4UAPA

X-ray structure of gh31 cbm32-2 bound to galnac
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
150
structure length
150
Chain Sequence
SHMNITVSGDSSQLQSGMGLDKLIDGTTSSDDSSRMDLKWIFTSDQQDKGTLPFEMTFEFNEPKTLENFTIYNRMNSNGTINIAAMKKVKAVGYLNGEEFDLGEKANITSATTVYELGGKEFDKIVITALDSHKDKNTLAINEIEFYEKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glycosyl hydrolase, family 31/fibronectin type III domain pr
publication title Diverse modes of galacto-specific carbohydrate recognition by a family 31 glycoside hydrolase from Clostridium perfringens.
pubmed doi rcsb
source organism Clostridium perfringens
molecule tags Sugar binding protein
total genus 36
structure length 150
sequence length 150
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-08-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 4uapA00
2Y6LA 1JZ8A 2QQNA 1UYYA 1W8OA 2QQJA 3IB3A 4W8JA 4GWJA 1SG3A 2VR4A 1ULPA 2VC9A 2YB7A 2EICA 2YC4A 5F7UA 5LCWL 3OGVA 2QQMA 3WNKA 1NKGA 2ZXQA 4TXWA 1UXXX 4JKMA 2VCAA 3CIHA 3NQHA 3C7FA 3PUHA 2XHNA 2WZ8A 3I3BA 3C7EA 1J83A 3MO4A 4PF1A 3I2FA 1WKYA 3SEEA 2VZ1A 2VZQA 3T09A 5EJZB 3T08A 3DECA 2DCJA 5JXHA 4KWUA 2BZDA 3D3AA 4UI9L 1JZ4A 2HYXA 1DYOA 3THCA 4TTGA 2VQUA 1JYXA 3OGSA 1UYXA 1JYNA 3SEPA 2ID4A 2C9KA 2QBXA 2Y6HA 5JXGA 3THDA 5C70A 2W1QA 1L7RA 4M4RA 4QPWA 1OD3A 2WN2A 5DN2A 1K3IA 1XC6A 4CUAA 1KEXA 2Y8KA 3GDBA 3NJVA 2VMDA 2J1UA 1IQDC 3WF3A 1UY3A 2WAAA 3C7HA 1L7QA 2PQSA 4ARXA 4DEQA 5JUVA 1JZ3A 3F2ZA 1PX4A 3EYPA 1W0NA 2EIBA 1NX9A 3FHQA 2YFUA 2EIDA 2LS6A 3I2IA 5LA2A 2W5FA 1SDDB 2J1SA 2ORXA 3CZUA 5G05L 3K4DA 2WO2A 3GXUA 5LA1A 1W9TA 3BN6A 5C71A 4P08A 1OF3A 5DMYA 4DUXA 1NAEA 5JXIA 2W1UA 2WO1A 1LNSA 1JI6A 1JZ5A 1K45A 2L9LA 3HNBM 4OZOA 2VZOA 2ZEZA 5IFTA 1MPXA 2J1VA 5DPNA 4E8CA 1D7PM 3OG2A 2Y6KA 3T0DA 4MADA 4RYDA 3FN9A 2W9XA 4GWIA 3LEKA 3A23A 2W46A 3LPFA 4QB6A 3WF4A 1F4HA 2JE8A 3WNLA 3IDAA 1ULOA 3VD9A 4HG6B 2ZEYA 2WAOA 5J1XA 1TVGA 4M4PA 5B4XA 2YFZA 4ZXEA 1DP0A 3BGAA 3T0AA 2VMEA 1OH4A 3CMGA 3C7OA 3ETPA 2VM9A 1F4AA 1EUTA 2C26A 4CVUA 2XQXA 4LPLA 2WDBA 3PUIA 1XNAA 5JR2A 3A21A 2OKXA 4ARYA 4QX3A 4MO3M 5JMOA 1PMJX 3VD5A 3MBWA 3W5MA 2W92A 3VD3A 2XONA 1XNTA 2ORZA 4OUEA 5CZKA 5CYYA 3UESA 2E31A 5IJRA 2RJ2A 3LPGA 4OMDA 2W47A 3A22A 3CDZB 3OEAA 1US2A 1GOFA 4FI9A 5HPOA 3WF2A 4BK5A 2E33A 3HOBA 5A1AA 3GGLA 2VMFA 2W91A 1P8JA 3ACGA 2XOMA 2E26A 4BJ0A 4QB1A 4JKKA 2YC2A 1UXZA 2VQTA 4QDRA 2W1SA 2VO5A 2WO3A 4RN5A 2C4XA 2VMCA 2B9VA 3K75B 4D0QA 3ACHA 2VZUA 4LQRA 2QQIA 2HLEA 3ABZA 5HXMA 1W99A 2J22A 1K12A 5B4NA 2Y6JA 3ACFA 4QB2A 3AC0A 2CDPA 3OB8A 3NRUA 1JU3A 1T2XA 4DXTA 1UX7A 3WNOA 4XUPA 3I3DA 2J1RA 2JD9A 4MGQA 4UOJA 3WEZA 1JZ6A 4JX0A 4P00B 2WABA 3UETA 3ZM8A 2QQLA 1RYYA 3WF1A 2LW8A 2WUHA 2VZRA 2VZ3A 2VCBA 5I0DA 1TG7A 2WZEA 1CIYA 2JKXA 4XUOA 1GMMA 3MUZ1 1UY1A 1UY4A 4JKLA 3HNMA 3VDBA 2VZSA 3LQCA 4OMCA 2ZEXA 2VZPA 3WQBA 2BBAA 1I5PA 3CQOA 3IAQA 1GUIA 3T2QA 3WSOA 4BK4A 4PQQA 4KMQA 2X05A 2VL4A 4QAWA 4DEVA 4DUVA 1O59A 1H6XA 2J1AA 3I2GA 3J7HA 4XUNA 4AAXA 4MGSA 3I2HA 2RVAA 3WF0A 4KI5M 4L0PA 4A3ZA 1O8SA 3FHAA 3T2PA 3WNPA 2WYSA 3EB7A 4QDSA 5DQ0A 1UY0A 2W94A 3OBAA 2WBKA 4ZZ5A 1W9WA 1W9SA 2VOTA 3K46A 5IYYA 2VZTA 3SKJE 4OYUA 1HN1A 2VZVA 5FUIA 3T2OA 3P6BA 4YPJA 1CZTA 2X10A 1GNYA 2V4VA 4CUBA 1XPWA 4E8DA 4BDVB 3I3EA 3VD4A 3VD7A 2X09A 1UWWA 3OEBA 4DXRA 2VCCA 3NJXA 4W4ZA 3HPNA 3ECQA 4UAPA 4Z2AA 1W8NA 3K4AA 4LKSA 4P02B 1US3A 2Y6GA 2Z4FA 1K42A 1CX1A 1JHJA 3WNNA 3CKHA 5EJ1B 3CZJA 1J84A 1O8PA 4LHSA 4XUQA 3SKVA 3UNPA 3U37A 1UY2A 2J1EA 4CUCA 3K4ZA 3VDAA 2W87A 5LA0A 1JYVA 1OF4A 4P5YA 2J1TA 4QDQA 2BGOA 2J7MA 3DYOA 4ET7A 4A6OA 4QX0A 2BGPA 2ZEWA 2WQ8A 3DYPA 3MUY1 1JZ2A 2EIEA 4XZUG 3T0BA 4XUTA 3LE0A 4W50A 3GM8A 1EUUA 3W5NA 1GOGA 2CDOA 3K77A 3DYMA 1GOHA 1CZVA 1H6YA 3HN3A 1KGYA 5G04L 3MV11 3NNGA 2DCKA 4QX1A 5IHRA 3IIIA 4A4AA 2V72A 3ACIA 4QX2A 3E1F1 1BHGA 4A45A 2V5DA 2QQOA 2BERA 4A44A 4CU7A 4XVHA 5EIYB 2Y64A 1UYZA 1PMHX 3C8XA 1GQPA 1DLCA 2VTFA 4ZY9A 4AG4A 3P1IA 1R64A 2QQKA 4CU8A 3IAPA 1UZ0A 5JXJA 1GU3A 4MOAA 1UMHA 3FL7A 1CZSA 1JZ7A 1PX3A 2KD7A 1NUKA 2W1WA 3HJRA 3MV01 4GZ9A 1SHWB 4DXSA 2RV9A 4D8MA 5C7GA 4IUGA 2JDAA 3I2JA 1UMIA 3LEIA 2VJXA 3LEGA 1JYWA 3JXSA 5IFPA 2DDUA 2W3JA 4DUWA 4CU6A 2WN3A 3A7QA 3C7GA 3VDCA 3I2KA 4XURA 1JU4A 1OT5A 4JHZA 3HEIA 4A42A 1YQ2A 2E32A 3WNMA 4BXSV 4PT6A 3HNYM 3OGRA 4CU9A 4A41A 3I97A 2W95A 1WCQA 4ZZ8A 2R7EB 2B4KA 2YG0A
chains in the Genus database with same CATH superfamily
5F5CA 3AMPA 4RR3C 3WZ1A 1X8EA 2PA7A 2QQNA 2QQJA 4F3JA 4W8JA 2GAUA 2VR4A 3O0VA 1ULPA 2ADDA 1IZ3A 1XJAA 4C0HA 2RR11 1YQ5A 1EY2A 2R6QA 1CQ9A 1GBGA 2VD7A 1CONA 1Q8VA 4AR2A 1S2KA 3P5BA 3N9MA 2QQPA 4MUVA 3C2UA 3NNJA 2ZZJA 2XKOA 2ZXQA 3WNKA 5F3IA 4TXWA 3RQ0A 5IVVA 1UOFA 3NMBA 2I2SA 3IZOA 2PELA 4IEXA 1R1ZA 2D93A 2RR12 3GCWA 4OZXA 5M0TA 1GP4A 1VRH3 2VCMA 3VDDC 1VBB1 2XHNA 3N9NA 1N47A 1GZWB 3LDBA 2JB8A 3C7EA 1J83A 3A0NA 4XFCA 4PF1A 2J42A 3FMGA 3KLSA 5ERLA 5LATA 1C8M3 3N9QA 1MEC1 1WKYA 5CKNA 3T1LA 4C90A 3WQ1A 4EROA 5FZBA 4NWWA 2VZ1A 2IFRA 4OHXA 4GIQA 1XSRA 4IQPA 4UF0A 1Q5OA 3T09A 1VBB2 4Q26A 3GZEA 4FXKB 3DECA 2ATFA 4WM8C 1F31A 2PHXA 5IVYA 3VHPA 5JXHA 4COVA 1MEC2 2FCTA 3AK0A 1JZ4A 1DLLA 5A3WA 1OMIA 4IE6A 5I8SA 3ZSMA 1SQ4A 2VG9A 3LIGA 1ULFA 1DYOA 5FP9A 5KXDA 1JTZX 4LBMA 3ZPOA 3BB6A 4BQ5A 3ZYFA 3OGSA 4SBVA 4MV2A 2CAVA 5DUUA 4FFHA 1FAYA 4BWOA 1MS9A 3L2YA 5JXGA 3PTRB 3THDA 3WX5A 3ALQA 1S1AA 5DUVA 1UU5A 2VMIA 2XUMA 2PAMA 3DGTA 4QPWA 2WN2A 5EZWA 3MYXA 4QQLA 4K40A 4CUAA 4COYA 2QE3A 5FOBB 4IV3C 1IG0A 5FLHA 2GN3A 4B8EA 5IVEA 3TEZA 3VUOA 3BTZA 5IAXA 1U5XA 1WBFA 4EE2A 4KWKA 4FFFA 2D6LX 3WF3A 4CCOA 3HT2A 1F2NA 1KXGA 1W6MA 3M3EA 4R4ZA 4X6RB 3TN93 4LKFA 3DXUA 4DEQA 5J96B 3NNMA 1A8MA 1QQP3 2RS51 2ZGUA 3FX3A 4YM3A 3SCFA 2EAKA 3VHRA 2GC3A 2BFUS 2CU5A 1W0NA 4DMIA 1NX9A 5FYSA 3PU8A 4XJAA 2LS6A 3I2IA 4M3CB 5C5UA 4XF4A 3SMHA 3TEYA 2RS52 2XBO3 4MGYE 4FPCA 3I59B 1GR3A 2WO7A 3HT1A 4KGGA 4P08A 4BQ2A 3LFMA 4BA6A 1OF3A 5FY5A 4DQAA 4DUXA 1NAEA 3WCRA 1PO21 2XJSA 1MS0A 1OD5A 2YGLA 2W1UA 3RJRA 3ZSKA 1ALYA 4CCEA 3I4IA 5CG9A 4KBZA 5EV7A 4XE9A 4Q0QA 2Y0OA 3CJIA 1K5JA 1BBT1 1DQ1A 5A3OA 1IGOA 4BQYA 1AX2A 1PO22 2ZEZA 3WY6A 1HJGA 5JI9A 3AX4A 1D7PM 1K5MB 1REDA 3BU0A 4YGEA 2DCZA 3E5UA 3KVAA 2P3KA 1PNGA 2Y6KA 2GDFA 5DAPA 3KHCA 3N35A 1BBT2 4MADA 3M3IA 4LITA 4BQ4A 3T0DA 4MGZE 4Y22A 2W46A 3KD4A 3LPFA 4QB6A 4NRQA 2VOVA 4L92A 2D97A 5FR3A 1F4HA 3VBRB 3BIWE 4YW5A 3VD9A 1ZRDA 1ZREA 2BGCA 2VUAA 4HG6B 2HWD1 5FMDA 3SH3A 4FXGB 5DUWA 1POV3 3H8RA 3KT1A 3WP4A 4HOOA 5I8TA 3BPZA 1I9RA 4NE9A 2WYFA 1FT9A 3QCWA 5FZ1A 1WCDJ 3DL3A 5J1XA 4QQOA 3FE5A 3KMHA 1PZ7A 2HWD2 1AR81 3T0AA 5CFCA 3JZVA 2RJLA 4UW5A 4YG6A 2AGSA 1QDCA 3JU9A 4AAPA 5JVVA 4HVQA 1VR3A 3ETPA 2VM9A 4QMAA 5A3NA 2BBVA 3V56A 4XW3A 1YHFA 4Z82A 1H8VA 4WVVA 2H6BA 1FNZA 2C26A 2P3YA 3S7IA 5FP3A 4B7KA 1HRV3 4DB5A 1AR82 5JR2A 3AFGA 1CD3G 4NIAA 1W9FA 2A6VA 3ES1A 1SFYA 5JMOA 1DG6A 1LAJA 3TNPB 2D5FA 2VUCA 3KV9A 4FTSA 2OQ7A 2BNNA 3AJYA 3J4UH 3N7JA 4H3WA 3W5MA 1COV1 2JE9A 5CVRA 3AZXA 4Z2WA 5LK5A 1XNTA 2ORZA 3NV1A 3ZKYA 2DTYA 4UF0B 2YDEA 4WBBA 4EN6B 5CFDB 1W2TA 5CZKA 3VZJA 2QTWB 2R0HA 5KXCA 1KDKA 3RGBA 2A1XA 4FPJA 3MIDA 2XLFA 4MH0E 4OI2A 5DG2A 4ASKA 5KWRA 1AUYA 1COV2 4H2AA 4XF9A 2GC2A 4BH9A 3AKSA 2B46X 3HBZA 1BEV3 1GOFA 4FFGA 1S0IA 3KF3A 3THTA 2K2SA 4B3NA 5F9TA 4ZKTB 4LT5A 3MFAA 3LFIA 4NPRA 4EN9B 4GWNA 3HQUA 2W91A 4EN7B 5KC5A 3BALA 4YVSC 4JV4A 5JOYA 3NWKA 4JKKA 4PBPA 4QB1A 2WNVA 2ARBA 1YEWA 4V1PA 1RUH3 4XEZA 2JG9B 1C8M1 1YIFA 4RR3A 2VQTA 5F2WA 4BQXA 3BOPA 4WVWA 2VO5A 2C4XA 4PDWC 2NLRA 2ZHMA 2B9VA 5H9PA 1KJLA 1DGRN 1VRH2 4H14A 1W6MB 4XFAA 5F1RA 4JZRA 4I30A 1VP6A 1UU4A 5LA9A 1W8TA 5HXMA 2VOWA 2I74A 3IBMA 2ZMKA 1C8M2 5FPLA 3BVCA 5A1LA 2G4IA 5B4NA 2WNUC 4XXPA 3VKOA 3O12A 5JPMB 3WQ7A 3ACFA 4O65A 4AVCA 4CUGA 1YQCA 1XYNA 2Q1FA 3NNFA 4IV1A 5JZGC 4AFDA 5FBZA 1CR7A 1SLTA 3VDDA 1H2KA 1HIXA 2OS2A 2XQRA 1UNBA 4R9AA 2V5YA 3WNOA 1PVC3 4WVZA 4XUPA 4NIIA 1OA2A 5DAQA 1LGNA 2J1RA 5E8AA 1KFXL 5FPVA 3WEZA 1RUJ3 4NHXA 4P00B 4EZHA 5CADA 2WABA 1WWYA 1CPNA 1GZ9A 4ZHNA 1T6BX 2WA3A 1RYYA 4WM8A 4LBQD 3OD0A 3WF1A 4COZA 1XYOA 2LW8A 1CJPA 4GJZA 1OLMA 1VPHA 1U5YA 4Y24A 3CJIB 5J37A 3I2OA 2YROA 1Y43B 3D5OA 3TN91 2VXJA 1QNYA 4CSWA 2R043 2MEV1 5I0DA 1TG7A 1QQP1 1RUG1 2YBKA 1CIYA 1AJKA 2JKXA 2CY6A 4J1WA 4WM7C 1V6OA 5DXDA 3M3QA 3GHMA 5FZKA 1WW6A 5FKBA 4A7YA 1V6MA 1B09A 4QXBA 1J3QA 1KITA 4UYBA 3HNMA 3LIHA 3TN92 4Y22B 4BLJA 4FOVA 2MEV2 4DFSA 1EPZA 1QQP2 1WW7A 1OSGA 2XBO1 2ZEXA 4O7XA 4XAEA 4Y1UA 1DYKA 4ES8A 3WSOA 4BK4A 3AMHA 4KMQA 4DO0A 3NW4A 2X05A 2WL1A 4H7MA 2DWRA 4Y5Z0 1XSQA 4AOCA 4BOWA 1HB4A 5LRRA 1GWLA 3I2GA 1X8MA 4XUNA 2IXCA 2ZX0A 1OH3A 2XBO2 3HMYA 2AEZA 1UIKA 2OPKA 5AC93 2QCSB 2YPJA 1C1LA 1SCRA 2RVAA 1LKNA 2WWJA 4L0PA 4Y1VA 4A3ZA 2TEPA 4NR1A 1YUDA 2FZ1A 3SQOA 5HV4A 3BI3A 2LRPA 1AF9A 5FMOL 3WNPA 3ZFEA 2ZX4A 2WFPA 4LTAA 4QDSA 5GZEA 5JLVA 4P9GA 3OBAA 5C8WA 1RL3A 1J3PA 4AYUA 5IK5A 1UQXA 3M70A 4QU2A 4XMAA 4D6SA 1PZ8A 3H3LA 3V64A 4C0BA 1J1TA 5K0UC 1W9SA 1Y9MA 1RINA 1AYN3 2LALA 3OUIA 1SLCA 2WQZC 5C8CC 2O0OA 1BKZA 5FXZA 2YBSA 1YFYA 3H1MA 4R4XA 2IVJA 3UJQA 1OKOA 2VECA 4OHYA 2CGNA 1ND2C 4YPJA 1CZTA 3MI8A 3OD4A 5CNAA 1POV1 4FPGA 4CP1A 4K3UA 4CUBA 1G6NA 4C1XA 4BDVB 4JAAA 1BYHA 1QNWA 1WCUA 2PHUA 3T2TA 2ZX2A 3PIJA 1C1FA 3PL0A 3TB0A 1GSLA 2D98A 1ULCA 2DVGA 1WLCA 4DXRA 2XGXA 4EWEA 4W4ZA 1RJ7A 2XXZA 2JDYA 3HPNA 2YMZA 1FI2A 4UAPA 1X36A 2XR4A 4GB33 1GANA 5C6CA 1OFSA 1O3RA 1VJ2A 2DUPA 4Z2AA 2YXSA 1RVF3 1AR63 4C91A 1XNKA 4PI0A 2Y6GA 1YJKA 2G9FA 2Z4FA 3RZJA 1K42A 2A3YA 2R061 3LA2A 3Q8CA 2VOKA 2ZMLA 3T30A 3WNNA 3U10A 5FPUA 4XJUA 1J84A 4RR3B 1AXKA 4NHKA 5FMCA 2ARXA 4ZU4A 4Y4YA 1Z7S3 1QWRA 2ZKLA 3SKVA 3HBKA 4Y5TA 4CDUC 2D6NA 5FPAA 2DTWA 1Z0HA 4BYYA 4MGTA 5IK8A 2J1EA 2QFEA 1UX6A 4ZU5A 1UF2C 5FZDA 3K4ZA 3WUDA 5SV5A 3RZHA 2E9QA 2Z69A 1N1YA 2C0ZA 4IV1B 1NE6A 1O3TA 1JOBA 1BEV1 1PMIA 5AVPA 3VDDB 4UW6A 3KGZA 4JTNA 1RIRA 4MXVA 4CXXA 1HX6A 3KCCA 1XNBA 2WT1A 3DYOA 1O6UA 2XL7A 5BNQA 4ET7A 2LROA 4A6OA 4XF0A 2JECA 2VTXJ 2WQ8A 1W05A 1PHMA 5E1RA 5FOJB 3R4SA 3KM5A 1BEV2 2RMU3 2R32A 3FBMA 5DUXA 2HBTA 4XCBA 3VBFC 1F35A 1VE0A 1GWMA 2HEYF 2H0BA 4M0NA 4W50A 4WM8B 4XTMA 1O3QA 3B5LB 3DKQA 2XLGA 1DQ6A 1EUUA 5GKAC 3R0RA 4YZ2A 3W5NA 4MG2A 4Q1PA 4XBLA 3ZSEA 1YIPA 1WA6X 2CDOA 4IEZA 1H6YA 1CZVA 1RUE3 3KT4A 2MPFA 2P2KA 3H9AA 1DQ4A 1LEDA 1V6JA 5ISLA 4WZCA 3POIA 3IIIA 4FPFA 2V72A 4QX2A 3E1F1 1UZVA 3S5QA 2BERA 3PHMA 3OBZA 4QKBA 4QPGC 1CVNA 1X9PA 2A6XA 5E88A 1PVC1 3VBUC 2GMPA 4I3GA 4EYUA 4IV3B 3KT7A 2UWAA 1R091 1W6QB 2VTFA 3DKWA 4AG4A 2YZ4A 1RUJ1 4PDWA 3ROUA 3IAPA 4Q5OA 4D3WA 3R4DB 3WW4A 5JXJA 4MOAA 3T1MA 4OHVA 5IK7A 2LTNA 3H8UA 1ZA4A 4I0AA 1W3VA 5FYBA 1NE4A 4NVPA 1PVC2 4X6QB 4BM8A 1JZ7A 4YSFA 2ZMNA 3TOJA 2WNUA 1R092 3PVBB 3WG4A 3WW3A 4CRQA 4D6QA 3O1PA 1IHMA 1RUJ2 3BU7A 3UK9A 1SFPA 4GZ9A 4UFJA 1SHWB 5T5LA 2R041 3VKNA 2GALA 4D8MA 4EN0A 5LWBA 4IUGA 2VH9A 2ET7A 2IUWA 1LR5A 3PLQA 1UMIA 4Q4V3 2LUWA 3B9IA 1FATA 5FPZA 5FZMA 1NCQC 5LBEA 2BDRA 5LEKA 1APNA 1WW4A 4XFFA 3SH4A 4XPVA 4E2QA 5C3RA 5FWJA 4N7UA 2QQWA 4U2AA 2R042 4LOSA 2WR9A 1Z78A 2DCYA 1RTVA 2HEVF 2WN3A 5L9VA 1FOD1 3C7GA 3AL6A 3VDCA 3I2KA 1W39A 2IXIA 2JKBA 3U78A 5CB7A 1V6LA 4N9HA 3HEIA 4Q4Y3 4A42A 2E32A 4PT6A 3USUA 3OGRA 5A7WB 3NV2A 1ZZ8A 1CIWA 4AI8A 4ZONA 4AHWA 3VB9A 2W95A 1FOD2 1VAKA 4WM7A 4XXAA 5EFUA 5AC91 4AW7A 1WCQA 5IT6A 3HWJA 1A34A 1LGCA 2UWBA 3VBOA 2Y0IA 4TSVA 4JQRA 5A3PA 2P4EA 3FHIB 2ZGSA 1W8OA 5IVFA 1POQA 5A7QA 4GWJA 2DU1A 1MZ6A 1QJZA 2V4AA 5AC92 5FO7B 3W58A 4JRLA 3WVJA 2C9AA 2JDKA 3W20A 1GYKA 2YBPA 2QUOA 4NJ4A 4IEYA 3BYWA 5FY8A 2ZHKA 4K6BA 1OLRA 3POSA 3U11A 1UZZA 3O1MA 3SITA 5A6ZA 2WZ8A 3I3BA 3KWVA 4QHZA 1D4M3 3TWIA 1N3PA 2G19A 3I2FA 4LLFA 4H7LA 4NRMA 3IPVA 5GZGA 2DVAA 4FQZA 4AQSA 4GB31 3FLRA 4AQ6A 3IIAA 2DCJA 1G9BA 1MZEA 4LNVA 2WJSA 4CYDA 5FCCA 1H2NA 2BNOA 1RVF1 5K0UA 1AR61 4LHKA 2BZDA 4CCKA 4AEKA 1SLLA 5H9QA 4E9KA 3ZO0B 2HYXA 3LDRA 4HXCA 3SHRA 1VRBA 3ZOIA 4IEQA 5GLUA 2B39A 2ZGOA 3DCQA 3ZR6A 1ZM1A 2WWSA 4IW3A 4GB32 4YZ5A 1QGLA 3IDEA 1UKGA 4COWA 2OT7A 1XBFA 1JYNA 4P9XA 2V73A 1S0DA 2CWMA 4E4ZA 1RVF2 4PQ9A 2UYAA 2ID4A 3SC7X 1AR62 2C9KA 2QBXA 3D0JA 5LRSA 3POFA 3D6EA 5A7OA 5HBAA 4DIQA 5IUQA 1H9WA 3D8CA 1QXPA 4CA9A 3ZX7A 1OD3A 1H1MA 2ZGKA 3QACA 4Y1YA 4R52A 1DDLA 1IKQA 1G8WA 4NROA 2VMDA 3RZZA 1G9AA 1SLIA 1IQDC 1VALA 2ILMA 1UY3A 2DU0A 3MEPA 4Q0UA 2HJIA 3G6JB 4K20A 4RHV1 1GQHA 1L7QA 2PQSA 1DBNA 4YVSB 5F5QA 4ARXA 2C24A 3F2ZA 1RUI3 4QQPA 1PX4A 4PIYA 1LHWA 5FZ0A 3EYPA 1YNAA 2ZBJA 4R9CA 4V2VA 5KBFA 2EIBA 3Q9OA 3PMEA 4PDWB 5F3GA 2YFUA 5FUPA 1JYCA 1F5FA 2EIDA 2WNEA 4RHV2 3OPWA 5LA2A 4CP9A 2J1SA 2ORXA 4IGOA 5GLWA 4XJWA 1NA1C 3MIFA 1YC61 1H4GA 3BN6A 3VL8A 5GLVA 1W6OB 2WNUB 2ZKNA 5JSPA 5GZDA 1AXYA 4EWDA 4QKNA 3N9PA 5FK7A 5C33A 5DMYA 1ENXA 4AE2A 1MS3A 2F17A 2X53S 5JZGB 1NCRC 3HIFA 3RWKX 1RUE1 5CKQA 1ZBE1 2WO1A 3FJSA 3RZLA 1MZ5A 1SBFA 4XAAA 5I0SA 2EIGA 3ON7A 4ZPIA 3QH7A 5HCBA 1HLCA 1V6NA 1QJX3 3ETQA 4AL9A 5FZ3A 3VBFA 2KM2A 1LCLA 1RUE2 1JBCA 1UU6A 3KVBA 1ZBE2 1MPXA 5IFTA 5DPNA 3N4MA 4E8CA 4OHWA 4GQ7A 4LO6B 5FK8A 1PM7A 3OG2A 4XJ8A 2IXHA 4IE4A 5AFEA 5I91A 2ZOEB 2W9XA 4GWIA 1EAH1 2DBIA 2XWBB 3IWZA 3A23A 3LEKA 4O61A 5F32A 4HONA 1K5MA 1ENRA 3K3OA 3WF4A 4CEYC 5FWEA 5CISA 2JWPA 4I3PA 1ZZ6A 1DQ0A 1REEA 3CL1A 3IDAA 4WM7B 1MVQA 1JOJA 2A5ZA 3JQWA 2NPIA 4ISRA 2WAOA 5L19A 1EAH2 2D43A 5FYYA 3VBRA 2VVDA 3N36A 5JCTA 5FZ4A 4QPGA 1W06A 4L97A 1OPOA 1XQNA 4BE3A 3VBUA 2ES3A 3ZYJB 3BGAA 5ANQA 4DY5A 4E4DX 2QZ3A 3AZWA 5C5TA 4FTBA 3NVCA 5LY1A 5I0UA 1F4AA 5D21A 1YLLA 3BIEA 4RFT0 2IXJA 3SISA 2ZCWA 1S2EA 1J58A 2WDBA 2ZACA 3PUIA 1XU2A 4Q4Y1 5IW0A 4E2GA 1Q8SA 3A21A 1DGWA 2OKXA 4MO3M 1PMJX 2PHTA 4AVBA 3FBYA 3AZYA 1EV11 1NG0A 2XONA 1QHDA 4CPBA 3IPVB 1NT0A 1RUD1 4OUEA 3NJYA 4S2HA 5CYYA 4Q4Y2 3AP6A 5HXVA 3B02A 3FUOA 1NCQA 1A6CA 5JWPA 1O4TA 1O5UA 1HDKA 1U12A 2Y38A 5IVJA 4OMDA 5K0UB 1AR93 3MHZA 5C8CB 3KQ4B 1OOPC 1EV12 2ZZQA 3OEAA 1O4YA 3MLJA 1RUD2 1QY4A 5FZIA 3RG0A 1PK6C 4Q4W3 3WF2A 2E33A 4YYOA 3BPSA 4LBLA 1V0AA 3GHNA 4XFIA 4CDQC 4G4FA 3HOBA 4M01A 4N43C 1Q8PA 1W0OA 3ACGA 1RHI3 3GYDA 4JGZC 2R073 5A7PA 4BJ0A 1SDWA 1B35C 4CXWA 5CEHA 4AFCA 5ABJC 2RS11 1YWKA 4FQ4A 4QPYA 1OPMA 1UXZA 5H9SA 4K8RB 2W1SA 2WO3A 3ZR5A 2AZ5A 4L2NA 3RNSA 2WFF3 4QKDA 1HW5A 4IL7A 4RGKA 2VZUA 2JG9A 3M3CA 5FY4A 2QQIA 3FFQA 2OA2A 2XLAA 3ABZA 1W99A 1DFQA 2RS12 4AVTA 2ZTNA 5A80A 1V9U3 2GP5A 2GC1A 3D82A 4AZZA 4QB2A 1PGSA 2I07B 2W68A 1S0EA 2HH9A 2CDPA 2KA3A 3K3NA 3OB8A 4QQ2A 3K48A 4FPHA 2JIGA 4UFKA 4CP9B 2O8QA 4JRAA 3S6PA 3U14A 4DXTA 4CDUB 1V00A 4M3CF 1CESA 2BV4A 2ZX3A 4XDQA 4MGQA 4AQTA 4UOJA 5FP7A 3OTFA 3CF6E 5J09A 1JZ6A 2FDGA 4IEPA 4LE4A 3WHTA 5J7MA 3D4KA 4YFWA 4DOUA 4FOYA 1Q43A 2B9UA 4KG0A 3U07A 3ZM8A 2QQLA 2VTXA 3Q8AA 3AJZA 1VAVA 4AVVA 4IE5A 1QXRA 2WUHA 5FZEA 2JXAA 1LODA 1CAWA 1W2OA 2VZRA 2JJ6A 5FXWA 5A33A 3P3NA 2XJUA 3H3ZA 4B4PA 3VBFB 3OSDA 1G9FA 3ZYIB 3IKWA 1NXD1 3H1YA 2F6BA 4IE0A 4XUOA 3MUZ1 2C6SA 2XDVA 1KQRA 1MVEA 1VBA1 1W2UA 5FJHA 1YCIA 2GMEA 3UKVA 1RUI2 2VZPA 3GBWA 2QQUA 2BBAA 1I5PA 2Z2SB 1W8FA 1OFNA 1GUIA 3ILRA 1MZFA 3J26N 3M4FA 3FLPA 3POGA 2Y33A 1IS4A 5C4WA 5FZ7A 3PURA 3MPPG 3AVRA 2GMMA 2HBUA 3AXEA 4E27A 2VL4A 2JG8C 4QAWA 1VBA2 3CHXA 2RDNA 5BNOA 1H6XA 4DY3A 3MDPA 2P6CA 2VGDA 3NO8A 4QPGB 4AAXA 3ZN5A 3RI9A 1AL23 3VBUB 1LRHA 4TZDA 5D8AC 2Q8OA 4IETA 1O8SA 3L2HA 1OXCA 4LA2A 1ZZBA 1QJX1 1LEMA 4FPKA 3WR0A 1ULGA 2DBNA 1F15A 3AMMA 3PJQA 1ZA7A 5DQ0A 2C1FA 2W94A 3G7DA 1NA1A 3PU3A 4A2UA 1N3OA 3VGIA 4A3XA 2UU8A 2RDQA 3N7MA 3RVHA 3WUCA 1QJX2 2VOTA 4MX3A 3SKJE 4BB3A 1NCRA 3VZMA 3B7MA 2FDFA 2XPJA 4IGPA 2VZVA 2XJPA 3T2OA 3P6BA 4OFGA 1J59A 5EYYA 1C57A 2V4VA 1XPWA 1V6KA 4CXYA 3RDIA 1NCQB 3I3EA 2Y6FA 4Q1RA 4FPOB 2X09A 1UWWA 3IMMA 5CU1A 3KGLA 4YVWC 4FO9A 5CAZA 2A75A 2O14A 2VCCA 3NJXA 2RS31 1R081 2VULA 3TNQA 5T5PA 4Y3OA 1FV3A 1X7NA 2D7FA 3OBTA 1JN2P 5FY0A 4GJYA 2A71A 3AYDA 1BK0A 3QH6A 1J1LA 2K9ZA 1SPPA 4SLIA 2EF6A 2IXLA 3O1UA 2RS32 1R082 5E16A 3B00A 4AF9A 4HBNA 4D69A 4N53C 1ONAA 2BTVC 3CKHA 3PUQA 1ND3A 5EJ1B 3CZJA 2JDHA 2W08A 1NOVA 2XG3A 2F4LA 4INDA 5BNNC 4PI2A 1JUIA 1XNCA 1VRH1 2PHLA 1G9DA 4C1WA 1LOBA 4XUQA 4KWJA 5J98B 3ATGA 1VB4A 2HEWF 3UNPA 2XVGA 3U37A 1UN1A 3AMQA 2VBDA 4K1YA 3ZXFA 3MZHA 1UPSA 3J9SA 1ENSA 2X5IC 4FVVA 1AR91 1RXGA 3VDAA 1OKQA 3J8F3 2ARAA 1JYVA 3TBDA 3OF1A 4P9WA 1CWPA 4S2FA 4P5HA 2W0XA 5LBBA 2J1TA 4Q4W1 2OX0A 3WXPA 1UYPA 3E6CC 2J7MA 2ZGLA 4AWDA 2C5DA 2D6KA 2QDNA 1FXZA 4FCAA 1YQ6A 3ZLIA 1AR92 4ASMB 3LF7A 2ZEWA 2Q1ZB 4FPEA 5BXXA 1H4HA 3DYPA 1WZXA 3MUY1 2R071 4MSVA 4AHYA 4YW4A 1WGPA 2EIEA 2XVLA 3LDKA 1TME3 3I3QA 3VN4A 4Q4W2 5FIXA 4CP0A 2P6HA 5EXOA 3BTYA 4JGYC 4Y20A 2H0VA 3GM8A 4YGDA 5FJKA 4BU2A 3I49A 3H3UA 2XJRA 2KXLA 4NHLA 4Z8BA 1CAWB 4UFIA 4Y26A 4YWAA 3ZXGA 2WFF1 2IVIB 2WLPA 4F7ZA 5A33B 2R072 5L73A 4OI0A 4NO4A 3DYMA 1GOHA 2GSYA 3HN3A 3VHNA 1DYPA 1V9U1 3NNGA 4AFBA 1OUXA 4CDQA 4YGCA 1DGLA 2DCKA 5DABA 4AEMA 2EAAA 3PVOA 2X8KA 3ACIA 2BU9A 2WFF2 4A7KA 1GP5A 1FX5A 4QX8A 2V5DA 1WD4A 4HK8A 1B35A 1HB1A 4XVHA 1ZNPA 3DXTA 1UYZA 1PMHX 1V9U2 4Z1VA 5HCHA 5FY9A 4UW4A 4ATFA 5C4WB 1G86A 2B7YA 2QZ2A 4M0HA 4XACA 3BTAA 3EXUA 3N3HA 4ZY9A 1D0GA 1R64A 2QQKA 3NL1A 3ZXDA 1CPMA 1LOEA 5BNOB 1GU3A 4OVEA 2WWUA 4META 3CU7A 4NIDA 1BCXA 1UMHA 4IV3A 4P9YA 2RE9A 1GZTA 2CGPA 4S2DA 1W6QA 5F37A 1XE8A 2BW8A 1VLNA 1PX3A 4JVAA 4Y33A 2KD7A 3AZVA 5C7GA 1YRZA 2WS93 2JDAA 1XYPA 4OLLA 1NA1B 5KC6A 1XOYA 5LBFA 3LEIA 3MW2A 4FAGA 1HQWA 3M1HA 3MF6A 2B5HA 2WQ4A 3QLQA 4QM8A 5APAA 1WW5A 3VKLA 1JYWA 4CCNA 1F9KA 3PIGA 1GP6A 4LO5B 2W3JA 5IFPA 1NCRB 4DUWA 1DZQA 4XF1A 2UWCA 4KH9A 4YARA 4Z92B 2I45A 3U75A 5FYHA 1JU4A 1V6IA 5A70A 3LCPA 3WG3A 4BLIA 1M06G 4CU9A 2NP0A 4ATEA 4QQHA 3RMXA 3INAA 2ARCA 4DXZA 4GKYA 5CBLA 2D44A 1AL21 1MQTC 1CAXB 2VBBA 2R7EB 2Z79A 2B4KA 3S5AA 2OZ6A 2YG0A 1LB2A 4D7YA 5I93A 5A7WA 2Y6LA 1LOCA 4AHXA 1JZ8A 1UYYA 3AP4A 1SG3A 1SPPB 1UZWA 2GZWA 2WT2A 3RRDA 4CEYB 2JDUA 4CCMA 3GALA 1SACA 1HKDA 5ACA3 1CX4A 1AL22 3FUQA 2YC4A 4K8FA 2HWF3 4AI0A 3TEWA 3K2OA 4EV0A 3OGVA 2QQMA 1ND3B 4IE7A 3PVEA 2XVKA 4JKMA 2QDRA 4ES9A 3CIHA 2GU9A 1HRV1 3DPRC 1LU1A 1U5IA 2WZPP 3C7FA 4K9SA 3K51A 1EYBA 4D7TA 4B4QA 2GNDA 2DYCA 3PUHA 3S0MA 3O1OA 4BPZA 1OLQA 5D8AA 1NQDA 4B7EA 1VBD3 2JDZA 1LU2A 4YLZA 3MO4A 4LBOA 1MS4A 3N7KA 1QIQA 5JPNB 2JICA 3UV9A 4BCUA 1HRV2 1XU1A 1IPSA 2P34A 3KQRA 2DF7A 2VZQA 5EJZB 3S7EA 4O9EA 1LENA 1MR5A 1VAMA 3AM2A 5D2AA 4LO7A 1YFUA 4KWUA 1RMU3 3AKQA 4LO8A 3ZYHA 2ZAAA 1W6NA 2BVBA 2QKDA 2Z5WA 3D3AA 3MW4A 4HN0A 3ES4A 4LULA 4UI9L 4X8NA 5CA6A 1F8VA 1FYUA 2PHRA 4LK6A 5A3LA 2JDMA 3LA7A 4TTGA 3P3PA 2VQUA 1JYXA 1ZBA3 4WVMA 1X82A 4Y20B 3CNAA 4FAHA 3SEPA 1UMZA 2CAUA 5A6QA 2FHRA 4YVWA 3W9AA 2Y6HA 2ZGNA 4COUA 1RUH1 3JUUA 1BVVA 1L7RA 1VMHA 3RYPA 1K3IA 1UKRA 5I0TA 1RUC3 1XC6A 1PK6B 2FMYA 2RM23 2FMDA 3E6BA 3S30A 3ZFFC 1KEXA 3GDBA 1QU0A 3AB0A 3J7MA 3NJVA 3J7LA 3J8F1 3WDUA 4CDQB 1J3RA 2J1UA 3WP5A 1XB9A 1DCSA 4UBGA 3ZXEA 4QPIC 5L7OC 3C7HA 1RUH2 2RDSA 4JGZB 1U5ZA 5JUVA 1ZZ7A 3POJA 1B35B 4MYEA 4JDMA 2QNKA 2ZGPA 4N53A 5ABJB 1LOFC 5LY2A 2JEMA 3U0ZA 5BNPC 4HKWA 3J8F2 4LORA 1D2QA 4YVSA 2PTMA 3FHQA 2A6YA 4OUMA 5FYIA 1TME1 2W5FA 1LJ7A 1SDDB 4RS5C 2XB6C 1TMF3 5K9YA 3ZXAC 1Q8OA 3KS7A 2WO2A 4J1XA 2ZHNA 4TLGA 4B1LA 5I8YA 5JOZA 5LA1A 1BLZA 5C71A 4QGNA 1VMFA 4K21A 4EWAA 1KFUL 1N1VA 5HV0A 3MGUA 1IS6A 2XUEA 4I0BA 4P14A 1TME2 4P9IA 4YW2A 1W28A 2IZWA 1NYWA 3IMNA 1W6OA 1KDMA 3FC0A 1LNSA 2Z42A 1UAIA 1JI6A 4JHTA 3PNAA 1W8HA 5JZGA 1K45A 4NIHA 1IOAA 1H1AA 3AVSA 4MXWA 1HXS3 2K0GA 2VZOA 4OZOA 4RGGA 2ET1A 2PAEA 3ME2A 1GV9A 4Y1XA 1O5LA 2J1VA 4JGYA 1GKBA 2AH2A 3ZN6A 4XF3A 3W59A 4LKEA 3FLTA 4I01A 4LBQA 5FY7A 2BPA2 5HI0A 4RYDA 2PLV3 1A78A 1W03A 5T50A 1BK1A 3ZSLA 4CCJA 3VZLA 4NUBA 5GLTA 2JE8A 4W65A 4IGQA 2WINB 3RYKA 1HN0A 2HKXA 5GM0A 2NQYA 3H7JA 1H8TC 3BODA 4DZGA 1PM4A 3OCPA 4RD7A 4YW3A 4CPBD 3AL5A 5EQUA 1HJFA 3AXDA 5FV3A 5B4XA 3M7AA 4ZXEA 1DP0A 2OXBA 4HN1A 2BOJA 3T3YA 3ORJA 2RR13 3R05A 5FQ0B 2VMHA 4AFAA 1JW6A 3CMGA 1LHVA 1QH6A 3C7OA 3DEMA 5FXXA 1MS8A 1RITA 2VNVA 5FBJA 2SBAA 3JQXA 4I0WB 2D5HA 4TYSA 3APBA 3UJOA 2DVFA 3HVDA 4CVUA 2XQXA 4LPLA 5J48A 4BZ4A 4PF5A 1AYN1 4KNCA 3B01A 5D8AB 2ZGRA 2K46A 4URTA 2EA7A 4IEOA 1NLRA 2W2IA 4NRPA 4OI1A 1OBNA 3VKFC 2JIJA 4UWDA 4CCCA 4XQ4A 2BVVA 2W92A 4ISQA 3VD3A 2PHWA 2R0FA 2E6VA 1AYM3 1AYN2 3RPQA 1LGBA 2E31A 2YU1A 4HL0A 1FNYA 2HWB3 4XHXA 3OJBA 1KRIA 2AENA 2W47A 1W6NB 2VW1A 2ZGQA 4R8HA 5AFBA 2NZ9A 3A22A 5ACA1 3CDZB 2MHFA 4GD4A 4JTOA 3RJ2X 2CGOA 1QH7A 4A6SA 4XILA 3OYWA 5C3OA 3LB9A 4WVMB 4BK5A 4HMZA 1OQ1A 5C8CA 1HB2A 1W90A 3GBGA 2WSUA 4KBBA 4G9SB 2D3RA 3JB8A 1ND2A 2BNMA 4YVWB 4AVSA 5A1AA 3WG1A 4YM1A 5ACA2 4CEWC 1VB2A 3B69A 5KHIA 2E26A 1MQTA 5DDJ3 1VBD1 4UFLA 4LUMA 2JENA 1Z7S1 4AQ2A 3FZ3A 3OGGA 3OBRA 1ZZCA 4HPKB 2YV8A 4RN5A 3ZXKA 1NQJA 5F6LB 1ODMA 2VMCA 5T5JA 3USSA 5T55A 4D0QA 3OY8A 4CDWC 1O4ZA 1MACA 1VBD2 2HLEA 1DHKB 3AYEA 5LEJA 4N53B 1RMU1 4L9BA 1Z7S2 1K12A 1E5IA 5T52A 1RUNA 1W8UA 3H50A 1BXHA 2IWGB 2DV9A 3DPRA 2YUEA 5TSWA 3NRUA 4JDNA 4ORFA 1JU3A 4JDOA 1T2XA 4CTEA 1ZBA1 2DFCA 2ENRA 1PGL1 1UX7A 5FYMA 1RMU2 2BRTA 4YG0A 2BEOA 1C5IA 2AACA 1GZCA 1L3JA 1HV0A 1F5JA 3I3DA 2RMU1 2JD9A 2VBPA 3SCGA 1RGSA 2E51A 4URAA 4JX0A 4CDUA 4QXHA 1RUC1 4IEVA 1ZBA2 2RM21 3DF0A 3UETA 3LOIA 1PGL2 4XJ9A 2DURA 3O5SA 4J25A 4MHUA 2B42B 5T5OA 1GLHA 1TNFA 1QDOA 1H1IA 2RMU2 3E5QA 4MXWB 3S57A 3V0AA 2EXHA 2VCBA 1D0HA 4XJZA 1OURA 1RUC2 2CNAA 2WZEA 1FPN3 3SNMA 2RM22 4P9JA 1YI9A 3JBG3 3U4SA 4JGYB 3ZN6B 1AXZA 1GMMA 3GNEA 4LBQB 1UY1A 3IM0A 4YG3A 5F5IA 4K7JA 2Q8CA 4JKLA 1YXWA 1LESA 3H7YA 4Q4X3 4XFBA 5CFCC 4DRRA 5LZ6A 3VDBA 2XJQA 4Q8LA 3WQBA 1S0FA 3WW1A 3CQOA 3MPBA 1H2LA 1NZIA 4N90A 1S0JA 3RZMA 2CHHA 3WCSA 4PQQA 3WDVA 1LOGA 2GP3A 4ZS2A 3GJAA 4YM0A 5A1FA 4QPIA 4DUVA 5KXBA 5L7OA 4V2WA 1O59A 2J1AA 3E97A 1PNFA 3J7HA 3HQRA 2GC0A 1GICA 4QHOA 2BP6A 4RGAA 2BJSA 5HCAA 1LOFA 2P17A 2UY8A 4MGSA 3WF0A 4KI5M 3Q8FA 1S4CA 4YZ3A 5BNPA 1HXS1 4RQPC 3HD8B 3MICA 2A73B 1C3HA 4Q4V1 4RA0A 1BZWA 2VNOA 4UFHA 1D2SA 1LHNA 2MNGA 4XBNA 5JIAA 4CDXC 2NMNA 1UY0A 1UPIA 2WBKA 4D7SA 1IG3A 1HXS2 2VW2A 2PLV1 4LR4A 1QF3A 3F95A 3GZUC 3K46A 3MIBA 2VZTA 1CGPA 2B45X 4Q4V2 5DZGA 1HN1A 5FUIA 3VLBB 1D4VB 1NLQA 1HQLA 2X10A 1GNYA 4E8DA 2PLV2 2WNVC 1YO8A 2JDPA 2XKPA 2AEYA 4LXLA 3ILFA 3VD7A 4M00A 4CCLA 1C5HA 4YW7A 1MS1A 2FD8A 1RXFA 2D6OX 3RS6A 1FV2A 4K1ZA 5C3SA 5L36A 5C9AC 3ZYPA 3OYWB 3H1WA 3KHBA 1ULEA 3ASIA 4KQ7A 1ASJ3 3EJKA 5FZFA 4OQ9A 5K8SA 2BFUL 4KGQA 2D40A 1W8NA 3K4AA 2VQ0A 3HQXA 1ND2B 4HFSA 2GNMA 1WCKA 2D3PA 4XQWA 5EYXA 5J36A 3MFCA 1DQ5A 4KU7A 2TBVA 3ENRA 4E4HA 4IV1C 1MQTB 1Q3EA 3BTXA 4OCTA 1CX1A 1ZRFA 5GZCA 2ETEA 3A4UA 3FWEA 4F8AA 4CZSA 1NLSA 1O8PA 1XNDA 3E6DA 2PMWB 2DUQA 1ZRRA 4LHSA 2E7AA 1H8TA 5FPBA 1AYM1 2P3IA 2ZA9A 1D4M1 3OY8B 3VBSC 4YZ1A 5GLZA 1UY2A 3O0WA 2HWB1 2NYYA 4LMFA 1OI6A 3PUSA 4LIVA 2D6MA 5LASA 1ACCA 2D6PA 4XYXA 4S2GA 1WBLA 2W87A 3N7LA 3DPRB 3WDXA 4EJRA 3N9LA 3FFZA 3QBQA 1AYM2 3AYCA 3PMSA 1D4M2 4TLFA 5JMCA 1QJU3 3OPTA 4P5YA 3VBHC 1L7LA 2BGOA 2EXKA 1HB3A 2TNFA 2HWB2 2VXRA 2WIIB 1XE7A 3ZDSA 1JMUB 1QMJA 4CP2A 2SLIA 4UW3A 3UT0A 2OUHA 2AUYA 2OPWA 3IDBB 2BGPA 3DN7A 5F6KA 1UZYA 5DDJ1 3T0BA 2UURA 4XUTA 4BMBA 1JH5A 2NN8A 1ZZ9A 4B29A 1XXNA 1YFXA 3H8XA 4ONUA 1X9TA 4GH4C 5K4LA 1X33A 2VVEA 2AC1A 4CE8A 2Y26A 4NAOA 1Y9GA 1OA3A 2FCVA 3WDTA 3ZVXA 4KU8A 4DINB 5J3UA 3V0AB 3K77A 1WMDA 5DDJ2 1KGYA 4GAZA 4RL7A 2PN5A 4XCAA 3LA3A 3MV11 1ENQA 5G04L 5B2GB 3V65A 4OI4A 2MEV3 4DNYA 1KD7A 2GH8A 4PLMA 1RUG3 4FPYA 5EHDA 4AFMA 2JD4A 4CEWA 1RUI1 1Y3TA 2GH2A 4A45A 4A44A 4CU7A 4NMIA 5GALA 3NKGA 4MLOA 5EIYB 1SZBA 4XETA 3ZFEC 2VUDA 5A3MA 2WC2A 1DGWX 4XDPA 3ZFFB 2PHFA 1GQPA 3C8XA 1JS9A 3J7NA 1DLCA 1E5RA 2FQPA 4PJYA 1NZCA 4QHBA 4UFMA 5FZ6A 2VMGA 4EQVA 4CU8A 4QX5A 3BCWA 4NPLA 1JYTA 4QPIB 1UZ0A 4DS0A 5L7OB 2YHJA 4XZPA 4CDWA 2ZX1A 1AX0A 4XOGA 1X50A 3B3QE 3ILNA 4LJHA 1CZSA 5IVBA 1RUF3 2ZGMA 3QD6A 3MW3A 4CCDA 5BNPB 4Q0PA 2W1WA 1NUKA 3AFKA 2VU9A 4FP2A 4Q0VA 1GWKA 4GA9A 4JCKA 2A3XA 4DXSA 2W39A 5FPXA 2A3WA 2RV9A 3PDQA 1FPN1 3H42B 3RWNA 1LECA 4MVTA 4RS5B 4PLNA 1UCXA 3JBG1 1KJRA 3SCHA 2OYZA 3TRSB 3WINE 2DVBA 5LW9A 1VBE3 1RUOA 4Q29A 4BHPA 1G9CA 1GNZA 4W6XA 2EVXA 4Q4X1 1KS5A 3WDYA 5K7PA 3LEGA 4WZFA 1WCSA 3M8LA 5GJ6A 5A32A 1OA4A 1E57A 5IK4A 1FPN2 1H0BA 5A6YA 1QJY3 4HKLA 5BUVA 3JBG2 4BMEA 3NAPC 4P9LA 3PJYA 2B8MA 5FREA 4XURA 3POEA 4YNIA 4M3CE 2ZGTA 3AKPA 5JOWA 4Q4X2 5F8PA 2FDHA 3EHKA 4GALA 2WRAA 3KV4A 1JYIA 5IWFA 4N7IA 1SMVA 5JI7A 4ZZ8A 3RFRA 4XMIA 2DUOA 4D94A 2VQAA 1I3HA 5EWSA 3SH5A 4BXFA 3IB3A 3JCIA 1DZTA 1GQGA 2VC9A 1CAXA 2WLQA 5E6HA 2YB7A 1PZ9A 4RFRB 4XIKA 2EICA 4W6YA 1GFF2 2R30A 1HRI3 5FY1A 3ZIWA 5F7UA 3BUCA 3HN1A 5BV6A 5LCWL 1WLDA 2BWCA 4QWNA 2WSVA 1NKGA 1PO13 4CEYA 2R063 3KF5A 3B93A 1R1A3 1UXXX 4L99A 4TN7A 2A6ZA 4Y4RA 2VCAA 1H8TB 2XHKA 3NQHA 3U4XA 5FMBA 1PIV3 2R16A 1BVP1 4FTEA 3OOXA 1NY71 4G3YC 5FKCA 4BISA 4Q8KA 4RQPA 5CKMA 4IXLA 2R1DA 1A8DA 1OVSA 4XTPA 4OULA 4DRVA 4XC9A 4XQDA 1RB8G 1CN1A 3SEEA 1U0AA 4CDXA 5ANNA 4MGIE 4NPMA 4HSLA 3T08A 1GNHA 5F3CA 3LSEA 1NY72 1ASJ1 3WW2A 3X29B 3H8OA 3O1SA 5FZ9A 2RHPA 2G1MA 3POYA 4ITCA 1SBDA 4HT1T 4PCRA 4FBFA 2A70A 4L11A 2R1BA 3ACLA 5JOXA 3THCA 1W9YA 2HWC3 3T4HB 1VMJA 1ASJ2 2N7GA 2VPVA 2UYBA 4BQ1A 1UYXA 4LBKA 1RHI1 5SV8A 3VHOA 1JHNA 5FYUA 5LBCA 1JUHA 3ZFGC 1WA4A 3LSDA 4AGVA 3GZTB 5C70A 2W1QA 4L8QA 4M4RA 5C9AA 5DN2A 4AGRA 1UD1A 3VKMA 4N9IA 4OUSA 1OOPA 1RHI2 2Y8KA 2VAUA 4I02A 3NSTA 1AX1A 2CV6A 3MIHA 1TQ5A 5KHHA 4LEJA 5IATA 3CBNA 2WAAA 4CEWB 3DUIA 1SLAA 2ZABA 3IT8A 1PK6A 1QJU1 3POWA 1Y9QA 3AYAA 5FYCA 3EQEA 2NMOA 1JZ3A 4NWVA 3V0BA 2KR2A 1N3QA 2CYFA 2GNTA 3RZKA 4N43A 5FP8A 5C3PA 1STMA 1S0BA 5BY5A 2OZJA 4JGZA 4LIUA 4BQ3A 1VIWB 2EXIA 2VY0A 3ZYRA 1QJU2 1R093 1WLWA 3VBSA 4CDWB 5ABJA 5E89A 2WZR3 3CZUA 5JSRA 5G05L 1WMEA 3DV8A 3K4DA 3JB4C 4BIOA 5CG8A 3GXUA 3I2DA 2VNRA 5C3QA 1UW8A 1W9TA 5DAWA 2DCTA 4YW6A 4AEJA 4FPLA 3L9JT 5F39A 1WLTA 5DZEA 4E4SA 3OUHA 1BQPA 4DPNA 5I0RA 4LHLA 5JXIA 1E5SA 1O7FA 1AHSA 2NM1A 5CIRA 3VBHA 2RG4A 3GF6A 4LHNA 5IAVA 3WOGA 5FP4A 5BPXA 2ZS6B 1O3SA 1JZ5A 4I09A 2L9LA 5FYZA 4KL1A 3UGGA 3HNBM 4AXOA 3VBOC 4B4RA 1XRUA 5FYVA 5A32B 3AKRA 4HLTA 5KHGA 3TYJA 2WKKA 3KV5A 4R9BA 4AEDC 1TEIA 1URXA 3NV4A 4ASLA 5LK7B 1RUG2 3M2MA 3ZYBA 3I8TA 5A6XA 3C3VA 4GH4A 1FOD3 2P1BA 3FN9A 2UY9A 1S2BA 4LBNA 3URFA 1H2MA 4XIOA 1OVPA 2JX9A 3WLUA 1IKPA 2DVDA 2YC0A 5F2SA 1RUF1 3UYJA 3WNLA 2TUNA 1OQEA 1ULOA 4OQ8A 1C8NA 3LWCA 1WMXA 3PUAA 2ZEYA 3AMNA 3WT3A 4LO4B 2O8OA 1POV0 3I54A 1Y4WA 4YRDA 5FLIA 2XH6A 5CFCB 2XWJB 2ZJCA 4HK9A 1TVGA 4QXKA 5A7SA 4M4PA 1RUF2 1VBE1 3VZOA 4Z07A 1HV1A 2YFZA 1JXNA 2FDJA 2IC1A 2VMEA 1OC1A 1OH4A 1N1TA 3UL2A 4AHZA 3AP7A 1QEXA 5D1IA 1QJY1 1ULDA 1EUTA 4FOWA 3CJXA 1AR73 2CWSA 2W52A 1SFNA 4KG8A 4LUKA 1VBE2 1QJFA 5FQ0A 4LLOA 4FFIA 1XNAA 2A7AA 4HZFA 1TE1B 2JG8A 3W21A 5IVCA 3RZGA 5L9BA 4QX3A 1A3KA 1QOTA 1W8WA 4RQPB 4QM9A 4ARYA 3ZSJA 1LOAA 2PYTA 3MBWA 3VD5A 5A7NA 2X29A 1QJY2 2JE7A 5CFDC 4CDXB 2O1QA 1S0GA 1IS3A 5DG1A 4MHRA 5FUNA 3KCXA 2AYHA 3UESA 4U36A 5T3NA 5IJRA 5FFOC 2RJ2A 3CO2A 2DFBA 1KS4A 3LPGA 3NV3A 2Q5TA 4QU1A 1EP0A 3Q8BA 4Q2FA 3LAGA 3ZN4A 3LKJA 1HRI1 1QXJA 1US2A 3NAPA 4QD2A 5AVAA 1FMD3 2VUJA 4FI9A 4O9GA 5H9RA 5HPOA 1ZYBA 1PO11 1ODNA 5FYTA 2CTVA 2Q0AA 2E7QA 5FMOS 4N8MA 2WNVB 1R1A1 5FO8B 1VBC3 5FZCA 5JIUA 3GGLA 2VMFA 1YI7A 3ELNA 4JQTA 4LBJA 1P8JA 2OW4A 5JDBA 5F3EA 3UKNA 1PIV1 1HRI2 2V09A 2P3JA 2XOMA 1Q56A 1JODA 5C9AB 4FOQA 1LHUA 1NXMA 4QX7A 5BYNA 1IPJA 1PO12 4QGMA 2R062 2YC2A 4AI1A 1OOPB 1R1A2 4XDOA 4BQWA 1W6PA 4LKDA 4QDRA 3IN9A 3ZXJA 1DU3D 2ERFA 2BYVE 2G9GA 3KCYA 3MLKA 4R9DA 3K75B 3ZYGA 1PIV2 2E7TA 3ACHA 2XL9A 4JC1A 4LQRA 1ST8A 3AP5A 1CAVA 2FDIA 3EBRA 1SCSA 2VOXA 4RHV3 3V0BB 4HPKA 1UIJA 1W3XA 2J22A 2Q30A 1DQ2A 4N43B 3EO6A 2ZHLA 2Y6JA 3VZNA 3BKZA 3AC0A 1W8ZA 4GULA 4GXLA 2HWC1 2HWE3 3VBSB 4QKFA 2FDKA 3MF9A 5A3TA 1AL0G 1M4WA 4PLOA 5BNNA 1AVBA 3R6SA 3OPZA 1IS5A 1YFWA 1H30A 1DGRA 4NOTA 2Q4SA 5GZFA 1WD3A 3UGFA 2QJVA 4EZ4A 2HWC2 3ZKUA 2PAKA 3LD8A 2Y34A 5DAVA 3VBHB 4FSJA 1S0CA 2X5IA 1K5MC 5FXVA 1HQNA 4IESA 2GNBA 1QOSA 1ZBE3 4UBHA 3WV6A 1C4RA 2VNGA 1TZOA 4HVRA 1I6XA 2OQ6A 2YY1A 3JD73 2VZ3A 1DIWA 5FZLA 2RDRA 4ZXKA 3R4UA 3NKTA 3RI8A 4GMP3 3VBRC 4Q0SA 3WHUA 4PIXA 1OUSA 4Y1ZA 1UY4A 4GH4B 2IXKA 3ZFGA 4UXAA 4X8PA 5EJ3A 4YGBA 4IDZA 4KWLA 2VZSA 2WZR1 3LQCA 2EALA 2FCUA 4OMCA 3THPA 1CAUA 1EAH3 3MIGA 2BOIA 3VV1A 1WMFA 2PHDA 3IAQA 3CLPA 3T2QA 1IQAA 2OIIA 3B9CA 3RSJA 1H9PA 2H6CA 1ZVFA 4DEVA 2Q1MA 3WD5A 2XJTA 4EN8B 1OLME 2WZR2 3HR9A 2WT0A 1UL9A 3NNLA 4Q27A 3O14A 3ZFEB 3ZMOA 4PBOA 3I2HA 3BOWA 3TAYA 2BWAA 1AZDA 3FHAA 2WS91 4AGGA 3T2PA 5FTTC 3H0OA 2D3SA 3ZIXA 2WYSA 3EB7A 1TNRA 2YU2A 3HAGA 2YPDA 3A0KA 3RMYA 1ZRIA 4BIFA 4YFZA 2HYKA 1Y7BA 2JB4A 4AVAA 3O1TA 2JG8B 4ZZ5A 5FZOA 1W9WA 3WQ0A 2WS92 5KR7A 3WP6A 5IYYA 3ZXLA 4QT6A 3ZDVA 4D6RA 4C8DA 1BMV1 4XHBA 4IERA 2EXJA 4OYUA 4YW1A 4AK3A 3I7DA 3LGRA 1EV13 1VBB3 3MIEA 1AJOA 3PTYA 3T4VA 3U1XA 3GJBA 1RUD3 1CJDA 5JR7B 4LK7A 1YJLA 3VD4A 2QQVA 3M3OA 3OEBA 1BMV2 1MEC3 2Y60A 2YYOA 3SXWA 4XABA 3NAPB 3ECQA 3WDWA 4AEDA 2FZ2A 4HKOA 2JG9C 2A6WA 4NIGA 3O7OA 3WG2A 2WA4A 4LKSA 4P02B 4NN0A 2HWF1 5DAXA 1C28A 1US3A 1AR71 2GN7A 5FZGA 4UT5A 3VL9A 4A7ZA 3GCXA 4ZS3A 1JHJA 1T6GC 4AI9A 2XMLA 3ITQA 1UOGA 1W6PB 2Q8DA 2HWF2 2RS13 1AR72 3QOPA 5KXEA 3AKTA 3N9OA 3IDCB 4OHZA 1CAVB 3B94A 4MZUA 1XE0A 1RC6A 1GZWA 3KZ4C 3UGHA 3VZKA 3RYRA 1LTEA 4TWTA 3POBA 1JOPA 4CUCA 3CEWA 2E53A 1YYNA 4LA3A 5LA0A 4QGLA 2ZPXA 1I1EA 3O0XA 1SLBA 1WUVA 1OF4A 4WV8A 2BQPA 1W2NA 1FMD1 4QDQA 5BNNB 2PXJA 1S55A 4FP3A 1QOOA 2BUKA 2RS53 1UO9A 1VBC1 5FZAA 3CJIC 5LB6A 4QX0A 2OVUA 3AP9A 5FDBA 5CFDA 1JZ2A 4MGKE 4FT8A 2AR6A 4IEWA 4YZ4A 1FMD2 3E5XA 4XZUG 3LE0A 2X5IB 3LEMA 5EP9A 1OHFA 1DF0A 1Q8QA 5T54A 1VBC2 5FRAA 3LOBA 1IPKA 4QXCA 4LE3A 3LZZA 2P5BA 5C4WC 4NHMA 5FLJA 3OGJA 5HCFA 1GOGA 3GZAA 1UOJA 2WNOA 4HVOA 2IFWA 2JDNA 1PO23 5BNOC 3GBFA 4PIZA 1W2AX 1W0PA 3WNXA 1PGW1 5EPAA 1O91A 2PQQA 4HSJA 4QX1A 5IHRA 4NHYA 4A4AA 3OUJA 3ZFGB 1BBT3 3KB5A 1YQ8A 2HWE1 4XFGA 1BHGA 4GMP0 2QQOA 4GWMA 1BJQA 3SLIA 4AI2A 5JSOA 1CAUB 1VBA3 2Y64A 1G7YA 1PGW2 2YGMA 5JAXA 1V70A 2RJKA 3ZMNA 3P1IA 4I2OA 2HWE2 1TMF1 1W04A 1LHOA 3KV6A 2XJVA 4GKXA 4M3CA 1ZRCA 2ADEA 2CL2A 2OUJA 1MS5A 3NJZA 5FZ8A 3ZFFA 3FL7A 2E63A 3I59A 5F5AA 3UKTA 2HWD3 3HJRA 5KHKA 4AI3A 3MV01 4E2SA 3JD71 3I3MA 1TMF2 5KHJA 2PFWA 1QKQA 4GMP1 4HETA 4J6GA 2CSGA 2QVSB 3I2JA 3KSCA 3Q8EA 3AZZA 4YM2A 4XFHA 5L9RA 1SBEA 4F83A 2G9ZA 5FZHA 1QJEA 1E5HA 2VJXA 1EPWA 1AR83 1UOBA 2ZAHA 4LOTA 5FZOB 4PHZA 1PVXA 5FAXA 3ZPYA 3D0SA 3JD72 2VE1A 3JXSA 3PVNA 2DDUA 4RS5A 4IEUA 4Y5SA 3TEXA 3O1VA 1LULA 2AREA 3EMRA 3ST7A 2FBEA 3USUB 4CU6A 1ZX5A 4ZU7A 1DZRA 3A7QA 5FO9B 1OT5A 1N1SA 4JHZA 4XBQA 2LM3A 3MLLA 4H55A 1SEFA 2R49A 1I5ZA 1YQ2A 4B1MA 2VW0A 3VBOB 3WNMA 4W6WA 4BXSV 1OQDA 4NAMA 1RJ8A 3HNYM 5DZFA 1ND3C 2Q8EA 5A3UA 1REFA 4A41A 3I97A 4RSUA 1COV3 2P37A 4HANA 3O1RA 4AEDB 2F4PA 2VVFA 2RS33 1R083 3WP3A
chains in the Genus database with same CATH topology
2Y6LA 1JZ8A 2QQNA 1UYYA 1W8OA 2QQJA 3IB3A 4W8JA 4GWJA 1SG3A 2VR4A 1ULPA 2VC9A 2YB7A 2EICA 2YC4A 5F7UA 5LCWL 3OGVA 2QQMA 3WNKA 1NKGA 2ZXQA 4TXWA 1UXXX 4JKMA 2VCAA 3CIHA 3NQHA 3C7FA 3PUHA 2XHNA 2WZ8A 3I3BA 3C7EA 1J83A 3MO4A 4PF1A 3I2FA 1WKYA 3SEEA 2VZ1A 2VZQA 3T09A 5EJZB 3T08A 3DECA 2DCJA 5JXHA 4KWUA 2BZDA 3D3AA 4UI9L 1JZ4A 2HYXA 1DYOA 3THCA 4TTGA 2VQUA 1JYXA 3OGSA 1UYXA 1JYNA 3SEPA 2ID4A 2C9KA 2QBXA 2Y6HA 5JXGA 3THDA 5C70A 2W1QA 1L7RA 4M4RA 4QPWA 1OD3A 2WN2A 5DN2A 1K3IA 1XC6A 4CUAA 1KEXA 2Y8KA 3GDBA 3NJVA 2VMDA 2J1UA 1IQDC 3WF3A 1UY3A 2WAAA 3C7HA 1L7QA 2PQSA 4ARXA 4DEQA 5JUVA 1JZ3A 3F2ZA 1PX4A 3EYPA 1W0NA 2EIBA 1NX9A 3FHQA 2YFUA 2EIDA 2LS6A 3I2IA 5LA2A 2W5FA 1SDDB 2J1SA 2ORXA 3CZUA 5G05L 3K4DA 2WO2A 3GXUA 5LA1A 1W9TA 3BN6A 5C71A 4P08A 1OF3A 5DMYA 4DUXA 1NAEA 5JXIA 2W1UA 2WO1A 1LNSA 1JI6A 1JZ5A 1K45A 2L9LA 3HNBM 4OZOA 2VZOA 2ZEZA 5IFTA 1MPXA 2J1VA 5DPNA 4E8CA 1D7PM 3OG2A 2Y6KA 3T0DA 4MADA 4RYDA 3FN9A 2W9XA 4GWIA 3LEKA 3A23A 2W46A 3LPFA 4QB6A 3WF4A 1F4HA 2JE8A 3WNLA 3IDAA 1ULOA 3VD9A 4HG6B 2ZEYA 2WAOA 5J1XA 1TVGA 4M4PA 5B4XA 2YFZA 4ZXEA 1DP0A 3BGAA 3T0AA 2VMEA 1OH4A 3CMGA 3C7OA 3ETPA 2VM9A 1F4AA 1EUTA 2C26A 4CVUA 2XQXA 4LPLA 2WDBA 3PUIA 1XNAA 5JR2A 3A21A 2OKXA 4ARYA 4QX3A 4MO3M 5JMOA 1PMJX 3VD5A 3MBWA 3W5MA 2W92A 3VD3A 2XONA 1XNTA 2ORZA 4OUEA 5CZKA 5CYYA 3UESA 2E31A 5IJRA 2RJ2A 3LPGA 4OMDA 2W47A 3A22A 3CDZB 3OEAA 1US2A 1GOFA 4FI9A 5HPOA 3WF2A 4BK5A 2E33A 3HOBA 5A1AA 3GGLA 2VMFA 2W91A 1P8JA 3ACGA 2XOMA 2E26A 4BJ0A 4QB1A 4JKKA 2YC2A 1UXZA 2VQTA 4QDRA 2W1SA 2VO5A 2WO3A 4RN5A 2C4XA 2VMCA 2B9VA 3K75B 4D0QA 3ACHA 2VZUA 4LQRA 2QQIA 2HLEA 3ABZA 5HXMA 1W99A 2J22A 1K12A 5B4NA 2Y6JA 3ACFA 4QB2A 3AC0A 2CDPA 3OB8A 3NRUA 1JU3A 1T2XA 4DXTA 1UX7A 3WNOA 4XUPA 3I3DA 2J1RA 2JD9A 4MGQA 4UOJA 3WEZA 1JZ6A 4JX0A 4P00B 2WABA 3UETA 3ZM8A 2QQLA 1RYYA 3WF1A 2LW8A 2WUHA 2VZRA 2VZ3A 2VCBA 5I0DA 1TG7A 2WZEA 1CIYA 2JKXA 4XUOA 1GMMA 3MUZ1 1UY1A 1UY4A 4JKLA 3HNMA 3VDBA 2VZSA 3LQCA 4OMCA 2ZEXA 2VZPA 3WQBA 2BBAA 1I5PA 3CQOA 3IAQA 1GUIA 3T2QA 3WSOA 4BK4A 4PQQA 4KMQA 2X05A 2VL4A 4QAWA 4DEVA 4DUVA 1O59A 1H6XA 2J1AA 3I2GA 3J7HA 4XUNA 4AAXA 4MGSA 3I2HA 2RVAA 3WF0A 4KI5M 4L0PA 4A3ZA 1O8SA 3FHAA 3T2PA 3WNPA 2WYSA 3EB7A 4QDSA 5DQ0A 1UY0A 2W94A 3OBAA 2WBKA 4ZZ5A 1W9WA 1W9SA 2VOTA 3K46A 5IYYA 2VZTA 3SKJE 4OYUA 1HN1A 2VZVA 5FUIA 3T2OA 3P6BA 4YPJA 1CZTA 2X10A 1GNYA 2V4VA 4CUBA 1XPWA 4E8DA 4BDVB 3I3EA 3VD4A 3VD7A 2X09A 1UWWA 3OEBA 4DXRA 2VCCA 3NJXA 4W4ZA 3HPNA 3ECQA 4UAPA 4Z2AA 1W8NA 3K4AA 4LKSA 4P02B 1US3A 2Y6GA 2Z4FA 1K42A 1CX1A 1JHJA 3WNNA 3CKHA 5EJ1B 3CZJA 1J84A 1O8PA 4LHSA 4XUQA 3SKVA 3UNPA 3U37A 1UY2A 2J1EA 4CUCA 3K4ZA 3VDAA 2W87A 5LA0A 1JYVA 1OF4A 4P5YA 2J1TA 4QDQA 2BGOA 2J7MA 3DYOA 4ET7A 4A6OA 4QX0A 2BGPA 2ZEWA 2WQ8A 3DYPA 3MUY1 1JZ2A 2EIEA 4XZUG 3T0BA 4XUTA 3LE0A 4W50A 3GM8A 1EUUA 3W5NA 1GOGA 2CDOA 3K77A 3DYMA 1GOHA 1CZVA 1H6YA 3HN3A 1KGYA 5G04L 3MV11 3NNGA 2DCKA 4QX1A 5IHRA 3IIIA 4A4AA 2V72A 3ACIA 4QX2A 3E1F1 1BHGA 4A45A 2V5DA 2QQOA 2BERA 4A44A 4CU7A 4XVHA 5EIYB 2Y64A 1UYZA 1PMHX 3C8XA 1GQPA 1DLCA 2VTFA 4ZY9A 4AG4A 3P1IA 1R64A 2QQKA 4CU8A 3IAPA 1UZ0A 5JXJA 1GU3A 4MOAA 1UMHA 3FL7A 1CZSA 1JZ7A 1PX3A 2KD7A 1NUKA 2W1WA 3HJRA 3MV01 4GZ9A 1SHWB 4DXSA 2RV9A 4D8MA 5C7GA 4IUGA 2JDAA 3I2JA 1UMIA 3LEIA 2VJXA 3LEGA 1JYWA 3JXSA 5IFPA 2DDUA 2W3JA 4DUWA 4CU6A 2WN3A 3A7QA 3C7GA 3VDCA 3I2KA 4XURA 1JU4A 1OT5A 4JHZA 3HEIA 4A42A 1YQ2A 2E32A 3WNMA 4BXSV 4PT6A 3HNYM 3OGRA 4CU9A 4A41A 3I97A 2W95A 1WCQA 4ZZ8A 2R7EB 2B4KA 2YG0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y6L A;  1JZ8 A;  2QQN A;  1UYY A;  1W8O A;  2QQJ A;  3IB3 A;  4W8J A;  4GWJ A;  1SG3 A;  2VR4 A;  1ULP A;  2VC9 A;  2YB7 A;  2EIC A;  2YC4 A;  5F7U A;  5LCW L;  3OGV A;  2QQM A;  3WNK A;  1NKG A;  2ZXQ A;  4TXW A;  1UXX X;  4JKM A;  2VCA A;  3CIH A;  3NQH A;  3C7F A;  3PUH A;  2XHN A;  2WZ8 A;  3I3B A;  3C7E A;  1J83 A;  3MO4 A;  4PF1 A;  3I2F A;  1WKY A;  3SEE A;  2VZ1 A;  2VZQ A;  3T09 A;  5EJZ B;  3T08 A;  3DEC A;  2DCJ A;  5JXH A;  4KWU A;  2BZD A;  3D3A A;  4UI9 L;  1JZ4 A;  2HYX A;  1DYO A;  3THC A;  4TTG A;  2VQU A;  1JYX A;  3OGS A;  1UYX A;  1JYN A;  3SEP A;  2ID4 A;  2C9K A;  2QBX A;  2Y6H A;  5JXG A;  3THD A;  5C70 A;  2W1Q A;  1L7R A;  4M4R A;  4QPW A;  1OD3 A;  2WN2 A;  5DN2 A;  1K3I A;  1XC6 A;  4CUA A;  1KEX A;  2Y8K A;  3GDB A;  3NJV A;  2VMD A;  2J1U A;  1IQD C;  3WF3 A;  1UY3 A;  2WAA A;  3C7H A;  1L7Q A;  2PQS A;  4ARX A;  4DEQ A;  5JUV A;  1JZ3 A;  3F2Z A;  1PX4 A;  3EYP A;  1W0N A;  2EIB A;  1NX9 A;  3FHQ A;  2YFU A;  2EID A;  2LS6 A;  3I2I A;  5LA2 A;  2W5F A;  1SDD B;  2J1S A;  2ORX A;  3CZU A;  5G05 L;  3K4D A;  2WO2 A;  3GXU A;  5LA1 A;  1W9T A;  3BN6 A;  5C71 A;  4P08 A;  1OF3 A;  5DMY A;  4DUX A;  1NAE A;  5JXI A;  2W1U A;  2WO1 A;  1LNS A;  1JI6 A;  1JZ5 A;  1K45 A;  2L9L A;  3HNB M;  4OZO A;  2VZO A;  2ZEZ A;  5IFT A;  1MPX A;  2J1V A;  5DPN A;  4E8C A;  1D7P M;  3OG2 A;  2Y6K A;  3T0D A;  4MAD A;  4RYD A;  3FN9 A;  2W9X A;  4GWI A;  3LEK A;  3A23 A;  2W46 A;  3LPF A;  4QB6 A;  3WF4 A;  1F4H A;  2JE8 A;  3WNL A;  3IDA A;  1ULO A;  3VD9 A;  4HG6 B;  2ZEY A;  2WAO A;  5J1X A;  1TVG A;  4M4P A;  5B4X A;  2YFZ A;  4ZXE A;  1DP0 A;  3BGA A;  3T0A A;  2VME A;  1OH4 A;  3CMG A;  3C7O A;  3ETP A;  2VM9 A;  1F4A A;  1EUT A;  2C26 A;  4CVU A;  2XQX A;  4LPL A;  2WDB A;  3PUI A;  1XNA A;  5JR2 A;  3A21 A;  2OKX A;  4ARY A;  4QX3 A;  4MO3 M;  5JMO A;  1PMJ X;  3VD5 A;  3MBW A;  3W5M A;  2W92 A;  3VD3 A;  2XON A;  1XNT A;  2ORZ A;  4OUE A;  5CZK A;  5CYY A;  3UES A;  2E31 A;  5IJR A;  2RJ2 A;  3LPG A;  4OMD A;  2W47 A;  3A22 A;  3CDZ B;  3OEA A;  1US2 A;  1GOF A;  4FI9 A;  5HPO A;  3WF2 A;  4BK5 A;  2E33 A;  3HOB A;  5A1A A;  3GGL A;  2VMF A;  2W91 A;  1P8J A;  3ACG A;  2XOM A;  2E26 A;  4BJ0 A;  4QB1 A;  4JKK A;  2YC2 A;  1UXZ A;  2VQT A;  4QDR A;  2W1S A;  2VO5 A;  2WO3 A;  4RN5 A;  2C4X A;  2VMC A;  2B9V A;  3K75 B;  4D0Q A;  3ACH A;  2VZU A;  4LQR A;  2QQI A;  2HLE A;  3ABZ A;  5HXM A;  1W99 A;  2J22 A;  1K12 A;  5B4N A;  2Y6J A;  3ACF A;  4QB2 A;  3AC0 A;  2CDP A;  3OB8 A;  3NRU A;  1JU3 A;  1T2X A;  4DXT A;  1UX7 A;  3WNO A;  4XUP A;  3I3D A;  2J1R A;  2JD9 A;  4MGQ A;  4UOJ A;  3WEZ A;  1JZ6 A;  4JX0 A;  4P00 B;  2WAB A;  3UET A;  3ZM8 A;  2QQL A;  1RYY A;  3WF1 A;  2LW8 A;  2WUH A;  2VZR A;  2VZ3 A;  2VCB A;  5I0D A;  1TG7 A;  2WZE A;  1CIY A;  2JKX A;  4XUO A;  1GMM A;  3MUZ 1;  1UY1 A;  1UY4 A;  4JKL A;  3HNM A;  3VDB A;  2VZS A;  3LQC A;  4OMC A;  2ZEX A;  2VZP A;  3WQB A;  2BBA A;  1I5P A;  3CQO A;  3IAQ A;  1GUI A;  3T2Q A;  3WSO A;  4BK4 A;  4PQQ A;  4KMQ A;  2X05 A;  2VL4 A;  4QAW A;  4DEV A;  4DUV A;  1O59 A;  1H6X A;  2J1A A;  3I2G A;  3J7H A;  4XUN A;  4AAX A;  4MGS A;  3I2H A;  2RVA A;  3WF0 A;  4KI5 M;  4L0P A;  4A3Z A;  1O8S A;  3FHA A;  3T2P A;  3WNP A;  2WYS A;  3EB7 A;  4QDS A;  5DQ0 A;  1UY0 A;  2W94 A;  3OBA A;  2WBK A;  4ZZ5 A;  1W9W A;  1W9S A;  2VOT A;  3K46 A;  5IYY A;  2VZT A;  3SKJ E;  4OYU A;  1HN1 A;  2VZV A;  5FUI A;  3T2O A;  3P6B A;  4YPJ A;  1CZT A;  2X10 A;  1GNY A;  2V4V A;  4CUB A;  1XPW A;  4E8D A;  4BDV B;  3I3E A;  3VD4 A;  3VD7 A;  2X09 A;  1UWW A;  3OEB A;  4DXR A;  2VCC A;  3NJX A;  4W4Z A;  3HPN A;  3ECQ A;  4UAP A;  4Z2A A;  1W8N A;  3K4A A;  4LKS A;  4P02 B;  1US3 A;  2Y6G A;  2Z4F A;  1K42 A;  1CX1 A;  1JHJ A;  3WNN A;  3CKH A;  5EJ1 B;  3CZJ A;  1J84 A;  1O8P A;  4LHS A;  4XUQ A;  3SKV A;  3UNP A;  3U37 A;  1UY2 A;  2J1E A;  4CUC A;  3K4Z A;  3VDA A;  2W87 A;  5LA0 A;  1JYV A;  1OF4 A;  4P5Y A;  2J1T A;  4QDQ A;  2BGO A;  2J7M A;  3DYO A;  4ET7 A;  4A6O A;  4QX0 A;  2BGP A;  2ZEW A;  2WQ8 A;  3DYP A;  3MUY 1;  1JZ2 A;  2EIE A;  4XZU G;  3T0B A;  4XUT A;  3LE0 A;  4W50 A;  3GM8 A;  1EUU A;  3W5N A;  1GOG A;  2CDO A;  3K77 A;  3DYM A;  1GOH A;  1CZV A;  1H6Y A;  3HN3 A;  1KGY A;  5G04 L;  3MV1 1;  3NNG A;  2DCK A;  4QX1 A;  5IHR A;  3III A;  4A4A A;  2V72 A;  3ACI A;  4QX2 A;  3E1F 1;  1BHG A;  4A45 A;  2V5D A;  2QQO A;  2BER A;  4A44 A;  4CU7 A;  4XVH A;  5EIY B;  2Y64 A;  1UYZ A;  1PMH X;  3C8X A;  1GQP A;  1DLC A;  2VTF A;  4ZY9 A;  4AG4 A;  3P1I A;  1R64 A;  2QQK A;  4CU8 A;  3IAP A;  1UZ0 A;  5JXJ A;  1GU3 A;  4MOA A;  1UMH A;  3FL7 A;  1CZS A;  1JZ7 A;  1PX3 A;  2KD7 A;  1NUK A;  2W1W A;  3HJR A;  3MV0 1;  4GZ9 A;  1SHW B;  4DXS A;  2RV9 A;  4D8M A;  5C7G A;  4IUG A;  2JDA A;  3I2J A;  1UMI A;  3LEI A;  2VJX A;  3LEG A;  1JYW A;  3JXS A;  5IFP A;  2DDU A;  2W3J A;  4DUW A;  4CU6 A;  2WN3 A;  3A7Q A;  3C7G A;  3VDC A;  3I2K A;  4XUR A;  1JU4 A;  1OT5 A;  4JHZ A;  3HEI A;  4A42 A;  1YQ2 A;  2E32 A;  3WNM A;  4BXS V;  4PT6 A;  3HNY M;  3OGR A;  4CU9 A;  4A41 A;  3I97 A;  2W95 A;  1WCQ A;  4ZZ8 A;  2R7E B;  2B4K A;  2YG0 A; 
#chains in the Genus database with same CATH topology
 5F5C A;  3AMP A;  4RR3 C;  3WZ1 A;  1X8E A;  2PA7 A;  2QQN A;  2QQJ A;  4F3J A;  4W8J A;  2GAU A;  2VR4 A;  3O0V A;  1ULP A;  2ADD A;  1IZ3 A;  1XJA A;  4C0H A;  2RR1 1;  1YQ5 A;  1EY2 A;  2R6Q A;  1CQ9 A;  1GBG A;  2VD7 A;  1CON A;  1Q8V A;  4AR2 A;  1S2K A;  3P5B A;  3N9M A;  2QQP A;  4MUV A;  3C2U A;  3NNJ A;  2ZZJ A;  2XKO A;  2ZXQ A;  3WNK A;  5F3I A;  4TXW A;  3RQ0 A;  5IVV A;  1UOF A;  3NMB A;  2I2S A;  3IZO A;  2PEL A;  4IEX A;  1R1Z A;  2D93 A;  2RR1 2;  3GCW A;  4OZX A;  5M0T A;  1GP4 A;  1VRH 3;  2VCM A;  3VDD C;  1VBB 1;  2XHN A;  3N9N A;  1N47 A;  1GZW B;  3LDB A;  2JB8 A;  3C7E A;  1J83 A;  3A0N A;  4XFC A;  4PF1 A;  2J42 A;  3FMG A;  3KLS A;  5ERL A;  5LAT A;  1C8M 3;  3N9Q A;  1MEC 1;  1WKY A;  5CKN A;  3T1L A;  4C90 A;  3WQ1 A;  4ERO A;  5FZB A;  4NWW A;  2VZ1 A;  2IFR A;  4OHX A;  4GIQ A;  1XSR A;  4IQP A;  4UF0 A;  1Q5O A;  3T09 A;  1VBB 2;  4Q26 A;  3GZE A;  4FXK B;  3DEC A;  2ATF A;  4WM8 C;  1F31 A;  2PHX A;  5IVY A;  3VHP A;  5JXH A;  4COV A;  1MEC 2;  2FCT A;  3AK0 A;  1JZ4 A;  1DLL A;  5A3W A;  1OMI A;  4IE6 A;  5I8S A;  3ZSM A;  1SQ4 A;  2VG9 A;  3LIG A;  1ULF A;  1DYO A;  5FP9 A;  5KXD A;  1JTZ X;  4LBM A;  3ZPO A;  3BB6 A;  4BQ5 A;  3ZYF A;  3OGS A;  4SBV A;  4MV2 A;  2CAV A;  5DUU A;  4FFH A;  1FAY A;  4BWO A;  1MS9 A;  3L2Y A;  5JXG A;  3PTR B;  3THD A;  3WX5 A;  3ALQ A;  1S1A A;  5DUV A;  1UU5 A;  2VMI A;  2XUM A;  2PAM A;  3DGT A;  4QPW A;  2WN2 A;  5EZW A;  3MYX A;  4QQL A;  4K40 A;  4CUA A;  4COY A;  2QE3 A;  5FOB B;  4IV3 C;  1IG0 A;  5FLH A;  2GN3 A;  4B8E A;  5IVE A;  3TEZ A;  3VUO A;  3BTZ A;  5IAX A;  1U5X A;  1WBF A;  4EE2 A;  4KWK A;  4FFF A;  2D6L X;  3WF3 A;  4CCO A;  3HT2 A;  1F2N A;  1KXG A;  1W6M A;  3M3E A;  4R4Z A;  4X6R B;  3TN9 3;  4LKF A;  3DXU A;  4DEQ A;  5J96 B;  3NNM A;  1A8M A;  1QQP 3;  2RS5 1;  2ZGU A;  3FX3 A;  4YM3 A;  3SCF A;  2EAK A;  3VHR A;  2GC3 A;  2BFU S;  2CU5 A;  1W0N A;  4DMI A;  1NX9 A;  5FYS A;  3PU8 A;  4XJA A;  2LS6 A;  3I2I A;  4M3C B;  5C5U A;  4XF4 A;  3SMH A;  3TEY A;  2RS5 2;  2XBO 3;  4MGY E;  4FPC A;  3I59 B;  1GR3 A;  2WO7 A;  3HT1 A;  4KGG A;  4P08 A;  4BQ2 A;  3LFM A;  4BA6 A;  1OF3 A;  5FY5 A;  4DQA A;  4DUX A;  1NAE A;  3WCR A;  1PO2 1;  2XJS A;  1MS0 A;  1OD5 A;  2YGL A;  2W1U A;  3RJR A;  3ZSK A;  1ALY A;  4CCE A;  3I4I A;  5CG9 A;  4KBZ A;  5EV7 A;  4XE9 A;  4Q0Q A;  2Y0O A;  3CJI A;  1K5J A;  1BBT 1;  1DQ1 A;  5A3O A;  1IGO A;  4BQY A;  1AX2 A;  1PO2 2;  2ZEZ A;  3WY6 A;  1HJG A;  5JI9 A;  3AX4 A;  1D7P M;  1K5M B;  1RED A;  3BU0 A;  4YGE A;  2DCZ A;  3E5U A;  3KVA A;  2P3K A;  1PNG A;  2Y6K A;  2GDF A;  5DAP A;  3KHC A;  3N35 A;  1BBT 2;  4MAD A;  3M3I A;  4LIT A;  4BQ4 A;  3T0D A;  4MGZ E;  4Y22 A;  2W46 A;  3KD4 A;  3LPF A;  4QB6 A;  4NRQ A;  2VOV A;  4L92 A;  2D97 A;  5FR3 A;  1F4H A;  3VBR B;  3BIW E;  4YW5 A;  3VD9 A;  1ZRD A;  1ZRE A;  2BGC A;  2VUA A;  4HG6 B;  2HWD 1;  5FMD A;  3SH3 A;  4FXG B;  5DUW A;  1POV 3;  3H8R A;  3KT1 A;  3WP4 A;  4HOO A;  5I8T A;  3BPZ A;  1I9R A;  4NE9 A;  2WYF A;  1FT9 A;  3QCW A;  5FZ1 A;  1WCD J;  3DL3 A;  5J1X A;  4QQO A;  3FE5 A;  3KMH A;  1PZ7 A;  2HWD 2;  1AR8 1;  3T0A A;  5CFC A;  3JZV A;  2RJL A;  4UW5 A;  4YG6 A;  2AGS A;  1QDC A;  3JU9 A;  4AAP A;  5JVV A;  4HVQ A;  1VR3 A;  3ETP A;  2VM9 A;  4QMA A;  5A3N A;  2BBV A;  3V56 A;  4XW3 A;  1YHF A;  4Z82 A;  1H8V A;  4WVV A;  2H6B A;  1FNZ A;  2C26 A;  2P3Y A;  3S7I A;  5FP3 A;  4B7K A;  1HRV 3;  4DB5 A;  1AR8 2;  5JR2 A;  3AFG A;  1CD3 G;  4NIA A;  1W9F A;  2A6V A;  3ES1 A;  1SFY A;  5JMO A;  1DG6 A;  1LAJ A;  3TNP B;  2D5F A;  2VUC A;  3KV9 A;  4FTS A;  2OQ7 A;  2BNN A;  3AJY A;  3J4U H;  3N7J A;  4H3W A;  3W5M A;  1COV 1;  2JE9 A;  5CVR A;  3AZX A;  4Z2W A;  5LK5 A;  1XNT A;  2ORZ A;  3NV1 A;  3ZKY A;  2DTY A;  4UF0 B;  2YDE A;  4WBB A;  4EN6 B;  5CFD B;  1W2T A;  5CZK A;  3VZJ A;  2QTW B;  2R0H A;  5KXC A;  1KDK A;  3RGB A;  2A1X A;  4FPJ A;  3MID A;  2XLF A;  4MH0 E;  4OI2 A;  5DG2 A;  4ASK A;  5KWR A;  1AUY A;  1COV 2;  4H2A A;  4XF9 A;  2GC2 A;  4BH9 A;  3AKS A;  2B46 X;  3HBZ A;  1BEV 3;  1GOF A;  4FFG A;  1S0I A;  3KF3 A;  3THT A;  2K2S A;  4B3N A;  5F9T A;  4ZKT B;  4LT5 A;  3MFA A;  3LFI A;  4NPR A;  4EN9 B;  4GWN A;  3HQU A;  2W91 A;  4EN7 B;  5KC5 A;  3BAL A;  4YVS C;  4JV4 A;  5JOY A;  3NWK A;  4JKK A;  4PBP A;  4QB1 A;  2WNV A;  2ARB A;  1YEW A;  4V1P A;  1RUH 3;  4XEZ A;  2JG9 B;  1C8M 1;  1YIF A;  4RR3 A;  2VQT A;  5F2W A;  4BQX A;  3BOP A;  4WVW A;  2VO5 A;  2C4X A;  4PDW C;  2NLR A;  2ZHM A;  2B9V A;  5H9P A;  1KJL A;  1DGR N;  1VRH 2;  4H14 A;  1W6M B;  4XFA A;  5F1R A;  4JZR A;  4I30 A;  1VP6 A;  1UU4 A;  5LA9 A;  1W8T A;  5HXM A;  2VOW A;  2I74 A;  3IBM A;  2ZMK A;  1C8M 2;  5FPL A;  3BVC A;  5A1L A;  2G4I A;  5B4N A;  2WNU C;  4XXP A;  3VKO A;  3O12 A;  5JPM B;  3WQ7 A;  3ACF A;  4O65 A;  4AVC A;  4CUG A;  1YQC A;  1XYN A;  2Q1F A;  3NNF A;  4IV1 A;  5JZG C;  4AFD A;  5FBZ A;  1CR7 A;  1SLT A;  3VDD A;  1H2K A;  1HIX A;  2OS2 A;  2XQR A;  1UNB A;  4R9A A;  2V5Y A;  3WNO A;  1PVC 3;  4WVZ A;  4XUP A;  4NII A;  1OA2 A;  5DAQ A;  1LGN A;  2J1R A;  5E8A A;  1KFX L;  5FPV A;  3WEZ A;  1RUJ 3;  4NHX A;  4P00 B;  4EZH A;  5CAD A;  2WAB A;  1WWY A;  1CPN A;  1GZ9 A;  4ZHN A;  1T6B X;  2WA3 A;  1RYY A;  4WM8 A;  4LBQ D;  3OD0 A;  3WF1 A;  4COZ A;  1XYO A;  2LW8 A;  1CJP A;  4GJZ A;  1OLM A;  1VPH A;  1U5Y A;  4Y24 A;  3CJI B;  5J37 A;  3I2O A;  2YRO A;  1Y43 B;  3D5O A;  3TN9 1;  2VXJ A;  1QNY A;  4CSW A;  2R04 3;  2MEV 1;  5I0D A;  1TG7 A;  1QQP 1;  1RUG 1;  2YBK A;  1CIY A;  1AJK A;  2JKX A;  2CY6 A;  4J1W A;  4WM7 C;  1V6O A;  5DXD A;  3M3Q A;  3GHM A;  5FZK A;  1WW6 A;  5FKB A;  4A7Y A;  1V6M A;  1B09 A;  4QXB A;  1J3Q A;  1KIT A;  4UYB A;  3HNM A;  3LIH A;  3TN9 2;  4Y22 B;  4BLJ A;  4FOV A;  2MEV 2;  4DFS A;  1EPZ A;  1QQP 2;  1WW7 A;  1OSG A;  2XBO 1;  2ZEX A;  4O7X A;  4XAE A;  4Y1U A;  1DYK A;  4ES8 A;  3WSO A;  4BK4 A;  3AMH A;  4KMQ A;  4DO0 A;  3NW4 A;  2X05 A;  2WL1 A;  4H7M A;  2DWR A;  4Y5Z 0;  1XSQ A;  4AOC A;  4BOW A;  1HB4 A;  5LRR A;  1GWL A;  3I2G A;  1X8M A;  4XUN A;  2IXC A;  2ZX0 A;  1OH3 A;  2XBO 2;  3HMY A;  2AEZ A;  1UIK A;  2OPK A;  5AC9 3;  2QCS B;  2YPJ A;  1C1L A;  1SCR A;  2RVA A;  1LKN A;  2WWJ A;  4L0P A;  4Y1V A;  4A3Z A;  2TEP A;  4NR1 A;  1YUD A;  2FZ1 A;  3SQO A;  5HV4 A;  3BI3 A;  2LRP A;  1AF9 A;  5FMO L;  3WNP A;  3ZFE A;  2ZX4 A;  2WFP A;  4LTA A;  4QDS A;  5GZE A;  5JLV A;  4P9G A;  3OBA A;  5C8W A;  1RL3 A;  1J3P A;  4AYU A;  5IK5 A;  1UQX A;  3M70 A;  4QU2 A;  4XMA A;  4D6S A;  1PZ8 A;  3H3L A;  3V64 A;  4C0B A;  1J1T A;  5K0U C;  1W9S A;  1Y9M A;  1RIN A;  1AYN 3;  2LAL A;  3OUI A;  1SLC A;  2WQZ C;  5C8C C;  2O0O A;  1BKZ A;  5FXZ A;  2YBS A;  1YFY A;  3H1M A;  4R4X A;  2IVJ A;  3UJQ A;  1OKO A;  2VEC A;  4OHY A;  2CGN A;  1ND2 C;  4YPJ A;  1CZT A;  3MI8 A;  3OD4 A;  5CNA A;  1POV 1;  4FPG A;  4CP1 A;  4K3U A;  4CUB A;  1G6N A;  4C1X A;  4BDV B;  4JAA A;  1BYH A;  1QNW A;  1WCU A;  2PHU A;  3T2T A;  2ZX2 A;  3PIJ A;  1C1F A;  3PL0 A;  3TB0 A;  1GSL A;  2D98 A;  1ULC A;  2DVG A;  1WLC A;  4DXR A;  2XGX A;  4EWE A;  4W4Z A;  1RJ7 A;  2XXZ A;  2JDY A;  3HPN A;  2YMZ A;  1FI2 A;  4UAP A;  1X36 A;  2XR4 A;  4GB3 3;  1GAN A;  5C6C A;  1OFS A;  1O3R A;  1VJ2 A;  2DUP A;  4Z2A A;  2YXS A;  1RVF 3;  1AR6 3;  4C91 A;  1XNK A;  4PI0 A;  2Y6G A;  1YJK A;  2G9F A;  2Z4F A;  3RZJ A;  1K42 A;  2A3Y A;  2R06 1;  3LA2 A;  3Q8C A;  2VOK A;  2ZML A;  3T30 A;  3WNN A;  3U10 A;  5FPU A;  4XJU A;  1J84 A;  4RR3 B;  1AXK A;  4NHK A;  5FMC A;  2ARX A;  4ZU4 A;  4Y4Y A;  1Z7S 3;  1QWR A;  2ZKL A;  3SKV A;  3HBK A;  4Y5T A;  4CDU C;  2D6N A;  5FPA A;  2DTW A;  1Z0H A;  4BYY A;  4MGT A;  5IK8 A;  2J1E A;  2QFE A;  1UX6 A;  4ZU5 A;  1UF2 C;  5FZD A;  3K4Z A;  3WUD A;  5SV5 A;  3RZH A;  2E9Q A;  2Z69 A;  1N1Y A;  2C0Z A;  4IV1 B;  1NE6 A;  1O3T A;  1JOB A;  1BEV 1;  1PMI A;  5AVP A;  3VDD B;  4UW6 A;  3KGZ A;  4JTN A;  1RIR A;  4MXV A;  4CXX A;  1HX6 A;  3KCC A;  1XNB A;  2WT1 A;  3DYO A;  1O6U A;  2XL7 A;  5BNQ A;  4ET7 A;  2LRO A;  4A6O A;  4XF0 A;  2JEC A;  2VTX J;  2WQ8 A;  1W05 A;  1PHM A;  5E1R A;  5FOJ B;  3R4S A;  3KM5 A;  1BEV 2;  2RMU 3;  2R32 A;  3FBM A;  5DUX A;  2HBT A;  4XCB A;  3VBF C;  1F35 A;  1VE0 A;  1GWM A;  2HEY F;  2H0B A;  4M0N A;  4W50 A;  4WM8 B;  4XTM A;  1O3Q A;  3B5L B;  3DKQ A;  2XLG A;  1DQ6 A;  1EUU A;  5GKA C;  3R0R A;  4YZ2 A;  3W5N A;  4MG2 A;  4Q1P A;  4XBL A;  3ZSE A;  1YIP A;  1WA6 X;  2CDO A;  4IEZ A;  1H6Y A;  1CZV A;  1RUE 3;  3KT4 A;  2MPF A;  2P2K A;  3H9A A;  1DQ4 A;  1LED A;  1V6J A;  5ISL A;  4WZC A;  3POI A;  3III A;  4FPF A;  2V72 A;  4QX2 A;  3E1F 1;  1UZV A;  3S5Q A;  2BER A;  3PHM A;  3OBZ A;  4QKB A;  4QPG C;  1CVN A;  1X9P A;  2A6X A;  5E88 A;  1PVC 1;  3VBU C;  2GMP A;  4I3G A;  4EYU A;  4IV3 B;  3KT7 A;  2UWA A;  1R09 1;  1W6Q B;  2VTF A;  3DKW A;  4AG4 A;  2YZ4 A;  1RUJ 1;  4PDW A;  3ROU A;  3IAP A;  4Q5O A;  4D3W A;  3R4D B;  3WW4 A;  5JXJ A;  4MOA A;  3T1M A;  4OHV A;  5IK7 A;  2LTN A;  3H8U A;  1ZA4 A;  4I0A A;  1W3V A;  5FYB A;  1NE4 A;  4NVP A;  1PVC 2;  4X6Q B;  4BM8 A;  1JZ7 A;  4YSF A;  2ZMN A;  3TOJ A;  2WNU A;  1R09 2;  3PVB B;  3WG4 A;  3WW3 A;  4CRQ A;  4D6Q A;  3O1P A;  1IHM A;  1RUJ 2;  3BU7 A;  3UK9 A;  1SFP A;  4GZ9 A;  4UFJ A;  1SHW B;  5T5L A;  2R04 1;  3VKN A;  2GAL A;  4D8M A;  4EN0 A;  5LWB A;  4IUG A;  2VH9 A;  2ET7 A;  2IUW A;  1LR5 A;  3PLQ A;  1UMI A;  4Q4V 3;  2LUW A;  3B9I A;  1FAT A;  5FPZ A;  5FZM A;  1NCQ C;  5LBE A;  2BDR A;  5LEK A;  1APN A;  1WW4 A;  4XFF A;  3SH4 A;  4XPV A;  4E2Q A;  5C3R A;  5FWJ A;  4N7U A;  2QQW A;  4U2A A;  2R04 2;  4LOS A;  2WR9 A;  1Z78 A;  2DCY A;  1RTV A;  2HEV F;  2WN3 A;  5L9V A;  1FOD 1;  3C7G A;  3AL6 A;  3VDC A;  3I2K A;  1W39 A;  2IXI A;  2JKB A;  3U78 A;  5CB7 A;  1V6L A;  4N9H A;  3HEI A;  4Q4Y 3;  4A42 A;  2E32 A;  4PT6 A;  3USU A;  3OGR A;  5A7W B;  3NV2 A;  1ZZ8 A;  1CIW A;  4AI8 A;  4ZON A;  4AHW A;  3VB9 A;  2W95 A;  1FOD 2;  1VAK A;  4WM7 A;  4XXA A;  5EFU A;  5AC9 1;  4AW7 A;  1WCQ A;  5IT6 A;  3HWJ A;  1A34 A;  1LGC A;  2UWB A;  3VBO A;  2Y0I A;  4TSV A;  4JQR A;  5A3P A;  2P4E A;  3FHI B;  2ZGS A;  1W8O A;  5IVF A;  1POQ A;  5A7Q A;  4GWJ A;  2DU1 A;  1MZ6 A;  1QJZ A;  2V4A A;  5AC9 2;  5FO7 B;  3W58 A;  4JRL A;  3WVJ A;  2C9A A;  2JDK A;  3W20 A;  1GYK A;  2YBP A;  2QUO A;  4NJ4 A;  4IEY A;  3BYW A;  5FY8 A;  2ZHK A;  4K6B A;  1OLR A;  3POS A;  3U11 A;  1UZZ A;  3O1M A;  3SIT A;  5A6Z A;  2WZ8 A;  3I3B A;  3KWV A;  4QHZ A;  1D4M 3;  3TWI A;  1N3P A;  2G19 A;  3I2F A;  4LLF A;  4H7L A;  4NRM A;  3IPV A;  5GZG A;  2DVA A;  4FQZ A;  4AQS A;  4GB3 1;  3FLR A;  4AQ6 A;  3IIA A;  2DCJ A;  1G9B A;  1MZE A;  4LNV A;  2WJS A;  4CYD A;  5FCC A;  1H2N A;  2BNO A;  1RVF 1;  5K0U A;  1AR6 1;  4LHK A;  2BZD A;  4CCK A;  4AEK A;  1SLL A;  5H9Q A;  4E9K A;  3ZO0 B;  2HYX A;  3LDR A;  4HXC A;  3SHR A;  1VRB A;  3ZOI A;  4IEQ A;  5GLU A;  2B39 A;  2ZGO A;  3DCQ A;  3ZR6 A;  1ZM1 A;  2WWS A;  4IW3 A;  4GB3 2;  4YZ5 A;  1QGL A;  3IDE A;  1UKG A;  4COW A;  2OT7 A;  1XBF A;  1JYN A;  4P9X A;  2V73 A;  1S0D A;  2CWM A;  4E4Z A;  1RVF 2;  4PQ9 A;  2UYA A;  2ID4 A;  3SC7 X;  1AR6 2;  2C9K A;  2QBX A;  3D0J A;  5LRS A;  3POF A;  3D6E A;  5A7O A;  5HBA A;  4DIQ A;  5IUQ A;  1H9W A;  3D8C A;  1QXP A;  4CA9 A;  3ZX7 A;  1OD3 A;  1H1M A;  2ZGK A;  3QAC A;  4Y1Y A;  4R52 A;  1DDL A;  1IKQ A;  1G8W A;  4NRO A;  2VMD A;  3RZZ A;  1G9A A;  1SLI A;  1IQD C;  1VAL A;  2ILM A;  1UY3 A;  2DU0 A;  3MEP A;  4Q0U A;  2HJI A;  3G6J B;  4K20 A;  4RHV 1;  1GQH A;  1L7Q A;  2PQS A;  1DBN A;  4YVS B;  5F5Q A;  4ARX A;  2C24 A;  3F2Z A;  1RUI 3;  4QQP A;  1PX4 A;  4PIY A;  1LHW A;  5FZ0 A;  3EYP A;  1YNA A;  2ZBJ A;  4R9C A;  4V2V A;  5KBF A;  2EIB A;  3Q9O A;  3PME A;  4PDW B;  5F3G A;  2YFU A;  5FUP A;  1JYC A;  1F5F A;  2EID A;  2WNE A;  4RHV 2;  3OPW A;  5LA2 A;  4CP9 A;  2J1S A;  2ORX A;  4IGO A;  5GLW A;  4XJW A;  1NA1 C;  3MIF A;  1YC6 1;  1H4G A;  3BN6 A;  3VL8 A;  5GLV A;  1W6O B;  2WNU B;  2ZKN A;  5JSP A;  5GZD A;  1AXY A;  4EWD A;  4QKN A;  3N9P A;  5FK7 A;  5C33 A;  5DMY A;  1ENX A;  4AE2 A;  1MS3 A;  2F17 A;  2X53 S;  5JZG B;  1NCR C;  3HIF A;  3RWK X;  1RUE 1;  5CKQ A;  1ZBE 1;  2WO1 A;  3FJS A;  3RZL A;  1MZ5 A;  1SBF A;  4XAA A;  5I0S A;  2EIG A;  3ON7 A;  4ZPI A;  3QH7 A;  5HCB A;  1HLC A;  1V6N A;  1QJX 3;  3ETQ A;  4AL9 A;  5FZ3 A;  3VBF A;  2KM2 A;  1LCL A;  1RUE 2;  1JBC A;  1UU6 A;  3KVB A;  1ZBE 2;  1MPX A;  5IFT A;  5DPN A;  3N4M A;  4E8C A;  4OHW A;  4GQ7 A;  4LO6 B;  5FK8 A;  1PM7 A;  3OG2 A;  4XJ8 A;  2IXH A;  4IE4 A;  5AFE A;  5I91 A;  2ZOE B;  2W9X A;  4GWI A;  1EAH 1;  2DBI A;  2XWB B;  3IWZ A;  3A23 A;  3LEK A;  4O61 A;  5F32 A;  4HON A;  1K5M A;  1ENR A;  3K3O A;  3WF4 A;  4CEY C;  5FWE A;  5CIS A;  2JWP A;  4I3P A;  1ZZ6 A;  1DQ0 A;  1REE A;  3CL1 A;  3IDA A;  4WM7 B;  1MVQ A;  1JOJ A;  2A5Z A;  3JQW A;  2NPI A;  4ISR A;  2WAO A;  5L19 A;  1EAH 2;  2D43 A;  5FYY A;  3VBR A;  2VVD A;  3N36 A;  5JCT A;  5FZ4 A;  4QPG A;  1W06 A;  4L97 A;  1OPO A;  1XQN A;  4BE3 A;  3VBU A;  2ES3 A;  3ZYJ B;  3BGA A;  5ANQ A;  4DY5 A;  4E4D X;  2QZ3 A;  3AZW A;  5C5T A;  4FTB A;  3NVC A;  5LY1 A;  5I0U A;  1F4A A;  5D21 A;  1YLL A;  3BIE A;  4RFT 0;  2IXJ A;  3SIS A;  2ZCW A;  1S2E A;  1J58 A;  2WDB A;  2ZAC A;  3PUI A;  1XU2 A;  4Q4Y 1;  5IW0 A;  4E2G A;  1Q8S A;  3A21 A;  1DGW A;  2OKX A;  4MO3 M;  1PMJ X;  2PHT A;  4AVB A;  3FBY A;  3AZY A;  1EV1 1;  1NG0 A;  2XON A;  1QHD A;  4CPB A;  3IPV B;  1NT0 A;  1RUD 1;  4OUE A;  3NJY A;  4S2H A;  5CYY A;  4Q4Y 2;  3AP6 A;  5HXV A;  3B02 A;  3FUO A;  1NCQ A;  1A6C A;  5JWP A;  1O4T A;  1O5U A;  1HDK A;  1U12 A;  2Y38 A;  5IVJ A;  4OMD A;  5K0U B;  1AR9 3;  3MHZ A;  5C8C B;  3KQ4 B;  1OOP C;  1EV1 2;  2ZZQ A;  3OEA A;  1O4Y A;  3MLJ A;  1RUD 2;  1QY4 A;  5FZI A;  3RG0 A;  1PK6 C;  4Q4W 3;  3WF2 A;  2E33 A;  4YYO A;  3BPS A;  4LBL A;  1V0A A;  3GHN A;  4XFI A;  4CDQ C;  4G4F A;  3HOB A;  4M01 A;  4N43 C;  1Q8P A;  1W0O A;  3ACG A;  1RHI 3;  3GYD A;  4JGZ C;  2R07 3;  5A7P A;  4BJ0 A;  1SDW A;  1B35 C;  4CXW A;  5CEH A;  4AFC A;  5ABJ C;  2RS1 1;  1YWK A;  4FQ4 A;  4QPY A;  1OPM A;  1UXZ A;  5H9S A;  4K8R B;  2W1S A;  2WO3 A;  3ZR5 A;  2AZ5 A;  4L2N A;  3RNS A;  2WFF 3;  4QKD A;  1HW5 A;  4IL7 A;  4RGK A;  2VZU A;  2JG9 A;  3M3C A;  5FY4 A;  2QQI A;  3FFQ A;  2OA2 A;  2XLA A;  3ABZ A;  1W99 A;  1DFQ A;  2RS1 2;  4AVT A;  2ZTN A;  5A80 A;  1V9U 3;  2GP5 A;  2GC1 A;  3D82 A;  4AZZ A;  4QB2 A;  1PGS A;  2I07 B;  2W68 A;  1S0E A;  2HH9 A;  2CDP A;  2KA3 A;  3K3N A;  3OB8 A;  4QQ2 A;  3K48 A;  4FPH A;  2JIG A;  4UFK A;  4CP9 B;  2O8Q A;  4JRA A;  3S6P A;  3U14 A;  4DXT A;  4CDU B;  1V00 A;  4M3C F;  1CES A;  2BV4 A;  2ZX3 A;  4XDQ A;  4MGQ A;  4AQT A;  4UOJ A;  5FP7 A;  3OTF A;  3CF6 E;  5J09 A;  1JZ6 A;  2FDG A;  4IEP A;  4LE4 A;  3WHT A;  5J7M A;  3D4K A;  4YFW A;  4DOU A;  4FOY A;  1Q43 A;  2B9U A;  4KG0 A;  3U07 A;  3ZM8 A;  2QQL A;  2VTX A;  3Q8A A;  3AJZ A;  1VAV A;  4AVV A;  4IE5 A;  1QXR A;  2WUH A;  5FZE A;  2JXA A;  1LOD A;  1CAW A;  1W2O A;  2VZR A;  2JJ6 A;  5FXW A;  5A33 A;  3P3N A;  2XJU A;  3H3Z A;  4B4P A;  3VBF B;  3OSD A;  1G9F A;  3ZYI B;  3IKW A;  1NXD 1;  3H1Y A;  2F6B A;  4IE0 A;  4XUO A;  3MUZ 1;  2C6S A;  2XDV A;  1KQR A;  1MVE A;  1VBA 1;  1W2U A;  5FJH A;  1YCI A;  2GME A;  3UKV A;  1RUI 2;  2VZP A;  3GBW A;  2QQU A;  2BBA A;  1I5P A;  2Z2S B;  1W8F A;  1OFN A;  1GUI A;  3ILR A;  1MZF A;  3J26 N;  3M4F A;  3FLP A;  3POG A;  2Y33 A;  1IS4 A;  5C4W A;  5FZ7 A;  3PUR A;  3MPP G;  3AVR A;  2GMM A;  2HBU A;  3AXE A;  4E27 A;  2VL4 A;  2JG8 C;  4QAW A;  1VBA 2;  3CHX A;  2RDN A;  5BNO A;  1H6X A;  4DY3 A;  3MDP A;  2P6C A;  2VGD A;  3NO8 A;  4QPG B;  4AAX A;  3ZN5 A;  3RI9 A;  1AL2 3;  3VBU B;  1LRH A;  4TZD A;  5D8A C;  2Q8O A;  4IET A;  1O8S A;  3L2H A;  1OXC A;  4LA2 A;  1ZZB A;  1QJX 1;  1LEM A;  4FPK A;  3WR0 A;  1ULG A;  2DBN A;  1F15 A;  3AMM A;  3PJQ A;  1ZA7 A;  5DQ0 A;  2C1F A;  2W94 A;  3G7D A;  1NA1 A;  3PU3 A;  4A2U A;  1N3O A;  3VGI A;  4A3X A;  2UU8 A;  2RDQ A;  3N7M A;  3RVH A;  3WUC A;  1QJX 2;  2VOT A;  4MX3 A;  3SKJ E;  4BB3 A;  1NCR A;  3VZM A;  3B7M A;  2FDF A;  2XPJ A;  4IGP A;  2VZV A;  2XJP A;  3T2O A;  3P6B A;  4OFG A;  1J59 A;  5EYY A;  1C57 A;  2V4V A;  1XPW A;  1V6K A;  4CXY A;  3RDI A;  1NCQ B;  3I3E A;  2Y6F A;  4Q1R A;  4FPO B;  2X09 A;  1UWW A;  3IMM A;  5CU1 A;  3KGL A;  4YVW C;  4FO9 A;  5CAZ A;  2A75 A;  2O14 A;  2VCC A;  3NJX A;  2RS3 1;  1R08 1;  2VUL A;  3TNQ A;  5T5P A;  4Y3O A;  1FV3 A;  1X7N A;  2D7F A;  3OBT A;  1JN2 P;  5FY0 A;  4GJY A;  2A71 A;  3AYD A;  1BK0 A;  3QH6 A;  1J1L A;  2K9Z A;  1SPP A;  4SLI A;  2EF6 A;  2IXL A;  3O1U A;  2RS3 2;  1R08 2;  5E16 A;  3B00 A;  4AF9 A;  4HBN A;  4D69 A;  4N53 C;  1ONA A;  2BTV C;  3CKH A;  3PUQ A;  1ND3 A;  5EJ1 B;  3CZJ A;  2JDH A;  2W08 A;  1NOV A;  2XG3 A;  2F4L A;  4IND A;  5BNN C;  4PI2 A;  1JUI A;  1XNC A;  1VRH 1;  2PHL A;  1G9D A;  4C1W A;  1LOB A;  4XUQ A;  4KWJ A;  5J98 B;  3ATG A;  1VB4 A;  2HEW F;  3UNP A;  2XVG A;  3U37 A;  1UN1 A;  3AMQ A;  2VBD A;  4K1Y A;  3ZXF A;  3MZH A;  1UPS A;  3J9S A;  1ENS A;  2X5I C;  4FVV A;  1AR9 1;  1RXG A;  3VDA A;  1OKQ A;  3J8F 3;  2ARA A;  1JYV A;  3TBD A;  3OF1 A;  4P9W A;  1CWP A;  4S2F A;  4P5H A;  2W0X A;  5LBB A;  2J1T A;  4Q4W 1;  2OX0 A;  3WXP A;  1UYP A;  3E6C C;  2J7M A;  2ZGL A;  4AWD A;  2C5D A;  2D6K A;  2QDN A;  1FXZ A;  4FCA A;  1YQ6 A;  3ZLI A;  1AR9 2;  4ASM B;  3LF7 A;  2ZEW A;  2Q1Z B;  4FPE A;  5BXX A;  1H4H A;  3DYP A;  1WZX A;  3MUY 1;  2R07 1;  4MSV A;  4AHY A;  4YW4 A;  1WGP A;  2EIE A;  2XVL A;  3LDK A;  1TME 3;  3I3Q A;  3VN4 A;  4Q4W 2;  5FIX A;  4CP0 A;  2P6H A;  5EXO A;  3BTY A;  4JGY C;  4Y20 A;  2H0V A;  3GM8 A;  4YGD A;  5FJK A;  4BU2 A;  3I49 A;  3H3U A;  2XJR A;  2KXL A;  4NHL A;  4Z8B A;  1CAW B;  4UFI A;  4Y26 A;  4YWA A;  3ZXG A;  2WFF 1;  2IVI B;  2WLP A;  4F7Z A;  5A33 B;  2R07 2;  5L73 A;  4OI0 A;  4NO4 A;  3DYM A;  1GOH A;  2GSY A;  3HN3 A;  3VHN A;  1DYP A;  1V9U 1;  3NNG A;  4AFB A;  1OUX A;  4CDQ A;  4YGC A;  1DGL A;  2DCK A;  5DAB A;  4AEM A;  2EAA A;  3PVO A;  2X8K A;  3ACI A;  2BU9 A;  2WFF 2;  4A7K A;  1GP5 A;  1FX5 A;  4QX8 A;  2V5D A;  1WD4 A;  4HK8 A;  1B35 A;  1HB1 A;  4XVH A;  1ZNP A;  3DXT A;  1UYZ A;  1PMH X;  1V9U 2;  4Z1V A;  5HCH A;  5FY9 A;  4UW4 A;  4ATF A;  5C4W B;  1G86 A;  2B7Y A;  2QZ2 A;  4M0H A;  4XAC A;  3BTA A;  3EXU A;  3N3H A;  4ZY9 A;  1D0G A;  1R64 A;  2QQK A;  3NL1 A;  3ZXD A;  1CPM A;  1LOE A;  5BNO B;  1GU3 A;  4OVE A;  2WWU A;  4MET A;  3CU7 A;  4NID A;  1BCX A;  1UMH A;  4IV3 A;  4P9Y A;  2RE9 A;  1GZT A;  2CGP A;  4S2D A;  1W6Q A;  5F37 A;  1XE8 A;  2BW8 A;  1VLN A;  1PX3 A;  4JVA A;  4Y33 A;  2KD7 A;  3AZV A;  5C7G A;  1YRZ A;  2WS9 3;  2JDA A;  1XYP A;  4OLL A;  1NA1 B;  5KC6 A;  1XOY A;  5LBF A;  3LEI A;  3MW2 A;  4FAG A;  1HQW A;  3M1H A;  3MF6 A;  2B5H A;  2WQ4 A;  3QLQ A;  4QM8 A;  5APA A;  1WW5 A;  3VKL A;  1JYW A;  4CCN A;  1F9K A;  3PIG A;  1GP6 A;  4LO5 B;  2W3J A;  5IFP A;  1NCR B;  4DUW A;  1DZQ A;  4XF1 A;  2UWC A;  4KH9 A;  4YAR A;  4Z92 B;  2I45 A;  3U75 A;  5FYH A;  1JU4 A;  1V6I A;  5A70 A;  3LCP A;  3WG3 A;  4BLI A;  1M06 G;  4CU9 A;  2NP0 A;  4ATE A;  4QQH A;  3RMX A;  3INA A;  2ARC A;  4DXZ A;  4GKY A;  5CBL A;  2D44 A;  1AL2 1;  1MQT C;  1CAX B;  2VBB A;  2R7E B;  2Z79 A;  2B4K A;  3S5A A;  2OZ6 A;  2YG0 A;  1LB2 A;  4D7Y A;  5I93 A;  5A7W A;  2Y6L A;  1LOC A;  4AHX A;  1JZ8 A;  1UYY A;  3AP4 A;  1SG3 A;  1SPP B;  1UZW A;  2GZW A;  2WT2 A;  3RRD A;  4CEY B;  2JDU A;  4CCM A;  3GAL A;  1SAC A;  1HKD A;  5ACA 3;  1CX4 A;  1AL2 2;  3FUQ A;  2YC4 A;  4K8F A;  2HWF 3;  4AI0 A;  3TEW A;  3K2O A;  4EV0 A;  3OGV A;  2QQM A;  1ND3 B;  4IE7 A;  3PVE A;  2XVK A;  4JKM A;  2QDR A;  4ES9 A;  3CIH A;  2GU9 A;  1HRV 1;  3DPR C;  1LU1 A;  1U5I A;  2WZP P;  3C7F A;  4K9S A;  3K51 A;  1EYB A;  4D7T A;  4B4Q A;  2GND A;  2DYC A;  3PUH A;  3S0M A;  3O1O A;  4BPZ A;  1OLQ A;  5D8A A;  1NQD A;  4B7E A;  1VBD 3;  2JDZ A;  1LU2 A;  4YLZ A;  3MO4 A;  4LBO A;  1MS4 A;  3N7K A;  1QIQ A;  5JPN B;  2JIC A;  3UV9 A;  4BCU A;  1HRV 2;  1XU1 A;  1IPS A;  2P34 A;  3KQR A;  2DF7 A;  2VZQ A;  5EJZ B;  3S7E A;  4O9E A;  1LEN A;  1MR5 A;  1VAM A;  3AM2 A;  5D2A A;  4LO7 A;  1YFU A;  4KWU A;  1RMU 3;  3AKQ A;  4LO8 A;  3ZYH A;  2ZAA A;  1W6N A;  2BVB A;  2QKD A;  2Z5W A;  3D3A A;  3MW4 A;  4HN0 A;  3ES4 A;  4LUL A;  4UI9 L;  4X8N A;  5CA6 A;  1F8V A;  1FYU A;  2PHR A;  4LK6 A;  5A3L A;  2JDM A;  3LA7 A;  4TTG A;  3P3P A;  2VQU A;  1JYX A;  1ZBA 3;  4WVM A;  1X82 A;  4Y20 B;  3CNA A;  4FAH A;  3SEP A;  1UMZ A;  2CAU A;  5A6Q A;  2FHR A;  4YVW A;  3W9A A;  2Y6H A;  2ZGN A;  4COU A;  1RUH 1;  3JUU A;  1BVV A;  1L7R A;  1VMH A;  3RYP A;  1K3I A;  1UKR A;  5I0T A;  1RUC 3;  1XC6 A;  1PK6 B;  2FMY A;  2RM2 3;  2FMD A;  3E6B A;  3S30 A;  3ZFF C;  1KEX A;  3GDB A;  1QU0 A;  3AB0 A;  3J7M A;  3NJV A;  3J7L A;  3J8F 1;  3WDU A;  4CDQ B;  1J3R A;  2J1U A;  3WP5 A;  1XB9 A;  1DCS A;  4UBG A;  3ZXE A;  4QPI C;  5L7O C;  3C7H A;  1RUH 2;  2RDS A;  4JGZ B;  1U5Z A;  5JUV A;  1ZZ7 A;  3POJ A;  1B35 B;  4MYE A;  4JDM A;  2QNK A;  2ZGP A;  4N53 A;  5ABJ B;  1LOF C;  5LY2 A;  2JEM A;  3U0Z A;  5BNP C;  4HKW A;  3J8F 2;  4LOR A;  1D2Q A;  4YVS A;  2PTM A;  3FHQ A;  2A6Y A;  4OUM A;  5FYI A;  1TME 1;  2W5F A;  1LJ7 A;  1SDD B;  4RS5 C;  2XB6 C;  1TMF 3;  5K9Y A;  3ZXA C;  1Q8O A;  3KS7 A;  2WO2 A;  4J1X A;  2ZHN A;  4TLG A;  4B1L A;  5I8Y A;  5JOZ A;  5LA1 A;  1BLZ A;  5C71 A;  4QGN A;  1VMF A;  4K21 A;  4EWA A;  1KFU L;  1N1V A;  5HV0 A;  3MGU A;  1IS6 A;  2XUE A;  4I0B A;  4P14 A;  1TME 2;  4P9I A;  4YW2 A;  1W28 A;  2IZW A;  1NYW A;  3IMN A;  1W6O A;  1KDM A;  3FC0 A;  1LNS A;  2Z42 A;  1UAI A;  1JI6 A;  4JHT A;  3PNA A;  1W8H A;  5JZG A;  1K45 A;  4NIH A;  1IOA A;  1H1A A;  3AVS A;  4MXW A;  1HXS 3;  2K0G A;  2VZO A;  4OZO A;  4RGG A;  2ET1 A;  2PAE A;  3ME2 A;  1GV9 A;  4Y1X A;  1O5L A;  2J1V A;  4JGY A;  1GKB A;  2AH2 A;  3ZN6 A;  4XF3 A;  3W59 A;  4LKE A;  3FLT A;  4I01 A;  4LBQ A;  5FY7 A;  2BPA 2;  5HI0 A;  4RYD A;  2PLV 3;  1A78 A;  1W03 A;  5T50 A;  1BK1 A;  3ZSL A;  4CCJ A;  3VZL A;  4NUB A;  5GLT A;  2JE8 A;  4W65 A;  4IGQ A;  2WIN B;  3RYK A;  1HN0 A;  2HKX A;  5GM0 A;  2NQY A;  3H7J A;  1H8T C;  3BOD A;  4DZG A;  1PM4 A;  3OCP A;  4RD7 A;  4YW3 A;  4CPB D;  3AL5 A;  5EQU A;  1HJF A;  3AXD A;  5FV3 A;  5B4X A;  3M7A A;  4ZXE A;  1DP0 A;  2OXB A;  4HN1 A;  2BOJ A;  3T3Y A;  3ORJ A;  2RR1 3;  3R05 A;  5FQ0 B;  2VMH A;  4AFA A;  1JW6 A;  3CMG A;  1LHV A;  1QH6 A;  3C7O A;  3DEM A;  5FXX A;  1MS8 A;  1RIT A;  2VNV A;  5FBJ A;  2SBA A;  3JQX A;  4I0W B;  2D5H A;  4TYS A;  3APB A;  3UJO A;  2DVF A;  3HVD A;  4CVU A;  2XQX A;  4LPL A;  5J48 A;  4BZ4 A;  4PF5 A;  1AYN 1;  4KNC A;  3B01 A;  5D8A B;  2ZGR A;  2K46 A;  4URT A;  2EA7 A;  4IEO A;  1NLR A;  2W2I A;  4NRP A;  4OI1 A;  1OBN A;  3VKF C;  2JIJ A;  4UWD A;  4CCC A;  4XQ4 A;  2BVV A;  2W92 A;  4ISQ A;  3VD3 A;  2PHW A;  2R0F A;  2E6V A;  1AYM 3;  1AYN 2;  3RPQ A;  1LGB A;  2E31 A;  2YU1 A;  4HL0 A;  1FNY A;  2HWB 3;  4XHX A;  3OJB A;  1KRI A;  2AEN A;  2W47 A;  1W6N B;  2VW1 A;  2ZGQ A;  4R8H A;  5AFB A;  2NZ9 A;  3A22 A;  5ACA 1;  3CDZ B;  2MHF A;  4GD4 A;  4JTO A;  3RJ2 X;  2CGO A;  1QH7 A;  4A6S A;  4XIL A;  3OYW A;  5C3O A;  3LB9 A;  4WVM B;  4BK5 A;  4HMZ A;  1OQ1 A;  5C8C A;  1HB2 A;  1W90 A;  3GBG A;  2WSU A;  4KBB A;  4G9S B;  2D3R A;  3JB8 A;  1ND2 A;  2BNM A;  4YVW B;  4AVS A;  5A1A A;  3WG1 A;  4YM1 A;  5ACA 2;  4CEW C;  1VB2 A;  3B69 A;  5KHI A;  2E26 A;  1MQT A;  5DDJ 3;  1VBD 1;  4UFL A;  4LUM A;  2JEN A;  1Z7S 1;  4AQ2 A;  3FZ3 A;  3OGG A;  3OBR A;  1ZZC A;  4HPK B;  2YV8 A;  4RN5 A;  3ZXK A;  1NQJ A;  5F6L B;  1ODM A;  2VMC A;  5T5J A;  3USS A;  5T55 A;  4D0Q A;  3OY8 A;  4CDW C;  1O4Z A;  1MAC A;  1VBD 2;  2HLE A;  1DHK B;  3AYE A;  5LEJ A;  4N53 B;  1RMU 1;  4L9B A;  1Z7S 2;  1K12 A;  1E5I A;  5T52 A;  1RUN A;  1W8U A;  3H50 A;  1BXH A;  2IWG B;  2DV9 A;  3DPR A;  2YUE A;  5TSW A;  3NRU A;  4JDN A;  4ORF A;  1JU3 A;  4JDO A;  1T2X A;  4CTE A;  1ZBA 1;  2DFC A;  2ENR A;  1PGL 1;  1UX7 A;  5FYM A;  1RMU 2;  2BRT A;  4YG0 A;  2BEO A;  1C5I A;  2AAC A;  1GZC A;  1L3J A;  1HV0 A;  1F5J A;  3I3D A;  2RMU 1;  2JD9 A;  2VBP A;  3SCG A;  1RGS A;  2E51 A;  4URA A;  4JX0 A;  4CDU A;  4QXH A;  1RUC 1;  4IEV A;  1ZBA 2;  2RM2 1;  3DF0 A;  3UET A;  3LOI A;  1PGL 2;  4XJ9 A;  2DUR A;  3O5S A;  4J25 A;  4MHU A;  2B42 B;  5T5O A;  1GLH A;  1TNF A;  1QDO A;  1H1I A;  2RMU 2;  3E5Q A;  4MXW B;  3S57 A;  3V0A A;  2EXH A;  2VCB A;  1D0H A;  4XJZ A;  1OUR A;  1RUC 2;  2CNA A;  2WZE A;  1FPN 3;  3SNM A;  2RM2 2;  4P9J A;  1YI9 A;  3JBG 3;  3U4S A;  4JGY B;  3ZN6 B;  1AXZ A;  1GMM A;  3GNE A;  4LBQ B;  1UY1 A;  3IM0 A;  4YG3 A;  5F5I A;  4K7J A;  2Q8C A;  4JKL A;  1YXW A;  1LES A;  3H7Y A;  4Q4X 3;  4XFB A;  5CFC C;  4DRR A;  5LZ6 A;  3VDB A;  2XJQ A;  4Q8L A;  3WQB A;  1S0F A;  3WW1 A;  3CQO A;  3MPB A;  1H2L A;  1NZI A;  4N90 A;  1S0J A;  3RZM A;  2CHH A;  3WCS A;  4PQQ A;  3WDV A;  1LOG A;  2GP3 A;  4ZS2 A;  3GJA A;  4YM0 A;  5A1F A;  4QPI A;  4DUV A;  5KXB A;  5L7O A;  4V2W A;  1O59 A;  2J1A A;  3E97 A;  1PNF A;  3J7H A;  3HQR A;  2GC0 A;  1GIC A;  4QHO A;  2BP6 A;  4RGA A;  2BJS A;  5HCA A;  1LOF A;  2P17 A;  2UY8 A;  4MGS A;  3WF0 A;  4KI5 M;  3Q8F A;  1S4C A;  4YZ3 A;  5BNP A;  1HXS 1;  4RQP C;  3HD8 B;  3MIC A;  2A73 B;  1C3H A;  4Q4V 1;  4RA0 A;  1BZW A;  2VNO A;  4UFH A;  1D2S A;  1LHN A;  2MNG A;  4XBN A;  5JIA A;  4CDX C;  2NMN A;  1UY0 A;  1UPI A;  2WBK A;  4D7S A;  1IG3 A;  1HXS 2;  2VW2 A;  2PLV 1;  4LR4 A;  1QF3 A;  3F95 A;  3GZU C;  3K46 A;  3MIB A;  2VZT A;  1CGP A;  2B45 X;  4Q4V 2;  5DZG A;  1HN1 A;  5FUI A;  3VLB B;  1D4V B;  1NLQ A;  1HQL A;  2X10 A;  1GNY A;  4E8D A;  2PLV 2;  2WNV C;  1YO8 A;  2JDP A;  2XKP A;  2AEY A;  4LXL A;  3ILF A;  3VD7 A;  4M00 A;  4CCL A;  1C5H A;  4YW7 A;  1MS1 A;  2FD8 A;  1RXF A;  2D6O X;  3RS6 A;  1FV2 A;  4K1Z A;  5C3S A;  5L36 A;  5C9A C;  3ZYP A;  3OYW B;  3H1W A;  3KHB A;  1ULE A;  3ASI A;  4KQ7 A;  1ASJ 3;  3EJK A;  5FZF A;  4OQ9 A;  5K8S A;  2BFU L;  4KGQ A;  2D40 A;  1W8N A;  3K4A A;  2VQ0 A;  3HQX A;  1ND2 B;  4HFS A;  2GNM A;  1WCK A;  2D3P A;  4XQW A;  5EYX A;  5J36 A;  3MFC A;  1DQ5 A;  4KU7 A;  2TBV A;  3ENR A;  4E4H A;  4IV1 C;  1MQT B;  1Q3E A;  3BTX A;  4OCT A;  1CX1 A;  1ZRF A;  5GZC A;  2ETE A;  3A4U A;  3FWE A;  4F8A A;  4CZS A;  1NLS A;  1O8P A;  1XND A;  3E6D A;  2PMW B;  2DUQ A;  1ZRR A;  4LHS A;  2E7A A;  1H8T A;  5FPB A;  1AYM 1;  2P3I A;  2ZA9 A;  1D4M 1;  3OY8 B;  3VBS C;  4YZ1 A;  5GLZ A;  1UY2 A;  3O0W A;  2HWB 1;  2NYY A;  4LMF A;  1OI6 A;  3PUS A;  4LIV A;  2D6M A;  5LAS A;  1ACC A;  2D6P A;  4XYX A;  4S2G A;  1WBL A;  2W87 A;  3N7L A;  3DPR B;  3WDX A;  4EJR A;  3N9L A;  3FFZ A;  3QBQ A;  1AYM 2;  3AYC A;  3PMS A;  1D4M 2;  4TLF A;  5JMC A;  1QJU 3;  3OPT A;  4P5Y A;  3VBH C;  1L7L A;  2BGO A;  2EXK A;  1HB3 A;  2TNF A;  2HWB 2;  2VXR A;  2WII B;  1XE7 A;  3ZDS A;  1JMU B;  1QMJ A;  4CP2 A;  2SLI A;  4UW3 A;  3UT0 A;  2OUH A;  2AUY A;  2OPW A;  3IDB B;  2BGP A;  3DN7 A;  5F6K A;  1UZY A;  5DDJ 1;  3T0B A;  2UUR A;  4XUT A;  4BMB A;  1JH5 A;  2NN8 A;  1ZZ9 A;  4B29 A;  1XXN A;  1YFX A;  3H8X A;  4ONU A;  1X9T A;  4GH4 C;  5K4L A;  1X33 A;  2VVE A;  2AC1 A;  4CE8 A;  2Y26 A;  4NAO A;  1Y9G A;  1OA3 A;  2FCV A;  3WDT A;  3ZVX A;  4KU8 A;  4DIN B;  5J3U A;  3V0A B;  3K77 A;  1WMD A;  5DDJ 2;  1KGY A;  4GAZ A;  4RL7 A;  2PN5 A;  4XCA A;  3LA3 A;  3MV1 1;  1ENQ A;  5G04 L;  5B2G B;  3V65 A;  4OI4 A;  2MEV 3;  4DNY A;  1KD7 A;  2GH8 A;  4PLM A;  1RUG 3;  4FPY A;  5EHD A;  4AFM A;  2JD4 A;  4CEW A;  1RUI 1;  1Y3T A;  2GH2 A;  4A45 A;  4A44 A;  4CU7 A;  4NMI A;  5GAL A;  3NKG A;  4MLO A;  5EIY B;  1SZB A;  4XET A;  3ZFE C;  2VUD A;  5A3M A;  2WC2 A;  1DGW X;  4XDP A;  3ZFF B;  2PHF A;  1GQP A;  3C8X A;  1JS9 A;  3J7N A;  1DLC A;  1E5R A;  2FQP A;  4PJY A;  1NZC A;  4QHB A;  4UFM A;  5FZ6 A;  2VMG A;  4EQV A;  4CU8 A;  4QX5 A;  3BCW A;  4NPL A;  1JYT A;  4QPI B;  1UZ0 A;  4DS0 A;  5L7O B;  2YHJ A;  4XZP A;  4CDW A;  2ZX1 A;  1AX0 A;  4XOG A;  1X50 A;  3B3Q E;  3ILN A;  4LJH A;  1CZS A;  5IVB A;  1RUF 3;  2ZGM A;  3QD6 A;  3MW3 A;  4CCD A;  5BNP B;  4Q0P A;  2W1W A;  1NUK A;  3AFK A;  2VU9 A;  4FP2 A;  4Q0V A;  1GWK A;  4GA9 A;  4JCK A;  2A3X A;  4DXS A;  2W39 A;  5FPX A;  2A3W A;  2RV9 A;  3PDQ A;  1FPN 1;  3H42 B;  3RWN A;  1LEC A;  4MVT A;  4RS5 B;  4PLN A;  1UCX A;  3JBG 1;  1KJR A;  3SCH A;  2OYZ A;  3TRS B;  3WIN E;  2DVB A;  5LW9 A;  1VBE 3;  1RUO A;  4Q29 A;  4BHP A;  1G9C A;  1GNZ A;  4W6X A;  2EVX A;  4Q4X 1;  1KS5 A;  3WDY A;  5K7P A;  3LEG A;  4WZF A;  1WCS A;  3M8L A;  5GJ6 A;  5A32 A;  1OA4 A;  1E57 A;  5IK4 A;  1FPN 2;  1H0B A;  5A6Y A;  1QJY 3;  4HKL A;  5BUV A;  3JBG 2;  4BME A;  3NAP C;  4P9L A;  3PJY A;  2B8M A;  5FRE A;  4XUR A;  3POE A;  4YNI A;  4M3C E;  2ZGT A;  3AKP A;  5JOW A;  4Q4X 2;  5F8P A;  2FDH A;  3EHK A;  4GAL A;  2WRA A;  3KV4 A;  1JYI A;  5IWF A;  4N7I A;  1SMV A;  5JI7 A;  4ZZ8 A;  3RFR A;  4XMI A;  2DUO A;  4D94 A;  2VQA A;  1I3H A;  5EWS A;  3SH5 A;  4BXF A;  3IB3 A;  3JCI A;  1DZT A;  1GQG A;  2VC9 A;  1CAX A;  2WLQ A;  5E6H A;  2YB7 A;  1PZ9 A;  4RFR B;  4XIK A;  2EIC A;  4W6Y A;  1GFF 2;  2R30 A;  1HRI 3;  5FY1 A;  3ZIW A;  5F7U A;  3BUC A;  3HN1 A;  5BV6 A;  5LCW L;  1WLD A;  2BWC A;  4QWN A;  2WSV A;  1NKG A;  1PO1 3;  4CEY A;  2R06 3;  3KF5 A;  3B93 A;  1R1A 3;  1UXX X;  4L99 A;  4TN7 A;  2A6Z A;  4Y4R A;  2VCA A;  1H8T B;  2XHK A;  3NQH A;  3U4X A;  5FMB A;  1PIV 3;  2R16 A;  1BVP 1;  4FTE A;  3OOX A;  1NY7 1;  4G3Y C;  5FKC A;  4BIS A;  4Q8K A;  4RQP A;  5CKM A;  4IXL A;  2R1D A;  1A8D A;  1OVS A;  4XTP A;  4OUL A;  4DRV A;  4XC9 A;  4XQD A;  1RB8 G;  1CN1 A;  3SEE A;  1U0A A;  4CDX A;  5ANN A;  4MGI E;  4NPM A;  4HSL A;  3T08 A;  1GNH A;  5F3C A;  3LSE A;  1NY7 2;  1ASJ 1;  3WW2 A;  3X29 B;  3H8O A;  3O1S A;  5FZ9 A;  2RHP A;  2G1M A;  3POY A;  4ITC A;  1SBD A;  4HT1 T;  4PCR A;  4FBF A;  2A70 A;  4L11 A;  2R1B A;  3ACL A;  5JOX A;  3THC A;  1W9Y A;  2HWC 3;  3T4H B;  1VMJ A;  1ASJ 2;  2N7G A;  2VPV A;  2UYB A;  4BQ1 A;  1UYX A;  4LBK A;  1RHI 1;  5SV8 A;  3VHO A;  1JHN A;  5FYU A;  5LBC A;  1JUH A;  3ZFG C;  1WA4 A;  3LSD A;  4AGV A;  3GZT B;  5C70 A;  2W1Q A;  4L8Q A;  4M4R A;  5C9A A;  5DN2 A;  4AGR A;  1UD1 A;  3VKM A;  4N9I A;  4OUS A;  1OOP A;  1RHI 2;  2Y8K A;  2VAU A;  4I02 A;  3NST A;  1AX1 A;  2CV6 A;  3MIH A;  1TQ5 A;  5KHH A;  4LEJ A;  5IAT A;  3CBN A;  2WAA A;  4CEW B;  3DUI A;  1SLA A;  2ZAB A;  3IT8 A;  1PK6 A;  1QJU 1;  3POW A;  1Y9Q A;  3AYA A;  5FYC A;  3EQE A;  2NMO A;  1JZ3 A;  4NWV A;  3V0B A;  2KR2 A;  1N3Q A;  2CYF A;  2GNT A;  3RZK A;  4N43 A;  5FP8 A;  5C3P A;  1STM A;  1S0B A;  5BY5 A;  2OZJ A;  4JGZ A;  4LIU A;  4BQ3 A;  1VIW B;  2EXI A;  2VY0 A;  3ZYR A;  1QJU 2;  1R09 3;  1WLW A;  3VBS A;  4CDW B;  5ABJ A;  5E89 A;  2WZR 3;  3CZU A;  5JSR A;  5G05 L;  1WME A;  3DV8 A;  3K4D A;  3JB4 C;  4BIO A;  5CG8 A;  3GXU A;  3I2D A;  2VNR A;  5C3Q A;  1UW8 A;  1W9T A;  5DAW A;  2DCT A;  4YW6 A;  4AEJ A;  4FPL A;  3L9J T;  5F39 A;  1WLT A;  5DZE A;  4E4S A;  3OUH A;  1BQP A;  4DPN A;  5I0R A;  4LHL A;  5JXI A;  1E5S A;  1O7F A;  1AHS A;  2NM1 A;  5CIR A;  3VBH A;  2RG4 A;  3GF6 A;  4LHN A;  5IAV A;  3WOG A;  5FP4 A;  5BPX A;  2ZS6 B;  1O3S A;  1JZ5 A;  4I09 A;  2L9L A;  5FYZ A;  4KL1 A;  3UGG A;  3HNB M;  4AXO A;  3VBO C;  4B4R A;  1XRU A;  5FYV A;  5A32 B;  3AKR A;  4HLT A;  5KHG A;  3TYJ A;  2WKK A;  3KV5 A;  4R9B A;  4AED C;  1TEI A;  1URX A;  3NV4 A;  4ASL A;  5LK7 B;  1RUG 2;  3M2M A;  3ZYB A;  3I8T A;  5A6X A;  3C3V A;  4GH4 A;  1FOD 3;  2P1B A;  3FN9 A;  2UY9 A;  1S2B A;  4LBN A;  3URF A;  1H2M A;  4XIO A;  1OVP A;  2JX9 A;  3WLU A;  1IKP A;  2DVD A;  2YC0 A;  5F2S A;  1RUF 1;  3UYJ A;  3WNL A;  2TUN A;  1OQE A;  1ULO A;  4OQ8 A;  1C8N A;  3LWC A;  1WMX A;  3PUA A;  2ZEY A;  3AMN A;  3WT3 A;  4LO4 B;  2O8O A;  1POV 0;  3I54 A;  1Y4W A;  4YRD A;  5FLI A;  2XH6 A;  5CFC B;  2XWJ B;  2ZJC A;  4HK9 A;  1TVG A;  4QXK A;  5A7S A;  4M4P A;  1RUF 2;  1VBE 1;  3VZO A;  4Z07 A;  1HV1 A;  2YFZ A;  1JXN A;  2FDJ A;  2IC1 A;  2VME A;  1OC1 A;  1OH4 A;  1N1T A;  3UL2 A;  4AHZ A;  3AP7 A;  1QEX A;  5D1I A;  1QJY 1;  1ULD A;  1EUT A;  4FOW A;  3CJX A;  1AR7 3;  2CWS A;  2W52 A;  1SFN A;  4KG8 A;  4LUK A;  1VBE 2;  1QJF A;  5FQ0 A;  4LLO A;  4FFI A;  1XNA A;  2A7A A;  4HZF A;  1TE1 B;  2JG8 A;  3W21 A;  5IVC A;  3RZG A;  5L9B A;  4QX3 A;  1A3K A;  1QOT A;  1W8W A;  4RQP B;  4QM9 A;  4ARY A;  3ZSJ A;  1LOA A;  2PYT A;  3MBW A;  3VD5 A;  5A7N A;  2X29 A;  1QJY 2;  2JE7 A;  5CFD C;  4CDX B;  2O1Q A;  1S0G A;  1IS3 A;  5DG1 A;  4MHR A;  5FUN A;  3KCX A;  2AYH A;  3UES A;  4U36 A;  5T3N A;  5IJR A;  5FFO C;  2RJ2 A;  3CO2 A;  2DFB A;  1KS4 A;  3LPG A;  3NV3 A;  2Q5T A;  4QU1 A;  1EP0 A;  3Q8B A;  4Q2F A;  3LAG A;  3ZN4 A;  3LKJ A;  1HRI 1;  1QXJ A;  1US2 A;  3NAP A;  4QD2 A;  5AVA A;  1FMD 3;  2VUJ A;  4FI9 A;  4O9G A;  5H9R A;  5HPO A;  1ZYB A;  1PO1 1;  1ODN A;  5FYT A;  2CTV A;  2Q0A A;  2E7Q A;  5FMO S;  4N8M A;  2WNV B;  1R1A 1;  5FO8 B;  1VBC 3;  5FZC A;  5JIU A;  3GGL A;  2VMF A;  1YI7 A;  3ELN A;  4JQT A;  4LBJ A;  1P8J A;  2OW4 A;  5JDB A;  5F3E A;  3UKN A;  1PIV 1;  1HRI 2;  2V09 A;  2P3J A;  2XOM A;  1Q56 A;  1JOD A;  5C9A B;  4FOQ A;  1LHU A;  1NXM A;  4QX7 A;  5BYN A;  1IPJ A;  1PO1 2;  4QGM A;  2R06 2;  2YC2 A;  4AI1 A;  1OOP B;  1R1A 2;  4XDO A;  4BQW A;  1W6P A;  4LKD A;  4QDR A;  3IN9 A;  3ZXJ A;  1DU3 D;  2ERF A;  2BYV E;  2G9G A;  3KCY A;  3MLK A;  4R9D A;  3K75 B;  3ZYG A;  1PIV 2;  2E7T A;  3ACH A;  2XL9 A;  4JC1 A;  4LQR A;  1ST8 A;  3AP5 A;  1CAV A;  2FDI A;  3EBR A;  1SCS A;  2VOX A;  4RHV 3;  3V0B B;  4HPK A;  1UIJ A;  1W3X A;  2J22 A;  2Q30 A;  1DQ2 A;  4N43 B;  3EO6 A;  2ZHL A;  2Y6J A;  3VZN A;  3BKZ A;  3AC0 A;  1W8Z A;  4GUL A;  4GXL A;  2HWC 1;  2HWE 3;  3VBS B;  4QKF A;  2FDK A;  3MF9 A;  5A3T A;  1AL0 G;  1M4W A;  4PLO A;  5BNN A;  1AVB A;  3R6S A;  3OPZ A;  1IS5 A;  1YFW A;  1H30 A;  1DGR A;  4NOT A;  2Q4S A;  5GZF A;  1WD3 A;  3UGF A;  2QJV A;  4EZ4 A;  2HWC 2;  3ZKU A;  2PAK A;  3LD8 A;  2Y34 A;  5DAV A;  3VBH B;  4FSJ A;  1S0C A;  2X5I A;  1K5M C;  5FXV A;  1HQN A;  4IES A;  2GNB A;  1QOS A;  1ZBE 3;  4UBH A;  3WV6 A;  1C4R A;  2VNG A;  1TZO A;  4HVR A;  1I6X A;  2OQ6 A;  2YY1 A;  3JD7 3;  2VZ3 A;  1DIW A;  5FZL A;  2RDR A;  4ZXK A;  3R4U A;  3NKT A;  3RI8 A;  4GMP 3;  3VBR C;  4Q0S A;  3WHU A;  4PIX A;  1OUS A;  4Y1Z A;  1UY4 A;  4GH4 B;  2IXK A;  3ZFG A;  4UXA A;  4X8P A;  5EJ3 A;  4YGB A;  4IDZ A;  4KWL A;  2VZS A;  2WZR 1;  3LQC A;  2EAL A;  2FCU A;  4OMC A;  3THP A;  1CAU A;  1EAH 3;  3MIG A;  2BOI A;  3VV1 A;  1WMF A;  2PHD A;  3IAQ A;  3CLP A;  3T2Q A;  1IQA A;  2OII A;  3B9C A;  3RSJ A;  1H9P A;  2H6C A;  1ZVF A;  4DEV A;  2Q1M A;  3WD5 A;  2XJT A;  4EN8 B;  1OLM E;  2WZR 2;  3HR9 A;  2WT0 A;  1UL9 A;  3NNL A;  4Q27 A;  3O14 A;  3ZFE B;  3ZMO A;  4PBO A;  3I2H A;  3BOW A;  3TAY A;  2BWA A;  1AZD A;  3FHA A;  2WS9 1;  4AGG A;  3T2P A;  5FTT C;  3H0O A;  2D3S A;  3ZIX A;  2WYS A;  3EB7 A;  1TNR A;  2YU2 A;  3HAG A;  2YPD A;  3A0K A;  3RMY A;  1ZRI A;  4BIF A;  4YFZ A;  2HYK A;  1Y7B A;  2JB4 A;  4AVA A;  3O1T A;  2JG8 B;  4ZZ5 A;  5FZO A;  1W9W A;  3WQ0 A;  2WS9 2;  5KR7 A;  3WP6 A;  5IYY A;  3ZXL A;  4QT6 A;  3ZDV A;  4D6R A;  4C8D A;  1BMV 1;  4XHB A;  4IER A;  2EXJ A;  4OYU A;  4YW1 A;  4AK3 A;  3I7D A;  3LGR A;  1EV1 3;  1VBB 3;  3MIE A;  1AJO A;  3PTY A;  3T4V A;  3U1X A;  3GJB A;  1RUD 3;  1CJD A;  5JR7 B;  4LK7 A;  1YJL A;  3VD4 A;  2QQV A;  3M3O A;  3OEB A;  1BMV 2;  1MEC 3;  2Y60 A;  2YYO A;  3SXW A;  4XAB A;  3NAP B;  3ECQ A;  3WDW A;  4AED A;  2FZ2 A;  4HKO A;  2JG9 C;  2A6W A;  4NIG A;  3O7O A;  3WG2 A;  2WA4 A;  4LKS A;  4P02 B;  4NN0 A;  2HWF 1;  5DAX A;  1C28 A;  1US3 A;  1AR7 1;  2GN7 A;  5FZG A;  4UT5 A;  3VL9 A;  4A7Z A;  3GCX A;  4ZS3 A;  1JHJ A;  1T6G C;  4AI9 A;  2XML A;  3ITQ A;  1UOG A;  1W6P B;  2Q8D A;  2HWF 2;  2RS1 3;  1AR7 2;  3QOP A;  5KXE A;  3AKT A;  3N9O A;  3IDC B;  4OHZ A;  1CAV B;  3B94 A;  4MZU A;  1XE0 A;  1RC6 A;  1GZW A;  3KZ4 C;  3UGH A;  3VZK A;  3RYR A;  1LTE A;  4TWT A;  3POB A;  1JOP A;  4CUC A;  3CEW A;  2E53 A;  1YYN A;  4LA3 A;  5LA0 A;  4QGL A;  2ZPX A;  1I1E A;  3O0X A;  1SLB A;  1WUV A;  1OF4 A;  4WV8 A;  2BQP A;  1W2N A;  1FMD 1;  4QDQ A;  5BNN B;  2PXJ A;  1S55 A;  4FP3 A;  1QOO A;  2BUK A;  2RS5 3;  1UO9 A;  1VBC 1;  5FZA A;  3CJI C;  5LB6 A;  4QX0 A;  2OVU A;  3AP9 A;  5FDB A;  5CFD A;  1JZ2 A;  4MGK E;  4FT8 A;  2AR6 A;  4IEW A;  4YZ4 A;  1FMD 2;  3E5X A;  4XZU G;  3LE0 A;  2X5I B;  3LEM A;  5EP9 A;  1OHF A;  1DF0 A;  1Q8Q A;  5T54 A;  1VBC 2;  5FRA A;  3LOB A;  1IPK A;  4QXC A;  4LE3 A;  3LZZ A;  2P5B A;  5C4W C;  4NHM A;  5FLJ A;  3OGJ A;  5HCF A;  1GOG A;  3GZA A;  1UOJ A;  2WNO A;  4HVO A;  2IFW A;  2JDN A;  1PO2 3;  5BNO C;  3GBF A;  4PIZ A;  1W2A X;  1W0P A;  3WNX A;  1PGW 1;  5EPA A;  1O91 A;  2PQQ A;  4HSJ A;  4QX1 A;  5IHR A;  4NHY A;  4A4A A;  3OUJ A;  3ZFG B;  1BBT 3;  3KB5 A;  1YQ8 A;  2HWE 1;  4XFG A;  1BHG A;  4GMP 0;  2QQO A;  4GWM A;  1BJQ A;  3SLI A;  4AI2 A;  5JSO A;  1CAU B;  1VBA 3;  2Y64 A;  1G7Y A;  1PGW 2;  2YGM A;  5JAX A;  1V70 A;  2RJK A;  3ZMN A;  3P1I A;  4I2O A;  2HWE 2;  1TMF 1;  1W04 A;  1LHO A;  3KV6 A;  2XJV A;  4GKX A;  4M3C A;  1ZRC A;  2ADE A;  2CL2 A;  2OUJ A;  1MS5 A;  3NJZ A;  5FZ8 A;  3ZFF A;  3FL7 A;  2E63 A;  3I59 A;  5F5A A;  3UKT A;  2HWD 3;  3HJR A;  5KHK A;  4AI3 A;  3MV0 1;  4E2S A;  3JD7 1;  3I3M A;  1TMF 2;  5KHJ A;  2PFW A;  1QKQ A;  4GMP 1;  4HET A;  4J6G A;  2CSG A;  2QVS B;  3I2J A;  3KSC A;  3Q8E A;  3AZZ A;  4YM2 A;  4XFH A;  5L9R A;  1SBE A;  4F83 A;  2G9Z A;  5FZH A;  1QJE A;  1E5H A;  2VJX A;  1EPW A;  1AR8 3;  1UOB A;  2ZAH A;  4LOT A;  5FZO B;  4PHZ A;  1PVX A;  5FAX A;  3ZPY A;  3D0S A;  3JD7 2;  2VE1 A;  3JXS A;  3PVN A;  2DDU A;  4RS5 A;  4IEU A;  4Y5S A;  3TEX A;  3O1V A;  1LUL A;  2ARE A;  3EMR A;  3ST7 A;  2FBE A;  3USU B;  4CU6 A;  1ZX5 A;  4ZU7 A;  1DZR A;  3A7Q A;  5FO9 B;  1OT5 A;  1N1S A;  4JHZ A;  4XBQ A;  2LM3 A;  3MLL A;  4H55 A;  1SEF A;  2R49 A;  1I5Z A;  1YQ2 A;  4B1M A;  2VW0 A;  3VBO B;  3WNM A;  4W6W A;  4BXS V;  1OQD A;  4NAM A;  1RJ8 A;  3HNY M;  5DZF A;  1ND3 C;  2Q8E A;  5A3U A;  1REF A;  4A41 A;  3I97 A;  4RSU A;  1COV 3;  2P37 A;  4HAN A;  3O1R A;  4AED B;  2F4P A;  2VVF A;  2RS3 3;  1R08 3;  3WP3 A; 
#chains in the Genus database with same CATH homology
 2Y6L A;  1JZ8 A;  2QQN A;  1UYY A;  1W8O A;  2QQJ A;  3IB3 A;  4W8J A;  4GWJ A;  1SG3 A;  2VR4 A;  1ULP A;  2VC9 A;  2YB7 A;  2EIC A;  2YC4 A;  5F7U A;  5LCW L;  3OGV A;  2QQM A;  3WNK A;  1NKG A;  2ZXQ A;  4TXW A;  1UXX X;  4JKM A;  2VCA A;  3CIH A;  3NQH A;  3C7F A;  3PUH A;  2XHN A;  2WZ8 A;  3I3B A;  3C7E A;  1J83 A;  3MO4 A;  4PF1 A;  3I2F A;  1WKY A;  3SEE A;  2VZ1 A;  2VZQ A;  3T09 A;  5EJZ B;  3T08 A;  3DEC A;  2DCJ A;  5JXH A;  4KWU A;  2BZD A;  3D3A A;  4UI9 L;  1JZ4 A;  2HYX A;  1DYO A;  3THC A;  4TTG A;  2VQU A;  1JYX A;  3OGS A;  1UYX A;  1JYN A;  3SEP A;  2ID4 A;  2C9K A;  2QBX A;  2Y6H A;  5JXG A;  3THD A;  5C70 A;  2W1Q A;  1L7R A;  4M4R A;  4QPW A;  1OD3 A;  2WN2 A;  5DN2 A;  1K3I A;  1XC6 A;  4CUA A;  1KEX A;  2Y8K A;  3GDB A;  3NJV A;  2VMD A;  2J1U A;  1IQD C;  3WF3 A;  1UY3 A;  2WAA A;  3C7H A;  1L7Q A;  2PQS A;  4ARX A;  4DEQ A;  5JUV A;  1JZ3 A;  3F2Z A;  1PX4 A;  3EYP A;  1W0N A;  2EIB A;  1NX9 A;  3FHQ A;  2YFU A;  2EID A;  2LS6 A;  3I2I A;  5LA2 A;  2W5F A;  1SDD B;  2J1S A;  2ORX A;  3CZU A;  5G05 L;  3K4D A;  2WO2 A;  3GXU A;  5LA1 A;  1W9T A;  3BN6 A;  5C71 A;  4P08 A;  1OF3 A;  5DMY A;  4DUX A;  1NAE A;  5JXI A;  2W1U A;  2WO1 A;  1LNS A;  1JI6 A;  1JZ5 A;  1K45 A;  2L9L A;  3HNB M;  4OZO A;  2VZO A;  2ZEZ A;  5IFT A;  1MPX A;  2J1V A;  5DPN A;  4E8C A;  1D7P M;  3OG2 A;  2Y6K A;  3T0D A;  4MAD A;  4RYD A;  3FN9 A;  2W9X A;  4GWI A;  3LEK A;  3A23 A;  2W46 A;  3LPF A;  4QB6 A;  3WF4 A;  1F4H A;  2JE8 A;  3WNL A;  3IDA A;  1ULO A;  3VD9 A;  4HG6 B;  2ZEY A;  2WAO A;  5J1X A;  1TVG A;  4M4P A;  5B4X A;  2YFZ A;  4ZXE A;  1DP0 A;  3BGA A;  3T0A A;  2VME A;  1OH4 A;  3CMG A;  3C7O A;  3ETP A;  2VM9 A;  1F4A A;  1EUT A;  2C26 A;  4CVU A;  2XQX A;  4LPL A;  2WDB A;  3PUI A;  1XNA A;  5JR2 A;  3A21 A;  2OKX A;  4ARY A;  4QX3 A;  4MO3 M;  5JMO A;  1PMJ X;  3VD5 A;  3MBW A;  3W5M A;  2W92 A;  3VD3 A;  2XON A;  1XNT A;  2ORZ A;  4OUE A;  5CZK A;  5CYY A;  3UES A;  2E31 A;  5IJR A;  2RJ2 A;  3LPG A;  4OMD A;  2W47 A;  3A22 A;  3CDZ B;  3OEA A;  1US2 A;  1GOF A;  4FI9 A;  5HPO A;  3WF2 A;  4BK5 A;  2E33 A;  3HOB A;  5A1A A;  3GGL A;  2VMF A;  2W91 A;  1P8J A;  3ACG A;  2XOM A;  2E26 A;  4BJ0 A;  4QB1 A;  4JKK A;  2YC2 A;  1UXZ A;  2VQT A;  4QDR A;  2W1S A;  2VO5 A;  2WO3 A;  4RN5 A;  2C4X A;  2VMC A;  2B9V A;  3K75 B;  4D0Q A;  3ACH A;  2VZU A;  4LQR A;  2QQI A;  2HLE A;  3ABZ A;  5HXM A;  1W99 A;  2J22 A;  1K12 A;  5B4N A;  2Y6J A;  3ACF A;  4QB2 A;  3AC0 A;  2CDP A;  3OB8 A;  3NRU A;  1JU3 A;  1T2X A;  4DXT A;  1UX7 A;  3WNO A;  4XUP A;  3I3D A;  2J1R A;  2JD9 A;  4MGQ A;  4UOJ A;  3WEZ A;  1JZ6 A;  4JX0 A;  4P00 B;  2WAB A;  3UET A;  3ZM8 A;  2QQL A;  1RYY A;  3WF1 A;  2LW8 A;  2WUH A;  2VZR A;  2VZ3 A;  2VCB A;  5I0D A;  1TG7 A;  2WZE A;  1CIY A;  2JKX A;  4XUO A;  1GMM A;  3MUZ 1;  1UY1 A;  1UY4 A;  4JKL A;  3HNM A;  3VDB A;  2VZS A;  3LQC A;  4OMC A;  2ZEX A;  2VZP A;  3WQB A;  2BBA A;  1I5P A;  3CQO A;  3IAQ A;  1GUI A;  3T2Q A;  3WSO A;  4BK4 A;  4PQQ A;  4KMQ A;  2X05 A;  2VL4 A;  4QAW A;  4DEV A;  4DUV A;  1O59 A;  1H6X A;  2J1A A;  3I2G A;  3J7H A;  4XUN A;  4AAX A;  4MGS A;  3I2H A;  2RVA A;  3WF0 A;  4KI5 M;  4L0P A;  4A3Z A;  1O8S A;  3FHA A;  3T2P A;  3WNP A;  2WYS A;  3EB7 A;  4QDS A;  5DQ0 A;  1UY0 A;  2W94 A;  3OBA A;  2WBK A;  4ZZ5 A;  1W9W A;  1W9S A;  2VOT A;  3K46 A;  5IYY A;  2VZT A;  3SKJ E;  4OYU A;  1HN1 A;  2VZV A;  5FUI A;  3T2O A;  3P6B A;  4YPJ A;  1CZT A;  2X10 A;  1GNY A;  2V4V A;  4CUB A;  1XPW A;  4E8D A;  4BDV B;  3I3E A;  3VD4 A;  3VD7 A;  2X09 A;  1UWW A;  3OEB A;  4DXR A;  2VCC A;  3NJX A;  4W4Z A;  3HPN A;  3ECQ A;  4UAP A;  4Z2A A;  1W8N A;  3K4A A;  4LKS A;  4P02 B;  1US3 A;  2Y6G A;  2Z4F A;  1K42 A;  1CX1 A;  1JHJ A;  3WNN A;  3CKH A;  5EJ1 B;  3CZJ A;  1J84 A;  1O8P A;  4LHS A;  4XUQ A;  3SKV A;  3UNP A;  3U37 A;  1UY2 A;  2J1E A;  4CUC A;  3K4Z A;  3VDA A;  2W87 A;  5LA0 A;  1JYV A;  1OF4 A;  4P5Y A;  2J1T A;  4QDQ A;  2BGO A;  2J7M A;  3DYO A;  4ET7 A;  4A6O A;  4QX0 A;  2BGP A;  2ZEW A;  2WQ8 A;  3DYP A;  3MUY 1;  1JZ2 A;  2EIE A;  4XZU G;  3T0B A;  4XUT A;  3LE0 A;  4W50 A;  3GM8 A;  1EUU A;  3W5N A;  1GOG A;  2CDO A;  3K77 A;  3DYM A;  1GOH A;  1CZV A;  1H6Y A;  3HN3 A;  1KGY A;  5G04 L;  3MV1 1;  3NNG A;  2DCK A;  4QX1 A;  5IHR A;  3III A;  4A4A A;  2V72 A;  3ACI A;  4QX2 A;  3E1F 1;  1BHG A;  4A45 A;  2V5D A;  2QQO A;  2BER A;  4A44 A;  4CU7 A;  4XVH A;  5EIY B;  2Y64 A;  1UYZ A;  1PMH X;  3C8X A;  1GQP A;  1DLC A;  2VTF A;  4ZY9 A;  4AG4 A;  3P1I A;  1R64 A;  2QQK A;  4CU8 A;  3IAP A;  1UZ0 A;  5JXJ A;  1GU3 A;  4MOA A;  1UMH A;  3FL7 A;  1CZS A;  1JZ7 A;  1PX3 A;  2KD7 A;  1NUK A;  2W1W A;  3HJR A;  3MV0 1;  4GZ9 A;  1SHW B;  4DXS A;  2RV9 A;  4D8M A;  5C7G A;  4IUG A;  2JDA A;  3I2J A;  1UMI A;  3LEI A;  2VJX A;  3LEG A;  1JYW A;  3JXS A;  5IFP A;  2DDU A;  2W3J A;  4DUW A;  4CU6 A;  2WN3 A;  3A7Q A;  3C7G A;  3VDC A;  3I2K A;  4XUR A;  1JU4 A;  1OT5 A;  4JHZ A;  3HEI A;  4A42 A;  1YQ2 A;  2E32 A;  3WNM A;  4BXS V;  4PT6 A;  3HNY M;  3OGR A;  4CU9 A;  4A41 A;  3I97 A;  2W95 A;  1WCQ A;  4ZZ8 A;  2R7E B;  2B4K A;  2YG0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...