1NCQB

The structure of hrv14 when complexed with pleconaril, an antiviral compound
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
255
structure length
255
Chain Sequence
GYSDRVQQITLGNSTITTQEAANAVVCYAEWPEYLPDVDASDVNKTSKPDTSVCRFYTLDSKTWTTGSKGWCWKLPDALKDMGVFGQNMFFHSLGRSGYTVHVQCNATKFHSGCLLVVVIPEHQLASHEGGNVSVKYTFTHPGERGIDLSSANEVGGPVKDVLYNMNGTLLGNLLIFPHQFINLRTNNTATIVIPYINSVPIDSMTRHNNVSLMVIPIAPLTVPTGATPSLPITVTIAPMCTEFSGIRSKSIVPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COAT PROTEIN VP1
publication title Structural and virological studies of the stages of virus replication that are affected by antirhinovirus compounds
pubmed doi rcsb
molecule tags Virus
total genus 53
structure length 255
sequence length 255
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2002-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1ncqB00
5CFCA 1VAKA 1R083 3VBFC 1RUI3 1FMD2 1HXS1 1QQP1 3VBHC 2R063 2X5IC 2HWD2 1AR71 4Q4W1 4Q4Y2 4CDUB 4FTBA 5ACA2 3DPRC 4AEDC 4Q4V3 1HRI2 4RS5C 1R081 2MEV3 1QJX2 1RUI1 2DF7A 3NAPC 4GH4A 4RQPA 5A33A 2R061 1OOPC 1VBC3 4Y5Z0 4RR3C 1NY72 1ASJ2 1R093 2MEV1 2R042 2XBO2 3ZFEC 1RHI3 1NCQB 5CFDB 1PO12 1Z7S2 1R1A3 1VB2A 5ABJA 1HX6A 4CEWB 4CDUA 1VBC1 1VBA3 2RS33 3S6PA 4CDXB 3VDDA 3JD72 1MEC2 5BNNC 5FMOL 3VBSB 1R1A1 4N53C 1RUJ3 2WZR3 5DDJ2 3VBRC 1VBA1 2RS31 2WS93 4YVSC 2HWB3 1RMU3 4Z92B 5C4WB 1RVF3 1AR82 1SMVA 4LLFA 3HAGA 5C8CA 1PIV2 1FPN3 1NCQA 1PVC2 1AYM2 2GSYA 1RUE3 1RUJ1 2WZR1 1VBD3 3TN93 4PDWB 2WS91 2HWB1 1RMU1 4CEWA 2FZ1A 1RVF1 4CDXA 2WFF2 1FPN1 4GH4C 3J8F1 5BNOC 1RUE1 4YVWC 3VBSA 1ND2B 1VBD1 5D8AA 3TN91 4WM8B 2HWC3 2VQ0A 5C4WA 1RUH3 1BEV1 5BNPA 3VBUB 2PLV2 1AUYA 5AC91 1PO22 1VB4A 5ABJC 1F2NA 4NWVA 4PDWA 2HWC1 3VDDC 1H8TC 1RUH1 1VBB2 4IV3C 1FMD3 1C8M1 4GMP0 1QJU2 4Q4Y3 1PGL1 5ACA3 1ND2A 1AR92 1HQNA 1K5MB 4WM8A 3ZXAC 3ZFGC 1HRI3 1EAH2 5C8CC 5C9AC 1QJX3 1FMD1 1ZBE2 4GMP3 3VBUA 3JB4C 2HWD1 4Q4Y1 4QPGB 5ACA1 1X36A 4JGYC 4FTSA 1ASJ3 1HRI1 4CDQB 4CDWB 1HRV2 1QJX1 2R043 4GMP1 1PO13 1Z7S3 1OHFA 5K0UC 5D8AC 2HWF2 4JGZA 4RFT0 4FSJA 1NY71 1ASJ1 1K5MA 3JD73 1NCRA 2R041 1MEC3 2XBO1 5BNPC 2RR12 1PO11 1Z7S1 4IV1B 1ND3C 5DDJ3 4QPGA 1MQTC 1B35B 4QPIB 3JD71 1AR83 1QJY3 1F8VA 1MEC1 2BFUL 4CDQA 4BCUA 1PIV3 4CDWA 1PVC3 1AYM3 4WM7B 5DDJ1 5J98B 1NA1B 1BBT2 2ZAHA 4N43B 1AR62 1AR81 1QJY1 1PIV1 5L7OC 2WFF3 3ZFFB 2HWE2 1FOD2 1PVC1 1AYM1 4IV1A 1RUC2 1W39A 3CJIC 1B35A 5FOJB 4QPIA 2WFF1 2PLV3 5JZGC 4CEYB 1PO23 5CFCC 4JGZC 4WM7A 3VBOB 2Y26A 1NA1A 4Y4YA 3J8F3 4N43A 5CFDA 4Q4X2 2ZTNA 1RUG2 2PLV1 1PO21 3ZFFA 1QJU3 4RHV2 4Q4V2 1AR93 2WWSA 3VBFB 1BEV3 1A6CA 4RQPC 5FMOS 1CJDA 5AC93 1ZBA2 1VBE3 1EAH3 3VBHB 2X5IB 1ZBE3 3DPRB 1QJU1 4CEYA 4AEDB 4RS5B 2R072 1AR91 1R092 1VRH2 4GB32 1C8M3 3NAPB 1RHI2 1VBE1 1EAH1 1HRV3 1OOPB 4CDUC 1ZBE1 2RMU2 1AL22 4RR3B 2HWF3 2RS12 2RM22 3ZFEB 1RUD2 2BBVA 3VBFA 1HRV1 2HWD3 5A32B 2RR13 3VBHA 2X5IA 4NWWA 3DPRA 2HWF1 4AEDA 1RB8G 1AYN2 5BNNB 1NCQC 5CFDC 1CD3G 3IDEA 3NAPA 4N53B 2RR11 4CEWC 1OOPA 3VBRB 4YVSB 2XPJA 5CFCB 4CDXC 1BBT3 3M8LA 2XBO3 1AR63 1EV12 3VBSC 3ZFEA 2ZZQA 2HWE3 1OPOA 1FOD3 5A32A 1RUF2 5C4WC 1TMF2 1RUC3 1BBT1 1AR61 1TME2 4GH4B 5BNNA 5A33B 5BNOB 3LOBA 4YVWB 1PGW2 2HWE1 1FOD1 1E57A 4PDWC 1IHMA 4YVSA 1COV2 1RUC1 4SBVA 4Q4X3 1ND2C 5ABJB 3JBG2 1RUG3 4WM8C 4RHV3 1V9U2 3VDDB 1H8TB 2RS52 4IV3B 1BMV2 1D4M2 3VBUC 5LK7B 1ZBA3 4Q4X1 5BNOA 1RUG1 4YVWA 4RHV1 1C8NA 1M06G 3ZFGB 2WLPA 1HXS2 1QQP2 2R073 4Q4V1 5C8CB 1VRH3 2BFUS 5C9AB 4GB33 4Q4W2 1DDLA 1AR72 1ZBA1 1GFF2 2RMU3 1AL23 2TBVA 1R082 4JGYB 1K5MC 1RUI2 2RS13 1NCRC 2GH8A 1QJZA 2R071 1VBB3 1R091 1VRH1 4GB31 1H8TA 2R062 2RM23 5J96B 1RUD3 4IV3A 1RHI1 2IZWA 1NG0A 5K0UB 1POV0 1WCDJ 4QPGC 5D8AB 2RMU1 1AL21 2MEV2 2RS11 1VBB1 4CDQC 3ZFGA 4CDWC 1QJY2 2FZ2A 1AYN3 2RM21 5BNPB 1RUD1 3JB8A 5C9AA 1VBC2 1POV3 1ND3B 3VBOA 1MQTB 2BUKA 1NOVA 4JGYA 1R1A2 1AYN1 1EV13 4IV1C 4FTEA 1VBA2 2RS32 1POV1 5K0UA 1RUF3 1B35C 4QPIC 1TMF3 1RUJ2 2WZR2 5L7OB 1EV11 1TME3 2WS92 4WM7C 2HWB2 1RMU2 1RVF2 1ND3A 1NA1C 4RS5A 1RUF1 4N43C 1MQTA 2QQPA 3CJIB 1FPN2 1TMF1 1COV3 3J8F2 1RUE2 3ZFFC 1TME1 1VBD2 1X33A 3TN92 5JZGB 1PGW1 3JBG3 4RR3A 4JGZB 5GKAC 1V9U3 1BEV2 1COV1 1NCRB 5AC92 2RS53 1VBE2 1D4M3 4CEYC 5L7OA 3JBG1 3VBOC 3FBMA 2HWC2 4EJRA 1RUH2 1V9U1 4RQPB 1HXS3 1C8M2 1QQP3 3CJIA 2RS51 1BMV1 4N53A 1D4M1 4Q4W3 2BPA2 1AL0G 1AR73 1PGL2 3VBRA 5JZGA
chains in the Genus database with same CATH superfamily
3ETPA 4YG3A 4BJ0A 3ZYJB 1VAKA 5E88A 1JZ2A 3AYEA 1R083 5FWEA 3RRDA 5JCTA 1W06A 4CUBA 4DUWA 3ZYRA 1FMD2 2QQVA 1VMHA 1QQP1 1DZTA 2AZ5A 4COWA 1NXMA 2R063 2X5IC 3VBHC 1AR71 4FTBA 1H30A 4LT5A 4LA3A 1XE0A 3NMBA 4MYEA 2PELA 1AX1A 3N7MA 1OT5A 4KL1A 1UL9A 1RUI1 2AGSA 1NXD1 4GH4A 4R4XA 4EQVA 4RQPA 2WAAA 3B9IA 4QGLA 5B2GB 3QBQA 4LE4A 4LKSA 2DVGA 3SISA 1LULA 4QDRA 4Y5Z0 3TYJA 4DINB 1ULEA 1VPHA 3SCHA 1WW4A 1YIFA 2MEV1 1OUXA 2QQWA 5IW0A 2XBO2 3BIWE 4HMZA 4CUAA 2YROA 1JYNA 1PO12 3AKTA 2VZQA 1DQ0A 2P4EA 2A7AA 2YBPA 4IW3A 2YU1A 4HZFA 2ZKLA 4QX2A 1X50A 1HX6A 2WNEA 4MSVA 4CU7A 2UY8A 4XE9A 3T2PA 1VBA3 4KU8A 3WF2A 4DFSA 1JHNA 1O8SA 2WRAA 4IEPA 1W8UA 4FPOB 3M3QA 3S6PA 2ARBA 4LOTA 2YG0A 5C3PA 5L9VA 2UY9A 3LA7A 3B7MA 5D1IA 3AMQA 2DURA 4XMAA 1X82A 2A5ZA 3HBKA 5FP3A 1F35A 2ZGLA 3ZM8A 1RUJ3 2QJVA 5FYMA 1HB1A 2PFWA 2FCVA 3WW3A 5K9YA 2RS31 2WS93 2Q1FA 2HWB3 2X8KA 4MGSA 1H0BA 3N9OA 1IOAA 1RVF3 5FZ3A 4QQ2A 5BUVA 1IQDC 1X7NA 2WNUA 2CU5A 4NAMA 3I2IA 3EBRA 1PIV2 2C9AA 1GWMA 1UZVA 1WLTA 1YFXA 2GNDA 2E6VA 4K8RB 1UZ0A 2BDRA 4AZZA 1NCQA 1RUE3 2XKPA 2GSYA 3T0DA 4P9WA 3AMPA 5HCBA 2BNMA 1MS1A 3N7LA 4JV4A 3TN93 1I6XA 2JDMA 4TWTA 4ZPIA 1SFYA 1RMU1 1S2KA 3P3PA 4Y5TA 4P9YA 2HBUA 3VZLA 1IS5A 1JW6A 3IN9A 4IE7A 3RVHA 1GP5A 1PMHX 4I01A 4YLZA 1FPN1 1YQCA 4XIOA 5T54A 4OULA 4L92A 1GP4A 1OF3A 3MW4A 1QY4A 2XJQA 5J36A 2DCTA 2QQLA 2BVVA 4N8MA 4QXKA 4XJ8A 3FC0A 1OA4A 3IZOA 2HWC3 2V09A 4FT8A 3V0AB 5C4WA 2TUNA 3GJBA 1RUH3 3RPQA 2PHRA 4LK6A 5BNPA 4ITCA 1POQA 5AC91 3K4DA 1PO22 2JJ6A 1DQ4A 4XQ4A 3DN7A 4FO9A 1H2NA 5ABJC 1SHWB 3ZKUA 2VZSA 2PHUA 4H7LA 2I45A 4HSJA 2RDRA 3ZIWA 2VOVA 3B3QE 4QQLA 3BALA 4PDWA 2B7YA 4P9XA 2F17A 3OPWA 1WMFA 3VDDC 3K3NA 1H8TC 1W3VA 4IV3C 2JICA 3DYPA 1FMD3 4JQRA 3DF0A 1WD4A 5FLHA 1X9PA 4OVEA 5FY9A 1XQNA 2WA4A 1W8OA 4QQPA 4KH9A 1LECA 1ND2A 3CMGA 1C57A 1FATA 1HQNA 1K5MB 2FMYA 4KBZA 4WM8A 5IJRA 3ZFGC 2JECA 3PTRB 4FPGA 2KD7A 4E4ZA 1GOHA 4YWAA 2WQ4A 5LEJA 1J84A 3PVEA 5C8CC 5IVEA 3SKJE 4OI0A 2D3SA 3B94A 1W3XA 4GMP3 5GJ6A 1BHGA 4HFSA 3WY6A 2ID4A 4XIKA 2WWJA 2BWAA 1YFYA 2Q8EA 1V00A 2CWMA 2QUOA 1WW5A 1HRI1 2OUJA 1CIYA 1KS4A 2N7GA 1HRV2 2QBXA 1PO13 1IPSA 1MPXA 1VR3A 3C7EA 3GALA 4XF0A 4LK7A 5D8AC 2HWF2 3H3ZA 1YJLA 4DY3A 4FBFA 2JE9A 4FSJA 1ASJ1 4OMDA 1UZWA 5FPLA 5JSPA 3GBWA 2PHFA 1ACCA 1WWYA 2JDNA 4AG4A 1AJKA 2R041 4UFHA 2J1UA 2VVEA 3PHMA 4KWLA 5GALA 4D7TA 3OF1A 5LK5A 2W2IA 4IEZA 1ND3C 4Y26A 2I2SA 2VZPA 5GZGA 4U2AA 3AXEA 1DQ2A 4FPYA 4URAA 3KM5A 1MQTC 2D44A 4JC1A 4COYA 2R7EB 3WNMA 1B35B 1OBNA 3V0BA 3JD71 3ZSLA 1F8VA 1MEC1 3TEWA 1ZRFA 4S2HA 4K1ZA 4J1XA 1PIV3 4OZXA 1JYWA 4NMIA 2BTVC 2BRTA 3SHRA 3RFRA 1YYNA 5GLTA 4WM7B 5FZLA 1JZ4A 5JR2A 3MIBA 4LKDA 2WNOA 5DDJ1 4XYXA 5E89A 1NA1B 2AENA 2ZGPA 3AZYA 5C5UA 4GWNA 5LBBA 4DMIA 2W92A 1BVVA 4L9BA 3K4AA 3RYPA 3ZFFB 2HWE2 4UW6A 1SEFA 1U5IA 1VMFA 3E5XA 1PVC1 2OYZA 5DUWA 5A70A 1REFA 3ACLA 4IV1A 1KEXA 4NHLA 4ZXKA 4QQHA 1N1TA 1WCSA 1MS5A 3N7KA 3NV3A 4XOGA 4BK5A 2W3JA 5A1FA 3ACFA 3OD4A 2JG8C 5FOJB 1OQDA 1Y7BA 3OYWA 1IKQA 4XCAA 5GLVA 5FWJA 1LHOA 2XOMA 3AVSA 3UNPA 3FL7A 5JZGC 1BYHA 1T2XA 2G19A 1PO23 2VNOA 3LWCA 4LNVA 4B8EA 4CEYB 3PDQA 2PQQA 3AZZA 1W8FA 4K3UA 1DGRN 3GHNA 1B09A 4N43A 2BYVE 2Z4FA 4AF9A 4V2WA 1RITA 4W6YA 4Q4X2 3WDWA 1WMDA 3M70A 1CZTA 2WQZC 2PLV1 1RIRA 1HN0A 3VHRA 4UAPA 5GZEA 3MLKA 2YFZA 3IDCB 1OMIA 3LGRA 5KBFA 2WWSA 3M3OA 1G86A 3UT0A 1A6CA 4H2AA 4RQPC 1D4VB 5FK8A 1CJDA 1XYPA 1L7LA 1ZBA2 2BP6A 3C7HA 3ZMNA 2ZGUA 3VBHB 2X5IB 3KT4A 4W4ZA 4CVUA 3R6SA 2J1RA 4X8PA 1JYTA 3OOXA 1QNYA 1X8MA 4QHZA 3E6BA 5FCCA 1LU1A 4E2QA 5FPBA 4OHYA 4LBLA 1AR91 1Q3EA 1US2A 2YYOA 3D0SA 3D4KA 4UWDA 2F4PA 4YM2A 3WQ7A 3K46A 3THPA 3OJBA 1DCSA 4XF9A 4AVSA 1C8M3 3QACA 1EAH1 3AKQA 3OD0A 4CU6A 1HRV3 2XONA 3Q8BA 3PJQA 1ZBE1 5E8AA 4MG2A 2JKBA 1GKBA 2VW1A 1AL22 1ST8A 2GN3A 3H1WA 3HPNA 4MVTA 4QB6A 4YNIA 5SV5A 1JZ3A 3B00A 1PMJX 4CRQA 2HWF3 1UYZA 1QJEA 4XURA 2E9QA 2JB8A 3S7EA 1I5ZA 2H6CA 3F95A 2RM22 4HG6B 4BISA 2BOIA 3ME2A 3PUHA 2HWD3 1FXZA 4PHZA 4XZUG 2GP3A 3DEMA 1W9FA 4QU1A 1LU2A 4ZU5A 3VKFC 1O3RA 3DECA 4HN0A 3I3BA 3WEZA 2Q8DA 4IEOA 3GHMA 5FPZA 1H9WA 3T2TA 1E5HA 4Y33A 4RGKA 2ARCA 1ZNPA 1NCQC 3P5BA 4Q0UA 5IVCA 3ZYPA 4DXZA 2PMWB 3NAPA 3M4FA 3HNMA 3HJRA 3PUSA 5FZMA 3IAPA 2RR11 2WZEA 2D6PA 1OOPA 2QFEA 3ENRA 4FCAA 3UGGA 3TB0A 3AB0A 4K8FA 3UGFA 2XPJA 5CFCB 4IXLA 2WC2A 1N1YA 1W2AX 2JDPA 4AFDA 5E6HA 1RXFA 1UF2C 1EV12 4FOVA 3WCRA 4Q29A 5T55A 2Q8CA 2Y34A 5IATA 1XXNA 2HWE3 1HLCA 4RSUA 5A32A 3ZN6B 4B4PA 4BLJA 2PA7A 3ZXFA 3NSTA 5C4WC 4DIQA 4UYBA 5IUQA 2OS2A 2VNVA 2YFUA 3BVCA 3HEIA 4PLOA 4RGAA 4FFFA 5T5JA 5I0SA 5JUVA 1TME2 2D6LX 1CVNA 2V73A 3E6CC 5A3TA 2ET1A 4HBNA 2D5FA 1UMIA 3ZYIB 1N47A 4LO7A 1FOD1 4MXWB 5CA6A 3ZKYA 4PDWC 1D2SA 4EN9B 3MHZA 2VZOA 3WUCA 4XFBA 2PHXA 4OUMA 2GP5A 2ZPXA 2CDOA 2IXKA 2QQUA 4AW7A 1C3HA 4SBVA 3UKVA 2Z69A 2GC0A 1UXXX 1CWPA 3NW4A 2YXSA 4Q4X3 4I2OA 1YC61 1JODA 1ND2C 1UU4A 2ATFA 2HYKA 4FFGA 5ABJB 3A21A 1FI2A 2E32A 4WM8C 2UWAA 5LY1A 1V9U2 2D7FA 4NIAA 1MS0A 4XHXA 1CAVA 3VDDB 5HV4A 1H8TB 3CZUA 2R1BA 3MIHA 3C8XA 4IV3B 5DAVA 3ABZA 4DB5A 4MX3A 3ZOIA 3BOWA 1ZBA3 4FPCA 4PBOA 2EA7A 5BNOA 4SLIA 2DWRA 1W28A 5G05L 3SCGA 3S5AA 5BYNA 3I59A 3ZFGB 3LDKA 1QQP2 3WDXA 2CWSA 4Q4V1 4YZ3A 3RZKA 5C8CB 2BFUS 3J9SA 4COUA 1AR72 5EPAA 2BERA 2BOJA 1DG6A 5FOBB 4LOSA 3MIGA 1YLLA 2QE3A 4EWAA 4CCLA 3RGBA 1AL23 1Q8QA 5LW9A 2VXRA 1RUI2 3IBMA 5LA0A 5EHDA 2R071 1VBB3 1R091 2R1DA 3FHAA 5CIRA 3WZ1A 5CADA 1LOCA 2RM23 4GB31 4MH0E 4BA6A 3OGRA 2IZWA 2D93A 4FAHA 5D8AB 1W05A 4XJWA 1CJPA 2XJUA 5FYYA 2RMU1 3VD4A 3H3UA 5BY5A 2MEV2 3WLUA 1GNZA 1E5SA 1SLAA 2DFBA 2RS11 3H50A 3JU9A 2HH9A 1G8WA 2R6QA 4WVMA 1QJY2 1XB9A 5F8PA 5A3MA 2A3YA 4DXSA 5EJ1B 1G9CA 1ND3B 3AL5A 3ITQA 2O8QA 3NQHA 2OQ6A 3OSDA 1MQTB 4BIOA 3H7JA 1W6NB 3W9AA 4QXCA 2VPVA 1ZRIA 1YXWA 1WZXA 5FZ4A 1YUDA 1DFQA 1EV13 1YCIA 2TEPA 1O4TA 4IV1C 2ES3A 4COVA 4NRPA 2RS32 1MVQA 5GLUA 3SCFA 1XU2A 4JX0A 3VD5A 4LO5B 5K0UA 3QOPA 3BTXA 3LCPA 2BZDA 4HKWA 2Y38A 1GOFA 5HXVA 1MS9A 1AVBA 5FPVA 1HB3A 3A0KA 5I91A 2HLEA 3OY8B 1OH4A 1TME3 1XPWA 2ZHLA 3AFKA 3N9QA 3CHXA 4KG0A 3OGJA 1RMU2 1NE6A 1ULFA 3WCSA 4XUPA 1KJLA 4HONA 1RUF1 4N43C 1JZ7A 4QHOA 1FPN2 2VG9A 3AKRA 4AFCA 2JG8B 4BE3A 2AYHA 4FPKA 5EYYA 2IVJA 4MHRA 1X33A 4EN7B 5JMCA 4BYYA 3WP3A 5JZGB 4AQ6A 5KWRA 4YW2A 1OQEA 2Y64A 2DBIA 2VGDA 1PGW1 4B29A 4Q0QA 1F15A 1V9U3 3KVBA 3RMYA 2B8MA 2B46X 1JYXA 3C7FA 5AC92 3BI3A 1SLCA 3OGSA 1DBNA 2MHFA 1S55A 1S0JA 2WN2A 2DFCA 2DU0A 1IS4A 2VOKA 2VQAA 3BYWA 2B39A 3FBMA 5LA2A 4FXKB 2XUMA 3KVAA 1GANA 4L99A 1KFXL 4META 5ERLA 1T6GC 4MO3M 4BU2A 4RQPB 2P3KA 3PL0A 1QQP3 2XKOA 3CJIA 3VHPA 2VUDA 4UT5A 1BMV1 3WINE 2QDRA 5AVPA 1AL0G 1AR73 1UPIA 4AAXA 3FE5A 5FJHA 2A6ZA 5FDBA 5FYIA 4RA0A 5CFCA 5I8SA 4D8MA 4TZDA 4XFHA 1UYXA 4BQ2A 1JHJA 1XSQA 1Y4WA 1RUI3 1W9YA 3MYXA 4DXRA 4JRAA 4UXAA 1JBCA 4IEUA 4Y1XA 5FY0A 1OURA 4AGVA 3RYKA 5C3OA 1XOYA 4Q5OA 2YBKA 1HRI2 3ZIXA 2YPJA 2EIBA 3KQ4B 4MGYE 2MEV3 2VZVA 2CTVA 3FZ3A 1ZZ8A 3VD7A 1W6QA 3NAPC 1H6YA 4HLTA 4LBQA 1SBFA 4H7MA 1OOPC 3EXUA 3D82A 3DXTA 3PMSA 4CCJA 1LENA 1NZIA 1ASJ2 1JOPA 2OUHA 4QKBA 1GYKA 1UU6A 1UY0A 4Y1ZA 2D6OX 2WNVA 1OA2A 3LF7A 4RD7A 4TN7A 2R042 1O4ZA 1UOBA 2DVFA 2E31A 1RHI3 1NCQB 2YUEA 4XBQA 1NUKA 3T4VA 1U0AA 1VB2A 4IUGA 5DG2A 5ABJA 1U5XA 4A7YA 1VAMA 2EAKA 4DXTA 2VOXA 4CDUA 2XG3A 2RS33 5B4NA 2DCJA 2ZBJA 5A7WB 5ANQA 3VDDA 4XUQA 3JD72 4AHXA 1MEC2 2E33A 5H9RA 2FDIA 1NLSA 1V6KA 4XQWA 1CAXA 1AXKA 1EP0A 5DDJ2 2WT2A 2PYTA 3VBRC 4D7YA 5JSRA 2EXKA 3WDVA 1RMU3 5C4WB 2IXIA 2CGOA 2B42B 1SMVA 1ZA4A 2J22A 3ACGA 4LLFA 4A4AA 5FPAA 5C8CA 5F2SA 2CSGA 4INDA 1FPN3 4KWUA 5DXDA 5FZCA 5L19A 1GSLA 4C1WA 1PVC2 2HJIA 2VCAA 3IMMA 4FOYA 4Q0VA 3RG0A 4BLIA 2ZABA 1WLWA 4XJAA 3TNQA 5F3IA 4PDWB 5FO7B 3OBTA 2LRPA 2W68A 4FI9A 1CZVA 5FYVA 1U5YA 3RJ2X 4CDXA 1W2TA 4D94A 3VKLA 3OPZA 2WFPA 5FXVA 2A70A 1QHDA 2B9UA 3J8F1 3S30A 2OKXA 4AEJA 4QAWA 5A3PA 5BNOC 1OUSA 4ASLA 1JU4A 3VBSA 1ND2B 3SITA 1VBD1 1CESA 2WL1A 2X09A 4XABA 3HR9A 4MXVA 5D8AA 2V4VA 5GLZA 4WM8B 3WV6A 5J09A 3FLRA 5HI0A 1BLZA 1H2MA 4CE8A 2GC3A 5IFTA 3WF0A 5DZFA 3UESA 4RL7A 3PLQA 3H7YA 1S0DA 2PLV2 5FYTA 2XGXA 3N9PA 4BIFA 2ZKNA 1TQ5A 1WBLA 1UOJA 2VCCA 4PF5A 3RQ0A 4AI3A 2QQNA 3ZXDA 4Z2AA 1E5RA 3MW3A 5APAA 2WUHA 3RWKX 4BWOA 4U36A 1GP6A 1LESA 3R4UA 1N3QA 1QXRA 5K4LA 4A2UA 4K7JA 3LQCA 4EZ4A 5CZKA 5C5TA 4QD2A 4PQQA 5FP8A 4M3CF 1Y9QA 4GMP0 1PX3A 2YY1A 4PF1A 2OQ7A 2VUAA 3MO4A 4XTMA 3A4UA 1AR92 1DF0A 1XYNA 4Q8LA 3DUIA 4YGEA 3ZXAC 1UXZA 2EXJA 3U4XA 5LRSA 1O3TA 1HRI3 2BGPA 2VMDA 5JWPA 1EAH2 4AHWA 2D97A 2V5YA 4W50A 1OD3A 1LRHA 2GALA 2OZJA 1ZBE2 4FVVA 3KHCA 4AQ2A 2WZPP 3GZEA 3HN1A 3JUUA 1SPPA 2AC1A 4MZUA 4F83A 2O1QA 4PQ9A 1QU0A 4C90A 4ASKA 3V0BB 4Q0SA 1ASJ3 3J7LA 3ZXLA 3VGIA 4UI9L 2R043 3WG4A 2PHDA 2Q30A 3N9NA 1WBFA 2VUCA 2GMEA 3GZUC 4A41A 4D6QA 5K0UC 1ZVFA 2P3IA 2IXHA 1UOGA 2OVUA 4AL9A 4RFT0 4PIYA 5JOWA 1NY71 1W6MA 3FLTA 3MLJA 4NUBA 5FJKA 5FKCA 2R0HA 3G7DA 3S7IA 5I0DA 5FO9B 5FZDA 3JD73 1OKOA 3SXWA 5FFOC 4UW3A 2ZMKA 1MEC3 1JYVA 5A1LA 5C6CA 2RR12 4LKEA 3ZSMA 4IV1B 4GAZA 1V6IA 4M4RA 4QGNA 5DDJ3 4CP1A 3PMEA 2XH6A 4J1WA 5J7MA 5FBJA 3OYWB 1N3PA 2JDZA 2P1BA 2XJTA 5HCFA 4ZZ8A 4DQAA 2VQTA 4GULA 2FMDA 4QX5A 3FMGA 2BFUL 4CDQA 3AJZA 4CDWA 3ZR6A 1PVC3 3ZN4A 3P1IA 4NIHA 3DKQA 2XHNA 5J98B 2XWJB 2DTYA 1C28A 3MGUA 3MDPA 1DQ6A 5FUNA 1LB2A 1CR7A 1ALYA 1S0BA 4N43B 3WW2A 2YU2A 4QX7A 4C8DA 4UBGA 4XDOA 2QQKA 1QJY1 1H1IA 1NE4A 3H42B 4QKDA 3OEAA 4R9CA 5LWBA 1YNAA 3VB9A 2QNKA 1FOD2 1Y43B 3AMMA 5CB7A 3Q9OA 2D3RA 2BBAA 3CJIC 4E27A 2VZ1A 4I3GA 2ZAAA 1V6LA 5BXXA 3WP5A 1QH6A 2DUQA 1XNTA 4EROA 3J26N 2HEWF 2PLV3 1PGSA 4NE9A 2W47A 5CFCC 2V4AA 1FNYA 3FX3A 4AGRA 5FZHA 1QJFA 4BZ4A 3HIFA 5CISA 2CAUA 2XQXA 4ZU7A 1SLBA 1KJRA 5EQUA 2IFWA 2VJXA 3MW2A 1A8DA 1A78A 3I3EA 1LOEA 3N9MA 1PNFA 3O1UA 2WINB 2XQRA 1UY2A 4FPLA 2ZOEB 3LFIA 4W6XA 1Q8SA 2C24A 5F6KA 5JAXA 3SH4A 1RXGA 5A7WA 4Q4V2 1AR93 2JXAA 4WVVA 1WGPA 1BEV3 1UU5A 1VJ2A 4I3PA 1GU3A 5CKNA 4OMCA 1EAH3 4XHBA 3OEBA 3FJSA 1ZBE3 3F2ZA 1OVPA 2ZCWA 3U14A 4XACA 2LTNA 5FQ0A 4XJUA 2WNVC 4QB2A 4NHKA 4O65A 4FFHA 2R072 4H3WA 1R092 3POIA 5DZEA 5FXXA 1BXHA 4LJHA 4GB32 4YGCA 4Z07A 3NAPB 3K48A 5JOZA 5FUIA 2A3XA 2WT0A 1OOPB 4XJ9A 4CDUC 1FYUA 1DGWA 3I7DA 3KB5A 5KHKA 4S2GA 1XNCA 2RMU2 4GALA 5FYCA 1GZWA 5FZ6A 4CUGA 4DPNA 3QLQA 4Y3OA 5CAZA 2RS12 2VZ3A 2BJSA 4Y22A 4ET7A 2WN3A 4GWMA 3WP4A 2WO2A 4AEKA 3W5NA 2UU8A 2GDFA 5A1AA 4L2NA 3VKNA 4HVOA 3VZOA 1ZREA 4X8NA 1UYPA 1ZX5A 5A32B 1TG7A 2PXJA 2RR13 1QF3A 4UFKA 4H55A 2NQYA 3DPRA 4JDMA 3POEA 5EP9A 4BQWA 4GZ9A 3MF9A 4MGTA 2XHKA 3BODA 3EQEA 4AEDA 3ZYFA 1LOAA 2JDHA 5FP9A 1ZM1A 4XFIA 4JAAA 4XXAA 1I9RA 4OHWA 1AX0A 2AH2A 4HKOA 4BM8A 2WO3A 3O1TA 1SFPA 2G9ZA 4FOQA 1J58A 4LA2A 4WVWA 3VBRB 5IVYA 1GOGA 3WG2A 3WQBA 1W2OA 4CDXC 3DXUA 2ZMNA 2QTWB 2WO1A 3WVJA 1H1MA 2CL2A 2H0VA 2XBO3 2ZEWA 3VHOA 5EXOA 3VBSC 3ZFEA 4N9HA 3LEGA 3WW1A 3R0RA 4AQTA 4ARYA 1OPOA 1FOD3 1PK6A 2AUYA 2UYBA 3ILFA 5KC6A 1CAVB 1RUF2 2GNBA 4NOTA 1TEIA 2WIIB 4LUMA 3ZVXA 5KHGA 3VZJA 5L36A 1BBT1 3HN3A 3I2HA 4Y4RA 3BKZA 4K1YA 1AR61 4AI0A 1XNAA 2H6BA 1JZ6A 2HKXA 4WZFA 5BNNA 5A33B 1HB2A 5BNOB 3LOBA 2RJ2A 3URFA 2XL9A 1PGW2 3PVNA 4RN5A 4BMEA 1W6OA 3I59B 1IHMA 4IEVA 3ECQA 4TYSA 4YVSA 5A7PA 4AFBA 5JI7A 3P6BA 3WNPA 1PVXA 2J42A 2P6CA 1AJOA 1CQ9A 3PTYA 2R32A 1JZ5A 4TXWA 4A44A 4KMQA 3CLPA 4JKMA 2AR6A 4KNCA 1RGSA 2ZEXA 3NV2A 1GZ9A 5LA9A 3SKVA 1G9BA 4NPMA 1SLIA 3OUHA 2XVGA 2NYYA 2ZGOA 1UPSA 3V64A 5FR3A 1JN2P 2VC9A 3ZLIA 2XL7A 4IE4A 4ZZ5A 1BMV2 3KGLA 3AVRA 2Q1MA 3NJXA 1S0EA 2OA2A 5G04L 3I3DA 1H8VA 4AHYA 3IM0A 1QWRA 5T5LA 3POSA 4RHV1 1SDWA 4R9DA 5FYHA 1BQPA 2C5DA 4WVMB 4LULA 3H8OA 2R073 2Y0OA 2Y6HA 3LE0A 1C5HA 4OUEA 1STMA 2CY6A 1LGCA 1S2EA 4GB33 1D0GA 4GA9A 3I8TA 3CU7A 3KF5A 3VHNA 1UNBA 5FP4A 2RMU3 4OI1A 4YPJA 2Y60A 3HQXA 1PM7A 4IESA 2GNMA 3HNYM 3CEWA 2W1SA 2RS13 2GH8A 3R4SA 1QJZA 2R30A 4NIGA 1VRH1 3A23A 1MVEA 3WDTA 4XAAA 4WV8A 3ZPYA 5FZ9A 1NG0A 2B4KA 5IK5A 5K0UB 3UK9A 2VW0A 1NKGA 3OBRA 1GV9A 1JOJA 3T0AA 3APBA 5FP7A 3NNMA 3W58A 3RI8A 5JI9A 2J1AA 4CDQC 5IVVA 1G9DA 1DLLA 2OZ6A 4CDWC 2YPDA 1A3KA 5DZGA 1RC6A 1N1VA 1RUD1 2VR4A 4BMBA 3JB8A 5C9AA 3USUB 4ZKTB 3ZXGA 4IEXA 4O61A 1F5JA 5AVAA 1QMJA 1LOFA 1BJQA 3MI8A 3T1LA 3ROUA 3WXPA 5FY7A 1IQAA 2PN5A 1OD5A 2JWPA 2IXLA 4S2DA 4EYUA 4Z2WA 1J1TA 2BUKA 4DUXA 2J7MA 3VLBB 2A75A 2E7AA 4Y1UA 1AYN1 1OLMA 3O12A 4BXSV 5CG9A 4LBJA 2VECA 2I74A 2VW2A 5H9PA 4AI9A 3NNFA 1POV1 3AP5A 5J3UA 2C6SA 2KM2A 2GU9A 3LEIA 4LBMA 3ST7A 4Q26A 3Q8CA 5D21A 3N7JA 2F4LA 3KS7A 1C4RA 1RUF3 1UCXA 3BTAA 2DVDA 3GGLA 3WP6A 2NPIA 4QXBA 5LBCA 1Q8PA 2BWCA 5TSWA 2HEVF 1HIXA 2C26A 1DZRA 4RGGA 2EIGA 4QX0A 4AI1A 4CCNA 2Q0AA 2RVAA 4NVPA 3Q8EA 3VZMA 2QKDA 4B1MA 2ZZJA 3L2HA 5T52A 3H1YA 2EXHA 2P2KA 2X53S 3DV8A 2FDGA 2VZUA 3CJIB 4GKYA 5EJ3A 3WQ1A 1DLCA 3J8F2 5A7QA 1NT0A 1YRZA 1VBD2 2RV9A 2KR2A 2ORZA 3AP6A 3E5QA 3N36A 4LHLA 3VL9A 1P8JA 2J1SA 3LEKA 5C33A 5F37A 1ENRA 1RUNA 2TNFA 5GKAC 2ERFA 2RHPA 3DCQA 2VZTA 5FPUA 4YM0A 1RUOA 5T50A 1GWKA 1LCLA 2W1UA 4HANA 4L0PA 3WUDA 1NCRB 4N7UA 2R0FA 3U07A 3TEZA 2E63A 1VBE2 5LY2A 2AREA 2D6MA 2JEMA 3TRSB 4AOCA 4EE2A 1EYBA 2BU9A 1UY3A 3I2FA 3K51A 3D8CA 5L7OA 1KS5A 3HD8B 4ISQA 3Q8FA 5F7UA 4IDZA 2CAVA 3VBOC 1ULPA 4P02B 2Z79A 1GBGA 3IIAA 4JRLA 4HOOA 1W6QB 4LE3A 2P3JA 4NHXA 4CP2A 4LBQB 2XJRA 2ADEA 1WLDA 4Q27A 5A3NA 1MS8A 2JDAA 1VRBA 3KWVA 3MIFA 2VAUA 4QWNA 2RS51 5FTTC 3WT3A 3RZLA 1D4M1 2X10A 1QXJA 2B9VA 4EN0A 4AVBA 4P08A 4FP2A 3VBRA 5F39A 5FZAA 2WNVB 2CYFA 2PTMA 3KV6A 1IPKA 2DUPA 3JQXA 1JOBA 1W99A 1QOOA 3O0XA 2ZEZA 4FPEA 1W8NA 4ZXEA 1F4HA 5KXBA 3CKHA 2IWGB 3KCCA 5JXGA 4Q4W1 4CDUB 4LBNA 2J1EA 3I3MA 2HBTA 3DPRC 3KGZA 3ZO0B 3NJVA 4V2VA 5T5PA 5ISLA 4AEDC 3HQRA 4C1XA 4E9KA 1OXCA 4ZONA 3ZDVA 2JD9A 4Q0PA 3N3HA 4LQRA 5FXZA 5FMDA 5A6ZA 1WW7A 2E7TA 2XJPA 1UN1A 2WABA 3ES1A 4XUTA 4TLGA 1CAXB 4YARA 2UURA 4QX3A 5FPXA 5A33A 3S5QA 3AXDA 3A0NA 4HPKB 4P00B 3KV4A 4FOWA 1W0NA 1IGOA 2ORXA 2ZGMA 4P9GA 4RR3C 1XU1A 5FK7A 3D0JA 1NY72 2RE9A 4E4HA 3ZYGA 2WA3A 1H2KA 2PHTA 3EHKA 1SBDA 3ASIA 2R16A 3ZFEC 1LODA 2EAAA 1QGLA 4UFLA 1V6JA 5JIUA 2V72A 1PK6C 1HQWA 2J1VA 2WZ8A 1VBC1 3IMNA 4UW5A 3OG2A 4JTOA 1ENXA 5FY8A 5HXMA 1QXPA 4MGKE 5HCAA 2IFRA 2NM1A 4CDXB 3PUAA 2WJSA 2LS6A 1S0FA 1K45A 1OFSA 5BNNC 4OUSA 4AFMA 1WLCA 5C71A 3VBSB 1R1A1 3SH3A 4K40A 1HKDA 1SQ4A 1VP6A 1G9FA 1SG3A 4D3WA 4YVSC 2BGOA 4TSVA 1YWKA 5A6QA 4IE6A 4GKXA 2Z42A 5FZ0A 3ZYBA 3HVDA 3T09A 4LR4A 1UOFA 1Q5OA 5EIYB 3PUQA 3HAGA 1C1LA 3EMRA 1VMJA 5FKBA 2SLIA 3WW4A 2WZR1 3B93A 3ATGA 4PLNA 1VBD3 5KXEA 2AEYA 2W5FA 2C1FA 5FMBA 4CEWA 2A6XA 2A73B 2HEYF 4V1PA 4Y20B 5GZCA 4M3CA 4DY5A 1BVP1 1LEMA 1Y9GA 4LHSA 2FDJA 4NPRA 5HV0A 3AYAA 2VMIA 3GBFA 5C7GA 4N9IA 5CNAA 4XC9A 4QQOA 1DHKB 1SCRA 1JU3A 2VCMA 3TEYA 2BNNA 3I49A 1BCXA 3WNLA 2VQ0A 3FWEA 2JB4A 5B4XA 4R9BA 4TLFA 1SPPB 1ZYBA 3K4ZA 4FPJA 3UGHA 3SNMA 3USUA 1VB4A 4KU7A 4P5HA 5A3OA 4G3YC 2VUJA 4NWVA 3UL2A 4LHKA 2X05A 3ES4A 5A7SA 3POFA 3OTFA 1S0CA 5DG1A 4NPLA 4Y5SA 4YW3A 4Y1VA 3IAQA 4D0QA 1HW5A 3A22A 3ACIA 3VDCA 1SLTA 4A45A 3PIJA 2OPWA 1C8M1 1W8ZA 3J4UH 1I1EA 2ENRA 5FUPA 1W2UA 4M0HA 5LB6A 2PAKA 4DS0A 3HMYA 2ZX3A 3NL1A 5L9RA 4AFAA 1W6MB 3DKWA 3IDBB 2Y6GA 4CCEA 1JYIA 5BPXA 4CCDA 1OKQA 3U75A 3WHUA 5C9AC 2GZWA 3LIGA 4KI5M 3UV9A 2UWBA 3OUJA 3CO2A 4Q1PA 1LOFC 2WYSA 3VBUA 1ZRCA 3GCWA 1F31A 1W9SA 2HWD1 2ZX0A 3JB4C 4Q4Y1 1K3IA 4P5YA 1APNA 4ES8A 5ACA1 2IXCA 3HOBA 4OQ8A 4GWJA 4E2GA 3IIIA 3UJOA 4FTSA 1W03A 1ODMA 2XVKA 4CDQB 3KCXA 3PURA 4CDWB 1I5PA 1QJX1 5A6YA 1PHMA 1IZ3A 1YQ6A 4GD4A 1QOSA 1OHFA 3K2OA 1BKZA 3OGVA 2QQOA 3H1MA 3H3LA 1PNGA 1RINA 4CU9A 4R9AA 4JCKA 2JG9A 2ZGSA 4UFIA 1NCRA 3J7HA 1LNSA 4CUCA 1J3QA 2K9ZA 1Z7S1 1ZRRA 3NVCA 1UIJA 4IE5A 1ULGA 3O1VA 1R1ZA 5A80A 4QPGA 1IG0A 2RDQA 3FUOA 3GZAA 4NJ4A 3WNKA 2RDSA 5IAXA 4URTA 1QJY3 3CNAA 1VIWB 2NMOA 3CL1A 2W95A 1Y3TA 3LIHA 3A7QA 1OPMA 3RZGA 1H2LA 1H4HA 2FD8A 4BH9A 1XSRA 4EN8B 5L9BA 3ON7A 1DU3D 5GM0A 3ELNA 1BBT2 2ZAHA 4XZPA 2W46A 3KZ4C 1AR62 4CXYA 2YZ4A 2XUEA 4OI4A 4YG6A 3DYOA 1AR81 3VKOA 4HK8A 4K21A 2C0ZA 4DOUA 2RDNA 5L7OC 3OB8A 2EIEA 3S57A 1XE8A 4CXWA 2LALA 1AYM1 5DQ0A 1C5IA 5DAPA 5FZ8A 2XB6C 3CBNA 3CDZB 4KQ7A 5FAXA 1RL3A 1FX5A 1G7YA 5LBFA 3ZR5A 2JX9A 4IERA 4NHYA 5DAQA 4K6BA 4QPIA 1O3QA 3ZPOA 2WFF1 3LPGA 4HPKA 1VLNA 5FQ0B 4BQ3A 2VMEA 5JLVA 5F2WA 4CPBA 1OLME 2JDYA 3POYA 3C3VA 3MBWA 3LDRA 4JGZC 3VBOB 4E8DA 2VU9A 2A1XA 1XRUA 4OLLA 3O1RA 2O14A 1GMMA 3ZXKA 3TNPB 2Q4SA 5KHHA 2ZTNA 1GZWB 2E53A 2VD7A 3MFCA 1ENQA 4OYUA 3LA2A 5FZOA 2NN8A 5F3GA 3RSJA 4LKFA 4RHV2 4Y22B 3UKNA 3U78A 3M7AA 4LHNA 2VO5A 4KGGA 4MHUA 4AAPA 1NX9A 3AZWA 3O0WA 3ZXEA 4LO6B 4B7KA 4AVCA 1G6NA 5FMOS 4AI2A 4Z8BA 5AC93 1Q8OA 3T1MA 1W6PA 1LEDA 3O7OA 1J3RA 2NZ9A 4GXLA 5A3WA 1UQXA 2WSUA 3DPRB 1WCUA 1QJU1 3SQOA 5IT6A 5AFEA 2SBAA 5FYSA 1GQPA 4MUVA 4AEDB 3RMXA 2YC2A 1JTZX 5CVRA 5JXJA 1Z78A 1W8TA 1VRH2 4QHBA 4YSFA 1LOBA 1RTVA 1VBE1 1ULCA 1CONA 3FBYA 5A6XA 3RI9A 3MLLA 3IB3A 4XQDA 3RJRA 1TNRA 4XFCA 1HB4A 4RR3B 4COZA 2XWBB 4EN6B 2OW4A 4P9IA 1KXGA 1O5UA 4Y20A 4XUNA 3VDBA 1EUUA 5FY4A 3ZFEB 1RUD2 4NAOA 3HQUA 3VBFA 2H0BA 2RJLA 5JPMB 1ZRDA 1X8EA 1WD3A 4G9SB 1J1LA 1PK6B 2VY0A 4C0BA 5I8TA 2WBKA 4JKLA 4FXGB 1W0PA 5FO8B 3EYPA 2K0GA 4RYDA 4I0WB 5CKMA 2O8OA 1AYN2 1A34A 5FREA 3TBDA 4Q8KA 5BNNB 4YW4A 5CFDC 1CD3G 3IDEA 4M4PA 2VOTA 4LUKA 2YBSA 4XPVA 2VMHA 3WDUA 3CJXA 1W6OB 1UZYA 4CEWC 1FV2A 4YVSB 4HSLA 4LITA 2JE7A 1RYYA 2F6BA 2P17A 2DTWA 4QPYA 2FCTA 1BBT3 3I2JA 3M8LA 3OBAA 3RNSA 3FHQA 1AR63 1GQHA 4KWJA 1LKNA 4CCKA 4EWDA 1V6OA 1MZEA 3PU8A 5JOXA 2VTFA 1OLRA 2ZZQA 1U5ZA 4LO8A 1JUHA 3N35A 1H4GA 1TVGA 2W1QA 4DEQA 4IEQA 2EF6A 2VVFA 1ENSA 3QH6A 4EZHA 1DYPA 4FAGA 3K77A 4YYOA 1FV3A 3VD3A 4HETA 1TZOA 4P9JA 5IVFA 1UY4A 2ZA9A 1I3HA 4AVVA 2ARXA 1CAWA 1E57A 1NLQA 2XLFA 2D6NA 1ODNA 1RUC1 4M00A 4MGZE 1BZWA 2QQJA 4MADA 4N90A 4XDPA 2D6KA 4XBLA 1GZCA 2FHRA 1ZZ6A 3H9AA 1GNHA 5H9QA 4E4SA 3WX5A 2DCKA 4QT6A 1KITA 2XLGA 3AL6A 4QM9A 4RHV3 3BPSA 2QQMA 3DYMA 3NV4A 4AGGA 4B1LA 4YRDA 3OBZA 2RS52 5FZGA 5CG8A 3RS6A 1D4M2 3K75B 3VBUC 4LXLA 2IVIB 1GR3A 1R64A 3KHBA 4KWKA 3WD5A 4AQSA 4AXOA 5LZ6A 1RUG1 2ZACA 2JD4A 4YVWA 5I0UA 2PHWA 5FYUA 3M3EA 4BB3A 3V65A 3MZHA 2PHLA 3GDBA 4GQ7A 3AP9A 5GLWA 4QX1A 4CU8A 1M06G 4ONUA 1HQLA 4DEVA 5GZDA 1MS3A 5F3CA 1UY1A 3B02A 1VRH3 3MEPA 5F3EA 2UYAA 4Q4W2 4CP9B 1F4AA 3MFAA 4M3CE 5C9AB 3WNXA 5DMYA 1Q43A 1UO9A 4LORA 2ZXQA 2YMZA 1LTEA 2YDEA 4DRVA 4ATFA 5FZKA 2BW8A 2XMLA 3T2QA 1DGLA 2GMMA 5DUXA 3AKPA 3QH7A 4XF1A 3THCA 2JG9C 4CYDA 1EY2A 1NCRC 2JKXA 4W6WA 2VOWA 4OHXA 4MGIE 1OF4A 5J96B 1RUD3 2D40A 5DPNA 4GIQA 1RHI1 2DYCA 3USSA 2CGPA 4LBQD 3JZVA 4QPGC 1WCDJ 4YZ1A 1DGWX 1OSGA 3BN6A 1LR5A 2EIDA 2NMNA 2Q5TA 2YGLA 3ETQA 2DCZA 4UW4A 5D2AA 3TEXA 3D6EA 4JDOA 5FY5A 4AR2A 1SFNA 5DAXA 4AEMA 3RYRA 1AYN3 4B4QA 3U0ZA 5CKQA 4NHMA 4ZY9A 2ADDA 5BV6A 4YFWA 1VBC2 3O0VA 3WQ0A 1POV3 3AYDA 4O9EA 2A3WA 4XFFA 3S0MA 1EUTA 3VBOA 3ZSKA 4K9SA 3O1OA 1OLQA 3FFZA 1J59A 4QKFA 4BXFA 2VL4A 2D5HA 3MIEA 2MPFA 4JGYA 4P14A 4LTAA 4PJYA 1JH5A 1V0AA 5T3NA 1R1A2 3N4MA 2BV4A 5DABA 3RZHA 4BQ4A 2DV9A 2LROA 1N1SA 5F5QA 1KD7A 5FLIA 4FFIA 2W87A 3ZSEA 2V5DA 5KHJA 1DP0A 3NJZA 4E2SA 5FZBA 2YHJA 4QPIC 4CPBD 4YW7A 1FNZA 3C7GA 3KLSA 2ZHMA 4MGQA 4S2FA 2WZR2 1KDKA 3O14A 1D7PM 4XDQA 5L7OB 1UKGA 4NROA 1MZ6A 2X29A 3JQWA 3PNAA 4YGBA 1YFWA 2BQPA 1WMXA 3VUOA 4IQPA 3AKSA 1KRIA 3H0OA 3T3YA 1PZ7A 3B01A 3IPVB 1W9TA 2QQPA 1MACA 4XFGA 3JCIA 1TMF1 2NP0A 5GZFA 2WLQA 2QQIA 3NRUA 4DUVA 2GNTA 3GYDA 4UOJA 5HCHA 1AXZA 3B5LB 5J37A 4RR3A 3MICA 4JGZB 1QEXA 2XJVA 4PI0A 1COV1 2D98A 3PIGA 3NNJA 2RS53 3AJYA 1D4M3 1L7QA 3GCXA 4QX8A 4HVQA 3ZSJA 4D6RA 3BGAA 1UIKA 3NJYA 1EPWA 2CGNA 3JBG1 3MPBA 5M0TA 1QNWA 1PMIA 2LW8A 1GWLA 4W65A 3J7MA 4EJRA 4JHZA 4XTPA 2W0XA 1UZZA 2OIIA 3R05A 3I97A 4PLMA 2WKKA 1C8M2 4L11A 2WO7A 1PX4A 3HWJA 3LB9A 4HL0A 4Y24A 5L73A 2E26A 4Q4W3 2BPA2 1KDMA 2A71A 5EZWA 3I2DA 4EV0A 2OT7A 1GQGA 2ARAA 1NQJA 2JDKA 5F5CA 1CGPA 2VNGA 4CA9A 4JHTA 1J3PA 3WNNA 2VVDA 2CV6A 4UFMA 3VBFC 3BOPA 3T08A 5JDBA 3MV11 1HXS1 4YW1A 1AX2A 2VMFA 1O59A 1QH7A 3GXUA 2A6WA 1CAUA 2HWD2 2W52A 4Q4Y2 1IG3A 2WQ8A 5ACA2 3H8XA 1LAJA 4XCBA 4J25A 1LHNA 2NLRA 3H8RA 3PVBB 4FQZA 4HVRA 4Q4V3 3PU3A 4RS5C 1R081 3E1F1 3GF6A 4GJZA 4BPZA 3P3NA 1QJX2 2W39A 3ALQA 1GZTA 4WVZA 2DF7A 4XVHA 3VKMA 1OFNA 5JPNB 3T2OA 3RZJA 5IYYA 2R061 4HKLA 3WF3A 5DAWA 3SMHA 3FUQA 4FP3A 3NO8A 3LA3A 5DUUA 1VBC3 1W04A 1BK1A 4OHVA 3W5MA 1R093 4Q1RA 3ORJA 2JE8A 2QZ3A 3E5UA 5F5IA 2K2SA 1UX6A 5CFDB 1AXYA 1Z7S2 2VNRA 3FFQA 1R1A3 1V6MA 3AM2A 3GNEA 3NKGA 4FQ4A 3ZXJA 3UYJA 4E4DX 2MNGA 4FPFA 1XNDA 4CEWB 2BNOA 3LFMA 3AP4A 3L2YA 4M3CB 1ZA7A 2VBPA 4PT6A 4X6QB 3U4SA 1V70A 3I2GA 1O3SA 1UW8A 1WKYA 2EVXA 1W2NA 1K5JA 1XYOA 4CXXA 4J6GA 2GC2A 5FMOL 1SCSA 1OH3A 4R4ZA 4UF0B 4CZSA 1ONAA 4YFZA 4N53C 2DCYA 2XDVA 4MOAA 2WZR3 3U1XA 4BQXA 2QVSB 3Q8AA 2QCSB 3LPFA 1VBA1 1D0HA 2WR9A 4DO0A 4QDQA 4Z92B 4YM3A 3RZZA 1AR82 2WWUA 4QKNA 1M4WA 4IETA 4CP9A 1AYM2 2AACA 3BUCA 1RUJ1 3O5SA 3FLPA 1O6UA 5CBLA 4O9GA 2WS91 4X6RB 2HWB1 1PM4A 2GC1A 4XJZA 5JVVA 5FZFA 3HBZA 2FZ1A 2P3YA 1RVF1 2ZHKA 3WNOA 1S4CA 4IGOA 3PVOA 4HN1A 3U37A 2WFF2 4GH4C 3POBA 2GN7A 1GUIA 1RUE1 2G9FA 4ZS2A 1LOGA 4YVWC 3LDBA 3TN91 4A3XA 4AE2A 3AP7A 1YEWA 2FBEA 2ZEYA 2XXZA 1GICA 5J1XA 5FZ7A 2CHHA 5FIXA 3VZKA 2VBBA 1AF9A 2WT1A 5K7PA 3EB7A 5C3QA 2OX0A 3AC0A 4UBHA 3KV5A 1BEV1 1XBFA 2VBDA 3KMHA 3VBUB 4ASMB 1AUYA 1JI6A 3AK0A 1NLRA 1FT9A 4A7ZA 3IT8A 4R52A 3FN9A 1F2NA 1J83A 3JXSA 5A7OA 2K46A 2ZMLA 5FRAA 3ZN5A 1QKQA 1N3OA 2HWC1 1U12A 2P34A 2VMCA 2P37A 2VE1A 1ZZCA 2VULA 3V56A 1WW6A 1RUH1 1VBB2 2VZRA 3LKJA 4NR1A 4YZ4A 3ZX7A 3GM8A 5IK4A 5A7NA 4ISRA 3WG1A 1QJU2 3WF4A 2DVAA 3E6DA 1O4YA 5LA1A 3AZXA 4Q4Y3 2G9GA 5E16A 1PGL1 5FZEA 2GH2A 4IL7A 5ACA3 1CN1A 3MIDA 1E5IA 1W90A 3QD6A 5FMCA 2JG9B 2WNUC 1GNYA 4I0AA 4XEZA 5FYZA 3WOGA 3V0AA 3KV9A 3ILRA 1YHFA 1QJX3 4EWEA 1FMD1 4A6OA 3KF3A 3TWIA 4NIDA 5LEKA 4KBBA 4QPGB 4RFRB 2Z2SB 3PJYA 4IEWA 3W59A 1LHUA 3KD4A 4AVAA 2YC4A 2C9KA 2VTXJ 2JDUA 1KQRA 1X36A 4JGYC 2W91A 4IGPA 3IPVA 2Y6KA 3OCPA 4IEYA 2I07B 5LCWL 2OXBA 3LAGA 3BCWA 1NZCA 4MV2A 4YZ2A 3CZJA 3NKTA 4GMP1 3X29B 1Z7S3 3IKWA 5JOYA 1MR5A 1SACA 3HT2A 4NO4A 1BK0A 4HK9A 5F6LB 3RWNA 4JGZA 1IS6A 1K42A 2WYFA 5C3SA 4OI2A 4OCTA 1K5MA 2ZGNA 3HNBM 3POJA 3AFGA 2QDNA 2XBO1 3KT7A 4K20A 4NRMA 5BNPC 3KQRA 3CIHA 5KR7A 2VH9A 2R49A 1PO11 2Z5WA 3M1HA 4A6SA 5KXDA 5E1RA 3B9CA 5F32A 1YIPA 1CPNA 4KG8A 1F5FA 4JZRA 1CIWA 2A6YA 1TE1B 5J48A 1W8WA 4XW3A 3LSDA 5C8WA 4QPIB 4YM1A 4YG0A 1AR83 1C1FA 1WA4A 2ZHNA 3BIEA 2JIGA 2XVLA 4BCUA 1UKRA 2VM9A 2PAMA 5I93A 1WUVA 4TTGA 1AYM3 3AZVA 3NV1A 4OFGA 4ORFA 1YI9A 4QM8A 1K12A 1TNFA 2ETEA 3BB6A 3RZMA 2XLAA 5FYBA 3L9JT 3IWZA 2W1WA 1DQ5A 1REEA 3KCYA 4N7IA 5FZ1A 5FZOB 2P6HA 3LEMA 1PIV1 2WFF3 3B69A 1X9TA 4D7SA 1PZ8A 2L9LA 2VTXA 2WSVA 5EFUA 4ARXA 2ZGQA 3ACHA 1RUC2 3NNLA 5I0TA 5LBEA 2AEZA 5FV3A 2PAEA 1W39A 3ZMOA 4CTEA 1W6PB 1URXA 1FAYA 1T6BX 2VXJA 2ZJCA 1B35A 4Y1YA 5JXIA 3W20A 1A8MA 4NN0A 5FY1A 1RJ7A 3W21A 1DYOA 2PQSA 3C2UA 4KGQA 4JTNA 1XC6A 4WM7A 2Y6JA 4OHZA 2Y26A 1NAEA 4BHPA 4PIZA 1F9KA 4A3ZA 3VL8A 1UWWA 1NA1A 4Y4YA 4ATEA 3J8F3 1HJFA 4A42A 5JSOA 5CFDA 1QOTA 4XAEA 4E8CA 5F1RA 3IDAA 4F8AA 1RUG2 2Y6LA 2EXIA 2FCUA 1PO21 2KA3A 1QJU3 3ZFFA 4YZ5A 1XNKA 4W8JA 2GAUA 2WAOA 3BTYA 5ANNA 3FHIB 3QCWA 2G1MA 2Y8KA 3VBFB 1UMHA 2ZGTA 1LGBA 4UF0A 1VBE3 2B45X 4O7XA 1QDOA 1OI6A 5F9TA 5FBZA 2ZS6B 3VN4A 1ZZBA 4I09A 1YI7A 5HBAA 2D3PA 4BQ1A 5I0RA 4XUOA 1D2QA 4CEYA 3I2KA 4RS5B 1VALA 5CYYA 1JS9A 3G6JB 3KSCA 4C91A 3I2OA 4LPLA 3BTZA 2Y0IA 1QDCA 4XF4A 1RHI2 1WCKA 5EWSA 1L3JA 3TOJA 3SC7X 4PI2A 5IK7A 2W94A 2ET7A 4AVTA 2CNAA 4OZOA 1YQ2A 3I3QA 5EV7A 5LATA 4I02A 2BBVA 2OPKA 2FQPA 3SLIA 1HRV1 4AI8A 1JXNA 4ZS3A 3EJKA 3VBHA 2E51A 2D43A 2X5IA 5CU1A 4NWWA 3SH5A 4BQ5A 3T0BA 4PIXA 2ILMA 4CCCA 2HWF1 4ZHNA 1Y9MA 4QB1A 1S1AA 1YO8A 3LOIA 3VDAA 5K8SA 1RB8G 1W9WA 1ZZ7A 5F5AA 3LD8A 3POWA 5DUVA 3O1PA 4OQ9A 1DIWA 4N53B 3THDA 3D3AA 3WR0A 1CAWB 1Q8VA 1PZ9A 2A6VA 2Y33A 3NWKA 4XXPA 3WHTA 3D5OA 2LM3A 2RG4A 1DYKA 1IPJA 5KC5A 2C4XA 4UFJA 4Q2FA 1Q56A 1ZZ9A 1WCQA 3DL3A 3LSEA 4NIIA 1W0OA 1SZBA 2RJKA 3SEEA 3U11A 3BPZA 4XILA 4AHZA 3PUIA 3TAYA 5I8YA 3NNGA 2FDKA 1TMF2 1RUC3 2CDPA 3VZNA 4DNYA 5IFPA 1UX7A 4L8QA 4QMAA 3U10A 4JDNA 2XR4A 4GH4B 2BVBA 1S0IA 4XMIA 4YVWB 2EICA 2HWE1 2VQUA 3UETA 3AMNA 1O91A 1WMEA 2YGMA 1AHSA 1COV2 1CX4A 1IS3A 2WDBA 3MV01 4I30A 4XETA 5FZIA 4FPHA 4CSWA 4F3JA 2DBNA 4PBPA 3C7OA 5EJZB 1AZDA 1DZQA 4QGMA 3RDIA 4DZGA 3JBG2 1RUG3 4GJYA 3KT1A 4HXCA 4BK4A 5HPOA 1HDKA 2VMGA 1NYWA 1H1AA 2IUWA 4ES9A 4YW5A 4LEJA 4R8HA 5SV8A 3ZN6A 3MF6A 2BGCA 3M2MA 4I0BA 5LRRA 4LLOA 2IC1A 4Z82A 3K3OA 4MLOA 3WSOA 1GLHA 2EALA 3EO6A 1OC1A 3OGGA 5A3UA 5IVJA 5LK7B 5DN2A 3O1MA 2Q1ZB 4Q4X1 1G9AA 1OQ1A 4L97A 2J1TA 2DU1A 2VCBA 1ULDA 1KFUL 4MXWA 1C8NA 3H8UA 1YQ8A 2ZGKA 4YW6A 2WNUB 2DDUA 1HV0A 2WLPA 4DRRA 1HXS2 2DVBA 2KXLA 1DDLA 1HV1A 3ZDSA 1EPZA 4BOWA 5CEHA 1ZBA1 5IVBA 2W08A 4JVAA 3HT1A 1H6XA 1SLLA 1UYYA 1GFF2 4LIVA 4AWDA 2QZ2A 1QIQA 2TBVA 5JIAA 5C3RA 1R082 2E7QA 1O5LA 4JGYB 1K5MC 2B5HA 1W8HA 4NRQA 2JENA 2YC0A 1H8TA 2R062 3OUIA 3VD9A 5BNQA 4IV3A 1YJKA 1CZSA 3MPPG 4CCMA 3POGA 1VE0A 1POV0 1AL21 4B4RA 1LHVA 2W9XA 3WG3A 5IK8A 2Q8OA 4P9LA 1MZ5A 4H14A 5JR7B 1VBB1 1MZFA 3ZFGA 1SBEA 3J7NA 2FZ2A 1ULOA 2RM21 3UJQA 5BNPB 1JZ8A 3WF1A 2FDHA 5IAVA 5JXHA 3I4IA 2IXJA 1JYCA 1XNBA 1SDDB 1MS4A 3WDYA 2G4IA 5LASA 5T5OA 5H9SA 3BU0A 1NOVA 1JUIA 1YFUA 4PCRA 3THTA 5IWFA 1LGNA 1REDA 5C70A 1LHWA 5FXWA 3T30A 4CCOA 4FTEA 1VBA2 3MUZ1 4LIUA 1US3A 1O7FA 2P5BA 4JKKA 4ZU4A 3BU7A 4BQYA 3DGTA 4QXHA 5KHIA 1HN1A 1B35C 4HT1T 4WBBA 3T4HB 4XBNA 1TMF3 1XE7A 4A7KA 4G4FA 4YGDA 4B7EA 1RUJ2 1EV11 4D69A 1CX1A 4XFAA 2WS92 4WM7C 2HWB2 3AX4A 1RJ8A 5FLJA 1DGRA 1RVF2 2JIJA 3CQOA 1S0GA 1ND3A 2HYXA 1NA1C 2YV8A 3UKTA 4RS5A 3M3IA 4AYUA 4D6SA 2XJSA 2ZX2A 1MQTA 2Y6FA 1S2BA 1DQ1A 4LBKA 1W6NA 1COV3 1CPMA 1OA3A 1VAVA 2YB7A 3ILNA 1RUE2 4QPWA 3CF6E 1UD1A 1TME1 3ZFFC 3TN92 5IHRA 4Z1VA 3R4DB 3ZYHA 4AK3A 4B3NA 3INAA 4GWIA 1KGYA 3E97A 1H9PA 3N9LA 1WA6X 1NQDA 3JBG3 2BEOA 5AFBA 2DUOA 1LJ7A 3GZTB 1XJAA 1UAIA 2ZX1A 4LMFA 3SEPA 3M3CA 1V6NA 1BEV2 1Z0HA 1JMUB 4C0HA 3O1SA 2FDFA 3GJAA 4XF3A 1CAUB 1OVSA 4QU2A 4M01A 4LO4B 1HJGA 4IE0A 1O8PA 3OY8A 4CEYC 5A3LA 3VV1A 2ZX4A 3MUY1 2HWC2 4IGQA 4F7ZA 3AYCA 2LUWA 1RUH2 4CP0A 4BDVB 1V9U1 3AMHA 1UMZA 5KXCA 4WZCA 1L7RA 4QDSA 1HXS3 1IKPA 5JMOA 4M0NA 3GBGA 3OPTA 1YQ5A 5EYXA 4LBOA 4N53A 2JG8A 3I54A 2ZGRA 4JQTA 1PGL2 3LZZA 2UWCA 2O0OA 2GMPA 5JZGA
chains in the Genus database with same CATH topology
4YG3A 3ZYJB 1VAKA 5E88A 3AYEA 1R083 3RRDA 5JCTA 3ZYRA 1FMD2 1QQP1 1DZTA 2AZ5A 4COWA 1NXMA 2R063 2X5IC 3VBHC 1AR71 4FTBA 1H30A 4LT5A 4LA3A 4MYEA 2PELA 1AX1A 3N7MA 4KL1A 1UL9A 1RUI1 2AGSA 1NXD1 4GH4A 4R4XA 4RQPA 3B9IA 5B2GB 4QGLA 3QBQA 4LE4A 2DVGA 3SISA 1LULA 3TYJA 4Y5Z0 4DINB 1ULEA 3SCHA 1WW4A 1YIFA 2MEV1 2XBO2 3BIWE 4HMZA 2YROA 1PO12 3AKTA 1DQ0A 2A7AA 4HZFA 2ZKLA 1X50A 1HX6A 2WNEA 4MSVA 2UY8A 4XE9A 1VBA3 4KU8A 4DFSA 1JHNA 3S6PA 4IEPA 4FPOB 3M3QA 2ARBA 2UY9A 3LA7A 3B7MA 5D1IA 3AMQA 2DURA 4XMAA 1X82A 2A5ZA 2ZGLA 1RUJ3 2QJVA 2PFWA 3WW3A 5K9YA 2RS31 2WS93 2HWB3 2X8KA 1H0BA 1IOAA 1RVF3 4QQ2A 5BUVA 1X7NA 2WNUA 3EBRA 1PIV2 2C9AA 1WLTA 1YFXA 2E6VA 2GNDA 1NCQA 1RUE3 2XKPA 2GSYA 4P9WA 3AMPA 5HCBA 2BNMA 1MS1A 3N7LA 4JV4A 3TN93 1I6XA 4TWTA 1SFYA 1RMU1 1S2KA 3P3PA 4P9YA 3VZLA 1IS5A 1JW6A 3IN9A 4I01A 4YLZA 1FPN1 4XIOA 5T54A 4OULA 4L92A 3MW4A 1QY4A 2XJQA 5J36A 2DCTA 2BVVA 4QXKA 4XJ8A 3FC0A 1OA4A 3V0AB 2HWC3 2V09A 4FT8A 5C4WA 2TUNA 1RUH3 3RPQA 2PHRA 5BNPA 4ITCA 5AC91 1PO22 2JJ6A 1DQ4A 4XQ4A 3DN7A 4FO9A 1H2NA 5ABJC 2PHUA 4H7LA 2I45A 4HSJA 3ZIWA 2VOVA 3B3QE 4QQLA 3BALA 4PDWA 2B7YA 4P9XA 3VDDC 1WMFA 1H8TC 4IV3C 2JICA 1FMD3 4JQRA 3DF0A 1WD4A 5FLHA 4OVEA 1XQNA 2WA4A 4QQPA 4KH9A 1LECA 1ND2A 1C57A 1FATA 1HQNA 1K5MB 2FMYA 4WM8A 3ZFGC 4E4ZA 2JECA 4FPGA 5LEJA 2WQ4A 3PVEA 5C8CC 4OI0A 2D3SA 3B94A 4GMP3 5GJ6A 4HFSA 3WY6A 4XIKA 2BWAA 1YFYA 1V00A 2CWMA 2QUOA 1WW5A 1HRI1 2OUJA 1KS4A 2N7GA 1HRV2 1PO13 1VR3A 3GALA 4XF0A 5D8AC 2HWF2 3H3ZA 1YJLA 4DY3A 4FBFA 2JE9A 4FSJA 1ASJ1 5JSPA 3GBWA 2PHFA 4AG4A 1AJKA 2R041 2VVEA 3PHMA 4KWLA 5GALA 4D7TA 3OF1A 5LK5A 5GZGA 4IEZA 1ND3C 4Y26A 2I2SA 4U2AA 3AXEA 1DQ2A 4FPYA 3KM5A 1MQTC 2D44A 4JC1A 4COYA 1B35B 3V0BA 3JD71 3ZSLA 1F8VA 1MEC1 1ZRFA 4S2HA 4K1ZA 4J1XA 1PIV3 4OZXA 2BTVC 3SHRA 1YYNA 5GLTA 4WM7B 3MIBA 5DDJ1 4XYXA 5E89A 1NA1B 2AENA 2ZGPA 3AZYA 4GWNA 4DMIA 1BVVA 4L9BA 3RYPA 3ZFFB 2HWE2 4UW6A 1SEFA 1U5IA 3E5XA 1PVC1 2OYZA 5DUWA 1REFA 3ACLA 4IV1A 4NHLA 4ZXKA 4QQHA 1N1TA 1WCSA 1MS5A 3N7KA 3NV3A 4XOGA 3OD4A 2JG8C 5FOJB 1OQDA 1Y7BA 3OYWA 1IKQA 5GLVA 1LHOA 5JZGC 1BYHA 4B8EA 4LNVA 1PO23 2VNOA 3LWCA 4CEYB 2PQQA 3AZZA 4K3UA 1DGRN 3GHNA 1B09A 4N43A 2BYVE 4AF9A 1RITA 4W6YA 4Q4X2 3WDWA 1WMDA 3M70A 2WQZC 2PLV1 1RIRA 3VHRA 5GZEA 3MLKA 3IDCB 1OMIA 3LGRA 5KBFA 2WWSA 3M3OA 1G86A 1A6CA 4RQPC 1D4VB 1CJDA 1XYPA 1ZBA2 3ZMNA 2ZGUA 3VBHB 2X5IB 3KT4A 3R6SA 4X8PA 1QNYA 1X8MA 3E6BA 5FCCA 1LU1A 4E2QA 4OHYA 4LBLA 1AR91 1Q3EA 3WQ7A 2YYOA 3D0SA 3D4KA 2F4PA 4YM2A 4AVSA 3THPA 3OJBA 4XF9A 1C8M3 3QACA 1EAH1 3AKQA 3OD0A 1HRV3 3PJQA 1ZBE1 5E8AA 2JKBA 1GKBA 2VW1A 1AL22 2GN3A 3H1WA 4YNIA 5SV5A 4MVTA 3B00A 4CRQA 2HWF3 2E9QA 3S7EA 1I5ZA 2H6CA 2RM22 3ME2A 2HWD3 1FXZA 1LU2A 4ZU5A 3VKFC 1O3RA 4HN0A 4IEOA 3GHMA 5FPZA 1H9WA 3T2TA 4Q0UA 1ZNPA 1NCQC 3ZYPA 4DXZA 3NAPA 3M4FA 2RR11 3ENRA 2D6PA 1OOPA 2QFEA 4FCAA 3TB0A 3AB0A 4K8FA 2XPJA 5CFCB 4IXLA 2WC2A 1N1YA 4AFDA 1UF2C 1EV12 4FOVA 3WCRA 4Q29A 5T55A 1XXNA 2HWE3 1HLCA 4RSUA 5A32A 3ZN6B 4B4PA 4BLJA 2PA7A 3ZXFA 3NSTA 5C4WC 5IUQA 4PLOA 5T5JA 4RGAA 5I0SA 1TME2 2D6LX 1CVNA 2V73A 3E6CC 2ET1A 4HBNA 2D5FA 3ZYIB 1N47A 4LO7A 1FOD1 4MXWB 5CA6A 4PDWC 1D2SA 4EN9B 3WUCA 4XFBA 2PHXA 4OUMA 2ZPXA 2IXKA 4AW7A 1C3HA 4SBVA 3UKVA 2Z69A 2GC0A 3NW4A 2YXSA 4Q4X3 4I2OA 1ND2C 5ABJB 1UU4A 2ATFA 2HYKA 1FI2A 4WM8C 2UWAA 1V9U2 2D7FA 1MS0A 4XHXA 1CAVA 3VDDB 1H8TB 2R1BA 3MIHA 4IV3B 4DB5A 4MX3A 3BOWA 1ZBA3 4FPCA 4PBOA 2EA7A 5BNOA 4SLIA 2DWRA 3SCGA 5BYNA 3I59A 3ZFGB 1QQP2 3WDXA 2CWSA 4Q4V1 4YZ3A 5C8CB 2BFUS 3J9SA 4COUA 1AR72 5FOBB 1DG6A 3MIGA 1YLLA 2QE3A 4EWAA 1AL23 1Q8QA 2VXRA 1RUI2 3IBMA 2R071 1VBB3 1R091 2R1DA 5CIRA 5CADA 3WZ1A 1LOCA 2RM23 4GB31 4MH0E 4BA6A 2IZWA 2D93A 4FAHA 5D8AB 4XJWA 1CJPA 2XJUA 2RMU1 3H3UA 5BY5A 2MEV2 3WLUA 1GNZA 2DFBA 1SLAA 2RS11 3JU9A 3H50A 1G8WA 2R6QA 4WVMA 1QJY2 5A3MA 2A3YA 1G9CA 1ND3B 2O8QA 1MQTB 4BIOA 3H7JA 1W6NB 3W9AA 2VPVA 1YXWA 1YUDA 1DFQA 1EV13 1YCIA 2TEPA 1O4TA 4IV1C 2ES3A 4COVA 5GLUA 2RS32 1MVQA 3SCFA 1XU2A 4LO5B 5K0UA 3QOPA 3LCPA 4HKWA 2Y38A 5HXVA 1MS9A 1AVBA 3A0KA 5I91A 3OY8B 1TME3 2ZHLA 3AFKA 4KG0A 3OGJA 1RMU2 1NE6A 1ULFA 3WCSA 1KJLA 1RUF1 4N43C 1FPN2 2VG9A 3AKRA 4AFCA 2JG8B 4BE3A 2AYHA 4FPKA 5EYYA 1X33A 4EN7B 5JMCA 4BYYA 3WP3A 5JZGB 4AQ6A 5KWRA 4YW2A 1OQEA 2VGDA 1PGW1 4B29A 4Q0QA 1V9U3 3RMYA 2B8MA 2B46X 5AC92 1SLCA 1DBNA 2MHFA 1S55A 1S0JA 2DFCA 2DU0A 1IS4A 2VOKA 2VQAA 2B39A 3FBMA 4FXKB 2XUMA 1GANA 4L99A 1KFXL 4META 1T6GC 4RQPB 2P3KA 1QQP3 2XKOA 3CJIA 3VHPA 1BMV1 3WINE 2QDRA 5AVPA 1AL0G 1AR73 1UPIA 3FE5A 2A6ZA 5FDBA 4RA0A 5CFCA 5I8SA 4TZDA 4XFHA 1RUI3 3MYXA 4JRAA 4UXAA 1JBCA 4IEUA 4Y1XA 4AGVA 3RYKA 1HRI2 3ZIXA 2YPJA 4MGYE 2MEV3 3FZ3A 2CTVA 1ZZ8A 1W6QA 3NAPC 4HLTA 4LBQA 1SBFA 4H7MA 1OOPC 3EXUA 3D82A 3PMSA 1LENA 4Y1ZA 1ASJ2 2OUHA 3WT3A 1GYKA 1UU6A 2D6OX 2WNVA 1OA2A 4RD7A 2R042 1O4ZA 2DVFA 2YUEA 1RHI3 1NCQB 4XBQA 1U0AA 1VB2A 5DG2A 5ABJA 1U5XA 4A7YA 1VAMA 2EAKA 2VOXA 4CDUA 2XG3A 2RS33 2DCJA 2ZBJA 3VDDA 3JD72 4AHXA 1MEC2 5H9RA 1NLSA 1V6KA 4XQWA 1CAXA 1AXKA 1EP0A 5DDJ2 2WT2A 2PYTA 3VBRC 4D7YA 5JSRA 2EXKA 3WDVA 1RMU3 5C4WB 2IXIA 2CGOA 2B42B 1SMVA 1ZA4A 4LLFA 5C8CA 4INDA 1FPN3 5DXDA 5L19A 1GSLA 4C1WA 1PVC2 2HJIA 3RG0A 4FOYA 4Q0VA 4BLIA 2ZABA 1WLWA 4XJAA 3TNQA 4PDWB 5FO7B 3OBTA 2W68A 1U5YA 3RJ2X 4CDXA 4D94A 3VKLA 3OPZA 2WFPA 2A70A 1QHDA 2B9UA 3J8F1 3S30A 4AEJA 5BNOC 4ASLA 3VBSA 1ND2B 3SITA 1VBD1 1CESA 2WL1A 5D8AA 4CP2A 3HR9A 4MXVA 5J09A 5GLZA 4WM8B 3WV6A 3FLRA 5HI0A 1H2MA 2GC3A 5DZFA 4RL7A 3PLQA 3H7YA 1S0DA 2PLV2 2XGXA 4BIFA 2ZKNA 1TQ5A 1WBLA 4PF5A 3RQ0A 4AI3A 3ZXDA 3MW3A 4BWOA 4U36A 1LESA 3R4UA 1N3QA 1QXRA 4A2UA 4K7JA 4QD2A 4M3CF 1Y9QA 4GMP0 2YY1A 2VUAA 4XTMA 3A4UA 1AR92 1DF0A 1XYNA 4Q8LA 3DUIA 4YGEA 3ZXAC 3U4XA 2EXJA 5LRSA 1O3TA 1HRI3 5JWPA 1EAH2 4AHWA 2D97A 2V5YA 2GALA 1LRHA 2OZJA 4FVVA 1ZBE2 4AQ2A 2WZPP 3HN1A 3JUUA 4MZUA 4F83A 2O1QA 4PQ9A 1QU0A 4C90A 3V0BB 4Q0SA 1ASJ3 3ZXLA 3VGIA 2R043 3WG4A 2PHDA 2Q30A 1WBFA 2GMEA 3GZUC 5K0UC 1ZVFA 2P3IA 2IXHA 2OVUA 4RFT0 4PIYA 5JOWA 1NY71 1W6MA 3FLTA 3MLJA 3S7IA 2R0HA 3G7DA 5FO9B 3JD73 3SXWA 5FFOC 4UW3A 2ZMKA 1MEC3 5C6CA 2RR12 3ZSMA 4IV1B 1V6IA 4QGNA 5DDJ3 4CP1A 3PMEA 2XH6A 4J1WA 5J7MA 3OYWB 1N3PA 2JDZA 2XJTA 5HCFA 4DQAA 4GULA 2FMDA 4QX5A 3FMGA 2BFUL 4CDQA 3AJZA 4CDWA 1PVC3 3ZN4A 5J98B 2XWJB 2DTYA 1C28A 3MGUA 3MDPA 1DQ6A 1LB2A 1CR7A 1ALYA 1S0BA 4N43B 3WW2A 4UBGA 1QJY1 1H1IA 1NE4A 4R9CA 1YNAA 2QNKA 1FOD2 1Y43B 3AMMA 5CB7A 3Q9OA 2D3RA 3CJIC 4E27A 4I3GA 2ZAAA 1V6LA 5BXXA 3WP5A 1QH6A 2DUQA 4EROA 3J26N 2HEWF 2PLV3 1PGSA 5CFCC 1FNYA 3FX3A 4AGRA 4BZ4A 3HIFA 2CAUA 4ZU7A 1SLBA 1KJRA 2IFWA 3MW2A 1A8DA 1A78A 1LOEA 1PNFA 2WINB 4FPLA 2ZOEB 4W6XA 1Q8SA 5F6KA 5JAXA 3SH4A 4Q4V2 1AR93 2JXAA 4WVVA 1WGPA 1BEV3 1UU5A 1VJ2A 4I3PA 1EAH3 4XHBA 3FJSA 1ZBE3 2ZCWA 2LTNA 5FQ0A 4XJUA 2WNVC 4NHKA 5DZEA 2R072 4H3WA 1R092 1BXHA 4GB32 4YGCA 4Z07A 3NAPB 3K48A 5JOZA 2A3XA 2WT0A 1OOPB 4XJ9A 4CDUC 1FYUA 1DGWA 3I7DA 3KB5A 5KHKA 4S2GA 1XNCA 2RMU2 4GALA 1GZWA 4DPNA 3QLQA 5CAZA 2RS12 4Y22A 4GWMA 3WP4A 4AEKA 2UU8A 2GDFA 4L2NA 3VKNA 4HVOA 3VZOA 1ZREA 4X8NA 1ZX5A 5A32B 2RR13 1QF3A 4H55A 2NQYA 3DPRA 4JDMA 3MF9A 2XHKA 3BODA 3EQEA 4AEDA 1LOAA 1ZM1A 4XFIA 4JAAA 4XXAA 1I9RA 4OHWA 1AX0A 2AH2A 4HKOA 4BM8A 4FOQA 4WVWA 3VBRB 1J58A 4LA2A 3WG2A 4CDXC 2ZMNA 3WVJA 1H1MA 2CL2A 2H0VA 2XBO3 3VHOA 5EXOA 3VBSC 3ZFEA 4N9HA 3WW1A 3R0RA 4AQTA 1OPOA 1FOD3 1PK6A 2AUYA 2UYBA 3ILFA 5KC6A 1CAVB 1RUF2 2GNBA 4NOTA 1TEIA 2WIIB 4LUMA 3ZVXA 5KHGA 3VZJA 5L36A 1BBT1 4K1YA 1AR61 4AI0A 2H6BA 2HKXA 4WZFA 5BNNA 5A33B 5BNOB 3LOBA 3URFA 2XL9A 1PGW2 3PVNA 4BMEA 1W6OA 3I59B 1IHMA 4IEVA 3ECQA 4TYSA 4YVSA 4AFBA 5JI7A 1PVXA 1AJOA 1CQ9A 3PTYA 2R32A 3CLPA 4KNCA 2AR6A 1RGSA 3NV2A 1G9BA 1GZ9A 1SLIA 2XVGA 2NYYA 2ZGOA 1UPSA 3V64A 1JN2P 2XL7A 1BMV2 3KGLA 2Q1MA 1S0EA 2OA2A 1H8VA 4AHYA 3IM0A 1QWRA 5T5LA 3POSA 4RHV1 1SDWA 4R9DA 1BQPA 2C5DA 4WVMB 4LULA 2R073 2Y0OA 1C5HA 2CY6A 4GB33 1LGCA 1D0GA 4GA9A 3I8TA 3CU7A 3VHNA 2RMU3 4OI1A 3HQXA 1PM7A 4IESA 2GNMA 3CEWA 2RS13 2GH8A 3R4SA 1QJZA 2R30A 1VRH1 1MVEA 3WDTA 4WV8A 3ZPYA 1NG0A 5IK5A 5K0UB 3UK9A 2VW0A 3OBRA 1GV9A 1JOJA 3APBA 3W58A 3RI8A 5JI9A 4CDQC 1G9DA 1DLLA 2OZ6A 4CDWC 5DZGA 1A3KA 1RC6A 1N1VA 1RUD1 4BMBA 3JB8A 5C9AA 3USUB 4ZKTB 3ZXGA 4IEXA 5AVAA 1F5JA 1QMJA 1LOFA 1BJQA 3MI8A 3T1LA 3ROUA 3WXPA 1IQAA 2PN5A 1OD5A 4S2DA 2IXLA 4Z2WA 1J1TA 2BUKA 3VLBB 2A75A 2E7AA 4Y1UA 1AYN1 3O12A 5CG9A 4LBJA 2VECA 2I74A 2VW2A 5H9PA 1POV1 3AP5A 5J3UA 2KM2A 4LBMA 2GU9A 3ST7A 4Q26A 3N7JA 3KS7A 1C4RA 1RUF3 1UCXA 3BTAA 2DVDA 3WP6A 2NPIA 1Q8PA 2BWCA 5TSWA 2HEVF 1HIXA 1DZRA 4RGGA 2EIGA 4AI1A 2Q0AA 4NVPA 3VZMA 2QKDA 2ZZJA 3L2HA 5T52A 3H1YA 2EXHA 2P2KA 2X53S 3DV8A 3CJIB 4GKYA 5EJ3A 3WQ1A 3J8F2 1YRZA 1VBD2 3AP6A 3E5QA 3N36A 4LHLA 3VL9A 5C33A 1ENRA 1RUNA 2TNFA 5GKAC 2ERFA 2RHPA 4YM0A 1RUOA 5T50A 1LCLA 4HANA 3WUDA 1NCRB 4N7UA 2R0FA 3U07A 2E63A 1VBE2 2AREA 2D6MA 2JEMA 3TRSB 1EYBA 3K51A 3D8CA 5L7OA 1KS5A 3HD8B 4ISQA 2CAVA 3VBOC 2Z79A 1GBGA 3IIAA 4JRLA 4LE3A 1W6QB 2P3JA 4LBQB 2XJRA 4Q27A 1WLDA 1MS8A 3MIFA 2RS51 5FTTC 1D4M1 1QXJA 4EN0A 4AVBA 4FP2A 3VBRA 2WNVB 2CYFA 2PTMA 1IPKA 2DUPA 3JQXA 1QOOA 3O0XA 4FPEA 5KXBA 2IWGB 3KCCA 4Q4W1 4CDUB 4LBNA 3KGZA 3DPRC 3ZO0B 5T5PA 4AEDC 4C1XA 4E9KA 4Q0PA 3N3HA 1WW7A 2E7TA 2XJPA 1UN1A 3ES1A 4YARA 1CAXB 2UURA 5FPXA 5A33A 3AXDA 3A0NA 4HPKB 4FOWA 1IGOA 2ZGMA 4P9GA 4RR3C 1XU1A 3D0JA 1NY72 2RE9A 3ZYGA 2WA3A 1H2KA 2PHTA 3EHKA 1SBDA 3ASIA 2R16A 3ZFEC 1LODA 2EAAA 1QGLA 5JIUA 1V6JA 1PK6C 1HQWA 1VBC1 3IMNA 4UW5A 4JTOA 1ENXA 1QXPA 4MGKE 5HCAA 2IFRA 2NM1A 4CDXB 2WJSA 1S0FA 1OFSA 5BNNC 4OUSA 4AFMA 1WLCA 3VBSB 1R1A1 3SH3A 4K40A 1HKDA 1SQ4A 1VP6A 1G9FA 4D3WA 4YVSC 4TSVA 1YWKA 4GKXA 2Z42A 4LR4A 1Q5OA 3HAGA 1C1LA 3WW4A 2SLIA 2WZR1 3B93A 3ATGA 4PLNA 1VBD3 5KXEA 2C1FA 4CEWA 2A6XA 2A73B 2HEYF 4V1PA 4Y20B 5GZCA 4M3CA 4DY5A 1BVP1 1LEMA 4NPRA 3AYAA 2VMIA 3GBFA 4N9IA 5CNAA 4QQOA 1DHKB 1SCRA 2BNNA 1BCXA 2VQ0A 3FWEA 4R9BA 4TLFA 1ZYBA 4FPJA 3SNMA 3USUA 1VB4A 4KU7A 4P5HA 4G3YC 2VUJA 4NWVA 3UL2A 4LHKA 3ES4A 3OTFA 1S0CA 5DG1A 4YW3A 4Y1VA 1HW5A 1SLTA 1C8M1 1I1EA 3J4UH 2ENRA 1W2UA 4M0HA 2PAKA 4DS0A 3HMYA 2ZX3A 3NL1A 4AFAA 1W6MB 3DKWA 3IDBB 1JYIA 5BPXA 1OKQA 3WHUA 5C9AC 2GZWA 3UV9A 2UWBA 3CO2A 4Q1PA 1LOFC 3VBUA 1ZRCA 1F31A 2HWD1 3JB4C 2ZX0A 4Q4Y1 4ES8A 5ACA1 1APNA 2IXCA 4E2GA 3UJOA 4FTSA 2XVKA 4CDQB 3KCXA 4CDWB 1QJX1 1PHMA 1IZ3A 1QOSA 1OHFA 1BKZA 3H1MA 1PNGA 1RINA 4R9AA 4JCKA 2JG9A 2ZGSA 1NCRA 1J3QA 2K9ZA 1Z7S1 1ZRRA