4NN0A

Crystal structure of the c1qtnf5 globular domain in space group p63
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
137
structure length
137
Chain Sequence
ARSAFSAKRSESRVPPPSDAPLPFDRVLVNEQGHYDAVTGKFTCQVPGVYYFAVHATVYRASLQFDLVKNGESIASFFQFFGGWPKPASLSGGAMVRLEPEDQVWVQVGVGDYIGIYASIKTDSTFSGFLVYSDWHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords Complement C1q tumor necrosis factor-related protein 5
publication title The macular degeneration-linked C1QTNF5 (S163) mutation causes higher-order structural rearrangements.
pubmed doi rcsb
source organism Homo sapiens
total genus 27
structure length 137
sequence length 137
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2013-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00386 C1q C1q domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.40 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4nn0A00
4MXWB 3V56A 1JTZX 2WNVA 5KC5A 2O0OA 3URFA 3LKJA 2JG8A 2Z5WA 4NN0A 4E4DX 1WCKA 5BNQA 4QQLA 1D2QA 3ME2A 4QQPA 4QQOA 3TWIA 1OQEA 1RJ8A 1C3HA 2R32A 1OSGA 1A8MA 4G4FA 1PK6A 4MSVA 4DOUA 1D0GA 2WNVB 3B9IA 1U5YA 4QQHA 3K48A 1KXGA 4EN0A 2JG8B 2X29A 2ZJCA 4D7YA 2WNUC 4KG8A 4OUMA 1DG6A 1GR3A 3QBQA 4OULA 5HBAA 3FC0A 3WD5A 2WNVC 1I9RA 4KGQA 1D4VB 2R6QA 4E4SA 5L36A 5KC6A 2AZ5A 2JG8C 3B93A 5TSWA 2WNUB 1XU1A 1RJ7A 4MXWA 4GIQA 2RJKA 2QDNA 1OQDA 4QPYA 1KD7A 2HEWF 3ALQA 2JG9A 4KGGA 3B94A 4DB5A 3L9JT 2R30A 2OIIA 3TYJA 4G3YC 1JH5A 1TNRA 2Q8OA 1O91A 1ALYA 4OUSA 4QQ2A 1PK6B 2TNFA 2RJLA 5KWRA 4J6GA 5CIRA 1IQAA 4RSUA 2Q1MA 4TSVA 4N90A 3K51A 4TWTA 2RE9A 2JG9B 2E7AA 1PK6C 1U5ZA 4F3JA 1S55A 3MI8A 5L19A 1C28A 1XU2A 2TUNA 2HEYF 3AB0A 4HT1T 2HEVF 1TNFA 2QE3A 3QD6A 2JG9C 1U5XA 1DU3D 3IT8A 2ZPXA 4MXVA 2KA3A 2WNUA
chains in the Genus database with same CATH superfamily
1C8NA 5FAXA 1ZA4A 3VBSC 2J1RA 3IKWA 1DYPA 5DAQA 3MLJA 5LA0A 3FUQA 3BN6A 4LBKA 3GZTB 4XMAA 1UYPA 4PJYA 4AF9A 1VE0A 2JWPA 3DYMA 1YQCA 4I3GA 3URFA 3WLUA 4AGGA 4L99A 3NJYA 2SLIA 3ZSJA 5AFEA 1PNGA 2PHUA 2EAAA 1C1LA 1EV12 3UJOA 4LITA 1Z78A 3EXUA 3AL5A 3MFCA 4KI5M 1A34A 4HBNA 4Q4X2 5EPAA 1N3OA 4Q4X1 1NCQB 2CU5A 4NE9A 4XF1A 2A5ZA 5CNAA 5EYYA 1AL23 1RUD2 2KD7A 1RUD1 2WFF2 5LWBA 2WFF1 1OLRA 1AR63 1OSGA 2GN3A 5BY5A 2VW1A 2QZ2A 3SCGA 1LHOA 2HWB1 2Z2SB 4NUBA 1H9PA 1SBDA 3EMRA 1ZX5A 2WNVB 4RD7A 1N3QA 1D4M2 3FLRA 2AR6A 1VBB2 4WVMB 1XSRA 1VBB1 4NIIA 3EHKA 5FTTC 1O4YA 3LE0A 1QJZA 2VOVA 2JE8A 2WKKA 2ZABA 4GB32 3LWCA 4GB31 2EAKA 4AQTA 1RUH1 3N35A 2IXIA 4CDXB 4PCRA 3ZFFA 4B3NA 3AC0A 4XQ4A 2JDZA 5FCCA 3ACIA 4XCBA 3AYCA 2WNVC 4XTPA 1PVC3 1SDWA 4XMIA 2BBVA 1HB2A 4AQ6A 2AZ5A 1POV1 3HT2A 2ZEWA 2B42B 5FZ7A 1E5IA 3CNAA 2RS31 2D5HA 3KQ4B 4QX2A 4V1PA 4F8AA 1C4RA 2VCCA 3T2QA 4CDXC 2VZRA 1ST8A 5L9RA 2CV6A 4DXRA 2ZGOA 5LBCA 4P9XA 1CX4A 2CGOA 2HEWF 3ALQA 1AR72 2JICA 4Q4X3 1CIYA 5LA2A 1WA6X 4CEYA 3OUHA 2RHPA 3BALA 2VVDA 4FFFA 1RUD3 2WFF3 1WBFA 1POV0 4CU8A 5L9BA 2X5IB 3H9AA 2J42A 2HWB3 2DCZA 3I3EA 1HQWA 2AREA 4JRAA 3WW1A 2ZAHA 3D8CA 4ZZ5A 1VBB3 1S1AA 2XVKA 3AJYA 4MGYE 5FYSA 5HCBA 1JZ5A 2PHTA 3GZUC 4UW3A 5T52A 2B9UA 4DINB 5L7OA 1GLHA 4C90A 1CAXB 2ETEA 3WZ1A 1LEDA 1JYCA 2XL7A 4GB33 2P37A 1RUH3 3W21A 2X5IC 1SDDB 1NLSA 3GNEA 2NP0A 4ZS2A 3M4FA 2EXKA 2QNKA 4QPWA 1XU2A 2BNNA 2GP5A 1POV3 1B35A 3KS7A 1H1IA 4LMFA 3LOIA 2Y6FA 1ZBE2 5D8AB 1ZBE1 3GBWA 2BW8A 2EXJA 2NZ9A 3I2KA 4G9SB 4O7XA 3I2IA 1NZIA 2YPJA 1PX3A 5HI0A 4I09A 3LA7A 4OHWA 3T2PA 1IG0A 2A6WA 4K21A 3ZXGA 4FPYA 1SBEA 2GU9A 1XNAA 2YV8A 2ZEYA 4IGPA 4LHLA 4QWNA 4SBVA 1V6KA 5FZGA 5LEJA 1N1SA 1LCLA 5D8AC 3FJSA 4FXKB 2JG8A 3H3ZA 4M3CE 1DGWA 3IZOA 3MIBA 3PLQA 1H30A 2WRAA 1QIQA 2YBKA 4JHTA 5LK5A 5J7MA 2ZACA 2R1DA 2JE7A 4GD4A 4OMCA 3OBAA 1OPMA 4WZFA 1FMD2 3A23A 1H2KA 1FMD1 4QDRA 4ASMB 1LRHA 2J7MA 1NY72 4NPRA 2J1TA 2XKOA 5CZKA 5F6KA 3FLTA 4MGIE 1AHSA 1N1YA 4MSVA 4W50A 2Z42A 1XB9A 1EUTA 5H9QA 4CTEA 4D0QA 4DOUA 5I8TA 1BVVA 1Q8SA 4YVWB 4LUMA 5DZEA 3IB3A 4JCKA 3O12A 3AM2A 3VHOA 1LODA 4IE5A 2X29A 5H9PA 2WS92 4ARYA 2WS91 1GFF2 3IBMA 1XQNA 1X9PA 4R8HA 5FMDA 1GP4A 1ZBE3 3KWVA 5FZDA 5EIYB 1YCIA 1R091 2VMGA 2A75A 3T2TA 3WNOA 4XPVA 1W6MB 5H9SA 4BMEA 4EROA 1VRBA 4YVWC 3U37A 4AXOA 1YUDA 5CYYA 4DPNA 3MHZA 4AVSA 5E8AA 4QU1A 5JXJA 5KC6A 2W1QA 4QXCA 4Y1UA 1DDLA 3VBOA 3WDWA 1T2XA 4UW5A 2OQ7A 4LBQD 4FBFA 1AYM1 4FAGA 4Q8KA 5C3OA 4A7YA 4TYSA 1AXYA 4AVTA 1ULCA 1OQDA 3UGGA 2O8QA 3HNYM 2HWE2 2HWE1 3T30A 4HPKA 3OBRA 4HKWA 4UW6A 1KRIA 2OZ6A 1FMD3 1X50A 2YU2A 3KCXA 1UY1A 4ZPIA 1F5FA 2JKXA 4BCUA 2PXJA 3VBSA 4CDUB 1ND2C 1PM4A 4AHZA 4BQ2A 1UF2C 3G6JB 2V72A 1OKQA 2CGPA 1OLQA 1UZ0A 1WLDA 3IIIA 4C8DA 3LQCA 5GALA 4YGEA 2WZ8A 3B01A 4XQWA 2ZX2A 1DF0A 2WS93 2ZCWA 4FPGA 3ZN6A 1WMDA 4P08A 1PZ9A 4TSVA 3K51A 4EWAA 3JB4C 2H6CA 1MS5A 5IWFA 1R093 1REDA 4E4ZA 2FD8A 3EBRA 2CDOA 1C28A 1VMJA 2JENA 5IVCA 3WW3A 3WNLA 1GP6A 4XUNA 2BOIA 1G9BA 1LR5A 1QHDA 1AF9A 3WCSA 1KDMA 2TBVA 2FMDA 1AYM3 1LB2A 4NAOA 2BFUS 4HANA 3CQOA 3QH7A 4IV1B 2AACA 3Q9OA 4D7SA 3AVRA 2YDEA 2HWE3 5GKAC 3T0AA 4NRMA 2JJ6A 2WNVA 3K3NA 2D6MA 4YGCA 1JN2P 3INAA 2W2IA 3MIEA 1Z7S2 1UCXA 2P4EA 5DZFA 5I0DA 2DCJA 5J98B 3MW4A 4KMQA 2Q0AA 4S2FA 4I30A 4HMZA 3VDBA 4Q4Y2 4Q4Y1 1JOBA 1W8HA 2BTVC 4CDXA 4COYA 4JTOA 1J59A 3OY8B 2RR11 4PDWB 5A1AA 1OLMA 2OYZA 2RV9A 4LEJA 1JYTA 2W08A 2ZGTA 4RR3B 1CVNA 1V0AA 1JYIA 5G04L 4BK5A 4OZOA 5K0UB 3UETA 1BVP1 1U5YA 3I59A 4NHYA 1N1VA 4LJHA 5KXCA 3KHCA 3TRSB 3VUOA 3RQ0A 2ET1A 1HV0A 2XLFA 1VJ2A 3I2GA 5CKNA 5ANQA 5JR2A 1CN1A 4YRDA 3WQ0A 4ATFA 3WVJA 4ASKA 4NVPA 1H8TB 2VD7A 1W8ZA 4GA9A 4AI3A 4BMBA 2YHJA 4OULA 4XFIA 1SQ4A 4QB2A 1JZ4A 1UYZA 5HXMA 5K0UC 2G4IA 1ULGA 3APBA 3MV11 3AX4A 5KHIA 3RFRA 3PUQA 3C8XA 4XETA 1XXNA 2LTNA 5F39A 4Q0VA 3JCIA 3DPRB 5FO8B 3MUZ1 3O1TA 5FZOA 2KM2A 1S0GA 1H8TC 3VDDC 5A33B 4P9WA 1W06A 4UFJA 3DEMA 2VCAA 3N4MA 2WAOA 4XYXA 2VNOA 3ACLA 3PJYA 1MZ6A 1LTEA 1OF3A 1RIRA 2HBUA 4Q4Y3 3I54A 3OB8A 1H4HA 2K2SA 3DPRC 3DXTA 5CFCC 3H8XA 1O3RA 2FDHA 1BQPA 2CHHA 2RR13 2X10A 2W92A 3HN1A 2VULA 5C4WB 2IVIB 5CA6A 1NT0A 4UI9L 4AAXA 3RMXA 1DZQA 2QQUA 5EJZB 3WX5A 3VL9A 1S4CA 3E5QA 2BWAA 4IEXA 3NV3A 1W04A 2GH2A 3PVEA 5DUWA 3RJRA 2A6VA 1SFYA 3GJAA 4EJRA 5C4WC 5JSPA 4HOOA 1IQAA 2YPDA 3ZLIA 2NM1A 3SH5A 3MDPA 3CJIC 2RG4A 1E5RA 2GN7A 2JX9A 4AVVA 3EB7A 1J83A 1ACCA 3HQUA 4L92A 1RUF2 3ZIWA 2BZDA 1UX7A 2RS51 5JXIA 1E57A 3J26N 4K3UA 2VOWA 4EN9B 3KCCA 2A6YA 3IDEA 2VZUA 5JIUA 4CDWA 1LHUA 4A3ZA 1IHMA 1NAEA 1QXPA 2E26A 2G9GA 2PA7A 4OMDA 3WP3A 1COV1 1DU3D 2HWF1 2PYTA 5FZ4A 4GWNA 5SV5A 1J1TA 1ULEA 2GH8A 4C91A 1CD3G 4DEQA 2VZQA 1VPHA 1RC6A 2VAUA 2CGNA 1BBT2 4AFAA 1BBT1 5KC5A 1UOBA 1HDKA 4YVWA 4MGQA 3BOPA 4LNVA 5LZ6A 5FPUA 1W05A 1L7RA 1VBD2 1VBD1 5C3RA 4Y1YA 2B46X 3M3QA 4LO7A 2AEZA 3POWA 1D7PM 2F4PA 1GSLA 2WA3A 2WO3A 2ZOEB 1QMJA 4XFHA 1CWPA 4YFZA 4HK9A 2CL2A 1W6NA 2VW2A 1SMVA 2H0VA 3PUAA 5I0UA 4AW7A 1IPSA 1QNWA 1W6MA 2LW8A 4BDVB 2BERA 2VUJA 3N9MA 3N7LA 5KHHA 4V2WA 1H2NA 4AI9A 2PELA 4MGZE 1DGRA 5JIAA 3OPWA 5JDBA 1OFNA 2XXZA 2OUHA 3B7MA 4B29A 3NO8A 2GC2A 4JX0A 1QDOA 3M1HA 3THDA 1HJFA 5AC92 1ODMA 1DFQA 2XUEA 5AC91 2RS53 3DUIA 3W5NA 1ND2A 2DCKA 4XJ9A 3OYWB 1AJKA 2D97A 4Z82A 1OUXA 1LAJA 5FYCA 3A7QA 4XJWA 5KHJA 1VBC1 1COV3 1OA4A 3W59A 2HWF3 1XJAA 3ABZA 4QHBA 4EQVA 3NAPC 2DURA 3R05A 4CP2A 2R16A 3H1MA 5L36A 4MO3M 2V4AA 4URTA 3J7NA 3SLIA 1NQDA 5EZWA 5JCTA 1BBT3 4E2QA 3J8F2 4IUGA 2DVDA 3J8F1 4UF0B 1VBD3 3C7HA 1O5LA 4DEVA 1Y4WA 3MYXA 2A7AA 1YHFA 3E6CC 2IXCA 3EYPA 3BU7A 2ZMLA 3KLSA 4AK3A 4ET7A 3K3OA 5F9TA 3OUIA 3GALA 2Q8CA 4Y1ZA 3D3AA 1JXNA 3IMMA 3B94A 1UWWA 2IXLA 1FPN2 3W5MA 1Q43A 1FPN1 2VBBA 4KNCA 3C3VA 4LO6B 2K0GA 2R062 3RZZA 3O1PA 1DQ4A 2CDPA 1IPKA 1YO8A 5JI7A 2FDGA 4YM2A 1PGL1 2JECA 2VBPA 4W65A 3ZPYA 5I93A 2WFPA 3DKWA 2WUHA 4CP0A 3IPVA 1BMV1 3I8TA 5J96B 1IS4A 3OF1A 4LBJA 5FMOS 5AC93 3FWEA 1R081 4LIVA 3HWJA 2ZMKA 3PJQA 2PLV2 5IJRA 3VZLA 2EIBA 3WDVA 3WR0A 3O5SA 3PVOA 4AVAA 3FL7A 2VMCA 3RPQA 3W9AA 4URAA 4H7MA 2XBO2 2XBO1 1UMHA 4EZHA 1L7QA 1VBC3 4I02A 3L2HA 5A7QA 5IK7A 4E2SA 2ZHKA 1IOAA 5JVVA 3ZOIA 2D6NA 1YQ2A 5LA9A 4DS0A 2WZR2 3H8UA 2E32A 2GAUA 2WZR1 3OEBA 4HT1T 2ZGRA 4O61A 4JDOA 4OQ9A 1NXMA 2MHFA 3ZSKA 2WZPP 4CCEA 1LULA 1FV3A 4ATEA 1CAVA 1WW5A 3J8F3 3P1IA 4DXZA 2XH6A 3OY8A 4XEZA 4CCDA 1WCUA 2FCTA 3AKSA 4MXVA 4XJUA 3KV4A 1QQP1 5FZ6A 4IEUA 1VB4A 2OS2A 2E9QA 4AHYA 4CE8A 3OGJA 4FPEA 5I91A 1LKNA 4PBPA 4PLOA 2DVBA 1CESA 5K0UA 4OI1A 4LA2A 1FPN3 1HXS1 2BFUL 3AKQA 2E31A 5D21A 5FUNA 2VNRA 3N9NA 4LXLA 3WNXA 4AQ2A 1VALA 2AYHA 3AXDA 3O1SA 1CGPA 4ES9A 3DECA 1YIPA 2NN8A 5JMOA 1H8TA 3VDDA 1KQRA 4RGAA 5EXOA 2QQLA 3V0BB 1OD3A 3FHAA 2Y8KA 1C5HA 3TWIA 5JOWA 3NWKA 1R083 2ORZA 1HB4A 1U0AA 5J09A 3UV9A 2BNOA 3POJA 3VB9A 1RUG2 3DPRA 1R1ZA 1RUG1 3HD8B 5FYUA 1TZOA 2XBO3 4IEQA 3T08A 5CFCA 2GNMA 1QJX2 2QDRA 3OGSA 1QJX1 4JV4A 1AX0A 4QXBA 5A33A 3RZMA 3S5AA 1XNBA 1F35A 2C1FA 2WZR3 5FRAA 4KWKA 3WOGA 3I2FA 1YRZA 3ZX7A 5BNOB 3NV4A 4KH9A 1AX2A 4YZ3A 3AYDA 3OPZA 5EQUA 3ZKYA 1WW7A 5A6ZA 3TBDA 5FR3A 3AJZA 1F8VA 2BVVA 3ZXDA 3WD5A 1HB3A 1HN0A 4P9IA 5IATA 5C4WA 3FFQA 4CPBA 1QQP3 3ZN6B 4U36A 2R6QA 3B69A 4YM0A 3CEWA 3MIHA 4ONUA 3DF0A 3CJIA 4PLMA 2FBEA 2DF7A 5TSWA 1OHFA 1L7LA 3IM0A 1HXS3 3C7GA 3POEA 4OHXA 4YZ1A 3U0ZA 2VUDA 1RJ7A 2QQKA 4AI2A 1W9WA 4BXFA 5JXHA 2GMMA 1REEA 3H3LA 1UL9A 2VM9A 4Y1XA 4AFMA 5E6HA 4JRLA 5E89A 5LY1A 3WUDA 4FSJA 2ARAA 5J37A 2P3YA 3THPA 4RGGA 1SEFA 1EYBA 3H3UA 4M4PA 3POBA 2P1BA 2WT0A 1CONA 5J1XA 4Q4V2 3OCPA 2W5FA 1AXZA 3ZDSA 2W87A 4BB3A 5BYNA 1W9FA 3N9PA 1PHMA 4QX8A 3OGGA 3SXWA 3VBFC 1LOBA 4TLFA 1RUG3 1IKQA 2XWBB 2UYAA 1V6OA 2RJ2A 3KV5A 4QQ2A 3RJ2X 1QJX3 3RMYA 2YC0A 4LO5B 2VZPA 3I3QA 3AMHA 3ECQA 1FAYA 1JUHA 4FP2A 2WO1A 2R0FA 4EYUA 2X05A 1CAWB 2NYYA 3K75B 1A8DA 1JZ2A 1VBA1 2AH2A 5LBBA 4TWTA 2DUOA 4HSJA 4XUQA 4Y4YA 3WG3A 3LA3A 4QX7A 1O3QA 4KL1A 5I0TA 1X82A 2NMNA 3CLPA 2JD4A 5JXGA 3LIGA 4K7JA 4NPLA 3O1MA 1UXXX 4GZ9A 5DUVA 1W2AX 2RM22 3CDZB 4DRVA 3O1RA 2GMEA 2ERFA 5IFPA 2Y0OA 4P9JA 2AC1A 1AR92 1VBE1 3H42B 1YIFA 1MEC2 3HR9A 2YFZA 3PVBB 4XHXA 1O3SA 3O1VA 5A7WB 2HJIA 5HV4A 1KS4A 4IEZA 4XDQA 4YW7A 3VKMA 4EV0A 1LNSA 1CQ9A 5FZ0A 5FV3A 4IE4A 5A6YA 3BU0A 3GDBA 3NAPA 2JB4A 4MHRA 3RVHA 4BISA 3CU7A 2JE9A 1C8M2 1C8M1 4P14A 2JDMA 5FY0A 3VBUB 5C9AA 2CSGA 1NYWA 1WCKA 1O4TA 2OUJA 3B5LB 5FZBA 3SISA 1G9CA 4IEWA 3OYWA 1TMF2 1TMF1 4Q27A 4YGBA 3T4HB 5FWJA 3VZOA 3H7YA 2GNBA 2HH9A 4CXXA 3WG4A 4GJYA 1XNCA 3DCQA 2FZ1A 4YW6A 4S2DA 3HBKA 5EV7A 4R52A 1VAMA 4CCJA 3AP4A 4JVAA 4AQSA 3SNMA 1VBA3 3JUUA 3VBUC 1JZ6A 1GKBA 5IAVA 1PO21 4UOJA 3B9IA 2VZVA 2VTXJ 1NE6A 1MS3A 2VZ3A 3K48A 4UF0A 1KXGA 1E5HA 1TVGA 2YZ4A 3WNNA 2FDKA 2WLQA 3I4IA 1BCXA 4HXCA 5FUPA 5LK7B 2HWD2 3CIHA 4CCLA 4QD2A 2D6OX 1RB8G 1US3A 3ZYFA 2J1AA 1VBE3 2V4VA 1EV11 4UFKA 5FZFA 4CUCA 3C7EA 1JU3A 4JKLA 4NHKA 1GZ9A 4QXHA 1YFWA 3RYKA 2WN2A 1UIKA 4IGOA 4UYBA 3DYOA 4HKOA 4ZXKA 1LHVA 2YB7A 1LENA 2O8OA 3JBG2 4ITCA 1ULFA 4ISRA 3I3MA 3D4KA 3JQXA 1W8UA 3WNMA 4Y5SA 4B4RA 1C8M3 1D4M1 4GIQA 5LB6A 1LU1A 4D8MA 1UY3A 1N47A 1ZRRA 5A32B 4FPFA 4P00B 2NLRA 1DHKB 1KD7A 1TMF3 4XURA 3RG0A 4WV8A 5CU1A 2W91A 1OVSA 3RZKA 1KJRA 3SHRA 4XF0A 5FYIA 3WF4A 3K77A 1UOGA 2PHRA 3VBRC 1NG0A 3VGIA 2QFEA 1ZREA 4OVEA 4B8EA 4WVZA 1WLTA 4TLGA 1JZ8A 1TNRA 2YFUA 4RHV2 4IDZA 5FZAA 4W8JA 1PO23 4E2GA 5HPOA 2C24A 5ACA2 5ACA1 3OBZA 3OD4A 4MOAA 3FHQA 1CZVA 4H7LA 2VZSA 3I59B 4A41A 2B8MA 2DBIA 4RSUA 5T5PA 3PIGA 5IUQA 3I2HA 2JG9B 4Z07A 4XIKA 5FP4A 2E7AA 5FMOL 1EV13 2BU9A 3PL0A 4QDSA 1H6XA 3ZPOA 1AR71 4I0BA 2PQSA 2WYSA 5IVBA 1NLRA 2JIJA 4BWOA 1OUSA 1YC61 1UYYA 4NOTA 3G7DA 1UMIA 4COZA 4Y20B 2XJVA 3V0BA 2JG9C 2B9VA 1W03A 2C9KA 2MPFA 5FZOB 1DIWA 4NHXA 1D4M3 5FZ3A 2WC2A 2GSYA 5FYYA 4PIYA 4DY3A 1MQTB 3BOWA 1URXA 2JEMA 1ZRIA 4B7EA 1SFNA 1PX4A 3AP7A 4B1MA 1ZVFA 1GNYA 2F4LA 4GXLA 1JMUB 1V6JA 3IMNA 4DIQA 3LKJA 3N9OA 1RYYA 2W1UA 1XC6A 2W68A 4XJZA 3ZYGA 1DGRN 5DZGA 4OYUA 4K40A 4L2NA 1NX9A 1SPPB 1DLCA 1MQTC 3HQRA 1ZZCA 2NPIA 3AMPA 1UU5A 4LLFA 3VLBB 5ACA3 3ACFA 3NW4A 4YNIA 3JB8A 1OQEA 4ZU4A 3VL8A 1B09A 2Y26A 2D6KA 2VVFA 4LQRA 3HT1A 3IDAA 5C3PA 3FBYA 4YG0A 1GOHA 4FTSA 5FREA 1Y9MA 2YU1A 3J9SA 2WABA 3MICA 2Y6GA 2LM3A 4UFHA 5H9RA 5FY4A 3T1LA 2BGOA 4DRRA 5J3UA 3WQ1A 4OLLA 1MZ5A 3V64A 1LECA 3GXUA 1J3RA 2VMFA 4NIHA 3NKGA 1OBNA 5F2WA 1AR73 3PURA 4MGSA 3S7EA 3VBFA 4EN0A 4FFGA 3HOBA 4A6OA 2B39A 3ZM8A 2B5HA 4XXPA 4IE6A 1PNFA 1S0IA 2JDUA 1GZTA 2VH9A 4HSLA 1K5MB 3WQ7A 4MHUA 4A45A 4L11A 4YZ2A 3NQHA 2VTXA 4CDWB 2DTWA 4R9DA 3O0WA 2EA7A 1GOGA 4E4SA 2EF6A 4FPCA 3B93A 1NY71 3MPPG 5E88A 3VD3A 2R49A 5JI9A 1K5MC 2BJSA 5JOYA 1H2MA 3IDBB 3AFGA 4K8FA 3J4UH 4RL7A 2W1WA 4CDWC 5A3UA 4A42A 4IEVA 1CAWA 4XUTA 2MNGA 4GULA 1Q5OA 4MH0E 4K1YA 5F6LB 4LE3A 1REFA 5LCWL 2Y6LA 1ODNA 2XPJA 4UBGA 1QJY2 1QJY1 1W6NB 1GZCA 4NHLA 2H0BA 3LGRA 4CVUA 2Y6JA 2Q8OA 1AZDA 1H1AA 2WJSA 3FHIB 1HRI2 1HRI1 4GMP1 2A6XA 3ZMOA 1DQ1A 4IEYA 2Q1ZB 2O14A 5FY5A 2AUYA 5A7WA 5FZMA 3JZVA 3ETQA 5A70A 1K12A 1KDKA 1SCRA 1C1FA 1V6IA 3KT7A 4PHZA 5FYZA 1CIWA 1ND2B 4ZONA 5APAA 1WLWA 1J58A 4FI9A 4GH4B 5F5AA 5LBEA 4UAPA 4JGZC 2IZWA 1XSQA 4KWJA 1WGPA 2OPKA 2QVSB 3ES4A 4MYEA 2BGCA 4KWUA 4YW2A 3VBUA 1NA1B 2P5BA 4GMP0 5BNOC 4UBHA 2VY0A 4GWMA 1MS4A 1HIXA 4GH4C 5T5OA 5FO9B 3T09A 1OLME 4Q8LA 4C1XA 2WO2A 3LDKA 1UOFA 4BXSV 5B4XA 4N8MA 5FZ8A 1JS9A 1TQ5A 2VMHA 1PMJX 4Z2WA 2JDPA 3ZYRA 1NA1C 1QJEA 4QKBA 1W9TA 3EQEA 3VDCA 4X6RB 5GM0A 1QJY3 2Y64A 5CVRA 5FFOC 2B7YA 3VKNA 4H2AA 2YC2A 3AP9A 4LLOA 2Z5WA 4RN5A 4AEMA 5F3EA 4YZ5A 1VAKA 3HIFA 4YWAA 1BK1A 2ZZJA 4XQDA 1SLIA 3PTYA 4B1LA 2BV4A 1HRI3 4GMP3 1ZRCA 2ZKLA 1ZA7A 3ACGA 3E1F1 4LKSA 4MGKE 3LFIA 4YM3A 3E5XA 2IFWA 5FK7A 3AL6A 3IPVB 1RMU2 5IVEA 1RMU1 4DZGA 2GNDA 3C7OA 2DWRA 4LBOA 1W2TA 2PHWA 3NVCA 3VV1A 3WT3A 5BPXA 4BQ5A 3UGHA 1W6QA 3VBRA 5DDJ2 5DDJ1 3UKVA 4LHNA 2W95A 4Y5Z0 1J84A 4YW5A 2BPA2 5CFDB 4CCNA 1Z7S1 1JW6A 2WNUC 2ZKNA 3C7FA 1ENQA 5A32A 1SFPA 5A3WA 1OA2A 4N53B 2V09A 4LOTA 5CB7A 2DV9A 3VDAA 4M01A 1QOSA 2YUEA 1CAVB 3MIFA 3MLKA 1AX1A 1VRH2 1AYN2 3AZZA 1QH7A 1AYN1 3P3NA 4LKDA 3AMNA 4RFRB 3ES1A 1WCQA 1NE4A 5CFDC 3LA2A 1I6XA 1KITA 3LEMA 4OHVA 1XU1A 1CX1A 3PMEA 4MXWA 2E6VA 4N53C 4EWDA 2E51A 2X09A 4IL7A 3TAYA 1APNA 4JQRA 3AKPA 4Q0PA 1QEXA 4Y24A 2P6CA 4HKLA 2VCBA 2JG9A 3H7JA 5E1RA 3M8LA 3X29B 4E8CA 3BYWA 3ZYBA 3RWKX 3GZEA 3VDDB 1PGSA 4HN0A 1HV1A 5DAXA 1RMU3 3VZJA 4EN7B 3A0NA 3HPNA 5JMCA 4UFLA 2BNMA 3AZVA 3MPBA 4LTAA 4XW3A 4XUPA 4Y20A 3VD5A 4D6RA 5ABJB 1UY0A 3LEIA 5CFCB 2GDFA 3NMBA 5DDJ3 4IE0A 4AEDB 3PTRB 2ORXA 2CNAA 2G19A 2X8KA 2ZS6B 2CWMA 1MQTA 1Z7S3 2HYKA 1UPIA 2XDVA 4RYDA 3UK9A 3SCFA 2VBDA 3F95A 1WW4A 5ABJC 2ES3A 1F15A 4ORFA 3IN9A 2D3RA 3MI8A 1MS0A 5A3OA 4F83A 4AEDC 5HXVA 1AYN3 1SPPA 4X6QB 5FXVA 5K8SA 4YW4A 1BHGA 3CJIB 4WVWA 2VCMA 2XWJB 5IK4A 1U5XA 2XHKA 4LO4B 4UFMA 1HQLA 2PFWA 2KA3A 1OFSA 4PBOA 2D3SA 1XBFA 3AXEA 2VOKA 2VC9A 2D43A 2WWJA 4ZS3A 1ZZ8A 2JDHA 1K45A 2RDRA 1TEIA 1X36A 1LGCA 1XYNA 4XZUG 4Y4RA 4NRQA 1GWKA 5JSRA 3RZJA 1RHI2 4RGKA 1RHI1 2P17A 3KQRA 3AK0A 1UXZA 4E4DX 4IGQA 1ZZ6A 1RUF1 1GBGA 2VTFA 2ZGQA 2DDUA 4LE4A 2XB6C 4UW4A 3WDTA 3I2DA 4QQPA 1K5MA 4NRPA 1S0CA 3A22A 1FOD2 1SLBA 4NROA 4FPLA 4BK4A 2R32A 3MW2A 3ZVXA 4QHOA 1DQ5A 4W4ZA 3WDXA 3OTFA 1PK6A 1Z0HA 4A2UA 2D40A 1JZ3A 2QUOA 5FLHA 2VPVA 1XPWA 4IXLA 4CPBD 3TB0A 1W90A 4CCCA 1SLAA 2WNEA 2HWC2 2ZGUA 3DGTA 3E6DA 1KEXA 4GAZA 5EWSA 5FWEA 5IAXA 2ZBJA 3IAQA 1DQ6A 4I3PA 5FMCA 4BQYA 2QBXA 1K3IA 4DY5A 5C71A 3GJBA 3TOJA 4KG8A 1OVPA 3S7IA 3K4AA 3P5BA 3WHTA 4A7KA 2A71A 3FC0A 3HN3A 4IETA 4BLJA 5C5UA 1NXD1 3OSDA 1RXGA 4ZY9A 4AHWA 4EN8B 3ON7A 3KT4A 3RI9A 1DZRA 4XBQA 3OPTA 2JDYA 4JGZA 4XIOA 1AR82 3R6SA 1AR81 1HKDA 3BVCA 1LHWA 3HQXA 1DP0A 3ZYIB 5T5LA 4DUXA 3LDRA 1RHI3 1FI2A 2XJSA 2FHRA 3NAPB 5BNOA 1RUF3 4BIFA 5IHRA 3TEXA 5FYBA 3ZFEA 4GH4A 3LSDA 3QH6A 3VKLA 1R1A2 1R1A1 4D94A 4UT5A 4GALA 4KWLA 1RUE2 4LO8A 1RUE1 2BRTA 4PI2A 5B2GB 4XABA 1JH5A 4W6YA 4XAEA 1W28A 1NA1A 2P3KA 3KT1A 2LS6A 3VD4A 2VR4A 1CAUB 4WBBA 1SHWB 2ZGSA 2D93A 5FY1A 5FOBB 2DTYA 3QACA 2ZA9A 3OEAA 1C5IA 5CAZA 3DYPA 5JZGB 5CIRA 1QDCA 1SLLA 4META 2OPWA 2R042 3PVNA 2YBPA 1UD1A 4JHZA 2J1EA 2K9ZA 1XNTA 1YFYA 2WSVA 3KHBA 3BTXA 2E7TA 4WM8B 3ZSEA 1OOPB 1GZWA 2VZTA 4Y33A 4CDQC 3OD0A 4XBLA 1KGYA 2QQIA 4S2GA 5JOXA 5JZGC 3NNMA 2R061 2DUPA 5BNPB 1TNFA 2DUQA 2KR2A 3RZGA 4XFAA 1AR83 3FBMA 5A7PA 5IVVA 2KXLA 4J1WA 5DAWA 1LGBA 1DZTA 4WM8C 1OOPC 1V00A 2UY8A 3H50A 2GZWA 1RUOA 2WNUA 4QDQA 5FZ1A 3POYA 1J1LA 1UU4A 2ILMA 2PLV1 2OKXA 1QJU2 4CU9A 1QJFA 1QJU1 4QPIB 1R1A3 5BNPC 2AGSA 2W46A 2DYCA 4XOGA 3PUHA 5I0RA 1RUE3 3ATGA 1NKGA 1YQ5A 2G9ZA 1XE8A 5CFDA 5BNQA 1JHNA 3U4XA 3ZXJA 1H8VA 4CSWA 1GWLA 3VHRA 1TE1B 3LEGA 5A3LA 1BKZA 1UZWA 4N53A 4QQOA 2XQRA 1VLNA 4QPIC 2XQXA 5EHDA 3RI8A 4TTGA 1HRV2 4JQTA 3VZMA 3FX3A 2VGDA 5GZGA 2YXSA 2CTVA 3BUCA 3LOBA 3Q8FA 1N3PA 4NIDA 3MLLA 4IESA 4QQHA 1Q3EA 2CAUA 4LT5A 1GYKA 3D0JA 1IG3A 1W8WA 3M3IA 4LBLA 1CPMA 1VP6A 5LBFA 2WDBA 3KSCA 3IWZA 1GNHA 4RQPB 2VOTA 3MGUA 2Q8EA 4EE2A 2R063 3GCWA 3Q8AA 4OI2A 4N7UA 2PAEA 1MS8A 5FO7B 3OUJA 1SG3A 3WW2A 2VVEA 1W39A 3POIA 4LHKA 3NRUA 4XJ8A 1PVXA 1XYPA 4JTNA 3BTZA 5GZEA 1RUJ2 2GMPA 3K2OA 2XJTA 4ZU5A 5IFTA 4FPOB 1H6YA 2PLV3 4RQPC 4XBNA 3MIDA 5ABJA 1QJU3 2VZ1A 3HEIA 3FE5A 1MVQA 1HB1A 2RDQA 3KF3A 3DL3A 4NAMA 4YLZA 4AEDA 2EIDA 4HETA 2A3YA 5IVFA 5KHGA 1W2NA 2Q1FA 1QF3A 1BEV2 3T1MA 2ZGLA 1EPZA 5IK8A 1TME2 4QPYA 1N1TA 4QHZA 1VIWB 3U14A 4BYYA 4RS5A 4CA9A 1RUNA 3UJQA 1ASJ2 4YGDA 2XLGA 4I0WB 1W3XA 2BYVE 3VN4A 1ZZ7A 3PHMA 2PMWB 3UESA 3ZYHA 5FYMA 3HMYA 3TYJA 1W0OA 1PM7A 4CUAA 3WY6A 1ULOA 3BTAA 2MEV2 5FBJA 4CXYA 3BIWE 5IK5A 3MW3A 4BQWA 1AJOA 1W0NA 1ZBA2 2IXKA 2XJRA 1ZBA1 4OUSA 4GKXA 1S0EA 2OZJA 5EP9A 4J1XA 4FCAA 1Y9GA 5FOJB 1BXHA 1DGLA 1L3JA 4DUVA 4R9AA 4Q0UA 5DMYA 1UZVA 2WL1A 4J6GA 2CYFA 4NJ4A 5GLWA 4AEJA 3VBFB 2CAVA 5FUIA 4DXTA 2ARBA 1LOAA 2RE9A 3AZXA 3O0XA 1UKGA 3Q8BA 5A80A 1P8JA 1Q8QA 1YXWA 4GKYA 2WQZC 5F2SA 4GJZA 1U5ZA 4P9GA 4A4AA 4Q1RA 3ZIXA 2TUNA 2F17A 3I7DA 5DN2A 1HX6A 1F2NA 5FMBA 5F7UA 4AFBA 4Q4V1 2HEYF 3SH3A 2JB8A 4UXAA 5D1IA 1I5PA 2IVJA 2RDNA 3JQWA 2Z69A 2W39A 4HVOA 4EWEA 3N3HA 4S2HA 5A7OA 3J7HA 1O3TA 1GU3A 1LOCA 4QKFA 4L8QA 1XOYA 4N9HA 2Q5TA 4XFBA 2WBKA 4FPJA 2P3JA 2NQYA 3V65A 4QGNA 1I5ZA 4XF3A 4ZKTB 4HK8A 5JOZA 1JYXA 3GBGA 1S0BA 2GALA 4LKFA 3VKFC 4AE2A 5LATA 4MG2A 3WDUA 1IS6A 4QQLA 4BH9A 1DYOA 4WVVA 1ZBA3 1GMMA 3WINE 2UYBA 5FYVA 3DV8A 3TN92 2RM21 2EIGA 2QKDA 2BDRA 4D69A 1WMFA 4I2OA 4LBNA 5IVYA 3WDYA 3MFAA 5BNNB 1A8MA 1SACA 2XL9A 5FLIA 1DGWX 1AR91 1G86A 1LJ7A 4FTEA 1MEC1 1RL3A 2FCVA 4LUKA 3HNMA 3OOXA 2XVLA 5LRRA 3NJVA 5C9AB 3WF2A 4LK6A 1S0JA 3VD7A 2VUCA 2E53A 4NIGA 1YYNA 2NMOA 2WINB 3ZN4A 3IIAA 4Q4V3 3J7LA 2WO7A 3FMGA 5HCFA 5BNNC 2ZX3A 4XCAA 3RYRA 3R0RA 3LIHA 1GR3A 2F6BA 1S0FA 1WD3A 1KFXL 2RS12 1QOTA 2RS11 5C9AC 1LOGA 2VNGA 4M00A 1RUI2 2PN5A 1RUI1 1QNYA 1SCSA 1SZBA 5FKBA 3OG2A 5JR7B 3OGVA 4EN6B 1YFUA 1UX6A 3NJZA 2OT7A 5FZKA 2QQOA 4FTBA 5FXWA 3JD72 4XUOA 3JD71 1DQ0A 1CAUA 2OXBA 1QKQA 4B4QA 1AR62 1LOFC 4IQPA 1XRUA 5SV8A 3POSA 4NIAA 4OI4A 4CDQA 2D6LX 4XFFA 2WNOA 3RWNA 1JI6A 5JZGA 2WQ8A 4ZU7A 2DCTA 4M3CB 4P5HA 4XAAA 4XVHA 3MIGA 2VQUA 4GQ7A 1OH3A 1TG7A 3E97A 3P3PA 3RYPA 4JKMA 3RGBA 1AL0G 2RM23 2HWD1 4DQAA 4WM8A 3CO2A 1GICA 1OOPA 2JD9A 2VXJA 2W3JA 3WF3A 4BHPA 1ZNPA 2C4XA 1AR93 5AVPA 4NWWA 1MEC3 2BOJA 4BPZA 2XOMA 3PDQA 1OMIA 1MS1A 2YMZA 5CBLA 1ALYA 5BNPA 4NWVA 4K1ZA 5GZDA 5T3NA 1OA3A 3LPGA 4LKEA 5JLVA 3JBG1 1OURA 3ILRA 2TNFA 3CHXA 4CP9A 5A6XA 1W6QB 3VBRB 3LZZA 4YPJA 4K8RB 5C5TA 3GHNA 4P9LA 4XE9A 4HVRA 1U5IA 3ZYPA 4PF5A 2VMDA 2QTWB 1EUUA 1BLZA 2RS13 3AFKA 4QPIA 4YVSB 1RUI3 2PHDA 3Q8EA 2QQMA 5T54A 5EYXA 4COUA 2VOXA 1G7YA 1ULPA 3WHUA 2P34A 2WWSA 3JD73 2W52A 4DB5A 2HEVF 4J25A 5FPXA 4BOWA 5L9VA 4JDMA 1BK0A 3WEZA 3WNPA 5DUXA 2P6HA 2ADDA 4OI0A 2LALA 4RHV1 4TN7A 2HWB2 1CJDA 4GWIA 4O65A 4YVSC 1JU4A 4NMIA 5F3IA 3AMMA 5L73A 5JWPA 4MXWB 3CZJA 2DVAA 4RA0A 4XXAA 1WA4A 3B02A 2EALA 4OCTA 3VBHA 1NQJA 1NCQC 1RUC2 1RUC1 2YBSA 3OGRA 2HWD3 3W20A 4CYDA 2J1SA 2GC1A 3PNAA 5LA1A 3PIJA 5IW0A 2HYXA 3RSJA 1RUH2 3MUY1 4D7TA 3LD8A 4RQPA 2Y34A 3KMHA 3LSEA 1T6GC 4AFDA 4FXGB 1QU0A 1GQHA 1V6NA 2TEPA 2WQ4A 3ITQA 4A6SA 3JBG3 1ENRA 1UKRA 5C3QA 3N36A 1JYWA 2LROA 2VU9A 1FNYA 3WG1A 2ZGKA 2YYOA 4G4FA 2RS32 5BV6A 1WWYA 3WUCA 2VMEA 3LEKA 4K6BA 5GJ6A 3WV6A 1I1EA 3PUSA 3K4ZA 3ZFGB 2DCYA 4NR1A 4LOSA 2XJQA 4BE3A 3U78A 2WN3A 4AGRA 1WW6A 5I0SA 4YG6A 5DABA 4CCMA 2VQ0A 5GLVA 3LCPA 3MEPA 3NL1A 1RGSA 5FJKA 2OVUA 1DG6A 2QQJA 3N7MA 3R4UA 3HNBM 5DAVA 2JDAA 2ET7A 4Y1VA 5LY2A 2CWSA 3KGLA 4FPHA 4RHV3 3ZFGC 3S57A 2V5DA 3E5UA 5C8WA 4MGTA 3NNGA 5LEKA 1OC1A 3WF0A 1RUC3 4QX5A 3USSA 4FOQA 3KGZA 4LIUA 4Q0QA 2PAKA 5FQ0A 5FY8A 3GCXA 2FDIA 5M0TA 4X8NA 1RVF2 5FK8A 1RVF1 3ETPA 4PI0A 2JXAA 2RJKA 5F8PA 3THCA 3BIEA 1S2KA 3BCWA 4B4PA 1W8OA 1DYKA 1EY2A 2IFRA 1W6OA 3AVSA 3DN7A 3KZ4C 1XNKA 2V5YA 2XLAA 1YFXA 1VAVA 2UWCA 3KB5A 3L9JT 1F4HA 2Y6HA 4NPMA 5EJ1B 3S6PA 3THTA 1H2LA 3ZDVA 1I3HA 5GLTA 3WF1A 3SITA 3BB6A 2RS33 3GM8A 1OD5A 4G3YC 5CG9A 2VO5A 5FPAA 4Q26A 2I2SA 3ASIA 3F2ZA 2ENRA 1PK6B 5AFBA 1QH6A 4Y3OA 1ZRDA 1CR7A 1Q8OA 3WP5A 4YZ4A 4P5YA 3FFZA 3V0AB 4XFGA 4QKDA 4QGLA 4ARXA 5CEHA 2FZ2A 1US2A 5A3MA 3DKQA 4AI8A 5KWRA 1NLQA 1UY4A 1QGLA 1JUIA 3TNQA 2W1SA 1O4ZA 5AVAA 5FY7A 2ZAAA 3D5OA 4E4HA 1ZM1A 1OXCA 2FMYA 4BM8A 4LBMA 4YARA 3H1WA 2E63A 1BZWA 2R1BA 2VQAA 1PK6C 2GC3A 3Q8CA 3WW4A 1BYHA 4KBBA 1MVEA 4LBQB 2A6ZA 3I49A 3WSOA 2BEOA 3GZAA 3AB0A 4N9IA 2QCSB 3H8RA 4XHBA 4Z92B 2WIIB 3O1UA 5BUVA 5T55A 5ERLA 3USUB 3ZSLA 4OHYA 4TXWA 2B4KA 1D0HA 4JGZB 1RVF3 2ZPXA 5T5JA 2A73B 2VG9A 4BQXA 2DVFA 4XZPA 3TNPB 5BNNA 2PHFA 1O8SA 1F9KA 1F31A 5J36A 4F7ZA 3AP5A 2BVBA 3D6EA 5CISA 1V9U2 4FPKA 1V9U1 1VMFA 4AFCA 4W6WA 4YW1A 5FZCA 1O8PA 4ZXEA 3ZFEB 1CPNA 4N43B 1PIV2 1PIV1 4NN0A 2ZZQA 1YI9A 4QU2A 3ZSMA 1G9AA 2UURA 2WSUA 1R092 2ZHMA 3VZNA 2OA2A 3ME2A 4PQQA 2W0XA 3RNSA 4BZ4A 1AVBA 1SLCA 1LOFA 4FP3A 1U12A 2C6SA 3O1OA 3WNKA 3A21A 5FPLA 3MZHA 2E7QA 3ZFEC 5F3CA 4N43C 4CP1A 2QQWA 2W9XA 4WM7B 1VB2A 3KD4A 1NUKA 1KJLA 1QXJA 2OQ6A 1MR5A 4YM1A 1AYM2 1JBCA 5FZEA 1W6PA 3HBZA 3OJBA 3M2MA 4PIZA 3KVAA 5BXXA 4BLIA 5I8YA 2R0HA 1IPJA 5A3NA 1PZ7A 1UZZA 2WT1A 5GZFA 2XR4A 1Q56A 4PLNA 4M3CA 1GZWB 1UW8A 3RZHA 4Y26A 3NV1A 4WM7C 1QY4A 4QPGA 1BJQA 3QBQA 4FFHA 3ELNA 2D44A 1QWRA 3T0BA 2QQPA 1QXRA 4H14A 3LB9A 4R4ZA 2ZX4A 5A3TA 3BKZA 4BQ1A 3CZUA 4KGQA 2WYFA 1IZ3A 5KHKA 4AYUA 1W8NA 3NNJA 1W3VA 1MS9A 2Z4FA 2WNUB 2XGXA 3MBWA 4BIOA 1V9U3 1S0DA 5A7SA 4TZDA 3SQOA 4FOWA 2R7EB 3HJRA 2A3XA 1H9WA 1QOOA 1PIV3 4CDUC 3B00A 1A78A 4AHXA 3O0VA 3AKRA 4OHZA 2VECA 4OZXA 3UL2A 1CZSA 4YYOA 2FDFA 2VQTA 4AL9A 4FO9A 4V2VA 4YVSA 5F3GA 3ZMNA 3CKHA 4Z8BA 1WKYA 1JHJA 1RITA 4QX0A 2PHXA 1HLCA 1O91A 1NCQA 4E9KA 3H1YA 3ZKUA 5FDBA 1OKOA 1VRH1 3U1XA 2B45X 2AEYA 2XVGA 3N9QA 2Y33A 4QM9A 5KXBA 3TEYA 4A3XA 3CL1A 5CG8A 1RXFA 4FFIA 2BWCA 4M0NA 2RJLA 1HN1A 3FLPA 2P2KA 3CF6E 4WVMA 1V6LA 3N7KA 1ZYBA 5F5CA 4YSFA 4N90A 1J3QA 5CADA 5IT6A 1WBLA 4DFSA 5EFUA 3CBNA 1PO12 2OW4A 1X8MA 1PO11 2XJPA 3OBTA 1WMXA 4FOYA 3CJXA 4IV1C 4YG3A 3T4VA 4F3JA 3AZYA 3I3DA 4FVVA 2WAAA 1H0BA 2BP6A 2FCUA 3GF6A 2BQPA 3I2OA 2SBAA 4IEOA 4P02B 5A1LA 1JZ7A 2RR12 3PUIA 2FDJA 4FQZA 3ENRA 4AWDA 4Z2AA 3EJKA 3TEZA 2XG3A 1VR3A 5FBZA 4D6SA 3BI3A 4HFSA 4HL0A 1LOEA 4JGYB 4O9GA 3KF5A 1O6UA 2ZHNA 1H4GA 1EP0A 2YY1A 4I01A 5FZ9A 3A0KA 1O59A 3ZN5A 2PHLA 1KFUL 2JKBA 3GYDA 4MUVA 3VD9A 4MX3A 2W47A 1OI6A 1HQNA 2UWAA 3ZFGA 4OQ8A 2N7GA 2JDNA 3HVDA 3WP6A 2ARXA 3ROUA 3S0MA 4PDWC 4RS5B 5LASA 1OT5A 1DCSA 4BJ0A 3RZLA 1POQA 3SEPA 4JGYC 4RR3C 5A7NA 3ZYJB 1D2QA 1C57A 5T50A 3GGLA 1VRH3 4O9EA 3SKVA 4CU7A 5FP8A 4M3CF 5C8CB 3NNFA 1SLTA 1MZFA 2X5IA 5FPVA 4CU6A 5C6CA 2RVAA 4AVCA 1C3HA 1YEWA 4RS5C 2VNVA 1YJKA 4QB6A 4LR4A 2WA4A 4YFWA 4C1WA 4H3WA 1DQ2A 4R4XA 4Y22B 4N7IA 1D0GA 1Y9QA 3O7OA 1K42A 1ZZ9A 3BODA 1V6MA 1CAXA 1PO13 5C8CC 5KXDA 1DBNA 2YG0A 4HZFA 2GP3A 2ZJCA 1W9SA 5E16A 1HJGA 2CY6A 3VHNA 4JC1A 2ZX1A 3T2OA 3KVBA 5HBAA 5GLZA 4K9SA 2D5FA 1GP5A 3U75A 4M0HA 1UQXA 2XMLA 1PGW2 1GWMA 2J22A 1PGW1 1FOD1 2BBAA 4MV2A 5D8AA 3U11A 4W6XA 2Y0IA 5DPNA 2G1MA 1XE7A 5FP9A 4AEKA 1LGNA 3H0OA 4DXSA 2A3WA 2PQQA 2ZGNA 5F32A 1RINA 5FPZA 1Y3TA 2RDSA 2Q8DA 1JOPA 3V0AA 2QDNA 2HWC1 4MVTA 1HW5A 3RRDA 1X8EA 3L2YA 4LA3A 4AI1A 1NZCA 1F5JA 3ORJA 5FKCA 3N7JA 5K4LA 2ATFA 4CEWB 2RS52 1ENXA 2RMU2 2UU8A 2RMU1 2ZX0A 2ZHLA 3E6BA 2XONA 3AYAA 2EICA 3M70A 2Z79A 4A44A 3ZR6A 2D6PA 1Q8PA 2A70A 1M4WA 3I97A 4LBQA 4OFGA 2QZ3A 1YLLA 1UAIA 2O1QA 1FATA 2H6BA 1VMHA 1COV2 4FQ4A 2HWF2 1FNZA 1IS5A 2VZOA 4QX3A 5FIXA 3USUA 1V70A 3UYJA 4CEWC 3JU9A 3B9CA 3D82A 1ENSA 1JODA 2V73A 2ZMNA 3I3BA 4DUWA 3FN9A 1X7NA 4CCKA 3ZXLA 2BUKA 3FUOA 5IYYA 3NNLA 3O14A 3SMHA 5A3PA 1PMIA 1WD4A 4XTMA 4D6QA 2JIGA 3IDCB 4N43A 4XFCA 1O5UA 5L19A 4IERA 2GC0A 1UYXA 2UWBA 1FOD3 4Q5OA 2D7FA 4MLOA 4CRQA 3IAPA 3M3CA 1ND3B 1OF4A 5FZHA 4C0HA 3QOPA 3ZR5A 3LFMA 4KQ7A 1YNAA 1YWKA 2C26A 3M3EA 4PT6A 1JOJA 2DFBA 2I74A 3KV9A 5FP3A 5FXZA 2Y60A 4KBZA 1LEMA 2HWC3 2YGLA 2X53S 1Q8VA 2HKXA 2Q4SA 4CDQB 4CZSA 4WM7A 2QJVA 2VXRA 2ZGPA 4OUEA 3C2UA 2R072 1IKPA 4L9BA 2R071 5G05L 4E8DA 1ND3C 4B7KA 2RMU3 1ZRFA 5IVJA 1F4AA 1FXZA 5DXDA 2R041 1A3KA 5DQ0A 4M4RA 3WCRA 5ISLA 1Y43B 3MO4A 4QXKA 3FZ3A 4IV3B 5FZIA 4FT8A 1MPXA 4EZ4A 2YGMA 1VBC2 4IE7A 2ID4A 5A6QA 3T3YA 1CJPA 4YW3A 1JYVA 4R9BA 1GOFA 3DXUA 1NCRB 3PMSA 4INDA 4CDUA 1UIJA 2ADEA 5C70A 1WZXA 4COWA 1WMEA 2QQNA 4IV3C 1OPOA 2QQVA 4IW3A 2WWUA 3U4SA 4D3WA 5DUUA 4CP9B 4LPLA 2VUAA 1G6NA 5FY9A 4AZZA 3UKTA 1UO9A 4RFT0 2ZGMA 4MADA 5HV0A 1R64A 3WXPA 1H1MA 4XC9A 3ZO0B 4H55A 5FYTA 2DVGA 1NCRC 3KCYA 1M06G 4XILA 3A4UA 5K7PA 5A1FA 2IC1A 4AI0A 2WLPA 1XNDA 4OUMA 3ILFA 4QKNA 1W99A 2DFCA 4UWDA 5JAXA 3AKTA 1PGL2 4NO4A 2IWGB 2LRPA 5KR7A 5LW9A 2DU1A 2EVXA 3BPZA 3SEEA 1UMZA 1BMV2 1GUIA 2J1UA 4WZCA 5FXXA 1CZTA 1R082 1HRV1 2G9FA 2R073 1GQGA 4HLTA 5D2AA 2R043 3J7MA 4L97A 4IV1A 1W8TA 1RTVA 3VBHB 4BQ3A 3T0DA 1LU2A 3ZXEA 3ZXKA 2C0ZA 3SC7X 3EO6A 3K46A 4Z1VA 1WUVA 2EXIA 2WR9A 1GQPA 1GV9A 4QT6A 4QGMA 3ZFFB 2A1XA 5HCHA 1UNBA 2D3PA 3AYEA 4IEPA 4L0PA 3SH4A 4AOCA 2BGPA 5FJHA 3ZXAC 1E5SA 2DBNA 2R30A 3K4DA 2DU0A 2OIIA 3M3OA 4X8PA 1W9YA 1W2UA 4FOVA 3VBHC 2W94A 1UN1A 4Q1PA 3RDIA 1PMHX 3BGAA 1STMA 3JXSA 1RUJ1 5FPBA 2FQPA 4PDWA 1QQP2 4ASLA 3ZFFC 2EIEA 2E33A 2XKPA 4JGYA 4RR3A 1LESA 3D0SA 4XF4A 4U2AA 4HONA 1HXS2 1FT9A 5KXEA 2I07B 4HVQA 1W0PA 1BEV1 4DO0A 4CEYB 1EPWA 5GZCA 3QLQA 1TME1 2ZXQA 1OH4A 5LRSA 3MF9A 5EJ3A 3B3QE 4AVBA 1ASJ1 2J1VA 2XJUA 4KG0A 2YROA 3LDBA 2L9LA 1YJLA 1JYNA 3U07A 1HRV3 5C7GA 4QMAA 4AG4A 3QD6A 4P9YA 3ILNA 2MEV1 4PQ9A 3WG2A 5C8CA 4JDNA 3IT8A 2I45A 4K20A 4CEYC 5L7OB 3NKTA 5DAPA 4XACA 5FQ0B 1XYOA 5FP7A 4KU7A 5FZLA 3KV6A 4JKKA 3V56A 4CUGA 1UOJA 3POGA 4UFIA 4Y22A 5DG1A 3LF7A 3AMQA 1JTZX 2VJXA 1W8FA 3PU8A 4XDOA 2K46A 1G9FA 1W6OB 2O0OA 3UT0A 1T6BX 3VHPA 3R4DB 2D98A 4HG6B 4LHSA 5L7OC 4KU8A 1B35B 1FX5A 4Q2FA 5F37A 1OQ1A 3TEWA 5JPMB 1RUJ3 4COVA 1FYUA 4A7ZA 1GANA 1RJ8A 1Y7BA 4Q4W2 3KM5A 1J3PA 4Q4W1 2JDKA 3R4SA 1W2OA 4LORA 2HBTA 3SKJE 1SBFA 4I0AA 1B35C 1GNZA 3QCWA 1O7FA 1BEV3 4BU2A 1TME3 2P3IA 3ACHA 3POFA 1UU6A 1ASJ3 2JG8B 4PF1A 3NJXA 4AAPA 4LULA 4AR2A 4D7YA 3NV2A 2VW0A 1UPSA 2Y38A 3S30A 3M7AA 2IXJA 1ONAA 1LHNA 1MACA 4CEWA 2LUWA 2MEV3 4E27A 1I9RA 1WCDJ 5F5QA 1IGOA 5KBFA 1D4VB 4XJAA 3TN91 1YQ6A 1K5JA 3ST7A 2JG8C 1S2BA 2C5DA 4GWJA 1AXKA 4QM8A 3VKOA 4FAHA 3SCHA 5JUVA 2UY9A 2YC4A 2ZEZA 2ZEXA 2ZTNA 1S2EA 1XE0A 5F1RA 4XF9A 1EAH2 1EAH1 1VBA2 3BPSA 4HN1A 1UZYA 4QB1A 5DG2A 2AENA 4NHMA 4AGVA 1NOVA 4QAWA 1DLLA 5GLUA 5CKMA 5C3SA 4JAAA 3U10A 5HCAA 1X9TA 1YQ8A 2HLEA 2XUMA 2OX0A 3P6BA 4KGGA 3ZXFA 5ANNA 1WCSA 3RS6A 4DMIA 4ZZ8A 1MZEA 4BA6A 1IQDC 2Y6KA 4SLIA 2C9AA 5FYHA 3UNPA 4JZRA 4Q4W3 4C0BA 3AZWA 4ISQA 5FLJA 5I8SA 5K9YA 4DNYA 2EXHA 3VBOB 3W58A 1VBE2 3HAGA 1ND3A 1X33A 3S5QA 4R9CA 4ES8A 3N9LA 3GBFA 1UY2A 2GNTA 3MV01 1AUYA 1W6PB 1AL22 1AL21 3PU3A 1PZ8A 1AR61 1FV2A 5F5IA 2Q1MA 4Q0SA 4ZHNA 4BQ4A 1G9DA 1IS3A 3H8OA 4XDPA 1WLCA 3GHMA 1ULDA 3VBOC 4HPKB 2PAMA 2VMIA 4LK7A 5CKQA 4Y5TA 4CUBA 4Q29A 5C33A 4QPGB 3UKNA 3LAGA 3UGFA 2WZEA 1D2SA 1S55A 2VE1A 4IV3A 1G8WA 3BTYA 3TN93 2Q30A 4PIXA 3VBSB 4CXWA 3WP4A 1ZZBA 3LPFA 4MZUA 5JSOA 3MF6A 2IUWA 3NSTA 4QX1A 1A6CA 2QE3A 3VZKA 3AP6A 1YI7A 1EAH3 1KS5A 2PTMA 1NCRA 2VL4A 1PVC2 2IXHA 2XHNA 1PVC1 3I2JA 3WQBA 4CCOA 5B4NA 5J48A 5JPNB 4QPGC 2WT2A 3CMGA 2ARCA 1PO22
chains in the Genus database with same CATH topology
1C8NA 5FAXA 1ZA4A 3VBSC 3IKWA 1DYPA 3MLJA 3FUQA 4LBKA 3GZTB 4XMAA 4PJYA 4AF9A 4I3GA 3URFA 3WLUA 4AGGA 4L99A 2SLIA 3ZSJA 5AFEA 1PNGA 2PHUA 2EAAA 1C1LA 1EV12 3UJOA 1Z78A 3EXUA 3MFCA 4HBNA 4Q4X2 1N3OA 4Q4X1 1NCQB 4XF1A 2A5ZA 5CNAA 5EYYA 1AL23 1RUD2 1RUD1 2WFF2 2WFF1 1OLRA 1AR63 1OSGA 2GN3A 5BY5A 2VW1A 2QZ2A 3SCGA 1LHOA 2HWB1 2Z2SB 1H9PA 1SBDA 4WVMB 1ZX5A 2WNVB 4RD7A 1N3QA 1D4M2 3FLRA 2AR6A 1VBB2 1VBB1 3EHKA 5FTTC 1O4YA 1QJZA 2VOVA 2WKKA 2ZABA 4GB32 3LWCA 4GB31 2EAKA 4AQTA 1RUH1 3N35A 2IXIA 4CDXB 4PCRA 3ZFFA 4B3NA 4XQ4A 5FCCA 2JDZA 3AYCA 2WNVC 4XTPA 1PVC3 1SDWA 4XMIA 2BBVA 4AQ6A 2AZ5A 1POV1 3HT2A 2B42B 3CNAA 2RS31 2D5HA 4V1PA 4F8AA 1C4RA 4CDXC 2CV6A 2ZGOA 4P9XA 1CX4A 2CGOA 2HEWF 3ALQA 1AR72 2JICA 4Q4X3 4CEYA 2RHPA 3BALA 2VVDA 1RUD3 2WFF3 1WBFA 1POV0 2X5IB 3H9AA 2HWB3 2DCZA 1HQWA 2AREA 4JRAA 3WW1A 2ZAHA 3D8CA 1VBB3 1S1AA 2XVKA 3AJYA 4MGYE 5HCBA 2PHTA 3GZUC 4UW3A 5T52A 2B9UA 4DINB 5L7OA 1GLHA 4C90A 1CAXB 2ETEA 3WZ1A 1LEDA 1JYCA 2XL7A 4GB33 2P37A 1RUH3 2X5IC 1NLSA 3GNEA 2NP0A 3M4FA 2EXKA 2QNKA 1XU2A 2BNNA 1POV3 1B35A 3KS7A 1H1IA 3LOIA 1ZBE2 5D8AB 1ZBE1 3GBWA 2BW8A 2EXJA 2NZ9A 4G9SB 2YPJA 5HI0A 4I09A 3LA7A 4OHWA 2A6WA 4K21A 3ZXGA 4FPYA 1SBEA 2GU9A 2YV8A 4LHLA 4SBVA 1V6KA 5LEJA 1N1SA 1LCLA 5D8AC 3FJSA 4FXKB 2JG8A 3H3ZA 4M3CE 1DGWA 3MIBA 3PLQA 1H30A 5LK5A 5J7MA 2ZACA 2R1DA 2JE7A 1OPMA 4WZFA 1FMD2 4ASMB 1H2KA 1FMD1 1LRHA 1NY72 4NPRA 2XKOA 5F6KA 3FLTA 4MGIE 1AHSA 1N1YA 4MSVA 2Z42A 5H9QA 4CTEA 4DOUA 5I8TA 1BVVA 1Q8SA 4YVWB 4LUMA 5DZEA 4JCKA 3O12A 3AM2A 3VHOA 1LODA 5H9PA 2X29A 2WS92 2WS91 1GFF2 3IBMA 1XQNA 4R8HA 1ZBE3 1YCIA 1R091 2VMGA 2A75A 3T2TA 4BMEA 4XPVA 1W6MB 5H9SA 4EROA 4YVWC 4AXOA 1YUDA 4DPNA 4AVSA 5E8AA 5KC6A 1DDLA 4Y1UA 3VBOA 3WDWA 4UW5A 4LBQD 4FBFA 1AYM1 4FAGA 4Q8KA 4A7YA 4TYSA 1AXYA 4AVTA 1ULCA 1OQDA 2O8QA 2HWE2 2HWE1 4HPKA 3OBRA 4HKWA 4UW6A 1KRIA 2OZ6A 1FMD3 1X50A 3KCXA 1F5FA 4BCUA 3VBSA 4CDUB 1ND2C 4AHZA 1UF2C 3G6JB 1OKQA 2CGPA 1OLQA 1WLDA 5GALA 4YGEA 4XQWA 3B01A 2ZX2A 1DF0A 2WS93 2ZCWA 4FPGA 3ZN6A 1WMDA 1PZ9A 4TSVA 3K51A 4EWAA 3JB4C 2H6CA 1MS5A 1R093 1REDA 4E4ZA 3EBRA 1C28A 2JENA 3WW3A 1G9BA 1LR5A 1QHDA 1AF9A 3WCSA 1KDMA 2TBVA 2FMDA 1AYM3 1LB2A 2BFUS 4HANA 3QH7A 4IV1B 3Q9OA 4D7SA 2YDEA 2HWE3 5GKAC 2JJ6A 2WNVA 2D6MA 4YGCA 1JN2P 3INAA 3MIEA 1Z7S2 1UCXA 5DZFA 2DCJA 5J98B 3MW4A 2Q0AA 4S2FA 4I30A 4HMZA 4Q4Y2 4Q4Y1 2BTVC 4CDXA 4COYA 4JTOA 1J59A 3OY8B 2RR11 4PDWB 2OYZA 4LEJA 2W08A 2ZGTA 4RR3B 1CVNA 1JYIA 5K0UB 1BVP1 1U5YA 3I59A 1N1VA 5KXCA 3TRSB 3VUOA 3RQ0A 2ET1A 1HV0A 2XLFA 1VJ2A 1CN1A 4YRDA 3WQ0A 4ATFA 3WVJA 4NVPA 1H8TB 4GA9A 4AI3A 4BMBA 2YHJA 4OULA 4XFIA 1SQ4A 5K0UC 2G4IA 1ULGA 3APBA 3AX4A 5KHIA 4XETA 1XXNA 2LTNA 4Q0VA 3JCIA 3DPRB 5FO8B 2KM2A 1S0GA 1H8TC 3VDDC 5A33B 4P9WA 3N4MA 4XYXA 2VNOA 3ACLA 3PJYA 1MZ6A 1LTEA 1RIRA 4Q4Y3 3I54A 1H4HA 2K2SA 3DPRC 1O3RA 5CFCC 1BQPA 2RR13 3HN1A 2VULA 5C4WB 5CA6A 3RMXA 1DZQA 3WX5A 3VL9A 3E5QA 2BWAA 4IEXA 3NV3A 2GH2A 3PVEA 5DUWA 3RJRA 2A6VA 1SFYA 4EJRA 5C4WC 5JSPA 1IQAA 2NM1A 3SH5A 3MDPA 3CJIC 2GN7A 2JX9A 4AVVA 4L92A 1RUF2 2RS51 1E57A 3J26N 4K3UA 2VOWA 4EN9B 3KCCA 2A6YA 3IDEA 5JIUA 4CDWA 1LHUA 1IHMA 1QXPA 2G9GA 2PA7A 3WP3A 1COV1 1DU3D 2HWF1 2PYTA 4GWNA 5SV5A 1J1TA 1ULEA 2GH8A 4C91A 1CD3G 1RC6A 2CGNA 1BBT2 4AFAA 1BBT1 5KC5A 1HDKA 4YVWA 3BOPA 4LNVA 1VBD2 1VBD1 4Y1YA 2B46X 3M3QA 4LO7A 3POWA 2F4PA 1GSLA 2WA3A 2ZOEB 1QMJA 4XFHA 4YFZA 4HK9A 2CL2A 1W6NA 2VW2A 1SMVA 2H0VA 4AW7A 5I0UA 1QNWA 1W6MA 2VUJA 3N7LA 5KHHA 1H2NA 2PELA 4MGZE 1DGRA 5JIAA 5JDBA 1OFNA 3B7MA 2OUHA 4B29A 3NO8A 2GC2A 1QDOA 3M1HA 5AC92 1DFQA 5AC91 2RS53 3DUIA 1ND2A 2DCKA 4XJ9A 3OYWB 1AJKA 2D97A 4Z82A 4XJWA 5KHJA 1VBC1 1COV3 1OA4A 3W59A 2HWF3 4QHBA 3NAPC 2DURA 3R05A 4CP2A 2R16A 3H1MA 5L36A 4URTA 3SLIA 1NQDA 5EZWA 5JCTA 1BBT3 4E2QA 3J8F2 2DVDA 3J8F1 1VBD3 1O5LA 3MYXA 2A7AA 1YHFA 3E6CC 2IXCA 3BU7A 2ZMLA 3KLSA 4AK3A 5F9TA 3GALA 4Y1ZA 1JXNA 3B94A 2IXLA 1FPN2 1Q43A 1FPN1 4KNCA 3C3VA 4LO6B 2K0GA 2R062 3RZZA 1DQ4A 1IPKA 1YO8A 5JI7A 4YM2A 1PGL1 2JECA 4W65A 3ZPYA 5I93A 2WFPA 3DKWA 4CP0A 3IPVA 1BMV1 3I8TA 5J96B 1IS4A 3OF1A 4LBJA 5FMOS 5AC93 3FWEA 1R081 3HWJA 2ZMKA 3PJQA 2PLV2 3WDVA 3VZLA 3WR0A 3O5SA 3PVOA 4AVAA 3RPQA 3W9AA 4H7MA 2XBO2 2XBO1 1VBC3 4I02A 3L2HA 5IK7A 4E2SA 2ZHKA 1IOAA 5JVVA 2D6NA 4DS0A 2WZR2 3H8UA 2GAUA 2WZR1 4HT1T 2ZGRA 4JDOA 1NXMA 2MHFA 3ZSKA 2WZPP 1LULA 1FV3A 4ATEA 1CAVA 1WW5A 3J8F3 4DXZA 2XH6A 3OY8A 4XEZA 4XJUA 3AKSA 4MXVA 1QQP1 4IEUA 1VB4A 4AHYA 2E9QA 3OGJA 4FPEA 5I91A 1LKNA 4PBPA 4PLOA 2DVBA 1CESA 5K0UA 4OI1A 4LA2A 1FPN3 1HXS1 2BFUL 3AKQA 2VNRA 3WNXA 4AQ2A 1VALA 2AYHA 3AXDA 1CGPA 4ES9A 1YIPA 2NN8A 1H8TA 3VDDA 1KQRA 4RGAA 5EXOA 3V0BB 1C5HA 3TWIA 5JOWA 3NWKA 1R083 1U0AA 5J09A 3UV9A 2BNOA 1RUG2 3DPRA 1R1ZA 1RUG1 3HD8B 5CFCA 2XBO3 4IEQA 2GNMA 1QJX2 2QDRA 1QJX1 4JV4A 1AX0A 5A33A 1XNBA 2C1FA 2WZR3 5FRAA 4KWKA 3WOGA 1YRZA 3ZX7A 3NV4A 4KH9A 1AX2A 4YZ3A 3AYDA 3OPZA 1WW7A 3TBDA 1F8VA 3AJZA 2BVVA 3ZXDA 3WD5A 4P9IA 5C4WA 3FFQA 1QQP3 3ZN6B 4U36A 2R6QA 3B69A 4YM0A 3CEWA 3MIHA 4ONUA 3DF0A 3CJIA 4PLMA 2FBEA 2DF7A 5TSWA 1OHFA 3IM0A 1HXS3 3U0ZA 4YZ1A 4OHXA 1RJ7A 4AI2A 2GMMA 1REEA 1UL9A 4Y1XA 4AFMA 4JRLA 5E89A 3WUDA 4FSJA 5J37A 3THPA 4RGGA 1SEFA 1EYBA 3H3UA 2WT0A 1CONA 4Q4V2 3OCPA 1AXZA 3ZDSA 5BYNA 3SXWA 1PHMA 3OGGA 3VBFC 1LOBA 4TLFA 1RUG3 1IKQA 2XWBB 2UYAA 1V6OA 4QQ2A 3RJ2X 1QJX3 3RMYA 2YC0A 4LO5B 3AMHA 3ECQA 1FAYA 1JUHA 4FP2A 2R0FA 1CAWB 2NYYA 1A8DA 1VBA1 2AH2A 4TWTA 2DUOA 4HSJA 4Y4YA 3WG3A 3LA3A 1O3QA 4KL1A 5I0TA 1X82A 2NMNA 3CLPA 2JD4A 4K7JA 5DUVA 2RM22 4DRVA 2GMEA 2ERFA 2Y0OA 4P9JA 1AR92 1VBE1 1YIFA 1MEC2 3HR9A 1O3SA 3PVBB 4XHXA 2HJIA 1KS4A 4IEZA 4XDQA 3VKMA 4EV0A 1CQ9A 3NAPA 3CU7A 2JE9A 1C8M2 1C8M1 4P14A 3VBUB 1NYWA 1WCKA 1O4TA 2OUJA 3B5LB 1G9CA 3SISA 4IEWA 3OYWA 1TMF2 1TMF1 4Q27A 4YGBA 3VZOA 3H7YA 2GNBA 3WG4A 1XNCA 2FZ1A 4S2DA 5EV7A 4R52A 1VAMA 3AP4A 4JVAA 4AQSA 3SNMA 1VBA3 3JUUA 3VBUC 1GKBA 1PO21 3B9IA 1NE6A 1MS3A 3K48A 1KXGA 2YZ4A 2WLQA 3I4IA 1BCXA 5LK7B 2HWD2 4QD2A 2D6OX 1RB8G 1VBE3 1EV11 4NHKA 1GZ9A 3RYKA 1YFWA 1UIKA 4HKOA 4ZXKA 1LHVA 1LENA 2O8OA 3JBG2 4ITCA 1ULFA 4ISRA 3D4KA 3JQXA 4B4RA 1C8M3 1D4M1 4GIQA 1LU1A 1N47A 1ZRRA 5A32B 4FPFA 2NLRA 1DHKB 1KD7A 1TMF3 3RG0A 4WV8A 5CU1A 1KJRA 3SHRA 4XF0A 2PHRA 3VBRC 1NG0A 3VGIA 2QFEA 1ZREA 4OVEA 4B8EA 4WVZA 1WLTA 1TNRA 4RHV2 4E2GA 1PO23 5ACA2 5ACA1 3OD4A 4H7LA 3I59B 2B8MA 4RSUA 5T5PA 5IUQA 4Z07A 2JG9B 4XIKA 2E7AA 5FMOL 1EV13 1AR71 4I0BA 1NLRA 4BWOA 4NOTA 3G7DA 4COZA 4Y20B 2XJVA 3V0BA 2JG9C 2MPFA 1DIWA 1D4M3 2WC2A 2GSYA 4PIYA 4DY3A 1MQTB 3BOWA 1URXA 2JEMA 4B7EA 1SFNA 3AP7A 1ZVFA 4GXLA 1V6JA 3IMNA 3LKJA 3ZYGA 2W68A 4XJZA 1DGRN 5DZGA 4K40A 4L2NA 1MQTC 1ZZCA 2NPIA 3AMPA 1UU5A 4LLFA 3VLBB 5ACA3 3NW4A 4YNIA 3JB8A 1OQEA 4ZU4A 3VL8A 1B09A 2Y26A 2D6KA 2VVFA 3HT1A 3FBYA 4YG0A 4FTSA 5FREA 3J9SA 5H9RA 3ZIWA 3MICA 4DRRA 2LM3A 3T1LA 5J3UA 3WQ1A 4OLLA 1MZ5A 3V64A 1LECA 1J3RA 3NKGA 1AR73 3S7EA 3VBFA 4EN0A 2B39A 2B5HA 4XXPA 1PNFA 1S0IA 2VH9A 4HSLA 1K5MB 3WQ7A 4L11A 4YZ2A 4CDWB 2DTWA 4R9DA 3O0WA 2EA7A 4E4SA 2EF6A 4FPCA 3B93A 1NY71 3MPPG 5E88A 2R49A 5JI9A 1K5MC 5JOYA 1H2MA 3IDBB 3AFGA 4K8FA 3J4UH 4RL7A 4CDWC 4IEVA 1CAWA 2MNGA 4GULA 1Q5OA 4MH0E 4K1YA 5F6LB 4LE3A 1REFA 2XPJA 4UBGA 1QJY2 1QJY1 1W6NB 1GZCA 4NHLA 2H0BA 3LGRA 2Q8OA 1AZDA 1H1AA 2WJSA 3FHIB 1HRI2 1HRI1 4GMP1 2A6XA 3ZMOA 1DQ1A 4IEYA 2Q1ZB 2AUYA 3JZVA 3ETQA 5BNOB 5C9AA 1KDKA 1SCRA 1C1FA 1V6IA 3KT7A 3WUCA 1CIWA 1ND2B 1WLWA 1J58A 4GH4B 4JGZC 2IZWA 4KWJA 1WGPA 2OPKA 2QVSB 3ES4A 4MYEA 2BGCA 4YW2A 3VBUA 1NA1B 4GMP0 5BNOC 4UBHA 2VY0A 4GWMA 1MS4A 1HIXA 4GH4C 5T5OA 5FO9B 4Q8LA 4C1XA 1TQ5A 2VMHA 4Z2WA 3ZYRA 1NA1C 3EQEA 4X6RB 5GM0A 1QJY3 5CVRA 5FFOC 2B7YA 3VKNA 3AP9A 4LLOA 2Z5WA 4AEMA 4YZ5A 1VAKA 3HIFA 1BK1A 2ZZJA 4XQDA 1SLIA 3PTYA 1HRI3 4GMP3 1ZRCA 2ZKLA 4MGKE 4YM3A 3E5XA 2IFWA 3IPVB 1RMU2 1RMU1 4DZGA 2GNDA 2DWRA 4LBOA 2PHWA 3NVCA 3VV1A 3WT3A 5BPXA 1W6QA 3VBRA 5DDJ2 5DDJ1 3UKVA 4LHNA 4Y5Z0 4YW5A 2BPA2 5CFDB 2WNUC 1Z7S1 1JW6A 2ZKNA 5A32A 1ENQA 1OA2A 4N53B 2V09A 5CB7A 2DV9A 4M01A 1QOSA 2YUEA 1CAVB 3MIFA 3MLKA 1AX1A 1VRH2 1AYN2 3AZZA 1QH7A 1AYN1 3P3NA 3AMNA 5CFDC 3ES1A 1NE4A 3LA2A 1I6XA 1KITA 4OHVA 1XU1A 3PMEA 4MXWA 2E6VA 4N53C 4EWDA 2E51A 4IL7A 3TAYA 1APNA 4JQRA 3AKPA 4Q0PA 4Y24A 4HKLA 2JG9A 3H7JA 5E1RA 3M8LA 3X29B 3VDDB 1PGSA 4HN0A 1HV1A 3VZJA 1RMU3 4EN7B 3A0NA 5JMCA 2BNMA 3AZVA 3MPBA 4LTAA 4XW3A 4Y20A 5ABJB 5CFCB 2GDFA 5DDJ3 4AEDB 2CNAA 2X8KA 2ZS6B 2CWMA 1MQTA 1Z7S3 2HYKA 1UPIA 3UK9A 3SCFA 1WW4A 5ABJC 2ES3A 4ORFA 3IN9A 2D3RA 3MI8A 1MS0A 4F83A 4AEDC 5HXVA 1AYN3 4X6QB 5K8SA 4YW4A 3CJIB 4WVWA 2XWJB 5IK4A 1U5XA 2XHKA 4LO4B 1HQLA 2PFWA 2KA3A 1OFSA 4PBOA 2D3SA 3AXEA 2VOKA 2D43A 1ZZ8A 1TEIA 1X36A 1LGCA 1XYNA 5JSRA 1RHI2 1RHI1 2P17A 3KQRA 3AK0A 4E4DX 1ZZ6A 1RUF1 1GBGA 3WDTA 2ZGQA 4LE4A 2XB6C 4UW4A 3I2DA 4QQPA 1K5MA 1S0CA 1FOD2 1SLBA 4FPLA 2R32A 3MW2A 3ZVXA 1DQ5A 3WDXA 3OTFA 1PK6A 1Z0HA 4A2UA 2D40A 2QUOA 5FLHA 2VPVA 4IXLA 3TB0A 1SLAA 2WNEA 2HWC2 2ZGUA 3DGTA 3E6DA 5EWSA 2ZBJA 4I3PA 1DQ6A 4DY5A 3TOJA 4KG8A 3S7IA 3WHTA 4A7KA 2A71A 3FC0A 4IETA 4BLJA 1NXD1 4AHWA 4EN8B 3KT4A 3RI9A 1DZRA 4XBQA 4JGZA 4XIOA 1AR82 3R6SA 1AR81 1HKDA 3HQXA 1LHWA 3ZYIB 5T5LA 1RHI3 1FI2A 2XJSA 2FHRA 3NAPB 5BNOA 1RUF3 4BIFA 3ZFEA 4GH4A 3LSDA 3QH6A 3VKLA 1R1A2 1R1A1 4D94A 4GALA 4KWLA 1RUE2 4LO8A 1RUE1 5B2GB 1JH5A 4W6YA 1NA1A 2P3KA 3KT1A 1CAUB 4WBBA 2ZGSA 2D93A 5FOBB 2DTYA 3QACA 2ZA9A 5CAZA 1C5IA 5JZGB 5CIRA 1QDCA 1SLLA 4META 2R042 3PVNA 1UD1A 2K9ZA 1YFYA 2WSVA 2E7TA 4WM8B 3ZSEA 1OOPB 1GZWA 4CDQC 3OD0A 4XBLA 4S2GA 5JOXA 5JZGC 2R061 2DUPA 5BNPB 1TNFA 2DUQA 4XFAA 1AR83 3FBMA 2KXLA 4J1WA 1LGBA 1DZTA 4WM8C 1OOPC 1V00A 2UY8A 3H50A 2GZWA 1RUOA 2WNUA 3POYA 1J1LA 1UU4A 2ILMA 2PLV1 1QJU2 5BNPC 1QJU1 4QPIB 1R1A3 2AGSA 4XOGA 2DYCA 5I0RA 1RUE3 3ATGA 1XE8A 5CFDA 5BNQA 1JHNA 3U4XA 3ZXJA 1H8VA 3VHRA 1TE1B 5A3LA 1BKZA 4N53A 4QQOA 1VLNA 4QPIC 3RI8A 1HRV2 3VZMA 3FX3A 2VGDA 5GZGA 2YXSA 2CTVA 3LOBA 1N3PA 3MLLA 4IESA 4QQHA 1Q3EA 2CAUA 4LT5A 1GYKA 3D0JA 3M3IA 4LBLA 1CPMA 1VP6A 3KSCA 3IWZA 1GNHA 4RQPB 3MGUA 2R063 4OI2A 4N7UA 2PAEA 1MS8A 5FO7B 3WW2A 2VVEA 1W39A 4LHKA 4XJ8A 1PVXA 1XYPA 4JTNA 5GZEA 1RUJ2 2GMPA 4ZU5A 2XJTA 4FPOB 2PLV3 4RQPC 4XBNA 3MIDA 5ABJA 1QJU3 3FE5A 1MVQA 3DL3A 4YLZA 4AEDA 4HETA 2A3YA 5KHGA 1QF3A 1BEV2 3T1MA 2ZGLA 1EPZA 5IK8A 1TME2 4QPYA 1N1TA 1VIWB 4BYYA 4RS5A 1RUNA 3UJQA 1ASJ2 4YGDA 2XLGA 4I0WB 2BYVE 3VN4A 1ZZ7A 3PHMA 3HMYA 3TYJA 1W0OA 1PM7A 3WY6A 3BTAA 2MEV2 3BIWE 5IK5A 3MW3A 1AJOA 2IXKA 1ZBA2 2XJRA 4OUSA 1ZBA1 4GKXA 1S0EA 2OZJA 4J1XA 4FCAA 5FOJB 1BXHA 1DGLA 1L3JA 4R9AA 4Q0UA 4J6GA 2WL1A 2CYFA 5GLWA 4AEJA 3VBFB 2CAVA 2ARBA 1LOAA 2RE9A 3AZXA 3O0XA 1UKGA 1YXWA 1Q8QA 4GKYA 2WQZC 1U5ZA 4P9GA 4Q1RA 3ZIXA 2TUNA 3I7DA 1HX6A 1F2NA 4AFBA 4Q4V1 2HEYF 3SH3A 4UXAA 5D1IA 3JQWA 2Z69A 2W39A 4HVOA 4EWEA 3N3HA 4S2HA 1O3TA 1LOCA 4L8QA 4N9HA 2Q5TA 4XFBA 4FPJA 2P3JA 2NQYA 3V65A 4QGNA 1I5ZA 4XF3A 4ZKTB 4HK8A 5JOZA 3GBGA 1S0BA 2GALA 3VKFC 4AE2A 3WDUA 1IS6A 4QQLA 4BH9A 4WVVA 1ZBA3 3WINE 2UYBA 3DV8A 3TN92 2RM21 2EIGA 2QKDA 4D69A 1WMFA 4I2OA 4LBNA 3WDYA 3MFAA 5BNNB 1A8MA 1SACA 2XL9A 5FLIA 1DGWX 1AR91 1G86A 1LJ7A 4FTEA 1MEC1 1RL3A 4LUKA 2XVLA 5LRRA 5C9AB 1S0JA 2E53A 1YYNA 2NMOA 2WINB 3ZN4A 3IIAA 4Q4V3 3FMGA 5HCFA 5BNNC 2ZX3A 3RYRA 3R0RA 1GR3A 2F6BA 1S0FA 1WD3A 1KFXL 2RS12 1QOTA 2RS11 5C9AC 1LOGA 2VNGA 4M00A 1RUI2 2PN5A 1RUI1 1QNYA 1SCSA 5JR7B 4EN6B 1YFUA 1UX6A 3NJZA 4FTBA 3JD72 3JD71 1DQ0A 1CAUA 1QKQA 4B4QA 1AR62 1LOFC 4IQPA 1XRUA 5SV8A 3POSA 4CDQA 4OI4A 2D6LX 4XFFA 3RWNA 5JZGA 4ZU7A 2DCTA 4M3CB 4P5HA 3MIGA 4GQ7A 3E97A 3RYPA 3P3PA 1AL0G 2RM23 2HWD1 4DQAA 4WM8A 3CO2A 1GICA 1OOPA 4BHPA 1ZNPA 1AR93 5AVPA 4NWWA 1MEC3 4BPZA 1OMIA 1MS1A 2YMZA 5CBLA 1ALYA 5BNPA 4NWVA 4K1ZA 5GZDA 5T3NA 1OA3A 5JLVA 3JBG1 3ILRA 2TNFA 1W6QB 3VBRB 3LZZA 3GHNA 4P9LA 4XE9A 4HVRA 1U5IA 3ZYPA 4PF5A 2RS13 3AFKA 4QPIA 4YVSB 1RUI3 2PHDA 5T54A 5EYXA 4COUA 2VOXA 1G7YA 3WHUA 2P34A 2WWSA 3JD73 2W52A 2HEVF 5FPXA 4BOWA 4JDMA 5DUXA 4OI0A 2LALA 4RHV1 2HWB2 1CJDA 4YVSC 3AMMA 5L73A 5JWPA 4MXWB 4RA0A 2DVAA 4XXAA 1WA4A 3B02A 2EALA 3VBHA 1NQJA 1NCQC 1RUC2 1RUC1 2HWD3 4CYDA 2GC1A 3PNAA 3RSJA 1RUH2 4D7TA 4RQPA 3KMHA 3LSEA 1T6GC 4AFDA 4FXGB 1QU0A 1GQHA 1V6NA 2TEPA 2WQ4A 3JBG3 1ENRA 1UKRA 3N36A 2VU9A 1FNYA 3WG1A 2ZGKA 2YYOA 4G4FA 2RS32 5BV6A 3WV6A 4K6BA 5GJ6A 1I1EA 3ZFGB 2DCYA 4NR1A 4BE3A 4AGRA 5I0SA 1WW6A 4YG6A 2VQ0A 5GLVA 3LCPA 3MEPA 3NL1A 1RGSA 2OVUA 1DG6A 3N7MA 3R4UA 2ET7A 4Y1VA 3ZFGC 2CWSA 3KGLA 4FPHA 4RHV3 3E5UA 5C8WA 5LEKA 1RUC3 4QX5A 3USSA 4FOQA 3KGZA 4Q0QA 2PAKA 5FQ0A 4X8NA 1RVF2 1RVF1 2JXAA 2RJKA 1S2KA 3BCWA 4B4PA 1DYKA 1EY2A 2IFRA 1W6OA 3DN7A 3UKNA 3KZ4C 1XNKA 2V5YA 2XLAA 1YFXA 1VAVA 2UWCA 3KB5A 3L9JT 3S6PA 3THTA 4DB5A 1H2LA 1I3HA 5GLTA 3SITA 3BB6A 2RS33 1OD5A 4G3YC 5CG9A 4Q26A 2I2SA 3ASIA 2ENRA 1PK6B 5AFBA 1QH6A 1ZRDA 1CR7A 1Q8OA 3WP5A 4YZ4A 3FFZA 3V0AB 4XFGA 4QGLA 2FZ2A 5A3MA 5KWRA 4AI8A 1QGLA 1JUIA 3TNQA 1O4ZA 5AVAA 4YARA 2ZAAA 3D5OA 1ZM1A 2FMYA 4BM8A 4LBMA 3H1WA 2E63A 1BZWA 2R1BA 2VQAA 1PK6C 2GC3A 3WW4A 1BYHA 4KBBA 1MVEA 4LBQB 2A6ZA 2BEOA 3GZAA 3AB0A