3ELNA

A putative fe2+-bound persulfenate intermediate in cysteine dioxygenase
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
187
structure length
187
Chain Sequence
TELLKPRTLADLIRILHELFAGDEVNVEEVQAVLEAYESNPAEWALYAKFDQYRYTRNLVDQGNGKFNLMILCWGEGHGSSIHDHTDSHCFLKLLQGNLKETLFDWPDKKSNEMIKKSERTLRENQCAYINDSIGLHRVENVSHTEPAVSLHLYSPPFDTCHAFDQRTGHKNKVTMTFHSKFGIRTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Cysteine dioxygenase type 1
publication title A putative Fe2+-bound persulfenate intermediate in cysteine dioxygenase.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 55
structure length 187
sequence length 187
ec nomenclature ec 1.13.11.20: Cysteine dioxygenase.
pdb deposition date 2008-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05995 CDO_I Cysteine dioxygenase type I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3elnA00
1NXMA 1UPIA 1XRUA 1O3RA 2XL7A 3CO2A 2ETEA 3RNSA 1XE7A 3R6SA 4QXKA 5EZWA 4HN1A 2XLGA 1UCXA 2Z69A 3IDCB 3BPZA 1Y9QA 3NKTA 3VHRA 1O3QA 1CAXA 1RL3A 3H1WA 2EA7A 4HLTA 4HSJA 4JTNA 4ORFA 3E5UA 4HZFA 2IC1A 1EY2A 4XFGA 3D82A 2VPVA 4EWAA 4MZUA 2IXIA 3S7IA 1EPZA 4HVRA 4UBGA 4D7TA 2QDRA 4OFGA 1J3RA 5KHGA 1SFNA 5LEJA 5JSRA 4XF1A 4E2QA 1I6XA 2QNKA 3NL1A 3CJXA 3DV8A 3WW1A 1IPKA 1OD5A 3SXWA 1YUDA 2UYAA 4YYOA 4Z07A 4TLFA 5J7MA 3H50A 4I09A 4F7ZA 4HN0A 1IPJA 5LEKA 3H7JA 2PQQA 4IERA 2D5HA 3KGLA 3ELNA 4XF3A 1YWKA 1CAUA 4YSFA 5KHHA 4XFBA 1NE6A 1J59A 3BCWA 3H3UA 4LUKA 4F8AA 3E6CC 4BHPA 2BNMA 4I0AA 1UIJA 3KMHA 5F1RA 4IEWA 4PJYA 5BPXA 4IEXA 3ES4A 2XLFA 4Q0UA 3ETQA 1RTVA 1NYWA 2OZJA 4L2NA 4AQ6A 2WC2A 5EFUA 3LWCA 3UKTA 1QXRA 3KCCA 3HIFA 4BH9A 4UBHA 4HVQA 4Q0SA 3DL3A 4PIYA 4LTAA 2E9QA 2VECA 3WW2A 1XE8A 2OYZA 3CLPA 5FQ0A 1DGWA 2PA7A 4O9GA 3HT1A 5JSPA 1NE4A 1DZRA 4BIFA 4AVAA 1NZCA 5KBFA 2IXKA 4IESA 1UIKA 2Z2SB 4AQ2A 4R8HA 5BV6A 5FPXA 4XFCA 4JVAA 5J3UA 4MGKE 1ZZ7A 2CV6A 2F4PA 1WA4A 2UY9A 2B8MA 3H9AA 3IDBB 2GC0A 4JTOA 1FI2A 2CGPA 2ET1A 1HW5A 4XF4A 1ZREA 4XFIA 3EQEA 4XFHA 3SHRA 2Y0OA 1PMIA 2QCSB 5KHIA 4META 2GC2A 3M3IA 2MHFA 3FHIB 4MGYE 4X6QB 1QXJA 3B02A 2OZ6A 3SCGA 1YLLA 4KWJA 2Q4SA 4HVOA 5I0RA 4B29A 2H6BA 1LRHA 2GU9A 1O3SA 1X8EA 3CL1A 3I59B 3SCFA 3G7DA 3RYKA 4Q0VA 2XGXA 4HMZA 1G6NA 3ZDSA 2IXHA 1DGRA 2PHDA 4IETA 1SEFA 3RZZA 5JCTA 4IEUA 1CAWB 4QMAA 5I0SA 2PTMA 4I3PA 4WVZA 4ZU4A 2H6CA 5C6CA 2IXLA 2BYVE 1J58A 3USSA 2PYTA 1O4TA 5AVPA 4XETA 2C0ZA 2WFPA 4PIZA 4NVPA 4OLLA 1L3JA 4LA3A 4FBFA 2OA2A 4Q0QA 3H1MA 3TNQA 1RGSA 3I7DA 4JV4A 2K9ZA 5FPZA 3D0SA 4EROA 4RD7A 4XEZA 3ST7A 4N9IA 4GULA 1RUOA 2GZWA 5BUVA 1GQGA 1YFXA 5KHJA 5BY5A 1X8MA 1LR5A 5CVRA 1J3QA 1V70A 1CGPA 4XF0A 4BYYA 2MPFA 3LA7A 3L2HA 4QGMA 4UXAA 3OD0A 4MV2A 1H1IA 1ZRFA 2B9UA 2P17A 5E16A 2CAUA 3SMHA 4MH0E 1CAVB 2GC1A 4FT8A 2IXCA 5E1RA 3QOPA 3PNAA 5FCCA 1H1MA 3ACLA 3LAGA 3C3VA 3RDIA 4CYDA 3E5XA 4AVBA 3ES1A 2XKOA 1J1LA 2UY8A 4KU7A 3WW3A 3HT2A 3N4MA 3FZ3A 3SCHA 1VR3A 1WLTA 3E6DA 2XL9A 5I0TA 3UKNA 2D40A 5T3NA 4O9EA 2FQPA 3OGJA 1O5LA 4LUMA 3NVCA 3RPQA 1ZZCA 5LRRA 3MPBA 2PFWA 3S7EA 2O1QA 3EJKA 4AXOA 2XHKA 3JZVA 1Q43A 2ET7A 2ZKLA 3M70A 5FLJA 5I8TA 3FE5A 2EVXA 3H1YA 1CAXB 2BEOA 2HJIA 4IEQA 4R52A 1U12A 1OFNA 4I01A 3I54A 4HSLA 5FLIA 4X6RB 1OI6A 1TQ5A 2UYBA 3EHKA 4Z82A 5JR7B 1DZTA 5BXXA 4Q0PA 3QACA 4ZU5A 1O3TA 4J1WA 2CAVA 4YNIA 2B5HA 3IWZA 3BB6A 2V09A 2BGCA 3LOIA 2ZCWA 1YHFA 1CX4A 3E5QA 3U0ZA 4MGZE 4XF9A 3CF6E 3O14A 1FXZA 1ZZ8A 4KU8A 4KWKA 2HKXA 1GQHA 2PAMA 3BALA 1VP6A 3MDPA 4EV0A 4IEZA 3U11A 5HI0A 2PAKA 3PVBB 1RUNA 2D5FA 3TNPB 3UKVA 3EO6A 4LEJA 5I0UA 4QX5A 1CAUB 2Q0AA 1X82A 5J48A 5JSOA 1ZZBA 2KXLA 1ZZ9A 4K8FA 3CEWA 2XKPA 4MX3A 1I5ZA 2PHLA 4FAHA 3NW4A 4LA2A 1J3PA 2VQAA 4ZU7A 3IBMA 4YRDA 4WBBA 4Q29A 3GYDA 3NSTA 2EAAA 2D93A 3BU7A 5FDBA 1EYBA 1O5UA 3FFQA 5I91A 1OMIA 4MUVA 1FT9A 3LZZA 3NJZA 2XLAA 1ZZ6A 5CU1A 5CADA 3I59A 3LA2A 2IXJA 1UW8A 4IEYA 4ONUA 1ZRRA 1QY4A 2H0VA 4YARA 4LULA 2ATFA 1VJ2A 4KWLA 3DN7A 1CAWA 4IEOA 4LLOA 2GC3A 4XFAA 1Q3EA 5FQ0B 3OCPA 2QJVA 5JAXA 5D1IA 3U10A 2GH2A 4AVCA 2Q30A 3RYPA 3IIAA 1PM7A 1LKNA 5LRSA 2FMYA 3OF1A 4QM8A 4I02A 2PAEA 2Q1ZB 3D0JA 4MGIE 3ROUA 3WW4A 4EWDA 4IEVA 3EBRA 2GAUA 4PIXA 1SQ4A 4E2GA 3PLQA 4P9GA 4A2UA 1YFYA 1LB2A 3GBFA 1YFUA 1ZX5A 4QM9A 3MZHA 2I45A 1JUHA 4L11A 4I0BA 1O7FA 3H8UA 4N9HA 1WGPA 4D7SA 1ZNPA 4FAGA 1ZRCA 4XFFA 4QGLA 1YFWA 3MYXA 5I8SA 1RC6A 4EWEA 5K8SA 3FX3A 4J1XA 3S0MA 3FWEA 1EP0A 4I2OA 4DINB 3HQXA 3LA3A 3H3ZA 2MNGA 4KL1A 3E97A 3E6BA 1ZRDA 1X7NA 2BNNA 5I93A 1Y3TA 1ZVFA 4E2SA 3KGZA 2QVSB 1CAVA 3H7YA 4HBNA 3OTFA 4IEPA 5FLHA 4H7LA 2DCTA 5C8WA 1UD1A 1Q5OA 1QWRA 2BNOA 3KSCA 4QGNA 5KHKA 2OPKA 5I8YA 3FJSA 2O8QA 2K0GA 3DKWA 4WZCA 3RYRA 2N7GA
chains in the Genus database with same CATH superfamily
4LOTA 1XPWA 2R062 4HANA 1NXMA 1XRUA 4P00B 3T1LA 5LK7B 5FYCA 4Q4W3 5FJKA 4AOCA 2ZGNA 3URFA 5FMOS 3M7AA 3MEPA 4WVMA 2E6VA 4L99A 2HWC3 4QU2A 4QHOA 5EZWA 2GNTA 2V73A 4RR3A 4D8MA 5BNOC 1B35C 2XLGA 1SDWA 1UCXA 4PLOA 5ISLA 3AJYA 4XJWA 2WLQA 1KD7A 1V9U3 2W5FA 3V65A 4C1XA 1RL3A 5LWBA 5GM0A 4JTNA 1IPSA 4ORFA 5SV8A 5IVBA 1OOPA 2I2SA 5LCWL 4XFGA 2VPVA 3U1XA 2ID4A 5AFBA 2XXZA 2E53A 5BNNA 5A3OA 3EB7A 4BQYA 2IXIA 4JDOA 3WCSA 3FUQA 1CD3G 5FBZA 3CBNA 1PO12 3SC7X 5GZCA 1RUE1 1LU2A 1DGWX 4AF9A 1W90A 1UWWA 3DEMA 4YVWA 3FBYA 4OFGA 1A78A 2P6HA 2WFF1 3LFIA 4LBQB 1SFNA 4YFZA 2RM22 4NN0A 2SBAA 4FXGB 2OS2A 2ILMA 1I6XA 2P1BA 2VQ0A 4LBKA 5F5IA 2HWE1 4M3CE 2QNKA 3CJXA 5EHDA 3RG0A 2RJLA 4FOQA 4OHYA 3SXWA 3HJRA 3O7OA 1UZWA 1X33A 5FTTC 5JPMB 2RG4A 4BQWA 3VN4A 3ZN6A 2YY1A 5F6LB 5H9RA 1U5ZA 5LEKA 3H7JA 4QX3A 2VXRA 2PQQA 4IERA 1W6OB 4COZA 2C1FA 4MG2A 3ACFA 3MIHA 3EYPA 4KH9A 1GNHA 3ELNA 1ZBA2 1CAUA 1ZBE1 3AYAA 1HXS3 4A41A 3RI9A 4Q8KA 2NMOA 3MFCA 4PI2A 3E6CC 3S5AA 4RQPB 2F6BA 4RSUA 3DYMA 2XVLA 2J1AA 2ZMLA 5LY2A 2VCCA 2BNMA 1RUC3 2E7AA 3X29B 1M06G 1WBFA 3BU0A 1CX1A 1W8WA 1W2TA 4IQPA 3OGSA 2BERA 2P3KA 3WQBA 5F1RA 4YZ2A 1F8VA 1VBE3 1QHDA 4FOVA 4Y26A 1Q56A 2V4VA 4FVVA 1MS0A 4XDOA 1REEA 3ES4A 4N8MA 1SFYA 2G4IA 3RZMA 1UKGA 2HWF2 5FZ7A 5GZFA 5F8PA 2FDFA 1MS4A 2Q1MA 2VE1A 4UFIA 2P3IA 3ZSKA 1QJZA 4GWNA 2QZ2A 1W6MB 1OLQA 3A4UA 4GKYA 3GM8A 4L2NA 3ZSLA 4EN9B 5FXVA 3WF2A 1X36A 3T2QA 2WT0A 5CYYA 3MIGA 2LUWA 2UWAA 4TXWA 4RFRB 5L9VA 2XMLA 2RV9A 3AJZA 5JOYA 1LOAA 2MEV1 1OPOA 1R091 2NMNA 2WIIB 5IFPA 4NIHA 4LTAA 3T0DA 2TBVA 1ASJ3 1XNAA 4BQ1A 4CDXB 4CP9B 5FZAA 1XE8A 4CSWA 4FQ4A 3R05A 1RVF2 4GALA 5ACA2 2A5ZA 1RHI1 2R042 3OUIA 3OY8A 4IV1B 3TN92 3HT1A 3ZYBA 4XCAA 5LATA 2A6VA 3VGIA 1NZCA 1DGLA 3O1PA 2XJTA 2Z2SB 4NO4A 4AWDA 3UK9A 1UOFA 4RQPC 4XFCA 1OQDA 5CISA 4K20A 1W03A 2RVAA 4COVA 1SLLA 5FZOA 3U78A 4D6RA 3HN1A 1US2A 2UY9A 2D6NA 1K5JA 2B8MA 2DVGA 3H9AA 4Y5TA 1JTZX 5A3NA 2LTNA 3RWKX 1W0OA 2WQ8A 3VL9A 4OVEA 3FMGA 1LECA 1WMXA 3AVSA 4C0HA 4GB33 5CKNA 1PMIA 3LF7A 4BU2A 4S2HA 2C5DA 5KHIA 3TEZA 1BMV2 3OGRA 4A4AA 1R082 1AYN1 4META 4Q2FA 5DN2A 4AI2A 1VAVA 4AFMA 4ASLA 3WP3A 1AVBA 4JAAA 1YIFA 3U4SA 1WLWA 3C7EA 1PIV3 5CG8A 3SCGA 1IOAA 3PUAA 4URTA 5C9AA 3N7MA 3BVCA 2Y64A 5C3QA 1U0AA 4HVOA 3NQHA 2H6BA 4CDXC 3E1F1 2VZQA 3HPNA 1N47A 4XJZA 1XNKA 2D6MA 4TN7A 3T0AA 4JGZB 1X8EA 4IV1C 3ON7A 2NN8A 3WINE 3JXSA 2JD9A 2CDPA 2CU5A 4YZ1A 4DRVA 3G7DA 2P3JA 5IYYA 2ZTNA 1A6CA 2VBPA 1KGYA 3DYPA 2XGXA 4HMZA 4WM7A 1KDMA 1DGRA 4IETA 1E57A 2GNMA 2XWBB 4XJUA 5FPLA 1NG0A 1AL0G 1S1AA 2IFRA 4UI9L 3VKOA 5I0SA 3VDDA 3WP6A 1MS9A 2H6CA 4E4SA 5C6CA 3ZSJA 4B3NA 5A7QA 4QAWA 2BYVE 1RUG3 3KT7A 2PYTA 3MUZ1 3Q8EA 1OUSA 1L3JA 2WSVA 4LA3A 4FBFA 4ZZ8A 3AKTA 3C7HA 2RR13 2GN7A 3J9SA 1JODA 2D3PA 1S2EA 1IGOA 3H1MA 3HNYM 3I2GA 3TNQA 2BBAA 1H2MA 2JDAA 3OBTA 4H55A 5FJHA 3M8LA 5FPZA 3SKJE 4XEZA 1C4RA 2VGDA 5LZ6A 2GZWA 1QEXA 2OQ7A 4CUAA 1GQGA 4FPLA 4BQ2A 3RMXA 2ZEYA 4K21A 5BY5A 4Y22B 2J1UA 3AX4A 1T6BX 4AI9A 3D6EA 3FUOA 3IDEA 1DG6A 4HK8A 4BYYA 5FZFA 4LK6A 3KT1A 4QGMA 5A32B 1MR5A 3OD0A 5CBLA 1XNCA 4HFSA 1H30A 2RS53 5IT6A 4JHTA 5DAXA 2JDZA 1I5PA 1TVGA 2WO3A 4Y1XA 3NNFA 2JIGA 5E16A 5L36A 3SMHA 1K5MB 1UX7A 1HLCA 4MH0E 5FZHA 4LBQD 4QPWA 4AEJA 4B4RA 3O1MA 3J8F1 4RHV2 5T5LA 2VMCA 3HEIA 3MUY1 3ACLA 2G9FA 3GCWA 3GXUA 3V64A 3RDIA 5HXVA 4UF0A 4KU7A 5K7PA 3WW3A 1W9FA 3HT2A 2CWSA 1UY4A 1WMFA 3VZNA 4QKBA 3V0AB 1ULCA 1LHWA 2D40A 4CDUA 1BBT1 1QOOA 2VH9A 1ND2A 2FQPA 4Y4RA 2JG9B 3AFKA 3HNBM 4W6WA 4LUMA 3PIGA 3NVCA 4L0PA 5A33A 4CU7A 1QDOA 4AHWA 3MPBA 3AZWA 2X29A 2Y6FA 3GZUC 2JB4A 4WVMB 2XB6C 1WMDA 1WKYA 2XG3A 2XHKA 3BOPA 4YVSA 1D2SA 4FO9A 4QPIA 1RUE2 4QQOA 4RR3B 1H8TA 3AP4A 5CNAA 2YU1A 1QJY3 4CCOA 2Y6KA 2ZKLA 3MICA 2HWD1 3D8CA 1REDA 3FE5A 2WFF2 4LE4A 2G9GA 1D0HA 4GIQA 2VZ3A 1XOYA 3I3DA 1VBD1 4IEQA 3WSOA 3ZXLA 1OOPB 2VOKA 1OFNA 3NO8A 4I01A 2HWE2 4QQ2A 1FPN2 3DGTA 5FLIA 3M3QA 5BNNB 2XVGA 4NPMA 4B8EA 1OI6A 1L7RA 1S0GA 2OX0A 2UYBA 3OEBA 3PTRB 4LKFA 5IK5A 4PDWA 3B94A 1VIWB 4J1WA 4RN5A 1DYOA 4YVWB 1K5MC 1LHOA 1QJEA 3BB6A 4IW3A 4AHYA 2ORXA 2BGCA 5FWEA 2HWB1 2ZBJA 2YXSA 2CY6A 1W05A 2ZZQA 1UZVA 1KS4A 1KITA 2DVDA 1TZOA 3LD8A 1A8MA 1ZBE2 2WBKA 4LHLA 4MGZE 3P5BA 4MO3M 5FOBB 3RZLA 3K3OA 4BPZA 3A0NA 3LSEA 2DU0A 3F2ZA 1RYYA 5BYNA 1R1A1 1FXZA 3AXEA 1UL9A 2WZR3 3ACIA 1ENQA 3K46A 4OHXA 2FD8A 1PZ7A 4LR4A 5IVFA 2R0HA 3ZN6B 1GQHA 1UF2C 1PVC1 2JG9C 4DUXA 5K0UA 1YQ8A 2P3YA 3KB5A 4IEZA 5HI0A 2PAKA 1RUNA 4KBZA 1ZM1A 1S0CA 3ZO0B 4DY5A 2JEMA 2NQYA 3MLJA 3OGVA 1BVP1 4RR3C 1N3PA 1CAUB 2I07B 5AC92 1S0BA 2Q0AA 3W9AA 4BJ0A 5JSOA 4L8QA 5C33A 2NM1A 3KF3A 5F5AA 1Y43B 2C9KA 5B4NA 3N7LA 5F3IA 5JI9A 3IZOA 4W6YA 1HRV1 2VW0A 2XHNA 3OPTA 2BP6A 1OOPC 3T4VA 3WNMA 2Q8CA 3VBHA 1HQNA 4D94A 2YYOA 2MEV2 4JGYA 4JX0A 5BNNC 3P3PA 4CDWA 4ZU7A 5JR2A 3ZYFA 4SBVA 3QBQA 3Q8CA 1W39A 4NROA 1POV3 1VMJA 2RDSA 3DXTA 4YRDA 5CIRA 2VNRA 5F39A 5FZKA 2R061 5CKQA 3QLQA 5A7OA 1JH5A 2EAAA 2Q1FA 2WS93 1RHI2 1GOFA 4QQLA 4YVWC 5FDBA 5EXOA 3WHUA 2WNVA 2DV9A 5JIAA 3VDBA 4XAEA 2ZPXA 2WN2A 2BRTA 4GJZA 3LZZA 1ZZ6A 2ZX3A 5CADA 3MI8A 3WVJA 3LA2A 1F35A 4ONUA 1WCQA 1DCSA 3D4KA 1COV2 5IAVA 4COUA 3PIJA 3M3EA 3ZOIA 1UY2A 3ZSMA 2X09A 4QX0A 4P14A 1BEV2 3DN7A 1W8HA 1ZA7A 2DVAA 1CAWA 2PHWA 1IKPA 1RJ7A 4LLOA 1DU3D 1AR93 1J84A 3AYCA 3OY8B 1I1EA 2YV8A 4DFSA 5D1IA 4GKXA 4ZZ5A 2BFUL 1DQ4A 1PO11 3IDAA 4JHZA 4AVCA 5FYSA 4DRRA 1F31A 3B00A 1QNWA 3P6BA 4XVHA 3M2MA 2HH9A 4B1MA 4I02A 1KFUL 3THDA 5FYBA 2Q1ZB 1PGW1 1UMZA 5IVCA 4EYUA 4UW3A 3VKFC 3QD6A 4IEVA 3RRDA 1W2NA 1W8OA 4CCMA 5FZOB 3CZUA 4PIXA 1SQ4A 3J7LA 4XHBA 3U37A 1AYM1 1MZ5A 1GP5A 4P9GA 4EE2A 5I0DA 4LHKA 2VNVA 1WW7A 4BK4A 1TNRA 4QM9A 4AVSA 2I45A 2VC9A 1O7FA 2VOVA 1GQPA 4ES8A 3LCPA 3RZJA 2XJRA 1S2KA 1YFWA 3MYXA 5I8SA 4ASMB 5K8SA 1Q8PA 1MS1A 1H9WA 3FWEA 5AVAA 3WUDA 2VOXA 5FY0A 3HQXA 1Z78A 1ZBA1 4GXLA 4FQZA 1C3HA 5FY1A 2VUCA 1UQXA 4RGAA 2WLPA 4MXWB 3RFRA 1AZDA 2AREA 1RMU2 1U5XA 3BGAA 1VAMA 3H3ZA 4K7JA 3UESA 5C9AB 1MACA 2EIBA 3E97A 4KL1A 4XUTA 3ZFEA 2LRPA 1SMVA 2YC4A 4R9BA 3AZVA 4AI8A 4E2SA 1QGLA 2GP3A 4IEPA 5E8AA 1H6YA 1NKGA 1QJX1 2RDQA 3ZR5A 3N36A 5FYZA 4A3XA 3MIDA 3RS6A 2O8OA 4IGQA 1FMD2 2DCTA 2VL4A 1XU1A 4RS5C 4Z92B 1WLDA 3A7QA 4AG4A 2HWF1 1HKDA 5FXWA 1AHSA 4BZ4A 2AH2A 2DVFA 1TME3 3FJSA 4NHYA 2O8QA 3B9CA 2K0GA 4OHZA 1EAH1 1IS5A 4WM7B 2JDMA 1V00A 2JE8A 4P5YA 5FOJB 3I49A 1AX0A 1E5HA 3VDDB 5EJ1B 2VZVA 1YNAA 2XL7A 2A75A 4IV3A 3WCRA 5CB7A 1YCIA 5EYXA 3D3AA 2PXJA 3SLIA 4H14A 1XNBA 1FOD2 2RMU1 1E5RA 2Z69A 1UZZA 5IW0A 4ET7A 3BPZA 1Y9QA 3NKTA 1CAXA 1HJGA 1RVF1 2C24A 3NNJA 2QQPA 4RFT0 1MEC1 1NY72 1W9TA 2EA7A 3H1WA 3PUQA 4HLTA 5FKBA 2FDHA 4PBPA 1SBDA 3TN91 4LO8A 4OMDA 3VKNA 4CZSA 4EWAA 4NWWA 2A3YA 3AMNA 3ZPOA 3HQRA 2C9AA 2EAKA 1KJRA 1KQRA 5LBCA 2VCAA 4JRLA 4ZXEA 1JU4A 2BOJA 1GKBA 4HVRA 1RUD3 5LBFA 4FPGA 5C9AC 3WQ7A 3POIA 4UBGA 1A8DA 3J8F2 4QD2A 5FP8A 4BQ4A 3VBUA 5A1FA 3TOJA 1G9DA 1EPWA 1RUI1 1CPNA 4ZS2A 1XSRA 1VBC1 4WM8A 4D69A 4EN7B 2WNOA 1D4M1 3C7GA 4LITA 3IPVA 4XF1A 1V6LA 5T5JA 4IUGA 5FZ0A 1IHMA 2J1EA 3GCXA 3USUA 4AW7A 1ST8A 3NL1A 1LODA 4D6QA 2ADDA 2G19A 2ZAHA 4CCNA 3RZKA 1EV13 5DUWA 2JG9A 3LSDA 5C3PA 2BFUS 1R081 2BOIA 3NV1A 4R9DA 2E7TA 4WM7C 5FMCA 5J7MA 3HAGA 3H50A 4I09A 1WZXA 2OVUA 4C90A 1UOBA 3KS7A 1OKOA 1IPJA 3B5LB 5A70A 5FZCA 2B4KA 1T6GC 1W6PA 2GP5A 2JDPA 3UGHA 5GZEA 4HXCA 3OSDA 4UF0B 1QJU2 5JI7A 2HWD2 4ARYA 2X53S 1AX1A 3LEGA 1LOCA 3I2OA 1AL21 3IN9A 5KHHA 2V5YA 1NE6A 1YEWA 1VBD2 3H3UA 4HK9A 5CFDA 4DIQA 4CDUB 1MZFA 1WD3A 4MADA 1ND2B 1F4HA 4I0WB 1AR71 4JKKA 5A33B 4Q4Y3 4ATEA 2R071 4LKDA 1MQTA 1RUJ3 2JDHA 3EMRA 4FPEA 2VMHA 4IEWA 5DQ0A 5J96B 4PJYA 2ERFA 1OSGA 1YYNA 4YVSB 5L7OB 5BPXA 3GBWA 4QPIB 1KXGA 3UYJA 1H8TB 1F15A 1S0FA 3WDWA 2YFZA 2D3RA 4FPFA 4OULA 2CGNA 4Q0UA 1Y9GA 3GGLA 4NAOA 4LK7A 5KXCA 1REFA 3LDKA 4LO7A 4K1YA 4P9XA 3O1OA 1UXZA 2WC2A 3LWCA 1HV0A 1QXRA 3KCCA 1L7LA 2QQUA 2XVKA 2HEWF 4R4ZA 3POWA 4YGDA 4BH9A 5FZ9A 5DZFA 4QDQA 1AF9A 1R1A2 1W6NA 5DAVA 3UV9A 5A3MA 1RB8G 1U5IA 1FV2A 3HD8B 4S2DA 3SKVA 4PIYA 3OBAA 4DUWA 5JZGA 1W6QA 2VNGA 1F5FA 5B2GB 1PVC2 1DDLA 5ANQA 3SEEA 2G9ZA 2A6YA 2QBXA 3WF3A 3CLPA 2R7EB 3DECA 4R9AA 4AHZA 4AEDA 2UU8A 4P5HA 4NPLA 5KXBA 5FPAA 5T55A 4OI0A 3HNMA 3OYWB 3J7NA 1OHFA 2VQTA 1OURA 2VO5A 4CCJA 5FZMA 1LOFA 3GZEA 1YQCA 1LCLA 2QFEA 1XNTA 2LS6A 4M3CA 2ARXA 4AFDA 2HWE3 4V1PA 1G9FA 5FPXA 4CDUC 1ND2C 1Q8SA 4OQ9A 3KZ4C 3ZX7A 5JWPA 4QPGC 1QMJA 2CSGA 2VMIA 3PURA 5K0UB 2F4PA 2J1RA 2Y38A 1ODMA 3FC0A 5FO8B 1JS9A 2W92A 1GWLA 1CWPA 4HOOA 1LTEA 2RJKA 4YVSC 5L7OC 5LBBA 4QPIC 1FI2A 2CGPA 1H8TC 1HW5A 1GANA 3GBGA 2LM3A 5DDJ2 4XFIA 5DXDA 5A7WA 3LFMA 3SHRA 5A3TA 4RHV1 1GYKA 3AKRA 4XUQA 2Q8EA 4N7UA 2X5IC 2ZEXA 4Y24A 4BISA 1RUF3 4LPLA 4UFJA 2F4LA 1GUIA 5GKAC 3VBHB 3JD73 4QDRA 2B39A 2PHTA 5A3WA 2OZ6A 4JGYB 1C8M2 1HB2A 4CDWB 5FBJA 1RINA 2RS33 4KWJA 5CEHA 4H3WA 1JYXA 4FTSA 3WDUA 5I0RA 3PUIA 4B29A 4XCBA 1LRHA 1K12A 2JWPA 1TMF3 4NE9A 1GR3A 2WNVB 2JDKA 5C4WA 3IB3A 4LE3A 1D4VB 4YGCA 4OUSA 3JUUA 3FHAA 1DIWA 3POBA 3SISA 4EN6B 1PK6A 4XBLA 3LPFA 4QT6A 1OA4A 4AQSA 2FZ1A 3CU7A 1MPXA 1DQ6A 3SCFA 1PGW2 3NV3A 4XW3A 1HV1A 1PHMA 1DF0A 3CZJA 1Y4WA 3ZDSA 3V0BA 1G6NA 3AB0A 2IXHA 2PHDA 5JCTA 2X8KA 1SEFA 4P9YA 3I3MA 4CEWA 1R093 3BTYA 1FPN1 1CAWB 1AYM2 1UU4A 1W2AX 2D7FA 1C28A 3O1RA 3ZFFA 3ZXAC 1OA2A 1PMJX 3I2FA 5K0UC 2GMPA 2FCTA 4XIKA 5FY7A 2XWJB 4GMP0 4COYA 4AVTA 1JYCA 1FNZA 4G9SB 2IXLA 4XMAA 3ENRA 3IIIA 1H8VA 2W52A 3K2OA 3OGGA 3PVEA 1DP0A 1OC1A 5AVPA 4LOSA 4XETA 2C0ZA 2WFPA 4UOJA 1V6KA 3ZDVA 4TYSA 2IZWA 2AACA 3M4FA 5IHRA 3W20A 5LBEA 1JHNA 4EN0A 3OD4A 4XIOA 1AR63 2OQ6A 5FFOC 3KV6A 4JDNA 3WZ1A 1RGSA 3AC0A 3D0SA 3ZXFA 4H2AA 4RD7A 3VBHC 4UAPA 1RUOA 2DCKA 2R49A 4QX7A 4F3JA 4JGYC 4NRPA 4YM1A 4CDWC 4FPYA 3IM0A 4JRAA 3SEPA 2VNOA 3MV11 4QX1A 1QJX2 4Q4X2 2XBO3 3P3NA 3ITQA 4MOAA 3ZYJB 2QTWB 1V70A 3FLPA 3ZN5A 1CGPA 5T5PA 4BB3A 2C6SA 2Y33A 4XF0A 1VBB3 2HEYF 2MPFA 5JOZA 1HN1A 2VVDA 2WNVC 3AFGA 3L2HA 3LA7A 4QQPA 4UXAA 4Q4W1 1UMHA 1H4GA 3VHNA 2WR9A 1H0BA 5F2SA 4ISQA 4N53A 3RI8A 4YM3A 1AYN3 2ZHLA 5AC91 4GWIA 1WWYA 1ZRFA 2HWC1 2B9UA 3AM2A 1G9BA 1RXGA 3RZGA 2AR6A 1EAH2 1K42A 5LA1A 3ZFEB 3MW4A 5D2AA 2PLV2 2QUOA 4CCCA 2GC1A 1PO22 1V9U1 4FT8A 3PL0A 1POV0 5E1RA 3QOPA 2CTVA 3PNAA 4Q4V2 1STMA 3C3VA 2B42B 4CYDA 3WF0A 3NNGA 2RMU2 2V72A 5FYUA 4AVBA 5IK7A 3AYDA 3R4DB 4PBOA 3VZOA 4B7EA 2XJQA 3O12A 1XNDA 4D0QA 2XPJA 1JW6A 3NJYA 1MEC2 4ZXKA 1LGCA 2QQLA 4O9EA 1YJLA 4AR2A 5HCHA 1OA3A 2KA3A 3RPQA 3HMYA 1ONAA 5LRRA 3ZKUA 2XDVA 1HB4A 3S7EA 1ZRIA 2ZHMA 3OBZA 2E63A 3L2YA 3NWKA 4IV3B 5FK8A 4JKLA 4IGPA 4FTBA 1COV1 5JIUA 3ZN4A 2ET7A 4BQ5A 5BNQA 4HPKA 2ZX4A 3N35A 1BEV1 3BTXA 3KQ4B 5FLJA 1LOEA 5I8TA 3H1YA 1CAXB 2VMGA 1RUI2 2HJIA 3T1MA 2VQUA 3MIEA 1VBC2 4YZ4A 5C7GA 1JN2P 1D4M2 1NT0A 4PQQA 2CDOA 3ZR6A 5F5CA 4YZ3A 2VBDA 1V0AA 4Z82A 5IVYA 2JKXA 4CP2A 5BXXA 1WW5A 1HXS1 3ACGA 3ZFEC 5D8AA 1YQ2A 1O3TA 4LBJA 2WO2A 4N90A 3VBUB 3ZXGA 2V5DA 2NLRA 4KQ7A 4LXLA 3IWZA 4YNIA 3PTYA 5FZGA 3CMGA 5HBAA 3U07A 3LOIA 2E33A 2VOTA 2ZGSA 4J6GA 4CDQB 4WM8B 5KC6A 1JOJA 1VRH3 1AR83 3IPVB 4CE8A 5FWJA 3U0ZA 1VBE1 1AL22 3USUB 2KM2A 2YBSA 4XF9A 3WF1A 4FTEA 3B69A 3CF6E 4NWVA 5LA9A 3CJIA 4OYUA 4OHVA 5IVEA 1ZZ8A 5A3LA 1AR72 4P9LA 2ARCA 1Z7S2 3WG3A 3T30A 4CP0A 2R072 3J7MA 4KWKA 4QKFA 2ZGPA 2HKXA 1QF3A 4YW6A 2PAMA 4GH4A 5LASA 5DZEA 3THCA 3AP5A 3AZYA 1VP6A 4B4PA 4Z8BA 2VVEA 1F4AA 5GLVA 4GA9A 1W6PB 3PVOA 1RMU1 3U11A 2WNUA 3PVBB 1IQAA 2KR2A 4IV3C 1ULDA 3VB9A 5FYVA 5T52A 2OUHA 4YG0A 3TNPB 4LEJA 3VBFB 3RJRA 1WCKA 1X82A 5J48A 1JMUB 3TWIA 2XQRA 1XC6A 5CFDB 1ZZBA 2WYFA 2CWMA 3BIEA 1ASJ1 3CEWA 1FMD1 3POGA 4YPJA 2A73B 2XKPA 4MX3A 4QKDA 3PDQA 1BBT3 4QDSA 4FAHA 1EUTA 2RHPA 2DURA 1W9WA 1MQTB 5KR7A 4LA2A 5KXDA 1J3PA 2QQWA 1W8FA 2VQAA 1AJOA 1D0GA 4IE4A 1CVNA 3VKLA 5FO7B 1NA1A 3ZSEA 4D3WA 1MZEA 2QQVA 3H0OA 1HJFA 4Q29A 2ZGUA 1GZCA 5A80A 2D93A 5IK4A 3VBUC 4A6SA 1I9RA 3FFQA 5IFTA 1URXA 4CDQC 4WM8C 2RS12 3MHZA 2VMFA 1FOD1 3NJZA 4IE6A 5A1AA 4FSJA 3VD5A 5JXHA 3I59A 3BTZA 1W6NB 1UW8A 1W3VA 4UWDA 3C7FA 4FPOB 5C5UA 4M00A 5JZGB 5FPUA 1NY71 5DG2A 4XJAA 2Z42A 4JGZC 1LJ7A 1OXCA 2ATFA 1VJ2A 2JICA 3DKQA 4GB31 3TEXA 1JZ8A 2JJ6A 3MLKA 4XACA 4FFHA 2CGOA 1H6XA 2W0XA 1JYIA 3CIHA 4AEDB 2W95A 2QJVA 1O4YA 3TEWA 5JAXA 3ZXJA 3AKPA 2HWB3 2SLIA 4MGSA 1BZWA 1NAEA 3RQ0A 3IIAA 1PM7A 1LKNA 3VBFC 3VBSA 4EJRA 2FMYA 1VB4A 1QQP2 3OF1A 1DYPA 2PAEA 4M3CB 5CKMA 1YO8A 3ZYRA 5CFDC 5FYMA 1MS3A 2VBBA 1XXNA 5EIYB 3K51A 3WW4A 3DF0A 2QQIA 4Y33A 3TRSB 4DEVA 1FX5A 2D6KA 1VBA2 2GMMA 3KV9A 4KBBA 2XUMA 1MQTC 4BDVB 1QDCA 1W04A 5FY4A 3VHPA 3H3LA 1CIYA 1YFUA 1ZX5A 2ES3A 2W39A 5D21A 3MZHA 2BWCA 5FKCA 3T2OA 2W47A 5A7WB 1WGPA 4AVVA 1ZNPA 1XJAA 4QB6A 4D7SA 4XFFA 2FDIA 4NOTA 3A23A 4JQTA 4OI2A 5A1LA 3FX3A 3I2JA 2A70A 5FZ8A 4BCUA 5GZDA 3RJ2X 3NNMA 1QJU1 4FFIA 4BXFA 5FZIA 2WN3A 1RUH2 1GSLA 2VAUA 2W87A 2Z4FA 5FZ6A 2B9VA 2JG8A 3THPA 1HRV3 1GP6A 2AC1A 2MNGA 3ABZA 2VW1A 3CHXA 3K3NA 3MPPG 3WX5A 4DB5A 3KT4A 1GZ9A 1RUG1 3E6BA 3WDXA 4CU9A 5I93A 2JDUA 4CEYA 4DPNA 4BIOA 5JZGC 1CAVA 3H7YA 3NNLA 2Q8DA 3W21A 4RA0A 1HRI3 1CJPA 1UO9A 4B1LA 2HEVF 4BMEA 2RR11 2R063 3JBG2 3I2KA 4XTPA 5E89A 3B7MA 4FPHA 4AEDC 3AKQA 2DTYA 1CIWA 1HX6A 1N3OA 1PK6B 1Q5OA 1QWRA 1YI7A 4M4RA 1RITA 2UWBA 4QU1A 3BYWA 3NV4A 4I3GA 4O7XA 4AI3A 2YB7A 3LQCA 3WDYA 1LOFC 4BLIA 3PU3A 5BNOA 3DKWA 2JDYA 3QH6A 5DUVA 4QXBA 3V0BB 4PF5A 1B35A 4HKWA 3VBOA 4K1ZA 1ENXA 4CEWB 1UPIA 3AP6A 4XTMA 4K3UA 4DEQA 3ZFFB 5EJ3A 4CCLA 1MVEA 4WVWA 5FY8A 1XE7A 3RNSA 4GAZA 5CG9A 2RS51 2AZ5A 3WLUA 3U14A 3VZJA 1LENA 1PGL1 2AEZA 3PVNA 3GJAA 2VMDA 3TYJA 3VD3A 3O5SA 1PGSA 3VHRA 1N1SA 1PO13 1O3QA 1LEDA 4M0HA 4M0NA 4MGQA 1QOTA 4ISRA 4Q4W2 3E5UA 2HYKA 1QIQA 2VTXA 3IKWA 2PELA 1EY2A 2GMEA 3D82A 2RM23 1LESA 2HWC2 3GJBA 1NCQA 2DFBA 1N1VA 2WJSA 4UW5A 3T09A 1OH3A 3S7IA 1NCRA 4NIDA 3BIWE 4C1WA 5T50A 1QOSA 1S0IA 1V9U2 1C57A 4FPCA 2ZZJA 4D7TA 1SPPA 1GLHA 1R1ZA 3POEA 3ZXKA 1CJDA 4AL9A 4ATFA 4U36A 4Z1VA 4ZY9A 4UFKA 1GFF2 4CPBD 1PM4A 5LEJA 2VM9A 4E2QA 2BWAA 4YW7A 4N53B 4D7YA 2VTXJ 1E5IA 1XU2A 5DDJ1 3WW1A 3DV8A 1PK6C 4JC1A 4FP2A 5H9SA 1ZBA3 1B09A 1QJY1 1YUDA 2UYAA 1SG3A 1A34A 3UJQA 1DQ5A 2ZX0A 1NXD1 4XQWA 1XBFA 5DAPA 1CZVA 3I4IA 4DMIA 3WV6A 1W0PA 3T3YA 4CEWC 5FK7A 2GN3A 3NAPA 1LULA 2YMZA 1EUUA 1Z0HA 2HLEA 4XUNA 3AVRA 1C8M1 2LALA 1O8PA 3ZFFC 1BK1A 2D5HA 4DOUA 5HXMA 3KGLA 2IVIB 4KGGA 2BTVC 4XHXA 1LOGA 1SCSA 1CQ9A 1YWKA 3AP9A 4YSFA 1TEIA 2WL1A 1GWKA 1WW6A 3N3HA 3BCWA 1AX2A 3SNMA 2HWF3 1X50A 3K75B 1UN1A 4FCAA 4NUBA 4BHPA 1XYOA 5JMOA 5FXXA 4OQ8A 1UIJA 1LGBA 4Y20A 5G05L 1IS3A 4NRMA 4GMP1 2L9LA 3WG2A 4LBNA 1UPSA 1HIXA 4N43A 2D97A 4E4ZA 1JBCA 3HVDA 4NAMA 1HXS2 3GZAA 1JUIA 1DHKB 1A3KA 2JIJA 1WW4A 2YPDA 4HPKB 3BI3A 3RGBA 3H8OA 4YWAA 4DQAA 1OF3A 3PUHA 4DINB 1RUC2 5A3UA 5FO9B 2QQOA 2WZR1 4X8NA 4YW3A 2ENRA 2JD4A 4FI9A 1LHNA 2YPJA 1NYWA 2WKKA 1RVF3 1SLIA 1VBE2 2QQKA 5ACA3 2DU1A 2BBVA 2D6LX 4AAXA 4JKMA 1ULPA 1PMHX 2R043 3ZKYA 4UBHA 3TN93 4HVQA 4N53C 3HBZA 2VCBA 4Q0SA 3ZVXA 2YC2A 4B4QA 1V6MA 2E32A 1GZWA 4GQ7A 1OH4A 2XJPA 4QKNA 4YM0A 2E9QA 5D8AB 1YJKA 2VECA 2OT7A 2WZPP 2CYFA 3WW2A 5KWRA 4XJ9A 1UY3A 4A7ZA 3AMQA 5FMDA 1DGWA 1N3QA 2PA7A 3PJYA 1H2LA 1HQLA 3FHQA 5A6QA 3RZHA 1OKQA 3OEAA 2WA4A 3K48A 1DZRA 2XOMA 4BIFA 4QB2A 5KBFA 3KM5A 2XQXA 4Q4X1 5K4LA 1H4HA 1ASJ2 1BHGA 2PMWB 3ME2A 3PHMA 2K46A 4AQ2A 1POV1 1UZ0A 3ILNA 5BV6A 2DFCA 1LNSA 3RMYA 4MGKE 1JI6A 3G6JB 1ND3A 2VU9A 2WS91 2VOWA 1ZZ7A 1XSQA 3ACHA 5DABA 5C8CA 1O8SA 4YM2A 1R083 5F32A 2AENA 1GV9A 4R4XA 2OXBA 2P2KA 2WNUB 1VAKA 1NQJA 4XAAA 3RWNA 3IDBB 1AUYA 2GC0A 2RDRA 2ET1A 2PLV1 1OF4A 4XF4A 1ZREA 1PO21 1UZYA 2GNBA 3OBRA 5BNPA 3EQEA 4XFHA 5IK8A 3C2UA 1W8NA 2Y0OA 2QCSB 2EICA 1OLMA 5FMBA 5FP7A 4HL0A 5JUVA 4Z2AA 2JECA 4Q4V1 3M3IA 4OHWA 4PLNA 1YQ5A 2MHFA 5JOWA 2ORZA 2WABA 4CP9A 3FHIB 4MGYE 2DVBA 1VALA 3B02A 3R4UA 3CKHA 1ZYBA 2QE3A 1RIRA 2Y26A 5C3OA 2DUOA 1YLLA 2VG9A 3N7KA 3LKJA 2VZTA 4CPBA 5GJ6A 4GB32 1JZ4A 1XB9A 1JZ6A 1AXZA 1M4WA 5FXZA 3WDVA 3WP4A 1W2UA 5DPNA 1KS5A 2ZGMA 1PZ9A 2IWGB 2QQMA 4CUBA 1IG3A 3CL1A 3KWVA 1PIV2 4TZDA 2W46A 4CCEA 2J1SA 1QKQA 3I59B 2VZ1A 2YFUA 2J22A 3D5OA 3O1UA 3POFA 3RYKA 4G4FA 4OUMA 3HN3A 4XZUG 3LDBA 5HV4A 4NRQA 5JPNB 3MW3A 4FP3A 3VLBB 2XJUA 4IEUA 5M0TA 4QMAA 1H1AA 2DCYA 2EALA 2DF7A 4WVZA 4ZU4A 3ZYGA 4CA9A 2A3WA 2ZA9A 1ODNA 4PCRA 5FMOL 3UL2A 1IQDC 1UYYA 2WNUC 3MLLA 1I3HA 2PHUA 2QDNA 5EWSA 1J58A 2Y60A 1UOGA 3VBSB 2R30A 2FCVA 4W50A 5FZ4A 3VDDC 4OLLA 2YU2A 4IL7A 4XE9A 4Q0QA 3OG2A 1NLSA 4CVUA 5HPOA 5JVVA 1OLME 4ES9A 1UOJA 2W1UA 4MSVA 1ACCA 3KHCA 4JV4A 2WQZC 4EROA 3O1VA 4N9IA 4GULA 5GALA 1RUG2 3WEZA 2WWJA 3MFAA 5BUVA 3KCYA 1Z7S1 1YFXA 4A44A 1TME1 3KQRA 5CFCA 5KHJA 3QH7A 3T2PA 1DLCA 1X8MA 1BXHA 2WWSA 5GLWA 2C26A 5CVRA 5F3EA 2RR12 2R0FA 1J3QA 2VZOA 4ZS3A 4UFHA 3WY6A 3VUOA 3NMBA 3VKMA 4C0BA 1YIPA 2VD7A 4RHV3 4XXAA 4W6XA 3W59A 1IZ3A 4MV2A 4DXSA 5C3SA 1H1IA 1W99A 2JG8B 2P17A 1GNZA 5DG1A 1HN0A 1GOHA 5K9YA 2CAUA 2B7YA 4CEYB 5ABJA 1NUKA 1S4CA 3ECQA 1SFPA 5CAZA 1CAVB 5EP9A 4A7KA 3MIFA 2QZ3A 2B46X 1C5HA 1PX4A 1H1MA 3LAGA 2RS52 3THTA 3SH3A 4PDWB 5HCFA 3ZFGA 3AZXA 1PGL2 2A71A 5L9BA 2XKOA 3N4MA 4MGTA 1J83A 5DUXA 1RUE3 1VR3A 4IGOA 1WLTA 2C4XA 2WINB 3UKNA 3NKGA 3VBSC 1VMHA 3W58A 4A6OA 4C8DA 2WFF3 5ANNA 4KG0A 3HOBA 3FBMA 3NJVA 2YDEA 4RL7A 3VBOB 3N7JA 3BKZA 4LBOA 1ZZCA 2RS11 3CQOA 2PFWA 4YGEA 2O1QA 5FUIA 3EJKA 4XOGA 2D43A 5DAWA 3O0WA 3AMHA 1FPN3 2J7MA 3IAPA 5SV5A 2NZ9A 5TSWA 4LT5A 1JZ3A 3SH5A 1AXYA 3FL7A 1EV11 2EVXA 5GLZA 2BU9A 2BEOA 3DCQA 4AFBA 4Q26A 1V6OA 1QH7A 2ZOEB 3KV4A 4HT1T 4YZ5A 3UNPA 1U12A 5GLTA 2WT2A 3DXUA 3K4DA 3I2HA 4B7KA 4HSLA 1WD4A 1NCQB 2QKDA 1NLQA 5JDBA 4X6RB 1QJY2 2ZMKA 2A3XA 4FXKB 1ZBE3 1QQP1 3EHKA 4AK3A 1NCRB 5JR7B 5J1XA 2VMEA 4AGVA 1PVXA 3OB8A 1SPPB 4ZHNA 3NV2A 4CEYC 1DQ2A 2CAVA 4E4DX 1VBA1 4DUVA 4MHRA 3I8TA 3QCWA 3BPSA 1UYZA 5ERLA 4PDWC 1OQ1A 2O14A 2BV4A 1U5YA 3O14A 2P6CA 5H9QA 4QHZA 5AC93 5CA6A 3OUHA 2R16A 3GHMA 2PHRA 2OW4A 3WQ1A 5DMYA 2A6ZA 1N1YA 2VULA 4GJYA 4KU8A 1G9CA 1LEMA 3KF5A 1L7QA 3ORJA 2E31A 4NIIA 4GWJA 3BALA 3VBOC 1HB3A 1PNFA 1RUH1 1MS8A 1ULGA 3NAPB 5FP9A 1UX6A 4DXRA 4EV0A 4CCDA 2OPWA 1DBNA 3JB4C 3OPZA 3UKVA 4MVTA 2VW2A 3EO6A 5I0UA 2MEV3 2ZGTA 4QX5A 3WNNA 1V6IA 1S0JA 2WWUA 2WZR2 3WR0A 1JZ2A 3POSA 4X8PA 1GP4A 2KXLA 3JCIA 3V56A 3JBG1 4K8FA 3WUCA 1RHI3 4Y20B 2VZPA 2PHLA 1K45A 2WQ4A 4I30A 5H9PA 1LAJA 3TEYA 5F37A 1DQ1A 3HBKA 2WRAA 4N43B 1ZA4A 2P4EA 1NCQC 5J37A 4XQDA 3N9MA 1BJQA 4Q1PA 5FRAA 1NCRC 3FLRA 1GWMA 1COV3 4LHSA 1NZIA 4LORA 1J1TA 3SH4A 1PZ8A 1IKQA 1CONA 1JU3A 4BQXA 1BEV3 1LGNA 1O5UA 2JE9A 2AUYA 1OMIA 3INAA 1ULOA 2HBTA 2WAAA 2WSUA 1BK0A 1QJFA 2XLAA 1POQA 3U75A 5EYYA 2D3SA 3GDBA 2IXJA 1VMFA 1ZRRA 2ZXQA 2A6WA 4DS0A 4V2WA 1GZWB 1QXPA 4XUPA 2WS92 4YARA 4BWOA 1S55A 5LA0A 5FPVA 1OFSA 2DBIA 4KWLA 1YQ6A 4HKOA 4XILA 1RUF1 1UU6A 4IEOA 1Y9MA 1Q3EA 4FOYA 5GZGA 3OCPA 4K9SA 3NAPC 1XYPA 2VZSA 4QQHA 1YC61 2W3JA 3IMMA 3U10A 1O59A 3JD71 3T2TA 4NJ4A 2GNDA 5C71A 2Q30A 4MYEA 4OI4A 1KFXL 2RS31 1S2BA 5LRSA 4QM8A 5A6XA 5C3RA 3CDZB 3ROUA 1ND3B 3WQ0A 3EXUA 1AR92 1TMF1 2DUPA 2GAUA 4FOWA 3C7OA 4L9BA 4LBLA 5C8CB 4E2GA 3JQWA 4UW6A 5APAA 4QHBA 4YW2A 4YG6A 4N43C 1Q8QA 2ZGLA 5FPBA 1F5JA 2ZS6B 1RMU3 1JUHA 2VY0A 2YGLA 3B9IA 4I0BA 5BNPB 5FYIA 1HB1A 4QGLA 4LBMA 1GU3A 1WBLA 3PU8A 1KDKA 1RC6A 2P34A 4KI5M 4XDPA 4EWEA 4J1XA 3S0MA 1EP0A 4LIVA 4AAPA 4I2OA 1JYTA 1FMD3 2YGMA 3LA3A 2WO7A 4YG3A 2W91A 3MO4A 1KJLA 3PMEA 2IFWA 2YC0A 4LJHA 4RS5A 5IAXA 4AHXA 1W8ZA 4AEKA 1Y3TA 3N9PA 3HWJA 1W8UA 3SQOA 5C70A 3KGZA 2QVSB 2WO1A 4M4PA 4XYXA 4HBNA 3N9NA 3OTFA 1WA6X 5EQUA 5FLHA 5A6YA 2VCMA 3I3QA 4H7LA 4OCTA 1CR7A 1O4ZA 4MXVA 4P9JA 5FZLA 4A3ZA 1AR61 5HV0A 1PNGA 2VXJA 5C8WA 1SLTA 1JZ5A 1SHWB 3SITA 4PT6A 3GNEA 3KSCA 4QGNA 2OPKA 1UU5A 5KHKA 5FZEA 1RUC1 4TTGA 2DCZA 1FOD3 2ZX2A 3MIBA 4A45A 4DZGA 3H42B 3IAQA 2XBO1 4NHKA 3ZPYA 2HBUA 3S6PA 2N7GA 1NOVA 2YBKA 4DY3A 4P9WA 4EZ4A 1ND3C 4PI0A 5FYYA 5B4XA 1O3RA 1VBB1 4NIGA 3CO2A 3B93A 2ETEA 5C8CC 4Y1ZA 2DYCA 4BM8A 3VBRA 5IJRA 3O0XA 3R6SA 1NQDA 4QXKA 4HN1A 4AFAA 4Y4YA 1TME2 2KD7A 4ITCA 5JOXA 3FN9A 4JDMA 3IDCB 4CP1A 1KEXA 4MXWA 5BNPC 2ZEZA 3J8F3 5T5OA 4HSJA 3ILFA 5DZGA 1UYPA 4HZFA 2D98A 2IC1A 3UETA 2BPA2 2DUQA 3ILRA 4MZUA 5AFEA 1X9TA 3R4SA 3BN6A 3POYA 1EPZA 4FFFA 5CFCB 4JZRA 2QDRA 5LK5A 1UKRA 3AXDA 4K8RB 2TEPA 1J3RA 3KCXA 5KHGA 4RGKA 2V4AA 4L97A 4IE0A 4Q5OA 3A22A 2YROA 4L92A 5JSRA 2XJSA 1CPMA 5E88A 3ZYHA 1RUD2 3K4AA 2FHRA 4IE5A 1JHJA 4JQRA 1IPKA 1QJU3 2HWD3 3LIGA 3T0BA 1FAYA 1OD5A 3ALQA 4LQRA 3LDRA 4YYOA 2PHXA 3VZMA 4DNYA 3OPWA 5ABJB 1V6JA 1VBD3 4Z07A 1US3A 3GZTB 2J1TA 4F7ZA 2FMDA 1O91A 1SACA 2EIEA 3L9JT 4HN0A 3H8XA 2IVJA 1JYVA 1PX3A 4LO4B 5EPAA 1W6QB 4XBNA 3MBWA 3ZFGB 2WZ8A 1T2XA 2FZ2A 3KD4A 1AXKA 1EV12 2YHJA 4XF3A 5EJZB 3WXPA 5L7OA 1BVVA 4XFBA 1J59A 3PUSA 3IMNA 3VD4A 4LUKA 4WV8A 5J98B 4F8AA 3ATGA 1G8WA 3N9OA 2YZ4A 4OZOA 1JZ7A 4KMQA 4KWUA 4I0AA 3H8RA 1OQEA 1W9YA 1UY1A 1PIV1 3LB9A 3KMHA 4HG6B 5F7UA 2WDBA 1VRH1 1AR81 2O0OA 3GHNA 1MVQA 2Z5WA 2QQNA 3UJOA 4IEXA 4KGQA 2GH8A 1R1A3 2XLFA 3M3CA 3DPRA 2ZGRA 5F2WA 3ETQA 4J25A 2UWCA 4BMBA 1F9KA 1RTVA 2XR4A 5CFCC 2Q8OA 1PVC3 4Q4Y2 1MS5A 2RJ2A 2XONA 2OZJA 2OUJA 1OD3A 4XURA 1SZBA 1RUJ2 5EFUA 3WF4A 4AQ6A 2AYHA 2ZAAA 3ASIA 3HIFA 3UKTA 2VTFA 2ARAA 3AMMA 4LKEA 3S5QA 1UXXX 1K3IA 2P5BA 1GICA 3TBDA 1BKZA 3WHTA 2XJVA 4AI0A 2DTWA 3DL3A 5JXIA 5FZ3A 5FAXA 1VLNA 4LO6B 5ABJC 2WZEA 2F17A 2OYZA 1MZ6A 4XXPA 4H7MA 5FQ0A 3K4ZA 4KG8A 2NP0A 4O9GA 1W0NA 4BE3A 1H2KA 5JSPA 1NE4A 4QPGA 2K2SA 4URAA 3ZFGC 4AVAA 5A7NA 3C8XA 3GF6A 3MW2A 1IG0A 4CU8A 3T4HB 2IXKA 5T54A 5LB6A 3MV01 4IESA 4LO5B 4QB1A 1UIKA 4AQTA 5C4WB 4UFLA 5DDJ3 4R8HA 4CTEA 2VVFA 2VZUA 4W4ZA 4JVAA 2P37A 2WUHA 5J3UA 3FLTA 4QWNA 3AYEA 4QXCA 5FYTA 4BK5A 2CV6A 2EIDA 1WLCA 2Q5TA 2X5IA 1WA4A 5HCAA 3HQUA 3UGFA 1UMIA 3I3BA 3N9LA 1OT5A 1OUXA 2Y0IA 4EN8B 1IS6A 4JTOA 1ULFA 2ARBA 3POJA 1C8M3 4NHMA 3WG4A 3O1SA 4XABA 1JXNA 1ULEA 3WOGA 5JXGA 2CNAA 2EXJA 4P9IA 5L19A 1GBGA 4OUEA 5F3CA 1OVSA 4FPJA 4PQ9A 2GC2A 4YFWA 5F3GA 4A42A 4N7IA 4ASKA 3M1HA 1N1TA 2WA3A 3DYOA 4X6QB 3I97A 4Y1YA 1QXJA 4TWTA 1W2OA 2QQJA 4GMP3 3TB0A 3VL8A 2ZEWA 4XDQA 3K77A 2Q4SA 2RDNA 4IDZA 5A6ZA 3RVHA 3OYWA 3LGRA 1JYWA 2Y6GA 1RUF2 2JX9A 2BZDA 2GU9A 2LROA 2CHHA 4FFGA 1CN1A 4UYBA 1O3SA 1YXWA 1OLRA 1W3XA 3JD72 1AYM3 1BLZA 3KV5A 2X05A 2VUAA 3U4XA 4PLMA 1YI9A 1DZQA 2RS32 1WCUA 2A1XA 4U2AA 2ZHKA 3WNOA 1VRBA 1DQ0A 2W1SA 3W5NA 2DBNA 1VB2A 4S2FA 5E6HA 2TNFA 5FP3A 1UNBA 1JOPA 4Q0VA 5C4WC 1SDDB 1TMF2 3AKSA 2WAOA 3RZZA 4R9CA 1X9PA 4FPKA 4Y5SA 5FY9A 2W94A 3HR9A 1W06A 2GSYA 4V2VA 1FNYA 2W1QA 5IATA 3LEMA 3WG1A 2PTMA 4I3PA 1SBFA 1WUVA 4K6BA 3IT8A 5IUQA 3J4UH 2ZMNA 3A21A 3BTAA 5JXJA 2BW8A 2W1WA 3VV1A 3S57A 3USSA 1OBNA 1QNYA 2R1DA 1O4TA 1O6UA 2R1BA 1G9AA 4PIZA 1QU0A 4NVPA 2Z79A 3ZXEA 1R092 3O1TA 1QJX3 4Q4X3 3WT3A 1SLAA 2R6QA 2OA2A 4P08A 3ZIWA 4ARXA 2Y6JA 2OKXA 4M01A 1H2NA 1JOBA 1HRI1 4NHLA 2Y6LA 3I7DA 2BGPA 2K9ZA 2UURA 3OOXA 3ST7A 3OJBA 4QX2A 1C1FA 4YW1A 3BODA 2LW8A 5FIXA 2BQPA 2BJSA 5IVJA 1ENSA 3VDCA 4E8CA 1EAH3 1LHVA 1LR5A 5FYHA 2DCJA 3I2IA 4Y1VA 4HKLA 4LBQA 4E9KA 3I2DA 2PLV3 1AR62 4Q1RA 3WNLA 1PO23 3KVBA 4XJ8A 4SLIA 1R64A 4UW4A 5J09A 4Q4V3 2WYSA 1S0DA 2NPIA 3DUIA 1FYUA 5L9RA 4NR1A 2RMU3 3B01A 4RS5B 3JB8A 4WZFA 4OI1A 3NRUA 3VD7A 2XBO2 4BLJA 4YLZA 1LHUA 3NJXA 3VDAA 2BDRA 1ENRA 1MEC3 5FP4A 3LEKA 3WP5A 1VBB2 2IXCA 3LIHA 2WNEA 5FUPA 4YW4A 2Y8KA 3VZLA 1W8TA 3PMSA 1XQNA 2YUEA 5FCCA 1E5SA 1AYN2 2RM21 3Q8AA 1W6OA 2EIGA 1YRZA 3E5XA 4NIAA 3ES1A 1J1LA 2UY8A 3LEIA 3LPGA 3P1IA 1G86A 5C5TA 1BQPA 3FZ3A 4QPYA 3Q8BA 3SCHA 2H0BA 2ZGOA 1WMEA 2XL9A 3E6DA 3F95A 4XZPA 5I0TA 4AEMA 4RQPA 5T3NA 4OMCA 1H9PA 2D6PA 2EXKA 5DAQA 1BCXA 4AI1A 2ZJCA 1Q8OA 2JDNA 3OGJA 1O5LA 1RUI3 4D6SA 2BVVA 1RXFA 1XE0A 1VBC3 1G7YA 1D4M3 2VZRA 2BUKA 3CJIB 4AXOA 2E7QA 2VUJA 3VBRB 4COWA 2WT1A 3JZVA 1OPMA 1HQWA 1Q43A 3UGGA 3AMPA 4GH4B 1LU1A 3M70A 2TUNA 3AL6A 3A0KA 4LMFA 1F2NA 3Q8FA 2EF6A 3BOWA 1AJKA 1SLCA 2GDFA 4ZKTB 1GZTA 1W6MA 4R52A 4O61A 2AEYA 4XC9A 1DYKA 2J42A 1CESA 3I54A 4W8JA 5IVVA 4CUCA 3T08A 5FR3A 3OUJA 4NPRA 4MLOA 1TQ5A 1AL23 5CZKA 2JKBA 1DZTA 1APNA 4Q0PA 3QACA 4NHXA 3N9QA 4EZHA 1D2QA 4ZU5A 4CDXA 4LIUA 5HCBA 4PHZA 1AR91 3W5MA 4PF1A 1AR73 2YBPA 1Z7S3 2B5HA 2V09A 2R073 1S0EA 5KXEA 2ZCWA 4E4HA 2HYXA 1YHFA 1NA1B 4INDA 1GMMA 2XH6A 4IV1A 1CX4A 1GOGA 3E5QA 1WCSA 4RGGA 4XMIA 1NLRA 5A7PA 5FZBA 4Y3OA 4ZONA 3M3OA 5D8AC 2E51A 4AYUA 4Q27A 2BGOA 2D6OX 5FZDA 3O0VA 5FY5A 3B3QE 2D44A 4IE7A 4UT5A 4XPVA 3AP7A 2PHFA 4E27A 5J36A 4ZPIA 3LOBA 1LOBA 3RSJA 4CXWA 4DXTA 2YG0A 4YGBA 1VRH2 1W28A 1AR82 2JE7A 2I74A 3MDPA 4TLGA 1CZTA 1WCDJ 4S2GA 5GLUA 5ACA1 2FCUA 3CJIC 2IUWA 2VJXA 2D5FA 3VBRC 2R041 3ZYPA 4EQVA 4K40A 1DFQA 5EV7A 5JMCA 4A7YA 5F9TA 1SBEA 3ZMOA 3ZYIB 4GH4C 2A7AA 3AK0A 3KLSA 4E8DA 1TNFA 2DWRA 1Q8VA 1ZZ9A 4Y5Z0 3MGUA 1I5ZA 3WDTA 1XYNA 2W08A 4KNCA 4GD4A 3NW4A 2EXHA 3WNXA 2PQSA 1C8NA 2RS13 2Y34A 4XUOA 2R32A 4CDQA 4DXZA 2RE9A 3IBMA 3DPRB 4WBBA 2BVBA 1FATA 2EXIA 4M3CF 3GYDA 3NSTA 3BU7A 2GALA 1BBT2 1EYBA 5I91A 1SLBA 1BMV1 3WD5A 2AGSA 4TSVA 4G3YC 2FDJA 4JGZA 4Y1UA 4MUVA 1FT9A 1NA1C 2J1VA 3CNAA 3MF9A 5CU1A 3VHOA 1UY0A 3FFZA 3KVAA 4CCKA 5F5QA 4F83A 5FUNA 3UT0A 1DGRN 4IEYA 1GNYA 2PN5A 3AL5A 3GALA 4GZ9A 1W9SA 1QY4A 2VUDA 2H0VA 1JYNA 3WNPA 3PJQA 1QQP3 2Y6HA 4LULA 4HETA 4CRQA 4LLFA 5IWFA 1QH6A 4Q8LA 3VBFA 4RYDA 3ZMNA 4QXHA 4JCKA 2GC3A 1C1LA 2ZACA 4XFAA 5FQ0B 4W65A 3MF6A 5A7SA 4BOWA 2ZX1A 1VBA3 5DUUA 4QPGB 2ZABA 3ZIXA 2ADEA 1KRIA 2GH2A 4WVVA 4C91A 3RYPA 2B45X 4AZZA 3VD9A 4XQ4A 2VR4A 1NX9A 2X10A 3JU9A 3D0JA 4MGIE 3JQXA 4CUGA 2XUEA 1C5IA 4OZXA 4EWDA 4UFMA 1CZSA 3EBRA 1VE0A 5G04L 1RUD1 1P8JA 2HWB2 1SCRA 3PLQA 2X5IB 5BNOB 5LY1A 4A2UA 1YFYA 5LW9A 1LB2A 1RUH3 1Y7BA 3J26N 2ZKNA 5L73A 1B35B 1IS4A 1V6NA 3GBFA 4LHNA 1TG7A 3VZKA 5JLVA 5FV3A 4CXYA 4BXSV 4L11A 3APBA 3H8UA 1ALYA 3DPRC 4N9HA 4Y22A 1ZRCA 3AZZA 4FAGA 3TAYA 5FZ1A 5LA2A 3R0RA 5FREA 5F6KA 3ZM8A 4O65A 2A6XA 2W9XA 4AGGA 5A32A 3I3EA 2W2IA 3JBG3 1D7PM 4XBQA 4BQ3A 2DDUA 1BYHA 4BA6A 4AE2A 2OIIA 4CU6A 4HONA 1TE1B 1ZRDA 4CXXA 2JXAA 1X7NA 2BNNA 4GWMA 1FV3A 1K5MA 1RJ8A 1ZVFA 4P02B 3ZLIA 4AGRA 2CL2A 3Q9OA 4QX8A 1OVPA 2ZGQA 3S30A 4Z2WA 4MHUA 2FDKA 2JG8C 2JB8A 3J7HA 5KC5A 2FDGA 3BUCA 2E26A 4NMIA 1HDKA 2JENA 4DO0A 2NYYA 4LKSA 1HRV2 3WNKA 1UAIA 1UD1A 2W68A 2FBEA 4LNVA 1DLLA 3ZXDA 3ETPA 2BNOA 2G1MA 2ZGKA 4IXLA 1VPHA 3V0AA 5I8YA 3LE0A 4Q4Y1 1UYXA 2ZHNA 4WZCA 5A3PA 4YW5A 3KHBA 4AFCA 1HRI2 1RUJ1 3RYRA 4TLFA
chains in the Genus database with same CATH topology
2R062 4HANA 1NXMA 1XRUA 3T1LA 5LK7B 4Q4W3 2ZGNA 3URFA 5FMOS 3M7AA 3MEPA 4WVMA 2E6VA 4L99A 2HWC3 4QU2A 5EZWA 5BNOC 2GNTA 2V73A 4RR3A 1B35C 2XLGA 1SDWA 1UCXA 4PLOA 3AJYA 4XJWA 2WLQA 1KD7A 1V9U3 3V65A 4C1XA 1RL3A 5GM0A 4JTNA 4ORFA 5SV8A 1OOPA 2I2SA 4XFGA 2VPVA 5AFBA 2E53A 5BNNA 2IXIA 4JDOA 3WCSA 3FUQA 1CD3G 5FBZA 1PO12 5GZCA 1RUE1 1LU2A 1DGWX 4AF9A 4YVWA 3FBYA 4OFGA 1A78A 4LBQB 2WFF1 1SFNA 4YFZA 2RM22 4NN0A 2SBAA 4FXGB 2ILMA 1I6XA 2VQ0A 4LBKA 2HWE1 4M3CE 2QNKA 3CJXA 3RG0A 2RJLA 4FOQA 4OHYA 3SXWA 3O7OA 1X33A 5FTTC 5JPMB 3VN4A 3ZN6A 2YY1A 5F6LB 5H9RA 1U5ZA 5LEKA 3H7JA 2VXRA 2PQQA 4IERA 1W6OB 4COZA 2C1FA 3MIHA 4KH9A 1GNHA 3ELNA 1ZBA2 1CAUA 1ZBE1 3AYAA 1HXS3 3RI9A 4Q8KA 2NMOA 3MFCA 3E6CC 4RQPB 2F6BA 4RSUA 2XVLA 2ZMLA 2BNMA 1RUC3 2E7AA 3X29B 1M06G 1WBFA 4IQPA 2P3KA 5F1RA 4YZ2A 1F8VA 1VBE3 1QHDA 4FOVA 4Y26A 1Q56A 4FVVA 1MS0A 1REEA 3ES4A 1SFYA 2G4IA 1UKGA 2HWF2 5GZFA 1MS4A 2Q1MA 2P3IA 3ZSKA 1QJZA 4GWNA 2QZ2A 1W6MB 1OLQA 3A4UA 4GKYA 4L2NA 3ZSLA 4EN9B 1X36A 2WT0A 3MIGA 2LUWA 2UWAA 3AJZA 5JOYA 1LOAA 2MEV1 1OPOA 1R091 2NMNA 2WIIB 4LTAA 2TBVA 1ASJ3 4CDXB 4BQ1A 1XE8A 4FQ4A 3R05A 1RVF2 4GALA 5ACA2 2A5ZA 1RHI1 2R042 3OY8A 4IV1B 3TN92 3HT1A 2A6VA 3VGIA 1NZCA 1DGLA 2XJTA 2Z2SB 4NO4A 4AWDA 3UK9A 4RQPC 4XFCA 1OQDA 4K20A 4COVA 1SLLA 3HN1A 2UY9A 2D6NA 2DVGA 2B8MA 3H9AA 1JTZX 2LTNA 1W0OA 3VL9A 4OVEA 3FMGA 1LECA 4C0HA 4GB33 1PMIA 5KHIA 1BMV2 4S2HA 2C5DA 1R082 1AYN1 4META 4Q2FA 4AI2A 1VAVA 4AFMA 4ASLA 3WP3A 1AVBA 4JAAA 1YIFA 1WLWA 1PIV3 5CG8A 3SCGA 1IOAA 5C9AA 4URTA 3N7MA 1U0AA 4HVOA 2H6BA 4CDXC 1N47A 4XJZA 1XNKA 2D6MA 4JGZB 1X8EA 4IV1C 2NN8A 3WINE 4YZ1A 4DRVA 3G7DA 2P3JA 2ZTNA 1A6CA 2XGXA 4HMZA 4WM7A 1KDMA 1DGRA 4IETA 1E57A 2GNMA 2XWBB 4XJUA 1NG0A 1AL0G 1S1AA 2IFRA 3VKOA 5I0SA 3VDDA 3WP6A 1MS9A 2H6CA 4E4SA 5C6CA 3ZSJA 4B3NA 2BYVE 1RUG3 3KT7A 2PYTA 1L3JA 2WSVA 4LA3A 4FBFA 3AKTA 2RR13 2GN7A 3J9SA 2D3PA 1IGOA 3H1MA 3TNQA 1H2MA 3OBTA 4H55A 5FPZA 3M8LA 4XEZA 1C4RA 2VGDA 2GZWA 1GQGA 4FPLA 3RMXA 4K21A 5BY5A 4Y22B 3AX4A 3D6EA 3FUOA 3IDEA 1DG6A 4HK8A 4BYYA 3KT1A 4QGMA 5A32B 1MR5A 3OD0A 5CBLA 1XNCA 4HFSA 1H30A 2RS53 5IT6A 2JDZA 4Y1XA 5E16A 5L36A 3SMHA 1K5MB 1HLCA 4MH0E 4LBQD 4AEJA 4B4RA 3J8F1 4RHV2 5T5LA 3ACLA 2G9FA 3V64A 3RDIA 5HXVA 4KU7A 5K7PA 3WW3A 3HT2A 2CWSA 3VZNA 1WMFA 3V0AB 1ULCA 1LHWA 2D40A 4CDUA 2VH9A 1BBT1 1QOOA 1ND2A 2FQPA 2JG9B 3AFKA 4W6WA 4LUMA 3NVCA 5A33A 1QDOA 4AHWA 3MPBA 3AZWA 2X29A 3GZUC 4WVMB 2XB6C 1WMDA 3BOPA 2XG3A 2XHKA 4YVSA 5L7OA 1D2SA 4FO9A 4QPIA 1RUE2 4QQOA 4RR3B 1H8TA 3AP4A 5CNAA 1QJY3 2ZKLA 3MICA 2HWD1 3D8CA 1REDA 3FE5A 2WFF2 4LE4A 2G9GA 1D0HA 4GIQA 1VBD1 4IEQA 3ZXLA 1OOPB 2VOKA 1OFNA 3NO8A 4I01A 2HWE2 4QQ2A 1FPN2 3DGTA 5FLIA 3M3QA 5BNNB 2XVGA 4B8EA 1OI6A 1S0GA 2UYBA 5IK5A 4PDWA 3B94A 1VIWB 4J1WA 4YVWB 1K5MC 1LHOA 3BB6A 4AHYA 2BGCA 2HWB1 2ZBJA 2YXSA 2CY6A 2ZZQA 1KS4A 1KITA 2DVDA 1A8MA 1ZBE2 4MGZE 4LHLA 5FOBB 4BPZA 3A0NA 3LSEA 2DU0A 5BYNA 1R1A1 1FXZA 3AXEA 1UL9A 2WZR3 1ENQA 4OHXA 1PZ7A 4LR4A 2R0HA 3ZN6B 1GQHA 1UF2C 1PVC1 2JG9C 5K0UA 3KB5A 4IEZA 5HI0A 2PAKA 1RUNA 1ZM1A 1S0CA 3ZO0B 4DY5A 2JEMA 2NQYA 3MLJA 4RR3C 1BVP1 5AC92 1N3PA 1CAUB 2I07B 1S0BA 2Q0AA 3W9AA 5JSOA 4L8QA 5C33A 2NM1A 1Y43B 3N7LA 5JI9A 4W6YA 1HRV1 2VW0A 1OOPC 3VBHA 1HQNA 4D94A 2YYOA 2MEV2 4JGYA 5BNNC 3P3PA 4CDWA 4ZU7A 4SBVA 3QBQA 1W39A 1POV3 4YRDA 5CIRA 2VNRA 2R061 3QLQA 1JH5A 2EAAA 2WS93 1RHI2 4QQLA 4YVWC 5FDBA 5EXOA 3WHUA 2WNVA 2DV9A 5JIAA 2ZPXA 3LZZA 1ZZ6A 2ZX3A 5CADA 3MI8A 3WVJA 3LA2A 4ONUA 3D4KA 1COV2 4COUA 3M3EA 3ZSMA 4P14A 1BEV2 3DN7A 2DVAA 1CAWA 2PHWA 1IKPA 1RJ7A 4LLOA 1DU3D 1AR93 3AYCA 3OY8B 1I1EA 2YV8A 4DFSA 5D1IA 4GKXA 2BFUL 1DQ4A 1PO11 4AVCA 4DRRA 1F31A 3B00A 1QNWA 3M2MA 4I02A 1KFUL 2Q1ZB 1PGW1 1UMZA 4UW3A 3VKFC 3QD6A 4IEVA 3RRDA 4PIXA 1SQ4A 4XHBA 1AYM1 1MZ5A 4P9GA 4LHKA 1WW7A 1TNRA 4QM9A 4AVSA 2I45A 1O7FA 2VOVA 4ES8A 3LCPA 2XJRA 1S2KA 1YFWA 3MYXA 5I8SA 4ASMB 5K8SA 1Q8PA 1MS1A 1H9WA 3FWEA 5AVAA 3WUDA 2VOXA 3HQXA 1Z78A 1ZBA1 4GXLA 4FQZA 1C3HA 5A3LA 4RGAA 2WLPA 4MXWB 1AZDA 2AREA 1RMU2 1U5XA 3H3ZA 1VAMA 4K7JA 5C9AB 1MACA 4KL1A 3E97A 3ZFEA 4R9BA 1SMVA 3AZVA 4AI8A 4E2SA 1QGLA 4IEPA 5E8AA 4C1WA 1QJX1 3N36A 4A3XA 3MIDA 3RS6A 2O8OA 1FMD2 2DCTA 4RS5C 1XU1A 4Z92B 1WLDA 4AG4A 1HKDA 2HWF1 1AHSA 4BZ4A 2AH2A 2DVFA 1TME3 3FJSA 2O8QA 3B9CA 2K0GA 4OHZA 1EAH1 1IS5A 4WM7B 1V00A 5FOJB 1AX0A 3VDDB 1YNAA 2XL7A 2A75A 4IV3A 3WCRA 5CB7A 1YCIA 5EYXA 3SLIA 4H14A 1XNBA 1FOD2 2RMU1 2Z69A 1UZZA 3BPZA 1Y9QA 3NKTA 1CAXA 1RVF1 2QQPA 4RFT0 1MEC1 1NY72 2EA7A 3H1WA 4HLTA 4PBPA 1SBDA 3TN91 4LO8A 3VKNA 4CZSA 4EWAA 4NWWA 2A3YA 3AMNA 2C9AA 2EAKA 1KJRA 1KQRA 4JRLA 3SITA 4HVRA 1GKBA 1RUD3 4FPGA 5C9AC 3WQ7A 4UBGA 1A8DA 3J8F2 4QD2A 3VBUA 3TOJA 1G9DA 1EPWA 1RUI1 1CPNA 4WM8A 1VBC1 4D69A 4EN7B 1D4M1 5T5JA 3IPVA 4XF1A 1V6LA 1IHMA 3USUA 4AW7A 3NL1A 1LODA 2ZAHA 1EV13 5DUWA 3LSDA 2BFUS 1R081 3NV1A 4R9DA 2E7TA 4WM7C 5J7MA 3HAGA 3H50A 4I09A 4C90A 2OVUA 3KS7A 3B5LB 1IPJA 1T6GC 1W6PA 5GZEA 1QJU2 5JI7A 2HWD2 2X53S 1AX1A 1LOCA 1AL21 3IN9A 5KHHA 2V5YA 1NE6A 4HK9A 1VBD2 3H3UA 5CFDA 4CDUB 1MZFA 1WD3A 1ND2B 4I0WB 1AR71 5A33B 4Q4Y3 4ATEA 2R071 1MQTA 1RUJ3 4FPEA 4IEWA 2VMHA 5J96B 4PJYA 2ERFA 1OSGA 1YYNA 4YVSB 5L7OB 5BPXA 3GBWA 4QPIB 1KXGA 1H8TB 1S0FA 3WDWA 2D3RA 4FPFA 4OULA 2CGNA 4Q0UA 5KXCA 1REFA 4LO7A 4K1YA 4P9XA 2WC2A 3LWCA 1HV0A 1QXRA 3KCCA 2XVKA 2HEWF 4R4ZA 3POWA 4YGDA 4BH9A 5DZFA 1AF9A 1R1A2 1W6NA 3UV9A 5A3MA 1RB8G 1U5IA 1FV2A 3HD8B 4S2DA 4PIYA 5JZGA 1W6QA 2VNGA 1F5FA 5B2GB 1PVC2 1DDLA 2A6YA 3CLPA 4AHZA 4R9AA 4AEDA 2UU8A 4P5HA 5KXBA 5T55A 4OI0A 3OYWB 1OHFA 1LOFA 1LCLA 2QFEA 4M3CA 2ARXA 4AFDA 2HWE3 4V1PA 1G9FA 5FPXA 4CDUC 1ND2C 1Q8SA 3ZX7A 3KZ4C 5JWPA 4QPGC 1QMJA 2VMIA 5K0UB 2F4PA 2Y38A 3FC0A 5FO8B 1LTEA 2RJKA 4YVSC 5L7OC 4QPIC 1FI2A 2CGPA 1H8TC 1HW5A 1GANA 3GBGA 2LM3A 5DDJ2 4XFIA 5DXDA 3SHRA 4RHV1 1GYKA 3AKRA 4N7UA 2X5IC 4Y24A 1RUF3 5GKAC 3VBHB 3JD73 2B39A 2PHTA 2OZ6A 4JGYB 1C8M2 4CDWB 1RINA 2RS33 4KWJA 4H3WA 4FTSA 3WDUA 5I0RA 4B29A 1LRHA 1TMF3 1GR3A 2WNVB 5C4WA 4LE3A 1D4VB 4YGCA 4OUSA 3JUUA 3SISA 1DIWA 4EN6B 1PK6A 4XBLA 4QT6A 1OA4A 4AQSA 2FZ1A 3CU7A 3SCFA 1DQ6A 1PGW2 3NV3A 4XW3A 1HV1A 1PHMA 1DF0A 3ZDSA 3V0BA 1G6NA 3AB0A 2IXHA 2PHDA 5JCTA 2X8KA 1SEFA 4P9YA 4CEWA 1R093 1FPN1 1CAWB 1AYM2 1UU4A 2D7FA 1C28A 3ZFFA 3ZXAC 1OA2A 5K0UC 2GMPA 4XIKA 2XWJB 4GMP0 4COYA 4AVTA 1JYCA 1FNZA 4G9SB 2IXLA 4XMAA 3ENRA 1H8VA 2W52A 3OGGA 3PVEA 5AVPA 4XETA 2C0ZA 2WFPA 1V6KA 4TYSA 2IZWA 3M4FA 4EN0A 1JHNA 3OD4A 4XIOA 1AR63 5FFOC 4JDNA 3WZ1A 1RGSA 3D0SA 3ZXFA 3VBHC 4RD7A 1RUOA 2DCKA 2R49A 4F3JA 4JGYC 4YM1A 4CDWC 4FPYA 3IM0A 4JRAA 2VNOA 1QJX2 4Q4X2 2XBO3 3P3NA 3ZYJB 1V70A 3FLPA 3ZN5A 1CGPA 5T5PA 4XF0A 1VBB3 2HEYF 2MPFA 5JOZA 2VVDA 2WNVC 3AFGA 3L2HA 3LA7A 4QQPA 4UXAA 4Q4W1 3VHNA 1H4GA 4YM3A 3RI8A 1H0BA 5AC91 4ISQA 4N53A 1AYN3 2ZHLA 1ZRFA 2HWC1 2B9UA 3AM2A 1G9BA 2AR6A 1EAH2 3ZFEB 3MW4A 2PLV2 2QUOA 2GC1A 1PO22 1V9U1 4FT8A 1POV0 5E1RA 3QOPA 2CTVA 3PNAA 4Q4V2 3C3VA 2B42B 4CYDA 2RMU2 4AVBA 5IK7A 3AYDA 3R4DB 4PBOA 3VZOA 4B7EA 2XJQA 3O12A 1XNDA 2XPJA 1JW6A 1MEC2 4ZXKA 1LGCA 4O9EA 1YJLA 1OA3A 2KA3A 3RPQA 3HMYA 1ONAA 5LRRA 3S7EA 2ZHMA 2E63A 3L2YA 3NWKA 4IV3B 4FTBA 1COV1 5JIUA 3ZN4A 2ET7A 5BNQA 4HPKA 2ZX4A 3N35A 1BEV1 5FLJA 1LOEA 5I8TA 3H1YA 1CAXB 2VMGA 1RUI2 2HJIA 3T1MA 4YZ4A 3MIEA 1VBC2 1JN2P 1D4M2 4YZ3A 4Z82A 4CP2A 5BXXA 1WW5A 1HXS1 3ZFEC 5D8AA 1O3TA 4LBJA 4N90A 3VBUB 3ZXGA 2NLRA 4KQ7A 4YNIA 3IWZA 3PTYA 5HBAA 3U07A 3LOIA 2ZGSA 4J6GA 4CDQB 4WM8B 5KC6A 1JOJA 1VRH3 1AR83 3IPVB 3U0ZA 1VBE1 1AL22 3USUB 2KM2A 4XF9A 4FTEA 3B69A 3CF6E 4NWVA 3CJIA 4OHVA 1ZZ8A 1AR72 4P9LA 3WG3A 1Z7S2 4CP0A 2R072 4KWKA 2ZGPA 2HKXA 1QF3A 2PAMA 4GH4A 5DZEA 4B4PA 3AP5A 3AZYA 1VP6A 2VVEA 5GLVA 4GA9A 1W6PB 3PVOA 1RMU1 3U11A 2WNUA 3PVBB 1IQAA 4IV3C 1ULDA 3TNPB 5T52A 2OUHA 4YG0A 4LEJA 3VBFB 3RJRA 1WCKA 1X82A 5J48A 3TWIA 5CFDB 1ZZBA 2CWMA 1ASJ1 3CEWA 1FMD1 2A73B 2XKPA 4MX3A 1BBT3 4FAHA 2RHPA 2DURA 1MQTB 4LA2A 5KXDA 1J3PA 2VQAA 1AJOA 1D0GA 3ZSEA 1CVNA 3VKLA 5FO7B 1NA1A 4D3WA 1MZEA 3H0OA 4Q29A 2ZGUA 1GZCA 2D93A 5IK4A 3VBUC 1I9RA 3FFQA 1URXA 4CDQC 4WM8C 2RS12 1FOD1 3NJZA 4FSJA 3I59A 1W6NB 1UW8A 4FPOB 4M00A 5JZGB 1NY71 5DG2A 4XJAA 2Z42A 4JGZC 1LJ7A 2ATFA 2JICA 1VJ2A 4GB31 2JJ6A 3MLKA 2CGOA 1JYIA 2W0XA 4AEDB 2QJVA 1O4YA 5JAXA 3ZXJA 3AKPA 2HWB3 2SLIA 1BZWA 3RQ0A 3IIAA 1PM7A 1LKNA 3VBFC 3VBSA 4EJRA 2FMYA 1VB4A 1QQP2 3OF1A 1DYPA 2PAEA 4M3CB 3ZYRA 1YO8A 5CFDC 1MS3A 1XXNA 3K51A 3WW4A 3DF0A 3TRSB 1FX5A 2D6KA 1VBA2 2GMMA 4KBBA 2XUMA 1MQTC 1QDCA 3VHPA 1YFUA 1ZX5A 2ES3A 2W39A 3MZHA 2BWCA 1WGPA 4AVVA 1ZNPA 4D7SA 4XFFA 4NOTA 4OI2A 3FX3A 2A70A 4BCUA 5GZDA 3RJ2X 1QJU1 4DINB 1RUH2 1GSLA 2JG8A 3THPA 1HRV3 2MNGA 4DB5A 2VW1A 3WX5A 3MPPG 3KT4A 1GZ9A 1RUG1 3E6BA 3WDXA 5I93A 4CEYA 4DPNA 4BIOA 5JZGC 1CAVA 3H7YA 4RA0A 1HRI3 1CJPA 2HEVF 4BMEA 2RR11 2R063 3JBG2 4XTPA 5E89A 3B7MA 4FPHA 4AEDC 3AKQA 2DTYA 1CIWA 1HX6A 1N3OA 1PK6B 1Q5OA 1QWRA 1YI7A 1RITA 2UWBA 4AI3A 3NV4A 4I3GA 3WDYA 1LOFC 4BLIA 5BNOA 3DKWA 3QH6A 5DUVA 3V0BB 4PF5A 1B35A 4HKWA 3VBOA 4K1ZA 1ENXA 4CEWB 1UPIA 3AP6A 4XTMA 4K3UA 3ZFFB 5EJ3A 1MVEA 4WVWA 3RNSA 1XE7A 5CG9A 2RS51 2AZ5A 3WLUA 3VZJA 1LENA 1PGL1 3PVNA 3TYJA 3O5SA 1PGSA 3VHRA 1N1SA 1PO13 1O3QA 1LEDA 4M0HA 4M0NA 1QOTA 4ISRA 4Q4W2 3E5UA 2HYKA 3IKWA 2PELA 1EY2A 2GMEA 3D82A 2RM23 1LESA 2HWC2 1NCQA 2DFBA 1N1VA 2WJSA 4UW5A 3S7IA 1NCRA 3BIWE 5T50A 1QOSA 1S0IA 1V9U2 1C57A 4FPCA 2ZZJA 4D7TA 1GLHA 1R1ZA 3ZXKA 1CJDA 4ATFA 4U36A 4Z1VA 1GFF2 5LEJA 4E2QA 2BWAA 4N53B 4D7YA 1XU2A 5DDJ1 3WW1A 3DV8A 1PK6C 4JC1A 4FP2A 5H9SA 1ZBA3 1B09A 1QJY1 1YUDA 2UYAA 3UJQA 1DQ5A 2ZX0A 1NXD1 4XQWA 4DMIA 3I4IA 3WV6A 1W0PA 4CEWC 2GN3A 3NAPA 1LULA 2YMZA 1Z0HA 1C8M1 2LALA 3ZFFC 1BK1A 2D5HA 4DOUA 3KGLA 4KGGA 2BTVC 4XHXA 1LOGA 1SCSA 1CQ9A 1YWKA 3AP9A 4YSFA 1TEIA 2WL1A 1WW6A 3N3HA 3BCWA 1AX2A 3SNMA 2HWF3 1X50A 1UN1A 4FCAA 4BHPA 1XYOA 1UIJA 1LGBA 4Y20A 1IS3A 3WG2A 4GMP1 4LBNA 1UPSA 1HIXA 4N43A 2D97A 4E4ZA 1JBCA 1HXS2 3GZAA 1JUIA 1DHKB 1A3KA 1WW4A 4HPKB 4DQAA 5FO9B 1RUC2 2WZR1 4X8NA 4YW3A 2ENRA 2JD4A 1LHNA 2YPJA 1NYWA 2WKKA 1RVF3 1SLIA 1VBE2 5ACA3 2BBVA 2DU1A 2D6LX 2R043 4UBHA 3TN93 4HVQA 4N53C 3HBZA 4Q0SA 3ZVXA 4B4QA 1V6MA