2CV6A

Crystal structure of 8salpha globulin, the major seed storage protein of mungbean
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
397
structure length
366
Chain Sequence
SVSRGKNNPFYFNSDRWFHTLFRNQFGHLRVLQRFDQRSKQMQNLENYRVVEFNSKPNTLLLPHHADADFLLVVLNGRAVLTLVNPDGRDSNILEQGHAQKIPAGTTFFLVNPDDEENLRIIKLAVPVNNPHRFQDFFLSSTEAQQSYLQGFSKNILEASFDSDIKEISRVLFGSQQEGVIVELKREQIRELTKHADQPFNLRNQKPIYSNKLGRWFEITPEKNPQLRDLDMFIRSVDMKEGSLLLPHYNSKAIVILVINEGKANIELVGQREESWEVQRYRAELSEDDVFIIPATYPVAINATSNLNFFAFGINAENNQRNFLAGEKDNVISEIPTEVLDVTFPASGEKVQKLIKKQSESQFVDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Seed storage protein
publication title Structure of 8Salpha globulin, the major seed storage protein of mung bean.
pubmed doi rcsb
source organism Vigna radiata
molecule tags Plant protein
total genus 89
structure length 366
sequence length 397
ec nomenclature
pdb deposition date 2005-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00190 Cupin_1 Cupin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2cv6A02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2cv6A01
2PA7A 1JUHA 2QCSB 3SXWA 4HVOA 2Y0OA 1J58A 4OLLA 4TLFA 4QGLA 1XE8A 2PYTA 3WW2A 1EY2A 5FPXA 1UD1A 3OCPA 3DN7A 4N9IA 3QOPA 2H0VA 4NVPA 4ONUA 3H8UA 2EA7A 4MGZE 3RYRA 1O5UA 3I59B 4A2UA 4XF0A 1NYWA 5FQ0A 5JAXA 2IXLA 4AVCA 5E1RA 1YWKA 3U11A 5I8YA 5C6CA 2PTMA 4IEVA 1G6NA 2GAUA 4FAHA 4HZFA 4IERA 2VECA 3KMHA 3BPZA 1YFUA 2I45A 3OTFA 4K8FA 2C0ZA 4MZUA 4N9HA 3DV8A 4B29A 4I09A 1UIKA 3E6BA 1ZZBA 1YLLA 1NE6A 2BNNA 4XFAA 1J1LA 3D0JA 2GU9A 4LEJA 1NXMA 4IEZA 3RNSA 4MGKE 3G7DA 2BNOA 3SCGA 4AQ2A 3OGJA 2ZCWA 3MYXA 3RYPA 1VR3A 2IXCA 3I7DA 4GULA 3CLPA 1XE7A 5I0UA 1ZRDA 4RD7A 1H1IA 4IEUA 4XFBA 3L2HA 4PJYA 3FJSA 1CAWA 5J7MA 4LA3A 1ZRFA 1IPKA 1VJ2A 2B5HA 5KHIA 1ZZ6A 3O14A 2XLGA 4EWAA 3ETQA 4UBHA 1PM7A 3UKVA 1DGWA 3CEWA 4WBBA 1FI2A 1OD5A 4H7LA 4KU7A 1ZZ8A 5JSPA 2VQAA 1X8EA 3FWEA 4J1XA 3USSA 1RC6A 2IC1A 3E6CC 1YFXA 3S7EA 1RUOA 3QACA 4QMAA 2XKPA 3EQEA 4QXKA 3RZZA 4XF3A 4EV0A 3LWCA 5CADA 1J3RA 3ELNA 2ATFA 2D40A 2XLAA 2ETEA 4BHPA 1H1MA 4Q0QA 5KBFA 3R6SA 2GH2A 3E5UA 2ZKLA 2HKXA 4LTAA 4XETA 5E16A 4YNIA 3SHRA 3JZVA 2EVXA 3DKWA 3HT2A 2WFPA 3B02A 1CAVB 2QVSB 4LUMA 5J3UA 5FPZA 2CAUA 1FT9A 3IDBB 2PHLA 1SFNA 2Q4SA 1IPJA 3ZDSA 1CGPA 1ZVFA 2OPKA 3BB6A 4META 2QDRA 1ZZCA 4Q0PA 1O5LA 2EAAA 4IETA 5LEJA 3N4MA 2XL7A 2P17A 3KSCA 1EYBA 3BCWA 2UYAA 4KL1A 4IEWA 3M3IA 4R8HA 3EO6A 4AXOA 3KGZA 3U10A 1WGPA 1J3QA 4HVRA 4KWLA 4PIXA 5LRSA 3OD0A 1UPIA 2XHKA 4KWKA 2KXLA 1ZNPA 2IXHA 4IEXA 4D7SA 2H6CA 4LLOA 2OZ6A 5I8SA 3ACLA 2QNKA 4E2QA 5I0SA 4ZU5A 5I91A 1X82A 5FLJA 5JR7B 3E97A 2PHDA 1LRHA 2Q0AA 3H3UA 4I0AA 3SCHA 2MHFA 3IDCB 2OA2A 2MPFA 3CJXA 3MDPA 4IESA 4O9EA 3D0SA 3RDIA 2O8QA 1EPZA 3BU7A 4KWJA 5KHJA 4L11A 3FZ3A 2O1QA 5I93A 5KHKA 2QJVA 4IEOA 1CAUB 4D7TA 2D5HA 5BV6A 2UYBA 4HN0A 2OZJA 3VHRA 4YSFA 1LKNA 3HT1A 5BUVA 4HLTA 3E6DA 3FHIB 1YUDA 1RUNA 3LOIA 3LA7A 2IXKA 4UXAA 2XGXA 2IXIA 3S7IA 2D5FA 1LR5A 1I5ZA 4QM9A 4JTOA 4F7ZA 1NZCA 3H9AA 5I8TA 1UIJA 4MH0E 4Q0SA 4XF9A 3ST7A 2CGPA 1CAXA 4Z07A 3M70A 2V09A 3FX3A 2E9QA 4YYOA 4ORFA 5AVPA 4J1WA 1J3PA 2PAEA 2VPVA 4XF1A 4WZCA 4JV4A 2UY9A 3WW3A 4X6RB 4OFGA 4QX5A 1WA4A 1ZX5A 3LZZA 1DZTA 4IEQA 5EFUA 3UKNA 1FXZA 3LA3A 1QXRA 5HI0A 3I59A 2OYZA 4F8AA 3IIAA 1ZRRA 5KHGA 3CF6E 3ES4A 3CL1A 2PQQA 4XFHA 3NL1A 3PNAA 4PIYA 3RYKA 4HBNA 4JTNA 3KGLA 5I0RA 3NW4A 5LEKA 2PAKA 1PMIA 4YRDA 4LULA 3HIFA 4Q0VA 4BYYA 3DL3A 3BALA 4X6QB 4IEYA 4FT8A 4HN1A 3H50A 4HVQA 3SCFA 4Q29A 3EJKA 5JSOA 1OI6A 2PAMA 3C3VA 3IBMA 1VP6A 1CAUA 1CAWB 4XFIA 1DGRA 3D82A 1XRUA 2DCTA 5J48A 2PFWA 2FQPA 4BH9A 4EWDA 1Y3TA 4Q0UA 4MGIE 1QY4A 4LUKA 4ZU4A 1X7NA 2ET7A 1NE4A 1DZRA 1RTVA 3SMHA 3U0ZA 4HSJA 3ROUA 3RPQA 2UY8A 1ZREA 4QGNA 1O7FA 1HW5A 2XL9A 2BGCA 4CYDA 5KHHA 3MZHA 4HMZA 4XF4A 1SQ4A 1TQ5A 1CX4A 3PVBB 4KU8A 2CAVA 3LA2A 5FDBA 4YARA 4E2SA 1ZZ9A 2F4PA 2K0GA 2WC2A 1OFNA 2GC3A 1ZZ7A 3NVCA 5C8WA 1Q43A 1YFYA 4JVAA 2XLFA 5FLHA 2CV6A 2Z69A 1I6XA 4FAGA 1QXJA 4EWEA 4ZU7A 1U12A 5FCCA 1QWRA 3H1MA 2ET1A 1V70A 1Q3EA 3E5QA 4I0BA 3TNQA 1LB2A 5K8SA 1YHFA 2Q30A 3LAGA 1SEFA 3H7YA 4FBFA 1O3TA 4QM8A 2BNMA 4O9GA 1Y9QA 4MX3A 1CAVA 3OF1A 1ZRCA 2MNGA 2K9ZA 4XFGA 4Z82A 3E5XA 3H7JA 5CU1A 3EHKA 2H6BA 2D93A 3FE5A 3MPBA 3KCCA 3UKTA 3S0MA 5LRRA 4WVZA 1O4TA 5FQ0B 4UBGA 4MGYE 1X8MA 2GC0A 3NSTA 2B8MA 2IXJA 4DINB 2N7GA 4MUVA 2XKOA 2FMYA 4EROA 3H1WA 4AVBA 1RGSA 2BEOA 3TNPB 3WW4A 5F1RA 3NKTA 1L3JA 4LA2A 2BYVE 1UW8A 4AVAA 2HJIA 1YFWA 4R52A 3PLQA 2GC2A 3GBFA 4E2GA 1J59A 2GC1A 5FLIA 1GQHA 5CVRA 1Q5OA 4XEZA 2Z2SB 4P9GA 4L2NA 3FFQA 5BY5A 3EBRA 4I3PA 4QGMA 1UCXA 5BXXA 5T3NA 3WW1A 1O3RA 4IEPA 4HSLA 4AQ6A 3ES1A 5I0TA 3NJZA 3H1YA 4I01A 1OMIA 4I2OA 2GZWA 1O3SA 5JCTA 3GYDA 5EZWA 1RL3A 1WLTA 1GQGA 4I02A 3H3ZA 3HQXA 5BPXA 4BIFA 3I54A 3CO2A 1CAXB 4XFFA 2Q1ZB 4MV2A 5JSRA 2B9UA 4XFCA 4PIZA 1O3QA 5D1IA 3IWZA 1EP0A
chains in the Genus database with same CATH superfamily
4Y1UA 3ZXLA 1JUHA 4SBVA 5IAVA 5E8AA 3DGTA 1UOFA 2X53S 3TRSB 5FBZA 1RUG3 2A6WA 2QKDA 3NKGA 4LO5B 5AVAA 4A44A 4CCKA 1POQA 4IV1B 1XE8A 5FYIA 4BMEA 3WW2A 3POIA 4WM7B 1V9U2 5FTTC 4CTEA 4BQ1A 1UD1A 5J36A 1HV0A 2RDNA 1AR91 1BEV2 2I2SA 1JZ7A 1UY4A 1H9WA 4UFHA 1S55A 3QOPA 1OLRA 3KHBA 3K48A 4B3NA 3DEMA 4NO4A 4NVPA 4Q4V2 1G9FA 3RWKX 4XTMA 5J1XA 2K46A 1O5UA 1CPMA 3OGVA 4XF0A 1XYNA 5FY7A 3ZXJA 1YWKA 3AFKA 2YV8A 1RUC2 4EYUA 3POYA 4V1PA 3AVSA 3WG3A 4NAOA 4N7IA 3POWA 1OH3A 4Q4X3 2VOXA 5DZEA 5EYYA 4NWVA 4FAHA 3VD9A 1T6BX 4IE7A 2Q5TA 2XDVA 3KMHA 1WLDA 4KNCA 1ASJ2 4I30A 4NIIA 1VBD3 4WM7C 4BQXA 2UURA 5FZ3A 1QOOA 2WO2A 4N9HA 4A42A 1UX6A 4YGCA 3KF3A 4W65A 5H9QA 4OQ9A 3E6BA 2B9VA 1FPN2 1ZZBA 5CKMA 3KQ4B 1JZ3A 4YVWB 1F15A 4XFAA 1H6XA 1NLQA 4CE8A 1D4VB 2AEYA 3RNSA 4N43A 4W6XA 3ZSKA 2ZKNA 1OVSA 4B1LA 4BM8A 5A6ZA 3MYXA 2DBNA 4Q27A 3NQHA 1ALYA 5EJZB 3P1IA 1VR3A 4MXWA 3U75A 2W87A 3WQ0A 1CD3G 1H0BA 2KR2A 4IE4A 1XE7A 1UU5A 1XNKA 2R062 2WR9A 1H1IA 1Z0HA 3LEGA 2YROA 5FYYA 4GIQA 4LA3A 1VJ2A 3FN9A 2C24A 1ZZ6A 4FPCA 2XOMA 2ZHMA 3O14A 4A7ZA 4YWAA 3V0AA 3ZYGA 4WV8A 4LKSA 3I4IA 2BUKA 3TN93 2J1UA 4UBHA 3WF0A 5FZ6A 2DTWA 4MOAA 4WVMB 4AQSA 2DV9A 1F31A 3FBYA 1DGWA 5JSPA 1FI2A 1OD5A 4LORA 4QPIB 3B93A 3OUHA 1X8EA 2RJ2A 3A22A 5DDJ3 5FOBB 4XBQA 2WNVA 4V2WA 2H0BA 4Y24A 1Z7S3 1VAMA 1YQ2A 4QQOA 2VMCA 3HN3A 4RR3A 3E6CC 1RYYA 3LFMA 1YFXA 5APAA 3URFA 3S57A 3PUHA 2P37A 1OOPB 5L9BA 5IVEA 1DYPA 4RFT0 3PVNA 3HMYA 3TEZA 1UNBA 3EQEA 1NY72 2O14A 4CP0A 4BLIA 1QJY2 2Y0IA 3ZXEA 2CWMA 4EV0A 3LWCA 5CADA 4ARXA 4RGGA 5AFEA 3TEYA 2VBDA 2A75A 2YC0A 3KZ4C 3ZLIA 1OSGA 4Q0QA 1OA3A 3N9MA 1YJKA 4QPIC 1OUXA 1IS5A 2GH2A 3ATGA 2ZKLA 4WM8A 2QQVA 3ZFGC 3M3QA 1UZZA 4Q4W2 3LSDA 4K40A 5JI7A 2JWPA 3ACFA 1FMD2 2BV4A 3JD73 2C9KA 1DP0A 1TG7A 2QQKA 1AR61 2ZGSA 5LCWL 3GDBA 5FPZA 2CAUA 3BGAA 5FZKA 1FAYA 1SFNA 3M2MA 2EF6A 2NLRA 3ZDSA 2E7QA 4IQPA 3TBDA 1I1EA 4IV3C 5T52A 1SPPA 1V9U3 3GCWA 1CGPA 2QBXA 2RS51 4IW3A 1VBE2 1BEV3 2D6PA 4B1MA 5BNPA 4YZ5A 3V56A 1UYZA 4IGPA 3C7FA 4META 5F39A 4NHXA 1RUF2 1D4M1 1W6NA 4Q4V3 1BBT2 1O5LA 4LKEA 3WNOA 4YZ4A 5LEJA 3WNLA 4CCMA 3N4MA 2XL7A 4JGZC 5KC5A 1MZ5A 5DUUA 3VBRB 2P4EA 3UGFA 1GYKA 1EYBA 4NR1A 3WUDA 1VBA1 5FKBA 3MGUA 1RUC3 4KL1A 3W58A 4GMP0 2ENRA 2VW0A 4CU8A 4R9DA 4R8HA 5HXMA 1TVGA 2YFZA 4TTGA 2WLPA 3KGZA 3WDXA 2VXRA 3ILNA 3AKPA 2ORZA 4HVRA 3C7EA 4KWLA 3FUOA 1ASJ3 4C1XA 3H3LA 1COV1 2VD7A 3RI8A 3OD0A 2W1UA 2PLV2 4YVSB 1SFPA 4KWKA 2KXLA 3AMMA 2PHTA 4B4PA 5ACA3 2IXHA 4IEXA 4NWWA 2CGOA 1PIV1 5FKCA 4CP9B 3I2GA 1R1A1 5ERLA 5I8SA 1FPN3 2R071 4FPLA 5G04L 2WABA 5FP8A 2ZS6B 2VNRA 2F4LA 2PHDA 2OKXA 3TYJA 2VH9A 3K4AA 1NZIA 4CCCA 3H3UA 3WNXA 3GNEA 3FUQA 1XE0A 3AL5A 5A7QA 3SCHA 4CDXA 2R49A 4XJAA 3IDCB 3V0BA 2JE7A 4IESA 5F37A 1F4AA 3OPZA 1JI6A 1ULCA 2AGSA 2BQPA 1OQEA 2IFRA 4QT6A 3BU7A 2WFF1 2ZABA 1C57A 4BQWA 1WBLA 3M4FA 3I3BA 1GP5A 2R063 2QJVA 3NV4A 2G1MA 1JUIA 1D2SA 4Q4Y2 1ND2C 4XUOA 5FO7B 3VBSC 1UXXX 4HLTA 4YVSC 1YUDA 2AR6A 1RUNA 1WCKA 4CEWC 3B7MA 3NJYA 4PF5A 3LA7A 3MW3A 5C8CB 5F3CA 4COYA 4YM0A 4Z92B 1Q8PA 2QQOA 2XGXA 3GF6A 1LOGA 2HEWF 5BNOA 5DABA 4ET7A 1PZ9A 1DGWX 1LR5A 2BWCA 4DMIA 2JEMA 4JTOA 3RG0A 1LCLA 3POSA 3H9AA 1HRV2 5T54A 4BXSV 4O65A 3CJIA 1UIJA 1UOBA 2JG9A 2XB6C 3QH6A 4ZXKA 4KG8A 5A7OA 5ABJC 4XF9A 2CGPA 4GB31 1CAXA 3AKQA 3AP5A 1L7RA 2BOJA 1OLME 2V09A 3ZOIA 4NHLA 5FJHA 2YU1A 4P02B 4R4XA 2WSUA 3NAPA 3O0VA 2OVUA 3VZMA 2UY9A 1JOJA 5FYCA 1H2MA 1QJY3 5J37A 3AKSA 3N9OA 1DZTA 3GZUC 2B39A 1PK6C 5A3LA 1GNZA 1KXGA 2Y6GA 1U5XA 2E51A 3I59A 4LHLA 5KXDA 3IIAA 5A70A 1FX5A 3KVBA 5IK7A 4YZ2A 4Q4W3 3AX4A 3RI9A 5FZDA 1RUG1 3LEMA 1VB4A 3POJA 5F6LB 3PURA 4FPHA 5I91A 4NIGA 3IAPA 1SCSA 4GMP1 4PDWA 4DS0A 4FFIA 2E26A 3HPNA 4AFDA 1JYNA 4W6WA 2VQTA 5CZKA 1DCSA 2JDKA 5JWPA 3B9IA 5LEKA 2PAKA 1PMIA 3MUZ1 4QB2A 4DNYA 5D2AA 3LDKA 4CUBA 3T2OA 3MUY1 4YRDA 4ZS3A 4CDWC 3SC7X 5LA0A 1LHNA 2J1TA 3GJBA 4N43B 1ODMA 3J7NA 5FXWA 4E8DA 1OLMA 5C3PA 5FO8B 1Y7BA 1QOSA 2G4IA 3HIFA 3IDAA 3PHMA 5FY1A 3T3YA 1RUF3 4GZ9A 2W39A 1OA4A 4MXWB 4AEDC 4IEYA 1X9TA 3AKTA 4HN1A 5CA6A 1VIWB 2XWBB 3AKRA 1HRI1 1OI6A 5DXDA 4NRQA 2PAMA 1HQLA 3CHXA 4FCAA 3N36A 3S5QA 1QU0A 3RZJA 1POV3 2VMFA 4TYSA 1G86A 5FBJA 1VAVA 1ULGA 2J1VA 1DGRA 1H2LA 3D82A 1K5MA 4LBJA 1FYUA 4AG4A 5C70A 5LASA 2YPJA 3V0AB 1KDMA 1XRUA 2DCTA 2VGDA 3KS7A 3J26N 5AC92 1D0HA 2P3IA 4CXWA 3H8XA 1OPMA 2PLV3 1RMU3 2VU9A 3ZR5A 3JCIA 4M4RA 4N43C 1AX1A 4RGKA 2P3KA 4ZU4A 2OUJA 2IUWA 3DPRA 4AAXA 3O1PA 2WNVB 1LGNA 1A78A 4QX8A 3MLJA 1WCSA 1NE4A 1DZRA 3SH3A 1RTVA 4C0BA 3O1TA 4N53C 4RR3B 3ROUA 1W9SA 5LZ6A 2WSVA 1KJLA 4OHZA 2OT7A 2ZX2A 1O7FA 3AMQA 1HW5A 5C7GA 1HN1A 3NO8A 5FZGA 2ZX4A 2GSYA 1SQ4A 5CKQA 1QH7A 1QJZA 3I2FA 5JIAA 3ZXAC 1N1SA 2CAVA 3LA2A 4YARA 5FYTA 3RMYA 5FP7A 4DY3A 2XVKA 3NVCA 3WF4A 3VBHA 2VCAA 1QJU1 2O0OA 4BWOA 1UZVA 3N7JA 4P9XA 5F9TA 4WM8B 2NM1A 1P8JA 1QXJA 2QTWB 1CX1A 1AR82 2ZZJA 1NCRB 2HBTA 3H8RA 2ZMNA 1RUH1 5HCFA 2WNVC 2X05A 5DDJ1 1Q3EA 4IXLA 3E5QA 3OBZA 1TE1B 4LMFA 3KWVA 1LB2A 1W8NA 2GMEA 4OZXA 3LAGA 1HRV3 2MEV2 3AP9A 3WG2A 4DB5A 3RJRA 4ES8A 4FTBA 2B45X 4FBFA 4XPVA 1W0OA 3ZXDA 5F5QA 2NMNA 2RS11 3SEEA 2Y38A 2XQRA 2NPIA 2XUEA 2RS31 1SPPB 4MX3A 3WNNA 2G9GA 5JOWA 1CAVA 4B8EA 2BDRA 1DGLA 4N8MA 4FXKB 3ECQA 5A7SA 1F4HA 2MNGA 3BIWE 3DUIA 1GMMA 5IVJA 1W6NB 2DU1A 2BZDA 3E5XA 3H7JA 4AR2A 2BGPA 4JDNA 4LITA 3VDDA 1HXS2 4YFWA 1FV2A 5FMOS 4B4RA 4XAEA 2R042 2RDRA 3FE5A 1KD7A 3S0MA 2CSGA 1XNAA 4WVZA 2X10A 1FNZA 2BFUL 3KV5A 3CNAA 5FQ0B 5FYZA 1F35A 1UY0A 2YBSA 4MGYE 4GH4C 5CFDC 1DF0A 1PVC2 2GC0A 1KQRA 5GZDA 1XNCA 1S0JA 1QHDA 1ZYBA 5FY8A 3AZXA 2N7GA 4QKDA 2DVBA 4HKOA 1OBNA 4JHZA 2VZSA 2FMYA 1V9U1 4OZOA 5D21A 1RVF2 4MO3M 4LBKA 5FMOL 1BEV1 1S2KA 1XQNA 4Y1VA 3TNPB 5JZGC 1JN2P 2QQUA 1KFXL 4LA2A 2VCMA 1UW8A 4Q4V1 4AVAA 2HJIA 1A34A 1YFWA 2EXIA 3U4SA 3WQBA 4R52A 4F3JA 4XACA 4DUVA 1T2XA 2XBO1 3B00A 2ZHNA 4CDXB 3V0BB 3ZXGA 1J59A 1GQHA 2WNUB 3VBOC 1S1AA 4XIOA 4D3WA 2R7EB 4QKBA 3OBRA 3H42B 1BMV2 2Y6KA 3AYEA 3LD8A 1BVVA 5GALA 3LGRA 1S4CA 2VNVA 2QDNA 4P9GA 5FYBA 2RM22 4L92A 2X5IC 5BY5A 4I3PA 4Y1XA 4QGMA 1ASJ1 2Y26A 4CZSA 3BI3A 5A3MA 5I0SA 3VKNA 5I0DA 2YFUA 1OC1A 2ZGRA 2J1AA 1B35C 1UMHA 2JICA 3VZNA 1GZWA 1US3A 3POFA 1JU4A 2E32A 1FPN1 2OXBA 4GWIA 5BNOB 2WBKA 5A3WA 4ZONA 1AL21 1NLSA 3DYMA 2GZWA 5JCTA 1OH4A 3VKLA 1RL3A 1WLTA 1GQGA 3CJIB 2JG9B 3RZMA 2HWF2 1NLRA 5M0TA 1MS9A 1VAKA 2WS91 3B94A 2XR4A 1CAXB 4XYXA 5TSWA 4G4FA 4PIZA 3OG2A 1EV12 1RXFA 5GLTA 4LK6A 3O1RA 1F5JA 2PA7A 1C8NA 1GBGA 1AYM1 4DXSA 1FATA 1V00A 4OLLA 5DMYA 3NAPB 2VZVA 4TLFA 4QGLA 1KEXA 1F9KA 3N9QA 5B4XA 2D6MA 1W2UA 1EY2A 1HJGA 1PM4A 3POBA 5A1LA 1PHMA 2YB7A 1GANA 5DAWA 4M3CE 2LROA 4RS5A 4CU6A 5K4LA 4N9IA 2JENA 3ZFGA 2HWE1 4LE4A 5IWFA 4RHV1 2HYXA 3VKMA 2EA7A 4MHUA 3ZYJB 3I59B 3J7HA 1TME2 4AFCA 4DXTA 5JAXA 1PZ7A 1AR83 4PLNA 4COVA 1ODNA 5E1RA 2J1EA 3U11A 1PNGA 2OQ6A 1Q56A 5C6CA 5IJRA 2Y64A 4IEVA 5FY9A 4EE2A 4DIQA 4PDWB 3T0BA 3ZKYA 5FPAA 1VRH2 4IV3A 4L97A 5FY5A 4IERA 4K7JA 2MEV3 1GSLA 3LEKA 2VE1A 3MW4A 3BPZA 2BBVA 3QCWA 1BJQA 1YFUA 4K3UA 3KT4A 2Y6HA 1HN0A 1EUUA 4LR4A 3RZHA 1GU3A 4QXHA 4FFHA 4JGZA 4I09A 1UIKA 3ZM8A 4B29A 1U0AA 2ZEWA 4QKFA 2WT1A 2P6CA 1YLLA 2HWD2 1R091 1GOHA 4H7MA 5CKNA 4UYBA 3O12A 2LRPA 2GU9A 4LEJA 1VBD2 4DPNA 1DQ1A 5DPNA 4AVSA 1SDDB 1HXS3 1LEMA 3DXUA 3I97A 4QKNA 1UMZA 2BNOA 2R043 4M3CA 4Q4W1 4AQ2A 3OGJA 4YG0A 1WA6X 3VKOA 2VAUA 2JIGA 4MADA 4PDWC 3AVRA 1FMD1 2B7YA 1K5MB 4LBQD 1DLLA 1ZRDA 4Y20A 2Q8DA 3WD5A 4PQ9A 2DTYA 4ZHNA 3AJZA 3N9NA 3L2HA 2GALA 1SLIA 1JW6A 3FJSA 2VNOA 1Y4WA 1Y9GA 5J7MA 2E7TA 3MV11 4XABA 5B2GB 1RVF3 2RMU1 1VBE1 3U37A 2D3PA 5IT6A 1QOTA 3DPRB 4JQRA 4QX2A 4EWAA 5T5LA 3VHPA 1Q8SA 2Y33A 1GWLA 3E1F1 3PJQA 5FY4A 4NPMA 1BBT1 1YIPA 3DF0A 4Q8LA 2VJXA 3UKVA 4XURA 3CEWA 5FZFA 1AX0A 3EMRA 4KU7A 4L9BA 2NP0A 2JDNA 2ZEYA 1WD4A 3TN92 3BIEA 2W46A 1JYCA 3VL8A 1MVEA 1LEDA 2EICA 4CEWA 4C90A 2ZX0A 5FXXA 1RC6A 5IHRA 2RM23 4ZZ5A 4OHXA 1US2A 4L99A 5DZGA 3WP5A 3VBHB 5JOXA 1N1VA 1O6UA 1ND3C 3QACA 4GA9A 2PLV1 4LHSA 2CWSA 4QMAA 4ARYA 4OUMA 4XJZA 4E4HA 1U5IA 4QXKA 1CZTA 4XF3A 3DPRC 1RB8G 3ZN4A 1OHFA 2DURA 3ZXFA 5ABJA 4DEVA 2IFWA 2B46X 2F17A 1W99A 4OQ8A 4JQTA 3RJ2X 1FNYA 3NNJA 4BHPA 1YQCA 5CEHA 4YW5A 1XXNA 5JPNB 1G9DA 3R6SA 5F7UA 1QQP1 2JDPA 3E5UA 3SNMA 5IVBA 2VZTA 4AE2A 2JX9A 4FPGA 1UX7A 5L7OA 1I5PA 5EWSA 4AWDA 1JMUB 2CGNA 3AJYA 1TNRA 3FLPA 1RUI1 4K6BA 5JIUA 1JZ4A 1EV13 1Q8OA 1CAVB 2WRAA 5AFBA 1MEC2 1RUE1 5J3UA 2QZ3A 3R4SA 1LOAA 2NMOA 2ZHKA 3ZFEA 4E4ZA 1W39A 3VDBA 4Q4Y1 4J25A 1JZ8A 5K7PA 2DYCA 1PK6A 5T5OA 3JD72 3VDDB 4R9CA 3WHTA 4UW6A 1UMIA 2RR12 2ZTNA 3PIJA 2OPKA 5EJ1B 4FTEA 1YO8A 5E89A 5FXZA 1GP6A 2QDRA 1REFA 4AVVA 3RZGA 2FCUA 1W0PA 4AHZA 3QH7A 2LM3A 1BZWA 1ZBA1 3M3EA 1JOBA 1TME3 2HEVF 2YC2A 3KLSA 4QDQA 2WT2A 3ZPYA 3S6PA 1HRV1 1YI9A 4M01A 4LBMA 1LOFC 4YW3A 1APNA 1GOGA 1OKOA 1OF3A 5FZLA 3GZEA 5EJ3A 3JU9A 1HQNA 3WQ1A 3LKJA 4CDWA 1VRH3 4Y5TA 5CG9A 4COWA 2WUHA 1J3QA 1JS9A 3T2PA 1JYVA 1ZRIA 2G9FA 2XMLA 3VDDC 3WCSA 4AEDA 1IOAA 1J84A 4BU2A 1G9CA 5JXJA 3UV9A 5JR2A 3THDA 1ACCA 1UXZA 1HB3A 2OZ6A 3SKVA 3WP3A 3IAQA 3JBG3 4LHNA 4E2QA 1C1LA 5F3GA 1C5IA 3AXDA 2HWD3 2VXJA 5FLJA 5JR7B 5HCBA 3E97A 1JZ2A 4KGGA 5ACA2 3T4HB 1UY1A 1LRHA 2VC9A 4I0AA 1W2TA 2YBPA 4AI3A 4AW7A 1BQPA 1WCUA 1YNAA 2LS6A 2Y8KA 2Z5WA 2MPFA 4O9EA 3OBTA 4K1YA 2NYYA 2BJSA 1OT5A 3D0SA 3HNYM 1YEWA 2O8QA 4HL0A 1MS4A 2VUCA 4KWJA 3S30A 2QFEA 3FZ3A 4A6SA 1GZWB 2OW4A 5KHKA 3OUIA 4Z2AA 2HH9A 3IM0A 4HN0A 3WDYA 5BV6A 5HV4A 1LKNA 3HT1A 2JECA 1R083 2RDQA 3FHIB 2OUHA 3RQ0A 3AZZA 4JKKA 3LOIA 2D6KA 4KWUA 4N53A 5LA9A 1ST8A 5A7NA 4DEQA 4LOTA 2DUQA 3C7GA 4XUPA 1UU4A 5LK7B 2IXIA 1ULOA 5JMCA 1VBB1 1RHI3 3S7IA 3THPA 3LDBA 1H2NA 2G9ZA 2WNOA 4Z2WA 1W6PA 4F7ZA 3VD4A 2FHRA 5KR7A 1EUTA 3OY8A 3SQOA 3UYJA 1UWWA 2J42A 2DVGA 2C6SA 4XQWA 5L9VA 4D94A 5IUQA 4NIAA 2ZAAA 4E27A 3HNBM 2VL4A 1JYIA 2VQ0A 4FPKA 1A3KA 4UFIA 3L2YA 2V4AA 4Z07A 3BUCA 2C9AA 4RS5B 2QUOA 3FX3A 4UFKA 3OYWA 2AACA 4MGSA 3ZFGB 1XJAA 5AC91 2FDGA 2VPVA 5H9RA 1BYHA 3KV9A 4QHBA 2YZ4A 3O1OA 5C3QA 3ZSLA 2VVFA 2WNEA 3D3AA 2BERA 2VMEA 1NXD1 3WW3A 1W06A 2ZGMA 1E5HA 5F5CA 1ZX5A 3LZZA 1UAIA 1GV9A 3LOBA 3QBQA 4LBLA 1FXZA 3IIIA 4S2DA 3WNPA 3NMBA 2CU5A 4IV3B 3HJRA 1YQ8A 1JBCA 2YDEA 3WEZA 3HBKA 5HI0A 5CG8A 1LNSA 1AJOA 3TEWA 5FUPA 2AEZA 3U4XA 3BOWA 1EPWA 4XJ9A 1K12A 1W8TA 2E7AA 3PNAA 1LHWA 2A3XA 1W04A 1MEC3 2P3JA 1N3QA 3MF9A 4HBNA 4RS5C 1HLCA 1W2AX 2ZGQA 3FMGA 2RHPA 3I3DA 3P3PA 4JGZB 5LY1A 3ORJA 4XJUA 4OI1A 3NW4A 5L19A 1ZBE1 2FCVA 2VW2A 3OD4A 1VMJA 2LALA 2WZ8A 1C1FA 2PN5A 2VG9A 1V6JA 4LULA 3J8F2 5CFDA 3KF5A 4GH4A 4E4SA 1AR81 4M3CB 2RR13 4PHZA 1G9BA 5A1FA 4Q0VA 1X33A 1DQ5A 1H8VA 2A1XA 1GICA 3BALA 4TXWA 3ACGA 4K20A 4X6QB 4YM2A 4EZHA 3H50A 2HLEA 4Q29A 1H1AA 3EJKA 3IMMA 4RA0A 4Y20B 3AK0A 3SCFA 3BTYA 4XZUG 5JZGA 2FDIA 3M8LA 1GP4A 1RIRA 4QD2A 1CAUA 1QJFA 4B7EA 5FK8A 5DG2A 4XFIA 2EALA 3HNMA 2Y60A 3ZO0B 4HPKA 2IZWA 5B4NA 2WJSA 3SLIA 2HWC2 1R1ZA 1VB2A 1GNHA 3ETPA 3VBOA 5A1AA 3HR9A 2PFWA 5F32A 1OQ1A 3RMXA 1Y3TA 4LQRA 5EXOA 4MGIE 1QY4A 2QQMA 3P3NA 1VBC1 2ES3A 2X5IA 5J96B 3VBSB 1ND2B 4P9WA 1H2KA 3PUAA 1RMU2 4OUEA 4CEWB 2RV9A 3QD6A 2W5FA 1CQ9A 2WO7A 2VW1A 1B35A 4LBQA 5SV5A 1PVC1 3MIDA 2XL9A 4XJWA 4TN7A 4WZFA 1PGW2 1HJFA 4XF4A 3WNKA 5IFTA 3MZHA 1XSQA 3GBGA 1AR71 4NJ4A 2BW8A 4E2SA 3ME2A 5JI9A 1YQ6A 2F4PA 3DKQA 2JDMA 1RINA 4FFGA 3VBFA 3AZYA 1XB9A 2R16A 4QDRA 5ABJB 3W5NA 2WWSA 4V2VA 2PMWB 1RUD3 2CV6A 2PQSA 4LT5A 2JE8A 3WDVA 4BISA 4FAGA 1TMF2 1S0CA 2FZ1A 1Q8QA 4UW4A 1OKQA 4QDSA 5FMBA 3ZSMA 5L7OB 1DLCA 5LBFA 5JLVA 1IG0A 1V70A 1JODA 1SLAA 4GWNA 4YW4A 3TNQA 5K8SA 1W05A 4NHYA 4XE9A 1NQJA 2DFCA 1C8M2 1S0DA 3B5LB 2FDKA 3ZFEB 2EIEA 3OBAA 4QPWA 2RM21 4ZPIA 1SEFA 5DZFA 4P5YA 1O3TA 4QM8A 1CZSA 2BBAA 2ARXA 2BNMA 4QU2A 1PK6B 4O9GA 4UT5A 4LPLA 4GQ7A 1Y9QA 2VTXJ 5FPUA 4OCTA 1VPHA 5K0UA 2D6LX 1YCIA 1IG3A 1ENRA 4HK8A 5FOJB 5IK4A 1QNYA 4E9KA 4U2AA 4L0PA 4EN9B 4CU9A 4IGOA 4XUTA 5C5UA 4XFGA 3O1VA 4OMDA 4Z82A 1MS3A 1MS5A 2NQYA 1WW6A 2KM2A 3EHKA 4FOVA 1SMVA 1CR7A 4XCAA 2VZ3A 3TWIA 3T30A 4YM3A 2HWF1 5L7OC 3AB0A 3WLUA 3KCCA 1PGL2 3LB9A 5CISA 3UKTA 2JKBA 3A0KA 4CDWB 2W9XA 1DG6A 3D8CA 1AXZA 3K3NA 1DQ2A 5A80A 4XAAA 3ZFEC 1LESA 2B8MA 4KG0A 2VO5A 1WMDA 4KMQA 4AAPA 4AFMA 5A3TA 2DBIA 4UFJA 5A7WA 3ZYFA 4DINB 2AREA 4HFSA 1AL0G 3IPVA 4AEDB 3PTRB 4GJYA 4FVVA 1SLBA 4QB6A 1PO23 2WWJA 3VDCA 3WZ1A 2WL1A 1QDCA 4AVBA 2ARBA 3WF2A 2FBEA 2OQ7A 4OI0A 1LAJA 1L3JA 5FZ0A 3AP6A 2XJSA 1HB2A 4Q5OA 4D6SA 3J8F3 4NRPA 3GBFA 3THTA 5FLIA 1UY2A 4AQTA 4EN7B 3MICA 3ZSEA 4C8DA 1Q5OA 3AMPA 2VZPA 1O91A 4Y1YA 5FZOA 5F8PA 5DN2A 1GUIA 1TZOA 2GH8A 3M7AA 4L2NA 5G05L 1SCRA 3ZIWA 1V0AA 3EBRA 4CXYA 1Y43B 1SBDA 1PO12 3HD8B 4LO7A 3WW1A 4IEPA 3N7LA 4N53B 3WVJA 4RSUA 4Q4X1 5F3EA 1S0BA 1SDWA 4AQ6A 5LBBA 1QMJA 3WT3A 2HWC3 1V6NA 3NJXA 2FCTA 3MIGA 3NJZA 4H2AA 5KXCA 3J9SA 1LJ7A 3SITA 5A33A 3I3QA 4HXCA 3T0AA 1W6PB 1VBD1 1NOVA 1HIXA 2VMHA 4YFZA 5JOYA 3DCQA 4TLGA 4COZA 3CZUA 3OY8B 3KV6A 1OD3A 2D44A 1CIWA 2ZX3A 3JUUA 2BU9A 1RJ7A 2Q1ZB 1ND3A 2WT0A 1GKBA 4MV2A 4XFCA 1O3QA 3IWZA 4DFSA 2AYHA 2VTXA 3ZN6A 1O4YA 4GJZA 1AYN2 3B9CA 2GDFA 2QCSB 5K9YA 4FO9A 2WN3A 3SXWA 4HVOA 5E6HA 1NA1A 1IS4A 3POEA 4NMIA 4S2HA 4A3XA 1WMEA 1O8SA 1REDA 1YI7A 3AP4A 4RL7A 3AYCA 2R1BA 3JB4C 4YW6A 5A32A 1RXGA 1ULPA 3MFAA 4KH9A 3K51A 2DUOA 1LODA 3GALA 2GNDA 3OCPA 3DN7A 4UF0A 4XXAA 3K3OA 3O1UA 3VUOA 3O1MA 2VMGA 2H0VA 3MIHA 4IE5A 1GWKA 2WYSA 4ONUA 4TZDA 1HX6A 3LEIA 3RYRA 4A2UA 1ENXA 1NYWA 1TMF3 2OIIA 3ZVXA 4AI8A 3WUCA 3Q8EA 2YMZA 2O8OA 4LO4B 4AVCA 5I8YA 2R1DA 3HBZA 3TN91 5FZ7A 1AXKA 1IHMA 1REEA 2DVAA 5FZMA 3RSJA 1KJRA 5FK7A 2GAUA 1WZXA 5IAXA 4BE3A 1C8M3 2RJLA 2TNFA 3I3MA 3PU8A 4HZFA 5FZIA 1WD3A 1XYOA 2WAAA 2PXJA 4QB1A 1WLCA 2J7MA 2I45A 2ZPXA 5C4WC 3LDRA 1SLLA 1YYNA 1Z7S1 3N7KA 2C0ZA 3AM2A 4X8PA 2YHJA 4K9SA 4MZUA 5CFDB 1LHUA 4FQZA 4GH4B 4C91A 5LB6A 4YPJA 1LOFA 3RZLA 5BYNA 2WQZC 1NE6A 4LXLA 3CIHA 2VVDA 1J1LA 2FMDA 1SZBA 3AXEA 3MI8A 3OEAA 2W95A 3W21A 2Q8CA 4G3YC 3WX5A 3W9AA 5JZGB 3KHCA 4P00B 3RGBA 1V6KA 4JRAA 3WSOA 2ZCWA 2DCZA 2XJPA 2XJTA 1YXWA 4P5HA 3I7DA 1H4HA 4GULA 4HPKB 4S2GA 1JXNA 3VBUA 3T1MA 4Y4YA 3D4KA 5I0UA 4RD7A 5FZ9A 3VBOB 2XXZA 1YJLA 2A6XA 2DFBA 1IKQA 4XFBA 5IW0A 4PJYA 3Q9OA 3CDZB 3JD71 3MHZA 3K77A 1XNBA 4NROA 3GZTB 5FPBA 1ZRFA 5KHIA 3ZX7A 2VZUA 5J09A 1AZDA 2X5IB 4I0WB 2RJKA 3T09A 3ZYBA 2XLGA 2AH2A 1VBA2 2VOVA 2VZQA 2YXSA 3ETQA 4JDMA 3NNGA 4K1ZA 2ZA9A 5KXBA 1B35B 3VHOA 2K2SA 4LBQB 3AMHA 1ZZ8A 4SLIA 2VQAA 4NPLA 2GN3A 1N1TA 2Y6LA 1D2QA 1COV2 1W8UA 3FWEA 4J1XA 1CJDA 2JJ6A 1YIFA 3DYPA 3MBWA 3USSA 5A6YA 4JKLA 1ENQA 2VOWA 4URAA 1W9FA 2WDBA 1R1A2 3VBFB 4AGVA 2R072 1PO13 1SG3A 1RUC1 4HKLA 4UFMA 4A6OA 2XKPA 5KXEA 1HQWA 4ASMB 1PX3A 5IATA 2GP3A 5C71A 3RZZA 3KV4A 1W03A 3VZOA 1D7PM 5C9AC 5CAZA 5T5PA 2TBVA 2DCKA 1K42A 1WMFA 1J3RA 3ELNA 5CBLA 2YC4A 1SLTA 3D5OA 2ATFA 3LFIA 2WYFA 4DY5A 4DXZA 2ETEA 5ACA1 2WFF2 1C4RA 4M0NA 3FBMA 4LKFA 2ERFA 2D6OX 2HKXA 3GGLA 4LTAA 1PNFA 3I2OA 5CYYA 1NAEA 2GMMA 2SLIA 5ISLA 1C5HA 2WFPA 1RUJ2 3B02A 4R9BA 5EYXA 5K0UB 1YQ5A 2QVSB 4LUMA 3ILFA 1AYN3 2BTVC 3N35A 3VBFC 1FT9A 4YM1A 3X29B 2PHLA 1POV0 1TNFA 2PHFA 3AYDA 3MFCA 4CPBD 2JB4A 4YVWA 2NZ9A 1AXYA 1IQAA 1LHOA 3SH4A 1LGBA 3GJAA 3GBWA 2R061 5EP9A 4QQ2A 3AZVA 3NV1A 4P9IA 3BB6A 4S2FA 1CPNA 2WIIB 4GB32 1ZZCA 2VCCA 1TEIA 3SH5A 1IKPA 4Q0PA 1H9PA 3WCRA 3LCPA 2JDYA 3BTAA 1V6OA 2ZGOA 2B42B 3OEBA 1X50A 3ZYPA 2HYKA 1NKGA 3BCWA 5A7WB 3ILRA 2UYAA 1IS3A 3IPVB 3NNLA 5GKAC 5K0UC 2BP6A 1PGSA 3CMGA 2Z42A 3EB7A 1KDKA 3M3CA 3M3IA 2D43A 4IEWA 4EQVA 4UAPA 4AXOA 4QQLA 1GFF2 3U10A 1CWPA 1HDKA 3F95A 4K8RB 4Y1ZA 4PIXA 3FLRA 3ZR6A 4ITCA 3AL6A 4CUGA 4BZ4A 3VGIA 3GZAA 3MPPG 1W6MA 2PHRA 2EIBA 3C7OA 5HBAA 5LW9A 2H6CA 3UNPA 1OVPA 1D0GA 3ACLA 1QNWA 2QNKA 1IS6A 1H8TC 4RYDA 2JG8C 2UU8A 1X82A 2V72A 3DECA 3MF6A 2XJQA 4Q1PA 4ZU5A 4C0HA 5LK5A 5FZOB 2Z79A 1JTZX 4P9JA 4UWDA 1NY71 3PUSA 4YG3A 1QJY1 3BTXA 3CBNA 3JBG2 5EHDA 3CJXA 2A7AA 2E33A 3MDPA 2VBBA 1OOPA 2WLQA 2WO1A 4XIKA 3AFGA 2CHHA 2TEPA 4BA6A 5GLVA 4NE9A 4MG2A 1EPZA 5KHJA 2A3WA 2J1SA 5LA2A 3FC0A 4G9SB 2W91A 2YPDA 1HB1A 1IQDC 3EXUA 4Q2FA 2YG0A 2VY0A 2UYBA 5FPVA 4D7TA 3VHRA 4YSFA 1BK0A 2D3SA 4AEKA 5A33B 1D4M3 2W92A 1W8ZA 2EIGA 1OURA 3CZJA 4CP2A 2JDAA 5JUVA 4XQDA 5FZAA 2IXKA 1HRI2 5DG1A 2NN8A 2XH6A 1VBA3 1DYKA 2D5FA 1R082 1J83A 1ND3B 5IVYA 3I2KA 4AI1A 4AEMA 3HQUA 4CCJA 4QXCA 2WZPP 1NZCA 4MGTA 3ZN6B 3WINE 1WUVA 5I8TA 4XILA 3VB9A 4A41A 1V6LA 1WLWA 1WCQA 1NA1B 1COV3 2ZGTA 1RHI2 1XC6A 3KB5A 4ES9A 3ST7A 1RUF1 1ULEA 5FZ1A 2VR4A 5GLZA 4CU7A 5A32B 3HOBA 4LJHA 2BPA2 3O5SA 4XBLA 3M70A 3FFZA 3VD7A 2E9QA 2OX0A 3DYOA 4PBOA 1R1A3 1O59A 4UF0B 5AVPA 4I3GA 2R073 4YYOA 2YU2A 1J3PA 4Z8BA 2W1SA 2E31A 3MW2A 4DO0A 1POV1 3O0WA 1PMHX 2PHUA 3B01A 2ADDA 5GZFA 3BOPA 1DHKB 4D0QA 3MLLA 1QIQA 3H0OA 2VOKA 4CP1A 4FP3A 1JZ5A 1WA4A 1QEXA 4WVVA 4FP2A 4UFLA 1JU3A 1PX4A 1UYXA 5EFUA 1RMU1 3LA3A 4MYEA 1QXRA 1W0NA 2WFF3 3T4VA 3T2QA 4HOOA 4F8AA 1DQ0A 1ZM1A 2P3YA 1ZRRA 1NA1C 3HVDA 4FOWA 1W6OA 4JAAA 3H8OA 2Y34A 1PGW1 4QPGC 1QJU2 3FL7A 1RUJ3 4XFHA 3NL1A 4PIYA 1QJX2 2JDZA 1LU1A 1UKRA 3KGLA 3LF7A 4AI9A 5GZGA 5JOZA 1Z78A 2WAOA 3UK9A 4FXGB 2J1RA 3ACIA 4CDUC 1BKZA 2ARAA 3TOJA 3WHUA 3ZPOA 5A6XA 3RWNA 4ATEA 2Q8OA 4MGQA 1W9WA 1S2EA 1L7QA 4BDVB 2ADEA 3TAYA 3N9LA 3VZJA 3JQWA 4BQ5A 1HKDA 2CDOA 2RS12 3U14A 4GB33 3IZOA 4BYYA 1WBFA 2RS32 4YZ1A 1NCQC 3R4UA 3VBUB 2RDSA 1G8WA 2BOIA 3WV6A 2WINB 5FYMA 3LSEA 5DUXA 3O7OA 2PHXA 3IBMA 2A6ZA 1VP6A 5T55A 1MS8A 1O4ZA 4YGBA 5CIRA 4YW7A 3WNMA 3Q8AA 3GXUA 4AZZA 1S0IA 1IPSA 3K2OA 5JVVA 4FFFA 4OMCA 1W9YA 3ALQA 4DQAA 1JZ6A 2FQPA 4GXLA 3R0RA 5F5IA 4NHKA 4QWNA 3ENRA 2VZOA 2BWAA 1XU2A 2FDJA 1X7NA 3U07A 1PGL1 1S0GA 1AX2A 2ET7A 4OHVA 4U36A 1MACA 4DUXA 1NX9A 3SMHA 4GMP3 3VBUC 4HSJA 3RS6A 1I3HA 5FUNA 3W59A 4CEYA 2R0HA 1ZREA 4QGNA 5A3OA 2QQIA 4UOJA 3NJVA 4CYDA 2D7FA 5KHHA 1DQ6A 3WDUA 1TQ5A 3PVBB 2ZX1A 5FDBA 4WVWA 1VALA 1W8HA 1ZZ9A 2XBO2 2CTVA 3C2UA 2VCBA 1AJKA 2WC2A 5L9RA 4QHZA 1JYXA 1ZZ7A 2VUJA 1Q43A 1YFYA 4JVAA 5CFCC 2XLFA 4JHTA 5FXVA 2Z69A 1LULA 4AHXA 4EWEA 4ZU7A 3OB8A 5BNNA 1HRI3 1U12A 2GNTA 1QWRA 2C1FA 5FRAA 5EIYB 2IVJA 4GKXA 3HAGA 1SBEA 2VULA 2XQXA 1RUD2 4I0BA 4LBNA 4BLJA 4IV1C 5F6KA 4AK3A 4QHOA 3VD3A 2Q30A 2WA4A 3IMNA 5A3UA 5L36A 1UYYA 1WCDJ 3WY6A 3BN6A 4DUWA 1DQ4A 1PO11 4XTPA 5DAVA 1ULDA 4XMAA 1DIWA 3BVCA 1AL22 1CONA 3IN9A 3N7MA 5D8AA 3ASIA 1PVXA 1BVP1 1F5FA 2YGMA 2EIDA 2EXJA 3GM8A 3ITQA 3Q8FA 1WKYA 1K3IA 1QXPA 1UZ0A 2WS92 4IE6A 5HCAA 5CU1A 4E4DX 2GN7A 1STMA 4H3WA 1SFYA 4CXXA 3QLQA 2H6BA 1NQDA 1W3XA 2ZOEB 3NNFA 3Q8BA 5KWRA 4HANA 3MPBA 1AYM2 4XVHA 3ZDVA 3KT7A 2I74A 3ZMNA 4M0HA 2QQJA 5C4WA 1O4TA 2IVIB 2VQUA 1X8MA 2HEYF 2R32A 1AYN1 3NSTA 4D69A 1XBFA 4BB3A 1LOEA 5SV8A 2HWE2 2P6HA 4FOYA 2CL2A 3P6BA 4RHV2 1QJU3 4YVWC 1W8FA 4MUVA 1MZEA 5T50A 4CCNA 4CPBA 2Z4FA 4AF9A 1QJX3 1W6MB 4INDA 2ZHLA 4O7XA 2BEOA 4RGAA 4F83A 1LTEA 3WXPA 5F1RA 2W47A 1RUH3 5BNPB 4YGEA 4DXRA 5BNQA 2WZR2 1MQTA 2W08A 4JRLA 4FPYA 4LIVA 4Y22A 5GLUA 2BYVE 5IFPA 1PO22 2WQ4A 4RQPA 1NG0A 5FAXA 4D6RA 4K21A 2XPJA 2J22A 4BJ0A 4D8MA 4E2GA 1MR5A 2GC1A 2W0XA 4QPYA 5CVRA 1EAH2 3RVHA 2RS13 4XEZA 1FOD2 2QQWA 4DOUA 4J6GA 2RS33 4XHBA 4ASLA 3NV3A 3HEIA 1IGOA 4QX1A 2DDUA 3UT0A 1UPSA 3C8XA 2W1QA 4BXFA 4CCOA 4Q8KA 3U78A 1UYPA 5BXXA 5T3NA 1R092 1O3RA 2XVLA 2A6VA 4MSVA 3IB3A 4XZPA 2XJVA 4HSLA 2MEV1 3ES1A 4UW5A 5I0TA 3IKWA 1J1TA 1L7LA 1OF4A 4LIUA 1PZ8A 5LWBA 5BNPC 1NCRA 4H55A 5HV0A 1ZA4A 1E57A 4OI2A 3MLKA 3WP6A 1UZWA 4RN5A 4JGYA 1O3SA 2F6BA 3I2IA 2FDHA 4EJRA 3H3ZA 2HWB2 3HQXA 4GAZA 4MHRA 1OOPC 2ILMA 4BMBA 3CO2A 4CCEA 1ONAA 3WR0A 1UZYA 5JSRA 3VV1A 2B9UA 2ZXQA 2JD4A 4O61A 5D1IA 5JMOA 1HXS1 1EP0A 4JDOA 2RMU2 5C9AA 1UN1A 3I8TA 4W4ZA 2R041 5FFOC 3VL9A 3V64A 2Y0OA 1J58A 2FDFA 3OPTA 1KRIA 2VMIA 3UGHA 2PYTA 2WA3A 4DZGA 1IZ3A 2X29A 4XUQA 1UL9A 5FPXA 3P5BA 3Q8CA 2XBO3 1V6MA 1S0FA 1JHNA 5FYVA 3DXTA 4C1WA 4PBPA 2DCJA 3H8UA 4MGZE 4PCRA 4Q1RA 1RVF1 5FQ0A 4KGQA 2IXLA 5IK8A 2AENA 3LPFA 1W6OB 2PTMA 1CIYA 1ULFA 3ACHA 4LLFA 1G6NA 3MIFA 3FHQA 3UJQA 1CVNA 1XNTA 2KA3A 2WQ8A 3PJYA 2C5DA 1NUKA 4A4AA 2VECA 4LKDA 3O0XA 4BOWA 5A7PA 2GP5A 4AOCA 3WG1A 1KS5A 1ZA7A 2V73A 3WDWA 3K46A 3OTFA 3ABZA 1AL23 4NRMA 1BMV1 4K8FA 4CVUA 1BK1A 3C7HA 3DV8A 1QQP2 5J98B 3VBRC 3J7LA 4QXBA 2ZGUA 3MO4A 2WNUA 2WS93 1ZRCA 4PF1A 3WF1A 4FSJA 2BNNA 2P34A 1RUI2 3D0JA 4FPJA 4QAWA 2WZEA 3OOXA 1NXMA 2OS2A 1RUE2 4IEZA 4MGKE 2X09A 1UKGA 3G7DA 4A7YA 2A70A 5JDBA 3SCGA 1AYM3 4EZ4A 1U5YA 4JKMA 3RYPA 4PLMA 3OPWA 1BCXA 2BRTA 3AZWA 4XQ4A 5FZBA 5FYHA 4AHYA 2TUNA 1RUJ1 5LATA 2IXCA 2P1BA 4XDOA 3SKJE 3RRDA 4CDQA 2Q1FA 3CLPA 2CY6A 3OGSA 1CZVA 1MPXA 2P5BA 3NRUA 2HWE3 4IEUA 1H8TA 3USUA 2JG8A 3B3QE 4RHV3 1CAWA 1OPOA 3CQOA 1EV11 1ZBA2 4CA9A 1IPKA 2B5HA 3VLBB 4NUBA 4FPOB 4A45A 1N47A 1AR92 5A3NA 5HPOA 5GJ6A 1C28A 1Q8VA 4KBZA 3BYWA 3PDQA 4TWTA 1QDOA 2WZR3 3LIHA 4ZY9A 4NHMA 1PM7A 2JKXA 2VZ1A 5EQUA 1QGLA 4XC9A 5ANNA 4CEYB 5JXHA 1A8MA 4WBBA 3WG4A 3PUIA 4H7LA 4W50A 4R9AA 3CU7A 1NT0A 4EN6B 1EAH3 1DDLA 1W8OA 3I3EA 4ISRA 5DQ0A 1FOD3 2E53A 3UETA 5C3RA 3T1LA 1W28A 1KFUL 1O8PA 1TME1 2IC1A 2XUMA 4PI2A 4XDPA 3RYKA 4A7KA 5HCHA 3LPGA 3OGGA 4P14A 5C8CC 1G7YA 2DU0A 4ZXEA 3TEXA 3VDAA 3S7EA 1R093 1RUOA 1AHSA 1XPWA 2VOTA 4BK4A 1VRH1 2D98A 1F8VA 3FHAA 5BNNB 2ZEXA 5CB7A 3UGGA 4M3CF 4YG6A 3WDTA 4GWMA 1VLNA 1E5RA 1F2NA 2ARCA 4UI9L 2XG3A 1JH5A 4BQ3A 3KT1A 5FZ4A 2D40A 2XLAA 1FMD3 5FMDA 1H1MA 1N3OA 4CEYC 4URTA 4B4QA 5KBFA 1X9PA 2WKKA 2VNGA 5DAXA 4TSVA 5FREA 4XETA 5E16A 2HWB3 2XVGA 4YNIA 3JBG1 2ZGNA 3SHRA 3JZVA 1XU1A 4HONA 2EVXA 2HWD1 2W68A 5F5AA 3DKWA 2P2KA 5D8AB 4P9LA 3HT2A 5F2WA 3N3HA 3ZIXA 1K45A 3K4DA 4HG6B 2RMU3 4LNVA 1VBE3 3KVAA 1HB4A 3IDBB 1W2NA 1CN1A 2GNBA 4AHWA 4FI9A 4OI4A 3FLTA 1VBB2 3I2JA 2Q4SA 4YW2A 3ZYIB 1IPJA 3B69A 2JDHA 4QX3A 1BBT3 3G6JB 4IGQA 3ZFFA 1XOYA 1ZVFA 3BODA 5BNNC 3OYWB 1DYOA 2VBPA 3ZKUA 2CDPA 3WQ7A 5DAQA 5LBEA 5DUVA 1RJ8A 1R081 1JYWA 5FMCA 2GMPA 4QPGA 3ZXKA 5C4WB 2EAAA 4IETA 2FZ2A 3D6EA 3BU0A 2SBAA 3HQRA 1YC61 4PI0A 2P17A 3KSCA 1WMXA 2UWBA 1VE0A 2XJRA 4OULA 2D97A 2ZJCA 2R0FA 4QX0A 1RHI1 3W20A 2C4XA 5D8AC 1OLQA 4CDUA 5FIXA 4EN0A 2QZ2A 5DUWA 2A5ZA 3EO6A 1MS1A 2EXKA 4JCKA 1GLHA 1W90A 1WGPA 2Y6JA 2G19A 2ORXA 3VN4A 4PT6A 1MQTB 3PUQA 2VTFA 4Y22B 4BQ2A 2Y6FA 5LRSA 5E88A 2VUDA 1UPIA 2XHKA 2DWRA 1LOCA 5C5TA 4NIHA 4RQPB 2ZACA 3A4UA 1NCQA 1ZNPA 4IUGA 4P9YA 4XXPA 4D7SA 4FTSA 4W6YA 1QQP3 4LLOA 3TB0A 3CKHA 4IDZA 3PVEA 1H30A 5A6QA 1E5SA 5F2SA 1OFSA 4FQ4A 2W2IA 4YW1A 1RUI3 4DRRA 5CNAA 1RUE3 4ZS2A 2Q0AA 4DRVA 3NV2A 3NWKA 4QX7A 2MHFA 5DAPA 2W3JA 3BPSA 1QF3A 2VZRA 2WO3A 4IE0A 2OA2A 2QQNA 2VUAA 4Q4Y3 1VRBA 1ZBE2 3RDIA 1OA2A 1QH6A 3WF3A 5FP4A 3M1HA 4CCLA 1JYTA 4BQYA 3O1SA 4W8JA 4L11A 1QJX1 2JB8A 4YZ3A 2O1QA 4BK5A 1AR62 1WW4A 1SHWB 1DU3D 3K75B 3W5MA 5I93A 2YYOA 4IEOA 1CAUB 2D5HA 1MQTC 2ZBJA 2OZJA 3AMNA 5BUVA 5EV7A 3E6DA 2R6QA 4JGYB 4RQPC 3GHNA 2V5DA 1ZBA3 4RR3C 4HT1T 4XW3A 5FZ8A 1MEC1 2RS52 1Y9MA 5FZHA 3T08A 1AR93 4AFAA 2A3YA 2VMDA 4UXAA 5FWEA 1OUSA 3S5AA 5FP9A 1G9AA 1D4M2 4EN8B 2A73B 5C33A 1I5ZA 2BFUS 1LU2A 4QM9A 2GNMA 3A21A 3POGA 5C9AB 3LE0A 1W6QA 2RR11 1DBNA 3JQXA 4MH0E 4Q0SA 3U1XA 4AVTA 3ZMOA 1GOFA 4AFBA 4BPZA 5CFCA 2V5YA 1GNYA 3THCA 4NIDA 2X8KA 2B4KA 4AYUA 2CYFA 4WM8C 2WWUA 1VBC2 4ORFA 1NCRC 2RVAA 4NPRA 3WOGA 4J1WA 2XJUA 5FO9B 1S0EA 1SLCA 2PAEA 5H9PA 1AVBA 3I2DA 1UOGA 4HK9A 4XF1A 4JGYC 3RZKA 2RE9A 4WZCA 4IV1A 4JV4A 4MLOA 4WM7A 4X6RB 3A0NA 1PIV2 5IYYA 2R30A 4OFGA 3A23A 4QX5A 2ZZQA 5ANQA 4MXVA 4IEQA 2D6NA 3UKNA 2YUEA 4ZKTB 4OHYA 1T6GC 3OUJA 4KBBA 1AR72 2E6VA 4KQ7A 1AUYA 4Q26A 2OYZA 4COUA 1R64A 4R4ZA 4AI2A 3OSDA 5KHGA 3CF6E 3ES4A 3CL1A 2PQQA 4BIOA 4P08A 1BLZA 3PMSA 1VMFA 4QQHA 2BGOA 3UJOA 3AYAA 3SEPA 5L73A 2XWJB 4CUCA 1MZ6A 2VM9A 4Y4RA 3ZYHA 4JTNA 3AP7A 4LHKA 5I0RA 2RG4A 1VBB3 2BVVA 3IDEA 3OJBA 5FPLA 3J7MA 4D6QA 5GM0A 1QKQA 2BVBA 4OVEA 4BCUA 1UF2C 4D7YA 2L9LA 4YGDA 4Y5Z0 2Q8EA 4LBOA 3ON7A 3VZLA 5A3PA 3DL3A 1MZFA 3MEPA 1RUD1 5IVCA 5FP3A 3R05A 4FT8A 3INAA 3KD4A 4CDQB 1MS0A 4NAMA 4HVQA 3N9PA 5FZEA 3MIBA 5JSOA 1S2BA 4M00A 4ATFA 4FPEA 2A71A 2PELA 5FUIA 5JXGA 1GZ9A 3C3VA 1H8TB 4LK7A 3USUB 1N1YA 1DFQA 2JG8B 2V4VA 3PL0A 2ZAHA 3GCXA 1CAWB 4XBNA 3V65A 3RFRA 3HN1A 5FJKA 2HBUA 1UOJA 4KI5M 1OQDA 1LOBA 2Q1MA 1W3VA 5T5JA 4ISQA 5FV3A 4CDXC 2QQLA 5FWJA 5J48A 2WNUC 3PIGA 4Z1VA 2W1WA 4PQQA 4BH9A 5FYSA 4EWDA 1GR3A 1I9RA 4Q0UA 4XJ8A 3LIGA 4B7KA 4X8NA 3SISA 4LUKA 2LW8A 2ZMKA 1JHJA 2ZGPA 3IT8A 4LOSA 1XNDA 4ZZ8A 5JXIA 4QU1A 3MIEA 1OXCA 1UY3A 1X36A 5FY0A 3A7QA 2ID4A 1M4WA 4H14A 4WVMA 4CDQC 5IVFA 3RPQA 3R4DB 2UY8A 4CUAA 3U0ZA 4QPIA 2BGCA 2C26A 5BNOC 2XHNA 1ZBE3 4HMZA 1RUG2 1LHVA 1CESA 2CNAA 1CX4A 1LECA 1W9TA 4IL7A 4KU8A 3KCXA 1AR63 3VHNA 3CJIC 2DCYA 2JG9C 2K0GA 1KS4A 2QE3A 1OFNA 2GC3A 5C8WA 3UESA 2WZR1 1ENSA 2IWGB 3JB8A 3L9JT 4L8QA 5FLHA 5FYUA 4CSWA 1UU6A 1VMHA 1I6XA 2DF7A 1PO21 3GHMA 2RS53 4OUSA 4A3ZA 1M06G 1CJPA 5FCCA 4JX0A 4E8CA 3H1MA 4N90A 2ET1A 3F2ZA 2JIJA 1EAH1 4XUNA 4GD4A 2EAKA 3NAPC 2DVDA 4YLZA 1E5IA 4MVTA 1FOD1 5F3IA 3ZYRA 1YHFA 4FOQA 3VKFC 5GLWA 2XONA 4Q4X2 1W8WA 4GALA 3I49A 3J8F1 4FPFA 3BKZA 1A6CA 1QJEA 3KCYA 2LTNA 3H7YA 1A8DA 4HKWA 3APBA 3EYPA 4JZRA 3ZFFB 3ZN5A 2AUYA 3NNMA 4LO6B 4XDQA 4AEJA 3OF1A 3I2HA 1MVQA 1VBC3 4QQPA 2ZEZA 5JPMB 1BXHA 3LQCA 1FV3A 2ZGLA 1UO9A 1GZCA 2K9ZA 2A6YA 5HXVA 4QPGB 4XHXA 5GZEA 4XOGA 1KITA 2AC1A 2UWCA 2DVFA 4AI0A 2YGLA 2FD8A 1PIV3 1HV1A 1PMJX 2D93A 2OPWA 1PVC3 2HWC1 2HWB1 3OGRA 3VZKA 2YY1A 2KD7A 5LRRA 2VVEA 4Y33A 4CDUB 1AR73 1DGRN 3M3OA 3PU3A 4GKYA 3T2TA 1DZQA 1H6YA 4LO8A 2UWAA 4UBGA 3ZSJA 5H9SA 2PHWA 2JXAA 4XCBA 2IXJA 3VBRA 1URXA 3AC0A 5EPAA 1C3HA 1V6IA 1H4GA 3ZFFC 1NCQB 2XKOA 4UW3A 2JD9A 1KGYA 4EROA 3H1WA 1LENA 1RGSA 3PMEA 3WW4A 5IVVA 1RITA 1B09A 3NKTA 2JDUA 2YBKA 4NN0A 3VBSA 2W94A 1ND2A 3WP4A 1LGCA 5FZCA 4YVSA 1JOPA 4Y5SA 1K5MC 1K5JA 1XSRA 3PLQA 2GC2A 3BTZA 4CP9A 1AF9A 4M4PA 1RUH2 2I07B 4NOTA 3J4UH 1SBFA 5DDJ2 1GZTA 2ZGKA 1WW7A 1Z7S2 4GWJA 2Z2SB 3JXSA 1TMF1 1BHGA 3KM5A 2QQPA 3PVOA 2LUWA 1YRZA 5LBCA 3FFQA 1WW5A 2EXHA 5KC6A 1UCXA 4HETA 4PLOA 5FR3A 3K4ZA 4AGRA 4CCDA 4LE3A 5C3OA 4OYUA 4Y3OA 5AC93 1GQPA 1C8M1 2WN2A 5GZCA 4OHWA 4BQ4A 5LA1A 3PTYA 2HWF3 2D3RA 1UQXA 4N7UA 2E63A 5LY2A 3H1YA 4ASKA 4I01A 3KQRA 4AGGA 4AL9A 1OMIA 2W52A 1SACA 5IK5A 4I2OA 4JC1A 2ZMLA 3GYDA 5EZWA 3UL2A 1W2OA 4RFRB 3HWJA 3VD5A 2DUPA 1U5ZA 1W6QB 4I02A 5C8CA 1XYPA 2AZ5A 5BPXA 4BIFA 3VBHC 3I54A 5C3SA 4XMIA 5CFCB 4XFFA 1WWYA 4Y26A 3MV01 2JE9A 3T0DA 1GWMA 4CRQA 1N3PA
chains in the Genus database with same CATH topology
4Y1UA 3ZXLA 1JUHA 4SBVA 5E8AA 3DGTA 3TRSB 2X53S 5FBZA 1RUG3 2A6WA 2QKDA 3NKGA 4LO5B 5AVAA 4IV1B 4BMEA 1XE8A 3WW2A 4WM7B 1V9U2 5FTTC 4CTEA 4BQ1A 1UD1A 5J36A 1HV0A 1AR91 1BEV2 2I2SA 1H9WA 1S55A 3QOPA 1OLRA 4B3NA 3K48A 4NO4A 4NVPA 4Q4V2 1G9FA 4XTMA 1O5UA 1CPMA 4XF0A 1XYNA 3ZXJA 1YWKA 3AFKA 2YV8A 1RUC2 3POYA 4V1PA 3WG3A 4FAHA 4N7IA 3POWA 4Q4X3 5DZEA 2VOXA 5EYYA 4NWVA 2Q5TA 3KMHA 1WLDA 4KNCA 1ASJ2 4I30A 1VBD3 4WM7C 2UURA 1QOOA 4N9HA 1UX6A 4YGCA 4W65A 5H9QA 3E6BA 1FPN2 1ZZBA 4YVWB 4XFAA 1D4VB 3RNSA 4N43A 4W6XA 3ZSKA 2ZKNA 4BM8A 3MYXA 4Q27A 1ALYA 1VR3A 4MXWA 3WQ0A 1CD3G 1H0BA 1XE7A 1UU5A 1XNKA 2R062 1H1IA 1Z0HA 2YROA 4GIQA 4LA3A 1VJ2A 1ZZ6A 4FPCA 2ZHMA 3O14A 4A7ZA 3V0AA 3ZYGA 4WV8A 3I4IA 2BUKA 3TN93 4UBHA 2DTWA 4WVMB 4AQSA 2DV9A 1F31A 3FBYA 1DGWA 5JSPA 1FI2A 1OD5A 4QPIB 3B93A 1X8EA 5DDJ3 5FOBB 4XBQA 2WNVA 2H0BA 4Y24A 1Z7S3 1VAMA 4QQOA 4RR3A 3E6CC 1YFXA 3URFA 2P37A 1OOPB 1DYPA 4RFT0 3PVNA 3HMYA 3EQEA 1NY72 4CP0A 4BLIA 1QJY2 2Y0IA 3ZXEA 2CWMA 4EV0A 3LWCA 5CADA 4RGGA 5AFEA 2A75A 2YC0A 3KZ4C 1OSGA 4Q0QA 1OA3A 1YJKA 4QPIC 4WM8A 1IS5A 2GH2A 3ATGA 2ZKLA 3ZFGC 3M3QA 1UZZA 4Q4W2 3LSDA 4K40A 5JI7A 3JD73 1FMD2 1AR61 2ZGSA 5FPZA 2CAUA 1FAYA 1SFNA 3M2MA 2EF6A 2NLRA 3ZDSA 2E7QA 4IQPA 3TBDA 1I1EA 4IV3C 5T52A 1CGPA 1V9U3 2RS51 1VBE2 1BEV3 2D6PA 5BNPA 4YZ5A 3V56A 4META 1RUF2 1D4M1 1W6NA 4Q4V3 1BBT2 1O5LA 5LEJA 4YZ4A 3N4MA 2XL7A 4JGZC 5KC5A 1MZ5A 5DUUA 3VBRB 1GYKA 1EYBA 4NR1A 3WUDA 1VBA1 3MGUA 1RUC3 4KL1A 3W58A 4GMP0 2ENRA 2VW0A 4R9DA 4R8HA 2WLPA 3KGZA 3WDXA 2VXRA 3ILNA 3AKPA 4HVRA 4KWLA 3FUOA 1ASJ3 4C1XA 1COV1 3RI8A 3OD0A 2PLV2 4YVSB 4KWKA 2KXLA 3AMMA 2PHTA 4B4PA 5ACA3 2IXHA 4IEXA 4NWWA 2CGOA 1PIV1 1R1A1 5I8SA 1FPN3 2R071 4FPLA 2ZS6B 2VNRA 2PHDA 3TYJA 2VH9A 3H3UA 3WNXA 3GNEA 3FUQA 3SCHA 4CDXA 3V0BA 2R49A 4XJAA 3IDCB 2JE7A 4IESA 3OPZA 2BQPA 1ULCA 2AGSA 1OQEA 2IFRA 4QT6A 3BU7A 2WFF1 2ZABA 1C57A 1WBLA 3M4FA 2R063 2QJVA 3NV4A 1JUIA 1D2SA 4Q4Y2 1ND2C 5FO7B 3VBSC 4HLTA 4YVSC 1YUDA 2AR6A 1RUNA 1WCKA 4CEWC 3B7MA 4PF5A 3LA7A 3MW3A 5C8CB 4COYA 4YM0A 4Z92B 1Q8PA 2XGXA 3GF6A 1LOGA 2HEWF 5BNOA 1PZ9A 1DGWX 1LR5A 2BWCA 4DMIA 2JEMA 4JTOA 3RG0A 1LCLA 3POSA 3H9AA 1HRV2 5T54A 3CJIA 1UIJA 2JG9A 2XB6C 3QH6A 4ZXKA 4KG8A 5ABJC 4XF9A 2CGPA 4GB31 1CAXA 3AKQA 3AP5A 2V09A 4NHLA 4R4XA 2WSUA 3NAPA 3O0VA 2OVUA 3VZMA 2UY9A 1JOJA 1H2MA 1QJY3 5J37A 3AKSA 1DZTA 3GZUC 2B39A 1PK6C 5A3LA 1GNZA 1KXGA 1U5XA 2E51A 3I59A 4LHLA 5KXDA 3IIAA 1FX5A 5IK7A 4YZ2A 4Q4W3 3AX4A 3RI9A 1RUG1 1VB4A 5F6LB 4FPHA 1SCSA 4GMP1 4PDWA 4DS0A 4AFDA 4W6WA 5JWPA 3B9IA 5LEKA 2PAKA 1PMIA 4DNYA 4CDWC 4YRDA 1LHNA 4N43B 5FO8B 1Y7BA 1QOSA 2G4IA 3HIFA 3PHMA 1RUF3 2W39A 1OA4A 4MXWB 4AEDC 4IEYA 3AKTA 4HN1A 5CA6A 1VIWB 2XWBB 3AKRA 1HRI1 1OI6A 5DXDA 2PAMA 1HQLA 4FCAA 3N36A 1QU0A 1POV3 4TYSA 1G86A 1VAVA 1ULGA 1DGRA 1H2LA 3D82A 1K5MA 4LBJA 1FYUA 4AG4A 3V0AB 2YPJA 1KDMA 1XRUA 2DCTA 2VGDA 3KS7A 3J26N 5AC92 1D0HA 2P3IA 1OPMA 2PLV3 1RMU3 2VU9A 3JCIA 4N43C 1AX1A 4ZU4A 2P3KA 2OUJA 3DPRA 2WNVB 1LGNA 1A78A 3MLJA 1WCSA 1NE4A 1DZRA 3SH3A 1RTVA 4C0BA 4N53C 4RR3B 3ROUA 2WSVA 1KJLA 4OHZA 2ZX2A 1O7FA 3AMQA 1HW5A 3NO8A 2ZX4A 2GSYA 1SQ4A 1QH7A 1QJZA 5JIAA 1N1SA 2CAVA 3LA2A 4YARA 3RMYA 4DY3A 2XVKA 3NVCA 3VBHA 1QJU1 2O0OA 4BWOA 4P9XA 3N7JA 5F9TA 4WM8B 2NM1A 1QXJA 1AR82 2ZZJA 1NCRB 2ZMNA 1RUH1 5HCFA 2WNVC 5DDJ1 1Q3EA 4IXLA 3E5QA 1TE1B 1LB2A 2GMEA 4OZXA 3LAGA 1HRV3 2MEV2 3AP9A 3WG2A 4DB5A 3RJRA 4ES8A 4FTBA 2B45X 4FBFA 4XPVA 1W0OA 3ZXDA 5F5QA 2NMNA 2RS11 2Y38A 2NPIA 2RS31 4MX3A 2G9GA 5JOWA 1CAVA 4B8EA 1DGLA 4FXKB 3ECQA 2MNGA 3BIWE 3DUIA 1W6NB 2DU1A 3E5XA 3H7JA 4JDNA 3VDDA 1HXS2 4YFWA 1FV2A 5FMOS 4B4RA 2R042 3FE5A 1KD7A 3S0MA 4WVZA 1FNZA 2BFUL 3CNAA 5FQ0B 5CFDC 4MGYE 4GH4C 1DF0A 1PVC2 2GC0A 1KQRA 5GZDA 1XNCA 1S0JA 1QHDA 1ZYBA 3AZXA 2N7GA 2DVBA 4HKOA 2FMYA 1V9U1 1RVF2 4LBKA 5FMOL 1BEV1 1S2KA 1XQNA 4Y1VA 3TNPB 5JZGC 1JN2P 1KFXL 4LA2A 1UW8A 4Q4V1 4AVAA 2HJIA 1YFWA 2EXIA 4R52A 4F3JA 3B00A 2XBO1 4CDXB 2ZHNA 3V0BB 1J59A 3ZXGA 1GQHA 2WNUB 3VBOC 1S1AA 4XIOA 4D3WA 3OBRA 1BMV2 3AYEA 1BVVA 5GALA 3LGRA 2QDNA 4P9GA 2RM22 4L92A 2X5IC 5BY5A 4I3PA 4Y1XA 4QGMA 1ASJ1 2Y26A 4CZSA 5A3MA 5I0SA 3VKNA 2ZGRA 1B35C 2JICA 3VZNA 1GZWA 1FPN1 5BNOB 1AL21 1NLSA 2GZWA 5JCTA 3VKLA 1RL3A 1WLTA 1GQGA 3CJIB 2JG9B 2HWF2 1NLRA 1MS9A 1VAKA 2WS91 3B94A 4XYXA 1CAXB 5TSWA 4G4FA 4PIZA 1EV12 5GLTA 1F5JA 2PA7A 1C8NA 1GBGA 1AYM1 1FATA 1V00A 4OLLA 3NAPB 4TLFA 4QGLA 1F9KA 2D6MA 1W2UA 1EY2A 1PHMA 1GANA 4M3CE 4RS5A 4N9IA 2JENA 3ZFGA 2HWE1 4LE4A 4RHV1 3VKMA 2EA7A 3ZYJB 3I59B 4AFCA 1TME2 5JAXA 1PZ7A 1AR83 4PLNA 4COVA 5E1RA 3U11A 1PNGA 1Q56A 5C6CA 4IEVA 4PDWB 1VRH2 4IV3A 4L97A 4IERA 4K7JA 2MEV3 1GSLA 3MW4A 3BPZA 2BBVA 3QCWA 1BJQA 1YFUA 4K3UA 3KT4A 4LR4A 4JGZA 4I09A 1UIKA 4B29A 1U0AA 2WT1A 1YLLA 2HWD2 1R091 4H7MA 3O12A 2GU9A 4LEJA 1VBD2 4DPNA 1DQ1A 4AVSA 1HXS3 1LEMA 1UMZA 2BNOA 2R043 4M3CA 4Q4W1 4AQ2A 3OGJA 4YG0A 3VKOA 4PDWC 1FMD1 2B7YA 1K5MB 4LBQD 1DLLA 1ZRDA 4Y20A 3WD5A 4PQ9A 2DTYA 3AJZA 3L2HA 2GALA 1SLIA 1JW6A 3FJSA 2VNOA 5J7MA 2E7TA 5B2GB 1RVF3 2RMU1 1VBE1 2D3PA 5IT6A 1QOTA 3DPRB 4JQRA 4EWAA 5T5LA 3VHPA 1Q8SA 3PJQA 1BBT1 1YIPA 3DF0A 4Q8LA 3UKVA 3CEWA 1AX0A 4KU7A 4L9BA 2NP0A 1WD4A 3TN92 1JYCA 3VL8A 1MVEA 1LEDA 4C90A 4CEWA 2ZX0A 1RC6A 2RM23 4OHXA 4L99A 5DZGA 3WP5A 3VBHB 5JOXA 1N1VA 4GA9A 1ND3C 3QACA 2PLV1 4QMAA 2CWSA 4OUMA 4XJZA 1U5IA 4QXKA 4XF3A 3DPRC 1RB8G 3ZN4A 1OHFA 2DURA 3ZXFA 5ABJA 2IFWA 2B46X 3RJ2X 1FNYA 4BHPA 4YW5A 1XXNA 5JPNB 1G9DA 3R6SA 1QQP1 3E5UA 3SNMA 4AE2A 2JX9A 4FPGA 5L7OA 5EWSA 4AWDA 3FLPA 2CGNA 3AJYA 1TNRA 5JIUA 1RUI1 4K6BA 1EV13 1Q8OA 1CAVB 5AFBA 1MEC2 1RUE1 5J3UA 2QZ3A 3R4SA 1LOAA 2NMOA 2ZHKA 3ZFEA 4E4ZA 1W39A 4Q4Y1 5K7PA 2DYCA 1PK6A 5T5OA 3JD72 3VDDB 4R9CA 3WHTA 2RR12 2ZTNA 4FTEA 2OPKA 1YO8A 5E89A 2QDRA 4AVVA 1REFA 4AHZA 1W0PA 3QH7A 2LM3A 1BZWA 1ZBA1 3M3EA 1TME3 3ZXAC 2HEVF 3KLSA 4D7YA 3ZPYA 2WT2A 3S6PA 1HRV1 1YI9A 4M01A 4LBMA 1LOFC 4YW3A 1APNA 5EJ3A 3JU9A 1HQNA 3WQ1A 3LKJA 4CDWA 1VRH3 5CG9A 4COWA 1J3QA 2G9FA 3VDDC 3WCSA 4AEDA 1IOAA 1G9CA 3UV9A 2OZ6A 3WP3A 3JBG3 4LHNA 4E2QA 1C1LA 1C5IA 3AXDA 2HWD3 5FLJA 5JR7B 5HCBA 3E97A 4KGGA 5ACA2 1LRHA 4I0AA 4AI3A 4AW7A 1BQPA 1YNAA 2Z5WA 2MPFA 4O9EA 3OBTA 4K1YA 2NYYA 3D0SA 2O8QA 4HL0A 1MS4A 4KWJA 3S30A 2QFEA 3FZ3A 1GZWB 2OW4A 5KHKA 3IM0A 3WDYA 4HN0A 5BV6A 1LKNA 3HT1A 2JECA 1R083 3FHIB 2OUHA 3RQ0A 3AZZA 3LOIA 2D6KA 4N53A 2DUQA 1UU4A 5LK7B 2IXIA 5JMCA 1VBB1 1RHI3 3S7IA 3THPA 1H2NA 4Z2WA 1W6PA 4F7ZA 2FHRA 3OY8A 2DVGA 4XQWA 4D94A 5IUQA 2ZAAA 4E27A 1JYIA 2VQ0A 4FPKA 1A3KA 3L2YA 4Z07A 2C9AA 4RS5B 2QUOA 3FX3A 3OYWA 3ZFGB 5AC91 2VPVA 5H9RA 1BYHA 4QHBA 2YZ4A 3ZSLA 2VVFA 2WNEA 1NXD1 3WW3A 2ZGMA 1ZX5A 3LZZA 1UAIA 1GV9A 3LOBA 3QBQA 4LBLA 1FXZA 4S2DA 4IV3B 5HI0A 5CG8A 1JBCA 2YDEA 1AJOA 3U4XA 3BOWA 1EPWA 4XJ9A 2E7AA 3PNAA 1LHWA 2A3XA 1MEC3 2P3JA 1N3QA 3MF9A 4HBNA 4RS5C 1HLCA 2ZGQA 3P3PA 3FMGA 2RHPA 4JGZB 4XJUA 4OI1A 3NW4A 5L19A 1ZBE1 2VW2A 3OD4A 2LALA 1C1FA 2PN5A 2VG9A 1V6JA 4LULA 3J8F2 5CFDA 4GH4A 4E4SA 1AR81 4M3CB 2RR13 1G9BA 4Q0VA 1X33A 1DQ5A 1H8VA 4YM2A 1GICA 3BALA 4K20A 4X6QB 3H50A 3SCFA 4Q29A 1H1AA 3EJKA 4RA0A 4Y20B 3AK0A 5JZGA 3M8LA 1RIRA 4QD2A 1CAUA 4B7EA 5DG2A 4XFIA 2EALA 3ZO0B 4HPKA 2IZWA 2WJSA 3SLIA 2HWC2 1R1ZA 1VB2A 1GNHA 3VBOA 3HR9A 2PFWA 1OQ1A 3RMXA 1Y3TA 5EXOA 4MGIE 1QY4A 3P3NA 1VBC1 2ES3A 2X5IA 5J96B 3VBSB 1ND2B 4P9WA 1H2KA 1RMU2 4CEWB 3QD6A 1CQ9A 2VW1A 1B35A 4LBQA 5SV5A 1PVC1 3MIDA 2XL9A 4XJWA 4WZFA 1PGW2 3MZHA 4XF4A 3GBGA 1AR71 2BW8A 4E2SA 3ME2A 5JI9A 2F4PA 1RINA 3VBFA 3AZYA 2R16A 5ABJB 2WWSA 4LT5A 1RUD3 2CV6A 3WDVA 4FAGA 1TMF2 1S0CA 2FZ1A 1Q8QA 4UW4A 1OKQA 3ZSMA 5L7OB 5JLVA 1V70A 1SLAA 4YW4A 4GWNA 3TNQA 5K8SA 4XE9A 1NQJA 2DFCA 1C8M2 1S0DA 3B5LB 3ZFEB 2RM21 1SEFA 5DZFA 1O3TA 4QM8A 2ARXA 2BNMA 4QU2A 1PK6B 4O9GA 4GQ7A 1Y9QA 5K0UA 2D6LX 1YCIA 5FOJB 1ENRA 4HK8A 5IK4A 1QNYA 4E9KA 4U2AA 1ZRCA 4EN9B 4XFGA 4Z82A 1MS3A 1MS5A 2NQYA 1WW6A 2KM2A 3EHKA 4FOVA 1SMVA 1CR7A 3TWIA 4YM3A 2HWF1 5L7OC 3AB0A 3WLUA 3KCCA 1PGL2 3LB9A 3UKTA 2JKBA 3A0KA 4CDWB 3D8CA 1DG6A 1AXZA 3ZFEC 1DQ2A 1LESA 2B8MA 4KG0A 1WMDA 4AFMA 4DINB 2AREA 4HFSA 1AL0G 3IPVA 4AEDB 4FVVA 1SLBA 1PO23 3WZ1A 2WL1A 1QDCA 4AVBA 2ARBA 2FBEA 4OI0A 1L3JA 3AP6A 2XJSA 3J8F3 3GBFA 3THTA 5FLIA 4AQTA 4EN7B 3MICA 3ZSEA 1Q5OA 3AMPA 4Y1YA 1O91A 2GH8A 3M7AA 4L2NA 1SCRA 3ZIWA 3EBRA 1Y43B 1SBDA 1PO12 3HD8B 4LO7A 3WW1A 4IEPA 3N7LA 4N53B 3WVJA 4RSUA 4Q4X1 1S0BA 1SDWA 4AQ6A 1QMJA 2HWC3 1V6NA 3MIGA 3NJZA 5KXCA 3J9SA 1LJ7A 3SITA 5A33A 1W6PB 1VBD1 1NOVA 1HIXA 2VMHA 4YFZA 5JOYA 4COZA 3OY8B 2D44A 1CIWA 2ZX3A 3JUUA 2Q1ZB 1RJ7A 2WT0A 1ND3A 4MV2A 1GKBA 4XFCA 1O3QA 3IWZA 4DFSA 2AYHA 3ZN6A 1O4YA 5K9YA 1AYN2 3B9CA 2GDFA 2QCSB 4FO9A 3SXWA 4HVOA 1NA1A 1IS4A 4S2HA 4A3XA 1WMEA 1REDA 1YI7A 3AP4A 4RL7A 3AYCA 2R1BA 3JB4C 5A32A 4KH9A 3MFAA 3K51A 2DUOA 1LODA 3GALA 2GNDA 3OCPA 3DN7A 4XXAA 3VUOA 2VMGA 2H0VA 3MIHA 4ONUA 4TZDA 1HX6A 3RYRA 4A2UA 1ENXA 1NYWA 1TMF3 2OIIA 3ZVXA 4AI8A 3WUCA 2YMZA 2O8OA 4LO4B 4AVCA 5I8YA 2R1DA 3HBZA 3TN91 1AXKA 1IHMA 1REEA 2DVAA 3RSJA 1KJRA 2GAUA 4BE3A 1C8M3 2RJLA 2TNFA 4HZFA 1WD3A 1XYOA 1WLCA 2I45A 2ZPXA 5C4WC 1SLLA 1YYNA 1Z7S1 3N7KA 2C0ZA 3AM2A 4X8PA 2YHJA 4K9SA 4MZUA 5CFDB 1LHUA 4FQZA 4GH4B 4C91A 1LOFA 5BYNA 2WQZC 1NE6A 2VVDA 1J1LA 2FMDA 3AXEA 3MI8A 4G3YC 3WX5A 3W9AA 5JZGB 1V6KA 4JRAA 2ZCWA 2DCZA 2XJPA 2XJTA 1YXWA 4P5HA 3I7DA 1H4HA 4GULA 4HPKB 4S2GA 1JXNA 3VBUA 3T1MA 4Y4YA 3D4KA 5I0UA 4RD7A 3VBOB 1YJLA 2A6XA 2DFBA 1IKQA 4XFBA 4PJYA 3Q9OA 3JD71 1XNBA 3GZTB 1ZRFA 5KHIA 3ZX7A 5J09A 1AZDA 2X5IB 4I0WB 2RJKA 2XLGA 2AH2A 1VBA2 2VOVA 2YXSA 3ETQA 4JDMA 4K1ZA 2ZA9A 5KXBA 1B35B 3VHOA 2K2SA 4LBQB 3AMHA 1ZZ8A 4SLIA 2VQAA 2GN3A 1N1TA 1D2QA 1COV2 3FWEA 4J1XA 1CJDA 2JJ6A 1YIFA 3USSA 1ENQA 2VOWA 1R1A2 3VBFB 4AGVA 2R072 1PO13 1RUC1 4HKLA 2XKPA 5KXEA 1HQWA 4ASMB 3RZZA 3VZOA 5C9AC 5CAZA 5T5PA 2TBVA 2DCKA 1WMFA 1J3RA 3ELNA 5CBLA 1SLTA 3D5OA 2ATFA 4DY5A 4DXZA 2ETEA 5ACA1 2WFF2 1C4RA 4M0NA 3FBMA 2ERFA 2D6OX 2HKXA 4LTAA 1PNFA 2GMMA 2SLIA 1C5HA 2WFPA 1RUJ2 3B02A 4R9BA 5EYXA 5K0UB 2QVSB 4LUMA 3ILFA 1AYN3 2BTVC 3N35A 3VBFC 1FT9A 4YM1A 3X29B 2PHLA 1POV0 1TNFA 2PHFA 3AYDA 3MFCA 4YVWA 2NZ9A 1AXYA 1IQAA