4UAPA

X-ray structure of gh31 cbm32-2 bound to galnac
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
150
structure length
150
Chain Sequence
SHMNITVSGDSSQLQSGMGLDKLIDGTTSSDDSSRMDLKWIFTSDQQDKGTLPFEMTFEFNEPKTLENFTIYNRMNSNGTINIAAMKKVKAVGYLNGEEFDLGEKANITSATTVYELGGKEFDKIVITALDSHKDKNTLAINEIEFYEKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords Glycosyl hydrolase, family 31/fibronectin type III domain pr
publication title Diverse modes of galacto-specific carbohydrate recognition by a family 31 glycoside hydrolase from Clostridium perfringens.
pubmed doi rcsb
source organism Clostridium perfringens
total genus 36
structure length 150
sequence length 150
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-08-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 4uapA00
4M4PA 2QQJA 3I97A 1CZTA 2EIEA 2YG0A 4FI9A 1SHWB 5C70A 2WAOA 1JZ4A 1EUUA 3IAQA 1OD3A 2Y6HA 1W0NA 4IUGA 4XVHA 4MO3M 4YPJA 2VCCA 2X09A 3SKJE 1WCQA 1SG3A 2J1SA 1UX7A 3I2KA 4P5YA 3SKVA 4A4AA 3ZM8A 3VDCA 3WNLA 5IFPA 3WNMA 3I2HA 1JYVA 3UETA 2V5DA 2ORXA 4UI9L 3T2OA 2YFUA 2HLEA 1O8SA 4CU6A 3K4AA 2VZ1A 3WNPA 1JZ8A 3HPNA 4JKLA 2LS6A 5IFTA 1TVGA 4CUBA 3NNGA 3HNMA 2CDPA 2EIDA 4QX1A 4XUTA 3LQCA 2Z4FA 4GWJA 1UMHA 2C4XA 3MV01 2QQLA 2WDBA 1O8PA 3T2PA 4E8CA 2J1RA 2HYXA 1JHJA 5JXJA 1BHGA 4A3ZA 1GU3A 3WF2A 4QX2A 2VCBA 4QB1A 4DUVA 2JD9A 1JYXA 4P02B 2QQMA 1WKYA 4JHZA 3THCA 2QQIA 2J1VA 2VMDA 1PMHX 3NRUA 1L7QA 1W8NA 3T2QA 3HNYM 1KGYA 3CKHA 4ARYA 1UY2A 2QBXA 4UOJA 5DMYA 3ETPA 3WEZA 2W1UA 4DEQA 2QQOA 2W92A 2VZVA 2DCJA 1JZ7A 3DYOA 3K75B 4TTGA 4DXTA 1JZ6A 3VDBA 2J1UA 3OB8A 4JKKA 1K3IA 1UYZA 5B4XA 1T2XA 3VD9A 1UZ0A 3HOBA 5LCWL 1JU3A 2VC9A 3CDZB 3P6BA 4TXWA 2XHNA 3WNNA 1GOFA 3PUHA 1GMMA 1UXZA 5JUVA 1CIYA 4W8JA 2VZOA 2BZDA 4DEVA 2VZQA 2WN3A 3E1F1 5I0DA 4BK5A 4QPWA 3I3EA 1GOGA 2VZSA 2W3JA 1OH4A 3SEEA 5EIYB 4ZZ8A 2XONA 4OUEA 1K42A 4P00B 2JDAA 1IQDC 2WN2A 4CU8A 5LA0A 4QDRA 2V72A 1US2A 1OT5A 2WQ8A 1NX9A 3I2FA 2OKXA 2VZ3A 4P08A 2J1AA 5EJZB 3VD5A 2WBKA 4JKMA 2VZTA 3ACHA 4XURA 3THDA 2J1EA 1GQPA 2BERA 1GUIA 2J22A 5DQ0A 2WO2A 1J83A 3WF3A 4QB6A 3LE0A 3DECA 3ACFA 3OBAA 3MUY1 2CDOA 3OGVA 4W50A 4DXSA 3LPGA 4D8MA 2VO5A 2W1QA 3U37A 2W87A 1MPXA 4PT6A 3A22A 3LEGA 1XNAA 2C26A 2ID4A 2W5FA 2Y64A 1K45A 1OF3A 1YQ2A 1W9WA 1UWWA 3MO4A 1GOHA 3IB3A 3ACGA 2WABA 4LPLA 1CZSA 2W46A 2ORZA 3A23A 4BXSV 3CQOA 5JMOA 1NAEA 4OMDA 4D0QA 4GZ9A 1K12A 5HPOA 4CVUA 4ZXEA 3I2GA 4DXRA 2WZ8A 1DYOA 2VOTA 2W1SA 1UXXX 2PQSA 3K77A 2X10A 2KD7A 2JKXA 2ZXQA 4KI5M 3T0AA 3VD4A 5IJRA 2QQKA 5A1AA 3OGSA 3VDAA 1OF4A 1US3A 3I2JA 3I3DA 3NQHA 3SEPA 2DCKA 3IAPA 3OEAA 3F2ZA 1W8OA 5B4NA 1PX3A 3CMGA 4MADA 2R7EB 2Y6KA 3FL7A 4GWIA 3NJVA 2WO1A 4DUWA 2WZEA 2J1TA 4OZOA 2VL4A 2VZRA 2WO3A 2XOMA 3K46A 2BBAA 2VMFA 2YB7A 4PQQA 3A21A 4LQRA 3P1IA 2VQTA 2W95A 4XUPA 2VZUA 5JXHA 4DUXA 2VJXA 3FN9A 2JE8A 2E32A 3I2IA 4OMCA 1PX4A 1JI6A 3WNKA 5DPNA 4LKSA 2BGOA 5FUIA 2W1WA 1UMIA 3ABZA 1JZ5A 2VTFA 4AG4A 2QQNA 1GNYA 1XC6A 1J84A 4Z2AA 3WSOA 3C7OA 4MGQA 4KWUA 4BK4A 2Y6GA 3T0BA 5IHRA 1JZ3A 3C7GA 3C7HA 1DLCA 2C9KA 3BN6A 3IIIA 2V4VA 4A44A 2ZEZA 3JXSA 5IYYA 4ET7A 4BDVB 1F4HA 4BJ0A 4A41A 1NUKA 2J7MA 3FHQA 1EUTA 1UY1A 2Y8KA 1UY4A 3MUZ1 4A42A 3K4ZA 3HJRA 4JX0A 5JR2A 2YFZA 3J7HA 4XZUG 4OYUA 3LEIA 3CZUA 3GDBA 5LA1A 1JYNA 3GM8A 3CZJA 4XUNA 1D7PM 5DN2A 4PF1A 5G04L 1W9SA 1JYWA 4E8DA 3ACIA 5C7GA 3VD3A 3T08A 5LA2A 2Y6JA 3ECQA 1PMJX 3DYPA 1W99A 4CU7A 1TG7A 5G05L 1W9TA 3OEBA 4QB2A 1UYYA 1XPWA 2XQXA 3WQBA 3HNBM 4LHSA 4CUAA 2ZEWA 1JZ2A 2VR4A 2VZPA 3W5NA 3HN3A 4KMQA 4QAWA 3VD7A 3PUIA 3BGAA 4AAXA 2X05A 1H6YA 2E31A 4RYDA 2E26A 3OG2A 4A6OA 3T09A 4W4ZA 2RVAA 4XUQA 4QDSA 4UAPA 4MGSA 4L0PA 1F4AA 4ZY9A 1R64A 3AC0A 3NJXA 2WUHA 2W91A 5JXGA 2W94A 4CU9A 3C8XA 4RN5A 3I3BA 3EB7A 2VMCA 1XNTA 3EYPA 2E33A 5EJ1B 2ZEYA 3UNPA 2L9LA 2WAAA 1NKGA 2WYSA 3CIHA 3C7EA 4QX0A 4M4RA 3HEIA 4XUOA 3C7FA 2DDUA 3WNOA 4HG6B 2VQUA 5J1XA 4ZZ5A 3W5MA 1CZVA 2W47A 3FHAA 4MOAA 1CX1A 2B4KA 3D3AA 3WF0A 3MV11 5CZKA 1P8JA 3UESA 2B9VA 2EIBA 2BGPA 5JXIA 1HN1A 3WF4A 2LW8A 5F7UA 2W9XA 5C71A 3DYMA 3WF1A 1H6XA 3GGLA 5HXMA 4A45A 2Y6LA 1ULOA 1KEXA 4ARXA 1SDDB 3OGRA 4CUCA 3K4DA 1L7RA 2VCAA 1DP0A 3A7QA 1RYYA 1UY3A 1UY0A 3T0DA 2VMEA 2EICA 1O59A 2RJ2A 2YC4A 4QDQA 3LPFA 3IDAA 2ZEXA 3LEKA 3MBWA 2VM9A 1UYXA 1ULPA 5CYYA 2YC2A 1JU4A 4QX3A 3GXUA 1LNSA 1I5PA 2RV9A
chains in the Genus database with same CATH superfamily
1SFYA 2QQJA 2G1MA 1N3OA 4UBGA 4YZ4A 2MEV1 3DXUA 3DPRB 4Y1YA 1WCKA 4BQ1A 2Q5TA 4FOVA 1LOBA 2GDFA 4NIIA 1XYNA 1CR7A 4GH4C 4GALA 1S0GA 4I0AA 3VBRC 5KXEA 4A7KA 3MIHA 2B42B 3Q8FA 4KWLA 2WAOA 1W2TA 1KRIA 2ZGTA 1PNGA 4IUGA 4XC9A 4XYXA 3W58A 2BGCA 4YPJA 4LLOA 1AR62 1HV0A 1TME1 4XFIA 4LUMA 3SKJE 3T4VA 1EAH1 5LK7B 3PVOA 3LF7A 4AEMA 3I2KA 4P5YA 2MPFA 4XDOA 2FCTA 1LAJA 2WO7A 2VNOA 1H30A 2XJTA 4Q4Y3 4AOCA 3WNLA 4AQ6A 4LBLA 3UETA 2V5DA 3N3HA 4CP2A 2OZ6A 1X33A 2GH2A 4NUBA 4BIFA 2V4AA 2ATFA 4XXPA 2HH9A 2YFUA 1EYBA 2HLEA 4QHBA 1CJPA 3ZKUA 4CU6A 2PELA 2TNFA 4S2FA 2JDPA 4CEYC 4AW7A 1U5YA 2VCMA 1O7FA 2VMHA 2YPJA 4JKLA 1LULA 2LS6A 1RVF1 3OBTA 3T2TA 1TVGA 2HWC2 1V6LA 3LD8A 3S57A 3MIBA 1REDA 5CFCA 2EIDA 1IG0A 2YU2A 1DGLA 4QX1A 1A78A 4XUTA 3LQCA 2JDKA 1YRZA 1O5LA 2R1DA 3TN93 5FZOB 2Z4FA 4Q4V1 4EWDA 3ZYFA 3UYJA 3U1XA 2QQLA 2WDBA 3MYXA 5DDJ3 1VBB3 3TRSB 3UK9A 3ZYPA 4XABA 3T2PA 5F2WA 4R9DA 1X82A 4B4QA 5CG8A 1JHJA 5A6XA 5C9AC 2HJIA 5KBFA 1MZEA 4QQHA 1OQEA 2BEOA 1HLCA 1RC6A 2R072 1G9BA 2ERFA 2QQMA 1WKYA 2JEMA 2NPIA 5KHIA 1ASJ1 3USUB 1BKZA 3T2QA 1TMF1 1C57A 4FXKB 1OA4A 4IW3A 1KGYA 5FPLA 4U2AA 4ARYA 3BALA 4M0HA 2YMZA 4N8MA 5GJ6A 3VB9A 2VW1A 1EV11 2BP6A 2ZKLA 3AZZA 2ARCA 3N9MA 2W92A 3I59A 1RUF3 2VZVA 4C91A 2FCUA 3BB6A 3KF3A 5JSOA 1JS9A 3R05A 1DU3D 1AL21 2FZ1A 2Y0OA 3AKRA 5JDBA 4AGRA 3NKTA 3N35A 1DIWA 1L3JA 2XKPA 3MLKA 4D6SA 4WM7B 3KT4A 5JCTA 3NSTA 3EJKA 1O6UA 3M3IA 2PAEA 1W6PB 4JKKA 4P9JA 2UWBA 4Y1XA 3ZKYA 4O61A 4PLNA 1S2KA 1OUXA 1UYZA 5B4XA 4Q4X2 3ZFGA 3VD9A 4IEXA 3HOBA 1DZRA 2FQPA 3AKQA 4PHZA 5FXXA 2WRAA 3WNNA 2QUOA 3N7JA 3PUHA 4RFT0 4BZ4A 4BQ4A 3ZN5A 1N1TA 1UXZA 2VXRA 3B00A 5A3OA 5JUVA 2BVVA 1B35B 4FOYA 4HKLA 4DEVA 3UGGA 3NAPC 2HBTA 1UCXA 2D6OX 1LKNA 3GCXA 4JGYB 2Q1FA 4KG0A 4XIOA 4BK5A 3ZN6B 5K9YA 1F5FA 2VY0A 5FQ0B 3DCQA 2VZSA 4AEKA 1HX6A 1VRH2 3WLUA 3K2OA 2A3YA 2ZAHA 1KJRA 1VMHA 4GB33 5LY1A 3R4DB 4HL0A 1DQ0A 4L8QA 3BUCA 5E16A 3VZOA 1IQDC 2EXIA 2WN2A 3Q8CA 5GLTA 4CDUB 4CU8A 3NL1A 4NVPA 3JD72 4PBOA 5A6YA 3BU0A 1V6KA 3AP4A 4BMBA 4ASMB 1NX9A 1XQNA 4UFJA 1V6MA 1FPN3 2YC0A 4FPKA 5FLHA 3TAYA 3VDDC 4E4SA 1MS8A 2XVGA 3ILNA 3S6PA 4OUMA 4OQ9A 1X9TA 5JIUA 3NNLA 1LB2A 3ACHA 1NCRA 1VMJA 3AZVA 4XURA 3IM0A 3THDA 3UGFA 3NNFA 1I1EA 5FO9B 2XJPA 2K0GA 1WLDA 1V0AA 2X5IB 3RZGA 1J83A 3WF3A 4P9YA 5FZ0A 2RS31 3ACFA 4Q1PA 4EN8B 4BPZA 3OGVA 4A2UA 3KCCA 4KG8A 1QJY2 2B39A 4BIOA 1TE1B 3O12A 4GIQA 4D7TA 4Z82A 4PT6A 1WBLA 3T30A 3SHRA 1REFA 4J6GA 2C26A 2A7AA 2ET1A 4BWOA 4CPBA 2JKBA 2OQ7A 3ZFEC 1W8HA 2GNBA 4A7YA 2Y64A 4Z8BA 1K45A 2GMEA 1RUC3 1AYM2 5GLVA 4BCUA 1FMD2 4MVTA 1OF3A 4UBHA 5CBLA 4LHLA 3GHNA 4DY5A 4P9XA 4FBFA 5I8YA 1RUD3 4HMZA 4HANA 2RJKA 1G6NA 2ZMKA 3ACGA 2WABA 2ZX1A 1CZSA 2JDYA 4XAAA 3A23A 4N43A 4Y5SA 3CQOA 1NCQA 1KFUL 3THTA 4K8RB 4H3WA 1QKQA 4QD2A 4OMDA 2ZHLA 2QNKA 3BCWA 3OOXA 1LGCA 2VOXA 1CAUA 4Q26A 4Z2WA 3B94A 4JAAA 4KL1A 2BQPA 2EALA 2EXJA 4UFIA 4P9WA 2D43A 4CVUA 5FR3A 2ZHKA 1ND2A 5H9QA 2ZJCA 3VBHC 1SMVA 4WZFA 1CAWA 2WS91 3AMMA 5I8TA 4MGKE 1QJX3 3ETQA 3ZIXA 3I2GA 4IEWA 4GQ7A 3RMXA 2WZ8A 4RQPB 2WWSA 2VOTA 3ZSMA 5F1RA 2W1SA 3LOBA 1POV0 1L7LA 3CJIA 4XEZA 4XE9A 4MH0E 2JKXA 3O0XA 4KI5M 4CCEA 4XQ4A 1VBE2 4MXWB 4WM8C 5A1AA 2ADDA 1Y7BA 4E2QA 1DYPA 4PIXA 4Q0UA 4LHNA 4AVSA 3NJZA 2R30A 1H8TA 3I3DA 3NQHA 1FOD3 2DCKA 3O0WA 5T3NA 2DV9A 5FYIA 1K5JA 1ZZBA 2FHRA 3OJBA 2JE9A 1VBD3 4LO6B 1RUE2 3KV4A 1MS5A 5I0SA 4UFHA 2XJVA 4FFIA 5IVJA 1JYIA 1H2MA 1RUI1 1WW6A 4LBQB 4QGLA 4YW5A 5B4NA 1OOPC 2JG8C 1MS3A 2JG9C 4MADA 1G86A 1FXZA 2XG3A 1HJFA 2MEV3 3H3LA 2DFBA 4Q4W1 4ES8A 2PTMA 4GWIA 5LZ6A 2JB8A 3PTRB 3BYWA 3KCYA 3OYWA 4O65A 4FOWA 1DQ5A 4DUWA 1URXA 3MIDA 3O1UA 5FTTC 2J1TA 4TLGA 2RHPA 4OZOA 1S0JA 3FHIB 5BNOB 2WO3A 2XOMA 3AP5A 2BBAA 3CL1A 3WDVA 3P1IA 4I2OA 3WNXA 5IATA 4XUPA 1BBT3 1TME3 3KD4A 1F15A 2V09A 1EAH3 5FYZA 5A7WB 1OUSA 3FN9A 4Y4YA 2JE8A 4HVRA 3WDUA 3VV1A 1CAVB 2DBNA 5E89A 3WG3A 2VMIA 5L9RA 5DPNA 4YZ3A 2GMMA 3ZR5A 4GAZA 2CWSA 2W1WA 1UMIA 1JZ5A 4Q8KA 1POV1 2E7TA 1CPMA 2HEWF 2VTFA 4NPLA 5FY0A 4AG4A 3S7EA 1OLQA 1GNYA 1PVC1 3MW3A 3MW2A 1Z78A 1LECA 1XC6A 2RM21 1FI2A 1RVF3 4HZFA 4JTOA 4OUSA 3MF6A 2B46X 1J1TA 1QQP1 4BK4A 1RUNA 1Z7S2 4H2AA 3ON7A 5IHRA 3TNPB 1PGL1 1SQ4A 4QPIA 4YM2A 4DB5A 2C9KA 1QGLA 3BN6A 1R1A2 4ZU7A 3IIIA 5FP7A 3BTXA 2Y26A 2Q30A 1WUVA 4LKDA 2ILMA 3U07A 4O7XA 4ET7A 3EXUA 1H1AA 3MEPA 4GH4B 4CZSA 2PQQA 3OD4A 4BQXA 2GC0A 2YU1A 4N7IA 1SLTA 4P5HA 1EUTA 4XMAA 5F6KA 4L92A 1UY1A 2Y8KA 3GZEA 3O1TA 2OZJA 2PHFA 3MUZ1 1ASJ3 3K4ZA 4LKFA 5FPZA 4MHUA 5CU1A 3I2OA 3KHBA 3EBRA 3O0VA 4XFBA 1W6MA 3DPRC 3CZUA 2ZMLA 2ZX2A 1XSQA 4LEJA 1K5MA 3KQ4B 2BYVE 2DVGA 4PLMA 4PLOA 2PHTA 1EV13 3BKZA 1REEA 3V0AB 4AI0A 3R6SA 1D7PM 3LAGA 4YLZA 2OX0A 5GM0A 1PIV3 5JR7B 1FATA 1E5IA 4PF1A 3U11A 1AL23 1AXZA 4AEJA 5FLIA 4AI9A 4HXCA 1AR72 5BNPA 4XF0A 1RXFA 4XMIA 2QQVA 4H7MA 3WQ1A 4FO9A 4TYSA 1NY71 1W6NA 2VBBA 4NIAA 1W6QA 1N3QA 5GZDA 4AHXA 2A1XA 4CDQA 4KGGA 4ISQA 4CU7A 2XLAA 2JB4A 2ZGNA 4LXLA 5G05L 2P6CA 1GQGA 2VGDA 2KA3A 3VHNA 3ZIWA 1A34A 1XU1A 2GSYA 2E63A 1IS3A 1YQ5A 1YQCA 4CUAA 1UIJA 4LIVA 1BK1A 1CQ9A 2HEYF 4MV2A 2OUHA 4X8PA 1NXMA 3ES1A 4Q2FA 5C6CA 4P9GA 2YY1A 2RS52 4C90A 4QAWA 2R063 5L9VA 2ETEA 3K51A 2HKXA 1ENXA 1D0HA 4CDWB 4RYDA 4B4RA 2AZ5A 1QEXA 5I0UA 1GKBA 4W4ZA 4IEZA 2UYAA 2RVAA 3ZPOA 3TOJA 5L7OA 3OF1A 1ZZ7A 3VBSA 2D7FA 5KXBA 5LEKA 5I8SA 3WX5A 5KHKA 1G9DA 1GWKA 4AGVA 2PN5A 3CEWA 2QVSB 1LU2A 3FUQA 5HCBA 3WP4A 3V0BA 1OMIA 5L36A 2ZOEB 1SACA 3NV3A 5JXGA 3QH7A 2VBDA 4NAOA 2XBO2 5ABJB 1D0GA 1YFUA 1YLLA 2ADEA 3H1YA 4QXCA 4B7KA 4ZKTB 3N7MA 2LUWA 4LA2A 3VHPA 2QKDA 1NZIA 1XNTA 1HW5A 1OA2A 4EJRA 1C5HA 3JUUA 1IGOA 3PUAA 4JDNA 5A3MA 2ZEYA 5FBJA 3ZX7A 1WW5A 2DUOA 4LMFA 4LO5B 2W2IA 2XJQA 4LNVA 4AK3A 1HKDA 4M4RA 2Q1ZB 3HEIA 4MLOA 1PK6B 5F3CA 3HD8B 2P3IA 4CA9A 4NO4A 4FCAA 3VZJA 4NMIA 4HG6B 2C24A 4YM0A 5JZGB 2VQUA 1BXHA 1YFYA 4NOTA 4WZCA 1RMU2 4ZZ5A 3IT8A 2A6ZA 3FHAA 1VAMA 1YHFA 3AL5A 1CX1A 3JBG2 5BUVA 1NA1A 5FK8A 1OSGA 3M1HA 1LHVA 1VBC2 1LOAA 4FQZA 5CZKA 5DZEA 4S2GA 1RUJ2 5FZAA 5J3UA 2BGPA 1HN1A 3WF4A 1OFSA 2XQRA 2LW8A 3LFIA 4DFSA 5BYNA 5C71A 5E6HA 1B35C 1UOFA 1XJAA 1YUDA 3GGLA 3ZXFA 2XVKA 1OLMA 3AXEA 5DUVA 2Y6LA 4JGYC 1KEXA 3HMYA 4XJAA 4MGZE 2EXKA 4YZ1A 4QPGB 4GWNA 3K4DA 2WS93 4FPEA 1GP4A 1TQ5A 5DDJ1 1UQXA 4E4ZA 1PZ9A 4Q4Y2 1NE4A 2VMEA 2HWB1 3POWA 2YROA 2EICA 5C8WA 1O59A 3ZFFA 2YC4A 5FREA 4CDUC 4XPVA 3LPFA 2PAMA 4IV1C 1QDOA 3AYDA 1NLSA 3TYJA 4GXLA 3MBWA 1AX0A 2Y34A 4R8HA 5JAXA 2VM9A 4ISRA 2AR6A 4R4ZA 3ZYHA 5C3PA 2HYKA 4Y20A 5CYYA 5FY8A 1PO13 5LWBA 3EMRA 4LBJA 3HWJA 1UU5A 3TNQA 1I5PA 2Q1MA 3PU3A 4XDPA 4INDA 2RV9A 1XE0A 2IC1A 1GQHA 4K21A 1W03A 4M4PA 1RUF1 1RUG3 4LTAA 5LK5A 1MACA 4A7ZA 2E51A 4COVA 4AWDA 3B69A 1XYOA 1BCXA 1W3VA 3I54A 2X5IC 3RZLA 4Q8LA 5DZFA 3TN92 1AYN2 1G7YA 2D97A 5FZKA 5C70A 1T6BX 4Q4W3 4U36A 2QE3A 1VBB2 5FZ3A 3WP5A 1JZ4A 1SLCA 5J09A 1QDCA 5EWSA 3N9LA 4UW5A 1W0NA 1OHFA 4NHKA 3FWEA 4MUVA 4Q27A 5EPAA 3MPBA 4MXVA 2X09A 2E6VA 2V73A 2R6QA 5L19A 5D8AA 1WCQA 5FZOA 3UT0A 2B7YA 4K40A 3JB4C 2AGSA 3SKVA 1BEV1 2GNTA 1CAXA 4S2DA 5KHHA 3VDCA 5IFPA 4DOUA 3SH4A 4LE4A 5H9SA 1H4HA 4UI9L 1UL9A 3P3NA 2A5ZA 4C0BA 2R49A 3KV5A 3KT1A 1FNZA 4GB31 1O8SA 4W6WA 4ZS3A 3T2OA 3RVHA 4PDWA 4AEDB 3USUA 2ZGMA 4JQTA 2RR12 2YV8A 3LDBA 3D5OA 3BIWE 3HIFA 4O9EA 5CISA 5ANNA 2BU9A 1POV3 4WM8B 5C8CB 1RIRA 4Q0QA 5DAWA 3NNGA 2ZGSA 1PVC3 5F8PA 4AZZA 5I0RA 4RS5B 3PVEA 4QT6A 1W0OA 2RM23 3VZLA 5JSPA 4YZ5A 2WINB 1WCDJ 4NHMA 1I5ZA 4URTA 4DZGA 2XDVA 4GWJA 3N9PA 4HLTA 3AMQA 3NVCA 3H8UA 3POGA 4IESA 4FPHA 3DGTA 4E8CA 5C4WB 2FDJA 5FJKA 1C1FA 4M3CE 1BMV2 2VUAA 3UJQA 3ZSEA 3MGUA 4A3ZA 1F9KA 3DUIA 3WF2A 1XRUA 4FPLA 3CHXA 1MR5A 1MQTA 2JD9A 1ZBE2 5ACA1 3WW2A 1W2NA 2D3SA 5FYYA 1NXD1 1PMHX 1PVXA 3E6CC 1L7QA 1J3PA 3HNYM 2O8QA 5T5LA 3J26N 3CKHA 2K46A 4OLLA 3SISA 5DMYA 2YDEA 1RUC1 3WEZA 2W1UA 1FPN2 1UF2C 3Q8EA 1VAKA 4DEQA 1PGW1 4BHPA 5A3TA 3K75B 1RUD1 5DUXA 3MF9A 1MS0A 5A3LA 4TTGA 4YG0A 3NO8A 5FMDA 4IV3A 2PXJA 3AZYA 2W08A 1S2BA 3HQRA 1KDKA 3N9QA 1Y4WA 3OB8A 3VDBA 4CXYA 5DG2A 5A3PA 3WP6A 1FNYA 2RMU3 4G3YC 1O4TA 1JU3A 4XTMA 5LCWL 2D3PA 3MIFA 1OH3A 2XHNA 5CFDA 3RZKA 2VVDA 4GJYA 3M3QA 1RUH3 3DN7A 4MYEA 4R9CA 1CIWA 1CIYA 1QJX1 4HVOA 4XF3A 4IEQA 2JDNA 2VZQA 3E1F1 3LIGA 1SLBA 2VVFA 4NWWA 4XJZA 1IKPA 4QPWA 3CLPA 4RR3A 2Z2SB 2YBPA 4AGGA 5FK7A 4Z1VA 1ZRFA 4L2NA 5BV6A 4EN9B 2P3JA 2UURA 3ENRA 2XONA 3PVBB 4Q1RA 1BJQA 3UL2A 1K42A 2D40A 4P00B 2FCVA 1NLQA 2JDAA 3WXPA 5E88A 5LA0A 1FOD1 3UV9A 5J48A 1YFWA 3WDWA 2V72A 4UT5A 2Y0IA 1US2A 1OT5A 1W2OA 4SLIA 1CONA 2WQ8A 2Y6FA 4ZU4A 2OKXA 2WNUB 2O14A 3RYKA 4FPJA 4LULA 4QU2A 3ATGA 4ITCA 5I0TA 4XQDA 4CPBD 4EE2A 2P1BA 2XPJA 3VD5A 3VL9A 2VXJA 3VUOA 2GP5A 1AF9A 1GYKA 3QBQA 2J1EA 1OKOA 3IMNA 2BERA 4YG3A 4UFLA 4K3UA 2P6HA 3AM2A 4J1WA 5FZMA 1JYCA 4DMIA 3BIEA 3DL3A 3PUSA 1OXCA 4QWNA 4CP1A 1HXS3 5LATA 2W68A 3LE0A 3TEZA 3KVBA 1DBNA 4Y22B 4W50A 4A6SA 3PLQA 3ZFGC 4DXSA 5FZ8A 2Z79A 4HONA 2HWD3 3PURA 3U37A 5J37A 1MPXA 1BBT1 1UN1A 2WFPA 5FIXA 5C3RA 5F5IA 4V1PA 4BQ2A 3V64A 1VBD2 3PL0A 4YVSB 1VP6A 5FP3A 4GKYA 1RJ8A 2XL7A 1S2EA 1W9WA 1QU0A 1UWWA 3IDBB 5FYCA 4CCDA 2MNGA 4BQ3A 1A8DA 1GOHA 2QTWB 3QCWA 1W2AX 1ZREA 3IB3A 1W9FA 2VVEA 4UXAA 2MEV2 2W46A 4Y5TA 2ORZA 5FJHA 3GZUC 5JMOA 1ZRCA 2AEZA 3MHZA 5FV3A 2IXKA 4LBQA 5F2SA 3O1SA 2CV6A 4XIKA 4BB3A 1O3TA 4D0QA 2HWF3 2D5HA 2ZZQA 2DVFA 4GZ9A 4CXXA 1ULDA 5FY5A 5HPOA 5J96B 1LEDA 2CL2A 5A1FA 4Y1ZA 2A75A 1RHI1 2DU1A 1TME2 2RDNA 3GBFA 4DRVA 4DXRA 1EAH2 1C5IA 1IS6A 2D6NA 2Y38A 1ND3B 2D93A 2YHJA 4MZUA 4P14A 3UKNA 1U5IA 2WZR1 3VBOB 4JGZA 5DG1A 3B93A 1NT0A 4NHYA 1WZXA 3T0AA 4YFZA 2HWB3 5BNOA 4CDWC 3VD4A 5AVPA 2CGNA 1UOBA 4XHXA 5FO7B 1OF4A 2H0VA 1US3A 4FFHA 3LKJA 4YVWA 3VBUB 3HT1A 4N53A 5JLVA 4FAGA 1ST8A 1NLRA 2UYBA 3F2ZA 2BFUS 5FZBA 2ZX0A 5LW9A 2WNVB 4F3JA 1ENRA 2PHUA 4LR4A 1RVF2 2Y33A 5FY7A 4EROA 2FMYA 1WD3A 5ABJC 1C1LA 1R091 4FSJA 1DQ2A 4I0WB 4HFSA 4YGCA 3U14A 3OCPA 2Y6KA 2ZKNA 4IE4A 1PIV1 1PNFA 4NPMA 3FL7A 3QACA 5K7PA 3DF0A 5K0UA 3KSCA 3NJVA 4Q4V2 4TSVA 1QNWA 2RS11 2RJLA 2UY9A 2WO1A 3N9NA 2AUYA 4FFFA 3CBNA 5DUWA 5BNNA 5F5AA 1NYWA 2Q8EA 4YG6A 3ZSJA 1PK6C 5C5UA 4NWVA 2OPKA 3U4SA 4MGTA 1DGRN 2XKOA 4OHWA 3N36A 4CEWA 1COV2 2GU9A 5JZGC 2VQAA 2NMOA 3NV4A 5KR7A 4KQ7A 3FLPA 5F3EA 3OBRA 5DAQA 1H0BA 3B3QE 2BWCA 1BEV3 2P34A 1ZX5A 4YYOA 1TMF2 2DVBA 1PX4A 1PO21 1JI6A 4XDQA 5GZFA 4M3CB 2GN7A 3VBRA 2VTXA 4IDZA 1EV12 5I93A 2R061 4NHXA 1HB4A 4C0HA 3KV6A 4QM9A 3ABZA 2WT1A 1MS4A 4LOTA 1OA3A 3WCRA 2QZ2A 4K8FA 1AL22 1OVPA 1DLLA 3B02A 2OS2A 3L2YA 5A3UA 2YGLA 3O14A 5IVFA 3VKOA 2XHKA 1V00A 3IIAA 5A32B 4IV1B 4CDXB 5HCHA 2LALA 3W21A 4QPGC 3WSOA 5IK5A 2UWCA 5D2AA 3USSA 1JODA 2Y6GA 1LCLA 4PBPA 3NNJA 5EZWA 3V0AA 2ZX4A 5FP9A 1JN2P 3KT7A 4FQ4A 1ZZCA 3PJQA 2VMGA 1QJU3 2XMLA 3IDEA 3KM5A 3OPZA 3R0RA 2QQPA 1C8M1 2DU0A 2VD7A 1GZWB 4IEVA 4A44A 3JXSA 5M0TA 1UOGA 4CEYA 4EWEA 1NQJA 1PZ8A 2R041 4JQRA 3RQ0A 1F4HA 1I3HA 2D6LX 4A41A 4JHTA 1NUKA 3RSJA 4YW2A 3IWZA 1MS1A 2XJSA 5F3GA 4A42A 5ACA3 1KXGA 2VNVA 4BA6A 3IN9A 3VBFB 2YFZA 1GV9A 2W0XA 3M7AA 3TB0A 2AACA 2DYCA 4QKBA 2JJ6A 5A7OA 4CYDA 1DQ1A 1MVQA 1D2QA 2G19A 4YFWA 1JYNA 2JECA 2XUMA 3GBWA 4B8EA 2CU5A 3E5XA 1KS5A 4EV0A 1H9WA 2XL9A 4XHBA 4OHXA 4UF0A 5C9AA 3RFRA 5JPMB 1QXPA 1W9SA 1LOEA 4WBBA 3H1WA 1UAIA 4E8DA 1EY2A 2EVXA 2F4LA 5C7GA 1KS4A 4WVMB 4GD4A 2VNRA 5CIRA 3T08A 3WG1A 5FXZA 3J4UH 2D6PA 2RS32 1XOYA 5FZEA 1CJDA 1TG7A 2BV4A 3RZHA 5A33B 2IZWA 4XFFA 5IK4A 3RJ2X 1O3SA 1YO8A 2PHLA 5EXOA 3HNBM 3WQBA 4LHSA 1DQ4A 1IG3A 2OPWA 4BU2A 5AFEA 4I30A 3J8F2 4AEDC 4WVZA 3BTAA 4AR2A 3GHMA 3IPVA 4OFGA 5FZGA 1GANA 4KMQA 1TZOA 3FFQA 2TBVA 2YPDA 4LUKA 3PUIA 5C8CC 2FZ2A 1HRI3 2CTVA 5A7QA 3GZTB 3WUDA 4Q29A 5J98B 4OI0A 3MPPG 2JDZA 1SFPA 2BPA2 4XTPA 4RS5C 3WY6A 3H42B 3OG2A 1N1SA 4C1WA 1PO11 1V6NA 1S0BA 5C3OA 2YYOA 4MGSA 2AC1A 4CCMA 1S55A 2CGOA 1OPMA 3BPSA 4LHKA 4M01A 2QZ3A 4QHZA 1JXNA 2OYZA 3SCFA 4OI4A 3NAPA 3NJXA 4IEUA 1RUG1 4FOQA 2Q8CA 1K5MC 2I2SA 5C4WC 2W91A 4AQ2A 4AVBA 3EHKA 1KITA 2W94A 1BVP1 1CVNA 2PAKA 2WS92 3D6EA 1HN0A 3I3BA 5FYTA 1A6CA 3ZXDA 3EB7A 5F5QA 4CCNA 2PMWB 4NPRA 1HRV1 2VMCA 3FBMA 1JUIA 3FE5A 2ZGRA 4XFCA 5FZHA 3I4IA 3D0JA 2E33A 4J25A 5EJ1B 4MGIE 3UNPA 3JZVA 2WYSA 2P4EA 3CIHA 4QX0A 3VGIA 5FWJA 3WG2A 5K4LA 1NE6A 1R081 1MZ5A 2Z69A 3C7FA 3PNAA 4D69A 1XE7A 1H1MA 1WMXA 5FKCA 3VDDA 3WDXA 2O1QA 5FMCA 3WNOA 5GZCA 4XJ9A 2PFWA 1V9U1 3ILFA 2Q8DA 2A6VA 4QM8A 5CFCB 1I9RA 3HBZA 1DDLA 2B4KA 1QJZA 3D3AA 3RJRA 1RUI2 2R1BA 3MV11 5FMBA 3AFKA 3UESA 3KV9A 2B9VA 5FFOC 2EIBA 5JXIA 2VBPA 3LWCA 1RGSA 1ZA4A 2J42A 4Q4W2 2GNDA 2GH8A 4EQVA 3FUOA 1AJOA 2YBSA 1H9PA 1H6XA 1ZZ6A 4R52A 5HXMA 4A45A 4K9SA 4HK9A 5GZEA 1TNRA 3H7JA 1ULOA 3M3CA 4OHZA 3TWIA 3M70A 1Q8QA 3FLTA 3ZFEA 4DNYA 4BQYA 2BOIA 2FDIA 3A7QA 5T54A 1RYYA 1RHI3 1V6JA 4NRMA 1CESA 5A6QA 3GNEA 3FFZA 1Q8PA 1RJ7A 1PZ7A 1HB1A 3WDTA 4NIDA 5T5PA 2HBUA 5DZGA 1VAVA 2WZR3 3I59B 1APNA 5F5CA 1BYHA 2RJ2A 4FAHA 2CYFA 1UW8A 4W65A 5GLUA 3OGGA 4HVQA 1ZBA1 4E2SA 5AC91 3LEKA 3PDQA 2A6WA 5T55A 3WVJA 1ULPA 2WNUC 4AI8A 3WOGA 3OPTA 2GC2A 2JDMA 2Z42A 2BFUL 1JBCA 4IGOA 3VBHA 3GXUA 3ZFGB 4H55A 3ZXLA 1WA4A 1UYPA 1PVC2 3IBMA 4UFMA 1O4YA 2P17A 4FTSA 1O3RA 2RM22 1CPNA 5T5OA 4NR1A 3JQXA 2D44A 3WP3A 1R093 1CZTA 2EIEA 1QQP2 1VIWB 3IKWA 2FMDA 5E1RA 1PM4A 1QOSA 2YG0A 4FI9A 5LBCA 2IUWA 2WQZC 2PHRA 4WM8A 4Q4X3 5CEHA 1PGL2 1H8VA 2R16A 3INAA 4HKOA 2Y6HA 3RZZA 3VZKA 3WHUA 3OY8A 3POFA 2RS13 2RMU1 4LOSA 2VG9A 1LOFA 2CNAA 3SXWA 2LM3A 1E5HA 1RUH1 1SG3A 4YVSC 3GALA 4CCJA 5FPXA 5FZCA 3ZR6A 3RZMA 1OOPA 3SNMA 1D4M1 2JG8A 2PHXA 4NRQA 2JG9A 4WVVA 5AFBA 1F5JA 2OIIA 3I2HA 4OVEA 1JYVA 5FPBA 2NMNA 1F31A 4NRPA 4BLIA 1W8UA 2XWJB 1PO23 1NCRB 2JD4A 5FKBA 1A3KA 2I07B 4P9LA 3RZJA 3JD73 1NOVA 1RL3A 4MG2A 5JPNB 2VZ1A 4RGKA 2XB6C 1SPPA 3F95A 2ZPXA 1LR5A 1ONAA 5FXVA 1SBFA 2IFWA 1H2KA 1WLTA 3O7OA 2CDPA 1ND3C 4JZRA 4F8AA 5KWRA 1AR81 3ZXGA 3GYDA 1NY72 4COUA 2B9UA 1BLZA 4CE8A 3VBOC 2PHDA 4R9BA 4LBKA 4XJ8A 4EZHA 4B1LA 3VHOA 4BE3A 1GSLA 1JMUB 3PHMA 2QFEA 2J1RA 1HIXA 1QIQA 3N9OA 4XCAA 1HXS1 5FZIA 1RUOA 2HYXA 3U4XA 2BOJA 1BHGA 1C8M3 3ES4A 3GJBA 5JMCA 3VBUC 1GU3A 4NIHA 2VNGA 2VCBA 4LITA 2R043 5ERLA 5FOBB 4RGGA 1JYXA 4IGQA 3E5QA 2HWD1 2BWAA 3THCA 4N43B 5LBFA 2R32A 2WNVC 1NCQB 4JV4A 2RG4A 4G9SB 1W8NA 2VU9A 2CAVA 3AK0A 1AYM3 2ARBA 2K9ZA 4F7ZA 1CAUB 5FZ9A 5KC5A 3URFA 1PMIA 4UOJA 3B5LB 3PUQA 1QWRA 4CP9A 5FY4A 4AI2A 1ND2B 2AREA 1W3XA 1C8NA 4QKNA 1CAWB 1RB8G 1SFNA 2IXIA 3G7DA 2GN3A 1X7NA 4ORFA 4GKXA 1QH6A 2C9AA 4AQTA 2IXJA 4DXTA 2G9FA 1SEFA 1QHDA 4HPKA 1YYNA 3ST7A 2J1UA 1DG6A 3SITA 3CJIB 5A6ZA 1UMZA 5F9TA 2HEVF 5AVAA 1K3IA 5GLWA 1T2XA 1WGPA 4DO0A 4RHV1 2HWF1 3P6BA 4TXWA 4AFMA 2ES3A 1GOFA 1LEMA 1GP5A 3ZO0B 2WR9A 2WSUA 3AP6A 1H8TB 1UZWA 2HWE1 2R0FA 3MLLA 4XF4A 4ZHNA 1LTEA 1UKRA 3DPRA 4YM1A 1HV1A 3M2MA 2VZOA 2BJSA 2BZDA 1LHWA 5L9BA 5I0DA 2XJUA 1GICA 1OLME 1U5ZA 2OA2A 3NW4A 1GOGA 3Q8AA 1U0AA 1XSRA 2F6BA 2VPVA 4LORA 1OH4A 2PLV1 4JDMA 3SEEA 5EIYB 2A6XA 3WHTA 1DZTA 2IFRA 2P2KA 3KGLA 2X8KA 4OUEA 2ET7A 4NHLA 4DIQA 4CDXC 1W28A 2JE7A 2XGXA 3OYWB 1AX2A 4AFDA 2F17A 4IERA 4D7SA 1B09A 5FMOS 3RWKX 2DUQA 1SCSA 3HT2A 2VZ3A 4P08A 5JOXA 3AMHA 4FVVA 1DYKA 2V5YA 3W20A 4PJYA 4YM3A 4IE7A 5FDBA 4K7JA 1YI9A 4M0NA 2J22A 1GUIA 4N90A 3AKSA 3U0ZA 1RTVA 2ZHNA 1U5XA 4GWMA 5FPUA 3M3EA 4LBOA 5DDJ2 1AR91 2FDGA 2YXSA 3GCWA 4M00A 1HRV3 2ZBJA 3OBAA 1YJKA 3MUY1 2CDOA 3ZDSA 2HWB2 1I6XA 4GJZA 1H2LA 4AVCA 1RITA 3AX4A 2C0ZA 1MZ6A 1E5SA 2VO5A 2W1QA 3VBFC 4AI3A 2W87A 4LA3A 3R4SA 2ZAAA 3A22A 5L73A 1XNAA 2IVJA 3NNMA 1YI7A 1X8EA 1F8VA 5I91A 2ID4A 2O8OA 1R083 5T50A 1QJFA 2W5FA 1MEC1 1OQ1A 1QOOA 1V9U3 1VBA1 2VAUA 4JDOA 3CF6E 3L2HA 3MO4A 4IGPA 5CKNA 1ULCA 5ISLA 4QPIB 1RUF2 2CHHA 3GJAA 5LBBA 4LPLA 4M3CF 4BXSV 1DGWX 5B2GB 5F3IA 3PU8A 1NAEA 1VLNA 2ZGKA 3ZN4A 4UFKA 5SV5A 3OPWA 5K8SA 1Z7S3 2KR2A 3J9SA 3RRDA 4IE6A 2GC3A 4UW4A 2OUJA 1K12A 4AE2A 2WWUA 4N7UA 3S7IA 2NQYA 1WLCA 2WKKA 4XACA 2VW0A 3OUIA 5EJ3A 4CCLA 3KMHA 4CP0A 5IVYA 4I01A 1QJU1 1YXWA 3ALQA 3LA2A 4WM7A 3BVCA 1W6MB 3NMBA 4QGNA 5FY1A 4AFAA 2PQSA 3K77A 1BEV2 1W6PA 3BOPA 2KD7A 1NQDA 1K5MB 1YIFA 1O4ZA 2ZXQA 1DGWA 4ATFA 4AHYA 2D98A 3AP9A 5IJRA 5LEJA 1CD3G 3OGSA 3VDAA 3JU9A 2RE9A 3I2JA 4IETA 4GB32 1ZBA3 3WCSA 2KM2A 3SEPA 5AC93 3IAPA 5BNPB 1B35A 2XJRA 1MS9A 3WQ0A 1WCUA 4HSLA 4JGYA 2D6KA 1W8OA 1X36A 5KXDA 3MZHA 4I0BA 4EWAA 3ZN6A 2FD8A 1W6NB 1ZVFA 3E97A 1CX4A 5FQ0A 1W6QB 4CDQB 1PX3A 3CMGA 1YQ8A 4N9HA 3ZYRA 2CWMA 4HN0A 3FBYA 3AJZA 1AR73 3M3OA 3WT3A 2Y60A 1XNKA 4ZXKA 3U78A 4YW4A 2YUEA 4Z07A 3ZYJB 4FPCA 3AB0A 1HJGA 1FV2A 2BUKA 4CDUA 3VKNA 5DAPA 4IV1A 2WZEA 2UY8A 3WDYA 2VL4A 4XFHA 3MFCA 1YEWA 1PGSA 1XYPA 4QKFA 1JYTA 5IK7A 3NWKA 2WFF1 5FZ6A 1W8WA 4KH9A 3BODA 4OCTA 4NIGA 2VQTA 2W95A 3KB5A 4IQPA 3ZMOA 2GP3A 3FLRA 4PCRA 4DUXA 5JXHA 1QF3A 5EFUA 5L7OB 2VJXA 3RWNA 4DPNA 5CFCC 5LRSA 5ACA2 4XF1A 2BNOA 4AVAA 5C3QA 3VBSB 3I2IA 3KS7A 1IPSA 1DGRA 2UU8A 4AFBA 1W8TA 1D4M3 2RS53 4OHVA 4C8DA 2GAUA 3G6JB 2A6YA 2X5IA 3H50A 2QJVA 3LB9A 4HETA 3WNKA 3BPZA 4LKSA 4A3XA 1EP0A 3V0BB 2BGOA 1PM7A 1RUC2 1N1YA 5FUIA 3C3VA 4IEOA 4JRLA 1HRI1 1PGW2 1AVBA 1Q8OA 2BNMA 2VOKA 3GBGA 3ZYIB 2VOVA 4Y33A 1RUD2 2B8MA 4ASKA 2BBVA 3WUCA 2C1FA 2VUCA 3BOWA 4CCCA 4NN0A 1LESA 1GZTA 2GMPA 4Z2AA 1C28A 1IQAA 3LEMA 4KWUA 4QPYA 1QOTA 2XBO3 1JZ3A 1JH5A 4XBLA 1NG0A 3C7GA 3H0OA 2OT7A 2TEPA 4Y1UA 1AR83 5BNQA 2Q4SA 2WA3A 1DLCA 4KU7A 4KWJA 4COWA 4FP2A 3FC0A 1QJX2 2Z5WA 4LBNA 5FYSA 3LDRA 4LE3A 1H4GA 4J1XA 1AR61 4FPFA 1NA1B 1SZBA 1FX5A 4GMP0 4EYUA 5FRAA 1YQ6A 4LO4B 4X6RB 3A4UA 5JVVA 3FHQA 2K2SA 4UW6A 3OUHA 1SCRA 3KQRA 3ZMNA 2WQ4A 4AHWA 1ZRRA 2X53S 4HSJA 1PHMA 4AHZA 3AZWA 4E9KA 4RQPA 4Y24A 4JX0A 1XU2A 5T5JA 5JR2A 1FOD2 1X8MA 3KF5A 4OYUA 3LEIA 3OBZA 2ZMNA 2JDHA 3GDBA 4AFCA 4YGBA 3HN1A 1VBC3 3ME2A 5A7NA 2ZGUA 1RUJ3 3GM8A 4MXWA 3SQOA 5GLZA 5D1IA 5DN2A 5JOWA 4RFRB 2JENA 1Y43B 5HCAA 4LBMA 1GNZA 2HWC1 4X6QB 5G04L 4D94A 1JYWA 5KC6A 4Y3OA 2RDQA 1LHOA 3MLJA 4Y26A 3ACIA 2SBAA 1FYUA 3ZFFB 1POQA 3TEXA 1X50A 1GZ9A 1PMJX 3ECQA 3MICA 1W99A 3S30A 4DQAA 2SLIA 3POJA 4RHV3 3LSDA 4L9BA 5EYYA 3RYPA 2E7AA 3WD5A 4Y20B 4LO8A 1Z0HA 3ZXKA 2HWE3 4URAA 4OHYA 1W9TA 1RINA 3OEBA 2XLFA 1BBT2 2XQXA 1STMA 1OVSA 1NCRC 2ZEWA 2R071 1JZ2A 1H1IA 5JIAA 3O1VA 5FZ1A 1H2NA 3SCHA 3W5NA 1UKGA 3AXDA 4PF5A 3HN3A 2WNEA 4RD7A 1IS4A 2WJSA 3VD7A 3BGAA 2PLV3 2DVDA 3WINE 2X05A 1HQLA 1H6YA 5JOYA 3I8TA 3MDPA 3UKVA 3QLQA 4KBZA 5F6LB 4A6OA 5A7WA 2GALA 3CJXA 3JCIA 5FMOL 3UGHA 4F83A 4LK7A 4QDSA 3IZOA 5F39A 3POYA 3APBA 4GMP1 5FCCA 4YW3A 5LB6A 1CAVA 4L0PA 5A80A 1F4AA 4OZXA 4ZY9A 1R64A 1ALYA 3RMYA 5D8AB 2TUNA 1AYN3 4QU1A 1AL0G 2WT0A 2WUHA 4QHOA 1CAXB 4CSWA 1OPOA 1LHUA 5CKQA 4CU9A 3C8XA 2NP0A 3D82A 5E8AA 4Q4X1 1RHI2 1LODA 3DKQA 1AX1A 1COV1 4ZPIA 2XH6A 4N43C 2XVLA 1IPKA 1NCQC 2WZR2 1AR93 3D0SA 3VKFC 2DCZA 4XFGA 2L9LA 2WAAA 4MHRA 1UIKA 4PDWB 1ULFA 1NKGA 3I49A 3C7EA 1HB3A 4LIUA 1MVEA 1Q56A 1Y9QA 3MIEA 3PTYA 1Y9GA 2QQWA 1N3PA 5FBZA 2ZHMA 1ND2C 1VRH1 3M4FA 1SLIA 1ASJ2 3OGJA 3W5MA 3ZOIA 1VJ2A 1E57A 4ONUA 5IT6A 2CGPA 1O5UA 4ZONA 1MEC3 3JQWA 3R4UA 3P5BA 1VBA3 1IKQA 2EF6A 2RR13 3VL8A 3X29B 3CJIC 4GH4A 5FY9A 1SBDA 3M8LA 1R092 3JD71 3HQUA 4HN1A 1IOAA 3D4KA 4QMAA 3KWVA 4E4DX 4XBNA 4E4HA 1PIV2 5JI7A 5F7UA 4LLFA 3AMPA 1KDMA 1UD1A 1H8TC 1N1VA 5EYXA 1SLAA 1W6OB 4BISA 3WF1A 5IK8A 1MQTB 2RS12 3UKTA 5FZFA 1VB2A 4XJWA 4BOWA 4ARXA 4AVVA 4CUCA 4AVTA 1L7RA 2VCAA 4CCOA 1DP0A 4HKWA 4EN6B 5BY5A 4XILA 5FZDA 2I45A 1UY3A 1UY0A 4QQPA 1HQWA 4B29A 4HBNA 2F4PA 3SH5A 1QJY1 5JI9A 5TSWA 1N47A 3IDCB 3SLIA 1YCIA 1M06G 4E27A 4AAPA 1ZBE3 3AP7A 4QDQA 1S0EA 4KGQA 3ZLIA 4DS0A 4BQWA 3WV6A 2XXZA 1PO22 3H1MA 2FDKA 2VQ0A 3IDAA 4IV3B 4YW7A 3AVRA 1TEIA 2XUEA 1QNYA 4PQ9A 5GZGA 2JXAA 1JOPA 2R062 3IMMA 5F32A 1Q8VA 2YC2A 3PMEA 1Q5OA 4PI2A 1AYM1 3H8RA 1KFXL 3KHCA 1LGBA 1FMD1 1VRBA 2CY6A 2OVUA 5IVCA 2R0HA 3UJOA 1G9AA 2H6BA 4QKDA 1IPJA 5CFDB 1F35A 2ZZJA 1RXGA 4HT1T 4IE5A 1W06A 2NM1A 3I97A 3N4MA 2KXLA 3DKWA 4O9GA 2DF7A 5HXVA 4ASLA 1SHWB 4RR3B 3ROUA 5CKMA 4B3NA 4CDWA 1JOJA 4Q0PA 1EUUA 4LK6A 3IAQA 1ULEA 4YARA 1OD3A 2NZ9A 4KWKA 5DXDA 5CADA 3H8OA 1C4RA 1C8M2 4XVHA 4MO3M 1WBFA 1O3QA 2DUPA 5A7SA 2VCCA 4DRRA 5FYHA 5H9PA 2R042 5LY2A 4EN0A 2J1SA 2WFF3 2GNMA 2MHFA 3CU7A 3J8F1 1UX7A 4K20A 3T1MA 2LRPA 2WZPP 3VZNA 5DUUA 4A4AA 5ABJA 3ZM8A 1G9FA 1Q3EA 2DFCA 1VBE1 1SLLA 3WNMA 2P3YA 4QPIC 4R4XA 1KD7A 2ORXA 4QQLA 5HI0A 2OXBA 1UZYA 1DQ6A 2PHWA 3ZXAC 3POBA 1W90A 1W2UA 4FTBA 4B7EA 2EAKA 2D5FA 3S0MA 1VPHA 1BZWA 3K4AA 1RUE1 4BLJA 2P3KA 3WNPA 4BQ5A 1JZ8A 1JHNA 4Z92B 1PK6A 3HPNA 2GC1A 3FX3A 4CXWA 4I09A 5IFTA 1ZRIA 1UU6A 3PMSA 1O91A 4HK8A 2WNOA 4CUBA 5JZGA 2G9GA 1YWKA 4KNCA 4LO7A 4H7LA 2BRTA 3HNMA 4YGEA 3HBKA 1JW6A 3BU7A 4K6BA 2BTVC 1G9CA 1QJEA 4QQ2A 1UMHA 2VW2A 2C4XA 3KCXA 3MV01 1WMEA 3SMHA 1KJLA 1O8PA 1WWYA 5FPVA 4IXLA 5FPAA 5JXJA 1FAYA 5GKAC 5BNPC 4QX2A 5IVVA 1AR63 4QB1A 4DUVA 4OQ8A 1ZNPA 4IEYA 5D21A 1AHSA 5H9RA 1LOFC 4P02B 4JHZA 2QQIA 2ZABA 2J1VA 2VMDA 3NRUA 3AJYA 4QPGA 4P9IA 4CDQC 3CO2A 4YRDA 1UY2A 1DCSA 2QBXA 3QOPA 1OFNA 3ETPA 2FDHA 1PO12 2VTXJ 4QX7A 3TBDA 3WZ1A 3WW4A 1V6IA 2BNNA 2QQOA 3ILRA 5CB7A 1OC1A 2DCJA 1JZ7A 3DYOA 1UX6A 3L9JT 3H8XA 2DVAA 3T3YA 2LROA 4YGDA 1VALA 3NV2A 1RUG2 5FYBA 3ZYGA 3KVAA 1JZ6A 4OULA 4OI2A 4HOOA 3ORJA 4WVWA 2P37A 4JGZB 2HWC3 4RL7A 1ZA7A 1LJ7A 3E6DA 1Z7S1 4D7YA 5FYMA 3FMGA 5A1LA 1UZ0A 1Y9MA 1HRV2 4UW3A 2VC9A 1VR3A 3CDZB 5L7OC 3GF6A 4YVWB 1GMMA 1XE8A 4RGAA 3VBSC 4N53B 3EO6A 2NYYA 1AJKA 1R1A1 2WL1A 1OURA 1KQRA 4W8JA 2A71A 2ZGQA 2AYHA 1FT9A 5HCFA 2WN3A 4FPGA 3RI8A 5A3NA 4FPYA 3I3EA 1W8ZA 1YJLA 1R082 2DTYA 5DAVA 4DINB 4NAMA 3DV8A 5FZ7A 3POSA 2W3JA 1V9U2 2R073 5HBAA 4WV8A 4AL9A 4ZZ8A 1M4WA 4ES9A 5FO8B 5K0UB 3T4HB 1EPZA 3MI8A 1UPSA 1UZVA 2NN8A 4QDRA 4JVAA 1FV3A 4Y5Z0 5BNNB 3FJSA 5HV0A 3I2FA 1WA6X 2G4IA 2W52A 5BXXA 5JSRA 3W9AA 4GMP3 5LBEA 2VECA 2J1AA 4CEWB 2B45X 5EJZB 5T52A 2WBKA 4IL7A 4JKMA 2H0BA 2VZTA 1AR71 3B9IA 4Q4V3 4AEDA 2C6SA 4ZU5A 1GQPA 1UZZA 3KLSA 3P3PA 2BVBA 5DQ0A 3O1RA 2WO2A 1NA1C 1TNFA 5IW0A 4EZ4A 1ZM1A 2XWBB 2W39A 3TEWA 5C8CA 4QB6A 5EV7A 3VBRB 3DECA 1XBFA 1COV3 3HQXA 2VE1A 3LIHA 3RGBA 4RS5A 4UYBA 5C33A 4S2HA 3K48A 3LPGA 4D8MA 5BPXA 5DABA 3SH3A 3AZXA 4FFGA 4X8NA 3AYCA 3LEGA 3O1PA 1TMF3 1ZBA2 3NKGA 3ZSKA 5AC92 1HQNA 1QXRA 3H9AA 3WR0A 3J7LA 5FYUA 4R9AA 3K3NA 3VZMA 5C4WA 1VRH3 2RS51 3CNAA 1UU4A 3Q8BA 1GBGA 2EAAA 1YQ2A 2AH2A 3OUJA 1QH7A 5CG9A 5EQUA 1AXKA 2QCSB 2ARXA 4I3PA 1HDKA 2A3WA 4META 3S5AA 3ZFFC 2X29A 2EA7A 2ZGLA 4L99A 3LFMA 3I7DA 3ITQA 1AZDA 2WT2A 1QY4A 1S1AA 1JTZX 5FWEA 1WW4A 4CEYB 4EN7B 2BDRA 5FLJA 3ACLA 2VOWA 1IHMA 2JX9A 2JICA 4Q0VA 5FZLA 2D6MA 2P5BA 2CAUA 3HR9A 2XBO1 1AUYA 1WMDA 2RMU2 4TZDA 4ZXEA 3D8CA 3DXTA 4QX8A 2ZS6B 3BTYA 2AENA 1DYOA 1RUH2 2WYFA 2ENRA 2PYTA 4QXBA 3O5SA 1WLWA 1UXXX 2YZ4A 5FOJB 4V2WA 3VKLA 2O0OA 2X10A 1D4M2 4OI1A 5FXWA 4QGMA 1QJY3 1BVVA 1S0FA 2QDNA 2QQKA 2D3RA 4NROA 4UF0B 5C9AB 1U12A 2ZGOA 2DTWA 4MX3A 4PIYA 1W04A 1W0PA 2WLPA 5APAA 5IUQA 2DBIA 1EPWA 4C1XA 3OEAA 4TN7A 1ODNA 2OW4A 1RMU1 2Q8OA 1WW7A 1S0IA 3PVNA 4PIZA 5D8AC 5FAXA 5KHGA 1DHKB 1OBNA 3JBG1 5J36A 3SC7X 1FMD3 3I2DA 4E2GA 1VBC1 1ENSA 1ZZ9A 3W59A 4COZA 5IAVA 1RUJ1 2DURA 3OTFA 2R7EB 4K1ZA 3LA7A 4LT5A 3QH6A 2N7GA 2DWRA 3RI9A 3T1LA 1AR82 4ATEA 1GR3A 2ZA9A 1ZZ8A 4PDWC 3N7KA 4RA0A 1Q43A 4IEPA 3ZVXA 3WQ7A 1QMJA 3IPVB 2RS33 3POEA 3O1MA 2VZRA 1HXS2 1J58A 2WNUA 4FPOB 4YWAA 5A3WA 3K46A 3RPQA 3S5QA 3TEYA 2VMFA 2YB7A 4PQQA 3A21A 4LQRA 3V65A 2A73B 2RDSA 1OD5A 2VZUA 5ANQA 3ZDVA 3AFGA 4YZ2A 4Y4RA 4B1MA 1D2SA 1X9PA 4Q4Y1 3RS6A 2HWD2 2RDRA 3J8F3 4GULA 4Y1VA 2E32A 1GFF2 2XR4A 4OMCA 4W6XA 3WG4A 4WM7C 2Q0AA 1VBE3 2E7QA 4LJHA 3NAPB 1V6OA 3LDKA 4TWTA 5CVRA 1GZCA 4N9IA 2DCTA 3HVDA 1LGNA 3WW3A 4XBQA 4Y22A 3THPA 5C3SA 4QXHA 5A70A 4CCKA 3PIJA 3AVSA 3PJYA 1MQTC 2ZTNA 4QQOA 3NJYA 2QQNA 4CUGA 1CGPA 2G9ZA 1RUE3 3B9CA 3U75A 3H7YA 1J84A 4MGYE 4Q5OA 1UO9A 2ZGPA 4JTNA 4SBVA 4YVSA 4G4FA 3C7OA 4MGQA 5LA9A 3POIA 1S0CA 3T0BA 5EHDA 3TN91 3RG0A 1AYN1 1ULGA 2GZWA 3MIGA 4XF9A 4RHV2 2HWF2 3VKMA 3VDDB 1VBB1 3C7HA 1W05A 4H14A 1J3QA 5FYVA 2HWE2 4XFAA 3VN4A 2EIGA 1A8MA 1W8FA 2V4VA 3A0NA 4XAEA 4YSFA 1VMFA 4FP3A 3MFAA 2IXHA 2ZEZA 5IYYA 4IV3C 1GLHA 4BDVB 3KZ4C 2VUDA 1ZYBA 1NZCA 4KBBA 4BJ0A 2WA4A 2IXCA 2JDUA 4YW6A 5CA6A 3J7MA 1J59A 5IVBA 2J7MA 3ZSLA 3QD6A 4RSUA 2PLV2 1D4VB 3ZXEA 4LBQD 4JRAA 4AQSA 3B7MA 1UY4A 5CFDC 4DXZA 1C3HA 3HJRA 4YNIA 5A7PA 5FP8A 2PA7A 1ND3A 3EQEA 3J7HA 4QX5A 4XZUG 2OQ6A 5LASA 3I3QA 1RUI3 1VB4A 5SV8A 3VBOA 5LA1A 2ZCWA 2FDFA 4L97A 2WWJA 3KGZA 3N7LA 4RR3C 2RR11 3CZJA 3LSEA 4XUNA 3ZFEB 5IVEA 1JOBA 5GALA 4AF9A 2LTNA 2C5DA 1XNCA 3VBUA 1HB2A 2XLGA 4TLFA 4YW1A 1S4CA 1ODMA 1E5RA 3A0KA 4B4PA 3VD3A 1J1LA 2WNVA 3OSDA 5LA2A 2Y6JA 1AR92 3DYPA 1LOGA 4I3GA 3AKPA 4GA9A 3H3ZA 3K3OA 4BYYA 3I3MA 3AL6A 3J7NA 2CSGA 4QXKA 1BMV1 1BQPA 4I02A 1R1A3 4QB2A 3PIGA 3VBHB 1UYYA 1XPWA 1T6GC 3RDIA 1SBEA 3ZPYA 2JIGA 3LZZA 4BXFA 5EP9A 2YBKA 2YGMA 1ACCA 5CNAA 1OLRA 1OI6A 1SDWA 1WMFA 2H6CA 2VZPA 2VR4A 3LOIA 2WC2A 3SCGA 3E5UA 4PI0A 1ZBE1 3VLBB 1MEC2 3B01A 1VBA2 4XCBA 1LENA 1MZFA 3V56A 4AAXA 2QQUA 3AYEA 2I74A 3NV1A 4XQWA 5FP4A 4XXAA 1WD4A 4BM8A 5JOZA 5IAXA 2E31A 2JWPA 4XW3A 2E26A 2JIJA 1DFQA 1WCSA 4FT8A 2DCYA 3T09A 4FXGB 4D3WA 4FTEA 4XUQA 1FPN1 3OY8B 2WSVA 1LU1A 4UAPA 4RQPC 1IZ3A 2AEYA 2WIIB 2BW8A 5HV4A 1VE0A 1QQP3 3AC0A 1CN1A 4M3CA 4CRQA 5JWPA 3FZ3A 5FUPA 2IXLA 2IVIB 1DZQA 5LRRA 3RYRA 5DAXA 3C2UA 3ZYBA 1OOPB 1J3RA 1F2NA 2JG8B 4IE0A 3AMNA 1OKQA 2JG9B 3MW4A 4K1YA 4RN5A 3ZXJA 5CAZA 1IS5A 1W9YA 1LRHA 2FBEA 4L11A 1V70A 1QJU2 1W6OA 2ZACA 1XNBA 3E6BA 3H3UA 3EYPA 5KXCA 4JCKA 4CDXA 5A32A 3VHRA 1LHNA 3LGRA 2E9QA 3BTZA 1GP6A 3OD0A 4XUOA 4ZS2A 2E53A 1SPPB 1QXJA 2DDUA 2WLQA 3AYAA 3Q9OA 1GWLA 1XXNA 2VULA 5J1XA 4Q0SA 5J7MA 1ENQA 1CZVA 1GZWA 2W47A 4LKEA 4MOAA 1YIPA 4AXOA 4DY3A 4CTEA 1W39A 3GZAA 2ARAA 1BK0A 5FZ4A 3WF0A 4BH9A 4JGZC 1P8JA 4JC1A 5BNOC 1LOCA 2B5HA 2QDRA 4NJ4A 4COYA 3U10A 1YNAA 2A70A 1XNDA 2W9XA 4YVWC 3AKTA 1UOJA 2EXHA 3WW1A 3VBFA 4N53C 5FUNA 3DYMA 3RNSA 1XB9A 2NLRA 4XZPA 4MSVA 4D6RA 1GWMA 4AI1A 1UNBA 4XETA 2VUJA 1SDDB 1AXYA 3ASIA 3LCPA 3OGRA 3O1OA 2ZX3A 3BI3A 3DEMA 2WFF2 3ELNA 5IWFA 2UWAA 3T0DA 1YFXA 4KU8A 4AYUA 4CP9B 5F37A 4BMEA 1G8WA 1Q8SA 4XJUA 5K0UC 5KHJA 4NE9A 4V2VA 4WVMA 4D6QA 4UWDA 2VH9A 3HAGA 1UPIA 1ZRDA 2ZEXA 5BNNC 1R1ZA 1Y3TA 1CWPA 4HPKB 1UYXA 4XOGA 5C5TA 1VBD1 5A33A 4W6YA 1HRI2 1JU4A 1OQDA 4QX3A 3LA3A 3JB8A 4CEWC 1S0DA 2A3XA 1GNHA 1RMU3 1JUHA 1DF0A 2IWGB 1YC61 1LNSA 3JBG3
chains in the Genus database with same CATH topology
4M4PA 2QQJA 3I97A 1CZTA 2EIEA 2YG0A 4FI9A 1SHWB 5C70A 2WAOA 1JZ4A 1EUUA 3IAQA 1OD3A 2Y6HA 1W0NA 4IUGA 4XVHA 4MO3M 4YPJA 2VCCA 2X09A 3SKJE 1WCQA 1SG3A 2J1SA 1UX7A 3I2KA 4P5YA 3SKVA 4A4AA 3ZM8A 3VDCA 3WNLA 5IFPA 3WNMA 3I2HA 1JYVA 3UETA 2V5DA 2ORXA 4UI9L 3T2OA 2YFUA 2HLEA 1O8SA 4CU6A 3K4AA 2VZ1A 3WNPA 1JZ8A 3HPNA 4JKLA 2LS6A 5IFTA 1TVGA 4CUBA 3NNGA 3HNMA 2CDPA 2EIDA 4QX1A 4XUTA 3LQCA 2Z4FA 4GWJA 1UMHA 2C4XA 3MV01 2QQLA 2WDBA 1O8PA 3T2PA 4E8CA 2J1RA 2HYXA 1JHJA 5JXJA 1BHGA 4A3ZA 1GU3A 3WF2A 4QX2A 2VCBA 4QB1A 4DUVA 2JD9A 1JYXA 4P02B 2QQMA 1WKYA 4JHZA 3THCA 2QQIA 2J1VA 2VMDA 1PMHX 3NRUA 1L7QA 1W8NA 3T2QA 3HNYM 1KGYA 3CKHA 4ARYA 1UY2A 2QBXA 4UOJA 5DMYA 3ETPA 3WEZA 2W1UA 4DEQA 2QQOA 2W92A 2VZVA 2DCJA 1JZ7A 3DYOA 3K75B 4TTGA 4DXTA 1JZ6A 3VDBA 2J1UA 3OB8A 4JKKA 1K3IA 1UYZA 5B4XA 1T2XA 3VD9A 1UZ0A 3HOBA 5LCWL 1JU3A 2VC9A 3CDZB 3P6BA 4TXWA 2XHNA 3WNNA 1GOFA 3PUHA 1GMMA 1UXZA 5JUVA 1CIYA 4W8JA 2VZOA 2BZDA 4DEVA 2VZQA 2WN3A 3E1F1 5I0DA 4BK5A 4QPWA 3I3EA 1GOGA 2VZSA 2W3JA 1OH4A 3SEEA 5EIYB 4ZZ8A 2XONA 4OUEA 1K42A 4P00B 2JDAA 1IQDC 2WN2A 4CU8A 5LA0A 4QDRA 2V72A 1US2A 1OT5A 2WQ8A 1NX9A 3I2FA 2OKXA 2VZ3A 4P08A 2J1AA 5EJZB 3VD5A 2WBKA 4JKMA 2VZTA 3ACHA 4XURA 3THDA 2J1EA 1GQPA 2BERA 1GUIA 2J22A 5DQ0A 2WO2A 1J83A 3WF3A 4QB6A 3LE0A 3DECA 3ACFA 3OBAA 3MUY1 2CDOA 3OGVA 4W50A 4DXSA 3LPGA 4D8MA 2VO5A 2W1QA 3U37A 2W87A 1MPXA 4PT6A 3A22A 3LEGA 1XNAA 2C26A 2ID4A 2W5FA 2Y64A 1K45A 1OF3A 1YQ2A 1W9WA 1UWWA 3MO4A 1GOHA 3IB3A 3ACGA 2WABA 4LPLA 1CZSA 2W46A 2ORZA 3A23A 4BXSV 3CQOA 5JMOA 1NAEA 4OMDA 4D0QA 4GZ9A 1K12A 5HPOA 4CVUA 4ZXEA 3I2GA 4DXRA 2WZ8A 1DYOA 2VOTA 2W1SA 1UXXX 2PQSA 3K77A 2X10A 2KD7A 2JKXA 2ZXQA 4KI5M 3T0AA 3VD4A 5IJRA 2QQKA 5A1AA 3OGSA 3VDAA 1OF4A 1US3A 3I2JA 3I3DA 3NQHA 3SEPA 2DCKA 3IAPA 3OEAA 3F2ZA 1W8OA 5B4NA 1PX3A 3CMGA 4MADA 2R7EB 2Y6KA 3FL7A 4GWIA 3NJVA 2WO1A 4DUWA 2WZEA 2J1TA 4OZOA 2VL4A 2VZRA 2WO3A 2XOMA 3K46A 2BBAA 2VMFA 2YB7A 4PQQA 3A21A 4LQRA 3P1IA 2VQTA 2W95A 4XUPA 2VZUA 5JXHA 4DUXA 2VJXA 3FN9A 2JE8A 2E32A 3I2IA 4OMCA 1PX4A 1JI6A 3WNKA 5DPNA 4LKSA 2BGOA 5FUIA 2W1WA 1UMIA 3ABZA 1JZ5A 2VTFA 4AG4A 2QQNA 1GNYA 1XC6A 1J84A 4Z2AA 3WSOA 3C7OA 4MGQA 4KWUA 4BK4A 2Y6GA 3T0BA 5IHRA 1JZ3A 3C7GA 3C7HA 1DLCA 2C9KA 3BN6A 3IIIA 2V4VA 4A44A 2ZEZA 3JXSA 5IYYA 4ET7A 4BDVB 1F4HA 4BJ0A 4A41A 1NUKA 2J7MA 3FHQA 1EUTA 1UY1A 2Y8KA 1UY4A 3MUZ1 4A42A 3K4ZA 3HJRA 4JX0A 5JR2A 2YFZA 3J7HA 4XZUG 4OYUA 3LEIA 3CZUA 3GDBA 5LA1A 1JYNA 3GM8A 3CZJA 4XUNA 1D7PM 5DN2A 4PF1A 5G04L 1W9SA 1JYWA 4E8DA 3ACIA 5C7GA 3VD3A 3T08A 5LA2A 2Y6JA 3ECQA 1PMJX 3DYPA 1W99A 4CU7A 1TG7A 5G05L 1W9TA 3OEBA 4QB2A 1UYYA 1XPWA 2XQXA 3WQBA 3HNBM 4LHSA 4CUAA 2ZEWA 1JZ2A 2VR4A 2VZPA 3W5NA 3HN3A 4KMQA 4QAWA 3VD7A 3PUIA 3BGAA 4AAXA 2X05A 1H6YA 2E31A 4RYDA 2E26A 3OG2A 4A6OA 3T09A 4W4ZA 2RVAA 4XUQA 4QDSA 4UAPA 4MGSA 4L0PA 1F4AA 4ZY9A 1R64A 3AC0A 3NJXA 2WUHA 2W91A 5JXGA 2W94A 4CU9A 3C8XA 4RN5A 3I3BA 3EB7A 2VMCA 1XNTA 3EYPA 2E33A 5EJ1B 2ZEYA 3UNPA 2L9LA 2WAAA 1NKGA 2WYSA 3CIHA 3C7EA 4QX0A 4M4RA 3HEIA 4XUOA 3C7FA 2DDUA 3WNOA 4HG6B 2VQUA 5J1XA 4ZZ5A 3W5MA 1CZVA 2W47A 3FHAA 4MOAA 1CX1A 2B4KA 3D3AA 3WF0A 3MV11 5CZKA 1P8JA 3UESA 2B9VA 2EIBA 2BGPA 5JXIA 1HN1A 3WF4A 2LW8A 5F7UA 2W9XA 5C71A 3DYMA 3WF1A 1H6XA 3GGLA 5HXMA 4A45A 2Y6LA 1ULOA 1KEXA 4ARXA 1SDDB 3OGRA 4CUCA 3K4DA 1L7RA 2VCAA 1DP0A 3A7QA 1RYYA 1UY3A 1UY0A 3T0DA 2VMEA 2EICA 1O59A 2RJ2A 2YC4A 4QDQA 3LPFA 3IDAA 2ZEXA 3LEKA 3MBWA 2VM9A 1UYXA 1ULPA 5CYYA 2YC2A 1JU4A 4QX3A 3GXUA 1LNSA 1I5PA 2RV9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M4P A;  2QQJ A;  3I97 A;  1CZT A;  2EIE A;  2YG0 A;  4FI9 A;  1SHW B;  5C70 A;  2WAO A;  1JZ4 A;  1EUU A;  3IAQ A;  1OD3 A;  2Y6H A;  1W0N A;  4IUG A;  4XVH A;  4MO3 M;  4YPJ A;  2VCC A;  2X09 A;  3SKJ E;  1WCQ A;  1SG3 A;  2J1S A;  1UX7 A;  3I2K A;  4P5Y A;  3SKV A;  4A4A A;  3ZM8 A;  3VDC A;  3WNL A;  5IFP A;  3WNM A;  3I2H A;  1JYV A;  3UET A;  2V5D A;  2ORX A;  4UI9 L;  3T2O A;  2YFU A;  2HLE A;  1O8S A;  4CU6 A;  3K4A A;  2VZ1 A;  3WNP A;  1JZ8 A;  3HPN A;  4JKL A;  2LS6 A;  5IFT A;  1TVG A;  4CUB A;  3NNG A;  3HNM A;  2CDP A;  2EID A;  4QX1 A;  4XUT A;  3LQC A;  2Z4F A;  4GWJ A;  1UMH A;  2C4X A;  3MV0 1;  2QQL A;  2WDB A;  1O8P A;  3T2P A;  4E8C A;  2J1R A;  2HYX A;  1JHJ A;  5JXJ A;  1BHG A;  4A3Z A;  1GU3 A;  3WF2 A;  4QX2 A;  2VCB A;  4QB1 A;  4DUV A;  2JD9 A;  1JYX A;  4P02 B;  2QQM A;  1WKY A;  4JHZ A;  3THC A;  2QQI A;  2J1V A;  2VMD A;  1PMH X;  3NRU A;  1L7Q A;  1W8N A;  3T2Q A;  3HNY M;  1KGY A;  3CKH A;  4ARY A;  1UY2 A;  2QBX A;  4UOJ A;  5DMY A;  3ETP A;  3WEZ A;  2W1U A;  4DEQ A;  2QQO A;  2W92 A;  2VZV A;  2DCJ A;  1JZ7 A;  3DYO A;  3K75 B;  4TTG A;  4DXT A;  1JZ6 A;  3VDB A;  2J1U A;  3OB8 A;  4JKK A;  1K3I A;  1UYZ A;  5B4X A;  1T2X A;  3VD9 A;  1UZ0 A;  3HOB A;  5LCW L;  1JU3 A;  2VC9 A;  3CDZ B;  3P6B A;  4TXW A;  2XHN A;  3WNN A;  1GOF A;  3PUH A;  1GMM A;  1UXZ A;  5JUV A;  1CIY A;  4W8J A;  2VZO A;  2BZD A;  4DEV A;  2VZQ A;  2WN3 A;  3E1F 1;  5I0D A;  4BK5 A;  4QPW A;  3I3E A;  1GOG A;  2VZS A;  2W3J A;  1OH4 A;  3SEE A;  5EIY B;  4ZZ8 A;  2XON A;  4OUE A;  1K42 A;  4P00 B;  2JDA A;  1IQD C;  2WN2 A;  4CU8 A;  5LA0 A;  4QDR A;  2V72 A;  1US2 A;  1OT5 A;  2WQ8 A;  1NX9 A;  3I2F A;  2OKX A;  2VZ3 A;  4P08 A;  2J1A A;  5EJZ B;  3VD5 A;  2WBK A;  4JKM A;  2VZT A;  3ACH A;  4XUR A;  3THD A;  2J1E A;  1GQP A;  2BER A;  1GUI A;  2J22 A;  5DQ0 A;  2WO2 A;  1J83 A;  3WF3 A;  4QB6 A;  3LE0 A;  3DEC A;  3ACF A;  3OBA A;  3MUY 1;  2CDO A;  3OGV A;  4W50 A;  4DXS A;  3LPG A;  4D8M A;  2VO5 A;  2W1Q A;  3U37 A;  2W87 A;  1MPX A;  4PT6 A;  3A22 A;  3LEG A;  1XNA A;  2C26 A;  2ID4 A;  2W5F A;  2Y64 A;  1K45 A;  1OF3 A;  1YQ2 A;  1W9W A;  1UWW A;  3MO4 A;  1GOH A;  3IB3 A;  3ACG A;  2WAB A;  4LPL A;  1CZS A;  2W46 A;  2ORZ A;  3A23 A;  4BXS V;  3CQO A;  5JMO A;  1NAE A;  4OMD A;  4D0Q A;  4GZ9 A;  1K12 A;  5HPO A;  4CVU A;  4ZXE A;  3I2G A;  4DXR A;  2WZ8 A;  1DYO A;  2VOT A;  2W1S A;  1UXX X;  2PQS A;  3K77 A;  2X10 A;  2KD7 A;  2JKX A;  2ZXQ A;  4KI5 M;  3T0A A;  3VD4 A;  5IJR A;  2QQK A;  5A1A A;  3OGS A;  3VDA A;  1OF4 A;  1US3 A;  3I2J A;  3I3D A;  3NQH A;  3SEP A;  2DCK A;  3IAP A;  3OEA A;  3F2Z A;  1W8O A;  5B4N A;  1PX3 A;  3CMG A;  4MAD A;  2R7E B;  2Y6K A;  3FL7 A;  4GWI A;  3NJV A;  2WO1 A;  4DUW A;  2WZE A;  2J1T A;  4OZO A;  2VL4 A;  2VZR A;  2WO3 A;  2XOM A;  3K46 A;  2BBA A;  2VMF A;  2YB7 A;  4PQQ A;  3A21 A;  4LQR A;  3P1I A;  2VQT A;  2W95 A;  4XUP A;  2VZU A;  5JXH A;  4DUX A;  2VJX A;  3FN9 A;  2JE8 A;  2E32 A;  3I2I A;  4OMC A;  1PX4 A;  1JI6 A;  3WNK A;  5DPN A;  4LKS A;  2BGO A;  5FUI A;  2W1W A;  1UMI A;  3ABZ A;  1JZ5 A;  2VTF A;  4AG4 A;  2QQN A;  1GNY A;  1XC6 A;  1J84 A;  4Z2A A;  3WSO A;  3C7O A;  4MGQ A;  4KWU A;  4BK4 A;  2Y6G A;  3T0B A;  5IHR A;  1JZ3 A;  3C7G A;  3C7H A;  1DLC A;  2C9K A;  3BN6 A;  3III A;  2V4V A;  4A44 A;  2ZEZ A;  3JXS A;  5IYY A;  4ET7 A;  4BDV B;  1F4H A;  4BJ0 A;  4A41 A;  1NUK A;  2J7M A;  3FHQ A;  1EUT A;  1UY1 A;  2Y8K A;  1UY4 A;  3MUZ 1;  4A42 A;  3K4Z A;  3HJR A;  4JX0 A;  5JR2 A;  2YFZ A;  3J7H A;  4XZU G;  4OYU A;  3LEI A;  3CZU A;  3GDB A;  5LA1 A;  1JYN A;  3GM8 A;  3CZJ A;  4XUN A;  1D7P M;  5DN2 A;  4PF1 A;  5G04 L;  1W9S A;  1JYW A;  4E8D A;  3ACI A;  5C7G A;  3VD3 A;  3T08 A;  5LA2 A;  2Y6J A;  3ECQ A;  1PMJ X;  3DYP A;  1W99 A;  4CU7 A;  1TG7 A;  5G05 L;  1W9T A;  3OEB A;  4QB2 A;  1UYY A;  1XPW A;  2XQX A;  3WQB A;  3HNB M;  4LHS A;  4CUA A;  2ZEW A;  1JZ2 A;  2VR4 A;  2VZP A;  3W5N A;  3HN3 A;  4KMQ A;  4QAW A;  3VD7 A;  3PUI A;  3BGA A;  4AAX A;  2X05 A;  1H6Y A;  2E31 A;  4RYD A;  2E26 A;  3OG2 A;  4A6O A;  3T09 A;  4W4Z A;  2RVA A;  4XUQ A;  4QDS A;  4UAP A;  4MGS A;  4L0P A;  1F4A A;  4ZY9 A;  1R64 A;  3AC0 A;  3NJX A;  2WUH A;  2W91 A;  5JXG A;  2W94 A;  4CU9 A;  3C8X A;  4RN5 A;  3I3B A;  3EB7 A;  2VMC A;  1XNT A;  3EYP A;  2E33 A;  5EJ1 B;  2ZEY A;  3UNP A;  2L9L A;  2WAA A;  1NKG A;  2WYS A;  3CIH A;  3C7E A;  4QX0 A;  4M4R A;  3HEI A;  4XUO A;  3C7F A;  2DDU A;  3WNO A;  4HG6 B;  2VQU A;  5J1X A;  4ZZ5 A;  3W5M A;  1CZV A;  2W47 A;  3FHA A;  4MOA A;  1CX1 A;  2B4K A;  3D3A A;  3WF0 A;  3MV1 1;  5CZK A;  1P8J A;  3UES A;  2B9V A;  2EIB A;  2BGP A;  5JXI A;  1HN1 A;  3WF4 A;  2LW8 A;  5F7U A;  2W9X A;  5C71 A;  3DYM A;  3WF1 A;  1H6X A;  3GGL A;  5HXM A;  4A45 A;  2Y6L A;  1ULO A;  1KEX A;  4ARX A;  1SDD B;  3OGR A;  4CUC A;  3K4D A;  1L7R A;  2VCA A;  1DP0 A;  3A7Q A;  1RYY A;  1UY3 A;  1UY0 A;  3T0D A;  2VME A;  2EIC A;  1O59 A;  2RJ2 A;  2YC4 A;  4QDQ A;  3LPF A;  3IDA A;  2ZEX A;  3LEK A;  3MBW A;  2VM9 A;  1UYX A;  1ULP A;  5CYY A;  2YC2 A;  1JU4 A;  4QX3 A;  3GXU A;  1LNS A;  1I5P A;  2RV9 A; 
#chains in the Genus database with same CATH topology
 1SFY A;  2QQJ A;  2G1M A;  1N3O A;  4UBG A;  4YZ4 A;  2MEV 1;  3DXU A;  3DPR B;  4Y1Y A;  1WCK A;  4BQ1 A;  2Q5T A;  4FOV A;  1LOB A;  2GDF A;  4NII A;  1XYN A;  1CR7 A;  4GH4 C;  4GAL A;  1S0G A;  4I0A A;  3VBR C;  5KXE A;  4A7K A;  3MIH A;  2B42 B;  3Q8F A;  4KWL A;  2WAO A;  1W2T A;  1KRI A;  2ZGT A;  1PNG A;  4IUG A;  4XC9 A;  4XYX A;  3W58 A;  2BGC A;  4YPJ A;  4LLO A;  1AR6 2;  1HV0 A;  1TME 1;  4XFI A;  4LUM A;  3SKJ E;  3T4V A;  1EAH 1;  5LK7 B;  3PVO A;  3LF7 A;  4AEM A;  3I2K A;  4P5Y A;  2MPF A;  4XDO A;  2FCT A;  1LAJ A;  2WO7 A;  2VNO A;  1H30 A;  2XJT A;  4Q4Y 3;  4AOC A;  3WNL A;  4AQ6 A;  4LBL A;  3UET A;  2V5D A;  3N3H A;  4CP2 A;  2OZ6 A;  1X33 A;  2GH2 A;  4NUB A;  4BIF A;  2V4A A;  2ATF A;  4XXP A;  2HH9 A;  2YFU A;  1EYB A;  2HLE A;  4QHB A;  1CJP A;  3ZKU A;  4CU6 A;  2PEL A;  2TNF A;  4S2F A;  2JDP A;  4CEY C;  4AW7 A;  1U5Y A;  2VCM A;  1O7F A;  2VMH A;  2YPJ A;  4JKL A;  1LUL A;  2LS6 A;  1RVF 1;  3OBT A;  3T2T A;  1TVG A;  2HWC 2;  1V6L A;  3LD8 A;  3S57 A;  3MIB A;  1RED A;  5CFC A;  2EID A;  1IG0 A;  2YU2 A;  1DGL A;  4QX1 A;  1A78 A;  4XUT A;  3LQC A;  2JDK A;  1YRZ A;  1O5L A;  2R1D A;  3TN9 3;  5FZO B;  2Z4F A;  4Q4V 1;  4EWD A;  3ZYF A;  3UYJ A;  3U1X A;  2QQL A;  2WDB A;  3MYX A;  5DDJ 3;  1VBB 3;  3TRS B;  3UK9 A;  3ZYP A;  4XAB A;  3T2P A;  5F2W A;  4R9D A;  1X82 A;  4B4Q A;  5CG8 A;  1JHJ A;  5A6X A;  5C9A C;  2HJI A;  5KBF A;  1MZE A;  4QQH A;  1OQE A;  2BEO A;  1HLC A;  1RC6 A;  2R07 2;  1G9B A;  2ERF A;  2QQM A;  1WKY A;  2JEM A;  2NPI A;  5KHI A;  1ASJ 1;  3USU B;  1BKZ A;  3T2Q A;  1TMF 1;  1C57 A;  4FXK B;  1OA4 A;  4IW3 A;  1KGY A;  5FPL A;  4U2A A;  4ARY A;  3BAL A;  4M0H A;  2YMZ A;  4N8M A;  5GJ6 A;  3VB9 A;  2VW1 A;  1EV1 1;  2BP6 A;  2ZKL A;  3AZZ A;  2ARC A;  3N9M A;  2W92 A;  3I59 A;  1RUF 3;  2VZV A;  4C91 A;  2FCU A;  3BB6 A;  3KF3 A;  5JSO A;  1JS9 A;  3R05 A;  1DU3 D;  1AL2 1;  2FZ1 A;  2Y0O A;  3AKR A;  5JDB A;  4AGR A;  3NKT A;  3N35 A;  1DIW A;  1L3J A;  2XKP A;  3MLK A;  4D6S A;  4WM7 B;  3KT4 A;  5JCT A;  3NST A;  3EJK A;  1O6U A;  3M3I A;  2PAE A;  1W6P B;  4JKK A;  4P9J A;  2UWB A;  4Y1X A;  3ZKY A;  4O61 A;  4PLN A;  1S2K A;  1OUX A;  1UYZ A;  5B4X A;  4Q4X 2;  3ZFG A;  3VD9 A;  4IEX A;  3HOB A;  1DZR A;  2FQP A;  3AKQ A;  4PHZ A;  5FXX A;  2WRA A;  3WNN A;  2QUO A;  3N7J A;  3PUH A;  4RFT 0;  4BZ4 A;  4BQ4 A;  3ZN5 A;  1N1T A;  1UXZ A;  2VXR A;  3B00 A;  5A3O A;  5JUV A;  2BVV A;  1B35 B;  4FOY A;  4HKL A;  4DEV A;  3UGG A;  3NAP C;  2HBT A;  1UCX A;  2D6O X;  1LKN A;  3GCX A;  4JGY B;  2Q1F A;  4KG0 A;  4XIO A;  4BK5 A;  3ZN6 B;  5K9Y A;  1F5F A;  2VY0 A;  5FQ0 B;  3DCQ A;  2VZS A;  4AEK A;  1HX6 A;  1VRH 2;  3WLU A;  3K2O A;  2A3Y A;  2ZAH A;  1KJR A;  1VMH A;  4GB3 3;  5LY1 A;  3R4D B;  4HL0 A;  1DQ0 A;  4L8Q A;  3BUC A;  5E16 A;  3VZO A;  1IQD C;  2EXI A;  2WN2 A;  3Q8C A;  5GLT A;  4CDU B;  4CU8 A;  3NL1 A;  4NVP A;  3JD7 2;  4PBO A;  5A6Y A;  3BU0 A;  1V6K A;  3AP4 A;  4BMB A;  4ASM B;  1NX9 A;  1XQN A;  4UFJ A;  1V6M A;  1FPN 3;  2YC0 A;  4FPK A;  5FLH A;  3TAY A;  3VDD C;  4E4S A;  1MS8 A;  2XVG A;  3ILN A;  3S6P A;  4OUM A;  4OQ9 A;  1X9T A;  5JIU A;  3NNL A;  1LB2 A;  3ACH A;  1NCR A;  1VMJ A;  3AZV A;  4XUR A;  3IM0 A;  3THD A;  3UGF A;  3NNF A;  1I1E A;  5FO9 B;  2XJP A;  2K0G A;  1WLD A;  1V0A A;  2X5I B;  3RZG A;  1J83 A;  3WF3 A;  4P9Y A;  5FZ0 A;  2RS3 1;  3ACF A;  4Q1P A;  4EN8 B;  4BPZ A;  3OGV A;  4A2U A;  3KCC A;  4KG8 A;  1QJY 2;  2B39 A;  4BIO A;  1TE1 B;  3O12 A;  4GIQ A;  4D7T A;  4Z82 A;  4PT6 A;  1WBL A;  3T30 A;  3SHR A;  1REF A;  4J6G A;  2C26 A;  2A7A A;  2ET1 A;  4BWO A;  4CPB A;  2JKB A;  2OQ7 A;  3ZFE C;  1W8H A;  2GNB A;  4A7Y A;  2Y64 A;  4Z8B A;  1K45 A;  2GME A;  1RUC 3;  1AYM 2;  5GLV A;  4BCU A;  1FMD 2;  4MVT A;  1OF3 A;  4UBH A;  5CBL A;  4LHL A;  3GHN A;  4DY5 A;  4P9X A;  4FBF A;  5I8Y A;  1RUD 3;  4HMZ A;  4HAN A;  2RJK A;  1G6N A;  2ZMK A;  3ACG A;  2WAB A;  2ZX1 A;  1CZS A;  2JDY A;  4XAA A;  3A23 A;  4N43 A;  4Y5S A;  3CQO A;  1NCQ A;  1KFU L;  3THT A;  4K8R B;  4H3W A;  1QKQ A;  4QD2 A;  4OMD A;  2ZHL A;  2QNK A;  3BCW A;  3OOX A;  1LGC A;  2VOX A;  1CAU A;  4Q26 A;  4Z2W A;  3B94 A;  4JAA A;  4KL1 A;  2BQP A;  2EAL A;  2EXJ A;  4UFI A;  4P9W A;  2D43 A;  4CVU A;  5FR3 A;  2ZHK A;  1ND2 A;  5H9Q A;  2ZJC A;  3VBH C;  1SMV A;  4WZF A;  1CAW A;  2WS9 1;  3AMM A;  5I8T A;  4MGK E;  1QJX 3;  3ETQ A;  3ZIX A;  3I2G A;  4IEW A;  4GQ7 A;  3RMX A;  2WZ8 A;  4RQP B;  2WWS A;  2VOT A;  3ZSM A;  5F1R A;  2W1S A;  3LOB A;  1POV 0;  1L7L A;  3CJI A;  4XEZ A;  4XE9 A;  4MH0 E;  2JKX A;  3O0X A;  4KI5 M;  4CCE A;  4XQ4 A;  1VBE 2;  4MXW B;  4WM8 C;  5A1A A;  2ADD A;  1Y7B A;  4E2Q A;  1DYP A;  4PIX A;  4Q0U A;  4LHN A;  4AVS A;  3NJZ A;  2R30 A;  1H8T A;  3I3D A;  3NQH A;  1FOD 3;  2DCK A;  3O0W A;  5T3N A;  2DV9 A;  5FYI A;  1K5J A;  1ZZB A;  2FHR A;  3OJB A;  2JE9 A;  1VBD 3;  4LO6 B;  1RUE 2;  3KV4 A;  1MS5 A;  5I0S A;  4UFH A;  2XJV A;  4FFI A;  5IVJ A;  1JYI A;  1H2M A;  1RUI 1;  1WW6 A;  4LBQ B;  4QGL A;  4YW5 A;  5B4N A;  1OOP C;  2JG8 C;  1MS3 A;  2JG9 C;  4MAD A;  1G86 A;  1FXZ A;  2XG3 A;  1HJF A;  2MEV 3;  3H3L A;  2DFB A;  4Q4W 1;  4ES8 A;  2PTM A;  4GWI A;  5LZ6 A;  2JB8 A;  3PTR B;  3BYW A;  3KCY A;  3OYW A;  4O65 A;  4FOW A;  1DQ5 A;  4DUW A;  1URX A;  3MID A;  3O1U A;  5FTT C;  2J1T A;  4TLG A;  2RHP A;  4OZO A;  1S0J A;  3FHI B;  5BNO B;  2WO3 A;  2XOM A;  3AP5 A;  2BBA A;  3CL1 A;  3WDV A;  3P1I A;  4I2O A;  3WNX A;  5IAT A;  4XUP A;  1BBT 3;  1TME 3;  3KD4 A;  1F15 A;  2V09 A;  1EAH 3;  5FYZ A;  5A7W B;  1OUS A;  3FN9 A;  4Y4Y A;  2JE8 A;  4HVR A;  3WDU A;  3VV1 A;  1CAV B;  2DBN A;  5E89 A;  3WG3 A;  2VMI A;  5L9R A;  5DPN A;  4YZ3 A;  2GMM A;  3ZR5 A;  4GAZ A;  2CWS A;  2W1W A;  1UMI A;  1JZ5 A;  4Q8K A;  1POV 1;  2E7T A;  1CPM A;  2HEW F;  2VTF A;  4NPL A;  5FY0 A;  4AG4 A;  3S7E A;  1OLQ A;  1GNY A;  1PVC 1;  3MW3 A;  3MW2 A;  1Z78 A;  1LEC A;  1XC6 A;  2RM2 1;  1FI2 A;  1RVF 3;  4HZF A;  4JTO A;  4OUS A;  3MF6 A;  2B46 X;  1J1T A;  1QQP 1;  4BK4 A;  1RUN A;  1Z7S 2;  4H2A A;  3ON7 A;  5IHR A;  3TNP B;  1PGL 1;  1SQ4 A;  4QPI A;  4YM2 A;  4DB5 A;  2C9K A;  1QGL A;  3BN6 A;  1R1A 2;  4ZU7 A;  3III A;  5FP7 A;  3BTX A;  2Y26 A;  2Q30 A;  1WUV A;  4LKD A;  2ILM A;  3U07 A;  4O7X A;  4ET7 A;  3EXU A;  1H1A A;  3MEP A;  4GH4 B;  4CZS A;  2PQQ A;  3OD4 A;  4BQX A;  2GC0 A;  2YU1 A;  4N7I A;  1SLT A;  4P5H A;  1EUT A;  4XMA A;  5F6K A;  4L92 A;  1UY1 A;  2Y8K A;  3GZE A;  3O1T A;  2OZJ A;  2PHF A;  3MUZ 1;  1ASJ 3;  3K4Z A;  4LKF A;  5FPZ A;  4MHU A;  5CU1 A;  3I2O A;  3KHB A;  3EBR A;  3O0V A;  4XFB A;  1W6M A;  3DPR C;  3CZU A;  2ZML A;  2ZX2 A;  1XSQ A;  4LEJ A;  1K5M A;  3KQ4 B;  2BYV E;  2DVG A;  4PLM A;  4PLO A;  2PHT A;  1EV1 3;  3BKZ A;  1REE A;  3V0A B;  4AI0 A;  3R6S A;  1D7P M;  3LAG A;  4YLZ A;  2OX0 A;  5GM0 A;  1PIV 3;  5JR7 B;  1FAT A;  1E5I A;  4PF1 A;  3U11 A;  1AL2 3;  1AXZ A;  4AEJ A;  5FLI A;  4AI9 A;  4HXC A;  1AR7 2;  5BNP A;  4XF0 A;  1RXF A;  4XMI A;  2QQV A;  4H7M A;  3WQ1 A;  4FO9 A;  4TYS A;  1NY7 1;  1W6N A;  2VBB A;  4NIA A;  1W6Q A;  1N3Q A;  5GZD A;  4AHX A;  2A1X A;  4CDQ A;  4KGG A;  4ISQ A;  4CU7 A;  2XLA A;  2JB4 A;  2ZGN A;  4LXL A;  5G05 L;  2P6C A;  1GQG A;  2VGD A;  2KA3 A;  3VHN A;  3ZIW A;  1A34 A;  1XU1 A;  2GSY A;  2E63 A;  1IS3 A;  1YQ5 A;  1YQC A;  4CUA A;  1UIJ A;  4LIV A;  1BK1 A;  1CQ9 A;  2HEY F;  4MV2 A;  2OUH A;  4X8P A;  1NXM A;  3ES1 A;  4Q2F A;  5C6C A;  4P9G A;  2YY1 A;  2RS5 2;  4C90 A;  4QAW A;  2R06 3;  5L9V A;  2ETE A;  3K51 A;  2HKX A;  1ENX A;  1D0H A;  4CDW B;  4RYD A;  4B4R A;  2AZ5 A;  1QEX A;  5I0U A;  1GKB A;  4W4Z A;  4IEZ A;  2UYA A;  2RVA A;  3ZPO A;  3TOJ A;  5L7O A;  3OF1 A;  1ZZ7 A;  3VBS A;  2D7F A;  5KXB A;  5LEK A;  5I8S A;  3WX5 A;  5KHK A;  1G9D A;  1GWK A;  4AGV A;  2PN5 A;  3CEW A;  2QVS B;  1LU2 A;  3FUQ A;  5HCB A;  3WP4 A;  3V0B A;  1OMI A;  5L36 A;  2ZOE B;  1SAC A;  3NV3 A;  5JXG A;  3QH7 A;  2VBD A;  4NAO A;  2XBO 2;  5ABJ B;  1D0G A;  1YFU A;  1YLL A;  2ADE A;  3H1Y A;  4QXC A;  4B7K A;  4ZKT B;  3N7M A;  2LUW A;  4LA2 A;  3VHP A;  2QKD A;  1NZI A;  1XNT A;  1HW5 A;  1OA2 A;  4EJR A;  1C5H A;  3JUU A;  1IGO A;  3PUA A;  4JDN A;  5A3M A;  2ZEY A;  5FBJ A;  3ZX7 A;  1WW5 A;  2DUO A;  4LMF A;  4LO5 B;  2W2I A;  2XJQ A;  4LNV A;  4AK3 A;  1HKD A;  4M4R A;  2Q1Z B;  3HEI A;  4MLO A;  1PK6 B;  5F3C A;  3HD8 B;  2P3I A;  4CA9 A;  4NO4 A;  4FCA A;  3VZJ A;  4NMI A;  4HG6 B;  2C24 A;  4YM0 A;  5JZG B;  2VQU A;  1BXH A;  1YFY A;  4NOT A;  4WZC A;  1RMU 2;  4ZZ5 A;  3IT8 A;  2A6Z A;  3FHA A;  1VAM A;  1YHF A;  3AL5 A;  1CX1 A;  3JBG 2;  5BUV A;  1NA1 A;  5FK8 A;  1OSG A;  3M1H A;  1LHV A;  1VBC 2;  1LOA A;  4FQZ A;  5CZK A;  5DZE A;  4S2G A;  1RUJ 2;  5FZA A;  5J3U A;  2BGP A;  1HN1 A;  3WF4 A;  1OFS A;  2XQR A;  2LW8 A;  3LFI A;  4DFS A;  5BYN A;  5C71 A;  5E6H A;  1B35 C;  1UOF A;  1XJA A;  1YUD A;  3GGL A;  3ZXF A;  2XVK A;  1OLM A;  3AXE A;  5DUV A;  2Y6L A;  4JGY C;  1KEX A;  3HMY A;  4XJA A;  4MGZ E;  2EXK A;  4YZ1 A;  4QPG B;  4GWN A;  3K4D A;  2WS9 3;  4FPE A;  1GP4 A;  1TQ5 A;  5DDJ 1;  1UQX A;  4E4Z A;  1PZ9 A;  4Q4Y 2;  1NE4 A;  2VME A;  2HWB 1;  3POW A;  2YRO A;  2EIC A;  5C8W A;  1O59 A;  3ZFF A;  2YC4 A;  5FRE A;  4CDU C;  4XPV A;  3LPF A;  2PAM A;  4IV1 C;  1QDO A;  3AYD A;  1NLS A;  3TYJ A;  4GXL A;  3MBW A;  1AX0 A;  2Y34 A;  4R8H A;  5JAX A;  2VM9 A;  4ISR A;  2AR6 A;  4R4Z A;  3ZYH A;  5C3P A;  2HYK A;  4Y20 A;  5CYY A;  5FY8 A;  1PO1 3;  5LWB A;  3EMR A;  4LBJ A;  3HWJ A;  1UU5 A;  3TNQ A;  1I5P A;  2Q1M A;  3PU3 A;  4XDP A;  4IND A;  2RV9 A;  1XE0 A;  2IC1 A;  1GQH A;  4K21 A;  1W03 A;  4M4P A;  1RUF 1;  1RUG 3;  4LTA A;  5LK5 A;  1MAC A;  4A7Z A;  2E51 A;  4COV A;  4AWD A;  3B69 A;  1XYO A;  1BCX A;  1W3V A;  3I54 A;  2X5I C;  3RZL A;  4Q8L A;  5DZF A;  3TN9 2;  1AYN 2;  1G7Y A;  2D97 A;  5FZK A;  5C70 A;  1T6B X;  4Q4W 3;  4U36 A;  2QE3 A;  1VBB 2;  5FZ3 A;  3WP5 A;  1JZ4 A;  1SLC A;  5J09 A;  1QDC A;  5EWS A;  3N9L A;  4UW5 A;  1W0N A;  1OHF A;  4NHK A;  3FWE A;  4MUV A;  4Q27 A;  5EPA A;  3MPB A;  4MXV A;  2X09 A;  2E6V A;  2V73 A;  2R6Q A;  5L19 A;  5D8A A;  1WCQ A;  5FZO A;  3UT0 A;  2B7Y A;  4K40 A;  3JB4 C;  2AGS A;  3SKV A;  1BEV 1;  2GNT A;  1CAX A;  4S2D A;  5KHH A;  3VDC A;  5IFP A;  4DOU A;  3SH4 A;  4LE4 A;  5H9S A;  1H4H A;  4UI9 L;  1UL9 A;  3P3N A;  2A5Z A;  4C0B A;  2R49 A;  3KV5 A;  3KT1 A;  1FNZ A;  4GB3 1;  1O8S A;  4W6W A;  4ZS3 A;  3T2O A;  3RVH A;  4PDW A;  4AED B;  3USU A;  2ZGM A;  4JQT A;  2RR1 2;  2YV8 A;  3LDB A;  3D5O A;  3BIW E;  3HIF A;  4O9E A;  5CIS A;  5ANN A;  2BU9 A;  1POV 3;  4WM8 B;  5C8C B;  1RIR A;  4Q0Q A;  5DAW A;  3NNG A;  2ZGS A;  1PVC 3;  5F8P A;  4AZZ A;  5I0R A;  4RS5 B;  3PVE A;  4QT6 A;  1W0O A;  2RM2 3;  3VZL A;  5JSP A;  4YZ5 A;  2WIN B;  1WCD J;  4NHM A;  1I5Z A;  4URT A;  4DZG A;  2XDV A;  4GWJ A;  3N9P A;  4HLT A;  3AMQ A;  3NVC A;  3H8U A;  3POG A;  4IES A;  4FPH A;  3DGT A;  4E8C A;  5C4W B;  2FDJ A;  5FJK A;  1C1F A;  4M3C E;  1BMV 2;  2VUA A;  3UJQ A;  3ZSE A;  3MGU A;  4A3Z A;  1F9K A;  3DUI A;  3WF2 A;  1XRU A;  4FPL A;  3CHX A;  1MR5 A;  1MQT A;  2JD9 A;  1ZBE 2;  5ACA 1;  3WW2 A;  1W2N A;  2D3S A;  5FYY A;  1NXD 1;  1PMH X;  1PVX A;  3E6C C;  1L7Q A;  1J3P A;  3HNY M;  2O8Q A;  5T5L A;  3J26 N;  3CKH A;  2K46 A;  4OLL A;  3SIS A;  5DMY A;  2YDE A;  1RUC 1;  3WEZ A;  2W1U A;  1FPN 2;  1UF2 C;  3Q8E A;  1VAK A;  4DEQ A;  1PGW 1;  4BHP A;  5A3T A;  3K75 B;  1RUD 1;  5DUX A;  3MF9 A;  1MS0 A;  5A3L A;  4TTG A;  4YG0 A;  3NO8 A;  5FMD A;  4IV3 A;  2PXJ A;  3AZY A;  2W08 A;  1S2B A;  3HQR A;  1KDK A;  3N9Q A;  1Y4W A;  3OB8 A;  3VDB A;  4CXY A;  5DG2 A;  5A3P A;  3WP6 A;  1FNY A;  2RMU 3;  4G3Y C;  1O4T A;  1JU3 A;  4XTM A;  5LCW L;  2D3P A;  3MIF A;  1OH3 A;  2XHN A;  5CFD A;  3RZK A;  2VVD A;  4GJY A;  3M3Q A;  1RUH 3;  3DN7 A;  4MYE A;  4R9C A;  1CIW A;  1CIY A;  1QJX 1;  4HVO A;  4XF3 A;  4IEQ A;  2JDN A;  2VZQ A;  3E1F 1;  3LIG A;  1SLB A;  2VVF A;  4NWW A;  4XJZ A;  1IKP A;  4QPW A;  3CLP A;  4RR3 A;  2Z2S B;  2YBP A;  4AGG A;  5FK7 A;  4Z1V A;  1ZRF A;  4L2N A;  5BV6 A;  4EN9 B;  2P3J A;  2UUR A;  3ENR A;  2XON A;  3PVB B;  4Q1R A;  1BJQ A;  3UL2 A;  1K42 A;  2D40 A;  4P00 B;  2FCV A;  1NLQ A;  2JDA A;  3WXP A;  5E88 A;  5LA0 A;  1FOD 1;  3UV9 A;  5J48 A;  1YFW A;  3WDW A;  2V72 A;  4UT5 A;  2Y0I A;  1US2 A;  1OT5 A;  1W2O A;  4SLI A;  1CON A;  2WQ8 A;  2Y6F A;  4ZU4 A;  2OKX A;  2WNU B;  2O14 A;  3RYK A;  4FPJ A;  4LUL A;  4QU2 A;  3ATG A;  4ITC A;  5I0T A;  4XQD A;  4CPB D;  4EE2 A;  2P1B A;  2XPJ A;  3VD5 A;  3VL9 A;  2VXJ A;  3VUO A;  2GP5 A;  1AF9 A;  1GYK A;  3QBQ A;  2J1E A;  1OKO A;  3IMN A;  2BER A;  4YG3 A;  4UFL A;  4K3U A;  2P6H A;  3AM2 A;  4J1W A;  5FZM A;  1JYC A;  4DMI A;  3BIE A;  3DL3 A;  3PUS A;  1OXC A;  4QWN A;  4CP1 A;  1HXS 3;  5LAT A;  2W68 A;  3LE0 A;  3TEZ A;  3KVB A;  1DBN A;  4Y22 B;  4W50 A;  4A6S A;  3PLQ A;  3ZFG C;  4DXS A;  5FZ8 A;  2Z79 A;  4HON A;  2HWD 3;  3PUR A;  3U37 A;  5J37 A;  1MPX A;  1BBT 1;  1UN1 A;  2WFP A;  5FIX A;  5C3R A;  5F5I A;  4V1P A;  4BQ2 A;  3V64 A;  1VBD 2;  3PL0 A;  4YVS B;  1VP6 A;  5FP3 A;  4GKY A;  1RJ8 A;  2XL7 A;  1S2E A;  1W9W A;  1QU0 A;  1UWW A;  3IDB B;  5FYC A;  4CCD A;  2MNG A;  4BQ3 A;  1A8D A;  1GOH A;  2QTW B;  3QCW A;  1W2A X;  1ZRE A;  3IB3 A;  1W9F A;  2VVE A;  4UXA A;  2MEV 2;  2W46 A;  4Y5T A;  2ORZ A;  5FJH A;  3GZU C;  5JMO A;  1ZRC A;  2AEZ A;  3MHZ A;  5FV3 A;  2IXK A;  4LBQ A;  5F2S A;  3O1S A;  2CV6 A;  4XIK A;  4BB3 A;  1O3T A;  4D0Q A;  2HWF 3;  2D5H A;  2ZZQ A;  2DVF A;  4GZ9 A;  4CXX A;  1ULD A;  5FY5 A;  5HPO A;  5J96 B;  1LED A;  2CL2 A;  5A1F A;  4Y1Z A;  2A75 A;  1RHI 1;  2DU1 A;  1TME 2;  2RDN A;  3GBF A;  4DRV A;  4DXR A;  1EAH 2;  1C5I A;  1IS6 A;  2D6N A;  2Y38 A;  1ND3 B;  2D93 A;  2YHJ A;  4MZU A;  4P14 A;  3UKN A;  1U5I A;  2WZR 1;  3VBO B;  4JGZ A;  5DG1 A;  3B93 A;  1NT0 A;  4NHY A;  1WZX A;  3T0A A;  4YFZ A;  2HWB 3;  5BNO A;  4CDW C;  3VD4 A;  5AVP A;  2CGN A;  1UOB A;  4XHX A;  5FO7 B;  1OF4 A;  2H0V A;  1US3 A;  4FFH A;  3LKJ A;  4YVW A;  3VBU B;  3HT1 A;  4N53 A;  5JLV A;  4FAG A;  1ST8 A;  1NLR A;  2UYB A;  3F2Z A;  2BFU S;  5FZB A;  2ZX0 A;  5LW9 A;  2WNV B;  4F3J A;  1ENR A;  2PHU A;  4LR4 A;  1RVF 2;  2Y33 A;  5FY7 A;  4ERO A;  2FMY A;  1WD3 A;  5ABJ C;  1C1L A;  1R09 1;  4FSJ A;  1DQ2 A;  4I0W B;  4HFS A;  4YGC A;  3U14 A;  3OCP A;  2Y6K A;  2ZKN A;  4IE4 A;  1PIV 1;  1PNF A;  4NPM A;  3FL7 A;  3QAC A;  5K7P A;  3DF0 A;  5K0U A;  3KSC A;  3NJV A;  4Q4V 2;  4TSV A;  1QNW A;  2RS1 1;  2RJL A;  2UY9 A;  2WO1 A;  3N9N A;  2AUY A;  4FFF A;  3CBN A;  5DUW A;  5BNN A;  5F5A A;  1NYW A;  2Q8E A;  4YG6 A;  3ZSJ A;  1PK6 C;  5C5U A;  4NWV A;  2OPK A;  3U4S A;  4MGT A;  1DGR N;  2XKO A;  4OHW A;  3N36 A;  4CEW A;  1COV 2;  2GU9 A;  5JZG C;  2VQA A;  2NMO A;  3NV4 A;  5KR7 A;  4KQ7 A;  3FLP A;  5F3E A;  3OBR A;  5DAQ A;  1H0B A;  3B3Q E;  2BWC A;  1BEV 3;  2P34 A;  1ZX5 A;  4YYO A;  1TMF 2;  2DVB A;  1PX4 A;  1PO2 1;  1JI6 A;  4XDQ A;  5GZF A;  4M3C B;  2GN7 A;  3VBR A;  2VTX A;  4IDZ A;  1EV1 2;  5I93 A;  2R06 1;  4NHX A;  1HB4 A;  4C0H A;  3KV6 A;  4QM9 A;  3ABZ A;  2WT1 A;  1MS4 A;  4LOT A;  1OA3 A;  3WCR A;  2QZ2 A;  4K8F A;  1AL2 2;  1OVP A;  1DLL A;  3B02 A;  2OS2 A;  3L2Y A;  5A3U A;  2YGL A;  3O14 A;  5IVF A;  3VKO A;  2XHK A;  1V00 A;  3IIA A;  5A32 B;  4IV1 B;  4CDX B;  5HCH A;  2LAL A;  3W21 A;  4QPG C;  3WSO A;  5IK5 A;  2UWC A;  5D2A A;  3USS A;  1JOD A;  2Y6G A;  1LCL A;  4PBP A;  3NNJ A;  5EZW A;  3V0A A;  2ZX4 A;  5FP9 A;  1JN2 P;  3KT7 A;  4FQ4 A;  1ZZC A;  3PJQ A;  2VMG A;  1QJU 3;  2XML A;  3IDE A;  3KM5 A;  3OPZ A;  3R0R A;  2QQP A;  1C8M 1;  2DU0 A;  2VD7 A;  1GZW B;  4IEV A;  4A44 A;  3JXS A;  5M0T A;  1UOG A;  4CEY A;  4EWE A;  1NQJ A;  1PZ8 A;  2R04 1;  4JQR A;  3RQ0 A;  1F4H A;  1I3H A;  2D6L X;  4A41 A;  4JHT A;  1NUK A;  3RSJ A;  4YW2 A;  3IWZ A;  1MS1 A;  2XJS A;  5F3G A;  4A42 A;  5ACA 3;  1KXG A;  2VNV A;  4BA6 A;  3IN9 A;  3VBF B;  2YFZ A;  1GV9 A;  2W0X A;  3M7A A;  3TB0 A;  2AAC A;  2DYC A;  4QKB A;  2JJ6 A;  5A7O A;  4CYD A;  1DQ1 A;  1MVQ A;  1D2Q A;  2G19 A;  4YFW A;  1JYN A;  2JEC A;  2XUM A;  3GBW A;  4B8E A;  2CU5 A;  3E5X A;  1KS5 A;  4EV0 A;  1H9W A;  2XL9 A;  4XHB A;  4OHX A;  4UF0 A;  5C9A A;  3RFR A;  5JPM B;  1QXP A;  1W9S A;  1LOE A;  4WBB A;  3H1W A;  1UAI A;  4E8D A;  1EY2 A;  2EVX A;  2F4L A;  5C7G A;  1KS4 A;  4WVM B;  4GD4 A;  2VNR A;  5CIR A;  3T08 A;  3WG1 A;  5FXZ A;  3J4U H;  2D6P A;  2RS3 2;  1XOY A;  5FZE A;  1CJD A;  1TG7 A;  2BV4 A;  3RZH A;  5A33 B;  2IZW A;  4XFF A;  5IK4 A;  3RJ2 X;  1O3S A;  1YO8 A;  2PHL A;  5EXO A;  3HNB M;  3WQB A;  4LHS A;  1DQ4 A;  1IG3 A;  2OPW A;  4BU2 A;  5AFE A;  4I30 A;  3J8F 2;  4AED C;  4WVZ A;  3BTA A;  4AR2 A;  3GHM A;  3IPV A;  4OFG A;  5FZG A;  1GAN A;  4KMQ A;  1TZO A;  3FFQ A;  2TBV A;  2YPD A;  4LUK A;  3PUI A;  5C8C C;  2FZ2 A;  1HRI 3;  2CTV A;  5A7Q A;  3GZT B;  3WUD A;  4Q29 A;  5J98 B;  4OI0 A;  3MPP G;  2JDZ A;  1SFP A;  2BPA 2;  4XTP A;  4RS5 C;  3WY6 A;  3H42 B;  3OG2 A;  1N1S A;  4C1W A;  1PO1 1;  1V6N A;  1S0B A;  5C3O A;  2YYO A;  4MGS A;  2AC1 A;  4CCM A;  1S55 A;  2CGO A;  1OPM A;  3BPS A;  4LHK A;  4M01 A;  2QZ3 A;  4QHZ A;  1JXN A;  2OYZ A;  3SCF A;  4OI4 A;  3NAP A;  3NJX A;  4IEU A;  1RUG 1;  4FOQ A;  2Q8C A;  1K5M C;  2I2S A;  5C4W C;  2W91 A;  4AQ2 A;  4AVB A;  3EHK A;  1KIT A;  2W94 A;  1BVP 1;  1CVN A;  2PAK A;  2WS9 2;  3D6E A;  1HN0 A;  3I3B A;  5FYT A;  1A6C A;  3ZXD A;  3EB7 A;  5F5Q A;  4CCN A;  2PMW B;  4NPR A;  1HRV 1;  2VMC A;  3FBM A;  1JUI A;  3FE5 A;  2ZGR A;  4XFC A;  5FZH A;  3I4I A;  3D0J A;  2E33 A;  4J25 A;  5EJ1 B;  4MGI E;  3UNP A;  3JZV A;  2WYS A;  2P4E A;  3CIH A;  4QX0 A;  3VGI A;  5FWJ A;  3WG2 A;  5K4L A;  1NE6 A;  1R08 1;  1MZ5 A;  2Z69 A;  3C7F A;  3PNA A;  4D69 A;  1XE7 A;  1H1M A;  1WMX A;  5FKC A;  3VDD A;  3WDX A;  2O1Q A;  5FMC A;  3WNO A;  5GZC A;  4XJ9 A;  2PFW A;  1V9U 1;  3ILF A;  2Q8D A;  2A6V A;  4QM8 A;  5CFC B;  1I9R A;  3HBZ A;  1DDL A;  2B4K A;  1QJZ A;  3D3A A;  3RJR A;  1RUI 2;  2R1B A;  3MV1 1;  5FMB A;  3AFK A;  3UES A;  3KV9 A;  2B9V A;  5FFO C;  2EIB A;  5JXI A;  2VBP A;  3LWC A;  1RGS A;  1ZA4 A;  2J42 A;  4Q4W 2;  2GND A;  2GH8 A;  4EQV A;  3FUO A;  1AJO A;  2YBS A;  1H9P A;  1H6X A;  1ZZ6 A;  4R52 A;  5HXM A;  4A45 A;  4K9S A;  4HK9 A;  5GZE A;  1TNR A;  3H7J A;  1ULO A;  3M3C A;  4OHZ A;  3TWI A;  3M70 A;  1Q8Q A;  3FLT A;  3ZFE A;  4DNY A;  4BQY A;  2BOI A;  2FDI A;  3A7Q A;  5T54 A;  1RYY A;  1RHI 3;  1V6J A;  4NRM A;  1CES A;  5A6Q A;  3GNE A;  3FFZ A;  1Q8P A;  1RJ7 A;  1PZ7 A;  1HB1 A;  3WDT A;  4NID A;  5T5P A;  2HBU A;  5DZG A;  1VAV A;  2WZR 3;  3I59 B;  1APN A;  5F5C A;  1BYH A;  2RJ2 A;  4FAH A;  2CYF A;  1UW8 A;  4W65 A;  5GLU A;  3OGG A;  4HVQ A;  1ZBA 1;  4E2S A;  5AC9 1;  3LEK A;  3PDQ A;  2A6W A;  5T55 A;  3WVJ A;  1ULP A;  2WNU C;  4AI8 A;  3WOG A;  3OPT A;  2GC2 A;  2JDM A;  2Z42 A;  2BFU L;  1JBC A;  4IGO A;  3VBH A;  3GXU A;  3ZFG B;  4H55 A;  3ZXL A;  1WA4 A;  1UYP A;  1PVC 2;  3IBM A;  4UFM A;  1O4Y A;  2P17 A;  4FTS A;  1O3R A;  2RM2 2;  1CPN A;  5T5O A;  4NR1 A;  3JQX A;  2D44 A;  3WP3 A;  1R09 3;  1CZT A;  2EIE A;  1QQP 2;  1VIW B;  3IKW A;  2FMD A;  5E1R A;  1PM4 A;  1QOS A;  2YG0 A;  4FI9 A;  5LBC A;  2IUW A;  2WQZ C;  2PHR A;  4WM8 A;  4Q4X 3;  5CEH A;  1PGL 2;  1H8V A;  2R16 A;  3INA A;  4HKO A;  2Y6H A;  3RZZ A;  3VZK A;  3WHU A;  3OY8 A;  3POF A;  2RS1 3;  2RMU 1;  4LOS A;  2VG9 A;  1LOF A;  2CNA A;  3SXW A;  2LM3 A;  1E5H A;  1RUH 1;  1SG3 A;  4YVS C;  3GAL A;  4CCJ A;  5FPX A;  5FZC A;  3ZR6 A;  3RZM A;  1OOP A;  3SNM A;  1D4M 1;  2JG8 A;  2PHX A;  4NRQ A;  2JG9 A;  4WVV A;  5AFB A;  1F5J A;  2OII A;  3I2H A;  4OVE A;  1JYV A;  5FPB A;  2NMN A;  1F31 A;  4NRP A;  4BLI A;  1W8U A;  2XWJ B;  1PO2 3;  1NCR B;  2JD4 A;  5FKB A;  1A3K A;  2I07 B;  4P9L A;  3RZJ A;  3JD7 3;  1NOV A;  1RL3 A;  4MG2 A;  5JPN B;  2VZ1 A;  4RGK A;  2XB6 C;  1SPP A;  3F95 A;  2ZPX A;  1LR5 A;  1ONA A;  5FXV A;  1SBF A;  2IFW A;  1H2K A;  1WLT A;  3O7O A;  2CDP A;  1ND3 C;  4JZR A;  4F8A A;  5KWR A;  1AR8 1;  3ZXG A;  3GYD A;  1NY7 2;  4COU A;  2B9U A;  1BLZ A;  4CE8 A;  3VBO C;  2PHD A;  4R9B A;  4LBK A;  4XJ8 A;  4EZH A;  4B1L A;  3VHO A;  4BE3 A;  1GSL A;  1JMU B;  3PHM A;  2QFE A;  2J1R A;  1HIX A;  1QIQ A;  3N9O A;  4XCA A;  1HXS 1;  5FZI A;  1RUO A;  2HYX A;  3U4X A;  2BOJ A;  1BHG A;  1C8M 3;  3ES4 A;  3GJB A;  5JMC A;  3VBU C;  1GU3 A;  4NIH A;  2VNG A;  2VCB A;  4LIT A;  2R04 3;  5ERL A;  5FOB B;  4RGG A;  1JYX A;  4IGQ A;  3E5Q A;  2HWD 1;  2BWA A;  3THC A;  4N43 B;  5LBF A;  2R32 A;  2WNV C;  1NCQ B;  4JV4 A;  2RG4 A;  4G9S B;  1W8N A;  2VU9 A;  2CAV A;  3AK0 A;  1AYM 3;  2ARB A;  2K9Z A;  4F7Z A;  1CAU B;  5FZ9 A;  5KC5 A;  3URF A;  1PMI A;  4UOJ A;  3B5L B;  3PUQ A;  1QWR A;  4CP9 A;  5FY4 A;  4AI2 A;  1ND2 B;  2ARE A;  1W3X A;  1C8N A;  4QKN A;  1CAW B;  1RB8 G;  1SFN A;  2IXI A;  3G7D A;  2GN3 A;  1X7N A;  4ORF A;  4GKX A;  1QH6 A;  2C9A A;  4AQT A;  2IXJ A;  4DXT A;  2G9F A;  1SEF A;  1QHD A;  4HPK A;  1YYN A;  3ST7 A;  2J1U A;  1DG6 A;  3SIT A;  3CJI B;  5A6Z A;  1UMZ A;  5F9T A;  2HEV F;  5AVA A;  1K3I A;  5GLW A;  1T2X A;  1WGP A;  4DO0 A;  4RHV 1;  2HWF 1;  3P6B A;  4TXW A;  4AFM A;  2ES3 A;  1GOF A;  1LEM A;  1GP5 A;  3ZO0 B;  2WR9 A;  2WSU A;  3AP6 A;  1H8T B;  1UZW A;  2HWE 1;  2R0F A;  3MLL A;  4XF4 A;  4ZHN A;  1LTE A;  1UKR A;  3DPR A;  4YM1 A;  1HV1 A;  3M2M A;  2VZO A;  2BJS A;  2BZD A;  1LHW A;  5L9B A;  5I0D A;  2XJU A;  1GIC A;  1OLM E;  1U5Z A;  2OA2 A;  3NW4 A;  1GOG A;  3Q8A A;  1U0A A;  1XSR A;  2F6B A;  2VPV A;  4LOR A;  1OH4 A;  2PLV 1;  4JDM A;  3SEE A;  5EIY B;  2A6X A;  3WHT A;  1DZT A;  2IFR A;  2P2K A;  3KGL A;  2X8K A;  4OUE A;  2ET7 A;  4NHL A;  4DIQ A;  4CDX C;  1W28 A;  2JE7 A;  2XGX A;  3OYW B;  1AX2 A;  4AFD A;  2F17 A;  4IER A;  4D7S A;  1B09 A;  5FMO S;  3RWK X;  2DUQ A;  1SCS A;  3HT2 A;  2VZ3 A;  4P08 A;  5JOX A;  3AMH A;  4FVV A;  1DYK A;  2V5Y A;  3W20 A;  4PJY A;  4YM3 A;  4IE7 A;  5FDB A;  4K7J A;  1YI9 A;  4M0N A;  2J22 A;  1GUI A;  4N90 A;  3AKS A;  3U0Z A;  1RTV A;  2ZHN A;  1U5X A;  4GWM A;  5FPU A;  3M3E A;  4LBO A;  5DDJ 2;  1AR9 1;  2FDG A;  2YXS A;  3GCW A;  4M00 A;  1HRV 3;  2ZBJ A;  3OBA A;  1YJK A;  3MUY 1;  2CDO A;  3ZDS A;  2HWB 2;  1I6X A;  4GJZ A;  1H2L A;  4AVC A;  1RIT A;  3AX4 A;  2C0Z A;  1MZ6 A;  1E5S A;  2VO5 A;  2W1Q A;  3VBF C;  4AI3 A;  2W87 A;  4LA3 A;  3R4S A;  2ZAA A;  3A22 A;  5L73 A;  1XNA A;  2IVJ A;  3NNM A;  1YI7 A;  1X8E A;  1F8V A;  5I91 A;  2ID4 A;  2O8O A;  1R08 3;  5T50 A;  1QJF A;  2W5F A;  1MEC 1;  1OQ1 A;  1QOO A;  1V9U 3;  1VBA 1;  2VAU A;  4JDO A;  3CF6 E;  3L2H A;  3MO4 A;  4IGP A;  5CKN A;  1ULC A;  5ISL A;  4QPI B;  1RUF 2;  2CHH A;  3GJA A;  5LBB A;  4LPL A;  4M3C F;  4BXS V;  1DGW X;  5B2G B;  5F3I A;  3PU8 A;  1NAE A;  1VLN A;  2ZGK A;  3ZN4 A;  4UFK A;  5SV5 A;  3OPW A;  5K8S A;  1Z7S 3;  2KR2 A;  3J9S A;  3RRD A;  4IE6 A;  2GC3 A;  4UW4 A;  2OUJ A;  1K12 A;  4AE2 A;  2WWU A;  4N7U A;  3S7I A;  2NQY A;  1WLC A;  2WKK A;  4XAC A;  2VW0 A;  3OUI A;  5EJ3 A;  4CCL A;  3KMH A;  4CP0 A;  5IVY A;  4I01 A;  1QJU 1;  1YXW A;  3ALQ A;  3LA2 A;  4WM7 A;  3BVC A;  1W6M B;  3NMB A;  4QGN A;  5FY1 A;  4AFA A;  2PQS A;  3K77 A;  1BEV 2;  1W6P A;  3BOP A;  2KD7 A;  1NQD A;  1K5M B;  1YIF A;  1O4Z A;  2ZXQ A;  1DGW A;  4ATF A;  4AHY A;  2D98 A;  3AP9 A;  5IJR A;  5LEJ A;  1CD3 G;  3OGS A;  3VDA A;  3JU9 A;  2RE9 A;  3I2J A;  4IET A;  4GB3 2;  1ZBA 3;  3WCS A;  2KM2 A;  3SEP A;  5AC9 3;  3IAP A;  5BNP B;  1B35 A;  2XJR A;  1MS9 A;  3WQ0 A;  1WCU A;  4HSL A;  4JGY A;  2D6K A;  1W8O A;  1X36 A;  5KXD A;  3MZH A;  4I0B A;  4EWA A;  3ZN6 A;  2FD8 A;  1W6N B;  1ZVF A;  3E97 A;  1CX4 A;  5FQ0 A;  1W6Q B;  4CDQ B;  1PX3 A;  3CMG A;  1YQ8 A;  4N9H A;  3ZYR A;  2CWM A;  4HN0 A;  3FBY A;  3AJZ A;  1AR7 3;  3M3O A;  3WT3 A;  2Y60 A;  1XNK A;  4ZXK A;  3U78 A;  4YW4 A;  2YUE A;  4Z07 A;  3ZYJ B;  4FPC A;  3AB0 A;  1HJG A;  1FV2 A;  2BUK A;  4CDU A;  3VKN A;  5DAP A;  4IV1 A;  2WZE A;  2UY8 A;  3WDY A;  2VL4 A;  4XFH A;  3MFC A;  1YEW A;  1PGS A;  1XYP A;  4QKF A;  1JYT A;  5IK7 A;  3NWK A;  2WFF 1;  5FZ6 A;  1W8W A;  4KH9 A;  3BOD A;  4OCT A;  4NIG A;  2VQT A;  2W95 A;  3KB5 A;  4IQP A;  3ZMO A;  2GP3 A;  3FLR A;  4PCR A;  4DUX A;  5JXH A;  1QF3 A;  5EFU A;  5L7O B;  2VJX A;  3RWN A;  4DPN A;  5CFC C;  5LRS A;  5ACA 2;  4XF1 A;  2BNO A;  4AVA A;  5C3Q A;  3VBS B;  3I2I A;  3KS7 A;  1IPS A;  1DGR A;  2UU8 A;  4AFB A;  1W8T A;  1D4M 3;  2RS5 3;  4OHV A;  4C8D A;  2GAU A;  3G6J B;  2A6Y A;  2X5I A;  3H50 A;  2QJV A;  3LB9 A;  4HET A;  3WNK A;  3BPZ A;  4LKS A;  4A3X A;  1EP0 A;  3V0B B;  2BGO A;  1PM7 A;  1RUC 2;  1N1Y A;  5FUI A;  3C3V A;  4IEO A;  4JRL A;  1HRI 1;  1PGW 2;  1AVB A;  1Q8O A;  2BNM A;  2VOK A;  3GBG A;  3ZYI B;  2VOV A;  4Y33 A;  1RUD 2;  2B8M A;  4ASK A;  2BBV A;  3WUC A;  2C1F A;  2VUC A;  3BOW A;  4CCC A;  4NN0 A;  1LES A;  1GZT A;  2GMP A;  4Z2A A;  1C28 A;  1IQA A;  3LEM A;  4KWU A;  4QPY A;  1QOT A;  2XBO 3;  1JZ3 A;  1JH5 A;  4XBL A;  1NG0 A;  3C7G A;  3H0O A;  2OT7 A;  2TEP A;  4Y1U A;  1AR8 3;  5BNQ A;  2Q4S A;  2WA3 A;  1DLC A;  4KU7 A;  4KWJ A;  4COW A;  4FP2 A;  3FC0 A;  1QJX 2;  2Z5W A;  4LBN A;  5FYS A;  3LDR A;  4LE3 A;  1H4G A;  4J1X A;  1AR6 1;  4FPF A;  1NA1 B;  1SZB A;  1FX5 A;  4GMP 0;  4EYU A;  5FRA A;  1YQ6 A;  4LO4 B;  4X6R B;  3A4U A;  5JVV A;  3FHQ A;  2K2S A;  4UW6 A;  3OUH A;  1SCR A;  3KQR A;  3ZMN A;  2WQ4 A;  4AHW A;  1ZRR A;  2X53 S;  4HSJ A;  1PHM A;  4AHZ A;  3AZW A;  4E9K A;  4RQP A;  4Y24 A;  4JX0 A;  1XU2 A;  5T5J A;  5JR2 A;  1FOD 2;  1X8M A;  3KF5 A;  4OYU A;  3LEI A;  3OBZ A;  2ZMN A;  2JDH A;  3GDB A;  4AFC A;  4YGB A;  3HN1 A;  1VBC 3;  3ME2 A;  5A7N A;  2ZGU A;  1RUJ 3;  3GM8 A;  4MXW A;  3SQO A;  5GLZ A;  5D1I A;  5DN2 A;  5JOW A;  4RFR B;  2JEN A;  1Y43 B;  5HCA A;  4LBM A;  1GNZ A;  2HWC 1;  4X6Q B;  5G04 L;  4D94 A;  1JYW A;  5KC6 A;  4Y3O A;  2RDQ A;  1LHO A;  3MLJ A;  4Y26 A;  3ACI A;  2SBA A;  1FYU A;  3ZFF B;  1POQ A;  3TEX A;  1X50 A;  1GZ9 A;  1PMJ X;  3ECQ A;  3MIC A;  1W99 A;  3S30 A;  4DQA A;  2SLI A;  3POJ A;  4RHV 3;  3LSD A;  4L9B A;  5EYY A;  3RYP A;  2E7A A;  3WD5 A;  4Y20 B;  4LO8 A;  1Z0H A;  3ZXK A;  2HWE 3;  4URA A;  4OHY A;  1W9T A;  1RIN A;  3OEB A;  2XLF A;  1BBT 2;  2XQX A;  1STM A;  1OVS A;  1NCR C;  2ZEW A;  2R07 1;  1JZ2 A;  1H1I A;  5JIA A;  3O1V A;  5FZ1 A;  1H2N A;  3SCH A;  3W5N A;  1UKG A;  3AXD A;  4PF5 A;  3HN3 A;  2WNE A;  4RD7 A;  1IS4 A;  2WJS A;  3VD7 A;  3BGA A;  2PLV 3;  2DVD A;  3WIN E;  2X05 A;  1HQL A;  1H6Y A;  5JOY A;  3I8T A;  3MDP A;  3UKV A;  3QLQ A;  4KBZ A;  5F6L B;  4A6O A;  5A7W A;  2GAL A;  3CJX A;  3JCI A;  5FMO L;  3UGH A;  4F83 A;  4LK7 A;  4QDS A;  3IZO A;  5F39 A;  3POY A;  3APB A;  4GMP 1;  5FCC A;  4YW3 A;  5LB6 A;  1CAV A;  4L0P A;  5A80 A;  1F4A A;  4OZX A;  4ZY9 A;  1R64 A;  1ALY A;  3RMY A;  5D8A B;  2TUN A;  1AYN 3;  4QU1 A;  1AL0 G;  2WT0 A;  2WUH A;  4QHO A;  1CAX B;  4CSW A;  1OPO A;  1LHU A;  5CKQ A;  4CU9 A;  3C8X A;  2NP0 A;  3D82 A;  5E8A A;  4Q4X 1;  1RHI 2;  1LOD A;  3DKQ A;  1AX1 A;  1COV 1;  4ZPI A;  2XH6 A;  4N43 C;  2XVL A;  1IPK A;  1NCQ C;  2WZR 2;  1AR9 3;  3D0S A;  3VKF C;  2DCZ A;  4XFG A;  2L9L A;  2WAA A;  4MHR A;  1UIK A;  4PDW B;  1ULF A;  1NKG A;  3I49 A;  3C7E A;  1HB3 A;  4LIU A;  1MVE A;  1Q56 A;  1Y9Q A;  3MIE A;  3PTY A;  1Y9G A;  2QQW A;  1N3P A;  5FBZ A;  2ZHM A;  1ND2 C;  1VRH 1;  3M4F A;  1SLI A;  1ASJ 2;  3OGJ A;  3W5M A;  3ZOI A;  1VJ2 A;  1E57 A;  4ONU A;  5IT6 A;  2CGP A;  1O5U A;  4ZON A;  1MEC 3;  3JQW A;  3R4U A;  3P5B A;  1VBA 3;  1IKQ A;  2EF6 A;  2RR1 3;  3VL8 A;  3X29 B;  3CJI C;  4GH4 A;  5FY9 A;  1SBD A;  3M8L A;  1R09 2;  3JD7 1;  3HQU A;  4HN1 A;  1IOA A;  3D4K A;  4QMA A;  3KWV A;  4E4D X;  4XBN A;  4E4H A;  1PIV 2;  5JI7 A;  5F7U A;  4LLF A;  3AMP A;  1KDM A;  1UD1 A;  1H8T C;  1N1V A;  5EYX A;  1SLA A;  1W6O B;  4BIS A;  3WF1 A;  5IK8 A;  1MQT B;  2RS1 2;  3UKT A;  5FZF A;  1VB2 A;  4XJW A;  4BOW A;  4ARX A;  4AVV A;  4CUC A;  4AVT A;  1L7R A;  2VCA A;  4CCO A;  1DP0 A;  4HKW A;  4EN6 B;  5BY5 A;  4XIL A;  5FZD A;  2I45 A;  1UY3 A;  1UY0 A;  4QQP A;  1HQW A;  4B29 A;  4HBN A;  2F4P A;  3SH5 A;  1QJY 1;  5JI9 A;  5TSW A;  1N47 A;  3IDC B;  3SLI A;  1YCI A;  1M06 G;  4E27 A;  4AAP A;  1ZBE 3;  3AP7 A;  4QDQ A;  1S0E A;  4KGQ A;  3ZLI A;  4DS0 A;  4BQW A;  3WV6 A;  2XXZ A;  1PO2 2;  3H1M A;  2FDK A;  2VQ0 A;  3IDA A;  4IV3 B;  4YW7 A;  3AVR A;  1TEI A;  2XUE A;  1QNY A;  4PQ9 A;  5GZG A;  2JXA A;  1JOP A;  2R06 2;  3IMM A;  5F32 A;  1Q8V A;  2YC2 A;  3PME A;  1Q5O A;  4PI2 A;  1AYM 1;  3H8R A;  1KFX L;  3KHC A;  1LGB A;  1FMD 1;  1VRB A;  2CY6 A;  2OVU A;  5IVC A;  2R0H A;  3UJO A;  1G9A A;  2H6B A;  4QKD A;  1IPJ A;  5CFD B;  1F35 A;  2ZZJ A;  1RXG A;  4HT1 T;  4IE5 A;  1W06 A;  2NM1 A;  3I97 A;  3N4M A;  2KXL A;  3DKW A;  4O9G A;  2DF7 A;  5HXV A;  4ASL A;  1SHW B;  4RR3 B;  3ROU A;  5CKM A;  4B3N A;  4CDW A;  1JOJ A;  4Q0P A;  1EUU A;  4LK6 A;  3IAQ A;  1ULE A;  4YAR A;  1OD3 A;  2NZ9 A;  4KWK A;  5DXD A;  5CAD A;  3H8O A;  1C4R A;  1C8M 2;  4XVH A;  4MO3 M;  1WBF A;  1O3Q A;  2DUP A;  5A7S A;  2VCC A;  4DRR A;  5FYH A;  5H9P A;  2R04 2;  5LY2 A;  4EN0 A;  2J1S A;  2WFF 3;  2GNM A;  2MHF A;  3CU7 A;  3J8F 1;  1UX7 A;  4K20 A;  3T1M A;  2LRP A;  2WZP P;  3VZN A;  5DUU A;  4A4A A;  5ABJ A;  3ZM8 A;  1G9F A;  1Q3E A;  2DFC A;  1VBE 1;  1SLL A;  3WNM A;  2P3Y A;  4QPI C;  4R4X A;  1KD7 A;  2ORX A;  4QQL A;  5HI0 A;  2OXB A;  1UZY A;  1DQ6 A;  2PHW A;  3ZXA C;  3POB A;  1W90 A;  1W2U A;  4FTB A;  4B7E A;  2EAK A;  2D5F A;  3S0M A;  1VPH A;  1BZW A;  3K4A A;  1RUE 1;  4BLJ A;  2P3K A;  3WNP A;  4BQ5 A;  1JZ8 A;  1JHN A;  4Z92 B;  1PK6 A;  3HPN A;  2GC1 A;  3FX3 A;  4CXW A;  4I09 A;  5IFT A;  1ZRI A;  1UU6 A;  3PMS A;  1O91 A;  4HK8 A;  2WNO A;  4CUB A;  5JZG A;  2G9G A;  1YWK A;  4KNC A;  4LO7 A;  4H7L A;  2BRT A;  3HNM A;  4YGE A;  3HBK A;  1JW6 A;  3BU7 A;  4K6B A;  2BTV C;  1G9C A;  1QJE A;  4QQ2 A;  1UMH A;  2VW2 A;  2C4X A;  3KCX A;  3MV0 1;  1WME A;  3SMH A;  1KJL A;  1O8P A;  1WWY A;  5FPV A;  4IXL A;  5FPA A;  5JXJ A;  1FAY A;  5GKA C;  5BNP C;  4QX2 A;  5IVV A;  1AR6 3;  4QB1 A;  4DUV A;  4OQ8 A;  1ZNP A;  4IEY A;  5D21 A;  1AHS A;  5H9R A;  1LOF C;  4P02 B;  4JHZ A;  2QQI A;  2ZAB A;  2J1V A;  2VMD A;  3NRU A;  3AJY A;  4QPG A;  4P9I A;  4CDQ C;  3CO2 A;  4YRD A;  1UY2 A;  1DCS A;  2QBX A;  3QOP A;  1OFN A;  3ETP A;  2FDH A;  1PO1 2;  2VTX J;  4QX7 A;  3TBD A;  3WZ1 A;  3WW4 A;  1V6I A;  2BNN A;  2QQO A;  3ILR A;  5CB7 A;  1OC1 A;  2DCJ A;  1JZ7 A;  3DYO A;  1UX6 A;  3L9J T;  3H8X A;  2DVA A;  3T3Y A;  2LRO A;  4YGD A;  1VAL A;  3NV2 A;  1RUG 2;  5FYB A;  3ZYG A;  3KVA A;  1JZ6 A;  4OUL A;  4OI2 A;  4HOO A;  3ORJ A;  4WVW A;  2P37 A;  4JGZ B;  2HWC 3;  4RL7 A;  1ZA7 A;  1LJ7 A;  3E6D A;  1Z7S 1;  4D7Y A;  5FYM A;  3FMG A;  5A1L A;  1UZ0 A;  1Y9M A;  1HRV 2;  4UW3 A;  2VC9 A;  1VR3 A;  3CDZ B;  5L7O C;  3GF6 A;  4YVW B;  1GMM A;  1XE8 A;  4RGA A;  3VBS C;  4N53 B;  3EO6 A;  2NYY A;  1AJK A;  1R1A 1;  2WL1 A;  1OUR A;  1KQR A;  4W8J A;  2A71 A;  2ZGQ A;  2AYH A;  1FT9 A;  5HCF A;  2WN3 A;  4FPG A;  3RI8 A;  5A3N A;  4FPY A;  3I3E A;  1W8Z A;  1YJL A;  1R08 2;  2DTY A;  5DAV A;  4DIN B;  4NAM A;  3DV8 A;  5FZ7 A;  3POS A;  2W3J A;  1V9U 2;  2R07 3;  5HBA A;  4WV8 A;  4AL9 A;  4ZZ8 A;  1M4W A;  4ES9 A;  5FO8 B;  5K0U B;  3T4H B;  1EPZ A;  3MI8 A;  1UPS A;  1UZV A;  2NN8 A;  4QDR A;  4JVA A;  1FV3 A;  4Y5Z 0;  5BNN B;  3FJS A;  5HV0 A;  3I2F A;  1WA6 X;  2G4I A;  2W52 A;  5BXX A;  5JSR A;  3W9A A;  4GMP 3;  5LBE A;  2VEC A;  2J1A A;  4CEW B;  2B45 X;  5EJZ B;  5T52 A;  2WBK A;  4IL7 A;  4JKM A;  2H0B A;  2VZT A;  1AR7 1;  3B9I A;  4Q4V 3;  4AED A;  2C6S A;  4ZU5 A;  1GQP A;  1UZZ A;  3KLS A;  3P3P A;  2BVB A;  5DQ0 A;  3O1R A;  2WO2 A;  1NA1 C;  1TNF A;  5IW0 A;  4EZ4 A;  1ZM1 A;  2XWB B;  2W39 A;  3TEW A;  5C8C A;  4QB6 A;  5EV7 A;  3VBR B;  3DEC A;  1XBF A;  1COV 3;  3HQX A;  2VE1 A;  3LIH A;  3RGB A;  4RS5 A;  4UYB A;  5C33 A;  4S2H A;  3K48 A;  3LPG A;  4D8M A;  5BPX A;  5DAB A;  3SH3 A;  3AZX A;  4FFG A;  4X8N A;  3AYC A;  3LEG A;  3O1P A;  1TMF 3;  1ZBA 2;  3NKG A;  3ZSK A;  5AC9 2;  1HQN A;  1QXR A;  3H9A A;  3WR0 A;  3J7L A;  5FYU A;  4R9A A;  3K3N A;  3VZM A;  5C4W A;  1VRH 3;  2RS5 1;  3CNA A;  1UU4 A;  3Q8B A;  1GBG A;  2EAA A;  1YQ2 A;  2AH2 A;  3OUJ A;  1QH7 A;  5CG9 A;  5EQU A;  1AXK A;  2QCS B;  2ARX A;  4I3P A;  1HDK A;  2A3W A;  4MET A;  3S5A A;  3ZFF C;  2X29 A;  2EA7 A;  2ZGL A;  4L99 A;  3LFM A;  3I7D A;  3ITQ A;  1AZD A;  2WT2 A;  1QY4 A;  1S1A A;  1JTZ X;  5FWE A;  1WW4 A;  4CEY B;  4EN7 B;  2BDR A;  5FLJ A;  3ACL A;  2VOW A;  1IHM A;  2JX9 A;  2JIC A;  4Q0V A;  5FZL A;  2D6M A;  2P5B A;  2CAU A;  3HR9 A;  2XBO 1;  1AUY A;  1WMD A;  2RMU 2;  4TZD A;  4ZXE A;  3D8C A;  3DXT A;  4QX8 A;  2ZS6 B;  3BTY A;  2AEN A;  1DYO A;  1RUH 2;  2WYF A;  2ENR A;  2PYT A;  4QXB A;  3O5S A;  1WLW A;  1UXX X;  2YZ4 A;  5FOJ B;  4V2W A;  3VKL A;  2O0O A;  2X10 A;  1D4M 2;  4OI1 A;  5FXW A;  4QGM A;  1QJY 3;  1BVV A;  1S0F A;  2QDN A;  2QQK A;  2D3R A;  4NRO A;  4UF0 B;  5C9A B;  1U12 A;  2ZGO A;  2DTW A;  4MX3 A;  4PIY A;  1W04 A;  1W0P A;  2WLP A;  5APA A;  5IUQ A;  2DBI A;  1EPW A;  4C1X A;  3OEA A;  4TN7 A;  1ODN A;  2OW4 A;  1RMU 1;  2Q8O A;  1WW7 A;  1S0I A;  3PVN A;  4PIZ A;  5D8A C;  5FAX A;  5KHG A;  1DHK B;  1OBN A;  3JBG 1;  5J36 A;  3SC7 X;  1FMD 3;  3I2D A;  4E2G A;  1VBC 1;  1ENS A;  1ZZ9 A;  3W59 A;  4COZ A;  5IAV A;  1RUJ 1;  2DUR A;  3OTF A;  2R7E B;  4K1Z A;  3LA7 A;  4LT5 A;  3QH6 A;  2N7G A;  2DWR A;  3RI9 A;  3T1L A;  1AR8 2;  4ATE A;  1GR3 A;  2ZA9 A;  1ZZ8 A;  4PDW C;  3N7K A;  4RA0 A;  1Q43 A;  4IEP A;  3ZVX A;  3WQ7 A;  1QMJ A;  3IPV B;  2RS3 3;  3POE A;  3O1M A;  2VZR A;  1HXS 2;  1J58 A;  2WNU A;  4FPO B;  4YWA A;  5A3W A;  3K46 A;  3RPQ A;  3S5Q A;  3TEY A;  2VMF A;  2YB7 A;  4PQQ A;  3A21 A;  4LQR A;  3V65 A;  2A73 B;  2RDS A;  1OD5 A;  2VZU A;  5ANQ A;  3ZDV A;  3AFG A;  4YZ2 A;  4Y4R A;  4B1M A;  1D2S A;  1X9P A;  4Q4Y 1;  3RS6 A;  2HWD 2;  2RDR A;  3J8F 3;  4GUL A;  4Y1V A;  2E32 A;  1GFF 2;  2XR4 A;  4OMC A;  4W6X A;  3WG4 A;  4WM7 C;  2Q0A A;  1VBE 3;  2E7Q A;  4LJH A;  3NAP B;  1V6O A;  3LDK A;  4TWT A;  5CVR A;  1GZC A;  4N9I A;  2DCT A;  3HVD A;  1LGN A;  3WW3 A;  4XBQ A;  4Y22 A;  3THP A;  5C3S A;  4QXH A;  5A70 A;  4CCK A;  3PIJ A;  3AVS A;  3PJY A;  1MQT C;  2ZTN A;  4QQO A;  3NJY A;  2QQN A;  4CUG A;  1CGP A;  2G9Z A;  1RUE 3;  3B9C A;  3U75 A;  3H7Y A;  1J84 A;  4MGY E;  4Q5O A;  1UO9 A;  2ZGP A;  4JTN A;  4SBV A;  4YVS A;  4G4F A;  3C7O A;  4MGQ A;  5LA9 A;  3POI A;  1S0C A;  3T0B A;  5EHD A;  3TN9 1;  3RG0 A;  1AYN 1;  1ULG A;  2GZW A;  3MIG A;  4XF9 A;  4RHV 2;  2HWF 2;  3VKM A;  3VDD B;  1VBB 1;  3C7H A;  1W05 A;  4H14 A;  1J3Q A;  5FYV A;  2HWE 2;  4XFA A;  3VN4 A;  2EIG A;  1A8M A;  1W8F A;  2V4V A;  3A0N A;  4XAE A;  4YSF A;  1VMF A;  4FP3 A;  3MFA A;  2IXH A;  2ZEZ A;  5IYY A;  4IV3 C;  1GLH A;  4BDV B;  3KZ4 C;  2VUD A;  1ZYB A;  1NZC A;  4KBB A;  4BJ0 A;  2WA4 A;  2IXC A;  2JDU A;  4YW6 A;  5CA6 A;  3J7M A;  1J59 A;  5IVB A;  2J7M A;  3ZSL A;  3QD6 A;  4RSU A;  2PLV 2;  1D4V B;  3ZXE A;  4LBQ D;  4JRA A;  4AQS A;  3B7M A;  1UY4 A;  5CFD C;  4DXZ A;  1C3H A;  3HJR A;  4YNI A;  5A7P A;  5FP8 A;  2PA7 A;  1ND3 A;  3EQE A;  3J7H A;  4QX5 A;  4XZU G;  2OQ6 A;  5LAS A;  3I3Q A;  1RUI 3;  1VB4 A;  5SV8 A;  3VBO A;  5LA1 A;  2ZCW A;  2FDF A;  4L97 A;  2WWJ A;  3KGZ A;  3N7L A;  4RR3 C;  2RR1 1;  3CZJ A;  3LSE A;  4XUN A;  3ZFE B;  5IVE A;  1JOB A;  5GAL A;  4AF9 A;  2LTN A;  2C5D A;  1XNC A;  3VBU A;  1HB2 A;  2XLG A;  4TLF A;  4YW1 A;  1S4C A;  1ODM A;  1E5R A;  3A0K A;  4B4P A;  3VD3 A;  1J1L A;  2WNV A;  3OSD A;  5LA2 A;  2Y6J A;  1AR9 2;  3DYP A;  1LOG A;  4I3G A;  3AKP A;  4GA9 A;  3H3Z A;  3K3O A;  4BYY A;  3I3M A;  3AL6 A;  3J7N A;  2CSG A;  4QXK A;  1BMV 1;  1BQP A;  4I02 A;  1R1A 3;  4QB2 A;  3PIG A;  3VBH B;  1UYY A;  1XPW A;  1T6G C;  3RDI A;  1SBE A;  3ZPY A;  2JIG A;  3LZZ A;  4BXF A;  5EP9 A;  2YBK A;  2YGM A;  1ACC A;  5CNA A;  1OLR A;  1OI6 A;  1SDW A;  1WMF A;  2H6C A;  2VZP A;  2VR4 A;  3LOI A;  2WC2 A;  3SCG A;  3E5U A;  4PI0 A;  1ZBE 1;  3VLB B;  1MEC 2;  3B01 A;  1VBA 2;  4XCB A;  1LEN A;  1MZF A;  3V56 A;  4AAX A;  2QQU A;  3AYE A;  2I74 A;  3NV1 A;  4XQW A;  5FP4 A;  4XXA A;  1WD4 A;  4BM8 A;  5JOZ A;  5IAX A;  2E31 A;  2JWP A;  4XW3 A;  2E26 A;  2JIJ A;  1DFQ A;  1WCS A;  4FT8 A;  2DCY A;  3T09 A;  4FXG B;  4D3W A;  4FTE A;  4XUQ A;  1FPN 1;  3OY8 B;  2WSV A;  1LU1 A;  4UAP A;  4RQP C;  1IZ3 A;  2AEY A;  2WII B;  2BW8 A;  5HV4 A;  1VE0 A;  1QQP 3;  3AC0 A;  1CN1 A;  4M3C A;  4CRQ A;  5JWP A;  3FZ3 A;  5FUP A;  2IXL A;  2IVI B;  1DZQ A;  5LRR A;  3RYR A;  5DAX A;  3C2U A;  3ZYB A;  1OOP B;  1J3R A;  1F2N A;  2JG8 B;  4IE0 A;  3AMN A;  1OKQ A;  2JG9 B;  3MW4 A;  4K1Y A;  4RN5 A;  3ZXJ A;  5CAZ A;  1IS5 A;  1W9Y A;  1LRH A;  2FBE A;  4L11 A;  1V70 A;  1QJU 2;  1W6O A;  2ZAC A;  1XNB A;  3E6B A;  3H3U A;  3EYP A;  5KXC A;  4JCK A;  4CDX A;  5A32 A;  3VHR A;  1LHN A;  3LGR A;  2E9Q A;  3BTZ A;  1GP6 A;  3OD0 A;  4XUO A;  4ZS2 A;  2E53 A;  1SPP B;  1QXJ A;  2DDU A;  2WLQ A;  3AYA A;  3Q9O A;  1GWL A;  1XXN A;  2VUL A;  5J1X A;  4Q0S A;  5J7M A;  1ENQ A;  1CZV A;  1GZW A;  2W47 A;  4LKE A;  4MOA A;  1YIP A;  4AXO A;  4DY3 A;  4CTE A;  1W39 A;  3GZA A;  2ARA A;  1BK0 A;  5FZ4 A;  3WF0 A;  4BH9 A;  4JGZ C;  1P8J A;  4JC1 A;  5BNO C;  1LOC A;  2B5H A;  2QDR A;  4NJ4 A;  4COY A;  3U10 A;  1YNA A;  2A70 A;  1XND A;  2W9X A;  4YVW C;  3AKT A;  1UOJ A;  2EXH A;  3WW1 A;  3VBF A;  4N53 C;  5FUN A;  3DYM A;  3RNS A;  1XB9 A;  2NLR A;  4XZP A;  4MSV A;  4D6R A;  1GWM A;  4AI1 A;  1UNB A;  4XET A;  2VUJ A;  1SDD B;  1AXY A;  3ASI A;  3LCP A;  3OGR A;  3O1O A;  2ZX3 A;  3BI3 A;  3DEM A;  2WFF 2;  3ELN A;  5IWF A;  2UWA A;  3T0D A;  1YFX A;  4KU8 A;  4AYU A;  4CP9 B;  5F37 A;  4BME A;  1G8W A;  1Q8S A;  4XJU A;  5K0U C;  5KHJ A;  4NE9 A;  4V2V A;  4WVM A;  4D6Q A;  4UWD A;  2VH9 A;  3HAG A;  1UPI A;  1ZRD A;  2ZEX A;  5BNN C;  1R1Z A;  1Y3T A;  1CWP A;  4HPK B;  1UYX A;  4XOG A;  5C5T A;  1VBD 1;  5A33 A;  4W6Y A;  1HRI 2;  1JU4 A;  1OQD A;  4QX3 A;  3LA3 A;  3JB8 A;  4CEW C;  1S0D A;  2A3X A;  1GNH A;  1RMU 3;  1JUH A;  1DF0 A;  2IWG B;  1YC6 1;  1LNS A;  3JBG 3; 
#chains in the Genus database with same CATH homology
 4M4P A;  2QQJ A;  3I97 A;  1CZT A;  2EIE A;  2YG0 A;  4FI9 A;  1SHW B;  5C70 A;  2WAO A;  1JZ4 A;  1EUU A;  3IAQ A;  1OD3 A;  2Y6H A;  1W0N A;  4IUG A;  4XVH A;  4MO3 M;  4YPJ A;  2VCC A;  2X09 A;  3SKJ E;  1WCQ A;  1SG3 A;  2J1S A;  1UX7 A;  3I2K A;  4P5Y A;  3SKV A;  4A4A A;  3ZM8 A;  3VDC A;  3WNL A;  5IFP A;  3WNM A;  3I2H A;  1JYV A;  3UET A;  2V5D A;  2ORX A;  4UI9 L;  3T2O A;  2YFU A;  2HLE A;  1O8S A;  4CU6 A;  3K4A A;  2VZ1 A;  3WNP A;  1JZ8 A;  3HPN A;  4JKL A;  2LS6 A;  5IFT A;  1TVG A;  4CUB A;  3NNG A;  3HNM A;  2CDP A;  2EID A;  4QX1 A;  4XUT A;  3LQC A;  2Z4F A;  4GWJ A;  1UMH A;  2C4X A;  3MV0 1;  2QQL A;  2WDB A;  1O8P A;  3T2P A;  4E8C A;  2J1R A;  2HYX A;  1JHJ A;  5JXJ A;  1BHG A;  4A3Z A;  1GU3 A;  3WF2 A;  4QX2 A;  2VCB A;  4QB1 A;  4DUV A;  2JD9 A;  1JYX A;  4P02 B;  2QQM A;  1WKY A;  4JHZ A;  3THC A;  2QQI A;  2J1V A;  2VMD A;  1PMH X;  3NRU A;  1L7Q A;  1W8N A;  3T2Q A;  3HNY M;  1KGY A;  3CKH A;  4ARY A;  1UY2 A;  2QBX A;  4UOJ A;  5DMY A;  3ETP A;  3WEZ A;  2W1U A;  4DEQ A;  2QQO A;  2W92 A;  2VZV A;  2DCJ A;  1JZ7 A;  3DYO A;  3K75 B;  4TTG A;  4DXT A;  1JZ6 A;  3VDB A;  2J1U A;  3OB8 A;  4JKK A;  1K3I A;  1UYZ A;  5B4X A;  1T2X A;  3VD9 A;  1UZ0 A;  3HOB A;  5LCW L;  1JU3 A;  2VC9 A;  3CDZ B;  3P6B A;  4TXW A;  2XHN A;  3WNN A;  1GOF A;  3PUH A;  1GMM A;  1UXZ A;  5JUV A;  1CIY A;  4W8J A;  2VZO A;  2BZD A;  4DEV A;  2VZQ A;  2WN3 A;  3E1F 1;  5I0D A;  4BK5 A;  4QPW A;  3I3E A;  1GOG A;  2VZS A;  2W3J A;  1OH4 A;  3SEE A;  5EIY B;  4ZZ8 A;  2XON A;  4OUE A;  1K42 A;  4P00 B;  2JDA A;  1IQD C;  2WN2 A;  4CU8 A;  5LA0 A;  4QDR A;  2V72 A;  1US2 A;  1OT5 A;  2WQ8 A;  1NX9 A;  3I2F A;  2OKX A;  2VZ3 A;  4P08 A;  2J1A A;  5EJZ B;  3VD5 A;  2WBK A;  4JKM A;  2VZT A;  3ACH A;  4XUR A;  3THD A;  2J1E A;  1GQP A;  2BER A;  1GUI A;  2J22 A;  5DQ0 A;  2WO2 A;  1J83 A;  3WF3 A;  4QB6 A;  3LE0 A;  3DEC A;  3ACF A;  3OBA A;  3MUY 1;  2CDO A;  3OGV A;  4W50 A;  4DXS A;  3LPG A;  4D8M A;  2VO5 A;  2W1Q A;  3U37 A;  2W87 A;  1MPX A;  4PT6 A;  3A22 A;  3LEG A;  1XNA A;  2C26 A;  2ID4 A;  2W5F A;  2Y64 A;  1K45 A;  1OF3 A;  1YQ2 A;  1W9W A;  1UWW A;  3MO4 A;  1GOH A;  3IB3 A;  3ACG A;  2WAB A;  4LPL A;  1CZS A;  2W46 A;  2ORZ A;  3A23 A;  4BXS V;  3CQO A;  5JMO A;  1NAE A;  4OMD A;  4D0Q A;  4GZ9 A;  1K12 A;  5HPO A;  4CVU A;  4ZXE A;  3I2G A;  4DXR A;  2WZ8 A;  1DYO A;  2VOT A;  2W1S A;  1UXX X;  2PQS A;  3K77 A;  2X10 A;  2KD7 A;  2JKX A;  2ZXQ A;  4KI5 M;  3T0A A;  3VD4 A;  5IJR A;  2QQK A;  5A1A A;  3OGS A;  3VDA A;  1OF4 A;  1US3 A;  3I2J A;  3I3D A;  3NQH A;  3SEP A;  2DCK A;  3IAP A;  3OEA A;  3F2Z A;  1W8O A;  5B4N A;  1PX3 A;  3CMG A;  4MAD A;  2R7E B;  2Y6K A;  3FL7 A;  4GWI A;  3NJV A;  2WO1 A;  4DUW A;  2WZE A;  2J1T A;  4OZO A;  2VL4 A;  2VZR A;  2WO3 A;  2XOM A;  3K46 A;  2BBA A;  2VMF A;  2YB7 A;  4PQQ A;  3A21 A;  4LQR A;  3P1I A;  2VQT A;  2W95 A;  4XUP A;  2VZU A;  5JXH A;  4DUX A;  2VJX A;  3FN9 A;  2JE8 A;  2E32 A;  3I2I A;  4OMC A;  1PX4 A;  1JI6 A;  3WNK A;  5DPN A;  4LKS A;  2BGO A;  5FUI A;  2W1W A;  1UMI A;  3ABZ A;  1JZ5 A;  2VTF A;  4AG4 A;  2QQN A;  1GNY A;  1XC6 A;  1J84 A;  4Z2A A;  3WSO A;  3C7O A;  4MGQ A;  4KWU A;  4BK4 A;  2Y6G A;  3T0B A;  5IHR A;  1JZ3 A;  3C7G A;  3C7H A;  1DLC A;  2C9K A;  3BN6 A;  3III A;  2V4V A;  4A44 A;  2ZEZ A;  3JXS A;  5IYY A;  4ET7 A;  4BDV B;  1F4H A;  4BJ0 A;  4A41 A;  1NUK A;  2J7M A;  3FHQ A;  1EUT A;  1UY1 A;  2Y8K A;  1UY4 A;  3MUZ 1;  4A42 A;  3K4Z A;  3HJR A;  4JX0 A;  5JR2 A;  2YFZ A;  3J7H A;  4XZU G;  4OYU A;  3LEI A;  3CZU A;  3GDB A;  5LA1 A;  1JYN A;  3GM8 A;  3CZJ A;  4XUN A;  1D7P M;  5DN2 A;  4PF1 A;  5G04 L;  1W9S A;  1JYW A;  4E8D A;  3ACI A;  5C7G A;  3VD3 A;  3T08 A;  5LA2 A;  2Y6J A;  3ECQ A;  1PMJ X;  3DYP A;  1W99 A;  4CU7 A;  1TG7 A;  5G05 L;  1W9T A;  3OEB A;  4QB2 A;  1UYY A;  1XPW A;  2XQX A;  3WQB A;  3HNB M;  4LHS A;  4CUA A;  2ZEW A;  1JZ2 A;  2VR4 A;  2VZP A;  3W5N A;  3HN3 A;  4KMQ A;  4QAW A;  3VD7 A;  3PUI A;  3BGA A;  4AAX A;  2X05 A;  1H6Y A;  2E31 A;  4RYD A;  2E26 A;  3OG2 A;  4A6O A;  3T09 A;  4W4Z A;  2RVA A;  4XUQ A;  4QDS A;  4UAP A;  4MGS A;  4L0P A;  1F4A A;  4ZY9 A;  1R64 A;  3AC0 A;  3NJX A;  2WUH A;  2W91 A;  5JXG A;  2W94 A;  4CU9 A;  3C8X A;  4RN5 A;  3I3B A;  3EB7 A;  2VMC A;  1XNT A;  3EYP A;  2E33 A;  5EJ1 B;  2ZEY A;  3UNP A;  2L9L A;  2WAA A;  1NKG A;  2WYS A;  3CIH A;  3C7E A;  4QX0 A;  4M4R A;  3HEI A;  4XUO A;  3C7F A;  2DDU A;  3WNO A;  4HG6 B;  2VQU A;  5J1X A;  4ZZ5 A;  3W5M A;  1CZV A;  2W47 A;  3FHA A;  4MOA A;  1CX1 A;  2B4K A;  3D3A A;  3WF0 A;  3MV1 1;  5CZK A;  1P8J A;  3UES A;  2B9V A;  2EIB A;  2BGP A;  5JXI A;  1HN1 A;  3WF4 A;  2LW8 A;  5F7U A;  2W9X A;  5C71 A;  3DYM A;  3WF1 A;  1H6X A;  3GGL A;  5HXM A;  4A45 A;  2Y6L A;  1ULO A;  1KEX A;  4ARX A;  1SDD B;  3OGR A;  4CUC A;  3K4D A;  1L7R A;  2VCA A;  1DP0 A;  3A7Q A;  1RYY A;  1UY3 A;  1UY0 A;  3T0D A;  2VME A;  2EIC A;  1O59 A;  2RJ2 A;  2YC4 A;  4QDQ A;  3LPF A;  3IDA A;  2ZEX A;  3LEK A;  3MBW A;  2VM9 A;  1UYX A;  1ULP A;  5CYY A;  2YC2 A;  1JU4 A;  4QX3 A;  3GXU A;  1LNS A;  1I5P A;  2RV9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...