1RUJ3

Rhinovirus 14 mutant with ser 1 223 replaced by gly (s1223g)
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
236
structure length
236
Chain Sequence
GLPTTTLPGSGQFLTTDDRQSPSALPNYEPTPRIHIPGKVHNLLEIIQVDTLIPMNNTHTKDEVNSYLIPLNANRQNEQVFGTNLFIGDGVFKTTLLGEIVQYYTHWSGSLRFSLMYTGPALSSAKLILAYTPPGARGPQDRREAMLGTHVVWDIGLQSTIVMTIPWTSGVQFRYTDPDTYTSAGFLSCWYQTSLILPPETTGQVYLLSFISACPDFKLRLMKDTQTISQTVALTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords RHINOVIRUS 14
publication title Structural studies on human rhinovirus 14 drug-resistant compensation mutants.
pubmed doi rcsb
source organism Human rhinovirus 14
total genus 40
structure length 236
sequence length 236
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1995-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1ruj300
1RUJ1 5DDJ1 5ABJB 4WM8A 4YVWC 1VBE2 1R1A1 1RUC3 2WZR2 1C8M3 1FOD3 3CJIC 5JZGA 4Q4W2 2RM22 2BUKA 4FTSA 2HWD3 2R061 5AC91 5C4WB 2GH8A 1HRV1 1HQNA 5BNOC 3VDDA 1R083 1C8M2 3VBFA 2XBO2 1AL23 1QQP3 3JBG1 2R073 1PIV2 1QJY3 1HXS3 3JD73 1ND3B 4RS5B 4QPGB 4JGYC 1VB4A 1ZBA1 1R092 3J8F3 1AL22 1QQP2 3NAPC 3JB4C 1D4M2 3VBRC 4CDXB 1QJY2 3HAGA 3VBSB 1EV13 4NWVA 1B35A 3M8LA 4FTEA 1VRH1 2WLPA 4Q4X1 1VB2A 4CDWC 4RFT0 5GKAC 4N43C 1TME2 4Q4Y1 1PVC3 5C8CA 5D8AC 1A6CA 4CDUA 1VBC3 1VAKA 2HWC3 3VBUC 1QJX2 4WM7C 3CJIA 1PO22 5BNNB 4RR3B 1AR63 1RB8G 1AR72 1RUE1 2GSYA 1FPN2 1NCRB 4Q4V3 5CFCA 1K5MA 2R041 1QJU1 4WM8C 3ZXAC 3TN93 3VBOB 4IV3B 5JZGC 1VBE1 4AEDB 1PGL1 1AR62 2WZR1 5ABJA 4GB32 4Q4W1 4BCUA 4Q4V2 1VRH3 2RM21 1COV3 1BMV2 2WFF3 1RUI3 3TN92 3VDDC 3IDEA 3VBFC 5C4WA 1ASJ2 1C8M1 1MEC3 1V9U2 3ZFEB 2XBO1 1PIV1 2RR12 2RS12 1E57A 4RQPA 1R081 1MEC2 1NCQA 1ND3A 4RS5A 4QPGA 1AL21 1QQP1 1NY72 1PGW1 1OOPB 5C9AB 1X36A 4QPIB 1B35C 1ND2B 1QJY1 3JD71 1ZBE3 4IV1B 4CDXA 3ZFGA 1QJU3 1HRI3 4PDWA 4YVSC 4RHV3 3VBHB 1BEV2 4JGZB 4LLFA 1EV11 5C8CC 1EAH2 2RM23 1TME1 2RS52 3DPRC 1HRI2 5BNPB 4CDUC 4RHV2 5K0UB 1VBA3 1RUD2 4CEYB 2IZWA 5L7OB 2XBO3 1BBT3 1RUG2 1PIV3 1PVC1 1C8NA 5LK7B 1AR92 5CFCC 1VBA2 2HWF2 1AR71 1K5MC 4CDQA 1F8VA 4N53A 1FPN1 5BNOB 1VBC1 1R093 1BBT2 5ABJC 2HWC1 1D4M3 3VBOA 1RUH3 1AR61 4IV3A 2MEV2 4AEDA 4Q4V1 5C4WC 1TMF3 3TN91 3NAPB 2X5IA 1RUH2 3VBRB 1AR82 1M06G 1COV1 1TME3 4RQPC 2PLV2 3S6PA 3ZFEA 1TMF2 1RMU3 1RUI1 2WFF1 4Y4YA 1NCQC 1ND3C 1AYN3 4QPGC 4RS5C 4YVSA 1MEC1 1VBD2 3JB8A 1NA1B 1AYM2 1X33A 1RVF3 1H8TB 1QJX3 4N43B 1PO23 1RMU2 4CDXC 1AR73 1OOPA 1AYN2 3DPRA 5D8AB 3ZFGC 2FZ2A 1FPN3 4IV1A 4PDWC 4CEWB 1CJDA 1GFF2 1RHI2 1RUF2 1RVF2 2DF7A 1BEV1 5CFDA 1NG0A 1ZBE1 4GB33 2Y26A 4JGZA 1FMD2 2RMU2 2RS51 1RUJ2 1HRI1 3FBMA 1MQTB 4RHV1 5DDJ2 1PO12 5BNPA 1R1A2 5K0UA 1SMVA 1ASJ3 1V9U3 4CEYA 1W39A 1RUG1 2HWE2 2RR13 5L7OA 2RS13 4CDQC 2R062 4RR3C 4N53C 1OHFA 1VBA1 2HWF1 1NCRC 1CD3G 2RS33 5A33B 2WS92 1BBT1 3VBOC 4IV3C 1QJZA 4AEDC 2MEV1 2ZTNA 1R091 2RS32 2X5IC 4EJRA 4GH4B 2TBVA 1BEV3 1D4M1 1RUH1 1AR81 3ZFFB 3ZFEC 1EAH3 3VBSA 2RS53 2PLV1 4Q4X2 1TMF1 3LOBA 1RUD3 1AYM1 2BBVA 1RUG3 1OOPC 1NA1A 1RMU1 4IV1C 1AR93 1H8TA 2HWF3 1AYN1 1AL0G 4YVWB 1DDLA 1WCDJ 3CJIB 5CFDC 1RHI1 1RVF1 4CEWA 1QJX1 1PO21 4JGZC 2MEV3 5BNNA 4RR3A 1FMD1 2RMU1 1NCRA 5BNPC 5K0UC 4Z92B 1PO11 2HWB3 4CEYC 1MQTA 1PGL2 1Z7S3 1AR83 5FOJB 4GB31 2QQPA 5L7OC 1HX6A 5A32B 1AUYA 4JGYB 2HWE1 2PLV3 1BMV1 2BFUS 2HWB2 2BPA2 1RUC2 1VBB3 1Z7S2 1ASJ1 1VBD3 4GMP0 4GMP3 1V9U1 1FOD2 2VQ0A 1AYM3 2WS91 2RR11 5A33A 2RS11 2HWD2 2XPJA 4RQPB 5ACA3 1NCQB 1VBB2 4CDWB 1R082 2RS31 1RHI3 1RUF3 1NY71 4Y5Z0 1PGW2 2R072 3JD72 1HXS2 3VBSC 5ACA2 5C9AA 4GH4A 4QPIA 3ZFGB 1ND2A 1FMD3 4PDWB 1POV3 1POV0 2RMU3 3ZFFA 3J8F2 4SBVA 1RUJ3 5DDJ3 3VBUB 1PO13 4WM7B 1R1A3 3VBHA 1NA1C 1EV12 1EAH1 1H8TC 2HWE3 4WM8B 2R063 5AC93 1F2NA 1RUD1 1HRV3 5JZGB 4FTBA 4CEWC 4YVWA 2WS93 4NWWA 5FMOS 3JBG3 1PVC2 5BNNC 5AC92 4CDQB 1AR91 3VDDB 1NOVA 4N53B 1HRV2 2BFUL 3VBFB 4FSJA 1VBC2 1ZBA3 5BNOA 1MQTC 3JBG2 2HWC2 1IHMA 1ZBA2 4Q4X3 1OPOA 2X5IB 5A32A 4JGYA 2ZZQA 2HWB1 2ZAHA 1RUC1 1B35B 1Z7S1 3NAPA 1FOD1 3VBRA 1VRH2 1COV2 4Q4Y3 2HWD1 2WFF2 1RUI2 5J96B 4YVSB 2FZ1A 1VBB1 1VBD1 4GMP1 5C8CB 4CDWA 2R071 5C9AC 4GH4C 4Q4Y2 4QPIC 3DPRB 1ND2C 4N43A 4CDUB 5ACA1 1HXS1 2WWSA 3ZFFC 1RUE3 5D8AA 2R043 3J8F1 1RUF1 5CFDB 3VBHC 5FMOL 5J98B 1VBE3 2WZR3 1ZBE2 3VBUA 4WM7A 5CFCB 1K5MB 1RUE2 4Q4W3 1POV1 2R042 1QJU2
chains in the Genus database with same CATH superfamily
1CAXA 2RDRA 2K2SA 2AC1A 4GJYA 3ZIXA 4AI0A 3OG2A 1G7YA 5FZLA 4AQ2A 2W46A 2D6MA 2BBAA 1VBE2 2CHHA 2J22A 1OSGA 2YG0A 3HT2A 1Y43B 1WLCA 3DXTA 2KA3A 4Q4W2 2GC1A 2X10A 3ON7A 4ZXKA 4GJZA 5FZOA 3NSTA 2BUKA 1YI9A 3RJ2X 3JCIA 4LIVA 1LHUA 4UF0A 1MVQA 2GH8A 5JSRA 2P6HA 3NKGA 5FV3A 5BNOC 1C8M2 5EPAA 3NJVA 3OYWA 5KHIA 3AB0A 2OT7A 4Z8BA 5JUVA 1WMEA 1STMA 1PIV2 2R0FA 1OFNA 4BXFA 1L7LA 2ZS6B 1JYXA 1IS4A 1Y3TA 1QJY3 1HXS3 2GNBA 2OQ7A 3JD73 5C5UA 1W6PA 4KGGA 3NVCA 2Q1FA 4QPGB 5CKNA 1R1ZA 2BOIA 3W58A 1S1AA 3MW3A 1R092 3AP6A 4PF1A 4K3UA 2IUWA 1QQP2 3OBRA 3I2FA 2VULA 2IXLA 2E6VA 3PTRB 3B5LB 2CWMA 4OZXA 1NX9A 1UYZA 1XSRA 4FPEA 4CCEA 3V0AA 2FDIA 3VDAA 3UESA 4NR1A 3LDBA 3S5QA 4QPWA 4MXVA 2CU5A 3ATGA 1W06A 4AFMA 4RFT0 2B4KA 5GZFA 3EYPA 4FP2A 3POIA 1XBFA 2XB6C 4WVMA 2DU1A 5JSOA 2OZJA 3M70A 5E6HA 1TME2 1PVC3 3DUIA 4YW3A 2KM2A 3VZJA 3ZKYA 4BM8A 3NJYA 4E8CA 5C8CA 5FPUA 3OGSA 5C3RA 4E4ZA 5F5AA 3QCWA 2XR4A 3WV6A 3RDIA 4Y1XA 1PK6C 1VBC3 3POGA 4GALA 4XURA 1UKRA 2UWCA 3VZLA 1D2QA 4F3JA 2IXHA 2UYAA 1S2EA 1NCRB 3VZKA 3WINE 1XYOA 1FNZA 1CAVA 3ZMNA 4KMQA 1DHKB 3UNPA 5FYMA 3MICA 4IV3B 2AUYA 1GKBA 5LBBA 2RG4A 4AEDB 2VJXA 1AR62 3GNEA 2P3IA 2Y34A 4Q4V2 1VRH3 2RM21 1LAJA 2QBXA 4J1XA 3BUCA 4XUQA 1A3KA 4Q1PA 3KVAA 4J25A 1ST8A 3ZYHA 1BMV2 3LD8A 2Q4SA 2AR6A 2YZ4A 3CJXA 3IZOA 4AR2A 5FZDA 3WQ0A 3PHMA 4DO0A 2QDNA 5FKBA 3IB3A 2XBO1 3H7JA 4I0AA 1H30A 2CGPA 5F2WA 4K40A 3A22A 4OUEA 3EJKA 3RRDA 2JIJA 1E57A 3PUAA 3E97A 1YUDA 1VPHA 4RQPA 4HT1T 4HSJA 4AGRA 2LW8A 4PLOA 5AFBA 5IHRA 1SFPA 4AVCA 1MZFA 4QPGA 4LO4B 2OPWA 1AL21 3C3VA 1NY72 1J83A 1E5RA 3L9JT 2YY1A 2E26A 2YGMA 4HKWA 2EIEA 1JZ6A 4YNIA 4YW2A 4CRQA 4QPIB 2BP6A 3NWKA 1ZRRA 4W6YA 2XG3A 2ZGKA 3VLBB 1CJPA 2FD8A 2X29A 1T6GC 5CG9A 1OH3A 3MFCA 4CE8A 1IPSA 3JXSA 5IVCA 4INDA 1DGWX 4FFGA 4RHV3 4YVSC 5FTTC 2RDNA 2TNFA 5SV5A 2JB4A 2ORXA 4FAHA 1EV11 1O91A 4Y1UA 5C8CC 2BTVC 3ES1A 1IS3A 3ZXKA 5LY1A 3DECA 1UXXX 5L9BA 3SEEA 4BPZA 3X29B 3ZVXA 5J3UA 2P4EA 4M3CE 4LKSA 1POQA 3LEKA 1JU3A 3WNKA 2W1WA 1JYNA 1GYKA 1QXJA 4QB2A 4YM1A 2IZWA 2VQTA 2VVDA 1BBT3 1N3QA 2VBPA 4Q27A 1LHNA 1H6YA 5KXEA 3CZUA 1UU4A 3SH5A 4CU9A 1F8VA 4N53A 1VAMA 1FPN1 2VZPA 1MZ5A 2WQZC 4NVPA 5LATA 2VCCA 5GZGA 3RG0A 1O5UA 4IETA 4S2GA 5B4NA 2D93A 2DUOA 2Q0AA 5CADA 4WZFA 1C1FA 1N3OA 4I0WB 3LA3A 4PBPA 4IV3A 2MEV2 2IC1A 4FPYA 3I59B 1BJQA 4LBMA 3NW4A 2VOXA 3TB0A 4AEDA 3VD4A 5FUNA 2QE3A 2FCVA 2VZSA 4DS0A 1Q56A 3ACIA 3ZOIA 3AP5A 3K46A 2PAMA 1H6XA 5A6XA 4DXSA 2VZVA 3PNAA 4F7ZA 2Z42A 3N7LA 3VKNA 3F2ZA 4E4DX 4QQ2A 4A4AA 1JS9A 5LBEA 4RQPC 4ZHNA 2WFF1 1GP5A 1BZWA 5HCAA 2O14A 3ZN4A 1XNTA 4QPGC 2VNOA 2EICA 4Y3OA 1XNAA 4RFRB 3BTXA 5CBLA 4P9IA 5CYYA 5IK8A 1VBD2 2NPIA 2XH6A 4DRVA 4F83A 3B9CA 2WL1A 3JB8A 3VHRA 4K8RB 5H9PA 5JR7B 4AFCA 1QJX3 3B93A 3SKJE 2GDFA 1BHGA 1I5PA 2YU2A 1CONA 4PLNA 1GZWB 2PQQA 4XJAA 4XQ4A 5FP7A 5A80A 5D8AB 1AYN2 3MF9A 4I2OA 1UY4A 1DQ6A 1ZYBA 4ORFA 1F31A 3HNMA 4CEWB 1DGWA 1SEFA 1ZX5A 5IYYA 4BIFA 1RHI2 5A7NA 1U5IA 3WSOA 5A3PA 1YIPA 4BQWA 2XLGA 4LHLA 4LT5A 5EV7A 3ZYJB 2JEMA 3AMHA 2J42A 1O3QA 4UI9L 5IVFA 1W8FA 1ZBE1 3D8CA 2YBSA 2WA4A 4JKLA 1T6BX 2Y26A 4JAAA 1EUTA 1XNKA 2GNTA 2FDJA 4HANA 4DOUA 2RS51 1DYKA 4FP3A 1UY3A 2YYOA 4JTOA 3PURA 2P2KA 1SLAA 2QZ3A 3T4HB 1R1A2 5F2SA 2MNGA 1SMVA 1ASJ3 2BVBA 1O4TA 2AZ5A 3J7NA 4R9CA 4XEZA 3PL0A 4Z82A 1ZVFA 1W39A 4I30A 4N8MA 2VVEA 4XBQA 1IQDC 2E31A 2EA7A 1SG3A 2RS13 4LO6B 5A3LA 2R062 3PUIA 4N53C 3RMYA 5EYXA 4MZUA 3IWZA 1NCRC 4R4ZA 2F6BA 4D94A 1UOFA 4LO7A 3PIJA 5IWFA 3ZFFC 1WLTA 3ZN6A 5FZIA 3INAA 2WZEA 3SH3A 4RGAA 4IV3C 4LJHA 1QJZA 2VU9A 4AEDC 2GC3A 5ERLA 4D6RA 1JOPA 5H9SA 1BKZA 1G86A 2VG9A 3HVDA 2CGNA 2KD7A 2XWJB 4AEKA 3N9LA 2H0VA 4B4QA 2WO1A 5HI0A 5F39A 1R091 3CF6E 4Q1RA 4LKEA 2VZQA 5EP9A 1EPWA 4FFHA 5LRRA 4B3NA 3BTZA 2DVAA 3B00A 4WVVA 1ENQA 3WNMA 1QEXA 4ZZ5A 1HB1A 1BEV3 1K12A 3WP5A 1RUH1 4EV0A 5CAZA 1AR81 4NO4A 4A41A 1LECA 3PMEA 1YNAA 2A6VA 5KC6A 4MADA 1W05A 1NZIA 3VBSA 2PLV1 4TLGA 1LODA 2JDNA 2V4AA 3WNNA 2BDRA 2XXZA 3OPZA 1IS6A 1RUD3 4IE5A 3TRSB 4KGQA 1BVVA 2P3KA 3ZR6A 1CZSA 2Q5TA 3FHAA 4L11A 2CL2A 2WO7A 2RHPA 4RGKA 1RUG3 1MZEA 2Z79A 3NQHA 1RMU1 1VR3A 1FV2A 2BEOA 1EP0A 3HBKA 4YW7A 4LHKA 1GICA 1WW5A 4Z1VA 2QFEA 4EN9B 1H2LA 4MV2A 4IEYA 1LR5A 2W9XA 3OUJA 3LSDA 2WINB 1RVF1 4CEWA 4Q0PA 2RJLA 3V0AB 2IVIB 1QMJA 2H6BA 3WCRA 5GM0A 4EZ4A 4G4FA 5JDBA 5FREA 1W28A 5EZWA 1K45A 5BNNA 1ULOA 3LPGA 4Q26A 3CLPA 2Y6JA 1XQNA 3FFQA 4FFIA 4HMZA 5FZ4A 4PIZA 4ZS2A 4N7UA 1F5FA 3CMGA 1PO11 2VUCA 2VZ3A 1ACCA 1OFSA 3H7YA 1DZRA 5EHDA 5K9YA 4P5YA 4BLJA 3RGBA 5T5OA 1G9DA 2QQPA 1YFXA 1LOGA 1HX6A 1YI7A 1IG3A 5A32B 4JGYB 3LEMA 3RQ0A 4QGMA 1GP6A 5DAQA 3GZAA 2YBKA 1BMV1 1ULEA 3C7OA 3HQXA 5FPBA 5KHJA 3OOXA 3BYWA 3J7LA 4TTGA 1RUOA 4FVVA 3ZXLA 4B4PA 3OJBA 4E4SA 5C3PA 5JWPA 1FOD2 2VQ0A 3KS7A 1YQ5A 1MVEA 2WS91 1GNYA 5FY8A 2G19A 3IBMA 4FPGA 2HWD2 2XPJA 3Q8BA 2QQOA 4KWLA 1H4HA 2VW1A 4JKMA 4M4PA 3O7OA 4CDWB 3RZHA 4LHNA 1R082 2YU1A 2RS31 2WQ4A 3SCFA 5BUVA 1CAUA 3OGJA 1NY71 3DL3A 4FPKA 1YHFA 4EYUA 4O9EA 2VD7A 1N1YA 5ACA2 3VBSC 5C9AA 4H2AA 3ECQA 3HPNA 4META 3ORJA 1OQDA 3H3UA 2SLIA 2CSGA 5JPMB 1POV0 2Q1ZB 2RMU3 4BWOA 2QQWA 4P9YA 3POBA 4SBVA 4XBLA 1OC1A 3DN7A 5EWSA 3VBUB 4NPLA 3UKTA 1UWWA 3O14A 4YW1A 3HQUA 4CUAA 4LPLA 4XFIA 1WLWA 1LGBA 3GALA 4XFFA 3N3HA 2Y6HA 3KCCA 2R1DA 4YYOA 1K3IA 1JU4A 2OX0A 4MH0E 3ACHA 1JYVA 2HWE3 5I8SA 5LEKA 2VMGA 4IEPA 2HEWF 2QTWB 1PZ9A 4BB3A 5AC93 3RZJA 1N1TA 1QKQA 1ULGA 2NMOA 3CU7A 3U14A 1WMFA 4QX2A 1HRV3 1IKPA 1J84A 3DV8A 2XL7A 4CVUA 2XJRA 4CTEA 1UF2C 4CEWC 1KJRA 5HV0A 4A44A 1GUIA 3D0JA 3POWA 2XKOA 4W8JA 2D40A 2F17A 2OZ6A 2AYHA 5BNNC 4J1WA 4QX8A 3WNPA 4OHZA 2UU8A 3BKZA 1HW5A 3PVEA 3VBFB 2HYXA 2C9AA 2YROA 1MS5A 1PMHX 2XWBB 3D4KA 5FUPA 2FDFA 1X7NA 2B7YA 2QCSB 4B7KA 5KHHA 1JW6A 1ODNA 2HKXA 2HWC2 3WW4A 1JZ8A 2IFRA 1TG7A 2WSUA 3AKSA 3Q9OA 4WV8A 1S0CA 2DVBA 3MLKA 4R9AA 4B8EA 3EQEA 1LU1A 3WF0A 3RZGA 3IDCB 4Q4X3 3WG1A 3BCWA 3ZKUA 4HN1A 1ENXA 4CYDA 5A32A 4JGYA 3KT1A 5E16A 5J7MA 5JMOA 2VOWA 4JVAA 3UV9A 2ZAHA 4QQHA 1B35B 1Z7S1 2BJSA 4QGLA 3NAPA 4A45A 1TVGA 1L3JA 1OMIA 2W91A 3CDZB 3GF6A 4BOWA 1LHWA 2EXIA 2ZEZA 3W9AA 3KHBA 1COV2 4IE4A 5JOYA 2NP0A 4Q4Y3 4XETA 1GU3A 1GBGA 3BB6A 5BXXA 5J96B 2NZ9A 1UCXA 5APAA 1VBD1 2ERFA 2PN5A 1Y7BA 2ZHLA 4LBQB 1W0NA 1JYIA 4CDWA 4CCJA 5C3QA 2Y0IA 5C9AC 3A7QA 3QLQA 1XRUA 4QDSA 1HXS1 1PNFA 1Q8QA 1RUE3 3KQ4B 4H7MA 4AVVA 3TEWA 3RI8A 2E7AA 5LBCA 4YPJA 4NHXA 4XYXA 1NQJA 3C7EA 1ZRIA 5CFDB 4KU8A 3ZXDA 1XE8A 5FZ7A 2GN7A 3ZXFA 4KH9A 4NIAA 1VBE3 3ZXGA 3VBUA 1Q8SA 4Q4W3 2WAAA 3KF3A 1F5JA 3ILNA 1CVNA 4Z2AA 5J09A 5DUWA 1BCXA 4GULA 4R9BA 3IMNA 5LWBA 3BI3A 5ABJB 4AGGA 3LCPA 2Y6LA 1QHDA 1R1A1 1RUC3 4BISA 2JXAA 4LE3A 1C8M3 2ARBA 1ENSA 2XVLA 2P3YA 4XIOA 4LBOA 2PXJA 2GNMA 3WUDA 2HLEA 2RM22 4DXRA 3BU7A 5JSPA 2R061 4AI3A 4X8PA 3KV6A 2HBTA 2QQMA 2XJVA 5K7PA 2D6LX 1AF9A 4FPFA 4NAMA 1HQNA 2A6ZA 2VUJA 4O7XA 4XC9A 1QH6A 2W92A 5BPXA 2PHLA 3VBFA 4P00B 2GP3A 2XBO2 1QQP3 3JBG1 2R073 4PT6A 1PMJX 1YYNA 2GAUA 1HKDA 2WNUB 2WZPP 4QM8A 4S2HA 4COZA 4Y5TA 1ND3B 2RE9A 4GWNA 4RS5B 4XTPA 4JGYC 3OB8A 1GMMA 3CO2A 4MGSA 1VB4A 5FP3A 2DVFA 2J1EA 1AL22 1DP0A 1SACA 1WZXA 3NAPC 4OI2A 4NHMA 1UIJA 4UW6A 1C4RA 3WDXA 1D4M2 4CDXB 4IERA 3DF0A 4YZ1A 5IVBA 3WZ1A 3VKLA 1UPSA 1UZVA 5CZKA 1N47A 3IPVA 2V73A 4OQ8A 5IVEA 1B35A 3I7DA 4DMIA 1XE7A 1VRH1 4X6RB 1GWMA 3ZSLA 4XE9A 4ITCA 4AI1A 4KBZA 4CDWC 3D6EA 5FZMA 5DPNA 2X09A 1B09A 3RYKA 1OQ1A 3T0DA 2V72A 4QKBA 3M3IA 2WT1A 4XAEA 4COYA 4NRQA 1GZCA 3A4UA 3ZSKA 2YMZA 3VL9A 2IXCA 5C5TA 1SCRA 4XDPA 2O1QA 4LUKA 4CCMA 4WZCA 3I2OA 3VD9A 2JIGA 2DV9A 4NE9A 3U11A 5CG8A 4O65A 3VBUC 3M3CA 4RN5A 5LY2A 4FCAA 2W1UA 2CV6A 3J26N 4IGOA 1AR63 1GQPA 1QXRA 2CYFA 2O8QA 2GSYA 1W04A 1FPN2 1YXWA 3J7MA 1JHJA 4Q4V3 4HLTA 3U4XA 4XDQA 5FXWA 3WOGA 3V0BA 4YGEA 3VBOB 2EF6A 5C3OA 3P1IA 3N36A 2D6PA 3K51A 4LR4A 3SCHA 1YJLA 5ABJA 3ILFA 1RJ7A 4GB32 4CXXA 1FATA 5IK4A 4CPBA 5ANQA 1LESA 2OUJA 2ZHNA 1RUI3 5FBZA 1HLCA 1TNRA 1OLRA 3S5AA 4MYEA 3IDEA 2FMDA 3VBFC 2BWCA 4IGPA 2BOJA 2GP5A 3I2HA 4KG0A 2ET7A 4XW3A 3Q8EA 1SLTA 2C24A 1HB4A 5I8YA 5CA6A 2I45A 1C5IA 4OUMA 2ENRA 3T0AA 1Z78A 2JE7A 1SFYA 1UYPA 3WCSA 3FLTA 1GNZA 2YV8A 1R081 4A6SA 1NCQA 3OPWA 3K48A 1ND3A 4RS5A 2JDUA 5CKQA 5T3NA 4CUBA 1LGNA 2GC2A 2A6WA 2J7MA 5FZ6A 3RZKA 2WNVB 4NHKA 2VUDA 3PVBB 3RYRA 3B3QE 1B35C 3ZPOA 1ND2B 3NV3A 4KI5M 1Q3EA 2EAKA 3P5BA 1E5IA 4BQ5A 4CDXA 2WNEA 3FFZA 5LA0A 3B9IA 2VMFA 1EUUA 4XJ8A 1WW7A 3KM5A 4EN6B 5CEHA 1PK6A 3UGGA 2PA7A 4BHPA 5I0RA 3I3MA 1LOFC 2ZJCA 4TYSA 1QDOA 2P3JA 3BVCA 1K5JA 1QNYA 2XMLA 4JGZB 1YFYA 2W5FA 3E6DA 3GZEA 4Y20B 4YSFA 1DG6A 1NE4A 5GALA 5FPXA 4JV4A 1KJLA 1W3XA 1EAH2 4N9HA 4GKXA 2RS52 4GAZA 4MGIE 1UYXA 4NUBA 4M3CB 3RZLA 3AZZA 4NN0A 2WAOA 1US2A 2XVGA 1H4GA 1ENRA 4CEYB 1OD5A 2ZBJA 5I8TA 5L7OB 4QXHA 4CU7A 4EN8B 5FAXA 5GLUA 1DGRA 4Y4RA 3I97A 4LITA 3G6JB 5CISA 2ZOEB 5IW0A 3WF1A 1W6NB 2OVUA 2QQVA 2XUEA 5FQ0B 3UKVA 3QH6A 1W6OA 1OI6A 3T2OA 4GIQA 4N7IA 4UW5A 4W6XA 2C0ZA 5FPAA 5ABJC 2HWC1 2HJIA 4BA6A 3VBOA 3SQOA 1QXPA 1JBCA 1C5HA 4DUXA 2GU9A 2QKDA 4IEXA 1G8WA 3I49A 1QIQA 2X53S 2W0XA 4PJYA 3TN91 3NKTA 3WP4A 2ZGSA 1KRIA 5F6KA 3H0OA 1RUH2 5LK5A 5FXXA 3VBRB 4Q29A 1AR82 2OKXA 4GWJA 3W5MA 2C26A 1M06G 1AJOA 3KGZA 3MGUA 2JG9A 5A7PA 1COV1 1RL3A 4IEUA 3KCXA 4UFIA 3ILRA 2PLV2 3VKMA 4Y4YA 5D1IA 5AVAA 5JLVA 5FZFA 4P9XA 3PUSA 1NCQC 5FY5A 1OQEA 1ND3C 1AYN3 4RS5C 4MO3M 4YVSA 5A3OA 1MEC1 5D21A 3V65A 2WA3A 1PM7A 2Q1MA 3MPPG 4FQZA 5EIYB 2PHWA 5B4XA 3MV01 5K8SA 1OBNA 1H8TB 5FZ1A 4N43B 3WNOA 4BZ4A 1PO23 2ILMA 1RMU2 3WP3A 3FLRA 3URFA 4AHYA 4CDXC 5KXCA 1CX1A 2WNVA 3AKTA 4OQ9A 1AR73 4FPHA 5DMYA 5HXMA 3V56A 5FZAA 1DU3D 2GMEA 3HN1A 4K1YA 4K21A 4XF0A 1UW8A 4UXAA 1JZ7A 3H1YA 4AI9A 2G9GA 1OA3A 2LTNA 1RUF2 2HBUA 2C6SA 2OIIA 1RVF2 4BH9A 2Q8OA 3PMSA 2DF7A 1BEV1 1SQ4A 4A3XA 3K4DA 1DGRN 4JGZA 3NL1A 3KLSA 3I8TA 1S0DA 3S7IA 4JRLA 4LOSA 1S0GA 1RUJ2 1HRI1 1YJKA 2DVDA 4UYBA 1MQTB 4DFSA 3DYOA 4LBKA 4JHZA 5DDJ2 2XJPA 3UYJA 1PO12 2D3SA 2NN8A 1W6MB 1KGYA 5I0UA 1OLQA 3LEIA 1V9U3 3ZO0B 1DZQA 2VOVA 3FE5A 4G3YC 1S0BA 4MSVA 5T50A 1RUG1 4CEYA 3LB9A 2RR13 1FNYA 5L7OA 4LK6A 3NV4A 1UU5A 1FT9A 5EJ3A 1O7FA 1OHFA 1QY4A 1HB2A 1NYWA 1VBA1 4P9WA 4E4HA 1PX4A 2VXRA 4E2SA 3LDKA 1YFUA 4LOTA 3HWJA 1CN1A 5FYCA 5A1AA 4COUA 5FQ0A 2WS92 3VBOC 4ASLA 2BWAA 3FZ3A 5FO9B 2ZXQA 4A6OA 5J36A 2DWRA 4IW3A 1WUVA 3LPFA 4COVA 3MUZ1 4CSWA 1UZYA 4HFSA 3KMHA 2RS32 4XACA 1MS0A 1F4AA 1W2UA 3M3OA 1C28A 3M1HA 3BOWA 5FP8A 5A1FA 1Y9MA 2EIGA 1HJFA 3AM2A 1D4M1 1DQ4A 1YQ8A 2JG9C 4QQOA 5F3EA 3K4AA 3IIIA 3HD8B 4B1LA 3BALA 2D43A 1H9PA 3I4IA 3GZUC 2W52A 1RITA 2B45X 1VALA 2ZEYA 1NXD1 1TMF1 1H9WA 3ES4A 3LE0A 4MGYE 3UGHA 2C1FA 5L9VA 3AZWA 2XLAA 2JDKA 4LBQD 2YPDA 1J3QA 2I07B 1DQ5A 2BW8A 1CGPA 5A6ZA 2VZOA 2R30A 2WNVC 2WRAA 3WDTA 3AVSA 4L99A 1AR93 1H8TA 1W8WA 2HWF3 3BPSA 4LK7A 1KFUL 1O3SA 3AJZA 1AL0G 3MF6A 4GZ9A 3TAYA 3S57A 1A8DA 2JICA 2XQRA 4K7JA 1DDLA 2LRPA 4M3CF 3GBWA 3OF1A 5FMDA 1J58A 4CP9B 1SBEA 3CJIB 4IUGA 4LTAA 3NV1A 5F3IA 2DCTA 1W99A 1GP4A 3W20A 2BERA 4B7EA 3K3NA 5A6YA 4JGZC 1W2NA 5AVPA 3QBQA 2ZHKA 5LA9A 4DZGA 1ZZ7A 1GR3A 4W65A 4C1XA 1DYOA 2RMU1 2W95A 1NCRA 1SLIA 1XYNA 2P1BA 2GH2A 4Y24A 3O1RA 4CPBD 4P9LA 4OCTA 1MQTA 4CEYC 1PGL2 4ISQA 2YC4A 5FOJB 4GB31 3SITA 2UWAA 3THCA 3N9MA 4HVOA 5LBFA 5L7OC 1W6MA 2V5DA 3K2OA 2D3PA 1DIWA 2HWE1 3ZYIB 3M7AA 1MS3A 5TSWA 4UWDA 1W90A 2NQYA 2UY8A 4ZS3A 1VMFA 4UFJA 4FXGB 4R52A 2XJSA 1IS5A 1OF3A 2ZMNA 3VDCA 1V6NA 1Z7S2 5F6LB 4GMP3 4N9IA 1VMHA 1AYM3 5FZ3A 5LA1A 2IXIA 1N3PA 3ZXEA 3KVBA 3TOJA 4CCOA 3LZZA 2VVFA 2IWGB 2ZX1A 2J1AA 3SNMA 2KXLA 1GOGA 5EYYA 3GHMA 2QQIA 2JD4A 1LRHA 4XTMA 3OPTA 5ACA3 5IATA 1DZTA 4ZU7A 2PHUA 3ZN5A 3E5QA 2WKKA 5F3CA 1ZRFA 4QPYA 1OUSA 4XUPA 3N9QA 5FY7A 2V4VA 2XJQA 4TN7A 4LBLA 2XHKA 5FXVA 3JD72 1HXS2 3MIBA 3ACLA 5T52A 4A42A 4QPIA 3ZFGB 4XQWA 4FOYA 3AC0A 3LGRA 1FMD3 4PDWB 3AKRA 4QX7A 1CESA 2HH9A 2W08A 4GXLA 4YWAA 2ZX3A 4ET7A 4EQVA 4Q0VA 1RJ8A 4UAPA 5DAVA 3PJYA 3AMMA 4BK5A 1V0AA 3OGGA 4XILA 4MG2A 2BGOA 4YZ5A 4XOGA 5KBFA 5A7SA 1UU6A 1EAH1 1H8TC 4BE3A 4ZKTB 4EN0A 1NLRA 3KZ4C 2FDHA 4FXKB 4F8AA 1F2NA 1WCUA 4Z07A 3AL5A 3H42B 1LB2A 1AX0A 2DBIA 2ET1A 2G4IA 2WYFA 2PHDA 3RVHA 5FO8B 4JCKA 4AZZA 3SEPA 4NWWA 4P08A 2ZGMA 3T4VA 5FZKA 4CP9A 5LEJA 3RZMA 1PVC2 3GDBA 3KSCA 4QQLA 3VDDB 4CDQB 4J6GA 2R16A 2BFUL 4AGVA 4BQXA 5DG1A 4QX5A 5HBAA 5LCWL 1C1LA 1BLZA 2XOMA 3AK0A 2A3YA 1VBC2 3NJZA 5JI7A 4K20A 4WVWA 1MQTC 3JBG2 4MLOA 3SMHA 4MGTA 2ID4A 3H9AA 1Y4WA 4OHYA 4LNVA 2VQAA 3WF3A 3POSA 2C4XA 4ASKA 3IMMA 5DG2A 1HV1A 3ZSJA 4CU6A 3B02A 3H3ZA 2Y38A 1YRZA 2CAUA 4OULA 4EN7B 1XC6A 3I59A 3IAQA 3AMPA 2X5IB 5L36A 2B8MA 1D0HA 2HWB1 2QJVA 2UY9A 3AMNA 3N9OA 1RUC1 5JMCA 2VW2A 2R7EB 2QQNA 1WKYA 5IAVA 2ETEA 1HIXA 1JUIA 4XFCA 2YB7A 4ZPIA 1VRH2 1DFQA 1KS4A 1REEA 2JDMA 2AGSA 2D5FA 3BODA 3HT1A 4I3PA 4QT6A 3SC7X 4ZY9A 1VBB1 1JOJA 5L19A 2AREA 2YUEA 4E8DA 3CBNA 3MO4A 2WT0A 2E9QA 2R071 5FRAA 1UPIA 3IKWA 3O0WA 4QPIC 3DPRB 2PQSA 2WSVA 3BN6A 4YG3A 1SLCA 1GZWA 2EAAA 5D8AA 1WWYA 1JOBA 1VAVA 3IDBB 4A7KA 5CIRA 1RUF1 3ZXJA 3ZSEA 2QVSB 5FMOL 5J98B 3LQCA 1QH7A 1Z0HA 4FQ4A 2CGOA 5GLZA 1J1LA 1GWLA 1PMIA 3L2YA 3U10A 1K5MB 4COWA 2ZGOA 5JOZA 4OMDA 4LO8A 3WDWA 3HNBM 1POV1 3K3OA 1RUJ1 1LJ7A 1QF3A 2FCTA 5DDJ1 1HJGA 2LROA 3ZYBA 5A3NA 3VHPA 3SCGA 3H8OA 1OLMA 1KITA 1OD3A 4FOQA 5FYVA 3T3YA 3CJIC 3RNSA 1NZCA 2F4PA 1JODA 1U5YA 3GXUA 2ZGLA 1WBFA 4UW4A 4PIXA 4FTSA 3FN9A 1PHMA 5FCCA 3VKFC 3TWIA 2LM3A 3QH7A 5C4WB 5CVRA 2VH9A 4UBGA 5HCFA 1DBNA 2WN3A 3MW2A 3ZYPA 3VDDA 5EXOA 5HPOA 4DB5A 2W2IA 4CCDA 2BQPA 4XMIA 1U5ZA 4U2AA 3HIFA 1KD7A 5LRSA 5FYHA 1AL23 4HK9A 4YFZA 2XKPA 1UX7A 3RWNA 3S30A 1W2TA 3FLPA 1W6QB 1VLNA 3EHKA 1IGOA 1JN2P 3FUQA 4LO5B 3PTYA 4LUMA 1RTVA 2JX9A 4AFAA 1PGSA 3N7MA 2JDAA 1ZBA1 1AXYA 2Y6FA 3J8F3 4Q0QA 2H0BA 2D6NA 4UFHA 1ALYA 3BOPA 1YQ6A 3JZVA 2B46X 5DXDA 2FDGA 3HAGA 1OA2A 3ROUA 2DCKA 1N1SA 1EV13 5FJKA 1X8MA 2VMIA 2P37A 1W8TA 2C9KA 3M8LA 2ZZJA 4ISRA 2WLPA 1MZ6A 1I3HA 4M0HA 5CB7A 3ZMOA 3VD7A 2E51A 1UIKA 1L7QA 5GKAC 3WR0A 1KQRA 3J4UH 1OH4A 5C7GA 2WT2A 1SCSA 3UETA 3POFA 5FJHA 3C2UA 3D0SA 3OBTA 2DCZA 2L9LA 5D8AC 1US3A 4NRPA 3JQWA 4C91A 2ZGUA 3RYPA 5T5PA 1XJAA 1WBLA 2D5HA 2YXSA 3ZSMA 5FDBA 5LASA 2XJTA 3BPZA 1V00A 4ZONA 2UWBA 4QXBA 5A7QA 1QJX2 3RJRA 2P17A 2VCAA 1WLDA 3TNPB 4RR3B 1X8EA 5GLVA 2YC2A 1RB8G 3UGFA 2R6QA 2XUMA 1L7RA 3HNYM 1W9SA 1LENA 1DQ1A 2MPFA 1K5MA 2R041 5FYYA 5FWJA 1QNWA 4Q5OA 5I0TA 2Y6GA 1LULA 3THDA 3T30A 1IZ3A 2Y64A 2TEPA 3AYCA 3VHOA 2BNMA 1PGL1 1KDKA 2VZTA 2WZR1 4L97A 4A2UA 4ARXA 4B4RA 4YM2A 3ACFA 3NMBA 4NRMA 1H0BA 2AENA 5FY1A 2XGXA 5KXBA 3RZZA 2WFF3 3TN92 3VDDC 3U75A 4DPNA 3FUOA 5BV6A 4ZXEA 3J7HA 4P9GA 1IQAA 4XF4A 1V6JA 2HEYF 5C4WA 4EWAA 3O1SA 2HYKA 3MLJA 1A34A 1ASJ2 1JTZX 2DDUA 3NO8A 1UMIA 2KR2A 5FLIA 1UZWA 4QHZA 4BYYA 2Y6KA 5F1RA 2OW4A 3LIGA 2ZKLA 5EJZB 5FP9A 2W1SA 2RS12 1YCIA 3U4SA 2OPKA 5DUXA 3WW3A 5DAPA 4L9BA 5JCTA 5E8AA 1FX5A 1W6QA 5FK7A 1KDMA 3LA2A 5BY5A 1MEC2 1QOTA 4BMBA 5J48A 3B01A 2WN2A 1I1EA 4Y1YA 1QJEA 4OMCA 4JDOA 4KQ7A 3CHXA 4P02B 5EJ1B 5I91A 1JYTA 1D7PM 3ZR5A 1OOPB 1X36A 4FO9A 4YGBA 1EY2A 2DTWA 3AP9A 1NXMA 3AVRA 1QJY1 3JD71 4IV1B 1ZBE3 3U37A 1MS4A 2QQLA 1OF4A 3KHCA 3ITQA 1IKQA 5JXGA 1QJU3 5I0DA 2JDPA 4H14A 1PNGA 4GWIA 3WF2A 1GANA 4LXLA 3C8XA 4XFBA 3VBHB 1BEV2 5C33A 1W9FA 1UNBA 3Q8AA 5IVJA 5HCHA 2E7QA 1LOAA 3VD3A 3I2DA 3DPRC 4CCKA 1RXFA 4FPLA 4QKFA 1HRI2 3VGIA 3KWVA 4H3WA 5K0UB 5J37A 4R9DA 4GD4A 1RUD2 4O9GA 3FC0A 4CUCA 1XNCA 3KF5A 2BVVA 4QDRA 4JDNA 4DINB 4JX0A 3AX4A 1RUG2 4PBOA 1PIV3 2ZACA 1PVC1 5G05L 1SPPB 5KXDA 5LK7B 1VBA2 4XAAA 1AJKA 1AVBA 1AR71 1F9KA 1K5MC 2QDRA 2WUHA 1PZ8A 4HN0A 4HONA 3WW1A 4E2QA 5BNOB 4Q8LA 5FZ0A 1VBC1 1R093 1UY0A 3OBAA 1F4HA 3U1XA 1NUKA 2ZHMA 3I2GA 3KD4A 5F32A 1F35A 2YHJA 1RUH3 2AEYA 2NLRA 1CPNA 4NIIA 4YW5A 5C4WC 1QOSA 3OCPA 1KFXL 1F15A 4BJ0A 2JKBA 1I6XA 1G9AA 2P34A 4WVZA 1W0PA 4LKFA 5M0TA 2Y0OA 3EMRA 1OKQA 4AQ6A 1UYYA 3I2JA 5C6CA 1TME3 2D7FA 4HVRA 4JC1A 5FYTA 3S6PA 4CCNA 1TMF2 1RMU3 4OI0A 3MIHA 4LMFA 2G9ZA 5C8WA 3PIGA 4XCBA 2WBKA 4PHZA 3VL8A 4AVTA 5DQ0A 1LOFA 3WDUA 3GBFA 4M00A 4YW4A 4AQTA 2Z69A 3BU0A 1RVF3 4LBQA 2JDYA 2R1BA 4O61A 4FBFA 3OY8B 3WG4A 3MIGA 3QD6A 3H1MA 1JMUB 4DNYA 2D97A 4E2GA 4PCRA 5C3SA 1OOPA 3D5OA 4K9SA 4HETA 2FZ2A 1Y9GA 5FO7B 4IV1A 3VV1A 2JG8B 4BU2A 4G9SB 1APNA 1VP6A 1FYUA 1GFF2 2IXJA 1AX2A 4RGGA 1YC61 3W59A 2VTXJ 1NQDA 4LBJA 5JXHA 1A8MA 4YZ4A 5CFDA 2D44A 4QX1A 2OQ6A 3OUHA 4KBBA 1ZA4A 4ES8A 1UQXA 1CAXB 3HJRA 4N90A 2DURA 2RMU2 3NNGA 1H1MA 2ZGPA 4QMAA 3DXUA 1DLCA 2X8KA 3FBMA 3LF7A 2VOKA 2B42B 4RHV1 4BIOA 2Y33A 3B69A 1G6NA 5K0UA 1WW6A 4P9JA 4X8NA 4BQ1A 2QNKA 4L8QA 2WZ8A 4UF0B 1BYHA 1D4VB 2HWE2 3SXWA 4MVTA 4RR3C 3LKJA 1X50A 5ANNA 1BK1A 2HWF1 4HOOA 4A3ZA 3ELNA 1ULDA 1KXGA 1SPPA 3OYWB 2FBEA 3TEYA 4XUOA 3LSEA 4MOAA 3AXDA 1CD3G 2B9VA 2RS33 5FZCA 2Q30A 3E6CC 1BBT1 2YC0A 2ZKNA 4ONUA 1MS8A 2ZAAA 5JXJA 1AHSA 5HXVA 1M4WA 1W6PB 4YLZA 4URAA 4L92A 1UOGA 2DVGA 2JE9A 2DU0A 2WNUA 3OUIA 4OFGA 4XFGA 2ZTNA 4YRDA 4AHXA 1KS5A 5FYSA 1HDKA 3T1LA 4RD7A 1V6MA 1BQPA 2A71A 2WABA 4LKDA 3U78A 4YARA 1H2MA 2A73B 2VCBA 2ADDA 1Q8VA 2VBBA 3AYDA 3W21A 4YM0A 2A6XA 4Q4X2 5DUVA 4OHXA 3K75B 1O3TA 2VZUA 3AXEA 4XF9A 4DIQA 3LOBA 2MHFA 3GCWA 4UFLA 1UOBA 4KWUA 3EXUA 2WO2A 2QQUA 3OGRA 4D6QA 2RV9A 4QAWA 1OVSA 4HG6B 4XVHA 5EQUA 4LE4A 2SBAA 1AYM1 2BBVA 1X9TA 2JDHA 3A23A 1WD3A 1O4ZA 1OOPC 5FY4A 2VBDA 2B39A 4HZFA 2FHRA 1KEXA 4IV1C 4D7SA 1J59A 1AXKA 1DQ2A 4YVWB 2ZX0A 3I3QA 2GMMA 5BNQA 3HMYA 4K8FA 1JUHA 1CX4A 1MPXA 1WW4A 2W87A 5CFDC 3IAPA 5A3WA 5FPLA 1QJX1 5FZBA 2CTVA 5A3MA 3H50A 2OYZA 3D3AA 3GBGA 2MEV3 3ZLIA 1T2XA 4LBNA 5FKCA 1CAVB 1FMD1 1GOHA 1R64A 1X9PA 2V09A 1ZM1A 3AJYA 5GZEA 2UYBA 5K0UC 4Z92B 2W1QA 5JVVA 2ZCWA 5FK8A 1Z7S3 3QOPA 4BLIA 4H55A 2FMYA 5A3UA 4ATFA 2RVAA 1AUYA 1DYPA 2ZGTA 3J9SA 4AEMA 4XQDA 5FXZA 3G7DA 5DN2A 5FZ8A 5FOBB 1S0JA 2BFUS 4JQRA 4XDOA 5FY0A 2HWB2 5KHKA 2BPA2 3MDPA 4I3GA 5JIAA 4NJ4A 1RUC2 5IVYA 1XSQA 1CZVA 1ASJ1 2O8OA 1VBD3 3CEWA 4GMP0 1CAWB 4KG8A 5A70A 3JQXA 4AHWA 5EFUA 1YIFA 2WO3A 4M4RA 3O5SA 2ORZA 2RS11 3SH4A 4RQPB 2WNUC 3VN4A 4TZDA 3O1OA 3WHTA 3RMXA 3WQ1A 5H9QA 3UT0A 3CKHA 4X6QB 1VBB2 2E53A 2WDBA 3WD5A 2PTMA 3WHUA 3DKQA 1RHI3 3HN3A 2FCUA 2WNOA 4FOWA 1GNHA 1PGW2 2R072 3MHZA 4I02A 5FZHA 4DQAA 1Q8PA 4XHBA 3OEAA 3SKVA 3WW2A 4QXKA 3PVOA 1MS1A 4FT8A 1ND2A 4W6WA 5SV8A 4XIKA 3BGAA 4P14A 2JKXA 5FMCA 3NNLA 1XNDA 4IXLA 2YBPA 1BK0A 1E5HA 3VHNA 4NHLA 4WM7B 4OHVA 4AI2A 1R1A3 3CNAA 1S2BA 1GQGA 4AAXA 5F9TA 2BGPA 2VAUA 2YGLA 4FOVA 3ZX7A 4Y20A 2BNNA 1QDCA 2VTFA 4WM8B 1YQCA 2R063 3MFAA 1ULPA 2OXBA 3NV2A 5FZGA 1S0EA 4CP1A 3UJOA 1RUD1 1PX3A 4M3CA 5F5QA 3VZNA 2EXKA 2JG8C 2JECA 3TEXA 5JZGB 2VXJA 4FTBA 1WD4A 3OTFA 4YVWA 4LA2A 3MI8A 3FMGA 5FMOS 2EXJA 3JBG3 5F7UA 3E6BA 4HKLA 4YZ3A 4LQRA 4HXCA 4N53B 2WIIB 1ULCA 5F3GA 2D6KA 2E33A 5T55A 3I3EA 1E5SA 2ZMKA 3AKQA 4XABA 3MBWA 2Z2SB 3VKOA 1W6NA 1CR7A 1P8JA 3R05A 3RFRA 4AK3A 4YG0A 5IJRA 4JHTA 2F4LA 2EXHA 5E89A 4ATEA 1IHMA 1GLHA 1VE0A 2EVXA 1S2KA 2RDQA 4M01A 1OVPA 4QX3A 2ZX2A 3N9PA 3RWKX 4BDVB 2PAKA 4I09A 3OEBA 1OUXA 3WXPA 3K4ZA 4GQ7A 1XU1A 1W8ZA 3GJBA 3H8RA 1XB9A 1OA4A 1W9WA 2XLFA 1ZBA2 2DCYA 1PZ7A 3VB9A 4YM3A 1JZ3A 1OPOA 3HR9A 1ZA7A 4LHSA 2ZZQA 2VCMA 3WY6A 1I9RA 3NRUA 3O1VA 3ABZA 4OI4A 3GJAA 4RYDA 2XJUA 1Q8OA 3DYMA 5E88A 3VBRA 3A21A 1A78A 4RA0A 4EWDA 5FUIA 2ZMLA 4EE2A 1CAWA 1TE1B 2RDSA 1SHWB 1RUI2 2VL4A 2XQXA 2VZRA 3E5XA 1NT0A 1W8NA 3KB5A 3O1TA 2A5ZA 3I2IA 3MW4A 4IE0A 1SLLA 4ASMB 4HBNA 2WLQA 4IESA 4MGKE 2WQ8A 5J1XA 3U07A 1UD1A 1ND2C 4Y22B 1XU2A 2HEVF 4N43A 3APBA 4CDUB 4SLIA 3AFKA 4Y1VA 2BU9A 5JOWA 2VQUA 1RXGA 3J8F1 1UMHA 1EPZA 5JIUA 1W9YA 3B7MA 1QOOA 3MIFA 3PUQA 3WX5A 4IEWA 1ZNPA 2PMWB 2BNOA 3MIEA 5CFCB 1ZRCA 4W4ZA 4WM7A 4PF5A 4XXAA 1X82A 4IQPA 1ZZ8A 3R0RA 4V2VA 1IPKA 1G9FA 3FBYA 2R042 3VD5A 4XXPA 1RGSA 1WMXA 5FYBA 5ISLA 4NIHA 2A3XA 3D82A 2IFWA 1WCKA 1ULFA 3PJQA 2YDEA 2JDZA 4K6BA 4WM8A 4D6SA 4YVWC 3Q8FA 4QKDA 2IVJA 2WZR2 3DYPA 4JDMA 2QUOA 5FYZA 4FPOB 1XPWA 1GQHA 1VJ2A 1FOD3 5JZGA 2E63A 4CA9A 2VMCA 1TQ5A 2GZWA 1UY2A 1LEDA 2J1VA 4JQTA 4UOJA 2B5HA 1UKGA 2HWD3 4V1PA 5AC91 4QB1A 4QHOA 3ZIWA 2QZ2A 3PU8A 5FYUA 1SBDA 3SLIA 1HRV1 3KCYA 3ZN6B 2XL9A 1LOCA 1R083 1UOJA 3JU9A 4HK8A 3QACA 4I0BA 3WF4A 2DUQA 1SLBA 3OBZA 1ONAA 3DCQA 4QU2A 5KR7A 3OGVA 5A6QA 5FMBA 1GZ9A 1YWKA 2OA2A 3KQRA 3IDAA 3S7EA 1O8PA 1IG0A 3PDQA 1DQ0A 3JB4C 1O3RA 3TNQA 1VIWB 3VBRC 3ZPYA 1QJY2 2W68A 1LOBA 4D69A 2BZDA 3T09A 4HPKB 3VBSB 5IVVA 4OHWA 4NWVA 4C1WA 4DY3A 3O0VA 4TLFA 3T0BA 3WP6A 4DEQA 4FTEA 2VOTA 4XMAA 3OSDA 5FLHA 1V6LA 2BYVE 4Q4X1 1TNFA 1MS9A 1REFA 4XUNA 3WLUA 2A1XA 5IFTA 4QM9A 3T2TA 3AKPA 2VM9A 2PFWA 4KWJA 1VB2A 2Y8KA 4QD2A 4IEQA 3ZDVA 3SHRA 1GWKA 5L9RA 1CZTA 3OD0A 1DGLA 2VGDA 3CQOA 4N43C 3N7JA 3VUOA 4Q4Y1 5K4LA 1XXNA 3I3BA 4Y22A 1VRBA 1A6CA 4CDUA 3FL7A 3KV4A 1CPMA 1W8UA 1VAKA 1JZ2A 1W2OA 1UAIA 2HWC3 2FQPA 4WM7C 1NE6A 3CJIA 5FWEA 1PO22 4HKOA 4XPVA 5HV4A 1AX1A 3NNFA 3ACGA 1OT5A 4XBNA 2WC2A 5BNNB 1AR72 3H8UA 1RUE1 4DXTA 4YZ2A 3WUCA 1H1IA 5DABA 2JE8A 2YPJA 5CFCA 2DUPA 4WM8C 1QJU1 4R8HA 3CL1A 2JB8A 5H9RA 3ZXAC 4XZPA 3ETPA 3TN93 2ARXA 2XDVA 4FAGA 3LDRA 3IIAA 5JZGC 1VBE1 1LTEA 5I0SA 3TEZA 5JR2A 2BRTA 1C57A 1W2AX 4KU7A 2OS2A 3PLQA 4Q4W1 3EO6A 3P3PA 1OPMA 4BCUA 4TWTA 4JKKA 1COV3 1LOEA 1S0FA 4YG6A 3I3DA 1C8M1 1MEC3 3R6SA 3MEPA 4HSLA 1HB3A 1V9U2 3ZFEB 2ES3A 3E5UA 2EIDA 3IT8A 4A7ZA 2W47A 1PIV1 2RR12 2D3RA 2WR9A 3LOIA 3R4SA 1REDA 2DBNA 4BQ3A 1LHVA 2WWUA 4IEOA 5A7WB 1CQ9A 5A3TA 4CCCA 4AQSA 3T08A 1H8VA 1Q5OA 1CWPA 1RYYA 5FFOC 2XONA 4QU1A 1CAUB 4NPMA 2PHFA 1I5ZA 2QQKA 1OKOA 3FX3A 4XFAA 2AEZA 1YQ2A 4PQ9A 1QQP1 3ASIA 4CUGA 1PGW1 4W50A 4NAOA 1O6UA 3MLLA 5C9AB 5LW9A 2D98A 1C3HA 3AZYA 1TEIA 4FPCA 2I74A 4V2WA 1H2KA 4AAPA 5DZGA 1GV9A 5JXIA 2VC9A 1WA4A 2OUHA 4HPKA 3ZFGA 3POYA 2TUNA 4E9KA 4Y1ZA 1G9CA 1HRI3 4PDWA 4LULA 5FYIA 2Q8DA 1U0AA 4OLLA 1U5XA 2NM1A 4LLFA 4QGNA 2ZGNA 4D8MA 1HQLA 1YLLA 3ENRA 4JRAA 3ME2A 4MHUA 1NLSA 1RUNA 2Y60A 4I01A 5GZCA 2QQJA 4YGCA 3T2PA 2RM23 3U0ZA 5IAXA 3N4MA 1TME1 4Z2WA 1O8SA 3MZHA 1V6KA 3AL6A 1LNSA 4CDUC 1WCQA 2AH2A 3OD4A 4RHV2 1VBA3 3GGLA 5BNPB 2EIBA 1W0OA 2JD9A 5AFEA 3MIDA 2BGCA 2XBO3 5GJ6A 4BK4A 3KT7A 1DLLA 5IK7A 1O4YA 4KNCA 4RL7A 1C8NA 2J1TA 1AR92 5CFCC 5KHGA 2HWF2 1OXCA 3AP4A 5F5CA 4CDQA 5CU1A 4FFFA 2FDKA 2GALA 2PHTA 2R32A 1ZZ9A 2ZABA 3ALQA 4PIYA 3WNXA 3H3LA 4Q2FA 5A1LA 3VDBA 1BBT2 1OURA 4GKYA 1CIYA 1UMZA 2J1SA 2GNDA 4OUSA 4C0BA 1D4M3 1AR61 3GCXA 4YW6A 1H2NA 3LWCA 3AYAA 4IEVA 3M2MA 4Q4V1 1EYBA 2ARAA 4AG4A 4QDQA 3UKNA 1TMF3 2DFCA 4NHYA 3MPBA 4MHRA 2G1MA 1ZREA 3NAPB 2X5IA 2O0OA 2RJ2A 4DXZA 3ETQA 2ZX4A 2A75A 4YFWA 4AOCA 4IEZA 1FI2A 1MACA 5C70A 4PLMA 5LA2A 5DAWA 3H8XA 1PVXA 3JUUA 4QX0A 4QXCA 3ZFEA 1RUI1 3VZOA 4OVEA 4Y26A 2VNVA 1JHNA 4QWNA 3IN9A 4AW7A 1K42A 1BVP1 3AZXA 3O1MA 1BXHA 1LCLA 3GZTB 3LFMA 5A7WA 4CZSA 3NNMA 5IFPA 3IM0A 5JOXA 1NA1B 2DFBA 2VW0A 3O1UA 1JH5A 1AYM2 5D2AA 1X33A 3GYDA 3TBDA 1JYCA 2ATFA 4OZOA 4XJUA 1O5LA 3ZFGC 3DPRA 1WGPA 4UW3A 3B94A 1W9TA 4QQPA 5JAXA 1FPN3 4PDWC 1UN1A 2VZ1A 1CJDA 4ZU4A 1GOFA 2A3WA 3NJXA 2CNAA 2Z4FA 3GM8A 1O59A 1V70A 1QJFA 1NG0A 2C5DA 5LB6A 3KV5A 1SFNA 1HN0A 4GB33 1D2SA 1WA6X 2UURA 2ZGRA 1RIRA 3AZVA 1RINA 4IE6A 4L2NA 1JI6A 1UZZA 1FMD2 3WG2A 3CIHA 1YFWA 4CP2A 4FI9A 3BTYA 2JJ6A 2WYSA 1OLME 5FZ9A 3LFIA 3R4DB 5BNPA 1FXZA 4LEJA 3MUY1 4CP0A 2LALA 3HOBA 2Q8CA 3WQ7A 2VMEA 5G04L 2A70A 4CDQC 2CDOA 4U36A 4QB6A 1S4CA 1NKGA 1JYWA 1G9BA 2ZA9A 4BQYA 1QU0A 4CXWA 2WFPA 5A33B 5BYNA 4KWKA 2ZPXA 3LEGA 3O1PA 3P3NA 4OI1A 3WT3A 1RC6A 2MEV1 4E27A 3RPQA 3ZYFA 1LEMA 4Q0SA 5GLWA 1ZZBA 3C7HA 1UZ0A 5DUUA 1QGLA 4MXWB 2X5IC 2GN3A 5FLJA 4EJRA 1V6OA 1GSLA 1SDWA 2W39A 3PUHA 2TBVA 3A0NA 1WCSA 3IPVB 4GH4B 3UK9A 1SZBA 1JXNA 3R4UA 2BV4A 3ZFFB 3ZFEC 3LA7A 1EAH3 1S0IA 2W94A 2RS53 3M3QA 4QHBA 4XJWA 2EALA 2YFUA 3CZJA 3RS6A 4AFBA 4CCLA 5FZEA 5HCBA 3THPA 2YFZA 1ZZCA 3N7KA 3USUB 2CY6A 3T2QA 4AVSA 3AP7A 5IK5A 2ARCA 2IXKA 4L0PA 3WG3A 4XJ9A 1NA1A 3HBZA 4LLOA 1LGCA 2CWSA 1NLQA 5KC5A 3S0MA 1AYN1 4DRRA 2GC0A 4BQ2A 3HEIA 4AL9A 1WCDJ 4Y5SA 1RHI1 2VO5A 4H7LA 1DCSA 5L73A 1PO21 4C8DA 4NIDA 4JTNA 3C7GA 5DZEA 5FBJA 3W5NA 4UFMA 4AXOA 4RR3A 2AACA 4IDZA 4Q0UA 4LORA 5KWRA 3V0BB 2J1RA 5CNAA 2VMHA 1CIWA 1W03A 5BNPC 3THTA 5E1RA 1S55A 3EB7A 2HWB3 3BIEA 5DAXA 2PYTA 4AEJA 4XUTA 1AR83 2A6YA 4S2FA 2PAEA 2VR4A 4TXWA 1UY1A 3USSA 1VMJA 3WVJA 2PLV3 4D0QA 3POEA 4EROA 5LZ6A 1W3VA 3I54A 3AMQA 4D7TA 4QKNA 1JZ5A 4PI2A 1VBB3 1ZZ6A 2I2SA 4MGZE 3WEZA 4D7YA 4HVQA 3TYJA 2ZEWA 1V9U1 2VNRA 2DYCA 3BIWE 3K77A 2WJSA 5T54A 5FPZA 2VPVA 3KGLA 1LHOA 4MUVA 5A7OA 2RR11 2NYYA 5A33A 2DCJA 3MYXA 3WQBA 3HQRA 1ZRDA 1UO9A 4ZU5A 2V5YA 2VUAA 4WBBA 1NCQB 1HV0A 4DUVA 1XYPA 3P6BA 2ZGQA 4GWMA 2DTYA 1RUF3 2ZEXA 4Y5Z0 3NNJA 3UJQA 4JZRA 4MXWA 2PHXA 5FIXA 4PI0A 1Y9QA 3ST7A 2JWPA 2VY0A 4BXSV 4GH4A 1YO8A 4UBHA 3EBRA 5F8PA 3H1WA 3ZYGA 1PK6B 1POV3 3ZFFA 3J8F2 4NIGA 1RUJ3 4AE2A 3VZMA 4R4XA 4AI8A 1FV3A 1H1AA 5CKMA 5DDJ3 4D3WA 1PO13 1UXZA 5IT6A 1IPJA 4EZHA 1SBFA 2LUWA 4K1ZA 3VBHA 1NA1C 4B1MA 1EV12 2W3JA 2E7TA 4AFDA 2K0GA 3USUA 4DEVA 1JZ4A 4IE7A 1U12A 3ZDSA 1W8HA 4M0NA 1MR5A 1D0GA 1FAYA 4CXYA 1LU2A 2RJKA 2NMNA 5FPVA 4ES9A 5FZOB 2D6OX 2WS93 4AVAA 2G9FA 3E1F1 1J3RA 1J1TA 1GZTA 1N1VA 4P5HA 1W8OA 4MGQA 5AC92 4NROA 4XCAA 1AR91 1NOVA 1V6IA 4BQ4A 1W6OB 3L2HA 4HL0A 1HRV2 3PVNA 2ADEA 3ZM8A 2A7AA 1PM4A 3Q8CA 4FSJA 4OYUA 3M4FA 1ZBA3 5F5IA 3FJSA 5BNOA 2VNGA 5T5LA 2N7GA 1XNBA 2E32A 3LIHA 2CDPA 1AZDA 3FHIB 3POJA 3RI9A 4DUWA 4AF9A 4AWDA 4ARYA 2R0HA 4UT5A 2WWJA 5I93A 3N9NA 3WDYA 1WMDA 1TZOA 4XHXA 3RSJA 4AYUA 4ZZ8A 4FPJA 5T5JA 2X05A 2LS6A 3KV9A 4YGDA 1IOAA 4XF1A 3BTAA 5C71A 1UX6A 3WDVA 2CAVA 4KL1A 3ZYRA 5B2GB 2VECA 2Z5WA 1XE0A 1LKNA 2JG9B 2K46A 2PELA 3AYEA 3AFGA 2GMPA 5FY9A 2P6CA 2Q8EA 1FOD1 5JI9A 1YEWA 3DKWA 5DZFA 2VTXA 3DEMA 3O12A 2XHNA 4S2DA 4XFHA 4DY5A 3N35A 4C90A 2HWD1 4Q8KA 1NAEA 2WFF2 3GHNA 5IUQA 4YVSB 1QWRA 2FZ1A 2VMDA 3LAGA 4UFKA 3V64A 4XZUG 3MV11 1AXZA 1SDDB 4IL7A 4WVMB 5FR3A 4XF3A 3T1MA 3FWEA 1DF0A 3KT4A 3PU3A 4GMP1 4URTA 5GLTA 3WNLA 4NOTA 5C8CB 3DGTA 3FHQA 4MX3A 4GH4C 2XVKA 4NPRA 4Q4Y2 4XJZA 4IGQA 2R49A 4LIUA 5ACA1 1URXA 3I2KA 3OY8A 4LA3A 2WWSA 2J1UA 3A0KA 3M3EA 1XOYA 2K9ZA 2VE1A 3O0XA 4Y33A 1HQWA 2P5BA 5F37A 5JPNB 5GZDA 2JENA 2R043 4A7YA 3SISA 1J3PA 2JG8A 4CU8A 1UL9A 4EWEA 3VBHC 1ODMA 4NMIA 5FP4A 4GA9A 3UL2A 3C7FA 2PHRA 2WZR3 1ZBE2 4AVBA 4TSVA 4AHZA 2H6CA 4BMEA 4C0HA 1Q43A 1HN1A 1RUE2 4PQQA 4B29A 4RSUA 2B9UA 1QJU2 3F95A
chains in the Genus database with same CATH topology
1CAXA 2K2SA 3ZIXA 4AI0A 1G7YA 4AQ2A 2D6MA 1VBE2 1OSGA 3HT2A 1Y43B 1WLCA 2KA3A 4Q4W2 2GC1A 4ZXKA 3NSTA 2BUKA 1YI9A 3RJ2X 3JCIA 1LHUA 1MVQA 2GH8A 5JSRA 3NKGA 5BNOC 1C8M2 3OYWA 5KHIA 3AB0A 4Z8BA 1WMEA 1PIV2 2R0FA 1OFNA 2ZS6B 1IS4A 1Y3TA 1QJY3 1HXS3 2GNBA 3JD73 1W6PA 4KGGA 3NVCA 4QPGB 1R1ZA 3W58A 1S1AA 3MW3A 1R092 3AP6A 4K3UA 1QQP2 3OBRA 2VULA 2IXLA 2E6VA 3B5LB 2CWMA 4OZXA 4FPEA 3V0AA 4NR1A 4MXVA 3ATGA 4AFMA 4RFT0 5GZFA 4FP2A 2XB6C 4WVMA 2DU1A 5JSOA 2OZJA 3M70A 1TME2 1PVC3 3DUIA 4YW3A 2KM2A 3VZJA 4BM8A 5C8CA 4E4ZA 3QCWA 3WV6A 3RDIA 4Y1XA 1PK6C 1VBC3 4GALA 1UKRA 2UWCA 3VZLA 1D2QA 4F3JA 2IXHA 2UYAA 1NCRB 3VZKA 3WINE 1XYOA 1FNZA 1CAVA 3ZMNA 1DHKB 3MICA 4IV3B 2AUYA 1GKBA 4AEDB 1AR62 3GNEA 2P3IA 4Q4V2 1VRH3 2RM21 4J1XA 1A3KA 4Q1PA 1BMV2 2Q4SA 2AR6A 2YZ4A 3CJXA 3WQ0A 3PHMA 2QDNA 2XBO1 3H7JA 4I0AA 1H30A 2CGPA 4K40A 3EJKA 3RRDA 1E57A 3E97A 1YUDA 4RQPA 4HT1T 4HSJA 4AGRA 4PLOA 5AFBA 4AVCA 1MZFA 4QPGA 4LO4B 1AL21 3C3VA 1NY72 3L9JT 4HKWA 4AFCA 2YY1A 2YGMA 4YNIA 4YW2A 4CRQA 4QPIB 3NWKA 1ZRRA 4W6YA 2XG3A 2ZGKA 3VLBB 1CJPA 2X29A 1T6GC 5CG9A 3MFCA 4INDA 1DGWX 4RHV3 4YVSC 5FTTC 2TNFA 5SV5A 4FAHA 1EV11 1O91A 4Y1UA 5C8CC 2BTVC 3ES1A 1IS3A 3ZXKA 4BPZA 3X29B 3ZVXA 5J3UA 4M3CE 1GYKA 1QXJA 4YM1A 2IZWA 2VVDA 1BBT3 1N3QA 4Q27A 1LHNA 5KXEA 1UU4A 3SH5A 1F8VA 4N53A 1VAMA 1FPN1 2WQZC 1MZ5A 4NVPA 5GZGA 3RG0A 1O5UA 4IETA 4S2GA 2D93A 2DUOA 2Q0AA 5CADA 4WZFA 1C1FA 1N3OA 4I0WB 3LA3A 4PBPA 4IV3A 2MEV2 2IC1A 4FPYA 3I59B 1BJQA 4LBMA 3NW4A 2VOXA 3TB0A 4AEDA 2QE3A 4DS0A 1Q56A 3AP5A 2PAMA 3PNAA 4F7ZA 2Z42A 3N7LA 3VKNA 4E4DX 4QQ2A 4RQPC 2WFF1 1BZWA 5HCAA 3ZN4A 4QPGC 2VNOA 5CBLA 4P9IA 5IK8A 1VBD2 2NPIA 2XH6A 4DRVA 4F83A 3B9CA 2WL1A 3JB8A 3VHRA 5H9PA 5JR7B 1QJX3 3B93A 2GDFA 4XQ4A 1ZREA 1CONA 4PLNA 1GZWB 2PQQA 4XJAA 5D8AB 1AYN2 3MF9A 4I2OA 1DQ6A 1ZYBA 4ORFA 1F31A 4CEWB 1DGWA 1SEFA 1ZX5A 4BIFA 1RHI2 1U5IA 1YIPA 2XLGA 4LHLA 5EV7A 3ZYJB 2JEMA 3AMHA 1O3QA 1ZBE1 3D8CA 2WA4A 2Y26A 4JAAA 1XNKA 2GNTA 4HANA 4DOUA 2RS51 1DYKA 4FP3A 2YYOA 4JTOA 2P2KA 1SLAA 2QZ3A 1R1A2 2MNGA 1SMVA 1ASJ3 2BVBA 1O4TA 2AZ5A 4R9CA 4XEZA 4Z82A 1ZVFA 1W39A 4I30A 2VVEA 4XBQA 2EA7A 2RS13 4LO6B 5A3LA 2R062 3RMYA 4N53C 5EYXA 4MZUA 3IWZA 1NCRC 4R4ZA 2F6BA 4D94A 4LO7A 3ZN6A 1WLTA 3INAA 3SH3A 4RGAA 4IV3C 1QJZA 2VU9A 4AEDC 2GC3A 5H9SA 1BKZA 1G86A 2VG9A 2CGNA 2XWJB 4AEKA 2H0VA 4B4QA 5HI0A 1R091 3CF6E 4Q1RA 1EPWA 5LRRA 4B3NA 2DVAA 3B00A 4WVVA 1ENQA 1BEV3 3WP5A 4EV0A 1RUH1 5CAZA 1AR81 4NO4A 1LECA 3PMEA 1YNAA 2A6VA 5KC6A 3VBSA 2PLV1 1LODA 3OPZA 1IS6A 1RUD3 3TRSB 4KGQA 1BVVA 2P3KA 2Q5TA 4L11A 2CL2A 2RHPA 1RUG3 1MZEA 2Z79A 1RMU1 1VR3A 1FV2A 2BEOA 1EP0A 4LHKA 1GICA 1WW5A 4Z1VA 2QFEA 4EN9B 1H2LA 4MV2A 4IEYA 1LR5A 3LSDA 2WINB 1RVF1 4CEWA 4Q0PA 2RJLA 1QMJA 2H6BA 3WCRA 5GM0A 5JDBA 4G4FA 5FREA 5EZWA 5BNNA 4Q26A 3CLPA 1XQNA 3FFQA 4HMZA 4PIZA 4N7UA 1F5FA 1PO11 5K9YA 1OFSA 3H7YA 1DZRA 4BLJA 5T5OA 1G9DA 2QQPA 1YFXA 1LOGA 1HX6A 1YI7A 5A32B 3RQ0A 4JGYB 4QGMA 3GZAA 1BMV1 1ULEA 3HQXA 5KHJA 1RUOA 4FVVA 3ZXLA 4B4PA 3OJBA 4E4SA 5JWPA 1FOD2 2VQ0A 3KS7A 1MVEA 2WS91 3IBMA 4FPGA 2HWD2 2XPJA 4KWLA 1H4HA 2VW1A 3O7OA 4CDWB 4LHNA 1R082 2RS31 2WQ4A 3SCFA 5BUVA 1CAUA 3OGJA 1NY71 3DL3A 4FPKA 1YHFA 4O9EA 1N1YA 5ACA2 3VBSC 5C9AA 3ECQA 4META 1OQDA 3H3UA 2SLIA 5JPMB 1POV0 2Q1ZB 2RMU3 4BWOA 4P9YA 4SBVA 4XBLA 3DN7A 5EWSA 3VBUB 3UKTA 3O14A 4YW1A 4XFIA 1WLWA 1LGBA 3GALA 4XFFA 3N3HA 4YYOA 3KCCA 2R1DA 4MH0E 2HWE3 5I8SA 5LEKA 2VMGA 4IEPA 2HEWF 1PZ9A 5AC93 1N1TA 1QKQA 1ULGA 2NMOA 3CU7A 1WMFA 1HRV3 1IKPA 3DV8A 2XL7A 2XJRA 4CTEA 1UF2C 4CEWC 1KJRA 3D0JA 3POWA 2XKOA 2D40A 2OZ6A 2AYHA 5BNNC 4J1WA 4OHZA 2UU8A 1HW5A 3PVEA 3VBFB 2YROA 2C9AA 1MS5A 2XWBB 3D4KA 1X7NA 2B7YA 2QCSB 4B7KA 5KHHA 1JW6A 2HKXA 2HWC2 3WW4A 2IFRA 2WSUA 3AKSA 3Q9OA 4WV8A 1S0CA 2DVBA 3MLKA 4R9AA 4B8EA 3EQEA 1LU1A 3IDCB 4Q4X3 3WG1A 3BCWA 5J7MA 4HN1A 1ENXA 4CYDA 5A32A 4JGYA 3KT1A 5E16A 2VOWA 4JVAA 3UV9A 2ZAHA 4QQHA 1B35B 1Z7S1 4QGLA 3NAPA 1L3JA 1OMIA 4BOWA 3GF6A 1LHWA 2EXIA 3W9AA 1COV2 5JOYA 2NP0A 4Q4Y3 4XETA 1GBGA 3BB6A 5BXXA 5J96B 2NZ9A 1UCXA 1VBD1 2ERFA 2PN5A 1Y7BA 2ZHLA 4LBQB 1JYIA 4CDWA 2Y0IA 5C9AC 3QLQA 1XRUA 1HXS1 1PNFA 1Q8QA 1RUE3 4H7MA 4AVVA 3RI8A 2E7AA 4XYXA 1NQJA 5CFDB 4KU8A 3ZXDA 1XE8A 3ZXFA 2GN7A 4KH9A 1VBE3 3ZXGA 3VBUA 1Q8SA 4Q4W3 5J09A 1F5JA 3ILNA 1CVNA 5DUWA 1BCXA 4GULA 4R9BA 3IMNA 5ABJB 4AGGA 3LCPA 1QHDA 1R1A1 1RUC3 2JXAA 4LE3A 1C8M3 2ARBA 1ENSA 2XVLA 4XIOA 4LBOA 2GNMA 3WUDA 2RM22 3BU7A 5JSPA 2R061 4AI3A 4X8PA 2XJVA 5K7PA 2D6LX 1AF9A 4FPFA 1HQNA 2A6ZA 2VUJA 1QH6A 5BPXA 2PHLA 3VBFA 2XBO2 1QQP3 3JBG1 2R073 1YYNA 2GAUA 1HKDA 2WNUB 2WZPP 4QM8A 4S2HA 4COZA 1ND3B 2RE9A 4GWNA 4RS5B 4XTPA 4JGYC 3CO2A 1VB4A 2DVFA 1AL22 1SACA 3NAPC 4OI2A 4NHMA 1UIJA 4UW6A 1C4RA 3WDXA 1D4M2 4CDXB 4IERA 3DF0A 4YZ1A 3WZ1A 3VKLA 1UPSA 1N47A 3IPVA 2V73A 1B35A 3I7DA 4DMIA 1XE7A 1VRH1 4X6RB 3ZSLA 4XE9A 4ITCA 4AI1A 4CDWC 3D6EA 1B09A 3RYKA 1OQ1A 4COYA 3M3IA 2WT1A 1GZCA 3A4UA 3ZSKA 2YMZA 3VL9A 2IXCA 1SCRA 2O1QA 4LUKA 4WZCA 3U11A 2DV9A 5CG8A 3VBUC 3M3CA 4FCAA 2CV6A 3J26N 1AR63 1QXRA 2CYFA 2O8QA 2GSYA 1FPN2 1YXWA 4Q4V3 4HLTA 3U4XA 4XDQA 3WOGA 3V0BA 4YGEA 3VBOB 2EF6A 3N36A 2D6PA 3K51A 4LR4A 3SCHA 1YJLA 5ABJA 3ILFA 1RJ7A 4GB32 1FATA 5IK4A 1LESA 2OUJA 2ZHNA 1RUI3 5FBZA 1HLCA 1TNRA 1OLRA 4MYEA 3IDEA 2FMDA 3VBFC 2BWCA 4KG0A 2ET7A 4XW3A 1SLTA 5I8YA 5CA6A 2I45A 1C5IA 4OUMA 2ENRA 1Z78A 2JE7A 1SFYA 3WCSA 3FLTA 1GNZA 2YV8A 1R081 1NCQA 3K48A 1ND3A 4RS5A 5T3NA 1LGNA 2GC2A 2A6WA 2WNVB 4NHKA 3PVBB 3RYRA 3B3QE 1B35C 1ND2B 3NV3A 1Q3EA 2EAKA 4CDXA 2WNEA 3FFZA 3B9IA 4XJ8A 1WW7A 3KM5A 4EN6B 1PK6A 2PA7A 4BHPA 5I0RA 1LOFC 2ZJCA 4TYSA 1QDOA 2P3JA 4JGZB 1QNYA 1YFYA 3E6DA 4Y20B 4YSFA 1DG6A 1NE4A 5GALA 5FPXA 4JV4A 1KJLA 1EAH2 4N9HA 4GKXA 2RS52 4MGIE 4M3CB 3AZZA 4NN0A 2XVGA 1H4GA 1ENRA 4CEYB 1OD5A 2ZBJA 5I8TA 5L7OB 4EN8B 5FAXA 5GLUA 1DGRA 3G6JB 2ZOEB 1W6NB 2OVUA 3UKVA 5FQ0B 3QH6A 1W6OA 1OI6A 4GIQA 4N7IA 4UW5A 4W6XA 2C0ZA 5ABJC 2HWC1 2HJIA 4BA6A 3VBOA 1QXPA 1JBCA 1C5HA 2GU9A 2QKDA 4IEXA 1G8WA 4PJYA 2X53S 2W0XA 3TN91 3WP4A 3NKTA 2ZGSA 1KRIA 5F6KA 3H0OA 1RUH2 5LK5A 3VBRB 4Q29A 1AR82 1M06G 1AJOA 3KGZA 3MGUA 2JG9A 1COV1 1RL3A 4IEUA 3KCXA 3ILRA 2PLV2 3VKMA 4Y4YA 5D1IA 5AVAA 5JLVA 4P9XA 1NCQC 1OQEA 1ND3C 1AYN3 4RS5C 4YVSA 1MEC1 3V65A 2WA3A 1PM7A 2Q1MA 3MPPG 4FQZA 2PHWA 5K8SA 1H8TB 4N43B 4BZ4A 1PO23 2ILMA 1RMU2 3WP3A 3FLRA 3URFA 4AHYA 4CDXC 5KXCA 2WNVA 3AKTA 1AR73 4FPHA 3V56A 1DU3D 2GMEA 3HN1A 4K1YA 4K21A 4XF0A 1UW8A 4UXAA 3H1YA 2G9GA 1OA3A 2OIIA 1RUF2 2LTNA 4BH9A 1RVF2 2Q8OA 3PMSA 2DF7A 1BEV1 1SQ4A 4A3XA 1DGRN 4JGZA 3NL1A 3KLSA 3I8TA 1S0DA 3S7IA 4JRLA 1S0GA 1RUJ2 1HRI1 1YJKA 2DVDA 4DFSA 1MQTB 4LBKA 5DDJ2 2XJPA 1PO12 2D3SA 2NN8A 1W6MB 5I0UA 1OLQA 1V9U3 3ZO0B 1DZQA 2VOVA 3FE5A 4G3YC 1S0BA 4MSVA 5T50A 1RUG1 4CEYA 3LB9A 2RR13 1FNYA 5L7OA 3NV4A 1UU5A 1FT9A 5EJ3A 1O7FA 1OHFA 1QY4A 1VBA1 1NYWA 4P9WA 2VXRA 4E2SA 1YFUA 3HWJA 1CN1A 4COUA 5FQ0A 2WS92 3VBOC 4ASLA 2BWAA 3FZ3A 5FO9B 5J36A 2DWRA 1WUVA 4COVA 1UZYA 4HFSA 3KMHA 2RS32 1MS0A 1W2UA 3M3OA 1C28A 3M1HA 3BOWA 2EIGA 3AM2A 3WX5A 1D4M1 1DQ4A 4QQOA 2JG9C 3HD8B 3BALA 2D43A 1H9PA 3I4IA 3GZUC 2W52A 1RITA 2B45X 1VALA 1NXD1 1TMF1 1H9WA 3ES4A 4MGYE 2C1FA 3AZWA 2XLAA 4LBQD 1J3QA 2I07B 1DQ5A 2BW8A 1CGPA 2R30A 2WNVC 3WDTA 4L99A 1AR93 1H8TA 2HWF3 1O3SA 1KFUL 3AJZA 1AL0G 3MF6A 3TAYA 1DDLA 1A8DA 2JICA 4K7JA 4M3CF 3GBWA 3OF1A 1J58A 1SBEA 3CJIB 4LTAA 3NV1A 2DCTA 4B7EA 4JGZC 5AVPA 3QBQA 2ZHKA 4DZGA 1ZZ7A 1GR3A 4W65A 4C1XA 2RMU1 1NCRA 1SLIA 1XYNA 2GH2A 4Y24A 4P9LA 4CEYC 1MQTA 1PGL2 4ISQA 5FOJB 4GB31 3SITA 2UWAA 5L7OC 4HVOA 1W6MA 2D3PA 1DIWA 2HWE1 3ZYIB 3M7AA 1MS3A 5TSWA 2UY8A 2NQYA 4FXGB 4R52A 2XJSA 1IS5A 2ZMNA 1V6NA 1Z7S2 5F6LB 4GMP3 4N9IA 1AYM3 2IXIA 1N3PA 3ZXEA 3TOJA 3LZZA 2VVFA 2IWGB 2ZX1A 3SNMA 2KXLA 5ACA3 5EYYA 3GHMA 4XTMA 2JD4A 1LRHA 1DZTA 4ZU7A 2PHUA 3ZN5A 3E5QA 2WKKA 1ZRFA 4QPYA 2XJQA 4LBLA 2XHKA 3JD72 1HXS2 3MIBA 3ACLA 5T52A 4QPIA 3ZFGB 4XQWA 4FOYA 3LGRA 1FMD3 4PDWB 3AKRA 1CESA 4GXLA 2W08A 2ZX3A 4Q0VA 1RJ8A 3PJYA 3AMMA 3OGGA 4XILA 4YZ5A 4XOGA 5KBFA 1UU6A 1EAH1 1H8TC 4BE3A 4ZKTB 4EN0A 1NLRA 3KZ4C 4FXKB 4F8AA 1F2NA 4Z07A 1LB2A 1AX0A 2ET1A 2G4IA 2PHDA 5FO8B 4JCKA 4NWWA 2ZGMA 5LEJA 1PVC2 3KSCA 4QQLA 3VDDB 4CDQB 4J6GA 2R16A 2BFUL 4AGVA 5DG1A 4QX5A 5HBAA 1C1LA 3NJZA 3AK0A 2A3YA 1VBC2 5JI7A 4K20A 4WVWA 1MQTC 3JBG2 4MLOA 3SMHA 3H9AA 4OHYA 4LNVA 2VQAA 3POSA 5DG2A 1HV1A 3ZSJA 3B02A 3H3ZA 2Y38A 1YRZA 2CAUA 4OULA 4EN7B 3I59A 3AMPA 2X5IB 5L36A 2B8MA 1D0HA 2HWB1 2QJVA 2UY9A 3AMNA 1RUC1 5JMCA 2VW2A 2ETEA 1HIXA 1JUIA 4XFCA 1VRH2 1DFQA 1KS4A 1REEA 2AGSA 2D5FA 3BODA 3HT1A 4I3PA 4QT6A 1VBB1 1JOJA 5L19A 2AREA 2YUEA 2WT0A 2E9QA 2R071 5FRAA 1UPIA 3IKWA 3O0WA 4QPIC 3DPRB 2WSVA 4YG3A 1SLCA 1GZWA 2EAAA 5D8AA 1VAVA 3IDBB 4A7KA 5CIRA 1RUF1 3ZXJA 3ZSEA 2QVSB 5FMOL 5J98B 1QH7A 1Z0HA 4FQ4A 2CGOA 5GLZA 1J1LA 3U10A 1PMIA 3L2YA 1K5MB 4COWA 2ZGOA 5JOZA 4LO8A 3WDWA 1POV1 1RUJ1 1LJ7A 1QF3A 5DDJ1 3VHPA 3SCGA 1KITA 4FOQA 3CJIC 3RNSA 1NZCA 2F4PA 1U5YA 2ZGLA 1WBFA 4UW4A 4PIXA 4FTSA 1PHMA 5FCCA 3VKFC 3TWIA 2LM3A 3QH7A 5C4WB 5CVRA 2VH9A 4UBGA 5HCFA 1DBNA 3MW2A 3ZYPA 3VDDA 5EXOA 4DB5A 2BQPA 4XMIA 1U5ZA 4U2AA 3HIFA 1KD7A 5LRSA 1AL23 4HK9A 4YFZA 2XKPA 3RWNA 3S30A 3FLPA 1W6QB 1VLNA 3EHKA 1IGOA 1JN2P 3FUQA 4LO5B 3PTYA 4LUMA 1RTVA 2JX9A 4AFAA 1PGSA 3N7MA 1ZBA1 1AXYA 3J8F3 4Q0QA 2H0BA 2D6NA 1ALYA 3BOPA 3JZVA 2B46X 5DXDA 3HAGA 1OA2A 3ROUA 2DCKA 1N1SA 1EV13 1X8MA 2VMIA 2P37A 3M8LA 2ZZJA 4ISRA 2WLPA 1MZ6A 1I3HA 4M0HA 5CB7A 3ZMOA 2E51A 1UIKA 5GKAC 3WR0A 1KQRA 3J4UH 2WT2A 1SCSA 3C2UA 3D0SA 3OBTA 2DCZA 5D8AC 3JQWA 4C91A 2ZGUA 3RYPA 5T5PA 1WBLA 2D5HA 2YXSA 3ZSMA 5FDBA 2XJTA 3BPZA 1V00A 2UWBA 3RJRA 1QJX2 2P17A 1WLDA 3TNPB 4RR3B 1X8EA 5GLVA 1RB8G 2R6QA 2XUMA 1LENA 1DQ1A 2MPFA 1K5MA 2R041 1QNWA 5I0TA 1LULA 1IZ3A 2TEPA 3AYCA 3VHOA 2BNMA 1PGL1 1KDKA 2WZR1 4A2UA 4L97A 4B4RA 4YM2A 1H0BA 2AENA 2XGXA 5KXBA 3RZZA 2WFF3 3TN92 3VDDC 5BV6A 4DPNA 3FUOA 4P9GA 1IQAA 4XF4A 1V6JA 2HEYF 5C4WA 4EWAA 2HYKA 3MLJA 1ASJ2 1JTZX 3NO8A 5FLIA 4BYYA 5F1RA 2OW4A 2ZKLA 2RS12 1YCIA 2OPKA 5DUXA 3WW3A 4L9BA 5JCTA 5E8AA 1FX5A 1W6QA 1KDMA 3LA2A 5BY5A 1MEC2 1QOTA 4BMBA 5J48A 3B01A 1I1EA 4Y1YA 4JDOA 4KQ7A 5I91A 1OOPB 1X36A 4FO9A 4YGBA 1EY2A 2DTWA 3AP9A 1NXMA 1QJY1 3JD71 4IV1B 1ZBE3 1MS4A 1IKQA 1QJU3 4H14A 1PNGA 1GANA 4XFBA 3VBHB 1BEV2 5C33A 2E7QA 1LOAA 3I2DA 3DPRC 4FPLA 3VGIA 1HRI2 4H3WA 5K0UB 5J37A 4R9DA 1RUD2 4O9GA 3FC0A 1XNCA 2BVVA 4JDNA 4DINB