2CV6A

Crystal structure of 8salpha globulin, the major seed storage protein of mungbean
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
397
structure length
366
Chain Sequence
SVSRGKNNPFYFNSDRWFHTLFRNQFGHLRVLQRFDQRSKQMQNLENYRVVEFNSKPNTLLLPHHADADFLLVVLNGRAVLTLVNPDGRDSNILEQGHAQKIPAGTTFFLVNPDDEENLRIIKLAVPVNNPHRFQDFFLSSTEAQQSYLQGFSKNILEASFDSDIKEISRVLFGSQQEGVIVELKREQIRELTKHADQPFNLRNQKPIYSNKLGRWFEITPEKNPQLRDLDMFIRSVDMKEGSLLLPHYNSKAIVILVINEGKANIELVGQREESWEVQRYRAELSEDDVFIIPATYPVAINATSNLNFFAFGINAENNQRNFLAGEKDNVISEIPTEVLDVTFPASGEKVQKLIKKQSESQFVDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of 8Salpha globulin, the major seed storage protein of mung bean.
pubmed doi rcsb
source organism Vigna radiata
molecule tags Plant protein
molecule keywords Seed storage protein
total genus 89
structure length 366
sequence length 397
ec nomenclature
pdb deposition date 2005-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00190 Cupin_1 Cupin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2cv6A02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2cv6A01
4LULA 2MPFA 4Z82A 4HVOA 3IDCB 1G6NA 3LA3A 1ZRCA 1LRHA 3D82A 1X7NA 1UD1A 3FZ3A 1JUHA 3RPQA 3WW1A 4J1WA 3RNSA 3I54A 2FQPA 2GU9A 2IXIA 4O9EA 1O3QA 2WC2A 4IEOA 4ZU7A 3MDPA 1X8MA 4E2QA 1GQHA 3IBMA 4X6QB 3H9AA 5FLHA 4HVQA 2KXLA 3H1MA 3PNAA 4E2GA 5BY5A 5EZWA 4OLLA 2PYTA 3ZDSA 1ZZ7A 1YLLA 1X8EA 3E6DA 4Q29A 2CAVA 3JZVA 4IEPA 2PHDA 4LEJA 3ELNA 2ZKLA 3BU7A 3KMHA 4QMAA 1O3SA 3HIFA 4XFIA 3CF6E 3H1YA 2XGXA 1ZRRA 2HKXA 5KBFA 4LA3A 1RL3A 3IWZA 2QDRA 4WBBA 2V09A 3I59B 4QX5A 2IXCA 2PTMA 2XLFA 4E2SA 1RTVA 1WGPA 5JR7B 5FQ0A 3S0MA 5C6CA 5FPXA 2B5HA 2E9QA 4UBHA 2OZJA 1PM7A 1IPKA 4AXOA 2B9UA 2CAUA 4OFGA 4LA2A 3BALA 1Y9QA 4IEXA 3VHRA 2EAAA 1OMIA 4IEYA 2VQAA 3LOIA 3H7JA 2PQQA 3U0ZA 4JTNA 3NVCA 5CU1A 2ZCWA 4K8FA 4L11A 1DGWA 3TNQA 5JSOA 3DV8A 1SQ4A 3FWEA 2Q0AA 1OFNA 3U11A 4PIZA 3SCGA 5BV6A 5E16A 4EWEA 4IEWA 4IEZA 3U10A 5AVPA 4X6RB 4R8HA 2O8QA 2OZ6A 1O7FA 5FCCA 5HI0A 2ET7A 4KU8A 3OTFA 5JSRA 2VPVA 1XE8A 2F4PA 3NJZA 5KHKA 4QGMA 3CO2A 3RYKA 3OF1A 1UIKA 1O3TA 4XETA 1YFYA 1CAXA 2UY8A 2GC3A 3E6CC 3IDBB 2UYBA 1H1MA 4HVRA 1YUDA 1Q43A 3H3ZA 5CVRA 4CYDA 4EROA 1HW5A 4XFBA 3R6SA 3ACLA 1FI2A 4MGYE 1NXMA 5F1RA 2GAUA 2UY9A 3E97A 2ETEA 1ZRDA 4MX3A 4JTOA 3WW2A 1CAXB 3H3UA 4XFGA 1QWRA 4MGIE 2BGCA 2C0ZA 3FHIB 3MZHA 4LUMA 4XF4A 4Q0PA 2DCTA 1ZZ8A 5LRSA 3LA2A 4QM9A 5I93A 4I3PA 1Q3EA 1ZZ6A 5I8YA 4EV0A 4Q0SA 1LB2A 4IETA 3RDIA 1O3RA 3EBRA 1CAVA 1NZCA 1QY4A 2HJIA 1J3PA 4YRDA 3DL3A 4XF9A 4IEQA 4ONUA 1RGSA 1UCXA 4O9GA 1J1LA 4QGLA 1VP6A 1X82A 1QXRA 1SEFA 4I0BA 4MGKE 1ZREA 2PA7A 4I01A 2IXKA 5BUVA 1J58A 4AQ6A 5I0RA 3H7YA 1GQGA 2GZWA 4N9IA 4XF3A 2PHLA 2OA2A 2OPKA 5I0UA 3CL1A 3PLQA 5J3UA 2P17A 1FT9A 3H8UA 1UPIA 3D0JA 1EP0A 1O4TA 4KL1A 3B02A 3EO6A 4HN1A 4B29A 2QNKA 5CADA 1CAWA 1LKNA 2XHKA 1IPJA 3E5QA 5KHJA 3HQXA 1EY2A 3E6BA 2GC2A 2Q30A 1RC6A 3CLPA 3OGJA 2D5HA 2XL7A 4META 4KU7A 2QVSB 4QM8A 3NSTA 4FT8A 4D7TA 3S7IA 3SCHA 2K0GA 2MNGA 3L2HA 3BB6A 2CGPA 2XL9A 1QXJA 1DZTA 5JSPA 3FE5A 2B8MA 4PIXA 4XFHA 5I91A 3LZZA 3FX3A 4XF0A 1XRUA 4PIYA 4AVCA 4A2UA 1OD5A 3SXWA 3NL1A 5K8SA 2BNMA 3WW4A 5KHHA 3C3VA 4Q0QA 4XFAA 3CJXA 3LA7A 4FAGA 4LLOA 2D93A 1DGRA 2O1QA 3QOPA 1WLTA 4XFCA 4XFFA 4MZUA 2N7GA 4HBNA 4Q0VA 4QXKA 3ETQA 1UW8A 4MGZE 2BEOA 3HT2A 1CAUA 4IEUA 1YWKA 3UKNA 4MV2A 1WA4A 4J1XA 1I5ZA 4EWAA 3LAGA 4F8AA 4IEVA 5FPZA 5I0TA 1YFXA 5D1IA 3IIAA 2CV6A 3EHKA 4MH0E 4BHPA 3M70A 1CGPA 1YFUA 4YYOA 2Q4SA 2WFPA 3I7DA 4PJYA 4F7ZA 1PMIA 1CAUB 1V70A 2UYAA 4YSFA 1VJ2A 2H6BA 3KGZA 1O5LA 4BIFA 3NKTA 1RUOA 3CEWA 2OYZA 2VECA 4D7SA 4Q0UA 1LR5A 4L2NA 3E5XA 4WZCA 4TLFA 2IC1A 3EQEA 2GC0A 3ES1A 3FFQA 4KWLA 4BH9A 2Y0OA 3HT1A 5E1RA 3TNPB 5LEKA 3I59A 3DN7A 4MUVA 4JV4A 3ST7A 5FQ0B 1Y3TA 4IERA 5KHGA 4P9GA 1Q5OA 4I02A 3KCCA 1I6XA 4RD7A 1YFWA 3H50A 3E5UA 1SFNA 4YNIA 2Q1ZB 4AVAA 3UKVA 4I0AA 3MPBA 4LTAA 5FDBA 2EVXA 5LEJA 5I0SA 4NVPA 3LWCA 1FXZA 2XLAA 2XKPA 2K9ZA 1TQ5A 2Z69A 4I2OA 2ET1A 1RUNA 5EFUA 2QCSB 2D40A 5T3NA 4R52A 3ROUA 2D5FA 4HSLA 4HN0A 2PAKA 1EPZA 5I8SA 4HZFA 4BYYA 1O5UA 1EYBA 3EJKA 3DKWA 1ZZ9A 4HMZA 2H0VA 4H7LA 3USSA 3SHRA 4HLTA 4HSJA 2BNOA 4UXAA 3QACA 1CAVB 4Z07A 1ZRFA 2MHFA 5FLIA 1J3QA 4FAHA 3FJSA 1OI6A 3SCFA 3BPZA 1ZZBA 5C8WA 5J48A 3H1WA 4N9HA 3KSCA 4LUKA 4WVZA 1J3RA 3OCPA 2XLGA 2H6CA 4ZU5A 1H1IA 3RZZA 4AQ2A 3KGLA 4FBFA 4YARA 2QJVA 4XEZA 3S7EA 1J59A 3NW4A 3N4MA 3RYRA 2GC1A 1ZNPA 1NYWA 4I09A 5KHIA 5BXXA 5JAXA 4UBGA 1CAWB 3O14A 3SMHA 2GH2A 1ZX5A 4GULA 2EA7A 1NE4A 4EWDA 3MYXA 3ES4A 2Z2SB 2I45A 3UKTA 3M3IA 3OD0A 2PFWA 4QGNA 2BNNA 1ZZCA 1VR3A 5J7MA 1DZRA 2IXJA 1CX4A 1L3JA 1XE7A 1U12A 2BYVE 4AVBA 2IXLA 5LRRA 5FLJA 3GYDA 2PAMA 3PVBB 4KWJA 5BPXA 3WW3A 4XF1A 4DINB 2ATFA 1ZVFA 4IESA 1UIJA 4JVAA 2XKOA 3GBFA 3BCWA 3RYPA 4KWKA 1NE6A 3D0SA 4ORFA 5JCTA 4ZU4A 2FMYA 3G7DA 2PAEA 2IXHA 5I8TA 1YHFA
chains in the Genus database with same CATH superfamily
1GOHA 1RVF1 2XBO1 2MPFA 1MZ5A 1JYTA 4L97A 2WKKA 1HRV1 1WMXA 3TEYA 3WNKA 5JXIA 1HDKA 2ZGMA 3W58A 2HWF3 4KWUA 3KD4A 1O59A 4K6BA 3RFRA 4AYUA 1K45A 1ZRCA 4Z1VA 4XXAA 2EIBA 1AYM1 3FZ3A 1NLSA 4N53B 4WVWA 4Y5Z0 1P8JA 4BPZA 4J1WA 2ADEA 1MQTC 4IV1C 1VBE2 4AVTA 4Q4X3 1V6IA 4DIQA 2Y34A 3NV3A 1KDMA 2I74A 3MV11 1O6UA 2WN3A 3M8LA 3DECA 4PF1A 1LOBA 3CDZB 3H9AA 4RS5B 1UX7A 2KXLA 2VUCA 5CBLA 1M4WA 5FYCA 1JW6A 4QU1A 5FZAA 5FO7B 4E2GA 4QHBA 2XVKA 5EZWA 4LIUA 5BY5A 2X5IA 5FXVA 2DVAA 4Y1XA 5FV3A 4OLLA 3MW3A 1ZZ7A 1BQPA 2JDHA 2V5DA 3IAPA 3P6BA 1N3OA 4HANA 4A6SA 4BDVB 2Z42A 4LEJA 1JZ5A 1HXS2 3ELNA 3OGVA 4RQPB 4CCMA 1MZ6A 4FXKB 2A3WA 3PU3A 1E5SA 1MVEA 2QFEA 1CESA 2D97A 2NM1A 3O1SA 1JS9A 3VZOA 1W04A 1RL3A 4C1WA 4P9IA 3V0AA 3IWZA 2ENRA 1QQP2 1W9WA 2CWMA 5F6LB 3VUOA 5IATA 1U5IA 2IXCA 1D2QA 3AXEA 3GDBA 2XLFA 3POEA 5KC5A 1RTVA 4PLMA 3AYCA 2P2KA 3RWNA 4LKEA 4XAEA 4F83A 2LM3A 1WD3A 1AR81 1HJGA 3I2GA 2DCJA 1JODA 3GCWA 2CDPA 1J83A 1YQ8A 3OPTA 2RS11 3BYWA 4UBHA 3I2KA 2CDOA 4QPGB 3T30A 4CEYB 3WDUA 2R071 1PM7A 1VIWB 3B69A 1RVF3 2XBO3 3VKLA 5FZ6A 5A6YA 3NAPB 2BP6A 1B35A 1MQTB 3OOXA 1HRV3 4IEXA 1LEMA 3K48A 3RZGA 1RUE1 2YROA 4PCRA 5EQUA 4D0QA 3UT0A 4XJAA 1QQP3 1XC6A 3S30A 1RUD1 2WJSA 2VCCA 2WL1A 3JXSA 3LOIA 3H7JA 4KBBA 5CFCC 2VMFA 3UV9A 4OHWA 2W91A 4IV1A 5FZ8A 3T09A 5JSOA 4D94A 1RUI1 3GCXA 1UAIA 3T1MA 1CQ9A 1GKBA 1YIFA 2UURA 2VMHA 1GYKA 3CBNA 1V6KA 4YZ3A 2Q0AA 4BCUA 2HEYF 2VUAA 1OFNA 5A32A 5DUVA 4ZKTB 1HXS3 4Q26A 4DRRA 3I3QA 3I97A 3CJIA 2JIJA 2VNRA 4EWEA 2PQSA 2BBVA 1RUD2 1UPSA 3M7AA 1OT5A 2O8QA 3KQ4B 5EJ1B 4NIAA 4AGGA 4Z92B 3FFZA 3VV1A 1R64A 1VBE3 1VBA1 2RV9A 3HQRA 3W21A 5F3CA 3THTA 4OI0A 2ET7A 2XONA 2VPVA 5K9YA 3OEBA 1MS9A 5FPUA 4Z2WA 4P9WA 3DCQA 3SNMA 2QQKA 4GZ9A 1IPSA 1QOTA 1JU4A 1XSQA 2DCYA 4CCOA 2P3YA 2HWB2 1O3TA 1PO23 4QX8A 4RHV2 1JI6A 3I3DA 1H4GA 1CAXA 2QQIA 5A6QA 3H3LA 1IKPA 3ZYBA 3E6CC 1JUIA 1W8NA 1RMU2 3FUQA 1ZBE1 4QB2A 3LEIA 2RDQA 5L7OA 4HVRA 1URXA 1F4HA 3H3ZA 1QJY1 5FJKA 2XXZA 4P9XA 1QNWA 3VBRC 3GNEA 4XFBA 3R6SA 4LHLA 1U5ZA 1YJLA 3HD8B 4MXWA 5A33A 3J7NA 1BBT1 1AL0G 4DS0A 2WSUA 3ZIXA 5FP8A 5LASA 2B46X 1NXMA 1UZYA 3I2DA 3K77A 3WF1A 4CDUC 2GAUA 3PUAA 2UY9A 1O8PA 1OKOA 1GUIA 2YU1A 4OZOA 3PIGA 2VR4A 3H3UA 1ODMA 3Q8CA 3C7OA 4WZFA 2V5YA 4LQRA 5LA2A 3VBHA 3AKSA 1JYWA 5JUVA 1N1TA 1GU3A 1QQP1 2HYKA 3MZHA 4Q0PA 5CFDB 1ZZ8A 4FP3A 5B4XA 4B8EA 5M0TA 4C0BA 1H1AA 2A5ZA 1GMMA 4YZ1A 1LEDA 1Q3EA 1OPMA 5I8YA 2FCVA 4YVSA 3HAGA 3KV5A 4FOVA 2NZ9A 4Q0SA 2WNUB 2IUWA 2OUHA 2Z5WA 4IETA 4IGOA 4BU2A 2X8KA 1W39A 3LB9A 2R6QA 3OUIA 4NHXA 5D8AC 4GAZA 4DZGA 1HXS1 4QQOA 2YBKA 2RS33 2ZX2A 1GZCA 2ZGPA 2HWD3 1QY4A 4JC1A 1ENQA 4KGGA 1UKGA 4RGGA 5DZEA 4YRDA 4A44A 3DL3A 4P5YA 4XUPA 1WCSA 3OJBA 3PURA 4AG4A 4BQ3A 5JLVA 4PI2A 1VBA3 1XYOA 2R063 3S5AA 4UF0B 3I2FA 4HKLA 3MGUA 4O9GA 2IZWA 3DYOA 4CU9A 4AQSA 1ZA7A 2HLEA 4AOCA 1VP6A 4KI5M 1A6CA 4I0BA 2LW8A 4MGKE 4JRAA 2PA7A 4FTBA 1J58A 4YG3A 3J8F3 1X36A 1POV0 4XDOA 3EMRA 4V1PA 3WNNA 4FFGA 4U36A 2JDPA 4DY5A 1EAH3 1YO8A 2ZGLA 1C4RA 2PHFA 2VXJA 4K1ZA 1OBNA 5IVJA 5GALA 2P17A 3WQ7A 4HK8A 2WRAA 4P9YA 5DG1A 1D0GA 2HYXA 3VZNA 1MS1A 1W6NB 3AL6A 4XQDA 3O1UA 1O4TA 4MVTA 2VNOA 1S0FA 4QPIA 3MIDA 2ZEZA 4RGAA 4EE2A 4B29A 3UGFA 5CADA 1CAWA 1LKNA 5T50A 1REDA 1SFYA 1ULOA 1US2A 2ZOEB 1B09A 4LO8A 1RUF2 1GZWB 2J1TA 4UW3A 2YC0A 4OI4A 4UW5A 1PGL2 1ZRIA 2WYSA 1QIQA 1SBDA 1ULDA 1PZ7A 2Y8KA 4H3WA 3VD9A 3E6BA 5IK5A 4A6OA 3VLBB 5EXOA 1RC6A 5JIAA 1CR7A 1V6LA 4XURA 4WM7C 2B4KA 4LE4A 4JKLA 1O4YA 4O65A 4Q4V2 3RSJA 3WG3A 3NSTA 1OLME 2MEV2 5F37A 1GP4A 2F17A 1VMHA 4D7TA 1ZBA2 3K75B 2K0GA 2DCZA 2MNGA 3L2HA 4GALA 3BB6A 3L9JT 4M4PA 1S0IA 5GKAC 4IL7A 3TYJA 1QXJA 4BLIA 2ARCA 2B8MA 4OQ9A 1DDLA 4XFHA 4IE7A 3LZZA 5FZ0A 4CP2A 5KXEA 2CWSA 4XF0A 4GJYA 2WA3A 4AGVA 2TEPA 5AFEA 1OD5A 3WNMA 2YY1A 4RQPA 4K8RB 1J1TA 3O5SA 2BNMA 2WUHA 2BPA2 5LA1A 1PO11 4NRPA 3WW4A 2DU1A 2DFCA 2ZZJA 4Q0QA 4XFAA 2XDVA 4BK5A 4FAGA 3LA7A 3J8F1 4LLOA 4PLNA 1WW4A 1DGRA 5HV0A 3SH5A 3R4SA 1F15A 4Q4V3 4QQPA 1H4HA 1AR63 1GFF2 4OVEA 4XFFA 2N7GA 2VTXA 4DQAA 2W9XA 4P08A 1W8OA 3HT2A 4CSWA 1XYPA 3MI8A 1OUXA 3H8RA 1OF4A 4XTPA 1W8FA 4K3UA 1TG7A 2JX9A 1FATA 3ATGA 4LBQA 4NHKA 4AAXA 2BOJA 1ND2C 3ZKUA 3VDBA 4IUGA 4EWAA 3LAGA 3UESA 1NOVA 1BEV1 3M1HA 3OBRA 1UZVA 2KR2A 4CA9A 2VZRA 3M70A 2NYYA 3JB4C 1G8WA 2VJXA 3TWIA 2ZHMA 1H6XA 2VZ1A 2ZMKA 3FHQA 1T2XA 3I7DA 1O4ZA 3MHZA 1I5PA 4UOJA 2ZHLA 3B9CA 5FUPA 1A8MA 1GOFA 1VJ2A 2QQPA 4UI9L 1UYZA 3ITQA 3CJIB 2H6BA 2DV9A 4ZS2A 2VOXA 2JWPA 1KJRA 3POYA 4KH9A 5FRAA 4BIFA 5IVFA 2QE3A 1ULPA 1YNAA 3OD4A 4M3CB 2W47A 2OXBA 2HBUA 4XUQA 5FY9A 2VECA 4EN8B 4XUOA 1TNFA 4Y5SA 2IC1A 4FPCA 3ES1A 2YUEA 1J84A 2Y0OA 4K9SA 3TNPB 5LEKA 1KFXL 3HPNA 2WO7A 2V72A 4JRLA 2VD7A 4CCKA 3VHOA 1KGYA 3ST7A 1YQ2A 1UNBA 5K4LA 5LY2A 4IERA 1VBD2 4PLOA 1JOJA 4I02A 4RD7A 4NPRA 4ZZ5A 1HV1A 3E5UA 4XMAA 2Q1ZB 3CU7A 1LECA 5A1AA 3ZDVA 4LTAA 2JE9A 2VVDA 2XR4A 2RS32 5FZMA 1U5XA 5IW0A 5FDBA 1IS5A 3VD5A 1ZBE3 2YG0A 2YZ4A 1JMUB 3OGSA 4KGQA 1QJY3 1RUI2 3BGAA 1LENA 2Z69A 1D4M3 4GWNA 3VN4A 2ET1A 1W3XA 4PDWC 1XQNA 1RUNA 5FZ4A 5A3TA 2QCSB 5F8PA 5FXWA 2D40A 2I2SA 3VDAA 5DUUA 1OC1A 4QPIC 3VBHB 4CDXB 4HN0A 4XJ8A 1H8VA 2XWJB 1UMIA 2D7FA 3LDRA 3HJRA 1ODNA 1GSLA 1JYCA 3J7HA 4Q4W3 1Y4WA 3EJKA 2EXJA 4RHV1 3WHTA 5JXGA 2WNUA 3SHRA 4IE4A 3IN9A 3UETA 5ABJB 4NWWA 2A75A 3USUA 1POQA 2CU5A 2ORXA 1KS5A 1QEXA 2E53A 1G86A 1KEXA 4ISQA 4CDXA 3DF0A 1S1AA 1ZRFA 4Q8LA 3ZKYA 4UW6A 4IV3B 2HWE1 3Q8EA 2HWD1 2VCAA 2WO1A 1LESA 3BPZA 1ZZBA 1GP6A 1UWWA 1REEA 1F9KA 2A71A 4LBNA 3M3OA 5LW9A 1FAYA 2ZEWA 3VBFA 4NAMA 1UXXX 3H1WA 4FOQA 2O8OA 3V65A 3K4ZA 1NQDA 1OPOA 1NCRC 2BVVA 4RFRB 4WM7B 3NV4A 2A6WA 3IPVA 4Y1VA 4AFCA 3KSCA 3VDDB 3LCPA 1J3RA 4EZHA 4CU8A 1YJKA 3OCPA 5JXHA 1AR62 1AYN2 1R092 4ZU5A 1H1IA 5FZGA 1ND3C 2J1AA 1G9CA 4FBFA 3EXUA 2RR13 1PNFA 1W2AX 1SCRA 1G9AA 3N7LA 1PGW2 3NW4A 2P34A 3D5OA 3NRUA 3U14A 5C9AC 5CNAA 4QPIB 1NYWA 2RMU3 3PVOA 2LUWA 2JJ6A 3ZIWA 5K7PA 3URFA 2AC1A 2ZGNA 1CAWB 1F5FA 2X29A 5IWFA 1AR82 3RRDA 3O0XA 1FOD1 2EA7A 2WNOA 1NE4A 4CPBA 1ULGA 1V9U3 2GN7A 3MYXA 3B00A 3PDQA 2VW2A 1A3KA 1HRV2 3GM8A 3BTXA 4CP9B 4UFKA 3GZAA 4Q1RA 1BVP1 2PFWA 3PJYA 4QXBA 3W9AA 3NNFA 1BEV2 2P3IA 4W6XA 1H8TB 1RUC3 2LRPA 3MW2A 1CX4A 5CFCA 4ZONA 2ZKNA 3VDCA 4RSUA 1XE7A 3MO4A 4GWJA 5JPMB 1W06A 4F3JA 3ZN5A 2VG9A 5FYIA 2BYVE 4LPLA 3KVAA 4P00B 5FLJA 4AFBA 2CYFA 2PAMA 2PLV2 4MGTA 1RXFA 1SDDB 5AC91 2DFBA 2ATFA 4QX1A 4RS5C 1UIJA 1FPN1 1ND2B 4XW3A 2HEWF 3ZXGA 1QJU3 1ASJ3 3BCWA 3ZSKA 1W0NA 4OCTA 5C3OA 4KWKA 2I07B 2YFUA 2C5DA 2RR12 4IE0A 3VBFC 4LHSA 4JGYA 1JOBA 3LSEA 3BTYA 2WINB 2GALA 2Q8DA 2VMEA 4ZU4A 2IXHA 5I8TA 3O0VA 3K3OA 1GBGA 2QDNA 3IDAA 2QBXA 5FZ1A 4Z82A 2XJSA 5IJRA 5FOJB 1UYXA 1G6NA 4HPKB 1AR71 3CJIC 1D7PM 1NY71 5C3SA 1DBNA 2JDMA 4Q4V1 2PXJA 1OQDA 3D82A 3T2QA 3N9PA 3N9NA 2DVBA 3RPQA 3WW1A 4LBQB 3OBZA 1CN1A 1QOOA 5JVVA 5FP4A 4QXCA 1RB8G 1VMFA 4O9EA 4QXHA 1O3QA 4H2AA 3LEGA 3RJ2X 1AJKA 2JD9A 1D4M2 3IIIA 1EV11 4E4DX 1GQHA 3SH4A 2JDYA 4QPGC 4CEYC 4FPHA 3VBUA 1V9U1 2EALA 5A3LA 5C3PA 4DRVA 1QH6A 2DYCA 4XACA 2OPWA 3PIJA 3V0BA 4LT5A 1FMD2 2VZTA 2YC4A 2VZSA 3I3BA 2D6PA 3WUDA 3ZDSA 1F8VA 1YLLA 1RHI1 1UXZA 1D0HA 4PDWA 2JD4A 1S55A 4Q2FA 1S2EA 2CAVA 4CDXC 1OH4A 4QB1A 1VB4A 3SEEA 1OOPC 2VULA 2WNVC 4BA6A 4A42A 4ASKA 1BHGA 2A1XA 3BU7A 4NPMA 4BM8A 1VAVA 2VTXJ 2CNAA 4QX2A 1JZ8A 4NIHA 4QKNA 2IVIB 1NAEA 3NNJA 3WF2A 1RITA 4E9KA 1JYVA 2XGXA 1ZRRA 3VKNA 5KBFA 2BU9A 4NWVA 4HG6B 2EXKA 4LA3A 1RUJ3 1UOBA 3T4VA 3DXUA 2ZMNA 3K4DA 2ZAHA 3ACIA 4JDNA 3VBHC 4JGYC 4Q8KA 4QD2A 3VBUC 2WQ8A 2VM9A 3QCWA 4CCEA 5IK4A 3SC7X 5C6CA 2E32A 5CB7A 2E9QA 3T3YA 4YM2A 2OZJA 4TXWA 4UW4A 1Z7S1 1LTEA 4CDWB 2D3SA 3KZ4C 4OFGA 4U2AA 5FPAA 3KWVA 4LA2A 3KHBA 1DQ4A 4R9CA 5FZLA 3VBRA 5FO9B 1OMIA 1K5JA 1NZIA 3ORJA 2QQNA 1L7RA 1W6QB 2HWB3 2VQAA 5FZ3A 1KDKA 5T5JA 3RZHA 3AP6A 3WF3A 4XIOA 4LO4B 5CZKA 1NQJA 1U0AA 4EN7B 4IV3C 2XUMA 3DV8A 1CPMA 5CKMA 1SQ4A 3FWEA 4YW4A 4ZXEA 3UGHA 2ZABA 4OMCA 3U11A 4OUSA 4PIZA 5FMCA 2GMEA 3TBDA 4NR1A 2EXIA 3WXPA 2VZVA 3B5LB 4A45A 3AJZA 4IEZA 5AVPA 5C71A 2B39A 2G9ZA 4X6RB 1PX3A 4LE3A 1OOPB 2WNVB 4Y4YA 1VB2A 3HN1A 1O7FA 2P1BA 2F4LA 1QJX3 4FPKA 1WW6A 4XIKA 1DP0A 2X10A 2XJUA 3AKPA 5A3MA 5F3IA 3RZLA 3OTFA 1OF3A 5E88A 2JICA 2OQ6A 1VLNA 3K2OA 2JECA 2Y6GA 1VBA2 1UY0A 3WDYA 1OUSA 4Q4W1 4AQTA 2WWSA 3USUB 3I3MA 2WFF1 4MGQA 2BFUS 4LO6B 3RYKA 5EHDA 1UIKA 2HWD2 2CGNA 2C24A 2AENA 1AL22 3WNXA 1C8M2 2J1SA 2UY8A 4IV3A 3ZFEB 4BQYA 3KCYA 2WLQA 2GC3A 5FPVA 2SLIA 4NHMA 1K3IA 1RVF2 2XBO2 5E8AA 2UYBA 1LODA 1F2NA 5JIUA 5IFTA 1S0CA 1YUDA 1YC61 3A4UA 3U1XA 2R0FA 4EROA 2A6VA 2RS52 3PUQA 1PK6C 1R083 1PVC2 4YW7A 5IYYA 2BFUL 5HBAA 2W39A 3ACLA 4DFSA 1N3PA 4WM7A 5J37A 1C8M1 2E33A 4ITCA 2WT1A 3VDDA 5A3UA 1KQRA 4WM8B 3WLUA 4V2WA 4YG6A 2Y38A 1NCQC 3I2IA 5L9RA 2W2IA 5EV7A 1Z7S3 3MFAA 3C7FA 2A7AA 4MX3A 1VRH2 1CAXB 2GSYA 1N1VA 4XFGA 1QWRA 2VQUA 4AEJA 1R1A1 4GIQA 4DUVA 4BOWA 5T5LA 3FHIB 1C1LA 1BKZA 1AL23 1AXKA 3LA2A 2FDGA 2W1SA 2JB4A 1U5YA 5I93A 5GZDA 4Y1ZA 4CCLA 4A4AA 4I3PA 4NHYA 4ASMB 3AYDA 1DGRN 2ERFA 5FY0A 5FY7A 2W5FA 1LOCA 4EV0A 2AR6A 2P6HA 4QU2A 3H42B 2FZ2A 1SFPA 5L73A 1C57A 1VRH1 1R1ZA 4FFHA 1O3RA 2K46A 2UWAA 3EBRA 1NZCA 1MR5A 4A3ZA 1J3PA 3T0BA 4CP9A 1AYN3 1R093 2QZ3A 4N43A 4Y26A 3WEZA 1HN1A 5F3GA 5FYSA 1ZA4A 4ONUA 1RGSA 3ZXFA 2EICA 1H8TA 1CD3G 2QZ2A 4Q4X2 1ONAA 5CFDA 1BCXA 4QGLA 4OHZA 1TNRA 2W08A 1RUH1 1W90A 4LOTA 4I01A 4YVSB 2BGPA 2BGOA 5FZDA 2BW8A 5ERLA 2R49A 4R9AA 1A78A 5F2SA 1S2KA 3H7YA 1GQGA 5FYZA 4XF3A 3HVDA 2PHLA 3ZMNA 4AI1A 1RUG2 2PHTA 4GKXA 4AVVA 1W6PA 3IMNA 3ILRA 4HETA 1FT9A 4L0PA 4FPYA 2BERA 3GZTB 2VOKA 3H8UA 4UF0A 3D0JA 4JGZA 5IVYA 1EP0A 2VMGA 1S0DA 1SLAA 4LR4A 4OHYA 4OUEA 2RMU2 2Z4FA 2O0OA 2XHKA 2ZBJA 3N7KA 1TME1 3OYWA 3TN93 2ZGQA 3TAYA 4A7KA 4ARYA 1COV2 2W3JA 1H2NA 5FPBA 3HQXA 2BVBA 1CIYA 3D8CA 2PN5A 3A21A 4NN0A 5FMBA 1UQXA 2XJPA 2D6OX 1CWPA 3TEWA 3WY6A 1WWYA 1OA4A 3O12A 3LEKA 2D5HA 2XL7A 2E51A 3BIWE 2DTYA 4META 4E27A 5L19A 3E1F1 4PI0A 5LK5A 3LIHA 4XZPA 3A7QA 4E4HA 5K0UB 3PUIA 4M3CE 3VBUB 4LBOA 3ZXDA 3UNPA 1W8WA 4Y22A 3ASIA 4DUWA 4AFDA 5IVEA 3ZYHA 1GZWA 1VBC2 1IOAA 1C1FA 3B01A 3KLSA 4LBJA 4ATEA 2MEV1 1SLIA 4S2DA 1XNBA 3V0BB 5I91A 4XTMA 1XJAA 3POFA 2VMDA 4PDWB 4PIYA 3CNAA 2XOMA 3VKMA 3AZYA 1VBB1 3G6JB 1APNA 1XNCA 4COWA 3ILFA 3KV6A 5K8SA 4QX7A 2P6CA 3POWA 2VZPA 4KG8A 2HWC1 3WCRA 4BB3A 1JZ2A 2XB6C 5A6ZA 3RMYA 4YW1A 4YPJA 2FDJA 1DLLA 1QXPA 3QOPA 5HXVA 3WNLA 4XFCA 3THDA 4IE5A 4JCKA 3VBSB 4BE3A 5IHRA 3BIEA 2WWUA 2RM22 1GP5A 1W8TA 3Q8BA 4HBNA 4O7XA 2KM2A 1DG6A 4Q0VA 1BMV1 1KFUL 3OEAA 2BEOA 4BQXA 4AI3A 3ZFFB 4LKSA 4G3YC 1GWKA 1WA4A 1AJOA 4R9DA 2UU8A 4BMEA 4BQ2A 1AX0A 3K4AA 1L7QA 4CDWA 1GZ9A 3APBA 4OULA 2JB8A 1TME3 5FO8B 3J7LA 3M3QA 4F8AA 2R1DA 1PIV1 1LOGA 4Y3OA 3HR9A 1YFXA 3MLLA 3IIAA 2CV6A 3JQWA 2DTWA 2QQLA 1W6QA 5J1XA 3N36A 2C6SA 2X53S 2UWCA 3DYPA 5LBBA 3ZYRA 5ACA2 1LGBA 4N7IA 4BQ1A 2WIIB 3ALQA 3JBG1 4EYUA 2XHNA 1XSRA 1H2LA 4XJWA 5BNNC 2XH6A 2YBPA 5T54A 2GMMA 2ZGRA 4LJHA 1S0JA 4PF5A 2ARAA 3BI3A 3MEPA 5IK8A 1OOPA 2WNVA 1SLCA 4CPBD 1N3QA 5HPOA 3AZZA 3DPRC 3MUZ1 2RDNA 1LR5A 2W1UA 4TLFA 2WFF2 5FZFA 2GC0A 5GLUA 3RQ0A 3WG4A 5BNOB 3GHNA 4XDQA 4FSJA 5EPAA 2GDFA 5J36A 3N9MA 5AFBA 1QJEA 3ECQA 2RS13 4GMP0 4MUVA 4AAPA 3HBKA 5FXZA 1Q8SA 2VW1A 1QF3A 2P37A 2F6BA 4FCAA 4M4RA 4P9GA 5DDJ1 1W8HA 1I6XA 4MLOA 1SBFA 5FYYA 3H50A 3ZFEA 1DQ6A 1SFNA 2E7QA 5JI7A 3C7GA 3RZJA 4KQ7A 4AVAA 3WNPA 4OYUA 4YVWC 5C9AA 4M3CA 3P3PA 3D6EA 3SH3A 5E6HA 4W4ZA 1RUG3 1BBT2 4FQZA 1PM4A 5IT6A 3C7HA 1HN0A 2EVXA 3AVSA 5LEJA 2DUQA 1V0AA 2ADDA 5FBJA 2R042 4NVPA 3LWCA 2D43A 1FXZA 2XKPA 4YGBA 3WX5A 2K9ZA 3T4HB 1Q8QA 2VW0A 1H6YA 3ZXKA 4P02B 1VBB2 1Z0HA 1HX6A 1XB9A 2ZHKA 1Q8PA 4WM8A 5F2WA 3VB9A 1YQ5A 4GJZA 4PQQA 1SBEA 2FBEA 3KT1A 1BJQA 1PVC1 1C8M3 1SZBA 1W3VA 4N90A 3N3HA 4DNYA 2ORZA 1G7YA 5C3RA 2EXHA 3HBZA 5EYYA 2W87A 4MGSA 2PAKA 4W8JA 4WVMB 4AFAA 4BQ5A 1Q8OA 2DVDA 1QGLA 4LXLA 3ABZA 5LK7B 3O1TA 2JDZA 4GB33 2AEYA 4Y24A 4OMDA 3DKWA 2O14A 4SLIA 4CRQA 1AL21 4I3GA 3U78A 3JUUA 5C8CB 4YGDA 2ZX0A 4HSJA 3WT3A 2BNOA 4GXLA 3KS7A 1SLTA 2WN2A 3QACA 3NQHA 2WZ8A 3WNOA 4UWDA 4AF9A 5FR3A 3Q8FA 5FK8A 3PJQA 4INDA 4QAWA 1IZ3A 1M06G 2Y6KA 2EIDA 4RA0A 5F9TA 1RUC2 2VZ3A 4N7UA 1NA1B 1BBT3 1NLQA 4L8QA 5D21A 5H9PA 2AZ5A 5A3NA 1C5IA 4H14A 4N9HA 3OBAA 4N53C 5ABJA 2C4XA 1HQWA 4DXRA 5IVVA 5FYUA 4CVUA 1YCIA 4WVZA 5SV8A 5T52A 5JOZA 4J25A 5BNPA 1SMVA 1O91A 1MS5A 3THPA 1LHUA 1IHMA 2NN8A 2H6CA 2HWF1 2C9KA 2XLGA 2YXSA 4IXLA 2ID4A 3KGLA 3RI8A 3VKFC 5FP3A 1HRI1 2QJVA 4UT5A 4XEZA 3S7EA 4YARA 5K0UC 1J59A 2FMDA 3GBWA 4JGZB 4XJZA 1WCDJ 1TME2 5JMOA 1BXHA 1WW7A 4N8MA 5BNPC 4X8PA 4Q4Y1 4ET7A 5EIYB 1LULA 3O14A 5TSWA 3VBFB 4GMP3 5A7OA 5C4WA 3SMHA 2XVLA 1STMA 4C0HA 1ZX5A 1N1YA 1LOAA 2ES3A 4PHZA 5FWEA 1FNYA 3IPVB 3JD73 1LU1A 2HEVF 2YFZA 2W46A 1Z78A 3KT7A 5A3PA 1DYOA 4CDUA 5L9VA 2ZHNA 4QGNA 4AI0A 2BNNA 2VL4A 3ZO0B 2Q1FA 3AM2A 1IS3A 5J7MA 5AVAA 4GH4C 5DABA 1VBC1 2VNVA 1F5JA 2A70A 3A0KA 1GANA 1U12A 3C7EA 3D3AA 3IM0A 5K0UA 4Y22B 1KITA 4BLJA 4M3CF 4GB32 3ZFFC 4FTSA 1MS8A 2JG8A 3GYDA 2JKBA 5CG9A 2OX0A 4XF1A 2J7MA 1H8TC 2P4EA 1Q8VA 3FBYA 1ENXA 2Y26A 4JQTA 1DFQA 1DQ0A 1HB2A 3J9SA 2R30A 3UYJA 4FFFA 4GWIA 1NE6A 2YHJA 3D0SA 4ORFA 1VBB3 5FZ9A 4XCAA 3WG1A 4NAOA 2EAAA 3G7DA 5FKBA 4B3NA 1XNTA 5CFCB 1YQCA 1YHFA 5FMDA 5G04L 4QKBA 2R043 5JZGB 3LOBA 2V4VA 4CZSA 3AKQA 5F32A 3DUIA 3CQOA 2ZEYA 2E31A 5FWJA 4Y33A 1IS6A 1LRHA 1UD1A 1VPHA 2AGSA 1CX1A 4K40A 3RNSA 3WF0A 1YYNA 4COYA 4JGYB 2YC2A 4Z2AA 2RE9A 2WC2A 4IEOA 3RI9A 4LLFA 4ZU7A 3MDPA 1X8MA 3O0WA 3IBMA 4XYXA 4X6QB 4E2QA 3MW4A 5FLHA 3UJOA 4HVQA 3PNAA 3H1MA 3I4IA 1GNYA 2Y6HA 4RYDA 4TTGA 5FUNA 2BWCA 2NPIA 3GJAA 3D4KA 3IB3A 1Y43B 2V73A 1CVNA 4HPKA 1R1A2 2NMNA 2PYTA 3KT4A 1Y9MA 4WM8C 2XPJA 1X8EA 5DZFA 3LEMA 2BRTA 5A7SA 1AZDA 3GXUA 3JZVA 1X50A 2PHDA 2VBPA 5DN2A 5F5QA 2ZKLA 5FXXA 3KCXA 4UYBA 1NXD1 4FP2A 3BN6A 3JBG3 3ENRA 1DLCA 2OKXA 1JZ7A 2AH2A 3HIFA 1NLRA 4XFIA 4CCCA 5ACA3 3AP7A 5JOYA 1MS3A 4Y20B 1YIPA 5BNOA 3LFIA 5A80A 3VZLA 2QDRA 1W6OB 4WBBA 2V09A 4BWOA 4QX5A 4QHOA 3MBWA 2PTMA 1HB4A 4XZUG 4B4RA 4D6QA 3MV01 5JR7B 4RR3A 5EJZB 4H55A 2WT2A 1K12A 2QKDA 2DF7A 3CIHA 4CCNA 5A7NA 2BOIA 1IG0A 4XUNA 3K51A 4GWMA 1X33A 1REFA 2R041 4FPOB 2B9UA 4AXOA 5C9AB 1PGW1 2CAUA 3DXTA 1WMFA 4GA9A 5HCHA 1Y9QA 1GWLA 1W9SA 1XXNA 2J1EA 2VQ0A 3BPSA 2B42B 2JEMA 3JBG2 3VHRA 3X29B 3ZXAC 5LCWL 3MIHA 4JDMA 4IEYA 4E8DA 1DGWX 3U37A 5CU1A 4YVWA 4OHXA 3AVRA 4K8FA 1AYM3 1C28A 4L11A 4PBPA 3KV4A 1V6NA 3VZJA 4AGRA 2WQZC 5A7PA 3PTYA 2VOTA 4QKFA 1UN1A 2PHXA 4CUBA 5A1FA 4D7YA 2IVJA 2R1BA 3U07A 4O61A 5CYYA 5BV6A 5E16A 3ZXJA 3L2YA 5ANNA 4IEWA 1JBCA 4RR3C 1HB1A 2W1QA 1K5MC 2ZJCA 3AFKA 4WVMA 1NCQB 3WP6A 3WQ0A 2VBDA 5FYBA 5C3QA 3ZN6B 3LPFA 3VBRB 5FCCA 3WINE 2OQ7A 1GOGA 2A3XA 3NV1A 1CJPA 4AZZA 4KU8A 2A6ZA 1OH3A 4IGQA 4AE2A 1FX5A 2F4PA 5KHKA 1CZSA 1QNYA 2WNEA 3CO2A 5CISA 3CZUA 3OUHA 5DDJ2 1O8SA 3OF1A 4XETA 1QHDA 2EIEA 3WOGA 3AMHA 1GR3A 2VUJA 1F35A 1YFYA 2W0XA 5FZEA 1HKDA 1W2TA 3AZVA 2SBAA 3ZX7A 2DU0A 4FXGB 3BOPA 5C5TA 1OSGA 1AYM2 4P14A 1Q43A 1HW5A 4FPGA 1D4M1 3FMGA 3BOWA 2VVEA 2PHUA 4IW3A 5CA6A 5I0DA 1JYXA 4AR2A 4JZRA 4B4QA 3ZFEC 1AVBA 3I8TA 3OB8A 4MGYE 5F1RA 3B94A 2VUDA 4K7JA 5IVCA 1ULEA 1LU2A 2ZTNA 3E97A 4OZXA 4QX3A 2R073 3SISA 1XBFA 4JTOA 3WW2A 1POV3 1LHOA 1ULCA 4FI9A 5FMOL 1RUE3 4XHBA 1UL9A 3DKQA 4XF4A 4RHV3 5FYVA 5J96B 4EN9B 4MG2A 2DCTA 3RS6A 2A6XA 3ZFGB 4AK3A 5LRSA 1MS0A 4P9JA 1RINA 1W6MA 2HWC2 4BIOA 2WO3A 3T2PA 1JHNA 4XAAA 4QWNA 4BQWA 3SKVA 3IDEA 1EUUA 1LB2A 3RDIA 4RGKA 2WYFA 4MOAA 2A6YA 2HWE3 1CAVA 2C9AA 1YI7A 3T2OA 2AYHA 4CDUB 3WDTA 3JD71 4XF9A 4YFZA 3W5NA 3M2MA 3VHNA 4CEWC 3RZMA 5JZGC 3AB0A 3I2HA 2VGDA 1E57A 4YGCA 4R4ZA 3VZMA 1X82A 1SEFA 3V56A 5JDBA 1OA3A 5A3OA 2J1VA 3TB0A 4C8DA 5J98B 1ZREA 2R072 2PLV3 1C5HA 2IXKA 3WD5A 5BNQA 5BUVA 4YW5A 2ARBA 1IQAA 1VBC3 2JG8B 4GH4A 1RJ8A 1RUH2 1AR61 4XC9A 4M0HA 2DURA 2RR11 4L9BA 2GZWA 4QDSA 5FY1A 2PHRA 5GZGA 2OA2A 2OPKA 3RZKA 4URTA 1WBLA 4EJRA 4NJ4A 4N43B 3PL0A 3CKHA 4YVSC 4DOUA 3ACHA 1RUJ2 1UPIA 1Q56A 1HJFA 3WSOA 5J09A 2QQJA 4KL1A 1WKYA 2DCKA 3AL5A 3B02A 5DAQA 5FP7A 3EO6A 4LIVA 3POBA 4FPFA 2QNKA 4EN0A 3KF3A 5JZGA 1PNGA 1UOGA 4XDPA 1UY4A 4YW3A 5FYTA 1BEV3 1X9TA 4S2HA 4M01A 3OBTA 3MLKA 3EYPA 3E5QA 1GLHA 5KHJA 1NUKA 1QDOA 1EY2A 2WO2A 5DPNA 3MF9A 1W28A 2Q30A 2FDHA 1HB3A 3CLPA 4YGEA 1OLQA 2HWE2 5FKCA 1MVQA 2VQTA 2WZR2 1WCUA 2OUJA 3MICA 2RJLA 1OURA 1W6PB 1EV12 4YM0A 1BVVA 1VRBA 4HL0A 4KU7A 3U4SA 1OVPA 3C2UA 4CDQC 4QM8A 3K46A 2ZGSA 4FT8A 4NUBA 2W68A 4D3WA 3S7IA 1WMEA 4FO9A 2ZS6B 3SCHA 3T0DA 4TSVA 2XL9A 3OYWB 5FOBB 5C70A 5CFDC 3BU0A 1G9FA 1FPN3 3FE5A 1ASJ1 4PIXA 4Q27A 1A8DA 3FX3A 2OT7A 1XRUA 5A7QA 1DU3D 2B7YA 4AVCA 1AX1A 1XNAA 1AHSA 2BTVC 5JR2A 3NL1A 3WP4A 2Y6FA 4W6WA 1UZZA 1XNKA 4HXCA 2ZPXA 1PHMA 3VBOA 5L7OC 5CAZA 1GICA 4XQ4A 3CJXA 2RG4A 4Y20A 1OD3A 2O1QA 1NX9A 2JG9A 5GLWA 3AC0A 3KVBA 1W6OA 2R7EB 4MZUA 1HIXA 5CKQA 1W9TA 3RMXA 3ILNA 2AUYA 4QPWA 4TYSA 3KF5A 4LK7A 4NO4A 1MZEA 4RR3B 2WABA 3SKJE 1CAUA 5HV4A 5LB6A 4XILA 2WZEA 3BKZA 3BVCA 3S57A 4LO7A 1YWKA 5FPLA 1W9FA 4MV2A 1EV13 1E5RA 4BK4A 4OHVA 4HOOA 4J1XA 2KD7A 4D6SA 1BMV2 1I5ZA 2D6MA 1E5IA 4AHYA 2PHWA 2L9LA 4YW2A 1ZBA3 3PVNA 5I0TA 2VE1A 2QQUA 5D1IA 5GLVA 3EHKA 4MH0E 4B7EA 4BHPA 3VBSA 1QJY2 1YFUA 4XBQA 5FZOA 4YVWB 4YYOA 2VOWA 5FY8A 3V64A 4COZA 4CUAA 3OPZA 2WFPA 4PJYA 5T55A 4F7ZA 5IVBA 2QQVA 4EZ4A 2OVUA 4C91A 1N47A 5F5IA 1PMIA 1V70A 4YSFA 2UYAA 3ZFFA 4A3XA 3TRSB 1RUI3 2GNDA 1UY2A 4L99A 2JE7A 2RVAA 3NKTA 3CEWA 3NNGA 4HT1T 4FOYA 3LSDA 3HN3A 1UKRA 4J6GA 4WZCA 5H9QA 3EQEA 3FBMA 3FFQA 4W6YA 4YW6A 2JDNA 3WDVA 4BH9A 1W2UA 1F31A 4CE8A 3I59A 3DN7A 1ALYA 4YLZA 5HCBA 1MS4A 1ND3B 2XUEA 3AJYA 3WQBA 4OQ8A 3TEXA 5GLZA 4JV4A 2VU9A 5FQ0B 1Y3TA 3M4FA 3ZXEA 2TNFA 5L36A 2PELA 1PO13 5A7WB 1Q5OA 1JXNA 3SEPA 2G4IA 2VXRA 2QQWA 3IAQA 3I2JA 3UKVA 3MUY1 3VD4A 3MPBA 2QQMA 4HONA 1XYNA 4P5HA 5CKNA 4XQWA 4DY3A 1FMD1 1OVSA 2RMU1 2XLAA 3BODA 4AHWA 4NROA 4AHZA 4XE9A 2FDIA 5DAPA 1V00A 2YBSA 3J26N 2ZAAA 1ACCA 2NLRA 3LIGA 3ZYGA 2G9FA 1WA6X 2V4AA 4YZ2A 4I2OA 4AI2A 5KXDA 1WCQA 2ZACA 1UZ0A 3N9LA 5BYNA 1FOD3 4JKMA 3HNBM 4R52A 1W2OA 1MZFA 1VALA 4HSLA 3ROUA 4NIDA 4XBLA 2BWAA 1ULFA 2D3RA 2RS51 5FBZA 2C1FA 5I8SA 4AWDA 5GZCA 2JDAA 1O5UA 1EYBA 3N7JA 4BYYA 1W6MB 4DO0A 3VGIA 1E5HA 1XE0A 2WFF3 1H2MA 2LTNA 3HQUA 4DXZA 2AREA 3FLTA 4JGZC 4AL9A 1HQLA 2IWGB 2ILMA 4QQ2A 5FYMA 3S5QA 3JD72 5GZFA 1QU0A 4MXVA 4UXAA 1CAVB 5A70A 2B45X 3H0OA 4YZ4A 4XPVA 4YZ5A 4TN7A 3VD7A 1PMJX 2DUPA 4ATFA 4RQPC 4BQ4A 4C1XA 3GZEA 2RS31 2MHFA 1WUVA 2FCUA 5FLIA 1J3QA 1RIRA 3AMMA 5FZ7A 1V9U2 4RN5A 4TWTA 3BUCA 1VE0A 3FJSA 3SCFA 5C33A 2GNTA 1PIV2 1YI9A 5HXMA 1UU4A 2HBTA 3A22A 5C8WA 1UO9A 4ZZ8A 3PUSA 3OY8B 1XOYA 4LITA 3PVEA 1YQ6A 3WCSA 5C8CA 3GGLA 3LKJA 1DIWA 4GH4B 5A1LA 4LUKA 4PBOA 4CCDA 2X05A 3GALA 1I1EA 1NA1C 1AUYA 4DB5A 1LHNA 1IKQA 2CGOA 3ZSLA 1LJ7A 4AQ2A 2ZZQA 4V2VA 5G05L 1MPXA 1YEWA 1EAH1 3ZPOA 4NIGA 3IZOA 4K20A 2WS91 3VHPA 2TBVA 5LWBA 3JQXA 4UFJA 1ZNPA 4C90A 1NA1A 1PO22 1TVGA 2DWRA 5BXXA 4CP0A 5JAXA 4UBGA 5GM0A 2JXAA 1DQ5A 4XHXA 3O1VA 2GH2A 1RXGA 1WLWA 1BK1A 1H30A 1WD4A 2JIGA 4KNCA 4A7ZA 4GULA 2RJKA 5CG8A 4ZS3A 1DHKB 5BNNB 5BNPB 4LBLA 1AXZA 2I45A 1JOPA 3UKTA 5B2GB 2WA4A 2WQ4A 3M3IA 1NY72 4XJ9A 3HWJA 5FZKA 3AX4A 1ZZCA 2ZGTA 2ZGUA 4UAPA 3ZYIB 2WDBA 3ZMOA 2D6LX 1XU1A 4Y4RA 4UFHA 4CXXA 1W8ZA 3NNLA 2VZQA 3F2ZA 1PZ9A 1QJZA 4QQHA 5DUWA 5FREA 5KWRA 4K1YA 5GJ6A 1JN2P 3WQ1A 3MF6A 4YG0A 4AVBA 1S4CA 2IXLA 2VO5A 2WWJA 1ST8A 3FC0A 4LK6A 5FJHA 5C4WB 5JMCA 4S2GA 1K42A 3O1PA 4CTEA 1V6JA 2E63A 1RUJ1 3LD8A 4DINB 3H8OA 5A6XA 2Y33A 4IESA 1PZ8A 4JVAA 2XKOA 3N9OA 2DUOA 2VMCA 2WR9A 2YB7A 4IQPA 2VH9A 4N53A 3RYPA 2W52A 5ABJC 4B4PA 1B35C 2VNGA 1HQNA 2GMPA 5FMOS 3VBOB 3JCIA 3AYEA 5LATA 5JCTA 1UU5A 5D8AA 1DZQA 3NV2A 2PAEA 2DDUA 4HKWA 4ZY9A 4DEQA 3GBGA 2VC9A 4RS5A 4LULA 2WBKA 1BYHA 1ZBE2 2JG9B 2Y60A 5GLTA 2ZX1A 1R082 4HVOA 2R062 3IDCB 5F5AA 1F4AA 4AI9A 3QLQA 3POJA 1H0BA 2AACA 1W9YA 1D2SA 2D6NA 2HWB1 2Q1MA 2R32A 3GJBA 3LA3A 1GV9A 2DBIA 1X7NA 4OUMA 1AR72 3ACGA 1JUHA 3QD6A 1VBD3 3CMGA 3JU9A 3I3EA 3I54A 2FQPA 4OI1A 1NKGA 2GU9A 3O1MA 2IXIA 1LGCA 3AZXA 3Q9OA 3P5BA 4CXWA 3B93A 3WZ1A 4JHZA 4QPYA 3IT8A 4RFT0 2MEV3 1MEC3 5F5CA 4DXTA 3V0AB 1C3HA 4BISA 2ARXA 2ZX3A 1EPWA 1DQ1A 5DZGA 1QJX1 2RDSA 1PGSA 1LHVA 1ZBA1 2Y6JA 3HMYA 1AX2A 1GZTA 2A3YA 2VBBA 3RGBA 4KMQA 1UX6A 5T5OA 3E6DA 4Q29A 4COUA 4FPJA 4IE6A 4IEPA 2VVFA 1AF9A 2C26A 2HWC3 1RMU3 2ZGOA 1RUC1 2HWF2 5FZBA 3KMHA 4QMAA 3T1LA 1O3SA 5KXBA 1PK6B 1UY1A 5D2AA 3CF6E 1LNSA 3NAPA 4LKFA 4E8CA 1B35B 1MQTA 3PTRB 3H1YA 3ZOIA 2HKXA 3MIFA 4QT6A 4AEKA 3RJRA 3THCA 2YPDA 4LHNA 5IAVA 4D8MA 5AC93 3I59B 4ES9A 2WAOA 4PQ9A 5FYHA 4IV1B 1ND3A 1T6GC 4QDRA 4CUCA 1QJU1 4E2SA 1RYYA 1W8UA 2P3KA 4NOTA 1WGPA 4KBZA 3FLRA 5FQ0A 1EAH2 3W5MA 2P5BA 3S0MA 5A32B 4AEMA 1N1SA 1RJ7A 5LY1A 5ISLA 1DYKA 4Q4W2 4NRQA 2B5HA 4JQRA 4XVHA 3SLIA 5FPXA 1PIV3 3KHCA 1UOJA 4Q4Y2 1IPKA 4AFMA 2H0BA 4YM3A 3DPRA 3GF6A 4XXPA 3J4UH 2XWBB 3BALA 3T2TA 3ZYPA 4AVSA 1QH7A 1AR73 1MEC2 3R05A 3BTZA 1VAMA 1W99A 2PQQA 3NVCA 3EB7A 4JTNA 2BJSA 1CPNA 2QTWB 2Z79A 2ZCWA 2WZPP 3WUCA 1DGWA 2JG8C 2YPJA 1OA2A 3AMQA 3F95A 3GZUC 1VBD1 2ZX4A 1FMD3 3PHMA 4HFSA 5LA9A 1UF2C 4A7YA 5KXCA 1S0EA 2XJQA 2YMZA 4D69A 1VRH3 3LFMA 3ZSJA 1KRIA 2W95A 3N9QA 3SCGA 4QQLA 2BV4A 1DYPA 3AFGA 4N43C 4YFWA 2WLPA 4PT6A 2IFRA 4IDZA 5ANQA 3U10A 3UK9A 1MEC1 4R8HA 2CSGA 5DXDA 2JDUA 2VY0A 2OZ6A 3ACFA 4XJUA 5IK7A 4CDWC 2K2SA 5HI0A 4MO3M 1GQPA 3ZVXA 4QB6A 3LDBA 2RS53 5JSRA 3OGGA 5A33B 1XE8A 3NJZA 2P3JA 1JTZX 4BJ0A 3POGA 1DCSA 3NO8A 4QGMA 5EJ3A 1PX4A 1XU2A 1VAKA 1RMU1 1TMF2 2VZUA 2YGLA 4AW7A 1JH5A 3LDKA 1AXYA 3HEIA 2EF6A 4MADA 5DMYA 1JZ3A 1WMDA 1NT0A 1PO12 5IFPA 5EP9A 3IDBB 2QUOA 3U75A 1FNZA 1H2KA 1NCQA 1H1MA 2XQRA 5DUXA 4CYDA 5CVRA 3ZN6A 5SV5A 3WV6A 1A34A 1RUF3 5KR7A 4FVVA 4FTEA 3KQRA 4R4XA 4G4FA 2LS6A 4GD4A 1GNHA 1FI2A 1MACA 1FV3A 1KJLA 3N35A 2ETEA 4UFLA 1ZRDA 4COVA 4P9LA 3IKWA 1FYUA 1ASJ2 4MGIE 1FV2A 2BGCA 4B7KA 2C0ZA 5FFOC 1LAJA 3GHMA 3AP4A 4LUMA 3PUHA 1PVXA 4AI8A 5C4WC 2PMWB 2RM21 4AEDB 3J8F2 3O1OA 3ZYJB 4QM9A 4JDOA 2FD8A 4LBMA 1OKQA 2WS93 1ZZ6A 5F7UA 3U4XA 1WW5A 3POSA 4LORA 4YM1A 1ENSA 4QKDA 4URAA 3S6PA 2DVGA 2LROA 3B7MA 2GNBA 3VL8A 3TEZA 5BNNA 3ZFGC 2EAKA 2CY6A 3AKRA 2HJIA 2OW4A 5LBEA 5FAXA 5CEHA 5L9BA 2GH8A 3MLJA 4XMIA 3UL2A 1V6MA 4YWAA 2E7AA 2GP3A 3WG2A 4CXYA 1NCRA 1Y7BA 1W6NA 2JENA 4IEQA 1UCXA 4CU7A 3TN92 3FUOA 4IGPA 1J1LA 3ZFGA 3C8XA 5A3WA 1QXRA 2RS12 3ZSEA 4ZPIA 3LPGA 3WVJA 3OG2A 1Z7S2 3B9IA 2E7TA 3DYMA 3QBQA 3LQCA 4DPNA 1LOFC 4Y5TA 4AQ6A 4CEWB 5I0RA 5H9SA 1CONA 2DBNA 3VL9A 4N9IA 1OQEA 1IQDC 2CTVA 3WP3A 5I0UA 1HRI2 1LHWA 2W94A 3CL1A 3ZR5A 5LZ6A 3ZN4A 3PLQA 5J3UA 1SLLA 2WS92 2A73B 4Q4Y3 5KC6A 1JZ4A 1AR92 4FPEA 1RUF1 3NJVA 4ISRA 2WNUC 3ZLIA 4GMP1 1R081 3WP5A 5D8AB 1COV1 4HN1A 3FHAA 1QMJA 5DG2A 1SHWB 5CIRA 4AEDC 1LCLA 2W92A 3AXDA 5FY4A 4CUGA 1CIWA 3FN9A 2D44A 3HNYM 5E89A 3ME2A 5AC92 1OQ1A 3JB8A 1IPJA 2G19A 4A41A 1W0PA 4NPLA 2GC2A 1AR91 1XPWA 2OS2A 1US3A 3AK0A 1H9PA 3AMNA 3AP9A 1I3HA 4Q5OA 4DEVA 2XQXA 1OLMA 3NKGA 3OGJA 4OI2A 1FOD2 2RM23 2W1WA 4NHLA 2JDKA 2QVSB 3U0ZA 3LF7A 1K5MB 2FCTA 5DAVA 1GNZA 4GQ7A 4UFIA 4XBNA 5F3EA 3W59A 3VBSC 2JKXA 2RDRA 1YXWA 2X5IC 2CGPA 4MYEA 3KB5A 1DZTA 5JSPA 3A23A 4ASLA 2RJ2A 5FTTC 2BDRA 4CDQB 1TMF3 1WLCA 1AYN1 1R091 2B9VA 2RHPA 3W20A 1ZM1A 2VTFA 3LGRA 4A2UA 2WSVA 1UYYA 1BK0A 2UWBA 3SXWA 2FHRA 4BMBA 5C7GA 4KG0A 1RHI3 1PK6A 1SPPB 2G9GA 5KHHA 2XJTA 3C3VA 5DDJ3 1RUH3 3QH7A 2D98A 5APAA 1SG3A 2D93A 1QJFA 3T0AA 3Q8AA 1WLTA 4G9SB 3HOBA 3SQOA 2Q8CA 4LKDA 1C8NA 1ENRA 4W50A 1QKQA 3OGRA 4LNVA 3PMEA 3ZM8A 4QXKA 3ETQA 1UW8A 4MGZE 4B1LA 1G9BA 3M3EA 4ARXA 1UY3A 5DAWA 3O1RA 2R0HA 2TUNA 4X8NA 4IEUA 3FL7A 3UKNA 2Q8EA 3AZWA 1COV3 3UGGA 3WDXA 1I9RA 2GNMA 3AP5A 3PMSA 3WHUA 1PVC3 2IFWA 3DPRB 1SACA 1DQ2A 5GZEA 1VMJA 2E6VA 3R0RA 4IEVA 4TLGA 5DAXA 5FPZA 2FDKA 1CZTA 1CZVA 3NJXA 4WV8A 2WT0A 3NJYA 3RG0A 4MHUA 1CGPA 5F6KA 1OHFA 2Q4SA 2X5IB 4BXSV 2Y64A 1TEIA 1V6OA 3BTAA 4H7MA 3AMPA 2D3PA 3O7OA 3DEMA 2BBAA 3M3CA 1KD7A 1DGLA 1CJDA 1CAUB 4ZXKA 5IAXA 5ACA1 2YU2A 3TNQA 5F39A 3INAA 3A0NA 3KGZA 1O5LA 3QH6A 1RUOA 1HLCA 5T5PA 4M00A 1QJU2 1WLDA 2ZGKA 2LALA 2OYZA 4HK9A 3ZXLA 4D7SA 4Q0UA 1S2BA 4L2NA 4MSVA 5FIXA 3E5XA 4JAAA 1TMF1 5C5UA 4KWLA 5JWPA 1UYPA 2CHHA 5FUIA 3HT1A 5E1RA 1LGNA 2BQPA 4DMIA 1KXGA 4HKOA 5FZOB 2XMLA 2VCMA 1WCKA 1UU6A 4Q1PA 3ZYFA 4B1MA 1GWMA 4M0NA 2BUKA 4BZ4A 2QQOA 2BZDA 1FPN2 1W0OA 4LHKA 3CHXA 1T6BX 2WAAA 5KHGA 2EIGA 3KCCA 3AYAA 4CP1A 1YFWA 3R4UA 3P3NA 4QPGA 4YNIA 3RWKX 4CEYA 4DUXA 2NP0A 1JHJA 1H9WA 1UZWA 4I0AA 1RUD3 5EWSA 2J22A 1HRI3 4I0WB 2VZOA 3T08A 2VOVA 3FLPA 1LOEA 3POIA 4FQ4A 4DXSA 5C8CC 5I0SA 2J1UA 2YDEA 5B4NA 2Q8OA 4FFIA 1TQ5A 1ZYBA 4Y1YA 3ZPYA 3ETPA 5H9RA 4Z8BA 1LOFA 4CU6A 1UMZA 2X09A 3UJQA 4ZHNA 1S0GA 5EFUA 1UMHA 4TZDA 4AHXA 1EUTA 1W2NA 3NWKA 2WZR3 5T3NA 4MHRA 5A7WA 1W05A 2YYOA 4XCBA 1TE1B 1VBE1 2D5FA 4GKYA 4QDQA 2YV8A 3H8XA 2FZ1A 4E4SA 3KV9A 4LBKA 1EPZA 4Y1UA 4AEDA 4CCJA 4HZFA 3NNMA 1SDWA 1R1A3 1XNDA 4EQVA 4K21A 3J7MA 3MPPG 1ZZ9A 4HMZA 2H0VA 2JG9C 4H7LA 4LBQD 3USSA 4WVVA 3NAPC 1PO21 2XJRA 2Y0IA 4S2FA 5JPNB 4HLTA 4QX0A 5LA0A 3ON7A 3CZJA 1QDCA 4JHTA 4LMFA 1UOFA 2J1RA 4Z07A 2J42A 5FP9A 3IMMA 5FY5A 1RHI2 2JE8A 3ZSMA 1NCRB 1KS4A 2VAUA 4FAHA 3P1IA 1D4VB 3VDDC 1Y9GA 1BLZA 4NMIA 1OI6A 5L7OB 3I2OA 3N7MA 4JX0A 4W65A 2YGMA 4FOWA 4FPLA 5J48A 4D6RA 1TZOA 3LE0A 4MXWB 1JZ6A 4CEWA 1BZWA 2E26A 2ZXQA 1POV1 3PU8A 4ES8A 1QJX2 5BNOC 5FZCA 3OSDA 3TOJA 4EN6B 3RZZA 5JI9A 2GP5A 4XABA 3DGTA 1RUG1 5IUQA 3AKTA 1X9PA 3RVHA 4I30A 5HCAA 4RL7A 4BXFA 3N4MA 3RYRA 2GC1A 3MIGA 1OLRA 5FZHA 1RUE2 4I09A 1JYNA 2XJVA 5KHIA 5FZIA 5LBCA 1YRZA 2KA3A 2NMOA 4Q4X1 3OPWA 4NRMA 3VD3A 3WR0A 1IG3A 3OY8A 1HV0A 4UFMA 5FK7A 3VBOC 2WZR1 3VZKA 3ZR6A 4EWDA 3MIBA 1QOSA 2G1MA 1SLBA 3ES4A 3TN91 2Q5TA 2Z2SB 4XOGA 2R061 3WDWA 1ND2A 5HCFA 3NMBA 2XVGA 3VKOA 3OD0A 3I49A 3OUJA 2ZMLA 3SITA 4LO5B 1AR93 1PGL1 4NE9A 4SBVA 4GB31 1PMHX 1K5MA 1VR3A 1WZXA 2OIIA 3B3QE 1WBFA 5JOWA 1DZRA 2PLV1 5DQ0A 2VMIA 2IXJA 4LOSA 4QHZA 1L3JA 3WF4A 1NG0A 1S0BA 4R9BA 2Y6LA 1G9DA 1L7LA 3MFCA 2D6KA 2DVFA 1JU3A 2VCBA 5LRRA 2R16A 1W03A 2AEZA 1SCSA 5LBFA 4CDQA 3PVBB 2XG3A 4KWJA 2CL2A 3K3NA 5BPXA 3WW3A 4JKKA 2HH9A 2NQYA 2ZA9A 5JXJA 5JOXA 1ZVFA 1JYIA 2ZEXA 3GBFA 4L92A 3MIEA 5EYXA 4XUTA 1OFSA 1OXCA 1IS4A 2FDFA 1SPPA 2GN3A 1AR83 4E4ZA 4NIIA 3KM5A 3R4DB 1DF0A 3HNMA 1IGOA 2FMYA
chains in the Genus database with same CATH topology
1RVF1 2XBO1 2MPFA 1MZ5A 4L97A 2WKKA 1HRV1 1HDKA 2ZGMA 3W58A 2HWF3 3KD4A 4K6BA 4AYUA 1ZRCA 4Z1VA 4XXAA 1AYM1 3FZ3A 1NLSA 4N53B 4WVWA 4Y5Z0 4BPZA 4J1WA 4IV1C 1MQTC 1VBE2 4AVTA 4Q4X3 1V6IA 3NV3A 1KDMA 2I74A 3M8LA 1LOBA 3H9AA 4RS5B 5CBLA 2KXLA 1M4WA 1JW6A 5FO7B 4E2GA 4QHBA 2XVKA 5EZWA 5BY5A 2X5IA 2DVAA 4Y1XA 4OLLA 3MW3A 1ZZ7A 1BQPA 1N3OA 4HANA 2Z42A 4LEJA 1HXS2 3ELNA 4RQPB 1MZ6A 4FXKB 2A3WA 1MVEA 2QFEA 1CESA 2D97A 2NM1A 3VZOA 1RL3A 4C1WA 4P9IA 3V0AA 3IWZA 2ENRA 1QQP2 5F6LB 2CWMA 3VUOA 1U5IA 2IXCA 1D2QA 3AXEA 5KC5A 2XLFA 1RTVA 4PLMA 3AYCA 2P2KA 3RWNA 4F83A 2LM3A 1WD3A 1AR81 2DCJA 2RS11 4UBHA 4QPGB 4CEYB 3WDUA 2R071 1PM7A 1VIWB 3B69A 1RVF3 2XBO3 3VKLA 3NAPB 1B35A 1MQTB 1HRV3 4IEXA 1LEMA 3K48A 1RUE1 2YROA 4PCRA 4XJAA 1QQP3 3S30A 1RUD1 2WJSA 2WL1A 3LOIA 3H7JA 4KBBA 5CFCC 3UV9A 4OHWA 4IV1A 5JSOA 4D94A 1RUI1 1UAIA 3T1MA 2UURA 1CQ9A 1GKBA 1YIFA 2VMHA 1GYKA 4BCUA 1V6KA 4YZ3A 2Q0AA 4ZKTB 2HEYF 2VUAA 1OFNA 5A32A 5DUVA 1HXS3 4Q26A 4DRRA 3CJIA 2VNRA 4EWEA 2BBVA 1RUD2 1UPSA 3M7AA 2O8QA 4AGGA 4Z92B 3FFZA 3VV1A 1VBE3 1VBA1 3THTA 4OI0A 2ET7A 2VPVA 5K9YA 1MS9A 4Z2WA 4P9WA 3SNMA 2DCYA 1QOTA 2HWB2 1O3TA 1PO23 4RHV2 1H4GA 1CAXA 1IKPA 3E6CC 1JUIA 1RMU2 3FUQA 1ZBE1 5L7OA 4HVRA 1URXA 3H3ZA 1QJY1 4P9XA 1QNWA 3VBRC 3GNEA 4XFBA 3R6SA 4LHLA 1U5ZA 1YJLA 3HD8B 4MXWA 5A33A 4DS0A 1BBT1 1AL0G 2WSUA 3ZIXA 2B46X 1NXMA 1UZYA 3I2DA 4CDUC 2GAUA 2UY9A 3H3UA 4WZFA 3ZXJA 2V5YA 3VBHA 3AKSA 1N1TA 2HYKA 1QQP1 3MZHA 4Q0PA 5CFDB 1ZZ8A 4FP3A 4B8EA 4C0BA 1H1AA 2A5ZA 4YZ1A 1LEDA 1Q3EA 1OPMA 5I8YA 4YVSA 3HAGA 4FOVA 4Q0SA 2NZ9A 2WNUB 2OUHA 2Z5WA 4IETA 2X8KA 1W39A 3LB9A 2R6QA 5D8AC 4DZGA 1HXS1 4QQOA 2RS33 2ZX2A 1GZCA 2ZGPA 2HWD3 1QY4A 4JC1A 1ENQA 4KGGA 1UKGA 4RGGA 5DZEA 4YRDA 3DL3A 1WCSA 3OJBA 4AG4A 5JLVA 1VBA3 1XYOA 2R063 4HKLA 3MGUA 4O9GA 2IZWA 4AQSA 1VP6A 1A6CA 4I0BA 4MGKE 4JRAA 2PA7A 4FTBA 1J58A 4YG3A 3J8F3 1X36A 1POV0 4V1PA 4U36A 4DY5A 1EAH3 1YO8A 2ZGLA 1C4RA 2PHFA 4K1ZA 5GALA 2P17A 3WQ7A 4HK8A 4P9YA 5DG1A 1D0GA 3VZNA 1MS1A 1W6NB 4XQDA 1O4TA 4MVTA 2VNOA 1S0FA 4QPIA 3MIDA 4RGAA 4B29A 5CADA 1CAWA 1LKNA 5T50A 1REDA 1SFYA 4LO8A 2ZOEB 3ZSEA 1B09A 4UW3A 1RUF2 1GZWB 4UW5A 2YC0A 4OI4A 1PGL2 1SBDA 4H3WA 1ULDA 1PZ7A 5IK5A 3E6BA 3VLBB 5EXOA 1RC6A 5JIAA 1CR7A 1V6LA 4WM7C 4LE4A 1O4YA 4Q4V2 3RSJA 3WG3A 3NSTA 2MEV2 4D7TA 1ZBA2 2K0GA 2DCZA 2MNGA 3L2HA 4GALA 3BB6A 3L9JT 3TYJA 1S0IA 5GKAC 4IL7A 4BLIA 1QXJA 2B8MA 1DDLA 4XFHA 3LZZA 4CP2A 5KXEA 2CWSA 4XF0A 2WA3A 4AGVA 2TEPA 5AFEA 1OD5A 2YY1A 4RQPA 1J1TA 3O5SA 2BNMA 2BPA2 1PO11 3WW4A 2DU1A 2DFCA 2ZZJA 4Q0QA 4XFAA 4FAGA 3LA7A 3J8F1 4LLOA 4PLNA 1WW4A 1DGRA 3SH5A 3R4SA 4QQPA 4Q4V3 1H4HA 1AR63 1GFF2 4OVEA 4XFFA 2N7GA 4DQAA 3HT2A 1XYPA 3MI8A 4XTPA 4K3UA 4NHKA 2JX9A 3ATGA 1FATA 4LBQA 1ND2C 4EWAA 3LAGA 1NOVA 1BEV1 3M1HA 3OBRA 3M70A 2NYYA 3JB4C 1G8WA 3TWIA 2ZHMA 2ZMKA 3I7DA 1O4ZA 2ZHLA 3B9CA 1A8MA 1VJ2A 2QQPA 3CJIB 2H6BA 2DV9A 2VOXA 1KJRA 3POYA 4KH9A 5FRAA 4BIFA 2QE3A 1YNAA 3OD4A 4M3CB 2VECA 4EN8B 1TNFA 2IC1A 4FPCA 3ES1A 2YUEA 2Y0OA 4K9SA 3TNPB 5LEKA 1KFXL 4JRLA 3VHOA 3ST7A 4IERA 1VBD2 4PLOA 1JOJA 4I02A 4RD7A 4NPRA 1HV1A 3E5UA 4XMAA 2Q1ZB 3CU7A 1LECA 4LTAA 2JE9A 2VVDA 2RS32 5FDBA 1U5XA 1IS5A 1ZBE3 2YZ4A 4KGQA 1QJY3 1RUI2 1LENA 2Z69A 1D4M3 4GWNA 3VN4A 2ET1A 4PDWC 1RUNA 1XQNA 2QCSB 2D40A 2I2SA 5DUUA 4QPIC 3VBHB 4HN0A 4XJ8A 1H8VA 2XWJB 2D7FA 1GSLA 1JYCA 4Q4W3 3EJKA 2EXJA 4RHV1 3WHTA 2WNUA 3SHRA 3IN9A 5ABJB 4NWWA 2A75A 3USUA 1KS5A 2E53A 1G86A 4ISQA 4CDXA 1ZRFA 3DF0A 1S1AA 4Q8LA 4UW6A 4IV3B 2HWE1 2HWD1 1LESA 3BPZA 1ZZBA 1REEA 1F9KA 2A71A 4LBNA 3M3OA 1FAYA 3VBFA 3H1WA 4FOQA 2O8OA 3V65A 1NQDA 1OPOA 1NCRC 2BVVA 4WM7B 3NV4A 2A6WA 3IPVA 4Y1VA 4AFCA 3KSCA 3VDDB 3LCPA 1J3RA 1YJKA 3OCPA 1AR62 1AYN2 1R092 4ZU5A 1H1IA 1ND3C 1G9CA 4FBFA 3EXUA 2RR13 1PNFA 1SCRA 1G9AA 3N7LA 1PGW2 3NW4A 2P34A 3D5OA 5C9AC 5CNAA 4QPIB 1NYWA 2RMU3 3PVOA 2LUWA 2JJ6A 3ZIWA 5K7PA 3URFA 2ZGNA 1CAWB 1F5FA 2X29A 1AR82 3RRDA 3O0XA 1FOD1 2EA7A 1NE4A 1ULGA 1V9U3 2GN7A 3MYXA 3B00A 2VW2A 1A3KA 1HRV2 3GZAA 4Q1RA 1BVP1 2PFWA 3PJYA 3W9AA 1BEV2 2P3IA 4W6XA 1H8TB 1RUC3 3MW2A 1CX4A 5CFCA 2ZKNA 4RSUA 1XE7A 5JPMB 4F3JA 3ZN5A 2VG9A 2BYVE 5FLJA 4AFBA 2CYFA 2PAMA 2PLV2 5AC91 2DFBA 2ATFA 4RS5C 1UIJA 1FPN1 1ND2B 4XW3A 2HEWF 3ZXGA 1QJU3 1ASJ3 3BCWA 3ZSKA 4KWKA 2I07B 2C5DA 2RR12 3VBFC 4JGYA 3LSEA 2WINB 2GALA 4ZU4A 2IXHA 5I8TA 3O0VA 1GBGA 2QDNA 4Z82A 2XJSA 5FOJB 1G6NA 4HPKB 1AR71 3CJIC 1NY71 1DBNA 4Q4V1 1OQDA 3D82A 2DVBA 3RPQA 3WW1A 4LBQB 1CN1A 1QOOA 5JVVA 1RB8G 4O9EA 1O3QA 3RJ2X 1AJKA 1D4M2 1EV11 4E4DX 1GQHA 3SH4A 4QPGC 4CEYC 4FPHA 3VBUA 1V9U1 2EALA 5A3LA 4DRVA 1QH6A 2DYCA 3V0BA 4LT5A 1FMD2 2D6PA 3WUDA 3ZDSA 1F8VA 1YLLA 1RHI1 4PDWA 1D0HA 4Q2FA 1S55A 2JD4A 4CDXC 2CAVA 1VB4A 1OOPC 2VULA 2WNVC 4BA6A 4BM8A 3BU7A 1VAVA 2CNAA 1RITA 4E9KA 2XGXA 1ZRRA 3VKNA 5KBFA 4NWVA 2EXKA 4LA3A 1RUJ3 2ZMNA 2ZAHA 4JDNA 3VBHC 4JGYC 4Q8KA 4QD2A 3VBUC 3QCWA 5IK4A 5C6CA 5CB7A 2E9QA 4YM2A 2OZJA 4UW4A 1Z7S1 1LTEA 4CDWB 2D3SA 3KZ4C 4OFGA 4U2AA 4LA2A 4R9CA 3VBRA 1DQ4A 5FO9B 1OMIA 1W6QB 2HWB3 2VQAA 1KDKA 5T5JA 3AP6A 4XIOA 4LO4B 1NQJA 1U0AA 4EN7B 4IV3C 2XUMA 3DV8A 1CPMA 1SQ4A 3FWEA 4YW4A 2ZABA 3U11A 4OUSA 4PIZA 3TBDA 2GMEA 4NR1A 2EXIA 3WXPA 3B5LB 3AJZA 4IEZA 5AVPA 2B39A 4Y4YA 4X6RB 4LE3A 1OOPB 2WNVB 1VB2A 3HN1A 1O7FA 1QJX3 4FPKA 1WW6A 4XIKA 5A3MA 2XJUA 3AKPA 3OTFA 5E88A 2JICA 1VLNA 2JECA 1VBA2 3WDYA 4Q4W1 4AQTA 2WWSA 3USUB 2WFF1 2BFUS 4LO6B 3RYKA 1UIKA 2HWD2 2CGNA 2AENA 1AL22 3WNXA 1C8M2 2UY8A 4IV3A 3ZFEB 3KCYA 2WLQA 2GC3A 2SLIA 4NHMA 2XBO2 1RVF2 5E8AA 2UYBA 1LODA 1F2NA 5JIUA 1S0CA 1YUDA 3A4UA 2R0FA 4EROA 2A6VA 2RS52 1PK6C 1R083 1PVC2 2BFUL 5HBAA 2W39A 3ACLA 4DFSA 1N3PA 4WM7A 5J37A 1C8M1 4ITCA 2WT1A 3VDDA 1KQRA 4WM8B 3WLUA 4YG6A 2Y38A 1NCQC 5EV7A 1Z7S3 3MFAA 2A7AA 4MX3A 1VRH2 1CAXB 2GSYA 1N1VA 4XFGA 1QWRA 4AEJA 1R1A1 4GIQA 4BOWA 5T5LA 3FHIB 1C1LA 1BKZA 1AL23 1AXKA 3LA2A 5I93A 1U5YA 5GZDA 4Y1ZA 4I3PA 4ASMB 3AYDA 1DGRN 2ERFA 4EV0A 1LOCA 2AR6A 4QU2A 2FZ2A 5L73A 1C57A 1VRH1 1R1ZA 1O3RA 2UWAA 3EBRA 1NZCA 1MR5A 1J3PA 1AYN3 1R093 2QZ3A 4N43A 4Y26A 1ZA4A 4ONUA 1RGSA 3ZXFA 1H8TA 1CD3G 2QZ2A 4Q4X2 1ONAA 5CFDA 1BCXA 4QGLA 4OHZA 1TNRA 2W08A 1RUH1 4I01A 4YVSB 2BW8A 2R49A 4R9AA 1A78A 1S2KA 3H7YA 1GQGA 4XF3A 2PHLA 3ZMNA 4AI1A 1RUG2 2PHTA 4GKXA 4AVVA 1W6PA 3IMNA 3ILRA 4HETA 1FT9A 4FPYA 3GZTB 2VOKA 3H8UA 3D0JA 4JGZA 1EP0A 2VMGA 1S0DA 1SLAA 4LR4A 4OHYA 2RMU2 2O0OA 2XHKA 2ZBJA 3N7KA 1TME1 3OYWA 3TN93 2ZGQA 3TAYA 4A7KA 1COV2 1H2NA 3HQXA 2BVBA 3D8CA 4NN0A 2PN5A 2XJPA 2D6OX 3WY6A 1OA4A 3O12A 2D5HA 2XL7A 2E51A 3BIWE 2DTYA 4META 4E27A 5L19A 5LK5A 4XZPA 5K0UB 4M3CE 3VBUB 4LBOA 3ZXDA 4Y22A 3ASIA 4AFDA 1GZWA 1VBC2 1IOAA 1C1FA 3B01A 3KLSA 4LBJA 4ATEA 2MEV1 1SLIA 4S2DA 1XNBA 3V0BB 5I91A 4XTMA 4PDWB 4PIYA 3CNAA 3VKMA 3AZYA 1VBB1 3G6JB 1APNA 1XNCA 4COWA 3ILFA 5K8SA 3POWA 4KG8A 2HWC1 3WCRA 2XB6C 3RMYA 4YW1A 1DLLA 1QXPA 3QOPA 5HXVA 4XFCA 4BE3A 4JCKA 3VBSB 2RM22 4HBNA 2KM2A 1DG6A 4Q0VA 1BMV1 1KFUL 2BEOA 4AI3A 3ZFFB 4G3YC 1WA4A 1AJOA 4R9DA 2UU8A 4BMEA 1AX0A 4CDWA 1GZ9A 3APBA 4OULA 1TME3 5FO8B 3M3QA 4F8AA 2R1DA 1PIV1 1LOGA 3HR9A 1YFXA 3MLLA 3IIAA 2CV6A 3JQWA 2DTWA 1W6QA 3N36A 2X53S 2UWCA 3ZYRA 5ACA2 1LGBA 4N7IA 4BQ1A 2WIIB 3ALQA 3JBG1 5BNNC 1H2LA 4XJWA 2XH6A 5T54A 2GMMA 2ZGRA 4PF5A 1S0JA 3MEPA 5IK8A 1OOPA 2WNVA 1SLCA 1N3QA 3AZZA 3DPRC 1LR5A 4TLFA 2WFF2 5GLUA 2GC0A 5BNOB 3RQ0A 3WG4A 3GHNA 4XDQA 4FSJA 2GDFA 5J36A 5AFBA 3ECQA 2RS13 4GMP0 4MUVA 1Q8SA 2VW1A 1QF3A 2P37A 2F6BA 4FCAA 4P9GA 5DDJ1 1I6XA 4MLOA 1SBFA 3H50A 3ZFEA 1DQ6A 1SFNA 2E7QA 5JI7A 4KQ7A 4AVAA 4YVWC 5C9AA 4M3CA 3P3PA 3D6EA 3SH3A 1RUG3 1BBT2 4FQZA 5IT6A 2EVXA 5LEJA 2DUQA 2R042 4NVPA 3LWCA 2D43A 1FXZA 2XKPA 4YGBA 3WX5A 2K9ZA 1Q8QA 2VW0A 3ZXKA 1VBB2 1HX6A 1Z0HA 2ZHKA 4WM8A 1Q8PA 1SBEA 2FBEA 3KT1A 1BJQA 1PVC1 1C8M3 4N90A 3N3HA 4DNYA 1G7YA 2EXHA 3HBZA 5EYYA 2PAKA 4AFAA 4WVMB 1Q8OA 2DVDA 1QGLA 5LK7B 2JDZA 4GB33 4Y24A 3DKWA 4SLIA 4CRQA 1AL21 4I3GA 3JUUA 5C8CB 4YGDA 2ZX0A 4HSJA 3WT3A 2BNOA 4GXLA 3KS7A 1SLTA 3QACA 4AF9A 3PJQA 4INDA 1M06G 1IZ3A 4RA0A 5F9TA 1RUC2 4N7UA 1NA1B 1BBT3 4L8QA 5H9PA 2AZ5A 1C5IA 4H14A 4N9HA 4N53C 5ABJA 1HQWA 1YCIA 4WVZA 5SV8A 5T52A 5JOZA 5BNPA 1SMVA 1O91A 1MS5A 3THPA 2XLGA 1IHMA 1LHUA 2H6CA 2HWF1 2NN8A 2YXSA 4IXLA 4CDXB 3KGLA 3RI8A 3VKFC 4CP0A 4YARA 1HRI1 2QJVA 4XEZA 3S7EA 5K0UC 1J59A 2FMDA 3GBWA 4JGZB 4XJZA 1WCDJ 1TME2 1BXHA 1WW7A 5BNPC 4X8PA 4Q4Y1 1LULA 3O14A 5TSWA 3VBFB 4GMP3 3SMHA 5C4WA 2XVLA 4C0HA 1ZX5A 1N1YA 1LOAA 2ES3A 1FNYA 3IPVB 3JD73 1LU1A 2HEVF 1Z78A 3KT7A 4CDUA 2ZHNA 4QGNA 4AI0A 2BNNA 3ZO0B 3AM2A 1IS3A 5J7MA 5AVAA 4GH4C 1VBC1 1F5JA 2A70A 3A0KA 1GANA 1U12A 5K0UA 4BLJA 3IM0A 4Y22B 1KITA 4M3CF 4GB32 3ZFFC 4FTSA 1MS8A 2JG8A 3GYDA 2JKBA 5CG9A 4XF1A 1H8TC 1Q8VA 3FBYA 1ENXA 2Y26A 1DFQA 1DQ0A 3J9SA 2R30A 1NE6A 2YHJA 3D0SA 4ORFA 1VBB3 3WG1A 2EAAA 3G7DA 5CFCB 4B3NA 1YHFA 2R043 5JZGB 3LOBA 4CZSA 3AKQA 3DUIA 1IS6A 1LRHA 1UD1A 2AGSA 4K40A 3RNSA 1YYNA 4COYA 4JGYB 2RE9A 2WC2A 4IEOA 3RI9A 4LLFA 4ZU7A 3MDPA 1X8MA 3O0WA 3IBMA 4XYXA 4X6QB 4E2QA 3MW4A 5FLHA 3UJOA 4HVQA 3PNAA 3H1MA 3I4IA 2BWCA 2NPIA 4HPKA 3D4KA 1Y43B 2V73A 1CVNA 1R1A2 2NMNA 2PYTA 3KT4A 4WM8C 2XPJA 1X8EA 5DZFA 1AZDA 3JZVA 1X50A 2PHDA 5F5QA 2ZKLA 3KCXA 1NXD1 4FP2A 3JBG3 3ENRA 2AH2A 3HIFA 1NLRA 4XFIA 5ACA3 3AP7A 5JOYA 1MS3A 4Y20B 1YIPA 5BNOA 3VZLA 2QDRA 1W6OB 4WBBA 2V09A 4BWOA 4QX5A 2PTMA 4B4RA 5JR7B 4RR3A 4H55A 2WT2A 2QKDA 2DF7A 3K51A 4GWMA 1X33A 1REFA 2R041 4FPOB 2B9UA 4AXOA 5C9AB 1PGW1 2CAUA 4GA9A 1WMFA 1Y9QA 1XXNA 2VQ0A 3VHRA 2B42B 2JEMA 3JBG2 3X29B 3ZXAC 3MIHA 4JDMA 4IEYA 1DGWX 5CU1A 4YVWA 4OHXA 4K8FA 1AYM3 1C28A 4L11A 4PBPA 3VZJA 1V6NA 4AGRA 2WQZC 3PTYA 1UN1A 2PHXA 4D7YA 3U07A 2R1BA 5BV6A 5E16A 3L2YA 4IEWA 1JBCA 4RR3C 3AFKA 4WVMA 1K5MC 2ZJCA 1NCQB 3WP6A 3WQ0A 3ZN6B 3VBRB 5FCCA 3WINE 2A3XA 3NV1A 1CJPA 4KU8A 2A6ZA 4AE2A 1FX5A 2F4PA 5KHKA 1QNYA 2WNEA 3CO2A 5DDJ2 3OF1A 4XETA 1QHDA 3WOGA 3AMHA 1GR3A 2VUJA 1YFYA 2W0XA 1HKDA 3AZVA 2SBAA 3ZX7A 2DU0A 4FXGB 3BOPA 1OSGA 1AYM2 4P14A 1Q43A 1HW5A 4FPGA 1D4M1 3FMGA 3BOWA 2VVEA 2PHUA 5CA6A 4B4QA 3ZFEC 1AVBA 3I8TA 4MGYE 5F1RA 3B94A 4K7JA 1ULEA 1LU2A 2ZTNA 3E97A 4OZXA 2R073 3SISA 4JTOA