1NCQB

The structure of hrv14 when complexed with pleconaril, an antiviral compound
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
255
structure length
255
Chain Sequence
b'GYSDRVQQITLGNSTITTQEAANAVVCYAEWPEYLPDVDASDVNKTSKPDTSVCRFYTLDSKTWTTGSKGWCWKLPDALKDMGVFGQNMFFHSLGRSGYTVHVQCNATKFHSGCLLVVVIPEHQLASHEGGNVSVKYTFTHPGERGIDLSSANEVGGPVKDVLYNMNGTLLGNLLIFPHQFINLRTNNTATIVIPYINSVPIDSMTRHNNVSLMVIPIAPLTVPTGATPSLPITVTIAPMCTEFSGIRSKSIVPQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COAT PROTEIN VP1
publication title Structural and virological studies of the stages of virus replication that are affected by antirhinovirus compounds
pubmed doi rcsb
molecule tags Virus
total genus 53
structure length 255
sequence length 255
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2002-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1ncqB00
3NAPB 4PDWA 4LLFA 1RUF1 1TMF3 1VRH1 1RUG1 2RS32 1FMD2 1RUF2 5J98B 1VRH2 4WM7B 1VBA1 1F8VA 1ZBE2 1RUG3 1TME2 2VQ0A 1AL0G 4RR3A 1H8TA 1VBA3 3ZFGC 5BNPB 1NY71 3ZFEB 4Q4Y3 5BNNB 2MEV1 2HWF1 3VBHC 1NY72 2HWB1 1RUJ1 1MQTB 4WM8B 1CD3G 5A32A 2MEV2 4QPIA 1PGW2 2HWB2 2HWF3 1RUJ2 5LK7B 2R041 2RR13 1C8M1 1ND3B 1AR63 2R042 5CFDA 1NCRB 1C8M3 1VBD1 5BNOB 1R081 1RUC1 1VBB3 4N43B 4Y5Z0 2RS11 1VBD2 1R082 1VBD3 1RUC2 2BFUL 2RS12 1ND2A 1HXS3 4GMP1 1NA1A 5C9AC 5C8CA 1FOD3 4GMP3 4RHV2 5CFCA 1BEV1 1Z7S3 3ZFGB 2BPA2 5C4WA 5FOJB 2FZ2A 4GB31 3VBHB 1BEV3 1W39A 4GB32 1RVF1 1QJU3 1VBC3 5K0UA 1RVF2 3VBOC 4GMP0 3DPRC 1AYM1 1RUD3 2RMU2 1EAH2 4QPGC 2ZZQA 3VBUC 1AYM2 1PIV3 4RFT0 1HRV3 4YVWC 4CEWC 2GH8A 3JB4C 5DDJ1 3M8LA 4YVSA 2GSYA 2BFUS 5C9AB 4Q4V3 4FTEA 5DDJ2 4RR3C 1AR81 2X5IC 1RHI3 4N53A 1AR82 4JGZA 4AEDA 3TN91 1K5MA 1ZBA1 1NG0A 5ABJC 2XBO1 4QPIC 3TN92 2R071 1ZBA2 2RS52 1HRI3 1X36A 2XBO3 1IHMA 4RQPA 2R072 1F2NA 3VBOB 3DPRB 5CFDC 4CDXA 1GFF2 1D4M2 4QPGB 3JD71 4JGYC 3VBUB 4GH4A 2RS31 4YVWB 1V9U1 4CEWB 1FMD1 1PO13 3JBG3 5GKAC 3JD72 5L7OC 1V9U2 1ZBE1 1TME1 2RS33 1FMD3 1NA1C 1RUF3 1VRH3 2WFF1 1DDLA 2PLV2 1ZBE3 1TME3 3IDEA 4RR3B 2WFF2 4CDUA 5CFCC 2X5IB 3J8F1 4IV1A 3VBSC 3NAPA 1E57A 4CDQC 1B35A 1PGW1 5A33A 3J8F2 1R091 4IV3C 3VBFC 3S6PA 3ZFFC 1AR91 5ABJB 1AYN2 1PO21 2MEV3 1R092 1VAKA 2HWB3 1RUJ3 1RUI1 4QPIB 1AR92 1VBE2 1PO22 1ASJ1 1RUI2 5BNPA 1X33A 2R043 2WS91 1HX6A 1RUI3 3ZFEA 1ASJ2 5CFDB 2WS92 2R062 2RM21 4JGYB 4WM8A 1R083 2RM22 1MEC2 1RUC3 5L7OB 4YVSC 2RS13 1RMU1 3VBRC 4RHV1 1NA1B 2WZR1 1VB4A 5JZGA 1EV11 2HWE2 1RMU2 1NCRA 1A6CA 5BNOA 2WZR2 4RHV3 1EV12 2QQPA 4BCUA 4N43A 4CDWC 5CFCB 3VBSB 5J96B 4CDQB 1K5MC 4IV3B 3VBFB 1FPN1 3ZFFB 1RUE1 4GB33 1COV2 2RMU1 1NCQC 1R1A1 5ACA1 1EAH1 1FPN2 1RUE2 4CEYC 1RVF3 2FZ1A 4RS5A 1R1A2 3ZFGA 5ACA2 2RMU3 1EAH3 2DF7A 1AYM3 3VBHA 1PGL1 4PDWC 1BBT2 1PGL2 1POV1 4NWWA 1QJX1 4YVSB 1QJX2 3VBRB 5DDJ3 1H8TC 1CJDA 2XPJA 5AC91 4Q4W1 4IV1C 1PVC1 3JBG2 1AR83 4CDWB 5AC92 4Q4W2 1B35C 1PVC2 2RS51 1K5MB 1QQP1 5C9AA 3TN93 1OOPA 3VDDA 2ZAHA 1RUH2 1ZBA3 2RS53 1POV0 1QQP2 1NCQB 1M06G 1D4M1 4Q4X1 1AL22 2R073 2WLPA 4CEYB 1QJY1 4Q4X2 1QJZA 1D4M3 1QJY2 2IZWA 1AUYA 2HWC2 3CJIA 4PDWB 3JD73 4FSJA 1ND2C 2PLV1 1V9U3 4FTBA 5D8AA 1C8NA 5C8CC 5FMOL 3DPRA 5JZGC 2HWD1 2PLV3 4FTSA 4QPGA 1AR72 3VBUA 2WFF3 1H8TB 2HWD2 4Z92B 4YVWA 5C4WC 4IV1B 1AYN1 1TMF2 1B35B 3J8F3 5A33B 2BBVA 1VBE1 5A32B 4WM7A 1AYN3 5K0UC 1R093 1RUG2 4Q4Y1 1AR93 1VBE3 1PO23 1VBA2 2WWSA 2R061 4RS5C 2X5IA 4Q4Y2 5BNNA 2ZTNA 1ASJ3 1MEC1 1MQTA 2WS93 2R063 2RR11 5ABJA 1AR61 2HWF2 2RR12 2RM23 1MEC3 1ND3A 2HWE1 4EJRA 1ND2B 1AR62 5C8CB 5FMOS 1VBB1 5JZGB 1RMU3 1C8M2 2HWE3 2Y26A 1VB2A 1NOVA 1VBB2 2WZR3 4JGYA 1EV13 4N53C 1HXS1 5C4WB 4JGZC 4AEDC 5L7OA 1COV1 1FOD1 2TBVA 1HXS2 1FOD2 1OOPC 3VDDC 5K0UB 1COV3 1Z7S1 4RQPC 1FPN3 1RUE3 1Z7S2 1R1A3 4RS5B 5ACA3 3VBSA 4CDXC 1HQNA 1BBT1 4CDQA 1QJU1 1VBC1 4GH4C 1BEV2 4IV3A 3VBFA 3CJIC 1QJU2 1VBC2 3ZFFA 1BBT3 1RUD1 3FBMA 5D8AC 1PIV1 1RUD2 1HRV1 1POV3 1QJX3 1PIV2 4CDUC 1HRV2 1RB8G 3NAPC 1BMV1 4N53B 3ZXAC 4JGZB 4AEDB 5AC93 4Q4W3 4Q4V1 1WCDJ 1BMV2 1RUH1 1PVC3 4WM7C 1OPOA 4Q4V2 1AL21 1RHI1 3VBRA 1OOPB 1RUH3 3VDDB 1QQP3 5BNPC 1RHI2 4RQPB 3ZFEC 1AL23 4Y4YA 5BNNC 2HWC1 2BUKA 1SMVA 4CDWA 4CDXB 4Q4X3 3LOBA 1MQTC 4WM8C 1QJY3 4GH4B 4NWVA 2HWC3 1HRI1 3CJIB 1OHFA 1HRI2 1ND3C 2XBO2 1NCQA 5D8AB 3VBOA 3HAGA 4CEYA 1AR71 1NCRC 3JBG1 1PO11 5BNOC 1TMF1 4SBVA 4N43C 1AR73 4CDUB 4CEWA 3JB8A 2HWD3 1PO12
chains in the Genus database with same CATH superfamily
2UY8A 4UFKA 4LO7A 3MGUA 4RL7A 3RZLA 2AC1A 1SQ4A 1RUG1 2WR9A 3WP4A 1W2UA 3ZXGA 4B1MA 4IERA 4BK4A 5FKBA 5IK8A 4FBFA 1YYNA 3LEKA 4UFIA 1DQ2A 1ZBE2 1EYBA 1RUG3 2J22A 1AL0G 2YC0A 2ZGTA 3Q8CA 4RR3A 5DAQA 3WUCA 2XHKA 1PK6C 2ZKNA 2RV9A 4A6OA 2JDUA 2DCZA 2ZPXA 1ZZ7A 1VR3A 4IGPA 2XOMA 2MEV1 3JZVA 5JR7B 1RUJ1 4XEZA 5FYVA 2D6MA 2MEV2 4IE6A 2PHRA 3OUIA 1IG0A 1RUJ2 2RDSA 2R041 4R4XA 1LB2A 1WLDA 4EWDA 2DCJA 3K4DA 2DURA 4QB6A 1C8M1 2B45X 1ND3B 1AR63 2MHFA 5L36A 1JOJA 5L19A 2R042 1W6PB 3P5BA 2KD7A 4UI9L 2VZTA 5GM0A 5IVJA 2QQIA 1GZTA 2DVDA 1RC6A 2QQWA 1C8M3 1OF3A 3BOWA 4M01A 1SLAA 5FYTA 2ZABA 1MPXA 5FZ3A 5FY1A 1VBB3 4AI0A 2BNOA 2VAUA 4YW6A 2WT2A 3N3HA 2D43A 4H7LA 4AFBA 1GNYA 2PQSA 4YYOA 3VHPA 4LHNA 4P00B 2C9KA 1ND2A 3S0MA 4J25A 1SCRA 3ZKUA 4BQ3A 1UOJA 4M3CE 3BGAA 4CP9A 2X53S 4FAGA 2VZOA 1H6YA 4Y1YA 1S0IA 4QWNA 2VJXA 4ARYA 4GJYA 5EIYB 3OB8A 3VD7A 4LK7A 3I2FA 3GXUA 1SLBA 1Z7S3 2BPA2 1NZIA 3AXDA 2ZJCA 2OKXA 1IKQA 3FE5A 4MGYE 1WD3A 1H30A 1W9TA 4HN1A 2VVEA 4A2UA 4W50A 5G05L 1OURA 1VMJA 2AREA 3NWKA 1RVF1 3AJZA 3UJOA 1HQLA 1NYWA 1W6OA 2D98A 2JG9B 3A0KA 4YGBA 1I1EA 1RVF2 5LK5A 3VDAA 1VMFA 1GZ9A 1W8TA 2RMU2 3PNAA 4RFRB 3PUQA 5LB6A 1EAH2 3RYPA 4QPGC 4AFDA 4AQTA 4BH9A 4LNVA 1M4WA 1PIV3 3KV9A 4RFT0 2VPVA 4MH0E 3GM8A 4PBOA 3CIHA 4YVWC 4AK3A 4CEWC 5TSWA 3M1HA 3WDVA 4CCDA 3RJ2X 1OLME 2ZGRA 3LD8A 4LOSA 2WZ8A 2B4KA 4PT6A 5I8YA 1H2MA 1JYNA 1A8MA 4YVSA 5IT6A 3THPA 4Y22B 5FKCA 3LSEA 1XE8A 3WV6A 3ZXJA 3DEMA 5A3MA 3WCSA 5C9AB 4MGTA 3NV3A 5FYHA 3QLQA 2XLAA 5IYYA 1UIJA 4WVMA 1UF2C 3QBQA 4GKYA 4OI0A 2VTFA 2EIGA 1AR81 1X9PA 3D0SA 3WOGA 3WQBA 3NJXA 4MXWB 4AEKA 1JHJA 2NN8A 1AR82 2XKOA 4B7KA 2D6PA 2ERFA 2Q1MA 1DQ1A 3DECA 2VZQA 3RSJA 3W21A 4FP2A 4NPRA 1ZBA1 3WNOA 3KVBA 2VUDA 3O1MA 4LBQA 2WO7A 4QPIC 2VH9A 1J84A 3HPNA 4IL7A 3AVRA 3MFCA 4A7KA 1ZBA2 3CLPA 4QX2A 5E16A 3FFZA 3W20A 2RE9A 4LOTA 1IHMA 2ZA9A 4AI3A 1F2NA 4JDMA 4DXSA 3CHXA 1G9AA 3J7HA 3DPRB 3WP3A 1NE6A 3VKNA 3WNPA 5CFDC 5LY2A 5JOYA 5JUVA 1MVEA 1K42A 4DEVA 1N3QA 1GFF2 1D4M2 2P3JA 3JD71 3GF6A 2YMZA 2NP0A 4NRMA 1W8NA 1D7PM 3JBG3 1PO13 4YW4A 2XLGA 3SITA 3JD72 2YPDA 5L7OC 4A42A 1REFA 4P02B 1OH4A 2WO3A 3RMXA 2WN2A 2B9VA 2WAAA 1WBLA 3M4FA 1YC61 1RUF3 1W90A 2Y60A 2OUHA 1H4GA 1AJOA 1VRH3 4AI1A 5A6XA 2PHFA 1HN0A 3I7DA 3AL5A 2DBNA 5I0DA 5JSOA 4QDQA 3ILFA 3MIGA 2W2IA 4Y3OA 4G4FA 2BGCA 5T50A 3RI9A 4XZPA 5FQ0A 2EAAA 3U10A 4MZUA 1LR5A 5AFEA 2DFBA 2WSUA 1UZ0A 3DV8A 1HB3A 3ACIA 4PJYA 5GLZA 1W2AX 4XMAA 5SV8A 1H9WA 5LBFA 2AUYA 3E97A 4M4PA 3H1YA 2P34A 1UWWA 5A7WA 1OD5A 4N8MA 1NLSA 2C0ZA 2R7EB 4ZKTB 1OSGA 3AKPA 4AVCA 2WS91 2VQTA 3ZFEA 4XJUA 3WNKA 3H9AA 2CWMA 5H9PA 4E4SA 5HBAA 1FV2A 1RITA 3EO6A 2WS92 4NIIA 4JC1A 3CJXA 4AQ2A 2V72A 4UAPA 1ZZ6A 1O3SA 3ITQA 1BKZA 1Y3TA 1CIWA 5DQ0A 1JZ8A 4GWIA 4QDSA 4IGQA 4PI2A 4E4DX 5DAPA 3RQ0A 2RS13 3APBA 3IDCB 3MICA 4X6RB 5FP3A 3ZXKA 2JICA 3DF0A 1UN1A 2I45A 1NCRA 3ATGA 1MZEA 4KWUA 2XJQA 3RRDA 5LRRA 1TEIA 5BNOA 3BU0A 3O12A 3OCPA 3NNGA 3ZYGA 1WW6A 4BQXA 1UL9A 5CFCB 3SLIA 1JODA 1XNTA 1KFXL 4CDQB 1CONA 1K5MC 4F8AA 3R4UA 4IV3B 4NVPA 3U0ZA 1W8HA 4HONA 2XXZA 1Y9QA 3O1PA 4I0WB 1GWKA 4P5YA 5AFBA 3TEZA 1Y43B 1CAUB 2B46X 2OZ6A 1DGLA 2FZ1A 2WNOA 1N3PA 2HLEA 2ID4A 3KV5A 4JAAA 4KNCA 5C8WA 1CAXB 3MF9A 4EQVA 2WQ8A 3WLUA 1W8FA 2PAKA 3AP9A 4IE0A 4IXLA 1WW4A 4OQ9A 2LRPA 2DBIA 1CESA 1GNHA 4WZFA 2GNTA 4XMIA 2D6LX 3EQEA 3QCWA 3LPFA 2GMMA 4HZFA 4QM9A 2BV4A 2EAKA 3A22A 4LTAA 3VUOA 3U4SA 3W59A 1FAYA 3TNPB 2VTXJ 3IPVA 1WBFA 5HCHA 2ZHMA 2UURA 1I6XA 1UIKA 1JOBA 4P08A 5DDJ3 3AZWA 3R4DB 1QXJA 4W6XA 2OPKA 3MLLA 1LGCA 1H8TC 2PYTA 2W0XA 3IZOA 2EIEA 2XPJA 2IC1A 3MEPA 4IDZA 4IV1C 1X50A 5DZGA 2J1UA 3I3MA 3VKMA 3C7HA 1HN1A 3MI8A 4FOVA 4QB1A 4OQ8A 1W3VA 1SDDB 1GQPA 1XNAA 4FP3A 1QQP1 1SFPA 4BLIA 2QFEA 1YQ2A 4GWMA 1L7RA 1V6IA 2A6YA 5GLVA 2ZAHA 1RUH2 2I07B 3BN6A 3TNQA 3POBA 2R32A 1QQP2 2RDRA 1Q43A 1W03A 4KBZA 4UBGA 3VL8A 2BWCA 4HFSA 1KDMA 4BPZA 1AL22 2P4EA 4JQTA 2VL4A 3ST7A 2ZGLA 5KXBA 2XLFA 2D44A 4BXSV 1F35A 3HNBM 2W68A 3EMRA 1HJFA 1FI2A 1CAWA 1W6MA 2A3XA 5DZFA 1QHDA 2HWC2 5CKMA 4ET7A 3CJIA 2YROA 5FJKA 3WSOA 3WP5A 3HOBA 4AW7A 5L9BA 1W9SA 1NLRA 1KS4A 1LU2A 1WMDA 2VUCA 3UETA 2PLV1 4FTBA 1V9U3 2JKXA 5HXVA 4XETA 3FC0A 2DCTA 5JZGC 4CCOA 3KT4A 2PLV3 1U5IA 3PMSA 1NAEA 1SG3A 2GNMA 2XJPA 4FTSA 4QPGA 2QNKA 2WFF3 4V2WA 2IXIA 2P6CA 1OVPA 4UW4A 4YVWA 1CAVA 1U0AA 1CZSA 2Y0OA 4HG6B 4ONUA 2KM2A 3K51A 2PXJA 5A3PA 2E53A 4QHZA 1JH5A 3NW4A 3NQHA 4LBMA 3GYDA 1B35B 5FP9A 3VKFC 3WG3A 3ZSMA 5A33B 4XFGA 4AVTA 5J36A 1IS5A 4PIXA 1W0PA 4BMEA 2BP6A 2BWAA 5K0UC 4F7ZA 2ZMKA 3VZOA 4LIVA 1YQCA 1W3XA 4HKWA 1JS9A 3AB0A 4K40A 1BVP1 1GOHA 2PA7A 2VZ1A 5FZ0A 3IDBB 3E5UA 2VQAA 3UYJA 3DUIA 4O9EA 3RI8A 5JPNB 1WWYA 2Y6FA 1VRBA 5FLJA 1DFQA 3LFIA 1HJGA 2ZCWA 2RHPA 1LGBA 4B4PA 1S0BA 3ZYJB 4AFCA 4TZDA 3IM0A 1I3HA 4LHSA 4XHXA 1WA6X 2RM23 2WKKA 4B3NA 2J7MA 1ND3A 4WVWA 3VD3A 1ND2B 4Y5SA 4DXTA 2FCVA 1ALYA 5FZHA 2K9ZA 1RXFA 3AK0A 3KGLA 1LCLA 5FYZA 5GJ6A 5LA9A 3AM2A 4CP9B 4EE2A 3B9CA 1RMU3 1WKYA 1VB2A 5I0TA 4NAMA 2ARCA 2WZR3 3G7DA 3RZKA 2VBDA 1EV13 3KCXA 1J83A 2VY0A 4KH9A 2PELA 4N53C 1O4TA 4XUNA 1QOSA 1CN1A 1UCXA 4JGZC 4AEDC 5L7OA 4DRRA 5ERLA 5A6QA 1Q5OA 2VUJA 4BOWA 2C26A 4WVVA 4XQDA 2QQJA 2J1VA 5EWSA 5FZFA 2A3YA 1DGWA 1LJ7A 2B39A 1SFNA 1W6OB 3VDDC 3IWZA 2WNVC 2P3YA 5JOWA 1DBNA 4R52A 1T6BX 3VD9A 5LA1A 4XAAA 1FPN3 1H4HA 1QY4A 1LESA 2XB6C 4BE3A 3UKVA 5FXVA 1R1A3 4NIHA 2PHWA 1D2QA 1XNKA 1XNCA 1HQNA 4JV4A 5FO7B 5C70A 1K12A 1QXRA 1YFWA 2PHUA 2WNUC 4QQHA 4GH4C 4QXKA 1XYPA 2WL1A 5FZ1A 4BHPA 2Y6HA 4CP1A 3ZXEA 5F2SA 5KR7A 2W52A 2KR2A 4R9CA 1V6KA 4XYXA 4GKXA 1RUD1 1OVSA 4LBQD 4LE4A 2DTWA 4DNYA 4FQZA 3WF2A 4O61A 3WCRA 4W4ZA 3ZN4A 1IPJA 2JX9A 1MS9A 1RUD2 1JU3A 5JR2A 4TTGA 4HANA 1HRV1 1OKOA 3KLSA 4GZ9A 4HBNA 1JBCA 1W99A 3NJZA 4KWKA 3T08A 4CVUA 5KXDA 2UYAA 3KQRA 4LEJA 2VXJA 3M7AA 3PVNA 5DAWA 1HRV2 3I2DA 4YG0A 3NAPC 3MV01 5C3QA 5FR3A 3U37A 1S0EA 5IUQA 4IGOA 5IVEA 4JKLA 4UW3A 4CU9A 1HV0A 1KDKA 3QACA 5AC93 5EHDA 4IEYA 4Q4V1 4Y22A 2G1MA 1WCDJ 4XJWA 4BQ4A 1PVC3 1Y7BA 3I3QA 5F1RA 5JI7A 1T6GC 2VMGA 4Q4V2 2VOKA 5C5TA 1RHI1 1YFUA 1QWRA 3O14A 2B9UA 4DXRA 1OOPB 2RDQA 1OMIA 4UT5A 2JJ6A 3BTAA 2JDKA 3UKTA 1RHI2 4DINB 1CZVA 1XU2A 2FHRA 5T55A 3ACFA 4ES9A 5BNNC 5I8TA 2VGDA 3R0RA 5FPBA 3CKHA 1X8MA 2HBUA 2VNGA 5IVFA 4UXAA 1J3RA 1MQTC 2YV8A 1QJY3 4XCBA 5C3OA 2BBAA 1HRI1 1YQ5A 2IFWA 2XJUA 3I2OA 5HXMA 1MS8A 3AJYA 5GLWA 3TRSB 1HRI2 5IATA 3INAA 1BVVA 3S7EA 1S2EA 3ZIXA 2L9LA 1SDWA 1ODNA 5JXJA 1AR71 2Y6KA 5F32A 4QKFA 2ZX3A 4FFIA 5FMBA 3MPPG 3J7LA 1TMF1 3SCGA 2D5HA 4N43C 1AR73 1G86A 2P3KA 4C0HA 4MHUA 2OQ6A 3D8CA 1H6XA 3K46A 1W8WA 3KT7A 4Y33A 1UYZA 4IE5A 1TMF3 4ASKA 2G9ZA 4AHYA 4B4RA 5EJZB 2RS32 3MIHA 1FMD2 4FVVA 2YGMA 4L99A 1Q8PA 3MLKA 1HV1A 4JKKA 1QF3A 1ULCA 2PAEA 1IPKA 1VBA1 2DYCA 5FUNA 4HVQA 3KGZA 1TME2 4K8FA 4Y20B 3WY6A 2OVUA 3RZGA 1SFYA 4MOAA 1XU1A 5A7WB 3VKLA 2Y6LA 1H8TA 1U5ZA 1VBA3 4YG6A 1NY71 2TNFA 3ZFEB 3U07A 4OFGA 3ZYBA 3HQUA 2HWF1 1GMMA 1NY72 2HWB1 4MGQA 4B29A 3EBRA 4Y5TA 5FZ6A 2FDKA 4LKSA 4FPFA 5KHKA 2NLRA 1PGW2 2HWB2 2HWF3 1Q8QA 2RVAA 2CGNA 4CXYA 2D93A 4XBQA 2E32A 2RR13 4Z82A 1GP6A 3T1MA 3ZSKA 3FBYA 3R6SA 3ILNA 4QKNA 1JMUB 4ZZ8A 4IEXA 1NCRB 2DVBA 3CO2A 5FAXA 2K2SA 4AF9A 2WWJA 1UPSA 4IUGA 4YM0A 5BNOB 5CEHA 3O1SA 2GC0A 4OUSA 1HKDA 2WN3A 4Y5Z0 4V1PA 3ILRA 3UK9A 3MO4A 1S0JA 3CQOA 4IEOA 5JIAA 4NHMA 4R9AA 3URFA 1YHFA 4BZ4A 4QX3A 3OGRA 5FZ8A 4FPLA 5H9QA 1FOD3 2C4XA 1XPWA 3CMGA 1ENSA 4RHV2 3E5XA 1BYHA 3HQRA 2ZGUA 5FXXA 5CFCA 1PMHX 2V73A 1PK6B 5CKQA 3RZMA 1G9BA 1LOFA 4HN0A 2WO2A 2AYHA 5FYSA 1O59A 2VZSA 4A44A 1W39A 2ZX0A 3VZJA 4AVVA 1AX2A 1VBC3 5K0UA 2OX0A 4N7IA 5AVAA 3OOXA 5FREA 4BIOA 3H3UA 2C5DA 4EZ4A 1O8SA 5KHIA 4GMP0 4CE8A 3UGFA 2XKPA 3IPVB 3ORJA 4Q1PA 3OJBA 3WQ1A 4IEPA 1MS5A 2J1SA 3VBUC 3N7MA 3UGHA 2CV6A 4P9YA 2LUWA 3GBWA 1W6NA 3T09A 3LDBA 4D7SA 3N9QA 4A3ZA 3KHBA 3SQOA 1QXPA 2Y6JA 4I0AA 2A70A 1AF9A 4A3XA 4QGNA 1ZREA 3MUZ1 1WW5A 1DLCA 2BFUS 3WF4A 4QKDA 1CQ9A 3ELNA 2B42B 5FYUA 1GICA 1LGNA 3SC7X 3FMGA 4GQ7A 3PVBB 4GAZA 2DWRA 3KCYA 2A73B 2CTVA 2O8QA 3ZYPA 1ZRCA 3C7GA 5FY9A 4NJ4A 1Y9GA 3DXUA 1EPWA 1UMIA 3IMNA 3KD4A 1S2BA 4XJ8A 3JUUA 3NL1A 4N53A 2VOTA 4JGZA 3AYCA 4TYSA 4AEDA 2VUAA 2YBKA 3KV4A 3TN91 1W6MB 3ZN5A 1UKGA 1IGOA 3CBNA 1WLCA 3I2IA 1HQWA 4EZHA 5ABJC 2XBO1 1WZXA 1YQ8A 2W9XA 1D4VB 1DYKA 1PM7A 3TN92 2J1AA 2NMNA 4R8HA 4YW7A 3HT1A 4LA2A 2RS52 2CGPA 2BNNA 1G9FA 2ORZA 4XZUG 3RWNA 1DIWA 2QBXA 2VNOA 4AFAA 2XBO3 1ZRDA 1GUIA 2XMLA 4XTPA 3DKWA 2GN7A 1ULEA 3I59A 3GHMA 2W3JA 4QPGB 1V00A 3I3BA 4JGYC 3MIDA 2W46A 4PCRA 4GH4A 4D8MA 3IN9A 4YVWB 1UPIA 3VZMA 1CAVB 1XE0A 3EJKA 4JDNA 4BQYA 4CEWB 2P3IA 3AMHA 4OI4A 2XJTA 4ZXEA 2J1RA 4L9BA 1ZBE1 2VMFA 3C7FA 1VALA 1NLQA 2WIIB 1F5FA 5B4XA 1NA1C 3TB0A 5K4LA 4LUMA 2VMIA 1PHMA 2MNGA 3NSTA 4CUCA 1ZBE3 3ETQA 1MZ6A 3P1IA 1JUHA 1XNBA 2VCAA 1H1AA 4A7ZA 5FXWA 4YZ3A 5C5UA 5FDBA 3AYEA 3IDEA 4H3WA 3WHUA 1UO9A 1GANA 4NROA 3J8F1 3VBSC 3SISA 3NAPA 1E57A 2C24A 1KJRA 1REEA 3AP5A 4OHWA 4WV8A 1B35A 5A33A 2R0FA 1WA4A 3J8F2 4CCLA 1N1YA 1R091 5JXGA 3VBFC 4OZOA 3S6PA 1UW8A 3BTXA 2HH9A 3AMQA 4MADA 1AR91 2C1FA 1AYN2 4XXAA 2MEV3 1Z78A 4LMFA 3ZSJA 1R092 2SBAA 3C2UA 3H50A 2OXBA 1RUJ3 2VNRA 1CPMA 2YHJA 3I4IA 4QPIB 5AVPA 2DTYA 1AR92 3VN4A 3OGGA 4I0BA 5GLUA 3TBDA 5FP7A 1VPHA 3PHMA 4UFMA 3U14A 5C71A 4MHRA 2R043 2UY9A 2DCYA 2VBBA 1LNSA 1HX6A 1YEWA 2Z79A 4N9IA 4NHKA 5E1RA 2UWCA 1MR5A 4LBLA 2BZDA 2DCKA 1S55A 2VZPA 5CFDB 2P1BA 5FPLA 1IPSA 2PFWA 4QAWA 3LOIA 2R062 3ETPA 1W8ZA 2UU8A 3WUDA 2D6KA 1N1TA 4JCKA 3ASIA 3L2YA 3H8XA 1XC6A 3NV2A 4QDRA 1AX1A 1MEC2 3O7OA 5L7OB 1VLNA 3OPTA 4QX7A 2IVJA 5A3NA 1J3PA 2GMEA 4IETA 4BJ0A 3HEIA 3I49A 4DQAA 4LQRA 2LALA 2MPFA 1VB4A 2JD4A 2QDNA 2ZX1A 4PF1A 5A3WA 3OY8A 5KXCA 4ORFA 1RINA 2JDZA 5JWPA 3LEIA 4WBBA 3AMMA 3NNFA 1DU3D 4K9SA 4N43A 1YFXA 2GU9A 4WVZA 3K48A 3BYWA 3PLQA 1WMFA 1X9TA 4CDWC 3MUY1 4BYYA 1O8PA 4TLFA 3TAYA 2JD9A 3KHCA 2JG8B 2D5FA 1FNZA 4XFAA 4XUPA 3THCA 1OBNA 5BV6A 1QIQA 1PM4A 4P9JA 3GGLA 2RMU1 3ZYFA 1NCQC 1DG6A 1EAH1 2EIDA 3D82A 2ARAA 3OUJA 5K7PA 4C1XA 1RVF3 3PURA 5L73A 1OUXA 2GDFA 3IDAA 2IXCA 2XVLA 2RMU3 4QGMA 4XACA 4EN8B 4YSFA 4ASLA 4E2QA 1EAH3 1LTEA 3VKOA 4X8NA 3H1MA 1PGL1 1IS6A 1BHGA 1O5UA 1OQEA 1DYOA 1JZ2A 4WZCA 2Y6GA 3J9SA 1PZ9A 1VAVA 4KU8A 1PGL2 1CX1A 2QJVA 1POV1 1G8WA 1QJX1 5FPAA 5CVRA 1QH7A 3GDBA 1GWMA 1Z0HA 3KQ4B 5JI9A 3VD5A 3UV9A 2J1TA 1LULA 4AFMA 1QJX2 4FCAA 1UZVA 2VVDA 3MPBA 4Q1RA 3KV6A 1TE1B 1YO8A 3HMYA 3OPWA 5DAXA 1XSRA 1DLLA 1POQA 4LKFA 4L92A 4DRVA 4GJZA 5C3PA 5LW9A 2HEYF 3MF6A 3OYWA 1AR83 1WMXA 3ZX7A 1F9KA 4NE9A 5T5JA 4Q2FA 4KL1A 1JXNA 4M0HA 3VLBB 3QH6A 1W8OA 4LR4A 1YIPA 1K5MB 2W1UA 3AP4A 2WA4A 2G9GA 1C1FA 1O7FA 1OOPA 4EYUA 1PMIA 1ZBA3 2PHXA 2D7FA 2XR4A 1GP5A 1H1MA 4YLZA 1W9WA 5IVBA 2XH6A 1M06G 3E1F1 1D4M1 4Q4X1 2WLPA 2WSVA 1SBEA 2XVKA 3NV1A 4QXBA 4AVBA 1H2NA 4UW5A 4JQRA 1SACA 5BY5A 1XE7A 4LBOA 5F3EA 2PN5A 2O0OA 1QJZA 4Q4X2 1D4M3 5A7SA 2IZWA 1AUYA 1S0GA 1UY2A 4COYA 4EN6B 3N4MA 3JD73 5J1XA 2Z69A 4I01A 2D3RA 2V09A 5SV5A 3LFMA 4H7MA 3NMBA 3LA2A 4UFLA 4UWDA 5C8CC 2AGSA 3W9AA 3T2TA 4R9BA 4DUVA 3T3YA 1QDOA 1J58A 2A6VA 1GBGA 2HWD1 4CCNA 3N9LA 4YGDA 2D97A 5IVYA 3BI3A 4RGGA 3VBUA 5HV0A 4OYUA 2GC2A 1H8TB 5JOZA 1QJEA 2HWD2 3KS7A 4N7UA 3WQ7A 2JDAA 5C4WC 1CVNA 4JHTA 2AR6A 2VZUA 1DP0A 4IV1B 3VHRA 4F83A 5LA2A 1UY0A 1W0NA 5FCCA 2JG8C 4DZGA 2Y34A 3RZJA 1SZBA 1JOPA 4NPMA 4BISA 2JKBA 4MYEA 2BBVA 1EY2A 5GZGA 1BQPA 3A7QA 4LJHA 3P3PA 3PUIA 3RG0A 3JU9A 2ZZJA 3VHNA 4Y20A 4DXZA 2E33A 1F31A 3AMPA 4YZ4A 4HOOA 4Q4Y1 3PUSA 3BTYA 1DCSA 5FLIA 3KWVA 3POSA 1L7LA 2WWSA 2FD8A 2JB8A 3L9JT 4RS5C 5JXIA 3POFA 1UZZA 1ZRFA 1UY3A 4JTNA 2I74A 4Q4Y2 3CDZB 2E63A 5FTTC 1RGSA 4P9GA 5LA0A 3AFGA 3HVDA 4FPKA 4KBBA 3ABZA 3PVOA 2WS93 4XF4A 1AX0A 1SPPA 5ABJA 2VXRA 3HT2A 2DV9A 3Q8BA 3NRUA 3LIGA 4R4ZA 1S0FA 4AWDA 3T2OA 3RMYA 4ZXKA 2ES3A 3LGRA 3OEAA 1DQ0A 3VHOA 2V5YA 2Z4FA 5FMOS 1RTVA 2WT1A 2OS2A 2TUNA 3DKQA 2Y26A 5JZGB 5L9RA 3D3AA 3M2MA 1S0DA 4XIOA 4JGYA 3MZHA 2QUOA 2QZ3A 3KMHA 4AG4A 1HXS1 3PTYA 3ZXLA 4XUTA 2G9FA 2R30A 2ZMNA 1LOBA 2QVSB 4XTMA 4JRAA 4AR2A 1HXS2 1OLMA 2CDPA 1QKQA 5C33A 4RA0A 1QNWA 2VR4A 2XDVA 1QDCA 3ZXDA 2ZKLA 3OBRA 3BB6A 5K0UB 4OI2A 5H9SA 5D2AA 1XB9A 1H0BA 1GYKA 3B01A 2TEPA 1PK6A 1G9DA 1DZTA 3RYKA 2WUHA 2HYKA 3WXPA 3VBSA 1APNA 1QJU1 4Q0UA 4AGRA 1W2TA 4CUGA 5E88A 5F6LB 1BEV2 1W6NB 1JHNA 1CIYA 3LE0A 4HPKA 3F2ZA 3VBFA 1JZ7A 3EHKA 3LCPA 1QJU2 5DMYA 1OUSA 1GZWB 1A8DA 2IFRA 5D8AC 3O1VA 1FV3A 4NHLA 4XQWA 1MZFA 4OVEA 5A3LA 1GP4A 2XL9A 3AFKA 4FFFA 4FT8A 1QMJA 3TOJA 1IS3A 4OI1A 5HPOA 2LROA 2WJSA 1Q8OA 5IK7A 1KXGA 5LZ6A 3T0AA 3KZ4C 1SBDA 4XDQA 2ATFA 2ZX2A 3GCWA 3BTZA 1RB8G 4N53B 2C6SA 4D3WA 2VD7A 3I2GA 5CKNA 2DU0A 3ZDVA 4JGZB 5FZCA 1JU4A 4AEDB 3LDKA 5F5IA 1RUH1 4ZS3A 4WM7C 2AZ5A 1LOAA 1AL21 3OSDA 4JX0A 2VMHA 1RUH3 3VDDB 2WNVB 1QQP3 4D7TA 2ARXA 5FYYA 3LIHA 2QQOA 4LKDA 4C90A 5BNPC 2JB4A 1AL23 4XFHA 3THTA 4PLNA 5C3RA 5J3UA 2HWC1 3EXUA 5L9VA 2DVFA 1LOGA 3I59B 4CZSA 3ZIWA 4CDWA 5CISA 2LS6A 2CAVA 2IWGB 3JQXA 1O4YA 4LO4B 4QX1A 1OQDA 2PAMA 2WNUB 5DUUA 4BWOA 3DCQA 3HN1A 4WM8C 4GH4B 5EV7A 3IAPA 2HWC3 2WRAA 4HVRA 1RUNA 3USSA 1SLLA 3BVCA 4BQ1A 4JHZA 4XFIA 1NCQA 4L8QA 1FYUA 1K5JA 3HIFA 3TWIA 3HAGA 5FUPA 3AC0A 3T4HB 4W8JA 2BOIA 3WG1A 2PQQA 3ENRA 4OMDA 5I0RA 3WR0A 1RUOA 1WD4A 4SBVA 4QXCA 4CEWA 3JB8A 3ZN6A 2EALA 3G6JB 3MIBA 2Q8EA 3NAPB 3VL9A 1MACA 2W39A 4PBPA 4PIYA 1W9YA 3OBZA 3BOPA 5F5QA 5ANQA 1QH6A 1TG7A 5CYYA 5FWJA 4LA3A 5J98B 2JENA 4GD4A 1O3QA 2ADEA 2Q1FA 3P3NA 4AEMA 2VQ0A 4LO5B 2EIBA 2VOWA 1LHVA 3AVSA 1QOTA 3OGJA 4H55A 5FK8A 5IJRA 1QNYA 2XJVA 5FBZA 5FO9B 3ZFGC 1OI6A 1N3OA 3H8OA 5D1IA 2F6BA 2LW8A 5FPUA 5BNNB 2W91A 3VZNA 4FAHA 4PQ9A 3VBHC 1QJFA 3MDPA 5IAXA 1BCXA 4XOGA 1MQTB 3ZDSA 5A32A 2XQRA 3WW3A 3NKTA 4QPIA 5LK7B 2OZJA 3WDYA 2ZGOA 3S30A 5HCAA 1KEXA 5LBEA 3NNJA 2ZACA 4IEZA 1D0GA 3ZMOA 2EF6A 3IBMA 2DFCA 2DUQA 5DABA 3I2KA 4Q0SA 4Y1XA 1GU3A 3OY8B 5CFDA 3ZO0B 5CADA 1CR7A 2CGOA 5FZOA 1VBD1 1R081 1RUC1 3CL1A 4LBNA 2EXJA 3PJYA 4N43B 3U75A 1VBD2 1IOAA 1Q3EA 3UNPA 4N90A 1R082 2VTXA 1VBD3 1RUC2 4XJAA 5FP8A 2A75A 1I5ZA 2YGLA 5FK7A 2QE3A 5KBFA 2BFUL 2EA7A 5EYXA 5JLVA 4GWJA 4XDPA 1W2OA 5C8CA 4BA6A 5BPXA 1SLIA 3HR9A 4LORA 2XL7A 1NXD1 4MX3A 1UY4A 4NUBA 4NPLA 4OCTA 3N36A 5LCWL 2VZRA 4AHXA 1C4RA 3HQXA 4LO8A 1C28A 2XUEA 5FY5A 2XVGA 3N9PA 5C4WA 3WP6A 5FOJB 2GN3A 2P5BA 2ZHLA 4CCKA 2P17A 2FZ2A 2JG8A 2IXJA 4GB31 5LRSA 2HKXA 4KWJA 2YBSA 2GC1A 3NVCA 4MGIE 5JOXA 2EXIA 3POWA 3VDCA 4GB32 2Q30A 2QQMA 3ALQA 4MGZE 1JYTA 4QHBA 2FDFA 3KF3A 1EUUA 3VBOC 1WGPA 3HJRA 2AEYA 2WT0A 4HKLA 4NAOA 2E26A 1AYM1 1RUD3 3R05A 4AGGA 4DMIA 1ZZ9A 2Y8KA 1MZ5A 1HB4A 1W9FA 3ECQA 3U1XA 2WFPA 4LE3A 5EFUA 1AYM2 4Q27A 5A3TA 1HRV3 2DUOA 4OUMA 4KGGA 2JEMA 4Y1UA 1LHOA 2B5HA 1ULPA 3OYWB 5A3UA 3M8LA 2VU9A 5DG2A 5LASA 3POYA 3WW1A 3H42B 1AVBA 5F5CA 2DUPA 4CUAA 2Q8OA 1P8JA 4Q4V3 4YARA 3S5AA 5LWBA 4RN5A 4RR3C 2ZGQA 1KD7A 2IVIB 2ZGKA 4XF9A 5FZ9A 1DQ5A 5KC6A 1RHI3 1O91A 2OW4A 2W95A 2X5IC 3LF7A 2YYOA 3S7IA 3H8RA 1LAJA 2W94A 3O1TA 1ZM1A 5F3GA 4YZ1A 2WBKA 4AAXA 1H8VA 2PHTA 5FZGA 3AZYA 1RL3A 3AKRA 1K5MA 1NG0A 1GQHA 1Y4WA 2BRTA 4LHKA 5F6KA 4OHVA 4ISQA 2D3SA 1UY1A 4UFJA 2R071 3PTRB 1YUDA 4K7JA 4YGEA 1O6UA 1HRI3 4MXVA 4ZZ5A 4G3YC 4D7YA 1G9CA 2R072 5FY8A 4H14A 3RFRA 3FHAA 1ODMA 3N9OA 4YPJA 2WABA 4ARXA 3I8TA 4LIUA 1HB2A 2KXLA 3T4VA 4X8PA 2CY6A 3VBUB 4HVOA 5HI0A 2RS31 2JDYA 1FMD1 4ZY9A 5IWFA 2FCUA 2XWBB 5FYBA 4ZONA 3NO8A 1JTZX 3VB9A 2A6WA 4I30A 1XYOA 2R0HA 1TME1 3J7MA 2DDUA 2RS33 4S2HA 5C3SA 1FMD3 1SCSA 2ILMA 3PVEA 3ZPOA 4YW3A 1YJKA 5KXEA 2JDNA 2FQPA 5A7OA 5F5AA 2WZEA 3GZEA 2BU9A 1DDLA 3ZM8A 4PHZA 3OGSA 1TME3 1IQAA 3NNLA 4M3CB 1CJPA 1NQDA 3WF0A 5KHGA 4M0NA 4XUOA 2JIJA 5LEJA 4IV1A 4CCEA 4D0QA 5GZFA 4FOYA 3TYJA 1PGW1 4FI9A 4F3JA 3C7OA 4KMQA 4BQ5A 3SEEA 1SPPB 5F37A 4Z2AA 3ZFFC 5ABJB 1PO21 3MW4A 2HWB3 1RUI1 4E2GA 1VBE2 1PO22 3PJQA 2ZXQA 4GXLA 1ASJ1 2VQUA 1RUI2 5BNPA 1X33A 4META 1IZ3A 1GKBA 1J1TA 1RUI3 2Y38A 4XFCA 4ZHNA 4XJ9A 1JW6A 4TXWA 1WCSA 1HB1A 1ASJ2 3NNMA 3ZOIA 1ST8A 2O14A 3PUAA 2OA2A 3N35A 4JGYB 3DYMA 4WM8A 4XF1A 1UYYA 5DAVA 4HETA 4OLLA 1DGWX 3NJVA 2R16A 4B7EA 3ME2A 4ZU5A 2GH2A 4Z92B 5D21A 4YVSC 3O5SA 4IEUA 4D94A 2X05A 3P6BA 3VBRC 4RHV1 1NA1B 1Q8SA 2YC4A 4L2NA 1VMHA 2D6NA 4NHYA 5JZGA 3N7LA 2HWE2 2WYFA 5KWRA 2GMPA 1A6CA 4AVAA 2A3WA 5F39A 4EWEA 4CU6A 4RHV3 4PIZA 1FX5A 1S4CA 4GA9A 2CU5A 4TLGA 4V2VA 3VBSB 1YNAA 4CU7A 4LT5A 3M3QA 2FMDA 3LPGA 4D6SA 1LU1A 1OA2A 4E27A 3AL6A 1CWPA 2VCMA 1IG3A 4HPKB 3VBFB 4LKEA 3AZVA 1U5YA 4XQ4A 1RUE1 4CP0A 3FFQA 1COV2 5I93A 3I3DA 5ACA1 3BPSA 2JECA 3RGBA 1RUE2 4CEYC 1ZRRA 2RG4A 3T0BA 1AXKA 3OD0A 5A3OA 3ZFGA 3AZZA 4ISRA 3LA3A 5ACA2 1XBFA 3C3VA 4I02A 1LOEA 3WINE 2CHHA 2K0GA 3VBHA 2D6OX 3MBWA 2ET1A 1V6JA 3K3OA 1J59A 5FZAA 4PDWC 1U12A 4AAPA 1GZWA 1BBT2 5H9RA 3VZKA 4AQ6A 1OLRA 2JWPA 3BCWA 3KT1A 4NWWA 4YWAA 5BUVA 1ZYBA 3PDQA 5A7PA 1W06A 1WMEA 1UU5A 4AGVA 4Q0QA 3DN7A 2WYSA 2W08A 3FX3A 3VD4A 4PQQA 1OFNA 4JVAA 1CJDA 1RYYA 3U78A 5FO8B 2W92A 4Q4W1 2ET7A 4PF5A 3UESA 5I91A 1DYPA 4QMAA 1LOCA 3WQ0A 2A1XA 4LK6A 4NHXA 4CDWB 2YUEA 4Q4W2 5CBLA 4NO4A 3QOPA 4FPCA 3O0WA 2Z2SB 2RS51 4TSVA 2X29A 4HK9A 1SHWB 2XUMA 3J26N 3KSCA 2YFZA 3POIA 4O65A 4QQ2A 5F3IA 4BLJA 2ZS6B 3TN93 3BKZA 3VDDA 2WNVA 5JMCA 4FFHA 4M00A 3AP6A 2BGPA 2RS53 4AL9A 4XCAA 1UOFA 3HN3A 1NCQB 4KG8A 4IEQA 3WT3A 5JPMB 4XIKA 1LHNA 1UOBA 2QQNA 2WC2A 1F4HA 3H3LA 5FMDA 2BOJA 2WNUA 3ES1A 2ARBA 1MS4A 4LBJA 2G19A 3CEWA 5FFOC 5KHJA 3FLRA 3ZN6B 3HD8B 4LITA 4MUVA 4D6RA 4CSWA 1IQDC 3GHNA 2YFUA 4A4AA 3R4SA 4QKBA 4QPWA 1YJLA 5FZDA 1EPZA 4COZA 3K4ZA 4Q0PA 3IIAA 1MS1A 1UD1A 5FMOL 4D69A 3S5QA 4URAA 2YZ4A 4QQPA 2IXLA 2PHLA 4Q0VA 2ORXA 2E7QA 3E5QA 1S2KA 2QZ2A 3OF1A 3WNXA 3ZXFA 4CCMA 1VE0A 3QH7A 3Q8EA 4CUBA 2XJRA 3LA7A 3M3IA 4C8DA 1AYN1 4DOUA 2AH2A 1STMA 1W6QA 2ZGNA 4J1WA 5E8AA 4ES8A 3J8F3 1JN2P 1RXGA 2W5FA 2A71A 3OTFA 4PI0A 3KF5A 3LWCA 5A32B 3V65A 1PX3A 3ZYHA 5ISLA 1IS4A 1AYN3 3FLTA 2ZHKA 3OG2A 4LPLA 1R093 2VW1A 1RUG2 4IEVA 5JDBA 2ETEA 3T30A 4P9LA 1AR93 3WNLA 1Q8VA 1OA4A 2NYYA 4D6QA 1V6MA 3A4UA 1F5JA 2R061 3SH3A 2X5IA 1KFUL 1PZ8A 3HWJA 5JMOA 5BNNA 4Z07A 5A6ZA 4DUXA 1UZYA 4QX0A 2WAOA 2X8KA 2CL2A 5FZOB 2NZ9A 2VOVA 4OMCA 1MEC1 1MQTA 5T3NA 2OYZA 2R063 4BXFA 4OUEA 3BUCA 3GBFA 2QQUA 1LKNA 4FOQA 1AR61 1MS3A 4QGLA 1W0OA 4DO0A 4PLMA 4P9XA 4E8DA 5J09A 1MEC3 2Z5WA 4X6QB 5FZEA 1AR62 2ZMLA 3H7JA 5C8CB 4XILA 4LULA 1R64A 1JYCA 1VBB1 3B9IA 3THDA 1EUTA 1HIXA 1C8M2 4UFHA 5FWEA 4QPYA 2A7AA 1NOVA 1VBB2 4XXPA 2NQYA 4DFSA 3FLPA 4YM3A 3WG4A 3IT8A 2PTMA 5C4WB 4J1XA 4K6BA 1N1SA 3H7YA 5IHRA 3LSDA 4Q8LA 3CU7A 5BYNA 2W1QA 1ZRIA 1S1AA 3ACGA 3V0BA 1JI6A 4PLOA 4O7XA 2LTNA 5IFTA 4CU8A 1Z7S1 4RQPC 1XOYA 1NX9A 3V0AA 1N1VA 5EQUA 3RNSA 1Z7S2 1PGSA 4RS5B 2ZEWA 4CDXC 1LEMA 1QGLA 4YM2A 5FY0A 2WZPP 5JSPA 3C8XA 1PNFA 5CIRA 3WDUA 4S2GA 4W6WA 3B69A 2XQXA 1FT9A 5CB7A 3SH4A 3CJIC 3ZFFA 5FPVA 2V4AA 2VMDA 1G7YA 1UMHA 3EB7A 4KGQA 3FBMA 4XABA 4QX5A 4KWLA 1L7QA 3UT0A 4CXXA 1PIV1 3FUOA 4DPNA 1I9RA 2H0VA 1BXHA 1POV3 2WNEA 1WUVA 1AZDA 1QJX3 2ZEZA 4XHBA 1T2XA 3GJAA 4W65A 1PIV2 4JKMA 4CDUC 1WCUA 5GZCA 4I09A 4Q29A 4AEJA 3K77A 4CPBA 4HSJA 1C3HA 4FQ4A 1ZVFA 3SMHA 2BQPA 2GNBA 5IAVA 5LY1A 3WW2A 2V5DA 4HSLA 2N7GA 3VBRA 4XAEA 5GALA 3ZKYA 2VNVA 1G6NA 1ZZBA 3BPZA 4GIQA 1YIFA 1XNDA 1A34A 1C5IA 4Y4YA 4DIQA 1HW5A 2GP3A 1YLLA 2BUKA 1SMVA 1Y9MA 3U4XA 4W6YA 2JDPA 4Q4X3 4C0BA 1UYXA 1FXZA 3AZXA 4HMZA 4UF0A 4NWVA 1AJKA 2Y0IA 3B5LB 3ZVXA 4JTOA 2R1BA 5EPAA 5IW0A 5T54A 5JCTA 5HCFA 1OHFA 3T2QA 1ND3C 4MV2A 4EROA 4B8EA 1UAIA 2Q5TA 4J6GA 3AX4A 5D8AB 5C7GA 3DXTA 5A7NA 3PU3A 4CEYA 3OUHA 1GWLA 2BGOA 3LEGA 3WZ1A 4CA9A 3ZYRA 2E51A 3OPZA 1UYPA 3JBG1 1PO11 3N9NA 4CRQA 2HEVF 5F3CA 4U36A 3WD5A 1ULFA 3LB9A 1O4ZA 4XURA 2GC3A 2JDHA 2HWD3 1PO12 3JBG2 4Y1VA 5T5PA 4DEQA 4XW3A 2OT7A 3D0JA 4LLFA 4PDWA 1RUF1 3IIIA 3BU7A 3B94A 1VRH1 1GQGA 2BEOA 1YFYA 4LLOA 1N47A 1US2A 2Z42A 1RUF2 2GP5A 1VRH2 3GZUC 4S2DA 2A5ZA 1W28A 3HBZA 4WM7B 2J1EA 4U2AA 1F8VA 1H2KA 4P9IA 5JIUA 4M3CA 2WLQA 1SBFA 4OHYA 2E9QA 4E2SA 4UYBA 5BNPB 4HK8A 3MHZA 4Q8KA 3WF1A 2AACA 2YU1A 4Q4Y3 4OULA 1VIWB 1XXNA 4Z8BA 3WDXA 5CG8A 1W8UA 2OUJA 3ZYIB 1OLQA 1XSQA 2QDRA 2X10A 2A6ZA 3B00A 3A23A 4K3UA 4WM8B 5CNAA 1CD3G 5FYCA 3OBAA 3MFAA 2JG9C 3ZR5A 1ULOA 2P6HA 2QQKA 4N9HA 2QQVA 4A45A 1OFSA 2BW8A 4QX8A 1E5IA 2CSGA 3D4KA 1X7NA 2YB7A 4UBHA 4R9DA 1L3JA 1H1IA 4FXKB 1JYWA 1ZX5A 5CZKA 3AKTA 4LXLA 3E6BA 3RZZA 2WWUA 4MGSA 4M3CF 5B2GB 5A80A 5A1FA 5T52A 4A7YA 2JXAA 3CZJA 1TQ5A 2EXHA 2VULA 2RS11 4TWTA 4NIGA 5FZIA 1B09A 1H2LA 4I3PA 1ENRA 3ACHA 3LZZA 3UJQA 5FZ7A 2E31A 3K4AA 2RS12 1JUIA 1HXS3 3FHIB 1ULGA 4GMP1 4QU2A 1NA1A 5C9AC 4DUWA 3O1UA 1WCKA 5CG9A 4QB2A 1RJ8A 4RSUA 3GNEA 4S2FA 5F7UA 4DY3A 1X8EA 1OD3A 4GMP3 5KC5A 3JCIA 1ZNPA 2ZBJA 3H8UA 1BEV1 2QCSB 4KI5M 4QHOA 3SKVA 4NMIA 3ZFGB 2Y33A 1DGRA 2O1QA 3UKNA 1LODA 3DGTA 4QM8A 1AHSA 3K2OA 5LBCA 2HBTA 5EP9A 1LRHA 3W5MA 1CZTA 1KRIA 3VBHB 4K21A 5FZ4A 1BEV3 1TNFA 2VOXA 1LHWA 3GCXA 3WF3A 1YXWA 3AMNA 1QJU3 5FZMA 2Q0AA 2O8OA 4IESA 1US3A 5G04L 1OT5A 3FHQA 1E5SA 3VV1A 1AXYA 2Y64A 4GALA 3DPRC 2CYFA 1UZWA 3TEYA 4YZ2A 4XC9A 3CF6E 5EJ1B 5EZWA 4P5HA 3KM5A 1JZ3A 2ZZQA 3RDIA 3E6CC 2RJ2A 4MO3M 5J48A 3WDTA 2GH8A 4YFWA 3ZPYA 1ACCA 2XHNA 1NZCA 3T1LA 3JB4C 3LAGA 3X29B 4E4ZA 5DDJ1 3MLJA 4YW5A 2GSYA 1D0HA 2ZHNA 2VZVA 4XBLA 1CX4A 2AENA 4K20A 2GAUA 2ZOEB 5GLTA 3J7NA 5DDJ2 2H6BA 4FTEA 2UYBA 5DUXA 1NUKA 3H3ZA 3USUA 1O5LA 1DQ4A 2HJIA 1W05A 4BMBA 1DGRN 4DY5A 4JZRA 3LEMA 1QOOA 2BERA 4GULA 5CU1A 4NIAA 4IE4A 4AHWA 5IK4A 2JIGA 3UL2A 5IFPA 5F8PA 1I5PA 2VCBA 3I97A 4AI2A 3MYXA 2FDIA 2AEZA 1NKGA 1UXXX 5LATA 1DZQA 3FN9A 2BNMA 5FBJA 4QD2A 2J42A 1OA3A 1FNYA 4UW6A 4XFFA 4Y4RA 1BZWA 1DF0A 4HL0A 5DN2A 2W1WA 2WQ4A 3SCHA 1X36A 4Q5OA 1A78A 3DL3A 2JE9A 4RQPA 3WEZA 3VBOB 2GZWA 5E89A 4CDXA 4QXHA 5K9YA 3NV4A 4NRPA 2W1SA 5DUVA 4EWAA 1KQRA 4FXGB 2R49A 1V9U1 2F4LA 5FUIA 5FJHA 1EP0A 2EICA 5GKAC 4YW2A 3DYPA 1LEDA 2XGXA 3H1WA 1DZRA 1W6QB 1V9U2 2F17A 1LECA 2RJLA 4Y1ZA 2YBPA 4ATEA 2XJSA 1DQ6A 5DXDA 1NXMA 3OD4A 4K1ZA 1V6OA 5FYIA 2WFF1 4BQWA 1F4AA 2PLV2 5BNQA 3RZHA 3FZ3A 3LKJA 2E7TA 4O9GA 4RR3B 2WFF2 1YI9A 1ULDA 4CDUA 1ONAA 2JDMA 4DS0A 4YFZA 3O1OA 5CFCC 2X5IB 1JYXA 1XQNA 1LOFC 3N7KA 4BIFA 5FZKA 2SLIA 4CDQC 4FFGA 3POGA 1PMJX 3HBKA 4E4HA 4XJZA 3KB5A 4IV3C 3RVHA 3WHTA 3V64A 5DPNA 1UMZA 1KJLA 1ENQA 2P2KA 3GJBA 5IVVA 4XF0A 4FPGA 5FPZA 5FY7A 3Q9OA 4COWA 2VBPA 5GZDA 3C7EA 1JZ6A 1VAKA 2E7AA 3M3OA 3SEPA 2WQZC 4I2OA 1OC1A 4B4QA 4QT6A 3IB3A 4SLIA 1TZOA 3JXSA 1JYVA 2RDNA 1K3IA 2XONA 3FWEA 3JQWA 2C9AA 4UOJA 4A41A 3BIEA 1OQ1A 1BK1A 4IEWA 3LOBA 2RM21 4GWNA 3GBGA 5E6HA 4ZU7A 2PHDA 4KG0A 2WINB 3MW2A 1R083 2RM22 1RUC3 4AHZA 1J1LA 1RIRA 3ZR6A 3SCFA 1MVQA 3TEWA 3S57A 1RMU1 4A6SA 4XDOA 4INDA 3O1RA 1W6PA 2WZR1 2DU1A 4NN0A 3V0BB 1EV11 2ADDA 1NQJA 1RMU2 1KS5A 2PMWB 2QTWB 1V0AA 5HV4A 3GALA 5FZLA 2H0BA 3AYAA 2WZR2 4ZU4A 3V0AB 1REDA 2UWAA 1SEFA 1EV12 5A6YA 4BCUA 2QQPA 3I3EA 4NR1A 3SKJE 1XJAA 4YRDA 1U5XA 3Q8FA 4DB5A 5F2WA 5J96B 4CXWA 1ZA4A 3AKQA 4AI8A 4CPBD 5FPXA 2P37A 5FY4A 5FXZA 5FV3A 2ZGMA 1NE4A 1KITA 1FPN1 1OPMA 2ZEXA 4GB33 3ZFFB 4ASMB 5A1LA 2Q4SA 5FIXA 3LDRA 4L0PA 1VAMA 1R1A1 2FDGA 1FPN2 5CA6A 2HEWF 1UOGA 3A21A 4QQLA 4RS5A 4AOCA 2WA3A 1ENXA 1R1A2 4XE9A 1V70A 3I2HA 4MLOA 5CAZA 2DF7A 3AYDA 3IMMA 2ZAAA 4ITCA 4BQ2A 4HKOA 3W5NA 1AYM3 3BODA 5A70A 1TVGA 2I2SA 2WO1A 5JXHA 3O0XA 4HXCA 4NRQA 2JG9A 1YCIA 2FBEA 2CAUA 1JYIA 3B3QE 2YC2A 1X82A 1ZA7A 2WDBA 3IKWA 3OEBA 4OHXA 3D6EA 1PX4A 2D40A 4YVSB 1Q56A 4FPJA 3SH5A 3HNYM 4RGKA 4LO6B 4TN7A 4B1LA 5K8SA 2XWJB 1VJ2A 1GSLA 3K3NA 3VBRB 4AE2A 1W04A 4QQOA 1JZ5A 3J4UH 4L97A 1H9PA 4FPEA 4WVMB 5DUWA 3SHRA 4AQSA 4AI9A 3EYPA 1CGPA 2ZX4A 2BDRA 5AC91 5DG1A 1PVC1 2GALA 3VDBA 3WG2A 1ZZCA 2BTVC 3WX5A 2F4PA 2YY1A 2VECA 1F15A 1WLWA 3HNMA 5GZEA 4COVA 5AC92 1B35C 3I54A 4RYDA 2Q1ZB 4KU7A 1PVC2 4UF0B 4Z2WA 3OGVA 1YRZA 3NKGA 2YPJA 5C9AA 1MS0A 2CWSA 2GNDA 2XG3A 4LBQB 1E5HA 3FUQA 3N7JA 2W47A 1POV0 1V6NA 2JE7A 2EXKA 2E6VA 5T5LA 4G9SB 2NMOA 2R073 4MXWA 4CEYB 3K75B 2EVXA 2ZGSA 1QJY1 3B93A 5FOBB 1BJQA 2D3PA 4C1WA 2VO5A 3CZUA 2YXSA 3PIJA 1QJY2 4P9WA 1ZZ8A 2FMYA 4EN7B 3PMEA 4PDWB 1PVXA 2UWBA 5J7MA 1TNRA 2VE1A 4YW1A 5FMCA 2BYVE 3VGIA 4FSJA 5A1AA 1ND2C 1NT0A 3MV11 4HT1T 4ZPIA 1C1LA 5D8AA 1C8NA 3W58A 4BM8A 4CP2A 3PU8A 3ZSEA 1OKQA 4YZ5A 3U11A 2HYXA 1OF4A 3FL7A 2Q8CA 1VP6A 3DPRA 5EYYA 1WCQA 4AVSA 2BVVA 4Y26A 2LM3A 3T0DA 1AR72 2G4IA 5DZEA 3A0NA 3D5OA 1SLCA 3VZLA 2FDJA 1IKPA 5FQ0B 3ZLIA 1TMF2 3O0VA 1O3TA 2ZEYA 3WVJA 3ROUA 1BK0A 4Y24A 5T5OA 4EV0A 4KQ7A 5F9TA 4MG2A 1VBE1 1JZ4A 4WM7A 4RGAA 3AP7A 1R1ZA 1S0CA 3SNMA 4XF3A 3UGGA 4CYDA 5LEKA 1RJ7A 1VBE3 1PO23 4M4RA 3PUHA 1VBA2 3PIGA 3H0OA 3RWKX 1GLHA 3TEXA 2K46A 2YDEA 2ZTNA 4ZS2A 1ASJ3 1QU0A 3GZTB 2CNAA 1LHUA 1UQXA 1YI7A 1E5RA 1DHKB 1GOGA 1K45A 2RR11 4OHZA 1WLTA 4K8RB 1YQ6A 5I0UA 5I8SA 3RS6A 2R1DA 2HWF2 5JVVA 3F95A 5IVCA 2RR12 5KHHA 3ZMNA 4BB3A 2A6XA 5EXOA 4YM1A 2HWE1 1KGYA 2NPIA 2VC9A 5A7QA 4EJRA 1HDKA 3MIEA 4AYUA 3DYOA 4FPYA 4E8CA 1UKRA 5C6CA 2HWE3 3KVAA 5FZBA 4RD7A 5M0TA 4EN0A 2NM1A 4CCCA 4HLTA 3MIFA 4OZXA 2OPWA 4JDOA 1GR3A 5I0SA 2YU2A 3RJRA 1UNBA 2W87A 2OQ7A 4COUA 1QEXA 3AKSA 3WNNA 2VW0A 1COV1 1FOD1 2KA3A 2TBVA 3LQCA 3OBTA 1CPNA 4L11A 1FOD2 3RYRA 1OOPC 1UU6A 3B7MA 1COV3 1PNGA 4Z1VA 3BIWE 3QD6A 5JSRA 2QQLA 1RUE3 2ENRA 1UU4A 4AXOA 1OXCA 2RJKA 2DVAA 3N9MA 4CTEA 4NOTA 5FRAA 2CDOA 2FDHA 3M3EA 5ACA3 1XYNA 5APAA 4MGKE 1UX7A 1AXZA 1HLCA 1BBT1 1XRUA 4IQPA 4CDQA 1VBC1 1YWKA 4LHLA 5FYMA 5B4NA 3POJA 4P14A 4IV3A 2VCCA 3L2HA 3WDWA 4CCJA 1D2SA 1GZCA 1C57A 1VBC2 2H6CA 2QKDA 1OH3A 4H2AA 1BBT3 3FJSA 4IW3A 4BDVB 5FP4A 2BVBA 2B7YA 4FO9A 1CAUA 3Q8AA 4MVTA 4BU2A 5EJ3A 3B02A 2VW2A 1GOFA 2R6QA 4MSVA 3USUB 1CAXA 3NJYA 4JRLA 1A3KA 3WNMA 1SLTA 2VM9A 4YNIA 3WW4A 4AZZA 4YGCA 1BMV1 4XVHA 1W2NA 4XBNA 4QU1A 3I2JA 3ZXAC 4E9KA 4EN9B 3V56A 2X09A 4Q4W3 2OIIA 3KCCA 2IUWA 2V4VA 4FOWA 1BMV2 3MW3A 1GNZA 5BXXA 4ATFA 4URTA 2FCTA 4LBKA 1OPOA 3GZAA 1WW7A 4K1YA 4LUKA 1GV9A 3ACLA 4NIDA 2VZ3A 3PL0A 1PZ7A 4RQPB 2ZGPA 3ON7A 1LENA 4XFBA 3BALA 4Q26A 4YG3A 4IE7A 3ZFEC 5HCBA 4XUQA 3M70A 2VG9A 2VVFA 4CDXB 5FLHA 2JE8A 3ZSLA 4FPOB 1CAWB 1UX6A 2B8MA 1C5HA 1O3RA 3AXEA 3SXWA 1FATA 4C91A 1V6LA 3CJIB 2YG0A 3E6DA 5JAXA 3CNAA 5J37A 1BLZA 2XBO2 3VBOA 5IK5A 3POEA 2VMEA 1NCRC 3RPQA 3IAQA 2IXKA 3M3CA 3T2PA 4BK5A 5BNOC 2DVGA 1UXZA 1J3QA 2BJSA 2IXHA 4FPHA 4XPVA 5LBBA 4CDUB 2Q8DA 2VMCA 3ES4A 4I3GA 5ANNA 1URXA
chains in the Genus database with same CATH topology
2UY8A 4LO7A 3MGUA 4RL7A 1SQ4A 1RUG1 3WP4A 1W2UA 3ZXGA 4IERA 5IK8A 4FBFA 1YYNA 1DQ2A 1ZBE2 1EYBA 1RUG3 1AL0G 2YC0A 2ZGTA 4RR3A 3WUCA 2XHKA 1PK6C 2ZKNA 2ZPXA 2DCZA 1ZZ7A 1VR3A 2MEV1 3JZVA 5JR7B 1RUJ1 4XEZA 2D6MA 2MEV2 2PHRA 1RUJ2 2R041 4R4XA 1LB2A 1WLDA 4EWDA 2DCJA 2DURA 1C8M1 2B45X 1ND3B 1AR63 2MHFA 5L36A 1JOJA 5L19A 2R042 1W6PB 5GM0A 2DVDA 1RC6A 3BOWA 1C8M3 4M01A 1SLAA 2ZABA 4AI0A 1VBB3 2BNOA 2WT2A 3N3HA 2D43A 4H7LA 4AFBA 4YYOA 3VHPA 4LHNA 3S0MA 1ND2A 1SCRA 4M3CE 4FAGA 2X53S 4Y1YA 1S0IA 1SLBA 1Z7S3 2BPA2 3AXDA 2ZJCA 1IKQA 3FE5A 4MGYE 1WD3A 1H30A 4HN1A 2VVEA 4A2UA 3NWKA 2AREA 1RVF1 3AJZA 3UJOA 1HQLA 1NYWA 1W6OA 2D98A 2JG9B 3A0KA 4YGBA 1I1EA 1RVF2 5LK5A 1GZ9A 2RMU2 3PNAA 1EAH2 3RYPA 4QPGC 4AFDA 4AQTA 4BH9A 4LNVA 1M4WA 1PIV3 4RFT0 2VPVA 4MH0E 4YVWC 4PBOA 4CEWC 4AK3A 5TSWA 3M1HA 3WDVA 3RJ2X 2ZGRA 5I8YA 1H2MA 1A8MA 4YVSA 5IT6A 3THPA 4Y22B 3LSEA 1XE8A 3WV6A 3ZXJA 5A3MA 3WCSA 5C9AB 3NV3A 3QLQA 2XLAA 1UIJA 4WVMA 1UF2C 3QBQA 4GKYA 4OI0A 2EIGA 1AR81 3D0SA 3WOGA 4MXWB 4AEKA 2NN8A 1AR82 2XKOA 4B7KA 2D6PA 2ERFA 2Q1MA 1DQ1A 3RSJA 4FP2A 4NPRA 1ZBA1 4LBQA 4QPIC 2VH9A 4IL7A 3MFCA 4A7KA 1ZBA2 3CLPA 5E16A 3FFZA 2RE9A 1IHMA 2ZA9A 4AI3A 1F2NA 4JDMA 1G9AA 3WP3A 3DPRB 1NE6A 3VKNA 5CFDC 5JOYA 1MVEA 1N3QA 1GFF2 1D4M2 2P3JA 3JD71 3GF6A 2YMZA 2NP0A 3JBG3 1PO13 4YW4A 2XLGA 3SITA 3JD72 5L7OC 1REFA 3RMXA 3M4FA 1WBLA 1RUF3 2OUHA 1H4GA 1AJOA 1VRH3 4AI1A 2PHFA 3I7DA 5JSOA 3ILFA 3MIGA 4G4FA 2BGCA 5T50A 3RI9A 4XZPA 5FQ0A 2EAAA 3U10A 4MZUA 1LR5A 5AFEA 2DFBA 2WSUA 3DV8A 5GLZA 4PJYA 4XMAA 5SV8A 1H9WA 2AUYA 3E97A 3H1YA 2P34A 1OD5A 1NLSA 2C0ZA 1OSGA 3AKPA 4AVCA 2WS91 3ZFEA 4XJUA 3H9AA 2CWMA 5H9PA 4E4SA 5HBAA 1FV2A 1RITA 3EO6A 2WS92 4JC1A 3CJXA 4AQ2A 1ZZ6A 1O3SA 1BKZA 1Y3TA 1CIWA 4E4DX 3RQ0A 3ZXKA 2RS13 3APBA 3IDCB 3MICA 4X6RB 2JICA 3DF0A 1UN1A 2I45A 1NCRA 3ATGA 1MZEA 2XJQA 3RRDA 5LRRA 1TEIA 5BNOA 3O12A 3OCPA 3ZYGA 1WW6A 1UL9A 5CFCB 3SLIA 1KFXL 4CDQB 1CONA 1K5MC 4F8AA 3R4UA 4IV3B 4NVPA 3U0ZA 1Y9QA 4I0WB 5AFBA 1Y43B 1CAUB 2B46X 2OZ6A 1DGLA 2FZ1A 1N3PA 4JAAA 4KNCA 5C8WA 1CAXB 3MF9A 3WLUA 2PAKA 3AP9A 4IXLA 1WW4A 4WZFA 1CESA 1GNHA 2GNTA 4XMIA 2D6LX 3EQEA 3QCWA 2GMMA 4HZFA 4QM9A 2EAKA 4LTAA 3VUOA 3W59A 1FAYA 3TNPB 3IPVA 1WBFA 2ZHMA 2UURA 1I6XA 1UIKA 5DDJ3 3AZWA 3R4DB 1QXJA 4W6XA 2OPKA 3MLLA 1LGCA 1H8TC 2PYTA 2W0XA 2XPJA 2IC1A 3MEPA 4IV1C 1X50A 5DZGA 3VKMA 3MI8A 4FOVA 4FP3A 1QQP1 4BLIA 2QFEA 4GWMA 1V6IA 2A6YA 5GLVA 2ZAHA 1RUH2 2I07B 3TNQA 2R32A 1QQP2 4UBGA 1Q43A 3VL8A 2BWCA 4HFSA 1KDMA 4BPZA 1AL22 3ST7A 5KXBA 2ZGLA 2XLFA 2D44A 2W68A 2A3XA 1FI2A 1CAWA 1W6MA 5DZFA 1QHDA 2HWC2 3CJIA 2YROA 3WP5A 4AW7A 1NLRA 1KS4A 1LU2A 1WMDA 2PLV1 4FTBA 1V9U3 5HXVA 4XETA 3FC0A 2DCTA 5JZGC 3KT4A 2PLV3 1U5IA 3PMSA 2GNMA 2XJPA 4FTSA 4QPGA 2QNKA 2WFF3 2IXIA 4YVWA 4UW4A 1CAVA 1U0AA 2Y0OA 4ONUA 2KM2A 3K51A 2E53A 1JH5A 3NW4A 4LBMA 3VKFC 3GYDA 1B35B 3WG3A 3ZSMA 5A33B 5JPNB 4XFGA 4AVTA 5J36A 1IS5A 4PIXA 1W0PA 4BMEA 2BWAA 5K0UC 4F7ZA 2ZMKA 3VZOA 4HKWA 3AB0A 4K40A 1BVP1 2PA7A 3IDBB 3E5UA 2VQAA 3DUIA 4O9EA 3RI8A 5FLJA 1DFQA 2ZCWA 2RHPA 1LGBA 4B4PA 1S0BA 3ZYJB 4AFCA 4TZDA 3IM0A 1I3HA 4XHXA 2RM23 2WKKA 4B3NA 1ND3A 4WVWA 1ND2B 1ALYA 2K9ZA 3AK0A 5GJ6A 3KGLA 1LCLA 3AM2A 3B9CA 1RMU3 1VB2A 5I0TA 2WZR3 3G7DA 1EV13 3KCXA 4KH9A 2VY0A 4N53C 2PELA 1O4TA 1QOSA 1CN1A 1UCXA 4JGZC 4AEDC 5L7OA 4DRRA 1Q5OA 2VUJA 4BOWA 4WVVA 4XQDA 5EWSA 1DGWA 1LJ7A 2A3YA 2B39A 1SFNA 1W6OB 3VDDC 3IWZA 2WNVC 5JOWA 1DBNA 4R52A 1FPN3 2XB6C 1H4HA 1QY4A 1LESA 4BE3A 3UKVA 1R1A3 2PHWA 1D2QA 1XNKA 1XNCA 1HQNA 4JV4A 5FO7B 2WNUC 1QXRA 1YFWA 2PHUA 4QQHA 4QXKA 4GH4C 1XYPA 2WL1A 4BHPA 4CP1A 3ZXEA 2W52A 4XYXA 4R9CA 1V6KA 4GKXA 1RUD1 4LBQD 4LE4A 2DTWA 4DNYA 4FQZA 3WCRA 3ZN4A 1IPJA 2JX9A 1MS9A 1RUD2 4HANA 1HRV1 3KLSA 5KXDA 4HBNA 1JBCA 3NJZA 4KWKA 2UYAA 3KQRA 4LEJA 3M7AA 3PVNA 1HRV2 3I2DA 4YG0A 3NAPC 1S0EA 5IUQA 4UW3A 1HV0A 1KDKA 3QACA 5AC93 4IEYA 4Q4V1 4Y22A 1WCDJ 4XJWA 1PVC3 1Y7BA 5F1RA 5JI7A 1T6GC 2VMGA 4Q4V2 2VOKA 1RHI1 1YFUA 1QWRA 3O14A 2B9UA 1OOPB 1OMIA 2JJ6A 3BTAA 3UKTA 1RHI2 4DINB 1XU2A 2FHRA 5T55A 4ES9A 5BNNC 5I8TA 2VGDA 3R0RA 1X8MA 2VNGA 4UXAA 1J3RA 1MQTC 2YV8A 1QJY3 1HRI1 2IFWA 2XJUA 1MS8A 3AJYA 5GLWA 3TRSB 1HRI2 3INAA 1BVVA 3S7EA 3ZIXA 1SDWA 1AR71 2ZX3A 3MPPG 3SCGA 1TMF1 2D5HA 4N43C 1AR73 1G86A 2P3KA 4C0HA 3D8CA 3KT7A 1TMF3 4AHYA 4B4RA 2RS32 3MIHA 1FMD2 4FVVA 2YGMA 4L99A 1Q8PA 3MLKA 1HV1A 1QF3A 1ULCA 2PAEA 1IPKA 1VBA1 2DYCA 4HVQA 3KGZA 1TME2 4K8FA 4Y20B 3WY6A 2OVUA 1SFYA 3VKLA 1XU1A 1H8TA 1U5ZA 1VBA3 4YG6A 1NY71 2TNFA 3ZFEB 3U07A 4OFGA 2HWF1 1NY72 2HWB1 4B29A 3EBRA 4FPFA 5KHKA 2NLRA 1PGW2 2HWB2 2HWF3 1Q8QA 2CGNA 2D93A 4XBQA 2RR13 3T1MA 4Z82A 3ZSKA 3FBYA 3R6SA 3ILNA 4IEXA 1NCRB 2DVBA 3CO2A 5FAXA 2K2SA 4AF9A 1UPSA 5BNOB 4YM0A 2GC0A 4OUSA 1HKDA 4Y5Z0 4V1PA 3ILRA 3UK9A 1S0JA 4IEOA 5JIAA 4NHMA 4R9AA 3URFA 1YHFA 4BZ4A 4FPLA 5H9QA 1FOD3 1ENSA 4RHV2 3E5XA 1BYHA 2ZGUA 5CFCA 2V73A 1PK6B 1G9BA 1LOFA 4HN0A 2AYHA 1W39A 2ZX0A 3VZJA 4AVVA 1AX2A 1VBC3 5K0UA 4N7IA 5FREA 5AVAA 4BIOA 3H3UA 2C5DA 5KHIA 4GMP0 2XKPA 3IPVB 4Q1PA 3OJBA 3WQ1A 4IEPA 1MS5A 3VBUC 3N7MA 2CV6A 4P9YA 2LUWA 3GBWA 1W6NA 4D7SA 1QXPA 4I0AA 2A70A 1AF9A 4A3XA 4QGNA 1ZREA 1WW5A 2BFUS 1CQ9A 3ELNA 2B42B 1GICA 1LGNA 3FMGA 4GQ7A 3PVBB 2DWRA 3KCYA 2A73B 2CTVA 2O8QA 3ZYPA 1ZRCA 1EPWA 3IMNA 3KD4A 1S2BA 4XJ8A 3JUUA 3NL1A 4N53A 4JGZA 3AYCA 4TYSA 4AEDA 2VUAA 3TN91 3ZN5A 1W6MB 1UKGA 1IGOA 1WLCA 5ABJC 1HQWA 2XBO1 1D4VB 1DYKA 1PM7A 3TN92 2NMNA 4R8HA 3HT1A 4LA2A 2RS52 2CGPA 2BNNA 1G9FA 3RWNA 1DIWA 2VNOA 4AFAA 2XBO3 1ZRDA 4XTPA 3DKWA 2GN7A 1ULEA 3I59A 3GHMA 4QPGB 1V00A 4JGYC 3MIDA 4PCRA 4GH4A 3IN9A 4YVWB 1UPIA 3VZMA 1CAVB 4JDNA 3EJKA 4CEWB 2P3IA 3AMHA 4OI4A 2XJTA 4L9BA 1ZBE1 1VALA 2WIIB 1F5FA 1NA1C 3TB0A 4LUMA 2VMIA 1PHMA 2MNGA 3NSTA 1ZBE3 3ETQA 1MZ6A 4A7ZA 1JUHA 1XNBA 1H1AA 5FDBA 4YZ3A 3AYEA 3IDEA 4H3WA 3WHUA 1GANA 3J8F1 3VBSC 3SISA 3NAPA 1E57A 1KJRA 1REEA 3AP5A 4OHWA 4WV8A 1B35A 5A33A 2R0FA 1WA4A 3J8F2 1N1YA 1R091 3VBFC 3S6PA 1UW8A 3AMQA 1AR91 2C1FA 1AYN2 4XXAA 2MEV3 1Z78A 3ZSJA 1R092 2SBAA 3C2UA 3H50A 1RUJ3 2VNRA 1CPMA 2YHJA 3I4IA 4QPIB 5AVPA 2DTYA 1AR92 3VN4A 3OGGA 4I0BA 5GLUA 3TBDA 3PHMA 2R043 2UY9A 2DCYA 4N9IA 5E1RA 1HX6A 2Z79A 4NHKA 4AFMA 2UWCA 1MR5A 4LBLA 2DCKA 1S55A 5CFDB 2PFWA 3LOIA 2R062 2UU8A 3WUDA 2D6KA 1N1TA 4JCKA 3ASIA 3L2YA 3NV2A 1AX1A 1MEC2 3O7OA 5L7OB 1VLNA 1J3PA 2GMEA 4IETA 4DQAA 2LALA 2MPFA 1VB4A 2JD4A 2QDNA 2ZX1A 3OY8A 5KXCA 4ORFA 1RINA 2JDZA 5JWPA 4WBBA 3AMMA 1DU3D 4K9SA 4N43A 1YFXA 2GU9A 4WVZA 3K48A 3PLQA 1WMFA 4CDWC 4BYYA 4TLFA 3TAYA 2JG8B 2D5FA 1FNZA 4XFAA 5BV6A 4P9JA 2RMU1 1NCQC 1DG6A 1EAH1 3D82A 5K7PA 4C1XA 1RVF3 5L73A 2GDFA 2IXCA 2XVLA 2RMU3 4QGMA 4EN8B 4YSFA 4ASLA 4E2QA 1EAH3 1LTEA 3VKOA 4X8NA 3H1MA 1PGL1 1IS6A 1O5UA 1OQEA 4WZCA 3J9SA 1PZ9A 1VAVA 4KU8A 1PGL2 2QJVA 1POV1 1G8WA 1QJX1 5CVRA 1QH7A 5JI9A 1Z0HA 3UV9A 1LULA 1QJX2 4FCAA 2VVDA 3MPBA 4Q1RA 1TE1B 1YO8A 3HMYA 1DLLA 4L92A 4DRVA 2HEYF 3MF6A 3OYWA 1AR83 3ZX7A 1F9KA 5T5JA 4Q2FA 4KL1A 1JXNA 4M0HA 3VLBB 3QH6A 4LR4A 1YIPA 1K5MB 3AP4A 2WA4A 2G9GA 1C1FA 1O7FA 1OOPA 1PMIA 1ZBA3 2PHXA 2D7FA 1H1MA 4YLZA 2XH6A 1M06G 1D4M1 4Q4X1 2WLPA 2WSVA 1SBEA 2XVKA 3NV1A 4AVBA 4CP0A 1H2NA 4UW5A 4JQRA 1SACA 5BY5A 1XE7A 4LBOA 2PN5A 2O0OA 1QJZA 4Q4X2 1D4M3 2IZWA 1AUYA 1S0GA 4COYA 4EN6B 3N4MA 3JD73 2Z69A 4I01A 2D3RA 2V09A 5SV5A 4H7MA 5C8CC 3LA2A 2AGSA 3W9AA 3T2TA 4R9BA 1QDOA 1J58A 2A6VA 1GBGA 2HWD1 4YGDA 2D97A 4RGGA 3VBUA 5JOZA 2GC2A 1H8TB 2HWD2 4N7UA 3KS7A 3WQ7A 5C4WC 4Z92B 1CVNA 3VHRA 2AR6A 4F83A 4IV1B 4DZGA 5FCCA 2JG8C 2JKBA 4MYEA 2BBVA 1EY2A 5GZGA 1BQPA 3P3PA 3RG0A 3JU9A 2ZZJA 3VHNA 4Y20A 4DXZA 1F31A 3AMPA 4YZ4A 4Q4Y1 5FLIA 3POSA 2WWSA 3L9JT 4RS5C 1UZZA 1ZRFA 4JTNA 2I74A 4Q4Y2 2E63A 5FTTC 1RGSA 4P9GA 3AFGA 4FPKA 4KBBA 3PVOA 2WS93 1AX0A 5ABJA 2VXRA 3HT2A 2DV9A 4AWDA 4R4ZA 1S0FA 3RMYA 4ZXKA 2ES3A 3LGRA 1DQ0A 3VHOA 2V5YA 5FMOS 1RTVA 2WT1A 2TUNA 5JZGB 2Y26A 3M2MA 1S0DA 4XIOA 4JGYA 3MZHA 2QUOA 2QZ3A 3KMHA 4AG4A 1HXS1 3PTYA 3ZXLA 2G9FA 2R30A 2ZMNA 1LOBA 2QVSB 4XTMA 4JRAA 1HXS2 1QKQA 5C33A 4RA0A 1QNWA 3ZXDA 1QDCA 2ZKLA 3OBRA 3BB6A 5K0UB 4OI2A 5H9SA 1H0BA 1GYKA 3B01A 2TEPA 1PK6A 1G9DA 1DZTA 3RYKA 2HYKA 3VBSA 1APNA 1QJU1 4Q0UA 4AGRA 5E88A 5F6LB 1BEV2 1W6NB 1JHNA 4ZKTB 4HPKA 3VBFA 3EHKA 3LCPA 1QJU2 1GZWB 1A8DA 2IFRA 5D8AC 1FV3A 4NHLA 4XQWA 1MZFA 4OVEA 5A3LA 2XL9A 3AFKA 4FT8A 1QMJA 3TOJA 1IS3A 4OI1A 2WJSA 1Q8OA 5IK7A 1KXGA 3KZ4C 1SBDA 4XDQA 2ATFA 2ZX2A 1RB8G 4N53B 4D3WA 2DU0A 4JGZB 4AEDB 1RUH1 4WM7C 2AZ5A 1LOAA 1AL21 2VMHA 1RUH3 3VDDB 2WNVB 1QQP3 4D7TA 2ARXA 5BNPC 4C90A 1AL23 4XFHA 3THTA 4PLNA 5J3UA 2HWC1 3EXUA 2DVFA 1LOGA 3I59B 4CZSA 3ZIWA 4CDWA 2CAVA 2IWGB 3JQXA 1O4YA 4LO4B 5DUUA 1OQDA 2PAMA 2WNUB 4BWOA 3LOBA 3HN1A 4WM8C 5EV7A 4GH4B 2HWC3 4HVRA 1RUNA 3USSA 1SLLA 4BQ1A 4XFIA 1NCQA 4L8QA 1FYUA 3HIFA 3TWIA 3HAGA 3WG1A 2PQQA 3ENRA 5I0RA 3WR0A 1RUOA 1WD4A 4SBVA 4CEWA 3JB8A 3ZN6A 2EALA 3G6JB 3MIBA 3NAPB 3VL9A 1MACA 2W39A 4PBPA 4PIYA 3BOPA 5F5QA 1QH6A 4LA3A 5J98B 2JENA 1O3QA 3P3NA 4AEMA 2VQ0A 4LO5B 3OGJA 2VOWA 1LHVA 4H55A 1QOTA 1QNYA 2XJVA 5FBZA 5FO9B 3ZFGC 1OI6A 1N3OA 5D1IA 2F6BA 5BNNB 3VZNA 4FAHA 4PQ9A 3VBHC 3MDPA 1BCXA 4XOGA 1MQTB 3ZDSA 5A32A 3WW3A 3NKTA 4QPIA 5LK7B 2OZJA 3WDYA 2ZGOA 3S30A 5HCAA 2ZACA 4IEZA 1D0GA 3ZMOA 2EF6A 3IBMA 2DFCA 2DUQA 4Q0SA 4Y1XA 3OY8B 5CFDA 3ZO0B 5CADA 1CR7A 2CGOA 1VBD1 1R081 1RUC1 3CL1A 4LBNA 2EXJA 3PJYA 4N43B 1VBD2 1IOAA 1Q3EA 4N90A 1R082 1VBD3 1RUC2 4XJAA 2A75A 1I5ZA 2YGLA 5KBFA 2QE3A 2BFUL 2EA7A 5EYXA 5JLVA 5C8CA 4BA6A 5BPXA 1SLIA 3HR9A 2XL7A 1NXD1 4MX3A 3N36A 4AHXA 1C4RA 3HQXA 4LO8A 1C28A 2XVGA 5C4WA 3WP6A 5FOJB 2GN3A 2ZHLA 2FZ2A 2P17A 2JG8A 2IXJA 4GB31 5LRSA 2HKXA 4KWJA 2GC1A 3NVCA 4MGIE 5JOXA 2EXIA 3POWA 4GB32 2Q30A 3ALQA 4MGZE 4QHBA 3VBOC 1WGPA 2WT0A 4HKLA 4AGGA 1AYM1 1RUD3 3R05A 4DMIA 1ZZ9A 1MZ5A 3ECQA 2WFPA 4LE3A 5EFUA 1AYM2 4Q27A 1HRV3 2DUOA 4OUMA 4KGGA 2JEMA 4Y1UA 1LHOA 2B5HA 3OYWB 3M8LA 2VU9A 5DG2A 3POYA 3WW1A 1AVBA 2DUPA 2Q8OA 4Q4V3 4YARA 4RR3C 2ZGQA 1KD7A 2ZGKA 4XF9A 1DQ5A 5KC6A 1RHI3 1O91A 2OW4A 2X5IC 3S7IA 2YYOA 1ZM1A 4YZ1A 1H8VA 2PHTA 3AZYA 1RL3A 3AKRA 1K5MA 1NG0A 1GQHA 4LHKA 5F6KA 4OHVA 4ISQA 2D3SA 2R071 1YUDA 4K7JA 4YGEA 1HRI3 4MXVA 4G3YC 4D7YA 1G9CA 2R072 4H14A 3I8TA 2KXLA 4X8PA 2CY6A 3VBUB 4HVOA 5HI0A 2RS31 1FMD1 2XWBB 3NO8A 1JTZX 2A6WA 4I30A 1XYOA 2R0HA 1TME1 2RS33 4S2HA 1FMD3 1SCSA 2ILMA 3PVEA 4YW3A 1YJKA 5KXEA 2FQPA 1DDLA 1TME3 1IQAA 4M3CB 5KHGA 1CJPA 1NQDA 4M0NA