2R071

Structural analysis of antiviral agents that interact with the capsid of human rhinoviruses
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
273
structure length
273
Chain Sequence
TVASISSGPKHTQKVPILTANETGATMPVLPSDSIETRTTYMHFNGSETDVECFLGRAACVHVTEIQNKDATGIDNHREAKLFNDWKINLSSLVQLRKKLELFTYVRFDSEYTILATASQPDSANYSSNLVVQAMYVPPGAPNPKEWDDYTWQSASNPSVFFKVGDTSRFSVPYVGLASAYNCFYDGYSHDDAETQYGITVLNHMGSMAFRIVNEHDEHKTLVKIRVYHRAKHVEAWIPRAPRALPYTSIGRTNYPKNTEPVIKKRKGDIKSY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords HUMAN RHINOVIRUS 14 COAT PROTEIN (SUBUNIT VP1)
publication title Structural analysis of antiviral agents that interact with the capsid of human rhinoviruses.
pubmed doi rcsb
source organism Human rhinovirus 14
total genus 41
structure length 273
sequence length 273
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1988-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2r07100
4Q4V2 1FMD1 3VBSA 1C8M1 2HWD3 1ND2B 1R1A1 2R042 2WZR2 4Q4W3 1VBC3 1AL21 3LOBA 2HWE2 2PLV2 1QJY2 1MQTB 2BBVA 4CDQB 4GH4A 4RHV2 4RQPA 1QJZA 2HWF1 3ZXAC 1HXS1 1PVC1 3JD72 4FTSA 1PIV2 2FZ2A 1AL0G 5K0UA 2RMU3 3ZFEC 1RHI2 5A32A 1BEV2 4GH4C 1HRI1 1PGW1 1ZBE2 4EJRA 4QPIB 5L7OB 5K0UC 2XBO2 1K5MC 4RR3A 5DDJ2 4YVWC 3VBRA 1VBA2 1AR81 4CDWA 1RUE2 1HRV2 4RR3C 1AR91 1PO13 2Y26A 3VBRC 4CDXA 1RUI2 5CFCC 5JZGA 1NG0A 3VBHB 1TMF2 1BMV1 1ASJ2 5D8AB 1AR63 1RUG3 1NY71 1MEC3 1AYN2 4FTEA 1AR72 1BBT2 5C8CB 5JZGC 4QPGB 4PDWB 5BNOA 2BPA2 1D4M3 2HWD2 3DPRB 4Q4X3 5CFDB 1GFF2 1QQP1 4Q4W2 1R082 1FOD2 1VBD1 1ZBA1 1V9U3 5C9AA 3JBG3 1COV1 1RUF1 5ACA3 2WS91 4CEYA 1EAH1 1RMU1 2RMU2 4RS5C 2HWC1 1RUJ1 1PO23 5C9AC 1TME1 1RUC3 2MEV1 3VBUA 2R062 2RR12 4CEYC 1PGL2 1ND3A 4JGZA 4N43B 1RUD3 1OPOA 2RS11 4WM8C 5AC91 3J8F1 1AUYA 3VBUC 5C4WB 1POV3 3VDDC 1H8TA 2R073 1B35C 1WCDJ 2WLPA 3TN93 3VBOA 4Q4Y1 5ABJA 1VBB3 4Q4V1 4GMP1 1R092 2R041 2WZR1 5BNPB 4WM7B 4AEDC 3VBOC 2HWE1 2PLV1 4YVSC 5BNNB 1QJY1 4CDUA 5ABJC 1RUH2 2BUKA 1R1A3 1D4M2 4RHV1 2RS52 4N53A 3JD71 3VBFB 4Y4YA 1PIV1 1Z7S3 4CDQA 2FZ1A 1QJX1 1VB2A 5GKAC 1RHI1 1BEV1 3ZFFB 1HXS3 1PVC3 1ZBE1 4N53C 1F2NA 5FOJB 4CDQC 2XBO1 1HRI3 1PO22 5DDJ1 3ZFEA 1POV0 1FPN2 1RUC2 1VBA1 2X5IB 1RUE1 5J98B 1QJU2 1RUD2 1HRV1 1A6CA 4GB33 1K5MA 4QPIC 1M06G 5L7OC 2RS32 1RUI1 4YVWA 1TMF1 1ASJ1 1VRH2 4IV1B 3TN92 1AYN1 1AR71 2RM22 1BBT1 5FMOS 2QQPA 1EV13 5CFCA 2HWD1 3VBSB 1CJDA 4Q4W1 1R081 4QPGA 3VBHC 1FOD1 5D8AC 1C8NA 1VBE3 5A33A 1QQP3 4GH4B 4RQPB 1RVF2 2HWB3 5LK7B 1Z7S2 1VBD3 4QPGC 4PDWC 1X33A 2RMU1 3DPRC 4NWWA 5K0UB 5CFDC 4JGYB 1COV3 4BCUA 2WFF3 5A32B 1RUF3 1EAH3 2R061 2RR11 1PGL1 1VBC2 2HWC3 4RS5A 4RR3B 1TME3 3S6PA 1AYM3 1F8VA 4CDWB 1NA1A 3NAPB 1NCRB 4GB32 2GH8A 3ZFGB 4WM8A 4CDXB 1NA1C 1R091 3VDDA 2GSYA 4Q4Y3 5C4WC 1B35A 1OOPA 1HX6A 4Q4V3 5FMOL 1DDLA 4FTBA 1EV12 1RUH1 1D4M1 5BNOB 2RS51 2WZR3 5BNNA 2ZTNA 1QJY3 4AEDA 1OOPC 1PO12 4IV3B 4YVSA 4RHV3 1VBE2 5BNPC 2WWSA 1OHFA 4WM7C 3JD73 1PIV3 5BNNC 2HWB2 1RUG2 1AR62 1MEC2 1QJX3 4CEYB 1FMD3 1ZBE3 1ND2A 1PO21 3VBFC 1C8M3 2WFF2 1CD3G 1FPN1 1RB8G 1RUC1 1NCQB 4Q4X2 1AL23 3VBUB 5J96B 1MQTA 1QJU1 1ND3B 1RUD1 4JGZB 2DF7A 1ND2C 1V9U2 1VBA3 2HWF3 3JBG2 2RS31 1AYM2 1RUE3 3JB8A 3CJIB 4Y5Z0 1VB4A 1MQTC 5ACA2 1HRV3 1H8TB 1VRH1 3IDEA 3TN91 2RM21 4QPIA 5L7OA 1ASJ3 4IV1A 1AYN3 4CEWB 1BBT3 2TBVA 1AR83 4CDUB 1SMVA 4IV1C 4FSJA 4N53B 1AR93 1RVF1 1R083 2R072 1Z7S1 1FOD3 3VBSC 3VBHA 1NOVA 1VBB2 5D8AA 1QJX2 1VBC1 4JGYA 5C8CA 4PDWA 1FMD2 3DPRA 2IZWA 4RQPC 1C8M2 5CFDA 1R1A2 2R063 1VAKA 3ZFEB 4Z92B 2RR13 1AL22 4JGYC 5C8CC 1ZBA3 2BFUS 4GB31 2ZAHA 1K5MB 2HWF2 4SBVA 1HXS2 1PVC2 3NAPA 2WS93 3HAGA 1NCRA 4YVWB 1RMU3 3ZFGA 1RUJ3 1HRI2 1PGW2 3FBMA 4CDWC 2MEV3 3M8LA 3NAPC 1R093 1EV11 1NCRC 4N43A 3VBRB 5CFCB 3ZFGC 1E57A 4CDXC 1PO11 2RS13 5C4WA 5AC93 3J8F3 1AR82 4LLFA 1RUH3 1VBE1 2RS53 4N43C 5JZGB 5A33B 1AR92 2HWB1 1IHMA 1AR61 1RUG1 4IV3A 1MEC1 2VQ0A 5BNOC 4GMP3 1BMV2 2WFF1 5BNPA 4WM7A 2R043 4Q4X1 1NY72 4IV3C 2HWE3 2PLV3 1NCQA 1FPN3 1V9U1 4RS5B 3VBFA 3JBG1 1X36A 1QQP2 1AYM1 5C9AB 1QJU3 2BFUL 5ACA1 1VBD2 1NA1B 1ZBA2 4RFT0 3ZFFA 2XPJA 2ZZQA 1NCQC 1RHI3 1BEV3 3CJIA 1COV2 2RS33 1RUF2 1ND3C 2WS92 4WM8B 4JGZC 1EAH2 1VRH3 1RMU2 1HQNA 2XBO3 2HWC2 3VDDB 3ZFFC 1RUJ2 5DDJ3 2RM23 3CJIC 1TME2 1B35B 1OOPB 2MEV2 2X5IA 4NWVA 1H8TC 4CEWA 1POV1 2R071 3JB4C 2RS12 4GMP0 5AC92 3J8F2 4AEDB 2X5IC 1RUI3 3VBOB 4YVSB 1VBB1 1TMF3 5ABJB 4CEWC 1RVF3 4CDUC 4Q4Y2 1AR73 1W39A
chains in the Genus database with same CATH superfamily
3ORJA 4V2WA 4E4ZA 2XH6A 3FUQA 3VHOA 1O7FA 4DO0A 2FCUA 4N90A 2QQWA 2BERA 3I8TA 1R1A1 2CV6A 1SFPA 4XMAA 1IS5A 1K3IA 5LRSA 1AL21 1LGNA 4LBLA 2RHPA 1MQTB 1X8MA 3CHXA 4YRDA 3E5QA 1SBEA 4PIZA 1UPIA 4OI1A 3ILFA 4RHV2 2Q8CA 2AC1A 4RQPA 1QJZA 3WNKA 3JD72 3OUIA 1BVP1 1WCSA 1YLLA 1DZRA 2FZ2A 5FY8A 4RL7A 4K40A 5K0UA 5JMCA 1QKQA 5FZHA 1W6OA 1AZDA 1RHI2 3BTZA 1AXZA 1US3A 2DTWA 2G19A 5FYUA 4YW5A 3QLQA 1BYHA 4XCAA 5KHKA 5JXIA 1Y4WA 3E6BA 2LROA 2FDKA 2OX0A 3MHZA 2ERFA 3POJA 5K9YA 3CF6E 2JXAA 4AYUA 4NRQA 3WG2A 4XFGA 4LQRA 2B9UA 4I3GA 2DURA 4MH0E 4E2GA 2YC4A 3VBRA 1AR81 2SLIA 3ZLIA 1RUE2 1UZ0A 3VZNA 3OY8A 4PF1A 1S2KA 2YY1A 1VAVA 1HRV2 1W3VA 4RR3C 4XDOA 5F32A 5FZOB 1PO13 5JXGA 2ARXA 5FY7A 3HEIA 2NM1A 3D3AA 4NHXA 2P5BA 2QDNA 1RUI2 3OGRA 2YB7A 2UY9A 5CFCC 3KGZA 3ZXEA 2VOTA 1AR63 3O0VA 4WVMB 4BM8A 1W9WA 2W68A 1MEC3 3AKTA 3OD4A 2WN2A 3PUIA 2I45A 2W3JA 3HMYA 4XIKA 1PVXA 1OT5A 5A6YA 4NHMA 3CQOA 5BNOA 4PDWB 2BGCA 3NV1A 3AMNA 3PLQA 3EYPA 1QOOA 5CFDB 3SKVA 3O12A 4XUOA 4A41A 4Q4W2 1W05A 1HJGA 3MIFA 1OC1A 1OF4A 2A6ZA 3HPNA 3SHRA 4D69A 1GSLA 1VBD1 2GNTA 2J1EA 3DGTA 4OUMA 1V9U3 1LOBA 4A7YA 5CA6A 2WN3A 3PUSA 2ID4A 2ARBA 1FXZA 1COV1 5FZ7A 3T1LA 1X9PA 3B7MA 4CUGA 3V0AB 5LBEA 2J22A 3O0WA 4E4DX 3MLKA 5EJ1B 3LWCA 4P9LA 2HWC1 4UFKA 3E6CC 2JJ6A 4QDSA 1RUJ1 2P3JA 4S2HA 1TME1 1W0NA 4A2UA 2VCMA 2VTFA 3RYPA 2NLRA 3ZIXA 5A7OA 1LOEA 1QY4A 2D5HA 2RR12 2PQQA 3ACGA 4CEYC 1LTEA 2EXHA 2I74A 2PHTA 3BI3A 3AP6A 4EZHA 1TEIA 1OPOA 3GDBA 4Y5SA 3C3VA 4LO4B 2FDFA 2RS11 2R30A 4WM8C 4XF9A 1E5RA 4EN7B 5I0RA 4AI2A 2XWJB 3U78A 1POV3 5DUXA 2GP5A 3H3LA 3M3CA 1W2TA 3GF6A 4XXPA 1LHWA 4QDQA 3VD7A 3WDYA 4JZRA 5I0DA 3BTXA 3VL8A 1I6XA 1XYPA 1RYYA 3SLIA 1KEXA 3B5LB 4FPFA 3IM0A 2OZJA 5ABJA 1ULGA 3T4VA 3KS7A 3CKHA 4GMP1 4CZSA 1ZZ8A 3GBWA 5IVBA 1OLRA 3EBRA 3KCXA 2FD8A 1FYUA 5BNPB 4BHPA 3A4UA 4WM7B 3V0BB 1JS9A 1J1LA 4XJ8A 3ZIWA 4H7LA 1YQ8A 2UY8A 2WQ4A 1UX6A 1FV3A 2YYOA 2WNUB 4IW3A 3THDA 2JEMA 1D4M2 1AJOA 1GZWB 2RS52 4RHV1 2Q8OA 1QDOA 2E53A 5T52A 1DYPA 3JD71 4NRPA 1Z7S3 4Q0UA 2VTXA 4CDQA 1UX7A 3ILNA 1V6IA 4W4ZA 1RHI1 4E8CA 1HXS3 1PVC3 4N53C 4XHBA 1V6LA 5GLUA 4B4QA 5ANNA 3NKTA 1APNA 2W1SA 1HLCA 1DGWA 1H1IA 3ZDSA 3LDKA 2R6QA 1D0GA 1HRI3 2JDNA 5KXCA 3QH6A 2BP6A 3ZXKA 3WF4A 1ZZCA 1C4RA 1LOFC 2EICA 3H1YA 2XL7A 3GALA 3SH5A 4DEQA 1UYXA 1X50A 3RYRA 2J1RA 4JC1A 2IXIA 1RUE1 1RTVA 1S0IA 5FZ1A 4AI3A 3TEYA 2E63A 4YFWA 3U4XA 1K12A 3O1VA 3NQHA 1HRV1 2WSUA 5FP4A 2JDYA 2ENRA 4GB33 1W9TA 4CUBA 4AQTA 1W6PA 2Y60A 4QPIC 1GOHA 1JOPA 2BQPA 2P3IA 4AHYA 5L7OC 3I3MA 4HPKB 1M06G 2BVBA 1RUI1 4FPJA 1AX1A 3VDBA 3KHCA 4HL0A 3RWNA 2VY0A 1AXYA 1WLTA 4R8HA 5C3OA 5KXDA 3U14A 3KB5A 1FV2A 2D3RA 3TN92 1N3PA 4YZ3A 4YGDA 1HW5A 5I93A 4FOWA 5B4NA 5FY0A 1EV13 3LFMA 5CFCA 4OHYA 4XJZA 3IMMA 4ZPIA 4Q4W1 3V56A 2W2IA 4WVVA 3S57A 1XSQA 2R0FA 3EMRA 4QX5A 3RS6A 4LBQD 1N1YA 3LCPA 1PMJX 5FXVA 3WW1A 1VBE3 1CZTA 2A3YA 3RNSA 1QQP3 3VZKA 1L7RA 3U4SA 4QXHA 2HWB3 1HV0A 3AKQA 4BQ2A 4QPGC 3PURA 2DV9A 5JLVA 4P9YA 3BGAA 3SEPA 4FT8A 4URTA 2ZBJA 4JGYB 5A32B 2PHXA 4LBQA 3WF3A 5FUIA 1QXRA 1W8ZA 4V1PA 3AVSA 2D97A 1I1EA 3AZXA 1J3QA 1UCXA 2RR11 2CGPA 3EB7A 4MGKE 4BH9A 1DQ6A 4QQPA 2A6VA 4L92A 2JB8A 3MPBA 2CAVA 4RR3B 1ZRIA 2DFBA 2XVLA 3N9OA 3S6PA 4LLOA 1W8HA 3CEWA 4YW3A 1AX0A 4F83A 5JVVA 5FXXA 3FUOA 2TUNA 3ETQA 4YGCA 1BLZA 5FYHA 3J7LA 3I4IA 3KQRA 3NMBA 4DUVA 1NCRB 1NXD1 1Y43B 5ANQA 3WSOA 4AHXA 5FAXA 4FPLA 4BQ4A 5EXOA 3AJZA 1IG0A 1XNCA 3T0BA 4WM8A 4AZZA 2RDSA 4Q8KA 4CDXB 1OBNA 1UN1A 1WWYA 2UURA 5J48A 5T5JA 1U5IA 3QCWA 4W65A 5E89A 1UOBA 3PUHA 1OSGA 1V6JA 5F5QA 1OOPA 5FMOL 4QHOA 2WQZC 4OI0A 4BIFA 3VD5A 1CPMA 3I3QA 3FMGA 1FATA 1D4M1 4XHXA 5DN2A 1LECA 2RS51 1UIKA 3H3ZA 3MI8A 5FP7A 2A5ZA 1VR3A 2ZTNA 5FK8A 4JCKA 1V6OA 4JKMA 1PO12 1D4VB 1UY2A 4OLLA 4QX1A 2VCAA 4LORA 3I59B 1JUHA 3OUJA 4X8PA 4ARXA 4AGRA 1H2KA 3WDWA 5DXDA 4Q0QA 3WY6A 2FQPA 1YHFA 3UL2A 1IQDC 3C7GA 4B8EA 1AR62 2A3WA 4LHNA 1MEC2 1QJX3 1CJPA 2ZA9A 1XE7A 3A0KA 3RSJA 3UKVA 4CEYB 1VE0A 1S0DA 3T2PA 2PMWB 3OGJA 4E2SA 1ZBE3 1ND2A 1CAUA 3M3OA 4YGEA 1OMIA 3BU7A 2TEPA 3UGGA 4AG4A 3ZMNA 1O5UA 1S4CA 2ZGKA 3FX3A 5GZCA 3N35A 2W1UA 1AL23 5FY4A 5J96B 2P6CA 3ZR6A 1XNAA 2VR4A 3O14A 4JGZB 2PHRA 5H9SA 1LJ7A 3NRUA 1V9U2 1S0JA 1VBA3 3NNJA 1CVNA 3K4AA 4JAAA 1GV9A 2PAKA 4IEQA 3THTA 4OHVA 2V09A 1EPWA 2VZ3A 2WR9A 4D7TA 4BJ0A 2BEOA 1SDDB 1J83A 3NV3A 4D6RA 2ZXQA 3AXDA 2WUHA 4WVWA 2DUPA 3IDEA 3JU9A 3TN91 1JZ4A 4IXLA 2DCJA 4F7ZA 2E26A 2YMZA 4OI4A 1FAYA 4P9GA 3B9CA 1Q8PA 4QPIA 2JB4A 4PQQA 3WNNA 5L7OA 3MIEA 2VULA 3NNMA 3KV4A 4IV1A 4Y26A 3U0ZA 2PN5A 1AYN3 1F4AA 5FY5A 3SITA 2R0HA 2YUEA 2VMHA 3LA2A 3PMSA 1BBT3 1AR83 4AHZA 3VD3A 4AEMA 5CYYA 1LU1A 1KS4A 4FSJA 1OVPA 2YBPA 3ZPOA 4N53B 2B42B 1R083 3PJYA 2G9GA 2BW8A 1S0GA 1AXKA 1DZQA 4LKEA 5IFPA 1NOVA 2Q1MA 4LULA 3TAYA 3MZHA 4IEVA 3QH7A 5C3PA 5IVFA 4JVAA 3VDCA 4XVHA 2ZMNA 3E1F1 1AF9A 5HCHA 3ACIA 3F95A 1XOYA 4PIXA 3WP4A 1NE6A 3HR9A 1QH6A 3BOWA 4KG0A 5JOZA 2XL9A 1IPJA 1S2EA 2IZWA 2RJKA 2VUJA 4XFBA 2ARCA 3OPZA 2R063 3ZFEB 4Z92B 4FOVA 3LEMA 5FXWA 3WP3A 3POSA 4X8NA 4E9KA 5HCAA 1DGRA 4K1ZA 4C0BA 4OUSA 1RJ7A 5F3EA 2KD7A 3H7JA 5HBAA 3RZJA 5D21A 4ZXEA 2HWF2 3IIIA 4SBVA 1HXS2 1PVC2 3SQOA 1CAXB 2DVDA 2RE9A 4YVWB 4I3PA 3TBDA 2ZHLA 2BNOA 3BOPA 3WG4A 1WMFA 1LB2A 4R9DA 1RUJ3 2AR6A 1O3QA 1HRI2 1DQ2A 2YGMA 1YYNA 5LCWL 4OZXA 4IGQA 4NE9A 5JSRA 1HV1A 5FK7A 5JOXA 3IAPA 3NAPC 4AL9A 1GZTA 1G9AA 5FWEA 1C28A 3B94A 3ZFGC 1AJKA 1E57A 2J42A 3PVNA 1DHKB 1PO11 2RS13 1SG3A 2ES3A 4K20A 1GICA 4Y20B 4AK3A 2H0VA 3BUCA 5A33B 4WBBA 1AR92 2DU0A 4AF9A 1JYNA 1AR61 4IV3A 5FYBA 1K5JA 3WLUA 1MEC1 1GWLA 2XJQA 2JWPA 2E51A 3NJYA 4ZXKA 1FNYA 4GMP3 1BMV2 3T0AA 2NZ9A 2P4EA 3PU3A 3WF2A 1SLCA 4H3WA 4Y1ZA 3W58A 1NY72 2JIJA 2YGLA 4D3WA 1MZ5A 4LBMA 4DOUA 5DABA 1E5SA 3WQ1A 4AVSA 1WUVA 1PK6C 2PTMA 3NNLA 1V9U1 4RS5B 3I3BA 1MZFA 1SBDA 2ZGNA 2Q1ZB 2ET1A 3NW4A 1QU0A 1WMEA 3WEZA 4QHBA 1QQP2 1YO8A 3CZUA 3LA3A 4LE3A 4GWMA 4XMIA 5C9AB 2YU2A 4LOTA 4Y22B 2VE1A 4HKWA 1OLME 3QOPA 1ZBA2 2P3KA 2H0BA 3AM2A 1FNZA 1IPKA 1NCQC 1RHI3 3WF0A 4BIOA 1GNHA 3KV5A 4OUEA 2VU9A 2E7QA 4N7UA 4JRLA 5T5LA 1SACA 1ULDA 1W28A 1J84A 1ND3C 4MXWB 3TNPB 2ZAAA 2WS92 4B4PA 2VBPA 5DG1A 1RMU2 2VGDA 3ZYJB 1DGLA 2H6CA 3VDDB 1YJKA 4HKOA 4AW7A 3WDTA 2CY6A 4DPNA 4KWUA 2ZGPA 1W0OA 4DFSA 2RM23 2PHDA 2JG9B 4ONUA 1QNWA 1B35B 1SPPA 2X5IA 3VHPA 5GLVA 4YZ2A 1MS9A 1H8TC 1XE0A 3MUZ1 3PUQA 3ZMOA 1W06A 1XC6A 1POV1 3QBQA 5A70A 1BJQA 5K4LA 2VZPA 2QFEA 4ARYA 1OQ1A 1KFXL 4META 4XACA 2OPKA 1F9KA 5AC92 2EXJA 2XQRA 5B4XA 2VZTA 1RUI3 4YVSB 3V65A 3LGRA 2J1TA 5FZMA 1EUTA 3K75B 5CU1A 4CEWC 1RVF3 4BPZA 1UXZA 1ZVFA 4ES8A 1W2UA 4Q0SA 3KCYA 3U75A 2DUOA 3S0MA 4HFSA 5JDBA 4X6QB 4Z82A 2QCSB 4XBQA 1JZ2A 5B2GB 3NNFA 4BB3A 4EN9B 3OBAA 2CDOA 4O9GA 5EIYB 2W94A 2VZRA 1VBC3 4Q4W3 4JDNA 4Y33A 5GZEA 4MG2A 3LOBA 2HWE2 3NNGA 4Z1VA 1W8WA 2Y38A 4NJ4A 2ZX4A 3GJAA 3T0DA 5JAXA 2WC2A 2BBVA 3WT3A 3AYAA 2HWF1 2ZGUA 4JTNA 1HXS1 1PVC1 2HH9A 4QQ2A 1QNYA 5JI7A 3SNMA 2DBNA 4FTSA 2MPFA 4C91A 2ZKLA 5FUNA 5LASA 2NYYA 5F8PA 5FZLA 2XLGA 3AKPA 5EYXA 3TEWA 5FY9A 4AGVA 4UW5A 1BEV2 2XHNA 1HRI1 1OH3A 1JOBA 1VMJA 1ZBE2 1ENQA 3T2QA 4H7MA 3WNMA 5FQ0A 3ZOIA 4EJRA 3HNMA 4AVBA 1I3HA 4B1LA 5AC91 3M3IA 3I7DA 3BTYA 5K0UC 4FAGA 4AVTA 2VNVA 4IE7A 3TWIA 1KRIA 4QX2A 1H8VA 1GNYA 4HZFA 5T54A 4BISA 4QKNA 3BALA 3C7EA 2A3XA 1VBA2 5L9VA 5LEJA 3PVEA 4AFMA 3KF3A 3LPFA 4JKLA 3OGGA 3WG3A 1JZ8A 1AR91 1D7PM 1WBLA 4KG8A 1PMIA 3NKGA 4MHUA 3AL5A 1VPHA 4LA2A 1OA4A 3IIAA 3VBRC 3PIGA 2GMMA 4LHKA 1NG0A 5JZGA 4IEOA 3O1MA 1BMV1 2JD4A 1LGCA 3UKNA 1OA2A 2BRTA 1KFUL 3AP7A 3PHMA 1NY71 4FP2A 3E5UA 3HBKA 4FXKB 3VHRA 2CHHA 3KWVA 3G7DA 1AYN2 1UKRA 4EROA 4XC9A 2ARAA 4M3CB 1OLMA 1PHMA 4DUWA 4YWAA 1BBT2 1DLLA 2VNOA 2BPA2 1D4M3 2HWD2 1S0CA 3W9AA 5LEKA 1OVSA 5KHJA 1QQP1 4XQ4A 5EZWA 4D94A 2ZMKA 5KXBA 3LKJA 4ZONA 1R082 2IWGB 2HEWF 1MS4A 4HONA 5IVEA 1ZBA1 4UBGA 3HBZA 4ITCA 1E5IA 3AP5A 1L7QA 3TEZA 3SC7X 4OMDA 1PK6A 4J25A 4N9IA 1STMA 1JODA 3OBZA 5ACA3 2LUWA 1JOJA 2WS91 4EN8B 2ORXA 2AREA 3OUHA 4UWDA 1RMU1 2RMU2 3GHMA 3BTAA 3SXWA 1VMHA 5IATA 2P37A 5IK4A 4EWAA 2SBAA 1MVEA 5FV3A 2P3YA 1POQA 3IDAA 4IEPA 5IYYA 3AFGA 2K0GA 3VBUA 2R062 5C3RA 4A7KA 1ND3A 2YC0A 4BQWA 3OOXA 3FN9A 4TZDA 1CX1A 3ZN6A 3AKRA 4NR1A 3POYA 3TOJA 2E32A 2F4LA 3BVCA 2BVVA 1SFNA 4I09A 3H0OA 5LY2A 4YM3A 2YU1A 2D98A 3ST7A 4QQHA 4GA9A 1W8UA 1W6NA 4ES9A 1H8TA 1C1FA 4COZA 4OVEA 4PLNA 5FZCA 4XF4A 3RQ0A 3TN93 3C7OA 3VBOA 4RGKA 1SCRA 2JDKA 1YFUA 1V6KA 3DL3A 5F1RA 2EXIA 2DTYA 3LZZA 3P1IA 5LW9A 1WD3A 1UZYA 3F2ZA 1JUIA 4AEDC 2VW0A 3ECQA 3LSDA 4LNVA 2HWE1 3H42B 1MS3A 5F5IA 1JW6A 3VGIA 4W6WA 5BNNB 3VZLA 5ABJC 1SLAA 2Y8KA 4UF0B 5A7WA 3PIJA 2OUHA 4NROA 3VB9A 5FMBA 1O5LA 4Y4YA 1WA4A 4LK6A 2D3PA 2R16A 2FZ1A 1QJX1 2W52A 5FYTA 4FO9A 2XJVA 3I54A 1BEV1 3LIGA 1ZBE1 4EN0A 1F2NA 5LA0A 3N4MA 5FOJB 1LHVA 2XXZA 1W03A 4WZFA 2XOMA 4CDQC 1OURA 1F5FA 3J7MA 3LEKA 4HOOA 4NRMA 4CP2A 1CR7A 1JI6A 1PO22 3DKWA 4LXLA 4QM8A 5E8AA 4YW6A 1POV0 3POEA 4PLMA 3AZVA 2J1SA 1VBA1 1RXFA 3R4DB 2VBDA 3X29B 2AEYA 4BLIA 3D5OA 3Q8EA 1BQPA 1CAVA 3LDRA 4V2VA 3RG0A 1KDKA 1EP0A 2WFPA 2ZX2A 3SH3A 5BNQA 3KZ4C 4QKFA 2X53S 4CP9B 4DY5A 3WNLA 4R9CA 1S0FA 1UYZA 2VUCA 1UF2C 4U36A 5LATA 2O14A 2XMLA 4LO8A 3USSA 5EHDA 1WCQA 2R49A 2XWBB 3NL1A 1AYN1 4IE0A 3ZYGA 1PZ7A 2FCTA 2RM22 5E88A 3W20A 4CXYA 1BBT1 1HQLA 5FMOS 4WVMA 1EPZA 1KITA 2HWD1 4J1XA 4KBBA 5CG8A 4L2NA 4RN5A 2VUDA 2W08A 4CP1A 1ENSA 1R081 2DVGA 2VMEA 1HQWA 3OCPA 3VBHC 4CCLA 5D8AC 4NIHA 3NJVA 3PL0A 4CCKA 2Q8EA 4RQPB 3CIHA 1RVF2 1LULA 3Q8CA 4XF0A 4ET7A 3APBA 1S0BA 2NQYA 4ZU7A 4OZOA 1QIQA 1X33A 1JYTA 4B1MA 2RMU1 4DXRA 2EIGA 3DPRC 4NWWA 4E8DA 5K0UB 2VZQA 1VLNA 4BXFA 5JXJA 3ZPYA 1W6OB 4CUCA 1RUF3 2JKXA 3OYWA 4CPBD 4MUVA 5DAQA 2R061 3CBNA 1O3SA 1VBC2 3DN7A 4S2GA 1NAEA 4Q5OA 3AJYA 4FCAA 3WV6A 2GMEA 2PHFA 4OHWA 2MHFA 3WVJA 2WZEA 1WMDA 4AI0A 1HN0A 4CPBA 3OPTA 5IJRA 2K2SA 1FX5A 5GJ6A 3WR0A 2YXSA 5FZKA 2GH8A 3INAA 4O7XA 4MX3A 1JMUB 3DXUA 5C7GA 3HNYM 3N7LA 2W92A 3DCQA 2B8MA 5KXEA 1YFXA 3N36A 4LPLA 2WT2A 2GSYA 4UFIA 2BNNA 4GJZA 1WW7A 4Q4Y3 5C4WC 1QJEA 5EYYA 2TNFA 2Y64A 5HCBA 4JTOA 2DVFA 2WINB 2DCZA 3RVHA 4GXLA 4DINB 1DDLA 2XVGA 4I2OA 1Y9QA 5EJ3A 3H7YA 5BNOB 3WF1A 1ODMA 2WZR3 2Q4SA 4DQAA 4AEDA 1OOPC 2WNUA 4CU6A 1LEDA 2C24A 3RZMA 4RSUA 1MS1A 2O8OA 3ZXJA 1M4WA 2JDHA 2OZ6A 2W46A 2WYSA 4GWJA 3SCFA 2X09A 3W5NA 2WYFA 1ULOA 1PIV3 3CZJA 2VVEA 1R1ZA 1QOTA 1TQ5A 1UU5A 2WNVA 4YZ5A 1LENA 3AP4A 2JKBA 4YG3A 5E1RA 3HT1A 4XBNA 4ISQA 4C8DA 3P6BA 1PO21 1CX4A 1JHNA 2Y33A 4QB2A 3NO8A 3VBFC 1IKPA 3I3EA 3WUDA 4DXZA 4WV8A 2E6VA 1JBCA 4CVUA 1NE4A 3ES4A 2GNMA 1G9DA 3HOBA 3ZN5A 1N3OA 1QXPA 2WJSA 2X10A 3I2KA 5A6ZA 1ND2C 2QQLA 3NV4A 3LB9A 1DIWA 2BNMA 4GD4A 1QF3A 5CNAA 1OA3A 3O1SA 2HWF3 1QHDA 5I8YA 3H8OA 2GDFA 1AYM2 3JB8A 3CJIB 1XNBA 5DZEA 3N9NA 5ACA2 1U0AA 1XQNA 2R1DA 4YLZA 1ZRDA 3SMHA 3KT7A 3PTYA 4Z2WA 3WCSA 1HB2A 2RM21 3O1OA 1DCSA 3T4HB 4Q1PA 4AFCA 5KHGA 4RGGA 1ASJ3 1QWRA 2VW2A 4QX8A 4TTGA 1ULFA 2NP0A 2G1MA 1JZ7A 1W99A 1DYKA 5CAZA 4EN6B 2FMYA 3CO2A 1JZ6A 4NIIA 3VKFC 2QQNA 1SMVA 4IV1C 5FDBA 1W6QA 2O8QA 4GIQA 1AR93 1RVF1 1US2A 4PBPA 5A1LA 1A8MA 1FOD3 2GC3A 4OCTA 5BXXA 3RJRA 3VBSC 3VBHA 1W8FA 1ALYA 5F2SA 3DXTA 5DPNA 1WGPA 4IE6A 4XILA 4XJAA 5D8AA 3J4UH 2Q30A 2JDZA 2WO7A 2B5HA 1BKZA 2XVKA 4ZU4A 4K9SA 2R1BA 1MS0A 1VBC1 2CNAA 4JGYA 1REFA 5C8CA 1Q8VA 4CCMA 5F37A 1DG6A 3ZM8A 4BZ4A 3DPRA 1C8M2 5LB6A 1UZZA 2J1VA 3GZUC 1VAKA 4UYBA 3HN3A 1GUIA 4JQTA 4F3JA 4MGSA 3GBGA 3HN1A 5GZFA 4YW2A 1GZCA 1ZBA3 2N7GA 3Q8BA 2ATFA 3S30A 3TEXA 4LUKA 5HI0A 2JD9A 1GMMA 2QBXA 1REEA 2QQKA 4Q26A 5FZDA 1OUXA 5EWSA 2QKDA 4XAAA 3AMPA 2WS93 5HV4A 2LRPA 1NCRA 1PGSA 4FI9A 4HXCA 5F5AA 1RMU3 5KC6A 1OUSA 1AVBA 2IXHA 4LA3A 4ZS3A 4QD2A 2VUAA 3PJQA 1QDCA 1XYNA 2AEZA 4CDWC 2QQJA 5A3PA 2QDRA 2P17A 3ROUA 2FDGA 1R093 2JG8C 2QQIA 4N43A 1T2XA 3O0XA 1C1LA 5FYSA 5CIRA 3KGLA 4BMEA 3AYCA 4COYA 5CFCB 2NPIA 4W50A 2WLQA 2MNGA 4TSVA 3UNPA 5L9BA 3OEAA 3C8XA 5FPVA 5C4WA 5AC93 3SCHA 1SQ4A 1DQ0A 2WWJA 3KT4A 1OKQA 1RUH3 2CGOA 2GP3A 4IEWA 4JX0A 3BKZA 2BDRA 3MW3A 2R32A 1OFNA 3EQEA 5IFTA 1UPSA 3L2HA 1Q5OA 1G9CA 5FY1A 2XQXA 1CPNA 3I59A 2FDHA 3USUB 3GYDA 5A7PA 1JYIA 1Q8QA 3AYDA 2C6SA 2VQ0A 4LBNA 2OQ6A 4BXSV 1BK1A 3WHTA 4QB6A 2O0OA 5J36A 5CEHA 2D6MA 2Q5TA 2GH2A 4P5YA 4ZS2A 5EQUA 5FJHA 1YQ2A 3J26N 4LBQB 2W91A 3M7AA 4IV3C 5J1XA 1W2AX 1UWWA 1EUUA 3CNAA 2HWE3 5HV0A 5HCFA 4Y1VA 1W04A 3DYOA 3I2GA 4IL7A 3ZSMA 5A1FA 1S55A 1ZA7A 1FPN3 1SHWB 1SEFA 1N47A 3FLPA 1LEMA 3VBFA 2EIBA 2GNDA 1CESA 1AYM1 2CWSA 1QJU3 5E6HA 4XF1A 1IKQA 3WW2A 3KHBA 5ACA1 3RZKA 1XJAA 3FL7A 3VD4A 1H2NA 2WNOA 2RV9A 3UT0A 4F8AA 1UY0A 4RFT0 4UAPA 5FPUA 1Z0HA 5IT6A 2XDVA 3ZFFA 3ON7A 1BEV3 2VOXA 3KF5A 3KD4A 3LOIA 4M0HA 1W2NA 4KWKA 1RUF2 1XNDA 4WM8B 3RPQA 1L3JA 2VNRA 5A80A 2IXJA 1VRH3 2VMFA 1HQNA 1G9FA 2VCBA 4Q8LA 5FLHA 1QEXA 2V5YA 2PQSA 3FFZA 4NPRA 4UFMA 2AENA 5FTTC 1OOPB 2MEV2 1DU3D 3OGSA 1J59A 1SLBA 2J1UA 4BQ3A 5T55A 4ZKTB 5L73A 3L2YA 1WCUA 4M01A 4CXWA 1KJRA 4TXWA 1LHUA 4P08A 4QU1A 4UI9L 4AVAA 2BGOA 4DZGA 5FOBB 3UGFA 5IK7A 1XRUA 1J3PA 1X8EA 3JB4C 2XLFA 4GMP0 4BE3A 3IPVA 3J8F2 2Y6LA 2X5IC 1RJ8A 4BQXA 4COUA 2Z4FA 2P34A 3RGBA 2XHKA 2Y34A 4PF5A 1R64A 1ULPA 5LA9A 5J37A 2ADEA 5JPMB 4AI1A 4FFHA 1J1TA 4QM9A 1GOGA 2ZHKA 5FPZA 4Q4Y2 3GXUA 5H9QA 4CDUC 1O3RA 1F31A 4LO7A 4N7IA 2J1AA 5IK8A 3VBSA 4OHZA 5K7PA 1C8M1 3AZYA 2HWD3 1ND2B 1CAUB 3ZSJA 1PZ8A 2F17A 4MGTA 2R042 2WZR2 3MO4A 2PA7A 2CGNA 1Y3TA 4TN7A 5KHHA 2PLV2 5FPXA 3J9SA 2D5FA 1MS5A 5SV5A 2RJ2A 2VM9A 4GH4A 1YWKA 4LK7A 3S7EA 3W59A 3ZXAC 3RFRA 4YM1A 2LTNA 4CU7A 3MDPA 1PIV2 5GLTA 4KGGA 4S2DA 3J7HA 1AL0G 1X7NA 3FLTA 3O1PA 5A7SA 2RMU3 5FZ4A 2GN7A 1XE8A 5FZ3A 1CAXA 2VECA 5FMCA 4BDVB 1LR5A 2GALA 4A6OA 4GWIA 1W8OA 4QPIB 5L7OB 2FCVA 2YBSA 3E97A 4P02B 1K5MC 2DCKA 2VOVA 3AKSA 5APAA 1YUDA 5DDJ2 1Y7BA 2DVAA 1Y9GA 1DQ4A 3EO6A 4IE4A 3DKQA 2VZSA 1XBFA 5GZDA 4CDWA 4CSWA 1IS6A 3ZDVA 4R9AA 2RJLA 2JG8A 2H6BA 1GU3A 3JZVA 5FYIA 1D0HA 2VCCA 3BB6A 3VKMA 3LA7A 1YNAA 4NIGA 2C0ZA 5DAWA 2CL2A 2BGPA 3LF7A 3SEEA 3M3EA 2WBKA 3PUAA 4N9HA 5F3CA 4QX7A 3AC0A 5C71A 2NN8A 3DF0A 3WP6A 1TMF2 4NHLA 1ASJ2 1XXNA 3ENRA 4BLJA 2VVFA 1H2LA 1RUG3 5FP3A 3RJ2X 3KM5A 4K1YA 1NZCA 1T6BX 2HBTA 3GZEA 3A23A 4FTEA 2ZEWA 3ZYIB 5F6KA 1CZSA 2W0XA 3N9MA 3H50A 3OJBA 2A6WA 2Y6GA 4QPGB 2ZOEB 1HN1A 4LIVA 3H8UA 5JZGC 1N1VA 4Q4X3 4QGMA 1GFF2 5G05L 2AYHA 3RRDA 2AUYA 3POFA 1MPXA 3MV01 3MLJA 4L11A 1CQ9A 3ETPA 1FOD2 2IVJA 4BOWA 1KQRA 3K4ZA 2UYBA 2WZ8A 5C9AA 1I5PA 3JBG3 2JICA 4FPOB 4AWDA 1RUF1 2RVAA 4CCCA 1FI2A 4C90A 2Z2SB 5A7QA 3R0RA 1OH4A 4QMAA 5FZIA 1PO23 1RUNA 3LD8A 5JR7B 5FO9B 1BXHA 1NLRA 2OUJA 2ZABA 4AFDA 2ILMA 2MEV1 5FZEA 1HIXA 5DAPA 5GALA 2ZGLA 4INDA 3UYJA 4A42A 2Q8DA 4BMBA 4Q0PA 5JOYA 3LDBA 5L9RA 5C6CA 2OIIA 5T5PA 4AQSA 1CIWA 2YPJA 4P5HA 3U1XA 3J8F1 2ZHMA 2OYZA 3VBUC 1OD5A 1Q3EA 1O6UA 2EIEA 3B3QE 3U10A 3R6SA 2Y0OA 4COVA 3AYEA 3KLSA 4IEXA 2VG9A 4D6QA 1IS4A 2JX9A 3BODA 5FKBA 2R073 3GCWA 2WLPA 2O1QA 4MGIE 4Q4Y1 3RI9A 1QXJA 2VMIA 3ACFA 3ALQA 4FPEA 4AI9A 1ZYBA 1CWPA 1RIRA 2FHRA 4AOCA 4O65A 4LKDA 4PLOA 3HVDA 4NHYA 1R092 4XAEA 1JYCA 1KD7A 4E4HA 3O1UA 4AGGA 2R041 2WZR1 4O61A 2WA3A 5M0TA 4DRVA 5F9TA 3RZGA 1TZOA 2X8KA 4UFHA 3VBOC 4AAPA 2PLV1 3OBRA 3UJQA 4B7KA 2VZ1A 3AL6A 4CDUA 4LBKA 3VKNA 2IUWA 3IN9A 4LKSA 4JRAA 2ZGSA 3WQ0A 4A3XA 1RUH2 2BUKA 1H0BA 3ZKUA 4FPYA 4A4AA 5CBLA 3B02A 2WO2A 1MS8A 1PIV1 4GAZA 5A3TA 4LTAA 1S0EA 4E4SA 1UQXA 3FHAA 5A3OA 4EQVA 5F3IA 5GKAC 3UJOA 4OQ8A 4Y3OA 3QACA 1JZ3A 5CZKA 4B3NA 5FZFA 3ZXLA 1BK0A 4Q27A 2C5DA 5BPXA 5F2WA 1YI9A 3R05A 5L19A 1DYOA 2W1QA 4HANA 4XDQA 1HB1A 4YW1A 1Q56A 2QNKA 4JHZA 5FO7B 5DDJ1 3D0JA 1FPN2 5F7UA 1RUC2 3A7QA 1SPPB 2B7YA 2X5IB 2A6XA 2GMPA 3EJKA 1QJU2 5EPAA 5FYYA 1RUD2 2HKXA 2W1WA 1SLTA 1K5MA 4IE5A 3T2OA 1ZM1A 3KVBA 2VQTA 5DAXA 2WT0A 1TVGA 5T3NA 1TMF1 2DUQA 4I01A 4QAWA 1ASJ1 1KJLA 1RC6A 1DGRN 3FFQA 1VRH2 1XSRA 1RL3A 1W6MB 4YFZA 5LBBA 3LE0A 3ZSKA 1ZRCA 5D2AA 2ET7A 5FYVA 3AZZA 1YJLA 4RGAA 3K3OA 3BU0A 3I2JA 2JDPA 3MFAA 1CJDA 2AACA 1UD1A 3LEGA 4YW7A 3AXEA 4Y24A 2HEVF 2DVBA 3BCWA 2D6NA 1FOD1 1O8SA 5EV7A 1IPSA 3ME2A 4KI5M 1CAWB 2WAOA 2J7MA 4XFHA 3WNXA 3ES1A 4UW4A 5A3WA 2YC2A 4YM0A 1GP6A 4ZY9A 3I2OA 2FDIA 5LRRA 3S5AA 3PMEA 5BUVA 4PDWC 5H9RA 1SFYA 4D0QA 3DEMA 1D2QA 5CFDC 4MGYE 4BCUA 4N8MA 1YQCA 5EP9A 3LEIA 3IB3A 1EAH3 5IW0A 5BY5A 2WO3A 2B9VA 2OS2A 4MSVA 5CVRA 3D82A 5SV8A 4BK4A 1V0AA 5GM0A 3M2MA 5C3SA 3PVOA 4RD7A 4ORFA 4ISRA 3DUIA 2YG0A 5FRAA 4FVVA 1AYM3 1E5HA 1F8VA 1PX3A 4MZUA 3O1RA 2WT1A 4LJHA 1NA1A 1QJFA 1QH7A 2EXKA 3NAPB 4NO4A 3DYMA 1YIFA 5D1IA 4LITA 3NV2A 4A6SA 2DDUA 4FPHA 4QXCA 2Z5WA 5FJKA 4COWA 2ZCWA 3ZFGB 1GZ9A 3BYWA 2UU8A 2JE8A 4YGBA 4EZ4A 2XONA 1R091 1UOGA 3MV11 3C2UA 2ZGRA 3U11A 2Q1FA 3WINE 2CAUA 4P9WA 4QKBA 1VIWB 4HVQA 2LALA 3GNEA 4Q4V3 2VH9A 5A3NA 4FTBA 5AFEA 3B01A 4W6YA 5FZ8A 5JOWA 1IOAA 1RUH1 2CWMA 1Q8SA 2FBEA 2V73A 4IERA 4XUTA 3UKTA 4Y1XA 4BQ5A 1YIPA 5BNNA 1BHGA 5FBJA 4QGNA 1QJY3 2HYKA 4K21A 2WL1A 3GZAA 3UESA 4DXTA 3L9JT 3LSEA 3MUY1 3VKLA 4E27A 5BNPC 3OSDA 4WM7C 2YROA 1XU1A 2WIIB 3FZ3A 1GP5A 3K51A 1H2MA 3KQ4B 1PK6B 1RUG2 5I0TA 2WNUC 3N7KA 4AVVA 3H1MA 4FFFA 2VW1A 1LCLA 4FOYA 4H2AA 4L0PA 2PFWA 1BVVA 2ZS6B 1JYVA 3PVBB 4XTPA 1XPWA 1C8M3 2WFF2 3FLRA 5AVPA 4KMQA 2C9KA 1FPN1 3OGVA 3WHUA 1RB8G 1RUC1 1NCQB 4Q4X2 2PHWA 4KU7A 4PBOA 3VBUB 1RUOA 2F6BA 2WNVC 1MQTA 1QJU1 1ND3B 3NJZA 4I0WB 4XJUA 4OI2A 1RUD1 1ZZ6A 3RZZA 2WAAA 1OD3A 1ZZ9A 2XJPA 4L99A 1K45A 3K48A 4XTMA 3JBG2 4LMFA 2UYAA 1VB4A 4XBLA 2Q0AA 2F4PA 5CKQA 3ZXDA 5GZGA 4L9BA 4XFAA 1W6NB 4H14A 1H8TB 1VRH1 4OFGA 4RYDA 2HYXA 4MYEA 5I91A 1UXXX 3JXSA 4IESA 3VN4A 2XG3A 2VZUA 3IAQA 4Y1UA 5CKNA 1LESA 2HJIA 4AAXA 4CEWB 2W9XA 1UAIA 1V6NA 1CN1A 2C9AA 4IDZA 3D8CA 5C5UA 5KHIA 3BIEA 4M4PA 2FDJA 1MVQA 5A7WB 5FZOA 2XKPA 4FBFA 2XLAA 4MLOA 3K77A 2R072 3OB8A 4URAA 1IS3A 1FT9A 1HJFA 5J3UA 1XB9A 3CMGA 3N9LA 4KWJA 2CU5A 5K8SA 1GQHA 4AEJA 4JDOA 1QMJA 5FZAA 1NUKA 2WRAA 4PDWA 4YSFA 1GYKA 1FMD2 1REDA 2IVIB 3ZO0B 4CP0A 5CFDA 1W9SA 3WNOA 1TNRA 3BIWE 2EA7A 2OXBA 1O8PA 1ZX5A 3MIGA 4XETA 4JGYC 1GWKA 5C8CC 3ATGA 3I3DA 1H1MA 1ZA4A 3ZXFA 2ZAHA 4LKFA 2YV8A 1CAVB 3V0AA 5CISA 2ZX3A 2WA4A 4NMIA 3WDUA 4HSLA 4UFJA 4CE8A 1BCXA 2BWAA 3HAGA 2ZEYA 4UFLA 3VD9A 3VUOA 3N9QA 4HG6B 3I2DA 3T1MA 2AH2A 2WNEA 4G4FA 1YFYA 4NAOA 2KA3A 1L7LA 1OFSA 2JDAA 3K2OA 4P9IA 1PGW2 4P00B 2P6HA 2E9QA 2ZZJA 5IUQA 4BQYA 2MEV3 4LHSA 3M8LA 2DCTA 4D6SA 3OPWA 1NCRC 3VBRB 2ZPXA 4P9XA 1V6MA 3WQ7A 3GHNA 5T5OA 2I07B 3OY8B 4Q29A 3ACHA 4CDXC 2GC0A 4DUXA 3J8F3 5TSWA 3TNQA 1HDKA 2KR2A 4LLFA 4JHTA 2XUEA 4GWNA 4N43C 2KM2A 2D43A 4LE4A 1H30A 4FQZA 2K46A 4DIQA 3AP9A 5ISLA 1UZVA 4CUAA 3K3NA 2G9ZA 5FZ0A 1IHMA 1LKNA 1RUG1 4FPCA 4YNIA 5FBZA 1WBFA 1I5ZA 1CONA 4UOJA 2Y0IA 3OG2A 1U5ZA 1ULEA 3HNBM 2Z79A 5FP9A 3GBFA 2WFF1 4XFIA 3ACLA 4PCRA 5BNPA 2A71A 4WM7A 4ATFA 3V0BA 3MEPA 2R043 3LIHA 3OYWB 4Q4X1 4CCOA 3RMXA 5FXZA 2PLV3 4PIYA 3WW4A 5LBFA 5FMDA 4XOGA 4D7YA 4XFFA 3Q9OA 2W47A 4HN1A 1GZWA 4K6BA 5DG2A 3VL9A 5I0SA 4QWNA 1NQDA 4HN0A 3JBG1 1IQAA 4IGPA 3T3YA 4QQOA 1C5IA 2KXLA 2V4AA 2VNGA 2WQ8A 3FBYA 2BFUL 3VZMA 3WUCA 1K42A 4S2FA 1Y9MA 3FHQA 3MF6A 3PTRB 5FCCA 5FR3A 1DZTA 3RZHA 2XPJA 5CADA 1UYPA 4FPGA 5DUWA 3CJIA 2RS33 1OQDA 2DYCA 3LQCA 2VMGA 2VL4A 4JGZC 4LUMA 4O9EA 1EAH2 4ZZ5A 5KC5A 1WLWA 1XYOA 3ZFFC 5DDJ3 4DS0A 5A6QA 4QX3A 1EY2A 4KH9A 3P3NA 4NWVA 4I0AA 2GN3A 5A3MA 1GOFA 1EYBA 1JYWA 1V70A 3AVRA 2A75A 3I2FA 1UO9A 2B46X 2VO5A 2YBKA 3GCXA 2R071 5DQ0A 1J3RA 2VZOA 4HPKA 3SH4A 3T30A 4AEDB 2OVUA 3LFIA 1DQ5A 3CLPA 1OPMA 1SBFA 1DGWX 1TMF3 1WMXA 5DUVA 4XXAA 3PDQA 3TYJA 3MIHA 5ABJB 4NIDA 4PI0A 1MACA 2FMDA 2IC1A 2QTWB 1G8WA 5FPAA 2IXCA 5LZ6A 1KXGA 2ZX0A 2E31A 3POIA 2HLEA 3MW4A 5G04L 1OI6A 2WNVB 5CB7A 3VDAA 4M4RA 3FC0A 4Q4V2 5IVVA 4G3YC 4YM2A 5FO8B 1FMD1 2IFRA 4PHZA 4XEZA 5JI9A 1CGPA 2QQUA 2ZKNA 4E2QA 1TNFA 4IETA 3P3PA 3ZYBA 4ZHNA 3N3HA 4FP3A 2LW8A 4UBHA 2OKXA 2EF6A 1O4TA 1ONAA 1PZ9A 5EFUA 1QJY2 1YFWA 3GM8A 4M00A 1MZ6A 2VMDA 4CDQB 5J09A 3UV9A 4G9SB 1H4HA 3D6EA 4L8QA 2EAKA 1NKGA 3JQXA 2X05A 3POWA 3VZJA 1ZNPA 5FP8A 3UK9A 2JE9A 5JMOA 4AXOA 2YPDA 2ZACA 5C5TA 1X82A 3ZFEC 5IAVA 3UETA 1JZ5A 5A32A 3K4DA 4GH4C 1PGW1 2B39A 4WZCA 4XDPA 1YQ5A 4AQ2A 2YFZA 1RITA 2BYVE 1YI7A 1MZEA 1GANA 3RWKX 1N1TA 2JECA 3R4SA 2VZVA 2XBO2 1NXMA 2ZMLA 3ITQA 4IEZA 4RR3A 4QPWA 5A3UA 4NIAA 1JHJA 1N1SA 5JIUA 2Y6JA 3CU7A 4YVWC 4EYUA 4Z2AA 1W6PB 4AE2A 3A22A 3MBWA 5FZBA 1UL9A 4DXSA 2BTVC 1PM4A 5FYCA 1W6QB 4AR2A 1YC61 3WD5A 2JDMA 2D6LX 1UMHA 3FWEA 1JN2P 2Y26A 4CDXA 5J7MA 2BU9A 2ZJCA 1NT0A 5FYMA 5H9PA 2D44A 3ZN4A 3VBHB 1JU3A 1H1AA 4IQPA 4FFGA 3USUA 5D8AB 3B9IA 2D40A 5C33A 4HETA 5JWPA 2OA2A 2ZEZA 3MGUA 4GKYA 4NPMA 3EXUA 3ZR5A 1WW6A 3VKOA 1AR72 3ZYHA 3MF9A 3N7JA 4H55A 4XE9A 5C8CB 2C1FA 2VD7A 4W6XA 1C3HA 3DPRB 5C3QA 4Y5TA 1XNKA 4U2AA 4Q1RA 1UOFA 1W9FA 1QGLA 4QXKA 1VRBA 1S1AA 1PX4A 3KT1A 1C5HA 3KMHA 2A7AA 3NVCA 4MOAA 4Z07A 5T50A 5FZ9A 3ZYRA 4DY3A 2UWAA 3TB0A 4NHKA 4K3UA 4A45A 5GLWA 4D7SA 3HJRA 1LHNA 2DBIA 1C57A 2UWBA 4K8RB 4CEYA 1EAH1 4HK8A 3T08A 3OD0A 2G4IA 4RS5C 2PAMA 3KVAA 4CCJA 5IVCA 1U12A 4AI8A 4GQ7A 5C9AC 4HKLA 4HLTA 4HMZA 1RUC3 2V5DA 1JH5A 4YZ1A 4NN0A 3SCGA 5C70A 1F5JA 4QT6A 5GLZA 4PT6A 2VOKA 3AMMA 5JR2A 4JGZA 4TYSA 4N43B 2D6OX 1IGOA 1RUD3 3OBTA 4OULA 5FZ6A 3UGHA 2IXKA 4A44A 3ZYFA 5I8TA 5HXVA 4QPYA 5KBFA 1AUYA 1GWMA 5C4WB 3VDDC 4AHWA 5C8WA 4YPJA 5JSOA 2JG9C 1ODNA 1B35C 1WCDJ 2XR4A 3B00A 4QXBA 2JE7A 1RGSA 2CDPA 4AEKA 4XW3A 2XKOA 1VBB3 4Q4V1 1UYYA 1YXWA 3BPSA 4BQ1A 3M4FA 1LOAA 3FJSA 4AFAA 1JU4A 1YQ6A 1KGYA 3ZVXA 3M3QA 3WXPA 3GZTB 4YVSC 2OW4A 1QJY1 1I9RA 2QUOA 4B7EA 1ZZ7A 2WABA 1R1A3 4PI2A 1W3XA 4KGQA 4N53A 4DEVA 5BV6A 1Q43A 2XJUA 1ZZBA 3VBFB 1UY4A 2VTXJ 3SKJE 3W5MA 2ZX1A 2P2KA 2D93A 1VB2A 4A3ZA 3O1TA 4XABA 3IKWA 4HVOA 4OYUA 3W21A 1GQPA 3ZFFB 1LOFA 4YG6A 2WDBA 2VC9A 1HKDA 5LY1A 2Y6HA 1GLHA 4I0BA 1O4YA 2PHUA 4QU2A 3WZ1A 5JCTA 2XBO1 1NLSA 2E7TA 2EIDA 2D3SA 3WNPA 3KV6A 3C7FA 3IZOA 3ZFEA 1P8JA 5I8SA 4LT5A 2I2SA 1ZREA 3KCCA 2ZEXA 1JXNA 3U37A 4CXXA 3HIFA 3HQRA 5J98B 2WO1A 1A6CA 5EJZB 1DQ1A 4KQ7A 3GGLA 1B09A 1NZIA 3GJBA 4P9JA 5FZGA 2VPVA 2GAUA 1O91A 3PU8A 2PYTA 2RS32 5KWRA 4QX0A 3IPVB 4YVWA 4MVTA 5CKMA 5JSPA 4XYXA 1ENRA 4W8JA 2BV4A 3MIDA 1TE1B 4PJYA 3BPZA 1DBNA 2EALA 2VAUA 4MXVA 2YFUA 2A73B 3I97A 4BK5A 4IV1B 3D0SA 5DMYA 2BWCA 2PAEA 2V4VA 1W0PA 1AR71 4XUNA 1OKOA 1DP0A 5JUVA 4JDMA 5AVAA 5JXHA 2QQPA 3EHKA 4D8MA 1NLQA 2XUMA 2ZHNA 3G6JB 3VBSB 2PHLA 3WQBA 5F5CA 4DMIA 4C1WA 4QDRA 5DZGA 3E6DA 3VLBB 4XJWA 1S2BA 5FLIA 3WX5A 4QPGA 2X29A 2YDEA 4Y20A 4EWDA 1C8NA 3LPGA 4OQ9A 2VXJA 2CSGA 2DCYA 5DUUA 1RXGA 1SLLA 4LR4A 2ZGTA 5A33A 4GH4B 2XB6C 4M0NA 1XNTA 3FE5A 4Y1YA 4ZZ8A 5LK7B 1Z7S2 1VBD3 2E7AA 2A6YA 4NVPA 3OTFA 2QVSB 4RA0A 4MGQA 4YYOA 3WDVA 4BA6A 1COV3 1W90A 4CCEA 4DB5A 2ZGQA 4Q2FA 2WFF3 3ZX7A 2JIGA 3B93A 2YHJA 2VOWA 4CA9A 5F3GA 3AB0A 1PGL1 4FAHA 2HWC3 4K7JA 1J58A 3RMYA 2W95A 4TLGA 2CTVA 3OEBA 4RS5A 4XIOA 4EWEA 1TME3 4JKKA 5LBCA 3A0NA 5FLJA 2VQUA 3M1HA 1YRZA 4P14A 1ACCA 3AK0A 3O5SA 1W9YA 3KSCA 4Y22A 4CDWB 4M3CE 1IG3A 4MO3M 1U5XA 5FPLA 3WOGA 5ERLA 2JG8B 3NWKA 4I30A 1SZBA 4GB32 2ETEA 4GKXA 4GALA 4XQWA 4XFCA 4XZUG 4NUBA 4KNCA 4MXWA 3ZSLA 1W2OA 4ATEA 3C7HA 2W5FA 3J7NA 1PM7A 4R4ZA 1UIJA 1NA1C 3VDDA 4UW6A 1LHOA 2W87A 1W8NA 1WZXA 5DZFA 1PGL2 2DFCA 1LGBA 1O4ZA 2JG9A 2VBBA 1GKBA 1B35A 4CU8A 3IWZA 1ZRFA 1IZ3A 1HX6A 3IDBB 4IGOA 3ZXGA 4FFIA 1GQGA 3FHIB 2D6PA 1GNZA 2G9FA 1EV12 2BJSA 4SLIA 2XJTA 1G86A 4K8FA 1F35A 4TWTA 4XURA 2PELA 3ZKYA 3H3UA 5L36A 2VMCA 1H9PA 1UOJA 1KDMA 3NSTA 4IV3B 4KBZA 4Y4RA 4YVSA 5A7NA 2A1XA 3MPPG 2LS6A 2C4XA 4CTEA 4RHV3 1VBE2 4NAMA 2AZ5A 2WWSA 1A34A 1OHFA 2VQAA 1D2SA 4AVCA 3JD73 5IAXA 1VJ2A 3THCA 4BWOA 5BNNC 4LO5B 4I02A 2HWB2 4OHXA 1ZRRA 4A7ZA 5FFOC 1LU2A 1UY1A 1X9TA 2QQVA 3HQXA 3I2HA 4HBNA 1GBGA 5FUPA 4CU9A 3AX4A 1A8DA 4FPKA 5IHRA 1UW8A 1FMD3 2C26A 5FREA 4MHRA 1DLCA 2BBAA 2XJRA 3HWJA 5I0UA 1NYWA 2ADDA 1CD3G 1CIYA 4XF3A 2QZ2A 3CJXA 3ABZA 4ASMB 2R7EB 3B69A 1WW4A 1UZWA 2WZPP 2RDNA 3AMHA 5JPNB 3JQWA 2DF7A 2K9ZA 1G7YA 3AFKA 3LAGA 4J1WA 5LK5A 4HK9A 2RS31 4UT5A 4WVZA 1RUE3 1WA6X 4Y5Z0 1ULCA 4Q0VA 1F15A 1H9WA 1LNSA 1MQTC 2AGSA 1HRV3 4CCDA 5IK5A 1CZVA 2JDUA 2OQ7A 4ZU5A 2EAAA 3I49A 2BZDA 4OMCA 5A3LA 1OF3A 3T09A 1LODA 4BYYA 1UY3A 1HB4A 4HVRA 1ENXA 1LOGA 1OQEA 4GZ9A 3U07A 1T6GC 1OXCA 1QOSA 2WSVA 2GU9A 1W6MA 1UU4A 1N3QA 2BOJA 2QZ3A 1H4GA 4LOSA 5IVYA 1H6XA 1ST8A 3DV8A 1H6YA 3I2IA 4HSJA 1LRHA 2E33A 2Z69A 3V64A 3MYXA 2Z42A 2JENA 2TBVA 1MR5A 4IUGA 3MLLA 4XPVA 4XJ9A 1VALA 4IEUA 4CDUB 4GJYA 3TRSB 1RINA 4LHLA 4UW3A 3HT2A 2RG4A 2Y6FA 3VZOA 1YEWA 3HQUA 4DRRA 1WLDA 3ILRA 4QQLA 4KU8A 1HB3A 4FOQA 5IWFA 2NMNA 1Z7S1 2Y6KA 3WW3A 1CAWA 2GZWA 4NPLA 2B45X 2QJVA 1KS5A 4GULA 3ZSEA 1VBB2 4FXGB 4ASLA 4HT1T 4B4RA 1UNBA 5FPBA 2EVXA 4AFBA 3QD6A 4QB1A 5E16A 2NMOA 1QJX2 3OF1A 4KWLA 4M3CA 4PQ9A 4XUQA 4TLFA 2ORZA 2RDRA 4YARA 1Z78A 1WKYA 2VVDA 5A1AA 4RQPC 1VMFA 3WP5A 1LOCA 3H1WA 1R1A2 1VP6A 4XCBA 2RR13 1WD4A 2D6KA 4CRQA 5LA1A 4EV0A 1AL22 2DWRA 3IT8A 3BN6A 3IMNA 1PNFA 1SDWA 4LBOA 3P5BA 2IFWA 2BFUS 4XQDA 1UU6A 4GB31 3KV9A 1WLCA 3RZLA 2VXRA 2P1BA 3THPA 1K5MB 2GC2A 5FWJA 4BU2A 3RI8A 4DNYA 3PNAA 3NAPA 3H9AA 5FKCA 5FQ0B 4QGLA 2QQMA 4IEYA 2YZ4A 2UWCA 1WCKA 3DECA 3S5QA 1O59A 3ZFGA 1OLQA 3ASIA 3FBMA 5KR7A 5FYZA 1VAMA 3VV1A 3IDCB 4C0HA 1EV11 2HBUA 3K46A 5FIXA 1URXA 4KL1A 4RFRB 3JCIA 3N9PA 1SCSA 4J6GA 1DF0A 4MADA 2GNBA 5LA2A 1WW5A 1XU2A 1AR82 3S7IA 3MFCA 5IVJA 2OT7A 1VBE1 2RS53 3HD8B 1UMZA 3R4UA 4YW4A 3E5XA 5JZGB 1A3KA 4R52A 2HWB1 1A78A 4ASKA 1BZWA 3AZWA 3CDZB 4MV2A 4C1XA 3H8RA 3POBA 5BNOC 3WDXA 1UKGA 2XJSA 2QQOA 4Z8BA 1W8TA 1F4HA 3Q8AA 1JYXA 3O7OA 3ZYPA 1SLIA 1JTZX 4JV4A 2HEYF 4R9BA 1UMIA 3H8XA 3NJXA 2QE3A 5F39A 3T2TA 1AHSA 1TG7A 4LEJA 4L97A 4UF0A 2ZGMA 5HXMA 4QKDA 4LIUA 3D4KA 1NCQA 1GR3A 1YCIA 3A21A 2GC1A 1X36A 3POGA 3MICA 2LM3A 4JQRA 1AX2A 5F6LB 4R4XA 1VBD2 3N7MA 4XZPA 1GP4A 1NA1B 3RYKA 5HPOA 2V72A 2ZZQA 3URFA 5A6XA 1COV2 2B4KA 3CL1A 1NX9A 1PMHX 2CYFA 4M3CF 1LAJA 4YZ4A 5LWBA 2WWUA 2WKKA 2ZGOA 3AMQA 3IBMA 1Q8OA 1G9BA 2XBO3 3DYPA 2HWC2 4LO6B 4EE2A 2OPWA 1RUJ2 5AFBA 1O3TA 2IXLA 3ZN6B 3CJIC 5CG9A 1TME2 1V00A 2PXJA 4MGZE 2XGXA 4UXAA 3M70A 4YG0A 2L9LA 3WG1A 1DFQA 4XUPA 2DU1A 3MIBA 3VHNA 4AQ6A 2BOIA 4CEWA 4B29A 2RDQA 5DAVA 3Q8FA 3JUUA 4X6RB 3ELNA 5JIAA 4NOTA 5BYNA 2RS12 1U5YA 4LBJA 2D7FA 1PNGA 4QHZA 4CP9A 3VBOB 4CCNA 1VBB1 2W39A 4CYDA 3RDIA 2A70A 2VJXA 3SISA 1NQJA 3WCRA 1G6NA 1AR73 1W39A 3MW2A 4FQ4A
chains in the Genus database with same CATH topology
4E4ZA 2XH6A 3FUQA 3VHOA 1O7FA 4N90A 3I8TA 1R1A1 2CV6A 4XMAA 1IS5A 5LRSA 1AL21 1LGNA 4LBLA 2RHPA 1MQTB 1X8MA 4YRDA 3E5QA 1SBEA 4PIZA 1UPIA 4OI1A 3ILFA 4RHV2 4RQPA 1QJZA 3JD72 1BVP1 1WCSA 1YLLA 1DZRA 2FZ2A 4RL7A 4K40A 5K0UA 5JMCA 1QKQA 1W6OA 1AZDA 1RHI2 1AXZA 2DTWA 4YW5A 3QLQA 1BYHA 5KHKA 3E6BA 2ERFA 5K9YA 3CF6E 2JXAA 4AYUA 3WG2A 4XFGA 2B9UA 4I3GA 2DURA 4MH0E 4E2GA 3VBRA 1AR81 2SLIA 1RUE2 3VZNA 3OY8A 1S2KA 2YY1A 1VAVA 1HRV2 4RR3C 1PO13 2ARXA 2NM1A 2QDNA 1RUI2 5CFCC 2UY9A 3KGZA 3ZXEA 1AR63 3O0VA 4WVMB 4BM8A 3OD4A 2W68A 1MEC3 3AKTA 2I45A 3HMYA 4XIKA 1PVXA 4NHMA 5BNOA 4PDWB 2BGCA 3NV1A 3AMNA 3PLQA 1QOOA 5CFDB 3O12A 4Q4W2 3MIFA 2A6ZA 3SHRA 4D69A 1GSLA 1VBD1 2GNTA 3DGTA 4OUMA 1V9U3 1LOBA 4A7YA 5CA6A 2ARBA 1FXZA 1COV1 3T1LA 3B7MA 3V0AB 3O0WA 4E4DX 3MLKA 3LWCA 4P9LA 2HWC1 3E6CC 2JJ6A 1RUJ1 2P3JA 4S2HA 1TME1 4A2UA 3RYPA 2NLRA 3ZIXA 1LOEA 1QY4A 2D5HA 2RR12 2PQQA 4CEYC 1LTEA 2EXHA 2I74A 2PHTA 3AP6A 1TEIA 1OPOA 3C3VA 4LO4B 2RS11 2R30A 4WM8C 4XF9A 4EN7B 5I0RA 4AI2A 2XWJB 1POV3 5DUXA 3M3CA 3GF6A 4XXPA 1LHWA 3WDYA 3VL8A 1I6XA 1XYPA 3SLIA 4FPFA 3B5LB 3IM0A 2OZJA 5ABJA 1ULGA 3KS7A 4GMP1 4CZSA 1ZZ8A 3GBWA 1OLRA 3EBRA 3KCXA 1FYUA 5BNPB 4BHPA 3A4UA 4WM7B 3V0BB 1J1LA 4XJ8A 3ZIWA 4H7LA 2WQ4A 2UY8A 2YYOA 1UX6A 1FV3A 2WNUB 2JEMA 1D4M2 1AJOA 1GZWB 2RS52 4RHV1 2Q8OA 1QDOA 2E53A 5T52A 1DYPA 3JD71 1Z7S3 4Q0UA 4CDQA 3ILNA 1V6IA 1RHI1 1HXS3 1PVC3 4N53C 4XHBA 1V6LA 5GLUA 4B4QA 3NKTA 1APNA 1HLCA 1DGWA 1H1IA 3ZDSA 2R6QA 1D0GA 1HRI3 5KXCA 3QH6A 3ZXKA 1ZZCA 1C4RA 1LOFC 3H1YA 2XL7A 3GALA 3SH5A 1X50A 3RYRA 4JC1A 2IXIA 1RUE1 1RTVA 1S0IA 4AI3A 2E63A 4YFWA 3U4XA 1HRV1 2WSUA 2ENRA 4GB33 4AQTA 1W6PA 4QPIC 1M06G 2BQPA 5L7OC 2P3IA 4AHYA 4HPKB 2BVBA 1RUI1 4FPJA 1AX1A 4HL0A 3RWNA 2VY0A 1AXYA 1WLTA 4R8HA 5KXDA 3KB5A 1FV2A 2D3RA 3TN92 1N3PA 4YZ3A 4YGDA 1HW5A 5I93A 4FOWA 1EV13 5CFCA 4OHYA 4XJZA 4Q4W1 3V56A 4WVVA 2R0FA 4QX5A 3RS6A 4LBQD 1N1YA 3LCPA 3WW1A 1VBE3 2A3YA 3RNSA 1QQP3 3VZKA 2HWB3 1HV0A 3AKQA 5JLVA 4QPGC 2DV9A 4P9YA 4FT8A 4URTA 2ZBJA 4JGYB 5A32B 2PHXA 4LBQA 1QXRA 4V1PA 2D97A 1I1EA 3AZXA 1J3QA 1UCXA 2RR11 2CGPA 4MGKE 4BH9A 1DQ6A 4QQPA 2A6VA 4L92A 3MPBA 2CAVA 4RR3B 2XVLA 2DFBA 3S6PA 4LLOA 4F83A 3CEWA 4YW3A 1AX0A 5JVVA 3FUOA 2TUNA 3ETQA 4YGCA 3I4IA 3KQRA 1NCRB 1NXD1 1Y43B 4AHXA 5FAXA 4FPLA 5EXOA 3AJZA 1XNCA 4WM8A 4Q8KA 4CDXB 1UN1A 2UURA 5J48A 5T5JA 1U5IA 3QCWA 4W65A 5E89A 1OSGA 1V6JA 5F5QA 1OOPA 5FMOL 2WQZC 4OI0A 4BIFA 1CPMA 3FMGA 1FATA 1D4M1 4XHXA 1LECA 2RS51 1UIKA 3H3ZA 3MI8A 2A5ZA 1VR3A 2ZTNA 4JCKA 1V6OA 1PO12 1D4VB 4OLLA 3I59B 1JUHA 4X8PA 4AGRA 1H2KA 3WDWA 5DXDA 4Q0QA 3WY6A 2FQPA 1YHFA 3UL2A 4B8EA 1AR62 2A3WA 4LHNA 1MEC2 1QJX3 1CJPA 2ZA9A 1XE7A 3A0KA 3RSJA 3UKVA 4CEYB 1S0DA 3OGJA 4E2SA 1ZBE3 1ND2A 1CAUA 3M3OA 4YGEA 1OMIA 3BU7A 2TEPA 4AG4A 3ZMNA 1O5UA 5GZCA 2ZGKA 3FX3A 3N35A 1AL23 5J96B 3O14A 4JGZB 2PHRA 5H9SA 1LJ7A 1V9U2 1S0JA 1VBA3 1CVNA 4JAAA 1GV9A 2PAKA 4IEQA 3THTA 4OHVA 2V09A 1EPWA 4D7TA 2BEOA 3NV3A 3AXDA 4WVWA 2DUPA 3IDEA 3JU9A 3TN91 4IXLA 2DCJA 4F7ZA 2YMZA 4OI4A 1FAYA 4P9GA 3B9CA 1Q8PA 4QPIA 5L7OA 3MIEA 2VULA 4IV1A 4Y26A 3U0ZA 2PN5A 1AYN3 3SITA 2R0HA 2YUEA 2VMHA 3LA2A 3PMSA 1BBT3 1AR83 4AHZA 4AEMA 1LU1A 1KS4A 4FSJA 4N53B 2B42B 1R083 3PJYA 2G9GA 2BW8A 1S0GA 1AXKA 1DZQA 1NOVA 2Q1MA 4LULA 3TAYA 3MZHA 4IEVA 3QH7A 4JVAA 2ZMNA 1AF9A 4PIXA 3WP4A 1NE6A 3HR9A 1QH6A 3BOWA 4KG0A 5JOZA 2XL9A 1IPJA 2IZWA 2RJKA 2VUJA 4XFBA 3OPZA 2R063 3ZFEB 4Z92B 4FOVA 3WP3A 3POSA 4X8NA 4E9KA 5HCAA 1DGRA 4K1ZA 4C0BA 4OUSA 1RJ7A 3H7JA 5HBAA 2HWF2 4SBVA 1HXS2 1PVC2 1CAXB 2DVDA 2RE9A 4YVWB 4I3PA 3TBDA 2ZHLA 2BNOA 3BOPA 3WG4A 1WMFA 1LB2A 4R9DA 1RUJ3 2AR6A 1O3QA 1HRI2 1DQ2A 2YGMA 1YYNA 4OZXA 5JSRA 1HV1A 5JOXA 3NAPC 1G9AA 1C28A 3B94A 3ZFGC 1AJKA 1E57A 3PVNA 1DHKB 1PO11 2RS13 2ES3A 4K20A 1GICA 4Y20B 4AK3A 2H0VA 5A33B 4WBBA 1AR92 2DU0A 4AF9A 1AR61 4IV3A 3WLUA 1MEC1 2XJQA 2E51A 4ZXKA 1FNYA 4GMP3 1BMV2 2NZ9A 1SLCA 4H3WA 4Y1ZA 3W58A 1NY72 2YGLA 4D3WA 1MZ5A 4LBMA 4DOUA 3WQ1A 4AVSA 1WUVA 1PK6C 2PTMA 1V9U1 4RS5B 1MZFA 1SBDA 2ZGNA 2Q1ZB 2ET1A 3NW4A 1QU0A 1WMEA 4QHBA 1QQP2 1YO8A 3LA3A 4LE3A 4XMIA 4GWMA 5C9AB 4Y22B 4HKWA 3QOPA 1ZBA2 2P3KA 2H0BA 3AM2A 1FNZA 1IPKA 1NCQC 1RHI3 4BIOA 1GNHA 2VU9A 2E7QA 4N7UA 4JRLA 5T5LA 1SACA 1ULDA 1ND3C 4MXWB 3TNPB 2ZAAA 2WS92 4B4PA 5DG1A 1RMU2 2VGDA 3ZYJB 1DGLA 2H6CA 3VDDB 1YJKA 4HKOA 4AW7A 3WDTA 2CY6A 4DFSA 2ZGPA 1W0OA 2RM23 2PHDA 2JG9B 4ONUA 1QNWA 1B35B 2X5IA 3VHPA 5GLVA 4YZ2A 1MS9A 1H8TC 3ZMOA 3QBQA 1POV1 1BJQA 2QFEA 1OQ1A 1KFXL 4META 2OPKA 1F9KA 5AC92 2EXJA 1RUI3 4YVSB 3V65A 3LGRA 5CU1A 4CEWC 1RVF3 4BPZA 1ZVFA 4ES8A 1W2UA 4Q0SA 3KCYA 3S0MA 2DUOA 4HFSA 5JDBA 4X6QB 4Z82A 2QCSB 4XBQA 5B2GB 4EN9B 4O9GA 4Q4W3 1VBC3 4JDNA 5GZEA 3LOBA 2HWE2 4Z1VA 2Y38A 2ZX4A 5JAXA 2WC2A 2BBVA 3WT3A 3AYAA 2HWF1 2ZGUA 4JTNA 1HXS1 1PVC1 4QQ2A 5JI7A 1QNYA 3SNMA 4FTSA 2MPFA 4C91A 2ZKLA 2NYYA 2XLGA 3AKPA 5EYXA 4AGVA 4UW5A 1BEV2 1HRI1 1ZBE2 5FQ0A 1ENQA 4H7MA 4EJRA 4AVBA 1I3HA 3M3IA 3I7DA 5K0UC 4FAGA 4AVTA 3TWIA 1KRIA 1H8VA 4HZFA 5T54A 3BALA 2A3XA 1VBA2 5LEJA 3PVEA 4AFMA 3OGGA 3WG3A 1AR91 1WBLA 4KG8A 1PMIA 3NKGA 4LA2A 1OA4A 3IIAA 3VBRC 2GMMA 4LHKA 1NG0A 5JZGA 4IEOA 1BMV1 2JD4A 1LGCA 3UKNA 1OA2A 1KFUL 3AP7A 3PHMA 1NY71 4FP2A 3E5UA 4FXKB 3VHRA 4EROA 3G7DA 1AYN2 1UKRA 4M3CB 1PHMA 1BBT2 1DLLA 2VNOA 2BPA2 1D4M3 2HWD2 1S0CA 3W9AA 5LEKA 5KHJA 1QQP1 4XQ4A 5EZWA 4D94A 2ZMKA 5KXBA 3LKJA 1R082 2IWGB 2HEWF 1MS4A 1ZBA1 4UBGA 3HBZA 4ITCA 3AP5A 1PK6A 4N9IA 5ACA3 2LUWA 1JOJA 2WS91 4EN8B 2AREA 3SXWA 1RMU1 2RMU2 3GHMA 3BTAA 2P37A 5IK4A 4EWAA 2SBAA 1MVEA 4IEPA 3AFGA 2K0GA 3VBUA 2R062 4A7KA 1ND3A 2YC0A 4TZDA 3ZN6A 3AKRA 4NR1A 3POYA 3TOJA 2BVVA 1SFNA 4I09A 3H0OA 4YM3A 5AC91 3ST7A 2D98A 4QQHA 4GA9A 1W6NA 4ES9A 1H8TA 1C1FA 4COZA 4OVEA 4PLNA 4XF4A 3RQ0A 3TN93 3VBOA 1SCRA 1YFUA 1V6KA 3DL3A 5F1RA 2EXIA 2DTYA 3LZZA 1WD3A 1UZYA 1JUIA 4AEDC 2VW0A 3ECQA 3LSDA 4LNVA 2HWE1 1MS3A 3VGIA 1JW6A 5BNNB 4W6WA 3VZLA 5ABJC 1SLAA 2OUHA 1O5LA 4Y4YA 1WA4A 2D3PA 2R16A 2FZ1A 1QJX1 2W52A 4FO9A 2XJVA 3I54A 1BEV1 1ZBE1 4EN0A 1F2NA 3N4MA 5FOJB 1LHVA 4WZFA 4CDQC 1F5FA 4CP2A 1CR7A 1PO22 3DKWA 5E8AA 4QM8A 1POV0 4PLMA 3AZVA 3R4DB 1VBA1 3X29B 4BLIA 3D5OA 1BQPA 1CAVA 3RG0A 1KDKA 1EP0A 2WFPA 2ZX2A 3SH3A 5BNQA 3KZ4C 2X53S 4DY5A 4R9CA 1S0FA 4U36A 1UF2C 4LO8A 3USSA 2R49A 2XWBB 3ZYGA 3NL1A 1AYN1 1PZ7A 2RM22 5E88A 1BBT1 1HQLA 5FMOS 4WVMA 1EPZA 1KITA 2HWD1 4J1XA 4KBBA 5CG8A 4L2NA 2W08A 4CP1A 1ENSA 1R081 2DVGA 3OCPA 1HQWA 3VBHC 5D8AC 4RQPB 1RVF2 1LULA 4XF0A 3APBA 1S0BA 2NQYA 4ZU7A 1X33A 2RMU1 2EIGA 3DPRC 4NWWA 5K0UB 1VLNA 3ZPYA 1W6OB 1RUF3 3OYWA 4MUVA 2R061 1O3SA 1VBC2 3DN7A 4S2GA 3AJYA 4FCAA 3WV6A 2GMEA 2PHFA 4OHWA 2MHFA 3WVJA 4AI0A 1WMDA 2K2SA 1FX5A 5GJ6A 3WR0A 2YXSA 2GH8A 3INAA 4MX3A 3N7LA 2B8MA 5KXEA 1YFXA 3N36A 2WT2A 2GSYA 2BNNA 1WW7A 4Q4Y3 5C4WC 5EYYA 2TNFA 5HCBA 4JTOA 2DVFA 2WINB 2DCZA 4DINB 4GXLA 1DDLA 2XVGA 4I2OA 1Y9QA 5EJ3A 3H7YA 5BNOB 2WZR3 2Q4SA 4DQAA 4AEDA 1OOPC 2WNUA 1LEDA 4RSUA 1MS1A 2O8OA 3ZXJA 1M4WA 2OZ6A 3SCFA 1PIV3 2VVEA 1R1ZA 1QOTA 1TQ5A 1UU5A 2WNVA 4YZ5A 1LENA 3AP4A 2JKBA 4YG3A 5E1RA 3HT1A 4XBNA 4ISQA 1PO21 1CX4A 1JHNA 3VBFC 3WUDA 3NO8A 4DXZA 1IKPA 4WV8A 2E6VA 1JBCA 1NE4A 3ES4A 2GNMA 1G9DA 3ZN5A 1N3OA 1QXPA 2WJSA 1ND2C 3NV4A 3LB9A 1DIWA 2BNMA 5CNAA 1QF3A 1OA3A 2HWF3 1QHDA 5I8YA 2GDFA 1AYM2 3JB8A 3CJIB 1XNBA 5DZEA 5ACA2 1U0AA 1XQNA 2R1DA 4YLZA 1ZRDA 3SMHA 3KT7A 3PTYA 4Z2WA 3WCSA 2RM21 4Q1PA 4AFCA 5KHGA 4RGGA 1ASJ3 1QWRA 2VW2A 1ULFA 2NP0A 1DYKA 5CAZA 4EN6B 2FMYA 3CO2A 3VKFC 1SMVA 4IV1C 5FDBA 1W6QA 2O8QA 4GIQA 1AR93 1RVF1 4PBPA 1A8MA 1FOD3 2GC3A 5BXXA 3RJRA 3VBSC 3VBHA 1ALYA 1WGPA 4XILA 4XJAA 5D8AA 3J4UH 2Q30A 2JDZA 2XVKA 2B5HA 1BKZA 4ZU4A 4K9SA 2R1BA 1MS0A 1VBC1 2CNAA 4JGYA 1REFA 5C8CA 1Q8VA 1DG6A 4BZ4A 3DPRA 1C8M2 1UZZA 3GZUC 1VAKA 4F3JA 3GBGA 3HN1A 5GZFA 4YW2A 1GZCA 1ZBA3 2N7GA 2ATFA 3S30A 4LUKA 5HI0A 1REEA 4Q26A 5EWSA 2QKDA 3AMPA 2WS93 1NCRA 1PGSA 1RMU3 5KC6A 2IXHA 1AVBA 4LA3A 4QD2A 2VUAA 3PJQA 1QDCA 1XYNA 4CDWC 2QDRA 2P17A 3ROUA 1R093 2JG8C 4N43A 3O0XA 1C1LA 4BMEA 5CIRA 3KGLA 5CFCB 3AYCA 4COYA 2NPIA 2WLQA 2MNGA 4TSVA 5C4WA 5AC93 3SCHA 1SQ4A 1DQ0A 3KT4A 4IEWA 1OKQA 1RUH3 2CGOA 3MW3A 2R32A 1OFNA 3EQEA 1G9CA 1UPSA 3L2HA 1Q5OA 1CPNA 3I59A 3USUB 3GYDA 1JYIA 1Q8QA 3AYDA 2VQ0A 4LBNA 1BK1A 3WHTA 5J36A 2O0OA 2D6MA 2Q5TA 2GH2A 3J26N 4LBQB 3M7AA 4IV3C 3CNAA 2HWE3 5HCFA 4Y1VA 3ZSMA 4IL7A 1S55A 1FPN3 1SEFA 1N47A 3FLPA 1LEMA 3VBFA 2GNDA 1CESA 1AYM1 2CWSA 1QJU3 3WW2A 4XF1A 1IKQA 5ACA1 1H2NA 4F8AA 4RFT0 5IT6A 1Z0HA 3ZFFA 1BEV3 2VOXA 3KD4A 3LOIA 4M0HA 4KWKA 1RUF2 1XNDA 4WM8B 3RPQA 1L3JA 2VNRA 2IXJA 1VRH3 4Q8LA 1HQNA 1G9FA 5FLHA 2V5YA 3FFZA 4NPRA 2AENA 5FTTC 1OOPB 2MEV2 1DU3D 1J59A 1SLBA 5T55A 4ZKTB 5L73A 3L2YA 4M01A 1KJRA 1LHUA 4AVAA 4DZGA 5FOBB 5IK7A 1XRUA 1J3PA 1X8EA 3JB4C 2XLFA 4GMP0 4BE3A 3IPVA 3J8F2 2X5IC 1RJ8A 4COUA 2P34A 2XHKA 4PF5A 5J37A 5JPMB 4AI1A 4QM9A 1J1TA 5FPZA 5H9QA 2ZHKA 4CDUC 4Q4Y2 1O3RA 1F31A 4LO7A 4N7IA 5IK8A 3VBSA 4OHZA 5K7PA 1C8M1 3AZYA 2HWD3 1ND2B 1CAUB 3ZSJA 1PZ8A 2R042 2WZR2 2PA7A 2CGNA 1Y3TA 5KHHA 2PLV2 5FPXA 3J9SA 2D5FA 1MS5A 5SV5A 4GH4A 1YWKA 3S7EA 3W59A 3ZXAC 4YM1A 2LTNA 3MDPA 1PIV2 5GLTA 4KGGA 4S2DA 1AL0G 1X7NA 3FLTA 2RMU3 2GN7A 1XE8A 1CAXA 2VECA 1LR5A 2GALA 4QPIB 5L7OB 3E97A 1K5MC 2DCKA 2VOVA 3AKSA 1YUDA 5DDJ2 1Y7BA 2DVAA 3EO6A 1DQ4A 5GZDA 4CDWA 1IS6A 4R9AA 2RJLA 2JG8A 2H6BA 3JZVA 1D0HA 3BB6A 3VKMA 3LA7A 1YNAA 2C0ZA 2CL2A 3M3EA 4N9HA 2NN8A 3DF0A 3WP6A 1TMF2 4NHLA 1ASJ2 1XXNA 3ENRA 4BLJA 2VVFA 1H2LA 1RUG3 3RJ2X 3KM5A 4K1YA 1NZCA 4FTEA 3ZYIB 5F6KA 2W0XA 3H50A 3OJBA 2A6WA 5JZGC 4QPGB 2ZOEB 3H8UA 1N1VA 4Q4X3 4QGMA 1GFF2 2AYHA 3RRDA 2AUYA 3MLJA 4L11A 1CQ9A 1FOD2 4BOWA 1KQRA 2UYBA 5C9AA 3JBG3 2JICA 4FPOB 4AWDA 1RUF1 1FI2A 4C90A 2Z2SB 3R0RA 4QMAA 1RUNA 1PO23 5JR7B 5FO9B 1BXHA 1NLRA 2OUJA 2ZABA 4AFDA 2ILMA 2MEV1 1HIXA 5GALA 2ZGLA 4INDA 4BMBA 4Q0PA 5JOYA 5C6CA 2OIIA 5T5PA 4AQSA 1CIWA 2YPJA 4P5HA 3J8F1 2ZHMA 2OYZA 3VBUC 1OD5A 1Q3EA 3U10A 3B3QE 3R6SA 2Y0OA 4COVA 3AYEA 3KLSA 4IEXA 2VG9A 1IS4A 2JX9A 3BODA 2R073 2WLPA 2O1QA 4MGIE 4Q4Y1 3RI9A 1QXJA 2VMIA 3ALQA 4FPEA 1ZYBA 1RIRA 2FHRA 4PLOA 1R092 1JYCA 1KD7A 4AGGA 2R041 2WZR1 2WA3A 4DRVA 5F9TA 2X8KA 3VBOC 2PLV1 3OBRA 3UJQA 4B7KA 4CDUA 4LBKA 3VKNA 3IN9A 4A3XA 4JRAA 2ZGSA 3WQ0A 1RUH2 2BUKA 1H0BA 4FPYA 5CBLA 3B02A 1MS8A 1PIV1 4LTAA 1S0EA 4E4SA 5GKAC 3UJOA 3QACA 4B3NA 3ZXLA 4Q27A 2C5DA 5BPXA 1YI9A 3R05A 5L19A 4HANA 4XDQA 4YW1A