2CV6A

Crystal structure of 8salpha globulin, the major seed storage protein of mungbean
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
397
structure length
366
Chain Sequence
b'SVSRGKNNPFYFNSDRWFHTLFRNQFGHLRVLQRFDQRSKQMQNLENYRVVEFNSKPNTLLLPHHADADFLLVVLNGRAVLTLVNPDGRDSNILEQGHAQKIPAGTTFFLVNPDDEENLRIIKLAVPVNNPHRFQDFFLSSTEAQQSYLQGFSKNILEASFDSDIKEISRVLFGSQQEGVIVELKREQIRELTKHADQPFNLRNQKPIYSNKLGRWFEITPEKNPQLRDLDMFIRSVDMKEGSLLLPHYNSKAIVILVINEGKANIELVGQREESWEVQRYRAELSEDDVFIIPATYPVAINATSNLNFFAFGINAENNQRNFLAGEKDNVISEIPTEVLDVTFPASGEKVQKLIKKQSESQFVDA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Seed storage protein
molecule tags Plant protein
source organism Vigna radiata
publication title Structure of 8Salpha globulin, the major seed storage protein of mung bean.
pubmed doi rcsb
total genus 89
structure length 366
sequence length 397
ec nomenclature
pdb deposition date 2005-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00190 Cupin_1 Cupin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2cv6A02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2cv6A01
3KGZA 5JSRA 1SEFA 1CAVA 2IC1A 1HW5A 4L11A 3VHRA 3FX3A 4GULA 1O3RA 2UYBA 3MPBA 4I09A 3L2HA 4UBGA 4KU8A 4IEZA 5J48A 3SHRA 1DGWA 1XE7A 4ORFA 1NZCA 4JTOA 4WVZA 1QY4A 4QM8A 1Y9QA 2PQQA 4Q0PA 3TNPB 3N4MA 1FXZA 1TQ5A 3E6CC 2K0GA 5F1RA 3MDPA 3FHIB 2XHKA 3FE5A 4LUKA 4I0BA 1CAWA 4QGLA 4HZFA 2ZCWA 1ZZ7A 1CX4A 2PHDA 5I8TA 5KHKA 1CAXA 4META 4BYYA 4L2NA 1RC6A 4KWLA 3ES1A 3E5XA 3I54A 2O1QA 4LUMA 4JTNA 3HIFA 3R6SA 3OF1A 3RDIA 1YFYA 2VPVA 2EVXA 2OPKA 1CAVB 3SCFA 3UKVA 4XF4A 4D7TA 3E97A 3QOPA 4XEZA 4HVQA 4RD7A 1UD1A 2CAVA 1UW8A 3G7DA 3ACLA 5JR7B 2CAUA 3I59B 3LZZA 5I0TA 5T3NA 1ZREA 2GC3A 3ZDSA 1H1IA 1RTVA 3PNAA 1J59A 2EA7A 5EFUA 2H6BA 3CEWA 3H1YA 3JZVA 1ZRRA 3WW1A 1ZZBA 2N7GA 3GBFA 4FT8A 3EHKA 4YSFA 4PIZA 4ONUA 4BHPA 4LA2A 4AVCA 4OLLA 3DV8A 4O9GA 4EWEA 4J1XA 5KHGA 4YRDA 1L3JA 3NJZA 3WW4A 5E1RA 4HN1A 3SCGA 4FAGA 2ATFA 4KL1A 1ZVFA 1PMIA 4HSJA 2IXCA 4E2SA 5J3UA 4ZU4A 3EBRA 3MYXA 5E16A 4XETA 4UXAA 5JAXA 4EROA 4MGIE 5JSPA 4FBFA 5EZWA 2XKPA 5FQ0B 3CO2A 3QACA 1DZTA 2D5FA 1J3RA 1VJ2A 1O4TA 4MZUA 1RUOA 2XKOA 3USSA 1X82A 4LTAA 1O7FA 3LA3A 5AVPA 4HVOA 5KHIA 1LR5A 2GC0A 4F8AA 3U0ZA 3HT2A 3FWEA 2Q30A 3IBMA 1VP6A 2GH2A 5JCTA 3NVCA 1UIKA 2E9QA 1J1LA 2PHLA 2MNGA 3RYPA 4AVBA 3RYRA 3CLPA 4XFHA 2C0ZA 3CJXA 2CV6A 2IXHA 4FAHA 3LA2A 4QGNA 1J3PA 4ZU7A 2XL9A 2GC2A 4IEVA 4MGZE 1WA4A 1J58A 3SCHA 4LA3A 1NE4A 2K9ZA 1UPIA 2QDRA 3H3ZA 3ROUA 3WW3A 1DZRA 2BNNA 4MGYE 2H6CA 3B02A 3KMHA 3IDBB 1QXJA 2UY9A 4MV2A 1LKNA 1YFXA 2XLFA 2PTMA 1ZNPA 2QNKA 4CYDA 3H3UA 4A2UA 4BH9A 4WBBA 3U10A 1O3QA 1ZRDA 2KXLA 3DN7A 4UBHA 4Q29A 4YYOA 1FT9A 1Y3TA 1WLTA 2GAUA 4KU7A 2PAMA 3HQXA 3KSCA 1ZZ9A 3I59A 4Q0UA 2DCTA 2XLAA 3SMHA 5LEKA 4XFAA 5JSOA 2OZ6A 5C8WA 2B5HA 1IPKA 1CAWB 5FLIA 3OD0A 3BCWA 3BPZA 5FCCA 1CAUB 3S7IA 1OD5A 1LRHA 2OA2A 1IPJA 3H1WA 1GQGA 4EV0A 3IWZA 2QCSB 1YWKA 2XLGA 3HT1A 4IETA 5J7MA 3OCPA 5I8SA 1ZX5A 4N9HA 2OZJA 4HN0A 3H9AA 4P9GA 4I3PA 2D40A 3BU7A 2Z2SB 1NXMA 1QWRA 5KHJA 3UKNA 1UIJA 3PVBB 4YARA 2CGPA 2ZKLA 2IXJA 1EP0A 1ZZCA 1CGPA 1YFWA 2Z69A 1SQ4A 1UCXA 1WGPA 5CU1A 3ETQA 3E6DA 1H1MA 3IDCB 3E5UA 3TNQA 1ZZ8A 3IIAA 4H7LA 5I91A 2Q0AA 3U11A 2GU9A 1OI6A 4ZU5A 3FZ3A 4D7SA 2BYVE 1OFNA 2Q4SA 4MUVA 1ZZ6A 1GQHA 5LRSA 4JV4A 3LA7A 2BNOA 2PFWA 5FLJA 4AVAA 3BALA 5D1IA 1XRUA 3NL1A 3D82A 2UYAA 2FQPA 1X8EA 2V09A 4NVPA 3WW2A 2QVSB 2WC2A 4AQ6A 2HJIA 4Q0SA 3E6BA 3LAGA 1YLLA 4JVAA 3H8UA 5LEJA 2O8QA 1EYBA 3H7JA 4F7ZA 4I02A 4I0AA 1SFNA 2GC1A 4LULA 4QMAA 5FPZA 4EWDA 4QM9A 4E2GA 3EO6A 3OTFA 1VR3A 1J3QA 2VQAA 4Q0QA 4XFIA 1LB2A 3RPQA 1RUNA 3BB6A 4B29A 5FPXA 5I0RA 2XGXA 1X7NA 4I2OA 4LLOA 1FI2A 1QXRA 4XF0A 3M70A 4N9IA 4IEQA 5I8YA 2GZWA 1O3TA 1DGRA 3S7EA 1RL3A 3CF6E 5BPXA 2PYTA 3FFQA 4K8FA 3GYDA 4PIXA 2QJVA 4X6QB 3UKTA 1ZRCA 2B9UA 2H0VA 5FQ0A 3MZHA 2P17A 4J1WA 4R52A 2UY8A 2ET1A 4MGKE 4Z07A 4XF3A 3NW4A 5I93A 3H7YA 3RNSA 2PA7A 4HBNA 5C6CA 4YNIA 4BIFA 5HI0A 4MX3A 4R8HA 3PLQA 4I01A 1YFUA 3E5QA 4XF1A 3KGLA 4XFGA 4Z82A 4DINB 4LEJA 4QXKA 4IEXA 2IXIA 5BY5A 2Y0OA 5BV6A 2XL7A 2ETEA 3RYKA 4HLTA 2PAKA 4PJYA 4X6RB 5FDBA 3EQEA 1I5ZA 4IERA 3NKTA 4HMZA 4XFBA 5KHHA 5K8SA 2MHFA 5I0UA 4HVRA 3C3VA 4HSLA 1O5UA 2IXKA 4XF9A 1NYWA 3EJKA 3FJSA 3SXWA 4AQ2A 4O9EA 4IEWA 3KCCA 3NSTA 4XFCA 5BXXA 2BGCA 1O3SA 2VECA 4IEUA 3H1MA 3D0JA 5LRRA 4OFGA 1EY2A 1EPZA 4QGMA 2IXLA 3ES4A 3ELNA 2B8MA 3LWCA 1PM7A 1Q3EA 1OMIA 1NE6A 2OYZA 3LOIA 4MH0E 5CADA 5FLHA 1V70A 4IEYA 3ST7A 5CVRA 2HKXA 4PIYA 4Q0VA 1X8MA 3CL1A 3O14A 2PAEA 4QX5A 1ZRFA 1YHFA 2BEOA 4E2QA 5I0SA 4KWJA 3S0MA 4WZCA 2Q1ZB 1CAUA 1XE8A 4EWAA 2D93A 3DKWA 5BUVA 2EAAA 2WFPA 4TLFA 1U12A 4IEOA 3I7DA 3OGJA 1Q5OA 4IEPA 1O5LA 2I45A 1YUDA 2MPFA 1RGSA 5KBFA 2ET7A 4XFFA 3H50A 3M3IA 2BNMA 1G6NA 4KWKA 1I6XA 1CAXB 2D5HA 3RZZA 1JUHA 4IESA 1Q43A 2F4PA 3D0SA 2FMYA 3DL3A 4AXOA
chains in the Genus database with same CATH superfamily
1YEWA 3ZXKA 4KI5M 4S2GA 1HRV2 4HPKB 4CUCA 5JSRA 5IK4A 2XQXA 1PZ7A 1SLBA 1Y9MA 1W06A 2VNGA 3MO4A 3VHRA 1UX7A 4YW5A 1O3RA 4EZ4A 4LO6B 3WX5A 1GMMA 4I09A 3URFA 2DUOA 3VBUB 3L2HA 1E57A 4JQTA 2QDNA 4IEZA 1F35A 1MS0A 4NPRA 1MQTC 3SHRA 4W6XA 4CP2A 4CXXA 5BNOC 5FP4A 1VRH3 3PURA 5A3TA 3OUIA 4QM8A 5JOYA 2W87A 3MV01 3ZR5A 1UL9A 3O5SA 3IMNA 4CXWA 2ORXA 3D8CA 4RN5A 1SBEA 2VAUA 5D8AB 1FXZA 1FX5A 4TLGA 2HBUA 3I3QA 4N7IA 4CDWB 2ARCA 5IVBA 2X53S 1XU2A 3FLTA 1UYXA 4FCAA 4QGLA 1R092 2OW4A 2VC9A 4HETA 1CX4A 1QNWA 5A70A 5CZKA 2HEWF 5CFCB 1AYM2 1ULGA 3DYPA 3AXDA 3J9SA 2W08A 3U14A 4BYYA 4UFMA 1IKPA 4NHMA 4HK9A 3ZYPA 2O1QA 3V65A 1NCRB 1LGCA 3HIFA 3I3DA 3OF1A 3R6SA 4NRQA 3KVAA 3WP3A 4YW4A 1JZ5A 4AAPA 1CAVB 3SCFA 3ACGA 4IE0A 2D44A 2Q5TA 1AXKA 1J83A 5FP3A 1ZRIA 2DCJA 1NCQB 3CZJA 5CYYA 3SNMA 5FOJB 1LHWA 4DB5A 2ZKNA 3TOJA 1LHVA 4LIUA 5T3NA 1V6OA 1QDOA 1MVQA 2IUWA 2FMDA 3PNAA 4QPIC 4AW7A 1JZ2A 2YU2A 1JMUB 1ND2C 3J26N 4Y1UA 4YGBA 2W9XA 3VZNA 4K1ZA 2H6BA 2FDJA 4OCTA 4XC9A 1GNHA 3NRUA 5FZCA 5TSWA 4CTEA 4CZSA 1VRH1 5FR3A 1US3A 3WW1A 4Q2FA 2XG3A 3OSDA 4DUXA 4K21A 4HFSA 3EHKA 3VKOA 4QX3A 5K0UB 4PIZA 4ONUA 3WP6A 4D0QA 3ZO0B 3I2HA 2QQMA 1DYOA 2CL2A 4Q4X1 1VBE1 1SMVA 4BLIA 3T2QA 4BQYA 1TE1B 4YRDA 4ARXA 3T3YA 3WP5A 3AVRA 3VD3A 4HN1A 5GLVA 1GYKA 3IT8A 5L7OB 4S2FA 5DZGA 2K2SA 3NNJA 1ZVFA 4Q8LA 2IXCA 3OGRA 1YJLA 4HSJA 4OUEA 4NIIA 4A44A 1JI6A 1YQ8A 1LHOA 1PGSA 3GXUA 3U37A 4DRRA 3EBRA 3MYXA 1CZSA 4XETA 5E16A 4UXAA 5JAXA 3IDAA 4JKMA 3AKQA 3MI8A 2XKPA 2WUHA 5CB7A 1UOJA 3VBSC 2E7TA 3TEZA 5ABJC 1W90A 4LKDA 3W59A 2W3JA 1AYM1 2VGDA 3ABZA 4HKLA 4NR1A 4PBPA 4RGGA 4CEWC 2XKOA 4Z2AA 5DG2A 3SKJE 2VMCA 2C1FA 3LA3A 4N53A 4B1LA 4BJ0A 1LR5A 1RMU1 4DUVA 4R9DA 2RS53 3WNXA 3ACFA 4H2AA 1DLCA 2HWC3 2ZZQA 5JIAA 3T0AA 3VBOA 4IE5A 3U0ZA 5IK5A 2WWSA 1AJKA 1YRZA 4CDUB 5LY2A 4D69A 1GOHA 1V0AA 1DQ0A 2DVDA 5IAVA 1W8WA 2FCVA 1VP6A 2ZA9A 4JGZB 3IAQA 3PTRB 2VW1A 4MYEA 1KQRA 3NVCA 3MFCA 3NNMA 2BGOA 2E9QA 2RS13 2VZSA 4LITA 2PHLA 4XBQA 4XJ9A 2FDFA 3NWKA 3AK0A 3ZFFA 4NIAA 3UJQA 1RUH1 4IV3A 1BEV3 4C90A 3O1RA 5FZOB 5GLTA 2YV8A 5KC6A 2XVKA 3CLPA 5H9QA 5GZEA 3TWIA 1YI7A 2WRAA 2AC1A 3WINE 2JG9B 2IXHA 4IE4A 1OPMA 1XXNA 3LA2A 1W8UA 1MZEA 1GU3A 1W0NA 2XL9A 4FPYA 3LSEA 1U0AA 4Y1ZA 4GJYA 2CYFA 1AYN2 3PDQA 5A7SA 5JZGC 4N43B 4Z1VA 3BPSA 4YFZA 3POWA 4IEVA 3V0AB 1XNKA 4QPWA 5FZBA 1K45A 1J58A 4M01A 1IZ3A 3SCHA 3NO8A 4IV1B 2HWD3 1W9SA 1RUE3 3DYMA 2ZZJA 3T4VA 4AI2A 5A3NA 1XSRA 2CTVA 1HB4A 1RVF2 4BWOA 4CU7A 5DZFA 2NP0A 1GP4A 1DQ2A 4W4ZA 3KMHA 4XCBA 5G05L 1H2LA 5IHRA 4GB31 4PBOA 1QKQA 2UY9A 3WG1A 1LKNA 4XBNA 1HB1A 2Y6FA 1ZNPA 5FUIA 2B46X 3H3UA 5BNNB 4A2UA 4LNVA 2EXIA 1O3QA 1QGLA 2KXLA 1YJKA 5FZ9A 5C3RA 4Q29A 1E5HA 1F9KA 4N8MA 3QH6A 5CKMA 4JGYC 3MPPG 1WLTA 1TME3 5C5UA 1UAIA 5A7WA 4QXHA 3KSCA 1G9AA 4FSJA 1BKZA 5CFCA 2VMGA 1NAEA 5A7PA 1DYPA 1HB3A 2GH8A 2WFF3 2WZR1 3BUCA 2D6OX 2XLAA 5DAQA 2OZ6A 4FPEA 3S5AA 1HQNA 1GR3A 1LCLA 1BEV1 3I4IA 1JZ7A 2YBKA 3OPTA 5F32A 5A1FA 2VBDA 2WR9A 2XBO3 1C3HA 3BCWA 3K4DA 3DGTA 3CDZB 4LHSA 1LRHA 1QJY3 5J98B 1C8M3 1V9U2 1OOPA 1GQGA 3OEBA 2ZEYA 1LHUA 1TNFA 2QCSB 2XLGA 1UU5A 3IWZA 3Q8AA 4NO4A 3VDDC 3ZFEB 5FP7A 4CA9A 1ZX5A 4FQZA 4ATFA 3OGVA 2KD7A 3H9AA 4A7KA 1NCRC 4P9GA 5C3PA 2QZ3A 2WNEA 3Q8BA 2P3YA 2RS52 2RS12 5FPLA 5HV4A 4CUAA 4Q1RA 4JHZA 4LOSA 3HJRA 1JODA 2LRPA 4ASMB 5J09A 3BIEA 3VZKA 1TME2 5CKQA 2FDHA 4P08A 4AEDA 4PQ9A 4D6SA 2DFBA 2VNVA 3AP9A 2EALA 3SKVA 3HD8B 3MUY1 1UCXA 2ADEA 1KJRA 2RG4A 5CU1A 3ZFGA 1H1MA 5FZ4A 4AHXA 3WD5A 5LA2A 4GQ7A 4OMCA 3TNQA 1BLZA 4ET7A 5FREA 3AYCA 3IIAA 3OY8A 1R081 1BBT2 1FOD2 1XOYA 2DTWA 5GLZA 4A42A 1WCDJ 3FZ3A 2BWCA 4COZA 1APNA 5JPMB 3KWVA 1AX1A 4MUVA 4CDUC 2Y6JA 2WLPA 1FPN2 2W92A 5FZLA 2ZX1A 3O1SA 5A32A 2BFUL 3NKGA 4JV4A 4PDWB 4E4DX 5AC93 1QH7A 2H0BA 1WD4A 5GZGA 2ARXA 2F17A 2PFWA 5HCAA 1ENSA 4LIVA 3A4UA 5FYBA 3HPNA 4FVVA 3D82A 1MZFA 4YG3A 1NY71 2UYAA 4AVTA 3BKZA 2A7AA 1V6NA 3CMGA 2V09A 2Y8KA 1R1ZA 4FPKA 1MQTA 4OYUA 2Q1FA 5GM0A 2NQYA 4SBVA 3WW2A 4MVTA 2HJIA 2ERFA 5EJZB 3WQ1A 4E4ZA 1UY3A 1XJAA 3ZXLA 2ADDA 4GMP1 4JVAA 4YVWA 4AF9A 2VTFA 3H8UA 5LEJA 1G7YA 1QJEA 3WG3A 4LULA 3X29B 3R4UA 2X05A 4AYUA 5HBAA 1PZ8A 2WWJA 3IZOA 2VMIA 4H14A 3EO6A 1COV2 4DNYA 3RJ2X 5A3LA 1ND3C 1NLSA 5DDJ2 3WF3A 4YG6A 4Y26A 4Y3OA 3JBG3 1VR3A 2ARAA 5FYSA 3RWNA 3ZX7A 2VQAA 4B7EA 1CD3G 3GCWA 2JD4A 5FZEA 1ALYA 2D3RA 3C7FA 3QBQA 3A23A 4UAPA 2QE3A 2DWRA 1VBA1 4YW3A 5CA6A 3VBRA 5FPXA 5I0RA 1UKRA 5FOBB 1SFYA 2RE9A 3VGIA 1OH4A 4XDQA 4FTEA 2WNVC 4M3CB 4P00B 4IV3B 1QXRA 4XF0A 1EUUA 2C9AA 5B4NA 4L9BA 1XPWA 3ACHA 5LBFA 4IEQA 1UZWA 4QX7A 5A6QA 4KMQA 4YM2A 1L7QA 2GZWA 3VBFA 4TWTA 4CCJA 4CPBD 4P9JA 4D3WA 3D4KA 3MF6A 3S7EA 5CBLA 3HVDA 4JC1A 4CEYC 5C70A 1S4CA 1ZBA2 5ABJA 2B7YA 4CDXC 2VUJA 3GYDA 3LSDA 4K8FA 4LR4A 3UKTA 2YGLA 2H0VA 1LOFA 1LOFC 3IB3A 3OUJA 5APAA 5J1XA 2QKDA 1JOJA 5DUXA 3UGHA 2UY8A 1RMU2 1PX4A 3ETPA 4BB3A 1WD3A 1XQNA 3N7MA 4W65A 2PA7A 5CFCC 2IVJA 2P3KA 3E1F1 4YNIA 4EYUA 4NIDA 1SLCA 2BJSA 1XC6A 4BCUA 4BMBA 4EN0A 4UT5A 4I01A 1LOEA 1OVSA 5DUVA 4YLZA 4DY5A 1QMJA 4Y20B 3KGLA 3GZEA 4XJ8A 4LEJA 3MIFA 3N7KA 3TAYA 4B8EA 3DCQA 2R073 3WQBA 1ULCA 1RUI2 2FZ1A 4GB33 5CG9A 3JBG1 1LHNA 2LTNA 2ETEA 2BQPA 3WUCA 3MBWA 3FLRA 1NZIA 5BV6A 1Z7S1 3C2UA 3NJXA 3B7MA 3GJBA 4LLFA 4NROA 5FYYA 3I8TA 1VBA3 5KWRA 1RUF1 2YHJA 1VBC1 2C6SA 5ERLA 1NCQC 1ST8A 3ZFFC 5BNPB 5BNNA 4IV3C 3MW4A 2JE9A 5FMOS 2RM23 1RINA 3RRDA 3AFKA 1I5ZA 3KCYA 1VBE2 4YPJA 1BEV2 4Y4YA 3BTYA 1VBD2 2O0OA 1HV0A 2HWE2 2K46A 2PHWA 2TBVA 2W47A 1UF2C 2BOJA 2CGNA 1FMD3 1HV1A 1RUE2 1IS4A 3D6EA 1YC61 2WNVA 1NYWA 3FJSA 3M8LA 2KA3A 3WG4A 2CWSA 5FRAA 1JOPA 3VBOC 3SXWA 4AQ2A 4O9EA 1AYN3 5FY4A 2VM9A 3SH5A 1F5JA 5FO9B 2ZHKA 1S0GA 3KCCA 4QKBA 3KHBA 3NSTA 4L99A 5BXXA 2BGCA 3VKMA 5JXHA 4IEUA 2GNDA 3H1MA 1POV1 2ILMA 2CY6A 3Q8EA 4GWMA 4MHUA 4V2VA 1W6PB 1W6NB 5LRRA 4CDUA 1LOCA 1W99A 4GMP0 4NAOA 2R1DA 3JBG2 3U07A 1CONA 4OFGA 3NV3A 1BK0A 2VO5A 1EY2A 1VAKA 2YZ4A 4FXGB 5FZHA 4Z8BA 4YGCA 1JZ8A 3UK9A 2R0FA 2RDQA 2RR13 1YIPA 2ZAAA 3ELNA 1GKBA 2SBAA 2HYXA 5L19A 4Y22B 2BOIA 3LWCA 2JKXA 5CG8A 5FZ1A 2W0XA 4NIGA 2HWE3 2DCKA 2RS32 1H6XA 3MIBA 4XDOA 2EXKA 2OYZA 4M3CF 4DPNA 1F4HA 3SQOA 2VD7A 1DCSA 3N9NA 4GH4C 1I9RA 5E8AA 3ZR6A 2BBVA 3MGUA 3ST7A 2LW8A 1AR71 2X09A 1M06G 3CL1A 3NJVA 2VTXJ 1UY2A 2O14A 2PAEA 2B4KA 4K8RB 4NJ4A 5ANNA 4KG0A 5FZGA 4XW3A 5H9SA 2RM21 2PLV2 4MGSA 4QPIB 4WM8A 1V6MA 3OEAA 2WBKA 2JG8C 5FXWA 2PLV1 1S0IA 2WNOA 4WZCA 4K9SA 4LBQB 3WCRA 1AR81 2D6LX 2YB7A 5BNNC 1MS3A 2FBEA 1S2BA 4ASLA 5F3CA 2QQWA 1QH6A 1GFF2 1IKQA 5A7OA 1M4WA 2QQKA 2XWBB 4J6GA 3RZMA 4JHTA 3RJRA 4XIOA 5FJKA 4ZZ8A 1U12A 2QQUA 1WLWA 4KQ7A 3POFA 1GQPA 2G19A 2ARBA 5L9RA 3AL6A 3VBHA 3HAGA 2GMEA 1PGW1 1S1AA 1XNAA 2YXSA 3C7EA 3I97A 3KF3A 3N35A 3NQHA 1S55A 5DAPA 3WHTA 5JDBA 1JYXA 1RUC1 1W8TA 5FP8A 5ISLA 3H50A 2NN8A 1WLCA 2BNMA 4XUNA 2JDPA 1DG6A 2ZGMA 1ZBA3 2ZGSA 3NNFA 2WQ4A 1BMV2 4CDQB 4D6QA 1SPPA 1WCUA 1DFQA 3JQWA 1N3QA 4IE6A 4X8NA 4Y20A 3AC0A 5FZMA 3ZOIA 5FZIA 3M3CA 2ENRA 4RQPB 3DL3A 4OVEA 2FCTA 1WW4A 4Y5SA 4AXOA 4YGEA 5LK5A 3KGZA 3HMYA 1YQ5A 4N53B 5A7NA 2DU1A 5HV0A 2ZX4A 1AR92 2ZACA 3NV1A 2W2IA 5T5LA 2G1MA 5CISA 1CAVA 2VQTA 5FYVA 2IC1A 3LEKA 1YQ6A 1YQCA 5ACA1 1BVVA 3PHMA 4CXYA 4UBGA 1W6NA 1DU3D 2VZ1A 1GP6A 1H8TB 1Y43B 1NZCA 4JTOA 4I0WB 4WVZA 4XJZA 3SISA 1JU3A 1Y9QA 2BZDA 3GALA 2C26A 3LDBA 2IFRA 3TNPB 4CUGA 1N1VA 3VBFB 4AAXA 3INAA 1TQ5A 3E6CC 2K0GA 1GOFA 5T54A 2ZGOA 2EAKA 3K3NA 1COV3 1I3HA 2XHKA 1LTEA 2BFUS 1BYHA 1TVGA 4I0BA 4CCCA 2GN3A 4HZFA 1C4RA 5IFTA 3T4HB 1NG0A 2A71A 3KV9A 1ZZ7A 4BM8A 3OOXA 3VB9A 5I8TA 1CJPA 2RR12 1F2NA 5IYYA 1RHI3 5CAZA 1OLQA 3DKQA 1Y4WA 4ZONA 4KWLA 1W6PA 2VCMA 3E5XA 3I54A 2F4LA 4XTPA 4WM7A 4R9BA 4XHBA 1QJU2 2RMU3 1YFYA 3APBA 1VRBA 4GWNA 3RDIA 3WP4A 5FZFA 1P8JA 2EVXA 1K5MA 3VL9A 3OYWB 5L36A 1ULOA 2JE7A 1WMFA 2GALA 1LULA 3QOPA 4HVQA 1D4M1 2JDNA 2YY1A 4DXSA 4JZRA 1UD1A 1UW8A 3ACLA 5JR7B 5IK7A 4JAAA 5I0TA 2C9KA 1UU4A 3KQRA 1LENA 1QEXA 2UWAA 4DOUA 5FXXA 2GC3A 5FPVA 1JHNA 1H1IA 1H4HA 2HWD1 3ZDSA 1RTVA 1V00A 1HB2A 2EA7A 4QPIA 3IM0A 4NHXA 2OKXA 1GWMA 3CEWA 2TNFA 5DDJ3 1REDA 3VDDA 4AI0A 1OUXA 4GAZA 5A33B 3ZDVA 1DZQA 1NUKA 1OQEA 1ZRRA 4WV8A 2BERA 3FMGA 5J37A 4QAWA 3THTA 3GBFA 4QDSA 4ATEA 2JE8A 4CE8A 4UW3A 3O1TA 5DMYA 2GSYA 4YSFA 4AEMA 2Q8DA 4BHPA 5C4WC 3MEPA 3DV8A 4OLLA 2XJQA 1PGL1 2E53A 4W6YA 3WY6A 1BHGA 1AR63 5KXDA 2QUOA 3ZYJB 1JZ4A 3OUHA 5H9PA 1RVF3 4XACA 4AEDC 1PGL2 2XVGA 2F6BA 2HWF3 4MLOA 5DAXA 1H30A 4K6BA 1G9DA 2FDGA 3N9QA 3ZYIB 2E26A 1GLHA 5C3QA 1ULDA 4JKKA 1X36A 3T0BA 4E2SA 4AFMA 2VOTA 4RGKA 2A6WA 1ZBE3 4ZU4A 4GB32 4A7YA 1N1SA 1TZOA 3SEPA 1L7RA 3GZTB 3MW3A 1RUH3 5D21A 1QHDA 3J7HA 4BQ1A 2YGMA 4B4RA 2E32A 1HN0A 4XE9A 3QACA 4LO8A 3VKFC 2W1QA 3TRSB 4CEWA 2WYFA 3USSA 4CDWA 4D94A 5DZEA 1ZM1A 4LTAA 2XWJB 4HVOA 4RS5C 3N9LA 2D98A 5C9AB 3K51A 1B35C 2GC0A 1RUD3 2EIEA 3KQ4B 3CJIB 1G9BA 1FMD2 2DTYA 1SPPB 1LOBA 1OOPB 4JX0A 1QXPA 1QJU3 2RMU2 3ZFEA 3CIHA 2RVAA 2FD8A 4KBZA 1A6CA 1TMF2 3FWEA 4GXLA 2Q30A 3TYJA 2WWUA 1YXWA 4XQDA 4Q4X2 1D7PM 1LNSA 1OLRA 3P1IA 5EV7A 3ZKUA 2HWC1 4CCNA 4AHYA 2HH9A 5F9TA 4OI2A 3LPGA 1X9TA 2DCYA 1G9CA 1RUG2 3RYPA 4B4QA 4AVBA 1IOAA 4M0HA 4BQ3A 1A3KA 4XBLA 1UZ0A 4RHV2 3PJYA 3FUOA 4YVSA 4P9LA 5FKBA 3VKLA 3TEYA 2VW2A 1KS5A 3AYDA 2Y64A 2QTWB 4QGNA 2J1VA 2YC0A 3PJQA 1LAJA 1OHFA 3H0OA 2RS11 5JI9A 3WDXA 2P2KA 4K1YA 2JJ6A 3LDRA 1QU0A 4PDWC 4E8CA 4A7ZA 1HLCA 1OBNA 1C8NA 3OBZA 2JECA 1D4VB 4NRPA 1WW6A 2WL1A 1NQDA 2JDAA 1OKQA 4MGZE 1MS1A 5IVEA 1WA4A 5JZGA 2XBO1 4QXBA 1WW5A 2QQJA 2FDKA 5F6LB 4COYA 4LO7A 3ZXDA 1N1TA 2JDHA 2PHFA 2ZGTA 4H3WA 5KR7A 1L7LA 3AFGA 1ONAA 1GZWB 5EJ3A 4G4FA 3SH4A 4C1WA 3A21A 3KT4A 3PMSA 5LBCA 4CEYA 4OI0A 1YFXA 2XLFA 3KS7A 1OQDA 1UY0A 1Q56A 3ZPOA 1FAYA 2Y6GA 1UMIA 2WNUA 3S30A 4WBBA 2JX9A 1OLME 4SLIA 4JRAA 1QOOA 1Y3TA 2Z5WA 4NWWA 1W2TA 1XYPA 3LQCA 4CDQA 2PAMA 1S0JA 2WA4A 1OUSA 1UY1A 1ZZ9A 3IPVA 4Q4W3 4Q0UA 2W46A 1ZA4A 3JD73 3AXEA 3TN92 3SMHA 3GZAA 4XFAA 2E31A 2R072 1VMHA 3KT1A 5FYHA 1VALA 2R061 4I3GA 2J1UA 4FOQA 5FLIA 1RIRA 4H55A 1BBT3 3WT3A 3B3QE 5FCCA 4CDXB 1U5ZA 4NPLA 2OA2A 1IPJA 1OD3A 2QQPA 3KM5A 3H1WA 3MFAA 4WVMB 4ZXEA 4CCDA 1D0GA 4YZ5A 3HT1A 3OJBA 1YO8A 4P02B 5J7MA 1NCQA 5LZ6A 4PT6A 3OCPA 1SG3A 2GNMA 1HRV3 1H9PA 2XR4A 4HN0A 5FYTA 5IVCA 4I3PA 1O8SA 4WVVA 4CEYB 1VBA2 1NXMA 2BP6A 2PHXA 1PO23 2WIIB 2W39A 3PVBB 1G8WA 1KGYA 3ZYHA 4KGGA 4QKFA 1EP0A 2ZX3A 1ZZCA 2FHRA 2Z69A 5F7UA 3BTZA 1SQ4A 2EXJA 3ZFGC 1VB4A 3E6DA 5EP9A 1C5IA 4YZ1A 3IDCB 4XJWA 3E5UA 3WDYA 1VE0A 1AYM3 2X8KA 2E51A 2Q0AA 1RHI2 3U11A 1MEC3 3AVSA 1O59A 3WV6A 2WSUA 4NMIA 5J96B 3EMRA 1RMU3 2PN5A 5GLUA 1OFNA 2D6MA 1NT0A 1IPSA 1WMEA 2GNTA 3JQXA 3K3OA 1GQHA 3N7LA 4LHNA 1AF9A 1VBC3 2ZMNA 3JB4C 1MVEA 3WCSA 1FV3A 5DUWA 5FLJA 4AVAA 5LCWL 1CZTA 1X9PA 3EXUA 1XRUA 3NL1A 4A6SA 4AFBA 4XABA 4C1XA 1K5MB 4UI9L 5I0DA 2BGPA 4YG0A 5BNOA 2PQSA 2QVSB 3T2OA 4XURA 4Q4V1 3E6BA 4AI9A 3ENRA 4QDRA 2W1SA 3LAGA 3NJYA 4D6RA 1HRV1 4Z2WA 1Y7BA 5IVYA 1BZWA 4AI8A 4D8MA 5IVJA 4AEKA 1UO9A 1V6KA 2JDUA 2O8QA 3ZN6A 2NYYA 3VDCA 4F7ZA 5L9VA 4I02A 3OPWA 4I0AA 1SFNA 1RYYA 3I3EA 1QNYA 1G9FA 2GC1A 4LBJA 4Y22A 3KVBA 4EWDA 2EF6A 3KCXA 5F5IA 4BQWA 3MF9A 3OTFA 3SLIA 3P3PA 4Y5Z0 4CCEA 5KXCA 4CSWA 1RUD1 4CP1A 5C9AC 1LB2A 4QHZA 2DCZA 2X5IB 2RDRA 2WFF2 3RPQA 2JENA 1CVNA 5JVVA 4CU9A 4EN9B 2DVFA 5FMBA 4LBLA 5LASA 4BQ2A 1X7NA 1KJLA 3U78A 1NLRA 3K77A 1H2NA 4I2OA 2VVFA 4CCOA 4DEQA 4BK5A 2OQ6A 3M70A 1UKGA 2BVVA 2P34A 4QXCA 2FZ2A 1PGW2 1R64A 1GNZA 1T2XA 5T5JA 3P3NA 3VHOA 1NY72 1D0HA 3I2GA 1AL22 2ZBJA 4IE7A 4CRQA 4MXVA 2VMDA 3MLLA 2YG0A 4AI3A 1F15A 3KV5A 3OGGA 2AYHA 4UFIA 3KHCA 1KD7A 3CF6E 1HDKA 5BPXA 3ZXFA 2CU5A 1DGWX 3KD4A 1DQ1A 1PVXA 1RUC2 1XNBA 1VMJA 4PIXA 4CDXA 2A3WA 1NA1C 4UW5A 3VUOA 4AVVA 3LB9A 4IV1A 4LBNA 4RGAA 4AE2A 1QIQA 3T0DA 2ZMKA 4MGKE 4Z07A 2WS91 3NW4A 3WNNA 1AR91 5I93A 3DECA 3H7YA 4WM7B 2WJSA 4EN6B 1HQLA 1C28A 5C4WA 3MV11 2EICA 3Q8FA 2PELA 3AZYA 1QJX3 5C6CA 5FUNA 5HI0A 2BRTA 3M1HA 1HJFA 3ACIA 3OBRA 1YFUA 4RR3A 2QQNA 3E5QA 4P9YA 4XF1A 3JCIA 4XFGA 5FZDA 3T1MA 3S6PA 1URXA 1UWWA 1BJQA 1Y9GA 1JN2P 3AYEA 2KR2A 3IMMA 3WEZA 1SBFA 2X5IC 2XXZA 2XL7A 3IAPA 4LO4B 4QU2A 3CZUA 4WM8C 2VTXA 4JDOA 4HLTA 5IFPA 2WT0A 2PHTA 1T6BX 4PJYA 1W0OA 4X6RB 3POSA 4J25A 3PUAA 4FPHA 5IATA 2DVBA 4IERA 1B35B 3HNMA 5A33A 1JYTA 1S0FA 4HMZA 1KS4A 4Q4W1 4XFBA 3UT0A 5KHHA 4XUQA 2MHFA 4N53C 3TBDA 4PDWA 3VBHC 1ENXA 2QQLA 4QQOA 3U75A 1O5UA 2IXKA 3U4XA 5E89A 5ACA3 3ZIWA 1W6MA 3B94A 3CQOA 5HXVA 1B09A 2FCUA 5A7QA 1VAMA 4R4ZA 1OA4A 3VD9A 2J1RA 3GZUC 1UYPA 3AB0A 4A3ZA 1V6LA 5KXEA 1WCSA 4URAA 4FQ4A 4C91A 3FN9A 3THPA 3BTXA 1O3SA 1Q8OA 4K7JA 4WVMA 1ODMA 1I1EA 5T52A 1SCSA 4HKWA 5FFOC 1REFA 5AVAA 1PIV2 1UMHA 3ASIA 4FOVA 3MUZ1 2IXLA 1Z7S2 1YNAA 4HXCA 2B8MA 3M4FA 4LQRA 3BN6A 1RUC3 1PM7A 2BUKA 2LM3A 1OMIA 3VLBB 1NE6A 4PHZA 4OULA 3DUIA 2MEV2 2L9LA 4N90A 4BQXA 2JG9C 1V70A 5FZOA 4YVWB 3ZFGB 3AKTA 2UURA 4PIYA 4Q0VA 5K0UA 4AQSA 3LKJA 1ZRFA 2YBPA 2A73B 5FY1A 3MIHA 4CEWB 4S2DA 2OXBA 2ZGQA 3BVCA 3POJA 4KWUA 2P1BA 2D7FA 1QF3A 4XJUA 3UETA 1OOPC 4KWJA 3HN3A 4DMIA 1CAUA 3ZKYA 1FV2A 1XE8A 1U5IA 1OF3A 4Q4Y1 4FPOB 2C4XA 1X50A 2EAAA 2WFPA 4FFFA 2P5BA 5CFDC 2XUMA 5F37A 2D6PA 3ZFFB 5BNPC 3RVHA 1WCKA 4X8PA 3OGJA 3T08A 1E5SA 4UWDA 1Q5OA 4IEPA 1V6IA 1GSLA 1O5LA 2YYOA 1K5MC 4FPLA 1YUDA 1WMXA 1RGSA 4Q4W2 3LCPA 1C1LA 4LKEA 5EQUA 4BQ5A 2VOKA 2GMMA 5F8PA 1COV1 1VIWB 2MEV1 3JU9A 4GJZA 3OB8A 1I6XA 2X10A 2JDMA 1H1AA 3AX4A 4LE3A 5A32B 4PF5A 4DFSA 2D5HA 5G04L 2RHPA 1JUHA 4IESA 1Q43A 3T30A 2F4PA 3D0SA 3B93A 2YFZA 4AFDA 3H8RA 3ON7A 2EIGA 2P3IA 2A3YA 1UPSA 1IGOA 4FFHA 3ZXGA 5H9RA 3W5NA 1UYYA 4H7MA 4XCAA 1HW5A 1QQP2 2WZ8A 3FX3A 4GULA 2UYBA 1PIV3 3MPBA 3POBA 4LJHA 4Y5TA 3WZ1A 2YPJA 3TB0A 4ISQA 4KU8A 2C24A 4DY3A 1RUG1 2P3JA 5J48A 1QJFA 1WBLA 1DGWA 2XVLA 4XUOA 3LGRA 4ORFA 4M4RA 3PU3A 3WG2A 3H42B 2WA3A 1W9FA 3BOPA 3PMEA 2PQQA 4Q0PA 4JDNA 2OUJA 5F39A 1SDWA 4FI9A 4M00A 3FBMA 5K9YA 4YW1A 1XYOA 1QJU1 3CJIC 1PO11 2VZUA 5SV5A 4AGVA 4EJRA 3VZLA 1AX2A 2JG8A 4LUKA 4XIKA 4WVWA 1CAWA 2Q8OA 5JLVA 4W8JA 4N7UA 3IDEA 2A6YA 1KFXL 1MR5A 5FY0A 5FPUA 4PQQA 2CGOA 3ZSKA 1NA1B 4META 4PF1A 4XAEA 5T50A 1KXGA 3AZWA 2LS6A 4GKXA 1VBB1 5HPOA 1AR93 4ZKTB 3S57A 2LALA 1XNTA 4JTNA 2A70A 2A75A 2MEV3 1EV13 4WM7C 5KXBA 1H4GA 4OMDA 2OPKA 2AZ5A 2RV9A 1S0CA 3UKVA 4XF4A 5EHDA 1Q8QA 5FYUA 4ZXKA 1LOGA 3AMNA 4D7TA 4Q4X3 1E5IA 1A78A 4XEZA 1UU6A 4RD7A 2CAVA 3POYA 2PHRA 2E33A 2BW8A 2VE1A 3I59B 1C5HA 3LZZA 5T5PA 1FATA 2ZHNA 2ZXQA 1ZREA 1GOGA 2XJUA 4RA0A 4YVWC 3TEWA 2IWGB 1J59A 3R0RA 2D6KA 4QKNA 4RHV3 5EFUA 5FMCA 1ND2A 2VZOA 1YIFA 2YC2A 1VB2A 3DXTA 3NV2A 3O0WA 3VBSB 4CCKA 3NAPA 3H1YA 1JH5A 1W8NA 3POIA 5FWEA 5FY7A 4PLMA 1OURA 3M2MA 4GH4B 3NMBA 2HYKA 2NM1A 1R082 2Y6HA 3N36A 3WNLA 4COWA 2HEYF 2Q8CA 3WSOA 1ND3B 1YCIA 2BV4A 1GZCA 4O9GA 4J1XA 1AXZA 2VCCA 5C33A 3HOBA 5KHGA 4CCMA 3WDUA 3LFMA 4YM0A 4KG8A 3SITA 2R1BA 3USUA 4HPKA 5E1RA 1W2UA 1ASJ3 4YW7A 4P9WA 1PO22 5M0TA 3SCGA 1NX9A 1UX6A 3AJYA 3VN4A 2EXHA 3ITQA 5DAWA 3ZYFA 5J3UA 3AZXA 1WUVA 2WINB 3A22A 1W2NA 1CPNA 5GZFA 1RVF1 2V4AA 4MGIE 1XB9A 5EZWA 2BDRA 3T2PA 4E4HA 2HWF1 1TME1 1BBT1 4OHVA 3C8XA 3CO2A 2D5FA 5BNPA 4S2HA 1J3RA 1O4TA 1O91A 4LBOA 2JDZA 5FBJA 3VV1A 2VZTA 4CU8A 1D2QA 4QQPA 4RS5A 1FYUA 1O7FA 5E88A 5AVPA 1CN1A 5ANQA 1B35A 2XUEA 1JUIA 3RG0A 3ZSMA 3MIEA 4YGDA 3P6BA 3QLQA 4KGQA 4Q4Y2 5L9BA 2VZPA 3HT2A 3LIGA 4UF0B 5FY8A 1UZYA 3HNYM 1E5RA 5K7PA 4DXRA 2AACA 4TZDA 3IBMA 2R30A 4QQHA 1F31A 1PNFA 2VQ0A 2VUDA 4YWAA 3I49A 2DURA 3D3AA 4RR3B 5IW0A 1A8DA 1IQDC 3JUUA 1CIYA 3HQUA 4UW4A 3W58A 3WQ7A 3WNKA 3AMQA 1J1LA 3SH3A 4IQPA 1LGBA 3A0KA 1KITA 3RYRA 3V0BB 1OQ1A 4YVSC 5J36A 1PVC3 2VBBA 4XFHA 5K4LA 1DLLA 3CJXA 2CV6A 5CKNA 2YUEA 2GDFA 4ZU7A 3VD4A 5FO8B 3VBRC 1KDKA 2WT2A 1A8MA 1DQ4A 2YBSA 4MO3M 4DS0A 1KRIA 3ZXEA 3J7NA 2R063 4ZPIA 3B69A 3B00A 2WFF1 1RHI1 1NE4A 3CJIA 3WDWA 1UPIA 2QDRA 1W04A 3H3ZA 5F3IA 1FNZA 3ROUA 1KFUL 3H3LA 1W6MB 1DDLA 2BNNA 4OHYA 1QOSA 3PU8A 2H6CA 1S0EA 3B02A 4INDA 5A6XA 3IDBB 1QXJA 4FXKB 5EXOA 3PUQA 3ZMNA 2PTMA 2SLIA 4IGQA 5CFDA 2JXAA 3DPRC 4NPMA 2Z79A 2BTVC 2ZAHA 4CDWC 1CWPA 5A3MA 4BH9A 5JXJA 1RUI1 2B42B 2WNUC 3MICA 4MGQA 4RSUA 3WUDA 4UBHA 2ZGNA 4JGYA 4A4AA 4PLNA 4CDQC 2GAUA 1JOBA 4KU7A 3WF1A 3AKPA 3I59A 4NHYA 1A34A 2ZPXA 2VMHA 2DCTA 4A45A 3VL8A 4E8DA 1AXYA 1MEC1 5LEKA 2R32A 5C7GA 1NLQA 5C8WA 5DPNA 4DUWA 5FWJA 3AKSA 2HBTA 3FLPA 1IPKA 4LPLA 5FK7A 1CAWB 1SZBA 2XJRA 3OD0A 3TN93 1PVC1 2XQRA 3MIDA 3WR0A 3RWKX 2X5IA 1CAUB 2VZRA 1OD5A 3VBRB 1K42A 2AH2A 4DIQA 1UY4A 4NWVA 1W8HA 4DXZA 2WO2A 2XBO2 5EYXA 1Q8PA 4IETA 5I8SA 2BU9A 2VJXA 2YROA 2P6HA 4N9HA 3O1OA 1J84A 1D4M2 3PIJA 3BU7A 3KF5A 4FPFA 5F5QA 5FXVA 3D5OA 1SFPA 1QWRA 4XILA 4O65A 5KHJA 3UKNA 5GALA 1UIJA 4YARA 2GNBA 2CGPA 1AHSA 1H6YA 2VU9A 1ZBE1 3OD4A 1BVP1 2RS33 2A1XA 3ZVXA 5IT6A 4P9XA 1R1A3 2G9ZA 1DBNA 1GUIA 3PIGA 3V56A 1W03A 4XHXA 3IIIA 1ZZ8A 5IK8A 1AL21 3HQRA 5FMOL 5I91A 2CDOA 4JCKA 1W9TA 2R7EB 2WT1A 4RHV1 3WDTA 3OGSA 4ZU5A 3HBKA 1W6QB 5JUVA 4O61A 4D7SA 1MEC2 5F6KA 2BYVE 2Q4SA 4FP2A 3RZLA 4LORA 5JZGB 4IW3A 3QD6A 1QDCA 2JB8A 1ZZ6A 2HWB2 3BGAA 4LO5B 4RQPC 5LRSA 5LK7B 4IV1C 2VULA 4YM1A 2VG9A 2VUCA 2R043 4BK4A 1FPN3 1OF4A 3BALA 2JEMA 3CU7A 4IGPA 4BXSV 4E4SA 5D1IA 3ZN5A 3LOBA 4QPGC 3AL5A 1ULPA 5A3UA 2ES3A 1X8EA 3R05A 1EAH1 1DYKA 3MIGA 3M3QA 2WC2A 3ME2A 2QFEA 5CNAA 2ORZA 4Q27A 4Q0SA 1WKYA 5F5CA 3HR9A 4QPYA 5A1LA 4BPZA 1N3PA 3KZ4C 4QQ2A 1J1TA 1RXFA 1ZA7A 5BNQA 3IKWA 2WZR3 3H7JA 1VAVA 2VCBA 3O1MA 4DZGA 4QMAA 2VXRA 2Z4FA 1GNYA 3P5BA 3AP5A 4Q4V3 4RL7A 5D8AA 2E7QA 2HWB3 5T5OA 4QM9A 4E2GA 1BCXA 3VZJA 4OQ8A 4IXLA 3WOGA 2WS93 2ZMLA 4PI0A 1RITA 3RS6A 3C7OA 3ZSLA 3NAPB 2ZS6B 4DQAA 4Q0QA 1QJY1 2OVUA 4LHKA 3TEXA 2OIIA 1QOTA 3WNPA 3BB6A 1CR7A 1DQ5A 3HEIA 3THCA 5C8CA 3VBUA 4LLOA 5EYYA 2ZX2A 1ZBE2 4GKYA 4WM8B 4V2WA 5HXMA 4N9IA 1JW6A 2JICA 5LBEA 5SV8A 1OH3A 4LXLA 4NAMA 1OT5A 4MXWB 4BMEA 1LEDA 4TSVA 4XDPA 4R4XA 1I5PA 1RL3A 3KB5A 5FYCA 3DXUA 3VBSA 4HANA 1MS8A 3GM8A 1H9WA 1HX6A 4P5YA 2ZTNA 2VZQA 1Z7S3 5DN2A 4X6QB 4C8DA 3DPRA 2QJVA 4CU6A 5C3SA 1ZRCA 2RM22 4FPCA 5FQ0A 3MZHA 1EAH3 4R52A 3VHPA 4Q4Y3 1BQPA 3ZXAC 4XF3A 1CESA 3LEMA 5FPAA 3AMHA 4FO9A 1O6UA 3RNSA 4FOYA 1ACCA 4HBNA 4CVUA 3CKHA 4CPBA 4UOJA 5CEHA 4R8HA 1IG3A 2R042 1HXS3 3PLQA 2HWD2 3VKNA 1OFSA 4BIOA 4ZHNA 5JWPA 1WW7A 3VBOB 5FMDA 5K0UC 4Z82A 4OZXA 2YMZA 4IEXA 4QXKA 4XAAA 5EJ1B 2IZWA 2V5DA 3N9MA 2Y0OA 3I2FA 3LD8A 3I3MA 2JWPA 3JD72 2WAAA 1FOD3 2W95A 2ZEXA 3J7LA 2PAKA 4AHZA 5D8AC 4K40A 1OA2A 5JOZA 3POEA 4JDMA 1F8VA 4FPGA 3ILFA 1W6QA 3UNPA 2E7AA 3NKTA 5C9AA 4PI2A 2XDVA 1CJDA 4C0BA 5FZ7A 4HKOA 3UV9A 5A6YA 2ZHLA 1N3OA 1LGNA 4XQ4A 2UWCA 2RR11 2WO1A 4MHRA 5I0UA 5DABA 5FZ8A 3T1LA 3WF4A 2JD9A 2ZGKA 4HVRA 4HSLA 5FYZA 5FYIA 2Q8EA 1UOGA 1VBD3 2C5DA 2DDUA 3EB7A 3EJKA 2DVGA 1CZVA 3UYJA 2OQ7A 3K46A 4HT1T 5F3EA 4AFAA 2WLQA 2TUNA 1SLIA 4IEWA 4OI4A 5HCHA 3W21A 1MACA 1AR73 3I2OA 2WABA 3BU0A 1V9U3 1KDMA 4QHOA 4YZ3A 2VECA 2NMOA 3RMXA 5B4XA 3H8XA 4MADA 3D0JA 1JYCA 1K5JA 1UNBA 3RZJA 4IDZA 3ZYBA 1S0BA 1GWLA 3K4AA 1EPZA 1PHMA 1HXS1 1WCQA 4QGMA 4MGTA 4YZ4A 3ES4A 4MOAA 2D3PA 4B1MA 1IQAA 2VZVA 2J22A 1Q3EA 1HQWA 4LKFA 1R1A1 1XNDA 5CADA 4MH0E 1LESA 5FLHA 2JDYA 2WZPP 1TEIA 3HNBM 4BZ4A 4NE9A 2BPA2 4LKSA 3I3BA 3VDBA 1T6GC 2HKXA 3AM2A 3B9IA 1MZ5A 1UXZA 2HWC2 4QX5A 4YW6A 3ZM8A 4FOWA 2V72A 4M4PA 4I30A 1PK6A 5I0SA 1UZZA 1LU2A 5FK8A 2VVEA 3Q9OA 4QKDA 5JI7A 4M3CE 4C0HA 4EWAA 5C71A 5JR2A 1UQXA 2VNRA 3OG2A 4UW6A 3DKWA 5BUVA 2XJVA 1CQ9A 2A6VA 3K48A 1VBB2 4HOOA 2ZJCA 1WA6X 5DAVA 5E6HA 2VR4A 2J42A 2VH9A 3GF6A 4RFT0 1RUF3 1D2SA 4A6OA 4NOTA 4P14A 2I45A 2MPFA 3BTAA 3WNMA 1MS5A 4QHBA 5GZCA 4R9AA 4ZS3A 4XFFA 5LA0A 5IJRA 5A3WA 4KBBA 3J8F3 4HL0A 2IFWA 1WMDA 4QWNA 1R1A2 3BYWA 3ZPYA 4IGOA 5DDJ1 3VD7A 3VBFC 1LECA 4ARYA 1CPMA 5IAXA 1FMD1 3KV4A 4XOGA 1CAXB 3ZXJA 2D43A 4EE2A 2DV9A 3RZZA 1UMZA 2DUPA 2DYCA 2WN2A 4QQLA 3NNGA 4XMAA 4AEJA 4E9KA 1YYNA 2ATFA 2OPWA 1AYN1 3IN9A 1AR61 2Y6KA 4FPJA 1SEFA 1PK6B 1GANA 2AEZA 3VD5A 4W50A 3NAPC 2HEVF 5FO7B 5LW9A 1HRI2 1ODNA 1POQA 1C8M2 3WF2A 1HXS2 4CCLA 4CP0A 4L11A 2KM2A 4QU1A 2AUYA 1Z0HA 1NXD1 3LPFA 4AZZA 4PLOA 1UYZA 4PCRA 1H2KA 1PNGA 2NPIA 3SEEA 4M0NA 1AVBA 1XE7A 3ILNA 4LOTA 3DPRB 1DGRN 3NNLA 1QY4A 2DBIA 2G9FA 2AR6A 4BQ4A 2AEYA 3OY8B 4ITCA 4FTBA 4FFIA 5FJHA 2AREA 3N4MA 4HG6B 2HWE1 5F1RA 3AKRA 3MDPA 4Q26A 5K8SA 3FHIB 5JPNB 3FE5A 2PMWB 2I2SA 4RS5B 2NMNA 4N43C 2J1TA 1JXNA 1TG7A 4Y33A 4N43A 5ABJB 1BK1A 4L8QA 2ZCWA 1DQ6A 3CBNA 2WN3A 5BYNA 4U36A 3V0AA 2WZR2 2DBNA 2PHDA 3LEGA 3ORJA 4TN7A 5KHKA 3BI3A 1CAXA 4BE3A 4ES9A 1ND3A 1GV9A 3WHUA 4L2NA 1R091 1RC6A 3ES1A 5A1AA 3BIWE 2B9VA 2WAOA 4RQPA 4LUMA 5JOXA 2XJPA 1JYVA 2VPVA 1O4YA 3K4ZA 1F4AA 1ASJ1 2D3SA 2YU1A 2WKKA 5FIXA 4OZOA 4NHLA 3RI8A 5FZ3A 3LDKA 1VBB3 1AUYA 2W91A 3GHMA 3E97A 3MHZA 4LK7A 4DO0A 4AEDB 5C5TA 1W6OA 4NRMA 1XE0A 2VVDA 3G7DA 1MZ6A 3GBWA 2CAUA 3WXPA 3IPVB 4K20A 5FAXA 2VNOA 3KLSA 1U5XA 2B39A 1EPWA 2CSGA 4Y1XA 1CX1A 1PVC2 1VBE3 4UYBA 2WQ8A 1ZBA1 4OQ9A 2ZGRA 2VQUA 3JZVA 4AHWA 2O8OA 5JMCA 1EAH2 1ZZBA 3EYPA 3LF7A 3LIHA 2N7GA 4XUPA 2G9GA 4FT8A 1SBDA 4UFJA 2D6NA 2QQIA 1C8M1 2V4VA 2ZGLA 4LA2A 3T2TA 3BODA 2P6CA 4AVCA 3AJZA 4EWEA 1ULFA 5LA1A 4D7YA 3RZHA 1AL0G 1D4M3 4F3JA 1L3JA 5C8CC 1YI9A 3NJZA 3WW4A 3FUQA 2CNAA 3POGA 3AP4A 3THDA 4FAGA 4HK8A 4LBMA 5DXDA 1LOAA 4BDVB 4KL1A 2JDKA 5GLWA 1RUH2 1ASJ2 1PMIA 5FP9A 4AG4A 4E27A 3RGBA 1RUJ1 5FBZA 3WDVA 5KC5A 2I07B 4OUMA 1FNYA 4EROA 5JSPA 4FBFA 2TEPA 5FQ0B 1N1YA 5HCBA 3VBHB 3ZN6B 1RUF2 1DZTA 3AP6A 3N7JA 1VJ2A 4MXWA 4MZUA 1IS6A 3ATGA 1RUOA 1GZ9A 1RXGA 1X82A 2XHNA 2Z42A 1QJZA 2JG8B 3A0NA 5C4WB 5KHIA 3UESA 1OLMA 1OPOA 3F2ZA 3LE0A 2ZEWA 4ISRA 4JRLA 5IUQA 5LY1A 3PVNA 4F8AA 2VCAA 1BMV1 5LWBA 4K3UA 4Y1YA 1GWKA 5LBBA 5FZKA 2YDEA 3W20A 5AC91 1SCRA 3AZVA 2OT7A 3AZZA 4AL9A 3QCWA 1TNRA 3OPZA 4Q5OA 3WLUA 4OHZA 2QQOA 2ID4A 4L97A 1K3IA 1W3XA 2GH2A 1CIWA 4BXFA 4EN8B 5JCTA 5B2GB 1AL23 1UIKA 2RDNA 2Y38A 2JIGA 1PIV1 5FY9A 2WNUB 5LB6A 4AGGA 1JU4A 1V6JA 2MNGA 4QDQA 1RUI3 2WS92 1EV12 1RJ7A 5AC92 1W9YA 1JYWA 4EN7B 3BOWA 2C0ZA 3VHNA 4FAHA 5JOWA 3ZSJA 4COUA 4URTA 4AK3A 1AR82 3PVEA 1J3PA 2VZ3A 4NUBA 1RUD2 2VOVA 3O1PA 3RFRA 1PMJX 3PVOA 5GJ6A 3N3HA 4AFCA 1OA3A 2GC2A 4G9SB 3U4SA 1AR72 2DFCA 3ZN4A 4LA3A 1HRI1 2K9ZA 1AJOA 1IHMA 1UZVA 4UFKA 2WO7A 2A3XA 1IG0A 1U5YA 3C7HA 4XTMA 2Y34A 3T09A 3WVJA 3QH7A 4LMFA 3WW3A 1NQJA 1DZRA 2WNVB 4MGYE 4M3CA 1RUJ2 2QBXA 3B5LB 1OXCA 1Z78A 2UU8A 5FXZA 4MV2A 3DYOA 3NV4A 5A80A 2BWAA 2QNKA 4CYDA 1S2EA 3GGLA 4GWIA 4UFLA 4BU2A 5BNOB 2J1EA 3R4SA 1PZ9A 4BLJA 3U10A 3ZMOA 1ZRDA 3J8F2 3R4DB 1UOFA 1DP0A 3DN7A 1W6OB 2GP3A 1FT9A 4YYOA 1JS9A 1RJ8A 4GIQA 2DU0A 3M3OA 1JZ3A 4QB1A 5FTTC 3V0BA 2R6QA 2VL4A 3HQXA 4GALA 2JG9A 5LA9A 2VOWA 2Y60A 4CP9A 3O0VA 1WLDA 1ULEA 5JSOA 1ZYBA 2CWMA 3ZYRA 3O7OA 1F5FA 2B5HA 4DRVA 3JXSA 4Q4V2 5D2AA 4UFHA 3BPZA 3OYWA 4P9IA 3L2YA 1RUE1 2E63A 3PUHA 3S7IA 1G86A 2W94A 4F83A 3RZKA 1C1FA 5A3PA 3FHAA 4EV0A 1XBFA 1YWKA 2G4IA 4B7KA 4XZUG 1NCRA 2OUHA 1GZWA 2OZJA 2XJTA 3I2DA 3I2IA 2D40A 2Z2SB 4R9CA 1Q8SA 4QX8A 4XUTA 3UGFA 2Y26A 3J7MA 1JHJA 5CFDB 5T55A 4ZY9A 1W05A 1W8FA 1W8OA 2J1SA 2ZKLA 3JD71 2XH6A 1XNCA 3I2KA 2IXJA 2NZ9A 2VMFA 3VBUC 1HKDA 1CGPA 1OSGA 1SDDB 1YFWA 4QB6A 2WO3A 1WGPA 2YPDA 2XPJA 3ETQA 5F2WA 3S5QA 3W5MA 3F95A 5FZ6A 4RFRB 4OHXA 4H7LA 5C3OA 4HONA 1W2AX 3J4UH 3V64A 3H8OA 1POV0 2Q1MA 3AMPA 4DXTA 2GU9A 2RDSA 1OI6A 2NLRA 1GP5A 1ENRA 4P5HA 1O8PA 3CNAA 4XMIA 5FZAA 5CIRA 1QJX1 2VY0A 1VMFA 3ZSEA 4BA6A 1IS5A 1PO21 1JTZX 5FUPA 3ZYGA 3LA7A 1H8VA 2BNOA 2XMLA 4AR2A 1QJX2 4LBKA 1POV3 3ILRA 1EUTA 1S2KA 4QPGA 4ZZ5A 3WQ0A 2OS2A 3M7AA 5ACA2 2P37A 2FQPA 4QB2A 1LU1A 4XXPA 4NVPA 3FFZA 2ZGUA 4LBQD 4AQ6A 1GZTA 2QQVA 3L9JT 1WBFA 5IVFA 2W5FA 2R062 1N47A 2R041 4JQRA 1VBD1 5HCFA 1YLLA 2QZ2A 4NHKA 2A5ZA 4MG2A 1LODA 1W9WA 1O4ZA 1SLAA 4B4PA 4XZPA 1H8TC 3DF0A 1EYBA 1R083 2GMPA 3K2OA 1US2A 3I2JA 5FPZA 3RSJA 1W28A 4L0PA 4DEVA 4YZ2A 4XYXA 3VZOA 4LHLA 2PXJA 1ND2B 5A6ZA 1SHWB 5A3OA 1UOBA 1J3QA 1XU1A 3RZGA 1UXXX 2W1WA 3A7QA 4LBQA 4XFIA 5GZDA 2WQZC 4EQVA 2XONA 3OBAA 1RUNA 2ZX0A 5DUUA 4JGZC 1AR83 2D97A 1Q8VA 3PUSA 5F5AA 4B29A 4A41A 4AQTA 2HWB1 2XGXA 2VMEA 3PTYA 1FI2A 4JGYB 2CDPA 5JXGA 4TYSA 2A6ZA 1UN1A 1W39A 2V73A 3AYAA 5DQ0A 2X29A 1RB8G 1FOD1 5I8YA 2UWBA 1O3TA 1OVPA 1ENQA 1HJGA 1PX3A 5F2SA 1DGRA 3HN1A 4FTSA 1W8ZA 4TXWA 2GP5A 4GMP3 4XQWA 5LATA 2JB4A 2ZABA 3WNOA 2PYTA 1PMHX 1TMF1 2P4EA 3FFQA 2VOXA 2XJSA 3KT7A 3FL7A 3O12A 2JIJA 1IS3A 5GKAC 1DGLA 4AWDA 2B9UA 1NA1A 2P17A 2WYSA 2YFUA 3FHQA 4J1WA 1VPHA 4OHWA 1NKGA 3W9AA 2GN7A 4YM3A 3FBYA 1VRH2 2AENA 2ET1A 2RJ2A 3RQ0A 1K12A 2B45X 3C7GA 2R071 1MPXA 2IVIB 3MLJA 3TN91 1AR62 3USUB 1W3VA 4BIFA 1QQP1 2W52A 1HRI3 4MX3A 4RR3C 3GHNA 5IWFA 1V9U1 2VW0A 5IVVA 3PUIA 4GWJA 1BXHA 2J7MA 4DINB 2JKBA 2I74A 5EPAA 2IXIA 3J8F1 2DUQA 4KNCA 5BY5A 1WWYA 1OC1A 1H8TA 5FZ0A 2HLEA 3RYKA 4TTGA 1H0BA 3LFIA 4AVSA 3O1UA 1MS4A 2FDIA 3B01A 5FDBA 4COVA 3GNEA 3HBZA 4MSVA 1GBGA 2RS31 4Q8KA 4GD4A 2BBAA 3EQEA 2W1UA 2DVAA 4V1PA 2VXJA 3MLKA 2RJKA 4L92A 4W6WA 5DG1A 1PO12 1SLTA 3G6JB 3CHXA 3Q8CA 3AMMA 5FKCA 2AGSA 4QX0A 2Y33A 3C3VA 3GBGA 4XF9A 1NOVA 3SC7X 2ZGPA 3U1XA 3O0XA 1LJ7A 3LEIA 4G3YC 3WF0A 4Y24A 1SLLA 1TMF3 3VDDB 3ZFEC 1AZDA 3OBTA 1W0PA 2RMU1 1DF0A 2LROA 4QX2A 5L73A 3AP7A 5L7OC 2E6VA 2WZEA 3RMYA 5L7OA 2PHUA 4XFCA 4ZS2A 4RYDA 1SACA 3UL2A 3VZMA 1C57A 4O7XA 1GICA 1FPN1 1X33A 1STMA 4YW2A 5FV3A 2LUWA 5C8CB 4LK6A 2Y6LA 3RI9A 1RUG3 3GCXA 1QQP3 2EIBA 2WDBA 2BVBA 1KEXA 4GZ9A 4AI1A 3ZIXA 4QD2A 4CP9B 5JMOA 3MW2A 2XB6C 2VBPA 3PL0A 4OI1A 1W2OA 3M3EA 2R0HA 5FPBA 4BISA 4QT6A 5EWSA 5AFBA 1PO13 2Y0IA 2EIDA 4Z92B 1S0DA 4NIHA 1DIWA 3LOIA 4EZHA 4QX1A 5JXIA 3KV6A 1XSQA 4GH4A 4IEYA 2PLV3 4AGRA 1MS9A 5CVRA 4XJAA 1X8MA 3GDBA 2RS51 4KH9A 4YFWA 1WZXA 2VUAA 3O14A 2R49A 5AFEA 4IUGA 4U2AA 1YHFA 2R16A 3UGGA 4XXAA 5JIUA 4CUBA 2BEOA 3ZLIA 3N9PA 4BOWA 4OUSA 4E2QA 1PK6C 1JZ6A 4LE4A 1HN1A 3ALQA 1EV11 3FC0A 2XOMA 3S0MA 3JB8A 1H2MA 5FYMA 2Q1ZB 1MQTB 2RJLA 2D93A 5F3GA 3VDAA 1JYNA 1VBC2 4UF0A 1VLNA 2ZOEB 5EIYB 3HWJA 4A3XA 4TLFA 1XYNA 2OX0A 4XVHA 4IEOA 3I7DA 4B3NA 4Q1PA 3ECQA 3N9OA 4NN0A 4IL7A 4JGZA 5A7WB 2W68A 2V5YA 2ZEZA 3DEMA 3O1VA 4WZFA 5KBFA 1DHKB 4AOCA 1PM4A 1REEA 2ET7A 4Y1VA 4LT5A 2WSVA 2HWF2 3M3IA 4FP3A 4Y4RA 2ZHMA 4ES8A 1G6NA 4KWKA 3GJAA 1JBCA 2DF7A 3K75B 4FFGA 5FY5A 1AX0A 4YVSB 3B9CA 2A6XA 2J1AA 1QJY2 3UJOA 4ASKA 1HIXA 4GA9A 1JYIA 1OKOA 4JKLA 1R093 2FMYA 1YQ2A 1RUJ3 2CHHA 1LEMA 2YC4A 4QPGB 4XPVA
chains in the Genus database with same CATH topology
3ZXKA 4S2GA 1HRV2 4HPKB 5JSRA 5IK4A 1PZ7A 1SLBA 2VNGA 3VHRA 4YW5A 1O3RA 4LO6B 3WX5A 4I09A 3URFA 2DUOA 3VBUB 3L2HA 1E57A 2QDNA 4IEZA 1MS0A 4NPRA 1MQTC 3SHRA 4W6XA 4CP2A 5BNOC 1VRH3 4QM8A 5JOYA 1UL9A 3O5SA 3IMNA 3D8CA 1SBEA 5D8AB 1FXZA 1FX5A 4N7IA 4CDWB 2X53S 1XU2A 3FLTA 4FCAA 4QGLA 1R092 2OW4A 4HETA 1CX4A 1QNWA 2HEWF 5CFCB 1AYM2 1ULGA 3J9SA 3AXDA 4BYYA 2W08A 1IKPA 4NHMA 4HK9A 3ZYPA 2O1QA 3V65A 1NCRB 1LGCA 3HIFA 3R6SA 3OF1A 3WP3A 4YW4A 1CAVB 3SCFA 2D44A 2Q5TA 1AXKA 2DCJA 1NCQB 3SNMA 5FOJB 1LHWA 4DB5A 2ZKNA 3TOJA 1LHVA 5T3NA 1V6OA 1QDOA 1MVQA 2FMDA 3PNAA 4QPIC 4AW7A 4Y1UA 1ND2C 3J26N 4YGBA 3VZNA 4K1ZA 2H6BA 5TSWA 1GNHA 4CTEA 4CZSA 1VRH1 3WW1A 4Q2FA 2XG3A 4K21A 4HFSA 3EHKA 3VKOA 5K0UB 4PIZA 4ONUA 3WP6A 3ZO0B 2CL2A 4BLIA 4Q4X1 1VBE1 1SMVA 1TE1B 4YRDA 3WP5A 4HN1A 5GLVA 1GYKA 3IT8A 5L7OB 4S2FA 5DZGA 2K2SA 1ZVFA 4Q8LA 2IXCA 4HSJA 1YJLA 1LHOA 1PGSA 4DRRA 3EBRA 3MYXA 5E16A 4XETA 4UXAA 5JAXA 3AKQA 3MI8A 2XKPA 5CB7A 3VBSC 2E7TA 5ABJC 3W59A 4HKLA 1AYM1 2VGDA 4NR1A 4PBPA 4CEWC 4RGGA 2XKOA 5DG2A 2C1FA 3LA3A 4N53A 1LR5A 1RMU1 4R9DA 2RS53 3WNXA 2ZZQA 2HWC3 5JIAA 3VBOA 5IK5A 3U0ZA 2WWSA 1AJKA 1YRZA 4CDUB 4D69A 1DQ0A 2DVDA 1VP6A 2ZA9A 4JGZB 2VW1A 4MYEA 1KQRA 3NVCA 3MFCA 2E9QA 2RS13 4XBQA 2PHLA 4XJ9A 3NWKA 3AK0A 3ZFFA 3UJQA 1RUH1 4IV3A 1BEV3 4C90A 5GLTA 2YV8A 5KC6A 2XVKA 3CLPA 5H9QA 5GZEA 3TWIA 1YI7A 3WINE 2JG9B 2IXHA 1OPMA 1XXNA 3LA2A 1MZEA 2XL9A 4FPYA 3LSEA 1U0AA 4Y1ZA 2CYFA 1AYN2 5JZGC 4N43B 4Z1VA 4YFZA 3POWA 4IEVA 3V0AB 1XNKA 1J58A 4M01A 3SCHA 1IZ3A 3NO8A 4IV1B 2HWD3 1RUE3 2ZZJA 4AI2A 2CTVA 4BWOA 1RVF2 5DZFA 2NP0A 1DQ2A 3KMHA 1H2LA 4GB31 4PBOA 1QKQA 2UY9A 3WG1A 1LKNA 4XBNA 1ZNPA 2B46X 3H3UA 5BNNB 4A2UA 4LNVA 2EXIA 1O3QA 1QGLA 2KXLA 1YJKA 4Q29A 1F9KA 3QH6A 4JGYC 3MPPG 1WLTA 1TME3 1UAIA 3KSCA 1G9AA 4FSJA 1BKZA 5CFCA 2VMGA 1DYPA 2GH8A 2WFF3 2WZR1 2D6OX 2XLAA 2OZ6A 4FPEA 1HQNA 1GR3A 1LCLA 1BEV1 3I4IA 3BCWA 2XBO3 1C3HA 3DGTA 1LRHA 1QJY3 5J98B 1C8M3 1V9U2 1OOPA 1GQGA 1LHUA 1TNFA 2QCSB 2XLGA 1UU5A 3IWZA 4NO4A 3VDDC 3ZFEB 1ZX5A 4FQZA 4ATFA 3H9AA 4A7KA 1NCRC 4P9GA 2QZ3A 2WNEA 2RS52 2RS12 4Q1RA 4ASMB 5J09A 3VZKA 1TME2 4AEDA 4PQ9A 2DFBA 3AP9A 2EALA 3HD8B 1UCXA 5CU1A 1KJRA 3ZFGA 1H1MA 4AHXA 3WD5A 4GQ7A 3TNQA 5FREA 3AYCA 3IIAA 3OY8A 1R081 1BBT2 1FOD2 2DTWA 5GLZA 1WCDJ 3FZ3A 2BWCA 4COZA 1APNA 5JPMB 1AX1A 4MUVA 4CDUC 2WLPA 1FPN2 2ZX1A 5A32A 2BFUL 3NKGA 4JV4A 4PDWB 4E4DX 5AC93 1QH7A 2H0BA 1WD4A 5GZGA 2ARXA 2PFWA 5HCAA 1ENSA 3A4UA 4FVVA 3D82A 1MZFA 4YG3A 1NY71 2UYAA 4AVTA 2A7AA 1V6NA 2V09A 1R1ZA 4FPKA 1MQTA 5GM0A 2NQYA 4SBVA 3WW2A 4MVTA 2HJIA 2ERFA 3WQ1A 4E4ZA 3ZXLA 4GMP1 4JVAA 4YVWA 4AF9A 3H8UA 5LEJA 1G7YA 3WG3A 4LULA 3X29B 3R4UA 4AYUA 5HBAA 1PZ8A 4H14A 2VMIA 4DNYA 3EO6A 1COV2 3RJ2X 5A3LA 1ND3C 1NLSA 5DDJ2 4YG6A 4Y26A 3JBG3 1VR3A 3RWNA 3ZX7A 4B7EA 2VQAA 1CD3G 2JD4A 1ALYA 2D3RA 3QBQA 5CA6A 2QE3A 2DWRA 1VBA1 4YW3A 3VBRA 5FPXA 5I0RA 1UKRA 5FOBB 1SFYA 2RE9A 3VGIA 2WNVC 4M3CB 4IV3B 1QXRA 4XF0A 2C9AA 4L9BA 4IEQA 4YM2A 2GZWA 3VBFA 4TWTA 4P9JA 4D3WA 3D4KA 3MF6A 3S7EA 5CBLA 4JC1A 4CEYC 1ZBA2 5ABJA 2B7YA 4CDXC 2VUJA 3GYDA 3LSDA 4K8FA 4LR4A 3UKTA 2YGLA 2H0VA 1LOFA 1LOFC 2QKDA 1JOJA 5DUXA 2UY8A 1RMU2 1WD3A 1XQNA 3N7MA 4W65A 2PA7A 5CFCC 2P3KA 4YNIA 1SLCA 4EN0A 4BCUA 4BMBA 4I01A 1LOEA 5DUVA 4YLZA 1QMJA 4Y20B 3KGLA 4XJ8A 4LEJA 3MIFA 3N7KA 3TAYA 4B8EA 2R073 1ULCA 1RUI2 2FZ1A 4GB33 5CG9A 3JBG1 1LHNA 2LTNA 2ETEA 2BQPA 3WUCA 5BV6A 3FLRA 1Z7S1 3C2UA 3B7MA 4LLFA 3I8TA 1VBA3 5KWRA 1RUF1 2YHJA 1VBC1 1NCQC 3ZFFC 5BNPB 5BNNA 4IV3C 3MW4A 2JE9A 5FMOS 2RM23 1RINA 3RRDA 3AFKA 1I5ZA 3KCYA 1VBE2 1BEV2 4Y4YA 1VBD2 1HV0A 2HWE2 2O0OA 2PHWA 2TBVA 1UF2C 2CGNA 1FMD3 1HV1A 1RUE2 1IS4A 3D6EA 2WNVA 1NYWA 3FJSA 3M8LA 2KA3A 3WG4A 2CWSA 5FRAA 3VBOC 3SXWA 4AQ2A 4O9EA 1AYN3 3SH5A 1F5JA 5FO9B 2ZHKA 1S0GA 3KCCA 3NSTA 4L99A 5BXXA 2BGCA 3VKMA 4IEUA 2GNDA 3H1MA 1POV1 2ILMA 2CY6A 4GWMA 1W6PB 1W6NB 5LRRA 4CDUA 1LOCA 4GMP0 2R1DA 3JBG2 3U07A 1CONA 4OFGA 3NV3A 4Z8BA 1EY2A 1VAKA 2YZ4A 4FXGB 4YGCA 3UK9A 2R0FA 2RR13 1YIPA 2ZAAA 3ELNA 1GKBA 2SBAA 5L19A 4Y22B 3LWCA 5CG8A 2W0XA 2DCKA 2RS32 2HWE3 3MIBA 2OYZA 2EXKA 4M3CF 4DPNA 4GH4C 5E8AA 1I9RA 2BBVA 3MGUA 3ST7A 1AR71 1M06G 3CL1A 4DY5A 2PAEA 5H9SA 4KG0A 4XW3A 2RM21 2PLV2 4QPIB 4WM8A 1V6MA 2JG8C 2PLV1 1S0IA 4WZCA 3WCRA 4K9SA 4LBQB 1AR81 2D6LX 5BNNC 1MS3A 2FBEA 1S2BA 4ASLA 1QH6A 1GFF2 1IKQA 1M4WA 2XWBB 4J6GA 3RJRA 4XIOA 1U12A 1WLWA 4KQ7A 2ARBA 3VBHA 3HAGA 2GMEA 1PGW1 1S1AA 2YXSA 3N35A 4XDQA 4FTEA 3WHTA 1S55A 5JDBA 1RUC1 3H50A 2NN8A 1WLCA 2BNMA 2ZGMA 1DG6A 1ZBA3 2ZGSA 2WQ4A 1BMV2 4CDQB 1DFQA 3JQWA 1N3QA 4X8NA 4Y20A 3M3CA 2ENRA 4RQPB 3DL3A 4OVEA 1WW4A 4AXOA 4YGEA 5LK5A 3KGZA 3HMYA 4N53B 2DU1A 2ZX4A 1AR92 2ZACA 3NV1A 5T5LA 1CAVA 2IC1A 5ACA1 1BVVA 3PHMA 4UBGA 1W6NA 1DU3D 1H8TB 1Y43B 1NZCA 4JTOA 4I0WB 4WVZA 4XJZA 3SISA 1Y9QA 3GALA 2IFRA 3TNPB 1N1VA 3VBFB 3INAA 1TQ5A 3E6CC 2K0GA 5T54A 2ZGOA 2EAKA 1COV3 1I3HA 2XHKA 1LTEA 2BFUS 1BYHA 4I0BA 2GN3A 4HZFA 1C4RA 1NG0A 2A71A 1ZZ7A 4BM8A 5I8TA 1CJPA 2RR12 1F2NA 1RHI3 5CAZA 1OLQA 4KWLA 1W6PA 3E5XA 3I54A 4XTPA 4WM7A 4R9BA 4XHBA 1QJU2 2RMU3 1YFYA 3APBA 4GWNA 3RDIA 3WP4A 2EVXA 1K5MA 3VL9A 3OYWB 5L36A 2JE7A 1WMFA 2GALA 1LULA 3QOPA 4HVQA 1D4M1 2YY1A 1UD1A 1UW8A 3ACLA 5JR7B 5IK7A 4JAAA 5I0TA 1UU4A 3KQRA 1LENA 2UWAA 4DOUA 2GC3A 3ZDSA 1JHNA 1H1IA 1H4HA 2HWD1 1RTVA 1V00A 2EA7A 4QPIA 3IM0A 3CEWA 2TNFA 5DDJ3 1REDA 3VDDA 4AI0A 5A33B 5J37A 1DZQA 1ZRRA 1OQEA 4WV8A 3FMGA 3THTA 3GBFA 4ATEA 4UW3A 2GSYA 4YSFA 4AEMA 4BHPA 5C4WC 3MEPA 3DV8A 4OLLA 2XJQA 1PGL1 2E53A 4W6YA 3WY6A 1AR63 5KXDA 2QUOA 3ZYJB 5H9PA 1RVF3 4AEDC 1PGL2 2XVGA 2F6BA 2HWF3 4MLOA 1H30A 4K6BA 1G9DA 3ZYIB 1GLHA 1ULDA 1X36A 4E2SA 4AFMA 2A6WA 1ZBE3 4ZU4A 4GB32 4A7YA 1N1SA 3GZTB 3MW3A 1RUH3 1QHDA 4BQ1A 2YGMA 4B4RA 4XE9A 3QACA 4LO8A 3VKFC 3TRSB 4CEWA 3USSA 4CDWA 4D94A 5DZEA 1ZM1A 4LTAA 2XWJB 4HVOA 4RS5C 5C9AB 2D98A 3K51A 1B35C 2GC0A 1RUD3 3CJIB 1G9BA 1FMD2 2DTYA 1LOBA 1OOPB 1QXPA 1QJU3 2RMU2 3ZFEA 1A6CA 1TMF2 3FWEA 4GXLA 2Q30A 3TYJA 1YXWA 4XQDA 4Q4X2 1OLRA 5EV7A 2HWC1 4AHYA 5F9TA 4OI2A 2DCYA 1G9CA 1RUG2 3RYPA 4B4QA 4AVBA 1IOAA 4M0HA 1A3KA 4XBLA 4RHV2 3PJYA 3FUOA 4YVSA 4P9LA 3VKLA 2VW2A 1KS5A 3AYDA 4QGNA 2YC0A 3PJQA 1OHFA 3H0OA 2RS11 5JI9A 3WDXA 2P2KA 4K1YA 2JJ6A 1QU0A 4PDWC 4A7ZA 1HLCA 1C8NA 2JECA 1D4VB 1WW6A 2WL1A 1NQDA 5JZGA 1OKQA 4MGZE 1MS1A 1WA4A 2XBO1 1WW5A 5F6LB 4COYA 4LO7A 3ZXDA 1N1TA 2PHFA 2ZGTA 4H3WA 3AFGA 1ONAA 1GZWB 5EJ3A 4G4FA 3SH4A 4C1WA 3KT4A 3PMSA 4CEYA 4OI0A 1YFXA 2XLFA 3KS7A 1OQDA 1Q56A 1FAYA 2WNUA 3S30A 4WBBA 2JX9A 4SLIA 4JRAA 1QOOA 1Y3TA 2Z5WA 4NWWA 1XYPA 4CDQA 2PAMA 1S0JA 2WA4A 1ZZ9A 3IPVA 4Q4W3 4Q0UA 1ZA4A 3JD73 3AXEA 3TN92 3SMHA 3GZAA 4XFAA 2R072 3KT1A 1VALA 2R061 4I3GA 4FOQA 5FLIA 1RIRA 4H55A 1BBT3 3WT3A 3B3QE 5FCCA 4CDXB 1U5ZA 2OA2A 1IPJA 2QQPA 3KM5A 3H1WA 3MFAA 4WVMB 1D0GA 4YZ5A 3HT1A 3OJBA 1YO8A 5J7MA 1NCQA 3OCPA 2GNMA 1HRV3 1H9PA 4HN0A 4I3PA 4WVVA 4CEYB 1VBA2 1NXMA 2PHXA 1PO23 2WIIB 2W39A 3PVBB 1G8WA 4KGGA 1EP0A 2ZX3A 1ZZCA 2FHRA 2Z69A 1SQ4A 2EXJA 3ZFGC 1VB4A 3E6DA 1C5IA 4YZ1A 3IDCB 4XJWA 3E5UA 3WDYA 1AYM3 2X8KA 2E51A 2Q0AA 1RHI2 3U11A 1MEC3 3WV6A 2WSUA 5J96B 1RMU3 2PN5A 5GLUA 1OFNA 2D6MA 1WMEA 2GNTA 3JQXA 3N7LA 1GQHA 4LHNA 1AF9A 1VBC3 2ZMNA 3JB4C 1MVEA 3WCSA 1FV3A 5DUWA 5FLJA 4AVAA 3EXUA 1XRUA 3NL1A 4AFBA 4C1XA 1K5MB 4YG0A 5BNOA 2QVSB 4Q4V1 3E6BA 3ENRA 3LAGA 1HRV1 4Z2WA 1Y7BA 1BZWA 4AI8A 4AEKA 1V6KA 2O8QA 3ZN6A 2NYYA 4F7ZA 4I02A 4I0AA 1SFNA 1QNYA 1G9FA 2GC1A 4LBJA 4Y22A 4EWDA 2EF6A 3KCXA 3MF9A 3OTFA 3SLIA 3P3PA 4Y5Z0 5KXCA 1RUD1 4CP1A 5C9AC 1LB2A 2DCZA 2X5IB 3RPQA 2WFF2 2JENA 1CVNA 5JVVA 4EN9B 2DVFA 4LBLA 1X7NA 1KJLA 4I2OA 1NLRA 1H2NA 2VVFA 3M70A 1UKGA 2BVVA 2P34A 2FZ2A 1PGW2 1GNZA 5T5JA 3VHOA 3P3NA 1NY72 1D0HA 1AL22 2ZBJA 4CRQA 4MXVA 3MLLA 4AI3A 3OGGA 2AYHA 1KD7A 3CF6E 1HDKA 5BPXA 3ZXFA 1DGWX 3KD4A 1DQ1A 1PVXA 1RUC2 1XNBA 4PIXA 4CDXA 2A3WA 1NA1C 4UW5A 3VUOA 4AVVA 3LB9A 4IV1A 4LBNA 4RGAA 4AE2A 2ZMKA 4MGKE 4Z07A 2WS91 3NW4A 1AR91 5I93A 3H7YA 4WM7B 2WJSA 4EN6B 1C28A 1HQLA 5C4WA 5C6CA 2PELA 3AZYA 1QJX3 5HI0A 3M1HA 4RR3A 3OBRA 1YFUA 3E5QA 4P9YA 4XF1A 3JCIA 4XFGA 3T1MA 3S6PA 1URXA 1BJQA 3AYEA 1JN2P 1SBFA 2X5IC 4LO4B 2XL7A 4QU2A 4WM8C 4JDOA 4HLTA 2WT0A 2PHTA 4PJYA 1W0OA 4X6RB 3POSA 4FPHA 2DVBA 4IERA 1B35B 5A33A 1S0FA 4HMZA 1KS4A 4Q4W1 4XFBA 5KHHA 2MHFA 4N53C 3TBDA 4PDWA 3VBHC 1ENXA 4QQOA 1O5UA 2IXKA 3U4XA 5E89A 5ACA3 3ZIWA 1W6MA 3B94A 5HXVA 1B09A 1VAMA 4R4ZA 1OA4A 3GZUC 3AB0A 1V6LA 5KXEA 1WCSA 4FQ4A 4C91A 3THPA 1O3SA 1Q8OA 4K7JA 4WVMA 1I1EA 5T52A 1SCSA 4HKWA 5FFOC 1REFA 5AVAA 1PIV2 3ASIA 4FOVA 2IXLA 1Z7S2 1YNAA 2B8MA 3M4FA 1RUC3 1PM7A 2BUKA 2LM3A 1OMIA 3VLBB 1NE6A 4OULA 3DUIA 2MEV2 4N90A 2JG9C 1V70A 4YVWB 3ZFGB 3AKTA 2UURA 4PIYA 4Q0VA 5K0UA 4AQSA 3LKJA 1ZRFA 2A73B 3MIHA 4CEWB 4S2DA 2ZGQA 4XJUA 2D7FA 1QF3A 1OOPC 4KWJA 4DMIA 1CAUA 1FV2A 1XE8A 1U5IA 4Q4Y1 4FPOB 1X50A 2EAAA 2WFPA 5CFDC 2XUMA 2D6PA 3ZFFB 5BNPC 1WCKA 4X8PA 3OGJA 1Q5OA 4IEPA 1V6IA 1GSLA 2YYOA 1O5LA 1K5MC 4FPLA 1YUDA 4Q4W2 1RGSA 3LCPA 1C1LA 2VOKA 2GMMA 1COV1 1VIWB 2MEV1 3JU9A 1I6XA 1H1AA 3AX4A 4LE3A 5A32B 4PF5A 4DFSA 2D5HA 2RHPA 1JUHA 4IESA 1Q43A 2F4PA 3D0SA 3B93A 4AFDA 2EIGA 2P3IA 2A3YA 1UPSA 1IGOA 3ZXGA 5H9RA 4H7MA 1HW5A 1QQP2 3FX3A 4GULA 2UYBA 1PIV3 3MPBA 3WZ1A 2YPJA 3TB0A 4ISQA 4KU8A 4DY3A 1RUG1 2P3JA 5J48A 1WBLA 2XVLA 1DGWA 3LGRA 4ORFA 3WG2A 2WA3A 3BOPA 3PMEA 2PQQA 4Q0PA 4JDNA 2OUJA 1SDWA 4M00A 3FBMA 5K9YA 4YW1A 1XYOA 1QJU1 3CJIC 1PO11 5SV5A 4AGVA 4EJRA 3VZLA 1AX2A 2JG8A 4LUKA 4XIKA 4WVWA 1CAWA 2Q8OA 5JLVA 4N7UA 3IDEA 2A6YA 1KFXL 1MR5A 2CGOA 3ZSKA 1NA1B 4META 5T50A 1KXGA 3AZWA 4GKXA 1VBB1 1AR93 4ZKTB 2LALA 4JTNA 2A70A 2A75A 2MEV3 1EV13 4WM7C 5KXBA 1H4GA 2OPKA 2AZ5A 1S0CA 3UKVA 4XF4A 1Q8QA 4ZXKA 1LOGA 3AMNA 4D7TA 4Q4X3 1A78A 4XEZA 1UU6A 4RD7A 2CAVA 3POYA 2PHRA 2BW8A 5T5PA 3I59B 1C5HA 3LZZA 1FATA 2ZHNA 1ZREA 2XJUA 4RA0A 4YVWC 2IWGB 1J59A 3R0RA 2D6KA 5EFUA 4RHV3 1ND2A 1YIFA 3NV2A 1VB2A 3O0WA 3VBSB 3NAPA 3H1YA 1JH5A 4PLMA 3M2MA 4GH4B 2HYKA 2NM1A 1R082 3N36A 4COWA 2HEYF 1ND3B 1YCIA 1GZCA 4O9GA 4J1XA 1AXZA 5C33A 5KHGA 3WDUA 4YM0A 4KG8A 3SITA 2R1BA 3USUA 4HPKA 5E1RA 1W2UA 1ASJ3 4P9WA