA 1NE6A 1XOYA 1JH5A 2ZX1A 3S7EA 3IDCB 1BBT3 4A7ZA 2VQTA 4L2NA 5EJZB 5BNOC 1A8DA 2ZGMA 4FPLA 3JUUA 2R6QA 4QQLA 4CDXA 4EQVA 5C3PA 5HCHA 4P00B 1ZRRA 3QACA 4IDZA 5LY2A 1WW4A 2WNVC 4HFSA 3SQOA 2CGOA 3M2MA 4RQPC 3WZ1A 2QQJA 1HLCA 3SISA 3N7JA 3VD5A 5KHIA 2YU2A 3KVAA 2XMLA 1FXZA 5EWSA 3U07A 4D7SA 2VXRA 3MLJA 1W9SA 3TRSB 4OHYA 4Q0UA 2I07B 4R8HA 5FJHA 2DBIA 5BNPA 5K0UB 4CCKA 1FOD2 2E7TA 1PNGA 3PJQA 1K5MA 4FAHA 4AF9A 4UF0A 2ZX2A 3WF2A 4AEDA 2JB4A 2QJVA 1LR5A 1PGSA 2Y38A 5F2WA 2DCJA 2JDKA 4Z8BA 3DPRA 2DFCA 1CAUA 3HN1A 4PT6A 4I0AA 3BN6A 2VE1A 4FPYA 3MGUA 4IQPA 5F5QA 2VM9A 1ND2A 4KL1A 4OUEA 4FPFA 3U37A 5FDBA 3LD8A 2RM22 1D0GA 2XONA 5IK4A 5FZ9A 1LEDA 2P1BA 3B9IA 2RS32 1YRZA 4AHXA 1OLRA 2DUQA 1I9RA 2W5FA 1JS9A 2WO1A 5SV5A 2VTXA 1NA1B 4JRAA 4NPLA 2ZGTA 2RM21 5T3NA 5JZGC 4COUA 3ZN6A 3H8OA 2RS31 3VZLA 1M06G 2X5IA 3U0ZA 2JICA 3VZNA 3O14A 3NL1A 1YYNA 3OEBA 5LBFA 2R073 4CYDA 4JKLA 1BCXA 1PK6C 1RVF2 2ZAAA 5M0TA 1CESA 1E5SA 3PUSA 3WG3A 4LKDA 4V2WA 2D5HA 1D4M2 2RR12 2XWJB 4FP2A 3MIEA 4XCAA 3WQ0A 3KV5A 1V6MA 4QX7A 3ST7A 4URAA 1RVF1 4NWVA 5C7GA 4YSFA 4NHXA 1HRV2 2UURA 4TSVA 3PVNA 1C5HA 4PF5A 1HDKA 3ZR6A 1D4M1 2RR11 1YLLA 5JPMB 1HQLA 4UFJA 3ZDVA 1TE1B 1MS0A 2VZOA 2ZPXA 2ENRA 4GWIA 1HRV1 4BE3A 5B4NA 3VDDB 5FK8A 2YC2A 4IW3A 4MXVA 3RZJA 1ZBA3 5L9VA 1BXHA 4GH4C 4FPEA 2EXKA 2OYZA 2LS6A 5B2GB 4H3WA 4AI3A 5E88A 3SLIA 1UX7A 4MVTA 1NCQA 3BU0A 1GP4A 5BXXA 4MLOA 5FZBA 3ZDSA 1OQEA 4XQWA 2VUCA 1Q3EA 2YBKA 4FSJA 3S6PA 1SLLA 1EAH3 3C7OA 3AP4A 3Q9OA 4MXWB 1OLME 1VRH2 3C2UA 4K40A 5CFDC 4FAGA 3IIAA 4CEWA 3H3LA 2Y64A 4N43A 2PAMA 5KXCA 1WLCA 1PVC3 1V9U2 4XE9A 5FOBB 1VRH1 2DBNA 3WOGA 3IZOA 1C28A 4HN0A 5C4WC 1V9U1 4BK4A 3LOIA 5G04L 1FNZA 3IDEA 2RDSA 4FPGA 4FPCA 3CLPA 4BZ4A 4Y5TA 3CO2A 3A0NA 4Q4Y2 3VLBB 4X6QB 2O8QA 5A1AA 1K45A 2E6VA 4R9AA 5C3OA 2W2IA 3AYDA 4CUCA 4EYUA 2UYAA 1G6NA 2JKBA 4AG4A 4HZFA 5GLWA 4PIXA 4Q4Y1 1H1IA 1OPMA 1TQ5A 1LOFC 3RZLA 2ZCWA 3WG4A 2VGDA 1ND3C 1AXKA 1SBEA 4HPKB 5H9SA 1OMIA 2QQIA 3O0VA 3U78A 4MX3A 4B4RA 4ET7A 4NVPA 5FPXA 3HNMA 5FUNA 1U5IA 1E57A 3QBQA 3WY6A 4HK9A 4K21A 2DCTA 2VMIA 3GBWA 3H0OA 2KM2A 3ILRA 4TLFA 5A7WB 5J48A 1W8UA 1QGLA 4UFLA 4ASMB 1DDLA 4IGQA 3ZFFB 3KCCA 1H8TC 2ZACA 3ZMOA 4DO0A 2EICA 3QD6A 1R1A2 5T5JA 4AWDA 1DGWA 3O1UA 2VU9A 5DUVA 1GP6A 4Y22B 3WX5A 4IGPA 1CAXA 1ZM1A 1B35C 5BYNA 5KWRA 4XFCA 3O1TA 1R1A1 4W65A 1OOPB 5IWFA 1N1TA 2E32A 4JQTA 1IQDC 2HWF2 4E4DX 2BUKA 3W5MA 1B09A 2K0GA 3F95A 5DXDA 3T08A 3E6BA 4BLIA 4D8MA 5IVCA 1BQPA 1ULEA 4KNCA 5IAXA 2ZGPA 2GN3A 2HWF1 2WSUA 3J7LA 1GKBA 2G4IA 3I3QA 3VUOA 1O4ZA 2W0XA 1GZTA 2JIGA 3AZXA 3IPVB 3LDBA 4BA6A 3O0WA 1RUH2 2NQYA 1N47A 1E5RA 1CWPA 1XYNA 3FC0A 4FVVA 4QX2A 1Y9GA 4MSVA 4Y1ZA 3DXUA 2WAOA 5FP8A 1RUH1 3CZUA 1HQWA 3NNGA 3O7OA 1RL3A 2QE3A 4YRDA 2FZ2A 4RFRB 2OT7A 2VZPA 5CAZA 4EZ4A 2P37A 2B9UA 3CF6E 2WFPA 3J4UH 1KFUL 3B94A 2D6MA 3FHIB 1SDWA 4XFIA 3Q8BA 5LB6A 1ACCA 2OS2A 4LK6A 4QX0A 2BQPA 3RPQA 1ZRFA 4N7IA 4ORFA 1XE0A 4YZ4A 3DN7A 4GMP3 3GBFA 5F6LB 4AFCA 1YHFA 1CONA 4KWLA 4Q4V2 4AI9A 2YGLA 5DZGA 4BJ0A 2C24A 5FZKA 4GKXA 3ZN4A 1J59A 4NR1A 4AVTA 5CISA 1JZ3A 3T1MA 1JMUB 4NHMA 3RZZA 3VGIA 4Q4V1 2VW1A 4QM8A 1W2OA 1GNYA 4FT8A 2LRPA 5A33B 4E2GA 2X10A 2E33A 3BPZA 3MI8A 4XUPA 1ZRCA 2P4EA 3UKNA 5A32A 1XJAA 3ZSEA 1HB2A 3SH3A 2BOJA 2WRAA 1VBB3 3KT7A 2RS53 2VECA 5ERLA 1Y9QA 4Y5Z0 4AXOA 5DDJ2 1US3A 2A6XA 4QM9A 4OI1A 3WF1A 1DZQA 3GHMA 5HBAA 4AVCA 3V0BB 1CZSA 3PVOA 4Y1YA 3NAPB 3W9AA 5FFOC 4D3WA 3KHCA 5DDJ1 3PUAA 5FRAA 3WW4A 2RJLA 2A71A 3LA2A 4ATFA 1UD1A 3ZLIA 3ZO0B 1LOCA 5FZOB 2HWC3 3OUJA 2ETEA 1IKPA 2FCTA 2HKXA 3H7JA 4JTNA 3GCXA 1URXA 2WNOA 4A3ZA 2VUJA 4A2UA 1AZDA 4NHYA 5IK8A 3AKSA 2WKKA 1JOPA 3I2IA 5LASA 4P5HA 4XFBA 1IKQA 2Z79A 4R9CA 4M00A 1KD7A 5A6ZA 3JBG3 3RI9A 3SCHA 2UU8A 2VMDA 1W8NA 2YPDA 1O6UA 1AYM2 4IV3C 4JGZA 4W6WA 1SZBA 1U5XA 4I3PA 1FV3A 2ZABA 3RQ0A 4IXLA 2ZGRA 3TBDA 3WQ7A 3T2OA 1RUI3 1X50A 4NIGA 3FWEA 3JQXA 1AYM1 2WO7A 3G6JB 1W06A 2DVAA 2R0FA 2VY0A 5FZFA 4DQAA 4RQPA 1U12A 1KGYA 2W39A 2WO2A 1CAUB 3Q8EA 1SQ4A 2EAAA 4R4ZA 2W92A 1QJX2 3P1IA 3WF4A 1BKZA 2VNRA 2RE9A 1XYOA 2A70A 4DRVA 3KD4A 1V6LA 1QY4A 3MFCA 1DU3D 1YQ5A 1OKOA 5ACA3 1QJX1 3VBOA 4MH0E 2BV4A 3V0AB 3WQ1A 2E51A 3FL7A 3LPFA 2WZPP 4FPOB 4I0WB 4RHV3 2B9VA 1HX6A 1YFUA 4GMP0 2VVDA 5D2AA 3WHTA 5IVVA 5CG9A 2VBPA 4FI9A 5F6KA 3HMYA 3LSEA 4Z2AA 4META 5J3UA 1VMHA 1WBFA 4HLTA 1SPPA 2VL4A 4XJ8A 1W90A 1YQ6A 3A0KA 4LBQB 1F15A 5BNNC 1AUYA 1OUXA 3KV9A 3OD4A 4BH9A 3M3EA 2NM1A 2BYVE 2J1UA 4BOWA 2D7FA 4XBLA 3S5AA 4Y26A 3AMMA 5EPAA 2WZR3 4ZPIA 1DYKA 4NAOA 3WNMA 5JSOA 4YW2A 4QPIA 5AVPA 3J8F3 3FZ3A 1CAVB 3P3PA 1BVP1 1XNBA 4I02A 4MGZE 4GALA 2Y6GA 3G7DA 1X7NA 4XFGA 3NKGA 4DXSA 2D3SA 4IEUA 4CDXC 2AYHA 2R042 4YW3A 2FDIA 5C9AA 1FATA 2YV8A 3N9OA 5L73A 5C70A 1VAMA 4XDQA 3OY8B 4LO5B 5FP4A 2XLFA 2R041 5FOJB 2WQ8A 4JGYB 2WFF2 1RXFA 3VKMA 3RMXA 5A3UA 2MNGA 4DB5A 3USUB 4S2HA 5FCCA 1ULDA 1VBC3 3E1F1 1R1ZA 3U4SA 3AZVA 1R082 3UGGA 5BNPC 1TZOA 3PL0A 5FPVA 1DQ1A 3SH4A 1K3IA 4GJZA 4LNVA 4Y24A 1K5MC 2PELA 4AEDC 1PO12 2JIJA 2Y6KA 2OXBA 3K4AA 1R081 1I5ZA 2VMFA 5B4XA 1MZ5A 3ZFGB 3C7GA 5FYSA 2BNMA 4TZDA 3DPRC 1J1LA 2VQAA 5DMYA 3HVDA 1PO11 2RS11 4PDWB 4CPBD 3TEZA 3O1PA 4YG3A 4CU7A 4J6GA 3FLRA 2GMEA 4F7ZA 2XJRA 2XHKA 1F31A 2W52A 5J36A 1AR72 1XQNA 2XOMA 1Y4WA 4K1ZA 2X5IC 4WVVA 4CCJA 4NIDA 4O61A 2QUOA 1H30A 4E9KA 4YZ2A 5J1XA 1GOFA 1AR71 2JE7A 5ANNA 4XHXA 3NV4A 1C4RA 1RUC3 5FP3A 4AAPA 2BOIA 2MPFA 4AEMA 5LRSA 5CADA 5AC92 1RITA 1SLCA 4Y4YA 1MR5A 3T4VA 4H7LA 4UYBA 3OGGA 1UIKA 1JUHA 4SLIA 4XZUG 2Y6FA 2GNMA 4B4PA 5AC91 4J1WA 3FFZA 3ZXAC 4DZGA 2WNUA 3R4UA 3CMGA 4Q0PA 4M01A 4QB2A 1VLNA 4DIQA 1NKGA 3T09A 3LFMA 3ABZA 2QDNA 3SC7X 2EF6A 1GZ9A 1GOHA 2JG9B 2PHFA 1ZA4A 1I6XA 1W8TA 2VZTA 2XVLA 2A75A 5I0RA 1N3OA 3MW2A 4KI5M 1NCQC 3B69A 3LAGA 3HBKA 3NKTA 3ZSJA 2ZAHA 5AFEA 3USSA 1LOAA 1ZREA 3BIWE 1W8ZA 4QPGB 3AL6A 1FX5A 3WV6A 5C5UA 3RYKA 3KS7A 1WUVA 4OI2A 4UFKA 5GZGA 1MVEA 2V09A 1H2NA 3FBYA 3IM0A 1AX0A 3POJA 4BU2A 4CEWC 5IATA 1UY0A 4M3CE 3U10A 4N43C 5ANQA 1JZ8A 3GJAA 1VBD3 3UNPA 1SCSA 1J3RA 1VIWB 2EIBA 2MEV3 3RZMA 1DQ6A 5C6CA 3NVCA 3RNSA 2CNAA 1QOOA 3ZYJB 1POV0 4AGVA 4FTSA 1COV3 1HRI3 4SBVA 1Z0HA 1W39A 2C26A 5I8SA 4EN8B 4RSUA 1TG7A 4XILA 3KB5A 1O3RA 2TEPA 3Q8CA 3N7MA 2IFWA 4YVWB 1PMIA 1GOGA 5JOWA 3AYCA 1VP6A 3CJIB 2D44A 2VG9A 2Y0IA 1ZBE3 4OZXA 2XKPA 4KH9A 4YFZA 5FY9A 4P9IA 2ZEZA 2ZA9A 1XU1A 1SLBA 1XNAA 4YM0A 4P08A 5FP9A 2NYYA 3OPWA 3VHNA 5K0UA 3BOWA 3BVCA 1X8EA 3OYWB 4PI2A 3VBHC 4BHPA 1O5LA 2BWCA 2OUJA 1U5YA 3PNAA 3VBFB 1OFSA 4CTEA 1SDDB 1XU2A 3W59A 1GU3A 4CDUB 4L99A 2WQZC 2FQPA 2NP0A 1BEV2 1QJU2 1QJFA 4WZCA 1QH7A 1YEWA 3SEPA 4GAZA 5K8SA 1H4GA 3FUOA 4Q1PA 3TEXA 4QQPA 4BQWA 1ZZCA 2F6BA 1SLTA 2BGCA 1PIV2 2G19A 1BEV1 1QJU1 1RUF2 2ZGUA 2WLPA 4LIVA 3KGZA 1JTZX 3D0SA 2VMHA 1NA1A 2WDBA 1PIV1 1JW6A 1RUF1 2OA2A 1M4WA 2Q1ZB 4FFHA 4PF1A 3KQ4B 4Q4X3 4FP3A 4CXYA 4Q8LA 2W3JA 5DUUA 2L9LA 3N9QA 1OH4A 2R30A 2WZEA 2JDZA 2X8KA 3AK0A 3B3QE 5FZGA 3W20A 3TN92 1G9BA 1GMMA 4I3GA 2UY8A 1NYWA 2XQXA 2QQOA 4Y1UA 1F5JA 1H8VA 3ZXFA 5FKCA 4EN9B 1STMA 4HKWA 4NRQA 4YFWA 1OT5A 3TN91 1HB1A 5H9RA 3UETA 1AVBA 5J96B 4HKLA 1FPN3 1ZZ7A 2QQWA 1HXS2 2V4AA 3PU8A 4NHLA 4M0NA 3ZN5A 2OX0A 5F32A 3VKNA 4OI4A 4QT6A 4N9HA 4YVSB 2Y60A 4LPLA 2XPJA 1KS5A 3VDDA 3OUHA 2C9KA 3K46A 1GANA 1AR82 3NRUA 1HXS1 2FDJA 1LHWA 1BZWA 3PHMA 1C5IA 2IZWA 2O1QA 4IEVA 3N7KA 1Q5OA 3WXPA 2P34A 3ASIA 1J84A 3HNBM 2A3WA 2JDHA 3CIHA 3JZVA 1AR81 4FO9A 5FYZA 4Q4W2 1H9PA 3MDPA 4UBHA 1OF4A 3VDBA 1OQ1A 2OZ6A 3E5UA 5FBJA 5FZ3A 2WA3A 5LZ6A 4HSLA 4Q4W1 5IK5A 1QIQA 3LF7A 4RFT0 4BIOA 4MXWA 3RFRA 4CUGA 4E8CA 5CFCB 2D3RA 5LRRA 1FOD3 5GKAC 3WHUA 3CL1A 3M4FA 5FY0A 3ZMNA 1R092 4AYUA 1MS1A 2XLAA 1FI2A 2XG3A 4ARYA 1PZ8A 5E8AA 2RMU3 1CQ9A 1N1VA 1RUG2 5L36A 5D21A 3UV9A 1R091 4QXCA 4Z07A 1FYUA 4B1LA 4IGOA 4CSWA 4B3NA 1IS6A 1VMFA 2VZQA 3GF6A 4G4FA 2BW8A 1PO22 1RHI2 2UWBA 1RUG1 4AGGA 3AVSA 1N1YA 4LBQD 4OQ8A 5DQ0A 3GYDA 1PHMA 3HR9A 4AQ6A 2AUYA 1LB2A 2HH9A 4COZA 2ES3A 3D8CA 1PO21 1RHI1 2CWSA 3PIGA 2WAAA 4HPKA 4OZOA 2FDHA 1TME3 4LULA 2VPVA 4N53B 2IXKA 1MQTB 2UY9A 4MUVA 2ZGQA 3LIHA 4UXAA 4W6YA 3TEWA 2YDEA 3Q8AA 5FZCA 1GBGA 2LUWA 2N7GA 3AP9A 4NN0A 1C8M2 4A44A 5A7WA 1ASJ2 4TYSA 1UU6A 3S30A 4AFMA 2C5DA 3ZFFA 2EIEA 3OPTA 5I0SA 4M4RA 3RZKA 4BXFA 3LA7A 4WM7B 1C8M1 3OGJA 2O0OA 5LCWL 1ASJ1 1AR63 4JDOA 4Y22A 2W08A 3OGRA 3MUZ1 3E5QA 4BWOA 4DY5A 4ISQA 5JOXA 4BQ2A 4GKYA 4CCMA 2R063 4JGZC 1OOPA 1SBDA 5FZDA 1YJKA 2EXIA 2JE9A 4JQRA 5T5LA 2V4VA 2XJVA 1JXNA 3DCQA 3JQWA 2GH2A 5D8AB 4C1WA 4MHUA 3ZYRA 3KVBA 1NUKA 3THTA 2LM3A 2CSGA 4KG0A 4B7EA 1AR92 1FMD2 1RINA 3ACFA 4BYYA 1RUE3 2HWD3 2XVGA 4XEZA 5KHHA 1QOSA 4W4ZA 3U4XA 2AGSA 4LO8A 5ABJB 5FZLA 3IPVA 3KCXA 4ASKA 1AR91 1FMD1 1P8JA 3APBA 3QH6A 5A7PA 2LTNA 1WMFA 4A7YA 2R7EB 1UZYA 4GB33 3NV2A 2A73B 3AFGA 5T5OA 1WW5A 1GICA 5KR7A 3CNAA 1VBA3 1DYPA 5FPBA 2VH9A 3VBOC 2D6NA 4R9DA 4ZU5A 3F2ZA 3VBSB 2ZHMA 3M1HA 4AVAA 1WD3A 1C1LA 3A23A 3J7MA 5AFBA 2WLQA 1UU5A 1ENXA 1Y9MA 2D93A 4AGRA 1VJ2A 5C33A 1PNFA 3FN9A 3NV3A 4IE6A 5EP9A 3GCWA 1YI9A 4QHBA 4AOCA 1JU3A 4BMEA 4CDQB 1EY2A 2E63A 3VKOA 2Z42A 1YQCA 3PVEA 1SEFA 4Q2FA 5LA9A 2PHRA 4L92A 2PFWA 4TXWA 5I91A 4AHZA 2QQLA 1LNSA 3DKWA 2A7AA 1DQ4A 3RRDA 4QXHA 1H2MA 4XAAA 3MBWA 1QF3A 2FD8A 3OG2A 4QPIC 3FE5A 5F5AA 5C71A 1V6OA 4LO7A 1QJY3 4XFHA 4CVUA 2XWBB 3QH7A 5IHRA 5A33A 4QDRA 3I2GA 1WLWA 1RJ8A 5E16A 3KZ4C 2ORXA 4QXBA 4E4HA 5C9AC 4ISRA 1UO9A 1O3QA 2GP5A 2XL7A 5DZFA 1CJPA 4XJUA 5FZMA 2WO3A 2EA7A 2PHXA 4WM8B 3E5XA 1CVNA 3LEMA 4MGKE 2W68A 3MF6A 4UW4A 4M3CF 5FYIA 5A3PA 1UY2A 3I4IA 2AH2A 1HN0A 5KC6A 3IDAA 5IUQA 3V0BA 4X6RB 3VBUB 3KM5A 3NAPA 4K8FA 3VL9A 4L0PA 5LEJA 2GNBA 1GZCA 3KSCA 4YGBA 2G9ZA 2ID4A 1SFNA 3QCWA 4YM2A 3AFKA 3PDQA 4OYUA 1UY3A 5FZOA 3WP5A 1JZ6A 1VBE3 4XOGA 5I0TA 3OB8A 5FMCA 5FO9B 3N35A 1KDKA 4M0HA 3PMEA 4LE4A 2WINB 4ZS3A 3HIFA 3LWCA 4OMCA 1H0BA 3B9CA 3OD0A 3P3NA 1Q43A 4FOWA 3W5NA 4Q29A 2RHPA 2HWE3 1OC1A 1BBT2 3GGLA 4IERA 4YGEA 3VKLA 3POEA 1F4AA 3AP6A 3UK9A 5EJ1B 1UYZA 1X82A 4N90A 4BB3A 1DQ5A 2GDFA 1JHJA 1GQGA 3AMQA 2XL9A 4A42A 1BBT1 2VOKA 4DUWA 3CHXA 2J1EA 4OLLA 4D69A 2WC2A 5T52A 4B7KA 4FTEA 2ZHLA 1EUUA 5BNQA 1J3PA 1KXGA 3J9SA 2PHUA 4LHLA 4PLOA 3K3NA 5FTTC 2ZKNA 1W6QB 2Z69A 2Z4FA 3CZJA 1HQNA 1QOTA 1UOGA 1NX9A 1PX4A 4P5YA 3THPA 1WZXA 3KGLA
chains in the Genus database with same CATH topology
4OFGA 2H6CA 5EJ3A 5FO7B 1Q8SA 2WSVA 3ZXLA 1CN1A 4C0BA 4E2SA 3M3OA 3EO6A 5EYXA 4JDMA 2HEWF 1A3KA 4WVMB 3R6SA 2QFEA 3VBHA 2WNUC 2WS93 1W6PB 4ES8A 4J1XA 2CGPA 1ONAA 3V0AA 2D6PA 2OPKA 3TNPB 1G8WA 4GULA 4GWMA 1NCRB 4G3YC 3UKTA 2QDRA 4O9GA 5KHGA 4EJRA 1REDA 3ZFEB 1WD4A 4LBQA 1AX2A 1Q8OA 1WCSA 2WJSA 3ECQA 5T55A 3WG1A 2R072 2BWAA 2ZGNA 3BOPA 2E7QA 1LTEA 4WVWA 1MACA 3X29B 4COYA 4LR4A 3RI8A 4DMIA 5LK7B 1H9WA 1OA2A 5JIUA 1YNAA 4Z2WA 1CAVA 2OUHA 3D0JA 2R071 4AI8A 3AKRA 1QDCA 1V6KA 4CEYB 3JB4C 2ERFA 1ZNPA 1RTVA 4Q8KA 1BMV2 2P2KA 4P9YA 5FLIA 4LHNA 1CR7A 1UU4A 3H8UA 3OY8A 5L7OB 2WT1A 5ABJC 4JGYA 2EVXA 1BMV1 1G86A 4HETA 3AYAA 1KDMA 1ZBA2 2KXLA 3USUA 4MYEA 4OULA 3N36A 4QGNA 1S0IA 5SV8A 2OIIA 5K0UC 2ILMA 1ZBA1 3MFAA 3HAGA 3D6EA 1QMJA 1IPKA 1HV1A 2DCYA 2FMYA 2XBO3 3AM2A 3WW1A 1RJ7A 3ZXJA 5FBZA 3WT3A 1SFYA 2ZGLA 3ZFGA 4IV1B 2DF7A 4CDWB 1EAH2 1RUJ3 2TBVA 1CGPA 4PDWA 4FPHA 4IEPA 2YGMA 2V5YA 3VKFC 1PVC2 4HMZA 1EAH1 4YW5A 5I8TA 1QNYA 1NZCA 3L2HA 1D2SA 1NA1C 3VHRA 4AVVA 1UCXA 1IS5A 1PVC1 2BFUS 2GNDA 2WWSA 3FX3A 1MZFA 3LKJA 1BK1A 1MS9A 1ND2B 5EYYA 4ITCA 4R52A 4E4ZA 2P17A 1N3QA 1CAWB 3AYEA 1DQ0A 5DG1A 1AYN3 3OPZA 2B5HA 2ARBA 3I2DA 3RS6A 4LEJA 3D82A 5JR7B 1AL23 1YIPA 1X33A 1IQAA 2ZHNA 4NWWA 1Q8PA 4CZSA 1QU0A 1HW5A 5CBLA 1J58A 3SMHA 3EQEA 4B29A 4XFAA 3VDDC 3UJOA 1G7YA 5C8CB 5JI7A 2JG9A 5J37A 4HVQA 4AEKA 4JTOA 5GJ6A 2DCKA 2CWMA 1LGNA 3TYJA 3WD5A 2WFF3 3AP7A 2JG8B 3VHPA 1DIWA 4XF0A 4QPGA 4LLFA 1OHFA 2B46X 4X8NA 5D1IA 2IXLA 5L19A 3KT1A 1OA4A 5EFUA 5FAXA 1H2LA 4LBKA 4L9BA 2IWGB 3ZVXA 3AZYA 4OI0A 1WMDA 3LSDA 4XTPA 2Q0AA 3ZXDA 1OLQA 1O5UA 4AFDA 3WP3A 3N4MA 4YVWA 4E27A 3CJIA 4L8QA 4P9XA 3I8TA 4P9GA 4ONUA 1RB8G 1V6JA 4KU7A 1YJLA 1JOJA 3OYWA 4KBBA 3EXUA 1LOEA 3ATGA 1IZ3A 2YUEA 2BVBA 4A3XA 2YXSA 3VBFA 2XJQA 1XNCA 3PTYA 4I09A 1EV13 5FREA 3GHNA 4CDUA 2D43A 2XJSA 3VBRB 2XUMA 3O12A 2WT0A 4KQ7A 5KC5A 3ZFFC 5BUVA 5EZWA 1I1EA 2Q8OA 4GMP1 3AB0A 4IEZA 2I74A 2JD4A 4I0BA 3MLKA 3WVJA 1AHSA 4A7KA 1W0PA 4P9LA 2GC0A 4BCUA 5JVVA 2VOXA 4R9BA 4OUSA 1OOPC 1T6GC 4AVBA 1VBB2 1ZX5A 4XJ9A 2PTMA 2RS52 2GH8A 4Z1VA 2R49A 2CYFA 3TB0A 3KMHA 4AQSA 1VBB1 3WDUA 2RS51 3I59B 1CD3G 2ZZQA 2CTVA 3H3ZA 1POV3 4ZXKA 5BY5A 4XMIA 5GZDA 4U2AA 3M70A 3NV1A 2HWC2 2A3YA 1V70A 3NJZA 1Q8QA 1GZWB 4RR3B 4K3UA 3HT1A 4YVSA 3DGTA 2HWC1 3QOPA 2RS12 5T50A 4LHKA 2AREA 4K6BA 2BPA2 3M3QA 1DF0A 2B42B 5JI9A 1D0HA 4RS5B 3JBG2 3OF1A 2JECA 3H3UA 5KXEA 1MVQA 1RMU3 2Y26A 3ES4A 1BYHA 1TMF3 3JBG1 5I8YA 1C1FA 1QH6A 1S0GA 3ME2A 1LHUA 5FO8B 1RUI2 5CIRA 5FLHA 2XJTA 4FQZA 5JAXA 4EROA 5CFCA 2IFRA 1RUI1 3FBMA 3EHKA 4BM8A 1SCRA 3ZSLA 4DOUA 3ZYGA 4PJYA 2YPJA 4XQ4A 3WDXA 1AF9A 3WG2A 5HCFA 2WQ4A 2MHFA 5ACA2 2CAVA 2QZ2A 3M7AA 1WMEA 3W58A 2IXJA 4LBJA 2VVFA 4RHV2 4WV8A 5CG8A 1WLDA 3NAPC 5ACA1 2Q4SA 2G9FA 2QZ3A 1XNKA 4RHV1 1LODA 4AI0A 4N53A 4HVOA 1MQTA 3V56A 1EP0A 5DUWA 3A4UA 2OZJA 3M8LA 3ZXEA 1KJLA 1RUD3 2YC0A 2WZR2 4Q0QA 1D4VB 3OBRA 2G9GA 5CB7A 3J8F2 4LLOA 1S55A 4D94A 4OHXA 2WZR1 1APNA 5HCBA 5KBFA 3ES1A 5JPNB 2D5FA 4RD7A 3J8F1 2GSYA 1NLSA 4QQOA 4XQDA 1RC6A 4PIZA 4FXKB 2RJKA 3S0MA 3HWJA 2VW0A 4OHZA 1LU2A 3K51A 5D8AA 3AKPA 3FLPA 1DGRN 1PGW2 2ZMNA 5IT6A 4XF9A 1DGWX 4KGQA 2D40A 3ZPYA 2KA3A 1VBC2 3IBMA 3MW4A 2DTYA 5ABJA 1MEC3 3ZIXA 1PGW1 1QXRA 2YROA 3V64A 3PVBB 5BNOB 1X36A 1V6NA 1VBC1 2UWCA 3IKWA 5J09A 3J26N 1O3SA 2DVBA 1DQ2A 1MS3A 1N3PA 5C8WA 2D6LX 2WNVB 1O91A 4XF1A 1YFYA 4RQPB 3RJRA 1F8VA 2GN7A 4JCKA 3VBSA 3HBZA 3ENRA 3AXEA 3WP4A 4QX5A 4HL0A 2PLV3 2BFUL 2CL2A 2D97A 3ETQA 1VAKA 3WNXA 1LU1A 5LEKA 2BTVC 2E7AA 2P3IA 1RUNA 2A5ZA 4CDQA 2HWB3 5FPZA 5GLZA 1Z7S3 1AXYA 1QQP3 2F4PA 2GC2A 3T1LA 3R4DB 1UPSA 3AMNA 3JD73 1C3HA 2ZZJA 3AXDA 3IT8A 4F83A 1RUC2 5EV7A 3WDVA 3WINE 4JVAA 5K7PA 1F5FA 2FZ1A 2BVVA 3NSTA 1RUC1 2JENA 5FMOS 4GQ7A 1L3JA 4PBPA 5JZGB 1AXZA 4WM8A 4AHWA 4LUMA 4JGYC 3M3CA 3SITA 4IEQA 1LHVA 3WUDA 4YM1A 3VBUA 1JYCA 1UZZA 1PK6B 3GALA 1F2NA 5JLVA 1S0DA 3MEPA 1SBFA 3N3HA 4RL7A 3ZSKA 3MZHA 2DCZA 1Y43B 4ZU4A 4RR3C 3WDTA 2EALA 2PHDA 4XXPA 4FBFA 3ZFGC 4QXKA 2GC3A 1NQJA 2XGXA 2P3JA 1OKQA 1ENRA 4YM3A 4PDWC 3RYPA 2ZJCA 1GV9A 3OBTA 1CPMA 1DGLA 2NLRA 1VBD2 4WBBA 4GH4B 2MEV2 1COV2 1HRI2 3O0XA 2EIGA 5T54A 1VBD1 1IS3A 4N7UA 2MEV1 2E9QA 3MICA 3POWA 1COV1 1WBLA 1HRI1 4H14A 4WVZA 1ZBE2 2ZX0A 2ARXA 4LBOA 4XBNA 2BNOA 1W6QA 1NXD1 4OHWA 4LA3A 4LO6B 4QGMA 5CFDB 3K48A 4XYXA 3L9JT 2RM23 4UW6A 1FT9A 1XYPA 1IGOA 1ZBE1 2DVFA 3D5OA 2AENA 2RS33 4R9CA 4AVSA 1PVXA 2I45A 2NPIA 5EXOA 3INAA 5JSPA 2HJIA 2K9ZA 3LGRA 4WVMA 2VW2A 5C4WB 1W6PA 1WGPA 4IETA 3MLLA 2YMZA 4X8PA 4FOYA 2DURA 4AHYA 1WCDJ 3RWNA 3E97A 4H7MA 1DGRA 1RVF3 1G9DA 2JG9C 4UW5A 5HCAA 1NCRA 5F1RA 1D4M3 2RR13 2VOWA 3L2YA 1ND3B 2Q1MA 4HN1A 5KHKA 3ZFEA 4LUKA 4Q4X2 1HRV3 1IPJA 3UJQA 2GAUA 3ZX7A 1C8NA 2EAKA 4QPGC 1QXJA 1TNFA 4HANA 4Q4X1 5JSRA 2NMOA 2PA7A 1H8TB 5GM0A 1UMZA 3N7LA 1LCLA 2ZTNA 4GA9A 3B00A 1W6NB 4CEYA 2ZGKA 1B35B 4XF4A 4V1PA 1EYBA 3OJBA 1FPN2 1UPIA 3ZXGA 3SHRA 4C91A 4YVWC 4C1XA 5L7OA 2ZX3A 3CJIC 3AJYA 4HVRA 1FPN1 3AJZA 1LULA 2PHLA 1MS8A 3VZOA 4YZ5A 1QJZA 1VRH3 1W6MB 1VAVA 5F9TA 5H9QA 2JEMA 4LT5A 2C9AA 2XKOA 1V9U3 4XJWA 5JDBA 3GZUC 1QHDA 3VBFC 4TWTA 2NMNA 3ACLA 4CDUC 4DNYA 2DUOA 4IV1A 1BJQA 4LBLA 4CDWA 5GZCA 4Q4Y3 1ENQA 1NOVA 2TUNA 2XVKA 4AE2A 2R1BA 5BPXA 5CVRA 3ELNA 5CU1A 4EWAA 1QDOA 1YFWA 2RMU2 1J1TA 3R05A 1FOD1 4FXGB 2WIIB 4JRLA 1S0FA 3LZZA 4HT1T 1PZ7A 5JWPA 1NG0A 3SCGA 2GNTA 1GQHA 4YZ1A 2RMU1 3VZMA 3JCIA 1CAWA 4EN6B 1ZRDA 4FQ4A 3WP6A 2VNGA 4MV2A 1ZZ9A 2DFBA 4IEOA 1R1A3 2WNEA 1LESA 4JV4A 2Q5TA 2B45X 1JN2P 1TME2 4D7TA 3CU7A 4U36A 5CA6A 4AQ2A 4QU2A 2R1DA 1YWKA 1SMVA 1RGSA 4BPZA 1LECA 2HWF3 1UAIA 4S2GA 4HSJA 1TME1 1Y7BA 4RGGA 3TAYA 4YVSC 2R32A 4JDNA 1S0JA 2V73A 5C8CA 4O9EA 1AR62 1J3QA 1QNWA 1YCIA 2HEYF 4Z92B 2R062 1HIXA 3KLSA 1KRIA 1RUH3 1H2KA 4BMBA 1AR61 3E6DA 2PN5A 1RIRA 1KS4A 2JG8A 1YXWA 1AL0G 2R061 4HBNA 2D3PA 2DU0A 2D98A 1RUE2 5CFCC 2HWD2 4XJAA 3ZIWA 4AI1A 4NO4A 1RUE1 2ZMKA 2HWD1 4Y20B 2DUPA 4QPYA 4GB32 2NN8A 1VB4A 4Z82A 4IV3B 2CV6A 3MPBA 1OSGA 1VBA2 5HXVA 1NQDA 3H1WA 2D6KA 4PQ9A 4DXZA 3LA3A 4Q4V3 1C57A 4DINB 4GB31 3B02A 1LJ7A 3IMNA 1VBA1 1OFNA 5FQ0B 1Q56A 2C0ZA 3MF9A 1DZTA 1REFA 3NO8A 2X53S 4K7JA 4N53C 1MQTC 1AJKA 2XH6A 3RDIA 1NLRA 4YG6A 3VBRA 3RMYA 4PLNA 4AFBA 5DDJ3 2JJ6A 5FMOL 3AZZA 3RG0A 3MIHA 5CNAA 1QJY2 4WM7C 4HK8A 2AZ5A 3VN4A 2WA4A 4LTAA 4M3CB 1GNZA 2GU9A 3JB8A 1QJY1 3B7MA 1F9KA 5GZFA 3AKQA 5BNNB 2A6VA 1H4HA 4LBNA 1TEIA 5D8AC 3SCFA 4IESA 4NOTA 4Y1VA 4AFAA 1W0OA 4K1YA 1W6OB 1D2QA 3I59A 2IXIA 4YARA 2GALA 4RGAA 2SBAA 1V00A 1I3HA 1CPNA 4FCAA 4I01A 4XZPA 3GZAA 3C3VA 3I7DA 2YZ4A 4XIOA 1NXMA 4CDXB 4PLMA 1VBE2 1AYM3 3U11A 4Y1XA 3WW3A 1GZWA 4RR3A 1DHKB 3H1MA 4CP2A 1NY72 4NPRA 4URTA 3VBSC 1VBE1 3PMSA 1ENSA 4KWKA 2HWE2 4P14A 1NY71 4RS5A 3MIGA 4DRRA 4CDQC 3MPPG 4COVA 3VZKA 5BNPB 1WCKA 4FOVA 1QJX3 2HWE1 2X29A 1K5MB 4KWJA 3HQXA 3WCSA 3FJSA 4AEDB 3AZWA 1DBNA 3DPRB 1G9FA 4LBMA 1S1AA 4COWA 3GBGA 4FTBA 3MW3A 1REEA 1ULGA 3IN9A 1YO8A 2B7YA 4L97A 4Q0SA 3LCPA 1KJRA 1GFF2 3ZN6B 3BB6A 1PM7A 3BU7A 4WM8C 2PAEA 2WS92 2X5IB 5GLTA 2VUAA 4I30A 2JXAA 1FAYA 2VVEA 4YW4A 2BBVA 3V65A 3VBUC 4JC1A 1LGBA 2WS91 5DG2A 1AJOA 3DL3A 3OCPA 5TSWA 4PBOA 2ZGOA 3RYRA 3H1YA 3WR0A 1U0AA 2O8OA 2AR6A 2R043 3AX4A 2TNFA 2CGNA 4CP1A 1MZEA 4FPJA 3CJXA 5GLUA 2XB6C 1A78A 1VB2A 1LOGA 1SLIA 3UL2A 3TNQA 1S0BA 3DV8A 4ZU7A 3B93A 1V6IA 2JX9A 1YUDA 4P9JA 4UW3A 3GNEA 1S2KA 3IWZA 4CP0A 4KU8A 5JOZA 1R083 1LGCA 1NCQB 4XW3A 3FMGA 3KQRA 5AVAA 2A6ZA 1PO13 1UF2C 2RS13 4GWNA 4ZKTB 1U5ZA 4S2FA 5E1RA 4FOQA 5GALA 1GSLA 4CEWB 2EXJA 3DF0A 1GYKA 4N43B 4UBGA 4BQ1A 1OQDA 1PZ9A 3TWIA 5BNOA 3ZYIB 2DYCA 4EV0A 2VNOA 2XBO2 2DV9A 3WW2A 2FBEA 1AR73 3EJKA 3PJYA 4OHVA 4I2OA 1UKGA 2EXHA 1DZRA 2WNVA 4CRQA 1H1MA 1RUJ2 4Q0VA 2PYTA 2XBO1 2WL1A 5K9YA 2LALA 2ZOEB 2YY1A 1NCRC 4EN7B 1RUJ1 5AC93 4JAAA 3E6CC 4GXLA 5I0UA 1H1AA 2I2SA 3S7IA 3VBHB 3ZFEC 2XJPA 3QLQA 4LA2A 1VALA 1FV2A 3SH5A 3VL8A 1LKNA 1UX6A 1LHNA 2Y0OA 2Q30A 1AYN2 3MYXA 5GZEA 4W6XA 1UW8A 2PHWA 3BCWA 1AL22 4CEYC 1CAXB 5IK7A 3AKTA 1S2BA 1AYN1 1CIWA 3WDWA 4AK3A 1G9CA 5JZGA 1AL21 1S0CA 3ALQA 3FFQA 5L7OC 1PGL2 3SXWA 2HYKA 3WDYA 3ZSMA 1ULCA 5KHJA 2P3KA 1PGL1 1PK6A 1GNHA 3AP5A 4XPVA 1SACA 4QGLA 1BVVA 4IEWA 4R4XA 3ZXKA 4AW7A 1OI6A 3M3IA 4IEXA 4MZUA 2DVGA 2NZ9A 4XBQA 3VHOA 4IV1C 4CDWC 1LRHA 3PLQA 2WT2A 2WFF1 5A3LA 1UIJA 4GH4A 1ALYA 3AMHA 5JIAA 1XXNA 3H7YA 4L11A 1MS4A 1NE4A 3LOBA 3KCYA 4BIFA 1YI7A 1ZVFA 3JU9A 2K2SA 3SNMA 1ND2C 5GLVA 1N1SA 1BEV3 1QJU3 2ZMLA 2QNKA 5JOYA 3AMPA 4QQHA 4D7YA 5CFDA 1GLHA 1ZYBA 1PIV3 2VQ0A 1RUF3 5H9PA 1EPZA 3I54A 4NHKA 4XIKA 4OUMA 2DWRA 2ZS6B 1QKQA 3FUQA 2IC1A 4GIQA 1EV12 4E2QA 5A32B 4Q27A 1O7FA 5C4WA 1O3TA 4YGCA 1UN1A 1XRUA 3BTAA 4LO4B 4Q1RA 1LOBA 5DUXA 1EV11 2Z5WA 1LHOA 1JUIA 5C8CC 3TN93 1Y3TA 3DUIA 2ZKLA 3H50A 2CAUA 1QXPA 1LOFA 5A3MA 3ILNA 4YZ3A 1ND3A 4WM7A 2DVDA 2A3XA 1KFXL 3KT4A 3NW4A 1O4TA 1Q8VA 2YHJA 2JG8C 3T2TA 1HXS3 4AQTA 2UYBA 2SLIA 1IOAA 1H8TA 3R0RA 1DFQA 1AR83 4K20A 2H0VA 2QQPA 1UL9A 4LE3A 1W6NA 2CY6A 1JBCA 4PIYA 4EWDA 1KQRA 1B35A 4K9SA 3WLUA 4XJZA 5J98B 4Q4W3 4JGZB 4QD2A 2YYOA 1POV1 4XTMA 4EWEA 1XE8A 1GR3A 1W2UA 4G9SB 1DG6A 2FHRA 2ZBJA 1G9AA 4DPNA 4BLJA 5FLJA 1VR3A 2OVUA 4XFFA 1W6MA 1LENA 2DU1A 2GC1A 3WUCA 2FMDA 3FLTA 2B39A 4KGGA 1MZ6A 3R4SA 1WLTA 1R093 1RMU2 2ATFA 4XHBA 4S2DA 2ET7A 4WZFA 1TMF2 3POYA 1ULFA 3VBRC 1RUG3 3URFA 2IXHA 3BALA 1RMU1 3VBOB 4RA0A 1TMF1 1IHMA 3HT2A 1PO23 1RHI3 1S0EA 2XLGA 3NWKA 2E53A 1MS5A 3D4KA 3RJ2X 3ILFA 4C0HA 1Z78A 2QCSB 5BV6A 1HKDA 2D6OX 2HEVF 2R0HA 1ZZ8A 4YLZA 3VV1A 4AI2A 1WW6A 4OVEA 1YFXA 1XE7A 1C8M3 5I93A 4E4SA 4P9WA 1ASJ3 4MGIE 2GMPA 1QWRA 5JCTA 4EN0A 4QPIB 3B5LB 3RSJA 1TNRA 1EPWA 3GZTB 3ZYPA 4B8EA 4QQ2A 4KG8A 1OA3A 1CJDA 1JHNA 1WA4A 5C9AB 1A6CA 2BNNA 1RUD2 3TOJA 4B4QA 1HV0A 1OPOA 1IS4A 2R16A 2PAKA 2A6WA 1KITA 1OD5A 2QKDA 1AR93 1FMD3 3HD8B 2UWAA 1RUD1 2QVSB 4RS5C 5J7MA 4FPKA 4YNIA 3OTFA 4XXAA 2ZX4A 3IDBB 2XJUA 5DZEA 1XNDA 2VOVA 4QMAA 5JMCA 2ZGSA 2A6YA 2VULA 3MIDA 4PCRA 4MGYE 4AEJA 3O5SA 4F8AA 3UKVA 1AX1A 4DS0A 2DTWA 5E89A 3MIFA 1MEC2 4ES9A 1ZZBA 4XETA 2BEOA 4Y20A 4IL7A 2ET1A 1JYIA 4IV3A 1MEC1 3H9AA 1LEMA 4ATEA 3VZJA 2GMMA 2B8MA 2H6BA 4N9IA 3WCRA 1SLAA 2OW4A 2PLV2 4INDA 5FQ0A 3BODA 5LK5A 1A8MA 3B01A 4YG0A 3CEWA 2HWB2 4Q26A 2PLV1 1X8MA 1Z7S2 1FNYA 5KXDA 2PQQA 4YW1A 4YYOA 1QQP2 1ZZ6A 2VMGA 2PHTA 4YGDA 1YIFA 4IEYA 2ZHKA 2HWB1 3JD72 1UKRA 4HKOA 3LB9A 1Z7S1 2WNUB 4DY3A 4DFSA 1O4YA 1QQP1 4F3JA 1DLLA 3JD71 2Z2SB 4ASLA 4XF3A </