2CV6A

Crystal structure of 8salpha globulin, the major seed storage protein of mungbean
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
397
structure length
366
Chain Sequence
SVSRGKNNPFYFNSDRWFHTLFRNQFGHLRVLQRFDQRSKQMQNLENYRVVEFNSKPNTLLLPHHADADFLLVVLNGRAVLTLVNPDGRDSNILEQGHAQKIPAGTTFFLVNPDDEENLRIIKLAVPVNNPHRFQDFFLSSTEAQQSYLQGFSKNILEASFDSDIKEISRVLFGSQQEGVIVELKREQIRELTKHADQPFNLRNQKPIYSNKLGRWFEITPEKNPQLRDLDMFIRSVDMKEGSLLLPHYNSKAIVILVINEGKANIELVGQREESWEVQRYRAELSEDDVFIIPATYPVAINATSNLNFFAFGINAENNQRNFLAGEKDNVISEIPTEVLDVTFPASGEKVQKLIKKQSESQFVDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Plant protein
molecule keywords Seed storage protein
publication title Structure of 8Salpha globulin, the major seed storage protein of mung bean.
pubmed doi rcsb
source organism Vigna radiata
total genus 89
structure length 366
sequence length 397
ec nomenclature
pdb deposition date 2005-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00190 Cupin_1 Cupin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2cv6A02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2cv6A01
2D93A 1CAVA 1ZNPA 1V70A 4XFIA 4HSJA 1DGWA 4EWDA 4IESA 4XF0A 2IC1A 4UBHA 1I6XA 2PQQA 5KHJA 1YFWA 4KWKA 4P9GA 1ZZ7A 1Q3EA 4FAHA 4MZUA 2MPFA 2Z69A 3RPQA 5K8SA 3I7DA 1YWKA 2MNGA 1VR3A 3RNSA 1YUDA 4JVAA 5C8WA 3E6BA 2OZJA 3DL3A 4Q29A 1CAUB 1ZZ6A 4BYYA 4QM9A 4PIYA 1YFYA 4IEOA 3E5QA 1O3QA 2GU9A 1FT9A 4XF1A 1CX4A 1ZRFA 1DZRA 1ZRRA 1WLTA 3WW2A 1LRHA 5BUVA 1CAXB 3HQXA 4IEPA 1EY2A 5D1IA 3IDCB 3C3VA 4MX3A 1PM7A 3B02A 1L3JA 2CAVA 5FQ0A 2EVXA 3WW4A 1UCXA 1OD5A 4MGIE 3IWZA 2Y0OA 2ATFA 2IXLA 1NZCA 3GBFA 3LAGA 4Q0SA 3KMHA 3I59A 4XFGA 2WFPA 4DINB 4HBNA 3RDIA 1UIJA 1G6NA 1U12A 5I8SA 1ZZBA 4XFCA 1HW5A 4XF4A 3HIFA 1RUOA 4I3PA 1O3RA 3EBRA 3LZZA 3JZVA 2VECA 2ZCWA 5CVRA 2P17A 4XFAA 1J3RA 2HKXA 3CJXA 1J3PA 1JUHA 3H1YA 4O9GA 3WW3A 1O5LA 2ET7A 1IPJA 4FT8A 3MYXA 2FQPA 4J1XA 2Q4SA 4IEXA 5JR7B 4QXKA 2IXHA 4L11A 3OD0A 2GZWA 1Q43A 2D40A 3H7JA 5F1RA 4Z07A 5AVPA 4JTOA 1UD1A 1QXRA 4N9HA 4AQ6A 3U11A 3OF1A 1OMIA 1ZRCA 2BNOA 1H1IA 3U10A 1ZVFA 2EAAA 2XGXA 2XKOA 3BCWA 4HVRA 4QGMA 1J59A 4IEYA 3H50A 2EA7A 3D0JA 4IEQA 2C0ZA 4I0AA 1CAXA 3IDBB 4UBGA 5JSOA 5I0RA 4IEWA 2GAUA 2QNKA 2QVSB 2PHDA 2XKPA 4CYDA 1RTVA 4PIXA 3FZ3A 4D7TA 1NYWA 3I59B 5EFUA 5KHGA 4L2NA 3TNPB 1YFUA 5EZWA 2OYZA 4WBBA 5KBFA 5I0SA 1J1LA 2PHLA 2GC0A 2CV6A 3BALA 3D0SA 2VQAA 2HJIA 4GULA 4K8FA 2VPVA 4ONUA 2BEOA 1J58A 1X8EA 4HN1A 3VHRA 4KL1A 1NE4A 3D82A 3DN7A 4Q0VA 2IXJA 5I0UA 4EWAA 4EV0A 1CAWA 3OTFA 4I0BA 2K9ZA 3FFQA 4AXOA 4ZU7A 4R8HA 3IIAA 1EYBA 4QMAA 4Q0QA 3I54A 2PYTA 4MGKE 4PIZA 1QXJA 2Q1ZB 1LR5A 3EHKA 4PJYA 1O3SA 4J1WA 5FLJA 3PNAA 4BIFA 5JSPA 2H0VA 3TNQA 2WC2A 4Z82A 2QDRA 1RUNA 4BH9A 3EJKA 2OA2A 4AVCA 3LA7A 4F8AA 4YNIA 3ST7A 5I93A 1Y3TA 4EROA 4JTNA 5KHKA 5CU1A 1XE7A 5FLIA 1X7NA 4HVOA 1GQGA 2E9QA 2IXCA 5J7MA 2GH2A 3NKTA 2PFWA 4YRDA 2O8QA 2FMYA 2H6BA 4HLTA 4IEVA 2N7GA 5HI0A 2GC2A 3S7IA 3ES1A 5FPXA 2BNMA 3OCPA 5FCCA 1ZREA 2UYBA 4IETA 1FXZA 3E6DA 1Y9QA 4LA2A 4YARA 4HN0A 5C6CA 3ES4A 3LA2A 4XFFA 5JCTA 5FLHA 3SHRA 3GYDA 3G7DA 5J48A 3S7EA 4KU7A 4Q0PA 1CAWB 1NXMA 1UPIA 1X82A 3E5XA 2D5HA 3NVCA 4OFGA 5KHIA 4E2GA 4ORFA 1PMIA 1O3TA 5LRSA 3SCGA 4N9IA 3USSA 4WZCA 1SFNA 1O4TA 2OZ6A 2BYVE 3SMHA 1CGPA 3MPBA 1EPZA 3EQEA 3WW1A 4FAGA 2CGPA 3H1WA 2GC3A 5LEJA 3LOIA 1H1MA 4KWJA 4XEZA 4B29A 2PA7A 4QGLA 4LEJA 5FDBA 3RZZA 1O5UA 3E6CC 3RYPA 5J3UA 3H9AA 2F4PA 3ACLA 1QWRA 4ZU5A 4IEUA 5LRRA 1UIKA 1J3QA 4LUMA 4YYOA 3DKWA 4JV4A 4LA3A 4LULA 4MH0E 5I91A 2QJVA 4WVZA 2CAUA 2ETEA 1SQ4A 4I01A 4A2UA 3MZHA 4KU8A 3NSTA 2PAMA 4OLLA 3IBMA 1OI6A 4MV2A 3NW4A 3R6SA 4X6QB 2XLFA 1UW8A 5T3NA 4LUKA 3RYKA 2B5HA 2I45A 3FWEA 4AVBA 3H7YA 3L2HA 4UXAA 3EO6A 2UYAA 4RD7A 5BV6A 1DZTA 1ZZ8A 2XL7A 3NJZA 3E5UA 1O7FA 2GC1A 3PLQA 2D5FA 1FI2A 1GQHA 2BNNA 5BPXA 1LB2A 1X8MA 1XRUA 1WA4A 3BB6A 1YLLA 2UY9A 2ZKLA 4EWEA 4LTAA 3DV8A 3SCHA 1LKNA 3UKVA 1XE8A 4HSLA 3SXWA 3RYRA 1ZZCA 3UKTA 3N4MA 4Q0UA 2XL9A 1SEFA 5FPZA 1WGPA 3ETQA 4XFBA 4X6RB 1VP6A 4I02A 2PAEA 3LWCA 2V09A 2XLGA 3FJSA 2Q30A 4XF9A 3SCFA 1IPKA 2UY8A 3CL1A 1OFNA 5I8YA 4HVQA 4XF3A 1RGSA 3FX3A 4R52A 5JAXA 3H3UA 5CADA 2OPKA 2XLAA 4H7LA 3MDPA 2Q0AA 1NE6A 3ZDSA 2B8MA 2QCSB 3CF6E 1CAVB 4TLFA 3PVBB 3ELNA 5E1RA 3QACA 4META 4MGYE 3NL1A 4FBFA 4NVPA 1I5ZA 3OGJA 4KWLA 1QY4A 4I2OA 3QOPA 5LEKA 4XFHA 3UKNA 3CO2A 1RC6A 4D7SA 3E97A 2PAKA 3CEWA 4AQ2A 4IERA 5KHHA 4LLOA 3H8UA 2K0GA 3M70A 5BY5A 5I0TA 3KGZA 4MGZE 2BGCA 1DGRA 2Z2SB 3CLPA 3KCCA 5BXXA 4F7ZA 4QX5A 5E16A 3ROUA 2PTMA 3FHIB 3LA3A 4ZU4A 4E2SA 3U0ZA 3S0MA 4YSFA 4AVAA 1ZZ9A 3HT1A 1YHFA 4HZFA 4O9EA 4QGNA 4I09A 2H6CA 2IXKA 4XETA 3H1MA 4HMZA 5I8TA 2B9UA 1CAUA 3H3ZA 2IXIA 2MHFA 1ZX5A 4QM8A 3FE5A 4E2QA 2KXLA 1ZRDA 2DCTA 1Q5OA 1VJ2A 3BPZA 2XHKA 3M3IA 3O14A 1EP0A 1RL3A 4MUVA 1TQ5A 2ET1A 3BU7A 5JSRA 3KGLA 5FQ0B 4IEZA 3HT2A 1YFXA 4BHPA 2O1QA 3KSCA
chains in the Genus database with same CATH superfamily
2D93A 1W8HA 5K4LA 5JLVA 2LW8A 2R30A 1R083 3AP4A 1ZBA1 2K46A 4OI0A 1OF3A 2VOKA 4FPYA 4XFIA 1DGWA 4Q4W2 5CFCA 3RZMA 2SBAA 5FP9A 3VBSC 4EWDA 2WO7A 5FPLA 1JYIA 3OPZA 1U5YA 2D6MA 2VZQA 2XUEA 2WL1A 4KG8A 5A7WA 1JODA 1EV11 3W59A 1PK6C 3I2IA 5A6YA 1AR62 3HPNA 1U5ZA 3V64A 1H6YA 3ILNA 2ZMLA 1GR3A 3PUHA 4JX0A 4LBNA 4FAHA 1JYVA 2W39A 4XTPA 3RZLA 1AR91 5DAVA 4Y1ZA 1SLLA 1VAMA 3U75A 2DF7A 1WD4A 3A23A 1UZWA 1DBNA 1VR3A 4A7YA 3RNSA 4YM0A 1VLNA 1YUDA 3JBG1 1QMJA 1RB8G 5C5TA 2E26A 2LTNA 1R1ZA 4UFMA 4LMFA 1YQ6A 1YNAA 3TYJA 1AYM1 4A41A 5A6ZA 2P3JA 2QE3A 1XC6A 1W6MB 3PURA 5FPAA 1WWYA 2JDNA 1VBC2 3UYJA 1YQ5A 1GP6A 2G19A 4ZZ8A 2HWB3 4AGRA 2VR4A 2A3YA 3E5QA 1O3QA 3K4DA 5FZ4A 4XF1A 3VZOA 4RQPC 3B9IA 2BVVA 4RSUA 3ETPA 3GJAA 5LA9A 2FDJA 3BOWA 3TBDA 1SACA 1XYOA 2DURA 4QHZA 4DQAA 1C8M3 4FQZA 5G04L 1JOJA 4A7ZA 4JGZB 3ZIWA 1DQ0A 3Q9OA 1SLCA 1H0BA 2NQYA 3IDCB 3PUQA 4CDXB 5LZ6A 3VBOA 5D8AB 3OOXA 1VBD1 3RJRA 1YJLA 2C24A 1KJRA 1HRV3 3AZZA 2RS33 1MACA 4HXCA 3LSDA 2QBXA 3MEPA 3W20A 1OD5A 4MGIE 5CFCB 5ANNA 5AVAA 3IWZA 1X33A 2IXLA 1NZCA 2Q8OA 5DXDA 4ASLA 4JDMA 3POBA 3I59A 3ZO0B 3NO8A 4XFGA 2WFPA 2VBPA 4A7KA 3O1UA 4P9WA 3PTYA 2VW0A 1J83A 4DINB 4TZDA 2VMEA 4LE3A 2DDUA 4GA9A 3I2FA 1QOSA 4EN8B 3HIFA 3CIHA 1RVF2 1W9TA 5HCBA 4GWMA 5F2SA 4XUPA 5BNPC 3OGSA 3RG0A 2YYOA 4MGSA 1FNYA 3USUA 5CVRA 3O1RA 1FOD1 1W0NA 3AMPA 3E1F1 1SMVA 2WN2A 1PIV1 1O8PA 3CJXA 1J3PA 3T2PA 3MIEA 2HWD3 4HANA 1PX4A 4Q27A 2WNVA 1UKRA 1O5LA 2DUPA 2HWF3 3IMNA 4XAAA 4XJAA 1GQPA 3WINE 4H55A 4DUWA 3VD9A 2O14A 3MYXA 4J1XA 1ULOA 1VBE1 1REEA 2PMWB 3O0XA 4IEXA 5EXOA 5FP7A 1OFSA 1CN1A 1COV2 4FPOB 3LOBA 5KXBA 3OD0A 5A3LA 4KBZA 5JXJA 3NV4A 3C7OA 3UT0A 3GZEA 3H7JA 1DHKB 2CYFA 2QQNA 4JRLA 4PBPA 4CU8A 1HB2A 2HBUA 4JTOA 2HWF2 1UMHA 3DCQA 1UD1A 1S0IA 5ACA1 4Q26A 4HG6B 1LAJA 1JYTA 5FYZA 2D97A 2JB8A 3GDBA 1UOBA 4O61A 3RMXA 2Y6HA 3K51A 4HVRA 3T0AA 1J59A 4LKEA 1JZ2A 1MVQA 4YW4A 2CY6A 3ALQA 3WSOA 2B45X 4I0AA 1CAXA 3ZR6A 2ZX3A 3WNOA 2WYSA 4YZ1A 1R081 2DVBA 1R093 4FPEA 4XBNA 5JSOA 3TEZA 1V6KA 4LT5A 2KD7A 2JDPA 1IHMA 2QNKA 5FY5A 1V6LA 4XJWA 3TN92 1S0DA 4FOVA 2W08A 1NYWA 3I59B 2RR12 4M0HA 4Y20A 5EFUA 5KHGA 1AJOA 3WCRA 4UW4A 4WVMA 3T4VA 3ZXJA 4NHLA 1NZIA 1R092 2P3YA 4WBBA 5I0SA 5J1XA 4P5YA 4YW3A 4H7MA 4FPGA 4CEWA 5FOBB 3BALA 4GH4A 2VQAA 2HJIA 4MOAA 1LTEA 1ULPA 1SPPB 1S55A 2VZ3A 3A21A 3USUB 5IK5A 4TXWA 1YYNA 2WNOA 4FOYA 5I0DA 1RUE2 2A3WA 4HN1A 2DTYA 3C8XA 4KL1A 2MEV3 4LORA 4XABA 2WNVB 1T6GC 4PDWA 1CAWA 4XQ4A 2P2KA 2W3JA 4B7EA 2K9ZA 3FFQA 3ZKYA 4C1XA 2EIDA 4NOTA 4Y3OA 4XXAA 5FUIA 2WN3A 2PHTA 5GZEA 4CDXC 4I0WB 5D8AC 4PLOA 2PYTA 2Z5WA 4OVEA 1C3HA 1YQ8A 3N9PA 4S2DA 3VBRA 4WM8B 2GN3A 3N9MA 5GALA 5FLJA 3AYCA 2HEWF 1WA6X 3GHMA 4BIFA 1JXNA 4AQTA 2H0VA 5C8CB 2P6HA 4NJ4A 2VCAA 2WC2A 1H2NA 3ZYIB 1E5SA 5HPOA 1W8UA 4P9IA 1W8NA 5FY0A 4DXZA 4BH9A 1RUNA 1D7PM 3EJKA 1VMFA 4M00A 1I3HA 1PVC3 3KVAA 2YPDA 3J7HA 2R061 4YNIA 2P34A 3OYWA 1YI9A 1H4GA 3VHNA 4BJ0A 4NIIA 1Q8QA 3PVEA 4JTNA 5T5PA 3WDWA 2RM22 5L73A 1RUJ1 1RMU3 3ACFA 4E8DA 3WNLA 3R4UA 1ST8A 3ILRA 1PVC2 1MS9A 2FZ1A 1OLME 2PFWA 1K42A 3LEGA 3WX5A 2JDKA 3EB7A 3HMYA 4HLTA 4WVMB 4XZUG 1YIFA 2YXSA 3I3DA 3LEIA 1OC1A 4Q4X1 1RMU2 4CEWB 5FOJB 4NHXA 3LCPA 1FXZA 3L9JT 4GH4B 4AGGA 2CGOA 1IGOA 5JI7A 4YARA 4HN0A 1QJX2 1PMHX 3MIDA 5JCTA 4ZXKA 2JDUA 3AX4A 3JB8A 2RDNA 2Y33A 1LOAA 1ZA4A 4IDZA 1H4HA 2WQ8A 3GM8A 1U5IA 1RXGA 3LIGA 3VV1A 3S7EA 2PLV2 1H8VA 3T1LA 4Q0PA 4PDWB 1JTZX 1CAWB 4DMIA 1JHJA 1IS3A 4OHZA 2DV9A 4OFGA 5KHIA 1X9PA 1W8TA 3FHAA 5T5OA 1HJFA 2Q8DA 3QH7A 3VBOC 1URXA 1I5PA 2QDNA 5A3OA 3ACHA 1O3TA 3ENRA 1HRI1 1EPWA 1UOFA 2DVDA 2XQRA 2YB7A 5FYIA 3VBRB 3N9QA 3WNKA 4NROA 3PMEA 4C8DA 3BTZA 2LM3A 1GOFA 3KLSA 4IV1A 3SMHA 1PO13 2A6XA 2WWSA 1EPZA 2R49A 3EQEA 1A3KA 3MI8A 3THCA 4FAGA 4Y1YA 1NCRA 2ZJCA 4NIGA 3OYWB 3AC0A 3PVNA 2ZEZA 1MZ5A 3T3YA 2E51A 1XSQA 1LOFC 4QHBA 2V4VA 4XEZA 3U10A 5F2WA 4B29A 1PO12 2WZPP 1HB4A 4HKOA 1PVXA 1FX5A 3N9NA 2EXJA 3RYPA 2YMZA 4GKYA 1OSGA 3M4FA 2BGPA 3H9AA 3ZYBA 2RMU1 2AR6A 4YGEA 2WNVC 1GWMA 2O8OA 4EN6B 2OX0A 3VDAA 4EN9B 4EYUA 1E5RA 5E6HA 1J3QA 2W1WA 3OGRA 2HYKA 4LULA 2G9GA 5I91A 3VD4A 3VBHA 1SQ4A 2OKXA 1DZQA 1S0EA 5A3MA 3FC0A 4OLLA 3PIJA 3IBMA 1BQPA 4ISRA 3R6SA 1HJGA 2MEV1 3LFMA 4WM8C 1JOPA 5FZGA 1STMA 4NUBA 4XDQA 4OMCA 2XLFA 2GH8A 3DKQA 3U4XA 3LPGA 3SEEA 3WDVA 3HVDA 1DYOA 2B5HA 2F17A 2YZ4A 1X36A 2ZGSA 3J8F2 4JCKA 4AVBA 3JD73 3H7YA 2OS2A 2VOWA 3L2HA 4UXAA 5DAPA 5IVYA 4LJHA 2C9KA 5FWJA 1GANA 1KFXL 4DB5A 2WWJA 2RS52 2VOTA 2FDHA 1DCSA 1O7FA 1OUSA 1W0OA 5AFBA 2FZ2A 2R073 1HV1A 3TWIA 3IDAA 4E4DX 1U0AA 2D6LX 1SLBA 3PLQA 2D5FA 1QJU1 2VUAA 1JZ5A 1FI2A 2D43A 4YVSA 2GMPA 1FYUA 1RUF3 1H2LA 1SDWA 3MIBA 1NCRB 5F3CA 2ZKLA 4M4RA 4E4ZA 3SCHA 4CEWC 3GZAA 4Z8BA 1XE8A 4GH4C 3IM0A 3SXWA 4CE8A 1ZZCA 3WP4A 1Z7S2 3MUY1 3I8TA 5FR3A 3AJYA 5A7SA 4IE4A 4JAAA 1RUF2 1GNHA 1TEIA 1WCSA 3KV4A 3LQCA 3OY8B 1NXD1 2PAEA 3KV6A 4NRPA 2Q8CA 3ZPOA 4A42A 1ENQA 3I97A 5FY9A 4M3CA 1H9WA 2BDRA 2XLGA 1RUH3 3LE0A 4PDWC 2XMLA 3VZJA 3LSEA 1DYKA 2Q30A 4UI9L 1W03A 3ASIA 4GAZA 3TEWA 3DXUA 5DAQA 3LF7A 3MIHA 1EAH3 2UY8A 3MFAA 1WCKA 5FYMA 2Y0IA 2BFUS 3VBHB 4XF3A 4HVQA 4RHV2 2JIJA 2GNTA 3MLKA 2XONA 3ZMOA 5CADA 2VC9A 1RUH2 2OPKA 4A6SA 4K20A 2XBO1 2CHHA 2XLAA 1HXS1 3VBRC 4H7LA 1ZBE3 4IW3A 3S57A 5CA6A 1JS9A 1JHNA 4NN0A 1LHUA 1SHWB 2RE9A 1UYYA 2VNOA 3KCXA 3M3OA 5EWSA 1A34A 3NV2A 4AI0A 3TAYA 3HNYM 4PF5A 4OUSA 4KH9A 4CU7A 2A70A 4Q4V1 1AVBA 1ZBE2 1G86A 2ZGLA 4FBFA 2AACA 3HAGA 1VE0A 3B01A 4KWLA 4MLOA 2WZ8A 4NRMA 3RVHA 2JKBA 3FFZA 3IMMA 3QOPA 1HX6A 4FTEA 4ASKA 4BM8A 5LEKA 3DUIA 4XFHA 2P1BA 3UKNA 4BK4A 1RUD2 4R4ZA 3WF0A 3PJQA 4BLJA 4C91A 4NIAA 3RWNA 3N3HA 2YC0A 1BEV1 1RUI3 1T6BX 2D3SA 2XVGA 5IHRA 4IV3A 1QQP2 1Z0HA 3ZPYA 5C70A 4BWOA 4URAA 3B9CA 1EUTA 1DGRA 3CLPA 4QPWA 1V0AA 2CU5A 3B3QE 3AFKA 2VU9A 2WT1A 3ROUA 3FHIB 3K4ZA 1TNFA 3LA3A 3WG2A 3S0MA 4YSFA 3K46A 4AVAA 1V00A 1WBFA 1CIYA 1YHFA 3A0NA 1RUI2 4U36A 2V72A 4YG6A 1UOJA 4O9EA 5GLWA 4I09A 4HMZA 5FZMA 2WBKA 3VDDA 2B9UA 4M3CB 1CAUA 1W9SA 3H3ZA 5EJZB 5IJRA 5K0UB 4DUXA 1US2A 1TG7A 2JIGA 2MHFA 3AKPA 1ZX5A 2D6PA 4HK8A 1NKGA 2GMMA 5C4WB 2D6OX 5IWFA 4LK7A 4CCOA 1FMD3 4XC9A 1TMF3 3BPZA 4AEJA 4FTBA 5FPUA 2XHKA 1VAKA 1Q8SA 2P3IA 3RI9A 1EP0A 1RL3A 3C7HA 2NM1A 3V65A 5DN2A 5GLTA 4A44A 5FYTA 4CDQA 3O1SA 1DGWX 4XHXA 1KJLA 1KFUL 4QKDA 5FREA 4FPHA 1AZDA 4N43A 4P9JA 3SITA 3WV6A 3JD71 4Y1VA 1BMV1 1MQTA 5JMCA 2IVIB 3HT2A 2YBSA 1C5IA 1NQJA 1WW5A 1Y7BA 1IS4A 2VUDA 3POFA 1NCRC 4N90A 5IATA 4ZHNA 1BCXA 1DIWA 4K8RB 5CISA 5FZ6A 4BU2A 1V70A 1OPOA 2RDRA 2R071 2WFF1 2WS92 4RQPA 4HT1T 4XQWA 4XF0A 5FMBA 4CP9A 1AR81 2XWBB 2YGMA 4YZ4A 2ZGKA 2VZ1A 2BUKA 1I6XA 3SQOA 4Z2WA 4GKXA 4P9GA 3IB3A 4KWKA 4P9XA 1ZZ7A 2RS13 2D3RA 4GB32 2V73A 2BQPA 3CZJA 1RUG2 2AYHA 2W46A 5FZBA 1KITA 2E53A 4EE2A 2MNGA 3IKWA 5DABA 3QBQA 3VBHC 5KC6A 5M0TA 3D6EA 2X05A 2BWAA 2ARBA 2HWE3 1OBNA 2VCBA 3OJBA 3WF2A 4V1PA 4LNVA 1TZOA 3VDDB 1M06G 5A6XA 1CAUB 3Q8BA 1IQAA 2OXBA 3BI3A 2Y38A 4CXYA 1TME2 4N53B 2DU0A 5LWBA 4LHKA 1YFYA 5EIYB 5FXXA 5HCFA 2D98A 1W05A 4MVTA 2XHNA 4YW7A 2HWE2 4JHTA 5FZIA 5T5LA 2ZX0A 2OQ7A 4Q4Y3 1LESA 3CKHA 1QJY2 2Y6GA 1ZRRA 3ILFA 3PDQA 4W4ZA 3W58A 3WW2A 3OB8A 3ZMNA 4AHZA 1XB9A 2DWRA 2J22A 3BTAA 3UESA 1ENSA 2ZGPA 3UK9A 4CDQB 5IFTA 3G6JB 5FP3A 4AI3A 5BUVA 3GALA 4S2FA 5D1IA 4FPCA 4NRQA 4OUMA 4N43B 1K5MA 1PM7A 2V5DA 3MF9A 4BPZA 3GBWA 1MS8A 2ARAA 3ZM8A 1H8TA 2AEYA 5FY4A 4CCNA 1CQ9A 2B42B 4JDOA 5IYYA 4KNCA 3ZFFA 5FQ0A 3DYOA 1BBT1 5LA2A 5B4NA 4OI4A 1UCXA 2Z79A 2HBTA 2ZZJA 4Y4RA 3K2OA 3OBZA 2WNUA 2Y0OA 2ATFA 4RR3A 2Y60A 4Q0SA 4M01A 3ZXAC 3KMHA 4Q8LA 3KT7A 4CP9B 4CP1A 2VVEA 2VBDA 1POV3 2CTVA 4PT6A 2VOVA 4RGAA 1B35A 1NCQA 4HBNA 3WDXA 3RDIA 3HEIA 5FY1A 1G6NA 3T2OA 4FQ4A 3AL5A 1HW5A 4XF4A 3ZSMA 1K45A 5FZAA 3VDCA 2C1FA 2HWC3 3HN1A 4I3PA 4AI8A 3WG4A 1O3RA 1N3PA 2ES3A 2WQ4A 2IWGB 3FN9A 1S0BA 4MO3M 5C4WC 1Z78A 3LB9A 4CUCA 2VECA 2DVGA 5FZEA 2JDYA 1MVEA 4QX0A 2VMDA 1S2KA 4K40A 4AWDA 2XJRA 3MW2A 4YM3A 2BBVA 1ASJ3 2QQPA 3H1YA 4O9GA 3WW3A 1QIQA 1ENRA 4D6RA 5CFCC 4ZZ5A 4FT8A 5JR7B 1R1A3 3WNNA 5SV8A 3AKQA 2E33A 4HFSA 1Q43A 1W6MA 1D4M3 1GV9A 1TMF1 4Y26A 3WG3A 1ASJ2 4JZRA 5FXVA 3KF3A 4QT6A 5LATA 1QXRA 1W8ZA 2ZGMA 3ZYJB 4DZGA 1C5HA 1OH3A 3GZTB 4QXBA 1R1A2 1LHWA 4XIOA 4XUNA 1JZ6A 4XYXA 5ISLA 1QF3A 4QU2A 2AUYA 1OF4A 2R0HA 5D21A 1KEXA 1WW7A 3WEZA 4IEYA 1K5MB 4Y22B 5ABJB 2EA7A 3D0JA 4ZONA 5E8AA 2LALA 4JGZA 4W50A 1H8TB 4OHWA 4CCKA 2FD8A 4XILA 4LIUA 4UBGA 3ZFFB 4XJ9A 4FI9A 3WHTA 5A1LA 1GZCA 5I0RA 5H9PA 2FHRA 1VRH1 2RDSA 1RHI3 2QVSB 5JZGB 1NG0A 2PHDA 2XKPA 2WNUB 2Y6FA 4Q1RA 1ACCA 4RR3B 1AR63 4XDPA 2K2SA 3NQHA 4URTA 4EZHA 2A6VA 1YFUA 1CVNA 4GALA 2QQKA 3BTXA 2G4IA 4AVSA 3VDDC 1B35B 1NCQB 2PHLA 2WA3A 2GC0A 2CV6A 1VBE2 4UFKA 1FPN1 1RHI2 4N53C 3URFA 3ZFGA 4MGQA 4K8FA 3RFRA 4L2NA 2QTWB 4F83A 3K4AA 4ONUA 4AFMA 2YV8A 3MIGA 1OQ1A 1X8EA 1C1LA 5FZOA 3QD6A 1NE4A 2QQJA 3CNAA 3DN7A 1VBC3 3AZWA 4Q0VA 5FMCA 4EWAA 3VKNA 2JB4A 4XJ8A 4CDQC 3WQ0A 1O4ZA 2IVJA 4D8MA 3IZOA 4EZ4A 4R9AA 5TSWA 2RVAA 4N43C 1YJKA 4QMAA 1MQTC 2GNDA 2VE1A 4BZ4A 2P37A 4A4AA 2W9XA 5J36A 4GJYA 1LR5A 1Y9MA 5LA0A 3AZVA 2XQXA 1ENXA 4J1WA 2J1AA 3AYEA 4TYSA 3POJA 3UJQA 1VMJA 2L9LA 2VW1A 5FZ3A 5JSPA 4B1MA 4W6XA 4E4HA 2YFZA 4YW5A 1UZZA 2QDRA 3SH3A 4HK9A 2BW8A 4GWJA 3KQRA 5DDJ2 4CDUA 4D3WA 2ENRA 2I74A 4JKKA 2EXIA 4FOQA 1PM4A 4GXLA 4PF1A 5HV0A 2QFEA 3HNMA 4CXWA 5BYNA 2R1DA 4EROA 5C9AA 4B4QA 4E27A 5CU1A 4A6OA 3KHBA 3WP5A 5JPMB 1OHFA 4CDWA 4OYUA 1GQGA 2IXCA 1OLRA 1UY3A 4PLNA 4A3ZA 1RVF3 3O1MA 3ES1A 5FPXA 2BNMA 3LFIA 3OCPA 4QU1A 5FCCA 1WCDJ 3HJRA 3ZFGB 2W95A 4NHMA 5C6CA 3ES4A 4K3UA 4OCTA 3FLPA 3HNBM 3SH4A 4LBKA 4XFFA 3TOJA 4P02B 2C26A 3JU9A 5FAXA 1LOFA 3G7DA 3ZN4A 2DCKA 2WQZC 4BE3A 4SLIA 5FZOB 2VMCA 1HQWA 2YROA 5J48A 1SPPA 2X10A 5FYCA 2ZGRA 1COV3 2QUOA 2VMFA 2CWSA 3OGGA 5L19A 2W1QA 2ARCA 2AEZA 2YC2A 1UPIA 2VZOA 1P8JA 4HKWA 1S4CA 2QQOA 3E5XA 4MGTA 1DDLA 3BU0A 1VBB1 2R062 3BVCA 1K5MC 5ABJC 1UOGA 2JDAA 5IK4A 4JRAA 1LECA 4R9DA 2WO2A 1H8TC 1D2QA 1SBEA 1ZA7A 4QHOA 1LCLA 3ZFFC 3KF5A 1RUJ2 1VALA 3VKOA 5FO8B 4YLZA 1F15A 2OZ6A 2WNUC 5GZCA 4KI5M 4RR3C 4WM8A 3AP7A 1GSLA 1PO23 5APAA 3K3OA 3WP3A 1H6XA 4CDUB 2TEPA 3WR0A 5C8CA 2ORXA 4S2HA 5JIUA 1BLZA 1W6NA 1G9DA 1B35C 1NCQC 4Q4X2 4Q4W1 2E31A 1ND2B 4QDQA 2DCZA 4X8PA 5DZGA 3TN93 5LEJA 4UOJA 5C9AB 3IT8A 2C9AA 4FFHA 1G9CA 2RR13 2VVDA 1CJPA 4CDWB 2PA7A 4XE9A 4LEJA 5FDBA 1PO22 2A6YA 4LKDA 2B46X 1O5UA 3ON7A 1BK0A 2BZDA 4PBOA 1BVVA 3ECQA 3GXUA 3CQOA 1LHVA 2F4PA 4KWUA 4TSVA 3O0WA 1N1YA 1APNA 4R9BA 3WNPA 4IEUA 3I49A 3ZX7A 5HXMA 3OEAA 4MSVA 4K1YA 4LUMA 4YYOA 1CX1A 4JV4A 2XG3A 1RUE3 3RRDA 4L9BA 4LA3A 3MIFA 2FCVA 3VKMA 4WVZA 2CAUA 5A7NA 4FFIA 2ZAHA 3MZHA 3ABZA 2XXZA 5EPAA 5FTTC 1HQNA 4LBQB 5F5CA 1W0PA 1FATA 5DUUA 1VBC1 3V0BB 3N7LA 3PUSA 3ZFEB 1CR7A 4B1LA 1JYWA 4RGKA 1UW8A 1JH5A 2R042 4BQXA 5DZFA 3NJYA 2ZABA 3FWEA 4AGVA 1UX7A 5A70A 5C33A 4I30A 4IUGA 1V6JA 3EO6A 3JCIA 5A3WA 3WY6A 2CL2A 2YY1A 2UYAA 4CSWA 2Y34A 5BV6A 4JGZC 1F5FA 2WAAA 1ZZ8A 2HWB1 3E5UA 3FMGA 4RS5A 5FYBA 2Y6LA 3KWVA 2VULA 1W6QB 4UFIA 2VD7A 3FLTA 3JXSA 5BPXA 3APBA 4AAPA 3TEYA 1Q8VA 2RMU2 4K9SA 4CPBD 1C8M1 4AF9A 4G3YC 1MZEA 1W6NB 2LS6A 2RM23 2UY9A 2ZGOA 4LIVA 4EWEA 4LTAA 1O91A 1NAEA 3DV8A 5A33A 2VG9A 4MYEA 5DAXA 2VNRA 2VGDA 5A7PA 3UKVA 3ZFGC 1JMUB 1UY1A 2QZ3A 2XL9A 4CPBA 1HRV1 3CDZB 1MR5A 5DPNA 5BNNB 2RS31 1WGPA 2ZPXA 2DVAA 4XFBA 3WQ1A 1VP6A 3VBUA 4ES9A 2V09A 2WJSA 3O7OA 1OVSA 3ZN5A 3HQUA 1V6OA 3AYDA 3J4UH 2WAOA 3FUQA 1OA3A 1QJX3 2W1UA 4AHXA 3RZHA 4YM2A 4XF9A 3SCFA 4BXSV 3PVOA 3P3NA 3CL1A 1OFNA 4Z2AA 4AEDB 2PLV3 1RGSA 3VL9A 3VHOA 1UY2A 1UZYA 3M3EA 3GJBA 3H3UA 1COV1 2KA3A 3MDPA 2CDPA 4Y24A 1RUC3 3O1TA 2VZSA 4XACA 1AX1A 1QJU2 2DFCA 4M4PA 3CF6E 1GYKA 3BKZA 1CAVB 2HWD1 4TLFA 4AG4A 1IS5A 5FY8A 4JQRA 2HWF1 3IN9A 4CDUC 2JG9B 2BOIA 4H3WA 1PGW2 2PHFA 3ELNA 3I2GA 5E1RA 5FV3A 3NL1A 1RUC2 2A6WA 4NVPA 5DUXA 5C9AC 4WVWA 1OVPA 3ZYFA 3KZ4C 4RS5B 4TWTA 2ARXA 4I2OA 1SLAA 4CDWC 2YPJA 3RI8A 3UGFA 4UWDA 3WHUA 4CP0A 5F3EA 5F5IA 3D3AA 1RC6A 1AR72 1POQA 5IK8A 3CEWA 3H3LA 1U5XA 1WMFA 1HB3A 2PHUA 2W91A 3B93A 1XNBA 2HEYF 4FFFA 2HH9A 3MUZ1 2K0GA 3AYAA 5BY5A 2AGSA 3TN91 2A3XA 5A33B 1PGL2 2VY0A 3U37A 3WP6A 4CCEA 2Z2SB 4F7ZA 2VO5A 4QX5A 3AVRA 1SZBA 4LBLA 1MEC3 2PTMA 1W28A 3DGTA 2EXKA 1US3A 1HV0A 3VHPA 3VD3A 2UURA 4BQ3A 1R091 2XVKA 1AYN2 1JZ8A 5GZGA 1OKOA 3MO4A 5JXGA 4HZFA 2WR9A 2XBO2 1QH6A 1HXS2 2H6CA 2B39A 1W2AX 3H1MA 3KS7A 3NJVA 4XETA 3VBUB 1L7LA 2C5DA 1F8VA 1AX2A 5EYYA 4E8CA 3ZFEC 1VPHA 3P1IA 1GP5A 2B7YA 1W9FA 2Q5TA 1MEC2 1WBLA 3OY8A 4QKNA 4WZFA 3R05A 3HQRA 1RUE1 2P3KA 4NE9A 3SKJE 2Q8EA 3PTRB 4KQ7A 3FE5A 4YZ2A 4Q4V2 4NPRA 2W2IA 3FLRA 5FZ8A 3T08A 2KXLA 1Q5OA 2DVFA 3NV3A 1C28A 5EYXA 1WW4A 1G8WA 3PMSA 4OMDA 3T1MA 4AFAA 4MUVA 1V6MA 1KXGA 1TQ5A 5IVCA 2CSGA 3J8F3 1JBCA 1WLDA 1LGCA 2VMGA 4LKSA 5JSRA 3KGLA 4O65A 1BEV2 1QKQA 4K6BA 5C8CC 2VMIA 3LIHA 4DXSA 3PIGA 2RS53 4JQTA 4D7YA 4NHYA 1N47A 1SFPA 3F95A 4RFRB 2ZGTA 3MW3A 4MHUA 5GLZA 5ERLA 3QLQA 3O12A 1UXZA 4HSJA 1IG3A 1DU3D 2JJ6A 4QQLA 4IGPA 3RZKA 1QNYA 3KM5A 3PHMA 4LK6A 2WKKA 4M3CE 5FZ7A 3H0OA 4AEMA 4UBHA 1DGLA 1WMDA 3T30A 4E9KA 2PQQA 3LEKA 4B4RA 2RM21 2WABA 3IAQA 4JKLA 5KR7A 5CKQA 2ZAAA 3HR9A 4I3GA 1PVC1 3CZUA 1Z7S3 4RL7A 5FMDA 1GZWA 1JYCA 2JDZA 2RV9A 2OW4A 3J9SA 3Q8EA 4MZUA 4YZ3A 1PX3A 4D69A 4NWWA 2Z69A 3HN3A 1N1SA 4QDRA 3ZSKA 4AYUA 5K8SA 1UMIA 1YWKA 2XB6C 5B4XA 2YG0A 2WINB 3ZKUA 4WV8A 1S0CA 1RMU1 2AZ5A 5J09A 4R4XA 3ZSJA 4YZ5A 4AI9A 3BYWA 5F39A 2OZJA 5C3QA 1AF9A 4OZXA 1ZZ6A 1QJX1 2XJUA 3ZXFA 3WUCA 4LO6B 1AL22 4EQVA 4RHV3 4PIYA 1WZXA 5FUNA 1UYPA 2JG9C 3CMGA 2JENA 1UX6A 5K0UA 2GU9A 3S30A 4IXLA 5LW9A 1V9U3 1ZRFA 1DZRA 1XU1A 1BJQA 4P08A 1J1TA 4BXFA 3AXDA 4NHKA 3BGAA 1WLTA 2WFF2 3X29B 5C4WA 1WW6A 4KBBA 3MW4A 3OSDA 4RS5C 3POSA 2DCJA 1LRHA 2GP5A 3AP5A 4XZPA 3TEXA 5CB7A 1W2UA 1AR82 4P14A 1EY2A 2ZTNA 3C3VA 3SISA 4M3CF 1NOVA 4XCBA 1V9U2 4W6YA 2Q1FA 1KD7A 3M2MA 3B02A 3HD8B 4YW6A 4YWAA 1WMEA 1XNCA 1UXXX 1VIWB 1IS6A 5DG2A 3WW4A 3ZXLA 1GWKA 1RUD3 4ZXEA 3GBFA 3LAGA 4ZS2A 5CFDB 4LOTA 4CA9A 1QQP3 2ILMA 4ASMB 3ACGA 3I2JA 4QB1A 2QQMA 2WZR2 4TN7A 3VBUC 4N7IA 1UZ0A 3OPTA 4DEQA 1CIWA 1PO11 1UIJA 1JZ4A 1U12A 1WMXA 1F4AA 5I8SA 4XFCA 5H9RA 5JOYA 1GZWB 4UW5A 2LUWA 5IK7A 5HV4A 1RUOA 1NLQA 1UPSA 2DUOA 1K12A 3LZZA 3JZVA 4HL0A 2XH6A 4WM7B 5BNOA 5A3NA 2ZCWA 4V2VA 5A7OA 1T2XA 2GP3A 5EQUA 1VBA2 5FXZA 4RGGA 4AFDA 1G9BA 1GNYA 1BYHA 4ARYA 3I3BA 2ET7A 3ZXDA 4MXWA 4AK3A 4XAEA 2B4KA 2Q4SA 1IQDC 5J98B 2A5ZA 4JGYA 3VL8A 2IXHA 1E57A 4HONA 1UF2C 3WF1A 2GZWA 4OHYA 2QQLA 2VCMA 5A3PA 1XQNA 2WIIB 3N36A 2PN5A 1QGLA 4BQ5A 4N53A 1UYZA 4YFWA 1Y4WA 2JDMA 4FPJA 1BBT2 3OBRA 5AVPA 4ET7A 2BFUL 1LGBA 4N9HA 2A75A 1OXCA 5CYYA 4BMBA 3O1PA 3T0DA 2AC1A 5CBLA 4BQ4A 2D44A 1ZRCA 3M3QA 3GCWA 3V56A 3BODA 3U14A 1ZVFA 3LDBA 1UU4A 3FHQA 2EAAA 2XGXA 1UN1A 1R64A 1VRBA 3AP6A 3NRUA 5IUQA 5FBJA 3ZLIA 4LQRA 4AQSA 1QH7A 3H50A 2RS51 2W87A 3MGUA 5AC92 2GNBA 2C0ZA 4OHVA 4Z1VA 5E88A 5DMYA 5L7OB 5IVJA 2WS93 5FYVA 3IDBB 1IG0A 3Q8FA 4XJUA 1LU2A 4IEWA 4AVVA 4UAPA 3T2QA 2TNFA 3NNMA 5CKNA 3HWJA 1C1FA 2WYFA 1H30A 1CZTA 1DLLA 1RTVA 4CYDA 3FZ3A 4D7TA 4AEKA 2Y8KA 1WD3A 4CP2A 3ZXKA 4XBLA 3TNPB 2EICA 1YC61 5A3TA 5EZWA 2X29A 4GB33 3ZXGA 5FP8A 5KBFA 2J1RA 1RUG3 5KXCA 1Z7S1 5FZHA 4L92A 5LY1A 2C6SA 4DS0A 1RUF1 1JN2P 4DXTA 4GULA 4A45A 1TNRA 2AENA 1NY72 2VTXA 1OLQA 2VPVA 1ZRIA 2ZX4A 4IE7A 5BNOB 4XDOA 1XPWA 4BDVB 4QX1A 1H9PA 2YBPA 3P6BA 3VHRA 5JOWA 5I0UA 3D82A 3KV9A 4EV0A 1SLTA 2IXJA 1TME3 2JXAA 2IFRA 2VCCA 4S2GA 4DNYA 4AHWA 4I0BA 4MXWB 4OULA 3OEBA 1PGSA 3ORJA 4AXOA 4ZU7A 4EJRA 2XR4A 4RHV1 4JGYB 4ATFA 4AVTA 1EYBA 2DU1A 1RUH1 1VB4A 1QJY3 1W3XA 1ZBA3 1OKQA 1W9YA 1XYNA 2XPJA 2OT7A 2ZGNA 1QXJA 2Q1ZB 3L2YA 1Y9GA 1EAH1 2BVBA 4PJYA 3BTYA 5FO7B 1MS5A 4Q8KA 1SLIA 5FPBA 1EV13 3PUAA 5HBAA 2WNEA 4Z82A 4FFGA 2FDGA 1ZBA2 1ZBE1 3SNMA 4AVCA 4XJZA 3AMHA 1DP0A 4F8AA 3ST7A 3BOPA 5I93A 3VBSB 1MS1A 2ZEYA 4FCAA 2E7QA 2DBNA 2JDHA 5KHKA 4NIHA 4Y22A 5T55A 1EV12 1KS4A 4CU6A 5ABJA 1RUD1 2ADDA 2IUWA 4ZKTB 1W3VA 1X7NA 3EMRA 1PK6B 4BLIA 5KWRA 4HVOA 4WM7C 3ZYPA 2E9QA 4L0PA 1QQP1 3NKTA 1GKBA 1AYM3 2RJKA 1AR92 2AREA 4HETA 3M8LA 2CNAA 4YRDA 2O8QA 4BIOA 1UKGA 5JZGA 1Y43B 1KGYA 3KCYA 4LHSA 2N7GA 3CJIA 5HI0A 1XOYA 2GC2A 3EXUA 3NNGA 5A7QA 3S7IA 1F2NA 3MLJA 1YI7A 3JBG2 5C3OA 2UYBA 3KT4A 4IETA 5CEHA 4FPKA 1RUI1 3E6DA 4CRQA 3KB5A 1XYPA 1BVP1 4LA2A 1AYM2 3SH5A 4ZPIA 5C71A 5KXEA 2YC4A 5K0UC 4QXCA 1YRZA 2ZEWA 4MADA 5CKMA 2JEMA 1BXHA 2WUHA 1ND3A 1GOGA 4Q1PA 2E32A 2QQIA 4KU7A 4LBOA 2DYCA 1X82A 2VBBA 4W65A 1QHDA 1UAIA 4XURA 4EN0A 2D5HA 4PHZA 4K1ZA 4ORFA 5FYUA 5FXWA 5F8PA 2YBKA 3ZSEA 1N3QA 1XBFA 5FIXA 5LRSA 3SCGA 4N9IA 3USSA 2A7AA 3JB4C 1FMD1 4FPFA 2YHJA 4QPGA 1VBD2 2RJ2A 3Q8AA 1NLSA 2NN8A 3B69A 2BYVE 2Z4FA 2Q1MA 3HBKA 4XPVA 1AXKA 1YCIA 3MPBA 3BIEA 5CG8A 2P5BA 2QQWA 4UF0A 3OG2A 4UFLA 3AKSA 2CGPA 5IVEA 3H1WA 2JD4A 4PQ9A 2GC3A 3WG1A 4FOWA 2W52A 4GQ7A 1J84A 2WS91 3VZNA 3LOIA 3MHZA 1FOD3 3OPWA 3POIA 1DLCA 2PHWA 2ZMNA 4KWJA 4XQDA 5LK7B 3VZLA 3WCSA 5BNOC 3LEMA 4QWNA 5K9YA 2ZOEB 4QX2A 1VBE3 2JG8A 4RN5A 1W8WA 5BNPB 2J1UA 1FOD2 3CJIB 4N8MA 1JU4A 5LRRA 4AL9A 1QJZA 2X53S 1PIV2 3WUDA 5IT6A 1MZ6A 3OGVA 1LU1A 1PMJX 1VBB2 1DGRN 4JGYC 4KGQA 2I07B 4MH0E 5ACA3 2RS11 3AP9A 1POV0 4Q2FA 3F2ZA 1PNGA 4I01A 4A2UA 1WKYA 3WOGA 5J96B 3FBYA 5FYYA 4UW6A 1RIRA 2ZX1A 4IQPA 3U78A 2P6CA 1H2KA 4MV2A 3NW4A 1ND3B 1QDOA 1GBGA 4OZOA 3J7MA 4X6QB 4YW2A 5FYHA 2XJPA 3AKRA 4FVVA 2PQSA 3UETA 5T3NA 4OQ8A 2HWE1 1WLWA 4QB6A 5ACA2 2WLPA 3IDEA 3RYKA 2I45A 3AB0A 1OT5A 2VQ0A 2VVFA 2VZVA 1QJY1 2X8KA 3VN4A 5DZEA 1NLRA 1H1AA 3ZOIA 3AMQA 4RD7A 4CTEA 3VDBA 4W8JA 4H2AA 4Y4YA 1DZTA 2VZTA 1QOTA 3BPSA 5JR2A 1E5IA 2XJQA 4DXRA 2XL7A 4YGCA 2GMEA 3NJZA 1FAYA 1PNFA 1MZFA 5DDJ3 2BOJA 4QPGB 2VOXA 5H9QA 1R082 5F6LB 1QOOA 2JE9A 4Q4Y1 2R0FA 4ARXA 5DG1A 4XOGA 4UYBA 5HXVA 1W9WA 4KG0A 4AOCA 2BNNA 4UF0B 1O59A 1FV3A 1X8MA 1XRUA 1OQEA 1F9KA 2W1SA 1CZVA 4FP2A 4COVA 4ZS3A 4IE5A 4JKMA 1RINA 3H42B 2IZWA 1LKNA 5GZFA 1PHMA 5FZ1A 4B8EA 5F5QA 4HSLA 5CIRA 3GF6A 1GP4A 3RYRA 2WLQA 3UKTA 5BNNA 1IPSA 1ND2A 4P00B 3MPPG 3OUJA 3ACIA 3W5MA 1SEFA 5FPZA 3CBNA 1VB2A 4A3XA 4GJZA 1YO8A 2DFBA 4IGOA 2JG8B 3I4IA 3LWCA 3W9AA 1Q8PA 2V4AA 4LO5B 1W8OA 3GZUC 1JW6A 3FJSA 1LGNA 4PCRA 1POV1 4GZ9A 2CDOA 4BQYA 1IPKA 2ZZQA 4NIDA 3MV01 1XNTA 5A80A 3RS6A 4LBQD 4LO7A 2J1SA 5A1FA 5I8YA 2BP6A 3LD8A 5L9RA 3MLLA 5LBBA 3FX3A 2HWC1 2HWB2 1UL9A 2A71A 1LULA 2OQ6A 4PI2A 4R52A 4YW1A 4QAWA 4L97A 3VD5A 1W99A 3WLUA 1GNZA 2JE7A 4LITA 2R063 1LEDA 3ZDSA 2F6BA 2QCSB 4P9LA 3DPRA 4LBQA 1ASJ1 2WSUA 5EJ1B 3V0BA 4UW3A 1REDA 2VZPA 1C8M2 1A78A 2GN7A 2WO3A 3ZFEA 3MV11 3AJZA 3AKTA 1RUJ3 1R1A1 4LKFA 4YPJA 3QACA 3ZVXA 2XJTA 3NNJA 4MGYE 5JDBA 2NYYA 4GIQA 3ME2A 5JMOA 1I5ZA 1JI6A 3J26N 3SLIA 4J25A 2ZBJA 3OUIA 1OQDA 5A7WB 1D4M1 3POEA 2NP0A 1NA1A 1HRV2 3AZYA 2RS32 1A8MA 3CO2A 4XVHA 4D7SA 4NPMA 4Q4X3 4P9YA 4MG2A 4H14A 1GOHA 5FZDA 5JZGC 2ZXQA 2W92A 2XOMA 4LLOA 1W6QA 3H8UA 4XXPA 3CJIC 3M70A 3UGHA 1D0HA 5I0TA 3RJ2X 3KCCA 4ZU4A 1WCQA 4D94A 3U0ZA 1LOBA 3HT1A 2BTVC 3LDRA 1KRIA 3UNPA 1YIPA 3DYPA 2J1EA 1K5JA 1RHI1 5CZKA 2IXKA 1ND3C 5EJ3A 3BUCA 2J1VA 4XW3A 4LXLA 3ZXEA 1LODA 1AR61 3O0VA 1SBDA 1UU5A 4OQ9A 4K21A 2HWD2 2XJVA 2FCTA 3IAPA 5EV7A 4JHZA 4JC1A 1CWPA 1KQRA 1HRI3 2JX9A 3NKGA 4BQ1A 4CZSA 1YQCA 1LOGA 4E2QA 3R0RA 1ZRDA 4N7UA 2DCTA 5JI9A 3VLBB 2R043 4FTSA 1XXNA 1D0GA 3O14A 1IKPA 3JQWA 4LBJA 3RWKX 4LE4A 3VBOB 4AEDA 4YGBA 4QPGC 3ZYRA 1OA2A 4X8NA 4CCMA 4PI0A 3DPRB 1HRI2 3A22A 5F5AA 2ET1A 2JE8A 3BU7A 5FO9B 4YG0A 2HEVF 2ZHKA 4C1WA 4IEZA 1PZ8A 1W6PA 4SBVA 5F3GA 4XBQA 5T54A 1YFXA 3W5NA 4LHLA 3KSCA 3BN6A 1CAVA 2Y6KA 1ZNPA 4ES8A 2JG9A 1D2SA 4XUOA 4DY3A 5DDJ1 5DUVA 4BQ2A 5JXIA 2FDFA 1K3IA 2RMU3 4IESA 1NA1B 3NNLA 5C3SA 1JZ7A 1UO9A 3C7FA 2BGOA 4AR2A 1CESA 2BBAA 2IC1A 4NAOA 4YM1A 1CZSA 1N1TA 2JG8C 3IIIA 1GZ9A 4Y1UA 2UWAA 5DUWA 5FUPA 4P5HA 5KHJA 5C3PA 1GLHA 1YFWA 3ZYHA 4CUAA 1NUKA 1YXWA 3POYA 3AM2A 1Q3EA 3JUUA 2VW2A 2PHRA 1NQDA 4IE0A 4DEVA 3KQ4B 2WSVA 1UQXA 2MPFA 3P3PA 5FKBA 3RPQA 3I7DA 3SKVA 4LO4B 3D5OA 5EP9A 4NMIA 5AFEA 1FV2A 2YUEA 4J6GA 5GKAC 1M4WA 2DBIA 2ZS6B 4LHNA 5GZDA 4JVAA 5F7UA 1BHGA 2ZKNA 4Y5TA 3E6BA 3K77A 1CJDA 4AW7A 3DL3A 4Q29A 4B3NA 5C8WA 1HKDA 5FK7A 3J7NA 3QCWA 2UU8A 1F31A 4BYYA 4D0QA 4DRRA 3KV5A 2MEV2 1GUIA 2WT2A 2VMHA 3CHXA 3I3EA 4QM9A 4IEOA 1OH4A 1RVF1 2D6KA 2GALA 3C2UA 4QB2A 5FPVA 1ULCA 4LR4A 1QDCA 1FT9A 1JUIA 4G4FA 1C8NA 1CX4A 5L9BA 3WF4A 1KS5A 4BK5A 4GWNA 2FMDA 1XE0A 2DCYA 3WDYA 3DF0A 2FDKA 1QJU3 3RZJA 2VUJA 1S1AA 1S0JA 4AZZA 3H8XA 1PZ9A 2VTFA 2KR2A 1CAXB 5IVFA 3HQXA 1DQ6A 4IEPA 2NZ9A 4MX3A 5FZKA 4FO9A 3ZYGA 2BERA 1L3JA 1W6PB 3ITQA 3M7AA 1F5JA 1TVGA 5FYSA 1CPMA 1W6OA 2CAVA 4OI2A 2EVXA 2GSYA 4Y20B 2P4EA 2VNGA 1AR73 4FSJA 5LCWL 1LJ7A 5BNNC 1QU0A 3THPA 1ND2C 3I2DA 4HOOA 3AVSA 5FMOS 2VQUA 1QEXA 3K75B 1TE1B 5JWPA 2C4XA 3RZGA 3FBMA 3UJOA 4DPNA 1LHOA 3U07A 2X5IA 3VKLA 3LDKA 1PO21 1ZZBA 4ITCA 4CUBA 1AYN3 1OOPA 5GLVA 1C4RA 1ODNA 1JYXA 2NPIA 3EBRA 5IFPA 1GMMA 2XBO3 1HXS3 5F6KA 4COWA 2ZHMA 4LLFA 4CCCA 3IPVA 2P17A 4CUGA 3AL6A 4XFAA 2RR11 1J3RA 2HKXA 3DECA 1JUHA 1OLMA 3NV1A 3DXTA 4HKLA 3ZSLA 4O7XA 1W2NA 2QQUA 1IPJA 3VD7A 2FQPA 3I2HA 3DPRC 2J1TA 4Q4V3 4DO0A 4QXKA 3LGRA 4L11A 1MPXA 1OURA 3JQXA 4XMAA 4DOUA 3NNFA 5JOXA 2YGLA 2FCUA 3I2KA 2A73B 2D40A 4RA0A 5F3IA 5E89A 2D7FA 2O0OA 3NWKA 5F1RA 1WCUA 2W0XA 2DUQA 4GMP3 1N3OA 2R041 4QQPA 4Z07A 2VXJA 1RYYA 1I9RA 4AQ6A 1NT0A 2LROA 3U11A 5SV5A 2YU2A 1W2OA 4XIKA 3OF1A 3LKJA 1OMIA 2VQTA 2ZMKA 1XJAA 3MFCA 1BEV3 2BNOA 2XUMA 1DQ4A 1JOBA 1H1IA 1NA1C 2ORZA 2VM9A 2ERFA 2E6VA 3BCWA 3MBWA 2XKOA 3N9LA 4QGMA 5CNAA 5T52A 1DG6A 1CONA 3DEMA 4QPIA 4G9SB 4IEQA 2OUJA 2BU9A 1W6OB 5LASA 1RJ8A 3THDA 2W5FA 4QQOA 3KT1A 3V0AA 3N35A 2OPWA 4LOSA 2GAUA 4XHBA 1IZ3A 5FMOL 3D4KA 3SEPA 5IVBA 2WT0A 1G9AA 4K7JA 4PIXA 2EIGA 2RHPA 3AZXA 4RFT0 4COZA 1REFA 3VUOA 1W06A 2E7TA 2I2SA 1ULFA 1MS4A 2NLRA 2J42A 2J7MA 2RG4A 1C57A 4QD2A 5LBFA 2OYZA 4FPLA 1PZ7A 5DAWA 3TB0A 3VGIA 3I3MA 5CFDA 3O1VA 1J1LA 1WUVA 2X5IB 5HCAA 3T4HB 3D0SA 3GBGA 1Q56A 1GICA 1XSRA 5G05L 1OOPB 3N7JA 3WNXA 4DY5A 4CCDA 1QNWA 4EN7B 4LBMA 4F3JA 1S0FA 3OUHA 2E7AA 2W94A 2ZA9A 2BEOA 3CU7A 1FNZA 1J58A 4UT5A 3IPVB 4V2WA 5L36A 1LEMA 2TBVA 3ZDVA 5FKCA 3S6PA 1LENA 4LO8A 1AL23 1ZYBA 4AI2A 3KHCA 4WM7A 1O8SA 2JECA 2FBEA 1VMHA 4DRVA 4C90A 4AEDC 4W6WA 3OTFA 5L9VA 1VAVA 2NMOA 5IAVA 3H8OA 4R8HA 3IIAA 1HDKA 4QDSA 5FFOC 2OUHA 4Q0QA 2F4LA 2WFF3 2WO1A 1EUUA 3I54A 2JKXA 4MGKE 4PIZA 3HBZA 3S5AA 4ZY9A 1HLCA 5A6QA 4GD4A 4XMIA 4YVWA 3JD72 4IV1B 3EHKA 1BMV2 1CD3G 1DQ5A 1LHNA 3WT3A 1AR83 1O3SA 2QZ2A 3M1HA 3PNAA 4GMP0 1MS0A 2VZUA 5FJKA 3SC7X 2PLV1 1UY4A 1HN1A 2VUCA 3S5QA 1BKZA 1GZTA 2A6ZA 3TNQA 5B2GB 3RMYA 1PGW1 2OIIA 4AAXA 2OA2A 2R072 2EIEA 5T5JA 4CCJA 2ZACA 5LBEA 1RUC1 2EF6A 3LA7A 2DTWA 5IAXA 1JZ3A 4QPIB 2G9ZA 3U4SA 5C3RA 1B09A 4XCAA 3GCXA 1H2MA 1Y3TA 3PL0A 4E4SA 3PUIA 4CEYA 5FZ9A 1XE7A 1AR71 3B5LB 3EYPA 3K48A 3NAPA 5FLIA 4CXXA 3V0AB 5L7OA 1UNBA 1UYXA 2WZR3 5J7MA 2GH2A 2SLIA 3AXEA 3OBAA 1AXYA 2PHXA 1PGL1 2FMYA 4QKBA 2H6BA 4IEVA 1LOCA 1Q8OA 3WQBA 4D6QA 1AYN1 1ZREA 5F37A 2WRAA 3VKFC 4COUA 1Y9QA 1ZM1A 1VBA3 3LPFA 3LA2A 1E5HA 1O6UA 1OA4A 1I1EA 1AL0G 5FLHA 3SHRA 2V5YA 3B94A 3GYDA 2CGNA 1G7YA 1EAH2 3VZMA 1MEC1 1YQ2A 2XJSA 3WZ1A 2UWBA 1AX0A 5K7PA 4BOWA 5FZLA 2A1XA 4L99A 2EALA 3WNMA 1NXMA 3GGLA 1JU3A 3K3NA 3N7MA 3PJYA 4B7KA 5JOZA 5FK8A 5DQ0A 3NVCA 5IVVA 3KVBA 1HIXA 4Y33A 4E2GA 1BBT3 3I2OA 2BJSA 1DQ2A 4Z92B 4CU9A 2R6QA 4CVUA 1V6NA 4GMP1 4IGQA 4YG3A 5FZCA 5GLUA 3N7KA 1PMIA 4UFJA 3VBFA 2Y26A 4YVWB 2WDBA 1AUYA 4NO4A 3GHNA 5CG9A 4WZCA 1SFNA 2EIBA 4YVSB 1O4TA 3ZN6A 1ONAA 1CGPA 4Y5SA 3O5SA 4ATEA 3J8F1 3WW1A 1ULEA 4XUQA 1GWLA 4QXHA 2X5IC 3ZR5A 4U2AA 1SCRA 1ALYA 1QXPA 4CEYB 2VH9A 1H1MA 1OOPC 5FZ0A 3W21A 3NAPB 4IL7A 3VBSA 1MS3A 1DFQA 2H0BA 4QGLA 4AFCA 5KXDA 2PXJA 5JUVA 2QKDA 3RZZA 4FXGB 3E6CC 4OHXA 4HPKA 1IOAA 5J3UA 2EAKA 2NMNA 2G9FA 1PK6A 1F4HA 2VL4A 3ACLA 1QWRA 4ZU5A 1RITA 2ADEA 1UZVA 2B9VA 3UGGA 3POGA 2WA4A 1XNDA 2QQVA 3J7LA 3ATGA 1UIKA 2TUNA 2EXHA 3RSJA 3VB9A 4NAMA 3A4UA 5J37A 2YU1A 1F35A 2YDEA 3DKWA 3WD5A 3B00A 1L7QA 5LK5A 2VXRA 2QJVA 4QQ2A 4OUEA 3POWA 2ETEA 1AJKA 1X9TA 4NWVA 4XTMA 5ANQA 2LRPA 3AFGA 4KU8A 3NSTA 4JDNA 2PAMA 1UWWA 3DYMA 4YFZA 1AL21 1OI6A 4IV1C 5CAZA 1SCSA 1FMD2 1SBFA 1S0GA 2WZEA 1TMF2 2XWJB 4R9CA 2CWMA 3TRSB 5JPNB 3FL7A 4AE2A 3WF3A 4QX3A 5A3UA 1LOEA 1QJEA 2R1BA 2IFWA 1DQ1A 2UWCA 1WLCA 4LUKA 4QX7A 5IW0A 1ULDA 4QPIC 1VRH3 1JYNA 1OUXA 2PELA 1W04A 1HN0A 3N9OA 3VBFB 5BNQA 3WVJA 1AXZA 2ZGUA 1W2TA 2XVLA 2GDFA 1L7RA 5F32A 1IKQA 4XUTA 5D2AA 1N1VA 1CPNA 2GC1A 1V9U1 4Y1XA 5GJ6A 2R7EB 1ULGA 4IV3B 3ZN6B 4MXVA 2AH2A 2YFUA 1VRH2 1GQHA 1FPN3 1W90A 5FJHA 2JWPA 2ZHLA 1LB2A 4DUVA 3I3QA 1WA4A 3BB6A 4UFHA 1YLLA 5CFDC 1QJFA 3A7QA 2BV4A 5F9TA 1O4YA 4PLMA 1AR93 2RS12 1NX9A 4DFSA 3N4MA 2WZR1 1FPN2 2WWUA 4Q0UA 5LBCA 2G1MA 1RJ7A 3RGBA 4BISA 5A32A 2RJLA 3OD4A 4HPKB 3Q8CA 3ETQA 4OI1A 4X6RB 4QQHA 3JBG3 4I02A 4NR1A 1V6IA 4RYDA 1OD3A 3RQ0A 2Y6JA 1X50A 5BNPA 4Q5OA 4AFBA 4CCLA 1VBA1 2VAUA 3A0KA 4LPLA 2ZGQA 3VZKA 2RDQA 1A8DA 4KGGA 4AHYA 4DIQA 5GM0A 5A1AA 3WDUA 5JAXA 1KDKA 4YVWC 1SDDB 2Y64A 4IE6A 4L8QA 3B7MA 5LA1A 4BMEA 2VJXA 3QH6A 3O1OA 2Q0AA 1MQTB 1NE6A 1SFYA 2ZEXA 3HOBA 2B8MA 3INAA 2X09A 4M0NA 4Q4Y2 4YVSC 5FBZA 3WDTA 5C5UA 2BRTA 3UV9A 3KD4A 5FZFA 4QX8A 2FDIA 1D4VB 4NPLA 3MF6A 2JD9A 3PVBB 5FY7A 3PU3A 3M3CA 2KM2A 1SG3A 1YEWA 4META 1BZWA 4RQPB 5H9SA 1VBD3 5LB6A 4C0HA 2ZHNA 4QPYA 4Y5Z0 3NMBA 3OGJA 4FXKB 5EHDA 4CEYC 4MHRA 1QY4A 4ISQA 3NAPC 5AC91 4TLGA 5L7OC 2XDVA 3OBTA 4BB3A 1BK1A 2W47A 3E97A 2PAKA 4AQ2A 2E63A 5JIAA 4IERA 1LNSA 5FP4A 1A6CA 1DF0A 5T50A 5KHHA 5KC5A 1GU3A 3KGZA 4MGZE 1UY0A 2BGCA 1XNKA 5BXXA 5JVVA 3ZIXA 5E16A 2BPA2 2JICA 2BWCA 3GNEA 4E2SA 1XNAA 1ZZ9A 1HQLA 3R4DB 4B4PA 4BA6A 5A32B 2HWC2 1HB1A 1GFF2 3UL2A 4QGNA 5C7GA 5HCHA 1S2BA 3P5BA 5I8TA 1PIV3 2Z42A 4PQQA 3FUOA 4BQWA 5JXHA 2D3PA 1VBB3 2VZRA 4INDA 1NY71 2ZX2A 2HYXA 4FP3A 3T0BA 4KMQA 1DYPA 2VTXJ 4WVVA 3PU8A 3C7GA 1OPMA 1W39A 4YGDA 1AHSA 2IXIA 4GB31 5FWEA 4QM8A 2W68A 1RXFA 5LY2A 1UMZA 1RUG1 1W8FA 3AMNA 1S2EA 4GWIA 3T2TA 2OVUA 1XU2A 3WQ7A 4COYA 4C0BA 1VJ2A 2D6NA 2VNVA 3VBFC 3M3IA 3T09A 3C7EA 4BCUA 1UU6A 1D4M2 1KDMA 2HLEA 3R4SA 3THTA 4AI1A 3WXPA 3U1XA 3NJXA 4TTGA 4IV3C 3AK0A 3MICA 3AMMA 4Q4W3 3BIWE 2GNMA 2R16A 4CDXA 1TME1 5AC93 5FQ0B 2ID4A 4QKFA 3D8CA 5D8AA 5FRAA 2R32A 3H8RA 4BHPA 1G9FA 4D6SA 2O1QA 1ODMA
chains in the Genus database with same CATH topology
2D93A 5JLVA 2R30A 1R083 3AP4A 1ZBA1 4OI0A 5CFCA 2VOKA 4FPYA 4XFIA 1DGWA 4Q4W2 2SBAA 4EWDA 3VBSC 1JYIA 3OPZA 1U5YA 2D6MA 2WL1A 4KG8A 1EV11 3W59A 1PK6C 1AR62 1U5ZA 3V64A 3ILNA 2ZMLA 1GR3A 4LBNA 4FAHA 2W39A 4XTPA 1AR91 4Y1ZA 1SLLA 1VAMA 2DF7A 1WD4A 1DBNA 1VR3A 4A7YA 3RNSA 4YM0A 1VLNA 1YUDA 3JBG1 1QMJA 1RB8G 2LTNA 1R1ZA 1YNAA 3TYJA 1AYM1 2P3JA 2QE3A 1W6MB 1VBC2 2HWB3 4AGRA 2A3YA 3E5QA 1O3QA 4XF1A 3VZOA 4RQPC 3B9IA 2BVVA 4RSUA 3BOWA 3TBDA 1SACA 1XYOA 2DURA 4DQAA 1C8M3 4FQZA 1JOJA 4A7ZA 4JGZB 3ZIWA 1DQ0A 3Q9OA 1SLCA 1H0BA 2NQYA 3IDCB 4CDXB 3VBOA 5D8AB 1VBD1 3RJRA 1YJLA 1KJRA 1HRV3 3AZZA 2RS33 1MACA 3LSDA 3MEPA 1OD5A 4MGIE 5CFCB 5AVAA 3IWZA 1X33A 2IXLA 1NZCA 2Q8OA 5DXDA 4ASLA 4JDMA 3I59A 3ZO0B 3NO8A 4XFGA 2WFPA 4A7KA 4P9WA 3PTYA 2VW0A 4DINB 4TZDA 4LE3A 4GA9A 1QOSA 4EN8B 3HIFA 1RVF2 5HCBA 4GWMA 5BNPC 3RG0A 2YYOA 1FNYA 3USUA 5CVRA 1FOD1 3AMPA 1SMVA 1PIV1 3CJXA 1J3PA 3MIEA 2HWD3 4HANA 4Q27A 2WNVA 1UKRA 1O5LA 2DUPA 2HWF3 3IMNA 3WINE 4XJAA 4H55A 3MYXA 4J1XA 5EXOA 3O0XA 1VBE1 1REEA 4IEXA 1OFSA 1CN1A 1COV2 4FPOB 3LOBA 5KXBA 3OD0A 5A3LA 3NV4A 3H7JA 1DHKB 2CYFA 4JRLA 4PBPA 4JTOA 2HWF2 1UD1A 1S0IA 5ACA1 4Q26A 2D97A 3RMXA 3K51A 4HVRA 1J59A 1MVQA 4YW4A 2CY6A 3ALQA 2B45X 4I0AA 1CAXA 2ZX3A 4YZ1A 1R081 2DVBA 1R093 4FPEA 4XBNA 5JSOA 1V6KA 4LT5A 1IHMA 2QNKA 1V6LA 4XJWA 3TN92 1S0DA 4FOVA 2W08A 1NYWA 3I59B 2RR12 4M0HA 4Y20A 5EFUA 5KHGA 1AJOA 3WCRA 4UW4A 4WVMA 3ZXJA 4NHLA 1R092 4WBBA 5I0SA 4YW3A 4H7MA 4FPGA 4CEWA 5FOBB 3BALA 4GH4A 2VQAA 2HJIA 1LTEA 1S55A 3USUB 5IK5A 1YYNA 4FOYA 1RUE2 2A3WA 4HN1A 2DTYA 4KL1A 2MEV3 2WNVB 1T6GC 4PDWA 1CAWA 4XQ4A 2P2KA 4B7EA 2K9ZA 3FFQA 4C1XA 4NOTA 4XXAA 2PHTA 5GZEA 4CDXC 4I0WB 5D8AC 4PLOA 2PYTA 2Z5WA 4OVEA 1C3HA 4S2DA 3VBRA 4WM8B 2GN3A 5GALA 5FLJA 3AYCA 2HEWF 3GHMA 4BIFA 5C8CB 1JXNA 4AQTA 2H0VA 5CFCC 2WC2A 3ZYIB 1H2NA 4P9IA 4DXZA 1RUNA 4BH9A 3EJKA 4M00A 1I3HA 1PVC3 2R061 4YNIA 2P34A 3OYWA 1YI9A 1H4GA 3VHNA 1Q8QA 3PVEA 4JTNA 5T5PA 3WDWA 2RM22 5L73A 1RUJ1 1RMU3 3R4UA 3ILRA 1PVC2 1MS9A 2FZ1A 2PFWA 3WX5A 3HMYA 4HLTA 4WVMB 1YIFA 2YXSA 4Q4X1 1RMU2 4CEWB 5FOJB 3LCPA 1FXZA 3L9JT 4GH4B 4AGGA 2CGOA 1IGOA 5JI7A 4YARA 4HN0A 1QJX2 3MIDA 5JCTA 4ZXKA 3AX4A 3JB8A 1LOAA 1ZA4A 1H4HA 1U5IA 3VV1A 3S7EA 2PLV2 1H8VA 3T1LA 4Q0PA 4PDWB 1JTZX 1CAWB 4DMIA 1IS3A 4OHZA 2DV9A 4OFGA 5KHIA 5T5OA 3VBOC 3QH7A 1URXA 2QDNA 1O3TA 3ENRA 1HRI1 1EPWA 2DVDA 3VBRB 3PMEA 2LM3A 3KLSA 3SMHA 4IV1A 1PO13 2A6XA 2WWSA 1EPZA 2R49A 3EQEA 1A3KA 3MI8A 4FAGA 4Y1YA 1NCRA 2ZJCA 3OYWB 3PVNA 1MZ5A 2E51A 1LOFC 4QHBA 4XEZA 4B29A 1PO12 2WZPP 4HKOA 1PVXA 1FX5A 2EXJA 3RYPA 2YMZA 4GKYA 1OSGA 3M4FA 3H9AA 2RMU1 2AR6A 4YGEA 2WNVC 2O8OA 4EN6B 4EN9B 1J3QA 2HYKA 4LULA 2G9GA 5I91A 3VBHA 1SQ4A 1DZQA 1S0EA 5A3MA 3FC0A 4OLLA 3IBMA 1BQPA 4ISRA 3R6SA 4WM8C 2MEV1 4XDQA 2XLFA 2GH8A 3U4XA 3WDVA 2B5HA 2YZ4A 1X36A 2ZGSA 3J8F2 4JCKA 4AVBA 3JD73 3H7YA 2VOWA 3L2HA 4UXAA 1GANA 1KFXL 4DB5A 2RS52 2FZ2A 1O7FA 1W0OA 5AFBA 2R073 1HV1A 3TWIA 4E4DX 1U0AA 2D6LX 1SLBA 3PLQA 2D5FA 1QJU1 2VUAA 1FI2A 2D43A 4YVSA 2GMPA 1FYUA 1RUF3 1H2LA 1SDWA 3MIBA 1NCRB 2ZKLA 4E4ZA 3SCHA 4CEWC 3GZAA 4Z8BA 1XE8A 4GH4C 3IM0A 3SXWA 1ZZCA 3WP4A 1Z7S2 3I8TA 3AJYA 4JAAA 1RUF2 1GNHA 1TEIA 1WCSA 3OY8B 5CIRA 1NXD1 2PAEA 1ENQA 4M3CA 1H9WA 2XLGA 1RUH3 4PDWC 3VZJA 3LSEA 1DYKA 2Q30A 3ASIA 3MIHA 1EAH3 2UY8A 3MFAA 1WCKA 2Y0IA 2BFUS 3VBHB 4XF3A 4HVQA 4RHV2 2GNTA 3MLKA 3ZMOA 5CADA 1RUH2 2OPKA 4K20A 2XBO1 2XLAA 3VBRC 1HXS1 4H7LA 1ZBE3 5CA6A 1JHNA 4NN0A 1LHUA 2RE9A 2VNOA 3KCXA 3M3OA 5EWSA 3NV2A 4AI0A 3TAYA 4PF5A 4OUSA 4KH9A 2A70A 4Q4V1 1AVBA 1ZBE2 1G86A 2ZGLA 4FBFA 3HAGA 3B01A 4KWLA 4MLOA 2JKBA 3FFZA 3QOPA 1HX6A 4FTEA 5LEKA 4BM8A 3DUIA 4XFHA 3UKNA 1RUD2 4R4ZA 3PJQA 4BLJA 4C91A 3RWNA 3N3HA 2YC0A 1BEV1 1RUI3 2D3SA 2XVGA 4IV3A 1QQP2 1Z0HA 3ZPYA 4BWOA 3B9CA 1DGRA 3CLPA 3B3QE 3AFKA 2VU9A 2WT1A 3ROUA 3FHIB 3LA3A 1TNFA 3WG2A 3S0MA 4YSFA 4AVAA 1V00A 1WBFA 1YHFA 3A0NA 1RUI2 4U36A 4YG6A 4O9EA 5GLWA 4I09A 4HMZA 3VDDA 2B9UA 4M3CB 1CAUA 3H3ZA 5K0UB 2MHFA 3AKPA 1ZX5A 2D6PA 4HK8A 2GMMA 5C4WB 2D6OX 1FMD3 1TMF3 3BPZA 4AEJA 4FTBA 2XHKA 1VAKA 1Q8SA 2P3IA 3RI9A 1EP0A 1RL3A 2NM1A 3V65A 4CDQA 5GLTA 1DGWX 4XHXA 1KJLA 1KFUL 5FREA 4FPHA 1AZDA 4N43A 4P9JA 3SITA 3WV6A 3JD71 4Y1VA 1BMV1 1MQTA 5JMCA 3HT2A 1C5IA 1NQJA 1WW5A 1Y7BA 1IS4A 4N90A 1NCRC 1BCXA 1DIWA 1V70A 1OPOA 2R071 2WFF1 2WS92 4RQPA 4HT1T 4XQWA 4XF0A 1AR81 2XWBB 2YGMA 4YZ4A 2ZGKA 2BUKA 1I6XA 4Z2WA 4GKXA 4P9GA 4KWKA 4P9XA 1ZZ7A 2RS13 2D3RA 4GB32 2V73A 2BQPA 1RUG2 2AYHA 1KITA 2E53A 2MNGA 3IKWA 5KC6A 3QBQA 3VBHC 3D6EA 2BWAA 2ARBA 2HWE3 3OJBA 4V1PA 4LNVA 3VDDB 1M06G 1CAUB 1IQAA 2Y38A 1TME2 4N53B 2DU0A 4LHKA 1YFYA 5HCFA 2D98A 4MVTA 2HWE2 5T5LA 2ZX0A 4Q4Y3 1LESA 1QJY2 1ZRRA 3ILFA 3W58A 3WW2A 3ZMNA 4AHZA 2DWRA 3BTAA 4CDQB 1ENSA 2ZGPA 3UK9A 3G6JB 4AI3A 5BUVA 3GALA 4S2FA 5D1IA 4FPCA 4OUMA 4N43B 1K5MA 1PM7A 3MF9A 4BPZA 3GBWA 1MS8A 1H8TA 1CQ9A 2B42B 4JDOA 4KNCA 3ZFFA 5FQ0A 1BBT1 4OI4A 1UCXA 2Z79A 2ZZJA 2WNUA 2Y0OA 2ATFA 4RR3A 4Q0SA 4M01A 3ZXAC 3KMHA 4Q8LA 3KT7A 4CP1A 2VVEA 1POV3 2CTVA 2VOVA 4RGAA 1B35A 1NCQA 4HBNA 3WDXA 3RDIA 1G6NA 4FQ4A 1HW5A 4XF4A 3ZSMA 2C1FA 2HWC3 3HN1A 4I3PA 4AI8A 3WG4A 1O3RA 1N3PA 2ES3A 2WQ4A 2IWGB 1S0BA 5C4WC 1Z78A 3LB9A 2VECA 2DVGA 1MVEA 1S2KA 4K40A 4AWDA 2XJRA 3MW2A 4YM3A 2BBVA 1ASJ3 2QQPA 3H1YA 4O9GA 3WW3A 1ENRA 4FT8A 5JR7B 1R1A3 5SV8A 3AKQA 4HFSA 1Q43A 1W6MA 1D4M3 1GV9A 1TMF1 4Y26A 3WG3A 1ASJ2 4QT6A 1QXRA 2ZGMA 3ZYJB 4DZGA 1C5HA 3GZTB 1R1A2 1LHWA 4XIOA 4XYXA 1QF3A 4QU2A 2AUYA 2R0HA 1WW7A 4IEYA 1K5MB 4Y22B 5ABJB 2EA7A 3D0JA 5E8AA 2LALA 4JGZA 1H8TB 4OHWA 4XILA 4UBGA 3ZFFB 4XJ9A 3WHTA 5I0RA 1GZCA 5H9PA 2FHRA 1VRH1 5JZGB 1RHI3 2QVSB 1NG0A 2PHDA 2XKPA 2WNUB 4Q1RA 4RR3B 1AR63 2K2SA 4URTA 2A6VA 1YFUA 1CVNA 4GALA 2G4IA 4AVSA 3VDDC 1B35B 1NCQB 2PHLA 2WA3A 2GC0A 2CV6A 1VBE2 1FPN1 1RHI2 4N53C 3URFA 3ZFGA 4K8FA 4F83A 4ONUA 4AFMA 2YV8A 3MIGA 1OQ1A 1X8EA 1C1LA 3QD6A 1NE4A 3CNAA 3DN7A 4Q0VA 1VBC3 3AZWA 4EWAA 3VKNA 4XJ8A 4CDQC 3WQ0A 1O4ZA 4R9AA 5TSWA 4N43C 1YJKA 4QMAA 1MQTC 2GNDA 4BZ4A 2P37A 5J36A 1LR5A 3AZVA 1ENXA 4J1WA 3AYEA 4TYSA 3UJQA 2VW1A 5JSPA 4W6XA 4YW5A 1UZZA 2QDRA 3SH3A 4HK9A 2BW8A 3KQRA 5DDJ2 4CDUA 4D3WA 2ENRA 2I74A 2EXIA 4FOQA 4GXLA 2QFEA 5BYNA 2R1DA 4EROA 5C9AA 4B4QA 4E27A 5CU1A 5JPMB 3WP5A 1OHFA 4CDWA 1GQGA 2IXCA 1OLRA 4PLNA 1RVF3 3ES1A 5FPXA 2BNMA 3OCPA 5FCCA 1WCDJ 3ZFGB 4NHMA 5C6CA 3ES4A 4K3UA 3FLPA 3SH4A 4LBKA 4XFFA 3TOJA 3JU9A 5FAXA 1LOFA 3G7DA 3ZN4A 2DCKA 2WQZC 4BE3A 4SLIA 1HQWA 2YROA 5J48A 2ZGRA 1COV3 2QUOA 2CWSA 3OGGA 5L19A 4HKWA 1UPIA 1DDLA 3E5XA 1VBB1 2R062 1K5MC 5ABJC 5IK4A 4JRAA 1LECA 4R9DA 1H8TC 1D2QA 1SBEA 1LCLA 3ZFFC 3VKOA 1RUJ2 1VALA 5FO8B 4YLZA 2OZ6A 2WNUC 5GZCA 4RR3C 4WM8A 3AP7A 1GSLA 1PO23 3WP3A 4CDUB 5C8CA 2TEPA 3WR0A 4S2HA 5JIUA 1W6NA 1G9DA 1B35C 1NCQC 4Q4X2 4Q4W1 5DZGA 1ND2B 4X8PA 2DCZA 5BNNB 5LEJA 3TN93 5C9AB 3IT8A 2C9AA 1G9CA 2RR13 2VVDA 1CJPA 4CDWB 2PA7A 4XE9A 4LEJA 5FDBA 1PO22 2A6YA 2B46X 1O5UA 4PBOA 1BVVA 3ECQA 1LHVA 2F4PA 4TSVA 3O0WA 1N1YA 1APNA 4R9BA 4IEUA 3ZX7A 4MSVA 4K1YA 4LUMA 4YYOA 4JV4A 2XG3A 1RUE3 3RRDA 4L9BA 4LA3A 3MIFA 3VKMA 4WVZA 2CAUA 2ZAHA 3MZHA 5FTTC 1HQNA 4LBQB 1FATA 1W0PA 5DUUA 1VBC1 3V0BB 3N7LA 3ZFEB 1CR7A 1UW8A 1JH5A 2R042 5DZFA 2ZABA 3FWEA 4AGVA 5C33A 4I30A 1V6JA 3EO6A 3JCIA 3WY6A 2CL2A 2YY1A 2UYAA 5BV6A 4JGZC 1F5FA 1ZZ8A 2HWB1 3E5UA 3FMGA 4RS5A 2VULA 1W6QB 3FLTA 5BPXA 3APBA 1Q8VA 2RMU2 4K9SA 1C8M1 4AF9A 4G3YC 1MZEA 1W6NB 2RM23 2UY9A 2ZGOA 4EWEA 4LTAA 1O91A 3DV8A 5A33A 2VG9A 4MYEA 2VNRA 2VGDA 3UKVA 3ZFGC 2QZ3A 2XL9A 1HRV1 1MR5A 2RS31 1WGPA 2ZPXA 2DVAA 4XFBA 3WQ1A 1VP6A 3VBUA 4ES9A 2V09A 2WJSA 3O7OA 3ZN5A 1V6OA 3AYDA 3J4UH 3FUQA 1OA3A 1QJX3 4AHXA 4YM2A 4XF9A 3SCFA 3PVOA 3P3NA 3CL1A 1OFNA 4AEDB 2PLV3 1RGSA 3VL9A 3VHOA 1UZYA 3M3EA 3H3UA 1COV1 2KA3A 3MDPA 4Y24A 1RUC3 1AX1A 1QJU2 2DFCA 3CF6E 1GYKA 1CAVB 2HWD1 4TLFA 4AG4A 1IS5A 4JQRA 2HWF1 3IN9A 4CDUC 2JG9B 4H3WA 1PGW2 2PHFA 3ELNA 5E1RA 3NL1A 1RUC2 2A6WA 4NVPA 5DUXA 5C9AC 4WVWA 3KZ4C 4RS5B 4TWTA 2ARXA 4I2OA 1SLAA 4CDWC 2YPJA 3RI8A 3WHUA 4CP0A 1RC6A 1AR72 5IK8A 3CEWA 1U5XA 1WMFA 3B93A 2PHUA 1XNBA 2HEYF 2K0GA 3AYAA 5BY5A 2AGSA 3TN91 2A3XA 5A33B 1PGL2 2VY0A 3WP6A 2Z2SB 4F7ZA 4QX5A 4LBLA 1MEC3 2PTMA 3DGTA 2EXKA 3VHPA 1HV0A 2UURA 1R091 2XVKA 1AYN2 5GZGA 4HZFA 2XBO2 1QH6A 1HXS2 2H6CA 2B39A 3KS7A 3H1MA 4XETA 3VBUB 1F8VA 2C5DA 1AX2A 5EYYA 3ZFEC 2Q5TA 2B7YA 1MEC2 1WBLA 3OY8A 4WZFA 3R05A 1RUE1 2P3KA 4KQ7A 3FE5A 4YZ2A 4Q4V2 4NPRA 3FLRA 2KXLA 1Q5OA 2DVFA 3NV3A 1C28A 5EYXA 1WW4A 1G8WA 3PMSA 3T1MA 4AFAA 4MUVA 1V6MA 1KXGA 1TQ5A 3J8F3 1JBCA 1WLDA 1LGCA 2VMGA 5JSRA 3KGLA 1BEV2 1QKQA 4K6BA 5C8CC 2VMIA 2RS53 4D7YA 1N47A 2ZGTA 3MW3A 5GLZA 3QLQA 3O12A 4HSJA 2JJ6A 1DU3D 4QQLA 1QNYA 3KM5A 3PHMA 2WKKA 4M3CE 3H0OA 4AEMA 4UBHA 1DGLA 1WMDA 4E9KA 2PQQA 4B4RA 2RM21 2ZAAA 3HR9A 4I3GA 1PVC1 1Z7S3 4RL7A 1GZWA 1JYCA 2JDZA 3J9SA 2OW4A 4MZUA 4YZ3A 4D69A 4NWWA 2Z69A 3ZSKA 1N1SA 4AYUA 5K8SA 1YWKA 2XB6C 2WINB 4WV8A 1S0CA 1RMU1 2AZ5A 5J09A 4R4XA 3ZSJA 4YZ5A 2OZJA 1AF9A 4OZXA 1ZZ6A 1QJX1 2XJUA 3ZXFA 3WUCA 4LO6B 1AL22 4RHV3 4PIYA 2JG9C 2JENA 1UX6A 5K0UA 2GU9A 3S30A 4IXLA 1V9U3 1ZRFA 1DZRA 1XU1A 1BJQA 1J1TA 3AXDA 4NHKA 1WLTA 2WFF2 3X29B 5C4WA 1WW6A 4KBBA 3MW4A 4RS5C 3POSA 2DCJA 1LRHA 3AP5A 4XZPA 5CB7A 1W2UA 1AR82 4P14A 1EY2A 2ZTNA 3C3VA 3SISA 4M3CF 1NOVA 1V9U2 4W6YA 1KD7A 3M2MA 3B02A 3HD8B 1WMEA 1XNCA 1VIWB 1IS6A 5DG2A 3WW4A 3ZXLA 1RUD3 3GBFA 3LAGA 5CFDB 1QQP3 2ILMA 4ASMB 2WZR2 3VBUC 4N7IA 1CIWA 1PO11 1UIJA 1U12A 5JOYA 5I8SA 4XFCA 5H9RA 1GZWB 4UW5A 2LUWA 5IK7A 1RUOA 1UPSA 2DUOA 3LZZA 3JZVA 4HL0A 2XH6A 4WM7B 5BNOA 2ZCWA 1VBA2 4AFDA 4RGGA 1G9BA 1BYHA 3ZXDA 2ET7A 4AK3A 4MXWA 2Q4SA 5J98B 2A5ZA 4JGYA 3VL8A 2IXHA 1E57A 1UF2C 2GZWA 4OHYA 1XQNA 2WIIB 3N36A 2PN5A 1QGLA 4N53A 4YFWA 5AVPA 5AC93 4FPJA 1BBT2 3OBRA 5JOXA 2BFUL 1LGBA 4N9HA 2A75A 4BMBA 5CBLA 2D44A 1ZRCA 3M3QA 3V56A 3BODA 1ZVFA 1UU4A 2EAAA 2XGXA 1UN1A 3AP6A 5IUQA 4AQSA 1QH7A 3H50A 2RS51 3MGUA 5AC92 2GNBA 2C0ZA 4OHVA 4Z1VA 5E88A 5L7OB 2WS93 3IDBB 4XJUA 1LU2A 4IEWA 4AVVA 2TNFA 3HWJA 1C1FA 4CYDA 1H30A 1DLLA 1RTVA 4D7TA 3FZ3A 4AEKA 1WD3A 4CP2A 3ZXKA 4XBLA 3TNPB 5EZWA 2X29A 4GB33