4UAPA

X-ray structure of gh31 cbm32-2 bound to galnac
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
150
structure length
150
Chain Sequence
SHMNITVSGDSSQLQSGMGLDKLIDGTTSSDDSSRMDLKWIFTSDQQDKGTLPFEMTFEFNEPKTLENFTIYNRMNSNGTINIAAMKKVKAVGYLNGEEFDLGEKANITSATTVYELGGKEFDKIVITALDSHKDKNTLAINEIEFYEKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Diverse modes of galacto-specific carbohydrate recognition by a family 31 glycoside hydrolase from Clostridium perfringens.
pubmed doi rcsb
source organism Clostridium perfringens
molecule tags Sugar binding protein
molecule keywords Glycosyl hydrolase, family 31/fibronectin type III domain pr
total genus 36
structure length 150
sequence length 150
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-08-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 4uapA00
2QQIA 3I2KA 3THDA 1LNSA 4AG4A 3ECQA 4GWIA 4A3ZA 2J1UA 4BXSV 5JXIA 1OH4A 4CUCA 1CX1A 2QQOA 2ORXA 1JI6A 3CZUA 4ZY9A 3WEZA 4DUVA 1XPWA 2E32A 2WO2A 3IDAA 3IB3A 3A22A 4RYDA 2VC9A 3PUIA 3K4DA 2L9LA 3E1F1 3K4AA 3LPGA 4ZZ5A 3K75B 4OYUA 5G04L 3WF1A 2VZQA 2X05A 2VR4A 3C7GA 4P02B 4P5YA 3MO4A 4DUWA 1GOHA 4QB2A 1JZ3A 5FUIA 2QQLA 4XVHA 3GDBA 3SKJE 2Y6HA 1NAEA 1O59A 2VCCA 2R7EB 3P6BA 4D0QA 4JKLA 2QQNA 2VOTA 2VL4A 3WF3A 4CUAA 3I3EA 1F4AA 1SHWB 4CVUA 2VQTA 3JXSA 2E26A 1JYWA 4W50A 1PX3A 5IFTA 1W9TA 3WNLA 4CU8A 3T0DA 3K46A 4KMQA 1R64A 5JMOA 4A41A 1JZ8A 1CZVA 3OGRA 4BK5A 4XUQA 3T2QA 4A42A 1DYOA 4XUPA 3LPFA 3WSOA 1UY1A 1KGYA 1JU4A 4P00B 1US3A 1OD3A 4ARXA 1JU3A 3T09A 3MBWA 1UYZA 4DXTA 2V4VA 3FN9A 1UMIA 3IAQA 4ARYA 1GNYA 5JR2A 3A21A 3GM8A 1JYXA 2WBKA 3IIIA 3PUHA 4DEVA 2YG0A 3CIHA 2W91A 1P8JA 3IAPA 3HJRA 1SDDB 1XNTA 2E31A 2YFZA 4QB1A 4Z2AA 1W9WA 1GU3A 1JYNA 1O8PA 4UOJA 1J83A 3CDZB 1F4HA 4BK4A 2LW8A 2XONA 2BZDA 2YC4A 2WN2A 3UESA 5IHRA 2W47A 2VZSA 4QDSA 2Y6KA 5C70A 3W5NA 4XUTA 4AAXA 1H6XA 2W95A 4MGQA 3WF0A 3T2PA 2VZTA 4YPJA 4QDRA 3MV01 1K42A 1CZSA 5B4XA 4MADA 4W4ZA 1GOFA 2VZVA 3D3AA 2ID4A 4ET7A 1J84A 2Y64A 1UY4A 2J1VA 2QQKA 3EYPA 3UETA 3W5MA 4BJ0A 3VDAA 2XQXA 3WF2A 4A6OA 3VDCA 2EIBA 3WNNA 4CU6A 4JKKA 3WF4A 2B9VA 2RJ2A 3NQHA 3WNMA 1K12A 5LA0A 3OGSA 3VD9A 2RVAA 4DXSA 1KEXA 3NJVA 4XURA 2WO1A 1NUKA 2VTFA 5A1AA 2J1RA 1GQPA 3FHQA 4DUXA 1YQ2A 2VCAA 2J1TA 1OF4A 2W9XA 3VD5A 2B4KA 2VZRA 3MUY1 3GXUA 4OMDA 4XUNA 3GGLA 3BGAA 2WO3A 1D7PM 2RV9A 3FHAA 4OUEA 1CZTA 3WNOA 2Y8KA 5CYYA 2WZ8A 2WZEA 3OEBA 3WQBA 5C7GA 4DXRA 1K45A 4QAWA 5JXGA 3P1IA 2ZEZA 4LQRA 1ULOA 4CU7A 5JUVA 2J1SA 5G05L 2EICA 5CZKA 4MOAA 2VZUA 3T08A 1JZ4A 3ACIA 3SKVA 2BBAA 2QQMA 3A23A 4CUBA 4XUOA 3ACGA 3I2JA 2VQUA 2QBXA 2WUHA 3SEEA 1BHGA 3I2HA 4LHSA 5EIYB 3ZM8A 4M4RA 4PF1A 2KD7A 2W1SA 3AC0A 3F2ZA 4LPLA 3VD4A 2YFUA 4CU9A 1TVGA 2YC2A 2ZXQA 4KI5M 3HNBM 1EUTA 4QX2A 3A7QA 1TG7A 1UYYA 2J22A 5IFPA 1I5PA 1SG3A 2W5FA 3C7HA 3HN3A 1CIYA 3K77A 3I97A 3K4ZA 3MUZ1 5IYYA 2JDAA 1JYVA 5EJZB 2W1QA 4GWJA 3T0AA 2BERA 3UNPA 3LEGA 2VMEA 4HG6B 5LA2A 2VMDA 2WABA 3THCA 1IQDC 5B4NA 1W99A 3DYMA 4QPWA 4TTGA 1O8SA 1DP0A 3MV11 2WQ8A 1L7RA 3I3DA 4E8DA 2VM9A 4ZXEA 1OT5A 5J1XA 3NJXA 2J1AA 1UXZA 5C71A 2ZEWA 2BGPA 5EJ1B 4QDQA 2XHNA 1UWWA 2W92A 4JKMA 3C7OA 2WAAA 5DPNA 3VD7A 1JZ7A 3SEPA 2ZEXA 4P08A 3CMGA 2C26A 3U37A 5HPOA 3CKHA 4JHZA 2ZEYA 4D8MA 3I3BA 5LCWL 5I0DA 3LE0A 1H6YA 1W8NA 5JXHA 3VDBA 2JD9A 1UXXX 2HYXA 1ULPA 4XZUG 4QX3A 2C4XA 3ETPA 2W94A 1JZ2A 1UMHA 1W0NA 2E33A 2DDUA 2W1WA 3I2FA 4PQQA 4A45A 1W8OA 2PQSA 1JZ5A 5DN2A 3WNKA 1MPXA 2J7MA 4RN5A 2JKXA 1L7QA 4MGSA 4A4AA 1XC6A 2LS6A 1UY0A 1UY2A 3DECA 4IUGA 4QX0A 4ZZ8A 2VCBA 3T0BA 1GOGA 3OBAA 2DCJA 3LEKA 3HPNA 2WAOA 2VZOA 5IJRA 1NX9A 1US2A 1OF3A 1XNAA 2V5DA 1WCQA 2ORZA 2VZ3A 2WN3A 3I2IA 2CDOA 2Y6GA 1JHJA 2DCKA 2VMFA 4UAPA 4M4PA 3HOBA 2W46A 1PMHX 2Y6JA 3EB7A 4BDVB 3DYPA 2JE8A 3T2OA 5LA1A 3OB8A 3NNGA 4L0PA 2CDPA 4QX1A 3HNMA 2X09A 4KWUA 5JXJA 3HNYM 3ACFA 1JZ6A 2VZ1A 2HLEA 2XOMA 3VD3A 3LEIA 2WDBA 2EIEA 3C7FA 1PX4A 1UYXA 3C7EA 2OKXA 4GZ9A 1T2XA 2VZPA 4OMCA 3NRUA 3OG2A 4UI9L 5DMYA 2W1UA 4MO3M 1HN1A 2VMCA 3J7HA 2V72A 1EUUA 1RYYA 3CQOA 3HEIA 4W8JA 4OZOA 1DLCA 2C9KA 3ACHA 1PMJX 3FL7A 1WKYA 5DQ0A 2J1EA 2QQJA 1NKGA 3OEAA 1UX7A 2VJXA 2W87A 4A44A 4TXWA 2EIDA 3I2GA 2WYSA 2Y6LA 3C8XA 4FI9A 5F7UA 1GMMA 2YB7A 4PT6A 3WNPA 2Z4FA 4QB6A 3LQCA 3OGVA 3DYOA 2BGOA 1W9SA 4DEQA 5HXMA 1UZ0A 2VO5A 2W3JA 1UY3A 1K3IA 4JX0A 4E8CA 3CZJA 1GUIA 2X10A 3ABZA 3BN6A 4LKSA
chains in the Genus database with same CATH superfamily
2QQIA 1HDKA 3NV3A 3RZKA 4ZU7A 1JZ6A 3I2KA 1UPIA 1AR92 1LNSA 1BEV1 4UYBA 4FPYA 2GDFA 3OPTA 4UF0B 5FY4A 5FZOA 4HOOA 4COUA 3N7MA 1Q43A 4NWVA 3GALA 4QT6A 1QDOA 1SFNA 2Y6FA 4DB5A 2QQOA 3O0VA 4F8AA 5IVVA 5T5PA 5KBFA 5KHHA 3CZUA 1HJGA 1QQP3 4JGYA 4CDWC 5SV8A 1R1ZA 1C57A 4XCBA 1WZXA 2DVGA 1Q8SA 4L97A 4NRQA 4LKDA 4CCEA 5FR3A 2JJ6A 4AFMA 4HVOA 4LIUA 3TN92 4DZGA 3CU7A 5C3PA 1X36A 3WG3A 1UMZA 4MLOA 2XR4A 1U12A 4RQPB 5FMBA 3B5LB 4IV1C 1W2OA 3C7GA 2XLAA 4QGMA 1UPSA 4NPLA 4R8HA 1AYM2 5FUIA 5JOWA 1YQCA 3AMQA 3ZYBA 4R4XA 2JD4A 4CDQA 1YQ5A 5I8YA 1POQA 1QHDA 3SKJE 2IC1A 2RS11 2VMHA 4LKFA 4RHV3 3KSCA 2VE1A 2B9UA 5FLIA 4Q1RA 5FPAA 1PIV2 2UYBA 1AZDA 4D0QA 1NCRB 4NAOA 2CNAA 4XC9A 1W3VA 1F35A 1FOD3 1V9U2 5CFDA 5LRSA 1XRUA 1AXZA 1GZWA 5HCBA 1DFQA 1JOPA 1NG0A 4LOSA 4ASKA 3JXSA 1JYWA 4W50A 1OVSA 4XEZA 5H9QA 1VBA3 2P1BA 3WW3A 3MYXA 1J59A 2GN7A 1GNHA 4KMQA 5SV5A 4YNIA 1D4M1 5FZ7A 5JMOA 3KCYA 2V09A 3U10A 2VQ0A 4K21A 4LO8A 3J7NA 4OHXA 2A6WA 4P14A 4YW5A 3BTXA 1OA3A 2R30A 4R9BA 5BNQA 4H55A 2HWD2 2XHKA 4NVPA 4A42A 5JOYA 3ME2A 1QOTA 1RL3A 3OSDA 3WHUA 5CB7A 2DU1A 1V6MA 4LBOA 4P00B 2Y0IA 3VZKA 4LNVA 4Q4V2 5DG2A 1NE6A 2XVLA 4ARXA 4BQYA 4AVSA 5A32A 5FPXA 1NA1C 2Y33A 1VBC3 5DDJ1 2E63A 3MBWA 1OLRA 1NCRA 3MI8A 1ZRDA 1H2MA 3N35A 4L9BA 1GNYA 3JBG1 3AMMA 1GWLA 3K51A 1D0HA 3GM8A 5JR2A 2XPJA 3LD8A 4XZPA 4HONA 3PUHA 1Q5OA 2RDNA 1C8M2 3S5AA 1HXS1 3GNEA 1KFXL 1CAUB 3HJRA 1PM4A 2E31A 4QB1A 2YFZA 5LK5A 4Z2AA 1F2NA 1W9WA 3WQ0A 2JG9B 3I3QA 4UBHA 4M00A 1MS9A 4HBNA 1F4HA 1VBB3 1B09A 2GC3A 1PM7A 4XFAA 1POV1 4BK4A 1HQNA 2IXLA 4BQ4A 1Q8PA 1ZM1A 2HWE3 1VE0A 4KG0A 4AVCA 2F4LA 4P9LA 5FDBA 3IBMA 4AXOA 5ACA1 5IK8A 2RS32 1IS3A 4XE9A 2WN2A 2CV6A 3MIDA 1OD5A 2HWB3 4QDSA 1YRZA 2JB8A 4N53C 3QBQA 1JTZX 5L7OB 3IT8A 1HB1A 1LHWA 4QKBA 1H6XA 1I9RA 1MS1A 4JDOA 1G9DA 4L99A 5FWJA 1LR5A 2WZPP 4DFSA 5BXXA 1VR3A 5D1IA 4BXFA 5FP8A 4OHVA 5DG1A 1GZTA 1X8EA 2VZVA 3LIHA 2ID4A 5IK7A 1N1TA 4ET7A 2QTWB 3DPRA 4HSJA 1J84A 2NMNA 1UY4A 1W6MB 2J1VA 2QQKA 3ZXDA 3RYPA 3WV6A 5HV0A 1A8MA 1S1AA 3ZN6A 4IEWA 3ZN4A 1N3OA 2WFF1 1U5IA 2VH9A 5CFCB 1WD4A 1DQ1A 4IGOA 2RJ2A 3N4MA 3MGUA 2QNKA 4J25A 1O7FA 2N7GA 2VVFA 4YLZA 3KS7A 4OCTA 3OY8A 4Q4W2 3SHRA 5F3CA 3FJSA 1K12A 2R073 1FNYA 2QKDA 1W03A 1RUI1 1H8TA 2ET1A 2BGCA 3O7OA 4Y4RA 1MZFA 3AYDA 5JR7B 3VKFC 1POV0 4N7IA 3VD9A 1C28A 5KHGA 3DV8A 1DYKA 4CEYB 3ZYIB 3NAPA 3ZN5A 1YQ6A 2P34A 1ULDA 2OVUA 1NUKA 4WM8C 4HPKB 1NCRC 5EPAA 5A80A 5A1AA 1NY72 2J1RA 5IW0A 1XOYA 4IE0A 4YM3A 1QF3A 3FHQA 1AR73 2W9XA 2GMEA 2VZRA 2WNUA 3DN7A 2A3YA 3ZO0B 5KXBA 3FLRA 1NY71 1FPN3 4Y33A 2VW1A 4RHV1 1C8M3 2ZZQA 4YVSC 4AHWA 3N9LA 4EE2A 1AVBA 2WO3A 1RUF1 3ILNA 4WM7B 1D7PM 2A3WA 3PVEA 4Z92B 2AH2A 2RV9A 4PI2A 2P37A 2E51A 4F3JA 5BNNA 1CZTA 1LGNA 3WNOA 5AFBA 3VBHA 1SBDA 1VBE1 4HN1A 4B4RA 1HQWA 1VBC2 3T3YA 3S7IA 3UT0A 1REDA 2FDFA 1W2AX 1VAVA 4XDPA 2YXSA 4XXPA 4YVWB 3ROUA 3OEBA 3I59A 4H3WA 1JXNA 1NOVA 3N9NA 4AEDB 5BNPC 2IXKA 1LCLA 3PTRB 4DXRA 5C7GA 4XJ9A 5C3QA 3KF3A 4JTOA 4QAWA 2YGMA 1W6OA 2V4AA 4HPKA 4IEYA 1VRH2 4IEUA 1GP4A 3ASIA 4E4SA 4QPYA 2ILMA 2P3IA 1C1LA 2JB4A 2YHJA 4AEDC 4M0NA 1JYCA 2R32A 2WNVA 4YVWC 3S57A 3M4FA 4B7KA 4XQ4A 1JZ4A 3KQ4B 3KT7A 4AF9A 3VHNA 4JDNA 4ATFA 1Y7BA 2ERFA 3O1PA 3ZYJB 4EN0A 5D21A 4NHKA 4XUOA 2C1FA 3VBSC 4Q4X2 3I2JA 3NKGA 4CCKA 5CVRA 2E7AA 1OUSA 4QPIC 4IV3B 1W6NA 1YYNA 1A34A 1HB4A 4KWJA 2ZGNA 3H0OA 3WXPA 2WWSA 4WZFA 3TNQA 3WDVA 4M4RA 1OC1A 2EXHA 1H4HA 2C9AA 3J8F3 2RM22 4LPLA 2YFUA 1LEDA 2VAUA 1A78A 4CU9A 3O1VA 2VOVA 4NAMA 2WRAA 3HNBM 3N7KA 1UX6A 3AZVA 5BNNC 3A7QA 3LDBA 4R4ZA 5EQUA 5IFPA 2WO7A 2A5ZA 3D0SA 1Z0HA 1AF9A 3ZKYA 2XGXA 1BVP1 5LEKA 2RDQA 2ZBJA 3FLTA 4UFKA 2XWJB 4CDQC 1W6PB 2DWRA 5FZ8A 5C8CB 1V6OA 2WA3A 4AFCA 2ZAAA 3THTA 5EJZB 3MLLA 5IATA 3O1MA 3O1SA 3LEGA 4HG6B 4Q29A 5KR7A 2WABA 1H4GA 4CZSA 5C3SA 1QOOA 2JG9A 2H6BA 1Y9GA 3BUCA 3DYMA 1WMDA 2EF6A 1JUIA 3ZYFA 5CFDC 5HV4A 1UZWA 4QPWA 2RS31 4Y1VA 1VBD3 4DO0A 2D6NA 1VB4A 1F31A 2WYFA 4YGEA 5ANQA 5GLTA 2BOJA 1O4ZA 4YZ5A 4I2OA 3I3DA 3VBSB 3AZZA 3LWCA 2NLRA 3H1YA 2HKXA 1VBA2 4Q26A 1S0GA 4R52A 4NE9A 3D6EA 3ETQA 4YVWA 1A6CA 5AVAA 1W0OA 4AVAA 3WNXA 2BUKA 2NMOA 1X7NA 1W9FA 3AP6A 2XHNA 2XB6C 4Z8BA 3AXEA 2W92A 1MQTC 3UGGA 3AYCA 3ES4A 3DKQA 2B42B 1PVC1 5F3IA 4Q0QA 4UFMA 4Y20B 5ABJA 3M2MA 1R082 2AEYA 1EAH3 4P08A 2C26A 1LHOA 1CONA 1SLCA 1XYPA 4JHZA 4IQPA 4HN0A 1DQ4A 5CKMA 4FOWA 5FYSA 3J9SA 4DRVA 3D8CA 4KWLA 1RMU1 5FMCA 1H6YA 2HEVF 3AZWA 1H30A 1NXMA 2JD9A 2LROA 4UBGA 3TN93 5AC93 5JPNB 1GNZA 4CP9A 2D6MA 4CEYA 3RGBA 2Q8EA 2C4XA 2QE3A 1YLLA 2NYYA 3ETPA 2XXZA 1WLDA 2W94A 5FP7A 1JZ2A 1ZBE3 4BHPA 3UGHA 1IG3A 1ZVFA 3DEMA 5JIAA 1Q8QA 4BCUA 2WT1A 5CKQA 2GC1A 3CJIA 4JQTA 4NPMA 4G3YC 1WW6A 4FPFA 1RUF3 5DN2A 3WNKA 3GHNA 2RR11 1QJY3 3R4UA 4RN5A 5E8AA 5AVPA 3HBKA 3BU7A 2ZGUA 4XETA 1PVC3 3EHKA 4EN8B 2RE9A 3V0BB 3GCXA 5FUNA 1CQ9A 1OPMA 5FXWA 3FFZA 5K4LA 1S0BA 4BIFA 2GAUA 4IUGA 2EA7A 4MHUA 1HRV2 4AVTA 4N43A 5A7WB 1OXCA 1HV0A 5FK8A 4AE2A 1ZBA3 4MZUA 1LAJA 4IL7A 4FXGB 3LEKA 1W3XA 1RMU3 1Z7S1 4OHZA 1W9YA 2BFUL 3V64A 1HLCA 4F83A 3KMHA 1B35B 1E57A 5FYCA 1OF3A 1G86A 5CAZA 4K6BA 4W65A 1WCQA 2ORZA 1ZX5A 2CDOA 1LHNA 1UU4A 1AXKA 3HR9A 2OS2A 1WD3A 2DCKA 3INAA 2OQ6A 1ENSA 2ZOEB 1QKQA 4E27A 5FY8A 3GF6A 1DGRN 1OA4A 1DYPA 5EV7A 2CYFA 2JE8A 2R49A 5L7OC 2HWF3 2VTXJ 3T2OA 2PAKA 4CDWA 4PLNA 2VVDA 3MDPA 4OULA 5FYZA 2R1BA 1QJU1 4QHZA 1ZYBA 2X09A 3ZIWA 1RGSA 3N7JA 5A7PA 3HMYA 2YZ4A 4XOGA 1E5RA 3ILFA 4QQ2A 5KWRA 1KQRA 1BEV3 2D5HA 1JOBA 4JAAA 4NJ4A 5E89A 5L9BA 1MS3A 4EJRA 5C5TA 1W06A 1XSRA 5JDBA 1WMFA 3GJAA 3VD3A 5CKNA 1HB2A 4ZONA 3RZGA 2WDBA 3JD71 2NP0A 3C7FA 5BY5A 2A6ZA 5LY1A 1FXZA 1HX6A 2Z42A 3ZVXA 5FFOC 4EYUA 2A73B 1T2XA 2VZPA 4OMCA 4YVSB 5H9RA 3NRUA 5IVFA 3R4SA 4FPHA 5A3PA 2GNDA 2VXRA 4JC1A 2YU1A 1PGL1 1BEV2 1NCQA 1EUUA 1NA1B 1S4CA 2R0HA 3H3ZA 5DZFA 3CQOA 1W6NB 1CIWA 4M3CE 2VUCA 2PLV3 2BW8A 1YQ8A 1F5FA 2HWC3 1AXYA 4AI9A 4OZOA 3OD0A 3V0AB 1JBCA 2DCYA 2C9KA 3ACHA 4QD2A 2X5IC 1YNAA 1PMJX 4QGLA 4IETA 2VUJA 2J1EA 2OA2A 1JW6A 2W52A 1URXA 2JDUA 3H1WA 2EIDA 2PHDA 3I2GA 1ZZCA 1C1FA 1R083 2B7YA 4AWDA 4FI9A 4AI2A 1UW8A 3JQWA 5F7UA 4GMP3 5J37A 2FCTA 2D43A 5FBJA 3H3UA 2ZPXA 3OGVA 3BKZA 3OOXA 1W9SA 4CP2A 5CADA 1I3HA 4JGZC 4YG0A 5C4WB 2CWMA 3N36A 1BJQA 4OQ9A 5HXMA 1UZ0A 1L7LA 2VO5A 2VW2A 4FP3A 4Y1ZA 3I2OA 3Q8BA 4NRPA 4I0BA 3ZMOA 4E8CA 1NA1A 3CZJA 3H7JA 3KT1A 4LKEA 1ULCA 4NRMA 1ZBA1 2X10A 4YW1A 5JCTA 4MGTA 5IUQA 4FFIA 2AREA 2QDNA 3RWKX 4AGRA 1ZA4A 1XNDA 2B8MA 3L9JT 1VRH1 4AG4A 1FOD1 1IS5A 4LHLA 3VBOB 4A3ZA 2BNOA 3PUSA 1MEC2 4COWA 2XJVA 4GA9A 5FYUA 3LA3A 4BQ2A 1D2SA 3CO2A 1H2NA 3WP6A 1NT0A 3RJ2X 1OH4A 1CX1A 1UCXA 5ANNA 1Q8VA 4FPOB 4QXHA 2GH8A 4DNYA 1ZBE2 2A71A 4I3PA 3ENRA 3SC7X 2QQWA 4H2AA 1VPHA 5GZGA 4DUVA 2EXKA 1XPWA 2JG9C 2WO2A 1MS8A 3ZX7A 4XW3A 3A22A 2ES3A 3DXTA 1DQ5A 4RYDA 1G9AA 1ZBE1 2Y0OA 4CCMA 2E9QA 3AXDA 1KITA 3PUIA 4Q0SA 3K4DA 1DQ2A 2PHWA 2L9LA 2B45X 2Q0AA 2ZX2A 4I02A 5A70A 3BPSA 2XKPA 3LPGA 5GLUA 4ZZ5A 1HRI2 3K75B 1VBE2 1ALYA 4DS0A 1W6QB 1AR81 1I1EA 4Q4Y3 4AGGA 4EV0A 2VY0A 3MO4A 1W6MA 4HFSA 2G9ZA 4RR3B 4HKOA 3J8F2 2WC2A 4LHKA 3J4UH 1EAH2 3UV9A 3WUCA 3GDBA 2ZGQA 1G9FA 4COVA 3WW1A 2JX9A 1VJ2A 3KD4A 1H2LA 2VL4A 3WF3A 2B39A 2ZCWA 3DPRC 3H42B 4OI0A 2FDIA 5A7WA 3B00A 4D7YA 2E26A 4IEVA 4ZS2A 4YW2A 3MLKA 1BBT3 3HT1A 4C0HA 4DINB 2EXIA 5IFTA 4NN0A 3R05A 2CSGA 4CU8A 4G4FA 4R9DA 1HV1A 1QJFA 3K46A 4ISRA 3KVAA 3M3EA 2WS93 2ZHKA 3DPRB 4RS5C 4HVQA 1J3QA 4NIHA 1LGBA 4NPRA 4DOUA 4GKYA 1VRH3 4XUQA 3T2QA 1VBD2 1V6LA 1RC6A 3JCIA 3LDRA 4IERA 3P5BA 5DDJ2 4YG3A 1JN2P 5CU1A 1JU4A 2C24A 4Y5SA 3USUA 1MZ6A 5F9TA 5J7MA 1IQAA 1WA6X 4GJZA 1O3RA 1AX1A 1I5ZA 3JBG2 5CA6A 3B93A 4FXKB 1SBFA 2ZA9A 1UMIA 4COYA 1W8WA 2WNVC 3IAQA 4QXCA 3U07A 2BTVC 3CJIC 4ARYA 1ZRFA 3WQ1A 1N3QA 4JDMA 2IFWA 5FCCA 5K0UB 5BPXA 1JYXA 4QGNA 4RFT0 5FY1A 2H0BA 5E16A 4UFHA 3V0BA 2XVKA 1AHSA 5A7NA 2CGPA 4P9XA 1VBB1 1P8JA 2UY9A 1AJKA 1RUD2 1R081 1K5MA 3IAPA 3T1MA 3CEWA 3W21A 2UURA 1QNWA 2PYTA 2YGLA 5JPMB 2BP6A 4QHOA 4N7UA 5FPZA 1JYNA 5ACA2 3GYDA 1GQHA 3B9IA 3HIFA 3QH7A 3CDZB 2G1MA 4HZFA 4RGAA 5FY5A 2BEOA 3AKQA 5I8SA 4BPZA 1ST8A 3LA7A 2BZDA 4LBNA 1DZRA 1GKBA 3NNFA 3UESA 3QD6A 1BMV1 2C5DA 3PHMA 5IHRA 2JKBA 5L9VA 1FMD2 5J3UA 2W47A 5FP4A 3ZFEA 1SACA 3KT4A 3L2HA 5C70A 4XUTA 1UZVA 5FXZA 1AR71 5A7SA 2VNOA 2QDRA 2Q8DA 1QWRA 3WF0A 4MGKE 2VZTA 1QOSA 4FO9A 4K1YA 4H7LA 3MV01 2WQ4A 4META 1CZSA 4FPGA 1IPSA 2LUWA 2VULA 1O3QA 5FAXA 1OA2A 1YUDA 1IKPA 1AYM1 4W4ZA 5EYYA 3R6SA 3D3AA 4HANA 3WW4A 2JICA 2UWCA 2WZR2 4IEXA 5JAXA 3KQRA 4KGQA 3W5MA 3AJYA 2PAMA 4GH4C 2LRPA 2R041 4GB31 3NNLA 2XQXA 1GR3A 3WNNA 3J26N 3WF4A 3NQHA 4XFFA 4RGKA 2Y26A 2NM1A 2JG8C 2RMU3 4IEPA 3TOJA 5FTTC 1CX4A 4BLJA 2ZAHA 4X6RB 5LBCA 2YU2A 2HWB2 1S2EA 4SLIA 1PGW2 4IE6A 3ZDSA 5FQ0B 3IKWA 5BV6A 1KEXA 3NJVA 1JODA 1D4M2 2HWE2 3TNPB 2G9FA 1QXRA 4P9IA 1PGW1 3VBUB 4M3CB 1RUE2 2VNVA 1XQNA 2K0GA 2BJSA 3FHIB 5H9SA 3RVHA 3SXWA 1OF4A 3AP4A 2B4KA 1MQTA 3N9MA 3PU3A 3ZXGA 3WY6A 2CWSA 3URFA 3ZFEC 1OKOA 4QPGB 4OMDA 2HYKA 3GGLA 2D6KA 1APNA 2EIGA 3HD8B 4IGQA 1PGSA 1DZTA 4XYXA 2Z79A 3M3OA 4Y1YA 1XE0A 1ENQA 3MIEA 3FHAA 3TRSB 5EYXA 1TMF3 3KCXA 5FK7A 5CG8A 5FZLA 5AFEA 4WBBA 4LUKA 3RWNA 3VBOC 2CAUA 4BMEA 1NLRA 2R072 4YVSA 4IEQA 2WZ8A 4Q4V3 1AYN3 3B69A 3WQBA 2HBUA 1N47A 3ZYRA 3S7EA 3E6DA 5H9PA 5ERLA 3ZFGC 5F5CA 5JXGA 1J1LA 2VNGA 4JTNA 2FCVA 4LQRA 4RGGA 3N9PA 1O4TA 2IXCA 4CU7A 5JUVA 4DXZA 1XJAA 5G05L 1ACCA 1JS9A 4FT8A 2WS92 5FY0A 4CCJA 3VZOA 2VZUA 3OUIA 2A3XA 4NIDA 2E7QA 2BU9A 3VZMA 1PZ8A 1W39A 4JRLA 2NPIA 4D69A 1QY4A 2UWBA 3ACGA 3B94A 2W39A 1LODA 4GJYA 1MVQA 1VAMA 3WD5A 1WMXA 1FV2A 2QBXA 1JHNA 1ZZ9A 5FZBA 2HEWF 3QACA 3WR0A 2VOKA 1REFA 3M3IA 1A3KA 4MGYE 5T5LA 2C0ZA 4MGZE 1BHGA 2MNGA 2WNVB 4JGZB 5C9AA 1C3HA 3ZM8A 4X8NA 1UOBA 4PF1A 5EIYB 4FPCA 1PVXA 2IXIA 4Y26A 5I91A 3O1RA 3I7DA 4Y4YA 1G9CA 2W1SA 3F2ZA 1F8VA 1TVGA 3G7DA 4B29A 1W6OB 2OZ6A 4PBPA 4DY3A 2E53A 4XAAA 5ACA3 4PI0A 3HVDA 3LF7A 4X8PA 5EJ3A 1TME1 2GMMA 4S2FA 1UYYA 2HH9A 2RHPA 2J22A 2YBPA 3TN91 4AK3A 4RA0A 1SG3A 4QKDA 3CBNA 3C7HA 4N8MA 4R9CA 4GB33 4IV1B 4LA3A 1KJRA 1W8HA 2QVSB 3K77A 5F8PA 4YSFA 1SCSA 2YV8A 1Q56A 4Q8KA 3H8XA 3MUZ1 5FYHA 3IM0A 5IYYA 1JYIA 4S2DA 4EZ4A 1OBNA 1PK6C 1R1A1 1SLTA 2VMEA 5FLJA 5B4NA 3UNPA 3THCA 1V6IA 5CFCA 3JZVA 4I01A 4YM2A 3ZN6B 4CP1A 5EXOA 3FZ3A 4QXKA 4HK8A 4AHXA 4DY5A 5GZEA 3PURA 2RJLA 3I3MA 5K8SA 3LB9A 1SZBA 4YW4A 2XLFA 2HWD3 3UGFA 3WDYA 4TTGA 2WL1A 1ODMA 4CP9B 3Q8EA 1W2TA 2RMU1 3BCWA 5EFUA 3J7LA 4WV8A 5FMOL 2K46A 3VV1A 3UJQA 3EQEA 3SQOA 4OQ8A 2JE7A 2VM9A 4ZXEA 1OT5A 5J1XA 4YM0A 1IPJA 1CAWB 1KS4A 2EAKA 1CGPA 2O8QA 5I93A 1VRBA 5JIUA 1H1IA 5JI7A 2IZWA 5DXDA 4Q4W1 4NR1A 4URTA 4QDQA 2ZGRA 4RSUA 3SH4A 1V9U1 1U5YA 5D8AA 2D6PA 4OLLA 1HRV1 4Q4V1 4ZU5A 1JZ7A 3SEPA 1RITA 3WP5A 2I45A 2HWE1 3OBTA 4E4ZA 1WGPA 5A33A 4LTAA 4XPVA 1ND3C 1SDWA 5HPOA 1Z7S2 4L92A 4XDQA 5FJKA 4Q0VA 3JU9A 4YFWA 3I49A 4UXAA 4MHRA 3I3BA 4NHLA 4AQSA 4K40A 4TLGA 2DTYA 4ORFA 2LTNA 3A0NA 1MS4A 1GZCA 1HRI3 1VBE3 5LA9A 1W8NA 4M3CA 4AL9A 4PF5A 1T6GC 1ZA7A 3OCPA 3LCPA 2P5BA 1UXXX 1GSLA 2HYXA 1DDLA 4YGCA 1EV12 1D4VB 4C0BA 4IE5A 2Q1MA 5C8CC 2PFWA 2XUEA 4CCDA 2ZABA 5IVEA 1OFSA 1UMHA 4XJUA 2IXJA 1DF0A 5GZDA 3KVBA 3R4DB 4HL0A 1GP5A 2DDUA 2IUWA 1XE8A 1ENRA 4LA2A 4EWAA 4A45A 4FPJA 3OPZA 5KXEA 4JGYC 3U75A 1BBT1 1W8FA 5A1FA 1GYKA 1CAUA 5A33B 2YYOA 3AKRA 3TEYA 2BOIA 2JKXA 3POFA 2D3SA 4CP0A 1NZCA 5JWPA 2RS13 3FBMA 3MIGA 5CIRA 2NN8A 2D7FA 2LS6A 4G9SB 1U5ZA 4A2UA 2RDSA 1PO13 2X8KA 5FWEA 3RMXA 1UY2A 4AVBA 3PVNA 3N9OA 3OGGA 2VCBA 2MPFA 3U1XA 4CRQA 3T0BA 4E2SA 4LIVA 3BTYA 1N3PA 2XJUA 3M70A 3CNAA 5FUPA 3GZTB 2ZJCA 5JZGA 1CWPA 3RMYA 3HPNA 3VN4A 3TB0A 1CAWA 2CHHA 1HXS2 5APAA 3ZDVA 4AHYA 3HBZA 1NX9A 5FPVA 3MFCA 3B3QE 1US2A 1AX0A 3APBA 4C1WA 1AR83 2WN3A 3WG1A 4D7TA 2FDJA 3D0JA 2WNUC 2A1XA 4YYOA 2VMFA 1PO21 4UAPA 2XQRA 3E5UA 3WCRA 4CA9A 2VGDA 4NOTA 3UJOA 2E7TA 5DZEA 3SISA 1PMHX 1HXS3 3DYPA 1IS6A 1VBD1 3H8RA 2B46X 4IXLA 5T5JA 4CDUC 3NNGA 4L0PA 3ORJA 1LENA 3CJXA 5BNPB 4GD4A 1UO9A 2QZ2A 4KWUA 1STMA 3OTFA 5K7PA 5K0UA 3ZXLA 2RS51 2ARBA 3RNSA 3VGIA 3HNYM 5F5IA 1PZ9A 1FAYA 2DCTA 5J09A 1COV2 4NIAA 5C8WA 2E6VA 1ZNPA 2FBEA 2DUPA 4TSVA 3ZFFB 2B5HA 5GM0A 3F95A 4UW5A 3AKPA 2XUMA 3S5QA 3V65A 3RPQA 5JLVA 2ZKLA 4NUBA 1COV1 2OUJA 3DL3A 1XB9A 3KWVA 4KU8A 4Y5TA 4UW6A 3KV5A 2OKXA 2WFF2 1ENXA 1TZOA 3IPVA 4XFCA 4QPGC 2ZTNA 3WDXA 5DAPA 2W1UA 2DUOA 4MO3M 5L73A 2AACA 1F15A 3PIGA 2VMCA 3PJQA 1ZRRA 5FZ0A 2V72A 1LHUA 3ZIXA 1YEWA 3VBFB 1RJ7A 1XYNA 1UL9A 5C4WC 4KBZA 2BV4A 3AP5A 4FTSA 4A7ZA 2O14A 4LK6A 3MLJA 1K5JA 4CUGA 2QQUA 2Q1ZB 2WNUB 5F3EA 5FJHA 2AZ5A 3PLQA 2HWF2 3DKWA 5LY2A 1SMVA 1ZRIA 2NZ9A 3DXUA 2YPDA 2YPJA 4KWKA 2W87A 4A44A 2P6CA 1RUI3 5FYMA 3B7MA 2Y6LA 2A6VA 1DG6A 4CEWC 4LORA 3OD4A 1HRI1 1GMMA 2YB7A 5A6YA 3ZXFA 2W68A 4QB6A 2Q8CA 1ZZBA 2BNNA 2WWUA 1ND3B 2D40A 4XMAA 2BGOA 2NQYA 1F5JA 3PVOA 4J1XA 4O9GA 2DYCA 5GZFA 4FBFA 1D0GA 1RMU2 4EWDA 1O3TA 3WZ1A 1ZBA2 4XACA 1MR5A 1N1SA 4XAEA 4OFGA 3LFIA 1YO8A 1HRV3 1UAIA 4FPLA 3VBRC 4WVWA 3AL5A 3RZLA 2D6OX 3ACLA 4UFJA 5JSOA 3BN6A 4LKSA 4S2HA 4IGPA 3HWJA 2HJIA 2EAAA 1OFNA 3JQXA 4WVMB 3ECQA 5F32A 4GWIA 3AM2A 4CXWA 1MQTB 2P6HA 1VMFA 1Q3EA 1IG0A 2I2SA 3NKTA 1NZIA 4HKLA 1WWYA 1VMJA 2VW0A 3PUAA 4BXSV 5JXIA 3NV4A 4YW6A 3MW3A 5T50A 2ORXA 3KHCA 1H9WA 5C33A 1JI6A 2RR12 4ZY9A 1MZ5A 4JCKA 1YI7A 3NV2A 4NHYA 4FOVA 2MEV1 3POYA 4LLFA 3IB3A 3IDAA 2W2IA 1U5XA 1XU1A 2VC9A 2VBBA 4KQ7A 1H8TC 3KF5A 4Y24A 3VZJA 4EN6B 4ATEA 2XJSA 3PIJA 5FXXA 3E1F1 3O14A 2DVBA 3O1OA 2JG8A 2TEPA 5FKCA 3NSTA 3SNMA 3C3VA 1Z78A 5F3GA 2DTWA 3CJIB 4CEWA 2VZQA 2X05A 4CEYC 1UZZA 3FWEA 2VUAA 4P02B 1AYN1 3MFAA 4LE4A 5FYTA 4N9HA 5A3MA 1GOHA 5EWSA 4QM8A 2VU9A 4K8RB 4Q8LA 1WLWA 1B35C 2QQLA 3NMBA 3ZFFA 2GALA 3LSEA 4ZU4A 1MVEA 5LATA 3H50A 1O59A 1E5IA 4BH9A 3VKOA 5KXDA 2R7EB 2XBO2 1YFXA 4BLIA 4JKLA 1OOPC 2KXLA 2VOTA 1OUXA 3GZUC 4MSVA 3JB8A 3I3EA 2YBSA 3ZXAC 4CUAA 1SHWB 5BNPA 4P5HA 1UN1A 1AR91 4RS5B 2VQTA 1LU1A 2JDMA 3T4VA 3WOGA 1DQ6A 1X82A 1W9TA 4Y22B 3RZZA 2YUEA 3U78A 1DIWA 3WNLA 1C5HA 3VBHB 4QQLA 5FO7B 1R64A 3IMMA 3LKJA 3E6CC 2UWAA 1JZ8A 2PQQA 3OGRA 2VG9A 4R9AA 2WFPA 3PUQA 3BIEA 3USSA 5JVVA 1DCSA 2PHFA 3FC0A 1BCXA 2I07B 4AGVA 3KV9A 3M8LA 3VHOA 4CSWA 3WSOA 2VCMA 2VVEA 2F4PA 4W6XA 4NWWA 1KGYA 1R093 1UY1A 1US3A 2BVVA 4RS5A 1JU3A 5FPUA 4YW3A 1QXPA 4RR3C 4YRDA 3PU8A 2GP3A 5FZGA 3AP9A 1WW5A 1CD3G 2RS53 3PDQA 4QXBA 4DXTA 4A7KA 1TMF2 5E88A 3VKMA 2O8OA 1X33A 3KV6A 4PCRA 3AL6A 2PAEA 3C2UA 2IWGB 4GB32 1WBFA 3D4KA 2WBKA 2ZGSA 1W2UA 4DEVA 3N7LA 2W91A 1DQ0A 1G6NA 2K2SA 3OUHA 3ES1A 4KL1A 1SDDB 3RG0A 2QUOA 1X9PA 2HWB1 1WUVA 1FNZA 5C5UA 4AQTA 4UOJA 3MIFA 4GMP1 3TEZA 1UOGA 2HWF1 4J1WA 3FUOA 5JMCA 1RUE3 4XBQA 2LW8A 2ZGMA 1RIRA 1IPKA 5GJ6A 5BNOB 4BOWA 1TME3 5JZGC 3FBYA 3LOIA 1PNFA 4H14A 4IW3A 3OYWB 5M0TA 2G19A 4BWOA 3W9AA 4AEJA 3DCQA 2XLGA 3W5NA 2Y6KA 3KB5A 2RMU2 4AAXA 1FT9A 1X50A 1BQPA 3FMGA 5DAVA 4FFGA 2W95A 4MGQA 1GWKA 1NCQC 4NROA 3USUB 2ZZJA 1PO23 4QM9A 4UF0A 5DABA 5B4XA 4L2NA 5J98B 1K42A 1SCRA 4AQ6A 3V56A 4MADA 2EXJA 4B1LA 3TBDA 4AFDA 4BIOA 4QX7A 2WLPA 1AL22 3AJZA 2FHRA 4WM8B 1MACA 1J1TA 1PK6A 1XYOA 3BALA 2DFBA 4FTEA 3EYPA 2AENA 3RRDA 5GLVA 4AR2A 4P9WA 3RZMA 4QX8A 2WIIB 4MYEA 4BJ0A 4XF1A 3VDAA 2OX0A 3IDBB 3PMSA 2EIBA 1WCDJ 4JKKA 4PQ9A 5KHKA 1AYN2 1Y3TA 1NQDA 3BOPA 5LA0A 1FMD3 3OGSA 2BDRA 1AR63 5FZ3A 2RVAA 4NIGA 4MXVA 2WT0A 3JD72 4JRAA 3UKNA 1FPN1 3K3NA 4JQRA 1E5HA 3MIBA 4GIQA 2H0VA 3IIAA 5LRRA 4YGDA 2VTFA 4COZA 1OOPB 4XQWA 3VBUC 1GQPA 3VL9A 5F1RA 2D97A 2R1DA 1BXHA 1FPN2 1OVPA 3K3OA 4DUXA 1IS4A 2LALA 2OIIA 2AR6A 4YZ2A 4NMIA 1NYWA 1W6QA 3GXUA 3MW4A 1LOGA 3TEWA 2A6XA 3LGRA 4XUNA 2KM2A 2V5YA 4GH4A 1LOFA 1NLQA 3IWZA 4MVTA 5A7QA 1ZRCA 2ZX4A 4XXAA 1UD1A 3WX5A 5BNNB 5I0TA 4OZXA 2K9ZA 3ALQA 1G9BA 4OUEA 3ZXEA 2D5FA 4D94A 3S6PA 2FD8A 5FY9A 4WM7A 4H7MA 4QWNA 2XJRA 1S0IA 1H2KA 4Z1VA 4HSLA 4Y22A 5FYVA 3JBG3 3KV4A 4LJHA 3VKLA 1C8M1 2WZEA 1Y4WA 1U0AA 3FX3A 3LFMA 2Q30A 4Q27A 1O5UA 3E97A 1GWMA 1K45A 4QPIB 4IESA 3JUUA 3P1IA 2ZEZA 5FZAA 1ULOA 3VBOA 1FV3A 2A7AA 4AFBA 1R091 2J1SA 3JB4C 5CNAA 2EICA 1CAXB 3RZHA 1G8WA 1AL23 1IHMA 1PZ7A 5CZKA 3W59A 4CDQB 5D8AC 1FX5A 3NW4A 3K48A 4L8QA 1FYUA 1AX2A 3ACIA 3SKVA 4AOCA 2BBAA 1PO22 4PLOA 1TE1B 2OT7A 3AFGA 1PO11 1W05A 1WMEA 2TNFA 2VNRA 4RQPA 1YJLA 2DVFA 1XNBA 3A23A 4B7EA 5FYBA 4CEWB 1SPPB 2FMDA 2JG8B 4N43C 4BQ1A 1FOD2 4WVVA 2GNTA 2X53S 4EZHA 5F2WA 1LOCA 4W6WA 1RUOA 4RHV2 2Y38A 2J42A 3BVCA 3GZAA 3KLSA 3BU0A 4JGYB 5LWBA 3HQUA 1TME2 3AC0A 5L19A 3K2OA 3PL0A 3LOBA 2YC2A 1VBB2 2FQPA 2R063 3ZSJA 2ZXQA 1VLNA 4Q4Y2 1EUTA 3M1HA 1QJY1 3LEMA 4C90A 2UY8A 2FDGA 1TG7A 2OQ7A 4E2GA 1SLAA 3RSJA 1F9KA 2CAVA 2WQZC 1LOFC 3EMRA 2FCUA 1E5SA 1PIV1 4ASLA 3HN3A 1AL21 1OI6A 1J3PA 4XBNA 1CIYA 4LO6B 4LUMA 4QQOA 5T5OA 4AI3A 5HCHA 1C4RA 4EQVA 5F6LB 5FOJB 4QQHA 4XJZA 3T0AA 4CDUA 1XBFA 4MXWB 4YWAA 3H9AA 5A3OA 1QDCA 1WBLA 4LBQB 5DAWA 4YG6A 1RTVA 3GCWA 2W0XA 1J58A 3POBA 2QFEA 1MEC3 1OHFA 4XILA 1S0JA 4GULA 1RUJ1 4N53A 3ZXKA 1O8SA 3OBZA 4Q4X1 1DP0A 4KG8A 1H0BA 2PA7A 1L7RA 5CFCC 3ZMNA 1IZ3A 2SLIA 3H1MA 5T55A 1SQ4A 4IE4A 2QJVA 4BMBA 1S2KA 5DAQA 4DRRA 2ZS6B 4XF3A 1UXZA 5C71A 2D6LX 2ZEWA 3IDCB 4N43B 1DZQA 4QU1A 4BQXA 1HKDA 2OPWA 5EJ1B 1XE7A 4CE8A 4AI1A 4MH0E 3WDTA 4W6YA 4YARA 1PIV3 2Y60A 3C7OA 1Q8OA 1YFWA 2WAAA 2ZGOA 5DPNA 5HBAA 4K8FA 1GLHA 3WP3A 5DUUA 1BK1A 2ZHMA 1OKQA 4MX3A 1KRIA 2BFUS 5HXVA 4AW7A 3CKHA 4IE7A 2ZEYA 5E1RA 1WW4A 2FMYA 1V70A 3PNAA 4TN7A 3VBRB 2DVDA 3S0MA 2OZJA 1YJKA 4BQWA 3LE0A 4HXCA 5IWFA 5A6ZA 5FOBB 5I0DA 2HWD1 4HVRA 4PDWC 4FQZA 5CFDB 2HWC2 5JXHA 1WLTA 2CY6A 4KH9A 3VDBA 2YC0A 2ZMLA 3IN9A 4XCAA 1UNBA 2CGOA 3NO8A 4MGIE 1G7YA 1CJDA 4XZUG 3G6JB 3CF6E 4QX3A 3PMEA 5J36A 3NNMA 1GANA 3U4XA 5LK7B 4HK9A 1M4WA 5FZ6A 1AL0G 2RR13 2VOWA 3TEXA 1W0NA 2E33A 3SH5A 1QMJA 1KJLA 2XG3A 3AX4A 4PQQA 1W8OA 1JZ5A 1D2QA 2FZ1A 1OH3A 4M3CF 4HT1T 1UKGA 2OXBA 1L7QA 2R061 4A4AA 5LBEA 4BE3A 3POEA 1GBGA 2WS91 2O0OA 3KHBA 4Q0PA 3DECA 1TMF1 3MPPG 1WCSA 5GALA 3IMNA 1CR7A 3H8UA 4QU2A 4D6SA 1REEA 2QQPA 3N3HA 3OBAA 1UYPA 2DCJA 2GC2A 4GXLA 1R1A2 1ND2C 3NJZA 4CCNA 1O6UA 1O91A 5L9RA 5FZDA 1BMV2 3VKNA 2BBVA 4GMP0 5IVCA 5HCAA 4S2GA 1YCIA 2G9GA 1XNAA 1FATA 1LU2A 3WCSA 4WVMA 1DGWA 2VZ3A 5LBBA 2Y6GA 1ODNA 1W2NA 1O4YA 1KDKA 1DGRA 1QJU3 4A7YA 2P17A 1EYBA 2ZHNA 4QKNA 5EZWA 3NJYA 2XJTA 1EY2A 1MEC1 4M4PA 1RUI2 2JIGA 1YFUA 1W04A 3O0WA 4LBKA 1WA4A 5KHIA 2Y6JA 3EB7A 4BDVB 3ILRA 1N1YA 5FZMA 1W8TA 1QQP1 3AMPA 4CDUB 1LHVA 2VTXA 4JVAA 4KU7A 5LA1A 2GMPA 1LOEA 1RUE1 2RJKA 3GBFA 4OI4A 2JDYA 5BNOC 2R042 1LB2A 1OQ1A 2EVXA 5CG9A 2ZACA 1OURA 1PVC2 4ASMB 2RS12 4ZHNA 4QMAA 4EROA 3ST7A 1QJY2 1K5MC 4FCAA 2VZ1A 4OHWA 2HLEA 5CISA 4LMFA 1RUF2 3R0RA 4LLOA 4V2VA 3SH3A 4EWEA 1WLCA 4AYUA 2ZMNA 2JEMA 1PX4A 1EPWA 4I3GA 1OPOA 1S0DA 3C7EA 2XJQA 3KGZA 1LEMA 4DQAA 3HN1A 5ISLA 2VOXA 3PTYA 3J7HA 3OUJA 1W6PA 3VBFA 2P3KA 4ES9A 1ASJ3 3SITA 1VB2A 4XJWA 2R043 1VIWB 3GBWA 3WQ7A 1W28A 3U0ZA 4Z2WA 2WR9A 2WWJA 4HLTA 2BWCA 1DLCA 2ZGPA 4QPGA 3H8OA 4C1XA 3Q9OA 2WNOA 2DVAA 1KS5A 3NVCA 4O65A 1RUJ2 1SFYA 2HWC1 5FZCA 1Z7S3 3AKTA 4XFHA 4Y5Z0 1UX7A 2R16A 3L2YA 2JWPA 4TXWA 3WLUA 5BYNA 2IVJA 2RM21 5GZCA 2HBTA 4PBOA 4B3NA 5JOZA 1UU6A 2WYSA 4WVZA 4U36A 2F17A 3C8XA 5GLZA 1QJU2 1LECA 4UT5A 1UF2C 1Y9MA 1UKRA 3WNPA 1AR82 1W8ZA 2Z4FA 1NQJA 5IAVA 2O1QA 3VZLA 1VP6A 4CCCA 4KGGA 4DEQA 1TEIA 4HETA 4P9GA 3QH6A 4PIYA 1RHI3 4K1ZA 2PHRA 3NAPC 4LULA 4Y3OA 2BQPA 5LASA 1R1A3 2ZX3A 5F5AA 5GKAC 2RDRA 4B4QA 2W3JA 3NNJA 1UZYA 1XSQA 3AK0A 4XJAA 3ZYGA 1UY3A 4OUMA 2WSUA 2Z2SB 4BQ3A 2GNBA 5FRAA 5F37A 1CAVA 1CPNA 1NCQB 5T54A 2OW4A 5DAXA 3WT3A 1BK0A 3AMNA 3RQ0A 3ABZA 5I8TA 4IV1A 1RUC3 2GSYA 1CVNA 4AAPA 3THDA 4U2AA 1RUD1 2EALA 5FYYA 4FFFA 1RUG2 2KR2A 1W90A 3TAYA 5FMOS 3MZHA 2J1UA 5FY7A 5IT6A 2Q8OA 1ZZ6A 1NE4A 4AEDA 5JZGB 1ZREA 4V2WA 3T4HB 3ITQA 5FV3A 4E4HA 4CUCA 2JDNA 1O5LA 2CGNA 1NXD1 3LZZA 3V0AA 5HCFA 3UK9A 5KXCA 3CHXA 3WEZA 3BPZA 2VPVA 3MEPA 1VBA1 2E32A 3IZOA 2I74A 4I30A 4MUVA 2ZGLA 4CDXC 4LO7A 4K7JA 1H8TB 3U14A 4FTBA 2GP5A 1WCUA 3SMHA 5FIXA 4D3WA 1SLIA 4LO5B 3K4AA 2F6BA 4CDWB 4NO4A 4OYUA 5G04L 3WF1A 1O3SA 2VR4A 1AJOA 3VL8A 5JOXA 3POWA 2MEV3 2X29A 4P5YA 2R062 3PJYA 4DUWA 2WKKA 4QB2A 2D44A 1JZ3A 1W0PA 2RM23 3U4SA 3M7AA 1PK6B 1V0AA 4XVHA 2G4IA 5FO8B 1RJ8A 4NIIA 3GZEA 2Y6HA 2VXJA 1NAEA 3BOWA 2WZR1 4XMIA 2VCCA 2OPKA 1QJX3 2VBPA 5DUWA 3P6BA 5IAXA 2QQNA 2DBIA 5FZ4A 4BISA 1F4AA 3PVBB 4Q4X3 1V6NA 5D2AA 3W58A 2PHUA 4AVVA 4CVUA 4EN7B 2PLV1 4Y1XA 3H3LA 3LIGA 4JV4A 1RINA 2YMZA 5DUXA 1PX3A 5L7OA 4NHMA 1EP0A 3T0DA 4DPNA 1IKQA 2A6YA 2JDKA 4WM7C 3OYWA 1UIJA 4YZ4A 4A41A 1BLZA 5L36A 1CZVA 1MZEA 4BK5A 2AEZA 2JDHA 4AZZA 3WG2A 4AEKA 4Z07A 1BYHA 1TNFA 5FP3A 2XL9A 1PHMA 5A1LA 5CBLA 1DYOA 4XUPA 3LPFA 4LR4A 4GALA 3QCWA 5FP9A 1KD7A 4AI0A 1OD3A 1FI2A 3T1LA 3T09A 2P4EA 3B02A 2QQVA 5FZHA 2XDVA 3KCCA 1UYZA 3RJRA 2V4VA 2DV9A 3FN9A 5FZIA 4B8EA 1RXGA 3MICA 4QX5A 4BA6A 4EN9B 4IDZA 2YROA 3A21A 3HQRA 1KFUL 2IFRA 1OMIA 3Q8CA 5FREA 1JMUB 3POSA 3VDDA 1VBC1 2Y34A 1WCKA 3H7YA 3IIIA 2CTVA 2ZKNA 2YG0A 2WA4A 4RR3A 3CIHA 3WINE 3OJBA 3ZPOA 4N90A 3J7MA 1UU5A 3T2TA 1OQDA 3A4UA 5J96B 3AVRA 1XNTA 2P2KA 3CLPA 3I8TA 1GU3A 1O8PA 5A3NA 1V6JA 1EV11 3POIA 1S0CA 1J83A 4KNCA 4Q2FA 4JZRA 4OI1A 4GKXA 2XONA 5C3RA 4OI2A 1D4M3 1ND2A 2IXHA 3FFQA 2YC4A 4FPKA 4Y20A 4XIOA 1CESA 2ET7A 1VAKA 5I0SA 1AR62 4Q1PA 2OUHA 1RUG1 2VZSA 4FVVA 5EHDA 5A6QA 3EXUA 4TLFA 4LT5A 1QH7A 3ZSKA 3NL1A 4UW4A 1GP6A 1RUH2 4XBLA 4XF0A 3ZYPA 1SFPA 2P3JA 2JECA 3N9QA 5A32B 3T2PA 4YPJA 3MF6A 1T6BX 1KXGA 1VALA 1LOAA 4QDRA 1LESA 3AB0A 4XHBA 4A3XA 3FLPA 3X29B 4FQ4A 4N9IA 1HJFA 1GOFA 1IGOA 2TUNA 4LE3A 3WDUA 5LZ6A 5FLHA 1ND2B 3VLBB 2R071 3ZR5A 5LEJA 5F5QA 2FZ2A 5DUVA 2Y64A 5C3OA 3LDKA 2PHLA 2Q1FA 3UETA 1QIQA 3QLQA 4GAZA 2UU8A 1BKZA 3O1TA 1TQ5A 2DCZA 3UKTA 3WF2A 3VDCA 4A6OA 4XABA 3BTZA 1C5IA 4CU6A 1RUH3 2B9VA 1UIKA 4MXWA 4AQ2A 4XF9A 3WNMA 1QEXA 5LW9A 1HB3A 1C8NA 3RI8A 4LBJA 4BYYA 2A75A 3DF0A 4XF4A 5AC91 2WINB 4DXSA 1RUC1 5LB6A 4INDA 1Y9QA 4XURA 2WO1A 4UFLA 4XTPA 2R0FA 3MIHA 4YGBA 1DBNA 3AMHA 1KDMA 4N53B 3EJKA 4ZKTB 4HKWA 4OVEA 1DGWX 1YQ2A 2VCAA 2OYZA 3VBFC 3ZR6A 5A3LA 1N1VA 2J1TA 2ARXA 3VD5A 3BB6A 3O5SA 3MUY1 2ARAA 1AR72 1SBEA 3ZPYA 2XKOA 2C6SA 2JDPA 1DU3D 2JXAA 1H1AA 3ZOIA 5FYIA 3BGAA 3D82A 5F2SA 1I6XA 3WVJA 3M3QA 4PIXA 5C8CA 1POV3 2VMIA 2DF7A 4TWTA 3VHPA 1A8DA 2W08A 2VUDA 2RG4A 3JD73 1RXFA 2GZWA 4F7ZA 2RS52 3Q8FA 3ZYHA 1OQEA 2Y8KA 2XL7A 3ZSLA 4BU2A 4CXXA 4FPEA 4Q4W3 2FDKA 2VD7A 1YC61 5CYYA 5FPBA 3U11A 4CCLA 2VBDA 4K9SA 1R092 1PNGA 2JE9A 2WSVA 2ZHLA 3WHTA 4QHBA 4RL7A 3UL2A 4OUSA 4A6SA 3RZJA 1RHI1 3VBUA 3M3CA 1OLQA 2WZR3 4J6GA 2YDEA 1NLSA 1CAXA 4IEOA 4MV2A 2H6CA 2AGSA 2DURA 3GHMA 4PHZA 1QH6A 4MOAA 4E2QA 3LA2A 4QPIA 3T08A 4O9EA 4LBLA 4Z82A 3ZXJA 4IV3A 2ADDA 4PJYA 4LBQD 4ZPIA 5T3NA 1DLLA 4XJ8A 2QQMA 1SPPA 4CUBA 3T30A 3EBRA 1S2BA 1V9U3 2LM3A 2VQUA 3GJBA 3MF9A 2WUHA 4O7XA 4B4PA 5K0UC 1JYTA 4D6RA 4YFZA 2XBO3 4SBVA 3AZYA 3NWKA 1JUHA 3SEEA 3WDWA 3MW2A 3TYJA 2TBVA 3I2HA 4LHSA 2X5IA 1M06G 2RS33 1HQLA 1IOAA 2PTMA 4LXLA 3W20A 2KD7A 1ASJ1 3VD4A 1AYM3 3IPVB 2GC0A 2DUQA 5B2GB 1L3JA 3THPA 4KI5M 3WP4A 2MEV2 4UFIA 2PHTA 4QX2A 4LO4B 1CJPA 4XIKA 4UW3A 4CDXA 4LOTA 5IK4A 3UKVA 1X8MA 1YIFA 3I59B 3RDIA 1RUD3 1OOPA 3HT2A 1I5PA 2W5FA 3OF1A 3ZFEB 1QU0A 5FKBA 4AFAA 3AKSA 2YY1A 4RQPC 4YM1A 5LBFA 3I4IA 4ZXKA 3B9CA 3CL1A 3I97A 1HW5A 3K4ZA 2ZX1A 1AR61 5I0UA 3I2DA 4CPBD 1LOBA 5IVBA 2BPA2 4MG2A 2JDAA 3OY8B 1JYVA 2W1QA 4GH4B 4GWJA 2DBNA 2BERA 2GNMA 3MPBA 4XDOA 5F6KA 5LA2A 5A3WA 2VMDA 4I0WB 2PMWB 1IQDC 1W99A 1XNCA 2ATFA 5C4WA 2XBO1 4P9JA 2GN3A 5DDJ3 5JSRA 3NV1A 4ONUA 1AR93 3O1UA 4FOQA 4LBMA 1RUC2 4WM8A 4XHXA 4FAHA 4WZCA 5E6HA 3MV11 2ZMKA 4URAA 1LKNA 1DGLA 2VMGA 2WQ8A 3BTAA 3BI3A 4E8DA 3S30A 1RUH1 2WJSA 1YFYA 5FZKA 3ZSMA 2QZ3A 2Z5WA 1RVF1 5FZ9A 3NJXA 5ABJC 1BBT2 4YZ3A 1EAH1 1QGLA 2J1AA 4LK7A 3LAGA 4NHXA 1UOFA 5BUVA 2DFCA 2KA3A 4GWMA 4HMZA 2BGPA 4CXYA 2A70A 3Q8AA 4X6QB 3RYRA 3VBRA 2CU5A 3KM5A 4QKFA 4BQ5A 4Q5OA 1UWWA 1HN0A 5A6XA 5IK5A 4JKMA 1LRHA 3ATGA 1QJX2 3P3PA 3VD7A 3ZFGB 5ABJB 3KGLA 5BNOA 1RB8G 2ZEXA 4FFHA 4M01A 3CMGA 4ZS3A 2BRTA 4XFGA 4FOYA 3U37A 2ZGKA 4Y1UA 5TSWA 3AP7A 4D8MA 3QOPA 1ZZ8A 3VBHC 2P3YA 4UWDA 4LITA 3POJA 1YWKA 5LCWL 3WUDA 4E9KA 1YIPA 5FXVA 5FO9B 3P3NA 1ULEA 1QJZA 2PLV2 4CPBA 4AI8A 1FMD1 3I54A 1YI9A 3BIWE 1ULPA 3VBSA 4CYDA 1BVVA 4XFIA 2XH6A 2YBKA 5KHJA 4CTEA 5FQ0A 2D3PA 2Q5TA 4YW7A 5KC6A 1QQP2 1WW7A 4PDWA 2WFF3 3B01A 2GH2A 4DMIA 3DGTA 2VECA 5FPLA 2UYAA 3SCFA 2W1WA 3I2FA 3POGA 5T52A 2QCSB 3MHZA 2PQSA 5FBZA 1OLME 1ZZ7A 2WT2A 3ZSEA 3RYKA 1MPXA 4DIQA 1RUG3 2J7MA 2ENRA 3AVSA 4RD7A 1YHFA 4PDWB 4PLMA 3WG4A 2D3RA 4MGSA 4C8DA 3ZFGA 1LTEA 2ARCA 1DHKB 3AYAA 3GBGA 3UYJA 1XC6A 1AUYA 5IVYA 3SCGA 4D6QA 2PELA 1PMIA 2GU9A 3SLIA 4K20A 1UY0A 4K3UA 4BB3A 2BWAA 4QX0A 1Y43B 1B35A 3ZFFC 1OLMA 4ZZ8A 2FDHA 1SLLA 4XQDA 4KBBA 4D7SA 1GOGA 4FSJA 1EPZA 5I0RA 5EP9A 2PXJA 1RHI2 2DU0A 4LHNA 2ADEA 4QQPA 2WAOA 2JIJA 2VZOA 2ZGTA 5IJRA 3O0XA 1LGCA 1GFF2 1ONAA 3J8F1 5FMDA 3OBRA 2V5DA 5A7OA 3I2IA 3RS6A 3ZLIA 5C6CA 1UOJA 1JHJA 2R6QA 3SCHA 1H1MA 2AYHA 3E5QA 1CAVB 4M0HA 4RFRB 3HOBA 2ETEA 5D8AB 4Q0UA 3D5OA 1MS5A 2W46A 1XU2A 3BYWA 4E4DX 3VUOA 2BVBA 1RUJ3 1XXNA 2JDZA 4CCOA 3E6BA 4L11A 4GWNA 5HI0A 5C9AC 4FP2A 2WNEA 1K5MB 1QJEA 1H8VA 3OB8A 1J3RA 3OGJA 5IVJA 2IVIB 2CDPA 1GZWB 3FE5A 4QX1A 3VB9A 3HNMA 5FZ1A 1YXWA 1RUNA 1X9TA 1VMHA 3VDDB 1GICA 5JXJA 3FUQA 3VZNA 1ASJ2 1LULA 2BYVE 1MS0A 2BNMA 1HIXA 2AC1A 3DUIA 1CN1A 3ACFA 3E5XA 2Q4SA 1RVF2 3BODA 5JSPA 2XOMA 4B1MA 4BZ4A 3LEIA 4JHTA 2EIEA 5K9YA 1S0EA 3LSDA 4CDXB 2PN5A 5FZOB 1UQXA 4XTMA 3RI9A 1UYXA 4TYSA 1S55A 1ULFA 1BZWA 1JOJA 4GZ9A 1CPMA 3KZ4C 1RVF3 3OG2A 4UI9L 2XWBB 5DMYA 4AHZA 1EV13 1OSGA 1HN1A 1SEFA 2ZX0A 1COV3 4JGZA 4BM8A 5C9AB 4OHYA 3AZXA 3RFRA 1RYYA 3AFKA 4ISQA 4P9YA 3HEIA 2D93A 3WW2A 4W8JA 5AC92 2CL2A 1SLBA 5DZGA 3HAGA 2WLQA 1PGL2 2V73A 5JI9A 1ULGA 3IDEA 4GQ7A 3VHRA 5J48A 2XJPA 2D98A 1LJ7A 3FL7A 1WKYA 5DQ0A 4LEJA 5GLWA 3AYEA 2QQJA 4XFBA 3ELNA 1JH5A 1TNRA 1H9PA 1NKGA 1W8UA 3OEAA 2VJXA 4IV3C 4TZDA 1GZ9A 4I09A 5A3UA 4ES8A 2SBAA 3A0KA 5KC5A 3TWIA 1QJX1 2MHFA 3NAPB 4IEZA 2JENA 1GV9A 2X5IB 4FAGA 3EO6A 3ZKUA 4PT6A 4ITCA 4YZ1A 4AEMA 1GQGA 3LQCA 5CEHA 1XNKA 2PHXA 1V6KA 3DYOA 3VDDC 1QNYA 2VQAA 4PIZA 4V1PA 1QXJA 4LBQA 2Z69A 5FZFA 3O12A 2AUYA 4I0AA 1V00A 5F39A 2XVGA 1K3IA 3ON7A 4O61A 1ND3A 1S0FA 2XMLA 3OPWA 4JX0A 4Q4Y1 5FZEA 4C91A 3HQXA 1GUIA 5A3TA 1PO12 2HEYF
chains in the Genus database with same CATH topology
2QQIA 3I2KA 3THDA 1LNSA 4AG4A 3ECQA 4GWIA 4A3ZA 2J1UA 4BXSV 5JXIA 1OH4A 4CUCA 1CX1A 2QQOA 2ORXA 1JI6A 3CZUA 4ZY9A 3WEZA 4DUVA 1XPWA 2E32A 2WO2A 3IDAA 3IB3A 3A22A 4RYDA 2VC9A 3PUIA 3K4DA 2L9LA 3E1F1 3K4AA 3LPGA 4ZZ5A 3K75B 4OYUA 5G04L 3WF1A 2VZQA 2X05A 2VR4A 3C7GA 4P02B 4P5YA 3MO4A 4DUWA 1GOHA 4QB2A 1JZ3A 5FUIA 2QQLA 4XVHA 3GDBA 3SKJE 2Y6HA 1NAEA 1O59A 2VCCA 2R7EB 3P6BA 4D0QA 4JKLA 2QQNA 2VOTA 2VL4A 3WF3A 4CUAA 3I3EA 1F4AA 1SHWB 4CVUA 2VQTA 3JXSA 2E26A 1JYWA 4W50A 1PX3A 5IFTA 1W9TA 3WNLA 4CU8A 3T0DA 3K46A 4KMQA 1R64A 5JMOA 4A41A 1JZ8A 1CZVA 3OGRA 4BK5A 4XUQA 3T2QA 4A42A 1DYOA 4XUPA 3LPFA 3WSOA 1UY1A 1KGYA 1JU4A 4P00B 1US3A 1OD3A 4ARXA 1JU3A 3T09A 3MBWA 1UYZA 4DXTA 2V4VA 3FN9A 1UMIA 3IAQA 4ARYA 1GNYA 5JR2A 3A21A 3GM8A 1JYXA 2WBKA 3IIIA 3PUHA 4DEVA 2YG0A 3CIHA 2W91A 1P8JA 3IAPA 3HJRA 1SDDB 1XNTA 2E31A 2YFZA 4QB1A 4Z2AA 1W9WA 1GU3A 1JYNA 1O8PA 4UOJA 1J83A 3CDZB 1F4HA 4BK4A 2LW8A 2XONA 2BZDA 2YC4A 2WN2A 3UESA 5IHRA 2W47A 2VZSA 4QDSA 2Y6KA 5C70A 3W5NA 4XUTA 4AAXA 1H6XA 2W95A 4MGQA 3WF0A 3T2PA 2VZTA 4YPJA 4QDRA 3MV01 1K42A 1CZSA 5B4XA 4MADA 4W4ZA 1GOFA 2VZVA 3D3AA 2ID4A 4ET7A 1J84A 2Y64A 1UY4A 2J1VA 2QQKA 3EYPA 3UETA 3W5MA 4BJ0A 3VDAA 2XQXA 3WF2A 4A6OA 3VDCA 2EIBA 3WNNA 4CU6A 4JKKA 3WF4A 2B9VA 2RJ2A 3NQHA 3WNMA 1K12A 5LA0A 3OGSA 3VD9A 2RVAA 4DXSA 1KEXA 3NJVA 4XURA 2WO1A 1NUKA 2VTFA 5A1AA 2J1RA 1GQPA 3FHQA 4DUXA 1YQ2A 2VCAA 2J1TA 1OF4A 2W9XA 3VD5A 2B4KA 2VZRA 3MUY1 3GXUA 4OMDA 4XUNA 3GGLA 3BGAA 2WO3A 1D7PM 2RV9A 3FHAA 4OUEA 1CZTA 3WNOA 2Y8KA 5CYYA 2WZ8A 2WZEA 3OEBA 3WQBA 5C7GA 4DXRA 1K45A 4QAWA 5JXGA 3P1IA 2ZEZA 4LQRA 1ULOA 4CU7A 5JUVA 2J1SA 5G05L 2EICA 5CZKA 4MOAA 2VZUA 3T08A 1JZ4A 3ACIA 3SKVA 2BBAA 2QQMA 3A23A 4CUBA 4XUOA 3ACGA 3I2JA 2VQUA 2QBXA 2WUHA 3SEEA 1BHGA 3I2HA 4LHSA 5EIYB 3ZM8A 4M4RA 4PF1A 2KD7A 2W1SA 3AC0A 3F2ZA 4LPLA 3VD4A 2YFUA 4CU9A 1TVGA 2YC2A 2ZXQA 4KI5M 3HNBM 1EUTA 4QX2A 3A7QA 1TG7A 1UYYA 2J22A 5IFPA 1I5PA 1SG3A 2W5FA 3C7HA 3HN3A 1CIYA 3K77A 3I97A 3K4ZA 3MUZ1 5IYYA 2JDAA 1JYVA 5EJZB 2W1QA 4GWJA 3T0AA 2BERA 3UNPA 3LEGA 2VMEA 4HG6B 5LA2A 2VMDA 2WABA 3THCA 1IQDC 5B4NA 1W99A 3DYMA 4QPWA 4TTGA 1O8SA 1DP0A 3MV11 2WQ8A 1L7RA 3I3DA 4E8DA 2VM9A 4ZXEA 1OT5A 5J1XA 3NJXA 2J1AA 1UXZA 5C71A 2ZEWA 2BGPA 5EJ1B 4QDQA 2XHNA 1UWWA 2W92A 4JKMA 3C7OA 2WAAA 5DPNA 3VD7A 1JZ7A 3SEPA 2ZEXA 4P08A 3CMGA 2C26A 3U37A 5HPOA 3CKHA 4JHZA 2ZEYA 4D8MA 3I3BA 5LCWL 5I0DA 3LE0A 1H6YA 1W8NA 5JXHA 3VDBA 2JD9A 1UXXX 2HYXA 1ULPA 4XZUG 4QX3A 2C4XA 3ETPA 2W94A 1JZ2A 1UMHA 1W0NA 2E33A 2DDUA 2W1WA 3I2FA 4PQQA 4A45A 1W8OA 2PQSA 1JZ5A 5DN2A 3WNKA 1MPXA 2J7MA 4RN5A 2JKXA 1L7QA 4MGSA 4A4AA 1XC6A 2LS6A 1UY0A 1UY2A 3DECA 4IUGA 4QX0A 4ZZ8A 2VCBA 3T0BA 1GOGA 3OBAA 2DCJA 3LEKA 3HPNA 2WAOA 2VZOA 5IJRA 1NX9A 1US2A 1OF3A 1XNAA 2V5DA 1WCQA 2ORZA 2VZ3A 2WN3A 3I2IA 2CDOA 2Y6GA 1JHJA 2DCKA 2VMFA 4UAPA 4M4PA 3HOBA 2W46A 1PMHX 2Y6JA 3EB7A 4BDVB 3DYPA 2JE8A 3T2OA 5LA1A 3OB8A 3NNGA 4L0PA 2CDPA 4QX1A 3HNMA 2X09A 4KWUA 5JXJA 3HNYM 3ACFA 1JZ6A 2VZ1A 2HLEA 2XOMA 3VD3A 3LEIA 2WDBA 2EIEA 3C7FA 1PX4A 1UYXA 3C7EA 2OKXA 4GZ9A 1T2XA 2VZPA 4OMCA 3NRUA 3OG2A 4UI9L 5DMYA 2W1UA 4MO3M 1HN1A 2VMCA 3J7HA 2V72A 1EUUA 1RYYA 3CQOA 3HEIA 4W8JA 4OZOA 1DLCA 2C9KA 3ACHA 1PMJX 3FL7A 1WKYA 5DQ0A 2J1EA 2QQJA 1NKGA 3OEAA 1UX7A 2VJXA 2W87A 4A44A 4TXWA 2EIDA 3I2GA 2WYSA 2Y6LA 3C8XA 4FI9A 5F7UA 1GMMA 2YB7A 4PT6A 3WNPA 2Z4FA 4QB6A 3LQCA 3OGVA 3DYOA 2BGOA 1W9SA 4DEQA 5HXMA 1UZ0A 2VO5A 2W3JA 1UY3A 1K3IA 4JX0A 4E8CA 3CZJA 1GUIA 2X10A 3ABZA 3BN6A 4LKSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QQI A;  3I2K A;  3THD A;  1LNS A;  4AG4 A;  3ECQ A;  4GWI A;  4A3Z A;  2J1U A;  4BXS V;  5JXI A;  1OH4 A;  4CUC A;  1CX1 A;  2QQO A;  2ORX A;  1JI6 A;  3CZU A;  4ZY9 A;  3WEZ A;  4DUV A;  1XPW A;  2E32 A;  2WO2 A;  3IDA A;  3IB3 A;  3A22 A;  4RYD A;  2VC9 A;  3PUI A;  3K4D A;  2L9L A;  3E1F 1;  3K4A A;  3LPG A;  4ZZ5 A;  3K75 B;  4OYU A;  5G04 L;  3WF1 A;  2VZQ A;  2X05 A;  2VR4 A;  3C7G A;  4P02 B;  4P5Y A;  3MO4 A;  4DUW A;  1GOH A;  4QB2 A;  1JZ3 A;  5FUI A;  2QQL A;  4XVH A;  3GDB A;  3SKJ E;  2Y6H A;  1NAE A;  1O59 A;  2VCC A;  2R7E B;  3P6B A;  4D0Q A;  4JKL A;  2QQN A;  2VOT A;  2VL4 A;  3WF3 A;  4CUA A;  3I3E A;  1F4A A;  1SHW B;  4CVU A;  2VQT A;  3JXS A;  2E26 A;  1JYW A;  4W50 A;  1PX3 A;  5IFT A;  1W9T A;  3WNL A;  4CU8 A;  3T0D A;  3K46 A;  4KMQ A;  1R64 A;  5JMO A;  4A41 A;  1JZ8 A;  1CZV A;  3OGR A;  4BK5 A;  4XUQ A;  3T2Q A;  4A42 A;  1DYO A;  4XUP A;  3LPF A;  3WSO A;  1UY1 A;  1KGY A;  1JU4 A;  4P00 B;  1US3 A;  1OD3 A;  4ARX A;  1JU3 A;  3T09 A;  3MBW A;  1UYZ A;  4DXT A;  2V4V A;  3FN9 A;  1UMI A;  3IAQ A;  4ARY A;  1GNY A;  5JR2 A;  3A21 A;  3GM8 A;  1JYX A;  2WBK A;  3III A;  3PUH A;  4DEV A;  2YG0 A;  3CIH A;  2W91 A;  1P8J A;  3IAP A;  3HJR A;  1SDD B;  1XNT A;  2E31 A;  2YFZ A;  4QB1 A;  4Z2A A;  1W9W A;  1GU3 A;  1JYN A;  1O8P A;  4UOJ A;  1J83 A;  3CDZ B;  1F4H A;  4BK4 A;  2LW8 A;  2XON A;  2BZD A;  2YC4 A;  2WN2 A;  3UES A;  5IHR A;  2W47 A;  2VZS A;  4QDS A;  2Y6K A;  5C70 A;  3W5N A;  4XUT A;  4AAX A;  1H6X A;  2W95 A;  4MGQ A;  3WF0 A;  3T2P A;  2VZT A;  4YPJ A;  4QDR A;  3MV0 1;  1K42 A;  1CZS A;  5B4X A;  4MAD A;  4W4Z A;  1GOF A;  2VZV A;  3D3A A;  2ID4 A;  4ET7 A;  1J84 A;  2Y64 A;  1UY4 A;  2J1V A;  2QQK A;  3EYP A;  3UET A;  3W5M A;  4BJ0 A;  3VDA A;  2XQX A;  3WF2 A;  4A6O A;  3VDC A;  2EIB A;  3WNN A;  4CU6 A;  4JKK A;  3WF4 A;  2B9V A;  2RJ2 A;  3NQH A;  3WNM A;  1K12 A;  5LA0 A;  3OGS A;  3VD9 A;  2RVA A;  4DXS A;  1KEX A;  3NJV A;  4XUR A;  2WO1 A;  1NUK A;  2VTF A;  5A1A A;  2J1R A;  1GQP A;  3FHQ A;  4DUX A;  1YQ2 A;  2VCA A;  2J1T A;  1OF4 A;  2W9X A;  3VD5 A;  2B4K A;  2VZR A;  3MUY 1;  3GXU A;  4OMD A;  4XUN A;  3GGL A;  3BGA A;  2WO3 A;  1D7P M;  2RV9 A;  3FHA A;  4OUE A;  1CZT A;  3WNO A;  2Y8K A;  5CYY A;  2WZ8 A;  2WZE A;  3OEB A;  3WQB A;  5C7G A;  4DXR A;  1K45 A;  4QAW A;  5JXG A;  3P1I A;  2ZEZ A;  4LQR A;  1ULO A;  4CU7 A;  5JUV A;  2J1S A;  5G05 L;  2EIC A;  5CZK A;  4MOA A;  2VZU A;  3T08 A;  1JZ4 A;  3ACI A;  3SKV A;  2BBA A;  2QQM A;  3A23 A;  4CUB A;  4XUO A;  3ACG A;  3I2J A;  2VQU A;  2QBX A;  2WUH A;  3SEE A;  1BHG A;  3I2H A;  4LHS A;  5EIY B;  3ZM8 A;  4M4R A;  4PF1 A;  2KD7 A;  2W1S A;  3AC0 A;  3F2Z A;  4LPL A;  3VD4 A;  2YFU A;  4CU9 A;  1TVG A;  2YC2 A;  2ZXQ A;  4KI5 M;  3HNB M;  1EUT A;  4QX2 A;  3A7Q A;  1TG7 A;  1UYY A;  2J22 A;  5IFP A;  1I5P A;  1SG3 A;  2W5F A;  3C7H A;  3HN3 A;  1CIY A;  3K77 A;  3I97 A;  3K4Z A;  3MUZ 1;  5IYY A;  2JDA A;  1JYV A;  5EJZ B;  2W1Q A;  4GWJ A;  3T0A A;  2BER A;  3UNP A;  3LEG A;  2VME A;  4HG6 B;  5LA2 A;  2VMD A;  2WAB A;  3THC A;  1IQD C;  5B4N A;  1W99 A;  3DYM A;  4QPW A;  4TTG A;  1O8S A;  1DP0 A;  3MV1 1;  2WQ8 A;  1L7R A;  3I3D A;  4E8D A;  2VM9 A;  4ZXE A;  1OT5 A;  5J1X A;  3NJX A;  2J1A A;  1UXZ A;  5C71 A;  2ZEW A;  2BGP A;  5EJ1 B;  4QDQ A;  2XHN A;  1UWW A;  2W92 A;  4JKM A;  3C7O A;  2WAA A;  5DPN A;  3VD7 A;  1JZ7 A;  3SEP A;  2ZEX A;  4P08 A;  3CMG A;  2C26 A;  3U37 A;  5HPO A;  3CKH A;  4JHZ A;  2ZEY A;  4D8M A;  3I3B A;  5LCW L;  5I0D A;  3LE0 A;  1H6Y A;  1W8N A;  5JXH A;  3VDB A;  2JD9 A;  1UXX X;  2HYX A;  1ULP A;  4XZU G;  4QX3 A;  2C4X A;  3ETP A;  2W94 A;  1JZ2 A;  1UMH A;  1W0N A;  2E33 A;  2DDU A;  2W1W A;  3I2F A;  4PQQ A;  4A45 A;  1W8O A;  2PQS A;  1JZ5 A;  5DN2 A;  3WNK A;  1MPX A;  2J7M A;  4RN5 A;  2JKX A;  1L7Q A;  4MGS A;  4A4A A;  1XC6 A;  2LS6 A;  1UY0 A;  1UY2 A;  3DEC A;  4IUG A;  4QX0 A;  4ZZ8 A;  2VCB A;  3T0B A;  1GOG A;  3OBA A;  2DCJ A;  3LEK A;  3HPN A;  2WAO A;  2VZO A;  5IJR A;  1NX9 A;  1US2 A;  1OF3 A;  1XNA A;  2V5D A;  1WCQ A;  2ORZ A;  2VZ3 A;  2WN3 A;  3I2I A;  2CDO A;  2Y6G A;  1JHJ A;  2DCK A;  2VMF A;  4UAP A;  4M4P A;  3HOB A;  2W46 A;  1PMH X;  2Y6J A;  3EB7 A;  4BDV B;  3DYP A;  2JE8 A;  3T2O A;  5LA1 A;  3OB8 A;  3NNG A;  4L0P A;  2CDP A;  4QX1 A;  3HNM A;  2X09 A;  4KWU A;  5JXJ A;  3HNY M;  3ACF A;  1JZ6 A;  2VZ1 A;  2HLE A;  2XOM A;  3VD3 A;  3LEI A;  2WDB A;  2EIE A;  3C7F A;  1PX4 A;  1UYX A;  3C7E A;  2OKX A;  4GZ9 A;  1T2X A;  2VZP A;  4OMC A;  3NRU A;  3OG2 A;  4UI9 L;  5DMY A;  2W1U A;  4MO3 M;  1HN1 A;  2VMC A;  3J7H A;  2V72 A;  1EUU A;  1RYY A;  3CQO A;  3HEI A;  4W8J A;  4OZO A;  1DLC A;  2C9K A;  3ACH A;  1PMJ X;  3FL7 A;  1WKY A;  5DQ0 A;  2J1E A;  2QQJ A;  1NKG A;  3OEA A;  1UX7 A;  2VJX A;  2W87 A;  4A44 A;  4TXW A;  2EID A;  3I2G A;  2WYS A;  2Y6L A;  3C8X A;  4FI9 A;  5F7U A;  1GMM A;  2YB7 A;  4PT6 A;  3WNP A;  2Z4F A;  4QB6 A;  3LQC A;  3OGV A;  3DYO A;  2BGO A;  1W9S A;  4DEQ A;  5HXM A;  1UZ0 A;  2VO5 A;  2W3J A;  1UY3 A;  1K3I A;  4JX0 A;  4E8C A;  3CZJ A;  1GUI A;  2X10 A;  3ABZ A;  3BN6 A;  4LKS A; 
#chains in the Genus database with same CATH topology
 2QQI A;  1HDK A;  3NV3 A;  3RZK A;  4ZU7 A;  1JZ6 A;  3I2K A;  1UPI A;  1AR9 2;  1LNS A;  1BEV 1;  4UYB A;  4FPY A;  2GDF A;  3OPT A;  4UF0 B;  5FY4 A;  5FZO A;  4HOO A;  4COU A;  3N7M A;  1Q43 A;  4NWV A;  3GAL A;  4QT6 A;  1QDO A;  1SFN A;  2Y6F A;  4DB5 A;  2QQO A;  3O0V A;  4F8A A;  5IVV A;  5T5P A;  5KBF A;  5KHH A;  3CZU A;  1HJG A;  1QQP 3;  4JGY A;  4CDW C;  5SV8 A;  1R1Z A;  1C57 A;  4XCB A;  1WZX A;  2DVG A;  1Q8S A;  4L97 A;  4NRQ A;  4LKD A;  4CCE A;  5FR3 A;  2JJ6 A;  4AFM A;  4HVO A;  4LIU A;  3TN9 2;  4DZG A;  3CU7 A;  5C3P A;  1X36 A;  3WG3 A;  1UMZ A;  4MLO A;  2XR4 A;  1U12 A;  4RQP B;  5FMB A;  3B5L B;  4IV1 C;  1W2O A;  3C7G A;  2XLA A;  4QGM A;  1UPS A;  4NPL A;  4R8H A;  1AYM 2;  5FUI A;  5JOW A;  1YQC A;  3AMQ A;  3ZYB A;  4R4X A;  2JD4 A;  4CDQ A;  1YQ5 A;  5I8Y A;  1POQ A;  1QHD A;  3SKJ E;  2IC1 A;  2RS1 1;  2VMH A;  4LKF A;  4RHV 3;  3KSC A;  2VE1 A;  2B9U A;  5FLI A;  4Q1R A;  5FPA A;  1PIV 2;  2UYB A;  1AZD A;  4D0Q A;  1NCR B;  4NAO A;  2CNA A;  4XC9 A;  1W3V A;  1F35 A;  1FOD 3;  1V9U 2;  5CFD A;  5LRS A;  1XRU A;  1AXZ A;  1GZW A;  5HCB A;  1DFQ A;  1JOP A;  1NG0 A;  4LOS A;  4ASK A;  3JXS A;  1JYW A;  4W50 A;  1OVS A;  4XEZ A;  5H9Q A;  1VBA 3;  2P1B A;  3WW3 A;  3MYX A;  1J59 A;  2GN7 A;  1GNH A;  4KMQ A;  5SV5 A;  4YNI A;  1D4M 1;  5FZ7 A;  5JMO A;  3KCY A;  2V09 A;  3U10 A;  2VQ0 A;  4K21 A;  4LO8 A;  3J7N A;  4OHX A;  2A6W A;  4P14 A;  4YW5 A;  3BTX A;  1OA3 A;  2R30 A;  4R9B A;  5BNQ A;  4H55 A;  2HWD 2;  2XHK A;  4NVP A;  4A42 A;  5JOY A;  3ME2 A;  1QOT A;  1RL3 A;  3OSD A;  3WHU A;  5CB7 A;  2DU1 A;  1V6M A;  4LBO A;  4P00 B;  2Y0I A;  3VZK A;  4LNV A;  4Q4V 2;  5DG2 A;  1NE6 A;  2XVL A;  4ARX A;  4BQY A;  4AVS A;  5A32 A;  5FPX A;  1NA1 C;  2Y33 A;  1VBC 3;  5DDJ 1;  2E63 A;  3MBW A;  1OLR A;  1NCR A;  3MI8 A;  1ZRD A;  1H2M A;  3N35 A;  4L9B A;  1GNY A;  3JBG 1;  3AMM A;  1GWL A;  3K51 A;  1D0H A;  3GM8 A;  5JR2 A;  2XPJ A;  3LD8 A;  4XZP A;  4HON A;  3PUH A;  1Q5O A;  2RDN A;  1C8M 2;  3S5A A;  1HXS 1;  3GNE A;  1KFX L;  1CAU B;  3HJR A;  1PM4 A;  2E31 A;  4QB1 A;  2YFZ A;  5LK5 A;  4Z2A A;  1F2N A;  1W9W A;  3WQ0 A;  2JG9 B;  3I3Q A;  4UBH A;  4M00 A;  1MS9 A;  4HBN A;  1F4H A;  1VBB 3;  1B09 A;  2GC3 A;  1PM7 A;  4XFA A;  1POV 1;  4BK4 A;  1HQN A;  2IXL A;  4BQ4 A;  1Q8P A;  1ZM1 A;  2HWE 3;  1VE0 A;  4KG0 A;  4AVC A;  2F4L A;  4P9L A;  5FDB A;  3IBM A;  4AXO A;  5ACA 1;  5IK8 A;  2RS3 2;  1IS3 A;  4XE9 A;  2WN2 A;  2CV6 A;  3MID A;  1OD5 A;  2HWB 3;  4QDS A;  1YRZ A;  2JB8 A;  4N53 C;  3QBQ A;  1JTZ X;  5L7O B;  3IT8 A;  1HB1 A;  1LHW A;  4QKB A;  1H6X A;  1I9R A;  1MS1 A;  4JDO A;  1G9D A;  4L99 A;  5FWJ A;  1LR5 A;  2WZP P;  4DFS A;  5BXX A;  1VR3 A;  5D1I A;  4BXF A;  5FP8 A;  4OHV A;  5DG1 A;  1GZT A;  1X8E A;  2VZV A;  3LIH A;  2ID4 A;  5IK7 A;  1N1T A;  4ET7 A;  2QTW B;  3DPR A;  4HSJ A;  1J84 A;  2NMN A;  1UY4 A;  1W6M B;  2J1V A;  2QQK A;  3ZXD A;  3RYP A;  3WV6 A;  5HV0 A;  1A8M A;  1S1A A;  3ZN6 A;  4IEW A;  3ZN4 A;  1N3O A;  2WFF 1;  1U5I A;  2VH9 A;  5CFC B;  1WD4 A;  1DQ1 A;  4IGO A;  2RJ2 A;  3N4M A;  3MGU A;  2QNK A;  4J25 A;  1O7F A;  2N7G A;  2VVF A;  4YLZ A;  3KS7 A;  4OCT A;  3OY8 A;  4Q4W 2;  3SHR A;  5F3C A;  3FJS A;  1K12 A;  2R07 3;  1FNY A;  2QKD A;  1W03 A;  1RUI 1;  1H8T A;  2ET1 A;  2BGC A;  3O7O A;  4Y4R A;  1MZF A;  3AYD A;  5JR7 B;  3VKF C;  1POV 0;  4N7I A;  3VD9 A;  1C28 A;  5KHG A;  3DV8 A;  1DYK A;  4CEY B;  3ZYI B;  3NAP A;  3ZN5 A;  1YQ6 A;  2P34 A;  1ULD A;  2OVU A;  1NUK A;  4WM8 C;  4HPK B;  1NCR C;  5EPA A;  5A80 A;  5A1A A;  1NY7 2;  2J1R A;  5IW0 A;  1XOY A;  4IE0 A;  4YM3 A;  1QF3 A;  3FHQ A;  1AR7 3;  2W9X A;  2GME A;  2VZR A;  2WNU A;  3DN7 A;  2A3Y A;  3ZO0 B;  5KXB A;  3FLR A;  1NY7 1;  1FPN 3;  4Y33 A;  2VW1 A;  4RHV 1;  1C8M 3;  2ZZQ A;  4YVS C;  4AHW A;  3N9L A;  4EE2 A;  1AVB A;  2WO3 A;  1RUF 1;  3ILN A;  4WM7 B;  1D7P M;  2A3W A;  3PVE A;  4Z92 B;  2AH2 A;  2RV9 A;  4PI2 A;  2P37 A;  2E51 A;  4F3J A;  5BNN A;  1CZT A;  1LGN A;  3WNO A;  5AFB A;  3VBH A;  1SBD A;  1VBE 1;  4HN1 A;  4B4R A;  1HQW A;  1VBC 2;  3T3Y A;  3S7I A;  3UT0 A;  1RED A;  2FDF A;  1W2A X;  1VAV A;  4XDP A;  2YXS A;  4XXP A;  4YVW B;  3ROU A;  3OEB A;  3I59 A;  4H3W A;  1JXN A;  1NOV A;  3N9N A;  4AED B;  5BNP C;  2IXK A;  1LCL A;  3PTR B;  4DXR A;  5C7G A;  4XJ9 A;  5C3Q A;  3KF3 A;  4JTO A;  4QAW A;  2YGM A;  1W6O A;  2V4A A;  4HPK A;  4IEY A;  1VRH 2;  4IEU A;  1GP4 A;  3ASI A;  4E4S A;  4QPY A;  2ILM A;  2P3I A;  1C1L A;  2JB4 A;  2YHJ A;  4AED C;  4M0N A;  1JYC A;  2R32 A;  2WNV A;  4YVW C;  3S57 A;  3M4F A;  4B7K A;  4XQ4 A;  1JZ4 A;  3KQ4 B;  3KT7 A;  4AF9 A;  3VHN A;  4JDN A;  4ATF A;  1Y7B A;  2ERF A;  3O1P A;  3ZYJ B;  4EN0 A;  5D21 A;  4NHK A;  4XUO A;  2C1F A;  3VBS C;  4Q4X 2;  3I2J A;  3NKG A;  4CCK A;  5CVR A;  2E7A A;  1OUS A;  4QPI C;  4IV3 B;  1W6N A;  1YYN A;  1A34 A;  1HB4 A;  4KWJ A;  2ZGN A;  3H0O A;  3WXP A;  2WWS A;  4WZF A;  3TNQ A;  3WDV A;  4M4R A;  1OC1 A;  2EXH A;  1H4H A;  2C9A A;  3J8F 3;  2RM2 2;  4LPL A;  2YFU A;  1LED A;  2VAU A;  1A78 A;  4CU9 A;  3O1V A;  2VOV A;  4NAM A;  2WRA A;  3HNB M;  3N7K A;  1UX6 A;  3AZV A;  5BNN C;  3A7Q A;  3LDB A;  4R4Z A;  5EQU A;  5IFP A;  2WO7 A;  2A5Z A;  3D0S A;  1Z0H A;  1AF9 A;  3ZKY A;  2XGX A;  1BVP 1;  5LEK A;  2RDQ A;  2ZBJ A;  3FLT A;  4UFK A;  2XWJ B;  4CDQ C;  1W6P B;  2DWR A;  5FZ8 A;  5C8C B;  1V6O A;  2WA3 A;  4AFC A;  2ZAA A;  3THT A;  5EJZ B;  3MLL A;  5IAT A;  3O1M A;  3O1S A;  3LEG A;  4HG6 B;  4Q29 A;  5KR7 A;  2WAB A;  1H4G A;  4CZS A;  5C3S A;  1QOO A;  2JG9 A;  2H6B A;  1Y9G A;  3BUC A;  3DYM A;  1WMD A;  2EF6 A;  1JUI A;  3ZYF A;  5CFD C;  5HV4 A;  1UZW A;  4QPW A;  2RS3 1;  4Y1V A;  1VBD 3;  4DO0 A;  2D6N A;  1VB4 A;  1F31 A;  2WYF A;  4YGE A;  5ANQ A;  5GLT A;  2BOJ A;  1O4Z A;  4YZ5 A;  4I2O A;  3I3D A;  3VBS B;  3AZZ A;  3LWC A;  2NLR A;  3H1Y A;  2HKX A;  1VBA 2;  4Q26 A;  1S0G A;  4R52 A;  4NE9 A;  3D6E A;  3ETQ A;  4YVW A;  1A6C A;  5AVA A;  1W0O A;  4AVA A;  3WNX A;  2BUK A;  2NMO A;  1X7N A;  1W9F A;  3AP6 A;  2XHN A;  2XB6 C;  4Z8B A;  3AXE A;  2W92 A;  1MQT C;  3UGG A;  3AYC A;  3ES4 A;  3DKQ A;  2B42 B;  1PVC 1;  5F3I A;  4Q0Q A;  4UFM A;  4Y20 B;  5ABJ A;  3M2M A;  1R08 2;  2AEY A;  1EAH 3;  4P08 A;  2C26 A;  1LHO A;  1CON A;  1SLC A;  1XYP A;  4JHZ A;  4IQP A;  4HN0 A;  1DQ4 A;  5CKM A;  4FOW A;  5FYS A;  3J9S A;  4DRV A;  3D8C A;  4KWL A;  1RMU 1;  5FMC A;  1H6Y A;  2HEV F;  3AZW A;  1H30 A;  1NXM A;  2JD9 A;  2LRO A;  4UBG A;  3TN9 3;  5AC9 3;  5JPN B;  1GNZ A;  4CP9 A;  2D6M A;  4CEY A;  3RGB A;  2Q8E A;  2C4X A;  2QE3 A;  1YLL A;  2NYY A;  3ETP A;  2XXZ A;  1WLD A;  2W94 A;  5FP7 A;  1JZ2 A;  1ZBE 3;  4BHP A;  3UGH A;  1IG3 A;  1ZVF A;  3DEM A;  5JIA A;  1Q8Q A;  4BCU A;  2WT1 A;  5CKQ A;  2GC1 A;  3CJI A;  4JQT A;  4NPM A;  4G3Y C;  1WW6 A;  4FPF A;  1RUF 3;  5DN2 A;  3WNK A;  3GHN A;  2RR1 1;  1QJY 3;  3R4U A;  4RN5 A;  5E8A A;  5AVP A;  3HBK A;  3BU7 A;  2ZGU A;  4XET A;  1PVC 3;  3EHK A;  4EN8 B;  2RE9 A;  3V0B B;  3GCX A;  5FUN A;  1CQ9 A;  1OPM A;  5FXW A;  3FFZ A;  5K4L A;  1S0B A;  4BIF A;  2GAU A;  4IUG A;  2EA7 A;  4MHU A;  1HRV 2;  4AVT A;  4N43 A;  5A7W B;  1OXC A;  1HV0 A;  5FK8 A;  4AE2 A;  1ZBA 3;  4MZU A;  1LAJ A;  4IL7 A;  4FXG B;  3LEK A;  1W3X A;  1RMU 3;  1Z7S 1;  4OHZ A;  1W9Y A;  2BFU L;  3V64 A;  1HLC A;  4F83 A;  3KMH A;  1B35 B;  1E57 A;  5FYC A;  1OF3 A;  1G86 A;  5CAZ A;  4K6B A;  4W65 A;  1WCQ A;  2ORZ A;  1ZX5 A;  2CDO A;  1LHN A;  1UU4 A;  1AXK A;  3HR9 A;  2OS2 A;  1WD3 A;  2DCK A;  3INA A;  2OQ6 A;  1ENS A;  2ZOE B;  1QKQ A;  4E27 A;  5FY8 A;  3GF6 A;  1DGR N;  1OA4 A;  1DYP A;  5EV7 A;  2CYF A;  2JE8 A;  2R49 A;  5L7O C;  2HWF 3;  2VTX J;  3T2O A;  2PAK A;  4CDW A;  4PLN A;  2VVD A;  3MDP A;  4OUL A;  5FYZ A;  2R1B A;  1QJU 1;  4QHZ A;  1ZYB A;  2X09 A;  3ZIW A;  1RGS A;  3N7J A;  5A7P A;  3HMY A;  2YZ4 A;  4XOG A;  1E5R A;  3ILF A;  4QQ2 A;  5KWR A;  1KQR A;  1BEV 3;  2D5H A;  1JOB A;  4JAA A;  4NJ4 A;  5E89 A;  5L9B A;  1MS3 A;  4EJR A;  5C5T A;  1W06 A;  1XSR A;  5JDB A;  1WMF A;  3GJA A;  3VD3 A;  5CKN A;  1HB2 A;  4ZON A;  3RZG A;  2WDB A;  3JD7 1;  2NP0 A;  3C7F A;  5BY5 A;  2A6Z A;  5LY1 A;  1FXZ A;  1HX6 A;  2Z42 A;  3ZVX A;  5FFO C;  4EYU A;  2A73 B;  1T2X A;  2VZP A;  4OMC A;  4YVS B;  5H9R A;  3NRU A;  5IVF A;  3R4S A;  4FPH A;  5A3P A;  2GND A;  2VXR A;  4JC1 A;  2YU1 A;  1PGL 1;  1BEV 2;  1NCQ A;  1EUU A;  1NA1 B;  1S4C A;  2R0H A;  3H3Z A;  5DZF A;  3CQO A;  1W6N B;  1CIW A;  4M3C E;  2VUC A;  2PLV 3;  2BW8 A;  1YQ8 A;  1F5F A;  2HWC 3;  1AXY A;  4AI9 A;  4OZO A;  3OD0 A;  3V0A B;  1JBC A;  2DCY A;  2C9K A;  3ACH A;  4QD2 A;  2X5I C;  1YNA A;  1PMJ X;  4QGL A;  4IET A;  2VUJ A;  2J1E A;  2OA2 A;  1JW6 A;  2W52 A;  1URX A;  2JDU A;  3H1W A;  2EID A;  2PHD A;  3I2G A;  1ZZC A;  1C1F A;  1R08 3;  2B7Y A;  4AWD A;  4FI9 A;  4AI2 A;  1UW8 A;  3JQW A;  5F7U A;  4GMP 3;  5J37 A;  2FCT A;  2D43 A;  5FBJ A;  3H3U A;  2ZPX A;  3OGV A;  3BKZ A;  3OOX A;  1W9S A;  4CP2 A;  5CAD A;  1I3H A;  4JGZ C;  4YG0 A;  5C4W B;  2CWM A;  3N36 A;  1BJQ A;  4OQ9 A;  5HXM A;  1UZ0 A;  1L7L A;  2VO5 A;  2VW2 A;  4FP3 A;  4Y1Z A;  3I2O A;  3Q8B A;  4NRP A;  4I0B A;  3ZMO A;  4E8C A;  1NA1 A;  3CZJ A;  3H7J A;  3KT1 A;  4LKE A;  1ULC A;  4NRM A;  1ZBA 1;  2X10 A;  4YW1 A;  5JCT A;  4MGT A;  5IUQ A;  4FFI A;  2ARE A;  2QDN A;  3RWK X;  4AGR A;  1ZA4 A;  1XND A;  2B8M A;  3L9J T;  1VRH 1;  4AG4 A;  1FOD 1;  1IS5 A;  4LHL A;  3VBO B;  4A3Z A;  2BNO A;  3PUS A;  1MEC 2;  4COW A;  2XJV A;  4GA9 A;  5FYU A;  3LA3 A;  4BQ2 A;  1D2S A;  3CO2 A;  1H2N A;  3WP6 A;  1NT0 A;  3RJ2 X;  1OH4 A;  1CX1 A;  1UCX A;  5ANN A;  1Q8V A;  4FPO B;  4QXH A;  2GH8 A;  4DNY A;  1ZBE 2;  2A71 A;  4I3P A;  3ENR A;  3SC7 X;  2QQW A;  4H2A A;  1VPH A;  5GZG A;  4DUV A;  2EXK A;  1XPW A;  2JG9 C;  2WO2 A;  1MS8 A;  3ZX7 A;  4XW3 A;  3A22 A;  2ES3 A;  3DXT A;  1DQ5 A;  4RYD A;  1G9A A;  1ZBE 1;  2Y0O A;  4CCM A;  2E9Q A;  3AXD A;  1KIT A;  3PUI A;  4Q0S A;  3K4D A;  1DQ2 A;  2PHW A;  2L9L A;  2B45 X;  2Q0A A;  2ZX2 A;  4I02 A;  5A70 A;  3BPS A;  2XKP A;  3LPG A;  5GLU A;  4ZZ5 A;  1HRI 2;  3K75 B;  1VBE 2;  1ALY A;  4DS0 A;  1W6Q B;  1AR8 1;  1I1E A;  4Q4Y 3;  4AGG A;  4EV0 A;  2VY0 A;  3MO4 A;  1W6M A;  4HFS A;  2G9Z A;  4RR3 B;  4HKO A;  3J8F 2;  2WC2 A;  4LHK A;  3J4U H;  1EAH 2;  3UV9 A;  3WUC A;  3GDB A;  2ZGQ A;  1G9F A;  4COV A;  3WW1 A;  2JX9 A;  1VJ2 A;  3KD4 A;  1H2L A;  2VL4 A;  3WF3 A;  2B39 A;  2ZCW A;  3DPR C;  3H42 B;  4OI0 A;  2FDI A;  5A7W A;  3B00 A;  4D7Y A;  2E26 A;  4IEV A;  4ZS2 A;  4YW2 A;  3MLK A;  1BBT 3;  3HT1 A;  4C0H A;  4DIN B;  2EXI A;  5IFT A;  4NN0 A;  3R05 A;  2CSG A;  4CU8 A;  4G4F A;  4R9D A;  1HV1 A;  1QJF A;  3K46 A;  4ISR A;  3KVA A;  3M3E A;  2WS9 3;  2ZHK A;  3DPR B;  4RS5 C;  4HVQ A;  1J3Q A;  4NIH A;  1LGB A;  4NPR A;  4DOU A;  4GKY A;  1VRH 3;  4XUQ A;  3T2Q A;  1VBD 2;  1V6L A;  1RC6 A;  3JCI A;  3LDR A;  4IER A;  3P5B A;  5DDJ 2;  4YG3 A;  1JN2 P;  5CU1 A;  1JU4 A;  2C24 A;  4Y5S A;  3USU A;  1MZ6 A;  5F9T A;  5J7M A;  1IQA A;  1WA6 X;  4GJZ A;  1O3R A;  1AX1 A;  1I5Z A;  3JBG 2;  5CA6 A;  3B93 A;  4FXK B;  1SBF A;  2ZA9 A;  1UMI A;  4COY A;  1W8W A;  2WNV C;  3IAQ A;  4QXC A;  3U07 A;  2BTV C;  3CJI C;  4ARY A;  1ZRF A;  3WQ1 A;  1N3Q A;  4JDM A;  2IFW A;  5FCC A;  5K0U B;  5BPX A;  1JYX A;  4QGN A;  4RFT 0;  5FY1 A;  2H0B A;  5E16 A;  4UFH A;  3V0B A;  2XVK A;  1AHS A;  5A7N A;  2CGP A;  4P9X A;  1VBB 1;  1P8J A;  2UY9 A;  1AJK A;  1RUD 2;  1R08 1;  1K5M A;  3IAP A;  3T1M A;  3CEW A;  3W21 A;  2UUR A;  1QNW A;  2PYT A;  2YGL A;  5JPM B;  2BP6 A;  4QHO A;  4N7U A;  5FPZ A;  1JYN A;  5ACA 2;  3GYD A;  1GQH A;  3B9I A;  3HIF A;  3QH7 A;  3CDZ B;  2G1M A;  4HZF A;  4RGA A;  5FY5 A;  2BEO A;  3AKQ A;  5I8S A;  4BPZ A;  1ST8 A;  3LA7 A;  2BZD A;  4LBN A;  1DZR A;  1GKB A;  3NNF A;  3UES A;  3QD6 A;  1BMV 1;  2C5D A;  3PHM A;  5IHR A;  2JKB A;  5L9V A;  1FMD 2;  5J3U A;  2W47 A;  5FP4 A;  3ZFE A;  1SAC A;  3KT4 A;  3L2H A;  5C70 A;  4XUT A;  1UZV A;  5FXZ A;  1AR7 1;  5A7S A;  2VNO A;  2QDR A;  2Q8D A;  1QWR A;  3WF0 A;  4MGK E;  2VZT A;  1QOS A;  4FO9 A;  4K1Y A;  4H7L A;  3MV0 1;  2WQ4 A;  4MET A;  1CZS A;  4FPG A;  1IPS A;  2LUW A;  2VUL A;  1O3Q A;  5FAX A;  1OA2 A;  1YUD A;  1IKP A;  1AYM 1;  4W4Z A;  5EYY A;  3R6S A;  3D3A A;  4HAN A;  3WW4 A;  2JIC A;  2UWC A;  2WZR 2;  4IEX A;  5JAX A;  3KQR A;  4KGQ A;  3W5M A;  3AJY A;  2PAM A;  4GH4 C;  2LRP A;  2R04 1;  4GB3 1;  3NNL A;  2XQX A;  1GR3 A;  3WNN A;  3J26 N;  3WF4 A;  3NQH A;  4XFF A;  4RGK A;  2Y26 A;  2NM1 A;  2JG8 C;  2RMU 3;  4IEP A;  3TOJ A;  5FTT C;  1CX4 A;  4BLJ A;  2ZAH A;  4X6R B;  5LBC A;  2YU2 A;  2HWB 2;  1S2E A;  4SLI A;  1PGW 2;  4IE6 A;  3ZDS A;  5FQ0 B;  3IKW A;  5BV6 A;  1KEX A;  3NJV A;  1JOD A;  1D4M 2;  2HWE 2;  3TNP B;  2G9F A;  1QXR A;  4P9I A;  1PGW 1;  3VBU B;  4M3C B;  1RUE 2;  2VNV A;  1XQN A;  2K0G A;  2BJS A;  3FHI B;  5H9S A;  3RVH A;  3SXW A;  1OF4 A;  3AP4 A;  2B4K A;  1MQT A;  3N9M A;  3PU3 A;  3ZXG A;  3WY6 A;  2CWS A;  3URF A;  3ZFE C;  1OKO A;  4QPG B;  4OMD A;  2HYK A;  3GGL A;  2D6K A;  1APN A;  2EIG A;  3HD8 B;  4IGQ A;  1PGS A;  1DZT A;  4XYX A;  2Z79 A;  3M3O A;  4Y1Y A;  1XE0 A;  1ENQ A;  3MIE A;  3FHA A;  3TRS B;  5EYX A;  1TMF 3;  3KCX A;  5FK7 A;  5CG8 A;  5FZL A;  5AFE A;  4WBB A;  4LUK A;  3RWN A;  3VBO C;  2CAU A;  4BME A;  1NLR A;  2R07 2;  4YVS A;  4IEQ A;  2WZ8 A;  4Q4V 3;  1AYN 3;  3B69 A;  3WQB A;  2HBU A;  1N47 A;  3ZYR A;  3S7E A;  3E6D A;  5H9P A;  5ERL A;  3ZFG C;  5F5C A;  5JXG A;  1J1L A;  2VNG A;  4JTN A;  2FCV A;  4LQR A;  4RGG A;  3N9P A;  1O4T A;  2IXC A;  4CU7 A;  5JUV A;  4DXZ A;  1XJA A;  5G05 L;  1ACC A;  1JS9 A;  4FT8 A;  2WS9 2;  5FY0 A;  4CCJ A;  3VZO A;  2VZU A;  3OUI A;  2A3X A;  4NID A;  2E7Q A;  2BU9 A;  3VZM A;  1PZ8 A;  1W39 A;  4JRL A;  2NPI A;  4D69 A;  1QY4 A;  2UWB A;  3ACG A;  3B94 A;  2W39 A;  1LOD A;  4GJY A;  1MVQ A;  1VAM A;  3WD5 A;  1WMX A;  1FV2 A;  2QBX A;  1JHN A;  1ZZ9 A;  5FZB A;  2HEW F;  3QAC A;  3WR0 A;  2VOK A;  1REF A;  3M3I A;  1A3K A;  4MGY E;  5T5L A;  2C0Z A;  4MGZ E;  1BHG A;  2MNG A;  2WNV B;  4JGZ B;  5C9A A;  1C3H A;  3ZM8 A;  4X8N A;  1UOB A;  4PF1 A;  5EIY B;  4FPC A;  1PVX A;  2IXI A;  4Y26 A;  5I91 A;  3O1R A;  3I7D A;  4Y4Y A;  1G9C A;  2W1S A;  3F2Z A;  1F8V A;  1TVG A;  3G7D A;  4B29 A;  1W6O B;  2OZ6 A;  4PBP A;  4DY3 A;  2E53 A;  4XAA A;  5ACA 3;  4PI0 A;  3HVD A;  3LF7 A;  4X8P A;  5EJ3 A;  1TME 1;  2GMM A;  4S2F A;  1UYY A;  2HH9 A;  2RHP A;  2J22 A;  2YBP A;  3TN9 1;  4AK3 A;  4RA0 A;  1SG3 A;  4QKD A;  3CBN A;  3C7H A;  4N8M A;  4R9C A;  4GB3 3;  4IV1 B;  4LA3 A;  1KJR A;  1W8H A;  2QVS B;  3K77 A;  5F8P A;  4YSF A;  1SCS A;  2YV8 A;  1Q56 A;  4Q8K A;  3H8X A;  3MUZ 1;  5FYH A;  3IM0 A;  5IYY A;  1JYI A;  4S2D A;  4EZ4 A;  1OBN A;  1PK6 C;  1R1A 1;  1SLT A;  2VME A;  5FLJ A;  5B4N A;  3UNP A;  3THC A;  1V6I A;  5CFC A;  3JZV A;  4I01 A;  4YM2 A;  3ZN6 B;  4CP1 A;  5EXO A;  3FZ3 A;  4QXK A;  4HK8 A;  4AHX A;  4DY5 A;  5GZE A;  3PUR A;  2RJL A;  3I3M A;  5K8S A;  3LB9 A;  1SZB A;  4YW4 A;  2XLF A;  2HWD 3;  3UGF A;  3WDY A;  4TTG A;  2WL1 A;  1ODM A;  4CP9 B;  3Q8E A;  1W2T A;  2RMU 1;  3BCW A;  5EFU A;  3J7L A;  4WV8 A;  5FMO L;  2K46 A;  3VV1 A;  3UJQ A;  3EQE A;  3SQO A;  4OQ8 A;  2JE7 A;  2VM9 A;  4ZXE A;  1OT5 A;  5J1X A;  4YM0 A;  1IPJ A;  1CAW B;  1KS4 A;  2EAK A;  1CGP A;  2O8Q A;  5I93 A;  1VRB A;  5JIU A;  1H1I A;  5JI7 A;  2IZW A;  5DXD A;  4Q4W 1;  4NR1 A;  4URT A;  4QDQ A;  2ZGR A;  4RSU A;  3SH4 A;  1V9U 1;  1U5Y A;  5D8A A;  2D6P A;  4OLL A;  1HRV 1;  4Q4V 1;  4ZU5 A;  1JZ7 A;  3SEP A;  1RIT A;  3WP5 A;  2I45 A;  2HWE 1;  3OBT A;  4E4Z A;  1WGP A;  5A33 A;  4LTA A;  4XPV A;  1ND3 C;  1SDW A;  5HPO A;  1Z7S 2;  4L92 A;  4XDQ A;  5FJK A;  4Q0V A;  3JU9 A;  4YFW A;  3I49 A;  4UXA A;  4MHR A;  3I3B A;  4NHL A;  4AQS A;  4K40 A;  4TLG A;  2DTY A;  4ORF A;  2LTN A;  3A0N A;  1MS4 A;  1GZC A;  1HRI 3;  1VBE 3;  5LA9 A;  1W8N A;  4M3C A;  4AL9 A;  4PF5 A;  1T6G C;  1ZA7 A;  3OCP A;  3LCP A;  2P5B A;  1UXX X;  1GSL A;  2HYX A;  1DDL A;  4YGC A;  1EV1 2;  1D4V B;  4C0B A;  4IE5 A;  2Q1M A;  5C8C C;  2PFW A;  2XUE A;  4CCD A;  2ZAB A;  5IVE A;  1OFS A;  1UMH A;  4XJU A;  2IXJ A;  1DF0 A;  5GZD A;  3KVB A;  3R4D B;  4HL0 A;  1GP5 A;  2DDU A;  2IUW A;  1XE8 A;  1ENR A;  4LA2 A;  4EWA A;  4A45 A;  4FPJ A;  3OPZ A;  5KXE A;  4JGY C;  3U75 A;  1BBT 1;  1W8F A;  5A1F A;  1GYK A;  1CAU A;  5A33 B;  2YYO A;  3AKR A;  3TEY A;  2BOI A;  2JKX A;  3POF A;  2D3S A;  4CP0 A;  1NZC A;  5JWP A;  2RS1 3;  3FBM A;  3MIG A;  5CIR A;  2NN8 A;  2D7F A;  2LS6 A;  4G9S B;  1U5Z A;  4A2U A;  2RDS A;  1PO1 3;  2X8K A;  5FWE A;  3RMX A;  1UY2 A;  4AVB A;  3PVN A;  3N9O A;  3OGG A;  2VCB A;  2MPF A;  3U1X A;  4CRQ A;  3T0B A;  4E2S A;  4LIV A;  3BTY A;  1N3P A;  2XJU A;  3M70 A;  3CNA A;  5FUP A;  3GZT B;  2ZJC A;  5JZG A;  1CWP A;  3RMY A;  3HPN A;  3VN4 A;  3TB0 A;  1CAW A;  2CHH A;  1HXS 2;  5APA A;  3ZDV A;  4AHY A;  3HBZ A;  1NX9 A;  5FPV A;  3MFC A;  3B3Q E;  1US2 A;  1AX0 A;  3APB A;  4C1W A;  1AR8 3;  2WN3 A;  3WG1 A;  4D7T A;  2FDJ A;  3D0J A;  2WNU C;  2A1X A;  4YYO A;  2VMF A;  1PO2 1;  4UAP A;  2XQR A;  3E5U A;  3WCR A;  4CA9 A;  2VGD A;  4NOT A;  3UJO A;  2E7T A;  5DZE A;  3SIS A;  1PMH X;  1HXS 3;  3DYP A;  1IS6 A;  1VBD 1;  3H8R A;  2B46 X;  4IXL A;  5T5J A;  4CDU C;  3NNG A;  4L0P A;  3ORJ A;  1LEN A;  3CJX A;  5BNP B;  4GD4 A;  1UO9 A;  2QZ2 A;  4KWU A;  1STM A;  3OTF A;  5K7P A;  5K0U A;  3ZXL A;  2RS5 1;  2ARB A;  3RNS A;  3VGI A;  3HNY M;  5F5I A;  1PZ9 A;  1FAY A;  2DCT A;  5J09 A;  1COV 2;  4NIA A;  5C8W A;  2E6V A;  1ZNP A;  2FBE A;  2DUP A;  4TSV A;  3ZFF B;  2B5H A;  5GM0 A;  3F95 A;  4UW5 A;  3AKP A;  2XUM A;  3S5Q A;  3V65 A;  3RPQ A;  5JLV A;  2ZKL A;  4NUB A;  1COV 1;  2OUJ A;  3DL3 A;  1XB9 A;  3KWV A;  4KU8 A;  4Y5T A;  4UW6 A;  3KV5 A;  2OKX A;  2WFF 2;  1ENX A;  1TZO A;  3IPV A;  4XFC A;  4QPG C;  2ZTN A;  3WDX A;  5DAP A;  2W1U A;  2DUO A;  4MO3 M;  5L73 A;  2AAC A;  1F15 A;  3PIG A;  2VMC A;  3PJQ A;  1ZRR A;  5FZ0 A;  2V72 A;  1LHU A;  3ZIX A;  1YEW A;  3VBF B;  1RJ7 A;  1XYN A;  1UL9 A;  5C4W C;  4KBZ A;  2BV4 A;  3AP5 A;  4FTS A;  4A7Z A;  2O14 A;  4LK6 A;  3MLJ A;  1K5J A;  4CUG A;  2QQU A;  2Q1Z B;  2WNU B;  5F3E A;  5FJH A;  2AZ5 A;  3PLQ A;  2HWF 2;  3DKW A;  5LY2 A;  1SMV A;  1ZRI A;  2NZ9 A;  3DXU A;  2YPD A;  2YPJ A;  4KWK A;  2W87 A;  4A44 A;  2P6C A;  1RUI 3;  5FYM A;  3B7M A;  2Y6L A;  2A6V A;  1DG6 A;  4CEW C;  4LOR A;  3OD4 A;  1HRI 1;  1GMM A;  2YB7 A;  5A6Y A;  3ZXF A;  2W68 A;  4QB6 A;  2Q8C A;  1ZZB A;  2BNN A;  2WWU A;  1ND3 B;  2D40 A;  4XMA A;  2BGO A;  2NQY A;  1F5J A;  3PVO A;  4J1X A;  4O9G A;  2DYC A;  5GZF A;  4FBF A;  1D0G A;  1RMU 2;  4EWD A;  1O3T A;  3WZ1 A;  1ZBA 2;  4XAC A;  1MR5 A;  1N1S A;  4XAE A;  4OFG A;  3LFI A;  1YO8 A;  1HRV 3;  1UAI A;  4FPL A;  3VBR C;  4WVW A;  3AL5 A;  3RZL A;  2D6O X;  3ACL A;  4UFJ A;  5JSO A;  3BN6 A;  4LKS A;  4S2H A;  4IGP A;  3HWJ A;  2HJI A;  2EAA A;  1OFN A;  3JQX A;  4WVM B;  3ECQ A;  5F32 A;  4GWI A;  3AM2 A;  4CXW A;  1MQT B;  2P6H A;  1VMF A;  1Q3E A;  1IG0 A;  2I2S A;  3NKT A;  1NZI A;  4HKL A;  1WWY A;  1VMJ A;  2VW0 A;  3PUA A;  4BXS V;  5JXI A;  3NV4 A;  4YW6 A;  3MW3 A;  5T50 A;  2ORX A;  3KHC A;  1H9W A;  5C33 A;  1JI6 A;  2RR1 2;  4ZY9 A;  1MZ5 A;  4JCK A;  1YI7 A;  3NV2 A;  4NHY A;  4FOV A;  2MEV 1;  3POY A;  4LLF A;  3IB3 A;  3IDA A;  2W2I A;  1U5X A;  1XU1 A;  2VC9 A;  2VBB A;  4KQ7 A;  1H8T C;  3KF5 A;  4Y24 A;  3VZJ A;  4EN6 B;  4ATE A;  2XJS A;  3PIJ A;  5FXX A;  3E1F 1;  3O14 A;  2DVB A;  3O1O A;  2JG8 A;  2TEP A;  5FKC A;  3NST A;  3SNM A;  3C3V A;  1Z78 A;  5F3G A;  2DTW A;  3CJI B;  4CEW A;  2VZQ A;  2X05 A;  4CEY C;  1UZZ A;  3FWE A;  2VUA A;  4P02 B;  1AYN 1;  3MFA A;  4LE4 A;  5FYT A;  4N9H A;  5A3M A;  1GOH A;  5EWS A;  4QM8 A;  2VU9 A;  4K8R B;  4Q8L A;  1WLW A;  1B35 C;  2QQL A;  3NMB A;  3ZFF A;  2GAL A;  3LSE A;  4ZU4 A;  1MVE A;  5LAT A;  3H50 A;  1O59 A;  1E5I A;  4BH9 A;  3VKO A;  5KXD A;  2R7E B;  2XBO 2;  1YFX A;  4BLI A;  4JKL A;  1OOP C;  2KXL A;  2VOT A;  1OUX A;  3GZU C;  4MSV A;  3JB8 A;  3I3E A;  2YBS A;  3ZXA C;  4CUA A;  1SHW B;  5BNP A;  4P5H A;  1UN1 A;  1AR9 1;  4RS5 B;  2VQT A;  1LU1 A;  2JDM A;  3T4V A;  3WOG A;  1DQ6 A;  1X82 A;  1W9T A;  4Y22 B;  3RZZ A;  2YUE A;  3U78 A;  1DIW A;  3WNL A;  1C5H A;  3VBH B;  4QQL A;  5FO7 B;  1R64 A;  3IMM A;  3LKJ A;  3E6C C;  2UWA A;  1JZ8 A;  2PQQ A;  3OGR A;  2VG9 A;  4R9A A;  2WFP A;  3PUQ A;  3BIE A;  3USS A;  5JVV A;  1DCS A;  2PHF A;  3FC0 A;  1BCX A;  2I07 B;  4AGV A;  3KV9 A;  3M8L A;  3VHO A;  4CSW A;  3WSO A;  2VCM A;  2VVE A;  2F4P A;  4W6X A;  4NWW A;  1KGY A;  1R09 3;  1UY1 A;  1US3 A;  2BVV A;  4RS5 A;  1JU3 A;  5FPU A;  4YW3 A;  1QXP A;  4RR3 C;  4YRD A;  3PU8 A;  2GP3 A;  5FZG A;  3AP9 A;  1WW5 A;  1CD3 G;  2RS5 3;  3PDQ A;  4QXB A;  4DXT A;  4A7K A;  1TMF 2;  5E88 A;  3VKM A;  2O8O A;  1X33 A;  3KV6 A;  4PCR A;  3AL6 A;  2PAE A;  3C2U A;  2IWG B;  4GB3 2;  1WBF A;  3D4K A;  2WBK A;  2ZGS A;  1W2U A;  4DEV A;  3N7L A;  2W91 A;  1DQ0 A;  1G6N A;  2K2S A;  3OUH A;  3ES1 A;  4KL1 A;  1SDD B;  3RG0 A;  2QUO A;  1X9P A;  2HWB 1;  1WUV A;  1FNZ A;  5C5U A;  4AQT A;  4UOJ A;  3MIF A;  4GMP 1;  3TEZ A;  1UOG A;  2HWF 1;  4J1W A;  3FUO A;  5JMC A;  1RUE 3;  4XBQ A;  2LW8 A;  2ZGM A;  1RIR A;  1IPK A;  5GJ6 A;  5BNO B;  4BOW A;  1TME 3;  5JZG C;  3FBY A;  3LOI A;  1PNF A;  4H14 A;  4IW3 A;  3OYW B;  5M0T A;  2G19 A;  4BWO A;  3W9A A;  4AEJ A;  3DCQ A;  2XLG A;  3W5N A;  2Y6K A;  3KB5 A;  2RMU 2;  4AAX A;  1FT9 A;  1X50 A;  1BQP A;  3FMG A;  5DAV A;  4FFG A;  2W95 A;  4MGQ A;  1GWK A;  1NCQ C;  4NRO A;  3USU B;  2ZZJ A;  1PO2 3;  4QM9 A;  4UF0 A;  5DAB A;  5B4X A;  4L2N A;  5J98 B;  1K42 A;  1SCR A;  4AQ6 A;  3V56 A;  4MAD A;  2EXJ A;  4B1L A;  3TBD A;  4AFD A;  4BIO A;  4QX7 A;  2WLP A;  1AL2 2;  3AJZ A;  2FHR A;  4WM8 B;  1MAC A;  1J1T A;  1PK6 A;  1XYO A;  3BAL A;  2DFB A;  4FTE A;  3EYP A;  2AEN A;  3RRD A;  5GLV A;  4AR2 A;  4P9W A;  3RZM A;  4QX8 A;  2WII B;  4MYE A;  4BJ0 A;  4XF1 A;  3VDA A;  2OX0 A;  3IDB B;  3PMS A;  2EIB A;  1WCD J;  4JKK A;  4PQ9 A;  5KHK A;  1AYN 2;  1Y3T A;  1NQD A;  3BOP A;  5LA0 A;  1FMD 3;  3OGS A;  2BDR A;  1AR6 3;  5FZ3 A;  2RVA A;  4NIG A;  4MXV A;  2WT0 A;  3JD7 2;  4JRA A;  3UKN A;  1FPN 1;  3K3N A;  4JQR A;  1E5H A;  3MIB A;  4GIQ A;  2H0V A;  3IIA A;  5LRR A;  4YGD A;  2VTF A;  4COZ A;  1OOP B;  4XQW A;  3VBU C;  1GQP A;  3VL9 A;  5F1R A;  2D97 A;  2R1D A;  1BXH A;  1FPN 2;  1OVP A;  3K3O A;  4DUX A;  1IS4 A;  2LAL A;  2OII A;  2AR6 A;  4YZ2 A;  4NMI A;  1NYW A;  1W6Q A;  3GXU A;  3MW4 A;  1LOG A;  3TEW A;  2A6X A;  3LGR A;  4XUN A;  2KM2 A;  2V5Y A;  4GH4 A;  1LOF A;  1NLQ A;  3IWZ A;  4MVT A;  5A7Q A;  1ZRC A;  2ZX4 A;  4XXA A;  1UD1 A;  3WX5 A;  5BNN B;  5I0T A;  4OZX A;  2K9Z A;  3ALQ A;  1G9B A;  4OUE A;  3ZXE A;  2D5F A;  4D94 A;  3S6P A;  2FD8 A;  5FY9 A;  4WM7 A;  4H7M A;  4QWN A;  2XJR A;  1S0I A;  1H2K A;  4Z1V A;  4HSL A;  4Y22 A;  5FYV A;  3JBG 3;  3KV4 A;  4LJH A;  3VKL A;  1C8M 1;  2WZE A;  1Y4W A;  1U0A A;  3FX3 A;  3LFM A;  2Q30 A;  4Q27 A;  1O5U A;  3E97 A;  1GWM A;  1K45 A;  4QPI B;  4IES A;  3JUU A;  3P1I A;  2ZEZ A;  5FZA A;  1ULO A;  3VBO A;  1FV3 A;  2A7A A;  4AFB A;  1R09 1;  2J1S A;  3JB4 C;  5CNA A;  2EIC A;  1CAX B;  3RZH A;  1G8W A;  1AL2 3;  1IHM A;  1PZ7 A;  5CZK A;  3W59 A;  4CDQ B;  5D8A C;  1FX5 A;  3NW4 A;  3K48 A;  4L8Q A;  1FYU A;  1AX2 A;  3ACI A;  3SKV A;  4AOC A;  2BBA A;  1PO2 2;  4PLO A;  1TE1 B;  2OT7 A;  3AFG A;  1PO1 1;  1W05 A;  1WME A;  2TNF A;  2VNR A;  4RQP A;  1YJL A;  2DVF A;  1XNB A;  3A23 A;  4B7E A;  5FYB A;  4CEW B;  1SPP B;  2FMD A;  2JG8 B;  4N43 C;  4BQ1 A;  1FOD 2;  4WVV A;  2GNT A;  2X53 S;  4EZH A;  5F2W A;  1LOC A;  4W6W A;  1RUO A;  4RHV 2;  2Y38 A;  2J42 A;  3BVC A;  3GZA A;  3KLS A;  3BU0 A;  4JGY B;  5LWB A;  3HQU A;  1TME 2;  3AC0 A;  5L19 A;  3K2O A;  3PL0 A;  3LOB A;  2YC2 A;  1VBB 2;  2FQP A;  2R06 3;  3ZSJ A;  2ZXQ A;  1VLN A;  4Q4Y 2;  1EUT A;  3M1H A;  1QJY 1;  3LEM A;  4C90 A;  2UY8 A;  2FDG A;  1TG7 A;  2OQ7 A;  4E2G A;  1SLA A;  3RSJ A;  1F9K A;  2CAV A;  2WQZ C;  1LOF C;  3EMR A;  2FCU A;  1E5S A;  1PIV 1;  4ASL A;  3HN3 A;  1AL2 1;  1OI6 A;  1J3P A;  4XBN A;  1CIY A;  4LO6 B;  4LUM A;  4QQO A;  5T5O A;  4AI3 A;  5HCH A;  1C4R A;  4EQV A;  5F6L B;  5FOJ B;  4QQH A;  4XJZ A;  3T0A A;  4CDU A;  1XBF A;  4MXW B;  4YWA A;  3H9A A;  5A3O A;  1QDC A;  1WBL A;  4LBQ B;  5DAW A;  4YG6 A;  1RTV A;  3GCW A;  2W0X A;  1J58 A;  3POB A;  2QFE A;  1MEC 3;  1OHF A;  4XIL A;  1S0J A;  4GUL A;  1RUJ 1;  4N53 A;  3ZXK A;  1O8S A;  3OBZ A;  4Q4X 1;  1DP0 A;  4KG8 A;  1H0B A;  2PA7 A;  1L7R A;  5CFC C;  3ZMN A;  1IZ3 A;  2SLI A;  3H1M A;  5T55 A;  1SQ4 A;  4IE4 A;  2QJV A;  4BMB A;  1S2K A;  5DAQ A;  4DRR A;  2ZS6 B;  4XF3 A;  1UXZ A;  5C71 A;  2D6L X;  2ZEW A;  3IDC B;  4N43 B;  1DZQ A;  4QU1 A;  4BQX A;  1HKD A;  2OPW A;  5EJ1 B;  1XE7 A;  4CE8 A;  4AI1 A;  4MH0 E;  3WDT A;  4W6Y A;  4YAR A;  1PIV 3;  2Y60 A;  3C7O A;  1Q8O A;  1YFW A;  2WAA A;  2ZGO A;  5DPN A;  5HBA A;  4K8F A;  1GLH A;  3WP3 A;  5DUU A;  1BK1 A;  2ZHM A;  1OKQ A;  4MX3 A;  1KRI A;  2BFU S;  5HXV A;  4AW7 A;  3CKH A;  4IE7 A;  2ZEY A;  5E1R A;  1WW4 A;  2FMY A;  1V70 A;  3PNA A;  4TN7 A;  3VBR B;  2DVD A;  3S0M A;  2OZJ A;  1YJK A;  4BQW A;  3LE0 A;  4HXC A;  5IWF A;  5A6Z A;  5FOB B;  5I0D A;  2HWD 1;  4HVR A;  4PDW C;  4FQZ A;  5CFD B;  2HWC 2;  5JXH A;  1WLT A;  2CY6 A;  4KH9 A;  3VDB A;  2YC0 A;  2ZML A;  3IN9 A;  4XCA A;  1UNB A;  2CGO A;  3NO8 A;  4MGI E;  1G7Y A;  1CJD A;  4XZU G;  3G6J B;  3CF6 E;  4QX3 A;  3PME A;  5J36 A;  3NNM A;  1GAN A;  3U4X A;  5LK7 B;  4HK9 A;  1M4W A;  5FZ6 A;  1AL0 G;  2RR1 3;  2VOW A;  3TEX A;  1W0N A;  2E33 A;  3SH5 A;  1QMJ A;  1KJL A;  2XG3 A;  3AX4 A;  4PQQ A;  1W8O A;  1JZ5 A;  1D2Q A;  2FZ1 A;  1OH3 A;  4M3C F;  4HT1 T;  1UKG A;  2OXB A;  1L7Q A;  2R06 1;  4A4A A;  5LBE A;  4BE3 A;  3POE A;  1GBG A;  2WS9 1;  2O0O A;  3KHB A;  4Q0P A;  3DEC A;  1TMF 1;  3MPP G;  1WCS A;  5GAL A;  3IMN A;  1CR7 A;  3H8U A;  4QU2 A;  4D6S A;  1REE A;  2QQP A;  3N3H A;  3OBA A;  1UYP A;  2DCJ A;  2GC2 A;  4GXL A;  1R1A 2;  1ND2 C;  3NJZ A;  4CCN A;  1O6U A;  1O91 A;  5L9R A;  5FZD A;  1BMV 2;  3VKN A;  2BBV A;  4GMP 0;  5IVC A;  5HCA A;  4S2G A;  1YCI A;  2G9G A;  1XNA A;  1FAT A;  1LU2 A;  3WCS A;  4WVM A;  1DGW A;  2VZ3 A;  5LBB A;  2Y6G A;  1ODN A;  1W2N A;  1O4Y A;  1KDK A;  1DGR A;  1QJU 3;  4A7Y A;  2P17 A;  1EYB A;  2ZHN A;  4QKN A;  5EZW A;  3NJY A;  2XJT A;  1EY2 A;  1MEC 1;  4M4P A;  1RUI 2;  2JIG A;  1YFU A;  1W04 A;  3O0W A;  4LBK A;  1WA4 A;  5KHI A;  2Y6J A;  3EB7 A;  4BDV B;  3ILR A;  1N1Y A;  5FZM A;  1W8T A;  1QQP 1;  3AMP A;  4CDU B;  1LHV A;  2VTX A;  4JVA A;  4KU7 A;  5LA1 A;  2GMP A;  1LOE A;  1RUE 1;  2RJK A;  3GBF A;  4OI4 A;  2JDY A;  5BNO C;  2R04 2;  1LB2 A;  1OQ1 A;  2EVX A;  5CG9 A;  2ZAC A;  1OUR A;  1PVC 2;  4ASM B;  2RS1 2;  4ZHN A;  4QMA A;  4ERO A;  3ST7 A;  1QJY 2;  1K5M C;  4FCA A;  2VZ1 A;  4OHW A;  2HLE A;  5CIS A;  4LMF A;  1RUF 2;  3R0R A;  4LLO A;  4V2V A;  3SH3 A;  4EWE A;  1WLC A;  4AYU A;  2ZMN A;  2JEM A;  1PX4 A;  1EPW A;  4I3G A;  1OPO A;  1S0D A;  3C7E A;  2XJQ A;  3KGZ A;  1LEM A;  4DQA A;  3HN1 A;  5ISL A;  2VOX A;  3PTY A;  3J7H A;  3OUJ A;  1W6P A;  3VBF A;  2P3K A;  4ES9 A;  1ASJ 3;  3SIT A;  1VB2 A;  4XJW A;  2R04 3;  1VIW B;  3GBW A;  3WQ7 A;  1W28 A;  3U0Z A;  4Z2W A;  2WR9 A;  2WWJ A;  4HLT A;  2BWC A;  1DLC A;  2ZGP A;  4QPG A;  3H8O A;  4C1X A;  3Q9O A;  2WNO A;  2DVA A;  1KS5 A;  3NVC A;  4O65 A;  1RUJ 2;  1SFY A;  2HWC 1;  5FZC A;  1Z7S 3;  3AKT A;  4XFH A;  4Y5Z 0;  1UX7 A;  2R16 A;  3L2Y A;  2JWP A;  4TXW A;  3WLU A;  5BYN A;  2IVJ A;  2RM2 1;  5GZC A;  2HBT A;  4PBO A;  4B3N A;  5JOZ A;  1UU6 A;  2WYS A;  4WVZ A;  4U36 A;  2F17 A;  3C8X A;  5GLZ A;  1QJU 2;  1LEC A;  4UT5 A;  1UF2 C;  1Y9M A;  1UKR A;  3WNP A;  1AR8 2;  1W8Z A;  2Z4F A;  1NQJ A;  5IAV A;  2O1Q A;  3VZL A;  1VP6 A;  4CCC A;  4KGG A;  4DEQ A;  1TEI A;  4HET A;  4P9G A;  3QH6 A;  4PIY A;  1RHI 3;  4K1Z A;  2PHR A;  3NAP C;  4LUL A;  4Y3O A;  2BQP A;  5LAS A;  1R1A 3;  2ZX3 A;  5F5A A;  5GKA C;  2RDR A;  4B4Q A;  2W3J A;  3NNJ A;  1UZY A;  1XSQ A;  3AK0 A;  4XJA A;  3ZYG A;  1UY3 A;  4OUM A;  2WSU A;  2Z2S B;  4BQ3 A;  2GNB A;  5FRA A;  5F37 A;  1CAV A;  1CPN A;  1NCQ B;  5T54 A;  2OW4 A;  5DAX A;  3WT3 A;  1BK0 A;  3AMN A;  3RQ0 A;  3ABZ A;  5I8T A;  4IV1 A;  1RUC 3;  2GSY A;  1CVN A;  4AAP A;  3THD A;  4U2A A;  1RUD 1;  2EAL A;  5FYY A;  4FFF A;  1RUG 2;  2KR2 A;  1W90 A;  3TAY A;  5FMO S;  3MZH A;  2J1U A;  5FY7 A;  5IT6 A;  2Q8O A;  1ZZ6 A;  1NE4 A;  4AED A;  5JZG B;  1ZRE A;  4V2W A;  3T4H B;  3ITQ A;  5FV3 A;  4E4H A;  4CUC A;  2JDN A;  1O5L A;  2CGN A;  1NXD 1;  3LZZ A;  3V0A A;  5HCF A;  3UK9 A;  5KXC A;  3CHX A;  3WEZ A;  3BPZ A;  2VPV A;  3MEP A;  1VBA 1;  2E32 A;  3IZO A;  2I74 A;  4I30 A;  4MUV A;  2ZGL A;  4CDX C;  4LO7 A;  4K7J A;  1H8T B;  3U14 A;  4FTB A;  2GP5 A;  1WCU A;  3SMH A;  5FIX A;  4D3W A;  1SLI A;  4LO5 B;  3K4A A;  2F6B A;  4CDW B;  4NO4 A;  4OYU A;  5G04 L;  3WF1 A;  1O3S A;  2VR4 A;  1AJO A;  3VL8 A;  5JOX A;  3POW A;  2MEV 3;  2X29 A;  4P5Y A;  2R06 2;  3PJY A;  4DUW A;  2WKK A;  4QB2 A;  2D44 A;  1JZ3 A;  1W0P A;  2RM2 3;  3U4S A;  3M7A A;  1PK6 B;  1V0A A;  4XVH A;  2G4I A;  5FO8 B;  1RJ8 A;  4NII A;  3GZE A;  2Y6H A;  2VXJ A;  1NAE A;  3BOW A;  2WZR 1;  4XMI A;  2VCC A;  2OPK A;  1QJX 3;  2VBP A;  5DUW A;  3P6B A;  5IAX A;  2QQN A;  2DBI A;  5FZ4 A;  4BIS A;  1F4A A;  3PVB B;  4Q4X 3;  1V6N A;  5D2A A;  3W58 A;  2PHU A;  4AVV A;  4CVU A;  4EN7 B;  2PLV 1;  4Y1X A;  3H3L A;  3LIG A;  4JV4 A;  1RIN A;  2YMZ A;  5DUX A;  1PX3 A;  5L7O A;  4NHM A;  1EP0 A;  3T0D A;  4DPN A;  1IKQ A;  2A6Y A;  2JDK A;  4WM7 C;  3OYW A;  1UIJ A;  4YZ4 A;  4A41 A;  1BLZ A;  5L36 A;  1CZV A;  1MZE A;  4BK5 A;  2AEZ A;  2JDH A;  4AZZ A;  3WG2 A;  4AEK A;  4Z07 A;  1BYH A;  1TNF A;  5FP3 A;  2XL9 A;  1PHM A;  5A1L A;  5CBL A;  1DYO A;  4XUP A;  3LPF A;  4LR4 A;  4GAL A;  3QCW A;  5FP9 A;  1KD7 A;  4AI0 A;  1OD3 A;  1FI2 A;  3T1L A;  3T09 A;  2P4E A;  3B02 A;  2QQV A;  5FZH A;  2XDV A;  3KCC A;  1UYZ A;  3RJR A;  2V4V A;  2DV9 A;  3FN9 A;  5FZI A;  4B8E A;  1RXG A;  3MIC A;  4QX5 A;  4BA6 A;  4EN9 B;  4IDZ A;  2YRO A;  3A21 A;  3HQR A;  1KFU L;  2IFR A;  1OMI A;  3Q8C A;  5FRE A;  1JMU B;  3POS A;  3VDD A;  1VBC 1;  2Y34 A;  1WCK A;  3H7Y A;  3III A;  2CTV A;  2ZKN A;  2YG0 A;  2WA4 A;  4RR3 A;  3CIH A;  3WIN E;  3OJB A;  3ZPO A;  4N90 A;  3J7M A;  1UU5 A;  3T2T A;  1OQD A;  3A4U A;  5J96 B;  3AVR A;  1XNT A;  2P2K A;  3CLP A;  3I8T A;  1GU3 A;  1O8P A;  5A3N A;  1V6J A;  1EV1 1;  3POI A;  1S0C A;  1J83 A;  4KNC A;  4Q2F A;  4JZR A;  4OI1 A;  4GKX A;  2XON A;  5C3R A;  4OI2 A;  1D4M 3;  1ND2 A;  2IXH A;  3FFQ A;  2YC4 A;  4FPK A;  4Y20 A;  4XIO A;  1CES A;  2ET7 A;  1VAK A;  5I0S A;  1AR6 2;  4Q1P A;  2OUH A;  1RUG 1;  2VZS A;  4FVV A;  5EHD A;  5A6Q A;  3EXU A;  4TLF A;  4LT5 A;  1QH7 A;  3ZSK A;  3NL1 A;  4UW4 A;  1GP6 A;  1RUH 2;  4XBL A;  4XF0 A;  3ZYP A;  1SFP A;  2P3J A;  2JEC A;  3N9Q A;  5A32 B;  3T2P A;  4YPJ A;  3MF6 A;  1T6B X;  1KXG A;  1VAL A;  1LOA A;  4QDR A;  1LES A;  3AB0 A;  4XHB A;  4A3X A;  3FLP A;  3X29 B;  4FQ4 A;  4N9I A;  1HJF A;  1GOF A;  1IGO A;  2TUN A;  4LE3 A;  3WDU A;  5LZ6 A;  5FLH A;  1ND2 B;  3VLB B;  2R07 1;  3ZR5 A;  5LEJ A;  5F5Q A;  2FZ2 A;  5DUV A;  2Y64 A;  5C3O A;  3LDK A;  2PHL A;  2Q1F A;  3UET A;  1QIQ A;  3QLQ A;  4GAZ A;  2UU8 A;  1BKZ A;  3O1T A;  1TQ5 A;  2DCZ A;  3UKT A;  3WF2 A;  3VDC A;  4A6O A;  4XAB A;  3BTZ A;  1C5I A;  4CU6 A;  1RUH 3;  2B9V A;  1UIK A;  4MXW A;  4AQ2 A;  4XF9 A;  3WNM A;  1QEX A;  5LW9 A;  1HB3 A;  1C8N A;  3RI8 A;  4LBJ A;  4BYY A;  2A75 A;  3DF0 A;  4XF4 A;  5AC9 1;  2WIN B;  4DXS A;  1RUC 1;  5LB6 A;  4IND A;  1Y9Q A;  4XUR A;  2WO1 A;  4UFL A;  4XTP A;  2R0F A;  3MIH A;  4YGB A;  1DBN A;  3AMH A;  1KDM A;  4N53 B;  3EJK A;  4ZKT B;  4HKW A;  4OVE A;  1DGW X;  1YQ2 A;  2VCA A;  2OYZ A;  3VBF C;  3ZR6 A;  5A3L A;  1N1V A;  2J1T A;  2ARX A;  3VD5 A;  3BB6 A;  3O5S A;  3MUY 1;  2ARA A;  1AR7 2;  1SBE A;  3ZPY A;  2XKO A;  2C6S A;  2JDP A;  1DU3 D;  2JXA A;  1H1A A;  3ZOI A;  5FYI A;  3BGA A;  3D82 A;  5F2S A;  1I6X A;  3WVJ A;  3M3Q A;  4PIX A;  5C8C A;  1POV 3;  2VMI A;  2DF7 A;  4TWT A;  3VHP A;  1A8D A;  2W08 A;  2VUD A;  2RG4 A;  3JD7 3;  1RXF A;  2GZW A;  4F7Z A;  2RS5 2;  3Q8F A;  3ZYH A;  1OQE A;  2Y8K A;  2XL7 A;  3ZSL A;  4BU2 A;  4CXX A;  4FPE A;  4Q4W 3;  2FDK A;  2VD7 A;  1YC6 1;  5CYY A;  5FPB A;  3U11 A;  4CCL A;  2VBD A;  4K9S A;  1R09 2;  1PNG A;  2JE9 A;  2WSV A;  2ZHL A;  3WHT A;  4QHB A;  4RL7 A;  3UL2 A;  4OUS A;  4A6S A;  3RZJ A;  1RHI 1;  3VBU A;  3M3C A;  1OLQ A;  2WZR 3;  4J6G A;  2YDE A;  1NLS A;  1CAX A;  4IEO A;  4MV2 A;  2H6C A;  2AGS A;  2DUR A;  3GHM A;  4PHZ A;  1QH6 A;  4MOA A;  4E2Q A;  3LA2 A;  4QPI A;  3T08 A;  4O9E A;  4LBL A;  4Z82 A;  3ZXJ A;  4IV3 A;  2ADD A;  4PJY A;  4LBQ D;  4ZPI A;  5T3N A;  1DLL A;  4XJ8 A;  2QQM A;  1SPP A;  4CUB A;  3T30 A;  3EBR A;  1S2B A;  1V9U 3;  2LM3 A;  2VQU A;  3GJB A;  3MF9 A;  2WUH A;  4O7X A;  4B4P A;  5K0U C;  1JYT A;  4D6R A;  4YFZ A;  2XBO 3;  4SBV A;  3AZY A;  3NWK A;  1JUH A;  3SEE A;  3WDW A;  3MW2 A;  3TYJ A;  2TBV A;  3I2H A;  4LHS A;  2X5I A;  1M06 G;  2RS3 3;  1HQL A;  1IOA A;  2PTM A;  4LXL A;  3W20 A;  2KD7 A;  1ASJ 1;  3VD4 A;  1AYM 3;  3IPV B;  2GC0 A;  2DUQ A;  5B2G B;  1L3J A;  3THP A;  4KI5 M;  3WP4 A;  2MEV 2;  4UFI A;  2PHT A;  4QX2 A;  4LO4 B;  1CJP A;  4XIK A;  4UW3 A;  4CDX A;  4LOT A;  5IK4 A;  3UKV A;  1X8M A;  1YIF A;  3I59 B;  3RDI A;  1RUD 3;  1OOP A;  3HT2 A;  1I5P A;  2W5F A;  3OF1 A;  3ZFE B;  1QU0 A;  5FKB A;  4AFA A;  3AKS A;  2YY1 A;  4RQP C;  4YM1 A;  5LBF A;  3I4I A;  4ZXK A;  3B9C A;  3CL1 A;  3I97 A;  1HW5 A;  3K4Z A;  2ZX1 A;  1AR6 1;  5I0U A;  3I2D A;  4CPB D;  1LOB A;  5IVB A;  2BPA 2;  4MG2 A;  2JDA A;  3OY8 B;  1JYV A;  2W1Q A;  4GH4 B;  4GWJ A;  2DBN A;  2BER A;  2GNM A;  3MPB A;  4XDO A;  5F6K A;  5LA2 A;  5A3W A;  2VMD A;  4I0W B;  2PMW B;  1IQD C;  1W99 A;  1XNC A;  2ATF A;  5C4W A;  2XBO 1;  4P9J A;  2GN3 A;  5DDJ 3;  5JSR A;  3NV1 A;  4ONU A;  1AR9 3;  3O1U A;  4FOQ A;  4LBM A;  1RUC 2;  4WM8 A;  4XHX A;  4FAH A;  4WZC A;  5E6H A;  3MV1 1;  2ZMK A;  4URA A;  1LKN A;  1DGL A;  2VMG A;  2WQ8 A;  3BTA A;  3BI3 A;  4E8D A;  3S30 A;  1RUH 1;  2WJS A;  1YFY A;  5FZK A;  3ZSM A;  2QZ3 A;  2Z5W A;  1RVF 1;  5FZ9 A;  3NJX A;  5ABJ C;  1BBT 2;  4YZ3 A;  1EAH 1;  1QGL A;  2J1A A;  4LK7 A;  3LAG A;  4NHX A;  1UOF A;  5BUV A;  2DFC A;  2KA3 A;  4GWM A;  4HMZ A;  2BGP A;  4CXY A;  2A70 A;  3Q8A A;  4X6Q B;  3RYR A;  3VBR A;  2CU5 A;  3KM5 A;  4QKF A;  4BQ5 A;  4Q5O A;  1UWW A;  1HN0 A;  5A6X A;  5IK5 A;  4JKM A;  1LRH A;  3ATG A;  1QJX 2;  3P3P A;  3VD7 A;  3ZFG B;  5ABJ B;  3KGL A;  5BNO A;  1RB8 G;  2ZEX A;  4FFH A;  4M01 A;  3CMG A;  4ZS3 A;  2BRT A;  4XFG A;  4FOY A;  3U37 A;  2ZGK A;  4Y1U A;  5TSW A;  3AP7 A;  4D8M A;  3QOP A;  1ZZ8 A;  3VBH C;  2P3Y A;  4UWD A;  4LIT A;  3POJ A;  1YWK A;  5LCW L;  3WUD A;  4E9K A;  1YIP A;  5FXV A;  5FO9 B;  3P3N A;  1ULE A;  1QJZ A;  2PLV 2;  4CPB A;  4AI8 A;  1FMD 1;  3I54 A;  1YI9 A;  3BIW E;  1ULP A;  3VBS A;  4CYD A;  1BVV A;  4XFI A;  2XH6 A;  2YBK A;  5KHJ A;  4CTE A;  5FQ0 A;  2D3P A;  2Q5T A;  4YW7 A;  5KC6 A;  1QQP 2;  1WW7 A;  4PDW A;  2WFF 3;  3B01 A;  2GH2 A;  4DMI A;  3DGT A;  2VEC A;  5FPL A;  2UYA A;  3SCF A;  2W1W A;  3I2F A;  3POG A;  5T52 A;  2QCS B;  3MHZ A;  2PQS A;  5FBZ A;  1OLM E;  1ZZ7 A;  2WT2 A;  3ZSE A;  3RYK A;  1MPX A;  4DIQ A;  1RUG 3;  2J7M A;  2ENR A;  3AVS A;  4RD7 A;  1YHF A;  4PDW B;  4PLM A;  3WG4 A;  2D3R A;  4MGS A;  4C8D A;  3ZFG A;  1LTE A;  2ARC A;  1DHK B;  3AYA A;  3GBG A;  3UYJ A;  1XC6 A;  1AUY A;  5IVY A;  3SCG A;  4D6Q A;  2PEL A;  1PMI A;  2GU9 A;  3SLI A;  4K20 A;  1UY0 A;  4K3U A;  4BB3 A;  2BWA A;  4QX0 A;  1Y43 B;  1B35 A;  3ZFF C;  1OLM A;  4ZZ8 A;  2FDH A;  1SLL A;  4XQD A;  4KBB A;  4D7S A;  1GOG A;  4FSJ A;  1EPZ A;  5I0R A;  5EP9 A;  2PXJ A;  1RHI 2;  2DU0 A;  4LHN A;  2ADE A;  4QQP A;  2WAO A;  2JIJ A;  2VZO A;  2ZGT A;  5IJR A;  3O0X A;  1LGC A;  1GFF 2;  1ONA A;  3J8F 1;  5FMD A;  3OBR A;  2V5D A;  5A7O A;  3I2I A;  3RS6 A;  3ZLI A;  5C6C A;  1UOJ A;  1JHJ A;  2R6Q A;  3SCH A;  1H1M A;  2AYH A;  3E5Q A;  1CAV B;  4M0H A;  4RFR B;  3HOB A;  2ETE A;  5D8A B;  4Q0U A;  3D5O A;  1MS5 A;  2W46 A;  1XU2 A;  3BYW A;  4E4D X;  3VUO A;  2BVB A;  1RUJ 3;  1XXN A;  2JDZ A;  4CCO A;  3E6B A;  4L11 A;  4GWN A;  5HI0 A;  5C9A C;  4FP2 A;  2WNE A;  1K5M B;  1QJE A;  1H8V A;  3OB8 A;  1J3R A;  3OGJ A;  5IVJ A;  2IVI B;  2CDP A;  1GZW B;  3FE5 A;  4QX1 A;  3VB9 A;  3HNM A;  5FZ1 A;  1YXW A;  1RUN A;  1X9T A;  1VMH A;  3VDD B;  1GIC A;  5JXJ A;  3FUQ A;  3VZN A;  1ASJ 2;  1LUL A;  2BYV E;  1MS0 A;  2BNM A;  1HIX A;  2AC1 A;  3DUI A;  1CN1 A;  3ACF A;  3E5X A;  2Q4S A;  1RVF 2;  3BOD A;  5JSP A;  2XOM A;  4B1M A;  4BZ4 A;  3LEI A;  4JHT A;  2EIE A;  5K9Y A;  1S0E A;  3LSD A;  4CDX B;  2PN5 A;  5FZO B;  1UQX A;  4XTM A;  3RI9 A;  1UYX A;  4TYS A;  1S55 A;  1ULF A;  1BZW A;  1JOJ A;  4GZ9 A;  1CPM A;  3KZ4 C;  1RVF 3;  3OG2 A;  4UI9 L;  2XWB B;  5DMY A;  4AHZ A;  1EV1 3;  1OSG A;  1HN1 A;  1SEF A;  2ZX0 A;  1COV 3;  4JGZ A;  4BM8 A;  5C9A B;  4OHY A;  3AZX A;  3RFR A;  1RYY A;  3AFK A;  4ISQ A;  4P9Y A;  3HEI A;  2D93 A;  3WW2 A;  4W8J A;  5AC9 2;  2CL2 A;  1SLB A;  5DZG A;  3HAG A;  2WLQ A;  1PGL 2;  2V73 A;  5JI9 A;  1ULG A;  3IDE A;  4GQ7 A;  3VHR A;  5J48 A;  2XJP A;  2D98 A;  1LJ7 A;  3FL7 A;  1WKY A;  5DQ0 A;  4LEJ A;  5GLW A;  3AYE A;  2QQJ A;  4XFB A;  3ELN A;  1JH5 A;  1TNR A;  1H9P A;  1NKG A;  1W8U A;  3OEA A;  2VJX A;  4IV3 C;  4TZD A;  1GZ9 A;  4I09 A;  5A3U A;  4ES8 A;  2SBA A;  3A0K A;  5KC5 A;  3TWI A;  1QJX 1;  2MHF A;  3NAP B;  4IEZ A;  2JEN A;  1GV9 A;  2X5I B;  4FAG A;  3EO6 A;  3ZKU A;  4PT6 A;  4ITC A;  4YZ1 A;  4AEM A;  1GQG A;  3LQC A;  5CEH A;  1XNK A;  2PHX A;  1V6K A;  3DYO A;  3VDD C;  1QNY A;  2VQA A;  4PIZ A;  4V1P A;  1QXJ A;  4LBQ A;  2Z69 A;  5FZF A;  3O12 A;  2AUY A;  4I0A A;  1V00 A;  5F39 A;  2XVG A;  1K3I A;  3ON7 A;  4O61 A;  1ND3 A;  1S0F A;  2XML A;  3OPW A;  4JX0 A;  4Q4Y 1;  5FZE A;  4C91 A;  3HQX A;  1GUI A;  5A3T A;  1PO1 2;  2HEY F; 
#chains in the Genus database with same CATH homology
 2QQI A;  3I2K A;  3THD A;  1LNS A;  4AG4 A;  3ECQ A;  4GWI A;  4A3Z A;  2J1U A;  4BXS V;  5JXI A;  1OH4 A;  4CUC A;  1CX1 A;  2QQO A;  2ORX A;  1JI6 A;  3CZU A;  4ZY9 A;  3WEZ A;  4DUV A;  1XPW A;  2E32 A;  2WO2 A;  3IDA A;  3IB3 A;  3A22 A;  4RYD A;  2VC9 A;  3PUI A;  3K4D A;  2L9L A;  3E1F 1;  3K4A A;  3LPG A;  4ZZ5 A;  3K75 B;  4OYU A;  5G04 L;  3WF1 A;  2VZQ A;  2X05 A;  2VR4 A;  3C7G A;  4P02 B;  4P5Y A;  3MO4 A;  4DUW A;  1GOH A;  4QB2 A;  1JZ3 A;  5FUI A;  2QQL A;  4XVH A;  3GDB A;  3SKJ E;  2Y6H A;  1NAE A;  1O59 A;  2VCC A;  2R7E B;  3P6B A;  4D0Q A;  4JKL A;  2QQN A;  2VOT A;  2VL4 A;  3WF3 A;  4CUA A;  3I3E A;  1F4A A;  1SHW B;  4CVU A;  2VQT A;  3JXS A;  2E26 A;  1JYW A;  4W50 A;  1PX3 A;  5IFT A;  1W9T A;  3WNL A;  4CU8 A;  3T0D A;  3K46 A;  4KMQ A;  1R64 A;  5JMO A;  4A41 A;  1JZ8 A;  1CZV A;  3OGR A;  4BK5 A;  4XUQ A;  3T2Q A;  4A42 A;  1DYO A;  4XUP A;  3LPF A;  3WSO A;  1UY1 A;  1KGY A;  1JU4 A;  4P00 B;  1US3 A;  1OD3 A;  4ARX A;  1JU3 A;  3T09 A;  3MBW A;  1UYZ A;  4DXT A;  2V4V A;  3FN9 A;  1UMI A;  3IAQ A;  4ARY A;  1GNY A;  5JR2 A;  3A21 A;  3GM8 A;  1JYX A;  2WBK A;  3III A;  3PUH A;  4DEV A;  2YG0 A;  3CIH A;  2W91 A;  1P8J A;  3IAP A;  3HJR A;  1SDD B;  1XNT A;  2E31 A;  2YFZ A;  4QB1 A;  4Z2A A;  1W9W A;  1GU3 A;  1JYN A;  1O8P A;  4UOJ A;  1J83 A;  3CDZ B;  1F4H A;  4BK4 A;  2LW8 A;  2XON A;  2BZD A;  2YC4 A;  2WN2 A;  3UES A;  5IHR A;  2W47 A;  2VZS A;  4QDS A;  2Y6K A;  5C70 A;  3W5N A;  4XUT A;  4AAX A;  1H6X A;  2W95 A;  4MGQ A;  3WF0 A;  3T2P A;  2VZT A;  4YPJ A;  4QDR A;  3MV0 1;  1K42 A;  1CZS A;  5B4X A;  4MAD A;  4W4Z A;  1GOF A;  2VZV A;  3D3A A;  2ID4 A;  4ET7 A;  1J84 A;  2Y64 A;  1UY4 A;  2J1V A;  2QQK A;  3EYP A;  3UET A;  3W5M A;  4BJ0 A;  3VDA A;  2XQX A;  3WF2 A;  4A6O A;  3VDC A;  2EIB A;  3WNN A;  4CU6 A;  4JKK A;  3WF4 A;  2B9V A;  2RJ2 A;  3NQH A;  3WNM A;  1K12 A;  5LA0 A;  3OGS A;  3VD9 A;  2RVA A;  4DXS A;  1KEX A;  3NJV A;  4XUR A;  2WO1 A;  1NUK A;  2VTF A;  5A1A A;  2J1R A;  1GQP A;  3FHQ A;  4DUX A;  1YQ2 A;  2VCA A;  2J1T A;  1OF4 A;  2W9X A;  3VD5 A;  2B4K A;  2VZR A;  3MUY 1;  3GXU A;  4OMD A;  4XUN A;  3GGL A;  3BGA A;  2WO3 A;  1D7P M;  2RV9 A;  3FHA A;  4OUE A;  1CZT A;  3WNO A;  2Y8K A;  5CYY A;  2WZ8 A;  2WZE A;  3OEB A;  3WQB A;  5C7G A;  4DXR A;  1K45 A;  4QAW A;  5JXG A;  3P1I A;  2ZEZ A;  4LQR A;  1ULO A;  4CU7 A;  5JUV A;  2J1S A;  5G05 L;  2EIC A;  5CZK A;  4MOA A;  2VZU A;  3T08 A;  1JZ4 A;  3ACI A;  3SKV A;  2BBA A;  2QQM A;  3A23 A;  4CUB A;  4XUO A;  3ACG A;  3I2J A;  2VQU A;  2QBX A;  2WUH A;  3SEE A;  1BHG A;  3I2H A;  4LHS A;  5EIY B;  3ZM8 A;  4M4R A;  4PF1 A;  2KD7 A;  2W1S A;  3AC0 A;  3F2Z A;  4LPL A;  3VD4 A;  2YFU A;  4CU9 A;  1TVG A;  2YC2 A;  2ZXQ A;  4KI5 M;  3HNB M;  1EUT A;  4QX2 A;  3A7Q A;  1TG7 A;  1UYY A;  2J22 A;  5IFP A;  1I5P A;  1SG3 A;  2W5F A;  3C7H A;  3HN3 A;  1CIY A;  3K77 A;  3I97 A;  3K4Z A;  3MUZ 1;  5IYY A;  2JDA A;  1JYV A;  5EJZ B;  2W1Q A;  4GWJ A;  3T0A A;  2BER A;  3UNP A;  3LEG A;  2VME A;  4HG6 B;  5LA2 A;  2VMD A;  2WAB A;  3THC A;  1IQD C;  5B4N A;  1W99 A;  3DYM A;  4QPW A;  4TTG A;  1O8S A;  1DP0 A;  3MV1 1;  2WQ8 A;  1L7R A;  3I3D A;  4E8D A;  2VM9 A;  4ZXE A;  1OT5 A;  5J1X A;  3NJX A;  2J1A A;  1UXZ A;  5C71 A;  2ZEW A;  2BGP A;  5EJ1 B;  4QDQ A;  2XHN A;  1UWW A;  2W92 A;  4JKM A;  3C7O A;  2WAA A;  5DPN A;  3VD7 A;  1JZ7 A;  3SEP A;  2ZEX A;  4P08 A;  3CMG A;  2C26 A;  3U37 A;  5HPO A;  3CKH A;  4JHZ A;  2ZEY A;  4D8M A;  3I3B A;  5LCW L;  5I0D A;  3LE0 A;  1H6Y A;  1W8N A;  5JXH A;  3VDB A;  2JD9 A;  1UXX X;  2HYX A;  1ULP A;  4XZU G;  4QX3 A;  2C4X A;  3ETP A;  2W94 A;  1JZ2 A;  1UMH A;  1W0N A;  2E33 A;  2DDU A;  2W1W A;  3I2F A;  4PQQ A;  4A45 A;  1W8O A;  2PQS A;  1JZ5 A;  5DN2 A;  3WNK A;  1MPX A;  2J7M A;  4RN5 A;  2JKX A;  1L7Q A;  4MGS A;  4A4A A;  1XC6 A;  2LS6 A;  1UY0 A;  1UY2 A;  3DEC A;  4IUG A;  4QX0 A;  4ZZ8 A;  2VCB A;  3T0B A;  1GOG A;  3OBA A;  2DCJ A;  3LEK A;  3HPN A;  2WAO A;  2VZO A;  5IJR A;  1NX9 A;  1US2 A;  1OF3 A;  1XNA A;  2V5D A;  1WCQ A;  2ORZ A;  2VZ3 A;  2WN3 A;  3I2I A;  2CDO A;  2Y6G A;  1JHJ A;  2DCK A;  2VMF A;  4UAP A;  4M4P A;  3HOB A;  2W46 A;  1PMH X;  2Y6J A;  3EB7 A;  4BDV B;  3DYP A;  2JE8 A;  3T2O A;  5LA1 A;  3OB8 A;  3NNG A;  4L0P A;  2CDP A;  4QX1 A;  3HNM A;  2X09 A;  4KWU A;  5JXJ A;  3HNY M;  3ACF A;  1JZ6 A;  2VZ1 A;  2HLE A;  2XOM A;  3VD3 A;  3LEI A;  2WDB A;  2EIE A;  3C7F A;  1PX4 A;  1UYX A;  3C7E A;  2OKX A;  4GZ9 A;  1T2X A;  2VZP A;  4OMC A;  3NRU A;  3OG2 A;  4UI9 L;  5DMY A;  2W1U A;  4MO3 M;  1HN1 A;  2VMC A;  3J7H A;  2V72 A;  1EUU A;  1RYY A;  3CQO A;  3HEI A;  4W8J A;  4OZO A;  1DLC A;  2C9K A;  3ACH A;  1PMJ X;  3FL7 A;  1WKY A;  5DQ0 A;  2J1E A;  2QQJ A;  1NKG A;  3OEA A;  1UX7 A;  2VJX A;  2W87 A;  4A44 A;  4TXW A;  2EID A;  3I2G A;  2WYS A;  2Y6L A;  3C8X A;  4FI9 A;  5F7U A;  1GMM A;  2YB7 A;  4PT6 A;  3WNP A;  2Z4F A;  4QB6 A;  3LQC A;  3OGV A;  3DYO A;  2BGO A;  1W9S A;  4DEQ A;  5HXM A;  1UZ0 A;  2VO5 A;  2W3J A;  1UY3 A;  1K3I A;  4JX0 A;  4E8C A;  3CZJ A;  1GUI A;  2X10 A;  3ABZ A;  3BN6 A;  4LKS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...