1NCQB

The structure of hrv14 when complexed with pleconaril, an antiviral compound
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
255
structure length
255
Chain Sequence
GYSDRVQQITLGNSTITTQEAANAVVCYAEWPEYLPDVDASDVNKTSKPDTSVCRFYTLDSKTWTTGSKGWCWKLPDALKDMGVFGQNMFFHSLGRSGYTVHVQCNATKFHSGCLLVVVIPEHQLASHEGGNVSVKYTFTHPGERGIDLSSANEVGGPVKDVLYNMNGTLLGNLLIFPHQFINLRTNNTATIVIPYINSVPIDSMTRHNNVSLMVIPIAPLTVPTGATPSLPITVTIAPMCTEFSGIRSKSIVPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and virological studies of the stages of virus replication that are affected by antirhinovirus compounds
pubmed doi rcsb
molecule tags Virus
molecule keywords COAT PROTEIN VP1
total genus 53
structure length 255
sequence length 255
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2002-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1ncqB00
2FZ2A 4Q4V3 3VDDB 1AR73 3VBUC 1ASJ3 4CDXB 3JD72 5C9AB 1BBT1 1R083 1VBA3 4IV1A 1BEV3 3VBOA 5C9AC 4GMP0 4CDXC 1PO12 1POV0 1R1A1 4IV1B 2FZ1A 4NWWA 5DDJ3 4YVSA 5ACA3 3M8LA 1GFF2 1ZBA1 1MQTA 1R082 1MQTC 3J8F1 1RUE1 1COV2 4GB32 1QQP3 1NCQB 1C8NA 1H8TB 1R1A2 4IV3A 1MEC2 3VBOC 1PO11 5C9AA 3ZFFC 1HRV2 2HWC1 1VBD2 1AYN1 3JBG1 2XPJA 3VBUA 2X5IB 1VBB3 1OPOA 5AC93 3ZFFA 4YVSB 1QJU1 2DF7A 1OOPB 5BNNC 4IV3C 1RUF2 1RHI2 1FOD2 5AC92 1VBB2 3VBHC 4CEWA 1IHMA 1R081 1NCRA 2GH8A 2WS92 1FPN3 1AR83 1RUH3 2WLPA 2R042 4YVSC 1TMF1 1QJX1 2R072 4N43B 1RUC1 4CDXA 1VBB1 5AC91 4IV1C 3CJIC 4GMP3 1FMD3 1X33A 3VBOB 4RR3C 1H8TC 3JBG2 1F8VA 2RR11 2R073 1VBD1 2WFF1 3VBSB 4CEYA 1RUG2 1PO13 1PVC1 2BUKA 2WZR2 4Q4X1 3VBUB 1ZBE2 5ACA1 2WZR3 5CFDC 2RS31 3VBSA 1FPN2 1RUG3 1AR61 4N53A 3J8F3 3TN93 5C4WC 4GB31 1Z7S2 2HWB1 3JD73 4QPIC 2BBVA 1FOD3 1AL23 2X5IA 2R061 3ZXAC 3ZFFB 1NA1C 3VBRB 3ZFGA 1ND3B 2HWB2 1Z7S1 1VRH3 1B35B 2RM21 5D8AB 1W39A 1VB2A 2XBO3 4RHV2 4CEYB 1PO21 2HWF1 3VBFA 5A33B 3NAPB 1K5MC 5J96B 1MEC3 2ZTNA 1AR82 1PGW1 2HWB3 5LK7B 1NCRB 2MEV3 1QJY2 2R063 2BFUL 5BNOC 1AL22 3VDDA 5C8CA 1AR81 1Z7S3 5ABJC 5DDJ2 1PO22 2HWF2 4Q4Y1 5FOJB 1HRI3 4RQPB 1AR91 1EAH2 4YVWA 5CFCB 4Z92B 2QQPA 1VBA2 1PIV1 2HWD1 1HXS1 4Q4Y2 1RVF2 4WM8C 3VBFB 2PLV3 4CDWB 5CFCA 1ND3A 1AR72 5GKAC 5K0UC 1BBT3 4JGZC 1RUF1 1EV11 1VBE2 1QJU2 1AYM3 2TBVA 1VRH1 1AL0G 1QJZA 5ACA2 4N43A 4Q4X3 3DPRC 5FMOS 1BMV1 1HQNA 4IV3B 1RUG1 2WFF2 1RUD2 4CDWC 2RS53 3NAPA 1NOVA 2RMU2 2RS13 1RUE3 4Q4V1 4QPGA 1B35A 2GSYA 4CDUC 1COV1 2RS12 2Y26A 1RVF1 4JGYB 2RM23 1AYM1 1VBA1 1NCQC 2R071 1ZBA2 1QJX2 1RB8G 1PVC3 3S6PA 5L7OA 4GH4C 1VBC3 4PDWC 1VBD3 1AYN3 3JB8A 2XBO2 1RUI2 1BEV1 1TME2 1MQTB 4Q4X2 2WS91 1PVC2 5L7OB 4FSJA 4RQPA 4YVWB 5JZGC 4AEDB 3VBRA 1VAKA 3ZFEA 5C8CB 1QJY1 1BBT2 4RS5C 4WM7C 3JD71 1WCDJ 5BNPC 4BCUA 4GH4B 2RMU3 5D8AC 3IDEA 2HWC2 3FBMA 1HRV1 1ZBE3 1HRI2 4CDUB 1PIV3 2HWD3 2XBO1 1ND2C 1OOPA 2HWC3 4AEDC 4CDQA 5JZGB 2ZZQA 1RMU2 1C8M3 1QJU3 1VBE3 4SBVA 1VB4A 1ASJ2 4CDQB 1X36A 1RHI1 3ZFEB 1ND2A 2PLV2 1FPN1 2RS32 4EJRA 4RR3B 4JGYC 2WZR1 1EAH3 1RUD1 2IZWA 1TME3 4NWVA 5K0UB 5D8AA 3TN91 5BNPA 1QJX3 4WM7A 4JGYA 1RUJ2 4Q4W2 1R093 1CJDA 1QQP1 4GMP1 4PDWB 1R092 4RQPC 1RUJ3 4Q4W3 1AUYA 3J8F2 3DPRB 4FTEA 1TMF2 1HXS2 1D4M2 1RUD3 2WFF3 4CDQC 4AEDA 4QPGB 1OHFA 1OOPC 4CDUA 5DDJ1 1FOD1 4QPGC 1ND2B 2HWE1 3NAPC 3JB4C 4CDWA 1C8M2 1RMU3 1POV1 3TN92 1RVF3 4RS5A 5ABJB 3ZFEC 1VBC1 3VBRC 3LOBA 5JZGA 5BNOB 1V9U1 1BEV2 1TME1 1MEC1 1NG0A 1TMF3 1PO23 2HWF3 5K0UA 1DDLA 1VBE1 3JBG3 4PDWA 5CFCC 4GH4A 5L7OC 2HWE3 1ASJ1 1RHI3 4WM8A 1FMD2 1NY72 1NCQA 1PGL1 4FTBA 1QJY3 2R062 2ZAHA 2MEV1 1B35C 1EAH1 1AR92 5A32B 1RUI3 2WWSA 4RS5B 1SMVA 5ABJA 2R043 4RHV3 5C8CC 1AR63 3CJIB 3VDDC 4QPIB 1ZBA3 2RS33 1AR93 1HXS3 1VRH2 1AL21 1CD3G 1K5MB 4Y4YA 4GB33 3DPRA 2VQ0A 4N43C 4CEWB 1EV12 1C8M1 4N53B 1RUF3 1HX6A 1AR71 1M06G 2RS52 2HWE2 1POV3 4JGZA 1ND3C 4FTSA 5BNPB 1RUI1 1PIV2 2HWD2 3VBHB 4WM7B 3ZFGB 1V9U3 5BNNB 1NA1A 1D4M1 4YVWC 1AYM2 5FMOL 2X5IC 1R1A3 2RS11 5CFDB 1PGL2 4LLFA 2RS51 1COV3 2RMU1 4Q4V2 1R091 4RFT0 3VBSC 5CFDA 1F2NA 5BNOA 4Q4Y3 1RUJ1 4Q4W1 1RUH1 1PGW2 2BFUS 1V9U2 1AYN2 1BMV2 1H8TA 1VBC2 4RR3A 4RHV1 1D4M3 1K5MA 2RR12 1A6CA 1RUH2 4WM8B 3VBFC 2RM22 2WS93 3CJIA 5J98B 2PLV1 1EV13 2MEV2 1RUE2 5A32A 3ZFGC 2BPA2 1FMD1 1NY71 4Y5Z0 1RUC2 3HAGA 1RMU1 2RR13 4QPIA 1AR62 5A33A 2R041 4JGZB 1NA1B 5C4WA 4N53C 1NCRC 1HRV3 1ZBE1 1HRI1 4CEWC 1E57A 3VBHA 5C4WB 5BNNA 1RUC3 4CEYC 1QQP2
chains in the Genus database with same CATH superfamily
2F4LA 3CBNA 2FZ2A 3VDDB 2WT1A 1AR73 3AYEA 4OUMA 1BQPA 3MPBA 4EE2A 4LBJA 4CDXB 1MS3A 3JD72 4OULA 5C9AB 3EYPA 4Q0VA 1XE7A 3IT8A 3OCPA 1I6XA 1BEV3 2XHNA 5C70A 4L0PA 5EP9A 3NV4A 2XH6A 2BVBA 2Y64A 1PO12 1QF3A 3D8CA 3M3OA 4XYXA 4E4SA 2FZ1A 3L2HA 3AYAA 1LEMA 1S0GA 1FT9A 2JG8B 4CUAA 2UU8A 3VUOA 1BK0A 2Q1ZB 1RC6A 5GLWA 3S30A 3NMBA 4L9BA 5CG8A 2D93A 4TZDA 1H8VA 1BHGA 5EYYA 3MLKA 5IHRA 4L8QA 1NLQA 2D6MA 2YUEA 4P00B 4BYYA 2W0XA 2ADEA 3M7AA 1NKGA 5FREA 5E6HA 2GDFA 3ORJA 3HN1A 4I0WB 1Q8VA 1W8WA 3KMHA 4GKYA 4N8MA 2VZ1A 2UWAA 4P14A 1J3QA 1HRV2 3B01A 5A7PA 4RL7A 5DMYA 5FYZA 2PAMA 1AYN1 1YWKA 4LJHA 4FO9A 3JUUA 1G8WA 3J7LA 3GDBA 4C1XA 3I2DA 1WWYA 2LTNA 1LOEA 1VBB3 3GGLA 4OMDA 1LESA 2DF7A 1IPKA 3KZ4C 2OVUA 4IV3C 4AVAA 1RHI2 2VU9A 1ZVFA 1GOFA 2D6PA 2XJTA 2WC2A 4Q1PA 2OUHA 3RS6A 5AC92 4GWIA 2ILMA 4AHXA 5DAPA 4QB6A 1O8PA 1R081 1NCRA 4X8PA 1UPSA 2BOJA 3RGBA 2QQJA 3D82A 5IWFA 1SLCA 4X8NA 4DS0A 3K3OA 5A7WA 2XLFA 5I0UA 4DFSA 4LNVA 3EXUA 4HBNA 2HBTA 5FK8A 3VHRA 3BOPA 1QJX1 4ZY9A 1VIWB 4QQOA 1UZ0A 3HEIA 4DXZA 2OW4A 1JYCA 2QQWA 2XVGA 4FP3A 1VBB1 3MFAA 1UY0A 4BMEA 5LRRA 4LMFA 5FO7B 5G05L 1VAMA 3CJIC 3IPVB 4P08A 1GV9A 4JV4A 5I8TA 1CAUA 4GMP3 2EIGA 3LGRA 1YQCA 3IMNA 3KT1A 5C3PA 2AENA 4BZ4A 5E88A 1WLDA 2PELA 4AQTA 1US2A 2WNUB 2A6YA 1LEDA 1PO13 5A7SA 2QFEA 4JRLA 1UN1A 3X29B 1OF3A 3WNLA 4C1WA 1QEXA 4QQLA 1G9AA 2BERA 2ZX4A 4AFMA 4WBBA 1ZBE2 2DCZA 4YG3A 2WZR3 1GKBA 1GQGA 4W6YA 5FBZA 5FZMA 5KC5A 3GNEA 4LA2A 4GB31 4EZHA 5F2WA 4XQ4A 1XC6A 3JD73 3H7JA 3GXUA 2C9KA 1GNYA 3OJBA 4ZS3A 1V6KA 4P5YA 2IC1A 1NA1C 3VBRB 4OUSA 3ZFGA 1PZ9A 5G04L 2YV8A 1Z7S1 4AFAA 4E4HA 4QMAA 4QGNA 2RM21 5D8AB 4BQ5A 3SMHA 1W39A 2XBO3 3H0OA 4E2SA 1OLRA 4YW4A 4BE3A 3C7OA 4M3CF 1Y9GA 3LAGA 3VV1A 1PO21 3I2IA 4OYUA 4BOWA 5A33B 4EWEA 2JE7A 3SKVA 2ZTNA 3FLTA 3LD8A 3NV1A 3R05A 4JTOA 4LR4A 4MGYE 5IVVA 5JDBA 3BPZA 1R1ZA 1MZEA 4PLMA 5J48A 1REEA 3UGHA 1YI7A 3AYCA 4OHVA 1JUHA 2ZGUA 1JOPA 2ENRA 2BFUL 2ATFA 4CU6A 1GP4A 5BNOC 1S55A 5GLVA 1AJKA 3MLLA 1Z7S3 2HLEA 2ZX1A 3RDIA 4LO8A 5L19A 4JQRA 2DU0A 4Y20A 5K9YA 3QD6A 3BIEA 3H7YA 5DAVA 2AGSA 4JDOA 4TLFA 4HK9A 4U2AA 1X8EA 1MR5A 3ES1A 5H9SA 3D3AA 2VMCA 5IFPA 2AEYA 2NN8A 4YVWA 2C24A 2ZX3A 3HWJA 1XOYA 1PIV1 2VMGA 2KR2A 4META 4DXTA 1ZM1A 5EIYB 4FXKB 1PZ7A 3VBFB 3IDAA 5T54A 2NM1A 2VUDA 3M3EA 2W2IA 2ZBJA 1I3HA 4NHLA 1AX0A 4AGVA 5GKAC 5K0UC 1OA3A 1VR3A 4HK8A 4BQYA 4Y5TA 1VBE2 3K77A 1U5ZA 1MS0A 1ZZ7A 1HQLA 1OVSA 1SHWB 2JKBA 2W1QA 3M3IA 1AYM3 5C7GA 2TBVA 1LGNA 4BQ2A 4N9IA 1VRH1 4K6BA 3SCFA 1FATA 4CXWA 2FBEA 4HZFA 1ALYA 1G7YA 2IFWA 3LDBA 1D2QA 4P9LA 2OKXA 5FP7A 1C28A 3RQ0A 1D7PM 4AVVA 5FY4A 3N4MA 4CVUA 3BTXA 3KVBA 1UZYA 4CDWC 2N7GA 2PXJA 1GOHA 4G9SB 2QQIA 1OLQA 3J26N 5KXEA 1ULOA 2D6KA 1UIKA 3WW1A 5FZ9A 2X29A 5FYMA 2GH2A 5LZ6A 2IFRA 2I07B 2Y38A 1U0AA 2BGPA 5A7OA 2XWBB 1A78A 1RVF1 2ARXA 2W92A 4QQHA 2RM23 1AYM1 3GZEA 1ZBA2 4FPOB 1V0AA 4JAAA 1PVC3 5HCAA 5L7OA 4GH4C 5FZ0A 3RZMA 1JMUB 1VBC3 2GC3A 2GNBA 3OYWB 4CCDA 3JB8A 1O59A 1MQTB 1V6MA 2R32A 2UYBA 3O12A 4QXCA 5FYCA 3ZXKA 2WWUA 4QT6A 2WS91 3MI8A 1E5SA 3P3NA 4JHTA 4QX7A 4XFCA 5L7OB 5L9RA 4FSJA 2Q8CA 4YVWB 4YM3A 5JZGC 4L2NA 2WA3A 1LRHA 3I59A 3ZFEA 4ASMB 3ZYGA 1BBT2 4QM8A 3ZM8A 4TLGA 5ANQA 1LHNA 4P9YA 2VZRA 4EWAA 4BM8A 3AKPA 1NZIA 1GZWB 1VPHA 2FCTA 3B9IA 4UXAA 5AVAA 4XJAA 2JE9A 1DBNA 1SLIA 3BUCA 4HETA 4I30A 3VKFC 2G9ZA 4CUGA 1I5PA 2XKOA 3PUQA 2Y34A 3VDAA 1ODMA 3AZXA 4QXHA 4ET7A 1ZNPA 3R0RA 3T2QA 3ZN6B 2ZMKA 2YBPA 1O91A 1PIV3 4XJ8A 1XNTA 1CJPA 3BOWA 2ZGPA 1ND2C 1H2NA 1K12A 1DGLA 1XU2A 5FPZA 1CIWA 2GMEA 4YGCA 4CDQA 2X09A 5DABA 5JZGB 4C90A 5LB6A 2RG4A 4D69A 4P9GA 4UYBA 1Q56A 1JN2P 2JB8A 1QH7A 2YC4A 2J7MA 4CDQB 3KF3A 4Z8BA 1MZ6A 3SCHA 3B7MA 4XUQA 2Y60A 2P3IA 3B02A 2F17A 4EJRA 2XJPA 2ZHMA 4A7KA 1BCXA 4RR3B 2VOWA 5EJ3A 3POBA 1S0CA 3OD4A 1FXZA 4KG0A 3SC7X 2WO7A 1RUD1 1TME3 4XW3A 3WEZA 4MGTA 5JLVA 4NIHA 2WYSA 3NJVA 1CAWA 2R0FA 3OF1A 5BNPA 4YARA 3V0AA 1FAYA 1EPZA 1VE0A 2W1UA 4JTNA 3HMYA 4WM7A 1J58A 1UU6A 4OI0A 4CCNA 1RUJ2 3E5QA 2B39A 4FOWA 2VOVA 4UF0A 5T55A 1RUOA 2AUYA 4OVEA 1KDMA 4AHZA 3BKZA 1O6UA 4GMP1 4RQPC 2VO5A 1R092 1NAEA 4W50A 4Y1ZA 1HB1A 4AFBA 2JIGA 4AE2A 1JYNA 2HJIA 3J8F2 1CAXA 3DPRB 4LO4B 4QKBA 4LXLA 5HCHA 4RSUA 1SPPA 4O9EA 3HOBA 1D4M2 1XYOA 4IUGA 4IE5A 1RUD3 1HW5A 1HDKA 4XXAA 5CYYA 3POEA 3ZYJB 4AI1A 3ZXEA 2VMDA 4CDQC 4LA3A 4M0NA 3KCXA 4QPGB 1OHFA 5CKQA 4XPVA 5LBFA 3ILFA 4AHYA 3WQ1A 2W95A 1NQDA 1ZX5A 1ZZ8A 3WDWA 4CZSA 5HXMA 1W0PA 4TN7A 3AL6A 1ND2B 3NAPC 3AMHA 2RHPA 3E97A 1WW4A 4QDSA 1GZTA 4I3PA 4IEPA 3RPQA 1POV1 2W3JA 5JR7B 4MO3M 2XQXA 4Y4RA 1S2BA 3NNGA 3AZZA 2MHFA 3ZFEC 5FV3A 4AVTA 3DYPA 1QMJA 3U14A 2PAKA 5BNOB 1D0HA 3AB0A 2YZ4A 1QJEA 1V9U1 2B9VA 3I2GA 3KQ4B 3KS7A 4JKMA 5IVYA 3UNPA 1RGSA 2Q1FA 1S0IA 4LO6B 3W59A 3ZYRA 5FPLA 4ASKA 1UOGA 2HWF3 2UY9A 4MXWB 4QX8A 3WINE 4EN7B 4YZ1A 1DDLA 1GOGA 5C3SA 3F95A 1N47A 2HH9A 4GH4A 1F5JA 2J1EA 4EV0A 3O0VA 5AFBA 5L7OC 1ASJ1 3P1IA 4QWNA 3VN4A 4Q8LA 3JZVA 4MXWA 5FR3A 1PGL1 3ZO0B 4I01A 2MEV1 3OGRA 3W21A 2XUEA 4F3JA 4A7YA 2J42A 3CMGA 5EWSA 4YZ4A 3WG1A 2A71A 2YPDA 1QNWA 2LALA 2KD7A 5F5AA 2HKXA 4AGGA 5A32B 2YBSA 2CY6A 1MZFA 3D6EA 4RS5B 5DG2A 1JOJA 2Z5WA 1UXXX 5C8CC 1JYVA 2VAUA 1F15A 1QH6A 2EXKA 2RV9A 4QPIB 3U78A 3ZDSA 3Q8BA 2AREA 3O14A 2J1RA 3EBRA 1SQ4A 4QB1A 1QU0A 3THCA 3VD7A 2E53A 3JU9A 5F39A 2VBDA 2GN3A 3DN7A 3IKWA 1J83A 4JHZA 4LHSA 2JG8A 4WZFA 3LEKA 2DUOA 4W6XA 3I49A 2ZACA 2ZKNA 3FHAA 2W52A 3LSDA 5JSRA 2P6HA 3FUQA 2XOMA 4FTSA 5FLJA 4ES9A 3KM5A 1FNYA 2WAOA 1GR3A 2PHUA 3OB8A 4V2WA 5FZ1A 2P3KA 2FQPA 1YJLA 3K51A 1IOAA 3Q8EA 5FZBA 3SLIA 2BW8A 5CU1A 1ONAA 1WBFA 4CU7A 4AI9A 4QU2A 3CLPA 1R1A3 1XQNA 1GQPA 3POIA 5CFDB 5FXZA 1U5YA 2E6VA 4ZKTB 3ZPYA 2ZGLA 2IVIB 3A22A 1R091 4NJ4A 3CZJA 3POFA 2GN7A 2GNDA 2BNNA 2Y6KA 3I3DA 5CZKA 3VBSC 5CFDA 1P8JA 4P9JA 1YFXA 5EYXA 2JJ6A 4Q4W1 3N9OA 1RUH1 2WNVC 2YMZA 2WT2A 2YXSA 2ZKLA 2BFUS 3KV6A 3MLJA 4IEYA 5FMBA 2PHFA 3AP5A 4YW5A 4M3CA 1HB2A 3FHQA 4NOTA 1NYWA 3UK9A 2RR12 1RUH2 2VPVA 2JX9A 3UKNA 1SCSA 1WGPA 5A6QA 3E5XA 3HD8B 4XETA 5LATA 3N9LA 4HKWA 4LOSA 4AQ6A 2GC1A 2CSGA 1Y7BA 3RWKX 3WF4A 2BWAA 3ELNA 5JAXA 1Q3EA 1GWKA 4KI5M 5HCFA 3ZFGC 4D6RA 2BPA2 4Y5Z0 2WZEA 1CIYA 3HAGA 4R4ZA 3WD5A 2UURA 3WW2A 2CWSA 3WQ7A 1RMU1 1OLME 1MS9A 3NL1A 1LU2A 1ZRIA 1NA1B 1PHMA 3B93A 3VZMA 5FPUA 3VD9A 1ZBE1 2AZ5A 2MPFA 4A3XA 3HPNA 4LEJA 1W2UA 3H42B 4O65A 1IS6A 2ORXA 2EICA 4N9HA 4RGKA 2YFZA 3AP6A 1S0EA 3ROUA 3WCSA 1WA6X 2FDFA 1QQP2 5LEKA 1QIQA 4PBPA 5HXVA 2EIEA 2H0BA 2X8KA 4NN0A 4HMZA 4Y1XA 4P9IA 1O5LA 2P3YA 4MZUA 1BBT1 2C9AA 2QCSB 4AOCA 2RDRA 4DQAA 3P6BA 4ES8A 4D94A 1T2XA 4E2GA 5CKNA 1AXZA 5F1RA 1OBNA 4S2DA 2CTVA 3VBOA 2J1SA 5C9AC 1GMMA 5FZKA 5KXCA 1FV2A 4CDXC 2VUAA 4B4QA 1LOBA 3PIGA 4FOYA 3AXDA 4AI0A 2XQRA 4Z82A 1R1A1 2WQ4A 2HYKA 4GAZA 4IQPA 3NKTA 5FQ0A 3M8LA 5I0RA 3BPSA 4NE9A 5GLZA 1UF2C 4XFFA 3ZMNA 4DUWA 2CGNA 3OUJA 1VMHA 2QZ3A 4Z07A 4NUBA 3WZ1A 4NIDA 4YG6A 4COYA 1IPJA 2W91A 1RUE1 2LROA 3B5LB 4ARXA 1CAVA 1GP6A 1A34A 1N1SA 4LKEA 4XAAA 4GD4A 3IPVA 2D7FA 1SLLA 1H8TB 4XMAA 3U75A 1GBGA 1R1A2 2BTVC 4IV3A 3FFZA 2BVVA 4B3NA 4HVQA 3WVJA 5T3NA 3AP4A 3OOXA 3O1UA 1H2LA 4WVMB 1CX4A 1NZCA 1AF9A 4OI1A 5KHGA 4QDQA 4ZPIA 3IM0A 3WQ0A 4IEVA 3LDRA 2IXCA 3JBG1 5F7UA 3PHMA 3W5MA 1CR7A 4LPLA 3OSDA 3UKVA 3OBTA 5A70A 3SEPA 5FOBB 1H30A 1DGRN 1W8FA 2YY1A 4M3CE 4FPYA 3ZFFA 4Q0SA 4QDRA 5BNNC 3O1PA 3OEAA 4ISQA 5CAZA 5FRAA 5F5QA 3K2OA 4PJYA 2QDNA 2RDQA 4CCJA 4LULA 2VBPA 4FAGA 5A6YA 5JMOA 2WR9A 3AMPA 3M2MA 2WS92 2PAEA 3LSEA 2E63A 1LGCA 2R0HA 3ZN4A 2E7QA 4OI2A 3K3NA 3SXWA 4DB5A 2R042 4XIKA 5FCCA 4OHWA 1ULFA 5FXXA 2BV4A 4NIIA 4E9KA 2W08A 3RMXA 4Y1UA 3N36A 4TTGA 2GNMA 4ZS2A 1XNCA 1N1TA 1JODA 2OZJA 1W2AX 2OT7A 5JPNB 3KHCA 2JDNA 4A45A 2D5FA 2EA7A 4LUMA 5T5PA 3DXTA 4Y5SA 2DVGA 1JZ2A 4XBNA 2LW8A 3CIHA 2XGXA 1J84A 4GIQA 4H55A 4YPJA 1LOGA 1H8TC 2H6BA 3NKGA 5BY5A 5C8WA 2RR11 1H6YA 1EYBA 4MG2A 1F8VA 3GZUC 1VBD1 3THPA 4NPRA 5FP8A 2VBBA 2NMNA 1W0NA 2WNVA 4ZZ8A 1KJLA 3VBUB 2BYVE 2BP6A 2GC0A 2JXAA 4LBOA 1DIWA 5FY0A 4F7ZA 1FPN2 3NV3A 1RUG3 2D97A 2VMEA 1AR61 1HLCA 4IEZA 3TN93 4EWDA 3I7DA 1Z7S2 5FYUA 3TAYA 1ULCA 4LTAA 3ZYBA 2K9ZA 2YYOA 2R061 4XJWA 4YW3A 3USUA 1TVGA 4Y1VA 5LCWL 3PVNA 5FY1A 2EALA 3ZFFB 3ZXAC 1MS4A 1MVEA 2QE3A 2VW0A 3H3ZA 4PLNA 4CCKA 1B35B 1DGWA 4AI2A 4CCLA 2EVXA 4BJ0A 2VL4A 4DEVA 3WXPA 5FBJA 1LECA 1VB2A 1ST8A 2XLAA 3DUIA 3I3MA 4IW3A 2XJRA 5SV5A 4OHYA 3S0MA 2HWF1 4K1YA 3RMYA 1WW6A 2EXHA 3VBFA 2JG8C 3WUCA 4PHZA 1MEC3 1JXNA 4XUNA 1XRUA 4LE4A 3CZUA 5LEJA 3WNPA 4GJZA 2DVFA 1V6JA 2ADDA 3SQOA 1APNA 1GWMA 2WSVA 2BGOA 2MEV3 2NYYA 3IDCB 4FFHA 3PTRB 3E6BA 2R063 4K3UA 4LHKA 5FZ6A 4I0BA 3Q8CA 4YSFA 5C71A 5ISLA 2GZWA 1AL22 1K3IA 2VXJA 3K48A 4P9WA 5FZCA 1H1AA 1WMFA 2DU1A 5DDJ2 1SBEA 3MIHA 5F37A 1NLSA 1EP0A 1PO22 3ENRA 2F4PA 1VRBA 4GULA 5FOJB 1YQ8A 3PUIA 1DGWX 3KHBA 4RQPB 1TE1B 1EAH2 2Z4FA 2RJ2A 4E2QA 2D6OX 4CYDA 1XSRA 1GZ9A 2HWD1 1G9BA 3VKLA 1OH4A 2YU1A 4QX3A 1HXS1 1RXFA 4Q4Y2 2O8OA 4XVHA 1UOBA 4CXYA 3C8XA 1XNBA 5CEHA 1SFNA 1KS4A 1PX4A 1JYIA 3ZYIB 3P3PA 2CHHA 5FO8B 1EV11 2SLIA 2DVDA 2AR6A 1OXCA 1S0DA 3JQWA 3HVDA 3IN9A 2ZHKA 4WVWA 3IAPA 1QJZA 4Q0UA 5ACA2 4N43A 4IE0A 4ZHNA 1Z78A 1BMV1 4QB2A 4XQWA 3VZLA 2LS6A 2WJSA 1RUG1 1UYPA 3IIIA 2WFF2 3ZXLA 5KWRA 3KGLA 2V09A 2WA4A 4NPLA 3TEWA 1YQ6A 4CPBD 1W6PA 1URXA 5T5JA 4LUKA 5F5CA 1GLHA 1W9YA 2QNKA 2XL9A 2VZUA 4QPGA 5FZ4A 5JI7A 5IATA 1JZ3A 3PJQA 3PMEA 4EN9B 2OPWA 2TNFA 2XLGA 3MW2A 4XJ9A 2W39A 2HYXA 4XZPA 3WW4A 2RS12 4CDUC 4YZ5A 5JR2A 4PIXA 2Y26A 4LBNA 2VVDA 1UD1A 4K8FA 4COUA 1H1MA 5FZLA 4FFGA 5L36A 1H9PA 2R071 2ZAAA 1QJX2 4L97A 1RB8G 1YFUA 1BVVA 1UY1A 2JG9A 2GMMA 3LF7A 4RYDA 4XEZA 2GMPA 2V5DA 3DF0A 4LQRA 4UWDA 2XBO2 1RUI2 3LKJA 1IQAA 1PZ8A 1W06A 4LORA 4RQPA 1W99A 1PX3A 3A23A 2JDAA 4AEDB 3UGGA 3WDXA 4XHXA 5C8CB 1WMDA 1QJY1 2YGMA 4NRQA 3UKTA 4WM7C 3JD71 2ZEYA 1PGSA 1EY2A 3KT7A 4IE7A 4MGIE 3NW4A 4GH4B 3RI9A 3RZHA 5D8AC 3H1YA 1HN0A 3OG2A 4GALA 3IDEA 3WOGA 2JICA 2VTXJ 1O3RA 2HWC2 1ZBE3 3ZVXA 3RZZA 1RXGA 1G86A 3FMGA 2GP5A 3GM8A 2HWD3 3POJA 2V73A 4J1WA 2XBO1 1AHSA 3ZXFA 2QJVA 4PCRA 2HWC3 5GLUA 3VZKA 3MF6A 3THTA 2W47A 3KV4A 3LA3A 3ZKYA 1OMIA 2ZZQA 5H9QA 1YO8A 2WDBA 3CU7A 5GM0A 3WDYA 5BNQA 1GNZA 1ASJ2 1DZTA 4HANA 1CONA 1RHI1 1ND2A 1QOTA 2LUWA 4QX1A 3S5QA 5A1FA 5C3QA 4COVA 3ZOIA 2WNUC 2PQSA 1F4HA 3I3EA 5HCBA 2VCMA 5KHHA 2OXBA 5KBFA 2RS32 5FPBA 3AP9A 2WL1A 3HBZA 4IE6A 5LA0A 3I4IA 2XJSA 3AK0A 4RFRB 2E51A 5DUUA 5FYHA 4S2GA 2A6ZA 3SCGA 4CP9A 4XCBA 1JI6A 5GZCA 5I0SA 4XHBA 1JU3A 1O3SA 2VM9A 1CZSA 5B2GB 1PM4A 1W6NA 3H3LA 2QTWB 2XJVA 4EN8B 1UZZA 4JGYA 2WNOA 3HNBM 2EAAA 3HQRA 4AXOA 1PMHX 5FTTC 4YRDA 2FMYA 4NHKA 3GJBA 5LASA 4DY5A 2FDKA 1ACCA 3SKJE 1CJDA 3LEGA 4XFBA 2WNUA 1UXZA 3TNQA 4CSWA 2XL7A 1RUJ3 4QHBA 4CU9A 3W20A 3E6CC 2VZQA 4IGPA 4BK5A 4UFIA 2JECA 4BPZA 3BGAA 4JKLA 1HXS2 4F83A 1F4AA 2OYZA 3MFCA 2WQ8A 2B42B 2WFF3 2DURA 3I2KA 3ZXJA 2WRAA 2D6LX 4DRRA 3G6JB 4ZU7A 5FO9B 1OOPC 2DCTA 2A73B 1WBLA 3UGFA 5B4NA 3RVHA 3T09A 3ACGA 3DECA 5DUWA 4NAOA 2YB7A 5IK7A 3DYOA 1XNAA 1DP0A 2H0VA 2EIBA 1RIRA 4NHYA 2B46X 4XF9A 2ET7A 4PQ9A 3ZX7A 5JPMB 2HWE1 1X9PA 3JB4C 5GZDA 1GUIA 2ZPXA 1QKQA 3IWZA 1YCIA 3FE5A 3CHXA 2ERFA 3HQUA 3JXSA 3QCWA 1C8M2 1LHWA 2D3RA 2NPIA 2VH9A 3D0JA 3AM2A 3N7JA 4KU8A 4AL9A 3LEMA 3HBKA 3RWNA 5C6CA 1RVF3 1A8DA 4RS5A 2X53S 3CJXA 3VBRC 3BTYA 3VDCA 3LOBA 1DCSA 1XYNA 3MYXA 2VZOA 4Q27A 4R9DA 3WP6A 4B1MA 4BLJA 1MEC1 1NG0A 2BEOA 3GCXA 1ZRDA 3DKQA 4DY3A 3N9QA 4QPWA 5FY9A 1RINA 2PHRA 3A0NA 3MPPG 3WNNA 3A0KA 4K8RB 4PDWA 2FHRA 2JG9C 2HWE3 2PHWA 3OY8A 4HLTA 4A44A 2VJXA 2WAAA 1AVBA 1RHI3 1NY72 2G19A 2CU5A 3FL7A 4OUEA 4H7LA 1DG6A 4I3GA 2R062 3L9JT 4YFWA 3MZHA 2YDEA 3WP5A 1KS5A 4K21A 3WP3A 5LA9A 1B35C 5K7PA 2IXJA 2NMOA 4JZRA 1CGPA 2WYFA 4HG6B 4PIYA 2SBAA 1AR92 4A4AA 5K4LA 4DUXA 4WVZA 1DZRA 2WWSA 5ABJA 1BXHA 1OSGA 4XFHA 1ZA7A 1AR63 4LK7A 3FWEA 3O7OA 1ZBA3 2RS33 1AR93 1HXS3 2PN5A 4WZCA 2ZGRA 4FP2A 3ALQA 4M3CB 4PF5A 5JXIA 2RDNA 2VVEA 5BYNA 2CL2A 1UKGA 4Y4YA 2IWGB 4UW3A 4LBQD 4N7UA 4KNCA 4NHXA 4N53B 4V2VA 2XUMA 1OURA 2QQVA 2IXHA 4AK3A 1WW5A 1J3PA 3QACA 2VOTA 2HWE2 4JRAA 2WIIB 4JGZA 4GQ7A 3U37A 2VUJA 5CG9A 1TNRA 3MBWA 1W03A 3FLRA 4QAWA 4R4XA 4XE9A 5FP4A 4XAEA 5JCTA 1POQA 1DYOA 3VZJA 1G9DA 4CCCA 3CF6E 1CZVA 3T0DA 3B69A 5A3UA 3ZSEA 3H8OA 4NIGA 3URFA 3H3UA 4LO7A 2WN2A 3KSCA 1NA1A 3H8RA 2B4KA 1AYM2 5FMOL 3F2ZA 1T6BX 3IBMA 5FZFA 1IKPA 5A7NA 4GA9A 1Q5OA 1Y4WA 3DEMA 4JC1A 1JZ6A 2CGPA 2RS51 2R16A 1K45A 4PLOA 5C3OA 1PMIA 3ZSLA 5IK4A 2WQZC 1H4HA 2RMU1 4Q4V2 3MW3A 4RFT0 3UT0A 3VKNA 3GHNA 5E8AA 3T30A 2ZJCA 3PUAA 3HR9A 1O7FA 2XJUA 3BU7A 3OPTA 4AVBA 4XTPA 3MIEA 2V72A 3N7KA 1YC61 3WF3A 3U0ZA 2Z2SB 3PNAA 2P34A 3LIGA 1YFYA 2WKKA 4Y33A 3UJQA 4BWOA 5FY7A 4E4DX 3OPWA 5L9VA 5LA1A 3SH4A 4B4RA 3PLQA 5FZDA 5GZFA 4YWAA 1G9FA 1SFPA 4PT6A 4OZXA 4RHV1 1K5MA 4EN6B 1NX9A 5EXOA 3ZYHA 4WM8B 4DMIA 1PM7A 2NZ9A 4DRVA 4QPYA 1F35A 2Q5TA 4LBKA 4K20A 4ORFA 3VHNA 1WUVA 2XMLA 1AJOA 5J98B 4A2UA 1ZZ9A 2V4AA 3FC0A 5I8SA 4XTMA 1EV13 1LHOA 1IZ3A 3D5OA 1JZ7A 2PHDA 3LEIA 2D98A 1NY71 3OPZA 2ARBA 3T1MA 2UY8A 1OQEA 4QM9A 2G1MA 2ZA9A 2FCUA 1PK6B 2ZEWA 1AR62 3LIHA 1KITA 3QH6A 4JGZB 5A33A 4CTEA 4DNYA 1ZZBA 4N53C 5ANNA 3T1LA 4E8DA 4WVVA 3BTZA 1BK1A 1DQ5A 4KU7A 3K4DA 4JQTA 4V1PA 2J1VA 1WCSA 1RUC3 2C6SA 4Q4V3 5FUNA 4QQ2A 4K1ZA 2B7YA 3LA7A 2DTYA 1S4CA 4OCTA 4W4ZA 3VBUC 4BDVB 1ASJ3 4COWA 1CPMA 3WF2A 2EXJA 2PTMA 3FN9A 1R083 3GYDA 5JXHA 1PK6C 4XF1A 4HPKA 1VBA3 1LULA 4D8MA 1YEWA 4WV8A 4IV1A 3WV6A 5F6LB 1OD5A 5DAQA 1LB2A 1VP6A 2GU9A 3U10A 4RD7A 2PHTA 4CCOA 3RYPA 1G9CA 3R4SA 2BBAA 1A8MA 3NJXA 1GANA 4N7IA 2W68A 1POV0 4IV1B 2EAKA 5H9PA 1PNFA 3HN3A 2O1QA 4NWWA 5DDJ3 5ACA3 2ES3A 4MH0E 5FZ7A 1GFF2 4NAMA 1CZTA 1S2KA 4Q8KA 1NXMA 2VZ3A 3O0XA 1D2SA 3WSOA 5HPOA 3ES4A 1WD4A 3N3HA 4QGMA 5DZEA 4A6SA 1Q8QA 3OBZA 4GB32 3E6DA 1GWLA 3BYWA 1QQP3 1LOAA 1LNSA 1NCQB 3D0SA 2I45A 1MEC2 1C5HA 1X82A 4XBLA 3VD3A 5FPAA 1PO11 3ZFFC 1TG7A 2VY0A 4GKXA 2DCKA 1PK6A 4XZUG 2LRPA 2HWC1 2Y6LA 4YZ2A 4TWTA 2JDKA 2VULA 4A6OA 2JKXA 1KRIA 1Y43B 2R1BA 5LBBA 1OH3A 1ZRRA 4Q0PA 3VBUA 1Q43A 1WW7A 1HN1A 2K46A 2P4EA 2ZGNA 3QLQA 3KF5A 3WDUA 2QZ2A 2X5IB 1ZREA 1E5IA 4Y3OA 1OPOA 5AC93 5CB7A 4YVSB 1QJU1 4NIAA 2OPKA 1OOPB 1RUF2 3GJAA 5EV7A 3ZPOA 1FOD2 3SH5A 2ZX0A 4DPNA 5FYIA 1VBB2 2GAUA 3VBHC 4XCAA 4CEWA 3O1SA 1IHMA 2OX0A 3OBAA 3U07A 3I3BA 1DLCA 1SEFA 1NUKA 5L73A 1FPN3 2VTFA 3T4HB 1RUH3 2WLPA 1FYUA 5FZ3A 3MUY1 2E7AA 1I1EA 4YVSC 1X9TA 2JD9A 1OD3A 5A3TA 5FXWA 2R072 4N43B 1QOSA 2Q30A 1RUC1 4CDXA 5A3OA 2DFCA 4SLIA 3MDPA 3B00A 3B94A 5AC91 1MVQA 3HT1A 4J1XA 3U4XA 2BGCA 1OKOA 1W6PB 5CADA 1L7QA 2PQQA 5FMDA 1STMA 2XDVA 1FMD3 1X33A 4JDNA 3RNSA 5T52A 3WY6A 2ZOEB 4XABA 4A42A 1NE6A 2ET1A 1V6OA 2JDUA 2IVJA 4XFGA 4Y24A 1BKZA 1UW8A 4LIUA 5FLHA 4C91A 2WFF1 4KMQA 1RUG2 1PVC1 2BUKA 3OGSA 1QWRA 2JDMA 4BQWA 4Q4X1 5F3EA 1BLZA 4URTA 1H1IA 5ACA1 4NRMA 5L9BA 4M4RA 1E5RA 2RS31 3WT3A 3Q8AA 1L7LA 3BN6A 1SBDA 2QQLA 3AFGA 3HQXA 4XUTA 4CP1A 3ITQA 1LR5A 5C4WC 2A75A 3HT2A 1UIJA 4QPIC 2BBVA 1YHFA 1EUUA 1AL23 2AYHA 2P17A 1KXGA 1UWWA 2X5IA 3D4KA 3RJ2X 2Q4SA 3KVAA 1I5ZA 4BA6A 5FDBA 5DPNA 4R8HA 4PI0A 2HWB2 3FZ3A 1VRH3 3ZIWA 2B45X 2Q8DA 1S1AA 2CAUA 1DQ0A 3BVCA 2ARCA 3GALA 3GZTB 3GBWA 4CEYB 1YI9A 4FQ4A 3FFQA 3DKWA 3WP4A 3I97A 1UX7A 1DF0A 1WZXA 4BK4A 5J96B 1AR82 4CP2A 1FX5A 1PGW1 2Y6JA 2JEMA 2PHLA 1XNDA 3PUHA 5AVPA 2ZMNA 3BU0A 1IPSA 1ENSA 5EJ1B 5A1LA 1NCRB 1O3TA 3RZLA 1QJY2 4C8DA 4J6GA 3WG2A 2YBKA 1ULPA 1UOFA 5E16A 5A3WA 4IGOA 1XE0A 4OLLA 1ENXA 4Q5OA 1YQ5A 3VDDA 1QOOA 5A3NA 3I59B 3AKQA 5FY5A 1W8NA 5ABJC 5FY8A 2X05A 2HWF2 3JCIA 2P3JA 4Q4Y1 4A7ZA 4EQVA 1CVNA 3BI3A 1HRI3 4IEUA 1A3KA 3NQHA 1AR91 4XC9A 4NR1A 3NSTA 4P02B 3SH3A 2D5HA 3MIFA 3S7EA 5CFCB 4AGRA 4HONA 1YIPA 4Z92B 5EHDA 4FFFA 1CAUB 2QDRA 4WM8C 3R4UA 1L3JA 2Q1MA 3POSA 4MV2A 4HKLA 3VZNA 2DFBA 5CFCA 1ND3A 2VD7A 3M4FA 3TEXA 2J22A 5A80A 5D21A 4RGAA 4D7YA 2XB6C 2VMFA 3NJZA 3ZDVA 1UYYA 5M0TA 5DQ0A 1HJFA 3QOPA 4O7XA 4S2HA 1C4RA 1RYYA 3T4VA 3DXUA 4NO4A 4Q4X3 3DPRC 3VHPA 4AG4A 4BQ1A 2I2SA 1SDDB 4ZU4A 5FMOS 2O8QA 4FPEA 1HQNA 3WUDA 4MADA 3ZIXA 3OTFA 1W9TA 5T50A 4B29A 1RUD2 2PYTA 5JWPA 3IZOA 2G4IA 3FHIB 1WD3A 5J37A 3I2FA 2RS53 2KXLA 3POYA 5FKBA 1NOVA 5IVEA 3HNYM 3IAQA 1AXYA 2RMU2 2RS13 4IETA 1V70A 4LBMA 3MHZA 4Q4V1 5FLIA 1RUNA 3PU3A 1COV1 2K0GA 1UMHA 1H4GA 4ATEA 4IE4A 1W0OA 1C5IA 1RITA 2BRTA 1VBA1 1VJ2A 3NNJA 2VECA 5A3LA 1OFSA 2PHXA 1ULDA 3S6PA 1LKNA 4XBQA 1LOFC 3AC0A 1B09A 4OFGA 5JVVA 2ZXQA 3ZXGA 1DFQA 1VBD3 1AYN3 1W6OA 3AXEA 4ZU5A 1KFXL 1TME2 2DYCA 3DV8A 4ZONA 4OHZA 1OI6A 2ID4A 1UMZA 1N1YA 2RJKA 5A7WB 1NE4A 1IG3A 1TZOA 2PMWB 4AEMA 1NLRA 3CQOA 3O1OA 4IEXA 1OQDA 1UY2A 4QKDA 4BH9A 2A1XA 2HEWF 1ZZCA 4YFZA 4OZOA 1WCDJ 3J9SA 3OBRA 4WVMA 3AKTA 1W6QB 2BJSA 4LLOA 1MS8A 2Z69A 4B4PA 2P37A 3N7MA 3K46A 5IK5A 5C33A 1Y9QA 2VQTA 3FBMA 4E27A 4ATFA 1OQ1A 4Y22A 2ZHNA 3T08A 5DAXA 4CDUB 1W04A 3PDQA 5TSWA 1F9KA 4CPBA 4Q26A 2VNVA 2YGLA 3FBYA 4R9CA 1RMU2 3C2UA 1C8M3 3NJYA 3ASIA 1QJU3 3UETA 5J09A 5F8PA 2VQUA 1UU4A 3RG0A 2DTWA 3ZR5A 1VB4A 4IEOA 2O14A 4C0HA 4UW5A 1IS5A 5C5UA 2E33A 3ACLA 2MNGA 3ACIA 3IDBB 4QGLA 4GZ9A 2WZPP 1JTZX 5LK5A 2WSUA 4Z2WA 2PLV2 1FPN1 4UFMA 2ZCWA 3SNMA 4HT1T 4AAXA 2Y6GA 2EF6A 4LHLA 1O3QA 4GJYA 3AZVA 2WZR1 2JENA 1SLBA 1WLWA 2XVKA 1EAH3 4KBZA 2IZWA 4W65A 4NWVA 3AZYA 4XFAA 2WWJA 1ODNA 3PU8A 4YGDA 5D8AA 3NV2A 1NQJA 4D7TA 2YPJA 2D3PA 3Q9OA 4XURA 3POGA 4IGQA 1UZWA 3T2OA 4AR2A 4BIOA 2ZGTA 1RTVA 3OD0A 2WO3A 1TNFA 4MOAA 2YG0A 4XDQA 4Q4W2 2VVFA 3LZZA 1SCRA 3Q8FA 1AXKA 1F31A 1RJ7A 1RL3A 1QQP1 4KWLA 4PDWB 5LY2A 5D2AA 2DDUA 2QVSB 4XJZA 3T0AA 5J36A 1HJGA 4MLOA 3OYWA 5CA6A 2OQ7A 2Q0AA 3ME2A 4FTEA 1TMF2 5JXGA 2D40A 4AW7A 1AX2A 5IVJA 2HBUA 2IXIA 4Y20B 2Y6HA 4H3WA 2DCJA 3W9AA 1ZRFA 3R6SA 1C1LA 3AVRA 1OPMA 5IT6A 2ORZA 4XIOA 4CDUA 4IL7A 1BZWA 4GWJA 2AH2A 3JQXA 4QPGC 2VGDA 1HV1A 2FDJA 1BVP1 3WX5A 2A3XA 1JHJA 3LCPA 5LBCA 4MGZE 1UO9A 3FLPA 5J7MA 1M4WA 2VR4A 3RJRA 1C57A 3TN92 3LB9A 3P5BA 1Z0HA 2QBXA 3DCQA 1UNBA 4UOJA 3ZSMA 1L7RA 1QJFA 3KD4A 1VBC1 2XG3A 4MGKE 5DUXA 4LE3A 3O1TA 4NMIA 1JU4A 1ZZ6A 1O4YA 1UYXA 2G9GA 2R30A 5JZGA 4CRQA 5FQ0B 2J1AA 5KHJA 4MYEA 2A6XA 1TME1 2P5BA 1FI2A 2QUOA 4QU1A 1TMF3 2XWJB 3S57A 1J1TA 4H2AA 5F5IA 4AQ2A 5I93A 1W8TA 4KGGA 5FYYA 3JBG3 4ZXKA 1LOFA 1U12A 1JZ4A 3A7QA 4Q0QA 1XYPA 2Y33A 1BYHA 1UQXA 4FTBA 1QJY3 2ZAHA 4B1LA 2XONA 2KM2A 4UT5A 1ULGA 1XB9A 1TEIA 4DXRA 2VUCA 1IS4A 3FUOA 1W28A 1CQ9A 3LDKA 1UU5A 5IAXA 4D0QA 2A5ZA 1EAH1 4KBBA 1WLCA 1UMIA 1RUI3 3LFIA 3ZSKA 2HEYF 3IIAA 4KH9A 4L11A 3RZJA 1SMVA 4IEQA 2R043 5IVCA 5I0TA 3VL8A 3PMSA 3VZOA 3TYJA 4YW1A 4OHXA 4N90A 1VRH2 1IKQA 1AL21 1DQ4A 1Q8SA 4LBQB 1K5MB 4UBGA 3TNPB 3DL3A 4OMCA 3DPRA 2W1WA 5DZFA 3VDBA 2R49A 1OVPA 2WINB 4TSVA 3TRSB 1JYWA 3GF6A 1WA4A 1KJRA 3J7MA 1X7NA 4QD2A 2W87A 1W8OA 3C7GA 2DCYA 3TBDA 1POV3 4AZZA 3WF1A 1DQ2A 1YXWA 2OS2A 1ND3C 1DQ1A 1GZWA 4K9SA 3G7DA 2DV9A 2FDIA 2IXKA 1Q8PA 1RUI1 3AMQA 1PIV2 1U5XA 2VC9A 4M4PA 4XJUA 4XMIA 3ZFGB 4A41A 5KHIA 1V9U3 5F32A 5LBEA 5JMCA 5BNNB 2JB4A 4AI8A 4DOUA 2Y0IA 3S7IA 1D4M1 4YVWC 4FPJA 1W3VA 4XF3A 1OLMA 4BB3A 4OI4A 3ATGA 3QBQA 1C1FA 2RS11 2RJLA 2Y6FA 5F3IA 5JUVA 4UFLA 1PGL2 4LLFA 4I0AA 4XACA 5DN2A 1COV3 1Y3TA 2D3SA 4CUBA 4G4FA 2VZPA 5FZIA 4Q1RA 3N9NA 2VMHA 3EJKA 3SITA 3UV9A 5BNOA 1O5UA 4Q4Y3 1VALA 1RUJ1 3DYMA 3RZGA 3ZYPA 4Q2FA 4MHRA 1PGW2 2D44A 1GICA 1HQWA 1V9U2 5FMCA 3MIBA 1SG3A 2AC1A 2P2KA 1AYN2 3M70A 1BMV2 1H8TA 5FWEA 1VBC2 4RR3A 5I91A 4AWDA 1D4M3 1YUDA 3MIDA 1XJAA 2NQYA 2RM22 2YROA 1VAVA 2DWRA 2VCBA 4BIFA 3AFKA 4NHMA 1GP5A 2PLV1 3BB6A 4FPFA 3AL5A 5D1IA 1LCLA 2MEV2 4LITA 5A32A 3ZMOA 4UF0B 4UI9L 4GWNA 4BU2A 1GYKA 1W6MA 3PVEA 3TOJA 1JOBA 4LKSA 3WF0A 4CCEA 2RR13 5HI0A 4QX0A 4QPIA 1YNAA 1CAXB 3WLUA 2R041 5E89A 2VW2A 5C4WA 3EMRA 3S5AA 5BPXA 1HRV3 3UYJA 4FQZA 1UY4A 4XQDA 5DZGA 5EJZB 5FJKA 1E57A 5FYSA 5JOZA 1J3RA 2VNRA 1OF4A 1CX1A 5C4WB 5KR7A 3CO2A 5BNNA 3I2OA 3AKSA 4HKOA 4I09A 1U5IA 1YYNA 4YW2A 3VD5A 5KXDA 1CWPA 3O1MA 1XSQA 5K8SA 3C7FA 4FT8A 2JDZA 2ETEA 1ENQA 2VNOA 2ZZJA 1UPIA 1OA2A 1SDWA 3THDA 4EYUA 4Z1VA 5KHKA 2VOKA 5EPAA 1W05A 4E4ZA 3FX3A 3J4UH 3J7NA 4IESA 4QHZA 3ZLIA 5CBLA 4FAHA 1R64A 5JOYA 2G9FA 1UKRA 4GMP0 4JKKA 3WNXA 4CXXA 4FBFA 1ZRCA 3PVBB 4M01A 2YFUA 3UESA 2FMDA 4YM0A 4YVSA 1CESA 5FK7A 1QDCA 1D4VB 1ZBA1 4LKDA 1SACA 1MQTA 1O8SA 1R082 3SEEA 5IFTA 5GZEA 4BMBA 1MQTC 3J8F1 1OFNA 3GBFA 5ERLA 3VD4A 4DINB 5FPXA 1COV2 1NXD1 1UX6A 4QX2A 5FUIA 2YC2A 1C8NA 1DGRA 3BTAA 1H6XA 4FXGB 5BUVA 2OQ6A 2WT0A 2ZGKA 3TEZA 3VBOC 2E32A 5C9AA 3KCCA 3WDTA 3L2YA 3MO4A 3C7HA 1AZDA 1QDOA 2OA2A 1UOJA 2OIIA 3ON7A 1ZYBA 3ACHA 5FKCA 1VBD2 1AX1A 5GJ6A 4B7KA 1OUXA 2XPJA 3MGUA 1SFYA 2C4XA 3EB7A 4YNIA 1UL9A 5DXDA 5C5TA 1IQDC 5LW9A 3LPFA 3PTYA 2D43A 2ARAA 3FJSA 3H9AA 1Y9MA 5FZOB 4CE8A 4PF1A 3AKRA 1I9RA 4Y26A 2ZABA 1UZVA 3I54A 2TEPA 4DO0A 2YU2A 1KEXA 3NWKA 2GH8A 3ETPA 3OGJA 5FP3A 5FZEA 1AR83 1HIXA 4M00A 3CL1A 3I2HA 2P1BA 4QHOA 3J7HA 3T2PA 1PMJX 1S0FA 1S0BA 1XE8A 4X6QB 1TMF1 5IYYA 2IUWA 2A70A 4KWKA 1YFWA 3U11A 1FV3A 4DIQA 4AEJA 3INAA 4Y1YA 3HJRA 4ASLA 2QQKA 3A21A 4IV1C 4TYSA 3GBGA 2BOIA 1YLLA 4D6QA 5J3UA 1XU1A 3APBA 3VKOA 3VBOB 2JE8A 2VOXA 1MS1A 4RR3C 2F6BA 5CVRA 2XR4A 3JBG2 4B8EA 1JYTA 3NNLA 2R073 2WNEA 3M3CA 3VBSB 2YHJA 4CEYA 4HVRA 1N3PA 2WZR2 2AEZA 5HBAA 1REDA 4O9GA 1LHVA 2Q8OA 1K42A 1EPWA 3LOIA 4A3ZA 4AI3A 5CFDC 5LA2A 3VBSA 1UYZA 1XXNA 1HB3A 4OQ9A 4N53A 5E1RA 1W6OB 3J8F3 1DU3D 2B8MA 2HWB1 1OA4A 4RN5A 5A3MA 2R6QA 2UYAA 2V4VA 4JX0A 1FOD3 3LWCA 1QXRA 1YJKA 4QKFA 3H8UA 4DEQA 4CP0A 5AFEA 4XUOA 3OGVA 2JDPA 2XHKA 5FZOA 3NNMA 2XXZA 4D3WA 5JOWA 5LRSA 5T5OA 4HN0A 1ND3B 2VW1A 2Z42A 2YC0A 1KGYA 3HNMA 2Q8EA 5KXBA 2GC2A 1XBFA 3RZKA 5F6KA 4J25A 2RVAA 4RHV2 4L92A 4KWUA 3O0WA 4HN1A 4UW4A 1S0JA 3ZKUA 3LQCA 3H1WA 4MSVA 3EHKA 4XILA 3T2TA 4HXCA 1WCKA 1K5MC 3NAPB 1DLLA 1OC1A 2C26A 3B9CA 4YZ3A 1V6LA 5I0DA 2HWB3 3RFRA 1VLNA 4COZA 5LK7B 1QNYA 1FNZA 4QQPA 4MUVA 2JDHA 1NT0A 1YQ2A 4E8CA 3W5NA 4I02A 2FD8A 3ZR6A 2QKDA 1JHNA 1XPWA 3KWVA 5FZAA 5HV4A 1UAIA 5C8CA 2WABA 1AR81 1F5FA 5FYTA 3H8XA 2ZGQA 4QKNA 2VTXA 2NP0A 3OUHA 2FDGA 2XVLA 5IAVA 3TB0A 4XF4A 1SBFA 3I2JA 5IW0A 5IVFA 3PVOA 5F3GA 4GXLA 3AMMA 3T3YA 2EXIA 2QQPA 1VBA2 1QGLA 2VZTA 3PUSA 4UFKA 4AFDA 2RE9A 1RVF2 2E9QA 1DZQA 2PLV3 5FZGA 3W58A 1OUSA 3OUIA 1PVXA 4CDWB 2A6WA 4MGSA 3KB5A 1W2NA 3IMMA 5FP9A 1LHUA 3RRDA 2Z79A 3KGZA 1AR72 1W90A 1BBT3 2BWCA 4JGZC 4RA0A 4BXSV 3I8TA 1RUF1 4KQ7A 3VKMA 4LIVA 2WNVB 1QJU2 1QXPA 2DVBA 5EFUA 5CISA 3VGIA 5JOXA 3CKHA 4H14A 4YM2A 4IDZA 2DBIA 4FOVA 1AL0G 3ABZA 4KL1A 4MGQA 3EQEA 3R4DB 3V65A 1REFA 1LAJA 2VQAA 4MHUA 2IXLA 1YRZA 4IV3B 5FYBA 4EN0A 4PI2A 4D7SA 1JBCA 4Q29A 3H1MA 5A7QA 2DVAA 4Y22B 2OZ6A 3SISA 4LKFA 1O4ZA 2VG9A 3USUB 4QXBA 1W2OA 3NAPA 2AACA 1RUE3 2WBKA 3O5SA 4H7MA 1B35A 1W6QA 2GSYA 4P9XA 1W6NB 3M1HA 1CPNA 3WHTA 5FUPA 2A3WA 4JGYB 1W3XA 1H0BA 5CNAA 4YGEA 4YGBA 3WNMA 2E31A 1NCQC 4YW6A 5JIAA 1W9SA 2A7AA 2W46A 4IXLA 5GZGA 2VZVA 1IG0A 1WKYA 2WFPA 1W9FA 3H50A 3LE0A 3NRUA 4HSJA 3HIFA 2CNAA 4PDWC 1BEV1 2W5FA 4LOTA 4Q4X2 4HFSA 2Y8KA 1DQ6A 1PVC2 5T5LA 2VXRA 3VL9A 4K7JA 3VBRA 3IB3A 1LU1A 1VAKA 4PIZA 4BLIA 4RS5C 4B7EA 2W94A 3MF9A 4R9AA 1CN1A 5BNPC 4BCUA 1N1VA 4CU8A 4JVAA 4UFHA 2RMU3 1PNGA 4L99A 3POWA 3V0BA 3I3QA 2PFWA 4NRPA 4ARYA 1HRV1 2WO1A 5FWJA 3E5UA 2NLRA 1HRI2 1MZ5A 2RDSA 1GZCA 2QQMA 1E5HA 4R52A 1JS9A 5LWBA 1JH5A 1OOPA 2B5HA 5H9RA 4AEDC 3RYKA 2DBNA 2GP3A 2JDYA 5CIRA 4FVVA 4HSLA 1UCXA 2K2SA 2C1FA 3PIJA 5A6ZA 3LPGA 1N3OA 2FCVA 4ZZ5A 1XNKA 2W9XA 2ZMLA 2J1UA 1VBE3 1T6GC 4ISRA 3WHUA 2V5YA 2DUPA 4SBVA 5IUQA 4AF9A 1X36A 2BQPA 3KT4A 3ZFEB 1EUTA 4DZGA 2W1SA 5F9TA 1W2TA 2CDPA 3OY8B 3PURA 5BV6A 1DYKA 1KDKA 3U4SA 1QXJA 3ZN5A 3UJOA 5DUVA 3N9PA 4OQ8A 4R9BA 1WMXA 3WG4A 3B3QE 4JGYC 1J1LA 3PL0A 4U36A 3WCRA 3AP7A 4RGGA 1W8UA 4DXSA 1UY3A 5K0UB 4YM1A 2CGOA 4AQSA 1V00A 1QHDA 5FJHA 3TN91 4QXKA 4BISA 5FFOC 3CDZB 5A6XA 1MACA 1QJX3 4LK6A 1W9WA 3RI8A 3UL2A 1GQHA 2P6CA 3BCWA 4UFJA 3AZWA 1R093 1HV0A 2CV6A 1ENRA 2C5DA 3K75B 1GNHA 3K4AA 3LA2A 5GALA 1X8MA 4CCMA 4Q4W3 5FYVA 4LBLA 1AUYA 4JCKA 5FPVA 3ZN6A 4W6WA 1JYXA 2KA3A 3MIGA 2QQOA 4M0HA 4PBOA 1CAVB 2ZGMA 4URAA 2WO2A 1G6NA 2ZEZA 2ZS6B 3CEWA 3V0BB 1C3HA 1VMJA 2BNMA 2VNGA 2UWCA 1LOCA 3N9MA 4YYOA 4AEDA 4BHPA 1J59A 3K4ZA 2TUNA 2R1DA 3AMNA 4FOQA 4CA9A 4CDWA 3MEPA 1H2KA 1H2MA 3QH7A 5DDJ1 1FOD1 3MICA 3AJYA 2VMIA 3V0AB 1IGOA 3MUZ1 4JDMA 2XKPA 2D6NA 3MV01 1OKQA 4LBQA 3VLBB 4UBHA 1WCUA 2PA7A 4HPKB 4MXVA 1X50A 1RMU3 5SV8A 2HEVF 1ULEA 1GSLA 3N35A 1Q8OA 4G3YC 4C0BA 3GHMA 2JIJA 5J1XA 2ZHLA 3KLSA 3WDVA 1S2EA 5A3PA 4AVCA 1CAWB 4EZ4A 4IERA 4MX3A 2ZEXA 1SPPB 2ZX2A 1GU3A 1WCQA 3AYDA 3LFMA 4FPHA 1BEV2 3T0BA 4CUCA 4HOOA 4AVSA 5JI9A 4BQXA 1VMFA 4AFCA 3BIWE 1PO23 4ZXEA 2VZSA 5K0UA 3U1XA 2WZ8A 5IVBA 1VBE1 2J1TA 1DYPA 5CFCC 2CDOA 4MVTA 2R7EB 5F3CA 4WM8A 1FMD2 5APAA 4DUVA 1NCQA 4FFIA 4NVPA 4I2OA 4XFIA 2GNTA 4BXFA 3WNKA 3ECQA 5FAXA 4ONUA 3V64A 3RYRA 4CP9B 1D0GA 4TXWA 5F2SA 5A1AA 5ABJB 3AVSA 1SLTA 3BODA 4Z2AA 2ZGOA 1SLAA 3NNFA 3ILNA 4YLZA 4XDOA 4RHV3 3CJIB 3NO8A 2JG9B 3KV5A 3VDDC 4K40A 1SZBA 5B4XA 3ACFA 3TEYA 3N7LA 1CD3G 4AEKA 4IEWA 5EQUA 2C0ZA 4GB33 4QX5A 2VQ0A 4N43C 2DUQA 5I8YA 4CEWB 2JWPA 1EV12 1C8M1 3ZSJA 1RUF3 4HVOA 1HX6A 3KQRA 1AR71 1M06G 5DG1A 3SHRA 5KC6A 2A3YA 2CYFA 4FCAA 4D6SA 2E26A 2RS52 2OUJA 4UW6A 1TQ5A 3VB9A 1JUIA 4HL0A 5GLTA 3AX4A 5IJRA 1V6IA 3USSA 3RSJA 1WMEA 4S2FA 5FXVA 5BNPB 2H6CA 2HWD2 2CAVA 3VBHB 4WM7B 5JSOA 3O1RA 2I74A 2BNOA 1LENA 2L9LA 3MW4A 4PQQA 1IS3A 2B9UA 3OGGA 5BXXA 4XXPA 4XUPA 1LTEA 3NVCA 2A6VA 3WW3A 2BDRA 2FDHA 2X5IC 2VE1A 3PJYA 2WN3A 3OEBA 4UAPA 3EO6A 1MPXA 2CWMA 2ZGSA 3M3QA 1JZ5A 1KQRA 2UWBA 1W8HA 1ZA4A 1W6MB 2VCAA 3ST7A 1OT5A 5JSPA 4INDA 4XF0A 2GALA 2WLQA 1JW6A 4EROA 1F2NA 2E7TA 2JD4A 4GWMA 4AAPA 3GCWA 3ETQA 2LM3A 4FPCA 2EIDA 5DAWA 3WNOA 5JIUA 1QY4A 5HV0A 4NPMA 3C7EA 2VCCA 3E1F1 5JXJA 1US3A 2QQUA 4KG8A 2X10A 1YIFA 3GZAA 3ILRA 3KV9A 4YW7A 1WLTA 3WR0A 3AJZA 1A6CA 3MV11 3VBFC 4FPKA 4O61A 2QQNA 2WS93 3CJIA 5FZHA 4X6RB 1LGBA 2BZDA 5LY1A 4AHWA 1K5JA 4F8AA 3C3VA 4NROA 3WQBA 2Y0OA 3BALA 4KGQA 4FI9A 1KFUL 3A4UA 1RUE2 1V6NA 4KWJA 4BQ4A 4XDPA 4FPGA 3WG3A 1FMD1 1RUC2 4FPLA 1LODA 1DHKB 1KD7A 5C3RA 3V56A 3TWIA 2WUHA 1H9WA 4YG0A 4LT5A 3VHOA 5EZWA 5FZ8A 4LHNA 4W8JA 1NCRC 2XJQA 5FIXA 3ZYFA 2BU9A 4AYUA 1HRI1 2O0OA 3DGTA 4LO5B 3CNAA 3VBHA 4CEWC 1N3QA 1HB4A 1HKDA 1LJ7A 4XOGA 1JZ8A 3ZXDA 3O1VA 3KCYA 1W8ZA 4ITCA 5IK8A 1RJ8A 4P5HA 1BJQA 1MS5A 5CKMA 4BQ3A 1O4TA 4CEYC
chains in the Genus database with same CATH topology
2FZ2A 3VDDB 2WT1A 1AR73 3AYEA 4OUMA 1BQPA 3MPBA 4LBJA 4CDXB 1MS3A 3JD72 4OULA 5C9AB 4Q0VA 1XE7A 3IT8A 3OCPA 1I6XA 1BEV3 3NV4A 2XH6A 2BVBA 1PO12 1QF3A 3D8CA 3M3OA 4XYXA 4E4SA 2FZ1A 3L2HA 3AYAA 1LEMA 1S0GA 1FT9A 2JG8B 2UU8A 3VUOA 5GLWA 2Q1ZB 1RC6A 3S30A 4L9BA 5CG8A 2D93A 4TZDA 1H8VA 5EYYA 3MLKA 4L8QA 2D6MA 2YUEA 4BYYA 2W0XA 3M7AA 5FREA 2GDFA 3HN1A 4I0WB 1Q8VA 4GKYA 3KMHA 2UWAA 4P14A 1J3QA 1HRV2 3B01A 4RL7A 2PAMA 1AYN1 1YWKA 4FO9A 3JUUA 1G8WA 4C1XA 3I2DA 2LTNA 1LOEA 1VBB3 1LESA 2DF7A 1IPKA 3KZ4C 2OVUA 4IV3C 4AVAA 1RHI2 2VU9A 1ZVFA 2D6PA 2XJTA 2WC2A 4Q1PA 2OUHA 3RS6A 5AC92 2ILMA 4AHXA 1R081 1NCRA 4X8PA 1UPSA 3D82A 1SLCA 4X8NA 4DS0A 4DFSA 2XLFA 5I0UA 4LNVA 3EXUA 4HBNA 3VHRA 3BOPA 1QJX1 1VIWB 4QQOA 4DXZA 2OW4A 1JYCA 2XVGA 4FP3A 1VBB1 3MFAA 4BMEA 5LRRA 5FO7B 1VAMA 3CJIC 3IPVB 1GV9A 4JV4A 5I8TA 1CAUA 4GMP3 2EIGA 3LGRA 3IMNA 3KT1A 2AENA 4BZ4A 5E88A 1WLDA 2PELA 4AQTA 2WNUB 2A6YA 1LEDA 1PO13 2QFEA 4JRLA 1UN1A 3X29B 4C1WA 4QQLA 1G9AA 4AFMA 2ZX4A 4WBBA 1ZBE2 2DCZA 4YG3A 2WZR3 1GKBA 1GQGA 4W6YA 5FBZA 5KC5A 3GNEA 4LA2A 4GB31 4XQ4A 3JD73 3H7JA 3OJBA 1V6KA 2IC1A 1NA1C 3VBRB 4OUSA 3ZFGA 1PZ9A 2YV8A 1Z7S1 4AFAA 4QMAA 4QGNA 2RM21 5D8AB 3SMHA 1W39A 2XBO3 3H0OA 4E2SA 1OLRA 4YW4A 4BE3A 4M3CF 3LAGA 3VV1A 1PO21 4BOWA 5A33B 4EWEA 2JE7A 2ZTNA 3FLTA 3NV1A 4JTOA 3R05A 4LR4A 4MGYE 5JDBA 3BPZA 1R1ZA 1MZEA 4PLMA 5J48A 1REEA 1YI7A 3AYCA 4OHVA 1JUHA 2ZGUA 2ENRA 2BFUL 2ATFA 5BNOC 1S55A 5GLVA 1AJKA 3MLLA 1Z7S3 2ZX1A 3RDIA 5L19A 4LO8A 4JQRA 2DU0A 4Y20A 5K9YA 3QD6A 3H7YA 2AGSA 4JDOA 4TLFA 4HK9A 4U2AA 1X8EA 1MR5A 3ES1A 5H9SA 2NN8A 4YVWA 2ZX3A 3HWJA 1PIV1 2VMGA 4META 1ZM1A 4FXKB 1PZ7A 3VBFB 5T54A 2NM1A 3M3EA 2ZBJA 1I3HA 4NHLA 1AX0A 4AGVA 5GKAC 5K0UC 1OA3A 1VR3A 4HK8A 1VBE2 1U5ZA 1MS0A 1ZZ7A 1HQLA 2JKBA 3M3IA 1AYM3 2TBVA 1LGNA 4N9IA 1VRH1 4K6BA 3SCFA 1FATA 2FBEA 4HZFA 1ALYA 1G7YA 2IFWA 1D2QA 4P9LA 3RQ0A 1C28A 4AVVA 3N4MA 1UZYA 4CDWC 2N7GA 4G9SB 1OLQA 3J26N 5KXEA 2D6KA 1UIKA 3WW1A 2X29A 2GH2A 2IFRA 2I07B 2Y38A 1U0AA 2XWBB 1A78A 1RVF1 2ARXA 4QQHA 2RM23 1AYM1 1ZBA2 4FPOB 4JAAA 1PVC3 5HCAA 5L7OA 4GH4C 1VBC3 2GC3A 2GNBA 3OYWB 3JB8A 1MQTB 1V6MA 2R32A 2UYBA 3O12A 3ZXKA 4QT6A 2WS91 3MI8A 3P3NA 4XFCA 5L7OB 4FSJA 4YVWB 4YM3A 5JZGC 4L2NA 2WA3A 1LRHA 3I59A 3ZFEA 4ASMB 3ZYGA 1BBT2 4QM8A 1LHNA 4P9YA 4EWAA 4BM8A 3AKPA 5AVAA 1GZWB 3B9IA 4UXAA 4XJAA 2JE9A 1DBNA 1SLIA 4HETA 4I30A 3VKFC 2XKOA 3AZXA 1ZNPA 3R0RA 3ZN6B 2ZMKA 1O91A 1PIV3 4XJ8A 1CJPA 3BOWA 2ZGPA 1ND2C 1H2NA 1XU2A 1DGLA 4COWA 5FPZA 1CIWA 2GMEA 4YGCA 4CDQA 5JZGB 4C90A 4D69A 4P9GA 1Q56A 1JN2P 1QH7A 4CDQB 4Z8BA 1MZ6A 3SCHA 3B7MA 2P3IA 3B02A 4EJRA 2XJPA 2ZHMA 4A7KA 1BCXA 4RR3B 2VOWA 5EJ3A 1S0CA 3OD4A 1FXZA 4KG0A 1RUD1 1TME3 4XW3A 5JLVA 1CAWA 2R0FA 3OF1A 5BNPA 4YARA 3V0AA 1FAYA 1EPZA 4JTNA 4WM7A 3HMYA 1J58A 1UU6A 4OI0A 1RUJ2 3E5QA 2B39A 4FOWA 2VOVA 5T55A 1RUOA 2AUYA 4OVEA 1KDMA 4AHZA 4GMP1 4RQPC 4AE2A 1R092 4Y1ZA 4AFBA 2HJIA 3J8F2 1CAXA 3DPRB 4LO4B 4RSUA 4O9EA 1D4M2 1XYOA 4XXAA 1RUD3 1HW5A 1HDKA 3ZYJB 4AI1A 3ZXEA 4CDQC 4LA3A 4M0NA 3KCXA 4QPGB 1OHFA 4XPVA 3ILFA 4AHYA 3WQ1A 1NQDA 1ZX5A 1ZZ8A 3WDWA 4CZSA 1W0PA 1ND2B 3NAPC 3AMHA 2RHPA 3E97A 1WW4A 4I3PA 4IEPA 3RPQA 1POV1 5JR7B 1S2BA 3AZZA 2MHFA 3ZFEC 4AVTA 1QMJA 2PAKA 5BNOB 1D0HA 3AB0A 2YZ4A 1V9U1 3KS7A 1RGSA 1S0IA 4LO6B 3W59A 3ZYRA 2HWF3 2UY9A 4MXWB 3WINE 4EN7B 4YZ1A 1DDLA 1N47A 4GH4A 1F5JA 5AFBA 4EV0A 3O0VA 5L7OC 1ASJ1 3VN4A 4Q8LA 3JZVA 4MXWA 1PGL1 3ZO0B 4I01A 2MEV1 4F3JA 4A7YA 5EWSA 4YZ4A 3WG1A 2A71A 1QNWA 2LALA 2HKXA 4AGGA 5A32B 2CY6A 1MZFA 3D6EA 4RS5B 5DG2A 1JOJA 2Z5WA 5C8CC 1QH6A 2EXKA 4QPIB 3ZDSA 2AREA 3O14A 3EBRA 1SQ4A 1QU0A 2E53A 3JU9A 2GN3A 3DN7A 3IKWA 2JG8A 4WZFA 4W6XA 2DUOA 2ZACA 2ZKNA 2W52A 3LSDA 5JSRA 3FUQA 4FTSA 5FLJA 4ES9A 3KM5A 1FNYA 1GR3A 2PHUA 2P3KA 2FQPA 1YJLA 3K51A 1IOAA 3SLIA 2BW8A 5CU1A 1ONAA 1WBFA 4QU2A 3CLPA 1R1A3 1XQNA 5CFDB 1U5YA 2E6VA 4ZKTB 3ZPYA 2ZGLA 1R091 2GN7A 2GNDA 2BNNA 3VBSC 5CFDA 4P9JA 1YFXA 5EYXA 2JJ6A 4Q4W1 1RUH1 2WNVC 2YMZA 2WT2A 2YXSA 2ZKLA 2BFUS 3MLJA 4IEYA 2PHFA 3AP5A 4YW5A 4M3CA 4NOTA 1NYWA 3UK9A 2VPVA 1RUH2 2RR12 2JX9A 3UKNA 1SCSA 1WGPA 3E5XA 3HD8B 4XETA 4HKWA 4AQ6A 2GC1A 1Y7BA 2BWAA 3ELNA 5JAXA 1Q3EA 3ZFGC 5HCFA 2BPA2 4Y5Z0 3HAGA 4R4ZA 3WD5A 2UURA 3WW2A 2CWSA 3WQ7A 1RMU1 1MS9A 3NL1A 1LU2A 1NA1B 1PHMA 3B93A 3VZMA 1ZBE1 2AZ5A 2MPFA 4A3XA 4LEJA 1W2UA 1IS6A 4N9HA 3AP6A 1S0EA 3ROUA 3WCSA 1QQP2 5LEKA 5HXVA 4PBPA 2H0BA 2X8KA 4NN0A 4HMZA 4Y1XA 4P9IA 1O5LA 4MZUA 1BBT1 2C9AA 2QCSB 4DQAA 4ES8A 4D94A 4E2GA 1AXZA 5F1RA 5KXCA 4S2DA 2CTVA 3VBOA 5C9AC 1FV2A 4CDXC 2VUAA 4B4QA 1LOBA 4FOYA 3AXDA 4AI0A 4Z82A 1R1A1 2WQ4A 2HYKA 4IQPA 3NKTA 5FQ0A 3M8LA 5I0RA 5GLZA 3ZMNA 1UF2C 4XFFA 2CGNA 4Z07A 2QZ3A 3WZ1A 4YG6A 4COYA 1IPJA 1RUE1 3B5LB 1CAVA 1N1SA 3IPVA 2D7FA 1SLLA 1H8TB 4XMAA 1GBGA 1R1A2 2BTVC 4IV3A 3FFZA 2BVVA 4B3NA 4HVQA 3WVJA 5T3NA 3AP4A 1H2LA 4WVMB 1CX4A 1NZCA 1AF9A 4OI1A 5KHGA 3IM0A 3WQ0A 4IEVA 2IXCA 3JBG1 3PHMA 1CR7A 3UKVA 3OBTA 5FOBB 1H30A 1DGRN 2YY1A 4M3CE 4FPYA 3ZFFA 4Q0SA 5BNNC 4ISQA 5CAZA 5FRAA 5F5QA 4PJYA 2QDNA 4FAGA 4LULA 3AMPA 3M2MA 2WS92 2PAEA 3LSEA 2E63A 1LGCA 2R0HA 3ZN4A 2E7QA 4OI2A 3SXWA 4DB5A 2R042 4XIKA 5FCCA 4OHWA 1ULFA 4E9KA 2W08A 3RMXA 4Y1UA 3N36A 2GNMA 1XNCA 1N1TA 2OZJA 5JPNB 2D5FA 2EA7A 4LUMA 5T5PA 2DVGA 4XBNA 2XGXA 4GIQA 4H55A 1LOGA 1H8TC 2H6BA 3NKGA 5BY5A 5C8WA 2RR11 1F8VA 1EYBA 3GZUC 1VBD1 3THPA 4NPRA 2NMNA 2WNVA 1KJLA 3VBUB 2BYVE 2GC0A 2JXAA 4LBOA 1DIWA 4F7ZA 1FPN2 3NV3A 1RUG3 2D97A 1AR61 1HLCA 4IEZA 3TN93 4EWDA 3I7DA 1Z7S2 3TAYA 1ULCA 4LTAA 2K9ZA 2YYOA 2R061 4XJWA 4YW3A 3USUA 4Y1VA 3PVNA 3ZFFB 2EALA 3ZXAC 1MS4A 1MVEA 2QE3A 2VW0A 3H3ZA 4PLNA 1B35B 1DGWA 4AI2A 2EVXA 3WXPA 1LECA 1VB2A 2XLAA 3DUIA 4OHYA 2XJRA 5SV5A 3S0MA 2HWF1 4K1YA 3RMYA 1WW6A 2EXHA 3VBFA 2JG8C 3WUCA 1MEC3 1JXNA 1XRUA 4LE4A 5LEJA 2DVFA 1V6JA 1APNA 3IDCB 2WSVA 2MEV3 2NYYA 3E6BA 2R063 4K3UA 4LHKA 4I0BA 4YSFA 2GZWA 1AL22 4P9WA 3K48A 1H1AA 1WMFA 2DU1A 5DDJ2 1SBEA 3MIHA 1NLSA 1EP0A 1PO22 3ENRA 2F4PA 5FOJB 4GULA 1DGWX 4RQPB 1TE1B 1EAH2 4E2QA 2D6OX 4CYDA 1GZ9A 2HWD1 1G9BA 3VKLA 1HXS1 4Q4Y2 2O8OA 1XNBA 1SFNA 1KS4A 1JYIA 3ZYIB 3P3PA 5FO8B 1EV11 2SLIA 2DVDA 2AR6A 1S0DA 3JQWA 4WVWA 3IN9A 2ZHKA 1QJZA 4Q0UA 5ACA2 4N43A 1Z78A 1BMV1 4XQWA 3VZLA 2WJSA 3ZXLA 1RUG1 5KWRA 2WFF2 3KGLA 2V09A 2WA4A 1W6PA 1URXA 5T5JA 4LUKA 1GLHA 2QNKA 2XL9A 4QPGA 5JI7A 3PJQA 3PMEA 4EN9B 2TNFA 3MW2A 2XLGA 4XZPA 4XJ9A 2W39A 3WW4A 4CDUC 2RS12 4YZ5A 4PIXA 2Y26A 4LBNA 2VVDA 1UD1A 4K8FA 4COUA 1H1MA 5L36A 1H9PA 2R071 2ZAAA 1QJX2 4L97A 1RB8G 1YFUA 1BVVA 2GMMA 2JG9A 4XEZA 2GMPA 3DF0A 2XBO2 1RUI2 3LKJA 1IQAA 1PZ8A 4RQPA 4AEDB 3WDXA 4XHXA 5C8CB 1WMDA 1QJY1 2YGMA 3UKTA 4WM7C 3JD71 1PGSA 1EY2A 3KT7A 4MGIE 3NW4A 4GH4B 3RI9A 5D8AC 3H1YA 4GALA 3IDEA 3WOGA 2JICA 1O3RA 2HWC2 1ZBE3 3ZVXA 3RZZA 1G86A 3FMGA 2HWD3 2V73A 4J1WA 2XBO1 1AHSA 3ZXFA 2QJVA 4PCRA 2HWC3 5GLUA 3VZKA 3MF6A 3THTA 3LA3A 1OMIA 2ZZQA 5H9QA 1YO8A 3CU7A 5GM0A 3WDYA 5BNQA 1GNZA 1ASJ2 1DZTA 4HANA 1CONA 1RHI1 1ND2A 1QOTA 2LUWA 4COVA 5KBFA 2WNUC 5HCBA 5KHHA 2RS32 3AP9A 2WL1A 3HBZA 3I4IA 2XJSA 3AK0A 2E51A 5DUUA 4S2GA 2A6ZA 3SCGA 5GZCA 5I0SA 4XHBA 1O3SA 5B2GB 1W6NA 2XJVA 4EN8B 1UZZA 4JGYA 2EAAA 4AXOA 5FTTC 4YRDA 2FMYA 4NHKA 4DY5A 1CJDA 4XFBA 3TNQA 2WNUA 2XL7A 1RUJ3 4QHBA 3E6CC 2JECA 4BPZA 4F83A 1HXS2 2OYZA 3MFCA 2B42B 2WFF3 2DURA 3ZXJA 4DRRA 4ZU7A 2D6LX 3G6JB 5FO9B 1OOPC 2DCTA 2A73B 1WBLA 5DUWA 5IK7A 2H0VA 1RIRA 4XF9A 2B46X 3ZX7A 2ET7A 4PQ9A 5JPMB 2HWE1 3JB4C 5GZDA 2ZPXA 1QKQA 3IWZA 1YCIA 3FE5A 2ERFA 3QCWA 1C8M2 1LHWA 2D3RA 2NPIA 2VH9A 3D0JA 3AM2A 3N7JA 4KU8A 3RWNA 5C6CA 1RVF3 1A8DA 4RS5A 2X53S 3CJXA 3VBRC 3LOBA 1XYNA 3MYXA 4Q27A 4R9DA 3WP6A 4BLJA 1MEC1 1NG0A 2BEOA 1ZRDA 4DY3A 1RINA 2PHRA 3A0NA 3MPPG 3A0KA 4PDWA 2FHRA 2JG9C 2HWE3 2PHWA 3OY8A 4HLTA 1AVBA 1RHI3 1NY72 4H7LA 1DG6A 4I3GA 2R062 3L9JT 4YFWA 3MZHA 2YDEA 3WP5A 1KS5A 4K21A 3WP3A 1B35C 5K7PA 2IXJA 2NMOA 1CGPA 4PIYA 2SBAA 1AR92 4WVZA 1DZRA 2WWSA 5ABJA 1BXHA 1OSGA 4XFHA 1AR63 3FWEA 3O7OA 1ZBA3 2RS33 1AR93 1HXS3 2PN5A 4WZCA 2ZGRA 4FP2A 3ALQA 4M3CB 4PF5A 2VVEA 5BYNA 2CL2A 1UKGA 4Y4YA 2IWGB 4UW3A 4LBQD 4N7UA 4KNCA 4N53B 2XUMA 2IXHA 4AK3A 1WW5A 1J3PA 3QACA 2HWE2 4JRAA 2WIIB 4JGZA 4GQ7A 5CG9A 2VUJA 1TNRA 4XE9A 3FLRA 4R4XA 5JCTA 3VZJA 1G9DA 3CF6E 3B69A 3ZSEA 3URFA 3H3UA 4LO7A 3KSCA 1NA1A 1AYM2 5FMOL 3IBMA 1IKPA 4GA9A 1Q5OA 4JC1A 2CGPA 2RS51 2R16A 4PLOA 1PMIA 3ZSLA 5IK4A 2WQZC 1H4HA 2RMU1 4Q4V2 3MW3A 4RFT0 3VKNA 3GHNA 5E8AA 2ZJCA 3HR9A 1O7FA 2XJUA 3BU7A 4AVBA 4XTPA 3MIEA 3N7KA 3U0ZA 2Z2SB 3PNAA 2P34A 3UJQA 1YFYA 2WKKA 4E4DX 4BWOA 3SH4A 4B4RA 3PLQA 5GZFA 1G9FA 4EN6B 4OZXA 4RHV1 1K5MA 5EXOA 4DMIA 4WM8B 1PM7A 2NZ9A 4DRVA 4QPYA 2Q5TA 4ORFA 4LBKA 4K20A 3VHNA 1WUVA 5J98B 1AJOA 4A2UA 1ZZ9A 3FC0A 5I8SA 4XTMA 1EV13 1LHOA 1IZ3A 3D5OA 2PHDA 2D98A 1NY71 3OPZA 2ARBA 3T1MA 2UY8A 1OQEA 4QM9A 2ZA9A 1PK6B 1AR62 3QH6A 1KITA 4JGZB 5A33A 4CTEA 4DNYA 1ZZBA 4N53C 3T1LA 4WVVA 1BK1A 1DQ5A 4KU7A 4V1PA 1WCSA 1RUC3 4Q4V3 4QQ2A 4K1ZA 2B7YA 3LA7A 2DTYA 3VBUC 1ASJ3 1CPMA 2EXJA 2PTMA 3GYDA 1R083 1PK6C 4XF1A 4HPKA 1VBA3 1LULA 4WV8A 4IV1A 3WV6A 5F6LB 1OD5A 1LB2A 1VP6A 2GU9A 3U10A 4RD7A 2PHTA 3RYPA 1G9CA 3R4SA 1A8MA 1GANA 4N7IA 2W68A 1POV0 4IV1B 2EAKA 5H9PA 1PNFA 2O1QA 4NWWA 5DDJ3 5ACA3 2ES3A 4MH0E 1GFF2 1S2KA 4Q8KA 1NXMA 3O0XA 1D2SA 3ES4A 1WD4A 3N3HA 4QGMA 5DZEA 1Q8QA 4GB32 3E6DA 1QQP3 1LOAA 1NCQB 3D0SA 2I45A 1MEC2 1C5HA 1X82A 4XBLA 1PO11 3ZFFC 2VY0A 4GKXA 2DCKA 1PK6A 2HWC1 4YZ2A 4TWTA 2VULA 1KRIA 1Y43B 2R1BA 1ZRRA 4Q0PA 3VBUA 1Q43A 1WW7A 3QLQA 3WDUA 2ZGNA 2QZ2A 2X5IB 1ZREA 1OPOA 5AC93 5CB7A 4YVSB 1QJU1 2OPKA 1OOPB 1RUF2 5EV7A 1FOD2 3SH5A 2ZX0A 4DPNA 1VBB2 2GAUA 3VBHC 4CEWA 1IHMA 3U07A 1SEFA 5L73A 1FPN3 1RUH3 2WLPA 1FYUA 2E7AA 1I1EA 4YVSC 2R072 4N43B 1QOSA 2Q30A 1RUC1 4CDXA 2DFCA 4SLIA 3MDPA 3B00A 3B94A 5AC91 1MVQA 3HT1A 4J1XA 3U4XA 2BGCA 1W6PB 5CADA 2PQQA 1FMD3 1X33A 4JDNA 3RNSA 5T52A 3WY6A 2ZOEB 1NE6A 2ET1A 1V6OA 4Y24A 4XFGA 1BKZA 1UW8A 5FLHA 4C91A 2WFF1 1RUG2 1PVC1 2BUKA 1QWRA 4Q4X1 4URTA 1H1IA 5ACA1 3WT3A 2RS31 1SBDA 3AFGA 3HQXA 4CP1A 1LR5A 5C4WC 2A75A 3HT2A 1UIJA 4QPIC 2BBVA 1YHFA 1AL23 2AYHA 2P17A 1KXGA 3D4KA 2X5IA 3RJ2X 2Q4SA 1I5ZA 4BA6A 5FDBA 4R8HA 2HWB2 3FZ3A 1VRH3 3ZIWA 2B45X 1S1AA 2CAUA 1DQ0A 3GALA 3GZTB 3GBWA 4CEYB 1YI9A 4FQ4A 3FFQA 3DKWA 3WP4A 5J96B 1DF0A 1AR82 4CP2A 1FX5A 1PGW1 2JEMA 2PHLA 1XNDA 5AVPA 2ZMNA 1ENSA 1NCRB 1O3TA 1QJY2 4J6GA 3WG2A 5E16A 4OLLA 1ENXA 3VDDA 1QOOA 3I59B 3AKQA