1NCQB

The structure of hrv14 when complexed with pleconaril, an antiviral compound
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
255
structure length
255
Chain Sequence
GYSDRVQQITLGNSTITTQEAANAVVCYAEWPEYLPDVDASDVNKTSKPDTSVCRFYTLDSKTWTTGSKGWCWKLPDALKDMGVFGQNMFFHSLGRSGYTVHVQCNATKFHSGCLLVVVIPEHQLASHEGGNVSVKYTFTHPGERGIDLSSANEVGGPVKDVLYNMNGTLLGNLLIFPHQFINLRTNNTATIVIPYINSVPIDSMTRHNNVSLMVIPIAPLTVPTGATPSLPITVTIAPMCTEFSGIRSKSIVPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords COAT PROTEIN VP1
publication title Structural and virological studies of the stages of virus replication that are affected by antirhinovirus compounds
pubmed doi rcsb
total genus 53
structure length 255
sequence length 255
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2002-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1ncqB00
2WS91 1QJX1 2RS11 5CFCA 2TBVA 1QQP3 1HX6A 1PGW2 4JGYA 5L7OC 2IZWA 5BNNA 1AL22 1ASJ3 1C8M2 1H8TC 1B35C 1QQP1 1ND3C 1VBD2 1RUF3 3ZXAC 1AUYA 4CDQC 4GMP0 2WFF3 1RMU3 3VBUC 2R072 4FTEA 1RUF1 5D8AB 1NA1C 4FTSA 3VBRB 1X33A 3TN91 2XBO3 1V9U2 1EV11 2WZR3 4Q4Y3 5D8AA 1RHI2 5A32B 1DDLA 4Q4X3 1RUJ3 3VBRA 4CEYC 1QJZA 1F2NA 4QPGA 1MQTB 2RS32 1BMV2 3JBG2 5A32A 2MEV2 1VRH2 4Q4X1 1AL23 5BNOC 1C8M3 1VBD3 4RR3A 1PIV2 2HWD3 1RVF2 1MQTA 3JB8A 1RUC2 2HWD1 2R041 4N53B 3VBFA 2HWF2 1POV0 1RUI3 1V9U3 1NOVA 1RUE2 4CEWC 2PLV2 1AR92 1RHI3 3FBMA 1M06G 4YVWB 1FPN2 1HRV2 1RUI1 5DDJ1 3NAPC 1QJU2 2RS33 4WM8B 3CJIC 3JBG3 2MEV3 1VRH3 1Z7S3 1AR63 4RQPB 1PIV3 1RVF3 2RS31 4PDWB 1NCRB 1RUC3 1VRH1 2RS51 4CDWC 5K0UC 5C9AC 1Z7S1 1AR61 1RVF1 4YVSC 4PDWA 2BUKA 1NCRA 2HWF3 3DPRC 4N43B 3LOBA 2BFUL 1NCQB 4CDXC 1VB4A 1RUD1 1VBB1 1AR93 1HXS3 2X5IC 2HWF1 4GH4B 1BEV2 2ZAHA 4GMP3 1F8VA 1ND2C 1EAH2 3VBOB 5C8CB 4AEDB 1K5MC 5CFDB 3VBHC 1QJU3 1HXS1 4GH4A 4GB33 5BNPC 4GMP1 5C8CA 1VBE1 3VBOA 5FMOL 4AEDA 1PGL1 1ZBA1 4FTBA 3ZFFC 4GB31 1VBC1 5JZGB 1H8TB 1FMD2 1GFF2 1NY72 1R1A2 1PVC2 1AYM1 4CDQB 1OOPB 1D4M3 5AC91 4Q4W2 1PO22 4QPIA 4CDUB 5JZGA 1CD3G 1NA1B 2WLPA 4CDQA 1OOPA 5ABJB 1EAH3 4CDUA 1D4M1 1AR72 1NA1A 1HRI2 2HWE2 3JD72 3J8F3 4Q4V2 4JGZC 5ABJA 2VQ0A 4CEYB 1POV3 1ASJ1 1TMF2 2Y26A 2HWC2 3J8F1 5BNOB 1FMD3 1POV1 4IV1B 1R1A3 2WFF1 1PVC3 1RMU1 5LK7B 1WCDJ 5J96B 4Q4W3 1PO23 1FMD1 4IV1A 2XBO1 5CFCC 1E57A 2WZR1 4Q4Y1 2ZZQA 4JGYC 4IV3C 1RUJ1 1AR73 1HRI3 2HWE3 1AR82 3JD73 1VAKA 1RUH2 1PGW1 4Q4V3 2RM22 3HAGA 1AL21 5ACA2 1AR71 1C8M1 2R073 2HWE1 2RR12 1VBD1 3ZFEB 2R071 5K0UB 4N53A 5D8AC 3ZFEA 1CJDA 1ZBE2 4YVSB 1V9U1 1IHMA 4QPGC 1MEC2 2FZ1A 1RHI1 3ZFGB 4LLFA 5C4WC 4YVWA 1AR83 4YVSA 1RUG2 2RM23 4RR3C 1BMV1 4WM8A 1MQTC 3JBG1 3ZFGA 2MEV1 1K5MB 1PO12 5ACA3 4RFT0 2RM21 5BNPB 4RQPA 1PIV1 3VBFC 1RUC1 1K5MA 5ACA1 4RHV2 4RS5B 1RUE3 3ZFFB 2R062 5BNPA 1AYN2 2PLV3 1HQNA 5FMOS 2BPA2 4NWVA 1ZBE3 1FPN3 4N43A 1HRV3 2HWB2 4RS5A 1BBT2 1FOD2 1QJY2 1NCQA 1RUE1 3VBSC 3ZFFA 1MEC3 2PLV1 1AR91 2RMU2 1FPN1 1HRV1 2FZ2A 1QJX2 1RUG3 5CFDA 1QJU1 5L7OB 1PO13 5A33B 1RUG1 1B35B 3VDDC 1ND3B 1QQP2 4JGZB 4PDWC 5L7OA 4NWWA 1NCRC 4RHV3 5A33A 3VBUB 1H8TA 1B35A 2R063 1ND3A 1AYN3 4JGZA 1RUF2 1C8NA 1BEV3 1X36A 2HWB3 1BBT3 3TN92 3VBUA 1QJY3 4SBVA 2GH8A 2DF7A 1AYN1 1EV12 1BEV1 1R082 2RMU3 1TME2 1EAH1 1QJX3 1QJY1 3VBOC 4AEDC 1RB8G 4IV3B 4Q4X2 4CEYA 2ZTNA 1AL0G 4IV3A 4WM7C 5BNOA 3S6PA 4QPIC 5JZGC 1NY71 1R1A1 1PVC1 2HWD2 2R042 1OOPC 3TN93 4Q4W1 1PO21 4CDUC 1W39A 4CEWB 5BNNC 1EV13 1NG0A 1R092 1R083 1TME3 5ABJC 1RUI2 5DDJ2 4CEWA 3NAPB 4QPGB 1TMF3 1HRI1 3JD71 3CJIB 2HWC3 1R081 1TME1 5C4WB 4Q4V1 4Y5Z0 3NAPA 1TMF1 4RR3B 3CJIA 2HWC1 4CDWB 5C4WA 2RS52 1OPOA 5C9AB 4IV1C 1Z7S2 3VBRC 1AR62 2R043 3VBFB 3DPRB 4CDWA 1COV2 5K0UA 3JB4C 5C9AA 4Y4YA 4CDXB 1R093 1RUD2 1VBB2 2X5IB 3DPRA 1RUH3 2BFUS 1ND2B 5DDJ3 3VBSB 4CDXA 3VBHB 1R091 1AR81 2RR13 2X5IA 1HXS2 1RUH1 1VBA2 4FSJA 1ND2A 3VBSA 1VBE2 1PGL2 3VBHA 1ZBA2 2RR11 5GKAC 2RS53 4GB32 5FOJB 1VBC2 4N53C 3VDDB 3ZFEC 5J98B 2XPJA 1AYM2 1COV3 2BBVA 2QQPA 5AC92 3VDDA 1ZBE1 4YVWC 1RUD3 1VBB3 2WS92 2RS12 1COV1 1MEC1 3M8LA 3IDEA 4WM8C 3ZFGC 1D4M2 4EJRA 1A6CA 1VBA3 4RQPC 4Z92B 1VBE3 1PO11 4BCUA 1ZBA3 1ASJ2 1VBA1 1OHFA 3J8F2 1VBC3 4RHV1 4N43C 2WFF2 4RS5C 1FOD3 1RMU2 1AYM3 4WM7B 1NCQC 2R061 1SMVA 1VB2A 2GSYA 5AC93 4QPIB 4GH4C 2HWB1 1BBT1 2WS93 2XBO2 1FOD1 2RS13 5C8CC 5CFCB 4WM7A 2WWSA 5CFDC 4JGYB 2WZR2 4Q4Y2 2RMU1 5BNNB 1RUJ2
chains in the Genus database with same CATH superfamily
2DUPA 2GU9A 5B4NA 1QJX1 3GDBA 3VZNA 5J3UA 4ZPIA 4O65A 3KV6A 3SXWA 3TNQA 1BXHA 2IVIB 3I3BA 3C7FA 1XNTA 4JTNA 1DGWX 1AL22 2CU5A 2ZKNA 4L2NA 2W0XA 1UL9A 4XFHA 1L7RA 1ND3C 1NE6A 4DUWA 2ZGKA 1VBD2 2W39A 5CVRA 3ZXAC 4IW3A 2TNFA 1AUYA 1SLIA 4FPOB 4CDQC 2R6QA 4GMP0 2WFF3 5F3IA 5FWEA 1J59A 2W68A 3WLUA 2R072 4Q8KA 2UURA 3OJBA 1DU3D 2R16A 1W28A 1QXJA 1NA1C 5D8AB 4A45A 5C4WB 1CVNA 4RFRB 4YRDA 2AEYA 4NAMA 4AQ2A 1W6MB 4DNYA 3DL3A 4UW6A 3TN91 1VMJA 1ULEA 2JEMA 5F7UA 4UFMA 1EV11 2WZR3 4Q4Y3 1O91A 1RYYA 1YQCA 3N7JA 1DDLA 4NIHA 4Q4X3 1JU4A 2PAMA 3LF7A 4LNVA 4WVMA 3VBRA 1U0AA 4CEYC 4BIOA 1LHWA 4BH9A 2VZPA 1SDWA 4Y1VA 4XAEA 4AHYA 1MQTB 5FP9A 4LBJA 2VZRA 5CB7A 2OZJA 3P3PA 4N7IA 3N9OA 1O3QA 2C1FA 3AP6A 4IGPA 1C8M3 3CDZB 5I8TA 3NV2A 4Y26A 5GJ6A 3SMHA 1E5HA 3B9IA 4RR3A 1PIV2 1GOGA 5JSPA 5DZGA 1S55A 1C3HA 3JB8A 2ZX4A 3OPWA 1S0BA 3H8OA 2VQUA 3PNAA 5LWBA 1IQDC 1XYPA 2C0ZA 1WCSA 2ES3A 2BU9A 3I54A 4YZ1A 1XE8A 5IVEA 3V0AB 1IQAA 3H0OA 3I3EA 4FPLA 2X29A 4N53B 5T5OA 3K77A 2WRAA 1U5XA 3EB7A 2P6HA 2P3IA 1V9U3 3EMRA 4BK4A 2WQ4A 2X8KA 4OI2A 3VZMA 4CEWC 1L7LA 4AFMA 5GLZA 3I2OA 3MLKA 4FPGA 4LBMA 3F2ZA 3MIEA 4BOWA 3FBMA 3ZXLA 1SLAA 2IXHA 1P8JA 1HRV2 2YMZA 1W03A 3HQUA 4D69A 2VZUA 5DABA 1ODNA 4E4ZA 2A6YA 4UAPA 3WQBA 3OPZA 5FYVA 1OFSA 2JDYA 4OMCA 1V00A 4ARYA 5F37A 1ZX5A 4AGRA 1GP5A 1S2EA 2XGXA 5FMCA 3ZMNA 1RVF3 2QDNA 4CUGA 4PDWB 1SPPA 2ZKLA 4AI0A 1RUC3 1PMHX 5K0UC 1KDMA 1LHOA 2IXJA 3AL6A 4JX0A 4TLFA 1S0IA 3HT1A 4W8JA 4RN5A 4B4PA 3VB9A 1Q8PA 3MFCA 1Z7S1 1HB4A 5FO8B 2Y33A 1J3RA 2BJSA 2BUKA 2HWF3 3DPRC 4N43B 2BFUL 2JG8C 2VUJA 3FX3A 5EQUA 5JXJA 1LESA 1RUD1 1D0GA 4XEZA 5F32A 2D6OX 4D3WA 3GHMA 2BGOA 3DXUA 3RFRA 1F8VA 2VNVA 5JIUA 3ZN5A 1MPXA 1QJU3 1WW4A 2C9AA 2XWJB 2ZPXA 5FPLA 4QDQA 1W8UA 3FLTA 4A3XA 3RZLA 4RGAA 5C8CA 2NMNA 3VBOA 4LOSA 2DUOA 4NHYA 3TWIA 5BNNB 5HPOA 4OQ9A 3KV9A 4J25A 4EE2A 1CAWB 4Q1RA 1UWWA 1DGLA 2WO1A 4GB31 4XYXA 4D8MA 1RIRA 2VZQA 4GALA 2GNBA 3CHXA 5CYYA 1CX1A 1PVC2 2YV8A 3IPVA 4MGQA 2XVLA 3EBRA 3PVBB 4CDQB 1JZ5A 4P08A 2LW8A 1ZVFA 1S0FA 3M7AA 1JXNA 4MV2A 4JDMA 2QNKA 3PUIA 4K6BA 1CD3G 1NA1B 2ATFA 5IVJA 2RJKA 2I74A 1OOPA 5FOBB 4FCAA 3MHZA 4Q27A 2HYXA 1YIFA 1LOGA 3ES1A 2A6WA 2ZGQA 5I8SA 5I93A 3L2YA 2J1TA 3WP4A 1CAXB 2A3YA 1HRI2 4QU1A 3PMSA 3J8F3 3U1XA 4JRAA 2QBXA 2D6MA 4JGZC 2W52A 1LB2A 4CEYB 4R9BA 1WLCA 3WHUA 2NQYA 4UFKA 1UZWA 4Y1ZA 5A3UA 1HJGA 5HXMA 5FZOB 2E51A 2WC2A 5FFOC 4IEOA 4CXXA 3UESA 4COYA 2HWC2 1OVPA 5A3PA 4ZU7A 2FD8A 3ENRA 5KHGA 1POV1 3K3NA 4ATFA 2WFF1 4BU2A 1ULCA 4YW4A 4IL7A 1LHNA 1H0BA 4XIKA 5GLVA 5CG9A 2PXJA 4C90A 2XB6C 3B94A 3PURA 4R4XA 4E2GA 5J96B 3ZYRA 1OURA 3I2JA 4Y33A 1YXWA 2BQPA 3LKJA 3KB5A 3RMYA 2BNOA 1LCLA 5JOWA 1YFUA 5CFCC 5LA1A 4PF1A 3OG2A 2WZR1 1G8WA 1W6PA 2ZZQA 4Q4Y1 3EQEA 5FPUA 4MHRA 5ANQA 4GA9A 2QZ2A 2YU1A 3BN6A 3NL1A 3OUHA 4H7LA 2GC1A 4E2SA 3TRSB 3DUIA 1JYXA 3M1HA 4E4HA 1NX9A 1JZ2A 2F6BA 4IEPA 5ACA2 3BVCA 1W05A 1C8M1 4IE0A 3N9LA 5JOXA 2E6VA 4XTMA 5EYYA 5IUQA 5FYIA 5AVAA 3VD9A 1TNFA 2H6CA 2GAUA 4OULA 4TN7A 2K46A 3PTRB 3NNLA 4ZHNA 3NNJA 4WZFA 2Q0AA 1IOAA 3HNBM 3LEIA 4NE9A 2Y6GA 3D5OA 3AX4A 4CP1A 5K0UB 1X9TA 3ZSLA 1D2SA 1SEFA 3HOBA 1WZXA 3VHNA 3MV01 1LGBA 2DCKA 3ZFEA 2HEVF 4BHPA 3BCWA 4DXRA 4IE7A 2ZX3A 3ZX7A 4B4RA 3KMHA 1V9U1 4B8EA 3AMNA 5FKBA 1I5PA 2WZ8A 1DGRA 1MEC2 2FZ1A 2JG8B 3ZKYA 4LLOA 4FPYA 5C33A 2VTXA 1MS0A 4YVWA 3N9QA 2RDNA 3UKNA 2A6XA 1NLRA 2JD9A 3O1OA 1SFYA 2JX9A 1LNSA 1S0EA 5E89A 3WCRA 1BMV1 2WNUA 4UF0A 1O59A 1SLTA 3J26N 4IERA 4WM8A 4AEMA 4LIVA 3HVDA 3ETPA 4CCCA 2ZJCA 1U5IA 4COZA 2BGPA 3WP3A 4BDVB 1ULPA 5F2WA 1OPMA 5K4LA 5A6XA 4OQ8A 1DQ6A 1RUC1 3NKGA 2A6ZA 4K8RB 5ACA1 1KD7A 1SG3A 4RS5B 1ULGA 4OI0A 3IAQA 2FQPA 4CU6A 3POSA 3PL0A 5BNPA 5EFUA 5HCBA 1AYN2 4HSJA 5LEKA 1ZREA 1JBCA 1QXRA 5FMOS 4ES9A 1S0JA 3NJZA 3MGUA 4NWVA 1SCRA 2Y0OA 3RZZA 1B09A 3LEMA 3BU0A 1QJY2 1NCQA 1YQ2A 1N1YA 3C7HA 5HCFA 5CADA 2VBDA 1KJRA 5JPMB 1XB9A 1C1FA 4I01A 4URAA 5DN2A 1UYZA 1HB2A 3N3HA 4F7ZA 1H8VA 4BQYA 1VP6A 1RUG3 3T2OA 3IN9A 1NQJA 1QJU1 2E32A 3FN9A 3GBFA 1QWRA 2B8MA 3RI8A 1E5SA 4CYDA 1PO13 4M00A 1HQWA 4Y5SA 1AJOA 2WA4A 1FNZA 2DFCA 4EN9B 1LHUA 4Z1VA 4BXSV 2VMEA 1W2OA 3LDKA 4JGZB 3HPNA 4YW1A 2XG3A 4BIFA 5I91A 2D6LX 3VD4A 2ZGMA 3D4KA 5FXZA 1MZFA 1JYNA 3K3OA 3ZPYA 4G4FA 2VVDA 1LOCA 1M4WA 4CCMA 5JWPA 1BEV3 3C7GA 4BXFA 2HWB3 2OQ7A 4LIUA 3VBUA 3PJYA 1HV0A 1PX4A 5FCCA 3RZKA 3WUCA 1AYN1 1HKDA 1NXMA 1JTZX 1CAUB 1BVP1 3AZXA 1SHWB 3MFAA 2RMU3 1R082 5FYHA 1TME2 2D44A 2LM3A 3VKLA 1AXZA 1DLLA 1OLMA 3AB0A 4MXWA 1GSLA 4W50A 4Y22A 1QJY1 3ZXEA 3JUUA 4OZXA 4GULA 4XFBA 3BTYA 3HEIA 1RB8G 1ENQA 2XJVA 4E27A 1W6QB 2D93A 3GXUA 3I8TA 1CZVA 3ON7A 4P9WA 3OB8A 1VALA 2ARBA 2FCUA 1NZIA 1YJKA 2C5DA 5EJ1B 2B9UA 3POFA 2ZGLA 1GZWB 2AH2A 3I97A 3S6PA 5BUVA 5FY9A 4N8MA 5JZGC 2MHFA 4I09A 4GWJA 3SCHA 4FAGA 4FPFA 4AVTA 1Q5OA 2HWD2 3MPBA 1EPZA 4QT6A 3BTXA 2CYFA 1D0HA 3PVNA 2Z5WA 2P17A 2BV4A 3POYA 4KGQA 1ONAA 5BNNC 4CU8A 2A70A 2ZX0A 3GNEA 4LBOA 1IPSA 4UFLA 2GNDA 4MADA 4XUQA 1UNBA 3AP9A 1GWLA 5CG8A 5B2GB 1W3VA 2YZ4A 2VCMA 3NAPB 4BQXA 4P9LA 4C1XA 4RGGA 1R081 4G3YC 5FZMA 1TME1 3HD8B 4NRMA 5A1FA 2ET7A 4M4PA 4XCAA 4XVHA 5JUVA 2EXIA 4BQ3A 2E26A 3AKTA 3N9NA 3MW3A 1TMF1 2HLEA 2O8QA 1DQ4A 3APBA 4H2AA 2VNOA 1OF3A 1MS3A 2X10A 2RS52 4HG6B 4IE5A 2DTWA 2CWMA 5C4WA 5M0TA 4BQWA 2XJQA 4M0NA 1OPOA 1H2LA 5C9AB 1U12A 3R05A 5DUUA 3I4IA 1YRZA 5E88A 1AR62 3KGLA 5FYTA 3V0BA 2VMDA 3ASIA 2IFRA 2VG9A 3HIFA 3OY8B 3VL9A 1SLLA 2CAVA 2VMGA 5IVYA 3GBGA 4Y4YA 1V70A 1VRBA 2QQUA 3THCA 3CIHA 1VBB2 2OPKA 4QXCA 3SEPA 2YPJA 3WV6A 2W1QA 2BFUS 3ELNA 3AZYA 4A42A 4DEVA 1ND2B 3WT3A 5DDJ3 1NAEA 4Y1UA 4CDXA 4YWAA 2QZ3A 3VBHB 4D6QA 2BP6A 3SCFA 2RR13 1MZEA 2W9XA 2X5IA 1HXS2 1RUH1 2VOVA 1Q8QA 3OBAA 2WNEA 4WVWA 4MLOA 3WG1A 4I02A 1GANA 2B5HA 5EJZB 4AZZA 2O0OA 3MLLA 3VBSA 5GLTA 1E5IA 1VE0A 4V2WA 4E2QA 3FMGA 2VZSA 1HW5A 3VL8A 5DUWA 1BKZA 5FPAA 4QQPA 1VBC2 1U5YA 1IS4A 1UCXA 4XBLA 5FYBA 5LY2A 2JDMA 5JXGA 3O1UA 5FZ9A 5KWRA 1JZ6A 1MZ5A 3AJZA 1JZ7A 4ZZ8A 1COV3 3VLBB 1JUIA 2WN2A 3CJXA 1XNBA 1QHDA 2QQPA 2ZHNA 2EAAA 2CAUA 3VDDA 4ZKTB 1CAVB 4GWIA 1RJ7A 3X29B 2VXJA 3R4SA 2WS92 4YNIA 3WNPA 4KWLA 3KCCA 4LHKA 3OPTA 2JECA 4AGVA 2ENRA 1WWYA 4ORFA 3KV5A 1OQDA 1D4M2 3O0WA 3WF1A 3W21A 2DVAA 1A6CA 4QDRA 4Y20B 1DP0A 1GP6A 2I07B 2WWJA 4XZUG 3WNKA 1KS5A 1VBE3 1O5LA 1PO11 2CDPA 4GWNA 4WVZA 2Z79A 3J7HA 4ASKA 2AZ5A 4LKSA 2Z42A 5IAXA 4AI2A 4L0PA 3TEWA 1ASJ2 3WP5A 2VNGA 2WT0A 5FZFA 4AI3A 3IWZA 4CSWA 3M3OA 1OD3A 3ZVXA 1UN1A 1N3PA 1RL3A 4CUBA 4JKKA 1AYM3 3O0VA 2ZGSA 2KM2A 5IVVA 5G04L 5CISA 5ERLA 2QCSB 3NW4A 1Y9QA 3NWKA 2PHTA 2HWB1 1LJ7A 3R0RA 5AFBA 2BTVC 5CEHA 2XKOA 4I3GA 5A80A 1U5ZA 4FBFA 4MSVA 1MS8A 2RMU1 2CGNA 2ZX1A 1RUJ2 3LEKA 4COUA 3DEMA 2WS91 3MIHA 4M01A 5FP3A 5GZDA 5T54A 4D6SA 2TBVA 5FZIA 5F8PA 1GQGA 1QNWA 1PGW2 3ACGA 4JGYA 3ZM8A 4CCOA 4XTPA 5L7OC 4S2GA 4HT1T 2HH9A 4INDA 4XBQA 5EP9A 5JVVA 1YO8A 3J9SA 4QPYA 4FO9A 2VCAA 1B35C 1QQP1 3CL1A 2VOXA 2QQJA 4DO0A 2WAOA 3S30A 3H8UA 3MDPA 1DQ5A 3GZUC 3IT8A 3QH7A 3KHCA 3WG4A 4AR2A 1RMU3 2PHDA 4EQVA 4BQ1A 2J7MA 3IKWA 1RUF1 1SFNA 1UMHA 2Z4FA 1ENRA 2JKBA 2YDEA 1LAJA 3MICA 4YLZA 1C5IA 1LHVA 3ZDSA 4XILA 1QNYA 1D4VB 5J1XA 5D8AA 1RHI2 1W06A 2GP5A 5A32B 1N1SA 2V09A 1W6MA 2ZZJA 3V64A 3LA3A 4AI8A 1QJZA 1W8OA 1LGNA 1DZRA 3RS6A 3PMEA 3MI8A 3ZXJA 1JZ4A 1BK1A 1F2NA 2E9QA 4XF1A 1W2NA 4WVVA 3M2MA 5FZKA 1A3KA 4GXLA 4Y3OA 3JBG2 4PBOA 4NN0A 3POIA 4XFFA 2NM1A 1AL23 4N9IA 3SHRA 3ZXDA 2EIEA 4O9EA 3ZO0B 3I2HA 4EV0A 2VZOA 3USUB 4LJHA 1UQXA 1VBD3 4MOAA 4IE4A 4JQRA 1MQTA 1H1AA 4AHZA 1UOBA 4YFWA 5IFPA 1DGWA 3W20A 5FUIA 1UY0A 2DU1A 2QQMA 1XSRA 4YW3A 4SLIA 5K9YA 5IVCA 4PI2A 3S5AA 1ZA4A 2VUDA 5T55A 4K9SA 1OKOA 3ZLIA 3LD8A 4XDOA 2EXJA 3KT7A 1XU2A 1ZA7A 4B4QA 1RUE2 1OBNA 3T08A 3V0AA 1CPMA 2VM9A 1WW6A 2PLV2 4K20A 5T5PA 1AR92 5HV0A 3FBYA 2YC0A 3UJQA 3N7LA 2JDKA 1FPN2 4YW2A 4L99A 1RUI1 5DDJ1 4HPKB 4LPLA 4NRQA 3MUY1 3P1IA 4XF4A 4KWKA 3CJIC 4QM9A 3ZYBA 5FPZA 3ZYFA 4LBLA 4XFIA 4LUMA 4B29A 1VPHA 1ZRCA 2VAUA 4XPVA 1Z7S3 4QXKA 5A7WB 2WO2A 1LOFA 1PIV3 3LPFA 5L19A 3M3QA 3ECQA 3SEEA 1NCRB 1K45A 4CDWC 3K51A 1BVVA 4URTA 2VPVA 4ITCA 1W8FA 3H1YA 5FJHA 1OFNA 1YUDA 2JG9B 4YVSC 5KR7A 1PM7A 4PDWA 2OXBA 3TAYA 4ZZ5A 2WSVA 1AJKA 1XU1A 5JI9A 1D2QA 4XIOA 3OTFA 2P37A 2XUEA 2VOKA 2Y64A 3KHBA 3U0ZA 2ZAHA 3Q8AA 4KMQA 2EIBA 4X8NA 4Q1PA 4C0HA 1EAH2 5FLJA 1F31A 2SLIA 4Q0UA 4AEDB 4CCLA 1YLLA 3T1LA 2DBNA 1WD3A 3F95A 1J84A 5I0UA 4BMBA 1OLRA 4GB33 2J22A 2SBAA 3P3NA 5GZGA 4CZSA 1I9RA 4GZ9A 1VBE1 5LASA 5FMOL 3UK9A 1PZ8A 5HXVA 4AQSA 3HQRA 2OS2A 1K12A 1MVEA 1W9SA 4XUNA 3ZFFC 4I0WB 3PUAA 2VR4A 3LCPA 2P2KA 1GKBA 1URXA 4CCNA 4ZU4A 2J1SA 5FPVA 1PZ7A 1G9AA 1FMD2 1QEXA 3DYOA 1UZYA 1NY72 3H8XA 3DV8A 4FPHA 4CA9A 2ZMKA 2C24A 2HJIA 2YROA 4PBPA 1AYM1 1CAWA 5H9QA 1W04A 3MEPA 3QCWA 4AEJA 2W2IA 1O6UA 5IWFA 2DTYA 4Q4W2 2V4AA 4CDUB 5IATA 3PVEA 2UYAA 1UPSA 2OQ6A 1H1MA 2P4EA 4CDQA 4S2HA 1YFWA 3WNOA 5ABJB 3VZOA 1ZRIA 3RZHA 1QY4A 3HWJA 1UZVA 4FPKA 4QQOA 3DXTA 1JYIA 1AR72 3GCXA 1NA1A 3Q8BA 2HWE2 3JD72 2ZHLA 4Q4V2 3AXDA 3NNMA 1SCSA 2VQ0A 1POV3 2ERFA 5EJ3A 2A5ZA 3D82A 5A7PA 1YI7A 1GZTA 1CAXA 4LO7A 2Y26A 1XRUA 3MIFA 2XVKA 1Y4WA 1X82A 1OXCA 1SBFA 2PHUA 5LW9A 2CGPA 5FZGA 1KFUL 1HN0A 3FWEA 5GZFA 4IV1B 2YBPA 4XJAA 5DG1A 4WZCA 1PVC3 5FZOA 4AVAA 1RMU1 1LECA 4XURA 5ISLA 2VMCA 5IK8A 5FBJA 3V56A 1WCDJ 3DGTA 5J36A 5LBBA 2AREA 4MHUA 1FMD1 4HL0A 5FY8A 4AFCA 5CAZA 1ZRDA 2R7EB 1PHMA 2PAEA 4FOWA 3VZLA 3FL7A 2ZEYA 2XOMA 3T2PA 4LQRA 3H7JA 5SV5A 2B39A 1LEMA 2W1UA 3AMPA 1HB3A 1HIXA 5JDBA 4W65A 5FZBA 1HRI3 1S0CA 5F5IA 3Q8CA 3WVJA 1VAKA 4NRPA 2DCYA 1W0NA 4UFIA 4GQ7A 4OYUA 3S0MA 4NROA 2ZX2A 3K4AA 2CTVA 3IIIA 4XJZA 5FZCA 3GCWA 3WF2A 1AL21 3ILRA 2HEYF 1AR71 2YPDA 3POWA 5FY4A 4AFAA 2HWE1 2WNVC 2XVGA 5FQ0B 5CA6A 4PLOA 1VBD1 2VBBA 1MS4A 3OEAA 1GQHA 1YWKA 4FP3A 3WDUA 1ZRFA 2GC0A 4CP9B 1XE7A 2DCZA 3D0SA 2UU8A 2R071 4AVCA 3H3ZA 3URFA 3U07A 5T5JA 2QQKA 2I45A 3HN1A 1SLCA 1LOAA 1CJDA 1ZBE2 3RDIA 5FYYA 4P5YA 4YVSB 3AYDA 1IHMA 4JRLA 2E31A 3SITA 5C5TA 4JVAA 4OLLA 3RVHA 4XW3A 3D6EA 3ZFGB 4DY5A 2VMHA 4LLFA 2BBAA 2WABA 2P34A 4CPBA 3RI9A 1W9TA 1ZRRA 5D2AA 5FP8A 4IEVA 4RR3C 2Z2SB 1LR5A 2JG8A 3J7NA 4AXOA 2ORXA 5ACA3 3NNGA 2XHNA 4YGBA 1GU3A 4RQPA 1PIV1 3RWNA 4DZGA 3NV3A 5AVPA 1OMIA 3WNMA 4P9GA 1O8PA 3B01A 3ORJA 3HR9A 3ZFFB 1RXGA 2DDUA 5LRRA 4HVOA 1CZSA 4OHWA 1DQ1A 5DZEA 3VUOA 2FHRA 4RS5A 1BBT2 2DU0A 3FFZA 4OUEA 1FOD2 4DXTA 3DKQA 5LBFA 2YBKA 3H42B 1MEC3 4NIIA 4JHTA 1SDDB 2W3JA 3TBDA 5J09A 1HRV1 1N3QA 2ZABA 2R0FA 3FHAA 4LEJA 3NJVA 2RHPA 2CNAA 2Q8CA 2LROA 5CFDA 5CIRA 2QUOA 3RZGA 1KGYA 1ENSA 3AXEA 2DVGA 4R9DA 3RNSA 3AZZA 4PIXA 5FZ6A 3BTZA 3IDAA 4CU7A 4TZDA 5FYSA 3VD5A 1ND3B 5DPNA 2A73B 2FDHA 1VMHA 2B7YA 4WV8A 5DG2A 3RGBA 2DBIA 3ZSMA 2ETEA 1H8TA 1ZM1A 2OA2A 1LEDA 3FJSA 1AYN3 2VMIA 4JGZA 2BDRA 2HBUA 4RSUA 2A7AA 4PQQA 4XJ9A 5A6ZA 5LA0A 1C8NA 3CKHA 3MF6A 2DFBA 3K4ZA 2V5DA 2WJSA 3LWCA 4XOGA 3K48A 1QJY3 4HXCA 2GH8A 1C57A 3H50A 1GWMA 4M3CF 1O3RA 3ST7A 1QMJA 1T6GC 1IPJA 3ZOIA 4YG3A 2FMYA 3VBOC 3MO4A 2I2SA 4YW5A 1CAUA 3ZPOA 3LAGA 3QD6A 2B45X 3I2GA 2WUHA 4Q4X2 4BJ0A 1PNGA 3SKVA 1DYOA 1AL0G 2G9FA 4QXBA 4HN0A 5G05L 2E7QA 5FP4A 5A7OA 1W6QA 2QQVA 4DS0A 3K4DA 4QHZA 5BNOA 5FMBA 1IS6A 5HCHA 3I3DA 2WNVB 3PTYA 4ZXEA 2BNMA 1QH6A 1ULOA 1DQ0A 2CDOA 1PVC1 2VU9A 3WX5A 1BZWA 1V0AA 2R042 4IEXA 1GZWA 3T2TA 3WW4A 1F4HA 1PMIA 1PGSA 4H55A 1OOPC 1W8WA 2V4VA 3SNMA 3WNLA 3MV11 4XF0A 4QQHA 4S2FA 1S0GA 4CEWB 4FOYA 5JIAA 4Z2AA 2RE9A 5A3TA 2VOWA 1R092 2JE7A 3GJAA 1R083 1TME3 3G6JB 4CE8A 3L2HA 1ULFA 1D7PM 3ATGA 3ZR5A 2DURA 3WD5A 5T50A 4BWOA 3ZR6A 2FCTA 4XC9A 1TMF3 1HRI1 3P6BA 2JIJA 4XJ8A 2QTWB 2WN3A 1V6JA 4FQ4A 5F5AA 3WDVA 4KBZA 4ZXKA 3SH3A 4Y5Z0 1A34A 3NAPA 3JCIA 4RR3B 4C0BA 1UAIA 2HWC1 2VULA 1XPWA 4FFHA 2D97A 4AOCA 1TQ5A 4BB3A 1BYHA 1XQNA 2C4XA 1A78A 2KA3A 5FY5A 1OVSA 5LBEA 3QOPA 1GOFA 5TSWA 1Y9GA 2UY8A 4I2OA 3DPRB 1ODMA 3WR0A 4FQZA 2W08A 5A6YA 1OKQA 2EA7A 2JWPA 2VZVA 3LZZA 2VO5A 4UW4A 5C9AA 5IVFA 2D98A 2F4PA 3W5MA 1T6BX 1TZOA 3CEWA 2UWAA 3GF6A 2ZGPA 1RUH3 3T09A 2WDBA 3OY8A 2VXRA 4EWAA 2Y6JA 3THTA 5SV8A 4RD7A 2DYCA 4A7YA 1H4GA 1R091 2Z69A 2JDZA 1XSQA 2D6PA 5EV7A 1VBA2 4YM1A 4FSJA 5FZ7A 1XNDA 2W95A 1ND2A 3N7MA 2XH6A 2W1SA 2XWBB 3SC7X 1QF3A 5LATA 3VBHA 4AG4A 1PGL2 1ZBA2 2ZMNA 3EO6A 2D3SA 2A75A 2RS53 4HKWA 3FLRA 1H30A 4XACA 3WSOA 1UKGA 4XETA 4FAHA 4QB6A 3HJRA 4AF9A 1GMMA 4CVUA 3ZFEC 3DYMA 4O61A 5J98B 1GZCA 1LKNA 4HKOA 4IEUA 2UY9A 4GAZA 4Z2WA 2XPJA 3VKNA 3S57A 2VZ3A 2BEOA 2DCJA 4K1ZA 5AC92 4AI1A 4AQ6A 3A21A 2QVSB 4YVWC 3AKPA 4P9XA 1AX1A 1VBB3 4HOOA 4LHNA 5F2SA 3KF5A 4OCTA 4HETA 1MEC1 1X50A 4LA2A 5FPBA 1W6OB 2WNUC 1E5RA 3IDEA 4KH9A 4WM8C 1CAVA 2PN5A 4GKXA 4EJRA 5DAXA 4NAOA 5FXXA 1PMJX 4B1LA 3AYCA 3J7LA 3T3YA 4A7ZA 4DFSA 2WO7A 4HSLA 2VECA 2K9ZA 4YARA 2XJUA 4BCUA 4EROA 1Q3EA 1DYKA 1DYPA 3VD7A 4Y20A 1VBA1 1YEWA 2IXLA 2KXLA 3J8F2 3M4FA 1VBC3 2OPWA 2R1DA 4J6GA 4UBGA 4IEYA 5FK7A 3GYDA 2YFUA 4XABA 2Q8OA 2C26A 1GICA 4X8PA 2W92A 5JR2A 3IPVB 2E33A 1NCQC 3ME2A 1LENA 4QPWA 5BV6A 4LITA 5C70A 5FYCA 5L9RA 4BLIA 2E53A 1NXD1 5F3CA 4GH4C 1ZZ7A 2OZ6A 3S7EA 3UKTA 2WS93 2XBO2 5FTTC 4LKFA 1QGLA 3NV4A 5CFCB 5IFTA 2WWSA 1MACA 5JMCA 2HKXA 1JMUB 3C7OA 1ZNPA 2AC1A 3KS7A 4LKEA 5KC5A 1YQ5A 2R30A 1UU6A 1WA6X 1D4M3 2GNTA 4KL1A 4Z82A 3UV9A 4DEQA 5A1AA 4A6OA 3WQ7A 4FXGB 1AX2A 1QQP3 3NKTA 4CUCA 4P5HA 1JH5A 1HX6A 2WLQA 3AP5A 4LBNA 2IZWA 4RL7A 3W5NA 5BNNA 3S5QA 4CCJA 1ASJ3 3LQCA 5GZEA 4EZ4A 2R1BA 1OA4A 4NIDA 4HLTA 2DVBA 1RUF3 3OYWB 2ZEWA 3FZ3A 4AFBA 1AF9A 2LS6A 2WWUA 3IMMA 3VBUC 4LHSA 4R4ZA 4FTEA 1XYNA 3RSJA 2UYBA 2ZOEB 2IXIA 1JZ8A 2ET1A 3NO8A 1G86A 5IHRA 4DRRA 3OD4A 1OT5A 3THDA 3WF0A 3GJBA 3K2OA 5BPXA 1C28A 2DWRA 4G9SB 1RUJ3 1AZDA 4NHXA 1POQA 3K75B 1JYVA 5A7QA 2EXKA 1EUTA 1REFA 3GZEA 3I7DA 2WYFA 3Q9OA 4QPGA 1PZ9A 2RS32 1RINA 2WO3A 2ARAA 2MEV2 5A32A 1FXZA 1VRH2 1GNYA 4OVEA 3TEYA 1CONA 2J1EA 4JKLA 3T4HB 2W1WA 5DAVA 1J3PA 1LU2A 2P3KA 2OKXA 3WNXA 1J1LA 2VVEA 3MW2A 3USUA 1KQRA 3LB9A 3A0NA 3R4DB 1XXNA 4DINB 4AHWA 2VJXA 3CZJA 2HWD1 1W6NB 2ZMLA 3AK0A 4K1YA 4CP0A 3AYEA 3VBFA 3I59B 2DUQA 4U36A 5JCTA 1POV0 1RUI3 2XJTA 3LPGA 4CCEA 4EN0A 1CIWA 1NOVA 3CO2A 3VZKA 2QQNA 3KLSA 2VH9A 3IBMA 4KGGA 2R32A 4LE3A 1RHI3 1FI2A 1UX7A 5F6LB 5F1RA 2OW4A 3WW2A 1QIQA 2QJVA 4YVWB 2A3XA 4JDOA 3ABZA 3B9CA 4FPEA 4AAPA 2BNNA 1OLQA 2WNUB 4WM8B 3JBG3 3RYPA 3T1MA 3HNMA 3VHRA 3RMXA 3N9MA 4NOTA 4QM8A 4XAAA 4HPKA 4AL9A 4UW5A 1S1AA 4YW6A 5T3NA 4GWMA 2RS31 2R49A 2JB8A 4HONA 1F9KA 5FKCA 1PK6A 1VRH1 2J1AA 2RS51 2XUMA 4Y4RA 3THPA 3BUCA 3AJYA 4KBBA 2W5FA 3OGSA 3BIEA 5LK5A 4Y5TA 4ISQA 1RC6A 5A7WA 1RUOA 3B5LB 1AR61 2TUNA 1DBNA 2ORZA 4FOVA 5F5CA 2LTNA 1OI6A 1NCRA 1PX3A 4XF9A 5A1LA 1N3OA 5IVBA 1CIYA 3OBTA 4K8FA 4D94A 1IKPA 2VY0A 1NCQB 1LOBA 2HBTA 3OBZA 4LHLA 4CDXC 2WT1A 1VBB1 2JG9A 1AR93 3AL5A 5CKQA 1H2NA 2TEPA 2X5IC 2XHKA 1BEV2 3AP4A 4GH4B 4QHOA 4XQDA 2FDGA 2BWCA 5T52A 2BRTA 3OOXA 2NMOA 1K5MC 1CZTA 3OEBA 1HXS1 5CBLA 3ACLA 1JHNA 1J83A 2IC1A 1UMIA 4OHYA 4HFSA 4GMP1 1W0PA 1WLDA 2QE3A 5FMDA 4CCDA 1QH7A 4AEDA 2NN8A 3VDBA 1UKRA 1V6OA 2XR4A 3LDRA 4H7MA 4A6SA 5I0SA 4FTBA 2GC3A 4AW7A 1VBC1 1O4YA 4QKBA 3RWKX 1ACCA 1OUXA 2OYZA 1ZZBA 1GV9A 5JZGB 3I2DA 4D7TA 1YI9A 1HDKA 2VOTA 1R1A2 4MYEA 3KCXA 2YB7A 5LY1A 4UFHA 3U78A 4YYOA 3HQXA 3GGLA 4UI9L 2DVDA 4MVTA 1VMFA 1PM4A 5IK7A 2UWCA 4QPIA 1PO22 4IEQA 5LB6A 5FZ4A 4CRQA 4XUOA 4ARXA 2A71A 2BW8A 4R52A 2XLFA 5LRSA 1G9DA 1FYUA 2A1XA 2GC2A 3RZMA 2K0GA 2XQRA 5DAWA 1O5UA 1EAH3 1VJ2A 4LBQB 4CDUA 2Q30A 3KQRA 1D4M1 2EF6A 3W59A 5KHJA 1QOSA 1VAMA 1GR3A 2RG4A 2NZ9A 2BVVA 4XFCA 3VGIA 5ABJA 3ZN6B 4FT8A 3KD4A 5K7PA 3N4MA 3KVBA 3V65A 2IWGB 4BM8A 1F35A 1ASJ1 2VD7A 2Y6HA 4XUTA 3WY6A 2DV9A 2G4IA 3MLJA 4YPJA 2NYYA 4XDPA 3C7EA 5FUNA 3ILNA 1FMD3 4B3NA 3WG3A 1WMEA 5JLVA 1N1VA 3B69A 1H4HA 5LA9A 1S0DA 2Y6KA 3OGRA 2BZDA 2D43A 2OX0A 3RG0A 1WD4A 1JYCA 2PFWA 2GN7A 4Q4W3 4YM2A 1MR5A 5GM0A 1C4RA 4IV1A 5IK4A 5J48A 2AEZA 5C3SA 1E57A 4KWUA 5JXHA 1UYPA 3ZMOA 1O3SA 4JGYC 5FO7B 4H3WA 4IV3C 5EZWA 1AXKA 3FE5A 1RUJ1 1Y43B 4GJYA 1AR73 3PUHA 2ZHMA 5F6KA 2HWE3 1AR82 3JD73 4M3CE 4Q4V3 1PGW1 1XNKA 2RM22 4ISRA 2YHJA 3U75A 3E6CC 2JDNA 1C5HA 3GM8A 4FFFA 3ZYPA 2ZHKA 3PIJA 4FPJA 2R073 4QDSA 2RR12 4GKYA 1F4AA 2CWSA 4HK9A 1UOGA 5I0DA 5A3OA 4LULA 5A3NA 1ST8A 3ZDVA 4K7JA 5FQ0A 3VHPA 1MS9A 5C3OA 1AVBA 4N53A 5D8AC 1JYWA 1AX0A 4Q8LA 2JXAA 4CTEA 4CP9A 5D21A 3OGVA 4M0HA 4IETA 3M3IA 4AEKA 1UYYA 2VE1A 3I3QA 4BQ5A 1YFYA 3SQOA 3SISA 1RHI1 2ID4A 4XQWA 4COVA 5FYMA 3W58A 4ZONA 1OD5A 2XL7A 3PHMA 1QU0A 2WBKA 4Q0QA 4YVSA 4L11A 5FZEA 4ET7A 2D3PA 4YFZA 2MNGA 3IB3A 3AKQA 5DUXA 3B3QE 1MQTC 3JBG1 3ZFGA 5A3MA 4XXAA 5DAQA 1K5MB 1XYOA 3AFGA 4QX1A 4BZ4A 1YFXA 2RM21 4QGNA 3WF4A 3HN3A 1CWPA 3AMHA 1KRIA 2PTMA 1MS1A 4NHLA 3WEZA 4RHV2 2J1RA 3DYPA 1IG0A 1ZZ9A 3WF3A 1TVGA 2R062 2PHRA 3ZIWA 4RGKA 3OUIA 1WBFA 3ALQA 1REEA 1LODA 1HQNA 1J58A 1Z78A 3BPSA 2Q4SA 1JHJA 1JOPA 3DF0A 2BPA2 2WKKA 1NLQA 1G7YA 1ZBE3 4MGYE 4KG0A 1HRV3 4LO8A 4N43A 4XFAA 4FFGA 4A44A 4BQ4A 1RUE1 1NUKA 1UY2A 3ZFFA 1EYBA 2PYTA 3KVAA 5KHIA 3KF3A 3PJQA 2PLV1 1Z0HA 2WA3A 1AR91 4NUBA 2Q8EA 3ACFA 2EIDA 4XDQA 4FPCA 2YG0A 3ES4A 1FPN1 5C8WA 2WZPP 2FZ2A 2FDIA 2W87A 5FAXA 1QJX2 3SCGA 2O1QA 4Q26A 3TYJA 3WUDA 1Q43A 4CPBD 4ASLA 4GJZA 5JI7A 2CY6A 5FDBA 1LOFC 2K2SA 2Y6FA 5L7OB 4OZOA 1A8DA 1JODA 3LA2A 5FO9B 2Y60A 5A33B 2AUYA 3M3EA 1B35B 3LIHA 4LK6A 4PI0A 5GALA 5JAXA 5KBFA 4PDWC 4TSVA 3H7YA 5GZCA 1WCUA 1XBFA 3WW1A 2ARXA 1Q8SA 2YYOA 2ZCWA 1YHFA 1ND3A 2P3JA 4AE2A 2CHHA 4O9GA 4QX5A 3BKZA 2GMMA 5EXOA 1CGPA 4P9IA 5FUPA 4LA3A 4XJWA 3OCPA 3JU9A 1BBT3 4FOQA 5CU1A 3TN92 5FZAA 4SBVA 3HNYM 4TWTA 5LBCA 4NO4A 1XC6A 1EV12 1OC1A 3MYXA 1GZ9A 4EWDA 1EAH1 1QDOA 2G9GA 4LOTA 5I0RA 4TTGA 1CQ9A 1S4CA 1V6NA 2DVFA 4IV3B 4LO4B 4FXKB 2Q5TA 3QH6A 5H9SA 4DRVA 4QAWA 4V1PA 4XFGA 4LTAA 4CEYA 3MF9A 3J4UH 2D3RA 5LCWL 5FV3A 4IE6A 3KGZA 3T0DA 1MZ6A 3LFMA 3I3MA 1CX4A 4P9YA 4WM7C 5FZ1A 1W8TA 2ZS6B 3NJXA 5C3QA 3RJ2X 3B7MA 3ITQA 4L97A 1NY71 1LRHA 4JKMA 4QXHA 3TB0A 5HBAA 4JAAA 4NHMA 1WW5A 1WMFA 1ULDA 2JKXA 1RGSA 3KCYA 3OF1A 1V6IA 5C5UA 2CL2A 3AC0A 4Q4W1 2Q1MA 2WNVA 1UXXX 4EWEA 4MO3M 4OI1A 5FZ0A 4BQ2A 5CKMA 3GBWA 2JIGA 2YU2A 3O1TA 4EZHA 3T0AA 1KEXA 4UW3A 1G9BA 2VC9A 5IK5A 3HMYA 4CEWA 1CJPA 1OUSA 1YYNA 2GALA 3JD71 2PQSA 4IXLA 3CJIB 2HWC3 3WCSA 3ZKUA 2ARCA 2Q1FA 4YZ5A 4Q4V1 4CU9A 2QKDA 3B00A 4YGCA 1PNFA 2YXSA 1VR3A 4LUKA 1DHKB 1JW6A 1GYKA 3MIBA 5E6HA 4X6RB 5A6QA 1K5JA 3BTAA 4CDWB 1BLZA 1ZZ6A 2QFEA 3LIGA 4IGQA 4MGZE 3WOGA 5C3RA 4N9HA 4UFJA 3WDTA 1GQPA 1Z7S2 3VBRC 4JQTA 5JSRA 3D3AA 2R043 3IMNA 2RDRA 3FLPA 3MUZ1 5F3EA 3Q8FA 2ZEXA 5K0UA 5A70A 1YQ8A 3MBWA 5H9RA 5L9BA 1AHSA 1S2BA 1WCKA 2OUHA 1A8MA 3POEA 1R093 3ZYJB 2N7GA 1RUD2 4C8DA 3SLIA 3DPRA 3FC0A 1W2TA 3TEZA 3T4VA 3VKOA 3LDBA 3LSDA 3O1MA 1UYXA 4QX2A 3ZXGA 4PCRA 3LSEA 4B7KA 1UY1A 1TEIA 5J7MA 4QU2A 1NZCA 3AP7A 4C1WA 4E8CA 3BI3A 3WQ0A 3WG2A 2VNRA 4ZY9A 4QD2A 5FYUA 2UWBA 2YY1A 4LK7A 4UOJA 2G19A 1W8HA 2FMDA 1OSGA 1EP0A 2VTFA 3GZTB 1OA3A 2AENA 4LE4A 1W2UA 4GB32 3WDWA 4QB2A 1Q8VA 1H6YA 4H14A 1W90A 4QMAA 2X05A 4YGDA 2AR6A 1K3IA 3KWVA 4AGGA 1SBDA 5JSOA 1ZBE1 2WR9A 3O7OA 3I2IA 5A7NA 1L3JA 2CSGA 2RS12 1FAYA 1SQ4A 2ZGRA 5FWJA 5FLIA 1DFQA 1ZZCA 1W9WA 3M8LA 5FBZA 5I0TA 3UT0A 4EN7B 4HK8A 1US2A 4JTOA 3A22A 1W8ZA 3BODA 4Q5OA 1VBA3 1UW8A 4LKDA 4TYSA 4RQPC 1IS3A 4Z92B 1W6OA 4NPRA 5FZLA 1S2KA 1QKQA 4BK5A 3ZXFA 1ZBA3 2B9VA 2Y8KA 5C6CA 4HKLA 4OMDA 2LUWA 1DZTA 1DCSA 3O1PA 2VBPA 3PLQA 4P14A 4JCKA 3TOJA 3SH4A 5KXDA 1NKGA 1V6MA 2QDRA 2YC4A 4EN6B 2WFF2 1OF4A 3POBA 2V72A 1CESA 4FP2A 4JC1A 4RS5C 3ROUA 4DPNA 4WM7B 2ZGOA 4AFDA 1SMVA 4BPZA 3U37A 3LFIA 2EAKA 4XQ4A 5AC93 3FFQA 4MGIE 3NSTA 2Q8DA 3HBKA 1BBT1 1NQDA 2PA7A 4DMIA 1FOD1 2VGDA 5F39A 3UGGA 4D0QA 5C8CC 2V73A 5KHKA 4HMZA 5CFDC 4C91A 2WZR2 2VW0A 2ADDA 3QBQA 4Q4Y2 4YG0A 1BHGA 2VZ1A 5FY1A 3ZSJA 4E4SA 2RS11 3POGA 5CFCA 5F5QA 4YZ2A 1G9CA 4EN8B 4P9JA 4PIZA 1R1ZA 4IDZA 4DXSA 3P5BA 3BGAA 4QX8A 5ANNA 4XHBA 4OHVA 4KU7A 3INAA 4AAXA 1C8M2 1H8TC 1WGPA 4PJYA 2L9LA 1XOYA 5E1RA 5EYXA 4COWA 1IG3A 2VW1A 3OGGA 4XZPA 1JOJA 2YFZA 2B4KA 2Y6LA 5FZ3A 1GWKA 4Q0SA 4OHZA 3OYWA 1PVXA 1J1TA 3K46A 3OUJA 4FTSA 4ASMB 4Z07A 5IYYA 4WVMB 1X33A 3VBRB 2XBO3 3O1VA 4NR1A 1GLHA 2AYHA 2C9KA 1V9U2 2YBSA 2WINB 3MIDA 3A0KA 1GUIA 1HV1A 4XCBA 1BCXA 3KZ4C 5FP7A 1O4ZA 5K8SA 3O14A 5BY5A 2E7TA 1I5ZA 5FK8A 3N35A 4O7XA 3OGJA 3FUQA 2H0BA 5LEJA 1BMV2 2ZA9A 4K3UA 4Q4X1 3UYJA 1IKQA 5BNOC 3VN4A 2O8OA 5KXCA 1VAVA 3OBRA 4QX7A 2HWD3 1RVF2 4B7EA 1UOFA 2C6SA 4W4ZA 1RUC2 1V6LA 2WIIB 4LBQD 1CR7A 4DY3A 4QX3A 5F3GA 3FHQA 2BVBA 2EXHA 2Y0IA 4OHXA 3USSA 3ZSEA 2GN3A 2R041 5FXWA 1FX5A 2HWF2 3A7QA 1FNYA 2WFPA 3CLPA 3TEXA 4F8AA 4ES8A 5DAPA 2V5YA 4XXPA 4CXYA 1GP4A 3AVRA 1W6NA 3MW4A 4Y1YA 5FJKA 2WL1A 3IIAA 2RJLA 1UU4A 3I59A 1M06G 1VLNA 4NHKA 4QGMA 1X8EA 1UU5A 4AK3A 3O0XA 1KDKA 2P3YA 1QOOA 1UO9A 2YGLA 5L9VA 3MZHA 1HN1A 4LR4A 2FCVA 3NAPC 1QJU2 2RS33 3CNAA 4U2AA 1SPPB 4MZUA 3VKFC 3WZ1A 2MEV3 2FDJA 1VRH3 3QACA 1I6XA 4DOUA 3O5SA 4HANA 4JZRA 3UL2A 2XJPA 2GMPA 5L73A 2AACA 4F83A 1HLCA 3ACIA 1AR63 4RQPB 3NVCA 4IUGA 2Y38A 4KU8A 1DZQA 4V2VA 4P00B 3NRUA 2JDAA 2KR2A 2PHLA 3JZVA 2E63A 2XLGA 5C9AC 1TE1B 1UY4A 3AFKA 2IXKA 3KT4A 3LEGA 1RVF1 3WW3A 2RDQA 5D1IA 3I2FA 4PLMA 4MGTA 1US3A 1YJLA 1CPNA 1ENXA 1UZZA 3LOBA 1K42A 3E6BA 3ZYHA 3CU7A 3PUSA 1VB4A 3A4UA 4NVPA 4UWDA 1OQ1A 3BIWE 4HZFA 1HXS3 2XJRA 2HWF1 3H9AA 3FUOA 4KG8A 4LT5A 3WINE 3VD3A 4GMP3 1ND2C 5C8CB 4LO6B 3IDBB 4YW7A 3VBOB 1N47A 5CFDB 3VBHC 1XNCA 2PHXA 3AYAA 3H1MA 4IEZA 5HV4A 5I8YA 2QQWA 4YSFA 1YIPA 4GH4A 5BNPC 3EXUA 5A3LA 1LULA 1AXYA 2VMFA 3KV4A 4MXVA 3FHIB 1C1LA 4PQ9A 4ZS2A 4DUVA 1PGL1 2RDSA 2PMWB 3BPZA 1ZBA1 4MX3A 2VTXJ 5H9PA 3ZXKA 1NE4A 2ILMA 4QGLA 2JENA 1BJQA 5CZKA 2OIIA 1TNRA 4YG6A 5KXBA 1H8TB 4OI4A 4Q0VA 4KI5M 5A3WA 2CGOA 4Q0PA 1GFF2 4FVVA 4EYUA 2JD4A 4YZ3A 4BISA 1YQ6A 3I2KA 1F5FA 3VHOA 2VQTA 1OOPB 3W9AA 1RTVA 1ZYBA 2G9ZA 4HVQA 5AC91 5C71A 5JZGA 3POJA 2W94A 3AZVA 5IW0A 2YC2A 3O12A 1XE0A 2WLPA 3WHTA 2D40A 2WT2A 3BB6A 1TG7A 1Q8OA 1W8NA 2IVJA 1X8MA 3IDCB 3PUQA 1N1TA 5BNQA 2MPFA 1JN2P 2D6KA 2PAKA 3CF6E 3JQXA 3S7IA 1OH4A 4QX0A 1IPKA 1NT0A 1H9WA 2B42B 4IEWA 2VCCA 2GH2A 4LBQA 2FBEA 1TMF2 3B02A 4RYDA 3ZN4A 5FY0A 3J8F1 1UMZA 2J1VA 4GIQA 5BNOB 4MH0E 3JXSA 3KQ4B 4D7SA 1UXZA 4PF5A 3ZN6A 4IESA 1WUVA 3EYPA 5HI0A 1R1A3 2VVFA 5FZHA 1G6NA 1QJFA 4LO5B 5FR3A 1JOBA 3E6DA 2NLRA 5LK7B 2R0HA 3DN7A 4ATEA 1W6PB 2BOIA 3PDQA 3WQ1A 1PO23 5B4XA 3PU3A 2IUWA 5DUVA 4R9AA 3U4XA 1T2XA 2XBO1 2X53S 4QQ2A 5FZ8A 1W9FA 1UIKA 4TXWA 4D7YA 5LZ6A 3L9JT 2VL4A 4META 3UNPA 5IAVA 3VDCA 4AVSA 5CKNA 5C7GA 1YCIA 4NIAA 1WMXA 1GOHA 3WXPA 1SACA 4QKDA 1H2KA 1F15A 1RUH2 4R9CA 1KFXL 2LALA 3HAGA 2OT7A 4UBHA 1WLTA 4QHBA 2A3WA 3TNPB 1SFPA 2JJ6A 2J42A 5EIYB 3PVOA 1ZZ8A 3BOWA 2WNOA 4FI9A 4MG2A 1O4TA 1Q56A 1V6KA 1EPWA 2H6BA 3AMMA 3ZFEB 4MUVA 2ZBJA 1UX6A 4F3JA 5A7SA 5FPXA 3NV1A 2JE9A 2JB4A 3NJYA 5FY7A 2WQZC 4Y1XA 3WNNA 4OUMA 4N7UA 5JXIA 1NYWA 2AGSA 1R64A 1DQ2A 4QB1A 4OFGA 1APNA 2RJ2A 2E7AA 2P6CA 2XQXA 3ACHA 1UOJA 4QPGC 3T30A 1EY2A 4NMIA 4UF0B 5FREA 4KWJA 5C4WC 3WDXA 3M3CA 1QXPA 5IJRA 1LU1A 2B46X 3UGHA 1AR83 2D5FA 1RUG2 4OUSA 1EUUA 2RM23 1IGOA 1FV3A 1RXFA 2XJSA 3AVSA 3OD0A 4JHZA 2BERA 4L8QA 4UT5A 5GLUA 1OLME 1STMA 2D7FA 1I3HA 2MEV1 1PO12 1W0OA 5F9TA 3A23A 5FLHA 2A6VA 2WSUA 3U11A 1JYTA 5FIXA 4RFT0 2VUCA 5BNPB 2XDVA 2GDFA 2JE8A 3IM0A 3UGFA 4DIQA 5BYNA 1IZ3A 3VBFC 1K5MA 4KQ7A 4Q2FA 3RYKA 1LTEA 3E1F1 4A2UA 2O14A 4PT6A 4XMIA 1JZ3A 1RUE3 3E5UA 1RITA 1Y7BA 2EALA 1NLSA 2PLV3 4MGKE 2KD7A 2IXCA 4L92A 1GBGA 1FPN3 2HWB2 2Y34A 2XMLA 1CN1A 5GLWA 3VBSC 3VV1A 5DMYA 4W6XA 1UD1A 3EJKA 4M3CA 2H0VA 4PLNA 4NPLA 4XBNA 2RMU2 2GMEA 4I30A 3GALA 2XONA 3C3VA 2BWAA 4DQAA 4GD4A 5JOYA 1F5JA 2ZGNA 3D8CA 1PK6C 4DUXA 3G7DA 4CCKA 1RUG1 3VDDC 5DQ0A 1QQP2 5APAA 3HT2A 1H6XA 3E5QA 3RZJA 2F4LA 5AFEA 1J3QA 5L7OA 4NWWA 1NCRC 4XJUA 1OA2A 1WW7A 2PELA 4RHV3 3CBNA 5A33A 4QQLA 3VBUB 3QLQA 3BALA 1G9FA 4HVRA 1B35A 2ZAAA 4JDNA 1JU3A 2LRPA 2R063 5JMOA 2XLAA 2VQAA 1RUF2 2JG9C 4AWDA 4A4AA 4HN1A 1X36A 2W91A 2EIGA 1O7FA 5E8AA 3LOIA 4MXWB 4Y22B 4Y24A 1UF2C 1KS4A 2GNMA 2WZEA 2DF7A 4A41A 1BK0A 1QOTA 4XMAA 3VDAA 4Q29A 1BEV1 3WDYA 5EPAA 1H1IA 3OSDA 2PHFA 1QJX3 3CMGA 4J1WA 4AEDC 4JV4A 3RJRA 1X9PA 2P5BA 3ZYIB 4BYYA 3VKMA 4BLJA 1HQLA 2ZGTA 1FATA 5IT6A 1DLCA 1WKYA 2JDUA 2VUAA 4AI9A 2ZTNA 4NPMA 4XF3A 1XNAA 2VCBA 3LE0A 4YM3A 2YUEA 2NPIA 4NJ4A 4IV3A 3ZSKA 3H8RA 4E4DX 1REDA 4Z8BA 3PU8A 4I0BA 2ZEZA 5CNAA 1SLBA 1W99A 4K40A 4QPIC 1IS5A 3U10A 1R1A1 3RPQA 4CXWA 2G1MA 3NMBA 2XL9A 3RQ0A 1KJLA 4XE9A 4MGSA 2QQOA 5E16A 2NP0A 3DCQA 3ILFA 3TN93 1W3XA 1PO21 2CV6A 3JQWA 4CDUC 1W39A 1GNHA 5JR7B 1EV13 1SZBA 1WBLA 1NG0A 3E5XA 2D5HA 4CP2A 3Q8EA 4QKNA 5ABJC 2OVUA 1OQEA 1RUI2 5DDJ2 2WQ8A 1JI6A 3AZWA 4QPGB 1XJAA 3BYWA 4R8HA 1LGCA 4UYBA 3O1SA 3LGRA 3AMQA 2EVXA 5KHHA 3H1WA 4TLGA 2QQIA 2JDHA 3N36A 4K21A 5FXVA 3UETA 2RVAA 1QDCA 2W46A 3HBZA 4IQPA 4E8DA 2DCTA 2Q1ZB 5L36A 3B93A 4AVBA 4DXZA 3PIGA 2FDFA 4XUPA 4CUAA 1X7NA 3J7MA 1I1EA 3V0BB 3CJIA 4W6WA 2W47A 3R6SA 3CZUA 4FFIA 4I3PA 2GP3A 3AM2A 4PIYA 5FYZA 4LXLA 1UIJA 2BGCA 2ZACA 4IV1C 2HEWF 5EWSA 1H9PA 2D6NA 5EHDA 4A7KA 4YM0A 3VBFB 4CDWA 1COV2 1UZ0A 3C8XA 5FZDA 3JB4C 1UY3A 2RV9A 3R4UA 4CDXB 1O3TA 4LORA 3ZYGA 4BMEA 1FV2A 1Y3TA 2X5IB 3MPPG 1DG6A 3N9PA 3T2QA 3BOPA 3SH5A 5JOZA 1JS9A 3U4SA 2ADEA 3VBSB 4XHXA 4DB5A 5J37A 4AYUA 3D0JA 2OUJA 1AR81 4ONUA 2PQQA 3ETQA 4QWNA 1YC61 1YNAA 1DIWA 1W2AX 3E97A 4PHZA 5T5LA 3AKSA 3MIGA 4IGOA 1L7QA 1VBE2 4N90A 3KM5A 1RUNA 2RR11 2BYVE 5GKAC 1MS5A 1PK6B 3GHNA 5FOJB 4X6QB 1WLWA 5LA2A 4N53C 4E9KA 3VDDB 1DF0A 1O8SA 1SBEA 2HYKA 3IAPA 5KC6A 1WCQA 5KXEA 1AYM2 5JPNB 1RJ8A 2WYSA 2VW2A 2ZXQA 2BBVA 3H3UA 3UJOA 2PHWA 2ZGUA 3ZIXA 1UPIA 3EHKA 1WA4A 3NNFA 5HCAA 3T0BA 4A3ZA 4NIGA 1RUD3 4S2DA 4AVVA 4LMFA 2J1UA 3LA7A 2VZTA 5DXDA 1COV1 4I0AA 1GNZA 5BXXA 2IFWA 1BQPA 2BOJA 2X09A 3GZAA 1WMDA 4ZS3A 4ZU5A 3ZFGC 3DECA 3N7KA 4AQTA 5C3PA 1H2MA 1DGRN 3UKVA 5FRAA 2QQLA 2XKPA 2GZWA 3M70A 4D6RA 4J1XA 1MVQA 2JDPA 4BE3A 2JICA 4B1MA 3IZOA 4YGEA 3NQHA 4HBNA 3AKRA 1Y9MA 4YZ4A 1HB1A 4LBKA 2FDKA 1OHFA 3BU7A 4P02B 3RRDA 1VIWB 2P1BA 2WAAA 4RHV1 4N43C 4L9BA 3RYRA 1FOD3 1RMU2 3H3LA 1OH3A 2F17A 2R061 1VB2A 4M3CB 1KITA 4M4RA 3I49A 4WBBA 2GSYA 1FT9A 3KSCA 1HJFA 3DKWA 4QPIB 1ALYA 4QKFA 4BA6A 3U14A 1QJEA 3KT1A 2RS13 3VZJA 3O1RA 1KXGA 4WM7A 1JUHA 3C2UA 3WP6A 2EICA 1LOEA 4UXAA 4JGYB 2XXZA 2YGMA 4AHXA 3CQOA 4KNCA 1W9YA 5DZFA 4RA0A 4W6YA 3SKJE
chains in the Genus database with same CATH topology
2DUPA 2GU9A 5J3UA 1QJX1 3VZNA 3SXWA 3TNQA 1BXHA 4JTNA 1DGWX 1AL22 4L2NA 2ZKNA 2W0XA 1UL9A 4XFHA 1ND3C 1NE6A 2ZGKA 1VBD2 2W39A 5CVRA 3ZXAC 2TNFA 1AUYA 1SLIA 4FPOB 4CDQC 2R6QA 4GMP0 2WFF3 1J59A 2W68A 3WLUA 2R072 4Q8KA 2UURA 3OJBA 1DU3D 2R16A 1QXJA 1NA1C 5D8AB 1CVNA 4YRDA 4AQ2A 4DNYA 1W6MB 3DL3A 4UW6A 3TN91 1ULEA 2JEMA 1EV11 2WZR3 4Q4Y3 1O91A 3N7JA 1DDLA 4Q4X3 2PAMA 4LNVA 4WVMA 3VBRA 1U0AA 4CEYC 4BIOA 1LHWA 4BH9A 1SDWA 4Y1VA 4AHYA 1MQTB 4LBJA 5CB7A 2OZJA 3P3PA 4N7IA 1O3QA 2C1FA 3AP6A 1C8M3 5I8TA 3NV2A 4Y26A 5GJ6A 3SMHA 3B9IA 4RR3A 1PIV2 5JSPA 5DZGA 1S55A 1C3HA 3JB8A 2ZX4A 1S0BA 3PNAA 1XYPA 2C0ZA 1WCSA 2ES3A 3I54A 4YZ1A 3V0AB 1XE8A 1IQAA 3H0OA 4N53B 4FPLA 2X29A 5T5OA 1U5XA 2P3IA 1V9U3 2WQ4A 2X8KA 4OI2A 3VZMA 4CEWC 4AFMA 5GLZA 3MLKA 4FPGA 4LBMA 4BOWA 3MIEA 3FBMA 3ZXLA 1SLAA 2IXHA 1HRV2 2YMZA 4D69A 4E4ZA 2A6YA 3OPZA 1OFSA 1V00A 1ZX5A 4AGRA 2XGXA 3ZMNA 1RVF3 2QDNA 4PDWB 2ZKLA 4AI0A 1RUC3 5K0UC 1KDMA 1LHOA 2IXJA 4TLFA 4B4PA 1S0IA 3HT1A 1Q8PA 3MFCA 1Z7S1 5FO8B 1J3RA 2BUKA 2HWF3 3DPRC 4N43B 2BFUL 2JG8C 2VUJA 3FX3A 1LESA 1RUD1 1D0GA 4XEZA 2D6OX 4D3WA 3GHMA 1F8VA 5JIUA 3ZN5A 1QJU3 1WW4A 2C9AA 2XWJB 2ZPXA 3FLTA 4RGAA 5C8CA 2NMNA 3VBOA 2DUOA 3TWIA 1CAWB 4Q1RA 1DGLA 4GB31 4XYXA 1RIRA 4GALA 2GNBA 1PVC2 2YV8A 3IPVA 2XVLA 3EBRA 3PVBB 4CDQB 1ZVFA 1S0FA 3M7AA 1JXNA 4MV2A 4JDMA 2QNKA 4K6BA 1CD3G 1NA1B 2ATFA 2RJKA 2I74A 1OOPA 5FOBB 4FCAA 4Q27A 1LOGA 1YIFA 3ES1A 5I8SA 2A6WA 2ZGQA 5I93A 3L2YA 3WP4A 1CAXB 2A3YA 1HRI2 3PMSA 3J8F3 4JRAA 4JGZC 2D6MA 1LB2A 2W52A 4CEYB 4R9BA 1WLCA 3WHUA 2NQYA 4Y1ZA 2E51A 2WC2A 5FFOC 4IEOA 4COYA 2HWC2 4ZU7A 3ENRA 5KHGA 1POV1 4ATFA 2WFF1 1ULCA 4YW4A 4IL7A 1LHNA 1H0BA 4XIKA 5GLVA 5CG9A 4C90A 2XB6C 3B94A 4R4XA 5J96B 4E2GA 3ZYRA 1YXWA 2BQPA 3LKJA 3KB5A 3RMYA 2BNOA 1LCLA 5JOWA 1YFUA 5CFCC 2WZR1 1G8WA 1W6PA 2ZZQA 4Q4Y1 3EQEA 4GA9A 2QZ2A 3NL1A 4H7LA 2GC1A 4E2SA 3TRSB 3DUIA 3M1HA 2F6BA 4IEPA 5ACA2 1C8M1 5JOXA 2E6VA 4XTMA 5EYYA 5IUQA 5AVAA 1TNFA 2H6CA 2GAUA 4OULA 4WZFA 2Q0AA 1IOAA 4CP1A 3D5OA 3AX4A 5K0UB 3ZSLA 1D2SA 1SEFA 3VHNA 1LGBA 2DCKA 3ZFEA 2HEVF 4BHPA 3BCWA 3ZX7A 2ZX3A 4B4RA 3KMHA 1V9U1 4B8EA 3AMNA 1DGRA 1MEC2 2FZ1A 2JG8B 4LLOA 4FPYA 5C33A 1MS0A 4YVWA 3UKNA 2A6XA 1NLRA 1SFYA 2JX9A 5E89A 1S0EA 3WCRA 1BMV1 2WNUA 4WM8A 1SLTA 3J26N 4IERA 4AEMA 2ZJCA 1U5IA 4COZA 3WP3A 1OPMA 1DQ6A 1RUC1 3NKGA 2A6ZA 5ACA1 1KD7A 4RS5B 1ULGA 4OI0A 2FQPA 3POSA 5BNPA 5LEKA 5EFUA 5HCBA 1AYN2 4HSJA 1ZREA 1JBCA 1QXRA 5FMOS 4ES9A 1S0JA 3NJZA 3MGUA 4NWVA 1SCRA 2Y0OA 3RZZA 1B09A 1QJY2 1NCQA 1N1YA 5HCFA 5CADA 1KJRA 5JPMB 4I01A 1C1FA 3N3HA 4F7ZA 1H8VA 1VP6A 1RUG3 3IN9A 1NQJA 1QJU1 3GBFA 1QWRA 2B8MA 3RI8A 4CYDA 1PO13 4M00A 1HQWA 1AJOA 2WA4A 1FNZA 2DFCA 1LHUA 4Z1VA 4JGZB 4YW1A 2XG3A 4BIFA 5I91A 2D6LX 2ZGMA 3D4KA 1MZFA 3ZPYA 4G4FA 2VVDA 1LOCA 1M4WA 5JWPA 1BEV3 2HWB3 3VBUA 3PJYA 1HV0A 5FCCA 3WUCA 1AYN1 1HKDA 1NXMA 1JTZX 1CAUB 1BVP1 3AZXA 3MFAA 2RMU3 1R082 1TME2 2D44A 2LM3A 3VKLA 1AXZA 1DLLA 3AB0A 4MXWA 4Y22A 1GSLA 1QJY1 3ZXEA 3JUUA 4OZXA 4GULA 4XFBA 1RB8G 1ENQA 2XJVA 4E27A 1W6QB 2D93A 3I8TA 4P9WA 1VALA 2ARBA 1YJKA 2C5DA 2B9UA 2ZGLA 1GZWB 2AH2A 3S6PA 5BUVA 5JZGC 2MHFA 4I09A 3SCHA 4FAGA 4FPFA 4AVTA 1Q5OA 2HWD2 3MPBA 1EPZA 4QT6A 2CYFA 1D0HA 3PVNA 2Z5WA 2P17A 3POYA 4KGQA 1ONAA 5BNNC 2A70A 2ZX0A 3GNEA 4LBOA 2GNDA 3AP9A 5CG8A 5B2GB 2YZ4A 3NAPB 4C1XA 4P9LA 4RGGA 1R081 4G3YC 1TME1 3HD8B 2ET7A 2EXIA 3AKTA 3MW3A 1TMF1 2O8QA 1DQ4A 3APBA 2VNOA 1MS3A 5C4WA 2RS52 2DTWA 2CWMA 2XJQA 4M0NA 1OPOA 1H2LA 5C9AB 1U12A 3R05A 5DUUA 3I4IA 1YRZA 5E88A 1AR62 3KGLA 3V0BA 3ASIA 2IFRA 2VG9A 3HIFA 3OY8B 3VL9A 1SLLA 2CAVA 2VMGA 3GBGA 4Y4YA 1V70A 1VBB2 2OPKA 2YPJA 3WV6A 2BFUS 3ELNA 3AZYA 1ND2B 3WT3A 5DDJ3 4Y1UA 4CDXA 2QZ3A 3VBHB 3SCFA 2RR13 1MZEA 2X5IA 1HXS2 1RUH1 2VOVA 1Q8QA 3WG1A 2WNEA 4WVWA 4MLOA 4I02A 1GANA 2B5HA 2O0OA 3MLLA 3VBSA 5GLTA 4E2QA 3FMGA 1HW5A 3VL8A 5DUWA 1BKZA 4QQPA 1VBC2 1U5YA 1IS4A 1UCXA 4XBLA 5KWRA 1MZ5A 3AJZA 1COV3 3VLBB 1JUIA 3CJXA 1XNBA 1QHDA 2QQPA 2ZHNA 2EAAA 2CAUA 3VDDA 4ZKTB 1CAVB 1RJ7A 3X29B 3R4SA 2WS92 4YNIA 4KWLA 3KCCA 4LHKA 2JECA 4AGVA 2ENRA 4ORFA 1OQDA 1D4M2 3O0WA 2DVAA 1A6CA 4Y20B 2I07B 1KS5A 1VBE3 1O5LA 1PO11 4GWNA 4WVZA 2Z79A 2AZ5A 2Z42A 4AI2A 1ASJ2 3WP5A 2VNGA 2WT0A 4AI3A 3IWZA 3M3OA 3ZVXA 1UN1A 1N3PA 1RL3A 1AYM3 3O0VA 2ZGSA 2KM2A 2QCSB 3NW4A 1Y9QA 3NWKA 2PHTA 2HWB1 1LJ7A 3R0RA 5AFBA 2BTVC 2XKOA 4I3GA 1U5ZA 4FBFA 4MSVA 1MS8A 2RMU1 2CGNA 2ZX1A 1RUJ2 4COUA 5BNNB 3MIHA 2WS91 4M01A 5GZDA 5T54A 2TBVA 1GQGA 1QNWA 1PGW2 4JGYA 4XTPA 5L7OC 4S2GA 4HT1T 4INDA 4XBQA 5JVVA 1YO8A 3J9SA 4QPYA 4FO9A 1B35C 1QQP1 3CL1A 2VOXA 3S30A 3H8UA 3MDPA 1DQ5A 3GZUC 3IT8A 3QH7A 3WG4A 1RMU3 2PHDA 4BQ1A 3IKWA 1RUF1 1SFNA 1ENRA 2JKBA 2YDEA 3MICA 4YLZA 1C5IA 1LHVA 3ZDSA 4XILA 1QNYA 1D4VB 5D8AA 1RHI2 3V64A 5A32B 1N1SA 2V09A 1W6MA 2ZZJA 3LA3A 4AI8A 1QJZA 1LGNA 1DZRA 3RS6A 3PMEA 3MI8A 3ZXJA 1BK1A 1F2NA 2E9QA 4XF1A 4WVVA 3M2MA 1A3KA 4GXLA 4A3XA 3JBG2 4PBOA 4NN0A 4XFFA 4COWA 2NM1A 1AL23 4N9IA 3SHRA 3ZXDA 3ZO0B 4O9EA 4EV0A 3USUB 1VBD3 4JQRA 1MQTA 1H1AA 4AHZA 4YFWA 1DGWA 2DU1A 4YW3A 5K9YA 4SLIA 1ZA4A 5T55A 4K9SA 2EXJA 3KT7A 1XU2A 4B4QA 1RUE2 3V0AA 1CPMA 4K20A 1WW6A 2PLV2 5T5PA 1AR92 3FBYA 2YC0A 3UJQA 3N7LA 1FPN2 4YW2A 4L99A 1RUI1 5DDJ1 4HPKB 4XF4A 4KWKA 3CJIC 4QM9A 5FPZA 4LBLA 4XFIA 4LUMA 4B29A 1ZRCA 4XPVA 1Z7S3 4QXKA 1LOFA 1PIV3 5L19A 3M3QA 3ECQA 1NCRB 4CDWC 3K51A 1BVVA 4URTA 2VPVA 4ITCA 3H1YA 1OFNA 1YUDA 2JG9B 4YVSC 1PM7A 4PDWA 3TAYA 2WSVA 1AJKA 1XU1A 5JI9A 1D2QA 4XIOA 3OTFA 2P37A 2VOKA 3U0ZA 2ZAHA 4X8NA 4Q1PA 4C0HA 1EAH2 5FLJA 1F31A 2SLIA 4Q0UA 4AEDB 1YLLA 3T1LA 1WD3A 5I0UA 4BMBA 1OLRA 4GB33 2SBAA 3P3NA 5GZGA 4CZSA 1I9RA 1VBE1 5FMOL 3UK9A 1PZ8A 5HXVA 4AQSA 1MVEA 3ZFFC 4I0WB 3LCPA 2P2KA 1GKBA 1URXA 4ZU4A 1G9AA 1PZ7A 1FMD2 1UZYA 1NY72 3DV8A 4FPHA 2ZMKA 4PBPA 2HJIA 2YROA 1AYM1 1CAWA 5H9QA 3MEPA 3QCWA 4AEJA 2DTYA 4Q4W2 4CDUB 3PVEA 2UYAA 1UPSA 1H1MA 4CDQA 4S2HA 1YFWA 5ABJB 3VZOA 1QY4A 3HWJA 4FPKA 4QQOA 1JYIA 1AR72 1NA1A 2HWE2 3JD72 2ZHLA 4Q4V2 3AXDA 1SCSA 2VQ0A 1POV3 2ERFA 5EJ3A 2A5ZA 3D82A 1YI7A 1CAXA 4LO7A 2Y26A 1XRUA 3MIFA 2XVKA 1X82A 2PHUA 1SBFA 1KFUL 3FWEA 5GZFA 4IV1B 4XJAA 5DG1A 4WZCA 1PVC3 4AVAA 1RMU1 1LECA 5IK8A 3V56A 1WCDJ 3DGTA 5J36A 2AREA 1FMD1 4HL0A 4AFCA 5CAZA 1ZRDA 1PHMA 2PAEA 4FOWA 3VZLA 5SV5A 3H7JA 2B39A 1LEMA 3AMPA 1HIXA 5JDBA 4W65A 1HRI3 1S0CA 3WVJA 1VAKA 2DCYA 4GQ7A 3S0MA 2ZX2A 2CTVA 4XJZA 1AL21 3ILRA 2HEYF 1AR71 4AFAA 3POWA 2HWE1 2WNVC 2XVGA 5FQ0B 5CA6A 4PLOA 1VBD1 1MS4A 1GQHA 1YWKA 4FP3A 3WDUA 1ZRFA 2GC0A 1XE7A 2DCZA 3D0SA 2UU8A 2R071 4AVCA 3H3ZA 3URFA 3U07A 5T5JA 2I45A 3HN1A 1SLCA 1LOAA 1CJDA 1ZBE2 3RDIA 4YVSB 3AYDA 1IHMA 4JRLA 3SITA 4JVAA 4OLLA 4XW3A 3D6EA 3ZFGB 4DY5A 2VMHA 4LLFA 2P34A 3RI9A 1ZRRA 4IEVA 4RR3C 2Z2SB 1LR5A 2JG8A 4AXOA 5ACA3 4YGBA 4RQPA 3RWNA 1PIV1 4DZGA 3NV3A 5AVPA 1OMIA 4P9GA 3B01A 3HR9A 3ZFFB 5LRRA 4HVOA 4OHWA 1DQ1A 5DZEA 3VUOA 2FHRA 4RS5A 1BBT2 2DU0A 3FFZA 1FOD2 1MEC3 3TBDA 5J09A 1HRV1 1N3QA 2ZABA 2R0FA 4LEJA 2RHPA 2CNAA 5CFDA 5CIRA 2QUOA 1ENSA 3AXEA 2DVGA 4R9DA 3RNSA 3AZZA 4PIXA 4TZDA 1ND3B 2A73B 2B7YA 4WV8A 5DG2A 3ZSMA 2ETEA 1H8TA 1ZM1A 2OA2A 1LEDA 3FJSA 1AYN3 2VMIA 4JGZA 4XJ9A 4RSUA 2A7AA 1C8NA 3MF6A 2DFBA 2WJSA 3LWCA 4XOGA 3K48A 1QJY3 2GH8A 1C57A 3H50A 4M3CF 1O3RA 3ST7A 1QMJA 1T6GC 1IPJA 4YG3A 2FMYA 3VBOC 2I2SA 4YW5A 1CAUA 3LAGA 3QD6A 2B45X 4Q4X2 1PNGA 1AL0G 2G9FA 4HN0A 2E7QA 1W6QA 4DS0A 5BNOA 1IS6A 2WNVB 3PTYA 2BNMA 1QH6A 2VU9A 1DQ0A 1PVC1 3WX5A 1BZWA 2R042 4IEXA 1GZWA 3T2TA 3WW4A 1PMIA 4H55A 1PGSA 1OOPC 3SNMA 4XF0A 4QQHA 4S2FA 1S0GA 4CEWB 4FOYA 5JIAA 2RE9A 2VOWA 1R092 2JE7A 1R083 1TME3 3G6JB 3L2HA 1ULFA 3ATGA 2DURA 3WD5A 5T50A 4BWOA 1TMF3 1HRI1 4XJ8A 1V6JA 4FQ4A 3WDVA 4ZXKA 3SH3A 4Y5Z0 3NAPA 3JCIA 4RR3B 4C0BA 1UAIA 2HWC1 2VULA 2D97A 1TQ5A 1BYHA 1XQNA 1A78A 2KA3A 3QOPA 5TSWA 2UY8A 4I2OA 3DPRB 3WR0A 4FQZA 2W08A 1OKQA 2EA7A 4UW4A 3LZZA 5C9AA 2D98A 2F4PA 3CEWA 3GF6A 2UWAA 2ZGPA 1RUH3 4EWAA 3OY8A 2VXRA 3THTA 5SV8A 4RD7A 2DYCA 4A7YA 1H4GA 1R091 2Z69A 2JDZA 2D6PA 5EV7A 1VBA2 4YM1A 4FSJA 1XNDA 1ND2A 3N7MA 2XH6A 2XWBB 4AG4A 1QF3A 3VBHA 1PGL2 1ZBA2 2ZMNA 3EO6A 2D3SA 2A75A 2RS53 4HKWA 3FLRA 1H30A 1UKGA 4XETA 4FAHA 4AF9A 3ZFEC 5J98B 1GZCA 1LKNA 4HKOA 4IEUA 2UY9A 4Z2WA 2XPJA 3VKNA 2BEOA 2DCJA 4K1ZA 5AC92 4AI1A 4AQ6A 2QVSB 4YVWC 3AKPA 4P9XA 1AX1A 1VBB3 4LHNA 4HETA 1MEC1 1X50A 4LA2A 1W6OB 2WNUC 3IDEA 4KH9A 4WM8C 1CAVA 2PN5A 4GKXA 4EJRA 3AYCA 4A7ZA 4DFSA 4HSLA 2VECA 2K9ZA 4YARA 2XJUA 4BCUA 4EROA 1Q3EA 1DYKA 1DYPA 4Y20A 1VBA1 2IXLA 2KXLA 3J8F2 3M4FA 1VBC3 4J6GA 2R1DA 4UBGA 4IEYA 3GYDA 2Q8OA 1GICA 4X8PA 3IPVB 1NCQC 3ME2A 1LENA 5BV6A 4BLIA 2E53A 1NXD1 4GH4C 1ZZ7A 2OZ6A 3S7EA 3UKTA 2WS93 2XBO2 5FTTC 1QGLA 3NV4A 5CFCB 2WWSA 1MACA 5JMCA 2HKXA 1ZNPA 3KS7A 5KC5A 2R30A 1UU6A 1D4M3 2GNTA 4KL1A 4Z82A 3UV9A 3WQ7A 4FXGB 1AX2A 1QQP3 3NKTA 4P5HA 1JH5A 1HX6A 2WLQA 3AP5A 4LBNA 2IZWA 4RL7A 5BNNA 1ASJ3 5GZEA 2R1BA 1OA4A 4HLTA 2DVBA 1RUF3 3OYWB 3FZ3A 4AFBA 1AF9A 3VBUC 4FTEA 4R4ZA 1XYNA 3RSJA 2UYBA 2ZOEB 2IXIA 2ET1A 3NO8A 1G86A 4DRRA 3OD4A 5BPXA 1C28A 2DWRA 4G9SB 1RUJ3 1AZDA 2EXKA 1REFA 3I7DA 3Q9OA 4QPGA 1PZ9A 2RS32 1RINA 5A32A 2MEV2 1FXZA 1VRH2 4OVEA 1CONA 1J3PA 1LU2A 2P3KA 3WNXA 1J1LA 2VVEA 3MW2A 3USUA 1KQRA 3LB9A 3A0NA 3R4DB 1XXNA 4DINB 4AHWA 2HWD1 1W6NB 2ZMLA 3AK0A 4K1YA 4CP0A 3AYEA 3VBFA 3I59B 2DUQA 4U36A 5JCTA 1POV0 1RUI3 2XJTA 4EN0A 1CIWA 1NOVA 3CO2A 3VZKA 3KLSA 2VH9A 3IBMA 4KGGA 2R32A 4LE3A 1RHI3 1FI2A 5F6LB 5F1RA 2OW4A 3WW2A 4YVWB 2QJVA 2A3XA 4JDOA 3B9CA 4FPEA 2BNNA 1OLQA 2WNUB 4WM8B 3JBG3 3RYPA 3T1MA 3VHRA 3RMXA 4NOTA 4QM8A 4HPKA 4UW5A 1S1AA 5T3NA 4GWMA 2RS31 2R49A 1F9KA 1PK6A 1VRH1 2RS51 2XUMA 3THPA 3AJYA 4KBBA 5LK5A 4ISQA 1RC6A 1RUOA 3B5LB 1AR61 2TUNA 1DBNA 4FOVA 2LTNA 1OI6A 1NCRA 4XF9A 1N3OA 4K8FA 3OBTA 4D94A 1IKPA 2VY0A 1NCQB 1LOBA 4CDXC 4LHLA 2WT1A 1VBB1 2JG9A 1AR93 1H2NA 2TEPA 2X5IC 2XHKA 1BEV2 3AP4A 4GH4B 4XQDA 2BWCA 5T52A 2NMOA 1K5MC 1HXS1 5CBLA 3ACLA 1JHNA 4OHYA 2IC1A 4HFSA 4GMP1 1W0PA 1WLDA 2QE3A 1QH7A 4AEDA 2NN8A 1UKRA 1V6OA 4H7MA 4FTBA 5I0SA 2GC3A 4AW7A 1VBC1 1O4YA 2OYZA 5JZGB 1ZZBA 1GV9A 3I2DA 4D7TA 1YI9A 1HDKA 1R1A2 4MYEA 3KCXA 4YYOA 3HQXA 2DVDA 4MVTA 5IK7A 2UWCA 4QPIA 1PO22 4IEQA 4CRQA 2A71A 2BW8A 4R52A 2XLFA 5LRSA 1G9DA 1FYUA 2GC2A 2K0GA 1O5UA 1EAH3 1VJ2A 4LBQB 4CDUA 2Q30A 3KQRA 1D4M1 2EF6A 3W59A 5KHJA 1QOSA 1VAMA 1GR3A 2NZ9A 2BVVA 4XFCA 3VGIA 5ABJA 3ZN6B 4FT8A 3KD4A 5K7PA 3N4MA 3V65A 2IWGB 4BM8A 1ASJ1 3WY6A 2DV9A