1FOD2

Structure of a major immunogenic site on foot-and-mouth disease virus
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
214
structure length
214
Chain Sequence
EETTLLEDRILTTRNGHTTSTTQSSVGVTYGYATAEDFVSGPNTSGLETRVVQAERFFKTHLFDWVTSDSFGRCHLLELPTDHKGVYGSLTDSYAYMRNGWDVEVTAVGNQFNGGCLLVAMVPELCSIQKRELYQLTLFPHQFINPRTNMTAHITVPFVGVNRYDQYKVHKPWTLVVMVVAPLTVNTEGAPQIKVYANIAPTNVHVAGEFPSKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords FOOT AND MOUTH DISEASE VIRUS
publication title Structure of a major immunogenic site on foot-and-mouth disease virus.
pubmed doi rcsb
source organism Foot-and-mouth disease virus
total genus 46
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 1993-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1fod200
3S6PA 1TME2 1HRI2 1NG0A 1FMD3 1ZBE1 1NA1B 2X5IC 5C9AA 4RQPB 2ZTNA 1D4M3 1PGW1 1RUH3 1AYM3 1AL23 4CDXB 1QQP3 5K0UB 1R1A3 1NCQC 3NAPA 1VBB1 1RUF3 2PLV1 3VBRB 4CDQA 2HWF2 2WS93 1AR71 2WZR2 4GB31 1RHI3 4Q4Y2 1NCQB 2WWSA 1Z7S1 1VBE3 1ND3A 1COV1 4Q4X1 1AYN3 1PO22 1FPN3 5DDJ2 1VBC2 4YVSB 1BEV2 1OPOA 3J8F2 2R043 4RHV2 4YVWC 1VBA3 4AEDA 1FOD3 1RVF3 4CEWB 1QJX2 5C4WA 1RUC2 1RUH1 4NWVA 1MEC1 1RUE3 3NAPC 1VB4A 1RB8G 1ND2A 1H8TA 5FOJB 1VBD1 1EAH2 1NOVA 1PIV3 5BNOA 4CDQC 5C9AB 1RUF1 4CDUB 5AC92 1CJDA 2HWC3 1R093 2RR11 4Q4V3 3NAPB 1PVC3 1VBE1 1VRH2 1QJU2 2FZ1A 1FPN1 1HXS2 4JGZC 4CDQB 3VBHA 3JBG3 3ZFFC 2BPA2 5GKAC 5JZGA 2HWD1 5L7OA 4N53A 1RMU2 2HWE2 1VB2A 1ND3B 1B35A 2R041 2RS11 1AR83 4GH4A 1VBA1 4AEDC 1EV12 1RUI2 2RS52 1RVF1 2R061 4IV3A 2GH8A 3VBUA 5DDJ1 5C4WC 1VBB3 2XBO2 1PO12 2PLV3 5ABJA 1ND2C 1WCDJ 4AEDB 1HQNA 3ZFEA 4RHV1 2RS32 2ZAHA 5BNOC 1C8M2 4Q4X3 5ACA3 3VDDC 2RMU1 5C4WB 1PGL2 1E57A 5BNNA 2HWB3 1ZBA3 1ND2B 1H8TB 4Q4V1 1RUC1 3VBSA 3IDEA 1AR93 1A6CA 3VBHC 1RUD2 4YVWA 3JBG1 5A32A 4RS5C 5JZGC 5L7OC 4N53C 3FBMA 1RUJ2 1B35C 1QJY2 4GH4C 1AR81 4GMP3 1MEC3 4IV3C 3VBHB 1AYM2 1AL22 1HRV3 1AR62 1QQP2 3VBUC 1NY71 1R1A2 2WFF3 5JZGB 5L7OB 1VBD3 2DF7A 5ABJC 1B35B 1TME3 1HRI3 2MEV1 2X5IB 4GH4B 4EJRA 1TMF2 1V9U2 1CD3G 3ZFEC 5C8CA 2FZ2A 2RR13 4IV3B 1BBT2 3VBUB 5LK7B 1RUG2 4QPIC 5ACA1 3JD72 5ABJB 3TN91 5BNNC 4JGZA 2HWB1 1ZBA1 3ZFFA 3VBSC 2HWD3 1ASJ2 3ZFEB 2RS13 1AR91 1BMV2 1C8M1 5BNNB 2R063 4RR3A 4Y4YA 1PO23 5DDJ3 3VBSB 1VBC3 1SMVA 1BEV3 5BNPA 4GMP1 2QQPA 4FTSA 3J8F3 4YVWB 1OHFA 1HRV1 1RUE2 1R082 4Q4W2 1NCRA 4RHV3 2WFF1 1TME1 1HRI1 2RMU3 1PIV2 1K5MC 3VDDA 3JB4C 5C8CC 1QJY1 1RUC3 2HWC2 1R092 1OOPA 1POV1 5CFCA 3VBFC 2BUKA 2RM22 1PVC2 5C8CB 4RS5A 4WM8A 1F2NA 2HWF1 3CJIC 5AC93 1TMF1 1ZBE2 1M06G 2WZR1 3ZXAC 4N43A 4Q4Y1 1PGW2 4JGZB 4RR3C 2R072 1VRH3 1DDLA 3ZFFB 3JD71 1QJU3 1PO21 1VBC1 2BFUL 5BNPC 1BEV1 2MEV3 1VBB2 2XPJA 2PLV2 3J8F1 4PDWA 1RMU3 4RFT0 1NCRC 1GFF2 4GMP0 4RR3B 1AR72 2VQ0A 4GB32 1F8VA 1Z7S2 2RS53 4QPIA 1QJX1 1COV2 4Q4X2 3TN93 5BNPB 1W39A 2IZWA 3M8LA 2XBO3 1PO13 4CEYC 1OOPC 5CFCC 1NCRB 5BNOB 1R081 4Q4W1 2RS33 3VDDB 1C8M3 1EAH1 4QPGA 4WM8C 4Z92B 1OOPB 1FMD2 5AC91 4N43C 3HAGA 1D4M2 3JB8A 1RUH2 5J98B 1VRH1 4LLFA 4RQPC 2RM21 4CDWA 1QJU1 4RS5B 1HXS1 4WM8B 4N53B 1VBD2 4WM7A 5A33A 4N43B 4PDWC 1RUF2 1RUJ3 3LOBA 1K5MA 1RMU1 2HWE1 1QJY3 2WS92 3VBRC 1POV3 2RR12 3DPRA 4CDUA 1RHI2 1EV11 1RUI1 1C8NA 5FMOS 3VBFA 2R071 1VBE2 2RS51 3ZFGA 1AR63 4NWWA 4Y5Z0 2BBVA 1AYN2 1FPN2 4IV1A 4PDWB 2XBO1 1PO11 4JGYA 5CFDA 5FMOL 2HWF3 2HWD2 1TMF3 3CJIA 1V9U3 4YVSC 2WZR3 2RS12 1BBT3 2R042 4Q4Y3 2TBVA 4QPIB 2RS31 4QPGC 1VBA2 4SBVA 1RUG3 3JD73 1FOD2 1RVF2 2R062 1PGL1 5D8AA 4CEWC 1ASJ3 4CDWC 2GSYA 4QPGB 5A32B 1RUD1 4WM7C 3VBOA 1QJX3 1QJZA 4FTBA 1RUJ1 2RMU2 1FMD1 5C9AC 3DPRC 4CDUC 4CDWB 4CEYA 4Q4V2 1D4M1 3ZFGC 1AYM1 1AL21 1AR61 1QQP1 1R083 4WM7B 4IV1C 1MQTA 4Q4W3 5A33B 1R1A1 1EAH3 1K5MB 4JGYC 5CFDC 3JBG2 2WLPA 3DPRB 1X33A 1V9U1 2BFUS 3VBFB 1VAKA 2WS91 3ZFGB 1BBT1 1AR82 4BCUA 4IV1B 1RHI1 1NA1A 1ND3C 1RUG1 2RM23 4JGYB 5CFDB 1HXS3 4RQPA 5J96B 1NY72 1AYN1 5D8AC 1AUYA 4CDXA 3CJIB 5K0UA 1ASJ1 2MEV2 2HWE3 1ZBE3 1BMV1 3VBRA 3VBOC 1EV13 1RUI3 2X5IA 2ZZQA 2R073 5D8AB 5ACA2 1FOD1 1IHMA 1HX6A 3TN92 1NCQA 2HWB2 1ZBA2 3VBOB 1MQTC 1RUE1 1POV0 4YVSA 1AR73 1H8TC 4FSJA 1AR92 4GB33 1Z7S3 2Y26A 1COV3 1PIV1 4CEYB 4FTEA 1AL0G 5CFCB 4CEWA 1X36A 1MQTB 1R091 2HWC1 1NA1C 1MEC2 1PVC1 1RUD3 1HRV2 4CDXC 2WFF2 5K0UC
chains in the Genus database with same CATH superfamily
4YM1A 5IJRA 2LM3A 4W4ZA 1CAWB 4CCEA 1S4CA 5A6XA 1R1ZA 4PIYA 3N9MA 3MBWA 5JI7A 1W6MA 3SH3A 1XE7A 2ZCWA 2XXZA 2QZ3A 2X09A 1PMJX 1Z0HA 3WX5A 3H7YA 3AX4A 4AVVA 4G4FA 1YFUA 5C9AA 5IK8A 2P3KA 2NM1A 1PGW1 2ZTNA 3ILRA 4CUAA 3N35A 3R4UA 4NR1A 4YG6A 5F5QA 4A3ZA 2E51A 5HXVA 3WQ7A 1SEFA 2B4KA 4XIOA 1X7NA 4QM8A 4AEKA 2VL4A 3NAPA 4B4RA 4QGLA 4NIAA 3M3QA 4AK3A 1YJLA 2RE9A 1QEXA 1YQ2A 2ZGLA 1RUF3 2PLV1 1Y9GA 2UU8A 3IMNA 4XJWA 2HWF2 5CIRA 4HL0A 2WS93 4ISRA 3NNJA 5EFUA 1AR71 2MPFA 3WHTA 4WVMB 4LHSA 1ODMA 1UKGA 4AHYA 2VOVA 3V64A 1Z7S1 2VTXJ 3PU8A 1W2NA 3W5NA 1GUIA 2DCTA 1AYN3 1W28A 2Q0AA 2R6QA 4CP1A 4EN0A 4C1XA 1VBC2 4JVAA 2RVAA 1Q8OA 1J84A 2PYTA 1UXZA 4GKXA 4LO7A 4Q2FA 1UOJA 2ET7A 2FDKA 1OPOA 5LATA 2VQTA 5F6LB 1OQ1A 2C4XA 2IXIA 4MVTA 5GLVA 3KM5A 5FO9B 2E31A 2IVIB 4RHV2 4SLIA 1VBA3 1ULGA 3GBWA 1UZYA 4AG4A 5CG8A 3W20A 1HV0A 2DUPA 2BVBA 4LT5A 1CPNA 5LEKA 5C8WA 2DVAA 1OH3A 2VZTA 4QKFA 4XXAA 3ZXDA 1IS5A 5I0TA 4HZFA 4HVQA 1JYVA 1YCIA 1L3JA 5SV5A 3KSCA 3QLQA 5F5CA 4MADA 3V0BA 3POJA 4YW2A 3WCSA 4OHVA 5FXZA 1AF9A 4XMIA 2ZMLA 1W9FA 1VB4A 4RL7A 3H1YA 1UU5A 3UYJA 2TNFA 4XFFA 4CCDA 1BLZA 2GNMA 3UKTA 4UXAA 4QXBA 2Z2SB 1PIV3 3AKRA 2P5BA 2YUEA 3JCIA 4QPYA 5B4XA 3B9CA 3VKMA 3RQ0A 4LKSA 3HVDA 2D5HA 2HWC3 1SLAA 4LUKA 3KCXA 5D21A 1QMJA 1WMXA 3NKTA 5IAVA 1PVC3 3VLBB 4F7ZA 1VRH2 3KQRA 2W94A 3HQXA 5FZIA 3SEEA 3WOGA 1PX4A 3ZN6A 3HT2A 4Y20B 1U5XA 3AYDA 4NRQA 1SZBA 2ZBJA 3JBG3 4XCAA 1MS3A 3IDBB 5FP8A 2IUWA 2VNRA 4P9IA 3H1WA 5FYUA 1ULEA 3ZYPA 2VZSA 1W2OA 4N53A 3V65A 2BWCA 5L73A 1OMIA 2D97A 2EIBA 1B35A 2R041 2RS11 3JUUA 4DY5A 1Q8PA 4G9SB 1AR83 3F95A 3AJZA 3TAYA 1UU6A 3MUZ1 1EV12 1RUI2 4QGMA 2EIDA 2KR2A 5FYHA 1JZ6A 1ZRCA 4IV3A 2GH8A 3WDTA 1YQCA 4URAA 4FPHA 3GZUC 4AEMA 1JU4A 5ERLA 3VKFC 2JDNA 4Q8KA 2W0XA 2ZAAA 5L9BA 2PLV3 1O4ZA 2I07B 1DF0A 3ILFA 3GALA 2LUWA 3OUIA 1H0BA 1V6KA 1DFQA 1ND2C 5LWBA 1GANA 5FY1A 1JYCA 2UY8A 3WDWA 1OVPA 3AZYA 4LPLA 4RHV1 5A6ZA 2XONA 2Y0OA 5BNOC 1AXZA 1WMEA 3LZZA 5ACA3 2ENRA 2ZABA 4HK9A 4BQ4A 3OD0A 1XU1A 5I0UA 2FHRA 4KWLA 3NNGA 2FBEA 1LB2A 1PNFA 1ZBA3 1ND2B 2GP3A 4Q4V1 2QQJA 1IOAA 4E4SA 2QQUA 3DXUA 3MLJA 2HLEA 1UYYA 2VUDA 2MNGA 4D7SA 4Y5SA 5FYCA 4MSVA 3VBHC 3H8XA 2A6WA 1IS3A 3UETA 2EIGA 1SBFA 3MEPA 3D4KA 3O5SA 3CBNA 3RWNA 5JSRA 5JZGC 3S0MA 3FBMA 2WNUA 4UF0A 2XWJB 4K3UA 2ZXQA 1UF2C 1UO9A 2H0VA 4PIXA 4MGQA 3VBHB 1PVXA 4GXLA 4BIOA 1HRV3 1QQP2 3VBUC 1NY71 1NYWA 4COUA 4AFMA 4M4PA 4DRRA 5JZGB 4J1WA 2IXCA 1OUXA 2F4PA 3AZZA 1GBGA 2JX9A 1OLME 2TUNA 2P2KA 4RGAA 5FKBA 1S2KA 1I5ZA 2A1XA 2A7AA 2X5IB 2BGPA 1YC61 4QB2A 4XAEA 3DKWA 4E8CA 4IETA 1TMF2 2QQKA 5F2SA 4JZRA 1F31A 5C8CA 1OKQA 1I5PA 3K3NA 4AQ6A 1KS5A 1BBT2 5FPVA 5T5JA 4EWEA 4EE2A 2E53A 3UT0A 3VBUB 4NAMA 3NJYA 3J7NA 5FAXA 4HSLA 4K1ZA 4Q1RA 3TNPB 1RJ8A 3N7LA 3ZMNA 2X8KA 3POEA 3TN91 4CXWA 3KF3A 1F5FA 1SFYA 5FMDA 2XB6C 1UX6A 3RZGA 4Q8LA 4EWAA 4CRQA 2RS13 1XSRA 1AR91 4K20A 3TWIA 4UW4A 1V6MA 5C71A 5HXMA 4MGIE 2D6PA 1W8HA 2BP6A 4QQPA 4LBQD 4YZ3A 3AFKA 4ZU5A 4BMEA 1UY4A 1H6XA 1SACA 5FZ8A 4L8QA 1VBC3 4MXVA 3J4UH 1H9PA 2W1QA 2CDOA 3B69A 4HONA 4JQRA 4WVZA 5FLIA 3ZXLA 2ADDA 1BHGA 3T3YA 4YVWB 2IC1A 1OHFA 3U75A 2Q30A 1RUE2 2W9XA 4RHV3 2P6HA 5T50A 4ES9A 5FP3A 1XQNA 3MPPG 2JD9A 1LU2A 4BQ5A 2BWAA 1HRI1 3HWJA 2PHDA 2E9QA 2C9KA 5JPMB 1S1AA 3PTYA 1QDCA 4CP9B 5FZOA 1APNA 1R092 2ZZJA 3LDBA 3OB8A 4I30A 4IEYA 4LKDA 4C0BA 1JS9A 4X6RB 3L2HA 1A78A 2E63A 4ZKTB 1O8PA 3V56A 3GZAA 1REEA 1W6NA 4M3CB 1US3A 2GC3A 3AP5A 2EXIA 2UWBA 2YDEA 3CJIC 5CKNA 1XYPA 3LD8A 1W0PA 4YZ4A 1MR5A 1TMF1 3RI8A 3U4XA 2G9ZA 3C7FA 3ZXAC 4N43A 5C33A 3J7MA 3OD4A 4A2UA 4Q4Y1 2YMZA 4AFBA 4YZ5A 2OA2A 4CP0A 2R072 3O0VA 5LY1A 1VRH3 1DDLA 3NNLA 1PO21 1Q8SA 2D3PA 2BFUL 3POYA 5EJ1B 1BEV1 2D6NA 4PQ9A 3RFRA 3WP3A 3GDBA 4FO9A 1VBB2 4LKFA 4YFZA 1UPSA 3VDAA 2Y64A 4CPBD 4RFT0 4GMP0 5CKQA 4A6SA 1CZSA 1KITA 1WZXA 3JXSA 4CTEA 1F4AA 1XPWA 3O0XA 4TXWA 4NPRA 4GAZA 3IN9A 1I3HA 4LLOA 1EYBA 5EWSA 3W9AA 2D5FA 1QJX1 4LK7A 3TN93 1EUUA 2IZWA 1JUHA 1GSLA 3B7MA 1S0FA 2D98A 3U10A 5DAXA 4CEYC 2FQPA 2VMEA 5CFCC 3I2FA 5KHHA 2DWRA 1A8DA 5FPAA 5FY4A 3WINE 4C91A 3BOWA 4NOTA 5F5IA 2KXLA 1REFA 4NMIA 1G7YA 4OVEA 3H1MA 1YHFA 4WM8C 1GWMA 1TNRA 1Y9MA 2VULA 2ZHMA 4CUBA 2ZKNA 5JDBA 4Z92B 2FMYA 2VW0A 5JR2A 5AC91 1JZ7A 1VRBA 3GBFA 4HN1A 3GZEA 4HPKB 4YFWA 2XGXA 2JIGA 4D7TA 4PHZA 4TLGA 1LHNA 1RUH2 5C3RA 3LCPA 2E7AA 1POQA 4L2NA 4LLFA 3DCQA 1UCXA 1QJU1 4QT6A 2O14A 4WM8B 3RYRA 1MZFA 2OXBA 2PAMA 3PNAA 2D3RA 1UZWA 2DUQA 2LALA 4YG0A 4IE5A 5BXXA 3GYDA 5A33A 3KCYA 1WGPA 5FZDA 4BMBA 5KHKA 2R49A 1VE0A 1XNKA 5DMYA 2EXHA 4AAPA 4BQ2A 1YI9A 3O1OA 3WNPA 1H1MA 3FUQA 4XFGA 5LBBA 5FUPA 4OUMA 3R05A 5FMOS 4GJYA 2VW1A 1XRUA 5C6CA 2R071 4IEVA 4Q29A 1VBE2 2JICA 3LDRA 1D2QA 2Z79A 2BBVA 4PBPA 1FNYA 5FZ1A 1FPN2 4IV1A 3ITQA 3HQUA 1O3TA 3IT8A 4RGKA 1QNYA 5FMOL 2B45X 2QQNA 1W6PB 1TMF3 4H14A 3CJIA 4JDOA 3KWVA 1DIWA 2WQZC 3I3MA 4CVUA 1S0DA 4NIHA 5LBCA 1WUVA 1BBT3 2GP5A 2BGOA 4Q4Y3 1H1IA 5EQUA 4QPGC 5GZFA 2Q8EA 4Q26A 4AI2A 1MS9A 3RZKA 4OI4A 3OPWA 5A7WA 2GZWA 3VV1A 3IMMA 2XJUA 3G6JB 4FP3A 2P3JA 1AZDA 1GP5A 5G05L 4B1MA 1BCXA 2IXJA 4CCCA 1VALA 1BZWA 1IZ3A 1QGLA 4FQZA 3NRUA 5D8AA 4COWA 5DUVA 2W5FA 4YG3A 5FZEA 5A6YA 5IYYA 1G9FA 3OPTA 4QPGB 5A32B 1YUDA 2D6OX 3T2TA 4DQAA 4JKMA 4QDQA 3RDIA 3KV5A 4ZHNA 1RUNA 4QB1A 2O8OA 1PK6C 1RC6A 4FFIA 5DUUA 5JXJA 1QJX3 2NPIA 4BQXA 4LHLA 1RUJ1 3PUIA 5T5LA 4NJ4A 3HD8B 4F83A 3KGZA 5BUVA 5E8AA 1E5RA 1LOCA 3P3NA 2ORXA 4GA9A 1O7FA 4CDUC 4CEYA 1JI6A 5LRRA 2VC9A 1W0OA 3DEMA 5K9YA 1SDWA 1AYM1 1AL21 1AR61 5IW0A 1MZ6A 1A3KA 1QJFA 3O1MA 1PK6B 1R1A1 1J3QA 1K5MB 5CFDC 3DF0A 1GR3A 2WZPP 3S5QA 2JDHA 3RPQA 1L7QA 4DOUA 4YZ1A 3RZJA 4ZY9A 5A80A 5LBFA 4OMCA 3M70A 2Y6LA 5L9VA 1V9U1 4XC9A 5FZ0A 1YO8A 3EBRA 1LKNA 3WSOA 3S57A 2AC1A 2J1UA 3D82A 4H55A 4PLOA 4BCUA 1JN2P 3LAGA 1RUG1 2J1AA 5J96B 5AFEA 5CFDB 1ZZ7A 3BTYA 2PAKA 5EYXA 1GLHA 2A71A 4XACA 2WQ8A 2WFPA 5E1RA 4B7KA 4CDXA 2V73A 4QXCA 2YG0A 2ZS6B 5J09A 2QQVA 1HJGA 4HBNA 5E6HA 4UW3A 3I49A 1US2A 4B4QA 4XUPA 2WT0A 5FP7A 2P17A 3AK0A 3OY8B 3POBA 4JDNA 2DV9A 3K77A 2ZGRA 4K7JA 4YGDA 4NAOA 2R073 3FHAA 3QBQA 2H6CA 1R64A 3B93A 3WG1A 3SITA 1IHMA 1JYTA 4YWAA 4LE4A 1KDMA 1K3IA 4YLZA 1S2BA 4J1XA 2HWB2 5FJKA 1F5JA 3POFA 2VZUA 3BKZA 1W04A 1GP6A 1QWRA 4LORA 4IEZA 3NO8A 1POV0 1H8TC 3OBZA 4JKKA 3I2JA 2Y6FA 3E5UA 4S2HA 1AXKA 3ZYRA 1SLLA 4K8FA 4BM8A 1ZA4A 3E6BA 2Q8OA 3E5QA 1SBDA 3WR0A 3FLTA 1NA1C 3U11A 2EAAA 3OGRA 5CB7A 3ILNA 2KM2A 2H6BA 5D2AA 2V4AA 2A75A 4L97A 5C3PA 2VJXA 4DY3A 4ZU7A 5EP9A 4BHPA 5CZKA 4B29A 3B5LB 1NG0A 4XJZA 1UN1A 4B3NA 4WZFA 4U36A 1ZBE1 1NE4A 1NA1B 2IXKA 3AP9A 4LUMA 4RQPB 3T4VA 4RGGA 1RUH3 4ZS2A 1ZVFA 5I0SA 1AYM3 1AL23 2PELA 2VOKA 2W1SA 3NJVA 3KV9A 1KJLA 3M3IA 4JHTA 4OI2A 5FV3A 1R1A3 4AFCA 3WF0A 5F9TA 5JXGA 1W0NA 3ST7A 1JOJA 4AI0A 1JODA 3EB7A 4U2AA 1URXA 4YGEA 2AEZA 5I93A 4CDQA 2PXJA 5C7GA 2JDPA 1U5ZA 3ZXJA 1UPIA 3RNSA 5IFTA 2WZR2 3ZYHA 5KC5A 3TOJA 2ZJCA 4S2DA 1GZWB 4BE3A 1DG6A 3ZO0B 1CVNA 1VBE3 3RWKX 3ALQA 4XDPA 4Q4X1 1XNBA 3EXUA 1IG0A 1FPN3 4AEJA 3AB0A 3FWEA 3IDCB 5DDJ2 4WZCA 2JIJA 4WVWA 1AJKA 2XH6A 4QWNA 3CZJA 1H2KA 2ARBA 3J8F2 1HJFA 1DLLA 2WO2A 5GZEA 4AXOA 2WDBA 5D1IA 4NIGA 3CNAA 4XQWA 3D0SA 3CO2A 2EA7A 3MZHA 3SXWA 3K4ZA 4AEDA 5FUIA 4CEWB 3IIIA 4YW7A 2ZGOA 4Z82A 1NXMA 2Q1ZB 3UESA 4AL9A 2VZRA 1I1EA 3BIWE 2VBPA 2ZMKA 4C1WA 5T3NA 3AXEA 3FMGA 5GZGA 5H9SA 1RUC2 3B02A 4AVBA 5FLJA 3T30A 1HLCA 1DQ0A 4UW6A 3CF6E 4M01A 2WO1A 1GZCA 1QHDA 3NAPC 3JZVA 1XNCA 1H8TA 1W6MB 1RB8G 4XCBA 4AOCA 4QX3A 5LASA 3AM2A 1EAH2 1NOVA 2I74A 5C9AB 1RUF1 2JXAA 3VKNA 1MZEA 3I3QA 1S0CA 1TNFA 4NIDA 3CLPA 3KVBA 4UFHA 2RR11 1W8UA 2WZEA 5C70A 3PVOA 4LIUA 3KCCA 3NAPB 4DRVA 1JOBA 2ZGUA 1D2SA 1DZTA 3U4SA 2X29A 1XYNA 2O8QA 3U1XA 1VP6A 1XYOA 2OX0A 1OSGA 1HXS2 4JGZC 2BBAA 5FY8A 4BQ3A 2WC2A 1W06A 2WA4A 3MF9A 1WMDA 4O7XA 3VL8A 5GKAC 4LULA 2XLAA 3ZOIA 5L7OA 2HWD1 1D0HA 1ENQA 5IUQA 3AZXA 2HWE2 3KVAA 4LBOA 1DYKA 2VTXA 5HCHA 1XXNA 3RG0A 1ALYA 2XKPA 1TZOA 1UOBA 3IPVA 1JYIA 4GH4A 5FXWA 4DS0A 1VBA1 1Q5OA 1Y3TA 3T1LA 2W3JA 1L7RA 2CAVA 2VCCA 2WO3A 3WVJA 2DDUA 3BTZA 2P6CA 2RS52 2R061 3KZ4C 3BU0A 1DGRA 1YIFA 3BN6A 3H0OA 1XU2A 4HOOA 4PLMA 2P1BA 4W65A 5DDJ1 1JYXA 1SLBA 1JZ8A 2XBO2 3J7LA 5ANNA 3LIHA 1ZRRA 5ABJA 3DN7A 1D0GA 3R6SA 2Y0IA 4XQDA 1DP0A 1QH6A 1UY3A 2JG8A 2ZACA 4GZ9A 3MIBA 3A7QA 2VCMA 3ZFEA 2RS32 2ZAHA 3E97A 5FZKA 4OHYA 1FXZA 1H9WA 3U14A 4Q4X3 3J9SA 3VDDC 2RMU1 2XLGA 3USSA 3V0BB 1UYPA 4GIQA 3SNMA 5L36A 1PGL2 1E57A 1X9PA 4GJZA 4XW3A 2FDFA 1GYKA 2WSUA 1JUIA 2HWB3 4DZGA 1DCSA 2FCTA 5KXCA 1RUC1 5JMCA 4DNYA 4O61A 1HW5A 2BJSA 3RS6A 3FX3A 4LMFA 4XUNA 1RUD2 2VOXA 2A6VA 2RJKA 2WL1A 2J1EA 1Q8VA 3JBG1 2WNVA 3SHRA 4BOWA 2EVXA 4ZXEA 4A7YA 1ONAA 4RS5C 4N53C 1XJAA 3ZN5A 3GBGA 1W03A 1B35C 1BK1A 1IG3A 3I3EA 1J83A 2VOWA 1CQ9A 2JD4A 3G7DA 3KB5A 4FI9A 4QX2A 3AC0A 4UWDA 1AR81 4E4DX 2B42B 2DVGA 1NQDA 4GMP3 3ZN6B 1BVP1 1DQ4A 4IV3C 3LA2A 4Y1UA 1LOGA 4LHNA 2DF7A 3FE5A 1WCSA 1B35B 1S55A 5CEHA 5F37A 2MEV1 1SPPA 2P3IA 2QBXA 3AMNA 4LBJA 2V4VA 3Q8CA 3OSDA 2VNOA 4OMDA 1LAJA 5F1RA 2RR13 4IV3B 3LA3A 2ZOEB 3VN4A 3NV1A 5ANQA 2WNEA 1N1YA 1WA6X 4QPIC 5ACA1 4QHZA 3JD72 3MIDA 4JQTA 4MYEA 4JGZA 2V72A 4R9CA 4P5HA 1UZ0A 3OUJA 3P5BA 1FYUA 1ZBA1 3BOPA 1YJKA 4Z2WA 3BTXA 2HWD3 1ASJ2 5A7NA 5A1FA 2VTFA 2W68A 2WLQA 2WYFA 2ZEXA 5F32A 5FY5A 4ARYA 2FDHA 3X29B 3W58A 3ROUA 3OGGA 3DYOA 1UY2A 1OC1A 3EYPA 3GXUA 2R063 3MIGA 4ZPIA 4RR3A 2VCBA 2GNBA 2WNUC 3JQWA 4FBFA 1K42A 3IBMA 5GALA 1LGCA 1QOOA 4XBQA 5DDJ3 5F3CA 3Q8EA 2CV6A 1GQHA 1SMVA 1K12A 1YRZA 2OUHA 5DUWA 2AH2A 4DO0A 1F9KA 1LOFC 2JE7A 4LBLA 5FP9A 2CSGA 2OS2A 5F39A 3J8F3 2DU0A 5FZ7A 1FATA 1SQ4A 4JRAA 5H9PA 3ZIWA 4PI0A 5A1AA 4NIIA 2J1VA 1HRV1 1CR7A 5FY0A 4OI0A 1RXFA 1NCRA 3GGLA 2XL7A 3ES4A 3PIGA 2VBBA 4UF0B 4D7YA 4EROA 1SCSA 1YFXA 3E5XA 2RMU3 3LEKA 3LOIA 1OURA 1S0JA 3VDDA 4OLLA 5C8CC 4MGKE 4XF0A 3WF2A 4AFAA 3RVHA 3VHRA 5JSPA 2ZEYA 3HMYA 3URFA 1RUC3 3T4HB 4CCOA 4MXWA 1OOPA 1POV1 1UD1A 2ZX4A 4XF4A 4NPMA 5FPLA 3WDVA 3AJYA 1V6LA 2VVFA 3MLKA 1LGBA 1W6OA 5T55A 2B5HA 3GHNA 5BYNA 3EQEA 2YZ4A 3MFCA 1HN0A 3IM0A 3PUSA 4UI9L 4RS5A 5C8CB 2XVKA 2HWF1 1LOBA 4META 4EYUA 3LKJA 4Q0SA 4FFGA 5H9QA 2A5ZA 3LFMA 2Y6JA 3POIA 1FI2A 2BDRA 1WWYA 2XVGA 1WA4A 4XUOA 3HN1A 1QY4A 1RGSA 2RJLA 3J7HA 4FT8A 2BV4A 1UW8A 3ZSJA 1RUOA 3JD71 4EZ4A 3USUB 4Z1VA 1MVQA 1VBC1 2EICA 4LO6B 3P1IA 1V70A 4OHWA 3T1MA 3OOXA 3ZPYA 5KC6A 2JB8A 4C0HA 2MEV3 2JDYA 2OKXA 2HYKA 4LO8A 4TYSA 4PDWA 1OA4A 4KL1A 2F17A 3LPFA 1YQ8A 1OFNA 4GB32 3C2UA 2C26A 4RYDA 3PVNA 1F8VA 2RS53 3KT7A 3Q8AA 1I9RA 3DV8A 1COV2 2PHWA 3PLQA 4FPJA 4QPIA 4E2GA 1N3OA 4XPVA 3T2OA 2GALA 2XBO3 3TYJA 3UJOA 5CYYA 1D7PM 2VPVA 4RN5A 1IPJA 4RSUA 4XURA 1MS4A 5FWEA 5I0RA 5I8TA 5L19A 5BNOB 4UYBA 4QX8A 1W9SA 2AEYA 2W2IA 3OGJA 2PMWB 2RS33 1CAXA 3FBYA 3NMBA 4H7MA 1YNAA 4YNIA 2BNOA 5FQ0B 5IVEA 3RZMA 1GU3A 3RZLA 3HT1A 2BTVC 4Q27A 1QH7A 2E7TA 2VMHA 5FZOB 3WXPA 1WD3A 4N43C 3ZSMA 4LJHA 1RIRA 5EV7A 3UKNA 2CAUA 1QKQA 4MHUA 4NE9A 1LOFA 5SV8A 5GLUA 1G86A 4JKLA 1UOFA 1VRH1 1W6NB 5FOBB 3ACGA 4CDWA 4UFMA 4ATFA 3L2YA 1VMFA 3R4DB 1VBD2 2CU5A 1J3RA 2ARAA 2ORZA 4N43B 4EN9B 4J25A 3LOBA 3H3UA 2UURA 3EMRA 3RYKA 3VBRC 2WJSA 1POV3 1ENXA 2IXLA 1DQ1A 5GZCA 1RHI2 1EV11 1RUI1 1C8NA 3LEIA 4QU1A 3AP4A 1FT9A 2YGMA 2WRAA 3KV6A 4JAAA 2RV9A 4NN0A 1NZCA 1UY0A 2OPWA 1VPHA 4RFRB 4XDQA 5FYTA 5A3PA 3ZVXA 4AW7A 2E6VA 2VOTA 4AR2A 1X8EA 3D3AA 4AF9A 2WT1A 5CBLA 2HWF3 3HN3A 4QD2A 3SISA 5JIUA 4NHXA 5LRSA 2R30A 2OZJA 2A73B 4YVSC 3FUOA 1ZZ9A 4RA0A 4IGQA 3NV2A 4B4PA 2UYAA 4QDSA 1Q56A 3LB9A 3JD73 2RDNA 4JDMA 3WHUA 3ZX7A 5J48A 1RVF2 4LE3A 4TN7A 3KS7A 5JIAA 2WR9A 4OZOA 3U78A 3FL7A 2BGCA 3AMPA 1MS1A 3UK9A 1ASJ3 3THCA 4QKNA 3GNEA 3KV4A 4TWTA 1UWWA 2ZKLA 4FPLA 4E4HA 3MLLA 1GNZA 1NQJA 4HKOA 1RXGA 4HETA 2VQUA 4YM3A 3MW4A 4NRMA 4QHBA 5JXHA 5A3OA 3VBOA 4IEOA 4K40A 3BCWA 4BWOA 3RYPA 4HXCA 3WW3A 3U07A 3HBKA 1G6NA 4HN0A 2C0ZA 4AE2A 3KT4A 1WCKA 3BB6A 4OYUA 3HNBM 5BV6A 4EN8B 4XDOA 3SKJE 3THPA 5EIYB 3SQOA 3MW3A 1EUTA 1QQP1 5A33B 4IV1C 5FPXA 1WLDA 2FCVA 4MX3A 4N9HA 4XMAA 4F3JA 2WLPA 4DXTA 2DURA 1VJ2A 3BPSA 3KLSA 3SCHA 4Y3OA 5EZWA 5FYZA 2O1QA 2BFUS 5KHIA 1VAKA 5FZFA 1W6QA 1BBT1 3KHBA 4R9BA 4IV1B 1RHI1 4EWDA 1CJPA 1ND3C 5DG2A 4JRLA 3WW4A 4PCRA 3ACFA 4W8JA 3PUAA 5D8AC 1ZA7A 3OCPA 1JZ5A 2W91A 3CJIB 4RD7A 2FCUA 4HKLA 3WQ0A 2B7YA 5K0UA 3WNOA 5JSOA 5LK5A 4BA6A 2PN5A 2ZHKA 4XE9A 4YM2A 4D6QA 3N7JA 2MHFA 1H2LA 1A34A 3ZN4A 4Q0VA 5A7WB 3H8OA 2PAEA 2DCZA 5JWPA 1QJEA 3VBRA 3J26N 4L92A 2ZHNA 1EV13 1B09A 1RUI3 2X5IA 3H9AA 4NROA 5C5UA 1H6YA 2BNMA 5D8AB 3QOPA 4TTGA 3ZXEA 1C5HA 2A3XA 2VUCA 4UFLA 1KQRA 1FV2A 1NCQA 3S7IA 4LHKA 5GJ6A 1PM7A 2DVDA 1PMIA 4AGGA 2W08A 4FQ4A 1RUE1 4YVSA 5CNAA 5IVFA 5IVVA 2YV8A 1AX2A 2OVUA 4GB33 4CA9A 2VGDA 4Q1PA 5JR7B 2GNTA 3VD3A 1RINA 2GH2A 2AENA 1COV3 2Y26A 3LPGA 4CEYB 4OQ8A 2LROA 2EAKA 5CFCB 2SBAA 4KG8A 2D3SA 1GWKA 3B01A 3IDAA 5DAWA 5KWRA 1U12A 1NT0A 1UYZA 2VECA 4P00B 1R091 4FOVA 5KR7A 1MEC2 2WKKA 4S2FA 5FZCA 3I2KA 3CL1A 3N9LA 1LRHA 5FY9A 3TB0A 1ZNPA 5FXXA 1NZIA 2P34A 4CDXC 5JUVA 2B8MA 2G1MA 1KS4A 5FMCA 2WFF2 2XJPA 2D40A 3WDUA 1ULPA 5T5PA 5J1XA 1C5IA 1F4HA 1S2EA 4W50A 1OQEA 4XHXA 3S6PA 1TME2 2RDRA 1BVVA 1BYHA 4M0NA 3L9JT 3V0AA 1OLRA 1W9YA 1ZX5A 2PHXA 4MGYE 2AYHA 5FR3A 5EYYA 3SC7X 3NNFA 4ASLA 4CDXB 1QQP3 3MI8A 1V6NA 4CE8A 3THDA 2VY0A 3H8UA 2VM9A 1LOAA 4MO3M 5AVPA 5EXOA 4MV2A 3WDYA 4L99A 4DMIA 2B9UA 2HKXA 1VBB1 2YXSA 1SCRA 1I6XA 1DGWX 2Z69A 1ZREA 2QDNA 2YPDA 3FZ3A 1QNWA 1ZRFA 3KMHA 4M3CA 5FFOC 2KA3A 1RHI3 3I3BA 4CU8A 4CCMA 1E5HA 2JECA 2V5YA 1EY2A 1ND3A 3NJXA 2WO7A 3EHKA 3WW1A 1C3HA 3SH5A 1CIYA 3ACHA 1BQPA 4BIFA 2B9VA 1WLCA 4XFAA 2UWAA 2Y8KA 5FBJA 5JOYA 5HCBA 3WV6A 2JG9A 3I2IA 3MPBA 4Q0QA 3WP5A 3HIFA 1QXRA 5LCWL 4AQTA 4Y1ZA 2ZMNA 1PZ8A 1H4GA 4OCTA 4AWDA 4DFSA 2DVBA 4Q0PA 1SLTA 2DFCA 3WNMA 3PUHA 5FK7A 1RVF3 2ZGNA 2CWMA 2ZPXA 3DGTA 3H3ZA 4HSJA 4V2VA 4FOQA 4QAWA 1FNZA 2N7GA 2R1BA 3AVRA 2VVEA 3RJ2X 1CAVA 5JOZA 1VAVA 5C4WA 4FVVA 1Y7BA 3OBAA 1RUH1 1NUKA 2BW8A 4KH9A 1MEC1 4LEJA 3B3QE 4NWVA 3MIFA 4BJ0A 1RUE3 4I01A 3UGGA 5J7MA 1ZZ8A 1DGLA 3VHPA 5FZ3A 4QMAA 5FOJB 5FYIA 3SKVA 1W2UA 4ONUA 3WW2A 3VD4A 2BRTA 1YLLA 4GWIA 4CDQC 1OT5A 4CDUB 2G4IA 4DIQA 2XJQA 3I8TA 2ETEA 1KD7A 4FPEA 2R0FA 5FXVA 3UKVA 1R093 1DYPA 5GZDA 4GKYA 3T2QA 5C3OA 1W05A 4XEZA 1O3SA 4URTA 5JLVA 2RJ2A 5FYVA 1CZTA 3WP4A 1VBE1 1J58A 4DXSA 4ATEA 2G9GA 5A1LA 1JZ4A 3O1VA 1FPN1 2GN3A 3JQXA 4X8PA 4CDQB 3OGSA 3ZFFC 1VLNA 2Q1MA 3ZXKA 2VZVA 5CAZA 3RSJA 2XJVA 2J42A 2OT7A 5FZBA 1RMU2 3MGUA 1VB2A 1HN1A 2UWCA 1IKQA 2WAAA 1HB4A 3BVCA 2WN3A 3NJZA 3N4MA 5J37A 3SEPA 4M0HA 3AVSA 4AEDC 4UBHA 4QM9A 3ZKYA 4DXRA 5FDBA 3POSA 2R16A 1GV9A 1HB2A 1G9CA 3BTAA 2VE1A 3SLIA 4LKEA 4ZONA 1BXHA 2XQRA 2ZX3A 4R8HA 1WD4A 1VBB3 1PO12 1W8NA 1HQLA 1ODNA 2XR4A 2YC2A 5JOXA 1UAIA 5G04L 1STMA 3JU9A 4FPOB 3ZDVA 3T0BA 4AEDB 3TEXA 3I97A 1HQNA 3WCRA 1ENSA 5IT6A 1W8FA 3E6CC 1C8M2 1PZ7A 4ISQA 2ZGKA 4NUBA 3N7KA 2Z4FA 1W2AX 4UFKA 4BDVB 5BNNA 1TVGA 3RZZA 3VGIA 4KGQA 2QTWB 3OGVA 4DEVA 1H8TB 2CDPA 1XB9A 2YHJA 3M1HA 4P08A 4EN7B 3VBSA 2IFWA 1CX1A 4KWJA 1VR3A 2K0GA 3OTFA 1A6CA 3POGA 1W2TA 2FDGA 1NE6A 2W46A 4ZS3A 3WY6A 2QQLA 1RITA 3APBA 4LNVA 5A32A 2HBTA 4LA3A 5L7OC 3VL9A 5DZEA 3RGBA 5LW9A 5CG9A 3AMQA 4P9JA 4I09A 4GH4C 3QH7A 5KXBA 2Y33A 1MEC3 3ZYGA 2Q8DA 2VZPA 5HBAA 2W1UA 4N8MA 4XBNA 1PX3A 2ZEZA 5A70A 4LTAA 1UY1A 5FO7B 2HJIA 3DUIA 2WFF3 5L7OB 2Z42A 4I02A 2VMFA 4XFCA 3PMEA 5A3LA 5ABJC 4H3WA 4KG0A 1TME3 3IPVB 3TNQA 4GH4B 2JG8C 1ZZCA 4XTMA 3U37A 4EJRA 4XZUG 4YW4A 2DU1A 1YFWA 5LB6A 1AXYA 1CD3G 3ZFEC 2FZ2A 4ET7A 2VUAA 2XJTA 1JHJA 2CGOA 2DTWA 3SH4A 3HPNA 4IE6A 4GALA 2BYVE 4QB6A 4LOTA 5C3QA 1UX7A 3FFZA 3ORJA 4XILA 5ABJB 4NHLA 5TSWA 3VZLA 2JG8B 3VZNA 5T52A 4XF3A 1O3QA 2HWB1 3ZFFA 1IQAA 4OQ9A 4E8DA 1UNBA 2CHHA 1LENA 2O0OA 4HVOA 3ZFEB 2XJRA 3PHMA 5LA1A 2ATFA 1GWLA 1PGSA 4WV8A 1W8WA 1BMV2 2WNVC 2V09A 2FDJA 3AYCA 1C8M1 2X05A 3B00A 1AVBA 5ISLA 4Y4YA 3Q8FA 1WKYA 2YFUA 1O91A 3Q8BA 4OHZA 3N3HA 2ZGQA 3BYWA 3NV4A 5BNPA 4GMP1 4QX5A 2YB7A 1IQDC 3AL6A 2XUEA 2WNVB 2OIIA 1GNYA 4OULA 4QXKA 1R082 2Y34A 4IE0A 2A3YA 1RJ7A 4I3GA 3WT3A 4BLIA 4XJUA 1Z78A 1LHVA 4FPGA 2IWGB 4XF9A 5E16A 2BVVA 1QDOA 2L9LA 3MV11 1PIV2 3QCWA 5FP4A 4JTNA 5BNQA 1SFPA 3JB4C 3M3EA 3AKQA 4JV4A 2OW4A 1S0EA 1N47A 3KQ4B 4YRDA 5FPZA 1LU1A 3ZIXA 2HWC2 5F3EA 3K51A 1ZRDA 3VBFC 2BUKA 1HB3A 4CCJA 2WAOA 3RJRA 4HANA 5CISA 2YC4A 1PVC2 2HEWF 5H9RA 3K3OA 3I2HA 1SPPB 1H30A 1MVEA 2YC0A 5FIXA 4HLTA 4CP2A 1O3RA 4QX7A 5A3UA 4E2SA 5C3SA 3O14A 5I91A 4AGRA 2RG4A 2YYOA 4PF5A 1CN1A 1F2NA 1C57A 2Y6KA 4YGBA 1Q43A 2BU9A 4D6SA 2XL9A 4FAHA 2WZR1 1CAUA 1S0BA 2JWPA 2BZDA 3I2OA 5JI9A 1PGW2 2QKDA 4JGZB 4RR3C 2BNNA 5FZLA 5EJZB 4UAPA 1L7LA 1YXWA 2VVDA 3CMGA 4KU7A 4UFIA 5FKCA 4IDZA 5A6QA 2FDIA 4A3XA 3CIHA 5B4NA 4C90A 4OZXA 1BJQA 4X6QB 2PLV2 3J8F1 5T5OA 3WG3A 3WLUA 1RMU3 4UBGA 1NCRC 4Q5OA 1GOGA 3CKHA 3OYWA 4RR3B 1AR72 2RHPA 3K4DA 1PNGA 4BB3A 2GN7A 2VQ0A 1V0AA 3M4FA 3WEZA 1C1LA 2WT2A 4Y24A 3IZOA 1Z7S2 1ACCA 1KGYA 3I7DA 2GMMA 4X8NA 3I59A 4AI9A 2VNGA 3DECA 4XXPA 3ZPOA 5K7PA 3M8LA 5GLTA 1DBNA 1PO13 4AAXA 1OOPC 3UNPA 1DGRN 5FY7A 1NCRB 3ZR6A 1C4RA 4YW6A 3O1PA 4IGPA 1GZ9A 1JZ3A 1HKDA 4D94A 1AJOA 4IESA 2R0HA 3HR9A 1R081 5IVCA 3H3LA 3PVBB 4KNCA 3VDDB 1C8M3 1IPSA 1IGOA 1EAH1 2PHUA 4YW1A 4Y22A 4FFHA 2DCJA 4AFDA 3ABZA 4JTOA 4S2GA 4MXWB 3SCFA 1OOPB 1FMD2 4LOSA 3WNNA 5LA9A 2OQ7A 2RDQA 5LEJA 1W6OB 3CEWA 1D4M2 1DZQA 3JB8A 2VBDA 2ADEA 2ZA9A 4L9BA 2EALA 2VMIA 1N3PA 2Q4SA 3VDCA 1KJRA 1HXS1 4IQPA 4RS5B 4EN6B 4N53B 5A3NA 3INAA 1YQ6A 2J1RA 1WW6A 3HNYM 4K1YA 1WLTA 4WM7A 4PDWC 1WW7A 3PJQA 2YGLA 3OBRA 1TE1B 2DBIA 1CESA 2HWE1 1MACA 1O5UA 2C6SA 3BU7A 3FLRA 3MIEA 4YZ2A 4P9XA 5F7UA 1JBCA 1LNSA 5A3WA 2QJVA 3DPRA 4LITA 4PIZA 2YFZA 4BLJA 5FZAA 4TZDA 3VBFA 2RS51 3ZFGA 3PVEA 4Y5Z0 2QZ2A 2Q8CA 5CADA 4BQWA 1V6JA 5DPNA 4PDWB 2D6KA 2WWUA 3VZJA 4BK5A 4Z2AA 5FRAA 5A7QA 2XBO1 4AVTA 4JGYA 3MUY1 1CONA 3ES1A 4Q0UA 1PHMA 3QD6A 3ACLA 1MZ5A 2YBPA 3RZHA 1MPXA 1UYXA 2WZR3 2XLFA 1U0AA 3PTRB 4NHKA 5GM0A 3RMXA 2RS12 2R042 2W52A 2XMLA 4QPIB 5DG1A 2RS31 3T0AA 5FCCA 3LWCA 3WF3A 3ZSEA 4AI1A 3PDQA 4B8EA 2P37A 1W9TA 3FJSA 1ULOA 4E27A 4OFGA 1FOD2 1OKOA 2GC2A 2PQSA 3ACIA 3WP6A 3T09A 1PGL1 4BQ1A 1JMUB 4PLNA 3AFGA 2C9AA 4UOJA 3HJRA 1GP4A 4A45A 2GAUA 1CAXB 1QXPA 4H7LA 1SLIA 4CDWC 2GNDA 2GSYA 5F2WA 2VUJA 4AHZA 2GC1A 4P5YA 1RUD1 2A6XA 2JDAA 2WNUB 4QQOA 3WQ1A 4QX1A 3ZSKA 2JDKA 1OLQA 2D7FA 1NXD1 3ATGA 4KWUA 4ZZ8A 4FTBA 4KQ7A 5CA6A 2EIEA 2JJ6A 1FMD1 3GCWA 2SLIA 3ZSLA 1DQ2A 2WWJA 4FAGA 4CDWB 2JDUA 2C1FA 4GWJA 4Q4V2 3GHMA 1D4M1 1PMHX 3NV3A 4HMZA 4N7UA 1YIPA 3DL3A 1VAMA 5IAXA 2ZX1A 5JPNB 3B94A 1R083 4AVSA 5FJHA 1MQTA 4XOGA 3FFQA 3VHOA 4I0WB 4EV0A 1V6OA 1EAH3 4J6GA 3VUOA 4LBQA 4XF1A 3N36A 2PA7A 4OUSA 1O59A 1UMIA 4P14A 5A7SA 1X33A 2GDFA 1QF3A 1SHWB 4IE7A 1LULA 4MH0E 5AVAA 2VZ1A 4DINB 1CAWA 2PHTA 3CZUA 5FYSA 3K48A 5A3MA 4BK4A 2D6LX 3M7AA 4HVRA 3LGRA 3M2MA 4MG2A 1LOEA 4P9LA 3PIJA 3WUCA 1HXS3 4TSVA 5FZHA 3VKLA 1MS0A 1NY72 3F2ZA 4HKWA 2ERFA 3WF1A 4CSWA 3NVCA 1GMMA 3I4IA 2GMPA 5K4LA 4PQQA 1ASJ1 3LDKA 2AREA 1H4HA 3IAPA 4QXHA 4D0QA 2HWE3 4Z8BA 2GMEA 3D6EA 5A7PA 3KHCA 3VBOC 2DTYA 4K8RB 2HEYF 5FO8B 2W95A 1OH4A 2DFBA 5KBFA 3WD5A 1FOD1 2WQ4A 4WVMA 4R4ZA 3ASIA 3AXDA 5IHRA 1HX6A 2NQYA 1N1SA 3TN92 1LECA 4AVCA 5KXEA 1F15A 2PTMA 3CDZB 4FP2A 1ZRIA 3TBDA 3VB9A 2A6YA 3VBOB 3GM8A 2XQXA 4IERA 2WABA 1AR73 2WSVA 1AR92 2CWSA 2F6BA 3NW4A 3AKTA 4WVVA 3OEBA 4LR4A 5APAA 3W21A 4AQ2A 5LZ6A 1XE8A 2QQIA 1IKPA 2EXKA 4IEXA 3RRDA 1Z7S3 2AUYA 2IFRA 4OHXA 1TEIA 4ZXKA 1ULCA 2YU1A 1AL0G 4XETA 1J1LA 2QNKA 3CQOA 3GF6A 1CZVA 1X36A 4M00A 1XSQA 2R32A 1KXGA 4K9SA 2G9FA 1VIWB 3LF7A 1XOYA 4CPBA 3AYEA 1ZZ6A 4QKDA 1RUD3 1CPMA 1Y9QA 1NLQA 3ON7A 4NVPA 3OG2A 4IEQA 5DZGA 5K0UC 2V5DA 2C5DA 3AL5A 2W87A 2OZ6A 4FCAA 1Q8QA 3KT1A 1W6QB 1Y4WA 4FFFA 1HRI2 5LA2A 1LR5A 4CU6A 1FMD3 1QXJA 3LQCA 2W47A 2X53S 3BPZA 2VXRA 1J59A 2X5IC 1JYWA 4XUQA 4IEUA 3AKSA 3HQRA 1D4M3 1FV3A 1XE0A 3PL0A 5FK8A 5IVYA 2WZ8A 2A3WA 2BOIA 1ULFA 3I2GA 5FLHA 2K46A 5K0UB 4DB5A 2VMGA 1NCQC 4CZSA 1MS5A 1W9WA 1W8OA 3NWKA 4AQSA 5KHJA 1S0IA 1XNAA 1UL9A 4CU9A 1IPKA 3VBRB 2AZ5A 4Y20A 4MGSA 3O1RA 2LS6A 1OUSA 1X9TA 1REDA 1E5SA 4GQ7A 1SLCA 5IVJA 3O1TA 4GB31 2JE9A 1F35A 3A22A 4Q4Y2 5IWFA 4IL7A 1NCQB 2WWSA 1COV1 2BQPA 5FYBA 3UGFA 4PT6A 1PO22 4DUXA 4F8AA 1OQDA 3UGHA 3IAQA 2VMCA 2XUMA 4LO5B 3NL1A 3O12A 2X10A 1BEV2 4YVSB 4D69A 3M3OA 2ET1A 3VKOA 4CU7A 2CGPA 3USUA 1OXCA 1VMJA 2EXJA 3C7GA 5L9RA 3PJYA 3ETQA 2R043 4D3WA 4YARA 1JW6A 1QU0A 2Q5TA 3I3DA 4I3PA 4V2WA 4WBBA 4LIVA 4W6XA 4YVWC 1X8MA 2YU2A 2J1TA 3LEGA 4M3CE 3W5MA 2VZQA 3H8RA 4M3CF 3S5AA 5LY2A 1FOD3 1OF3A 2VO5A 2W92A 3FLPA 4LXLA 4ZZ5A 1QJX2 4MZUA 1LESA 1WBLA 2WIIB 3VD7A 1CGPA 3TRSB 1JTZX 5FZMA 1NKGA 5B2GB 1QOTA 3IIAA 2TEPA 2CYFA 3O1UA 1FAYA 1DYOA 1GOFA 1HB1A 2D93A 3ZYBA 3VZOA 4A7ZA 1ND2A 1LHOA 5CVRA 4JC1A 3ZMOA 2XG3A 3V0AB 3N7MA 1VBD1 3ETPA 5DABA 3GJBA 5BNOA 2P4EA 4XUTA 4FXKB 1JYNA 5FPUA 4QU2A 2NMNA 5FQ0A 5AC92 3IWZA 1RTVA 1CJDA 4KBBA 3ZR5A 5JMOA 4O9EA 4LA2A 3AMMA 2AR6A 1X82A 4Q4V3 4DUVA 4PBOA 3PURA 2QE3A 2XJSA 2D6MA 4KGGA 4CXXA 1JHNA 4IW3A 4PF1A 3T2PA 1O4TA 2ZEWA 3AZWA 1QJU2 2FZ1A 5IVBA 1UOGA 5FZ9A 2OYZA 3WQBA 3VBHA 1A8MA 1JZ2A 2JG9C 2PFWA 4C8DA 2BPA2 2BERA 4FOWA 2XVLA 5CKMA 5JZGA 3TEZA 1O6UA 2NMOA 1W3VA 5IK4A 1ND3B 1E5IA 2NZ9A 1BKZA 1N1TA 4I0BA 3D8CA 3LSDA 4Y5TA 2NLRA 3K2OA 1W8TA 4HT1T 3RI9A 2GU9A 3CJXA 5HV4A 1WCQA 3A0NA 1RVF1 3QH6A 1DHKB 2GC0A 2JG9B 3NQHA 1GOHA 3THTA 3VBUA 4H2AA 3U0ZA 2QQMA 3AZVA 3POWA 5C4WC 3MDPA 1ST8A 4AVAA 1G8WA 5E89A 4Y1YA 3ZYFA 1AHSA 5BY5A 1WCDJ 5DXDA 4NO4A 1KRIA 4KMQA 4E9KA 4OUEA 1BK0A 1OPMA 5JVVA 5KHGA 2CL2A 5GLZA 2JB4A 1KDKA 5EPAA 2ID4A 1GZTA 4DPNA 2VXJA 1CAVB 4YW3A 4XYXA 2AACA 2JDZA 3LE0A 1MS8A 4XFIA 3WG2A 2D43A 5C4WB 4MOAA 3CHXA 2A6ZA 4M4RA 4IXLA 3VDBA 1WCUA 1V6IA 2ES3A 5FMBA 2VG9A 4B1LA 5JOWA 3FHIB 4QHOA 3IDEA 4CCLA 1AR93 3MFAA 1UIJA 1GKBA 1QOSA 3P3PA 1OLMA 3BUCA 4YVWA 5I8YA 2ZGMA 2KD7A 3K75B 1NAEA 4XIKA 2JDMA 4FPCA 4NRPA 1RUJ2 4K6BA 1H2MA 2IXHA 3EO6A 1G9DA 1N1VA 2JE8A 3MW2A 1O8SA 1QJY2 2RDSA 2CGNA 4Y26A 1OF4A 4P9GA 1DLCA 3MO4A 4IUGA 4KWKA 5F8PA 4N9IA 2ZX0A 4R4XA 4BISA 2J22A 1AYM2 1AL22 3AKPA 3GCXA 1J1TA 2VZOA 3LSEA 2OQ6A 3MV01 4NHMA 4UT5A 4MHRA 1R1A2 3KF5A 3WNXA 1DQ5A 3MIHA 1VBD3 2QUOA 2QDRA 2PHRA 1HRI3 3C7HA 5IFPA 3T0DA 2QFEA 1YWKA 3NSTA 1OA3A 2DCKA 3WZ1A 4FXGB 1V9U2 5DZFA 5E88A 3ZYJB 3NKGA 1UZVA 4D6RA 4YYOA 3AP6A 2DBNA 2YY1A 1OFSA 2Z5WA 3C7OA 5FZ4A 1LGNA 1K45A 1NLRA 1RUG2 5LK7B 2E32A 5FREA 3LFIA 3A23A 5IK5A 5BNNC 3VD5A 3FC0A 1OI6A 3K46A 2H0BA 3OJBA 3SCGA 1AX0A 3VBSC 1LHWA 3ME2A 3RMYA 1SDDB 3KD4A 2WNOA 2D44A 2VMDA 2W39A 4BPZA 1JH5A 5JCTA 2VH9A 4N7IA 3E1F1 3ZDSA 2IVJA 2NN8A 3K4AA 5DAVA 3ECQA 2R7EB 1YEWA 4DEQA 4FPKA 3IKWA 1YQ5A 5BNNB 1OA2A 4W6WA 3HBZA 3LA7A 1S0GA 1CIWA 5FTTC 1PO23 5GLWA 4CUGA 1O5LA 1UIKA 5HI0A 3VBSB 1T6GC 4XJ8A 4COYA 1BEV3 4L0PA 1IS6A 5HV0A 3ZM8A 2QQPA 4ASMB 4FTSA 2XDVA 1T2XA 2NP0A 3LIGA 4Y4RA 5LBEA 2E7QA 4V1PA 4Q4W2 3UV9A 4BXSV 2AGSA 1EPZA 2WFF1 3N9OA 4XFHA 3KGLA 2F4LA 5DQ0A 3CU7A 1TME1 1OVSA 3AYAA 1T6BX 2XKOA 4PJYA 3DYMA 1K5MC 4P9YA 1CWPA 3MF6A 3UL2A 3BI3A 1Y43B 1AR62 1QJY1 2Y38A 3DYPA 2YPJA 4Y33A 4CP9A 2XHKA 2PQQA 1NLSA 4E2QA 5CFCA 2W1WA 2A70A 4HPKA 2RM22 5I0DA 1IS4A 5DAQA 4GWNA 1VMHA 2BOJA 3OF1A 1XBFA 4N90A 5HCFA 4LBMA 1EPWA 2DCYA 2NYYA 1O4YA 1C28A 3BALA 1NX9A 3A4UA 4WM8A 5FBZA 2OPKA 4EZHA 5AC93 5FUNA 3M3CA 1ZBE2 5FPBA 3MICA 1M06G 2YBSA 1DQ6A 4IGOA 2QVSB 1SBEA 4XJ9A 4HG6B 2EF6A 1SFNA 3ZFFB 1QJU3 5HPOA 4FOYA 2K9ZA 3D0JA 4XVHA 4A42A 4DUWA 5FWJA 3OBTA 2PHFA 1P8JA 3VHNA 5BNPC 2C24A 1GICA 2LRPA 3N9PA 2XPJA 2G19A 2ARCA 3HOBA 4YGCA 4UFJA 3EJKA 1G9BA 1GFF2 3MYXA 4R52A 1ZYBA 3ZKUA 4A4AA 1W6PA 2Y6HA 2VNVA 3QACA 5FZGA 4KBZA 3IB3A 1TQ5A 3R0RA 5LA0A 5HCAA 4Q4X2 3A21A 5BNPB 1W39A 1LEDA 4MGZE 3VZKA 2E26A 1U5YA 2K2SA 3S30A 1X50A 3H7JA 1YFYA 4I0AA 1H1AA 4PI2A 1WLWA 4LBKA 1D4VB 2WN2A 1SG3A 4UW5A 2DYCA 1H2NA 4LK6A 2ZX2A 4Q4W1 4A41A 4XQ4A 2VCAA 5C5TA 4QPGA 4XZPA 5EHDA 1RYYA 3T08A 4XBLA 3GJAA 1KFXL 2P3YA 4P9WA 1W90A 1HQWA 4XHBA 3S7EA 5JAXA 2YBKA 4YPJA 1UZZA 4E4ZA 2LW8A 4O9GA 4B7EA 1GQPA 5KXDA 5AFBA 3ELNA 3HAGA 4MGTA 5I8SA 1W99A 5J98B 4RQPC 2RM21 3BGAA 1HIXA 2I45A 3ZXFA 3VZMA 1UMHA 4NPLA 1LODA 2B46X 1RL3A 2CTVA 1Q3EA 3DKQA 4ITCA 3SMHA 1CAUB 1W8ZA 1G9AA 1PK6A 1WW5A 1RUF2 1RUJ3 4QKBA 1OD5A 1K5MA 1RMU1 1H8VA 1QJY3 2WS92 3OEAA 2R1DA 2RR12 4CCKA 4CYDA 4CDUA 4COZA 4HFSA 2WA3A 3HEIA 4IEWA 3P6BA 1EP0A 3N9NA 3UJQA 3TEYA 1W3XA 3H50A 1AR63 4NWWA 4L11A 4NHYA 4JCKA 5FYYA 3H42B 4AI3A 4BQYA 1AYN2 1UKRA 1XNDA 2UY9A 3WNLA 3N9QA 1WMFA 4ORFA 3BIEA 3W59A 1PO11 3OYWB 5CFDA 3AP7A 3R4SA 2XHNA 4QQLA 2XOMA 4YSFA 1CX4A 2HWD2 2ARXA 4G3YC 1DGWA 1V9U3 2OUJA 1JXNA 5DN2A 3PMSA 4ES8A 4JX0A 3DXTA 2TBVA 3OPZA 1OBNA 3I59B 2VZ3A 1ULDA 1DZRA 1K5JA 1VBA2 1WBFA 3LEMA 4SBVA 1TG7A 1RUG3 4Y1VA 2VQAA 3A0KA 4IE4A 5BPXA 1JU3A 2UYBA 3OY8A 3VD9A 4ARXA 2R062 2LTNA 4YW5A 4AI8A 4TLFA 4MLOA 2CNAA 4QQ2A 2ZGSA 3WUDA 4BYYA 4GWMA 4CEWC 2VD7A 1WW4A 1DU3D 2QQWA 1JOPA 4LBNA 4Y1XA 1LJ7A 3E6DA 4JHZA 5DUXA 4QDRA 5T54A 4A6OA 1ZM1A 4XABA 5EJ3A 4BZ4A 4MUVA 4Y22B 2VAUA 4CCNA 1OD3A 2ZHLA 4DXZA 4FPYA 4ASKA 1J3PA 1KEXA 5FYMA 4WM7C 1GNHA 2JENA 2VR4A 4Z07A 2FD8A 5A3TA 1ENRA 1QJZA 3WF4A 1HDKA 2RMU2 1XC6A 2PHLA 5FZ6A 4AHXA 4BH9A 5M0TA 4CXYA 1FX5A 5C9AC 3DPRC 1QIQA 3WDXA 1UU4A 3WNKA 4AGVA 1ZZBA 3MHZA 3PU3A 3ZFGC 1LCLA 4EQVA 3HNMA 3ZLIA 4LO4B 3ZYIB 4WM7B 4Q4W3 3B9IA 4JGYC 3C8XA 3JBG2 5CU1A 4XJAA 1V00A 4BU2A 3FN9A 1GQGA 2JKXA 3BODA 3DPRB 4XAAA 4ZU4A 4BXFA 3PUQA 3VBFB 4GULA 5J36A 2WS91 3ZFGB 3O1SA 5JXIA 1AR82 2QCSB 5IATA 2J1SA 1LHUA 1NA1A 2RM23 2VU9A 4IEPA 4JGYB 3Q9OA 5K8SA 1HV1A 4RQPA 2BEOA 4COVA 1XNTA 2JEMA 1AYN1 1UQXA 3OUHA 2HYXA 1AUYA 5DAPA 2HBUA 4A44A 2WUHA 2B39A 4W6YA 2MEV2 2FMDA 2XWBB 1YYNA 3C3VA 4KU8A 5F5AA 1ZBE3 1KFUL 1UXXX 2JKBA 1PM4A 4LQRA 1BMV1 2ILMA 4XFBA 1AX1A 2HEVF 3AMHA 3GZTB 2ZZQA 1UMZA 3I2DA 2WINB 4XTPA 5F3GA 4AYUA 1C1FA 3C7EA 5ACA2 3I54A 2Y60A 3FHQA 2Q1FA 1GZWA 2I2SA 4O65A 3NNMA 4HK8A 2DVFA 4AHWA 2Y6GA 5IK7A 1ZBA2 4QQHA 4P02B 2DUOA 3TEWA 2YROA 4CUCA 4FPFA 1MQTC 3O0WA 4FSJA 1N3QA 2QQOA 3D5OA 3ENRA 1YI7A 1U5IA 1LTEA 3O7OA 4R9AA 2J7MA 4YM0A 4A7KA 4I2OA 2WBKA 4QX0A 5F3IA 1M4WA 4R9DA 1PIV1 4FTEA 4AZZA 1LEMA 2ZGPA 4GD4A 5F6KA 4QGNA 5J3UA 2ZGTA 4CEWA 2HWC1 1MQTB 5A7OA 2WYSA 4INDA 4QPWA 2E33A 1PZ9A 4KI5M 4D8MA 3ZXGA 2HH9A 1PVC1 4LBQB 4OI1A 3WG4A 2VW2A 1HRV2 4K21A 2CY6A
chains in the Genus database with same CATH topology
4YM1A 2LM3A 1CAWB 1R1ZA 4PIYA 5JI7A 1W6MA 3SH3A 1XE7A 2ZCWA 4AVVA 2QZ3A 1Z0HA 3WX5A 3H7YA 3AX4A 4G4FA 1YFUA 5C9AA 5IK8A 2P3KA 2NM1A 1PGW1 2ZTNA 3ILRA 3N35A 3R4UA 4NR1A 4YG6A 5F5QA 2E51A 5HXVA 3WQ7A 1SEFA 4XIOA 4AEKA 1X7NA 4QM8A 3NAPA 4B4RA 4QGLA 3M3QA 4AK3A 1YJLA 2RE9A 2ZGLA 1RUF3 2PLV1 2UU8A 3IMNA 4XJWA 2HWF2 5CIRA 4HL0A 2WS93 4ISRA 5EFUA 1AR71 2MPFA 3WHTA 4WVMB 1UKGA 4AHYA 2VOVA 3V64A 1Z7S1 2DCTA 1AYN3 2Q0AA 2R6QA 4CP1A 4EN0A 4C1XA 1VBC2 4JVAA 4Q2FA 1Q8OA 2PYTA 4GKXA 4LO7A 2ET7A 1OPOA 5F6LB 1OQ1A 2IXIA 5FO9B 4MVTA 5GLVA 3KM5A 4RHV2 4SLIA 1VBA3 1ULGA 3GBWA 1UZYA 4AG4A 5CG8A 1HV0A 2DUPA 2BVBA 4LT5A 1CPNA 5LEKA 5C8WA 2DVAA 4XXAA 3ZXDA 1IS5A 5I0TA 4HZFA 4HVQA 1YCIA 1L3JA 5SV5A 3KSCA 3QLQA 3V0BA 4YW2A 3WCSA 4OHVA 1AF9A 4XMIA 2ZMLA 1VB4A 4RL7A 3H1YA 1UU5A 2TNFA 4XFFA 2GNMA 3UKTA 4UXAA 2Z2SB 1PIV3 3AKRA 3JCIA 2YUEA 4QPYA 3B9CA 3VKMA 3RQ0A 2D5HA 2HWC3 1SLAA 4LUKA 3KCXA 1QMJA 3NKTA 1PVC3 3VLBB 4F7ZA 1VRH2 3KQRA 3HQXA 3WOGA 3ZN6A 3HT2A 4Y20B 1U5XA 3AYDA 2ZBJA 3JBG3 1MS3A 3IDBB 2VNRA 4P9IA 3H1WA 1ULEA 3ZYPA 3V65A 4N53A 2BWCA 5L73A 1OMIA 2D97A 1B35A 2R041 2RS11 3JUUA 4DY5A 1Q8PA 4G9SB 1AR83 3TAYA 3AJZA 1UU6A 1EV12 1RUI2 4QGMA 1ZRCA 4IV3A 2GH8A 3WDTA 4FPHA 3GZUC 4AEMA 3VKFC 4Q8KA 2W0XA 2ZAAA 2PLV3 1O4ZA 2I07B 1DF0A 3ILFA 3GALA 2LUWA 1H0BA 1V6KA 1DFQA 1ND2C 1GANA 1JYCA 2UY8A 3WDWA 3AZYA 4RHV1 2Y0OA 5BNOC 1AXZA 1WMEA 3LZZA 5ACA3 2ENRA 2ZABA 4HK9A 3OD0A 1XU1A 5I0UA 2FHRA 4KWLA 2FBEA 1LB2A 1PNFA 1ZBA3 1ND2B 4Q4V1 1IOAA 4E4SA 3MLJA 2MNGA 4D7SA 4MSVA 3VBHC 2A6WA 1IS3A 2EIGA 1SBFA 3MEPA 3D4KA 3O5SA 3RWNA 5JSRA 5JZGC 3S0MA 3FBMA 2WNUA 2XWJB 4K3UA 1UF2C 2H0VA 4PIXA 3VBHB 1PVXA 4GXLA 4BIOA 1HRV3 1QQP2 3VBUC 1NY71 1NYWA 4COUA 4AFMA 4DRRA 5JZGB 4J1WA 2IXCA 2F4PA 3AZZA 2TUNA 1GBGA 2JX9A 4RGAA 2P2KA 1S2KA 1I5ZA 2A7AA 2X5IB 3DKWA 4IETA 1TMF2 1F31A 5C8CA 1OKQA 4AQ6A 4EWEA 1KS5A 1BBT2 5T5JA 2E53A 3VBUB 5FAXA 4HSLA 4K1ZA 4Q1RA 3TNPB 1RJ8A 3N7LA 3ZMNA 2X8KA 3TN91 1F5FA 1SFYA 2XB6C 1UX6A 4Q8LA 4EWAA 4CRQA 2RS13 1AR91 4K20A 3TWIA 4UW4A 1V6MA 4MGIE 2D6PA 4QQPA 4YZ3A 4LBQD 4ZU5A 3AFKA 4BMEA 1SACA 4L8QA 1VBC3 4MXVA 3J4UH 1H9PA 4JQRA 3B69A 4WVZA 5FLIA 3ZXLA 4YVWB 2IC1A 1OHFA 2Q30A 1RUE2 4RHV3 5T50A 4ES9A 1XQNA 3MPPG 1LU2A 2BWAA 1HRI1 3HWJA 2PHDA 2E9QA 5JPMB 1S1AA 3PTYA 1QDCA 1APNA 1R092 2ZZJA 4I30A 4IEYA 4C0BA 4X6RB 3L2HA 1A78A 2E63A 4ZKTB 3V56A 3GZAA 1REEA 1W6NA 4M3CB 2GC3A 3AP5A 2EXIA 2UWBA 2YDEA 3CJIC 1XYPA 3U4XA 1W0PA 4YZ4A 1MR5A 1TMF1 3RI8A 3ZXAC 4N43A 5C33A 3OD4A 4A2UA 4Q4Y1 2YMZA 4AFBA 4YZ5A 2OA2A 4CP0A 2R072 3O0VA 1VRH3 1DDLA 1PO21 1Q8SA 2D3PA 2BFUL 3POYA 1BEV1 2D6NA 4PQ9A 3WP3A 4FO9A 1VBB2 4YFZA 1UPSA 4RFT0 4GMP0 4CTEA 1KITA 3O0XA 4NPRA 3IN9A 1I3HA 4LLOA 1EYBA 5EWSA 3W9AA 2D5FA 1QJX1 3TN93 2IZWA 1JUHA 1GSLA 3B7MA 1S0FA 2D98A 3U10A 4CEYC 2FQPA 5CFCC 5KHHA 2DWRA 1A8DA 3WINE 4C91A 3BOWA 4NOTA 2KXLA 1REFA 1G7YA 4OVEA 3H1MA 1YHFA 4WM8C 2VULA 1TNRA 2ZHMA 5JDBA 4Z92B 2ZKNA 2FMYA 2VW0A 5AC91 3GBFA 4HN1A 4HPKB 4YFWA 2XGXA 4D7TA 1LHNA 1RUH2 3LCPA 2E7AA 4L2NA 4LLFA 1UCXA 1QJU1 4QT6A 4WM8B 3RYRA 1MZFA 2PAMA 3PNAA 2D3RA 2DUQA 2LALA 4YG0A 5BXXA 3GYDA 5A33A 3KCYA 1WGPA 4BMBA 5KHKA 2R49A 1XNKA 2EXHA 1YI9A 1H1MA 3FUQA 4XFGA 4OUMA 3R05A 5FMOS 2VW1A 1XRUA 5C6CA 2R071 4IEVA 4Q29A 1VBE2 2JICA 1D2QA 2Z79A 2BBVA 4PBPA 1FNYA 1FPN2 4IV1A 1O3TA 3IT8A 1QNYA 5FMOL 2B45X 1W6PB 1TMF3 4H14A 3CJIA 4JDOA 1DIWA 2WQZC 1S0DA 1WUVA 1BBT3 4Q4Y3 1H1IA 4AI2A 4QPGC 5GZFA 4Q26A 1MS9A 4OI4A 2GZWA 3VV1A 2XJUA 3G6JB 4FP3A 2P3JA 1AZDA 1BCXA 2IXJA 1VALA 1BZWA 1IZ3A 1QGLA 4FQZA 5D8AA 4COWA 5DUVA 4YG3A 1G9FA 4QPGB 5A32B 1YUDA 2D6OX 3T2TA 4DQAA 3RDIA 1RUNA 2O8OA 1PK6C 1RC6A 5DUUA 1QJX3 2NPIA 4LHLA 1RUJ1 5T5LA 4F83A 3HD8B 3KGZA 5BUVA 5E8AA 1LOCA 3P3NA 4GA9A 4CDUC 1O7FA 4CEYA 5LRRA 1W0OA 5K9YA 1SDWA 1AYM1 1AL21 1AR61 1MZ6A 1A3KA 1PK6B 1R1A1 1J3QA 1K5MB 5CFDC 3DF0A 1GR3A 2WZPP 4DOUA 3RPQA 4YZ1A 3M70A 1V9U1 1YO8A 3EBRA 1LKNA 4H55A 3D82A 4BCUA 4PLOA 1JN2P 3LAGA 1RUG1 5J96B 5AFEA 5CFDB 1ZZ7A 2PAKA 5EYXA 1GLHA 2A71A 2WFPA 5E1RA 4B7KA 4CDXA 2V73A 2ZS6B 5J09A 4HBNA 4UW3A 4B4QA 2WT0A 2P17A 3AK0A 3OY8B 4JDNA 2DV9A 4YGDA 2ZGRA 4K7JA 2R073 3QBQA 2H6CA 3B93A 3WG1A 3SITA 1IHMA 4LE4A 1KDMA 4YLZA 1S2BA 4J1XA 2HWB2 1F5JA 1QWRA 4IEZA 3NO8A 1POV0 1H8TC 3E5UA 4S2HA 1AXKA 3ZYRA 1SLLA 4K8FA 4BM8A 1ZA4A 3E6BA 2Q8OA 3E5QA 1SBDA 3WR0A 3FLTA 1NA1C 3U11A 2EAAA 5CB7A 3ILNA 2KM2A 2H6BA 2A75A 4L97A 4ZU7A 4BHPA 4B29A 3B5LB 1NG0A 4XJZA 1UN1A 4B3NA 4WZFA 4U36A 1ZBE1 1NE4A 1NA1B 2IXKA 3AP9A 4LUMA 4RQPB 4RGGA 1RUH3 1ZVFA 5I0SA 1AYM3 1AL23 2PELA 2VOKA 4OI2A 3M3IA 1KJLA 4AFCA 1R1A3 5F9TA 3ST7A 1JOJA 4AI0A 4U2AA 1URXA 4YGEA 5I93A 4CDQA 1U5ZA 3ZXJA 1UPIA 3RNSA 2WZR2 5KC5A 3TOJA 2ZJCA 4S2DA 1GZWB 4BE3A 1DG6A 3ZO0B 1CVNA 1VBE3 3ALQA 4Q4X1 1XNBA 3EXUA 1FPN3 4AEJA 3AB0A 3FWEA 3IDCB 5DDJ2 4WZCA 4WVWA 1AJKA 2XH6A 1H2KA 2ARBA 3J8F2 1DLLA 5GZEA 4AXOA 5D1IA 3CNAA 4XQWA 3D0SA 3CO2A 2EA7A 3MZHA 3SXWA 4AEDA 4CEWB 2ZGOA 4Z82A 1NXMA 2Q1ZB 1I1EA 3BIWE 2ZMKA 4C1WA 5T3NA 3AXEA 3FMGA 5GZGA 5H9SA 1RUC2 3B02A 4AVBA 5FLJA 1HLCA 1DQ0A 4UW6A 3CF6E 4M01A 1GZCA 1QHDA 3NAPC 3JZVA 1XNCA 1H8TA 1W6MB 1RB8G 3AM2A 1EAH2 1NOVA 2I74A 5C9AB 1RUF1 2JXAA 3VKNA 1MZEA 1S0CA 1TNFA 3CLPA 2RR11 3PVOA 4DRVA 3KCCA 3NAPB 2ZGUA 1D2SA 1DZTA 2X29A 1XYNA 2O8QA 1VP6A 1XYOA 1OSGA 1HXS2 4JGZC 2WC2A 2WA4A 3MF9A 1WMDA 3VL8A 5GKAC 4LULA 2XLAA 5L7OA 2HWD1 1D0HA 1ENQA 5IUQA 3AZXA 2HWE2 4LBOA 1DYKA 1XXNA 3RG0A 1ALYA 2XKPA 3IPVA 1JYIA 4GH4A 4DS0A 1VBA1 1Q5OA 1Y3TA 3T1LA 2CAVA 3WVJA 2RS52 2R061 3KZ4C 1DGRA 1YIFA 3H0OA 1XU2A 4PLMA 4W65A 5DDJ1 1SLBA 2XBO2 1ZRRA 5ABJA 3DN7A 1D0GA 3R6SA 2Y0IA 4XQDA 1QH6A 2JG8A 2ZACA 3MIBA 3ZFEA 2RS32 2ZAHA 3E97A 4OHYA 1FXZA 1H9WA 4Q4X3 3J9SA 3VDDC 2RMU1 2XLGA 3USSA 3V0BB 4GIQA 3SNMA 5L36A 1PGL2 1E57A 4XW3A 1GYKA 2WSUA 1JUIA 2HWB3 4DZGA 5KXCA 1RUC1 5JMCA 4DNYA 1HW5A 3RS6A 3FX3A 1RUD2 2VOXA 2A6VA 2RJKA 2WL1A 1Q8VA 3JBG1 2WNVA 3SHRA 4BOWA 2EVXA 4A7YA 1ONAA 4RS5C 4N53C 3ZN5A 3GBGA 1B35C 1BK1A 2VOWA 1CQ9A 2JD4A 3G7DA 3KB5A 4E4DX 1AR81 2B42B 2DVGA 1NQDA 4GMP3 3ZN6B 1BVP1 1DQ4A 4IV3C 3LA2A 4Y1UA 1LOGA 4LHNA 2DF7A 3FE5A 1WCSA 1B35B 1S55A 2MEV1 2P3IA 3AMNA 4LBJA 2VNOA 5F1RA 2RR13 4IV3B 3LA3A 2ZOEB 3VN4A 3NV1A 2WNEA 1N1YA 4QPIC 5ACA1 3JD72 3MIDA 4MYEA 4JGZA 4R9CA 4P5HA 1FYUA 1ZBA1 3BOPA 1YJKA 4Z2WA 2HWD3 1ASJ2 2W68A 2WLQA 3X29B 3W58A 3ROUA 3OGGA 2R063 3MIGA 4FBFA 4RR3A 2WNUC 2GNBA 3JQWA 3IBMA 5GALA 1LGCA 1QOOA 4XBQA 5DDJ3 2CV6A 1GQHA 1SMVA 1YRZA 2OUHA 5DUWA 2AH2A 1F9KA 1LOFC 2JE7A 4LBLA 3J8F3 2DU0A 1FATA 1SQ4A 4JRAA 5H9PA 3ZIWA 1CR7A 1HRV1 4OI0A 1NCRA 2XL7A 3ES4A 4D7YA 4EROA 1SCSA 1YFXA 3E5XA 2RMU3 3LOIA 1S0JA 3VDDA 4OLLA 5C8CC 4MGKE 4XF0A 4AFAA 3VHRA 5JSPA 3HMYA 3URFA 1RUC3 4MXWA 1OOPA 1POV1 1UD1A 2ZX4A 4XF4A 3WDVA 3AJYA 1V6LA 2VVFA 3MLKA 1LGBA 1W6OA 5T55A 2B5HA 3GHNA 5BYNA 3EQEA 2YZ4A 3MFCA 5C8CB 3IM0A 4RS5A 2XVKA 2HWF1 1LOBA 4META 3LKJA 4Q0SA 5H9QA 2A5ZA 1FI2A 2XVGA 1WA4A 3HN1A 1QY4A 1RGSA 2RJLA 4FT8A 3ZSJA 1UW8A 1RUOA 3JD71 3USUB 4Z1VA 1MVQA 1VBC1 4LO6B 1V70A 4OHWA 3T1MA 5KC6A 3ZPYA 4C0HA 2MEV3 2HYKA 4LO8A 4TYSA 4PDWA 1OA4A 4KL1A 1OFNA 4GB32 3C2UA 3PVNA 1F8VA 2RS53 3KT7A 4QPIA 1I9RA 3DV8A 1COV2 2PHWA 3PLQA 4FPJA 4E2GA 1N3OA 4XPVA 2GALA 2XBO3 3TYJA 3UJOA 2VPVA 1IPJA 4RSUA 5I0RA 1MS4A 5I8TA 5L19A 5BNOB 3OGJA 2RS33 1CAXA 3FBYA 4H7MA 4YNIA 1YNAA 5FQ0B 2BNOA 3HT1A 2BTVC 4Q27A 1QH7A 2E7TA 2VMHA 3WXPA 1WD3A 4N43C 3ZSMA 1RIRA 5EV7A 3UKNA 2CAUA 1QKQA 1LOFA 5SV8A 5GLUA 1G86A 1VRH1 1W6NB 4CDWA 4ATFA 3L2YA 3R4DB 1VBD2 1J3RA 4N43B 4EN9B 3LOBA 3H3UA 2UURA 3RYKA 3VBRC 2WJSA 1POV3 1ENXA 2IXLA 1DQ1A 5GZCA 1RHI2 1EV11 1RUI1 1C8NA 3AP4A 1FT9A 2YGMA 4JAAA 4NN0A 4E2QA 1NZCA 4XDQA 3ZVXA 4AW7A 2E6VA 1X8EA 4AF9A 2WT1A 5CBLA 2HWF3 4QD2A 3SISA 5JIUA 5LRSA 2R30A 2OZJA 2A73B 4YVSC 3FUOA 1ZZ9A 4RA0A 3NV2A 4B4PA 2UYAA 1Q56A 3LB9A 3JD73 3WHUA 4JDMA 5KWRA 3ZX7A 5J48A 1RVF2 4LE3A 3KS7A 5JIAA 2BGCA 3AMPA 1MS1A 3UK9A 1ASJ3 3GNEA 4TWTA 2ZKLA 4FPLA 3MLLA 1GNZA 1NQJA 4HKOA 4HETA 4YM3A 3MW4A 4QHBA 3VBOA 4IEOA 4K40A 3BCWA 4BWOA 3RYPA 3WW3A 3U07A 1G6NA 4HN0A 2C0ZA 4AE2A 3KT4A 1WCKA 3BB6A 5BV6A 3THPA 3MW3A 1QQP1 5A33B 4IV1C 5FPXA 1WLDA 4MX3A 4N9HA 4XMAA 4F3JA 2WLPA 2DURA 1VJ2A 3KLSA 3SCHA 5EZWA 2O1QA 2BFUS 5KHIA 1VAKA 1W6QA 1BBT1 4R9BA 4IV1B 1RHI1 4EWDA 1CJPA 1ND3C 5DG2A 4JRLA 3WW4A 4PCRA 5D8AC 3OCPA 3CJIB 4RD7A 3WQ0A 4HKLA 2B7YA 5K0UA 5JSOA 5LK5A 4BA6A 2PN5A 2ZHKA 4XE9A 4YM2A 3N7JA 2MHFA 1H2LA 3ZN4A 4Q0VA 2PAEA 2DCZA 5JWPA 3VBRA 3J26N 4L92A 2ZHNA 1EV13 1B09A 2X5IA 1RUI3 3H9AA 2BNMA 5D8AB 3QOPA 3ZXEA 1C5HA 2A3XA 1KQRA 1FV2A 1NCQA 3S7IA 4LHKA 5GJ6A 1PM7A 2DVDA 1PMIA 4AGGA 2W08A 4FQ4A 1RUE1 4YVSA 5CNAA 2YV8A 1AX2A 2OVUA 4GB33 2VGDA 4Q1PA 5JR7B 2GNTA 1RINA 2GH2A 2AENA 1COV3 2Y26A 4CEYB 2EAKA 5CFCB 2SBAA 4KG8A 2D3SA 3B01A 1U12A 2VECA 1R091 4FOVA 1MEC2 2WKKA 4S2FA 3CL1A 1LRHA 3TB0A 1ZNPA 2P34A 4CDXC 2B8MA 1KS4A 2XJPA 2WFF2 2D40A 3WDUA 5T5PA 1C5IA 3S6PA 1OQEA 4XHXA 1TME2 1BVVA 1BYHA 4M0NA 3L9JT 3V0AA 1OLRA 1ZX5A 2PHXA 4MGYE 2AYHA 5EYYA 4ASLA 4CDXB 1QQP3 3MI8A 1V6NA 2VY0A 3H8UA 1LOAA 5AVPA 5EXOA 4MV2A 3WDYA 4L99A 4DMIA 2B9UA 2HKXA 1VBB1 2YXSA 1SCRA 1I6XA 1DGWX 2Z69A 1ZREA 2QDNA 3FZ3A 1QNWA 1ZRFA 3KMHA 4M3CA 5FFOC 2KA3A 1RHI3 2JECA 2V5YA 1EY2A 1ND3A 3EHKA 3WW1A 1C3HA 3SH5A 1BQPA 4BIFA 1WLCA 4XFAA 2UWAA 5JOYA 5HCBA 3WV6A 2JG9A 3MPBA 4Q0QA 3WP5A 3HIFA 1QXRA 4AQTA 4Y1ZA 2ZMNA 1PZ8A 1H4GA 4AWDA 4DFSA 2DVBA 4Q0PA 1SLTA 2DFCA 1RVF3 2ZGNA 2CWMA 2ZPXA 3DGTA 3H3ZA 4HSJA 4FOQA 1FNZA 2N7GA 2R1BA 2VVEA 3RJ2X 1CAVA 5JOZA 1VAVA 5C4WA 4FVVA 1Y7BA 4KH9A 1RUH1 2BW8A 4LEJA 4NWVA 1MEC1 5IT6A 3B3QE 3MIFA 1RUE3 4I01A 5J7MA 1ZZ8A 1DGLA 3VHPA 4QMAA 5FOJB 1W2UA 4ONUA 3WW2A 1YLLA 4CDQC 4CDUB 2G4IA 2XJQA 3I8TA 2ETEA 1KD7A 4FPEA 2R0FA 3UKVA 1R093 1DYPA 5GZDA 4GKYA 4XEZA 1O3SA 4URTA 5JLVA 3WP4A 1VBE1 1J58A 4ATEA 2G9GA 1FPN1 2GN3A 3JQXA 4X8PA 4CDQB 3ZFFC 1VLNA 2Q1MA 3ZXKA 5CAZA 3RSJA 2XJVA 1RMU2 3MGUA 1VB2A 2UWCA 1IKQA 3NJZA 3N4MA 5J37A 4M0HA 4AEDC 4UBHA 4QM9A 5FDBA 3POSA 2R16A 1GV9A 1G9CA 3BTAA 3SLIA 1BXHA 2ZX3A 4R8HA 1WD4A 1VBB3 1PO12 1HQLA 5JOXA 1UAIA 3JU9A 4FPOB 4AEDB 1HQNA 3WCRA 1ENSA 3E6CC 1C8M2 1PZ7A 4ISQA 2ZGKA 3N7KA 5BNNA 3RZZA 3VGIA 4KGQA 1H8TB 2YHJA 3M1HA 4EN7B 3VBSA 2IFWA 4KWJA 1VR3A 2K0GA 3OTFA 1A6CA 1NE6A 3WY6A 1RITA 3APBA 4LNVA 5A32A 4LA3A 5L7OC 3VL9A 5DZEA 5CG9A 3AMQA 4P9JA 4I09A 4GH4C 3QH7A 5KXBA 1MEC3 3ZYGA 5HBAA 4XBNA 4LTAA 5FO7B 2HJIA 3DUIA 2WFF3 5L7OB 2Z42A 4I02A 4XFCA 3PMEA