4SBVA

The refinement of southern bean mosaic virus in reciprocal space
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
199
structure length
199
Chain Sequence
SSMDVTILSHCELSTELAVTVTIVVTSELVMPFTVGTWLRGVAQNWSKYAWVAIRYTYLPSCPTTTSGAIHMGFQYDMADTLPVSVNQLSNLKGYVTGPVWEGQSGLCFVNNTKCPDTSRAITIALDTNEVSEKRYPFKTATDYATAVGVNANIGNILVPARLVTAMEGGSSKTAVNTGRLYASYTIRLIEPIAAALNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords SOUTHERN BEAN MOSAIC VIRUS COAT PROTEIN
publication title The Refinement of Southern Bean Mosaic Virus in Reciprocal Space
pubmed rcsb
source organism Southern bean mosaic virus
total genus 44
structure length 199
sequence length 199
chains with identical sequence B, C
ec nomenclature
pdb deposition date 1985-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00729 Viral_coat Viral coat protein (S domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4sbvA00
1QJZA 1F8VA 4WM8A 1AR61 1RUC1 1H8TB 1PGW1 5LK7B 1RMU3 1IHMA 1A6CA 1HXS3 3FBMA 1PIV3 2WZR3 5ABJB 5A32B 2RS51 1NY71 1RUH2 2R062 3JD71 4IV1C 4FTBA 1RUI3 2HWF3 1AR72 4RQPB 1RHI3 4RS5B 2RS33 3ZFFB 5BNOC 4RHV3 1FPN1 1NG0A 2XBO3 4CDWB 1MEC1 4Z92B 1VRH3 2MEV3 2R041 1C8M1 1EV13 4FSJA 4PDWB 1B35B 1RMU2 2RS13 1HXS2 1RUD1 4JGYC 1PIV2 2WZR2 1ZBA1 1VBB1 3LOBA 1AYN3 1RUI2 2HWF2 1RUE1 2R072 1ZBE3 3ZXAC 1TMF1 1NA1B 1R082 1RVF3 1QJY3 1RHI2 1AR93 4FTEA 4EJRA 1OOPB 4YVWB 1R093 1VBA1 3NAPC 4RHV2 1OHFA 2GSYA 4AEDB 2HWE3 4GB31 5C4WC 2BBVA 2MEV2 5K0UB 1FMD3 1MQTA 1EV12 3CJIB 1VBD3 2RS12 3DPRC 2RM23 1QJU3 1AYN2 1VB2A 3JBG1 4GMP0 1ZBE2 1NCRC 1RVF2 1AR92 3VBFC 1VBE3 1R092 5ACA2 5BNNA 2HWE2 4QPGB 2X5IC 5GKAC 3VBUC 1AR63 1PO13 1RUG1 4N43B 5L7OC 3VBSB 1K5MC 1NCRA 1M06G 3VBFA 1VBD2 1R1A2 3JD73 2RM22 1QJU2 5L7OA 1AYM1 1VBE2 1QQP2 1MEC3 1D4M1 2R043 1PO12 3ZFEC 1AR62 1BMV2 1PGW2 5CFCA 4GMP1 1QJX1 4CEWC 1H8TC 1RUD3 1ZBA3 1NY72 1VBB3 1W39A 4N53B 5C9AB 4RR3B 5ABJC 1RUE3 2HWD3 1TMF3 4CEYB 3HAGA 1HRI2 1VBA3 4Q4W1 1WCDJ 4CEWA 4Q4X1 4RS5C 4GB33 5JZGB 4JGZC 2BFUL 1MEC2 3ZFGB 1X36A 3IDEA 2R042 4CDWC 4QPIB 1NCQA 1RUD2 5C8CA 1B35C 1ZBA2 1VBB2 5BNPC 5D8AB 1RUE2 4JGZA 3JBG3 1CD3G 1PVC2 2HWD2 1V9U2 1TMF2 5FMOL 1NA1C 1VBA2 1VBC1 2HWC1 4GB32 1OOPC 4YVSC 4AEDC 1TME3 5BNPA 2WS91 4Q4Y1 3VDDB 1ASJ1 4LLFA 5CFCB 5FOJB 1OPOA 2PLV3 4Q4V1 1ND2C 3CJIC 2GH8A 1AR83 1FOD3 4YVSA 3JBG2 3VBHB 2WFF1 4Y5Z0 1AYM3 4IV1A 4SBVA 1ND2A 4CDUB 3VBOB 1TME2 4QPGC 3S6PA 5BNOA 2ZAHA 1RUF3 4GMP3 4CDQB 4CDXB 4N43C 4IV3B 1NCQB 5CFDB 2PLV2 3VBRB 1AR82 1FOD2 1RUJ1 2RS32 4JGYA 1DDLA 2XBO2 2Y26A 1AYM2 4Q4W3 4Q4X3 4WM8B 1VRH2 4NWVA 3NAPA 1RUF2 1Z7S1 5C4WA 1HRV1 5J96B 1QJY2 2HWB1 1GFF2 4N53C 5C9AC 4RR3C 3DPRA 4Q4W2 4Q4X2 1RUC3 2HWC3 1EAH1 1RUH1 1FMD2 2WS93 4Q4Y3 1AR71 5JZGC 2RS53 1ASJ3 5FMOS 3ZFGC 1ND3C 3JB4C 4Q4V3 2X5IA 4QPIC 3VBUA 1COV1 4GH4C 1K5MA 2VQ0A 1FPN3 4JGYB 5D8AC 4WM7C 1RMU1 3TN91 1ND3A 1HXS1 1PIV1 1RUC2 2HWC2 1C8M3 2ZZQA 1MQTB 1RUI1 2HWF1 2R071 4GH4A 2WS92 4Q4Y2 1R081 1ASJ2 2RS52 3M8LA 3JD72 1RHI1 4WM7A 5C4WB 4Q4V2 1RB8G 2ZTNA 3ZFEA 1RUJ3 4RQPC 1PO21 1H8TA 1FPN2 5BNNB 3ZFFC 1BEV1 3VBHC 5ABJA 5A32A 5A33A 1C8M2 1F2NA 1NCRB 1AYN1 3VBFB 3VBOC 4RQPA 4PDWC 4RS5A 1AR91 4CDXC 1R091 1HRV3 5ACA1 4IV3C 5L7OB 2HWB3 4CDWA 1POV0 3VBRC 4PDWA 4YVWC 1B35A 1RUG3 1EAH3 1R1A1 1RUH3 2RM21 1BBT1 4WM8C 5K0UC 2WLPA 1AR73 1NA1A 2RMU1 1OOPA 4YVWA 4AEDA 1HRV2 1COV3 3ZFEB 2HWB2 1QQP1 1HX6A 1NOVA 1PO11 5K0UA 4CEWB 1BMV1 1HQNA 4RFT0 3CJIA 3TN93 1D4M3 1RUG2 1EAH2 3J8F1 5A33B 5DDJ1 1QJX3 2R073 3VBSC 5AC91 1R083 5C8CB 1POV1 2IZWA 1HRI1 4JGZB 1PGL1 1COV2 4QPGA 2DF7A 1PO23 4N43A 3VBSA 1BEV3 3TN92 1D4M2 5BNPB 1X33A 1QJX2 2XPJA 1AL21 1PVC1 1MQTC 1V9U1 2HWD1 2RR11 4FTSA 2BFUS 4YVSB 5ACA3 1VAKA 4IV1B 2FZ1A 1PO22 1VBC3 4Y4YA 4CEYC 1VB4A 2FZ2A 1ND2B 2R061 1BEV2 5BNNC 1R1A3 1SMVA 5BNOB 1BBT3 4N53A 5C9AA 2WWSA 4RR3A 4CEYA 2RMU3 3JB8A 4NWWA 2WFF3 1QQP3 5JZGA 3ZFGA 1AL0G 1TME1 1VBC2 2WZR1 4QPIA 2BPA2 2PLV1 3J8F3 2QQPA 5DDJ3 3NAPB 1BBT2 1AR81 2TBVA 5D8AA 5AC93 1FOD1 2RS31 3VDDC 4RHV1 5CFCC 2XBO1 1POV3 2RMU2 1HRI3 1VRH1 2MEV1 2WFF2 3DPRB 1EV11 2RS11 3VDDA 1RUF1 4BCUA 3J8F2 4CDUC 1AUYA 1ZBE1 1E57A 5DDJ2 1RVF1 1QJY1 1Z7S3 5J98B 5AC92 1AL23 1PVC3 3ZFFA 1V9U3 3VBHA 2X5IB 2RR13 4CDQC 3VBUB 1NCQC 2HWE1 5CFDC 1K5MB 1RUJ2 5C8CC 1PGL2 4CDUA 3VBOA 1FMD1 1ND3B 1CJDA 1VBD1 2BUKA 4CDQA 1C8NA 4CDXA 2R063 4IV3A 1QJU1 5CFDA 4GH4B 3VBRA 1Z7S2 4WM7B 1AL22 1VBE1 2RR12
chains in the Genus database with same CATH superfamily
3KZ4C 2DUOA 2VUCA 1W8WA 1KJLA 1WW7A 5KC6A 2XLFA 4WM8A 3LEKA 4CXWA 3CIHA 4AF9A 3TEWA 1KITA 4A42A 4M4RA 1S4CA 2BDRA 2VTXJ 4WVMA 5D1IA 1ODMA 1O5UA 2YFZA 1PIV3 3I2OA 2A71A 5KWRA 4JKMA 1RUH2 2R062 4IV1C 5LK5A 3ZPOA 3ACHA 4H14A 2CWSA 2DCKA 1OH3A 4Z07A 3WP6A 5IT6A 4UI9L 1J83A 1H9WA 4WV8A 4UFJA 3ECQA 1PZ9A 1REFA 3LFMA 4PIYA 1W6NA 3SLIA 1Q8OA 3ZFFB 5BNOC 1XSQA 4XBLA 3OPZA 4CDWB 4MGSA 3OGGA 2BRTA 4E8CA 2R041 3WXPA 4OHYA 1UF2C 1EV13 3GZUC 4PQQA 4ZY9A 2ZKNA 1B35B 3UJQA 1YNAA 3BODA 5FWEA 3HN1A 1RUD1 2VBDA 3DUIA 1RJ8A 3ELNA 4YWAA 4QDQA 4AZZA 1VBB1 4TTGA 2XVKA 4OYUA 3OUJA 3IB3A 2QNKA 3WOGA 3BCWA 4P9LA 3AMQA 1RYYA 2QKDA 1R093 3TOJA 2JG9B 1OHFA 4RHV2 1VMFA 2VZ1A 5C4WC 1MZ6A 2ADDA 1QH7A 1GP4A 2H6CA 2ETEA 2VMDA 1F4HA 1LOEA 1UD1A 3RDIA 1FMD3 4MYEA 1MQTA 3K3NA 2I45A 3OJBA 1R64A 3OGSA 2KA3A 4QXKA 1KRIA 1D0GA 3DPRC 1WCKA 2X10A 3ZYRA 5FWJA 1G6NA 2B8MA 2VOTA 1QJU3 4NVPA 3PU8A 3R4SA 4BK5A 3JBG1 1ZBE2 1UOFA 4TLGA 3RZLA 5A6YA 4QX0A 1AR92 3THCA 1D2SA 1HV1A 2FHRA 2XJTA 3WY6A 2XXZA 4NROA 1JOJA 3WF1A 2HWE2 2RJ2A 4S2HA 3S5QA 2YBKA 4Y4RA 3ACGA 4CCLA 2BGCA 2X5IC 4N43B 5L7OC 1CAUA 3VBSB 5BNQA 2N7GA 2GMPA 5CKNA 4M3CF 1E5RA 5T5JA 1M06G 4KU7A 2WT0A 3K2OA 4Q1RA 2JD4A 3VKLA 5C6CA 5FMBA 1OA4A 5FIXA 1XC6A 1YFUA 2P5BA 4UWDA 2YY1A 1DIWA 4YM3A 5T52A 5L7OA 1KD7A 4F8AA 4FQZA 2XJQA 1LOAA 1AYM1 1OD5A 3POJA 3AKRA 3MF6A 1KEXA 3CQOA 3LEIA 4I30A 3ZSKA 2WO3A 2R043 1IZ3A 5GZDA 4MX3A 1YI9A 1BMV2 4EZHA 1PGW2 2JDUA 3L9JT 4DUXA 4OZOA 4SLIA 4A7KA 1IKPA 1QJX1 3BIEA 4EV0A 4WZCA 1PX3A 5IK5A 1H8TC 1A8DA 1RUD3 1ULFA 1UZZA 2JIJA 2XDVA 3WP3A 1NY72 1VBB3 4ISRA 1H6YA 4N53B 5A7OA 4RR3B 1IS5A 4YSFA 4BU2A 4NJ4A 1RXFA 2CDPA 3DGTA 2QQUA 1FX5A 1LCLA 1C1FA 2P4EA 3HAGA 4P02B 3PLQA 3FUQA 2EIBA 1HRI2 4MHRA 4CPBD 5AFEA 1OT5A 1JZ6A 1WCDJ 4OUSA 2K2SA 3OPWA 4RS5C 4QQ2A 4XEZA 4XAAA 5JZGB 4JGZC 2BFUL 1MEC2 2DTYA 2G9ZA 2WNVA 5FYIA 4FFGA 2WZEA 1PNGA 3IDEA 1DGRA 3ZFGB 1AXKA 4HZFA 4QB1A 3T3YA 5IK7A 2A3XA 5A3OA 4TN7A 2VQAA 3K46A 2W87A 1ZBA2 4IE6A 3AMPA 3UETA 3KV9A 2C9AA 2FMDA 4M00A 5D8AB 1RUE2 4JGZA 3JBG3 4YGCA 5DABA 1PVC2 5FPLA 3SKVA 3UGHA 1UYXA 1TMF2 3EYPA 2SLIA 4QDSA 3WT3A 3O1RA 2B39A 3ACFA 1NXD1 5A3UA 1NA1C 1V6JA 1NLQA 1VBA2 1X8EA 1QGLA 1VBC1 3IAPA 5LA0A 1HB1A 4IEUA 1OOPC 1Q5OA 3ACLA 3N7JA 4AEDC 1C4RA 4OMDA 4KWUA 3SKJE 4M3CA 4Z8BA 1Q56A 5FZKA 2WQZC 3B94A 4GJZA 3VDDB 4LLFA 5CFCB 3GJBA 3AL5A 3QH7A 1OPOA 2ZOEB 1UYYA 2D7FA 1S2EA 1OKOA 2E6VA 3IZOA 2D6NA 4AQ6A 3UJOA 3BUCA 2UWBA 5J48A 1V6KA 1QKQA 3ZN4A 1GICA 2ZS6B 1FOD3 4YARA 1QOOA 1LOGA 1FNZA 3IPVB 3MI8A 3AKSA 4RD7A 4Y5Z0 4LBLA 1AYM3 4N90A 4CU7A 2W1WA 2YUEA 3P5BA 4UT5A 1MS8A 1AXZA 2NMNA 1JHJA 2RE9A 3MUY1 4AK3A 3VBOB 4D69A 5L19A 1BK1A 3OGVA 1LTEA 1ZRDA 1PHMA 1HN0A 4NIHA 4LE3A 5F6KA 1RUF3 4C0HA 4R4XA 4TSVA 4IV3B 2PHWA 5FY5A 4C0BA 2AR6A 3PMSA 1CPNA 2VMEA 3AK0A 4IUGA 5FBJA 4COVA 1J58A 1CJPA 2O0OA 4FPJA 3E6DA 3K3OA 4JGYA 4WBBA 4YNIA 4IL7A 3H3ZA 2WT1A 3ZDVA 3OPTA 4ES8A 4ZZ5A 2FDJA 1LAJA 4HANA 5FP7A 4P00B 2GP5A 1YUDA 3C7OA 1VRH2 4NWVA 1QH6A 4QU1A 4AHYA 1L7RA 3RVHA 3O0VA 5T5LA 2B7YA 4F83A 1N1SA 1SEFA 3NAPA 4R8HA 3DCQA 5CIRA 3T2OA 1V6NA 5EIYB 1Z7S1 2QDNA 2OZ6A 5FZHA 3ZYIB 3VLBB 1HRV1 2C6SA 2CSGA 1O59A 3LIGA 3POGA 4X8NA 5EQUA 3T2PA 4AR2A 5FFOC 2D6OX 1QNYA 2YG0A 5FXWA 2J1SA 2ZGOA 5A3NA 5C9AC 1BXHA 3O1UA 4IEVA 3RQ0A 3D6EA 4Q4W2 1J3RA 5FKBA 1Y9MA 2JDAA 4CA9A 1RUC3 2VCBA 3SH5A 3THPA 1YFYA 2D3PA 1RUH1 1JH5A 1MZEA 4XJAA 1XYNA 3ZXKA 2RS53 3NJXA 2H6BA 1ND3C 3FBYA 4LNVA 5GZCA 1HKDA 4QPYA 4EZ4A 2ZABA 3VBUA 2A7AA 1X50A 4DOUA 4J1XA 1K5MA 3RZZA 3ZXDA 4I02A 2J1UA 2WDBA 4NMIA 3S7IA 4BHPA 1UO9A 4RA0A 3N35A 4LO6B 3PJQA 1ND3A 3KV5A 3GALA 4HBNA 1YEWA 1KXGA 4LORA 5H9PA 2NP0A 4XF0A 2WNEA 4B4PA 4XJZA 2ZACA 2OYZA 1XQNA 4MOAA 2WAAA 3KS7A 1N3QA 4Q4Y2 4DFSA 1DZTA 2A6ZA 4NHLA 3JCIA 3VZKA 2D5HA 2ENRA 4D3WA 4KGQA 2BJSA 3LA3A 1ZRCA 2J1TA 1AHSA 1US3A 1ULEA 4QQPA 2A73B 4YW2A 5E6HA 5FP3A 3BKZA 5I0RA 3LZZA 5A80A 1SBDA 1FPN2 5FZGA 2XOMA 2WN2A 3M4FA 3ZFFC 1BEV1 1VIWB 2H0VA 3C2UA 3TNPB 3I3QA 3RWKX 3U4XA 5A1AA 1C8M2 2AREA 4YYOA 1UW8A 2GH2A 5J37A 5CG9A 1S0DA 4AEJA 2YDEA 3VBFB 3ASIA 4XJWA 1QEXA 1U0AA 5LATA 1WGPA 2E51A 1AR91 4L9BA 2VOKA 4TLFA 5F5IA 2RJLA 4TWTA 3AMMA 3T4HB 1HRV3 1K5JA 4NHKA 3FFQA 4CDWA 4G3YC 4EROA 5CZKA 4K1ZA 4UW4A 3RWNA 4EN6B 5J3UA 2AEZA 2Y8KA 4MSVA 1UOJA 2BZDA 1B35A 3RZKA 1HN1A 2EIGA 4I09A 1RUG3 2BGOA 4GALA 3S30A 3I2FA 1RUH3 3MZHA 1H4GA 1NE4A 2E7TA 2PQQA 3V56A 4MGQA 5FK8A 1J1TA 5HXMA 3D0SA 5LZ6A 2KM2A 3LFIA 5JR7B 2P37A 3POBA 5FZIA 2JG9A 4P9YA 1DQ6A 1G86A 3ZFEB 2HWB2 2IWGB 3POIA 4YW6A 1H0BA 5KR7A 3RG0A 1J59A 1BHGA 3WSOA 1BMV1 1HQNA 1OLMA 1WZXA 4RFT0 1XSRA 1Y43B 2VNRA 4HFSA 1D4M3 1W04A 1ZZ8A 5FPBA 2P1BA 1OLRA 3KVAA 4J25A 3ZN6B 5FPUA 3PIGA 5DDJ1 3TEYA 4HVQA 4LO8A 3LEMA 4LO5B 1RINA 3IN9A 3VBSC 1OC1A 2C24A 2GNTA 3OYWB 1DBNA 4KWJA 5C8CB 4BIOA 1HRI1 3FE5A 2JD9A 1QXPA 4JHTA 3RJRA 4ASMB 4B1LA 2J1VA 2W08A 2DF7A 2WC2A 2WKKA 3MIDA 4XDQA 2ORZA 5FZ9A 4AHXA 1WMDA 2VW0A 1I9RA 3C7GA 1SLAA 4N43A 5A3LA 3VBSA 1CIYA 2ZMKA 3L2HA 3IAQA 1BEV3 3ME2A 1HB3A 3TN92 4DZGA 3ZXJA 4LIUA 3W58A 1HW5A 2D40A 4MVTA 5JAXA 1DQ2A 3FFZA 2XPJA 2WNUC 3KT1A 4QB6A 1PVC1 5JLVA 4ZONA 1H1IA 5FYVA 1DLCA 1OFSA 1GQHA 3TRSB 2BFUS 1UZ0A 1T6GC 1UWWA 3LDRA 1BZWA 1OF3A 3I2HA 4HLTA 2UWAA 4YVSB 3ZMNA 3A22A 4ITCA 2Q8EA 5FUPA 5I0SA 2B4KA 4IV1B 4ARXA 4CUAA 1PO22 3N4MA 3WVJA 2FZ2A 4L97A 3C7EA 1URXA 1GWKA 2ARCA 4QXCA 4RN5A 4PI2A 2VZOA 5BNNC 1IG0A 2J7MA 2VO5A 4JDMA 5BNOB 1HJGA 3HR9A 4N53A 3V0AB 4RR3A 5GLUA 2ZZJA 4LBQD 5FZOB 3VD9A 2TNFA 3U1XA 4QGMA 2DCZA 1MS1A 3F95A 5SV5A 4BQ5A 4CXYA 3JB8A 3MIGA 1EP0A 2BP6A 3NO8A 5JZGA 3TNQA 1XNBA 3ZFGA 4YZ5A 1PZ8A 5FTTC 2WZR1 1VPHA 3DECA 5C33A 4YLZA 1JXNA 4AL9A 2A6XA 5DDJ3 2CDOA 2VVDA 1YQ2A 3KGZA 5D8AA 2PHLA 3Q8FA 4ZU5A 3VDDC 2W0XA 1MS4A 5CFCC 3HN3A 2RG4A 3WNNA 3FLPA 1ZZCA 2FDIA 1ONAA 2A5ZA 1HRI3 4GAZA 4XIKA 5F1RA 4RGAA 4YM0A 5H9QA 1VRH1 2H0BA 2MEV1 2OX0A 2PELA 2F6BA 4AXOA 3DPRB 5JR2A 4UFMA 1TQ5A 3HPNA 4PF1A 1ZM1A 2RS11 1KS5A 3VDDA 4YRDA 3D0JA 2DVDA 2NQYA 1WCSA 1IS4A 2XJUA 3J8F2 5FZ0A 1SDWA 1S0FA 2E26A 4R9BA 4C1XA 3VDAA 1PVC3 3A4UA 3IPVA 2X5IB 1PK6B 2GALA 3I2JA 3VB9A 3MICA 2VTFA 1BLZA 5AVAA 3T30A 1RUJ2 2O1QA 1A34A 4QU2A 5LEKA 1PGL2 4P5HA 5FY4A 3VBOA 4COUA 2RJKA 1U12A 2F4PA 4LBOA 4PI0A 4FPOB 2ADEA 2VQTA 4FI9A 3E97A 3QACA 1VBD1 1LHWA 3TEXA 3ZYHA 1AX1A 1G7YA 2ZGPA 4ASKA 5FZCA 1CIWA 4IV3A 5A1LA 4OHXA 5LEJA 4R9AA 1EY2A 1W3XA 2VZUA 3HBKA 4IETA 2BBAA 1CZVA 2VMCA 4YW4A 1MZ5A 1XNAA 4WM7B 1Y9GA 3QCWA 5F3CA 1VBE1 3LPFA 4G4FA 3IDAA 1ZVFA 2Z2SB 4GJYA 4MH0E 3WDVA 4EE2A 2R30A 1ODNA 4A6SA 4JKKA 5E88A 1W3VA 1F8VA 4N7IA 5FLIA 3HBZA 3MPPG 3NWKA 4V2WA 1H8TB 2RDRA 2AC1A 4Y26A 1QWRA 1I1EA 3AX4A 3IDBB 4NO4A 1HXS3 1YJLA 4GWJA 2WZR3 5A32B 3OOXA 2JX9A 4AHZA 5LY1A 3FL7A 4NHYA 4XC9A 4D7YA 1RUI3 1Y4WA 2HWF3 1FNYA 4QT6A 2G9FA 3D3AA 4IEZA 3E5UA 4RQPB 1AX0A 4CCMA 2VOVA 4RS5B 1Q8SA 5T55A 3UT0A 1JZ3A 1S2BA 5FMDA 3T08A 2P17A 1YLLA 4LR4A 1FPN1 1LHNA 2W91A 3N9MA 2EIEA 5IVVA 2WRAA 5GM0A 3WW2A 1IQAA 1SBFA 1VRH3 2MEV3 3SQOA 3S57A 1Q43A 1C8M1 3AYDA 4BLIA 4OUMA 4FSJA 4JQRA 1RMU2 3B93A 2JEMA 2JXAA 2RS13 3OBAA 2VUJA 4OULA 2QQNA 2DVGA 2KD7A 2GMMA 1ULDA 1W2TA 1GYKA 3EO6A 3BALA 1AYN3 2YROA 3FC0A 2BU9A 3EQEA 3FHAA 3U10A 3KQRA 4QGNA 3ZXAC 1NA1B 2VZ3A 1C5HA 3BPZA 1RHI2 3AKQA 3ZIXA 1OOPB 3BIWE 4YVWB 1H2NA 3WNOA 4C8DA 4P14A 3AJZA 4HKOA 4LHSA 2QDRA 4X6QB 4AEDB 2RDNA 3PVOA 1ULPA 2NZ9A 3JUUA 1QXJA 4XTMA 4AFMA 1JTZX 5I0DA 2MHFA 3W59A 5FRAA 3WUDA 4HSLA 3APBA 2EVXA 5I8YA 1I5ZA 4AGGA 4KH9A 2D5FA 1VBD3 2C4XA 3Q8EA 5JOXA 3KM5A 2ZGNA 3C7HA 2QQJA 4HN0A 4X8PA 2GAUA 4QX2A 4GMP0 1UU5A 1YXWA 2VCMA 3LAGA 5F2SA 3RGBA 1RVF2 2OT7A 4J6GA 5LBFA 3VKMA 3LCPA 4Q0QA 2FDGA 5IW0A 2OXBA 3VBFC 1VBE3 3DXUA 1LJ7A 2QQLA 4ZKTB 3WNLA 4FP2A 5B4NA 3SMHA 3U75A 4Y5SA 2VMGA 5GKAC 3NKTA 2IXKA 1XU1A 3TYJA 4HPKA 1YFWA 3ZYJB 1ENXA 1LB2A 1SLLA 1L7QA 5FP8A 3HQXA 3HD8B 3FJSA 3VBFA 4CXXA 1R1A2 3I2DA 1FV2A 2RM22 1HQLA 3WDTA 3KT4A 4FP3A 4JKLA 4LEJA 3D82A 5I0UA 3MV11 5FXVA 1W05A 3K4ZA 4E2GA 2MNGA 3OCPA 3SCHA 1X7NA 4PLNA 3U11A 1I3HA 1PX4A 2AZ5A 3HEIA 3VHRA 2ZEYA 3VKNA 3ZN5A 3ZLIA 4RFRB 1PO12 3ZFEC 1AR62 4QM8A 5A3TA 1S0BA 3MLJA 4PCRA 4S2FA 2QZ3A 4FPYA 2DBIA 5FYMA 3I4IA 4LHKA 4OUEA 3Q8CA 3IMNA 3B9CA 3AZYA 2C1FA 5C9AB 4NIAA 5ABJC 3H1MA 4EN7B 4MHUA 4FVVA 1O7FA 2GDFA 4AVBA 5A6ZA 4AFDA 4YZ3A 4DXTA 2W1UA 4FFIA 1XNTA 5JIUA 1MVEA 2XQRA 4QKDA 4COYA 3K4DA 4FAGA 1DG6A 4Q29A 2JB4A 4XZPA 1FYUA 2LALA 4BZ4A 2VY0A 3ZN6A 3HQUA 4KL1A 1H6XA 4OLLA 2EICA 2KXLA 2O8QA 4ZXKA 4AVVA 4Z1VA 2KR2A 2BTVC 1HB2A 2VL4A 3WCSA 4FPCA 4QMAA 3U37A 5C8CA 2WQ8A 3B9IA 2WIIB 1UMZA 1CD3G 4S2DA 2BVVA 2HWD2 1IGOA 2V4VA 4J1WA 2EF6A 5CEHA 3P3NA 4PIZA 2Q30A 2GN3A 3L2YA 4IEOA 5IYYA 3MV01 4GKYA 2ZGQA 2ZX1A 4GB32 4QX3A 2EALA 4YVSC 3HOBA 1NLSA 1TME3 2IVIB 4LTAA 4PT6A 4ZS2A 2Q1MA 3V0BB 1UY1A 1ASJ1 4BPZA 4XFFA 3SEEA 4B4QA 2PLV3 2HEVF 4FOWA 3VZNA 1JZ7A 4YW7A 4UAPA 3I2KA 1RITA 1S0EA 1WWYA 2WWJA 3ETQA 4MGKE 4YVSA 3CL1A 4R4ZA 4LHLA 2V09A 2XGXA 1NZIA 4IV1A 4IGQA 4BLJA 3E6CC 1LOBA 1CAVA 1WMXA 2X53S 3GBWA 2HBTA 3AM2A 2FDFA 3GGLA 4GWMA 4TYSA 4UFLA 4L2NA 4QPGC 4UW5A 1W8ZA 5BNOA 5FPAA 1CVNA 2ZAHA 3V0AA 3HT1A 5FLHA 3WDUA 3HMYA 1NCQB 5FZOA 4C90A 5CFDB 1OURA 3LE0A 1ENQA 5EV7A 3KF3A 2X8KA 1AR82 2JIGA 4RGGA 1RUJ1 5T5PA 5A6XA 4BMEA 4B29A 2D44A 1TZOA 4KG0A 3KWVA 3VD5A 4XQDA 3WX5A 1QIQA 3QLQA 2Y26A 2ORXA 2R16A 4BE3A 2WQ4A 4CTEA 3NQHA 1GUIA 3R6SA 4BQWA 4LIVA 5FO9B 1SPPB 3I3EA 4XMIA 3VZLA 3PUQA 2UY9A 1UU4A 3BB6A 3ZVXA 2Y6HA 5CYYA 1ZRFA 2VZSA 4A45A 4HOOA 3PNAA 4ASLA 5C4WA 3FLRA 1UY4A 4LO7A 2WYFA 5KXDA 2ZPXA 3RS6A 1QJY2 1AX2A 3P1IA 4JTOA 2EXHA 1GFF2 2AGSA 3LWCA 1JYWA 5FP4A 2HJIA 3AZZA 3DPRA 4YM1A 4HONA 4YGEA 1KDKA 4FOQA 1PK6C 2VPVA 4Q4X2 4CCJA 1JOBA 1LHVA 1EAH1 3RYRA 2X05A 1ZA4A 4HKWA 2IUWA 3INAA 2ZX0A 4Q2FA 3T4VA 1ASJ3 5FMOS 5K7PA 2XR4A 2ZGKA 2X5IA 2BWCA 1PK6A 4QPIC 1CN1A 3HNMA 1UOBA 4KWKA 3WQBA 3OGRA 5FZ7A 4XJUA 4BH9A 4CCCA 1R1ZA 4NHXA 3OBZA 1GNZA 5FY1A 2DBNA 4ONUA 4H3WA 3WD5A 4WM7C 3MIFA 4CP0A 1W90A 1RMU1 1O4TA 2ZAAA 5AVPA 4CP1A 4B3NA 2QBXA 3RZJA 4MG2A 2HWC2 2WNUB 2XUMA 2ZZQA 3VDCA 1GOFA 4NHMA 2VZRA 1NLRA 2WS92 3ALQA 2ZHLA 4GA9A 1KQRA 2R7EB 1AJKA 1W9TA 3JD72 1RHI1 3NV2A 1SLIA 4WM7A 5F7UA 2E63A 4Q4V2 1FATA 1RB8G 5HV0A 2ZTNA 5C5TA 1KJRA 3ACIA 4Y33A 4XUQA 1RUJ3 2WFPA 5FZ6A 4RQPC 1ZX5A 2A1XA 5LA1A 1H8TA 3K51A 1ZNPA 4BOWA 5BNNB 2PYTA 3N9NA 2C5DA 1LGNA 1C57A 2JECA 4K40A 2JENA 3GZTB 4GULA 2QJVA 3LDBA 5A32A 5DAWA 5EP9A 3UL2A 2WZPP 3M2MA 3HNBM 3RRDA 1NCRB 2LM3A 4LKEA 2WNOA 4RQPA 3O1MA 1EUUA 3B69A 2W46A 1GKBA 4RS5A 5LASA 1OA3A 1E5SA 1JODA 4CDXC 3W20A 4CCKA 1HLCA 3LGRA 4JTNA 1Y3TA 1WW5A 1GQPA 1G9BA 2ET1A 5F2WA 3THTA 1QNWA 1PMIA 4F3JA 3K48A 4D6SA 1POV0 3M3IA 1S0GA 3E5XA 4YVWC 2AEYA 2YU1A 2P3YA 5FY8A 4MGTA 3LSEA 1PGSA 4Y1YA 1EAH3 1OUSA 1R1A1 1SDDB 2OUHA 3E1F1 2BYVE 3GJAA 4YG6A 3A0KA 2RM21 3WQ0A 4Q27A 2VNOA 4AFCA 2E53A 3FHQA 2UURA 5FP9A 2WLPA 4OZXA 1NA1A 4XPVA 2JE7A 2VNGA 1OOPA 2ZX2A 4YVWA 1HB4A 5JCTA 4AEDA 5JPMB 4UBGA 1W99A 1XE8A 2VG9A 5FZ1A 5JMCA 2BWAA 2DCJA 4BK4A 1NOVA 1PO11 4LE4A 2PAMA 2WBKA 4CEWB 2ZHNA 2G1MA 2VZVA 2BGPA 1LOFC 2JICA 4FFFA 5DUWA 4COWA 4INDA 1XNKA 2IVJA 5A33B 2G4IA 4ET7A 1WW4A 1QJX3 3AYAA 3POEA 2RVAA 4UF0B 2ILMA 3IIAA 4GKXA 3LF7A 5E1RA 1M4WA 4GWIA 2WABA 2WINB 5DQ0A 4Y1VA 4JDNA 2IZWA 1YRZA 5I8TA 1LOFA 3AYCA 3LA7A 4Y20B 5IVJA 1COV2 1CWPA 3J7NA 4O61A 4BQYA 3E6BA 1NE6A 3PTRB 3W5NA 3CBNA 3POSA 2ZGUA 3RJ2X 1NT0A 2HEWF 2VNVA 2D3RA 3PUSA 1W2OA 5BNPB 4ATFA 1IPJA 4OMCA 3B7MA 4Y1ZA 4QWNA 5JI7A 1HV0A 5A3PA 2YV8A 5CVRA 1W6PB 1PM4A 3FN9A 4AG4A 1VP6A 4OQ8A 2HWD1 5F9TA 3J7LA 2RR11 5FK7A 1JZ8A 3UKVA 3ZIWA 2K46A 1W2AX 4LJHA 4YZ2A 2V5YA 5IAVA 5FAXA 1UZWA 3WINE 1MS3A 5JSRA 2GZWA 4NRQA 1VBC3 3HWJA 4Y4YA 1AZDA 3LEGA 2R061 2EAAA 1N1YA 3GHNA 1R1A3 1SG3A 2W9XA 2YYOA 3AC0A 4XF1A 3UGFA 3WG4A 2AUYA 1WBFA 4TZDA 1AVBA 1PNFA 5C9AA 4META 4MUVA 1I5PA 1S55A 1ULCA 1W0NA 2XLGA 2VR4A 2ARBA 3I59B 5T50A 4KNCA 1OXCA 2CGPA 5EZWA 5F5AA 4UFIA 2ZMNA 2L9LA 4QM9A 5HCFA 2PFWA 5JIAA 4EQVA 2LRPA 3ZR5A 1AJOA 1AL0G 2ZXQA 4MXVA 2VUDA 2CV6A 4DIQA 1VLNA 5JVVA 3LQCA 2B46X 2Y6KA 2VECA 2EXIA 1GQGA 3N7LA 5B2GB 4FO9A 5LRSA 4PF5A 4A2UA 5LCWL 1XE7A 4L0PA 1FAYA 2LS6A 4ZHNA 4XF3A 1XB9A 1BBT2 4JAAA 3NNJA 1AR81 1X9TA 4K8FA 1MS9A 2ZEXA 3AZVA 5LA9A 3UYJA 2WJSA 4RHV1 1TE1B 3OUIA 2HYXA 4NAOA 1SZBA 4PLMA 2RMU2 4XFBA 4B1MA 4IESA 3H8OA 4DPNA 2DVAA 3ENRA 4HL0A 2WFF2 4CP9B 1EPWA 2PN5A 1H1AA 1KS4A 4L8QA 4QX1A 2TUNA 3O7OA 2Y33A 4NIIA 3V0BA 2VCAA 2ZEWA 4BMBA 3IM0A 4PBOA 1GOHA 5EFUA 2DFBA 2BNNA 3O14A 2R49A 3SHRA 4NN0A 1AUYA 1ZBE1 5JMOA 1ENSA 2Z42A 1QJY1 3VZJA 1Z7S3 1WMEA 2XVLA 3ZSJA 2YFUA 5AC92 3ZFFA 1W6QB 2RR13 4X6RB 1XRUA 4LXLA 2VXJA 1NCQC 1GR3A 2HWE1 2XQXA 3DEMA 4HN1A 4YW5A 3TBDA 3WF4A 2VBBA 5CFDC 1ZYBA 3GXUA 2VZTA 3MEPA 5FZEA 4CCOA 2VGDA 5F6LB 3IBMA 2B9UA 1V00A 5L9VA 2VXRA 5EYXA 4YFZA 4XFAA 3I2IA 1QDCA 1W03A 2BUKA 4FQ4A 2UY8A 1C8NA 1DZRA 2R063 4Y1XA 1DGWA 4PBPA 2Y6JA 4L92A 2JJ6A 5A7WB 5CFDA 4GH4B 1XPWA 2VMFA 3F2ZA 5FMCA 2VAUA 3JQXA 1WD3A 2Z5WA 4LOTA 3E5QA 3AVRA 4AQSA 1AL22 4H7MA 4CYDA 1LR5A 2JDMA 3KGLA 5CG8A 4P9WA 2F17A 4AQTA 2LW8A 5FJHA 5IWFA 5A1FA 1UY0A 2V5DA 2JB8A 2P6HA 3ABZA 3AXEA 4QD2A 5JOYA 2BOJA 1SPPA 1PGW1 5LK7B 3S5AA 4LKFA 2WL1A 1IHMA 3SC7X 3NKGA 3SITA 3DV8A 4XILA 4ZXEA 5ABJB 4GWNA 1NY71 4P08A 1C28A 1NX9A 3JD71 4Q5OA 4FTBA 3SNMA 2R0HA 5CKQA 4AI8A 3USUB 5J7MA 3NV3A 3VV1A 4E2SA 3NNFA 1LNSA 4RHV3 3WNKA 1JUIA 1NG0A 4XETA 3BTXA 1MEC1 2IXJA 3WG1A 4P9IA 4DS0A 4BQ1A 3NRUA 4DRRA 1W6MB 4QKBA 3V65A 2IXCA 4PDWB 2W2IA 2IXHA 1XXNA 1HQWA 1PIV2 4N9HA 1ZBA1 3FZ3A 4R9CA 3ZDSA 1SHWB 4XAEA 3LOBA 1RUE1 2WUHA 1O4ZA 1UYPA 1ZBE3 1W06A 3VL8A 3P6BA 1TMF1 1R082 1YQ6A 3G6JB 1QJY3 5F8PA 4Q0PA 5FOBB 1AR93 3WW1A 4FTEA 3RYPA 2GC0A 4Y1UA 5FLJA 2P2KA 2XMLA 3WP5A 4CE8A 1VBA1 1W9SA 4HMZA 2W68A 3GZEA 2GSYA 5J36A 5IATA 2HWE3 3BPSA 5KXEA 3SXWA 3MDPA 5FPVA 5BY5A 1UAIA 2BBVA 2AENA 2WNUA 3OEAA 5K0UB 1EV12 2YU2A 2VZQA 3WNMA 4CUGA 1W6OB 2JDYA 2DVBA 3PUAA 4XXPA 4CP2A 4IEYA 1T2XA 4LKDA 2VD7A 3OB8A 4U36A 1NCRC 3QH6A 2VQUA 4EN0A 1W6NB 4A3XA 4AE2A 3D5OA 1POQA 1R092 1VAMA 3CJXA 1GNYA 5BNNA 4QPGB 5I0TA 4AYUA 3UKTA 3OGJA 3N7KA 4OI4A 3UV9A 1CAXB 3POFA 4WVZA 5DG1A 4QKNA 1MS0A 3QD6A 3Q8BA 3NL1A 1NCRA 3RMXA 4XACA 5BV6A 5C71A 3CDZB 1LU2A 3JD73 4AOCA 3H7JA 3ES4A 4K9SA 3GYDA 1QJU2 4CP9A 1D2QA 5FREA 4H2AA 3OSDA 2D6PA 3MFAA 4XIOA 4ORFA 1W28A 4DY3A 5FPXA 4M0HA 4XCAA 2VTXA 3DN7A 3HJRA 3AFKA 4GIQA 5FYYA 2VU9A 3PURA 4XF4A 1QQP2 5FYBA 3PTYA 1MEC3 3EXUA 2Q8DA 1W8UA 5KXBA 3WHTA 4EWEA 2CAVA 1MZFA 2I74A 5A6QA 4AFBA 5CFCA 4GMP1 1UX7A 1LU1A 4CEWC 5IFPA 2Q8CA 1EYBA 2DWRA 4XUOA 1ZBA3 4AI9A 5LWBA 1SLCA 4BXFA 1RUE3 2Y0OA 1YIPA 1OQDA 2VULA 2YXSA 1TMF3 2ZX3A 3GCWA 3MW2A 4YFWA 4H7LA 1U5YA 3POWA 3TB0A 4XF9A 1DQ5A 4QHOA 2A75A 1VBA3 4Q4W1 4E4SA 2CHHA 4CEWA 5CNAA 3BTZA 3CMGA 4C91A 2Y6GA 2WT2A 3DKWA 4EYUA 5DZGA 5JXJA 2R042 1ZZBA 5IK8A 2YPDA 1MVQA 3FWEA 2VM9A 4QPIB 1W9FA 4UF0A 2OQ6A 4JRAA 1RUD2 1JYIA 4Q8LA 2WN3A 1TG7A 1VBB2 3J9SA 4LHNA 2IC1A 4NAMA 5BNPC 4EWAA 1SLBA 4Y20A 5LY2A 1XE0A 4L11A 5BYNA 1V9U2 3VGIA 3VN4A 4BA6A 1W9WA 5FMOL 5HI0A 4AFAA 4ARYA 3U0ZA 1QOTA 4HXCA 2BQPA 4K7JA 3KT7A 1Q8PA 4XURA 1YYNA 5C70A 4LUKA 3AFGA 3LSDA 4KBBA 1H2KA 4NR1A 1QJEA 2XUEA 2ZGMA 5FYZA 2HYKA 3KCCA 4YGBA 3WQ1A 5BNPA 4LA3A 3H8UA 1CESA 2PHTA 5JXIA 2ZKLA 4Q4Y1 1PVXA 2Y64A 1WLWA 5FOJB 1REEA 1UIKA 4K1YA 1DGWX 2PAEA 5FZMA 3ON7A 3RPQA 3T2TA 3CZUA 1O6UA 3CJIC 3JZVA 3LPGA 2D93A 4IEXA 4KWLA 1H2MA 4PLOA 4Q0UA 5T5OA 1MACA 1UX6A 1Y9QA 5JUVA 3JBG2 2XB6C 4YG0A 5A7NA 2PHXA 2WFF1 3OY8B 4W50A 4KGGA 2GNMA 4N8MA 5DG2A 1O3TA 1JHNA 2HBUA 2QZ2A 5C3PA 1UXZA 3JXSA 3ZM8A 3WW3A 1PMJX 1LKNA 3VD7A 4ZZ8A 3S6PA 3I2GA 1H8VA 4GMP3 4CDXB 4WVVA 4QAWA 2WAOA 3P3PA 3THDA 4KBZA 4LKSA 1S0CA 3I59A 3Q8AA 1W8TA 1H9PA 1X9PA 4KMQA 1FOD2 4QXBA 2RS32 2ZCWA 4D6QA 2D6MA 5JI9A 4I3GA 2XBO2 2JE9A 2CNAA 1AYM2 4Q4W3 3ILFA 4MZUA 3A21A 3PHMA 2ZJCA 3IT8A 3DYOA 3WEZA 1EUTA 2JDPA 1CX1A 4I3PA 1OMIA 5LW9A 2ZEZA 4ATEA 4XQ4A 1RUF2 1A78A 1UCXA 3H3UA 5IVBA 5IJRA 1U5ZA 4EN8B 4XABA 2NPIA 2HWB1 2W3JA 2OQ7A 1JYVA 3B02A 1WCQA 1XBFA 4YW3A 4OQ9A 2W95A 2R1DA 2V73A 1LULA 4XFGA 5DN2A 4FOYA 1ZZ9A 4FPHA 4D7SA 5F3GA 1UIJA 2DUQA 3FUOA 2DU1A 4HSJA 4CSWA 5GLTA 2XVGA 3VUOA 4LBNA 4P5YA 2O14A 2RHPA 2QUOA 1OUXA 2VVEA 4NIGA 3BTYA 5K4LA 3T0BA 4Q4Y3 3WDYA 4D8MA 3TEZA 1Z78A 1TNFA 3PJYA 3WLUA 4W8JA 5F5QA 5FCCA 1G9AA 4JRLA 1W6QA 2XJVA 5A7SA 4FPGA 1DYPA 4XJ8A 1WLDA 5TSWA 3BOWA 1S1AA 5C5UA 4LO4B 1OLQA 5HCAA 4GH4C 3VKFC 3HIFA 1IPSA 1BK0A 3B01A 1FPN3 1GZTA 4JGYB 1LOCA 2EXJA 3I7DA 2XKPA 2QQOA 2ZMLA 3TN91 4AVSA 1LGCA 3J26N 1PIV1 4MV2A 1RUC2 5DPNA 1C8M3 3SH3A 2FD8A 3ZKUA 1VJ2A 1ZRRA 3IIIA 5A7WA 2YC2A 4N9IA 4A7YA 1JW6A 1REDA 3AKPA 4GH4A 1DF0A 1UMIA 4QXHA 1FT9A 1R081 2RS52 4LT5A 2JKXA 4E2QA 4JHZA 4XHXA 4EN9B 3M70A 1DFQA 1YQCA 1KDMA 3I54A 3NV1A 3VZMA 2OIIA 1O3RA 4FBFA 3ZFEA 1YWKA 3O12A 5FZ4A 2W47A 3BVCA 3U07A 1PO21 1F5JA 2PHUA 1RL3A 2WYSA 3SCFA 3AP6A 1GZWB 2E32A 3VBHC 5JSPA 4OCTA 5ABJA 1JBCA 2VJXA 4B8EA 3T09A 4C1WA 3RNSA 2JKBA 5JSOA 3TAYA 1WCUA 2WLQA 5FDBA 1W0PA 4R9DA 4CU6A 2DFCA 3USUA 1OVSA 2YBPA 4PDWC 3OYWA 5FYTA 5KBFA 5JXHA 1ST8A 3R0RA 1R091 2XL7A 1F5FA 3AP4A 4JV4A 2DVFA 4I01A 2HWB3 5DUUA 2ARXA 3ZMOA 5FQ0B 2JG8C 3PIJA 5FJKA 2CYFA 1W6MA 4IGOA 2V4AA 1DYOA 3VBRC 5F37A 5FYUA 3SH4A 2A6YA 4DMIA 1YCIA 4PDWA 2WO2A 2GN7A 1TVGA 2QQMA 5DUXA 2PA7A 5IUQA 1OH4A 4AGVA 1UY2A 4AGRA 4CZSA 4MGZE 2IFWA 4HETA 5FV3A 1S0IA 3KQ4B 4WM8C 5K0UC 5KHGA 2JWPA 1WA6X 1CGPA 2VE1A 3ZYBA 2DU0A 1O4YA 2DTWA 2PHDA 2UYBA 3DYMA 2P3IA 3ORJA 4FFHA 3R05A 4I0AA 4DXZA 5FBZA 3HQRA 2QQKA 4HK9A 4LBJA 5FYHA 5A7QA 4M4PA 1VMJA 2NM1A 1HRV2 3R4DB 5A3WA 1QQP1 5FXXA 5B4XA 4LOSA 3LD8A 1E5IA 4XBQA 4IQPA 5K0UA 1B09A 1J84A 1CX4A 3TN93 1YQ8A 2CTVA 5LBBA 2R32A 5EJ3A 1W6OA 1RUG2 5F5CA 3BTAA 3J8F1 3I49A 4DRVA 2CAUA 4YGDA 5J1XA 4E4HA 3MO4A 4N7UA 3WDXA 2Z4FA 1R083 3K4AA 2WZ8A 5L9BA 2D6KA 1POV1 4HT1T 4PHZA 4XTPA 5FZ8A 1UMHA 1S2KA 2JDKA 3ILRA 1PGL1 1IOAA 1OQ1A 4QPGA 4BQ4A 4JX0A 4HK8A 5BXXA 5FO8B 3PVEA 4WVWA 1PO23 3UESA 1CAXA 1N1VA 1LENA 2ET7A 5HBAA 1J1LA 3N36A 5T54A 1K45A 1K3IA 1D4M2 1KFXL 3PUHA 4DXSA 4W6YA 4UW3A 1X33A 2RDSA 5IFTA 5HPOA 4I0WB 1UXXX 4MO3M 4P9JA 4IE5A 1MQTC 1V9U1 2VW2A 3KHCA 2D3SA 2WA4A 3H42B 4LK6A 4O9GA 3ROUA 2VW1A 4YZ1A 3AB0A 5C3RA 2J1RA 2FBEA 2WO7A 3MHZA 3FX3A 1CZSA 3NNMA 3N9QA 3C3VA 3NJYA 3C8XA 3WR0A 4NE9A 2VZPA 4XYXA 1ND2B 5LRRA 1BEV2 3LB9A 3IDCB 3NVCA 4Z2WA 2XJPA 4B7KA 1E5HA 2WWSA 4FCAA 4IW3A 3KV6A 3S7EA 2WSVA 4XXAA 1LGBA 4XZUG 4BWOA 2AYHA 3MLKA 5L36A 2VUAA 5CA6A 2VC9A 2B5HA 4PIXA 3ES1A 3JQWA 3M3OA 2GC1A 1BYHA 4NWWA 2E31A 1QQP3 1JS9A 4QQLA 2FCUA 1IPKA 1H2LA 3CZJA 4NRMA 4AVCA 3OD0A 4UBHA 5E8AA 1HIXA 1UYZA 4YZ4A 4QPIA 2VMHA 3GBGA 1GOGA 1QU0A 2YPJA 3J8F3 2QQPA 3T1LA 4E9KA 2TBVA 5EWSA 4CRQA 4XUTA 1FOD1 3KLSA 2OUJA 2RS31 1JOPA 3QBQA 1A3KA 1LEDA 1O8PA 2D98A 4AQ2A 4DEQA 3AMNA 2XBO1 3M7AA 1POV3 3O1SA 3VD4A 5T3NA 1FV3A 1WUVA 2J1EA 3O1OA 3A7QA 2ZGRA 5GJ6A 1RJ7A 4XE9A 3M3CA 3WG2A 5FZAA 4A6OA 1JZ5A 3H8XA 5GALA 4YG3A 2K0GA 2JDZA 1H30A 1V6LA 3WUCA 4Y5TA 4CU9A 1OPMA 1VE0A 4NPMA 1F31A 1RUF1 2AACA 3CEWA 3N9PA 2OKXA 3ZKYA 4CCNA 5HV4A 1HJFA 4FPEA 1YIFA 2PTMA 2ZHKA 4XVHA 2UU8A 3GNEA 3H7YA 5DDJ2 1Z0HA 2WNVC 1RVF1 1W8NA 2WWUA 3IMMA 3OBTA 5IHRA 3N9LA 4IGPA 1V9U3 3LIHA 3OY8A 3POYA 4A4AA 1SCRA 4BDVB 5F3EA 1JYNA 3ZSEA 5FYSA 3ZXFA 1DCSA 2DUPA 4QX7A 2J1AA 3KB5A 5FY9A 3OG2A 4E8DA 4KG8A 1CPMA 4AWDA 1JYCA 1CQ9A 1IG3A 1RC6A 4CDXA 1W8OA 3IWZA 4V1PA 2W1QA 1XNCA 5J09A 5C7GA 1DLLA 3MW3A 3USSA 2MPFA 1G9CA 2HH9A 5I93A 3RFRA 2WO1A 1O91A 2YMZA 1K12A 4FOVA 3LKJA 1ALYA 1F4AA 1DGLA 1QJZA 2CGOA 2D43A 2GNDA 3HVDA 2DCTA 1AR61 4MGIE 1RUC1 5FR3A 1RMU3 5FXZA 1A6CA 3KF5A 3FBMA 5GZFA 2Y6FA 1X8MA 2RS51 3AYEA 2W5FA 1N47A 1YO8A 4R52A 3VZOA 1WLTA 5F3IA 5E16A 1AR72 1UY3A 5JOWA 1RHI3 3LOIA 4LQRA 4MXWB 3BI3A 5FZBA 2RS33 3MFCA 1BKZA 2ZA9A 2HKXA 3AJYA 2I2SA 2YHJA 1MPXA 2XBO3 1F35A 3R4UA 3O0XA 3H1WA 4D0QA 3M1HA 4BM8A 4K20A 4Z92B 1PZ7A 3NMBA 2LROA 4BQ2A 4LK7A 4XDOA 1K42A 5FYCA 2QTWB 5DXDA 5DUVA 4JGYC 1HXS2 3NNGA 5HCBA 1QXRA 1J3QA 2WZR2 5KHJA 1AXYA 1UQXA 1NKGA 1SFNA 1RUI2 2A3WA 2B9VA 1DZQA 2HWF2 2R072 3EB7A 4Q1PA 5EHDA 3VHPA 2CU5A 1RVF3 1V6OA 2D6LX 4W6XA 5DAVA 1BCXA 4IE7A 4EJRA 1IQDC 5DMYA 1F9KA 3OD4A 4QX5A 3NAPC 3ZXGA 1LEMA 3LDKA 4GD4A 4GB31 5IK4A 1P8JA 4M0NA 4FXGB 2X09A 2Y60A 3MW4A 3ZX7A 1WMFA 4YPJA 2MEV2 3ETPA 1OFNA 4BJ0A 4LLOA 4UFHA 3EJKA 4Q0SA 2HLEA 2BEOA 3CJIB 1GWMA 4CVUA 4KI5M 1EPZA 2RS12 5FPZA 3UKNA 3ZOIA 3O1TA 5SV8A 5HCHA 2RM23 1XOYA 1AYN2 1VB2A 3D4KA 3WNXA 2FMYA 1VRBA 1OF4A 3CLPA 3OTFA 5IAXA 2Y6LA 5ACA2 5LA2A 1S0JA 1GZWA 4FPKA 2NLRA 3VBUC 2GU9A 1AR63 1NYWA 1PO13 1RUG1 1BQPA 3PVBB 1K5MC 1JMUB 1ZZ6A 4E27A 1RXGA 4HVRA 1VBD2 4HG6B 4AEKA 1GLHA 2FCVA 3UGGA 2JDHA 2LUWA 5EYYA 4AI2A 4UFKA 1NQDA 2XWBB 5BPXA 4MADA 4DINB 5FQ0A 3MYXA 4AI0A 2QCSB 1VBE2 3NJVA 3DL3A 2P3JA 5IVCA 1GWLA 1CAWB 3PU3A 1LECA 2ZBJA 4RSUA 3WV6A 1D4M1 4XUPA 2RDQA 1DYKA 3NJZA 1PM7A 2ZGSA 3GCXA 3BU0A 2R6QA 4XCBA 4IE0A 1BVVA 2SBAA 1OA2A 1XYPA 1W39A 5FY0A 1JZ4A 1FXZA 3DF0A 4Y22B 5GLVA 4LITA 3WP4A 2WSUA 4W4ZA 1RUNA 2HWD3 4COZA 4OVEA 1US2A 1DGRN 4LUMA 1DP0A 4CEYB 4LBQB 3AMHA 5FY7A 3AZWA 4CPBA 4Q4X1 4M3CE 4ZPIA 2IXIA 5I8SA 4DNYA 4ES9A 4GB33 5FZFA 5C8WA 2GC3A 5JOZA 1ENRA 3CKHA 3CO2A 3ZYGA 5IVYA 4BYYA 5K9YA 1W8FA 1LHUA 1X36A 1N1TA 4RYDA 2C9KA 4XW3A 4OHZA 1H1MA 2R1BA 3SISA 4CDWC 4HPKB 4W65A 4LPLA 4DEVA 2CWMA 4K3UA 1NCQA 1W0OA 2BVBA 5JWPA 4OI0A 2E7AA 5I91A 1B35C 2GNBA 1XYOA 1XNDA 3ILNA 2Q5TA 4I0BA 5CAZA 2WR9A 4IXLA 1RGSA 4U2AA 2A6WA 5LB6A 4BB3A 3BGAA 4ZU7A 3KMHA 1GU3A 3T0AA 4ISQA 4AVAA 5F39A 2RV9A 1VALA 3EMRA 1Y7BA 4WZFA 2VVFA 1IKQA 2HWC1 3A23A 4XBNA 2D97A 2YGLA 4CUCA 3WZ1A 4AW7A 2JG9C 1TEIA 4M01A 4KU8A 5DZEA 2EIDA 2IXLA 2WS91 2W52A 2J42A 1QDOA 2HEYF 2BERA 1VR3A 4Q4V1 2IFRA 1ND2C 4OI2A 4L99A 1ZREA 2GH8A 2AH2A 1C3HA 1AR83 4GZ9A 2ZGTA 2PHFA 1CZTA 2YC4A 3VKOA 3WDWA 1ZZ7A 1A8MA 1NXMA 1W2UA 3VBHB 5CB7A 4DQAA 3T0DA 1QJFA 2X29A 1DQ0A 4XOGA 3RZMA 3RZGA 1NZCA 4Z82A 3W5MA 2E7QA 4SBVA 3RSJA 1SCSA 2OPKA 1FI2A 2NYYA 2P34A 1ND2A 3VHOA 1DHKB 4CDUB 2XL9A 1G8WA 5H9RA 5CBLA 4MGYE 1TME2 3ZPYA 1WA4A 4CDQB 2CL2A 2XONA 2ZX4A 2OVUA 4IERA 4N43C 1Q3EA 3VD3A 4A3ZA 2PLV2 3K75B 2JG8B 2B42B 3VBRB 2QE3A 3RMYA 3BU7A 2VMIA 2FDKA 3GZAA 3H3LA 3J4UH 4OHVA 1JZ2A 3GDBA 3GBFA 2YZ4A 3PVNA 2PMWB 1DDLA 2GC2A 5ERLA 2G19A 2V72A 1Q8VA 1Q8QA 4O65A 4Q4X3 5DAXA 4QHZA 2TEPA 4WM8B 4IEWA 3U78A 3EBRA 1NUKA 1UPSA 3X29B 4WVMB 1IS6A 1AF9A 4NPRA 4IEPA 5DAQA 4Q0VA 3WW4A 3MIBA 4NPLA 2Q1ZB 2Q0AA 1D7PM 1YC61 1DU3D 4HKLA 1IS3A 2F4LA 3KHBA 4FT8A 3SEPA 2XJRA 3WHUA 1QY4A 3ZYPA 3WF2A 1ACCA 3W21A 5J96B 3I3MA 5EPAA 4QKFA 3V64A 4N53C 4XDPA 4RR3C 2YGMA 1HDKA 1L3JA 4H55A 2PAKA 1CAVB 4LMFA 2HWC3 3O1PA 1U5XA 1VMHA 2NN8A 2YC0A 1FMD2 1JUHA 4NRPA 4QQHA 2B45X 2W39A 2WS93 3MUZ1 1AR71 2QQVA 5JZGC 4EWDA 3VL9A 4NIDA 3ZFGC 5H9SA 3CNAA 4LBMA 1CR7A 3JB4C 1C1LA 3FLTA 4Q4V3 1BVP1 5ISLA 2QQIA 4FPLA 3A0NA 5LBEA 5JDBA 1UPIA 1COV1 2XKOA 2QVSB 2Y38A 3BYWA 4Z2AA 5FZ3A 3FMGA 3RI8A 1QMJA 1ULOA 3AP9A 3O1VA 3RYKA 2JE8A 2VQ0A 4LA2A 5D8AC 5GLZA 4LBKA 4FAHA 5FZLA 1ZA7A 1HXS1 2E9QA 1LODA 1KFUL 5LBCA 2DURA 1MQTB 1RUI1 2HWF1 2R071 1VAVA 3GM8A 4JVAA 2OPWA 4O7XA 1XJAA 3H1YA 1ASJ2 1W2NA 1ZRIA 3DYPA 3M8LA 3O5SA 3U14A 1SQ4A 4DB5A 4AAPA 4XFHA 5C3QA 3MIEA 2C26A 5C4WB 2J22A 5L73A 2I07B 5ANQA 4AI1A 1DQ4A 1SBEA 2CGNA 3WF0A 3KCXA 1GP5A 1UZVA 2P3KA 3PDQA 4JDOA 3KCYA 5F32A 4OI1A 1SFPA 4QDRA 1SLTA 1DQ1A 3CHXA 4AEMA 4FXKB 1H4HA 2OA2A 1RTVA 1YQ5A 4I2OA 3PMEA 1F15A 3JU9A 4DO0A 1UN1A 5A33A 1CAUB 2FQPA 1F2NA 1BJQA 2UWCA 4QPWA 2DDUA 1AYN1 3VBOC 3H50A 4GXLA 1QF3A 4W6WA 1GV9A 1JU3A 3I3DA 4AHWA 5CKMA 4MXWA 4BXSV 1L7LA 2PHRA 1X82A 2Q4SA 5D2AA 4RGKA 2PQSA 2ZGLA 4XFIA 4XMAA 5ACA1 5EXOA 4IV3C 5L7OB 1OLME 4ZS3A 2VH9A 1APNA 1GNHA 2R0FA 3NW4A 3OUHA 5ANNA 4D94A 5FO7B 1XU2A 1N3OA 2GMEA 1JYTA 3T2QA 5KHHA 2XHNA 3BN6A 3GF6A 4DUVA 1BBT1 4RL7A 3FHIB 2EA7A 4URTA 1LRHA 2EXKA 1W6PA 3KV4A 1AR73 1YJKA 2WA3A 5JPNB 5KHKA 1RIRA 2RMU1 2DV9A 1CONA 4AAXA 1G9DA 1COV3 4JC1A 5CU1A 4BIFA 4JQTA 4NOTA 3HNYM 1MS5A 3AXDA 4D6RA 1SFYA 1D4VB 3ZO0B 3VDBA 1HX6A 3KD4A 5GZEA 3H0OA 1GZ9A 2E33A 1U5IA 2CY6A 3CJIA 3O0WA 2WNVB 5EJ1B 3AP5A 1UZYA 2ES3A 1EAH2 2UYAA 3OBRA 3WNPA 1V0AA 3G7DA 5D21A 4IE4A 5G04L 4DY5A 3K77A 5AFBA 2R073 2BOIA 3U4SA 5AC91 5K8SA 2BV4A 2ZHMA 3I3BA 4JGZB 2BNOA 1V70A 1T6BX 5C3OA 4KQ7A 4QX8A 3ZXLA 3AKTA 3NNLA 4PJYA 1D0HA 3H9AA 5HXVA 3KSCA 4A44A 2P6CA 2VOXA 1WW6A 2W1SA 3EHKA 3I97A 2VOWA 2VBPA 4G9SB 3W9AA 1LESA 5IVFA 2A3YA 5APAA 4LULA 4YW1A 5GZGA 4M3CB 1O3SA 2A6VA 2K9ZA 3GHMA 4IEQA 3URFA 4BQXA 3TWIA 1QJX2 3CU7A 2LTNA 3B5LB 3UK9A 1AL21 2DYCA 3SCGA 2Q1FA 4FPFA 4QHBA 4Y24A 4FTSA 2DCYA 5FZDA 1JN2P 1UKRA 2XH6A 1GP6A 4XUNA 5L9RA 4CCDA 3S0MA 2ID4A 5ACA3 4QQOA 4B7EA 4K21A 1WBLA 1CAWA 4Y3OA 5EJZB 1VAKA 2OW4A 4OHWA 3ZSMA 4E4ZA 1QHDA 3DXTA 1OVPA 4D7TA 2FZ1A 3ZR6A 4CEYC 5DZFA 3J7MA 3ZYFA 1VB4A 5CADA 4QB2A 1QOSA 1UNBA 3B3QE 5BUVA 1OBNA 4XFCA 5GLWA 4Q8KA 1SMVA 2OS2A 1UOGA 2G9GA 5E89A 1BBT3 1UL9A 2Z69A 3IKWA 4Y22A 4URAA 3AZXA 5A7PA 4AVTA 1ULGA 4DUWA 3H8RA 4HVOA 3ZSLA 5JXGA 3BOPA 2W94A 3C7FA 1V6MA 4LBQA 4CEYA 2RMU3 3RZHA 4P9GA 5A70A 3N7MA 3PL0A 2EAKA 5IVEA 1PMHX 4MLOA 1W9YA 2WFF3 1G9FA 4OFGA 2FCTA 1OQEA 1KGYA 1JYXA 1TME1 5DAPA 3WF3A 1VBC2 4A7ZA 2C0ZA 4NUBA 1JI6A 1V6IA 4YM2A 5KHIA 3ATGA 1LHOA 1YI7A 3AP7A 3I8TA 3OF1A 4PQ9A 4XQWA 3N9OA 4CUBA 2BPA2 3MF9A 2PLV1 2XJSA 3ST7A 3Q9OA 2VCCA 4IDZA 1SACA 3NAPB 4JZRA 3ITQA 4A41A 2W92A 3MPBA 5AC93 3J7HA 3WQ7A 5A3MA 3LA2A 3N3HA 3NV4A 4K8RB 3OEBA 4E4DX 2Q8OA 2O8OA 4UXAA 1J3PA 1TNRA 3UNPA 1RUOA 4K6BA 4P9XA 3HT2A 1C5IA 3M3QA 1EV11 2BNMA 3ZXEA 2FDHA 5KXCA 1JU4A 2XG3A 2Z79A 1O8SA 1WD4A 3WCRA 1OKQA 3NSTA 4BCUA 2OZJA 1STMA 4BISA 1N3PA 4CDUC 3MBWA 1E57A 2XHKA 4F7ZA 1GSLA 5M0TA 5J98B 4UYBA 3WG3A 5C3SA 1AL23 4S2GA 4AI3A 1W8HA 5G05L 3VBHA 4CDQC 4XJ9A 1UU6A 3VBUB 4CU8A 3D8CA 3KVBA 1YHFA 3MIHA 4O9EA 5FUIA 2PXJA 2Y0IA 1WLCA 3M3EA 2YBSA 1K5MB 2XLAA 3DKQA 5FKCA 5C8CC 3VHNA 1GZCA 1OI6A 2QFEA 4CCEA 4CDUA 1FMD1 4GQ7A 4Q26A 2BW8A 2Y34A 4QGLA 3QOPA 1UKGA 3CF6E 2NMOA 1I6XA 3B00A 1NQJA 3MLLA 1ND3B 3PUIA 1CJDA 4XHBA 4B4RA 4UW6A 5KC5A 1WKYA 4CDQA 3MGUA 1GBGA 2A70A 4JCKA 5CISA 1QJU1 2ATFA 2ERFA 2JG8A 4V2VA 4UOJA 3T1MA 1GANA 3AVSA 1OSGA 4ZU4A 3RI9A 4BQ3A 2YB7A 1MR5A 4DXRA 2ARAA 3AL6A 3VBRA 2JDNA 1Z7S2 2QQWA 5FUNA 4TXWA 1GMMA 1O3QA 1OD3A 1O5LA 2RR12 2GP3A 1NAEA 1YFXA 2XWJB
chains in the Genus database with same CATH topology
3KZ4C 2DUOA 1WW7A 1KJLA 5KC6A 2XLFA 4WM8A 4AF9A 1KITA 4WVMA 5D1IA 1O5UA 1PIV3 2A71A 5KWRA 1RUH2 2R062 4IV1C 5LK5A 1I1EA 4Z07A 4H14A 2CWSA 2DCKA 5IT6A 3WP6A 4WV8A 1H9WA 3ECQA 1PZ9A 1REFA 4PIYA 1W6NA 3SLIA 1Q8OA 3ZFFB 5BNOC 4XBLA 3OPZA 4CDWB 3OGGA 2R041 3WXPA 4OHYA 1UF2C 1EV13 3GZUC 2ZKNA 1B35B 3UJQA 1YNAA 3BODA 3HN1A 1RUD1 3DUIA 1RJ8A 3ELNA 1VBB1 2XVKA 2QNKA 3WOGA 3BCWA 4P9LA 3AMQA 2QKDA 1R093 3TOJA 2JG9B 1OHFA 4RHV2 5C4WC 1MZ6A 1QH7A 2H6CA 2ETEA 1LOEA 1UD1A 3RDIA 1FMD3 4MYEA 1MQTA 3OJBA 2I45A 2KA3A 4QXKA 1KRIA 1D0GA 3DPRC 1WCKA 3ZYRA 1G6NA 2B8MA 1QJU3 4NVPA 3R4SA 3JBG1 1ZBE2 1AR92 1D2SA 1HV1A 2FHRA 2XJTA 3WY6A 1JOJA 2HWE2 4S2HA 2BGCA 2X5IC 4N43B 5L7OC 1CAUA 3VBSB 5BNQA 2N7GA 2GMPA 4M3CF 5T5JA 1M06G 4KU7A 2WT0A 5C6CA 4Q1RA 2JD4A 3VKLA 1OA4A 1YFUA 2YY1A 1DIWA 4YM3A 5T52A 5L7OA 1KD7A 4F8AA 4FQZA 2XJQA 1LOAA 1AYM1 1OD5A 3AKRA 3MF6A 3ZSKA 4I30A 2R043 1IZ3A 5GZDA 4MX3A 1YI9A 1BMV2 1PGW2 3L9JT 4SLIA 4A7KA 1IKPA 1QJX1 4EV0A 4WZCA 5IK5A 1H8TC 1A8DA 1RUD3 1ULFA 1UZZA 3WP3A 1NY72 1VBB3 4ISRA 4N53B 4RR3B 1IS5A 4YSFA 3DGTA 1FX5A 1LCLA 1C1FA 3HAGA 3PLQA 3FUQA 1HRI2 5AFEA 1WCDJ 4OUSA 2K2SA 4RS5C 4QQ2A 4XEZA 5JZGB 4JGZC 2BFUL 1MEC2 2DTYA 2WNVA 3ZFGB 3IDEA 1PNGA 1DGRA 1AXKA 4HZFA 5IK7A 2A3XA 2VQAA 1ZBA2 3AMPA 2C9AA 2FMDA 4M00A 5D8AB 1RUE2 4JGZA 3JBG3 4YGCA 1PVC2 3WT3A 1TMF2 2SLIA 2B39A 1NXD1 1NA1C 1V6JA 1VBA2 1X8EA 1QGLA 1VBC1 4IEUA 1OOPC 1Q5OA 3ACLA 3N7JA 4AEDC 1C4RA 4M3CA 4Z8BA 1Q56A 2WQZC 3B94A 3VDDB 4LLFA 5CFCB 3QH7A 1OPOA 2ZOEB 2D7FA 2E6VA 2D6NA 4AQ6A 3UJOA 2UWBA 5J48A 1V6KA 1QKQA 3ZN4A 1GICA 2ZS6B 1FOD3 4YARA 1QOOA 1LOGA 1FNZA 3IPVB 3MI8A 3AKSA 4RD7A 4Y5Z0 4LBLA 1AYM3 4N90A 2YUEA 1MS8A 1AXZA 2NMNA 2RE9A 4D69A 4AK3A 3VBOB 5L19A 1BK1A 1LTEA 1ZRDA 1PHMA 4LE3A 5F6KA 1RUF3 4C0HA 4R4XA 4TSVA 4IV3B 2PHWA 4C0BA 2AR6A 3PMSA 1CPNA 3AK0A 4COVA 1J58A 1CJPA 2O0OA 4FPJA 3E6DA 4JGYA 4WBBA 4YNIA 4IL7A 3H3ZA 2WT1A 4ES8A 4HANA 1YUDA 1VRH2 4NWVA 1QH6A 4AHYA 3O0VA 5T5LA 2B7YA 4F83A 1N1SA 1SEFA 3NAPA 4R8HA 5CIRA 1V6NA 1Z7S1 2QDNA 2OZ6A 3ZYIB 3VLBB 1HRV1 4X8NA 5FFOC 2D6OX 1QNYA 2ZGOA 5C9AC 1BXHA 4IEVA 3RQ0A 3D6EA 4Q4W2 1J3RA 1RUC3 3SH5A 3THPA 1YFYA 2D3PA 1RUH1 1JH5A 1MZEA 4XJAA 1XYNA 3ZXKA 2RS53 2H6BA 1ND3C 3FBYA 4LNVA 5GZCA 1HKDA 4QPYA 2ZABA 3VBUA 2A7AA 1X50A 4DOUA 4J1XA 1K5MA 3RZZA 3ZXDA 4I02A 3S7IA 4BHPA 4RA0A 3N35A 4LO6B 3PJQA 1ND3A 3GALA 4HBNA 1KXGA 5H9PA 2NP0A 4XF0A 2WNEA 4B4PA 4XJZA 2ZACA 2OYZA 1XQNA 4DFSA 3KS7A 1N3QA 4Q4Y2 1DZTA 2A6ZA 4NHLA 3JCIA 3VZKA 2D5HA 2ENRA 4D3WA 4KGQA 3LA3A 1ZRCA 4YW2A 1AHSA 4QQPA 1ULEA 2A73B 5I0RA 3LZZA 1SBDA 1FPN2 3M4FA 3ZFFC 1BEV1 1VIWB 2H0VA 3C2UA 3TNPB 3U4XA 1C8M2 2AREA 4YYOA 1UW8A 2GH2A 5J37A 5CG9A 1S0DA 4AEJA 2YDEA 3VBFB 3ASIA 4XJWA 1U0AA 1WGPA 2E51A 1AR91 4L9BA 2VOKA 4TLFA 2RJLA 4TWTA 3AMMA 1HRV3 4NHKA 3FFQA 4CDWA 4G3YC 4EROA 4K1ZA 4UW4A 3RWNA 4EN6B 5J3UA 4MSVA 1B35A 2EIGA 4I09A 1RUG3 3S30A 4GALA 1RUH3 3MZHA 1H4GA 1NE4A 2E7TA 2PQQA 3V56A 1J1TA 3D0SA 2KM2A 5JR7B 2P37A 2JG9A 4P9YA 1DQ6A 1G86A 3ZFEB 2HWB2 2IWGB 1H0BA 3RG0A 1J59A 1BMV1 1HQNA 4RFT0 1Y43B 2VNRA 4HFSA 1D4M3 1ZZ8A 1OLRA 3ZN6B 5DDJ1 4HVQA 4LO8A 4LO5B 1RINA 3IN9A 3VBSC 2GNTA 3OYWB 4KWJA 1DBNA 5C8CB 4BIOA 1HRI1 3FE5A 1QXPA 3RJRA 4ASMB 2W08A 2DF7A 2WC2A 2WKKA 3MIDA 4XDQA 4B8EA 5J36A 4AHXA 1WMDA 2VW0A 1I9RA 1SLAA 4N43A 5A3LA 3VBSA 2ZMKA 3L2HA 3ME2A 1BEV3 4DZGA 3TN92 3ZXJA 3W58A 1HW5A 2D40A 4MVTA 5JAXA 1DQ2A 3FFZA 2XPJA 2WNUC 3KT1A 1PVC1 5JLVA 1H1IA 1OFSA 1GQHA 3TRSB 2BFUS 1T6GC 4HLTA 4YVSB 1BZWA 2UWAA 3ZMNA 4ITCA 5I0SA 4IV1B 1PO22 3N4MA 3WVJA 2FZ2A 4L97A 1URXA 5BNNC 4JDMA 5BNOB 3HR9A 4N53A 3V0AB 4RR3A 5GLUA 2ZZJA 4LBQD 2TNFA 4QGMA 2DCZA 1MS1A 5SV5A 3JB8A 3MIGA 1EP0A 3NO8A 5JZGA 3TNQA 1XNBA 3ZFGA 4YZ5A 1PZ8A 5FTTC 2WZR1 5C33A 4YLZA 1JXNA 2A6XA 5DDJ3 2VVDA 3KGZA 5D8AA 2PHLA 4ZU5A 3VDDC 2W0XA 1MS4A 5CFCC 3FLPA 1ZZCA 1ONAA 2A5ZA 1HRI3 4XIKA 5F1RA 4RGAA 4YM0A 5H9QA 1VRH1 2H0BA 2MEV1 2PELA 2F6BA 4AXOA 3DPRB 1TQ5A 1ZM1A 2RS11 1KS5A 3VDDA 4YRDA 3D0JA 2DVDA 2NQYA 1WCSA 1IS4A 2XJUA 3J8F2 1SDWA 1S0FA 4R9BA 4C1XA 1PVC3 3A4UA 3IPVA 2X5IB 1PK6B 2GALA 3MICA 5AVAA 1RUJ2 2O1QA 4QU2A 5LEKA 1PGL2 4P5HA 3VBOA 4COUA 2RJKA 1U12A 2F4PA 4LBOA 4FPOB 3E97A 3QACA 1VBD1 1LHWA 1AX1A 1G7YA 2ZGPA 1CIWA 4IV3A 4OHXA 5LEJA 4R9AA 1EY2A 4IETA 4YW4A 1MZ5A 4WM7B 3QCWA 1VBE1 4G4FA 1ZVFA 2Z2SB 4MH0E 3WDVA 2R30A 5E88A 1F8VA 4N7IA 5FLIA 3HBZA 3MPPG 3NWKA 4Y26A 1H8TB 1QWRA 3AX4A 3IDBB 4NO4A 1HXS3 1YJLA 2WZR3 5A32B 2JX9A 4AHZA 4D7YA 1RUI3 2HWF3 1FNYA 4QT6A 2G9FA 4IEZA 3E5UA 4RQPB 1AX0A 2VOVA 4RS5B 1Q8SA 5T55A 1S2BA 2P17A 1YLLA 4LR4A 1FPN1 1LHNA 5GM0A 3WW2A 1IQAA 1SBFA 1VRH3 2MEV3 1Q43A 1C8M1 3AYDA 4BLIA 4OUMA 4FSJA 4JQRA 1RMU2 3B93A 2JEMA 2JXAA 2RS13 2VUJA 4OULA 2DVGA 2GMMA 1ULDA 1GYKA 3EO6A 3BALA 1AYN3 2YROA 3FC0A 3U10A 3EQEA 3KQRA 4QGNA 3ZXAC 1NA1B 1C5HA 3BPZA 1RHI2 3AKQA 3ZIXA 1OOPB 3BIWE 4YVWB 1H2NA 4P14A 3AJZA 4HKOA 4X6QB 2QDRA 4AEDB 3PVOA 2NZ9A 3JUUA 4XTMA 1QXJA 4AFMA 1JTZX 2MHFA 3W59A 5FRAA 3WUDA 4HSLA 3APBA 2EVXA 5I8YA 1I5ZA 4AGGA 4KH9A 2D5FA 1VBD3 5JOXA 3KM5A 2ZGNA 4HN0A 4X8PA 2GAUA 4GMP0 1UU5A 1YXWA 3LAGA 1RVF2 4J6GA 3VKMA 3LCPA 4Q0QA 3VBFC 1VBE3 1LJ7A 4ZKTB 4FP2A 3SMHA 2VMGA 5GKAC 3NKTA 2IXKA 1XU1A 3TYJA 4HPKA 1YFWA 3ZYJB 1ENXA 1LB2A 1SLLA 3HQXA 3HD8B 3FJSA 3VBFA 1R1A2 3I2DA 1FV2A 2RM22 1HQLA 3WDTA 3KT4A 4FP3A 4LEJA 3D82A 5I0UA 4E2GA 2MNGA 3OCPA 3SCHA 1X7NA 4PLNA 3U11A 1I3HA 3ZN5A 2AZ5A 3VHRA 3VKNA 1PO12 3ZFEC 1AR62 4QM8A 1S0BA 3MLJA 4PCRA 4S2FA 2QZ3A 4FPYA 3I4IA 4LHKA 3IMNA 3B9CA 3AZYA 2C1FA 5C9AB 5ABJC 3H1MA 4EN7B 4FVVA 1O7FA 2GDFA 4AVBA 4AFDA 4YZ3A 5JIUA 1MVEA 4COYA 4FAGA 1DG6A 4Q29A 4XZPA 1FYUA 2LALA 4BZ4A 2VY0A 3ZN6A 4KL1A 4OLLA 2KXLA 2O8QA 4AVVA 4ZXKA 4Z1VA 2BTVC 3WCSA 4FPCA 4QMAA 5C8CA 3B9IA 2WIIB 1UMZA 1CD3G 4S2DA 2BVVA 2HWD2 1IGOA 4J1WA 2EF6A 3P3NA 4PIZA 2Q30A 2GN3A 3L2YA 4IEOA 4GKYA 2ZGQA 2ZX1A 4GB32 2EALA 4YVSC 1NLSA 1TME3 4LTAA 2Q1MA 3V0BB 1ASJ1 4BPZA 4XFFA 4B4QA 2PLV3 2HEVF 4FOWA 3VZNA 1RITA 1S0EA 3ETQA 4MGKE 4YVSA 3CL1A 4R4ZA 4LHLA 2V09A 2XGXA 4IV1A 4BLJA 3E6CC 1LOBA 1CAVA 2X53S 3GBWA 3AM2A 4GWMA 4TYSA 4L2NA 4QPGC 4UW5A 5BNOA 1CVNA 2ZAHA 3V0AA 3HT1A 5FLHA 3WDUA 3HMYA 1NCQB 4C90A 5CFDB 1ENQA 5EV7A 2X8KA 1AR82 4RGGA 1RUJ1 5T5PA 4BMEA 4B29A 2D44A 4KG0A 3WX5A 4XQDA 3QLQA 2Y26A 2R16A 4BE3A 2WQ4A 4CTEA 3R6SA 5FO9B 4XMIA 3VZLA 2UY9A 1UU4A 3BB6A 3ZVXA 1ZRFA 3PNAA 5C4WA 3FLRA 4LO7A 5KXDA 2ZPXA 3RS6A 1QJY2 1AX2A 4JTOA 2EXHA 1GFF2 2AGSA 3LWCA 2HJIA 3AZZA 3DPRA 4YM1A 4YGEA 1KDKA 4FOQA 1PK6C 2VPVA 4Q4X2 1LHVA 1EAH1 3RYRA 1ZA4A 4HKWA 3INAA 2ZX0A 4Q2FA 1ASJ3 5FMOS 5K7PA 2ZGKA 2X5IA 2BWCA 1PK6A 4QPIC 1CN1A 4KWKA 4XJUA 4BH9A 1R1ZA 1GNZA 4ONUA 4H3WA 3WD5A 4WM7C 3MIFA 4CP0A 1RMU1 1O4TA 2ZAAA 5AVPA 4CP1A 4B3NA 2HWC2 2WNUB 2XUMA 2ZZQA 4NHMA 1NLRA 2WS92 3ALQA 2ZHLA 4GA9A 1KQRA 3NV2A 1AJKA 3JD72 1RHI1 1SLIA 4WM7A 2E63A 4Q4V2 1FATA 1RB8G 2ZTNA 1KJRA 1RUJ3 2WFPA 4RQPC 1ZX5A 1H8TA 3K51A 1ZNPA 4BOWA 5BNNB 2PYTA 2C5DA 1LGNA 1C57A 2JECA 4K40A 2JENA 3GZTB 4GULA 2QJVA 5A32A 3UL2A 2WZPP 3M2MA 3RRDA 1NCRB 2LM3A 4RQPA 3B69A 1GKBA 4RS5A 1OA3A 4CDXC 1HLCA 3LGRA 4JTNA 1Y3TA 1WW5A 1G9BA 2ET1A 3THTA 1QNWA 1PMIA 4F3JA 3K48A 1POV0 3M3IA 1S0GA 3E5XA 4YVWC 3LSEA 1PGSA 4Y1YA 1EAH3 1R1A1 2OUHA 4YG6A 3WQ0A 2BYVE 3A0KA 2RM21 4Q27A 2VNOA 4AFCA 2E53A 2UURA 2WLPA 4OZXA 1NA1A 4XPVA 2JE7A 2VNGA 1OOPA 2ZX2A 4YVWA 5JCTA 4AEDA 5JPMB 4UBGA 1XE8A 2VG9A 5JMCA 2BWAA 2DCJA 1NOVA 1PO11 4LE4A 2PAMA 4CEWB 2ZHNA 1LOFC 2JICA 5DUWA 4COWA 4INDA 1XNKA 5A33B 2G4IA 1WW4A 1QJX3 3AYAA 2ILMA 3IIAA 4GKXA 5E1RA 1M4WA 2WINB 4Y1VA 4JDNA 2IZWA 1YRZA 5I8TA 1LOFA 3AYCA 3LA7A 4Y20B 1COV2 3E6BA 1NE6A 3POSA 2ZGUA 3RJ2X 2HEWF 2D3RA 5BNPB 4ATFA 1IPJA 3B7MA 4Y1ZA 5JI7A 1HV0A 2YV8A 5CVRA 1W6PB 4AG4A 1VP6A 2HWD1 5F9TA 2RR11 3UKVA 3ZIWA 4YZ2A 2V5YA 5FAXA 3WINE 1MS3A 5JSRA 2GZWA 1VBC3 3HWJA 4Y4YA 1AZDA 2R061 2EAAA 1N1YA 3GHNA 1R1A3 3WG4A 2YYOA 4XF1A 4TZDA 2AUYA 1WBFA 1AVBA 1PNFA 5C9AA 4META 4MUVA 1S55A 1ULCA 3I59B 2XLGA 2ARBA 5T50A 4KNCA 2CGPA 5EZWA 2ZMNA 4QM9A 5HCFA 2PFWA 5JIAA 1AJOA 1AL0G 4MXVA 2CV6A 1VLNA 5JVVA 2B46X 5LRSA 2VECA 2EXIA 1GQGA 3N7LA 5B2GB 4FO9A 4PF5A 4A2UA 1XE7A 1FAYA 4XF3A 1BBT2 4JAAA 1AR81 4K8FA 1MS9A 3AZVA 2WJSA 4RHV1 1TE1B 4PLMA 2RMU2 4XFBA 4IESA 4DPNA 2DVAA 3ENRA 4HL0A 2WFF2 1EPWA 2PN5A 1H1AA 1KS4A 4L8QA 2TUNA 3O7OA 3V0BA 4BMBA 3IM0A 4PBOA 5EFUA 2DFBA 2BNNA 3O14A 2R49A 3SHRA 4NN0A 1AUYA 1ZBE1 1ENSA 2Z42A 1QJY1 3VZJA 1Z7S3 1WMEA 2XVLA 3ZSJA 5AC92 3ZFFA 1W6QB 2RR13 4X6RB 1XRUA 1NCQC 1GR3A 2HWE1 4HN1A 4YW5A 3TBDA 5CFDC 1ZYBA 3MEPA 2VGDA 5F6LB 3IBMA 2B9UA 1V00A 2VXRA 5EYXA 4YFZA 4XFAA 1QDCA 4FQ4A 2BUKA 4Y1XA 2UY8A 1C8NA 1DZRA 2R063 1DGWA 4PBPA 4L92A 2JJ6A 5CFDA 4GH4B 3JQXA 1WD3A 2Z5WA 3E5QA 4AQSA 1AL22 4H7MA 4CYDA 1LR5A 5CG8A 3KGLA 4P9WA 4AQTA 3AXEA 4QD2A 5JOYA 1PGW1 5LK7B 2WL1A 1IHMA 3NKGA 3SITA 3DV8A 4XILA 5ABJB 4GWNA 1NY71 1C28A 3JD71 4FTBA 3SNMA 2R0HA 4AI8A 3USUB 5J7MA 3NV3A 3VV1A 4E2SA 4RHV3 1JUIA 1NG0A 4XETA 1MEC1 2IXJA 3WG1A 4P9IA 4DS0A 4BQ1A 4DRRA 1W6MB 3V65A 2IXCA 4PDWB 2IXHA 1XXNA 1HQWA 1PIV2 4N9HA 1ZBA1 3FZ3A 4R9CA 3ZDSA 3LOBA 1RUE1 1O4ZA 1ZBE3 3VL8A 1TMF1 1R082 3G6JB 5FOBB 1QJY3 4Q0PA 1AR93 3WW1A 4FTEA 3RYPA 2GC0A 4Y1UA 5FLJA 2P2KA 3WP5A 1VBA1 4HMZA 2W68A 2GSYA 2HWE3 5KXEA 3SXWA 3MDPA 5BY5A 1UAIA 2BBVA 2AENA 2WNUA 5K0UB 1EV12 1W6OB 2DVBA 4XXPA 4CP2A 4IEYA 4U36A 1NCRC 3QH6A 4EN0A 1W6NB 4A3XA 4AE2A 3D5OA 1R092 1VAMA 3CJXA 5BNNA 4QPGB 5I0TA 4AYUA 3UKTA 3OGJA 3N7KA 4OI4A 3UV9A 1CAXB 4WVZA 5DG1A 1MS0A 3QD6A 3NL1A 1NCRA 3RMXA 5BV6A 1LU2A 3JD73 3H7JA 3ES4A 4K9SA 3GYDA 1QJU2 1D2QA 5FREA 2D6PA 3MFAA 4XIOA 4ORFA 4DY3A 5FPXA 4M0HA 3DN7A 3AFKA 4GIQA 2VU9A 4XF4A 1QQP2 3PTYA 1MEC3 3EXUA 5KXBA 3WHTA 4EWEA 2CAVA 1MZFA 2I74A 4AFBA 5CFCA 4GMP1 1LU1A 4CEWC 1EYBA 2DWRA 1ZBA3 1SLCA 1RUE3 2Y0OA 1YIPA 1OQDA 2VULA 2YXSA 1TMF3 2ZX3A 3MW2A 4YFWA 4H7LA 1U5YA 3POWA 3TB0A 4XF9A 1DQ5A 2A75A 1VBA3 4Q4W1 4E4SA 4CEWA 5CNAA 4C91A 2WT2A 3DKWA 5DZGA 2R042 1ZZBA 5IK8A 1MVQA 3FWEA 4QPIB 4JRAA 1RUD2 1JYIA 4Q8LA 1VBB2 3J9SA 4LHNA 2IC1A 5BNPC 4EWAA 1SLBA 4Y20A 5BYNA 4L11A 1V9U2 3VGIA 3VN4A 4BA6A 5FMOL 5HI0A 4AFAA 3U0ZA 1QOTA 4K7JA 2BQPA 3KT7A 1Q8PA 1YYNA 4LUKA 3AFGA 3LSDA 4KBBA 1H2KA 4NR1A 2ZGMA 2HYKA 3KCCA 4YGBA 3WQ1A 5BNPA 4LA3A 3H8UA 1CESA 2PHTA 2ZKLA 4Q4Y1 1PVXA 1WLWA 5FOJB 1REEA 1UIKA 4K1YA 1DGWX 2PAEA 4ASLA 3RPQA 3T2TA 3JZVA 3CJIC 4IEXA 4KWLA 4PLOA 2D93A 5T5OA 1H2MA 4Q0UA 1MACA 1UX6A 1Y9QA 3JBG2 2XB6C 4YG0A