1FOD2

Structure of a major immunogenic site on foot-and-mouth disease virus
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
214
structure length
214
Chain Sequence
b'EETTLLEDRILTTRNGHTTSTTQSSVGVTYGYATAEDFVSGPNTSGLETRVVQAERFFKTHLFDWVTSDSFGRCHLLELPTDHKGVYGSLTDSYAYMRNGWDVEVTAVGNQFNGGCLLVAMVPELCSIQKRELYQLTLFPHQFINPRTNMTAHITVPFVGVNRYDQYKVHKPWTLVVMVVAPLTVNTEGAPQIKVYANIAPTNVHVAGEFPSKE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FOOT AND MOUTH DISEASE VIRUS
publication title Structure of a major immunogenic site on foot-and-mouth disease virus.
pubmed doi rcsb
source organism Foot-and-mouth disease virus
molecule tags Virus
total genus 46
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 1993-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1fod200
4CDWC 1RB8G 1PIV2 1R1A1 1RUC1 1ND3C 1ND2B 4GB32 4GH4A 2HWD3 1RVF2 5C9AA 1R082 4SBVA 3TN91 2XBO3 1VBA1 2MEV1 1AR62 1ZBA2 2RMU3 3NAPB 4N53B 1PGL2 2HWD1 3LOBA 5CFDA 3VDDA 1CD3G 5A32A 4WM7C 1AYN3 1TME2 5JZGA 2ZAHA 2WS92 5A33B 4CDWB 2PLV2 4JGYC 3VBRC 1H8TC 1AR92 1NCRC 1ND3B 1RMU2 5GKAC 4RHV3 1AYN1 4RFT0 3TN92 5C4WC 1RUH2 1QJY2 1COV3 4QPGA 1FOD1 2RM23 3ZXAC 2BFUL 1NA1A 1C8NA 4Q4W3 2XPJA 4NWVA 4RS5C 4PDWC 4WM7B 4LLFA 1RUE2 2X5IB 3VBSC 1TMF2 1BEV3 1WCDJ 1MEC3 4IV1C 2RM21 1K5MC 4JGYB 2R042 2RR13 3VBRB 4Q4W1 1H8TB 3HAGA 3ZFFC 1E57A 1RHI2 1VBC3 1QQP3 1BEV1 1VB2A 5C8CA 5ACA1 3CJIC 5D8AC 5C4WB 1FPN3 4CDQC 3DPRC 2RR11 1B35A 1PO11 1Z7S3 4GMP1 1FOD2 4GMP0 1AL0G 1PIV3 1QQP1 1C8M1 5DDJ2 1AYM1 5CFCC 4GB33 4JGZA 4RS5B 4PDWB 1RVF3 2BPA2 1HRI2 5ABJB 1Z7S1 2WZR1 2RS12 1BBT3 5L7OA 1K5MB 2R072 1RUG1 4GH4C 1RUD2 3M8LA 4Q4Y1 1R081 5C9AC 1X33A 3JD72 3JBG2 5FMOS 1AR61 1ZBA1 2RS32 1TME3 3NAPC 2GH8A 1HXS2 2WS93 5CFDC 3VDDC 2PLV3 2R062 1R092 1OOPA 1AR93 1R1A3 1RMU3 1RUC3 1W39A 1TME1 4RQPA 3TN93 2WFF2 2WS91 1AL22 1PGW2 1QJY3 1D4M2 3J8F1 1AR91 1RMU1 4GH4B 1OHFA 1RUG2 1AR82 1VRH2 2HWE2 5C9AB 5BNOA 1AR72 4Q4Y2 4CEYA 1RUH1 1PO22 1DDLA 1RUE3 1ZBE2 4IV3A 1QJY1 1TMF3 1NCQA 4YVWA 4QPGC 1HQNA 5CFDB 1VBB2 3VDDB 5A32B 1NA1C 1QJU1 4Q4X2 4CDUA 2BBVA 1RUE1 1RHI3 4WM8A 1TMF1 2X5IC 2HWB2 4FTEA 1RUI2 5JZGB 5BNPA 2R041 3JB8A 2BFUS 3J8F2 1POV0 1RHI1 1FOD3 5C8CC 5DDJ3 2WWSA 1HRV2 4QPGB 1BMV1 2R073 5DDJ1 1NA1B 4JGZC 3VBOA 1QJU2 1RUJ2 1HRI1 3JD73 3FBMA 5K0UA 5ACA3 5ABJC 1CJDA 4YVSA 2RS33 3ZFEA 2RS11 2R071 4CDXA 1RUD1 1HXS3 1PO13 1V9U2 2R063 4QPIA 4Y5Z0 4GMP3 3JD71 5C8CB 3JBG1 3VBFA 1C8M3 4RR3A 1A6CA 4Q4V2 1AYM3 2RS31 4BCUA 1B35B 1HXS1 2WFF3 2R061 1BMV2 1R091 2WZR3 1OOPC 1D4M3 4EJRA 4NWWA 2QQPA 2RS52 4JGZB 1HX6A 1RUG3 1AR83 1VRH3 1AR73 5LK7B 1NCRA 4Q4Y3 1R083 4RQPC 2WFF1 1AL21 1PGW1 1AR63 1VBD1 1ZBA3 5L7OB 1D4M1 1NY72 3S6PA 1AR81 1VBB3 1VRH1 2HWE1 2BUKA 1AR71 5BNOC 4Z92B 1PO21 1QJX2 2IZWA 1ZBE1 4RHV2 3ZFGA 2HWB3 5BNNA 4FSJA 1NCQC 4YVWC 5J98B 1VBB1 3VBSA 4Q4X1 1OOPB 4FTBA 1COV2 4CDUC 3J8F3 4IV1A 1EAH1 1MQTB 4WM8C 2HWB1 4CEWA 1RUI1 4RQPB 3ZFFA 3JB4C 5JZGC 1HRV3 1RUH3 5BNPC 4AEDA 3CJIA 2HWC2 1VBD2 5D8AA 3VBUA 1MEC2 4CDQA 1F2NA 3DPRA 4N43A 5BNOB 3VBHA 2HWF2 1QJU3 4CEYB 1NOVA 1RUJ3 1HRV1 1V9U3 4IV3B 2WLPA 5CFCA 1NCQB 4YVWB 1ASJ2 1FMD1 1FPN2 5FMOL 2R043 4CDUB 1IHMA 1RUJ1 1MQTA 5AC92 4WM8B 1POV3 1EAH2 2Y26A 2GSYA 4Q4V3 2FZ2A 5K0UC 1ND2A 4YVSC 3ZFEC 5BNPB 4CDXC 1EV12 1NG0A 5FOJB 1V9U1 1POV1 1BBT2 1PVC2 4QPIC 3NAPA 4N53A 3VBFC 4Q4V1 4RR3C 2RS53 2FZ1A 1RUF2 2XBO1 5J96B 1HRI3 1B35C 2RMU1 1FMD2 2RS13 2RS51 3VBOB 1VBE2 1VAKA 1RUD3 5A33A 4CDWA 1R1A2 1QJX3 1ND3A 3JBG3 1RUC2 5K0UB 4YVSB 3ZFEB 4CDXB 1F8VA 5L7OC 1NY71 1VBA2 2MEV2 4QPIB 3VBFB 1R093 4RR3B 1QJX1 4RHV1 3IDEA 2HWD2 3ZFGC 5BNNC 2XBO2 4WM7A 2TBVA 2X5IA 1COV1 2RMU2 1AL23 2HWC3 1VBD3 2VQ0A 4JGYA 4CEWC 2HWE3 1NCRB 2HWF3 3VBRA 1H8TA 1M06G 1PO23 1ZBE3 1AYN2 2HWC1 4AEDC 1SMVA 3VBUC 1ASJ3 1MEC1 1QJZA 5C4WA 4N43C 1X36A 2HWF1 3VBHC 4Q4X3 5AC93 1VBC1 1OPOA 4CEYC 1EAH3 3ZFGB 4IV3C 5BNNB 1ASJ1 1FPN1 1RUI3 4RS5A 4PDWA 3VBSB 1VB4A 1EV13 5ABJA 4Y4YA 4IV1B 5AC91 1PIV1 1MQTC 1PVC3 2RM22 1K5MA 4GB31 4CEWB 3ZFFB 1GFF2 1ND2C 1RVF1 4Q4W2 2ZZQA 1EV11 1RUF3 4AEDB 3CJIB 1BEV2 5D8AB 3VBUB 5ACA2 4FTSA 4CDQB 1BBT1 1PVC1 1PGL1 3DPRB 1FMD3 4N43B 4N53C 2ZTNA 2RR12 3VBHB 1VBE3 1PO12 1RUF1 1VBC2 1QQP2 5CFCB 1C8M2 2DF7A 1AYM2 1VBE1 1VBA3 2MEV3 3VBOC 2PLV1 1Z7S2 1AUYA 2WZR2
chains in the Genus database with same CATH superfamily
1OFSA 1YJKA 3IIAA 1WLDA 1RUC1 1JOPA 1ND3C 3V64A 5A1LA 2ZEWA 4LHSA 4XAEA 1F35A 5EQUA 4XJUA 5JXHA 2XBO3 4V2WA 2BU9A 2MNGA 3INAA 5IYYA 3D0SA 2AH2A 3HN3A 1I9RA 2RMU3 5FZCA 2JX9A 3SQOA 2UWAA 2Y6JA 1PGL2 2QQMA 2WWJA 1HQWA 3E5UA 2CHHA 4JHZA 1WMEA 4I3GA 3ZM8A 2HWD1 2F17A 1C4RA 3AK0A 4PLOA 4GWJA 4IEYA 4PF1A 4D7TA 1D7PM 4NPRA 4CCMA 2HBTA 4UFJA 1W6OB 2XJVA 4AGGA 2VGDA 3POWA 4FOYA 3H1YA 2PHFA 3PVBB 1ENSA 4HPKB 2K46A 1VMHA 1W90A 4EE2A 1LJ7A 3VBRC 3K2OA 4FP2A 5JOYA 1DLCA 3NQHA 4E8CA 1OVPA 1PK6A 1XE0A 4BISA 1SFNA 5FZLA 3WDVA 1QMJA 3PUQA 5FYVA 1UY0A 5C5TA 4AFBA 2PA7A 4H14A 4LPLA 1RUH2 1F4AA 3OEAA 5FJHA 2ET1A 2KA3A 1Q5OA 1COV3 5CB7A 5FYTA 3T4HB 4K9SA 1AF9A 3O1PA 2A7AA 2VZVA 4HVOA 2YGLA 4L8QA 3ZXEA 1ODMA 3AKSA 4P9IA 3ZXAC 1GQPA 1NA1A 4LE4A 2PHTA 2XPJA 2CU5A 1J1TA 2KR2A 2VMDA 4YSFA 1FAYA 2OYZA 2QQUA 2P3KA 4Q0UA 4XFBA 4AGRA 4UW4A 1MEC3 4QKDA 1AXKA 4Z2WA 2PFWA 4QHZA 1LOBA 1G9BA 3E97A 1LR5A 1H8TB 2BW8A 2YUEA 2TUNA 3C7EA 4LBLA 4AK3A 1E57A 1ULEA 2QUOA 3N4MA 1RHI2 3LOIA 1QQP3 1BEV1 1S2KA 3A0KA 3WXPA 5C8CA 1UMZA 3CJIC 5LW9A 1HJGA 5FBZA 4IE6A 4MHRA 4CXWA 4E27A 1Y4WA 4IQPA 3OJBA 1A78A 4OHWA 3KV6A 4XVHA 2AENA 3MIDA 1PO11 5EFUA 5A6QA 2JE7A 1D4VB 1FOD2 3HBKA 2ARCA 1C8M1 3LEIA 1K3IA 2CL2A 1A8MA 2AYHA 4Q0PA 1AYM1 3N9LA 5DDJ2 1MR5A 4DXRA 4RS5B 4Y5SA 1FNYA 5CAZA 2PAKA 1CAWA 1O4TA 4EN8B 1HRI2 4XHBA 4B1LA 5GZEA 5CG9A 1BJQA 2RS12 1BBT3 4HMZA 1K5MB 3ALQA 5FP8A 3A21A 2VMEA 3SH4A 3FC0A 3SITA 1J3PA 3TWIA 4GH4C 3M8LA 4BZ4A 1OF3A 2DUPA 4UW3A 1R081 2D6MA 1X33A 1F15A 2V5DA 3JD72 2W1SA 4FFHA 2HH9A 5FMOS 1K45A 2WINB 2RS32 3BTXA 5K4LA 2ZOEB 5IAXA 4NRMA 1G8WA 5DAWA 1OBNA 1DFQA 1SLTA 1UXXX 1KQRA 5CFDC 2I2SA 3PL0A 4DXSA 1APNA 5A3WA 4YYOA 3EHKA 4FPFA 3IPVB 1RUC3 2VCMA 4CCCA 2CSGA 1TME1 1LGNA 1JXNA 2Q1ZB 4TWTA 4JQTA 2D7FA 2FMYA 1LEMA 4NHKA 2W68A 3K4DA 1EPZA 1F31A 3T0DA 1D0HA 1DZRA 2QQJA 4COWA 5C70A 1ZRIA 1JYWA 2VOXA 3J8F1 3BYWA 1AR91 1H8VA 4OFGA 2X8KA 3LEGA 4CE8A 3NO8A 1YWKA 2VUDA 1PX4A 3I59A 2XLAA 1RUG2 1ZX5A 3I4IA 1HKDA 1JU4A 1VRH2 1KDKA 1GZCA 4S2DA 3VN4A 5KHIA 5DN2A 3KV9A 4RFRB 4LXLA 2ZXQA 3M3CA 2XQXA 1PVXA 1WGPA 3Q8AA 4IV3A 3RJRA 4AXOA 5ISLA 3CF6E 5F2WA 1ULOA 2CDOA 1MACA 1STMA 1IS5A 4N9HA 5FY1A 4A2UA 3SEEA 3VKMA 1UOBA 2R0HA 4JDNA 1J1LA 3AP7A 3KV4A 4LEJA 1O3RA 4Q1PA 1BKZA 4JTNA 4CSWA 1KDMA 3NNGA 1XNBA 4N90A 1UXZA 1TMF1 4S2HA 4W50A 4LBJA 3W21A 2OVUA 3PUHA 2EXIA 3ELNA 3TBDA 1JYXA 5HI0A 2PAEA 1SDWA 2DCJA 4EWEA 4BIFA 1QNWA 5BNPA 2P6CA 3SLIA 1ZA7A 4F8AA 3SHRA 2BFUS 1S0EA 4TTGA 3K51A 4XETA 2A73B 3GJAA 4AI3A 2DBIA 2D6PA 1PK6B 2ZKLA 4F7ZA 2JDAA 2WJSA 2WWSA 1E5RA 5BXXA 5A1AA 1HRV2 1DQ5A 4BQ3A 1G9AA 2D97A 3D8CA 1OH4A 4TYSA 1DZQA 4BLJA 1BMV1 3ACLA 1CWPA 2NPIA 3HNYM 1MZEA 5JPMB 1NA1B 3MFCA 3M3OA 3ZPOA 1RUJ2 4IESA 3F2ZA 4DB5A 3NKTA 1T6GC 4XF4A 4GWNA 4B8EA 2YB7A 2VCBA 3AL5A 3TEYA 2R071 1NLSA 4IEPA 1ZRRA 3C2UA 2W52A 5JLVA 3UGHA 4QAWA 1HXS3 2JG8A 1PO13 1DU3D 2XJPA 4R4ZA 1RJ7A 5C8CB 1X50A 3JBG1 1IGOA 1CZSA 1C8M3 3WINE 3DECA 1A6CA 1V6JA 2DTYA 3IAPA 4Q4V2 1AYM3 2E9QA 3AZWA 4YWAA 4AE2A 4A7KA 4B4RA 3RZJA 4BCUA 1CGPA 2VU9A 1PNGA 2D44A 1SBDA 3H8XA 4TZDA 3ES1A 2WFF3 1TQ5A 3LDBA 2UYAA 1R091 2RDRA 5J7MA 2VTFA 2DWRA 4NWWA 1AX2A 4CUCA 1HX6A 2D3PA 2DUQA 2GN7A 4GKXA 4A44A 4KMQA 5JZGC 1AR83 1CAWB 4ORFA 4OLLA 1NCRA 2EVXA 1R083 5FLHA 5A7QA 1VALA 4J25A 4FFFA 1N3PA 1VBD1 1D4M1 1J3RA 3I2JA 1BQPA 3P1IA 3R6SA 5LATA 3RG0A 1SCRA 4XURA 5I0UA 2ES3A 5IVEA 3S30A 1GUIA 3LEMA 1VBB3 2VMIA 1VR3A 4FVVA 1W9YA 3WQBA 1SLAA 2VL4A 2ADEA 1AR71 2WWUA 3WR0A 5JOWA 2W1WA 3A0NA 3SMHA 5E16A 1LNSA 1PO21 4N8MA 1O7FA 5A3MA 2Z5WA 1L3JA 2H0VA 5JDBA 4FSJA 2CYFA 1DLLA 4IEZA 5ANQA 3U10A 4YZ1A 2W0XA 4C1WA 4DY3A 1SCSA 3KSCA 4CPBD 5I93A 5FREA 4EZ4A 3KQ4B 1MS1A 1MVQA 2FMDA 3OGVA 4XCAA 4M3CE 3IMMA 3J8F3 4CPBA 2R32A 4YGDA 4CP9A 1W6MA 2HWB1 2QE3A 3QCWA 4CEWA 3S5AA 3ES4A 3ZFFA 3PUAA 5DZEA 1GZWB 5B2GB 4OMDA 3ZYFA 4OUSA 1O6UA 5JSRA 3R4SA 2E31A 5D8AA 1OA3A 5JR7B 1IPJA 3I59B 4CDQA 4N43A 4M0NA 3DF0A 3KVAA 3AMHA 4QDSA 2HWF2 2VCCA 1XU1A 2VR4A 4YW2A 5L9VA 4YFWA 4IV3B 4IXLA 1Q3EA 2GH2A 3LCPA 4FI9A 4FPOB 4XFCA 5CFCA 5FYCA 5FYSA 1H9WA 2VBBA 1W05A 4G4FA 4LJHA 1WCSA 2DFBA 5DG2A 1LAJA 3CL1A 5DZGA 3NJZA 3OD4A 5HV0A 4MGTA 1IHMA 1RUOA 4DY5A 4QXKA 2B9VA 4LKFA 5FYUA 3ZKYA 5T52A 4A42A 5T54A 5K0UC 3GYDA 1ND2A 3ENRA 4YVSC 1IS3A 3KLSA 3ETQA 4HOOA 5BNPB 3DEMA 4P08A 5HCFA 3RDIA 1GOHA 2C26A 3GBGA 1ODNA 1V9U1 4Q2FA 2ZX0A 2EAKA 3NAPA 4FPCA 1GP6A 5FZ8A 4QKNA 2WA3A 1YQ2A 1IQAA 1UNBA 4WBBA 3C7GA 4LHLA 3GXUA 4ARXA 3ZXJA 1Y3TA 1CZTA 2EIDA 2YY1A 1B35C 4WZCA 1NQJA 3ZR5A 3ILFA 3RJ2X 4FQ4A 4EROA 3O5SA 4CP0A 4OVEA 4UBHA 5F5IA 4O9GA 3WNKA 2VZOA 1VBE2 2WN3A 1VAKA 3O0WA 3T4VA 1J84A 4R9DA 5L36A 5M0TA 5A33A 4CDWA 2BRTA 2H6BA 1OA4A 1YXWA 1MS5A 1R1A2 1QJX3 2JKXA 3JBG3 5T5LA 2KM2A 2ZX3A 1W2AX 5DUUA 1F8VA 2YC0A 5T50A 5L7OC 1Q8OA 1H4HA 1NE6A 1NY71 3LWCA 1VBA2 2JG8B 4A4AA 4P00B 4D94A 1V6KA 4AI8A 3TYJA 1JZ3A 1R093 2JDYA 4WZFA 1LCLA 4D6SA 1E5HA 5JUVA 4AVSA 1OUXA 1Q56A 1YFYA 2WLQA 1KITA 3IWZA 5FXWA 4FCAA 5BNNC 5FV3A 5F3IA 4QPWA 2EXJA 1JI6A 2ZGSA 5FO7B 2ADDA 2WNOA 4WM7A 1KD7A 3AP6A 4OHYA 5IVJA 1X82A 2HWC3 1VBD3 3FL7A 3TRSB 2WYSA 3WUDA 2QQLA 4EWAA 1AJKA 1OURA 1JMUB 3AFKA 4JGYA 5IW0A 1O3SA 1NCRB 1XPWA 1SEFA 1W06A 2P3IA 3I3MA 1LODA 2NZ9A 1PO23 5DQ0A 4YM3A 5APAA 4R4XA 1AYN2 1PZ8A 4XACA 2WSVA 1SMVA 4AYUA 1QOOA 3OPTA 1GICA 4AQSA 1S1AA 1X9TA 3LF7A 3Q8BA 4YGEA 3OB8A 1W03A 1DQ0A 4Y3OA 2GP3A 1WUVA 3GDBA 3NJXA 1US3A 2YFZA 4ZY9A 1F5FA 4CEYC 2HYKA 2Y6GA 3VZLA 1C3HA 4UFIA 3VDAA 3KF5A 5GZCA 2PMWB 2BWCA 5KWRA 1FPN1 2HJIA 1VB4A 5FY7A 1OSGA 1O4YA 4ZXEA 4Y4YA 2R7EB 4MXWA 2CY6A 3L2HA 1MQTC 4CP9B 1PVC3 1W6MB 2D6LX 2DCKA 4WVMA 4GD4A 2RM22 1WD4A 5JXJA 4CEWB 3ME2A 2YMZA 3ZFFB 5LA1A 2V4VA 3K75B 3GALA 2QZ2A 3KCYA 4KQ7A 2ZCWA 2IFWA 5CKQA 3WDXA 2GMEA 4DUXA 1RUF3 2J1AA 5EJ3A 3AVRA 4MOAA 3U4SA 5D8AB 2VQUA 2YC4A 1JYNA 4KU8A 4AVVA 4FTSA 4CDQB 2BGOA 1PGL1 5IUQA 5LK5A 1IPKA 1TVGA 1UZWA 3NW4A 4N43B 5FYIA 3PTYA 1UL9A 2RR12 2ZGOA 2E7QA 1MS0A 5JOZA 3T08A 3QOPA 3SH5A 5FP7A 1RXFA 4LITA 1BYHA 2WAOA 1VBC2 3HBZA 3IKWA 3SCFA 5CFCB 5FO9B 2VCAA 1VRBA 2DF7A 2E63A 2SBAA 3I2FA 3JU9A 4NRQA 2G9GA 1JW6A 1XNAA 2ZX4A 1ST8A 1I6XA 4BK5A 4NUBA 4YM2A 2XVLA 2PQSA 3VBOC 4JDMA 1H1MA 2OA2A 1VMFA 2A75A 1AUYA 1NAEA 1V9U3 1PIV2 2ZBJA 1BXHA 3AMQA 3LIHA 1OA2A 4IEWA 3MPPG 4DQAA 4ZZ8A 1ND2B 3MUZ1 2QBXA 4GB32 4UFKA 3THCA 5K8SA 3M3IA 1JS9A 3LFIA 5HCHA 2VPVA 1RVF2 1ULGA 2B5HA 4SBVA 2EIBA 2XWBB 2HEWF 3HOBA 2JD9A 2MEV1 2V72A 2ZEXA 3WG3A 5FWJA 1D0GA 1ZBA2 5A7WA 4AFCA 2AGSA 1V00A 3NAPB 1WLTA 3I2OA 1HV1A 2WZEA 4Q0SA 2XDVA 4K8RB 1JOBA 2Y60A 3BU7A 3LSDA 2JWPA 3LOBA 3UL2A 5DUVA 1CD3G 3VDDA 5FPXA 1REFA 2JDUA 1W8FA 2PHLA 2Y38A 4QX1A 5GZFA 3BGAA 4BMEA 4HANA 2XLFA 3EB7A 3FHIB 3NKGA 4N7IA 3NNMA 3FFZA 4EV0A 1SHWB 1GV9A 1TE1B 1UOJA 2D3RA 1QH7A 2WS92 3HEIA 3NV3A 4HBNA 4XF9A 4CDWB 5A33B 3SNMA 1BK1A 2JIJA 1N1SA 1H8TC 1JZ7A 4K6BA 4GALA 4HETA 4LO7A 1RMU2 2K0GA 3JXSA 5DUXA 5JCTA 2LTNA 1W9SA 3BVCA 3UJQA 1PMJX 1LHNA 1SACA 4O65A 1W3VA 5L19A 1SDDB 4URTA 1NZCA 2VZRA 1QJY2 2WBKA 3V0BA 4I0WB 4W4ZA 4QPGA 1FOD1 2EICA 1G7YA 2AZ5A 3WT3A 3S0MA 3AZVA 3AKQA 1JZ4A 5FZFA 5JSPA 1TEIA 3FFQA 3ON7A 2VZ3A 2XWJB 2BFUL 3VHOA 3CIHA 4D0QA 1C8NA 3AVSA 3N9QA 4Q4W3 4RS5C 3RNSA 3ETPA 5JXGA 2C5DA 3ITQA 4WM7B 1FI2A 1RUE2 1BLZA 3J4UH 2ZGLA 3VBSC 1UAIA 5F37A 4FOQA 3ZXKA 1UYPA 1WCDJ 2WABA 1DYPA 2AUYA 2JE8A 2Q5TA 2HEYF 1PGSA 1K5MC 2YBKA 4JGYB 4ES8A 5C3SA 4UWDA 4R9CA 3I2GA 2ARAA 5L73A 5ACA1 3UK9A 2X10A 3D5OA 1FPN3 4LA2A 5T3NA 2I74A 4MH0E 4DEVA 3D4KA 3DPRC 2ZS6B 3PURA 4Y33A 1Z7S3 2Q1MA 4GMP1 4GMP0 1AL0G 1QQP1 1UY3A 1WWYA 1DF0A 2D5FA 2VUAA 3UGGA 2GZWA 3N7MA 4I01A 5I0DA 3WZ1A 4PCRA 5B4XA 5IVYA 4INDA 1OPMA 2JG9A 1XQNA 4MXWB 2XKPA 1PM4A 2FDHA 2WZR1 4ARYA 4WVMB 1Q8VA 2CAUA 4GJZA 3POSA 4EYUA 5A6ZA 4QB1A 4KWJA 3ILRA 1RUG1 3BI3A 4UFLA 1XJAA 4C8DA 2RHPA 3LSEA 4QX7A 1QOSA 3O1TA 2PXJA 5HPOA 2Y34A 4AVBA 2Q8OA 2W08A 4Y1ZA 4F3JA 2OXBA 1V6LA 2R1DA 2BGPA 5J48A 3LPFA 1ZRFA 3Q8EA 3KMHA 4WVVA 4XMIA 3I2DA 1CQ9A 3FLPA 3VD4A 1U5IA 2VH9A 1W0NA 2P6HA 2DVAA 4Z07A 4CU7A 3BTZA 2R062 3PU8A 1OOPA 2VECA 3MW2A 5FZKA 4AQTA 3Q9OA 3GHNA 1UYYA 2WNUA 3VKLA 4HKWA 4IGPA 2G19A 1IS4A 3BTAA 1WCUA 1I3HA 4RQPA 2RDNA 4M3CA 3UKVA 3MGUA 5K9YA 4ONUA 2ZGMA 3VUOA 2J22A 1AL22 2XOMA 1LOFA 1D2SA 3MF6A 2ZGRA 4XOGA 3ACHA 5C5UA 4AEMA 4DRVA 4XCBA 2P17A 1PK6C 1W8HA 2VULA 4ITCA 3MLLA 4KBZA 5BNOA 2XJTA 3RWNA 4XAAA 4Q4Y2 5FXVA 3WD5A 3KGLA 3O1UA 3NSTA 3NNFA 2VVEA 1QJEA 5A7WB 5JMOA 2D6OX 2XVKA 1ZNPA 4XTMA 5FZ3A 3ZSMA 1JBCA 1W9FA 1U5XA 4YVWA 4IERA 4EZHA 4MGSA 3OGSA 3IDCB 4L2NA 1YFXA 3DN7A 3VDDB 3IAQA 1NA1C 2C24A 3PUSA 3DKQA 1BVVA 2X53S 3D6EA 1MZFA 3N9MA 4CDUA 4NRPA 2BBVA 1K42A 1FV2A 1RHI3 4WM8A 3RZGA 3OGJA 2X5IC 4C0BA 1RL3A 4FTEA 1OMIA 1SLLA 1RUI2 4AAPA 3APBA 4QDRA 5CEHA 4COVA 2YFUA 1LENA 4OHXA 2R041 1S4CA 4XF3A 5F3EA 1DIWA 2XQRA 4LTAA 3VLBB 3JB8A 5BUVA 1LECA 1POV0 2FCVA 2NM1A 1FOD3 2OUJA 3O0VA 4M01A 5T55A 4XILA 5FMCA 5C8CC 2ERFA 5DDJ3 4XJZA 1UIJA 4IEOA 4MSVA 2B4KA 1YQ6A 3H42B 3W59A 3V0BB 3SCHA 1QNYA 4KU7A 4QPGB 4DPNA 5IVVA 1VAMA 2PAMA 2VMGA 5DZFA 2WO3A 3PMEA 4BDVB 1IQDC 3I54A 1WW4A 4QXCA 1SBFA 3ILNA 3VD9A 3RZLA 1UKRA 2EF6A 4Z2AA 2PQQA 3NV4A 1UO9A 1ZVFA 1O5UA 3WLUA 4JDOA 1R64A 1RC6A 2Z42A 4AGVA 3JD73 3NWKA 3FBMA 2DDUA 4U2AA 4CA9A 4BQ5A 1OQEA 2EIGA 4LUMA 4XEZA 3UKTA 4CP2A 2RS33 5ACA3 5ABJC 2IWGB 2PHXA 2FHRA 1LHVA 2WO7A 1YIFA 2TNFA 4JKKA 4YLZA 5FPVA 3WP4A 2E7TA 2XKOA 3ZYHA 3M4FA 1RUD1 3E5QA 2UYBA 2DCTA 1SBEA 4Y5Z0 3B93A 4GMP3 3WNLA 1SLBA 1S0JA 4IE5A 1HN0A 2ZHMA 4J6GA 2UURA 5A6XA 2NP0A 1XXNA 3WEZA 3GHMA 1HXS1 2R0FA 5KXBA 2WZ8A 3BB6A 4LUKA 5EXOA 4CXXA 4IEUA 3GZUC 3BKZA 1UKGA 1NT0A 2WZR3 3MLJA 4EJRA 2RS52 1FNZA 1RUG3 5FKBA 3SC7X 2GC3A 1ULFA 1VRH3 1XE7A 3A4UA 3G6JB 2PTMA 1T6BX 1JU3A 2JG9B 2WFF1 3AKRA 1LU2A 2YPJA 3HT2A 3K3OA 3VDCA 4B1MA 4D8MA 1PGW1 2IXCA 3WG4A 5SV8A 1GSLA 2XJQA 4H2AA 4Q27A 1R1ZA 1OFNA 1CX1A 1CPMA 5A3LA 4B7KA 1OH3A 4O9EA 1AR81 4HK9A 4MGZE 2HWE1 1MZ6A 3U78A 4B3NA 4Z92B 2DVGA 2WT2A 4P9WA 1ULDA 2DVFA 4YG3A 1ZBE1 2D5HA 2RDQA 3R0RA 4FO9A 5DPNA 5LY2A 3RFRA 3V0AA 4I30A 3AXEA 4AVCA 4DO0A 1W28A 4QQHA 3EQEA 3ABZA 4Y5TA 2OQ6A 1VBB1 4OHZA 1ZRCA 4Q4X1 1OOPB 1LRHA 1COV2 4FFGA 2BDRA 2E6VA 2VMHA 4QGNA 5GZGA 5FYBA 1O3QA 1UYZA 3NNLA 2E32A 3PU3A 1XOYA 3CMGA 3X29B 2WNUB 3FBYA 1X8MA 1Z7S2 4D3WA 4HSJA 2GALA 4HL0A 3WF2A 2Z79A 1QY4A 3MV01 4RQPB 2GU9A 4M3CB 1HRV3 4MGKE 4EN0A 4PBPA 1KJLA 3ZN6A 2K9ZA 1U5ZA 4LE3A 4Y1VA 3KVBA 1Q8QA 3RQ0A 4BQWA 3CJIA 4CCDA 5BNPC 1GNHA 2WC2A 3QH7A 1LU1A 3OF1A 3VBUA 1OVSA 1MEC2 1FXZA 3H0OA 4DMIA 4LLOA 3D82A 3ZYBA 1KFUL 2A1XA 3GNEA 3QH6A 4RL7A 2Y6FA 5BNOB 3VBHA 1NOVA 1RUJ3 1ZZ9A 5T5JA 3S7EA 2VMFA 2WQZC 4YW6A 2VBDA 1U0AA 4YVWB 3ZYGA 1ASJ2 2EIEA 1CAUA 1LHUA 2C4XA 2YROA 1W8NA 2CV6A 3RPQA 3SEPA 4DZGA 5HBAA 4YZ2A 2ZGNA 2QQNA 2R043 4J1XA 5DAXA 4CDUB 4A7ZA 4MVTA 2RJLA 4OZXA 5AC92 3K4AA 4WM8B 1POV3 1EAH2 4X8PA 2Y26A 4NMIA 5I91A 1WW5A 5IVBA 1WBFA 4NAOA 1QXJA 4Q4V3 2ZMKA 3E1F1 3ASIA 3O1RA 1UY2A 3PHMA 2WNVA 3H7JA 1EV12 1XE8A 3ZOIA 4IGQA 4DOUA 5FOJB 2GC2A 4Y24A 3KHBA 3RYKA 2JICA 1U5YA 2VNRA 3H9AA 1XRUA 2JG8C 3WW4A 1BBT2 1LGCA 1HB1A 5JPNB 5H9RA 1NLRA 5FXXA 4XJ8A 2R1BA 1UWWA 4AI2A 1UY4A 1X8EA 2W2IA 3P3PA 3KB5A 5C3PA 4CVUA 2FZ1A 4ES9A 1MPXA 3GBFA 1A34A 1QKQA 3I3DA 5HCAA 3OTFA 1SZBA 1C5IA 1UMHA 2WT0A 2P3JA 4K40A 4E4DX 1O59A 3KT4A 2IXHA 1YRZA 4MV2A 3ZMNA 5C33A 5GALA 4N7UA 3SKVA 3A23A 1RUD3 2W5FA 2ZHNA 4K8FA 4JKMA 5HXVA 3TEXA 3MIEA 3VDBA 5T5OA 1S55A 1ZRDA 3FN9A 5KC6A 2WYFA 1RUC2 2FDKA 4HLTA 2WKKA 1GU3A 5FY4A 3VHPA 4XUTA 4BPZA 1REDA 1UN1A 3B02A 5KBFA 2F4LA 4R9AA 2P34A 1OLRA 5F7UA 3BALA 5HV4A 2CWMA 1SFYA 5G04L 5IVCA 3QACA 4P9YA 3T30A 1IKQA 1S0BA 1G86A 1S0FA 1GWMA 1QJX1 2VM9A 4JRAA 4Q26A 4QXHA 4RHV1 5FYHA 5FCCA 3AJYA 4J1WA 5DMYA 2HWD2 2B8MA 1UQXA 1OLQA 2A71A 4XFIA 4CUBA 4QWNA 4YGCA 3LE0A 3UKNA 4AHZA 2CGPA 3WQ0A 2W95A 2LUWA 1Y9GA 2YG0A 3OPZA 1S0CA 3WF4A 5FUIA 2ID4A 3AYDA 4DEQA 4X6RB 4CEWC 2HWE3 2HWF3 5FPBA 3R4DB 1FX5A 2ZZJA 4IEVA 3SCGA 1GZTA 4JC1A 2VTXA 1M06G 1OKQA 1HV0A 1ZBE3 5I8YA 2HWC1 4AI9A 3N9NA 2JB4A 5C4WA 5FZ7A 4N43C 1LTEA 2JKBA 3I3BA 4A45A 1CESA 1W6QA 1GNYA 1M4WA 4NN0A 4Q4X3 4A3ZA 5J09A 1VBC1 3V0AB 3MICA 5GLTA 2IC1A 3BODA 4BOWA 5LEKA 1BVP1 3IIIA 1GQGA 4E4HA 1IZ3A 5A70A 4GJYA 4BU2A 2UY8A 4PDWA 3OPWA 2GNMA 2BOIA 2QQOA 1SLIA 3NRUA 4G9SB 5FK8A 5JOXA 4AHWA 2DBNA 4XABA 3CQOA 5C6CA 1PIV1 2ZX1A 4YW5A 3E6BA 3CO2A 3F95A 1ZZBA 3ZSEA 4FQZA 3H1WA 4GB31 3ZX7A 1ND2C 3FWEA 1RVF1 5BNQA 1JOJA 3JUUA 5JVVA 4I09A 3ZN6B 4LOSA 1OQ1A 3TNQA 3KHCA 3ACIA 4HXCA 2VC9A 3CJIB 5LWBA 1BEV2 3MF9A 3VBUB 3ZSJA 4COUA 5A6YA 1WZXA 2JECA 2RDSA 3N9PA 3VD5A 1PVC1 1ULPA 1TNRA 2ILMA 2ZTNA 1ZZ6A 3LPGA 3GZAA 4NO4A 3VBHB 1VBE3 1GBGA 4Q8LA 2OPWA 1PO12 3MZHA 4CU9A 1O8SA 1O91A 4MG2A 3ZR6A 1RUF1 2VBPA 2VQTA 3KF3A 1AX1A 1YFUA 4XBLA 5HCBA 1C8M2 4YRDA 3ZKUA 1CAUB 2XH6A 1AYM2 4NR1A 4QDQA 3UESA 3H7YA 5FY0A 5I0TA 3O1VA 3HQRA 3WNXA 5FZHA 1GYKA 2VW1A 4P9LA 3OD0A 3AP5A 4OI4A 1VBA3 1W6PA 4LO8A 5FPZA 3RMXA 4ASLA 3MO4A 4CDWC 1RB8G 2FDFA 4IGOA 4KNCA 4NHLA 5FP4A 4D6QA 5AFEA 2W94A 5F8PA 1F9KA 2VG9A 3MFAA 3O1MA 5CYYA 4ZU5A 4Q0QA 2WNVB 3OGGA 2V73A 4HVRA 1G9CA 5EYXA 4COYA 2ZMNA 2O1QA 5C9AA 1R082 1RYYA 2VD7A 3M1HA 5EZWA 2J7MA 3KT1A 2NQYA 3B01A 4QHBA 3J9SA 4GKYA 4OQ9A 4PLNA 1W99A 1XBFA 1N1TA 4UAPA 2OUHA 1KGYA 2WA4A 3M7AA 2Q8DA 2BVBA 2WFPA 5DAPA 3HVDA 4LK7A 3ACGA 1HDKA 1CAXA 1QGLA 2WQ4A 1YO8A 3P3NA 4W6XA 3KZ4C 4KGQA 3OG2A 1W2TA 3I7DA 4WM7C 2VNGA 1AYN3 4E8DA 1PHMA 2ZMLA 1TME2 3AXDA 3OBTA 1OT5A 4UI9L 5C3OA 2ARXA 3I3EA 2O14A 4EWDA 2C9AA 2XUEA 2ZAHA 5C3RA 4LKSA 2GNTA 1E5IA 2H6CA 3P6BA 4BXSV 3JQXA 1SFPA 2PLV2 2ET7A 2JD4A 4JGYC 4AZZA 2Y6KA 3FLRA 1AR92 4QQPA 4YZ5A 5AFBA 1P8JA 3RRDA 4CUGA 4RHV3 3AC0A 3LD8A 2BWAA 3WV6A 2H0BA 5FZ1A 4QX2A 3W20A 4QB6A 4CCNA 1IKPA 1KS4A 2ORXA 3WNOA 4BIOA 4AW7A 3TN92 5FZ9A 3FLTA 3B00A 3MBWA 2GNBA 1J59A 1PMIA 1XYOA 3USSA 2I07B 4M00A 4X8NA 1YHFA 4XIKA 1NZIA 1SQ4A 4U36A 3VGIA 3WQ1A 1JZ5A 1UPIA 3E6CC 2RM23 4RGAA 2GC1A 2DCYA 2D6NA 4QKFA 2IXIA 2RE9A 3DKWA 4EN6B 4LLFA 4QU2A 5D2AA 1N3QA 1TMF2 1Y9MA 1ACCA 2XGXA 2JDNA 4D7SA 5C3QA 1UZYA 2E33A 2QKDA 3DV8A 4IV1C 4IETA 2QJVA 2QQWA 4W8JA 2G4IA 2GMPA 1QWRA 3AMPA 2RR13 5TSWA 4OI2A 3FJSA 3ZXFA 4Q4W1 5JXIA 3HAGA 4XJWA 4XDOA 5FPAA 5JI7A 1NXMA 1VBC3 1X9PA 4LNVA 4YG6A 1VB2A 1HLCA 3FUOA 2R49A 2WL1A 4MGQA 1O8PA 5C4WB 3H8OA 5FZOA 3HNMA 4I3PA 3WNMA 4LQRA 5LBFA 1W6QB 1B35A 3HR9A 4ZHNA 1W8TA 1H0BA 3OYWA 4LOTA 3HT1A 3S57A 1DGWA 1PIV3 4XJ9A 5FR3A 5LZ6A 3PUIA 2VNVA 1FV3A 4GB33 4JGZA 2DVBA 1SPPA 2OT7A 3PDQA 1YNAA 3POGA 4PDWB 1RVF3 1OF4A 3CZJA 3B7MA 1AVBA 2HEVF 3GF6A 2BPA2 1OKOA 1WMXA 1RJ8A 2J1EA 1GWKA 3K3NA 3TOJA 4LMFA 1Z7S1 2JDHA 5DXDA 4FFIA 1CIYA 4H7LA 5L7OA 3M2MA 2R072 2YXSA 3IDBB 4BLIA 1AX0A 1DP0A 2QQKA 2E7AA 4ASKA 2Y0OA 5FP3A 1LHWA 2UWBA 2JDMA 4CU6A 4NIAA 4Q4Y1 1S0DA 3R05A 3EYPA 3JBG2 4IE0A 4YW4A 2C1FA 1UOFA 2VTXJ 2XONA 4QX3A 2G9ZA 2BGCA 5L9BA 2ZHKA 2GH8A 2YBSA 1DCSA 4FBFA 4GIQA 4IUGA 2WS93 2GDFA 1Y7BA 4IE4A 3VDDC 3KGZA 4DS0A 1R092 4XQDA 3I49A 1VMJA 3EXUA 1RMU3 1I5ZA 2G1MA 2Q1FA 1NKGA 3IMNA 1DZTA 1UMIA 1W6PB 3WUCA 5F1RA 2XUMA 4PT6A 3BPSA 2AEYA 2IXLA 1QJY3 5KHGA 3ATGA 1D4M2 1O5LA 1QOTA 2JE9A 2R16A 2ZA9A 4CCKA 4FPEA 5IK7A 5F6KA 1OHFA 3H3UA 4LORA 4NHXA 3KT7A 3A22A 2Y33A 5C9AB 3E6DA 1AR72 1IOAA 2IVIB 2PYTA 2W46A 3DXTA 3KD4A 4CEYA 5DAQA 1RUH1 1PO22 1DDLA 1RUE3 1DBNA 2YV8A 3GGLA 4QM9A 3WOGA 4YM0A 2NLRA 1DGWX 1YC61 4HG6B 4CCEA 4W65A 1NCQA 4QPGC 2BJSA 3VV1A 4SLIA 1EP0A 1HQNA 3AJZA 4L9BA 3EBRA 4OI1A 1CAXB 1W0OA 3MDPA 1OD3A 4PIYA 1W9WA 2RJKA 3BCWA 5KHHA 2YU1A 3ZDSA 4E2GA 4DINB 1ZYBA 4DXTA 2HWB2 1JH5A 5GLVA 1W2UA 5FY8A 2CAVA 3ACFA 4K20A 2ZEZA 5FAXA 3OCPA 3MV11 4NE9A 3G7DA 3VHRA 4FPKA 5ERLA 1GLHA 4UF0A 3ZXGA 1W6NA 1RHI1 1AHSA 1ENRA 2XHKA 5CADA 1ZZCA 3MPBA 4PLMA 4YFZA 2N7GA 2QCSB 4XIOA 2WDBA 3N35A 4S2FA 3ZXDA 4XF0A 3RVHA 4QQ2A 4LO5B 5J3UA 1YQ5A 5LA0A 3T1MA 2ZHLA 5DDJ1 3HN1A 4PIZA 4BQXA 2QDRA 2HLEA 3VBOA 4R9BA 1OLME 1QJU2 5CNAA 2XB6C 1ZZ8A 5EWSA 3BN6A 4GAZA 5CVRA 2YHJA 4HONA 3PJYA 1HRI1 1HIXA 1DYOA 1YCIA 2BYVE 3AKPA 2JG9C 4BMBA 5JI9A 1EY2A 1CJDA 3PVNA 2YU2A 1NQDA 3NJVA 2RS11 4YW3A 3ZFEA 4NIGA 2Y6LA 4BM8A 1MZ5A 3B94A 4CDXA 2Q0AA 5EIYB 1YLLA 4QHOA 3MHZA 1H2NA 1V9U2 5CZKA 5FBJA 1PMHX 2R063 1KEXA 1REEA 4QPIA 3JD71 1J58A 3VBFA 4KG8A 4JV4A 3RZHA 5F6LB 1DYKA 4RR3A 2SLIA 1QDCA 1LOGA 2RS31 3AMNA 3DYPA 1W8UA 2Y0IA 4K3UA 1Y43B 5FZOB 3VKNA 1AJOA 4AWDA 4AFMA 1B35B 2BNMA 4IW3A 3OYWB 1J3QA 2B39A 1HW5A 4OUEA 5LB6A 1OOPC 1QDOA 2Y8KA 3AL6A 2JXAA 2QFEA 2QQIA 4JGZB 4NIDA 1H2LA 1MS8A 1EUUA 1SPPB 4CCLA 2WNUC 3WF1A 4CCJA 2OZJA 2B7YA 1ZA4A 2A3YA 2BQPA 4GWIA 2A3WA 3CU7A 3IZOA 4AG4A 4ATEA 3WVJA 5LK7B 4Q4Y3 4C90A 4RQPC 3H3ZA 4LHKA 4QX8A 4TXWA 1UU4A 5EHDA 2Q30A 2YGMA 5L7OB 1RIRA 1LOFC 2DU1A 2AR6A 2X05A 1NY72 5CA6A 2KXLA 3K77A 4AEKA 2EALA 1KS5A 5FIXA 3VKFC 3GJBA 4LO6B 1SG3A 2DURA 3S6PA 1VRH1 2PHRA 3KCCA 4BHPA 4Z82A 1Z0HA 2EA7A 4BQYA 5BNOC 3A7QA 1RTVA 5LCWL 5FZ6A 2ZGUA 2LROA 5F32A 1LB2A 2YBPA 3ZFGA 1AXYA 3ZIXA 5J36A 2Z2SB 1S2BA 2ZACA 5JIUA 5BV6A 1AZDA 3N7KA 5D1IA 4OULA 5E8AA 2O8OA 2UWCA 4YVWC 5J98B 4E2QA 4Z8BA 1FATA 4MZUA 3VBSA 3RWKX 3WY6A 2XJSA 3DYOA 3LIGA 5A3OA 3SH3A 2WNEA 2FDGA 4CDUC 3LA2A 1GWLA 2W91A 3RZKA 1EAH1 3GZTB 1QH6A 4QKBA 4WM8C 3OY8A 4P9XA 1Y9QA 2FCTA 4MUVA 4Q8KA 4XE9A 1B09A 1A8DA 4KH9A 3H50A 5LBCA 4H55A 1D2QA 3AP4A 4L97A 5FP9A 2W1UA 1HB4A 4JVAA 4GULA 1RUH3 4HFSA 4ZZ5A 3I8TA 4AEDA 4A3XA 5FDBA 2WQ8A 5FK7A 3OGRA 4UT5A 3NV2A 3W9AA 1NX9A 2VVFA 3DPRA 4ET7A 4JHTA 3BPZA 3GCXA 4JCKA 2ETEA 4OZOA 3VZNA 1LOAA 4CEYB 2E53A 1HRV1 3U07A 2XG3A 1GANA 2WLPA 1HB2A 3SKJE 2XLGA 1VJ2A 1UOGA 5HXMA 1NCQB 1XSQA 1H6XA 2VOKA 2VXRA 4LIUA 2Q8CA 5C8WA 2D93A 1FPN2 2VW0A 2VOTA 4H3WA 5E89A 4PI0A 3GM8A 3WW2A 4EN7B 4FAGA 3WDUA 3PIJA 1UCXA 1RUJ1 1W8WA 2QVSB 3E5XA 3FZ3A 1BHGA 4RD7A 2GSYA 4UW5A 2XXZA 4ASMB 5J1XA 1ALYA 1JZ8A 4XTPA 4O61A 2JEMA 1QXPA 3RZMA 1YIPA 4RN5A 2YPDA 3FX3A 3DCQA 3WHUA 4RA0A 1YI7A 3KQRA 3WP6A 4BQ2A 3LZZA 3FMGA 1YQ8A 4UF0B 1W6NB 2JB8A 1POV1 4K21A 1ZZ7A 2DUOA 3CJXA 4Y26A 5A80A 4N53A 4Q4V1 4BB3A 3I3QA 2RS53 5FY9A 3T2TA 4E4ZA 2GMMA 5FZ0A 3VL8A 3SXWA 1C1LA 4L11A 4AEJA 1WLWA 4PQQA 5A7OA 4KG0A 4FXGB 4LK6A 4CZSA 1N3OA 4G3YC 5J96B 1HN1A 1HRI3 4TLFA 5FZEA 2BVVA 1ZREA 2J1UA 1FMD2 2RS13 1UF2C 2BV4A 3B9IA 3VBOB 3HQXA 4FOVA 3ZO0B 3NV1A 5H9QA 3U75A 4MO3M 5CIRA 1CONA 3BIEA 2IUWA 2VJXA 5GJ6A 1ND3A 5H9SA 1ENQA 3ZFEB 1DGRA 5LRRA 4HKOA 2OPKA 4CDXB 1ENXA 4FXKB 3JQWA 4Y4RA 2JJ6A 4P5YA 3OOXA 4CTEA 2MEV2 1CR7A 2CNAA 3RSJA 1K5JA 2ATFA 4QPIB 5IFPA 2VUCA 4HN1A 2G9FA 1O3TA 3VBFB 4RR3B 5FKCA 2B9UA 3ZIWA 2EXHA 5FZDA 3AYCA 4KL1A 4XHXA 2D98A 5B4NA 3LDRA 4LKDA 4DFSA 4LIVA 2XBO2 1K12A 2BBAA 4XXAA 2TBVA 2X5IA 3T2OA 4Y20A 2RMU2 4AQ2A 5C71A 2NN8A 3Q8FA 3GZEA 5H9PA 4XUPA 2P2KA 3DUIA 4QB2A 2IFRA 2X09A 1VE0A 1YFWA 5F39A 3O7OA 3VBRA 4EQVA 5FZAA 4FPJA 3BOPA 4B7EA 1GKBA 2MPFA 3L9JT 5FO8B 5FQ0A 3O14A 4QXBA 4C91A 3VBUC 3ZSLA 1ASJ3 2E26A 4AVTA 5KC5A 4XUNA 2OW4A 2X29A 1QJZA 2P37A 5EPAA 4NPMA 1WMDA 1W0PA 3PLQA 3UNPA 2V4AA 1X36A 2DVDA 2HWF1 1H4GA 3VBHC 2A6VA 3VHNA 5LY1A 1MS9A 2WR9A 5LBBA 3WF0A 4P02B 5AC93 1CN1A 1LHOA 3N7LA 1EAH3 3OUIA 4XUQA 3FHQA 3ZFGB 3PVEA 4IV3C 3W5NA 2ZGQA 4V1PA 4XDQA 2W1QA 1G9DA 1ZM1A 2HYXA 3B5LB 2BZDA 3IBMA 2WSUA 1W8ZA 3H8UA 3J7HA 4JQRA 4YZ4A 3VBSB 4CRQA 3HPNA 1EV13 4UOJA 2ARBA 3JCIA 1I5PA 2ZX2A 3IB3A 3AP9A 5ABJA 1JHNA 2ZGTA 2OKXA 3U14A 3NNJA 3I97A 3OY8B 1JHJA 1VIWB 3WG1A 4UBGA 2IXKA 2LM3A 4NHMA 3WNNA 1UZZA 1GFF2 2C6SA 4OMCA 3I2IA 4X6QB 3Q8CA 2OX0A 2WNVC 1DGLA 2IXJA 1IPSA 4META 2CTVA 4AEDB 1JYCA 5IK5A 1NXD1 4OI0A 5ACA2 2J1RA 5FZIA 3DPRB 1WBLA 3ZYPA 4K1ZA 3KS7A 1TZOA 3AB0A 1XNDA 4CCOA 2JDPA 5FRAA 1WKYA 4XPVA 4EN9B 2W39A 5KHKA 5GLWA 4QGMA 5A3NA 1CPNA 4IL7A 3NVCA 1QQP2 3ECQA 2ZABA 4COZA 2JIGA 4Q1RA 2W3JA 3MI8A 2ORZA 1IG3A 4PQ9A 5DUWA 4YZ3A 4HK8A 4L99A 1T2XA 1GZWA 1VBE1 4FP3A 5FZMA 1XYNA 1MVEA 2PLV1 1WD3A 2VY0A 4UW6A 2WZR2 4ZKTB 2RG4A 1R1A1 2A6ZA 3LQCA 3RYRA 1URXA 1HJFA 4GH4A 4P9GA 5LA2A 2HWD3 2DFCA 4BA6A 3N7JA 4KWKA 3TN91 3M70A 3WF3A 3T2PA 1VBA1 4CU8A 1XU2A 1POQA 1UIKA 3OBAA 4IDZA 5JSOA 3PJQA 2J42A 4N53B 4K1YA 3VZJA 3MIFA 3RGBA 3VB9A 4LBKA 3WP3A 4MX3A 1DQ2A 3ZLIA 1JZ6A 1I1EA 4UFHA 3U37A 2P1BA 5LBEA 2J1SA 5CFDA 3HNBM 1XSRA 1LULA 1GZ9A 5A32A 3WDYA 2DU0A 4BWOA 3PNAA 3K46A 4PBOA 4NIHA 4PJYA 1C5HA 1L7RA 5JZGA 1S0IA 1LKNA 1WW7A 3TEZA 5F9TA 1UPSA 1OUSA 1W3XA 1ND3B 1NCRC 1QIQA 2XR4A 5GKAC 3V56A 1AYN1 2FD8A 1EYBA 3MW4A 2AEZA 3EO6A 4RFT0 1L7QA 2A5ZA 3U11A 1PM7A 4YW1A 5BPXA 1JUIA 3BUCA 2B42B 5C4WC 4OQ8A 1GP4A 1WW6A 4FPLA 5JMCA 5EJ1B 2ZAAA 2O8QA 4A6SA 5FMBA 4XFGA 3I2HA 3C7OA 1N1VA 2LRPA 1KXGA 5EJZB 4AQ6A 1QU0A 3PVOA 2XL7A 2LS6A 4Z1VA 1S0GA 4AHXA 4NWVA 5I8SA 3C7FA 4PDWC 4LULA 3B69A 1OXCA 1X7NA 2VZSA 2X5IB 1Q8PA 4Y20B 1LOCA 1BEV3 2B46X 4Q29A 1LOEA 1W2OA 2ENRA 3MEPA 4YPJA 3BOWA 2DTWA 1V6OA 3S5QA 2B45X 2I45A 2RM21 3ORJA 1OLMA 4S2GA 1C28A 3AX4A 4O7XA 1HB3A 4V2VA 3WQ7A 2R042 2VMCA 3VBRB 4AR2A 5A3TA 4XFAA 1JYTA 2JENA 1JZ2A 5FWEA 3ZFFC 1H1AA 5ANNA 4LBOA 1CJPA 5DABA 4ZXKA 3MYXA 4YG0A 5FQ0B 3POBA 3TNPB 2BNOA 3LGRA 4NVPA 5D8AC 3T0AA 1SLCA 3VZKA 1NYWA 4AOCA 5BY5A 4CDQC 1YYNA 2VNOA 5F5AA 1RXGA 3HWJA 4Y22A 2RR11 5F5CA 4AFAA 5L9RA 5FZBA 3CEWA 3KM5A 2F6BA 5IT6A 1UU5A 4B4PA 4E4SA 1CZVA 2PHWA 4KGGA 1F4HA 2WUHA 5CFCC 2XMLA 3LA7A 3J7LA 4FT8A 4M4PA 4OHVA 3MIGA 3URFA 1JUHA 3UETA 4D69A 4JAAA 5JAXA 3DYMA 5LA9A 3WSOA 5ABJB 1CVNA 1DHKB 3CDZB 2ZPXA 5E88A 4LA3A 5DAVA 1GR3A 2BERA 4BYYA 3V65A 3K4ZA 4GZ9A 3M3EA 1JODA 3CNAA 4WVWA 3O12A 3HMYA 2WN2A 1IG0A 5FUPA 1RUD2 1VAVA 3CLPA 4KI5M 5A1FA 3K48A 5F2SA 5C9AC 5FPUA 3KV5A 1H30A 4KWUA 5C7GA 4XQ4A 4HZFA 1AR61 3LDKA 1PZ9A 1QEXA 1ZBA1 3USUA 4XMAA 3T0BA 3WX5A 1XNKA 1TME3 2L9LA 3NAPC 3J7NA 3RI9A 2VZ1A 1PX3A 4M3CF 5LEJA 4QGLA 1HXS2 4NPLA 4BE3A 2RVAA 2W92A 2PLV3 2WO2A 3RYPA 4OUMA 3T2QA 1EUTA 2NMOA 2WAAA 1C1FA 4Q5OA 4DIQA 1AR93 1UX6A 2NYYA 1R1A3 4MXVA 1W39A 4MGYE 5GZDA 4DUWA 5G05L 1G9FA 2OIIA 3HQUA 1WLCA 3TN93 2WFF2 2WS91 5E6HA 5IVFA 1A3KA 1PGW2 3TB0A 4HKLA 4BQ4A 2GAUA 1NUKA 1BCXA 1RMU1 4GH4B 4R8HA 5FFOC 5T5PA 2XL9A 4GQ7A 1AR82 4GWMA 2LW8A 2HWE2 5CU1A 2Y6HA 2D40A 2AACA 1AXZA 2VQAA 3ZYJB 4JZRA 3UT0A 1ZBE2 4ZU4A 3PIGA 1QJY1 1TMF3 1US2A 1N47A 1VLNA 2VOWA 4FAHA 4YARA 1WCKA 5EP9A 4NHYA 1VBB2 3PMSA 5E1RA 4JRLA 4HN0A 1OD5A 3VZOA 5CFDB 5A32B 1RGSA 1QJU1 2DV9A 4GXLA 4Q4X2 2FDIA 1W9TA 4LR4A 1C57A 1RUE1 1UZVA 3ZXLA 1BZWA 4TLGA 4C0HA 4B4QA 4AI0A 1V0AA 1YUDA 4QD2A 5I0SA 5IK4A 5JZGB 4FPYA 2YZ4A 2PN5A 2VUJA 2QNKA 3KCXA 1F5JA 1W04A 4PIXA 3OSDA 4L92A 2HBUA 1V70A 1XYPA 3J8F2 3O1SA 3VD7A 5FZ4A 5J37A 2WT1A 2AREA 1XNCA 5IJRA 4ATFA 3T09A 1WMFA 4CUAA 5CKNA 4RGGA 3W58A 5FLJA 2WO1A 2R30A 4FOWA 1H2KA 4MYEA 3T1LA 2GC0A 4NJ4A 1UD1A 3J26N 4LKEA 3PTRB 4ZS3A 2R073 1XC6A 2W9XA 3AKTA 2BNNA 1RITA 4FPGA 4NOTA 2VW2A 4A7YA 3FE5A 3OUHA 2OS2A 4JGZC 5AVPA 5FMDA 5FYZA 4B29A 2BP6A 2ZKNA 2RV9A 1JTZX 2LALA 4I0AA 4UYBA 5IAVA 4QPYA 3RZZA 4TSVA 3AYEA 5A3PA 5DG1A 2W87A 5GM0A 5K0UA 2Z4FA 2ZGPA 3HIFA 4I02A 4YVSA 3D3AA 2WZPP 2ZEYA 1DGRN 2RJ2A 3LA3A 4P9JA 2BTVC 3WNPA 3ZMOA 3W5MA 2HKXA 2QZ3A 1QXRA 3NL1A 3QBQA 4QQOA 3THPA 2TEPA 1QHDA 3OEBA 3R4UA 3WHTA 5FY5A 3N9OA 4QT6A 3MIHA 3WW1A 5BYNA 1YJLA 2QTWB 4Y22B 5EYYA 4HVQA 3IN9A 1CX4A 5FJKA 3VKOA 3U4XA 1U12A 2EXKA 2NMNA 2D3SA 2R061 1Q8SA 3NJYA 1BMV2 4XZPA 4BQ1A 1D4M3 4RGKA 3OBZA 2QQPA 2R6QA 2BOJA 4XXPA 3VL9A 1Z78A 2QQVA 3C7HA 5I8TA 2MHFA 2O0OA 2YDEA 1XB9A 1AR73 3POFA 4IEQA 4XZUG 1MS4A 2P4EA 2V09A 3D0JA 5FTTC 1VPHA 2YYOA 4XYXA 1WA6X 1CAVA 1AL21 2VZTA 1AR63 2V5YA 1ZBA3 4P14A 4YM1A 1AR62 1N1YA 3EMRA 4D6RA 2A3XA 5D21A 3ZDVA 4AI1A 1DQ1A 4LHNA 3FHAA 4XBNA 2BUKA 4OCTA 2VZQA 1H1IA 3H1MA 3CZUA 5IHRA 3WW3A 1JN2P 1QJX2 2IZWA 4LBQD 4RHV2 2CDPA 4R52A 3USUB 2EAAA 1IS6A 3THTA 4XW3A 4ZU7A 1TG7A 2C9KA 2JDZA 2HWB3 2J1VA 2UY9A 4LBMA 4MLOA 4E2SA 5BNNA 4LBQA 1NCQC 2WIIB 1H9PA 4NAMA 5F3CA 1JYIA 1UYXA 1NLQA 4QU1A 4K7JA 4BJ0A 4FTBA 2A6YA 1PZ7A 3LKJA 4DXZA 4PHZA 4Y1YA 4IV1A 3SISA 3MW3A 3WDTA 4E9KA 4I2OA 3I2KA 1PNFA 3OBRA 4IEXA 1J83A 3AZZA 1H2MA 1RUI1 3RMYA 3JB4C 2PELA 3ZPYA 5KXCA 4XC9A 4JX0A 4CXYA 2P3YA 2HWC2 1BK0A 1VBD2 3ZYIB 3THDA 1GNZA 5F3GA 3B3QE 2OZ6A 1F2NA 2VOVA 5GLZA 4BXFA 4F83A 3LFMA 1JYVA 4W6WA 1UW8A 5CBLA 4ISQA 1QJU3 3DXUA 4NIIA 3TEWA 4UXAA 4QMAA 3MIBA 1GP5A 1G6NA 3QLQA 4MADA 5CKMA 1V6IA 1UZ0A 3LB9A 3QD6A 4OYUA 1FMD1 4RSUA 3ZSKA 5KHJA 1KRIA 2AC1A 3CKHA 4URAA 2QDNA 4ISRA 4XBQA 4ZS2A 5FMOL 1GOFA 2A70A 2A6WA 1MQTA 4NROA 5IWFA 2E51A 4I0BA 3C8XA 4ZONA 1UY1A 3DGTA 4ZPIA 2FZ2A 2K2SA 3BU0A 1V6MA 3N3HA 4LBNA 3VD3A 3ZFEC 4D7YA 1ULCA 1QJFA 4AFDA 4CDXC 3POEA 4HSLA 1RINA 4HT1T 1NG0A 4BK4A 4PI2A 1YEWA 4WVZA 4P5HA 5JIAA 3DL3A 5LASA 1Q43A 4PF5A 3RI8A 1PVC2 3UGFA 4XF1A 4QPIC 4AL9A 5K7PA 1QF3A 2IVJA 1DG6A 3VBFC 4YNIA 1W2NA 4RR3C 4BH9A 1RUNA 5JWPA 2GP5A 1OI6A 3RS6A 4H7MA 4XJAA 1RUF2 2XBO1 3WG2A 3IDAA 4QX5A 5IATA 2P5BA 2RMU1 4UFMA 5FLIA 1W6OA 3WP5A 5KXEA 1GQHA 5CG8A 1OC1A 4XQWA 2VE1A 2VXJA 3EJKA 4QX0A 2RS51 4QQLA 4Y1XA 5LRSA 5IK8A 2D43A 4KBBA 4HPKA 4XFHA 2UU8A 3CHXA 1KFXL 2FQPA 5K0UB 4YVSB 3HD8B 1GMMA 1KJRA 4DUVA 3AZYA 4Y1UA 4YGBA 3T3YA 1UX7A 1HQLA 3TAYA 4AHYA 5AVAA 4CP1A 3O1OA 4IE7A 3U1XA 2XJUA 3ZN5A 3MLKA 5FYMA 4A41A 4QM8A 3BIWE 5FUNA 3AZXA 4XDPA 5CISA 3IDEA 3GCWA 3ZFGC 4LT5A 2FBEA 1WCQA 3J7MA 4L0PA 4AF9A 4XFFA 4AVAA 3FUQA 4M0HA 4DRRA 5A7SA 1OQDA 2Q4SA 1CIWA 1COV1 1AL23 2GNDA 4TN7A 3N36A 4CYDA 2A6XA 5FPLA 1LEDA 1YI9A 2VQ0A 3UJOA 3ST7A 4AAXA 3C3VA 5FYYA 1H8TA 2F4PA 2PHUA 2Y64A 2FDJA 1CAVB 3U0ZA 2VZPA 5JR2A 2GN3A 1S2EA 2W47A 3IT8A 5F5QA 5A7NA 4AEDC 4RYDA 1E5SA 1MEC1 5EV7A 4JKLA 5A3UA 3ROUA 1VP6A 4YW7A 1LGBA 3JZVA 3WCRA 3UYJA 4FPHA 1H6YA 4WV8A 3NMBA 3ZVXA 3ZYRA 1OPOA 2FCUA 3LEKA 2VZUA 1NE4A 4W6YA 1TNFA 2Q8EA 2YC2A 5BNNB 1WA4A 1ASJ1 2D6KA 4LBQB 4M4RA 5KXDA 3HJRA 4N9IA 1UU6A 1RUI3 3LAGA 4RS5A 5FOBB 1L7LA 1DQ4A 3GBWA 5I0RA 3M3QA 2CWSA 5FZGA 2Z69A 4LO4B 2JDKA 3O0XA 3ZN4A 4IV1B 2DYCA 4XUOA 5AC91 3OUJA 3VZMA 3POIA 5SV5A 3L2YA 4GA9A 1K5MA 3P5BA 1FT9A 2WRAA 4MGIE 3H8RA 2OQ7A 1V6NA 1FYUA 4MHUA 4Q4W2 2ZZQA 5IFTA 5KR7A 4Q0VA 2XJRA 2XVGA 2XHNA 1XNTA 2J1TA 1YQCA 1EV11 2PHDA 2VO5A 3MUY1 5FXZA 4JTOA 3AMMA 3AFGA 1GOGA 2CGOA 2VAUA 1BBT1 1FMD3 4N53C 5A7PA 4A6OA 2KD7A 1W8OA 3POJA 2DCZA 2VVDA 5GLUA 2BEOA 2CGNA 3BTYA 4DNYA 3S7IA 1MS3A 1DQ6A 4KWLA 3B9CA 3AYAA 3UV9A 2ZGKA 4C1XA 1EPWA 3AM2A 3IPVA 2ZJCA 3H3LA 3WCSA 3IM0A 3KWVA 3WDWA 1O4ZA 3POYA 1ONAA 1LESA 2MEV3 1MQTB 2C0ZA 3CBNA
chains in the Genus database with same CATH topology
1OFSA 1YJKA 3IIAA 1WLDA 1RUC1 3V64A 1ND3C 4XJUA 2XBO3 3INAA 2MNGA 3D0SA 2AH2A 1I9RA 2RMU3 2JX9A 2UWAA 1PGL2 3E5UA 1HQWA 4I3GA 1WMEA 2HWD1 1C4RA 3AK0A 4PLOA 4IEYA 4D7TA 4NPRA 1W6OB 2XJVA 4AGGA 2VGDA 3POWA 4FOYA 3H1YA 2PHFA 3PVBB 1ENSA 4HPKB 1LJ7A 3VBRC 4FP2A 5JOYA 1PK6A 1SFNA 3WDVA 1QMJA 4AFBA 2PA7A 4H14A 1RUH2 2ET1A 2KA3A 1Q5OA 1COV3 5CB7A 4K9SA 1AF9A 2A7AA 4HVOA 2YGLA 4L8QA 3ZXEA 3AKSA 4P9IA 3ZXAC 1NA1A 4LE4A 2PHTA 2XPJA 1J1TA 4YSFA 1FAYA 2OYZA 2P3KA 4Q0UA 4XFBA 4AGRA 4UW4A 1MEC3 1AXKA 4Z2WA 2PFWA 1G9BA 1LOBA 3E97A 1LR5A 1H8TB 2BW8A 2YUEA 2TUNA 4LBLA 4AK3A 1E57A 1ULEA 2QUOA 3N4MA 1RHI2 3LOIA 1QQP3 1BEV1 1S2KA 3A0KA 3WXPA 5C8CA 1UMZA 3CJIC 5FBZA 4E27A 4IQPA 3OJBA 1A78A 4OHWA 2AENA 3MIDA 1PO11 5EFUA 2JE7A 1D4VB 1FOD2 1C8M1 5C6CA 2CL2A 1A8MA 2AYHA 4Q0PA 1AYM1 5DDJ2 1MR5A 4RS5B 1FNYA 5CAZA 2PAKA 1CAWA 1O4TA 4EN8B 1HRI2 4XHBA 5GZEA 5CG9A 1BJQA 2RS12 1BBT3 4HMZA 1K5MB 3ALQA 3SH4A 3FC0A 3SITA 1J3PA 3TWIA 4GH4C 3M8LA 4BZ4A 2DUPA 4UW3A 1R081 2D6MA 1X33A 3JD72 5FMOS 2WINB 2RS32 2ZOEB 1G8WA 1SLTA 1DFQA 5CFDC 1KQRA 2I2SA 1APNA 4YYOA 3EHKA 4FPFA 3IPVB 1RUC3 1TME1 1LGNA 1JXNA 2Q1ZB 4TWTA 2D7FA 2FMYA 1LEMA 4NHKA 2W68A 1EPZA 1F31A 1D0HA 1DZRA 4COWA 2VOXA 3J8F1 1AR91 1H8VA 4OFGA 2X8KA 3NO8A 1YWKA 3I59A 2XLAA 1RUG2 1ZX5A 3I4IA 1HKDA 1VRH2 4S2DA 1KDKA 1GZCA 3VN4A 5KHIA 3M3CA 1PVXA 1WGPA 4IV3A 3RJRA 4AXOA 3CF6E 1MACA 1IS5A 4N9HA 4A2UA 3VKMA 2R0HA 4JDNA 1J1LA 3AP7A 4LEJA 1O3RA 4Q1PA 1BKZA 4JTNA 1KDMA 1XNBA 4N90A 1TMF1 4S2HA 4LBJA 2OVUA 2EXIA 3ELNA 3TBDA 5HI0A 2PAEA 1SDWA 2DCJA 4EWEA 4BIFA 1QNWA 5BNPA 3SLIA 4F8AA 3SHRA 2BFUS 1S0EA 3K51A 4XETA 2A73B 4AI3A 2D6PA 1PK6B 2ZKLA 4F7ZA 2WJSA 2WWSA 5BXXA 1HRV2 1DQ5A 1G9AA 2D97A 3D8CA 4TYSA 1DZQA 4BLJA 1BMV1 3ACLA 2NPIA 1MZEA 5JPMB 1NA1B 3MFCA 3M3OA 1RUJ2 4IESA 4DB5A 3NKTA 1T6GC 4XF4A 4GWNA 4B8EA 2R071 1NLSA 4IEPA 1ZRRA 3C2UA 2W52A 5JLVA 1HXS3 2JG8A 1PO13 1DU3D 2XJPA 4R4ZA 1RJ7A 5C8CB 1X50A 3JBG1 1IGOA 1C8M3 3WINE 1A6CA 1V6JA 2DTYA 4Q4V2 1AYM3 2E9QA 3AZWA 4A7KA 4AE2A 4B4RA 4BCUA 1CGPA 2VU9A 1PNGA 2D44A 1SBDA 4TZDA 3ES1A 2WFF3 1TQ5A 2UYAA 1R091 5J7MA 2DWRA 4NWWA 1AX2A 1HX6A 2D3PA 2DUQA 2GN7A 4GKXA 5JZGC 1AR83 1CAWB 4ORFA 4OLLA 1NCRA 2EVXA 1R083 5FLHA 1VALA 1N3PA 1VBD1 1D4M1 1J3RA 1BQPA 3R6SA 3RG0A 1SCRA 5I0UA 2ES3A 3S30A 4FVVA 1VBB3 2VMIA 1VR3A 1SLAA 3WR0A 1AR71 5JOWA 3A0NA 3SMHA 5E16A 1PO21 1O7FA 5A3MA 2Z5WA 1L3JA 2H0VA 5JDBA 4FSJA 2CYFA 1DLLA 4IEZA 3U10A 4YZ1A 2W0XA 4C1WA 4DY3A 1SCSA 3KSCA 5I93A 5FREA 1MS1A 1MVQA 2FMDA 4M3CE 3J8F3 2R32A 4YGDA 1W6MA 2HWB1 2QE3A 3QCWA 4CEWA 3ES4A 3ZFFA 5DZEA 1GZWB 5B2GB 4OUSA 3R4SA 5D8AA 1OA3A 5JR7B 1IPJA 3I59B 4CDQA 4N43A 4M0NA 3DF0A 3AMHA 2HWF2 1XU1A 4YW2A 4YFWA 4IV3B 4IXLA 1Q3EA 2GH2A 3LCPA 4FPOB 4XFCA 5CFCA 1H9WA 4G4FA 5DG2A 1WCSA 2DFBA 3CL1A 5DZGA 3NJZA 3OD4A 1IHMA 1RUOA 4DY5A 4QXKA 5T52A 5T54A 5K0UC 3GYDA 1ND2A 3ENRA 4YVSC 1IS3A 3KLSA 3ETQA 5BNPB 5HCFA 3RDIA 3GBGA 4Q2FA 1V9U1 2ZX0A 2EAKA 3NAPA 4FPCA 2WA3A 1IQAA 4WBBA 4LHLA 3ZXJA 1Y3TA 2YY1A 1B35C 4WZCA 1NQJA 3ILFA 3RJ2X 4FQ4A 3O5SA 4CP0A 4OVEA 4UBHA 4O9GA 1VBE2 1VAKA 3O0WA 5L36A 4R9DA 5A33A 4CDWA 2H6BA 1OA4A 1YXWA 1MS5A 1R1A2 1QJX3 3JBG3 5T5LA 2KM2A 2ZX3A 5DUUA 1F8VA 2YC0A 5T50A 5L7OC 1Q8OA 1H4HA 1NE6A 1NY71 3LWCA 1VBA2 2JG8B 4D94A 1V6KA 4AI8A 3TYJA 1R093 4WZFA 1LCLA 4AVSA 1Q56A 1YFYA 2WLQA 1KITA 3IWZA 4FCAA 5BNNC 2EXJA 2ZGSA 5FO7B 4WM7A 1KD7A 3AP6A 4OHYA 1X82A 2HWC3 1VBD3 3TRSB 3WUDA 4EWAA 1AJKA 3AFKA 4JGYA 1O3SA 1NCRB 1SEFA 2P3IA 1LODA 2NZ9A 1PO23 4YM3A 4R4XA 1AYN2 1PZ8A 2WSVA 1SMVA 4AYUA 1QOOA 1GICA 4AQSA 1S1AA 4YGEA 1DQ0A 1WUVA 1F5FA 4CEYC 2HYKA 3VZLA 1C3HA 5GZCA 2BWCA 5KWRA 1FPN1 2HJIA 1VB4A 1OSGA 1O4YA 4Y4YA 4MXWA 2CY6A 3L2HA 1MQTC 1PVC3 1W6MB 2D6LX 2DCKA 4WVMA 2RM22 1WD4A 4CEWB 3ME2A 2YMZA 3ZFFB 3GALA 2QZ2A 3KCYA 4KQ7A 2ZCWA 2IFWA 3WDXA 2GMEA 1RUF3 5EJ3A 5D8AB 4KU8A 4AVVA 4FTSA 4CDQB 1PGL1 5IUQA 5LK5A 1IPKA 3NW4A 4N43B 3PTYA 1UL9A 2RR12 2ZGOA 2E7QA 1MS0A 5JOZA 3QOPA 3SH5A 1BYHA 3HBZA 1VBC2 3IKWA 3SCFA 5CFCB 5FO9B 2DF7A 2E63A 2SBAA 3JU9A 2G9GA 1JW6A 2ZX4A 1I6XA 4YM2A 2XVLA 3VBOC 4JDMA 1H1MA 2OA2A 1AUYA 2A75A 1V9U3 3FLPA 2ZBJA 1PIV2 4BPZA 1BXHA 3AMQA 4DQAA 1OA2A 4IEWA 3MPPG 1ND2B 4GB32 5K8SA 3M3IA 2VPVA 1RVF2 1ULGA 2B5HA 4SBVA 2XWBB 2HEWF 2MEV1 3WG3A 1AR62 1D0GA 1ZBA2 4AFCA 2AGSA 1V00A 3NAPB 1WLTA 1HV1A 4Q0SA 3BU7A 3LSDA 3LOBA 3UL2A 5DUVA 1CD3G 3VDDA 5FPXA 1REFA 2PHLA 2Y38A 5GZFA 4BMEA 4HANA 2XLFA 3FHIB 3NKGA 4N7IA 3FFZA 4EV0A 1TE1B 1GV9A 2D3RA 3NV3A 4HBNA 1QH7A 2WS92 4XF9A 4Z07A 5A33B 4CDWB 3SNMA 1BK1A 1N1SA 1H8TC 4K6BA 4GALA 4HETA 4LO7A 1RMU2 2K0GA 5DUXA 5JCTA 2LTNA 3UJQA 1LHNA 1SACA 5L19A 4URTA 1NZCA 1QJY2 3V0BA 4I0WB 4QPGA 1FOD1 1G7YA 2AZ5A 3WT3A 3S0MA 3AZVA 3AKQA 5JSPA 1TEIA 3FFQA 3VHOA 2XWJB 2BFUL 1C8NA 4Q4W3 3RNSA 4RS5C 2C5DA 4WM7B 1FI2A 1RUE2 3J4UH 2ZGLA 3VBSC 1UAIA 4FOQA 3ZXKA 1WCDJ 1DYPA 2AUYA 2Q5TA 2HEYF 1PGSA 1K5MC 4ES8A 4JGYB 4R9CA 5L73A 5ACA1 3UK9A 3D5OA 1FPN3 4LA2A 5T3NA 2I74A 4MH0E 3D4KA 3DPRC 2ZS6B 1Z7S3 2Q1MA 4GMP1 4GMP0 1AL0G 1QQP1 1DF0A 2D5FA 2VUAA 2GZWA 3N7MA 4I01A 3WZ1A 4PCRA 4INDA 1OPMA 2JG9A 1XQNA 4MXWB 2XKPA 2WZR1 4WVMB 1Q8VA 2CAUA 3POSA 4KWJA 3ILRA 1RUG1 2RHPA 3LSEA 1QOSA 4AVBA 2Q8OA 2W08A 4Y1ZA 4F3JA 1V6LA 2R1DA 5J48A 1ZRFA 3KMHA 4WVVA 4XMIA 3I2DA 1CQ9A 1U5IA 2VH9A 2DVAA 2R062 1OOPA 2VECA 3MW2A 4AQTA 3Q9OA 3GHNA 2WNUA 3VKLA 4HKWA 1IS4A 3BTAA 1I3HA 4RQPA 4M3CA 3UKVA 3MGUA 5K9YA 4ONUA 2ZGMA 3VUOA 1AL22 3MF6A 1LOFA 1D2SA 2ZGRA 4XOGA 4AEMA 4DRVA 2P17A 1PK6C 4ITCA 2VULA 3MLLA 5BNOA 2XJTA 3RWNA 4Q4Y2 3WD5A 3KGLA 3NSTA 2VVEA 2D6OX 2XVKA 1ZNPA 4XTMA 3ZSMA 1JBCA 1U5XA 4YVWA 4IERA 4L2NA 3IDCB 1YFXA 3DN7A 3VDDB 1NA1C 4CDUA 1BVVA 2X53S 3D6EA 1MZFA 2BBVA 1FV2A 1RHI3 4WM8A 3OGJA 2X5IC 4C0BA 1RL3A 4FTEA 1OMIA 1SLLA 1RUI2 3APBA 4COVA 1LENA 4OHXA 2R041 4XF3A 4EROA 1DIWA 4LTAA 3VLBB 3JB8A 5BUVA 1LECA 1POV0 2NM1A 2OUJA 1FOD3 3O0VA 4M01A 5T55A 4XILA 5C8CC 2ERFA 5DDJ3 4XJZA 1UIJA 4IEOA 4MSVA 3W59A 3V0BB 3SCHA 1QNYA 4KU7A 4QPGB 4DPNA 1VAMA 2PAMA 2VMGA 5DZFA 3PMEA 3I54A 1WW4A 1SBFA 3ILNA 1UKRA 2EF6A 2PQQA 3NV4A 1ZVFA 1O5UA 3WLUA 4JDOA 1RC6A 2Z42A 4AGVA 3JD73 3NWKA 3FBMA 4U2AA 1OQEA 2EIGA 4LUMA 4XEZA 3UKTA 4CP2A 2RS33 5ACA3 5ABJC 2IWGB 2PHXA 2FHRA 1LHVA 1YIFA 2TNFA 3WP4A 4YLZA 2E7TA 2XKOA 3M4FA 1RUD1 3E5QA 2UYBA 2DCTA 1SBEA 4Y5Z0 3B93A 4GMP3 1SLBA 1S0JA 2ZHMA 4J6GA 2UURA 2NP0A 1XXNA 3GHMA 1HXS1 2R0FA 5KXBA 3BB6A 4LUKA 5EXOA 4IEUA 3GZUC 1UKGA 2WZR3 3MLJA 4EJRA 2RS52 1FNZA 1RUG3 2GC3A 1ULFA 1VRH3 1XE7A 3A4UA 3G6JB 2PTMA 2JG9B 2WFF1 3AKRA 1LU2A 2YPJA 3HT2A 2IXCA 1PGW1 3WG4A 5SV8A 1GSLA 2XJQA 4Q27A 1R1ZA 1OFNA 1CPMA 5A3LA 4B7KA 4O9EA 1AR81 4HK9A 4MGZE 2HWE1 1MZ6A 4B3NA 4Z92B 2DVGA 2WT2A 4P9WA 1ULDA 2DVFA 4YG3A 1ZBE1 2D5HA 3R0RA 4FO9A 3V0AA 4I30A 3AXEA 4AVCA 4QQHA 3EQEA 1VBB1 4OHZA 1ZRCA 4Q4X1 1OOPB 1LRHA 1COV2 4QGNA 1O3QA 2E6VA 2VMHA 5GZGA 3X29B 2WNUB 3FBYA 1X8MA 1Z7S2 4D3WA 4HSJA 2GALA 4HL0A 2Z79A 1QY4A 4RQPB 2GU9A 4M3CB 1HRV3 4MGKE 4EN0A 4PBPA 1KJLA 3ZN6A 2K9ZA 1U5ZA 4LE3A 4Y1VA 3RQ0A 1Q8QA 5BNPC 3CJIA 1GNHA 2WC2A 3QH7A 1LU1A 3OF1A 3VBUA 4DMIA 1MEC2 1FXZA 3H0OA 4LLOA 3D82A 1KFUL 3GNEA 3QH6A 4RL7A 5BNOB 3VBHA 1NOVA 1RUJ3 1ZZ9A 5T5JA 3S7EA 2WQZC 1U0AA 4YVWB 3ZYGA 1ASJ2 2YROA 1CAUA 1LHUA 2CV6A 3RPQA 4DZGA 5HBAA 4YZ2A 2ZGNA 4J1XA 2R043 4CDUB 4A7ZA 4MVTA 2RJLA 4OZXA 5AC92 4WM8B 1POV3 1EAH2 4X8PA 2Y26A 5I91A 1WW5A 1WBFA 1QXJA 4Q4V3 2ZMKA 3ASIA 3PHMA 2WNVA 3H7JA 1EV12 1XE8A 4DOUA 5FOJB 2GC2A 4Y24A 3RYKA 2VNRA 2JICA 1U5YA 3H9AA 1XRUA 2JG8C 3WW4A 1BBT2 1LGCA 5JPNB 5H9RA 1NLRA 4XJ8A 2R1BA 4AI2A 1X8EA 3P3PA 3KB5A 2FZ1A 4ES9A 3GBFA 1QKQA 5HCAA 3OTFA 1C5IA 2WT0A 2P3JA 4K40A 4E4DX 3KT4A 2IXHA 1YRZA 4MV2A 3ZMNA 5C33A 5GALA 4N7UA 4K8FA 1RUD3 5HXVA 2ZHNA 3MIEA 5T5OA 1S55A 1ZRDA 5KC6A 1RUC2 4HLTA 2WKKA 3VHPA 1REDA 1UN1A 3B02A 5KBFA 4R9AA 2P34A 1OLRA 3BALA 2CWMA 1SFYA 3QACA 4P9YA 1IKQA 1S0BA 1G86A 1S0FA 1QJX1 4JRAA 4Q26A 4RHV1 5FCCA 3AJYA 4J1WA 2HWD2 2B8MA 1OLQA 2A71A 4XFIA 4YGCA 3UKNA 4AHZA 2CGPA 3WQ0A 2LUWA 3OPZA 1S0CA 3AYDA 4X6RB 4CEWC 2HWE3 2HWF3 3R4DB 1FX5A 2ZZJA 4IEVA 3SCGA 4JC1A 1M06G 1OKQA 1HV0A 1ZBE3 5I8YA 2HWC1 5C4WA 4N43C 1LTEA 2JKBA 1CESA 1W6QA 1M4WA 4NN0A 4Q4X3 5J09A 1VBC1 3V0AB 3MICA 5GLTA 2IC1A 3BODA 4BOWA 5LEKA 1BVP1 1GQGA 1IZ3A 2UY8A 4PDWA 2GNMA 1SLIA 4G9SB 5JOXA 4AHWA 1PIV1 2ZX1A 4YW5A 3E6BA 3CO2A 3ZSEA 1ZZBA 4FQZA 3H1WA 4GB31 3ZX7A 1ND2C 3FWEA 1RVF1 5BNQA 1JOJA 3JUUA 5JVVA 4I09A 3ZN6B 1OQ1A 3TNQA 3CJIB 1BEV2 3MF9A 3VBUB 3ZSJA 4COUA 2JECA 1PVC1 1TNRA 2ILMA 2ZTNA 1ZZ6A 3GZAA 4NO4A 3VBHB 1VBE3 1GBGA 4Q8LA 3MZHA 1PO12 1O91A 1RUF1 4XBLA 1AX1A 1YFUA 5HCBA 1C8M2 4YRDA 1CAUB 2XH6A 1AYM2 4NR1A 3H7YA 5I0TA 3WNXA 1GYKA 2VW1A 4P9LA 3OD0A 3AP5A 4OI4A 1VBA3 1W6PA 4LO8A 5FPZA 3RMXA 4ASLA 4CDWC 1RB8G 4KNCA 4NHLA 5AFEA 1F9KA 2VG9A 3MFAA 4ZU5A 4Q0QA 2WNVB 3OGGA 2V73A 4HVRA 1G9CA 5EYXA 4COYA 2ZMNA 2O1QA 5C9AA 1R082 3M1HA 5EZWA 3KT1A 2NQYA 3B01A 4QHBA 3J9SA 4GKYA 4PLNA 1N1TA 2OUHA 2WA4A 3M7AA 2BVBA 2WFPA 1HDKA 1CAXA 1QGLA 2WQ4A 1YO8A 3P3NA 4W6XA 3KZ4C 4KGQA 3I7DA 4WM7C 2VNGA 1AYN3 1PHMA 2ZMLA 1TME2 3AXDA 3OBTA 2ARXA 4EWDA 2C9AA 2ZAHA 2GNTA 2H6CA 3JQXA 2PLV2 2ET7A 2JD4A 4JGYC 3FLRA 1AR92 4QQPA 4YZ5A 5AFBA 3RRDA 4RHV3 2BWAA 3WV6A 2H0BA 1IKPA 1KS4A 4BIOA 4AW7A 3TN92 3FLTA 3B00A 2GNBA 1J59A 1PMIA 1XYOA 3USSA 2I07B 4M00A 4X8NA 1YHFA 4XIKA 3WQ1A 1SQ4A 4U36A 3VGIA 3E6CC 1UPIA 2RM23 4RGAA 2GC1A 2DCYA 2D6NA 2IXIA 2RE9A 3DKWA 4EN6B 4LLFA 4QU2A 1N3QA 1TMF2 2XGXA 4D7SA 1UZYA 2QKDA 3DV8A 4IV1C 4IETA 2QJVA 2G4IA 2GMPA 1QWRA 3AMPA 2RR13 5TSWA 4OI2A 3FJSA 3ZXFA 4Q4W1 3HAGA 5JI7A 1NXMA 1VBC3 4YG6A 4LNVA 1VB2A 1HLCA 3FUOA 2R49A 2WL1A 5C4WB 4I3PA 1W6QB 1B35A 3HR9A 1H0BA 3OYWA 3HT1A 1DGWA 1PIV3 4XJ9A 1FV3A 4GB33 4JGZA 2DVBA 4PDWB 1YNAA 1RVF3 3B7MA 1AVBA 2HEVF 3GF6A 2BPA2 3TOJA 1RJ8A 5DXDA 1Z7S1 4H7LA 5L7OA 3M2MA 2R072 2YXSA 3IDBB 4BLIA 1AX0A 2E7AA 2Y0OA 1LHWA 2UWBA 4Q4Y1 1S0DA 3R05A 3JBG2 4YW4A 2C1FA 2BGCA 2ZHKA 2GH8A 4FBFA 4GIQA 2WS93 2GDFA 1Y7BA 3VDDC 4DS0A 3KGZA 1R092 4XQDA 3EXUA 1RMU3 1I5ZA 3IMNA 1DZTA 3WUCA 1W6PB 5F1RA 2XUMA 2IXLA 1QJY3 5KHGA 3ATGA 1D4M2 1O5LA 1QOTA 2JE9A 2R16A 2ZA9A 4FPEA 5IK7A 5F6KA 1OHFA 3H3UA 3KT7A 5C9AB 3E6DA 1AR72 1IOAA 2PYTA 3KD4A 4CEYA 1RUH1 1PO22 1DDLA 1RUE3 1DBNA 2YV8A 4QM9A 3WOGA 4YM0A 2NLRA 1DGWX 4W65A 1NCQA 4QPGC 3VV1A 4SLIA 1EP0A 1HQNA 3AJZA 4L9BA 3EBRA 4OI1A 1CAXB 1W0OA 3MDPA 4PIYA 2RJKA 3BCWA 5KHHA 3ZDSA 4E2GA 4DINB 1ZYBA 2HWB2 1JH5A 5GLVA 1W2UA 2CAVA 4K20A