4IESA

Cys-persulfenate bound cysteine dioxygenase at ph 6.2 in the presence of cys
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
186
structure length
186
Chain Sequence
ELLKPRTLADLIRILHELFAGDEVNVEEVQAVLEAYESNPAEWALYAKFDQYRYTRNLVDQGNGKFNLMILCWGEGHGSSIHDHTDSHCFLKLLQGNLKETLFDWPDKKSNEMIKKSERTLRENQCAYINDSIGLHRVENVSHTEPAVSLHLYSPPFDTCHAFDQRTGHKNKVTMTFHSKFGIRTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cysteine Dioxygenase Structures from pH4 to 9: Consistent Cys-Persulfenate Formation at Intermediate pH and a Cys-Bound Enzyme at Higher pH.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Oxidoreductase
molecule keywords Cysteine dioxygenase type 1
total genus 55
structure length 186
sequence length 186
ec nomenclature ec 1.13.11.20: Cysteine dioxygenase.
pdb deposition date 2012-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05995 CDO_I Cysteine dioxygenase type I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4iesA00
2HJIA 2ET1A 4KWJA 5I93A 3TNPB 4XEZA 1LR5A 5FDBA 3CF6E 1CGPA 2OZJA 4MGYE 3GYDA 4IEPA 4WBBA 4EV0A 1O3QA 5JSRA 1GQGA 2EVXA 4B29A 3E5XA 4META 4BIFA 3RZZA 4XFGA 4RD7A 4J1XA 4P9GA 3DV8A 2IXHA 4K8FA 4E2QA 5FLHA 1UCXA 4HN0A 2N7GA 3BPZA 1L3JA 4MGKE 3U11A 1YUDA 3JZVA 4ORFA 5KBFA 3USSA 1LKNA 4ONUA 2DCTA 2OPKA 4F7ZA 5K8SA 3WW3A 2PQQA 2MNGA 4HBNA 4UBHA 3EBRA 3LA7A 1ZZ6A 1H1MA 4EWDA 4Q0PA 4QGLA 3DKWA 3GBFA 3S7IA 3IDCB 4XF9A 4MUVA 1J58A 5T3NA 5I8YA 3RYPA 1RC6A 2IXLA 2CGPA 1ZX5A 3RDIA 4CYDA 4KWKA 5E1RA 1CAVA 3LA3A 4IEXA 1IPKA 3RNSA 1CAXA 4AVCA 1XRUA 2IC1A 1XE7A 1NE4A 3UKTA 2WFPA 1ZZCA 3CJXA 1CAXB 2UY8A 1ZRRA 3BB6A 4XFAA 4OLLA 4MX3A 2GZWA 3LZZA 4XFCA 5FLIA 1O3TA 5LRRA 2BEOA 1DZRA 3ES4A 1O5LA 4I01A 1YHFA 2QVSB 5LRSA 2XKPA 4UBGA 4PIZA 2C0ZA 4H7LA 5I0UA 5C6CA 3R6SA 3SMHA 5FLJA 1CAUA 3I59A 2ATFA 4MH0E 1DGRA 4O9GA 5JCTA 5BXXA 4R52A 4KU8A 4I09A 5EZWA 3H3UA 1ZREA 4EROA 1RTVA 1X7NA 2K0GA 2UYBA 4XF0A 3KMHA 1GQHA 1EY2A 4IEOA 2IXCA 2ET7A 2B8MA 3FX3A 4X6QB 2GH2A 4WVZA 5JR7B 1V70A 2XLFA 5F1RA 3ETQA 4HZFA 3ROUA 3RYRA 3U0ZA 3TNQA 5KHJA 2O1QA 5E16A 2FQPA 1NZCA 4HVOA 3NSTA 2K9ZA 2GC1A 3H8UA 3H7JA 4L11A 1EYBA 4PJYA 3QOPA 1Q3EA 1CAWA 2UYAA 5KHKA 4BYYA 5FCCA 4J1WA 3E5QA 1O3SA 4Q0SA 3ELNA 3E6DA 2B9UA 4OFGA 1EP0A 4AVAA 2ZCWA 4QGNA 2MPFA 4LEJA 1CAWB 1NE6A 3BALA 4GULA 3EJKA 2D40A 4AVBA 1O5UA 1SFNA 1UPIA 3H50A 4HMZA 1QXRA 3SXWA 3M70A 4Q0QA 4DINB 5BV6A 3BCWA 3C3VA 2GC0A 3O14A 1QWRA 4N9IA 1RL3A 3UKVA 3LAGA 4AQ2A 1ZRCA 1J3QA 3WW4A 3NL1A 3VHRA 4XF1A 4Q0VA 2XLGA 3EHKA 3ACLA 4I0BA 3FZ3A 2BYVE 4JTNA 4NVPA 4LTAA 2XHKA 3I59B 3QACA 2PFWA 3SCHA 1JUHA 4IESA 1LB2A 4XF4A 5CVRA 3SCGA 4LA3A 3KCCA 5BY5A 2PAKA 2Q4SA 3MDPA 5I91A 5I8SA 1TQ5A 2ZKLA 5JAXA 1UD1A 2Q0AA 1J59A 3MYXA 3RYKA 3S7EA 2O8QA 2XKOA 4YNIA 4KWLA 1CX4A 1CAUB 5LEKA 1OD5A 1LRHA 1OMIA 1RUNA 1PMIA 4JV4A 1O7FA 4XFBA 4QX5A 1Q5OA 5JSOA 3HQXA 2OZ6A 1WGPA 3H9AA 2CV6A 2PTMA 4HVRA 4XF3A 3ZDSA 3I7DA 2BNMA 5EFUA 3IBMA 2D5HA 2IXIA 2XL9A 1DZTA 2Y0OA 3FFQA 1U12A 4IEQA 2D93A 2Q30A 2QDRA 2QNKA 1OFNA 4YRDA 3E6CC 3L2HA 4BHPA 4AQ6A 3OF1A 1J1LA 4MZUA 1HW5A 1J3RA 2H6CA 1SQ4A 5KHGA 3MPBA 1ZZ8A 2P17A 1UIKA 3OTFA 3IWZA 3NVCA 5CU1A 1X8EA 3KGZA 4Q0UA 2V09A 4HN1A 2PA7A 4EWAA 3E97A 4XETA 2HKXA 4I02A 1X8MA 1X82A 4FAHA 1WA4A 1Y3TA 3FJSA 4QMAA 1YLLA 3CEWA 2BNNA 3EO6A 4HLTA 4I2OA 3PNAA 3CLPA 4BH9A 4ZU4A 3N4MA 1ZZ9A 2KXLA 2QCSB 4LLOA 3E6BA 3H7YA 1NXMA 4KU7A 1UW8A 1PM7A 2BNOA 1YFYA 4YARA 2F4PA 5BPXA 2IXKA 2EA7A 3NKTA 3SCFA 5LEJA 4MGIE 2XGXA 3G7DA 5I0TA 4Z07A 1RUOA 4MV2A 1WLTA 2H0VA 4KL1A 3IIAA 1ZZBA 4FBFA 3FE5A 4D7TA 5J3UA 4HSLA 2OYZA 1DGWA 4TLFA 1ZNPA 2D5FA 1O3RA 3SHRA 1I6XA 5CADA 5J7MA 1XE8A 1ZRFA 4QM8A 5C8WA 5KHIA 3CO2A 2CAVA 3BU7A 4E2SA 5FQ0B 3LA2A 4HVQA 4UXAA 1FT9A 4Q29A 1VR3A 3E5UA 1G6NA 4IERA 3DL3A 1YWKA 3LWCA 4IEYA 3DN7A 1J3PA 3PLQA 3WW2A 2PHDA 4I3PA 4LUMA 3EQEA 3HIFA 4FT8A 3S0MA 5D1IA 4EWEA 4ZU5A 2CAUA 2IXJA 3U10A 2UY9A 3CL1A 5FQ0A 4PIXA 2QJVA 2MHFA 2XL7A 4QXKA 4A2UA 4HSJA 4O9EA 1YFXA 2GU9A 2VQAA 5J48A 4ZU7A 1QY4A 3H1WA 3NJZA 3H3ZA 1IPJA 1OI6A 3PVBB 2Q1ZB 2B5HA 4R8HA 2VPVA 3D82A 2BGCA 2PYTA 4WZCA 5I0SA 3D0JA 4IEUA 5AVPA 4LA2A 3MZHA 5I0RA 5FPXA 2EAAA 3H1YA 3IDBB 1ZRDA 4XFHA 1FXZA 4YYOA 3HT1A 4QM9A 2OA2A 2PAMA 3RPQA 5FPZA 4E2GA 4D7SA 3LOIA 4FAGA 5JSPA 2VECA 2GC3A 2PHLA 4LULA 4YSFA 4N9HA 2GAUA 2I45A 3FHIB 5HI0A 4L2NA 1FI2A 3OCPA 1VP6A 4F8AA 3ES1A 4IEVA 1RGSA 2WC2A 3H1MA 4LUKA 4AXOA 3OGJA 1NYWA 1VJ2A 1ZVFA 3NW4A 3D0SA 3M3IA 4IEZA 2ETEA 2PAEA 1Q43A 4IEWA 3ST7A 1YFUA 1EPZA 2GC2A 2XLAA 4QGMA 3OD0A 3B02A 4XFIA 4I0AA 4XFFA 3UKNA 1I5ZA 1Y9QA 3KGLA 3FWEA 3KSCA 2Z69A 3HT2A 1YFWA 4MGZE 4PIYA 1QXJA 1ZZ7A 3WW1A 5KHHA 5I8TA 2H6BA 2FMYA 4IETA 4X6RB 5BUVA 4Z82A 1H1IA 1O4TA 3I54A 4JTOA 2E9QA 1CAVB 4JVAA 1SEFA 1UIJA 2Z2SB
chains in the Genus database with same CATH superfamily
2JKBA 3BTYA 2ET1A 4KWJA 1VBD2 1G9CA 1ACCA 5I93A 1VBE1 1S0DA 1W8TA 2TNFA 5FZ6A 4XEZA 5CNAA 3N7KA 2MEV1 3T0AA 3R4UA 3PUHA 2ADEA 2HWF2 4JRAA 4ATFA 1LCLA 2VZSA 3DUIA 3LDRA 1S2KA 2LM3A 4CUAA 4OHWA 1O3QA 4LMFA 3QBQA 2VMIA 3ZR6A 5CKMA 1E5RA 4B29A 5JSRA 3LPFA 3LEGA 1O91A 4META 1QNWA 2VMFA 4IE4A 4BIFA 3T2PA 3RZZA 4CTEA 2RR13 2P6CA 2BZDA 3PUAA 4R4XA 3ZSKA 4YZ2A 3WSOA 4AI8A 5FZHA 1DLCA 1RUH3 4FPHA 4OQ8A 1JOJA 5L73A 2R061 1JN2P 4A6OA 4K8FA 2ZXQA 4CXYA 2BJSA 4YPJA 5FZEA 3N9LA 2VQ0A 2W52A 2TEPA 5FMDA 1DQ6A 2B46X 1U5IA 3BPZA 4CPBA 1W9FA 4AAXA 1KGYA 4MGKE 2AR6A 3AMNA 3GBGA 1RVF3 4Q4V1 1KDMA 4TWTA 3MFCA 4L97A 4PF5A 4YW3A 4YW2A 3USSA 5LASA 1R082 2XVLA 1QOTA 3AZWA 4AFMA 4XW3A 2DCZA 2PQQA 2FDKA 2MNGA 1GLHA 1NUKA 4HBNA 4UBHA 3J8F2 2VZUA 4EWDA 5F2WA 4Q0PA 3CNAA 1SLIA 1BEV1 3LB9A 1ZA7A 3K51A 1KD7A 5JLVA 1W90A 3BUCA 4X8PA 3KT7A 5L7OC 4XF9A 4MUVA 3WR0A 5T3NA 1AR91 4GALA 1PO23 3VBUB 4CDUA 3GZEA 5LA0A 2IXLA 4EZHA 2ZMKA 5AFBA 3A21A 3UGFA 3VBHC 4UFJA 1ZX5A 2P3JA 3GCWA 4YM0A 1AVBA 4Q4X3 3VDCA 4CVUA 4KWKA 1FNZA 3UV9A 1ONAA 3WZ1A 4QDRA 3MLLA 1VBD1 4GKXA 3POBA 4NPLA 1YJKA 2RS12 3RNSA 2WZPP 5CIRA 1EAH3 1TME1 4BU2A 1GSLA 2G9ZA 4Q4W2 5A70A 2LUWA 3UKTA 2YBPA 3I2JA 1JOPA 1ZZCA 3CJXA 3L2YA 1CAXB 1AR73 1FAYA 1B35A 1UYPA 1WCUA 4JGZB 2LW8A 4L99A 4OLLA 3AZZA 2GZWA 1IPSA 1GUIA 3VKOA 5FYSA 1NCRC 1TNFA 2Q8CA 3MIGA 1DZRA 2VR4A 4QPWA 4N8MA 4B1MA 3RZJA 1ASJ3 3ZPYA 1XOYA 1EUTA 2RJ2A 2A6VA 2GNBA 3KLSA 4FXKB 4DXZA 3ZKYA 3RZHA 2ZHKA 2WDBA 5DMYA 5FYIA 4LKFA 4CEWC 5C9AC 3RZGA 2C0ZA 1GICA 4DO0A 1OA3A 2R063 3R6SA 3INAA 4QWNA 3T4HB 4GH4A 5A6YA 4HL0A 4SBVA 4JQRA 3NWKA 1FX5A 2A6YA 2UWCA 1MACA 5L9RA 4AGRA 2E63A 1MEC3 5BXXA 2OS2A 4R52A 4RL7A 4QPGA 1XPWA 1YIPA 3H3UA 3AL6A 2DDUA 5FZLA 1JBCA 2GN7A 1X7NA 2JEMA 2D6PA 5A3NA 1BHGA 1RIRA 1POQA 3WG1A 1EY2A 1ASJ1 2FZ1A 4PBOA 2ET7A 1K5MC 2B8MA 3O1RA 4FCAA 1LOFC 1W28A 1SCRA 1AYM3 3ETQA 4JGYB 1DGRN 4A7YA 2V5YA 5FYVA 3FLTA 2O1QA 4PDWB 3UYJA 5A3MA 5ACA3 4HXCA 1UXXX 2WL1A 1QNYA 4FPCA 3NSTA 3H8UA 4P9IA 1BBT3 4ASLA 3UT0A 1PO12 4PJYA 2XJRA 1LENA 3B93A 3VZLA 3KVAA 5FMOS 4C1XA 2PHRA 4MGSA 4KH9A 3ZFFA 5FFOC 3P3PA 1GQPA 1V00A 4UF0A 4H2AA 1Y9MA 4YVWC 4J1WA 3JB8A 3JUUA 1O3SA 1A8DA 3AYEA 4Q0SA 2EXHA 3ELNA 1HJFA 1JYCA 3WDYA 2YFZA 2E6VA 2QQKA 1WD4A 1UY3A 4QX2A 5FBJA 4A7ZA 1QJU3 1QJFA 3NAPC 3MEPA 2C5DA 3POEA 2LTNA 2WN2A 1AL0G 4R9AA 2D3RA 5IVBA 3EJKA 2D40A 3N9QA 1QJX3 2VU9A 2ZX3A 3OPTA 1EV13 3I2DA 4GJYA 5E88A 5C8CB 1S0CA 5ACA1 3WCSA 4XBNA 3SXWA 2VUCA 1FMD3 5DUWA 1TG7A 3USUB 2G9GA 4LBKA 2VOTA 3SH3A 3WT3A 1RMU3 5DAVA 4AQ2A 4AE2A 2PLV3 4NR1A 1ZRCA 5EIYB 4YG6A 3C7FA 4Y1UA 3KV5A 2LALA 3J26N 1C5IA 1VBC1 4MYEA 1IKPA 4Y24A 2XLGA 2C6SA 3VHRA 1WCDJ 2JDPA 2XWJB 4I0WB 4PT6A 3U4SA 3H8XA 5FKBA 3RJRA 3MIBA 1A3KA 3S30A 2PFWA 3HJRA 3OOXA 4XF4A 2DCJA 4ZS2A 5F5IA 2W2IA 1PX3A 4Q27A 3LFMA 5FMBA 3VBFA 2JG9B 3VUOA 2I07B 2B4KA 3JBG3 4JDMA 2RM21 1RJ7A 4C91A 2JDZA 4KWUA 2Q0AA 2WNUB 4JX0A 2NPIA 4MSVA 3RYKA 3N7JA 4IGPA 2O8QA 4YNIA 3ZFEA 4DS0A 3WDXA 3WHUA 4OHVA 1J83A 2AENA 1OD5A 2RG4A 3F95A 1PMIA 2ENRA 3I2HA 1MPXA 1O7FA 4XACA 1SDWA 4AFBA 5DDJ2 3KV4A 1LODA 2JE8A 3KCYA 4CCCA 1LGNA 3PJQA 2R062 4Y4RA 3BYWA 4Z8BA 2OZ6A 3OUHA 1WGPA 2A3WA 2VQTA 3H9AA 2SLIA 4WVMA 2Y8KA 3ZXAC 5EYXA 1U5XA 5CZKA 4AFDA 4RS5C 3AVRA 1DGWX 2Y6FA 1QKQA 2BNMA 4XHBA 3IBMA 1RHI3 1S55A 4IE0A 1NQDA 3AP9A 4YG0A 4FPJA 2OQ7A 2IFRA 1PGW2 5LY1A 1OFNA 2ZAHA 3C8XA 5ERLA 3KCXA 3NJYA 2ZBJA 4FOWA 4XTPA 1RUE2 1L7LA 4XYXA 4A4AA 3OBTA 4AQ6A 1VBE2 5C9AB 1XU2A 4LO5B 1GNHA 2R7EB 1W2AX 3ENRA 1J3RA 5G04L 1VPHA 1SQ4A 5GJ6A 3BU0A 1SLLA 2B45X 2JDYA 1CIWA 4Q8LA 2DWRA 2P17A 2OX0A 4NIIA 2RHPA 1YO8A 2WNOA 2YU2A 3OD4A 1C8M2 2VOKA 1PGL1 5EHDA 3M8LA 3NVCA 1ZRIA 4PQQA 1IG3A 1D4M2 3J7HA 4Q0UA 4D6SA 1RJ8A 1KJLA 2BBAA 1UF2C 2F17A 4YW1A 5F8PA 2F4LA 3OUIA 1HN1A 4W50A 1C4RA 3ZSJA 4D7YA 1YXWA 2JDKA 2PA7A 5JMCA 1W8OA 5B4NA 2QFEA 1B35C 1D4M1 4LIUA 2CU5A 1FPN3 1X82A 5BNPC 1LHOA 1Y3TA 2YFUA 1VBC3 3FJSA 1OHFA 3OG2A 4Y20A 3KHBA 1SPPB 2BNNA 4LO4B 5HPOA 2QKDA 4CDQC 3TBDA 1YQ6A 4C0BA 4XQ4A 5DUVA 1S0GA 1W06A 4HLTA 4LJHA 5FZKA 2A5ZA 4D6RA 5A33B 4C8DA 2YBSA 1CZVA 3GBWA 4QPIB 4R9BA 4ZU4A 3LIHA 4XAEA 3MPPG 1ZZ9A 5FP4A 2AH2A 4AR2A 1R1A2 3E6BA 2F6BA 3VBSB 2WZR3 1OT5A 5FY7A 1AJOA 1BZWA 1PVC1 2WO1A 2X53S 3N9PA 1NT0A 5CG8A 1KS5A 3NO8A 2G9FA 5GZEA 1N1YA 3URFA 2IXKA 2EA7A 2VG9A 2W08A 3AZYA 2X5IB 3WY6A 4ASKA 5F3EA 1A6CA 1O8SA 1X36A 3ILRA 1AR92 4K3UA 3BTXA 3T08A 1VBB1 3OB8A 4DRVA 1GP5A 1ZZBA 4NRQA 4FBFA 1DP0A 5HCAA 3H8OA 3MLKA 3J8F1 1DGWA 1PMJX 1UO9A 1IZ3A 2C1FA 3PMEA 4G3YC 1ZBA3 3ZYHA 2D6OX 1ZNPA 2D5FA 5D21A 3VBOC 1ND2A 1S2BA 3MO4A 1PK6B 5DDJ1 4UAPA 1XE8A 3MUZ1 4P08A 3JD72 1JYTA 1GOGA 3OPZA 1ZRFA 4CCNA 1IQDC 4QB6A 4E2SA 1DQ0A 5FQ0B 4Q4V2 4AHYA 4FTSA 3GM8A 4AWDA 4UFMA 1IOAA 1VR3A 3E5UA 1XC6A 2HYXA 3C7HA 3HN1A 2Y34A 3NNJA 4YVSC 5LA2A 2QQMA 4PCRA 4IEYA 3U78A 3DN7A 1PGSA 4RGGA 4CP2A 1ULCA 5DZEA 5C4WB 5JOXA 4NE9A 5ISLA 1RHI2 3B7MA 3OGVA 4XABA 3VD5A 3HIFA 5CFCC 5IK7A 2UURA 3LEMA 4RS5A 5D1IA 4K6BA 3LDKA 4GZ9A 4FFHA 2ZEZA 1GWLA 5E6HA 2WFF3 3WQ1A 5ABJC 4AEMA 1V9U2 3Q8CA 1TMF2 3NV1A 4DXTA 5FQ0A 4QX7A 4PIXA 5LB6A 1BXHA 2RMU1 3WP4A 1ND3A 3RS6A 3AXEA 2XL7A 5IVEA 1JZ5A 2DUOA 2YDEA 3QH7A 4YVSA 1H8TB 2JENA 3VZMA 4QX0A 2R042 4LOSA 4ZU7A 2VQUA 4ISRA 2XJTA 1OURA 2BOJA 3AC0A 1POV3 4CZSA 2B5HA 1DQ5A 1W8UA 5FY1A 1CPMA 2K46A 2RS33 3O7OA 1AR61 1BLZA 2CHHA 2RE9A 4JQTA 2TUNA 3AKRA 3MZHA 2WQZC 5J37A 3V64A 2JDMA 1GBGA 4GXLA 4IV3B 2Z42A 4DXSA 4G4FA 4RYDA 1H8VA 2BU9A 3IDBB 1ZRDA 3ILNA 3LPGA 5L19A 1UL9A 1UY0A 2K2SA 2PAMA 3N3HA 4GWJA 5FPZA 5IK4A 3KVBA 2JIGA 4D7SA 4DY5A 1STMA 4N53C 5FP8A 5C3RA 5FZCA 4LULA 4YSFA 4LLFA 1MZFA 5EQUA 2GAUA 4A3XA 3WDVA 3FHIB 5GLVA 2P5BA 4L2NA 2AEYA 3AKQA 1SPPA 4FPYA 3WG4A 1JU4A 1BBT1 1AZDA 1POV1 1FI2A 5FZ8A 1VP6A 2NMOA 4GB33 4DB5A 5BNNA 4F8AA 2QQUA 1MS8A 2HWE3 1YYNA 4FPEA 2WC2A 1RINA 3AKPA 3IDEA 5GLTA 4N7IA 3OGJA 2HH9A 4YGDA 4ZZ5A 2DUPA 4NWWA 3NW4A 3B9IA 3D0SA 2JG9A 3NV3A 1AX1A 3NAPA 3WP6A 1K5JA 5E89A 2ETEA 4S2FA 2G1MA 5DAPA 3ZIXA 1OQ1A 2WRAA 3AM2A 1YNAA 3N9MA 4Q8KA 2Y6HA 1JYVA 1CZSA 4XJUA 2V4AA 5FUNA 5FR3A 5JDBA 2HWB3 2P34A 3O1UA 3AL5A 5FP3A 4QQ2A 5A80A 2DU0A 1OFSA 2W92A 1YFUA 1EPZA 3HNYM 4CXXA 1K12A 2XLAA 3B02A 4XFIA 4NIAA 5FK7A 3QLQA 3O0WA 4XFFA 1Y9QA 4XQWA 1UMIA 3KGLA 1UY1A 1W3XA 3TYJA 3ZYPA 2OIIA 1DZQA 2QQPA 4A44A 2E53A 5DZFA 4L0PA 3VDBA 1JYXA 4MGZE 1QXJA 1ZZ7A 2OVUA 3VBRB 4LO6B 4FPOB 2DVGA 5GLWA 5IVCA 2H6BA 2RM23 2VD7A 5GZCA 3R0RA 2ZABA 4NUBA 4Z2AA 5BYNA 4HK9A 4NIDA 3DKQA 1O4TA 2BFUS 1IQAA 1HN0A 1LHUA 1ND2B 3I54A 4QAWA 2E9QA 1SEFA 5JI7A 2JJ6A 4LE3A 4D0QA 2Z2SB 4K7JA 5M0TA 4Q26A 5EWSA 4CDXC 1GOFA 3TNPB 2VULA 3ZO0B 5FDBA 3CF6E 4DNYA 5EJZB 2OZJA 1K3IA 2ZGMA 1NZIA 2VTFA 1JXNA 3V0BA 4YGEA 1F5FA 1A78A 3J7LA 2J1TA 3E5XA 1UU6A 2UWAA 5FREA 4LBLA 5A3UA 5F3GA 5GZFA 4J1XA 1BQPA 3JU9A 4MHRA 4P9GA 1VMFA 3DV8A 3ZYRA 2O8OA 3FFZA 2VNGA 4N90A 3W21A 1RITA 3HEIA 1NCRA 4AF9A 1NAEA 3TEYA 2KM2A 3F2ZA 4QHOA 3POWA 3VBFB 4Q4V3 2LROA 3O1SA 4HN0A 3A0KA 2N7GA 4P9WA 1L3JA 4S2HA 1AX2A 3ACHA 4D94A 3U11A 2VUJA 2V73A 5A6QA 5FO9B 1YUDA 3K77A 4BIOA 5IVJA 4COWA 5D2AA 2HEYF 1UZ0A 2VC9A 2D6KA 4K8RB 4FSJA 4WZFA 3N9OA 3WF2A 2DCTA 2OPKA 3P5BA 2FDIA 3HN3A 3ZSLA 4R4ZA 3GHMA 1SLTA 3B00A 3VBHA 1LHWA 1ZZ6A 3M2MA 3RMXA 2E7AA 4LHLA 1HRV3 3DKWA 4GWMA 3GBFA 5JUVA 3PL0A 4XJWA 2B42B 1O6UA 2R072 3THPA 1J58A 1MS5A 1W6QB 2BVVA 1JHJA 3P1IA 4AI1A 4LKDA 1LOGA 1CD3G 3DF0A 4MHUA 5FZMA 5C8CA 2W87A 5HCHA 2CGPA 2WUHA 4CP9B 5FZGA 3H0OA 1PZ8A 3PVNA 1UQXA 3ZYFA 3GXUA 1R093 4BQ5A 1XNCA 4XE9A 5I0DA 4U2AA 5E1RA 4NPRA 1HIXA 4IEXA 2ZHNA 5IJRA 3ZN5A 3CU7A 2P3IA 1CAXA 1UWWA 1LEDA 1F15A 2A6XA 4AHZA 1XRUA 4EN0A 2GP3A 2FBEA 4Q4Y1 2OPWA 2VNOA 1C1FA 2WS91 3ZKUA 3BIWE 2WS92 2WFPA 3TEXA 1W9SA 1N1TA 2CY6A 3WLUA 1LOCA 1M4WA 2WZR1 1RXFA 1O3TA 5LRRA 5K0UC 1KFXL 3GCXA 2IUWA 2SBAA 3K3OA 2XVKA 4JKMA 5DN2A 1E5IA 5E8AA 1O5LA 4UFKA 3ZYIB 1DFQA 2ILMA 3BPSA 4I01A 3KZ4C 2DF7A 1W99A 1AR72 1YHFA 1NA1A 4XJAA 5ABJB 5HV0A 4PBPA 5EPAA 5ANQA 4PIZA 4H7LA 2ZTNA 5I0UA 1JU3A 1VB2A 3BN6A 5LY2A 3SMHA 5FLJA 4WM7C 3VB9A 2E7TA 2E33A 2WFF2 2ZGRA 3I59A 3Q9OA 2PHXA 3R4SA 2RS53 2J7MA 2NMNA 2VTXA 2DVFA 1OF3A 2VBBA 2CGOA 2WWJA 1W9YA 2AACA 2QZ3A 4EROA 3CJIA 3K48A 1PO22 4DIQA 2UYBA 3DCQA 4BISA 2WO2A 1D2SA 5FYMA 4XF0A 2NP0A 4V2WA 4OI0A 4GH4B 1LECA 4HETA 1YQ5A 5LK7B 4IEOA 4L8QA 1BVVA 1SBEA 2IXCA 3FX3A 5IT6A 2GH2A 2OXBA 4QPGC 5JR7B 5C3OA 5HV4A 2XLFA 1Y9GA 3M7AA 1HRV2 1JTZX 3AMPA 4HZFA 1D4VB 3U0ZA 4LBQA 3ZXFA 4CCOA 5KHJA 4OUSA 5FP9A 3IB3A 3ZM8A 4PF1A 2I2SA 1OUXA 2K9ZA 5GKAC 1AF9A 4LQRA 4E8CA 1OVSA 1Q3EA 1CAWA 2J42A 1CQ9A 2XJVA 1AYN2 5KHKA 4LITA 2RDNA 3O1PA 2HEWF 1CJPA 2DVDA 3E5QA 1YC61 2R16A 4YG3A 4RHV1 2B9UA 1WW5A 1K45A 2VAUA 1AR93 1MZEA 1RUI3 4UW3A 4IGOA 4XMAA 3VD7A 4AVAA 2ZCWA 5F5AA 1OLMA 1DGLA 2VMHA 4GB31 4QKDA 3ZYBA 5LA9A 1XBFA 3QCWA 2RDQA 4NO4A 1GR3A 2W1WA 2Q8DA 3WNMA 1FATA 3T09A 4AVBA 4CP9A 4TYSA 2WZ8A 1WZXA 1R091 2ZEXA 2JDHA 1MR5A 2WNUC 1RUC1 1SLAA 5F9TA 3M70A 1ND3B 4BK5A 3HOBA 4BWOA 4CUCA 5BV6A 1RUJ1 3FMGA 1VB4A 3C3VA 1QDCA 4UW6A 2GC0A 3O14A 5JXIA 1QWRA 2CL2A 2QQOA 3UKVA 5BNNC 2WFF1 3LAGA 4HANA 4OI4A 5J09A 2D6NA 3KD4A 1PX4A 2ZHMA 2IFWA 3WW4A 1AR82 2VZ3A 3VZKA 5L7OA 2WKKA 4Q0VA 2RS51 3EHKA 3OYWB 3FBMA 4JGYA 1RMU2 5IW0A 5C4WA 3ZMNA 4NVPA 5FZ9A 4XTMA 4QHZA 4QXCA 4FOQA 3I59B 5FUPA 2KR2A 4ATEA 4IESA 5LBFA 1OKOA 4RQPB 5FY8A 3RWKX 4AGVA 4LA3A 3KCCA 3I4IA 2WIIB 1I3HA 3A4UA 3WHTA 2BOIA 2E31A 1TQ5A 1YI7A 4Q4Y2 5JAXA 2VBPA 3TN93 1HXS3 1UD1A 4XDOA 2ID4A 2ZZJA 3VL8A 2C9KA 4B4PA 1OH3A 2XKOA 4TXWA 1C28A 1H6XA 1LGCA 1QJU2 2Z79A 4KWLA 3ZN6B 1PM4A 4PLNA 3WQ7A 1OMIA 1RUNA 4WVVA 3RWNA 2YC0A 4KQ7A 4OZXA 4QX5A 1Q5OA 4CEWB 4Y5Z0 1UKRA 4D6QA 2VCCA 5CFDC 2WT1A 4AHXA 1OPMA 2CDOA 2GMEA 3U14A 5T54A 2HBUA 3HNMA 4IV1B 2L9LA 2X5IA 4COUA 3OY8B 4YFWA 2PTMA 4M4PA 4HVRA 4FPLA 3SKVA 1G9BA 4QB1A 2WSVA 3VBSC 3FFQA 3IZOA 4LBOA 4PI2A 2Z5WA 2PHFA 2QDRA 1QJZA 1B35B 2QNKA 2WINB 4GD4A 4CCLA 4W6XA 2BWCA 4WM8C 5FZ4A 1WCKA 4BHPA 4P9JA 5JXHA 4LXLA 3ZXGA 1AR62 4ISQA 5F5QA 1OXCA 5DDJ3 5FO7B 2PMWB 3ZFGB 1J1LA 2ZGKA 3I2OA 1HW5A 1F5JA 2VMEA 2H6CA 5SV8A 3O1TA 2AYHA 4L92A 5FXXA 1R1ZA 1REDA 2R041 4XPVA 1UAIA 3VBOB 4GAZA 1G9DA 4RGAA 3VN4A 3BOPA 3I8TA 4LBQB 1QQP3 2NYYA 5BNQA 2ZOEB 3CZUA 4Y33A 4A3ZA 2J1EA 5FYZA 5A7QA 1VRH2 1MS4A 3PUSA 1COV1 3X29B 4AFCA 3KGZA 1F8VA 5LBBA 3SC7X 3ZR5A 1FPN2 4XXPA 2H0BA 5FUIA 3W59A 1RUJ3 1XQNA 2W1UA 5CFDA 1DIWA 4K9SA 3ASIA 5LW9A 1RXGA 2BWAA 3DXTA 3V56A 3E97A 4AI9A 5FAXA 3POSA 3VLBB 1NCQC 1WA4A 3NMBA 2GSYA 4IE6A 2ZACA 2ZGTA 3M3CA 4QKNA 2FMDA 1Q8SA 5C9AA 2VL4A 1VBA1 1BJQA 1GP6A 2EF6A 3PNAA 1RUG3 1FMD2 2VH9A 5C33A 1GZWB 3AZVA 4GWIA 3N4MA 2YGLA 3U07A 1PZ9A 2PHWA 4U36A 2FDHA 1ZA4A 4ZY9A 3SITA 1GV9A 2RS31 2GMPA 4GB32 1UW8A 2QTWB 4XVHA 4PLOA 1QH7A 1XNTA 4YARA 4ES9A 2QQWA 1DLLA 3BTAA 1KITA 3NKTA 3K46A 2D3PA 3SCFA 3MV01 4JCKA 5B4XA 5LEJA 5FPUA 4MGIE 4QX8A 2XGXA 1BK1A 1H2KA 3G7DA 3Q8AA 3UGHA 1PIV1 4MV2A 1WLTA 4DQAA 2H0VA 3IIAA 3D6EA 1TE1B 4ZXEA 3DYPA 5IAVA 3SH4A 4E8DA 3LCPA 5FY0A 2OYZA 4BQ4A 3AYCA 1OSGA 2QQIA 1TEIA 2WNUA 1G8WA 4MGQA 3MI8A 4XILA 4B8EA 1LOAA 3AP5A 2AUYA 3I49A 1TZOA 2XBO3 3AK0A 4XC9A 4BQ2A 3LOBA 1FOD1 1OPOA 1W6QA 3DPRC 1ZBE2 4KBZA 1VAKA 4QM8A 2CAVA 5C8WA 5KHIA 1JYNA 1AYM2 2NQYA 1MQTA 1W6NA 3MIDA 4GMP0 1WD3A 4UXAA 4A7KA 4CUGA 3H3LA 4HVQA 5CFCB 4NIHA 5EV7A 4IERA 1T2XA 2Y0IA 3T1LA 1OQEA 1PO21 5DAQA 1Y7BA 1YQCA 3AMQA 4Y1XA 1GZ9A 3PLQA 3T2QA 3PVOA 2ZEWA 4ZXKA 5DAWA 4I3PA 3DXUA 4LUMA 3AFGA 2A3XA 3EQEA 4IV3C 3N7MA 2HWB1 4M0HA 2B7YA 3THCA 5BNOA 1IG0A 4Y1ZA 2YV8A 4Y22A 4BMEA 5LCWL 1D2QA 1ULGA 1H2NA 3OGGA 2C9AA 4LT5A 2BW8A 3POYA 1YJLA 1UZYA 3CL1A 3HQRA 2D6LX 1HB2A 4HKLA 1MQTC 1AR71 3VKNA 2WA4A 4K20A 3KQRA 3EXUA 4QXKA 5EYYA 3ZMOA 4A2UA 4EN6B 4HSJA 4O9EA 2YXSA 2GU9A 3P3NA 4HKOA 1SBFA 4JDOA 3UNPA 2GP5A 1S0BA 3Q8FA 4RR3C 4Q5OA 1WW7A 5T5PA 4CCJA 3RFRA 2ZGSA 5J48A 2ARCA 5C71A 2VMDA 4FOVA 3H3ZA 1IPJA 3NNFA 3M1HA 4TZDA 4N43A 2XDVA 5LBEA 4R8HA 3AYAA 4YM1A 2DV9A 3D82A 3BIEA 1WCSA 4DUWA 2JDAA 2BGCA 2DU1A 3N9NA 4AYUA 1D4M3 1W3VA 2Y6LA 1OC1A 1OF4A 1RUD2 4AHWA 1ZBE3 1ULPA 3VD3A 2RMU2 5KXEA 3AZXA 3U37A 2JXAA 5CB7A 2HWC2 4YYOA 1NA1C 4CDXB 4D69A 2YHJA 3MICA 4XIKA 1EUUA 4YVSB 3RPQA 3U75A 2XJQA 4PDWA 4FAGA 1RHI1 2EXKA 1KXGA 3AMHA 4CDUC 1E57A 1YRZA 4XBLA 3TAYA 5TSWA 3V0AB 2HWD3 2FDGA 4CCMA 2HWE1 1PIV3 4CCEA 4B4QA 1DF0A 3PUQA 5FYHA 3OPWA 4HFSA 5LWBA 1XYOA 3VKFC 3IDAA 2EAKA 2JECA 3ATGA 4XJ9A 4CU7A 1U5YA 3K4ZA 4LUKA 4QU1A 4AXOA 5T5OA 2R1BA 3JD71 5CA6A 4RHV3 2R49A 1UN1A 2YC4A 4J6GA 5JPMB 1QJY3 3W9AA 4MGTA 4RSUA 5B2GB 3M3OA 3WVJA 3UK9A 3FC0A 4JKKA 1G7YA 3ZXEA 1JHNA 3RVHA 4UYBA 1R64A 3NAPB 4AOCA 4R9CA 4ARYA 1LNSA 3ZXLA 2HEVF 1W6MA 1N1SA 2GC2A 4QGMA 3AFKA 4LBJA 4OYUA 4S2GA 1RUI1 2RV9A 4DY3A 2KA3A 1OOPC 1TMF1 4XCBA 2WSUA 1CZTA 1W8FA 2ZX0A 4XIOA 4CPBD 1P8JA 5IWFA 3T30A 2Z69A 4JHZA 4TN7A 1YFWA 3WW1A 4NHMA 3BGAA 4A42A 2UWBA 1HQNA 1VMHA 1WMFA 3HMYA 2BV4A 4IGQA 2W46A 1Q8VA 2HLEA 1T6GC 5DPNA 5ABJA 3WQBA 3IT8A 1H1IA 1X9TA 1ULOA 2JE7A 3POJA 4AK3A 4JVAA 2YPDA 3T0BA 5EJ1B 3ZYJB 2VXJA 1K5MA 4M3CF 4N43C 3UL2A 2HJIA 2AZ5A 3KWVA 1C5HA 3O1MA 3VBSA 5C70A 3PU8A 3WDWA 3AKTA 3VBUC 2AGSA 2WAOA 1BK0A 2VCMA 2Q8EA 1DYKA 2A70A 1CGPA 4MGYE 4RR3B 1DBNA 4JKLA 4QPIA 2V4VA 4FFGA 1TMF3 1F2NA 1V9U3 4EN8B 1B09A 4NOTA 5EJ3A 1AYN3 4N43B 4EV0A 3K4DA 2CYFA 3TB0A 2WZEA 5FY5A 5A1FA 1GQGA 1UX7A 2EVXA 2FCTA 3MLJA 3JBG1 5A7PA 1F31A 1WUVA 4M4RA 3KHCA 2D7FA 1NCQB 4GH4C 4XFGA 1S0FA 3ACGA 4BMBA 1H8TA 4E4ZA 3GJAA 1BCXA 4YZ1A 3HBKA 1VE0A 1F4HA 4MXWB 1AHSA 4CEYC 1PGL2 1HXS1 4E2QA 3JQWA 4A41A 4XOGA 4QPIC 3RI9A 1UCXA 5JVVA 4AL9A 4E4HA 4Y5SA 1QIQA 2VW2A 1JOBA 1RUG1 1WKYA 1CESA 3PUIA 3WEZA 3N7LA 4GIQA 3KF5A 1C57A 1R1A1 5IAXA 3I3QA 2YYOA 2O0OA 2WABA 1UYXA 2VZTA 3JZVA 4ORFA 4RFRB 5KBFA 2QQLA 3A22A 1QQP1 4XUPA 4JHTA 4ONUA 4AW7A 1HXS2 3MV11 4PLMA 4ES8A 5K8SA 5J1XA 3AX4A 2VM9A 4OI2A 1Z7S1 4CXWA 3EBRA 1YQ8A 3LA7A 4URTA 5SV5A 5HXVA 4AEJA 2CWSA 3USUA 5F6KA 4LIVA 4OULA 4P14A 3TEWA 3O1OA 1E5HA 5C5TA 5FPBA 3I3BA 2Y33A 4OZOA 4QT6A 3RYPA 2J1VA 2J22A 4P9YA 2VUAA 2DTYA 5L36A 5FYYA 1J1TA 2FHRA 3B01A 3WP3A 2QZ2A 4FFIA 4BM8A 1BYHA 3HD8B 4DPNA 1JUIA 3VL9A 4CDWA 1COV3 3OY8A 4XHXA 2Y6KA 1NLSA 2P3KA 2ZGPA 4CA9A 1H2MA 3UJOA 4AVCA 4ZS3A 2JE9A 4O61A 2BBVA 2Q1FA 2UY8A 3BB6A 5EP9A 1L7RA 1TME2 2WT0A 4M01A 3LZZA 1LEMA 4XFCA 2RS11 5FLIA 1PHMA 1UZWA 4PHZA 4CDWB 4NAOA 1GP4A 1D0GA 5FK8A 1W8HA 4Y26A 5FJKA 2A6WA 2XR4A 4MOAA 3VZOA 2VJXA 4N53A 4LO7A 3J7NA 1D7PM 2D97A 5D8AC 5LRSA 4P02B 2XKPA 2ORXA 1XU1A 1RUI2 1X9PA 3AMMA 4E9KA 2JDNA 2X8KA 1HQWA 3LE0A 4QX1A 2WAAA 3VBRA 5AFEA 3A7QA 3AJYA 2J1UA 2YMZA 3T3YA 3UJQA 5C6CA 4JRLA 4MG2A 4EE2A 5FZIA 5DZGA 2ATFA 2BGPA 4MH0E 1ALYA 2WLQA 1QDOA 4IQPA 5K9YA 5IK8A 4KU8A 5EZWA 1ZREA 1T6BX 4LHSA 4QPGB 3IM0A 2ZGNA 5ACA2 2ZHLA 5FXWA 5CFDB 3GZUC 4WVWA 2K0GA 2W47A 5A3LA 2WBKA 5FKCA 4CRQA 3KMHA 1QEXA 1RUE3 4QQOA 3ACFA 3NNGA 5T50A 3ZFFC 4WVZA 3D3AA 2VOVA 1V70A 3C7GA 4BQXA 5F1RA 3O0XA 3KV9A 1ND3C 1VALA 3PDQA 3GNEA 3PJYA 3ROUA 1IS4A 1US3A 3TNQA 5E16A 2FQPA 1NZCA 2EXJA 4HVOA 1MS0A 3AP6A 3I2FA 3O5SA 4HPKA 1SLBA 4NN0A 3H7JA 5A1AA 5DABA 2XHNA 3BTZA 4L11A 3QOPA 2W39A 2G19A 1F35A 1DG6A 2UYAA 3DPRA 4QU2A 3VD4A 1VBB2 2RDSA 5K0UA 4XJ8A 2XONA 5FCCA 1QOSA 3AB0A 2RJLA 2CGNA 2W95A 3VHOA 2ZA9A 1XNKA 1VBC2 4IV1C 1BMV2 1EP0A 1RUD1 3LD8A 3PTRB 4YWAA 2C24A 3QH6A 4CDXA 3IKWA 2BGOA 2MEV2 1OLME 1V6KA 4FPKA 4P5YA 2MPFA 4QGNA 4UF0B 4ZZ8A 1CAWB 1NE6A 1K5MB 1RVF1 4GULA 3VDDC 1TVGA 2X05A 1CR7A 3VBRC 1GWKA 2G4IA 1O5UA 5A7OA 1S0JA 1SFNA 4DXRA 4WVMB 1EPWA 1LJ7A 3I97A 3NJVA 3H50A 4NAMA 4P5HA 4HMZA 1WA6X 4QDQA 3WF4A 3IMMA 5IUQA 2MEV3 3WF3A 1DYPA 2JG8C 1PK6C 2FD8A 4Q0QA 2VZOA 1V6IA 5FMCA 3BCWA 1UXZA 3POFA 1Z78A 4PI0A 1VRBA 3I2IA 3NV4A 1GANA 3S5QA 1J3QA 2A3YA 1O59A 4Q4X2 1V0AA 5FPAA 4RA0A 4XF1A 1HKDA 4YVWB 3ACLA 4I0BA 4IXLA 1VBE3 2FCUA 2JG8A 1DYOA 2HWB2 4CDWC 1TNRA 4EN9B 2BYVE 4Q4X1 2YPJA 1S2EA 1JH5A 3QACA 4AEDC 3SCHA 1JUHA 4MLOA 1U5ZA 5CVRA 3ALQA 3IAPA 2NZ9A 3ITQA 3SCGA 2FZ2A 5D8AB 3ECQA 4NHLA 4D3WA 5BY5A 2YB7A 3MDPA 5FWEA 3AP4A 3WG3A 3JXSA 1K42A 3VGIA 3RQ0A 3AJZA 2OUJA 2W3JA 1R083 2FDJA 2ZKLA 5A6XA 5KWRA 1ZBE1 1J59A 2VE1A 1U0AA 4XQDA 3AYDA 3MYXA 2VOWA 2QUOA 2B39A 2ZMLA 3C2UA 1APNA 4FQZA 1RVF2 1CAUB 3J4UH 5LEKA 4EJRA 1RUG2 3PTYA 1HRI2 4QXHA 1H0BA 5T52A 3TOJA 1MQTB 3V0AA 3RZKA 4UFHA 3K2OA 3HQXA 1LOEA 4BLJA 5LA1A 1DHKB 2OW4A 4XUOA 4YM2A 1ULFA 4M3CE 3ZXKA 4M3CA 1XYPA 1NXD1 4AVSA 4AGGA 2EIGA 2DVAA 3ZDSA 1UU5A 1S4CA 3JBG2 2P1BA 4ZPIA 5EFUA 2IXIA 2HBTA 4OQ9A 5FY4A 2Q30A 1LAJA 2B9VA 5GLZA 2RS32 4N7UA 1R081 4YW6A 1TME3 2ZX1A 5ANNA 5KXCA 3FLRA 1POV0 1BMV1 4UI9L 3ZLIA 3IPVA 1G86A 3OF1A 1GKBA 2Y26A 4AAPA 1PMHX 2X5IC 1Y4WA 3OUJA 4HG6B 1FV3A 5CAZA 5KHGA 3MPBA 1JMUB 2E51A 3I3DA 5H9QA 2PLV2 1O4YA 1W8ZA 4HKWA 4QQLA 1UIKA 4Q4W1 2VW0A 4BQWA 1AR83 1G9FA 4K1ZA 4Y4YA 1GZWA 3T2TA 5FO8B 2GH8A 5D8AA 5CBLA 3HQUA 4JC1A 1SFPA 2Y38A 3U1XA 4RQPA 4V1PA 5CU1A 2VBDA 1N1VA 1X8EA 1UMHA 2LRPA 2VZ1A 1DCSA 3OBZA 4HOOA 3HAGA 1W0OA 1FPN1 1IS6A 4C90A 4HN1A 4AVTA 1MZ5A 1H4HA 2YBKA 1KRIA 2XUEA 2HWF1 3KF3A 4XETA 2HKXA 2DYCA 2XMLA 5FIXA 2VW1A 4FAHA 3EB7A 3ZXDA 1JZ6A 3B5LB 5JXJA 4QMAA 3M3QA 1NLQA 1ULDA 2ARXA 1EV11 4QDSA 5C4WC 2ZX4A 1AL23 2PN5A 4AVVA 1NKGA 3ZYGA 3T4VA 4J25A 3CLPA 2VMCA 3M3EA 5C3QA 3HPNA 4BH9A 1GOHA 4LORA 3WP5A 4YM3A 1MEC1 2KXLA 2XXZA 4OMDA 2CTVA 2GN3A 3VBOA 2ZGUA 1SHWB 1QMJA 2EXIA 4LLOA 3G6JB 3AXDA 4FO9A 4KU7A 1PM7A 2HWE2 2D6MA 4GKYA 1YFYA 3ZFGA 4P9XA 1IGOA 2F4PA 3BODA 3UGGA 5CISA 2UU8A 4JGZA 2A6ZA 5IYYA 2W91A 2I74A 1JZ3A 1JS9A 1G9AA 4Z07A 1ZBA1 4G9SB 4PQ9A 5A3WA 3TEZA 5GM0A 1RUOA 1F4AA 2GMMA 2VCAA 2VCBA 1HQLA 5IFPA 4RQPC 4BLIA 3FE5A 4D7TA 4JZRA 4H3WA 4B7EA 4TLFA 5FWJA 1R1A3 3FLPA 4E4DX 2PQSA 1I6XA 2R32A 1BVP1 1NX9A 3L9JT 1V6LA 1SACA 3ZIWA 5CADA 3WDUA 5J7MA 4UOJA 3PHMA 4QXBA 2BERA 1HB4A 2Q1MA 1C1LA 1XNAA 4L9BA 3PVEA 1HRI1 2R6QA 1MS3A 1SFYA 3BU7A 4CEYA 4X8NA 2YY1A 3V65A 4NJ4A 1UOGA 1Z7S3 3LA2A 4NHKA 4IE5A 1G6NA 3DL3A 4YW7A 1YWKA 1W6PB 3MF6A 3ZN6A 4EYUA 4DOUA 4RGKA 1J3PA 2BUKA 4E27A 3WUCA 4BQ3A 2JIJA 3WW2A 1CPNA 4UFLA 3CIHA 4YVWA 2Q8OA 2PHDA 3NKGA 4B1LA 2BP6A 4LKSA 1LTEA 3ZPOA 3DYMA 3DGTA 5BNNB 1QU0A 2HWD2 3ETPA 4BB3A 5AC91 5K7PA 2GNTA 3FBYA 4TLGA 4ZU5A 4IL7A 2VVEA 4H14A 4COYA 4Z2WA 4OI1A 2UY9A 3NRUA 5DQ0A 2P6HA 5JR2A 1W2NA 1DDLA 1NA1B 4CE8A 1QJY2 5F7UA 1ODNA 1UYZA 2WR9A 4WM7A 1ST8A 1WLWA 3D5OA 1R092 1Y43B 3CZJA 4NHYA 3TRSB 3LFIA 1GU3A 3MIFA 4IV3A 3R05A 3I2KA 4LK6A 4AG4A 1OI6A 4LBQD 1Z0HA 1O8PA 2Q1ZB 2VTXJ 4ZHNA 3IN9A 2PYTA 1GNZA 1NQJA 1RUH1 1NY72 2VZRA 4AQTA 3D0JA 2O14A 2DFBA 3CKHA 3GJBA 2YC2A 3P6BA 4IEUA 5AVPA 4AEDA 1PVXA 5I0RA 4EN7B 5FPXA 5FPVA 2WO3A 2ZAAA 3MF9A 2WQ8A 1AYN1 2VY0A 3HT1A 4HPKB 1YCIA 3WDTA 3EMRA 2XG3A 3ZOIA 3B3QE 2Z4FA 2X29A 2XQXA 2VECA 2GC3A 2PHLA 3I3EA 3VKLA 1RUD3 5F6LB 1BEV2 2XPJA 2I45A 5FTTC 4O65A 1AX0A 5A3OA 3LSDA 3K75B 2E32A 2WNVB 3OCPA 4H7MA 2ZS6B 5FJHA 1ENQA 1UYYA 4IEVA 1UOJA 1OQDA 1NYWA 3OGRA 1VJ2A 1F9KA 1ZVFA 2HYKA 3FUQA 3KV6A 3UESA 4JDNA 3VBFC 2JD4A 3PURA 3MW4A 4MVTA 3H42B 1VBA2 4CU8A 1SBDA 2W9XA 4XUNA 3OGSA 2PAEA 1W05A 3N36A 5FPLA 3A23A 2YGMA 2P37A 1YI9A 1NCRB 2EIBA 1OUSA 3CJIB 3ST7A 3ZN4A 1EAH1 1FOD3 4YW4A 4URAA 3OD0A 2A75A 2WT2A 1PK6A 4OVEA 3W20A 4AI2A 5L7OB 2JDUA 4I0AA 1H2LA 4N53B 2PELA 2YROA 4CCKA 5C8CC 3J9SA 3VZNA 2E26A 3THDA 4CDQB 3KSCA 4QX3A 2P2KA 5T5LA 4A45A 4WM8B 4O7XA 3LSEA 3KQ4B 4K40A 4PIYA 1RUC3 5KHHA 1W6OB 3CDZB 5FP7A 1W2OA 2YUEA 3OJBA 2YU1A 4X6RB 3BKZA 4RR3A 3EYPA 1XXNA 2VZQA 2A71A 4IUGA 4XCAA 1UOBA 4LE4A 2BRTA 4JTOA 3GZAA 5JIAA 5JMOA 1CAVB 1UIJA 2DFCA 4BOWA 2QQJA 2ZGOA 4QHBA 3O0VA 2NN8A 4KI5M 2ES3A 2TBVA 3KB5A 4HONA 3ZX7A 3WQ0A 3FUOA 5F3CA 1LR5A 1Q8PA 2WYFA 2J1AA 3POGA 3RZLA 3GYDA 2OKXA 3VV1A 5BNOC 4IEPA 1ZM1A 2DBNA 3VDAA 3ZSEA 5KC6A 3U4XA 4WBBA 3MHZA 1LGBA 5K0UB 4FP3A 2R071 3HWJA 2XB6C 1SG3A 3J8F3 5A7SA 1XB9A 1QOOA 2QQNA 3ZFEC 4RD7A 1XE0A 4LHKA 1H1AA 3VKMA 4NIGA 1JZ4A 2RR11 2IXHA 5FLHA 1FV2A 1KFUL 2GNMA 1JI6A 5A7WB 5IATA 4YGCA 3RI8A 2VMGA 1Z7S2 1PZ7A 3PU3A 2RVAA 1IKQA 1HV1A 4OHZA 2ZZQA 3LEIA 4LOTA 4YLZA 2A73B 1ENRA 1HB3A 5JZGC 1QQP2 4CU9A 1AYM1 1W03A 1WBLA 4DZGA 2ADDA 1JODA 3MUY1 1LKNA 5APAA 4MO3M 4MXWA 3WCRA 1WWYA 1UZVA 1HB1A 1C8NA 1VMJA 4Q2FA 3W58A 1DQ1A 3VZJA 1HV0A 4AFAA 4F7ZA 3AP7A 3WW3A 3WV6A 3VD9A 2R30A 5FZFA 3OSDA 4E4SA 1ND2C 1H1MA 3JCIA 4OHXA 4LR4A 3LQCA 2Y6GA 4QGLA 3KM5A 4CSWA 4DFSA 3S7IA 1V6OA 2P4EA 3IDCB 4BDVB 1UPSA 1YIFA 4Q1RA 5I8YA 4INDA 3CBNA 1RC6A 2HWF3 5C7GA 2R0FA 5JOZA 1AR81 4IW3A 3RDIA 1CX1A 1RUF2 2W1SA 1VAMA 2GNDA 4W6WA 4CYDA 2R0HA 2R043 2ARBA 1CAVA 5L9BA 4TTGA 3LA3A 1AL21 2BTVC 1IPKA 4AEKA 5JI9A 3RMYA 2BVBA 2IC1A 5JIUA 1US2A 1NE4A 1XE7A 2VVFA 4XUTA 4W65A 4NHXA 2JG9C 4P00B 3T2OA 4EQVA 2WA3A 5FZ3A 1AR63 1ZRRA 2QQVA 3PIGA 4XFAA 4MX3A 3PIJA 3S57A 2XUMA 4JAAA 1MS1A 2BEOA 4Q4Y3 2WLPA 4CDQA 3ES4A 1QJX2 3D4KA 1W8NA 3ZFEB 4BA6A 5JZGA 3Q8EA 4CCDA 2C26A 2DBIA 5JPNB 2QVSB 3SNMA 5AC93 3ON7A 4UBGA 5A7NA 4DRRA 1FNYA 5HXMA 4UW4A 1O4ZA 1LOFA 1ZYBA 2A1XA 4YZ5A 1JYIA 3K4AA 1COV2 2QE3A 1CAUA 1NG0A 2OQ6A 4Y3OA 3WNNA 3LGRA 5FOBB 1DGRA 4O9GA 3RGBA 4RS5B 5JCTA 2E7QA 3HVDA 3K3NA 4LBNA 4UWDA 3GHNA 5BNOB 5JXGA 5CKNA 5CKQA 5IK5A 2FCVA 2GDFA 4I09A 2JICA 3BOWA 5HCFA 3WNPA 1HLCA 2VVDA 1RTVA 3TN92 4B3NA 3VDDB 5T55A 1H9PA 3OBRA 1UY4A 4LHNA 2VXRA 1WW6A 4KG8A 2JB8A 1GQHA 5CFCA 5JOWA 2DCKA 2QDNA 3ACIA 4S2DA 2YG0A 1XYNA 2CDPA 4X6QB 5DAXA 4LO8A 2JG8B 1FYUA 3N35A 1OOPB 2ZX2A 3RYRA 2V72A 4BK4A 3HNBM 2C4XA 5KXBA 4BZ4A 4TSVA 2RR12 5DXDA 4LPLA 1REEA 2GC1A 2EIDA 3C7EA 2WJSA 1D0HA 5LBCA 1W9WA 1EYBA 5DG1A 5H9PA 4XZUG 5G05L 2WN3A 3CJIC 1VLNA 4FQ4A 3W5MA 4LK7A 1W8WA 4NROA 4RFT0 4K21A 4AEDB 4BYYA 4Z1VA 3OEBA 5LZ6A 1JYWA 1QJEA 3V0BB 3H8RA 1KDKA 5FZBA 3E6DA 2PHUA 3T1MA 4BE3A 1ENXA 2HWC1 4OFGA 5IHRA 3S5AA 1JZ2A 4QPYA 3VHPA 5IVFA 4DUVA 4LEJA 4CUBA 3DECA 5FYCA 1BKZA 1YQ2A 3BALA 1OA2A 1AUYA 4OMCA 3T0DA 2JKXA 2ZMNA 1UPIA 2J1RA 1PNGA 4XURA 4NRPA 3O12A 4CU6A 3BI3A 1QXRA 1OOPA 2X10A 3NNLA 3WXPA 4JGYC 4F83A 2XWBB 5A33A 4DINB 4ZKTB 5C5UA 3FHAA 5DUXA 1L7QA 3NNMA 1VAVA 5A3PA 4IE7A 4FTEA 3DPRB 4N9IA 1RL3A 4Y20B 1AXZA 1XNBA 3KS7A 4QB2A 1OH4A 3WNOA 1V9U1 3GGLA 4Y22B 4XZPA 1VIWB 5FXZA 3NL1A 1S0IA 1KJRA 1RUF3 1RYYA 2RS52 1UY2A 4SLIA 1REFA 1W6MB 4DUXA 3FZ3A 4JTNA 1WLCA 4LTAA 1CJDA 2XHKA 5L9VA 3AKSA 1LULA 1WMEA 1LB2A 5BNPA 1UU4A 5BNPB 5KC5A 5DG2A 5AVAA 2ARAA 2BPA2 4COZA 1URXA 2PAKA 1JW6A 2Q4SA 4GJZA 2XJPA 2KD7A 3WG2A 4DMIA 4HK8A 1RUC2 3SISA 3WUDA 3OEAA 1UNBA 4BXFA 1LESA 5I91A 5I8SA 3LKJA 4OUMA 1SLCA 2XBO1 3FN9A 2X09A 1V6JA 1KEXA 4CP0A 2VOXA 3D8CA 5K4LA 3CHXA 3S7EA 3RRDA 1CX4A 1KS4A 5LATA 1WBFA 2CSGA 1LRHA 5FRAA 1OBNA 3WF0A 1FOD2 1I5PA 4JV4A 1W2UA 4KBBA 3TN91 5GZGA 1RUF1 4XFBA 1LU2A 2IVJA 5FZ1A 5JSOA 4RHV2 2WWUA 1ENSA 4KNCA 4XJZA 3LIGA 4FXGB 4A6SA 5FXVA 1OLRA 1XNDA 4AI0A 2ERFA 2CV6A 4XDPA 2D44A 2XOMA 1V6MA 4XF3A 2Y64A 2XJSA 4Y1YA 3I7DA 1GZTA 5FYTA 1WMXA 2D5HA 1PIV2 1DZTA 1WMDA 2XL9A 1U12A 2Y0OA 2ZJCA 4KGQA 4V2VA 4IEQA 2D93A 4ARXA 3B94A 4W8JA 5H9RA 4IV1A 2LS6A 3WINE 1PVC2 2IWGB 2R1DA 4YRDA 3E6CC 3VBUA 3J7MA 1HRV1 2NLRA 2AREA 4FVVA 3L2HA 4M00A 5DUUA 3TWIA 3GZTB 2WS93 5FMOL 3I3MA 1QJX1 3DEMA 1C8M3 5JOYA 3W5NA 4W4ZA 1BEV3 3ZFFB 2W1QA 5F3IA 4MZUA 1A8MA 4KG0A 2HWC3 2W5FA 1SCSA 1VBD3 2VZVA 2XBO2 4ASMB 3GF6A 1ULEA 4WV8A 1ZZ8A 5A3TA 1FMD1 3FL7A 3LDBA 4XUQA 5FZDA 5LK5A 5J36A 4Q1PA 4GWNA 1XSRA 1QJY1 3OTFA 3HBZA 1AL22 1GFF2 3IWZA 1W04A 3NV2A 2P3YA 4YGBA 2R073 1Q8QA 1UKGA 3MBWA 4M0NA 4CP1A 3KT4A 4Z92B 1DQ4A 2DTWA 2IZWA 2V09A 1RB8G 2XQRA 4MADA 3ME2A 4YZ4A 5AC92 3CQOA 4EWAA 5A6ZA 4BQ1A 1LHNA 3GALA 1UOFA 2WWSA 2YZ4A 4I02A 1CONA 3HR9A 4QKBA 1H9WA 1X8MA 2PHTA 2W0XA 4XXAA 2RDRA 1VRH1 2ZKNA 1YLLA 2WO7A 3CEWA 4FPFA 1QXPA 4LBMA 4ZONA 1N3PA 3RG0A 5GZDA 4KGGA 3ZFGC 1W6NB 3EO6A 3IPVB 3SKJE 4GQ7A 2ORZA 4I2OA 1LOBA 4RN5A 5A7WA 1LHVA 4B7KA 1SMVA 3MIEA 2BFUL 4KMQA 3SQOA 1X50A 2DVBA 1RUE1 4QQPA 4C1WA 1JZ7A 2QCSB 4LNVA 3H7YA 1NXMA 1NCQA 1PO13 1PGW1 4MXVA 1BBT2 3M4FA 5F32A 1A34A 3AVSA 3FHQA 5KXDA 2BNOA 4YFZA 5BPXA 4UFIA 1AXKA 4M3CB 5F37A 5EXOA 2PXJA 1WCQA 3R4DB 5I0TA 2Y6JA 5JWPA 1S0EA 5HBAA 1MVEA 3MW3A 4NPMA 4BCUA 2BDRA 4KL1A 3WNKA 2VO5A 4XAAA 1VBB3 3ABZA 5J3UA 4HSLA 2AC1A 4QD2A 5A32B 4AI3A 5CEHA 2EICA 3BVCA 3WX5A 1GYKA 1O3RA 3SHRA 3JQXA 3WF1A 2ZGQA 3LEKA 4ITCA 1IHMA 1W0PA 1AXYA 5FZAA 1MEC2 5FYBA 3E1F1 3CO2A 3QD6A 1N3OA 1QH6A 1X33A 1QJU1 1IS3A 2RM22 1FT9A 2Y60A 4Q29A 1MZ6A 1SZBA 4XBQA 4WM8A 5FV3A 5F39A 1EV12 3LWCA 4D8MA 4XMIA 1CN1A 3WD5A 4I3GA 5FOJB 3UETA 1PNFA 1XJAA 4K1YA 4YZ3A 3SLIA 3APBA 5FZOA 1W39A 4Y5TA 3IIIA 4XDQA 2BQPA 5HCBA 5C3SA 1C3HA 2VUDA 4HT1T 4FT8A 3S0MA 1NLRA 1OA4A 2ZGLA 3I2GA 1OKQA 2XVGA 4YW5A 1I1EA 4EWEA 1UX6A 2CAUA 2EIEA 2V5DA 5F2SA 1RMU1 2IXJA 3U10A 5A1LA 2A7AA 1IS5A 5F5CA 2QJVA 2MHFA 3SH5A 2WNEA 2VGDA 1EAH2 1XSQA 1NY71 2RS13 1YFXA 3ZDVA 3NJXA 4BQYA 3ZSMA 2D43A 5GLUA 4LKEA 1Q56A 2VQAA 3LF7A 4OCTA 2W68A 5H9SA 2NM1A 1OVPA 2PLV1 2VNRA 1WLDA 1W9TA 1RUJ2 1H6YA 2JD9A 3A0NA 2IVIB 3ORJA 1W0NA 1CIYA 1QY4A 3H1WA 3NJZA 1I9RA 3MGUA 1W2TA 3PVBB 4OHYA 5KR7A 4NRMA 4COVA 1VRH3 2VPVA 1J84A 2OT7A 1MS9A 1PVC3 1QGLA 2D98A 4WZCA 2VNVA 5GALA 3ZVXA 4B4RA 5I0SA 1JZ8A 1NOVA 4LA2A 5FY9A 2OUHA 1CWPA 4FP2A 4R9DA 3RSJA 3POIA 4Y1VA 2EAAA 1OD3A 1ODMA 2XJUA 4P9LA 3H1YA 4C0HA 4XFHA 4FTBA 4BXSV 1FXZA 2WYSA 3CMGA 1M06G 2HWD1 4FFFA 4QM9A 4QQHA 5J98B 2OA2A 1PO11 2VZPA 2WNVC 3THTA 3MW2A 4E2GA 3LOIA 2XH6A 5JSPA 4CDUB 1N47A 2EALA 4N9HA 4DEQA 3C7OA 4CEWA 3JB4C 1GWMA 1GNYA 1W6OA 5HI0A 4QKFA 3RZMA 3ILFA 1GZCA 1SDDB 2CNAA 1VBA3 3VBHB 2DCYA 1V6NA 4FPGA 1ASJ2 4BJ0A 1UMZA 4WM7B 2DUQA 5FZ0A 3ES1A 1RUH2 1GMMA 1LU1A 1RGSA 3H1MA 2JB4A 3WNXA 3SEPA 2JWPA 1DQ2A 1CVNA 1HX6A 1UZZA 4NWVA 5FZOB 2WQ4A 5C3PA 3M3IA 4IEZA 4AZZA 4GA9A 5IFTA 3SEEA 1S1AA 2GALA 1WW4A 3KT1A 3PMSA 4OUEA 4Q4W3 4GMP3 3O1VA 4W6YA 1AJKA 4H55A 4DEVA 4JGZC 3IAQA 3NQHA 3B9CA 3B69A 3JD73 4NMIA 3S6PA 3VDDA 3RJ2X 1Q43A 4IEWA 3MIHA 2CWMA 3WOGA 1KQRA 3OYWA 4IDZA 1HRI3 1ZBA2 2JX9A 3IMNA 3ZXJA 5FYUA 5IVYA 1OLQA 3Q8BA 1H30A 5J96B 3UKNA 1E5SA 1I5ZA 2ZPXA 1H8TC 5FBZA 2FDFA 1QHDA 2RMU3 3FWEA 2WNVA 4FOYA 1W6PA 2J1SA 4I30A 1Q8OA 5CYYA 1HDKA 2RJKA 5A32A 1DU3D 3MFAA 3VHNA 3HT2A 4UW5A 1H4GA 2ZEYA 4F3JA 4CEYB 5CG9A 2DURA 4UT5A 5I8TA 3GDBA 2D3SA 2FMYA 3WNLA 4IETA 1N3QA 1C8M1 1HJGA 2W94A 4PDWC 5T5JA 1QF3A 5FZ7A 5BUVA 5IVVA 4EZ4A 4AQSA 4Z82A 4ET7A 4BPZA 2AEZA 1YEWA 3DYOA 2WZR2 2QBXA 2Q5TA 4GMP1 5JZGB 1MVQA 4FI9A 3OBAA
chains in the Genus database with same CATH topology
2JKBA 2ET1A 4KWJA 1VBD2 1G9CA 5I93A 1VBE1 1S0DA 2TNFA 4XEZA 5CNAA 3N7KA 2MEV1 3R4UA 2HWF2 4JRAA 4ATFA 1LCLA 3DUIA 1O3QA 1S2KA 2LM3A 4OHWA 3QBQA 2VMIA 4B29A 5JSRA 1O91A 4META 1QNWA 4BIFA 3RZZA 4CTEA 2RR13 3ZSKA 4R4XA 4YZ2A 4AI8A 1RUH3 4FPHA 1JOJA 5L73A 2R061 1JN2P 4K8FA 2VQ0A 2W52A 2TEPA 1DQ6A 2B46X 1U5IA 3BPZA 4MGKE 2AR6A 3AMNA 3GBGA 1RVF3 4Q4V1 1KDMA 4TWTA 3MFCA 4L97A 4PF5A 4YW3A 4YW2A 3USSA 1R082 2XVLA 1QOTA 3AZWA 4AFMA 4XW3A 2DCZA 2PQQA 2MNGA 1GLHA 4HBNA 4UBHA 3J8F2 4EWDA 4Q0PA 3CNAA 1SLIA 1BEV1 3LB9A 3K51A 1KD7A 5JLVA 4X8PA 3KT7A 5L7OC 4XF9A 4MUVA 3WR0A 5T3NA 1AR91 4GALA 1PO23 3VBUB 4CDUA 2IXLA 2ZMKA 5AFBA 3VBHC 1ZX5A 2P3JA 4YM0A 1AVBA 4Q4X3 4KWKA 1FNZA 3UV9A 1ONAA 3WZ1A 3MLLA 1VBD1 4GKXA 1YJKA 2RS12 3RNSA 2WZPP 5CIRA 1EAH3 1TME1 1GSLA 4Q4W2 2LUWA 3UKTA 1ZZCA 3CJXA 3L2YA 1CAXB 1AR73 1FAYA 1B35A 4JGZB 4L99A 4U36A 3VKOA 4OLLA 3AZZA 2GZWA 1NCRC 1TNFA 3MIGA 1DZRA 1ASJ3 3ZPYA 3KLSA 2A6VA 2GNBA 4FXKB 4DXZA 2ZHKA 4CEWC 5C9AC 2C0ZA 1GICA 1OA3A 2R063 3R6SA 3INAA 4GH4A 4HL0A 4SBVA 4JQRA 3NWKA 1FX5A 2A6YA 2UWCA 1MACA 4AGRA 2E63A 1MEC3 5BXXA 4R52A 4RL7A 4QPGA 1YIPA 3H3UA 1JBCA 2GN7A 1X7NA 2JEMA 2D6PA 1RIRA 3WG1A 1EY2A 1ASJ1 2FZ1A 4PBOA 2ET7A 1K5MC 2B8MA 4FCAA 1LOFC 1SCRA 1AYM3 3ETQA 4JGYB 1DGRN 4A7YA 2V5YA 3FLTA 2O1QA 4PDWB 5A3MA 5ACA3 2WL1A 1QNYA 4FPCA 3NSTA 3H8UA 4P9IA 1BBT3 4ASLA 1PO12 4PJYA 2XJRA 1LENA 3B93A 3VZLA 5FMOS 4C1XA 2PHRA 4KH9A 3ZFFA 5FFOC 3P3PA 1V00A 4YVWC 4J1WA 3JB8A 3JUUA 1O3SA 1A8DA 3AYEA 4Q0SA 2EXHA 3ELNA 1JYCA 3WDYA 2E6VA 4A7ZA 1WD4A 1QJU3 3NAPC 3MEPA 2C5DA 2LTNA 1AL0G 4R9AA 2D3RA 3EJKA 2D40A 1QJX3 2VU9A 2ZX3A 1EV13 3I2DA 5E88A 5C8CB 1S0CA 5ACA1 3WCSA 4XBNA 3SXWA 1FMD3 5DUWA 3USUB 2G9GA 4LBKA 3SH3A 3WT3A 1RMU3 4AQ2A 4AE2A 2PLV3 4NR1A 1ZRCA 4YG6A 4Y1UA 2LALA 3J26N 1C5IA 1VBC1 4MYEA 1IKPA 4Y24A 2XLGA 3VHRA 1WCDJ 4I0WB 2XWJB 3RJRA 3MIBA 1A3KA 3S30A 2PFWA 4XF4A 2DCJA 3VBFA 4Q27A 2JG9B 3VUOA 2I07B 3JBG3 4JDMA 2RM21 1RJ7A 4C91A 2JDZA 2Q0AA 2WNUB 4MSVA 2NPIA 3RYKA 3N7JA 2O8QA 4YNIA 3ZFEA 4DS0A 3WDXA 3WHUA 4OHVA 2AENA 1OD5A 1PMIA 2ENRA 1O7FA 1SDWA 4AFBA 5DDJ2 1LODA 3KCYA 1LGNA 3PJQA 2R062 4Z8BA 2OZ6A 1WGPA 2A3WA 3H9AA 2SLIA 4WVMA 3ZXAC 5EYXA 1U5XA 4AFDA 4RS5C 1DGWX 1QKQA 2BNMA 4XHBA 3IBMA 1RHI3 1S55A 1NQDA 3AP9A 4YG0A 4FPJA 2IFRA 1PGW2 1OFNA 2ZAHA 3KCXA 2ZBJA 4FOWA 4XTPA 1RUE2 4XYXA 3OBTA 4AQ6A 1VBE2 5C9AB 1XU2A 4LO5B 1GNHA 3ENRA 1J3RA 1SQ4A 5GJ6A 1SLLA 2B45X 1CIWA 4Q8LA 2DWRA 2P17A 2RHPA 1YO8A 3OD4A 1PGL1 1C8M2 2VOKA 3M8LA 3NVCA 1D4M2 4Q0UA 1RJ8A 1KJLA 1UF2C 4YW1A 4D7YA 1C4RA 3ZSJA 5JMCA 1YXWA 2PA7A 2QFEA 1B35C 1D4M1 1FPN3 1X82A 5BNPC 1LHOA 1Y3TA 3FJSA 1VBC3 1OHFA 4Y20A 4LO4B 2BNNA 2QKDA 4CDQC 3TBDA 4C0BA 4XQ4A 5DUVA 1S0GA 4HLTA 2A5ZA 5A33B 4QPIB 3GBWA 4R9BA 4ZU4A 3MPPG 1ZZ9A 2AH2A 1R1A2 3E6BA 2F6BA 3VBSB 2WZR3 1AJOA 1BZWA 1PVC1 2X53S 5CG8A 1KS5A 3NO8A 2G9FA 5GZEA 1N1YA 3URFA 2IXKA 2EA7A 2VG9A 2W08A 3AZYA 2X5IB 3WY6A 1A6CA 1X36A 3ILRA 1AR92 4K3UA 1VBB1 4DRVA 1ZZBA 4FBFA 5HCAA 3MLKA 3J8F1 1DGWA 1IZ3A 2C1FA 3PMEA 4G3YC 1ZBA3 2D6OX 1ZNPA 2D5FA 3VBOC 1ND2A 1S2BA 1PK6B 5DDJ1 1XE8A 3JD72 3OPZA 1ZRFA 4E2SA 1DQ0A 5FQ0B 4Q4V2 4AHYA 4FTSA 4AWDA 1IOAA 1VR3A 3E5UA 3HN1A 4YVSC 4PCRA 4IEYA 3DN7A 1PGSA 4RGGA 4CP2A 1ULCA 5DZEA 5C4WB 5JOXA 1RHI2 3B7MA 3HIFA 5CFCC 5IK7A 2UURA 4RS5A 5D1IA 4K6BA 2WFF3 3WQ1A 5ABJC 4AEMA 1V9U2 1TMF2 3NV1A 5FQ0A 4PIXA 1BXHA 2RMU1 3WP4A 1ND3A 3RS6A 3AXEA 2XL7A 2DUOA 2YDEA 3QH7A 4YVSA 1H8TB 2JENA 3VZMA 2R042 4ZU7A 4ISRA 2XJTA 1POV3 4CZSA 2B5HA 1DQ5A 1CPMA 2RS33 3O7OA 1AR61 2RE9A 2TUNA 3AKRA 3MZHA 2WQZC 5J37A 3V64A 4GXLA 1GBGA 4IV3B 2Z42A 4G4FA 1H8VA 3IDBB 1ZRDA 3ILNA 5L19A 1UL9A 2K2SA 2PAMA 3N3HA 5FPZA 5IK4A 4D7SA 4DY5A 4N53C 4LULA 4YSFA 4LLFA 1MZFA 2GAUA 4A3XA 3WDVA 3FHIB 5GLVA 4L2NA 3AKQA 4FPYA 3WG4A 1BBT1 1AZDA 1POV1 1FI2A 1VP6A 2NMOA 4GB33 4DB5A 5BNNA 4F8AA 1MS8A 2HWE3 1YYNA 4FPEA 2WC2A 1RINA 3AKPA 3IDEA 5GLTA 4N7IA 3OGJA 4YGDA 2DUPA 4NWWA 3NW4A 3B9IA 3D0SA 2JG9A 3NV3A 1AX1A 3NAPA 3WP6A 5E89A 2ETEA 4S2FA 3ZIXA 1OQ1A 3AM2A 1YNAA 4Q8KA 4XJUA 5JDBA 2HWB3 2P34A 4QQ2A 2DU0A 1OFSA 1YFUA 1EPZA 2XLAA 3B02A 4XFIA 3QLQA 3O0WA 4XFFA 1Y9QA 4XQWA 3ZYPA 3KGLA 3TYJA 2OIIA 1DZQA 2QQPA 2E53A 5DZFA 4MGZE 1QXJA 1ZZ7A 2OVUA 3VBRB 4LO6B 4FPOB 2DVGA 5GLWA 2H6BA 2RM23 5GZCA 3R0RA 2ZABA 5BYNA 4HK9A 1O4TA 1IQAA 2BFUS 1LHUA 1ND2B 3I54A 2E9QA 1SEFA 2JJ6A 4LE3A 2Z2SB 4K7JA 4Q26A 5EWSA 4CDXC 3TNPB 2VULA 3ZO0B 5FDBA 3CF6E 4DNYA 2OZJA 2ZGMA 3V0BA 1JXNA 4YGEA 1F5FA 1A78A 3E5XA 1UU6A 2UWAA 5FREA 4LBLA 5GZFA 4J1XA 1BQPA 3JU9A 4P9GA 3DV8A 3ZYRA 2O8OA 3FFZA 2VNGA 4N90A 1RITA 4AF9A 1NCRA 2KM2A 3POWA 3VBFB 4Q4V3 4HN0A 3A0KA 2N7GA 4P9WA 1L3JA 4S2HA 1AX2A 4D94A 3U11A 2VUJA 2V73A 5FO9B 1YUDA 4BIOA 4COWA 2HEYF 2D6KA 4FSJA 4WZFA 2DCTA 2OPKA 3ZSLA 4R4ZA 3GHMA 1SLTA 3B00A 3VBHA 1LHWA 1ZZ6A 3M2MA 3RMXA 2E7AA 4LHLA 1HRV3 3DKWA 4GWMA 3GBFA 4XJWA 2B42B 2R072 3THPA 1J58A 1MS5A 1W6QB 2BVVA 4AI1A 1LOGA 1CD3G 3DF0A 5C8CA 2CGPA 3H0OA 1PZ8A 3PVNA 1R093 1XNCA 4XE9A 4U2AA 5E1RA 4NPRA 1HIXA 4IEXA 2ZHNA 3ZN5A 3CU7A 2P3IA 1CAXA 1LEDA 2A6XA 4AHZA 1XRUA 4EN0A 2FBEA 4Q4Y1 4CRQA 2VNOA 1C1FA 2WS91 3BIWE 2WS92 2WFPA 1N1TA 2CY6A 3WLUA 1LOCA 1M4WA 2WZR1 1O3TA 5LRRA 5K0UC 1KFXL 2SBAA 2XVKA 5E8AA 1O5LA 3ZYIB 1DFQA 2ILMA 4I01A 3KZ4C 2DF7A 1YHFA 1AR72 4XJAA 1NA1A 5ABJB 4PBPA 4PIZA 4H7LA 2ZTNA 5I0UA 1VB2A 3SMHA 5FLJA 4WM7C 2E7TA 2ZGRA 2WFF2 3I59A 3Q9OA 2PHXA 3R4SA 2RS53 2NMNA 2DVFA 2CGOA 4EROA 2QZ3A 3CJIA 3K48A 1PO22 2UYBA 1D2SA 4XF0A 2NP0A 4OI0A 4GH4B 1LECA 4HETA 5LK7B 4IEOA 4L8QA 1BVVA 1SBEA 2IXCA 3FX3A 5IT6A 2GH2A 4QPGC 5JR7B 2XLFA 3M7AA 4HZFA 1HRV2 1JTZX 3AMPA 1D4VB 3U0ZA 4LBQA 3ZXFA 5KHJA 4OUSA 2I2SA 2K9ZA 5GKAC 1AF9A 1Q3EA 1CAWA 1CQ9A 2XJVA 1AYN2 5KHKA 2HEWF 1CJPA 2DVDA 3E5QA 2R16A 4YG3A 4RHV1 2B9UA 1WW5A 1AR93 1MZEA 1RUI3 4UW3A 4XMAA 4AVAA 2ZCWA 1DGLA 2VMHA 4GB31 3QCWA 4NO4A 1GR3A 4AVBA 1FATA 4TYSA 1R091 1MR5A 2WNUC 1RUC1 1SLAA 5F9TA 3M70A 1ND3B 4BWOA 5BV6A 1RUJ1 3FMGA 1VB4A 3C3VA 1QDCA 4UW6A 2GC0A 3O14A 1QWRA 2CL2A 3UKVA 5BNNC 2WFF1 3LAGA 4HANA 4OI4A 5J09A 2D6NA 3KD4A 2ZHMA 2IFWA 3WW4A 1AR82 3VZKA 5L7OA 2WKKA 4Q0VA 2RS51 3EHKA 3OYWB 3FBMA 4JGYA 1RMU2 5C4WA 3ZMNA 4NVPA 4XTMA 4FOQA 3I59B 4ATEA 4IESA 4RQPB 4AGVA 4LA3A 3KCCA 3I4IA 2WIIB 1I3HA 3A4UA 3WHTA 1TQ5A 1YI7A 4Q4Y2 5JAXA 3TN93 1HXS3 1UD1A 3VL8A 2ZZJA 4B4PA 2XKOA 1C28A 4KWLA 1LGCA 1QJU2 2Z79A 3ZN6B 4PLNA 3WQ7A 1OMIA 1RUNA 4WVVA 3RWNA 2YC0A 4KQ7A 4OZXA 4QX5A 1Q5OA 4CEWB 4Y5Z0 1UKRA 5CFDC 2WT1A 4AHXA 1OPMA 2GMEA 5T54A 4IV1B 2X5IA 4COUA 3OY8B 4YFWA 2PTMA 4HVRA 4FPLA 1G9BA 2WSVA 3VBSC 3FFQA 4LBOA 2Z5WA 2PHFA 2QDRA 1QJZA 1B35B 2QNKA 2WINB 4W6XA 2BWCA 4WM8C 1AR62 1WCKA 4BHPA 4P9JA 3ZXGA 4ISQA 5F5QA 5DDJ3 5FO7B 3ZFGB 2ZGKA 1J1LA 1HW5A 1F5JA 2H6CA 5SV8A 2AYHA 4L92A 1R1ZA 1REDA 2R041 4XPVA 1UAIA 3VBOB 1G9DA 4RGAA 3VN4A 3BOPA 3I8TA 4LBQB 1QQP3 2NYYA 5BNQA 2ZOEB 1VRH2 1MS4A 1COV1 3X29B 4AFCA 3KGZA 1F8VA 1FPN2 4XXPA 2H0BA 3W59A 1RUJ3 1XQNA 5CFDA 1DIWA 4K9SA 3ASIA 2BWAA 3V56A 3E97A 5FAXA 3POSA 3VLBB 1NCQC 1WA4A 2GSYA 2ZACA 2ZGTA 3M3CA 2FMDA 1Q8SA 5C9AA 1VBA1 1BJQA 2EF6A 3PNAA 1RUG3 1FMD2 2VH9A 5C33A 1GZWB 3AZVA 3N4MA 2YGLA 3U07A 1PZ9A 2PHWA 1ZA4A 3SITA 1GV9A 2RS31 2GMPA 4GB32 1UW8A 4PLOA 1QH7A 4YARA 4ES9A 1DLLA 3BTAA 1KITA 3NKTA 3SCFA 2D3PA 4JCKA 5LEJA 4MGIE 2XGXA 1BK1A 1H2KA 3G7DA 1PIV1 4MV2A 1WLTA 4DQAA 2H0VA 3IIAA 3D6EA 1TE1B 3SH4A 3LCPA 2OYZA 3AYCA 1OSGA 1TEIA 2WNUA 1G8WA 4XILA 3MI8A 4B8EA 1LOAA 3AP5A 2AUYA 2XBO3 3AK0A 3LOBA 1FOD1 1OPOA 1W6QA 3DPRC 1ZBE2 4QM8A 1VAKA 5C8WA 2CAVA 5KHIA 1AYM2 2NQYA 1MQTA 1W6NA 3MIDA 4GMP0 1WD3A 4UXAA 4A7KA 4HVQA 5CFCB 5EV7A 4IERA 2Y0IA 3T1LA 1OQEA 1PO21 1Y7BA 3AMQA 4Y1XA 1GZ9A 3PLQA 3PVOA 4ZXKA 4I3PA 4LUMA 3AFGA 2A3XA 3EQEA 4IV3C 3N7MA 2HWB1 4M0HA 2B7YA 5BNOA 4Y1ZA 2YV8A 4Y22A 4BMEA 1D2QA 1ULGA 1H2NA 3OGGA 2C9AA 4LT5A 2BW8A 3POYA 1YJLA 1UZYA 3CL1A 2D6LX 4HKLA 1MQTC 1AR71 3VKNA 2WA4A 4K20A 3KQRA 3EXUA 4QXKA 5EYYA 3ZMOA 4A2UA 4EN6B 4HSJA 4O9EA 2YXSA 2GU9A 3P3NA 4HKOA 1SBFA 4JDOA 1S0BA 4RR3C 1WW7A 5T5PA 2ZGSA 5J48A 4FOVA 3H3ZA 1IPJA 3M1HA 4TZDA 4N43A 4R8HA 3AYAA 4YM1A 2DV9A 3D82A 1WCSA 2BGCA 2DU1A 4AYUA 1D4M3 1RUD2 4AHWA 1ZBE3 5KXEA 2RMU2 3AZXA 2JXAA 5CB7A 2HWC2 4YYOA 1NA1C 4CDXB 4D69A 2YHJA 3MICA 4XIKA 3RPQA 4YVSB 2XJQA 4PDWA 4FAGA 1RHI1 2EXKA 1KXGA 3AMHA 4CDUC 1E57A 1YRZA 4XBLA 3TAYA 5TSWA 3V0AB 2HWD3 2HWE1 1PIV3 4B4QA 1DF0A 4HFSA 1XYOA 3VKFC 2EAKA 2JECA 3ATGA 4XJ9A 1U5YA 4LUKA 4AXOA 5T5OA 2R1BA 3JD71 5CA6A 4RHV3 2R49A 1UN1A 4J6GA 5JPMB 1QJY3 3W9AA 4RSUA 5B2GB 3M3OA 3WVJA 3UK9A 3FC0A 1G7YA 3ZXEA 1JHNA 3NAPB 4R9CA 3ZXLA 2HEVF 1W6MA 1N1SA 2GC2A 4QGMA 3AFKA 4LBJA 4S2GA 1RUI1 4DY3A 2KA3A 1OOPC 1TMF1 2WSUA 2ZX0A 4XIOA 2Z69A 1YFWA 3WW1A 4NHMA 2UWBA 1HQNA 1WMFA 3HMYA 1Q8VA 1T6GC 5ABJA 3IT8A 1H1IA 2JE7A 4AK3A 4JVAA 3ZYJB 1K5MA 4M3CF 4N43C 3UL2A 2HJIA 2AZ5A 1C5HA 3VBSA 3WDWA 3AKTA 3VBUC 2AGSA 1DYKA 2A70A 1CGPA 4MGYE 4RR3B 1DBNA 4QPIA 1TMF3 1F2NA 1V9U3 4EN8B 1B09A 4NOTA 5EJ3A 1AYN3 4N43B 4EV0A 2CYFA 3TB0A 1GQGA 2EVXA 3MLJA 3JBG1 1F31A 1WUVA 2D7FA 1NCQB 4GH4C 4XFGA 1S0FA 4BMBA 4E4ZA 1H8TA 1BCXA 4YZ1A 4MXWB 4CEYC 1AHSA 1PGL2 1HXS1 4E2QA 3JQWA 4XOGA 4QPIC 3RI9A 1UCXA 5JVVA 2VW2A 1RUG1 1CESA 3N7LA 4GIQA 1C57A 1R1A1 2YYOA 2O0OA 3JZVA 4ORFA 5KBFA 1QQP1 4ONUA 4AW7A 1HXS2 4PLMA 4ES8A 5K8SA 3AX4A 4OI2A 1Z7S1 3EBRA 3LA7A 5SV5A 4URTA 4AEJA 5HXVA 2CWSA 3USUA 5F6KA 4OULA 4P14A 4QT6A 3RYPA 4P9YA 2VUAA 2DTYA 5L36A 1J1TA 2FHRA 3B01A 3WP3A 2QZ2A 4BM8A 1BYHA 3HD8B 4DPNA 1JUIA 3VL9A 4CDWA 1COV3 3OY8A 4XHXA 1NLSA 2P3KA 2ZGPA 1H2MA 3UJOA 4AVCA 2JE9A 2BBVA 2UY8A 3BB6A 2WT0A 1TME2 4M01A 3LZZA 1LEMA 4XFCA 2RS11 5FLIA 1PHMA 4CDWB 1D0GA 4Y26A 2A6WA 3VZOA 4N53A 4LO7A 2D97A 5D8AC 5LRSA 2XKPA 1XU1A 1RUI2 3AMMA 4E9KA 5AFEA 2X8KA 1HQWA 3VBRA 5C6CA 3AJYA 3UJQA 2YMZA 4JRLA 5DZGA 2ATFA 4MH0E 1ALYA 2WLQA 1QDOA 4IQPA 5K9YA 5IK8A 4KU8A 5EZWA 1ZREA 4QPGB 3IM0A 2ZGNA 5ACA2 2ZHLA 5CFDB 3GZUC 4WVWA 2K0GA 5A3LA 3KMHA 1RUE3 4QQOA 1BMV2 5T50A 3ZFFC 4WVZA 2VOVA 1V70A 5F1RA 3O0XA 1ND3C 1VALA 3PJYA 3GNEA 3ROUA 1IS4A 3TNQA 5E16A 2FQPA 1NZCA 2EXJA 4HVOA 1MS0A 3AP6A 3O5SA 4HPKA 1SLBA 4NN0A 3H7JA 4L11A 3QOPA 2W39A 1DG6A 2UYAA 3DPRA 4QU2A