4IESA

Cys-persulfenate bound cysteine dioxygenase at ph 6.2 in the presence of cys
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
186
structure length
186
Chain Sequence
b'ELLKPRTLADLIRILHELFAGDEVNVEEVQAVLEAYESNPAEWALYAKFDQYRYTRNLVDQGNGKFNLMILCWGEGHGSSIHDHTDSHCFLKLLQGNLKETLFDWPDKKSNEMIKKSERTLRENQCAYINDSIGLHRVENVSHTEPAVSLHLYSPPFDTCHAFDQRTGHKNKVTMTFHSKFGIRTP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cysteine dioxygenase type 1
publication title Cysteine Dioxygenase Structures from pH4 to 9: Consistent Cys-Persulfenate Formation at Intermediate pH and a Cys-Bound Enzyme at Higher pH.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Oxidoreductase
total genus 55
structure length 186
sequence length 186
ec nomenclature ec 1.13.11.20: Cysteine dioxygenase.
pdb deposition date 2012-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05995 CDO_I Cysteine dioxygenase type I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4iesA00
1G6NA 3ES4A 4UXAA 1VR3A 1ZZ6A 2BGCA 3QACA 4O9EA 5C8WA 4YSFA 2BEOA 3UKNA 3KGLA 4AVCA 3FZ3A 3IIAA 5E1RA 4PJYA 1O5LA 1YFXA 3LAGA 1EY2A 1HW5A 3DN7A 3PLQA 2EAAA 3HT1A 2QVSB 4ORFA 1ZZ8A 2QCSB 1YFWA 4HSLA 2KXLA 3UKVA 3H7YA 4LUKA 3H3UA 4KWLA 2WC2A 1UCXA 2GC2A 3FFQA 4IEPA 1V70A 1TQ5A 1CAUB 1NXMA 4LEJA 3GBFA 5BXXA 4WZCA 1O4TA 4QX5A 5AVPA 3U11A 5J7MA 1X8MA 5BPXA 3LOIA 5I8SA 2IXLA 4EWDA 4L2NA 2UYAA 4A2UA 1VP6A 5FLJA 4O9GA 3MZHA 2VECA 3I54A 2ET1A 1OFNA 4QXKA 2ZCWA 4Z07A 1WGPA 2PFWA 2DCTA 1RL3A 4E2SA 3E5QA 1CAUA 2OPKA 5I0UA 5I93A 2Q1ZB 4MUVA 3H7JA 1CAVA 5D1IA 1YFYA 4XFIA 2XKOA 1QXRA 4YARA 3H50A 3DKWA 1O3SA 3KMHA 3BALA 4FAGA 5LRSA 2CAVA 1L3JA 3D0JA 4AQ2A 1O3TA 1DZRA 1UIJA 4QGMA 1RC6A 3UKTA 4F8AA 3NJZA 4WVZA 4TLFA 4XFHA 3EO6A 1ZNPA 4AVBA 2XL9A 3OCPA 4KWKA 4IERA 2B5HA 3LA2A 3RYPA 1FT9A 1U12A 3USSA 4HZFA 4IEZA 2ZKLA 4R52A 3N4MA 3CJXA 2ATFA 2PTMA 3E5XA 4XFCA 3WW2A 4XF9A 2OYZA 3SCFA 3C3VA 5BV6A 3B02A 1EYBA 3HIFA 1OMIA 4AQ6A 2PAKA 4R8HA 2P17A 3KGZA 1GQGA 4RD7A 3FJSA 1PMIA 2GC1A 4BIFA 3O14A 1ZX5A 5LEKA 1LB2A 2HKXA 4E2GA 4LULA 5FQ0B 1J3QA 1O3QA 5I91A 2H6BA 1CAXB 2XHKA 4XF1A 3S7EA 1NYWA 5FDBA 1ZREA 1QXJA 3RDIA 3SXWA 3H8UA 1Y3TA 4META 1J3PA 4AVAA 4XEZA 2BYVE 4JV4A 1I5ZA 2FMYA 3LZZA 4XFGA 1X82A 3HT2A 1ZRFA 3KSCA 4N9IA 2UY8A 1ZZBA 4Q0PA 5KHJA 2CV6A 4Z82A 5FPXA 2IXHA 2GC0A 2N7GA 3I7DA 3IWZA 4PIYA 5EFUA 4EROA 4MZUA 1H1MA 1UD1A 1NE4A 1ZZCA 4IEWA 3CEWA 3FWEA 4YYOA 3D0SA 4ONUA 4HVRA 1RTVA 2XLFA 2Q30A 1X7NA 2D93A 4I2OA 5JR7B 2PHDA 1YUDA 4IEUA 2CGPA 2H0VA 4F7ZA 1H1IA 3S7IA 3E6BA 2EA7A 2XKPA 2GU9A 2Q0AA 5I0TA 4LUMA 4ZU4A 5JAXA 3ES1A 4YNIA 3E5UA 3MDPA 5I8TA 5LRRA 1YLLA 4IEQA 4KWJA 1YFUA 3LA3A 1WLTA 2Q4SA 5FCCA 3H1YA 4BYYA 4IETA 4HSJA 2OZJA 2XGXA 3ZDSA 2GC3A 4EWEA 1UPIA 5CVRA 4D7TA 4E2QA 3PVBB 2H6CA 4I0BA 4XF0A 1GQHA 4HN1A 3TNPB 3LA7A 4IEVA 3OGJA 4JTOA 4LA2A 2QDRA 1CAWB 3IBMA 3QOPA 3CL1A 4JTNA 1SEFA 1ZRRA 2UYBA 3CLPA 2D5FA 1ZVFA 4QMAA 3DL3A 1DGWA 1NE6A 1QWRA 4PIZA 4HBNA 4Q0VA 2UY9A 2VPVA 1O7FA 4JVAA 2XLAA 1FXZA 5J3UA 4I3PA 4MGYE 1LKNA 4H7LA 1Q5OA 4HN0A 4AXOA 2ET7A 4HVQA 2IXIA 4XF3A 5EZWA 3WW4A 1ZRDA 2PYTA 2K0GA 3RYKA 4CYDA 3ELNA 5HI0A 4EWAA 3H1MA 4D7SA 3BU7A 5K8SA 4QGLA 2QNKA 1YWKA 5KBFA 1Q3EA 4KU8A 2I45A 2QJVA 1J1LA 2F4PA 2GZWA 2MHFA 3CF6E 4NVPA 3SMHA 4MGZE 4FBFA 5FLHA 3H9AA 3I59B 4IESA 1JUHA 1ZZ9A 3H3ZA 5JCTA 3BCWA 1OI6A 1SFNA 3NKTA 4I01A 4XF4A 3GYDA 3E97A 4QM8A 1LRHA 4PIXA 4LLOA 3OD0A 1EP0A 2HJIA 3IDBB 3ACLA 4IEXA 1RUOA 5KHGA 3OTFA 2PAEA 1CGPA 5FQ0A 3MPBA 2VQAA 1CAXA 3KCCA 5I0SA 1RGSA 3U0ZA 1QY4A 3M3IA 3WW1A 1O3RA 5I0RA 2GAUA 3PNAA 3EJKA 2D5HA 1O5UA 1XRUA 2WFPA 1VJ2A 4Q0SA 5J48A 3NL1A 1CX4A 1WA4A 3R6SA 4FAHA 3RPQA 4LTAA 3G7DA 2PQQA 3L2HA 1X8EA 4X6RB 3FE5A 3JZVA 5BY5A 5CADA 3BPZA 1LR5A 4N9HA 4OFGA 1Q43A 2PHLA 1OD5A 2PA7A 4MGIE 4ZU7A 5F1RA 3NSTA 5I8YA 2PAMA 3LWCA 3E6DA 3NW4A 1UW8A 4HMZA 4HLTA 2IC1A 3EQEA 3M70A 4IEYA 5KHIA 3VHRA 1IPJA 4Q0UA 3WW3A 4J1XA 4BH9A 4X6QB 2FQPA 3U10A 2MNGA 1SQ4A 2Z69A 1NZCA 3EHKA 4MX3A 4MH0E 1CAVB 5KHHA 2XL7A 3ST7A 1XE7A 4P9GA 3RNSA 4YRDA 4I09A 3ETQA 5BUVA 1DZTA 4WBBA 3CO2A 1I6XA 4Q29A 3S0MA 5CU1A 2IXKA 4I02A 4QM9A 4I0AA 4K8FA 2O1QA 1DGRA 4QGNA 4UBHA 5LEJA 4LA3A 3ROUA 1ZZ7A 4KU7A 3HQXA 4ZU5A 2O8QA 4MGKE 4EV0A 4XFBA 1RUNA 5C6CA 2E9QA 3D82A 2IXCA 3MYXA 1CAWA 1IPKA 4B29A 2MPFA 2BNMA 4BHPA 1Y9QA 1J3RA 3RYRA 2BNNA 1YHFA 2Y0OA 1PM7A 4XFFA 2C0ZA 2GH2A 4IEOA 2BNOA 2OA2A 5FLIA 3OF1A 5FPZA 3TNQA 3BB6A 5JSPA 3RZZA 3SCHA 1J58A 1XE8A 3FX3A 3IDCB 4HVOA 2CAUA 4DINB 5T3NA 1FI2A 3SCGA 4Q0QA 5JSOA 2D40A 4UBGA 5JSRA 2Z2SB 4GULA 2EVXA 3E6CC 4XETA 2XLGA 4L11A 1ZRCA 3I59A 1EPZA 3EBRA 4J1WA 2V09A 3SHRA 3FHIB 4XFAA 3DV8A 4KL1A 2B8MA 2ETEA 3H1WA 2IXJA 2OZ6A 4MV2A 5E16A 1J59A 2K9ZA 5KHKA 2B9UA 4FT8A 1UIKA 4OLLA 3NVCA
chains in the Genus database with same CATH superfamily
5JXJA 3TEZA 4IV1A 3MW4A 2VTXA 1VBC1 1KRIA 1Q56A 1VR3A 1JYTA 1ZZ6A 2BGCA 5M0TA 2VC9A 5C8WA 4QXHA 5HXVA 2W87A 1AVBA 5FK8A 2XJQA 2YV8A 3ZDVA 4AVCA 1W0NA 1ALYA 3FZ3A 1V9U1 3J9SA 4PLNA 5FUPA 5FZDA 1A8DA 2HBTA 2HWE2 5FBJA 4CCDA 3PLQA 3MIFA 2EAAA 2WO1A 5CYYA 4ORFA 4ZHNA 1ZZ8A 5FOBB 1LOFC 2QCSB 4IV1C 1TME3 1YFWA 4HSLA 2KXLA 5CKQA 3UKVA 1HKDA 1OKQA 2CU5A 5CFDA 2D3PA 1TE1B 2ZHMA 4HG6B 4QB2A 1W2TA 3WF2A 3FL7A 4KWLA 2WC2A 4OUSA 2VULA 1H0BA 4MG2A 4Y1VA 4JGYC 4LO4B 2VOWA 4ZY9A 3OY8B 2ZACA 4J25A 5IK8A 5T54A 3JD73 5FY0A 4AVSA 4XJZA 2EIGA 1HB3A 1HN1A 2HWD3 1JN2P 2EALA 1JZ6A 3GM8A 1LGCA 5EJ1B 1MS3A 1WLCA 1WMFA 1Y7BA 1X8MA 3N35A 5BPXA 3LOIA 4E4SA 1GKBA 4LE3A 1NY71 4L2NA 3T30A 4BQ2A 1W9FA 4Q27A 1VP6A 1AR82 4W50A 3ZXKA 4OI1A 4H55A 5C71A 1N3OA 1SDWA 5IK7A 3ZYFA 4O9GA 4NWVA 4P5YA 3HVDA 4W65A 2VECA 1REDA 3M2MA 4Q4W3 4Q4V2 5F9TA 2AR6A 1WGPA 1UY1A 1FPN2 1UZVA 2WINB 3NV2A 4LK6A 5DZFA 2A6XA 3ACGA 3E5QA 3OBTA 1CAUA 2OPKA 4UFJA 4AHXA 4E2SA 5CA6A 1QU0A 1CIWA 3BODA 3IM0A 5L36A 3NAPC 2ZEZA 1ZBA2 1X9TA 3DKWA 2R073 3KMHA 4QX2A 3ZFEB 3D6EA 1O3SA 3VHNA 5FRAA 4AQ2A 5LRSA 1DZRA 1D4M3 1A6CA 1JTZX 2HWF3 2W91A 3VBSA 1COV2 2RR12 4ARYA 3NJZA 1WLDA 4BQ1A 2J7MA 3WNNA 2E7TA 4XJAA 5LY1A 5KC6A 1QJY3 3AB0A 3I97A 1GICA 4AVBA 1W2AX 5EIYB 1RMU3 1GWMA 2V4VA 4KWKA 3VD7A 4IERA 4MGQA 4PDWB 4K21A 2A3WA 3RYPA 1FT9A 3NV4A 4Z2WA 4IUGA 4IEZA 5F2SA 1PX4A 2ILMA 2ZKLA 2JE9A 3ENRA 4B7EA 3V0BA 3N4MA 2E63A 2DFBA 1PHMA 2AREA 5IWFA 3N7JA 2VW1A 3WUDA 1RUE1 5HV0A 4Y20B 4XF9A 5FZEA 3C3VA 1UYYA 3B02A 3THTA 1OMIA 3THDA 4AQ6A 4EN6B 2ZZQA 3B7MA 2CTVA 3C7GA 5G05L 5GM0A 1HQWA 2W92A 4FQZA 4Y1XA 3EMRA 3FJSA 1H8TA 1XSRA 1PMIA 4Q4X2 1LB2A 2Q8EA 4E2GA 1AR93 3Q9OA 2J1EA 4WVVA 2R0FA 1SACA 2ZGQA 5FQ0B 2H6BA 3P1IA 4OI2A 1OH3A 1GR3A 4RYDA 4XF1A 4P9IA 3RRDA 1OLMA 2VUCA 4P9XA 3O1SA 1GP5A 2PHXA 1AL0G 2D6OX 2KA3A 1ZREA 4FFIA 5BNOC 1QXJA 3W5MA 1Q8QA 2HBUA 4WM8A 1APNA 1RUH3 1UZZA 1QDOA 1DGRN 3PMEA 5ANQA 1PM4A 1J3PA 1DHKB 2X09A 1RVF2 3AMPA 3T2QA 5BNPC 1VBA3 4XEZA 2XPJA 4Q8LA 3ZN6B 1D0GA 3LZZA 3VD4A 2BUKA 3B94A 3W20A 5FPAA 1G9FA 1W3VA 3GCWA 4FFHA 3KSCA 4N9IA 3THCA 1ZZBA 4AGVA 1PGW1 1SBFA 5FPXA 1FMD1 1ND2A 3IWZA 4EN8B 4EROA 1PO13 3IT8A 3I3BA 4QU1A 3LGRA 1UD1A 2W1SA 3T2OA 2VVEA 1XPWA 3W21A 4FO9A 4XVHA 5C4WB 3BUCA 3NRUA 3FWEA 4OI0A 3UGHA 3AP6A 1NOVA 2UWAA 2FDIA 1VAMA 3VB9A 2RS31 4HVRA 2VZRA 5FMDA 5FYTA 1FNYA 3J7MA 3RZGA 1ND2C 2R063 2HEYF 3KQ4B 1YUDA 3POIA 4JHZA 1W28A 2CGPA 1CD3G 3AKTA 4UI9L 1W8ZA 1JYIA 3S7IA 1MQTC 5A32B 4Y4YA 3ZLIA 4OI4A 3LD8A 4E8CA 3TN92 4PLOA 2NMNA 2GU9A 3Q8FA 2VQ0A 1RYYA 3WNLA 3W59A 5A80A 3ZM8A 1LOCA 2J42A 5GZCA 2IFWA 3PVNA 4NIAA 5I0DA 4LUMA 4YVWA 3FLTA 3CZUA 2C26A 5JAXA 5JPMB 4YNIA 2YHJA 3HBZA 1OSGA 2RHPA 1QIQA 3MUY1 2YYOA 5H9QA 3UK9A 3OYWA 1V6JA 2JE7A 4YLZA 3ZN5A 5CFCA 1DG6A 1E5RA 4QPIC 1ND3A 3B93A 4YG0A 4GMP3 4UOJA 5A6YA 2R49A 4GIQA 1C8M3 1EAH1 2WL1A 1WLTA 1JZ8A 5T5LA 1F9KA 1K12A 3BTYA 5CEHA 2OQ7A 3KD4A 4YVSB 3WDTA 1X50A 1YRZA 2W9XA 4HSJA 1VBB1 2GP5A 3AKQA 4IGQA 4ES8A 1XU2A 4PBPA 2VQTA 2YC0A 3JXSA 5EYYA 3AZWA 1DCSA 5CVRA 4A7KA 4IE7A 2GALA 2G1MA 3PVBB 4JKKA 1GZTA 1GQHA 5L7OB 1QJU2 1CZTA 1QMJA 3I2JA 2E53A 4JTOA 1ASJ1 3T3YA 4LQRA 1F15A 1TMF3 1UOGA 3FLPA 1JMUB 1DYPA 2DCJA 3ACHA 1LAJA 1BYHA 1FOD2 5C70A 3FHAA 5AC93 5F7UA 1AUYA 3CL1A 3OBZA 3ILRA 2MEV1 2QQIA 4CDWA 3QCWA 2ZA9A 3A4UA 1ZVFA 3H0OA 3DL3A 1STMA 4IL7A 1DGWA 5FY7A 1NE6A 3OG2A 4M00A 4LHKA 3WD5A 1D4VB 2BBVA 4HBNA 4Q0VA 2ZGKA 2ARXA 5JXHA 1YQ6A 1GANA 2O0OA 4PCRA 3ABZA 4OUMA 5FO7B 1LHVA 1POV0 1OQDA 1DFQA 4LO6B 2W3JA 4LITA 4FPHA 2ET7A 3ME2A 4FXKB 2WNOA 1BK1A 4Y5TA 3ZPYA 3WW4A 4HVQA 1VBE2 2PYTA 1H2KA 2WS91 2D43A 3LE0A 2VZSA 2Y6GA 4QPWA 4RQPB 3ORJA 1H9WA 4CYDA 4CXXA 4DY5A 5JMCA 1QJX1 1RHI1 1K45A 1XXNA 1S0GA 3IKWA 1DQ4A 2JG9A 2P4EA 4RHV3 5A7WA 5K8SA 4CDUC 2PHTA 4KBBA 2WNUA 2X5IB 3RI9A 1R1A3 1Q3EA 4P9YA 2I45A 3ZR5A 1W6QB 4YM2A 4DZGA 2WNVB 3K4DA 1J1LA 2ZHNA 2F4PA 2WSUA 3B9IA 1UY4A 3WNKA 4Y24A 5A1FA 1Z0HA 3ASIA 5KC5A 4KGGA 4IESA 2BQPA 1ZZ9A 4H2AA 1L7LA 1WA6X 4XBLA 5BNNC 1UOBA 3BCWA 2WT0A 1OI6A 2HWE3 2VH9A 3DKQA 3UETA 3URFA 3NKTA 4XF4A 3GYDA 4QM8A 1HXS1 1H2NA 1RUF1 3HQRA 3J8F2 1T6BX 3F2ZA 1UMHA 3MIDA 3MV11 3OD0A 4FQ4A 3F95A 4PIXA 3VBRB 5J98B 1EP0A 2DDUA 1JOBA 1RUOA 4IV1B 3K2OA 1W9TA 1H4GA 5CAZA 3CIHA 2Y6KA 4IE4A 5KXCA 4MXWA 2CWMA 2IVIB 3PJYA 4LR4A 3N7KA 5FMBA 1EPWA 4QKFA 3M3IA 4IV3A 4NRMA 1O91A 1PZ7A 1YI7A 2R041 2YBPA 4B3NA 5C33A 1RITA 1RUD2 2AENA 3N36A 3VDDA 1SZBA 1WW7A 3I2HA 5FMCA 3VDCA 4LT5A 4EJRA 2LW8A 3LPGA 4PF5A 2JEMA 1QGLA 5CFDB 1JU3A 2HYKA 1N1VA 3KM5A 1RJ7A 4IDZA 1HIXA 4K20A 1AR83 4KG8A 5DUXA 5FYIA 1OOPA 5DDJ1 4E9KA 3ZIWA 5FZ4A 5C9AC 2A75A 3G7DA 2FMDA 3L2HA 4X6RB 5JI7A 1GZWA 3BPZA 1BHGA 5T55A 1FPN3 1BBT1 4C8DA 1Q43A 4IQPA 2X8KA 4I30A 3AYAA 3WNOA 2O14A 4EZ4A 4C91A 4XQ4A 2J1RA 5F3EA 4FOWA 4QQLA 5T5PA 1OUXA 5F1RA 5I8YA 1W8HA 1SFYA 1ZBA3 2PAMA 3SISA 1S0JA 2VQUA 5LK7B 3P6BA 3POEA 2YPDA 4HMZA 3HMYA 4C0HA 2VZ3A 4NHMA 5FZKA 1COV3 2RR13 1QDCA 2VOKA 3KCYA 5TSWA 3O0VA 3S5QA 3OB8A 4ATFA 1H1AA 3S30A 4Q0UA 4N53A 5HCFA 5D2AA 3L9JT 3NNLA 2Y33A 3MW2A 5FY9A 4MH0E 3NNJA 1NCQA 4CP1A 3KB5A 3MLJA 4QX8A 1XNDA 3PHMA 4UW4A 1RUG1 4MXVA 2VR4A 4LBOA 2VZ1A 5BUVA 4N53C 2CYFA 3OUHA 3VBSB 4BZ4A 4OVEA 3M8LA 2FZ1A 1I6XA 4Q29A 1ULGA 5CU1A 4I02A 4DOUA 1GBGA 3USUA 3TAYA 1DGLA 4QM9A 1W0PA 4G3YC 2W1QA 4Q4X3 2ZHLA 4LHSA 2OQ6A 3SLIA 1S2KA 2B39A 2WSVA 4GH4A 1JS9A 4FP2A 4Q4Y1 4UBHA 3RI8A 5IHRA 4LHNA 5T5OA 3V0BB 1L7QA 4DEVA 4D7YA 1ZZ7A 2R0HA 4KU7A 3N9OA 3CKHA 4R9AA 1NCRA 5IJRA 3I3QA 3O0WA 4EV0A 4K1YA 2VZVA 1IHMA 2E9QA 4U36A 2DU1A 1FV3A 2Q5TA 2QQUA 1BJQA 1W8TA 3APBA 3MYXA 3SH5A 4KI5M 4B29A 1WUVA 2BNMA 1RVF3 2MPFA 5GLUA 5IVYA 1IS6A 3AKSA 3MLLA 3RJRA 4AEKA 2BNNA 4R4XA 2VMFA 1H8TB 2EXIA 1UL9A 3AZXA 4QPGA 3QLQA 1YHFA 4Y33A 5CBLA 1JUIA 3GF6A 3KVBA 2DF7A 4I3GA 3O1OA 1O8PA 2PHRA 1HB2A 2BNOA 2OA2A 4PI0A 4ZKTB 1SLCA 3HN1A 4P9JA 3ZFEC 3JBG2 4ATEA 5FLIA 2RV9A 4COUA 3WNMA 2A5ZA 4CU9A 4BIOA 4WM8B 5F32A 4YGDA 5ISLA 3BB6A 1S0DA 4EYUA 2P37A 2JDPA 4FVVA 2B45X 2RDNA 1LU2A 3HOBA 4Q26A 4QWNA 1VE0A 2JXAA 2QQLA 4HVOA 1E5HA 3DYPA 4P5HA 2XR4A 2XJRA 2XHNA 3LIGA 3VBUC 1SFPA 3A21A 5HCBA 3OEAA 2JDYA 1ULFA 4X8PA 1Z7S1 3KV9A 1MZ6A 5AFEA 3OPZA 5JOXA 1ND2B 2ZEYA 4DRVA 2JWPA 2Z2SB 3AMNA 5JIAA 4MYEA 3TN93 1AYN2 1UXZA 1WW6A 2VZOA 4L11A 4WVMB 4XHBA 2WRAA 1UQXA 3U37A 1ZRCA 5FYMA 2ZGTA 4YW3A 5C8CA 1XNTA 3IPVA 4GQ7A 1KJLA 3DV8A 1O8SA 2ETEA 2JE8A 4MGSA 4MV2A 5E16A 3VZKA 1F5JA 4BK4A 4GB32 2B9UA 4E8DA 1UIKA 1VRH1 4OLLA 2WWUA 4O65A 2BGOA 1LJ7A 2DU0A 1HRV1 4XDOA 4R9DA 1POV1 4LNVA 1G6NA 1W6MA 2ZMKA 1VBC2 2W08A 1KS4A 1OPMA 4NPLA 2A3YA 3LFIA 3BKZA 1PIV1 1AYM3 1ENXA 1V0AA 3VD3A 5K0UC 3RZMA 1FAYA 2I07B 4NJ4A 3MF9A 2Y6LA 1IZ3A 4PF1A 5E1RA 4YVWB 5FZIA 2AC1A 3LAGA 3DN7A 1QJU3 3NMBA 3VKFC 3HT1A 4MHRA 3M1HA 4OCTA 3OYWB 3MIBA 1WCDJ 4HKLA 4IE5A 3UV9A 5C7GA 5CFCB 2HWB2 4N43A 5DQ0A 1FOD3 4BPZA 1ND3B 1SCRA 1QQP2 3H7YA 4EQVA 5L9VA 3VKOA 2VZTA 4HT1T 4Y1ZA 5FYHA 3TB0A 1TVGA 1YO8A 1UCXA 1ZBE1 3ZYBA 4AF9A 1YXWA 2OUJA 2Y38A 4UYBA 5FZMA 1V70A 1Z78A 4YZ3A 5C4WC 2HEVF 3TEYA 3AVRA 1AR71 1IGOA 1NXMA 1QXPA 4LEJA 4XXAA 1D2QA 3MHZA 4QKBA 3LSDA 3U11A 2BRTA 2FCUA 1FV2A 3GXUA 1AJOA 1NA1A 2BFUL 2WABA 1PK6A 4A41A 3ATGA 2YGLA 1YQ2A 1NY72 4AEJA 4N7IA 4CCMA 3ZYJB 4CDWB 2RS11 4R4ZA 1XYNA 2HH9A 5BYNA 2JIJA 2EIBA 5LB6A 5CG9A 3AP9A 1OFSA 3DYMA 2D6PA 3I54A 2ET1A 2A6ZA 4YW1A 1OFNA 4QXKA 2XVGA 3H8XA 4Z07A 3NO8A 2WKKA 3DPRA 2DCTA 4HXCA 1C28A 4RR3A 1MR5A 5I0UA 2R32A 1LU1A 3CZJA 1WZXA 5LA9A 4A42A 1QJFA 2NN8A 4AGGA 2OUHA 1MEC1 3VD9A 4FPEA 3BALA 4CA9A 1TME1 4DO0A 2YZ4A 4QGMA 1RC6A 4MO3M 3UKTA 5GLZA 4YVSC 2ZGPA 5JI9A 3J8F3 2ID4A 3POGA 2DVBA 5DG2A 4TLFA 2VOXA 2WNUB 3OUIA 4XFHA 3N9LA 1ZNPA 5LA0A 2BVVA 2VG9A 2GNDA 4XIOA 2P2KA 5L7OC 1KFXL 4Q8KA 4DXZA 5GLWA 2HWD1 3USSA 1SPPA 3HEIA 3Q8BA 4D94A 2JDZA 4R52A 4AVVA 2A70A 4WVWA 1GMMA 4F3JA 1X36A 1VBD2 3CJXA 4UW3A 2ATFA 1QH6A 1RUE2 1RUD3 4NIDA 3WW2A 1VAKA 1K3IA 1OA4A 3NJVA 5BV6A 1EYBA 4OMCA 1LOAA 1I9RA 2D3SA 1DP0A 3GBWA 3ALQA 3MO4A 2PAKA 4DXSA 3LEMA 2P17A 4Q4W1 2TUNA 1UO9A 4GD4A 1KD7A 4YM3A 4HKOA 5FK7A 1WCUA 2VXRA 2GC1A 2NPIA 3UESA 4BIFA 1ZX5A 1W06A 4MXWB 2XJSA 5FY5A 1J83A 4P00B 2BWAA 5I91A 4MGTA 3ZX7A 4YM0A 4CCOA 2YG0A 3KS7A 3PUIA 4S2FA 3GZUC 5C9AB 4IV3B 4C90A 4CEYC 4RQPC 2VCMA 5FZ7A 5IK5A 1LTEA 3SXWA 2G9FA 4G4FA 4QX1A 4IGOA 2RVAA 2ZGLA 3DUIA 4GWJA 5LBCA 5H9SA 4FTEA 5A3UA 1W6OA 5IW0A 3VUOA 4AVAA 3U1XA 1VB4A 1OOPB 2LS6A 2BYVE 2A71A 2FMYA 2WFF1 4XCBA 5FZLA 1QJY1 2C9KA 4Q2FA 2JG8A 4XFGA 1PNGA 1X82A 1MPXA 1RMU1 3K4AA 1V6OA 4KG0A 4NRPA 1YI9A 1ZRFA 1PGW2 2XMLA 5KHJA 1W2UA 2JD4A 2IXHA 3I7DA 1UKGA 4OQ8A 4Y26A 5JZGA 1NE4A 2QQMA 3CJIA 1GNYA 3PMSA 4YYOA 5DG1A 3D0SA 3VKMA 3KQRA 3VBRC 4CDQA 3JU9A 5F2WA 2RS32 1YCIA 2QQOA 4AEMA 5FYUA 3I3DA 2XVLA 2BGPA 4AI3A 5JZGC 2ARAA 2P3IA 4N53B 5CISA 5DPNA 1D7PM 2Y26A 5FPLA 4M3CA 3AP5A 5EXOA 1AR91 2BPA2 1N3QA 4CU8A 4FSJA 3ZFFA 1PGL1 3O0XA 4CDQC 2EA7A 3NWKA 1NCQB 2WWSA 4DRRA 5GLTA 1UWWA 4XUPA 1CIYA 1OA3A 3D5OA 4HONA 5CFDC 3RZKA 4XJUA 1RUH1 3RFRA 3FUQA 3Q8AA 2FDHA 3BOWA 5IYYA 4OHWA 3GCXA 4QPYA 2UWBA 3KV5A 3RMYA 1DBNA 1GYKA 2Q1MA 2RS51 2VE1A 3KT4A 5FBZA 2JENA 5FMOS 1VBA1 3WG1A 1YLLA 4N8MA 5A7OA 3CBNA 4BA6A 1SBEA 3B5LB 1YFUA 3RZHA 1EAH2 4L0PA 5T52A 3LA3A 4P9WA 3USUB 1AX0A 3VZJA 4E27A 1LGNA 2V5DA 5CIRA 3N9MA 1ODMA 1AX1A 1VBB2 4HFSA 1QNYA 2XGXA 3ZDSA 1OQEA 4BISA 5J36A 4A7ZA 2C4XA 2VXJA 4EWEA 5K4LA 4D7TA 4N90A 3JBG3 3Q8CA 1MS8A 3I2OA 4Z2AA 3LF7A 2HWC2 3MUZ1 2Q8CA 2Y6FA 3J7NA 4AR2A 1Y9MA 3U75A 3O1MA 1AHSA 1ASJ2 2YB7A 2ZABA 1WW4A 2QDRA 1VPHA 4JAAA 1BZWA 3ON7A 2W52A 4PHZA 2E32A 4M0NA 3QOPA 3SEPA 5LY2A 2WZPP 2VNVA 4JKMA 5FMOL 1HDKA 2EAKA 2YPJA 2JICA 4QPGB 2QE3A 3I2GA 4LBKA 5FXZA 2QBXA 4X8NA 1OVPA 4F83A 4WM7A 3JQXA 2K2SA 3T1MA 1DYKA 1WBFA 4HOOA 4HPKA 2UY9A 3TEXA 3VBUB 1O7FA 3FC0A 1RUI1 3VBSC 1CONA 4DY3A 1QOTA 1XE0A 4ES9A 1FXZA 4QU2A 4XDQA 1UOFA 3DXUA 3IAQA 4H7LA 3QH7A 4Y3OA 1Q5OA 5DABA 4HN0A 5CKMA 2VVDA 4FTSA 1LEDA 2WS92 3N9NA 4WM7C 2AYHA 1A78A 2AEYA 2F4LA 3PTRB 4HKWA 3RYKA 1QJX2 4GJYA 5HI0A 1C8M1 4D7SA 5LA1A 4GB33 2P3JA 2RMU1 5A7SA 2NP0A 5A6QA 4BMEA 1BLZA 3C7OA 5IVVA 3AZYA 2QJVA 2GZWA 1AF9A 1KDMA 3CF6E 5HV4A 3C7EA 4XUQA 4FBFA 5FLHA 3H9AA 2YXSA 4YZ1A 4CP0A 4AI9A 4UW6A 3ZR6A 2PHFA 5HXMA 3H3ZA 1PZ8A 5DAQA 5JCTA 3ZXFA 2G9GA 5C8CB 4YW4A 2QQJA 3ILNA 4P9LA 3WINE 4BDVB 4I01A 5A33A 5K0UB 2AEZA 1A8MA 1H8TC 2CHHA 5AC91 1RUF2 4L9BA 4AFMA 1OPOA 2HWB3 2YFZA 1UZYA 1W2NA 2ZX0A 4BJ0A 4CP9A 3TEWA 1QQP3 4LLOA 1NQDA 2J22A 3PU3A 5E8AA 2HJIA 3UNPA 2E6VA 1W6MB 4ZPIA 4YZ2A 4QXBA 3SNMA 2VU9A 4WM8C 4DS0A 2WZEA 4O61A 4CDXA 2PAEA 2WWJA 4XCAA 3WV6A 1IQAA 1C8NA 1F35A 1UPSA 2TBVA 3ZXJA 2Y6JA 3LFMA 3U0ZA 3ZYPA 3WW1A 3AM2A 1JZ3A 2RDSA 3RJ2X 2R042 3GHMA 1W6PA 3LQCA 2GAUA 2VNGA 2BTVC 3PNAA 2WDBA 5H9RA 3EJKA 1RUJ3 1TZOA 4N43B 2WFPA 4ZZ8A 5A3PA 3NL1A 1OURA 1SLIA 2BBAA 3QH6A 3ZVXA 1ULCA 5FP9A 3ZMNA 5DDJ2 1XQNA 1WA4A 4D0QA 2LTNA 1SG3A 1SLBA 3OSDA 3VGIA 1KJRA 1OLME 1PVC2 1VIWB 3U07A 3WT3A 1I3HA 1QOOA 2FBEA 4OFGA 1DQ5A 1REFA 4NHXA 3OPWA 4CTEA 4LJHA 1PO23 4XACA 3BVCA 5F3GA 3KF3A 2PA7A 4MGIE 2JDHA 5A3MA 4ZU7A 1NA1B 2BDRA 2WLPA 3WCSA 1PK6B 3FHQA 3KHBA 3OGVA 3FBYA 2E31A 3NNGA 1KEXA 3NQHA 3NW4A 5K7PA 4ARXA 5LA2A 2ZGNA 4BE3A 3IDEA 5FREA 5ABJA 3EQEA 3M70A 3I8TA 3GZEA 4IEYA 4GWMA 5KHIA 3VHRA 3BTZA 3WP3A 4AVTA 4BH9A 2V73A 3DPRB 5KWRA 1HJGA 4YVWC 2QDNA 2Y60A 4RR3B 3OBAA 4B7KA 3ZSJA 2MNGA 1SQ4A 4HK9A 2A1XA 2LM3A 4PLMA 2CGNA 4IE0A 5KHHA 4XHXA 3ST7A 3AK0A 5CFCC 4P9GA 1RUG2 3RNSA 3IIIA 1ND3C 2WBKA 4LKSA 2EXHA 2DBNA 1VBD3 1F8VA 1DYOA 4R9BA 4AW7A 1RUE3 1N1SA 2XDVA 4NHLA 5FP3A 4A45A 4XQDA 4AEDA 1NAEA 1AR81 2WN3A 2ZMNA 3LIHA 3S6PA 5EP9A 3BU0A 1KS5A 5J1XA 2F6BA 1WKYA 1BEV1 4RGGA 1GZCA 1X33A 3POYA 4I0AA 4Y22A 5DXDA 4LK7A 2R1BA 2UU8A 1OQ1A 2YMZA 4NE9A 4LBNA 1DGRA 1M4WA 2D44A 4QGNA 3BYWA 3ZFGA 1CESA 3LCPA 4K9SA 4Q4Y2 3VZMA 4AEDC 4LA3A 2EIEA 5D8AA 1CPNA 2ZX2A 5T5JA 4D6QA 5FWEA 3PJQA 2Z79A 4AAXA 4CDWC 5LZ6A 1UU4A 2W1WA 3GBGA 3POFA 4RN5A 4XFBA 2FCTA 5C6CA 3A23A 2BJSA 1S0EA 3D82A 3K46A 4FPJA 5E89A 3VLBB 4CEYB 1T2XA 4UFKA 1OF4A 4BU2A 1YNAA 4OHYA 3A7QA 2WZR1 2Y0OA 3GDBA 1PM7A 4W6YA 4AWDA 4XFFA 1LEMA 4AG4A 1JZ2A 3M3OA 3B3QE 2GNMA 3WDWA 4Z8BA 1HB4A 2DUPA 3K48A 4AI1A 4XE9A 3H8RA 2P3KA 5FJKA 1ST8A 2XB6C 2B42B 5GZFA 1EV11 4B1LA 1IKQA 3IAPA 3OF1A 3V56A 4TN7A 3WDXA 2VVFA 3VBOA 3VKLA 3RZLA 5JSPA 2XVKA 2JG9C 1NLSA 1ULEA 2ADDA 1XE8A 3E1F1 2WNUC 1W6OB 2RS33 3N9QA 1KDKA 4M3CF 3J7LA 4RS5A 4ASKA 2CAUA 1PZ9A 1JHNA 2JB4A 2E7AA 3AC0A 4L8QA 5T3NA 4DINB 2VTXJ 3MI8A 4AFCA 2VGDA 1VAVA 4JDOA 2JG8B 3SCGA 4BQ4A 3VD5A 3UL2A 1Z7S2 3D8CA 2XWJB 4KWUA 4YG6A 4AQSA 2FDKA 1HRI1 3ZYHA 1MACA 2R16A 2WR9A 4Y4RA 4GWIA 2XQRA 4GULA 2EVXA 3POBA 4PQ9A 4NROA 3RWNA 1NX9A 5JZGB 3O1VA 3E6CC 2DBIA 2PHUA 1POQA 2W95A 2X10A 1ENRA 2XLGA 1JBCA 3CJIB 1Q8SA 1EPZA 3I59A 3EBRA 4J1WA 5A3OA 3CU7A 3SHRA 4CDQB 3FHIB 4LHLA 1GWKA 1UNBA 1HLCA 5A6XA 5L9BA 2Q8OA 1GP4A 3AX4A 1SBDA 2BP6A 2XQXA 3AP4A 4XAEA 2ENRA 3DCQA 4B4RA 2A6YA 3CNAA 5JOWA 4GAZA 5GZDA 3CQOA 5LBBA 1EAH3 1W8UA 4M3CB 1CJPA 1HRV2 2XBO2 1WCSA 4IV3C 3ZFFB 2RDRA 4Q4V3 3KCXA 3VDDC 4AL9A 2P6CA 3BOPA 4O9EA 1YEWA 2BEOA 1W9YA 5C3PA 3T0AA 2VZQA 1DGWX 5JVVA 4PJYA 3KV4A 2HWC3 1OOPC 2KD7A 1LHNA 1R092 1N1TA 2E33A 2W0XA 5F3CA 1ASJ3 4NIGA 2GNTA 3D4KA 4BMBA 1K5MA 4CE8A 2DVFA 1CR7A 1LULA 1UOJA 4GWNA 1MZ5A 4LUKA 5GLVA 2I2SA 5EHDA 2DTYA 3ZSLA 3WG2A 1ZBE2 1UY0A 1CVNA 1KQRA 3HAGA 3OD4A 5IVBA 2CNAA 2GC2A 3IN9A 3ZYGA 2JKXA 2TNFA 3PIJA 3V0AA 2GH8A 1AR72 5F37A 3CMGA 1CAUB 3I49A 2R6QA 1HV1A 1H6XA 1H8VA 3DEMA 1U0AA 2VZPA 3O1RA 2WA4A 4QX5A 4ZS3A 5AVPA 2J1TA 2ORZA 5ANNA 4AZZA 2PLV2 3UGFA 5I8SA 2IXLA 4FPGA 4EWDA 2A6VA 3O12A 2D98A 1H4HA 1YJLA 2WS93 2DUQA 4DNYA 5DAVA 4A2UA 2RS12 1QJX3 5FLJA 1OXCA 3AL6A 1NCQC 3PURA 5A7QA 1G9DA 1C1FA 3WZ1A 4AGRA 2WN2A 1VRBA 4OZXA 4OULA 4WM7B 3WG4A 5C3SA 1MS0A 5FZ9A 2PFWA 2VW0A 4HPKB 1AYM1 2CDPA 4H7MA 4J6GA 2BERA 3ZXEA 2WT2A 4FPFA 4XUOA 4QX7A 4MUVA 5I93A 3H7JA 2B46X 5D1IA 1YFYA 4XFIA 3HQUA 2XKOA 4TXWA 2DCYA 3QD6A 4CUAA 1QXRA 2ZAHA 4K6BA 3T1LA 1MEC2 2OKXA 1HQNA 1W8OA 3H50A 1TME2 3KT7A 3LB9A 4D8MA 4QAWA 1OT5A 3D0JA 5IT6A 1XOYA 4IW3A 1RUF3 1NKGA 2R7EB 4YGEA 4F8AA 1GNZA 4YW6A 2WA3A 4GH4C 2JECA 4FFFA 4FXGB 2XONA 3WNPA 1R081 4CP2A 1AJKA 4H3WA 1B35A 5FP4A 2XL9A 1AL21 1KFUL 3OCPA 1VB2A 3ZN4A 5JXIA 1NCRC 1UY2A 4XC9A 4EZHA 3WQBA 4COYA 3LA2A 1GU3A 2DVAA 2XJPA 1CX1A 1U12A 2QKDA 1PX3A 1W99A 1C57A 5A6ZA 4ZONA 1ZA7A 1MS5A 4YGBA 5B2GB 5IK4A 2QUOA 2ZJCA 3WEZA 5GZEA 3WDYA 3E5XA 1PNFA 5A33B 2CL2A 5LWBA 4QPGC 2OYZA 3SCFA 2RM22 5FV3A 1GP6A 1RUC2 4XTPA 4CP9B 3B01A 4Q1PA 4BLIA 3OBRA 4XTMA 3ZYRA 2DFCA 4R8HA 4BQWA 3KGZA 4UF0A 4V2VA 5DDJ3 2DURA 4TWTA 2ZAAA 4GXLA 4BWOA 2EXJA 3O14A 5LEKA 3U78A 1AR62 2D6LX 4CDXB 3BGAA 4LULA 4YZ4A 5C3RA 1O3QA 1PVC3 4PDWA 3I2KA 2EF6A 4OHVA 5DAWA 4CRQA 1F4HA 3S7EA 4FCAA 4TSVA 1NYWA 2PQSA 3B69A 1BCXA 1UZ0A 1W3XA 1W6PB 3RDIA 3WXPA 1R1ZA 2RJ2A 4ISRA 2WQZC 3H8UA 3SQOA 1Y3TA 2ZX3A 2CY6A 1XYPA 5FZAA 2OT7A 3J8F1 1RJ8A 2WAOA 4JV4A 1I5ZA 2WFF2 1IG0A 2P5BA 5CZKA 2QQWA 2OPWA 2G4IA 2B7YA 1AZDA 1HJFA 4JRLA 4CU6A 5FZ8A 4W6XA 2W2IA 3HT2A 2UY8A 5DUVA 4LPLA 2CV6A 5C8CC 2L9LA 1XNCA 2IWGB 2GC0A 2ORXA 3R0RA 1H2LA 1MVEA 2BOJA 5EFUA 3WX5A 2A6WA 4Y5Z0 2BFUS 2CDOA 1G9BA 4GKXA 5T50A 1V9U2 1ZZCA 4IEWA 2JDMA 1RUG3 3FFZA 3T0DA 4TLGA 3I4IA 2C9AA 1PMHX 2XJTA 4AHYA 4UT5A 3AMMA 5ERLA 1F5FA 1N47A 2XJVA 4GKYA 4CCKA 4CCCA 1RTVA 2XLFA 3J26N 1QH7A 1V6LA 4DUVA 5JR7B 2PHDA 3PL0A 1T6GC 1S0IA 2H0VA 4F7ZA 1H1IA 4XAAA 2D7FA 5FUIA 1ENQA 4ZXKA 3M3QA 1PGL2 5EWSA 2X29A 1SLAA 3JB4C 1J1TA 4XZPA 4GMP0 5ACA1 4Q4Y3 5FWJA 2J1SA 4RA0A 2FZ2A 4N43C 2Q0AA 2VZUA 1AXKA 1RUH2 3OGRA 4URAA 3SC7X 3ZMOA 4ZU4A 4LORA 3ES1A 1Y4WA 3KLSA 2LUWA 5GJ6A 1MZEA 1G86A 1C1LA 1W2OA 2RS52 3PUQA 4XMIA 4AEDB 4CVUA 3MDPA 5I8TA 5LRRA 3WDUA 1VBE3 4IEQA 5DN2A 4AFAA 4W8JA 4XPVA 4CEWA 2FD8A 4JQTA 3WQ0A 3MIHA 2Z4FA 3POWA 3AJZA 4QDRA 4Y22B 5LATA 3VBFA 4BYYA 4IETA 1OVSA 5E88A 3ZFGB 4M0HA 1NA1C 2OZJA 2OVUA 5LASA 1PK6C 1YJKA 3SEEA 2GC3A 2YROA 1W39A 4BQ3A 4QDQA 1H2MA 2VY0A 2Y64A 3HNBM 4HN1A 3LA7A 4IEVA 3OGJA 3VV1A 2DVDA 1W6NA 4OYUA 3R4SA 4YFZA 1JH5A 4BM8A 3O5SA 3IBMA 3RMXA 4A4AA 3DPRC 5A3LA 4JTNA 3BPSA 5HCHA 4LO7A 4RR3C 5FTTC 4DUWA 2B4KA 3VHOA 1XB9A 5A3TA 1SEFA 1ZM1A 2JG9B 2AGSA 2D5FA 2Y0IA 3CLPA 3M4FA 4QMAA 1G9AA 4AAPA 3MFAA 1Z7S3 2VL4A 4PIZA 2BV4A 2ZMLA 3JD71 2W47A 3T0BA 4A44A 1G8WA 4NO4A 4LKFA 2VPVA 1RUI2 5FYCA 2XLAA 2BVBA 3VBOB 2VOTA 1NLRA 2BWCA 5CG8A 1QJEA 3WR0A 4S2DA 2VNRA 4I3PA 4FFGA 4SLIA 4XJWA 4EN9B 1DLCA 5IATA 2C24A 1HB1A 2BOIA 4RS5B 2YBSA 1UF2C 2P6HA 2J1AA 3AL5A 3PUAA 4XF3A 5EZWA 1ZRDA 1H30A 4QB6A 1WD3A 1C8M2 4S2GA 4YFWA 4EWAA 5B4NA 2VUDA 3G6JB 3H1MA 4R9CA 1SDDB 2RMU2 3WQ1A 1OLRA 1QOSA 3BU7A 3ZXGA 3IB3A 3WY6A 2QNKA 2ZKNA 3U4SA 1VMFA 1HRV3 1YWKA 2DCKA 2JJ6A 2VTFA 2A3XA 2XBO3 2WQ4A 3KT1A 4XOGA 5FFOC 3VBHA 3RG0A 4UAPA 4DQAA 1G7YA 4DFSA 5IAVA 3RQ0A 2MHFA 2VUJA 1HV0A 4NVPA 4C1XA 3W58A 1S2BA 2VMGA 1LHOA 4IXLA 3MV01 5FZ1A 3I59B 5JWPA 4GA9A 4E4HA 3I2IA 4QT6A 5JXGA 2X53S 3PU8A 3WDVA 2G19A 5BNNA 1BMV1 3VDDB 2R071 1NT0A 3FUOA 1R093 5GKAC 1S4CA 3IMNA 4K3UA 3E97A 1D4M1 2HWF1 3VZLA 4Z1VA 4K40A 3WP4A 4TYSA 4RL7A 2QZ2A 4RFRB 1S2EA 1UKRA 2EXKA 5FO9B 3ZFFC 3BTXA 1RB8G 1GOFA 2XG3A 4IGPA 4XJ9A 3HBKA 4E4ZA 1ZBE3 3ACLA 4IEXA 4LBJA 4NOTA 5KHGA 3WHUA 4HETA 1W6QA 1GZWB 3HJRA 3VDAA 3OTFA 4A7YA 1FMD2 1CGPA 1AR73 1KGYA 5L73A 4L99A 3KCCA 1CAXA 5I0SA 1RGSA 2XOMA 3WF4A 3N7MA 5I0RA 4OQ9A 3T08A 2ZZJA 2JG8C 4KGQA 1O4YA 2PLV3 4LXLA 1K5MB 1UX6A 4DPNA 1O5UA 1XRUA 1SCSA 1SMVA 3NV1A 4Q0SA 5F6LB 5FY8A 2Q8DA 2X05A 5J48A 2RS13 5G04L 2R30A 5IFTA 3EXUA 2P1BA 1UMIA 1IPSA 1N1YA 1CJDA 3R6SA 3RPQA 1OF3A 2VMCA 4FTBA 2FDFA 2RE9A 2PQQA 1LOFA 2FCVA 3CJIC 2H0BA 3FE5A 3JZVA 3K77A 3L2YA 3V0AB 3AKRA 2QQKA 4JRAA 1BVVA 4N9HA 3D3AA 4K7JA 1NG0A 2DVGA 4P14A 3WVJA 1WWYA 5FIXA 3FBMA 2PHLA 3HN3A 1C5IA 3VZNA 1OD5A 4JGYA 2OS2A 3NSTA 4NWWA 3W9AA 1MEC3 2VBPA 1PMJX 1IOAA 4GZ9A 2WQ8A 5FXXA 3E6DA 4LOSA 2HWB1 3UYJA 1LOEA 2YBKA 1LECA 2XJUA 3AYEA 3NJXA 4RGKA 4XXPA 1KITA 1QQP1 2VMDA 4JX0A 2NYYA 4LBMA 2UURA 1W0OA 3MFCA 4OZOA 4ZS2A 3PVOA 4Y1UA 2VAUA 3DF0A 3WW3A 1IPJA 5AFBA 2K46A 2RJLA 3MIGA 1WD4A 4FI9A 1U5ZA 1DQ2A 5IUQA 1JZ5A 2W1UA 4X6QB 2VMEA 4NN0A 3MBWA 2OXBA 5J09A 1S0CA 4MX3A 2Z69A 5FYSA 3EHKA 5IAXA 1PO11 4GH4B 2XL7A 2LALA 3VN4A 5LW9A 1XE7A 2VM9A 3HPNA 2W46A 4BB3A 1PVXA 4I09A 4LIVA 3ETQA 3K75B 1ZYBA 1NCRB 1RUJ1 3QBQA 1V6NA 2DYCA 2JX9A 1Q8PA 1DZTA 2R061 1RUC3 1ZA4A 2RM23 3CO2A 4WBBA 4C0BA 3NAPA 4M3CE 3RWKX 3S0MA 1WMXA 2MEV2 1LODA 4XMAA 2QQPA 1NXD1 4PI2A 3VL9A 4EN0A 1B35B 5BNQA 1BEV2 5GALA 3ZXLA 3K3OA 3R05A 4CCNA 4K8FA 2PMWB 1AR63 2O1QA 3BIWE 1GQPA 4Y1YA 1QHDA 1V00A 5LEJA 1KXGA 1PO21 1QF3A 2SBAA 4A3XA 2VBDA 1LOGA 4V2WA 3ROUA 4WZFA 4COVA 3IDAA 3M7AA 2FDJA 4NMIA 2PELA 4DIQA 1AYN3 5JR2A 3H8OA 1JU4A 3HQXA 2O8QA 2WNEA 4NR1A 2JDNA 4IE6A 5JOYA 4FPLA 3MF6A 5SV8A 5JIUA 2VBBA 4QHBA 4NAMA 3WF0A 3SH4A 2IXCA 3ZIXA 1UU5A 1CAWA 1IPKA 4BHPA 4W6WA 4KMQA 1I1EA 1RHI2 4FOVA 4GMP1 4UF0B 1J3RA 5FP7A 3RYRA 1E5IA 2WFF3 4Q1RA 1CN1A 4E4DX 1LENA 2YY1A 2WZR2 4BCUA 4C1WA 3P5BA 5FPVA 1HN0A 1W9SA 1UYZA 5DUWA 2GH2A 1GNHA 4A3ZA 1VBC3 2E7QA 1EV12 5F5AA 2HEWF 2D6KA 3ZPOA 5FPZA 3TNQA 3GNEA 1W05A 4LBLA 5IFPA 1JI6A 1V9U3 1VBD1 2WZ8A 3WP5A 1RXFA 4KBZA 1QKQA 3AP7A 1TMF1 1UAIA 2DCZA 3HNYM 2GSYA 3I2DA 3IPVB 3FX3A 3NNMA 4JKLA 4LE4A 4P08A 4CCEA 3IDCB 3AKPA 1W9WA 1TNRA 2ZOEB 1HXS2 2VO5A 2ZX1A 3RSJA 2QTWB 5BNOA 4JDMA 1LESA 3MPPG 2WO2A 1GLHA 1FI2A 1XNBA 5L19A 5GZGA 5J96B 4Q0QA 2D97A 4Y5SA 1LNSA 1S55A 2ZGSA 4LBQA 5JSOA 2D40A 4AQTA 4NUBA 1HRI2 5KXBA 4UBGA 5JSRA 5BNPA 4XIKA 3TWIA 3PUSA 1WLWA 1S0FA 5FOJB 2V5YA 3P3PA 4DXTA 4CXWA 4QDSA 2J1VA 1JYVA 4XFAA 1NLQA 3VZOA 2WIIB 3AZZA 3ACFA 2JDAA 4KL1A 2B8MA 1GSLA 2RS53 3H1WA 2YUEA 3FLRA 4YW7A 3AYDA 2IXJA 5FY4A 1GOGA 4ASLA 3C8XA 3SKJE 4CDXC 5KHKA 4K1ZA 1V6KA 4L97A 4RHV1 4XQWA 3ZOIA 1K42A 5A7NA 4XILA 3NVCA 4LOTA 1XBFA 1R1A1 3IMMA 2Y8KA 4B4PA 3ES4A 4UXAA 4RFT0 4XURA 5DZEA 4XJ8A 4JGZA 2JKBA 4D3WA 4AOCA 1G9CA 2CWSA 1W8WA 1BBT2 3QACA 2AH2A 3LEKA 4YSFA 1W8FA 3UKNA 3KGLA 1D2SA 4ASMB 1CPMA 3IIAA 3LPFA 4WVMA 1OUSA 1O5LA 1YFXA 1MQTA 1EY2A 1HW5A 2HWE1 3T09A 5HBAA 5JMOA 3MW3A 3ZSKA 2QVSB 2GP3A 3OEBA 4QQOA 1VMJA 4H14A 1YIFA 3INAA 1FYUA 2A7AA 4JGZC 4CEWB 3FN9A 1EUUA 3H3UA 4KQ7A 1QNWA 1Y9GA 4MVTA 1DIWA 3VBFB 4HL0A 5F5CA 1HQLA 3FFQA 4FPYA 1YQCA 1MS9A 1S1AA 2ZEXA 3ACIA 3LEIA 2ZGMA 1D0HA 1MS4A 1TQ5A 4IEPA 4LMFA 4OMDA 4QPIA 4PT6A 2Z42A 3I3MA 2WT1A 3C7FA 4DMIA 5AVAA 2VD7A 3GBFA 5BXXA 2B9VA 3GZAA 4WZCA 1US2A 1RUI3 1C5HA 1O4TA 4BLJA 4NPRA 3H42B 1NUKA 5FZGA 2V4AA 5A7PA 1C3HA 1IG3A 1ULDA 5ABJC 5J7MA 1W6NB 1U5IA 2GMEA 4UFHA 4DB5A 2VW2A 2O8OA 2WO3A 2J1UA 5KR7A 1DQ6A 4GALA 2UYAA 1E57A 1GUIA 1W04A 3O1PA 5IVEA 2G9ZA 2QQVA 3WF1A 3W5NA 2Z5WA 3MZHA 1UU6A 2RMU3 5A3WA 3R4UA 1JOJA 3V65A 3KHCA 1XNAA 2ZCWA 4ZXEA 4Q4V1 3ZYIB 5DMYA 2ZGOA 2YGMA 3PIGA 1AYM2 5CB7A 3VKNA 1FPN1 1RL3A 5FZHA 3VDBA 1LGBA 4QX3A 5F6KA 3KWVA 4YG3A 3AYCA 1SPPB 2Q1ZB 3A0KA 3AMHA 5C5TA 3GJAA 1CAVA 1DLLA 2HWC1 5FO8B 1R64A 5CKNA 4YARA 1ZBA1 2W94A 1SHWB 3KZ4C 2ARBA 5FZOA 3ZSEA 4MLOA 1UMZA 5FJHA 4FAGA 1O3TA 2CAVA 1L3JA 3Q8EA 3TOJA 1UIJA 3AMQA 4ISQA 2QQNA 1VALA 1RIRA 1JYNA 3ECQA 3ZFGC 1COV1 2RR11 4LKDA 4WVZA 2RDQA 3GJBA 5DAXA 1R082 3H3LA 5D8AC 1CQ9A 3EO6A 1EUTA 3N7LA 1AL22 2XH6A 3VBHB 1H9PA 4UFLA 3UGGA 2B5HA 5L9RA 1A34A 1FMD3 3KVAA 4HZFA 3SKVA 3KF5A 4CDUA 2UWCA 5BNNB 1DQ1A 2XXZA 4M4PA 5FAXA 1P8JA 2DTWA 1XSQA 2PTMA 4QKDA 1OD3A 5H9PA 3ZSMA 4XFCA 3ZXDA 3CDZB 2VOVA 4L92A 5FUNA 1JZ4A 3HIFA 4A6OA 1Q8VA 3WF3A 1WMDA 2ZGUA 1U5XA 5IVCA 4DUXA 1B09A 2GN3A 5FYZA 4FOYA 1GQGA 4RD7A 5FPBA 3VBOC 3O7OA 2AACA 4YGCA 4OUEA 2HKXA 4Q4X1 1JW6A 4FPOB 4AHWA 2VCBA 1J3QA 4MSVA 5J37A 4A6SA 4BQ5A 1CAXB 5K9YA 2XHKA 4LKEA 4ZZ5A 4Z92B 4S2HA 3HD8B 2YC2A 4RS5C 1WMEA 2GNBA 4XZUG 3ITQA 4JZRA 3T4HB 5FDBA 4PQQA 4JC1A 1BQPA 2FDGA 3WNXA 2C5DA 2ERFA 5APAA 4PBOA 1FNZA 1F31A 1JYCA 2ZPXA 4META 1NZIA 1QJZA 4LIUA 4EE2A 4NPMA 1RVF1 4M01A 3RVHA 4COWA 2WUHA 2I74A 3AXDA 2ZHKA 1GWLA 1VRH2 5FKCA 5CNAA 3WCRA 4CPBD 3HNMA 4QB1A 1REEA 2DV9A 5C3OA 4NHKA 2CGOA 4Q0PA 1XU1A 4Z82A 3DGTA 4PIYA 3WG3A 1DZQA 1VBB3 1PIV2 1SLLA 2N7GA 4MZUA 1H1MA 3GALA 5FY1A 4QXCA 3N3HA 5C9AA 4JGYB 5FZ6A 4FOQA 4AK3A 4GJZA 2GMPA 3CEWA 3JUUA 5JLVA 3B00A 5EYXA 3S57A 1N3PA 2ZBJA 3OGSA 1BK0A 1URXA 4ONUA 2ZTNA 5C5UA 2HLEA 5A1LA 2Q30A 1X7NA 2D93A 2Y34A 4I2OA 1Y43B 3BIEA 1WW5A 3U14A 4IEUA 2MEV3 5JUVA 2YFUA 5JDBA 1BEV3 2W5FA 1C4RA 5E6HA 1OKOA 1PVC1 1OLQA 3E6BA 3LDRA 1PGSA 4DEQA 5KXEA 1IQDC 2XKPA 2KR2A 1YIPA 1H6YA 1LOBA 2QFEA 3TN91 5ACA2 5FKBA 5FZCA 4AI8A 1K5MC 3V64A 2V72A 5I0TA 5EV7A 4KH9A 1UZWA 2JD9A 3S5AA 4QKNA 4AFBA 3ILFA 2EIDA 4OHZA 4U2AA 4HANA 2FHRA 3E5UA 2W39A 2VMIA 2YC4A 1TG7A 2R1DA 2C1FA 4MHUA 5EQUA 3NAPB 2WYSA 4HK8A 2D3RA 2JDUA 1O4ZA 2VNOA 4FP3A 3OOXA 4KWJA 1RHI3 1MZFA 1LHUA 1MS1A 5LCWL 2Q4SA 4NHYA 5FCCA 3SH3A 3H1YA 2IFRA 4CUGA 1CZSA 2WZR3 4LLFA 1XNKA 3VL8A 2XUEA 3ZKYA 3RZJA 3OY8A 4TZDA 4G9SB 3CHXA 4AE2A 4P02B 4BQYA 1UPIA 1OBNA 4QQPA 1EV13 5EPAA 3K3NA 4E2QA 4I0BA 2H6CA 1O6UA 4XF0A 4YW2A 3I3EA 4NRQA 1ONAA 3TNPB 1QJU1 4K8RB 4CCLA 2CSGA 2P34A 4DXRA 4LA2A 1ZRIA 5A70A 5EJ3A 2WAAA 5A1AA 4RGAA 1CAWB 1FOD1 1BVP1 2ZS6B 1HXS3 4COZA 3NJYA 1OHFA 1ZRRA 2UYBA 3POSA 1GFF2 1WCKA 4BOWA 5DZGA 5LBEA 2JIGA 3IZOA 1QWRA 1M06G 3JD72 1HRI3 4JQRA 4YM1A 4KNCA 5F8PA 3WLUA 2XWBB 5FZFA 2VCCA 3ZXAC 1AXYA 4YW5A 2HWD2 3TYJA 4B4QA 1CZVA 2NMOA 2XUMA 4JVAA 2WYFA 3UJQA 4M4RA 4YWAA 2ADEA 2A73B 5J3UA 1XYOA 3HR9A 4MGYE 1LKNA 2OIIA 2R043 1DQ0A 4UWDA 4CSWA 3GGLA 2IXIA 3ZFEA 4YZ5A 1B35C 1DF0A 3SITA 1VBE1 2K0GA 4XABA 1IS5A 1ACCA 5BNOB 1TEIA 3ELNA 3LKJA 3O1UA 2QZ3A 5EJZB 3AZVA 3TRSB 4QHZA 1V6MA 1ULPA 2W68A 4Q4W2 3WHTA 4QGLA 5HCAA 3GZTB 1AX2A 4XDPA 2PN5A 4LBQB 2WLQA 2NQYA 5KBFA 3B9CA 4KU8A 5KXDA 1W03A 5DAPA 5BNPB 4XUNA 2ZXQA 3SMHA 5C3QA 4MGZE 3VBUA 1YYNA 1BBT3 3MEPA 2BZDA 3LSEA 1JUHA 1QEXA 2PHWA 4Q5OA 1BMV2 4CU7A 2R072 1SFNA 3EB7A 3DYOA 5FYVA 3HWJA 4ITCA 1D4M2 2ARCA 2HWF2 3N9PA 4Y20A 5HPOA 3RS6A 2KM2A 3DXTA 1YQ8A 1U5YA 3AFKA 1LRHA 4CPBA 3JB8A 4PDWC 1WBLA 2ZEWA 1ODNA 2E51A 3I2FA 3KV6A 1QJY2 2IZWA 3IDBB 1XJAA 3OJBA 1OA2A 4OHXA 4XYXA 3WOGA 3PVEA 3U4XA 1RMU2 2Q1FA 3LDKA 4JGZB 3NNFA 5A3NA 3BN6A 1UYXA 4AYUA 2D6NA 4YPJA 5FQ0A 2JB8A 3J4UH 3MPBA 3K4ZA 2VQAA 4WV8A 3GHNA 1TNFA 5FZ3A 1QY4A 4NIHA 1AXZA 1JZ7A 1MQTB 5FZ0A 2Y6HA 3JCIA 1J84A 1O3RA 4W4ZA 4CUCA 3RGBA 1RUD1 5F5IA 1F2NA 5FPUA 5FXVA 5K0UA 5FYBA 2D5HA 2IUWA 1VJ2A 4BXSV 2OX0A 4LO5B 1RXGA 1UY3A 1UXXX 1L7RA 2AZ5A 5ABJB 1CX4A 2P3YA 3MIEA 5SV5A 3ZN6A 4B1MA 4FAHA 2XBO1 4AXOA 4LTAA 2GMMA 1X8EA 1JOPA 5A7WB 1A3KA 4QPIB 1AR92 5BY5A 4CXYA 5CADA 4JHTA 1UN1A 2PXJA 1JHJA 1LR5A 5LBFA 2ZX4A 1DU3D 1ULOA 2BU9A 1Q8OA 4LO8A 4FPKA 2GDFA 5C4WA 1R091 1BXHA 3J7HA 4BQXA 4QHOA 3LWCA 2GN7A 2ZGRA 5IVFA 1UW8A 1W90A 2IVJA 2VUAA 3MLKA 1WCQA 3NV3A 1VBA2 3OGGA 5FZBA 1IKPA 4AI2A 4MADA 4HLTA 1NQJA 2IC1A 4AHZA 1LCLA 3THPA 1V6IA 3DECA 5DUUA 5JPNB 5F3IA 1YC61 1R083 4J1XA 1AL23 3AXEA 2DWRA 1GV9A 2FQPA 3U10A 3X29B 4BK5A 1PO12 1NZCA 4URTA 4UW5A 5A32A 1CAVB 5D8AB 4XUTA 1CWPA 2VJXA 3WQ7A 1ENSA 2HYXA 4UFMA 4YRDA 5FYYA 5B4XA 1GZ9A 4CEWC 3T2PA 2LROA 5FZOB 1RUJ2 1IS4A 2PLV1 1XC6A 2LRPA 3PTYA 4O7XA 4XBQA 2TEPA 4INDA 3VBFC 3AVSA 3M3CA 1VLNA 2R062 3MGUA 5FP8A 2WO7A 4ET7A 1FATA 1UX7A 2E26A 1OC1A 3K51A 2IXKA 1JXNA 2EICA 3M3EA 5D21A 1UYPA 3LEGA 1RINA 4QQ2A 3ZKUA 4YVSA 1S0BA 1E5SA 2C6SA 4XW3A 5LK5A 4JDNA 3UT0A 1PO22 4NIIA 4CDUB 4QX0A 3BTAA 3O1TA 2VCAA 3WUCA 2D6MA 2RG4A 3TBDA 1I5PA 3AFGA 3C7HA 4RSUA 4AI0A 4TTGA 3T4VA 2VMHA 2SLIA 4ZU5A 5IVJA 4V1PA 4MGKE 4D6RA 5JOZA 5L7OA 4CZSA 1RUNA 4B8EA 1IS3A 1BKZA 3PDQA 1HX6A 1Y9QA 1US3A 2NM1A 4AFDA 2NLRA 3LOBA 3NKGA 2YU1A 3MICA 4I0WB 3ZO0B 1LHWA 2DUOA 3R4DB 1VRH3 3T2TA 3A0NA 1POV3 2C0ZA 4IEOA 4BXFA 1W8NA 1PIV3 3JBG1 2RJKA 4FPCA 2YDEA 1GOHA 3POJA 3RZZA 3SCHA 1TMF2 1SLTA 1J58A 1MVQA 3LDBA 2YU2A 3PUHA 2RM21 2OW4A 3A22A 1RUC1 5F39A 5AC92 3AJYA 3VBHC 3OPTA 1YQ5A 3WP6A 4RQPA 4CEYA 2AUYA 3JQWA 5FR3A 3EYPA 3BI3A 5F5QA 4MOAA 1AR61 4N7UA 4QQHA 1VMHA 2X5IA 2JDKA 2NZ9A 3P3NA 2BW8A 1K5JA 4JCKA 4UFIA 3UJOA 2WNVA 1X9PA 4D69A 4EN7B 3VHPA 2F17A 4CUBA 4LBQD 5ACA3 3C2UA 3FMGA 4XETA 4CCJA 1OH4A 1AYN1 2ES3A 2V09A 4SBVA 1JYWA 1FX5A 2WJSA 5FXWA 1O59A 4D6SA 2X5IC 1DDLA 1JYXA 3OUJA 4XBNA 4NAOA 1JODA 1F4AA 2WNVC 2OZ6A 1J59A 2K9ZA 4GB31 4RHV2 4FT8A 4QD2A 3VBRA 3ETPA 1R1A2 3WSOA
chains in the Genus database with same CATH topology
4IV1A 3MW4A 1VBC1 1KRIA 1Q56A 1VR3A 1ZZ6A 2BGCA 5C8WA 5HXVA 1AVBA 2XJQA 2YV8A 4AVCA 1ALYA 3FZ3A 1V9U1 3J9SA 4PLNA 1A8DA 2HWE2 3PLQA 3MIFA 2EAAA 4ORFA 1ZZ8A 5FOBB 1LOFC 2QCSB 4IV1C 1TME3 1YFWA 4HSLA 2KXLA 3UKVA 1HKDA 1OKQA 5CFDA 2D3PA 1TE1B 2ZHMA 4KWLA 2WC2A 4OUSA 2VULA 1H0BA 4Y1VA 4JGYC 4LO4B 2VOWA 3OY8B 2ZACA 5IK8A 5T54A 3JD73 4AVSA 4XJZA 2EIGA 2HWD3 1JN2P 2EALA 1LGCA 1MS3A 1WLCA 1WMFA 1Y7BA 1X8MA 3N35A 5BPXA 3LOIA 4E4SA 1GKBA 4LE3A 1NY71 4L2NA 4Q27A 1VP6A 1AR82 3ZXKA 4OI1A 4H55A 1N3OA 1SDWA 5IK7A 4O9GA 4NWVA 4W65A 2VECA 1REDA 3M2MA 4Q4W3 4Q4V2 5F9TA 2AR6A 1WGPA 1FPN2 2WINB 3NV2A 5DZFA 2A6XA 3E5QA 3OBTA 4AHXA 1CAUA 2OPKA 4E2SA 5CA6A 1QU0A 1CIWA 3BODA 3IM0A 5L36A 3NAPC 1ZBA2 3DKWA 2R073 3KMHA 3ZFEB 1O3SA 3D6EA 3VHNA 5FRAA 4AQ2A 5LRSA 1DZRA 1D4M3 1A6CA 1JTZX 2HWF3 3VBSA 1COV2 2RR12 3NJZA 1WLDA 4BQ1A 2E7TA 4XJAA 5KC6A 1QJY3 3AB0A 4AVBA 1GICA 1RMU3 4KWKA 4IERA 4PDWB 4K21A 2A3WA 3RYPA 1FT9A 3NV4A 4Z2WA 4IEZA 2ILMA 2ZKLA 2JE9A 3ENRA 4B7EA 3V0BA 3N4MA 2E63A 2DFBA 1PHMA 2AREA 3N7JA 2VW1A 3WUDA 1RUE1 4Y20B 4XF9A 3C3VA 3B02A 3THTA 1OMIA 4AQ6A 4EN6B 2ZZQA 3B7MA 2CTVA 5GM0A 1HQWA 4FQZA 4Y1XA 3FJSA 1H8TA 1PMIA 4Q4X2 1LB2A 4E2GA 1AR93 3Q9OA 4WVVA 5FQ0B 2R0FA 1SACA 2ZGQA 2H6BA 4OI2A 1GR3A 4XF1A 4P9IA 3RRDA 4P9XA 2PHXA 1AL0G 2D6OX 2KA3A 1ZREA 5BNOC 1QXJA 1Q8QA 4WM8A 1APNA 1RUH3 1UZZA 1QDOA 1DGRN 3PMEA 1J3PA 1DHKB 1RVF2 3AMPA 5BNPC 1VBA3 4XEZA 2XPJA 4Q8LA 3ZN6B 1D0GA 3LZZA 2BUKA 3B94A 1G9FA 3KSCA 4N9IA 4AGVA 1ZZBA 1PGW1 1SBFA 5FPXA 1FMD1 1ND2A 3IWZA 4EN8B 4EROA 1PO13 3IT8A 3LGRA 1UD1A 2VVEA 4FO9A 5C4WB 3FWEA 4OI0A 3AP6A 1NOVA 2UWAA 1VAMA 2RS31 4HVRA 1FNYA 1ND2C 2R063 2HEYF 1YUDA 2CGPA 1CD3G 3AKTA 1JYIA 3S7IA 1MQTC 5A32B 4Y4YA 4OI4A 3TN92 4PLOA 2NMNA 2GU9A 2VQ0A 3W59A 1LOCA 5GZCA 2IFWA 3PVNA 4LUMA 4YVWA 3FLTA 5JAXA 5JPMB 4YNIA 2YHJA 3HBZA 1OSGA 2RHPA 5H9QA 2YYOA 3UK9A 3OYWA 1V6JA 2JE7A 4YLZA 3ZN5A 5CFCA 1DG6A 4QPIC 1ND3A 3B93A 4YG0A 4GMP3 2R49A 4GIQA 1C8M3 1EAH1 2WL1A 1WLTA 5T5LA 1F9KA 3KD4A 4YVSB 3WDTA 1X50A 1YRZA 4HSJA 1VBB1 3AKQA 4ES8A 1XU2A 4PBPA 2YC0A 5EYYA 3AZWA 5CVRA 4A7KA 2GALA 3PVBB 1GQHA 5L7OB 1QJU2 1QMJA 2E53A 4JTOA 1ASJ1 1TMF3 3FLPA 1DYPA 2DCJA 1BYHA 1FOD2 5AC93 1AUYA 3CL1A 3ILRA 2MEV1 4CDWA 3QCWA 2ZA9A 3A4UA 1ZVFA 3H0OA 3DL3A 4IL7A 1DGWA 1NE6A 4M00A 4LHKA 3WD5A 1D4VB 2BBVA 4HBNA 4Q0VA 2ZGKA 2ARXA 1GANA 2O0OA 4PCRA 4OUMA 5FO7B 1LHVA 1POV0 1OQDA 1DFQA 4LO6B 4AXOA 4FPHA 2ET7A 3ME2A 4FXKB 4HVQA 1BK1A 3ZPYA 3WW4A 2PYTA 1VBE2 1H2KA 2WS91 2D43A 4RQPB 4DY5A 4CYDA 5JMCA 1H9WA 1QJX1 1RHI1 1XXNA 1S0GA 3IKWA 1DQ4A 2JG9A 4RHV3 5K8SA 4CDUC 2PHTA 4KBBA 2WNUA 2X5IB 3RI9A 1R1A3 1Q3EA 4P9YA 2I45A 1W6QB 4YM2A 4DZGA 2WNVB 1J1LA 2ZHNA 2F4PA 2WSUA 3B9IA 4Y24A 1Z0HA 3ASIA 5KC5A 4KGGA 4IESA 2BQPA 1ZZ9A 4XBLA 3BCWA 2WT0A 1OI6A 2HWE3 2VH9A 3URFA 3NKTA 4XF4A 3GYDA 4QM8A 1HXS1 1H2NA 1RUF1 3J8F2 4FQ4A 4PIXA 3MIDA 3OD0A 3VBRB 5J98B 1EP0A 1RUOA 4IV1B 1H4GA 5CAZA 5KXCA 4MXWA 2CWMA 3PJYA 4LR4A 3N7KA 1EPWA 3M3IA 4IV3A 1O91A 1PZ7A 1YI7A 2R041 4B3NA 5C33A 1RITA 1RUD2 2AENA 3N36A 3VDDA 1WW7A 4LT5A 4EJRA 4PF5A 2JEMA 1QGLA 5CFDB 2HYKA 1N1VA 3KM5A 1RJ7A 1HIXA 4K20A 1AR83 4KG8A 5DUXA 1OOPA 5DDJ1 4E9KA 3ZIWA 5C9AC 2A75A 3G7DA 2FMDA 3L2HA 4X6RB 5JI7A 1GZWA 3BPZA 5T55A 1FPN3 1BBT1 1Q43A 4IQPA 2X8KA 4I30A 3AYAA 4C91A 4XQ4A 4FOWA 4QQLA 5T5PA 5F1RA 5I8YA 1ZBA3 1SFYA 2PAMA 3SISA 1S0JA 5LK7B 4HMZA 3HMYA 4C0HA 4NHMA 1COV3 2RR13 1QDCA 2VOKA 3KCYA 5TSWA 3O0VA 4ATFA 1H1AA 3S30A 4Q0UA 4N53A 5HCFA 3L9JT 3MW2A 4MH0E 4CP1A 1NCQA 3KB5A 3MLJA 1XNDA 3PHMA 4UW4A 1RUG1 4MXVA 4LBOA 5BUVA 4N53C 2CYFA 3VBSB 4BZ4A 4OVEA 3M8LA 2FZ1A 1I6XA 4Q29A 1ULGA 5CU1A 4I02A 4DOUA 1GBGA 3USUA 3TAYA 1DGLA 4QM9A 1W0PA 4G3YC 4Q4X3 2ZHLA 3SLIA 1S2KA 2B39A 2WSVA 4GH4A 4Q4Y1 4FP2A 4UBHA 3RI8A 4LHNA 5T5OA 3V0BB 4D7YA 1ZZ7A 2R0HA 4KU7A 4R9AA 1NCRA 4EV0A 3O0WA 4K1YA 1IHMA 2E9QA 4U36A 2DU1A 1FV3A 2Q5TA 1BJQA 3MYXA 3APBA 3SH5A 4B29A 1WUVA 2BNMA 1RVF3 2MPFA 5GLUA 1IS6A 3AKSA 3MLLA 3RJRA 4AEKA 2BNNA 4R4XA 1H8TB 2EXIA 1UL9A 3AZXA 4QPGA 3QLQA 1YHFA 5CBLA 1JUIA 3GF6A 2DF7A 4I3GA 2PHRA 2BNOA 4ZKTB 2OA2A 1SLCA 3HN1A 4P9JA 3ZFEC 3JBG2 4ATEA 5FLIA 4COUA 2A5ZA 4BIOA 4WM8B 4YGDA 3BB6A 1S0DA 2P37A 4FVVA 2B45X 1LU2A 4Q26A 2JXAA 4HVOA 4P5HA 2XJRA 3VBUC 5HCBA 4X8PA 1ULFA 1Z7S1 1MZ6A 5AFEA 3OPZA 5JOXA 1ND2B 4DRVA 2Z2SB 3AMNA 5JIAA 4MYEA 3TN93 1AYN2 4L11A 1WW6A 4XHBA 4WVMB 1ZRCA 2ZGTA 4YW3A 5C8CA 3IPVA 4GQ7A 1KJLA 3DV8A 2ETEA 4MV2A 5E16A 3VZKA 1F5JA 4GB32 2B9UA 1UIKA 1VRH1 4OLLA 1LJ7A 2DU0A 1HRV1 4R9DA 1POV1 4LNVA 1G6NA 1W6MA 2ZMKA 1VBC2 2W08A 1KS4A 1OPMA 2A3YA 1PIV1 1AYM3 1ENXA 5K0UC 1FAYA 2I07B 3MF9A 1IZ3A 5E1RA 4YVWB 3LAGA 3DN7A 1QJU3 3VKFC 3HT1A 3M1HA 3OYWB 3MIBA 1WCDJ 4HKLA 3UV9A 5CFCB 2HWB2 4N43A 1FOD3 4BPZA 1ND3B 1SCRA 1QQP2 3H7YA 3VKOA 4HT1T 4Y1ZA 3TB0A 1YO8A 1UCXA 1ZBE1 4AF9A 1YXWA 2OUJA 2Y38A 5C4WC 1V70A 1Z78A 4YZ3A 2HEVF 1AR71 1IGOA 1NXMA 1QXPA 4LEJA 4XXAA 1D2QA 3LSDA 3U11A 1FV2A 1AJOA 1NA1A 2BFUL 1PK6A 3ATGA 2YGLA 1NY72 4AEJA 4N7IA 3ZYJB 4CDWB 2RS11 4R4ZA 1XYNA 5BYNA 5CG9A 3AP9A 1OFSA 2D6PA 3I54A 2ET1A 2A6ZA 4YW1A 1OFNA 4QXKA 2XVGA 4Z07A 3NO8A 2WKKA 3DPRA 2DCTA 1C28A 4RR3A 1MR5A 5I0UA 2R32A 1LU1A 2NN8A 4AGGA 2OUHA 1MEC1 4FPEA 3BALA 1TME1 2YZ4A 4QGMA 1RC6A 3UKTA 5GLZA 4YVSC 2ZGPA 5JI9A 3J8F3 5DG2A 2DVBA 4TLFA 2VOXA 2WNUB 4XFHA 1ZNPA 2BVVA 2VG9A 2GNDA 4XIOA 2P2KA 5L7OC 1KFXL 4Q8KA 4DXZA 5GLWA 2HWD1 3USSA 4D94A 2JDZA 4R52A 4AVVA 2A70A 4WVWA 4F3JA 1X36A 1VBD2 3CJXA 4UW3A 2ATFA 1QH6A 1RUE2 1RUD3 3WW2A 1VAKA 1OA4A 5BV6A 1EYBA 1LOAA 1I9RA 2D3SA 3GBWA 3ALQA 2PAKA 2P17A 4Q4W1 2TUNA 1KD7A 4YM3A 4HKOA 2VXRA 2GC1A 2NPIA 4BIFA 1ZX5A 4MXWB 2XJSA 2BWAA 5I91A 3ZX7A 4YM0A 4S2FA 3KS7A 3GZUC 5C9AB 4IV3B 4C90A 4CEYC 4RQPC 5IK5A 1LTEA 3SXWA 2G9FA 4G4FA 2ZGLA 3DUIA 5H9SA 4FTEA 1W6OA 3VUOA 4AVAA 1VB4A 1OOPB 2BYVE 2A71A 2FMYA 2WFF1 1QJY1 4Q2FA 2JG8A 4XFGA 1PNGA 1X82A 1ZRFA 1RMU1 4KG0A 1V6OA 1YI9A 1PGW2 5KHJA 1W2UA 2JD4A 2IXHA 3I7DA 1UKGA 4Y26A 5JZGA 1NE4A 3CJIA 3PMSA 4YYOA 5DG1A 3D0SA 3VKMA 3KQRA 3VBRC 4CDQA 3JU9A 2RS32 1YCIA 4AEMA 2XVLA 4AI3A 5JZGC 2P3IA 4N53B 2Y26A 4M3CA 3AP5A 5EXOA 1AR91 2BPA2 1N3QA 4FSJA 3ZFFA 1PGL1 3O0XA 4CDQC 2EA7A 3NWKA 1NCQB 2WWSA 4DRRA 5GLTA 1OA3A 3D5OA 5CFDC 4XJUA 1RUH1 3FUQA 3BOWA 4OHWA 4QPYA 2UWBA 3RMYA 1DBNA 1GYKA 2Q1MA 2RS51 5FMOS 3KT4A 5FBZA 2JENA 3WG1A 1VBA1 1YLLA 4BA6A 1SBEA 3B5LB 1YFUA 1EAH2 4E27A 5T52A 3LA3A 4P9WA 3USUB 1AX0A 3VZJA 1LGNA 5CIRA 1AX1A 1VBB2 4HFSA 1QNYA 2XGXA 3ZDSA 1OQEA 5J36A 4A7ZA 4EWEA 4D7TA 4N90A 3JBG3 1MS8A 2HWC2 1AHSA 1ASJ2 2ZABA 1WW4A 2QDRA 4JAAA 1BZWA 2W52A 4M0NA 3QOPA 2WZPP 5FMOL 1HDKA 2EAKA 2YPJA 2JICA 4QPGB 2QE3A 4LBKA 4X8NA 4F83A 4WM7A 3JQXA 2K2SA 3T1MA 1DYKA 1WBFA 4HPKA 2UY9A 3VBUB 1O7FA 3FC0A 1RUI1 3VBSC 1CONA 4DY3A 1QOTA 4ES9A 1FXZA 4QU2A 4XDQA 4H7LA 3QH7A 1Q5OA 4HN0A 2VVDA 4FTSA 1LEDA 2WS92 4WM7C 2AYHA 1A78A 4HKWA 3RYKA 1QJX2 5HI0A 1C8M1 4D7SA 4GB33 2P3JA 2RMU1 2NP0A 4BMEA 3AZYA 2QJVA 2GZWA 1AF9A 1KDMA 3CF6E 4FBFA 5FLHA 3H9AA 2YXSA 4YZ1A 4CP0A 4UW6A 2PHFA 3H3ZA 1PZ8A 5JCTA 3ZXFA 2G9GA 5C8CB 4YW4A 3ILNA 4P9LA 3WINE 4I01A 5A33A 5K0UB 1A8MA 1H8TC 5AC91 1RUF2 4L9BA 4AFMA 1OPOA 2HWB3 2ZX0A 1UZYA 1QQP3 4LLOA 1NQDA 5E8AA 2HJIA 2E6VA 1W6MB 4YZ2A 3SNMA 2VU9A 4WM8C 4DS0A 4CDXA 2PAEA 3WV6A 1IQAA 1C8NA 1UPSA 3ZXJA 2TBVA 3U0ZA 3WW1A 3AM2A 3RJ2X 2R042 3GHMA 1W6PA 2GAUA 2VNGA 2BTVC 3PNAA 5H9RA 3EJKA 1RUJ3 4N43B 2WFPA 3NL1A 1SLIA 3QH6A 3ZVXA 1ULCA 3ZMNA 5DDJ2 1XQNA 1WA4A 2LTNA 1SLBA 3VGIA 1KJRA 1PVC2 1VIWB 3U07A 3WT3A 1I3HA 1QOOA 2FBEA 4OFGA 1DQ5A 1REFA 4CTEA 1PO23 5A3MA 2PA7A 4MGIE 4ZU7A 1NA1B 2WLPA 3WCSA 1PK6B 3FBYA 3NW4A 5K7PA 2ZGNA 4BE3A 3IDEA 5FREA 5ABJA 3EQEA 3M70A 3I8TA 4IEYA 4GWMA 5KHIA 3VHRA 3WP3A 4AVTA 4BH9A 2V73A 3DPRB 5KWRA 4YVWC 2QDNA 4RR3B 4B7KA 3ZSJA 2MNGA 1SQ4A 4HK9A 2LM3A 4PLMA 2CGNA 5KHHA 4XHXA 3ST7A 3AK0A 5CFCC 4P9GA 1RUG2 3RNSA 1ND3C 2EXHA 1VBD3 1F8VA 4R9BA 4AW7A 1RUE3 1N1SA 4NHLA 4XQDA 4AEDA 1AR81 3S6PA 2ZMNA 1KS5A 2F6BA 1BEV1 4RGGA 1GZCA 1X33A 3POYA 4I0AA 4Y22A 5DXDA 2R1BA 2UU8A 1OQ1A 2YMZA 4LBNA 1DGRA 1M4WA 2D44A 4QGNA 3ZFGA 1CESA 3LCPA 4K9SA 4Q4Y2 3VZMA 4AEDC 4LA3A 5D8AA 1CPNA 2ZX2A 5T5JA 3PJQA 2Z79A 4CDWC 1UU4A 3GBGA 4XFBA 5C6CA 3D82A 1S0EA 4FPJA 5E89A 3VLBB 4CEYB 1YNAA 4OHYA 2WZR1 2Y0OA 4W6YA 1PM7A 4AWDA 4XFFA 1LEMA 4AG4A 3M3OA 3B3QE 2GNMA 3WDWA 4Z8BA 2DUPA 3K48A 4AI1A 4XE9A 2P3KA 2XB6C 2B42B 5GZFA 1EV11 1IKQA 3OF1A 3V56A 3WDXA 2VVFA 3VBOA 3VKLA 5JSPA 2XVKA 2JG9C 1NLSA 1ULEA 1XE8A 2WNUC 1W6OB 2RS33 4M3CF 1KDKA 4RS5A 2CAUA 1PZ9A 1JHNA 4DINB 2E7AA 4L8QA 5T3NA 3MI8A 4AFCA 2VGDA 1VAVA 4JDOA 2JG8B 3SCGA 3UL2A 1Z7S2 3D8CA 2XWJB 4YG6A 4AQSA 1HRI1 1MACA 2R16A 4GULA 2EVXA 3RWNA 4PQ9A 5JZGB 3E6CC 2PHUA 2XLGA 3CJIB 1ENRA 1JBCA 1Q8SA 1EPZA 3I59A 3EBRA 4J1WA 3CU7A 3SHRA 4CDQB 3FHIB 4LHLA 1HLCA 2Q8OA 3AX4A 1SBDA 3AP4A 5JOWA 2ENRA 4B4RA 2A6YA 3CNAA 5GZDA 1EAH3 4M3CB 1CJPA 2XBO2 1HRV2 1WCSA 4IV3C 3ZFFB 4Q4V3 3KCXA 3VDDC 3BOPA 4O9EA 2BEOA 1DGWX 5JVVA 4PJYA 2HWC3 1OOPC 1LHNA 1R092 1N1TA 2W0XA 1ASJ3 2GNTA 3D4KA 4BMBA 1K5MA 2DVFA 1CR7A 1LULA 4GWNA 1MZ5A 4LUKA 5GLVA 2I2SA 2DTYA 3ZSLA 3WG2A 1ZBE2 1CVNA 1KQRA 3HAGA 3OD4A 2CNAA 2GC2A 3IN9A 3ZYGA 2TNFA 3V0AA 2GH8A 1AR72 1CAUB 2R6QA 1HV1A 1H8VA 1U0AA 2WA4A 4QX5A 5AVPA 2PLV2 5I8SA 2IXLA 4FPGA 4EWDA 2A6VA 3O12A 2D98A 1H4HA 1YJLA 2WS93 2DUQA 4DNYA 4A2UA 2RS12 1QJX3 5FLJA 1NCQC 1G9DA 1C1FA 3WZ1A 4AGRA 4OZXA 4OULA 4WM7B 3WG4A 1MS0A 2PFWA 2VW0A 4HPKB 1AYM1 4J6GA 4H7MA 3ZXEA 2WT2A 4FPFA 5I93A 4MUVA 3H7JA 2B46X 5D1IA 1YFYA 4XFIA 2XKOA 2DCYA 3QD6A 1QXRA 2ZAHA 4K6BA 3T1LA 1MEC2 1HQNA 3H50A 1TME2 3KT7A 3LB9A 3D0JA 5IT6A 1RUF3 4YGEA 4F8AA 1GNZA 2WA3A 4GH4C 2JECA 4FXGB 1R081 4CP2A 1AJKA 4H3WA 1B35A 2XL9A 1AL21 1KFUL 3OCPA 1VB2A 3ZN4A 1NCRC 4COYA 3LA2A 2DVAA 2XJPA 1U12A 2QKDA 1C57A 1MS5A 4YGBA 5B2GB 5IK4A 2QUOA 2ZJCA 5GZEA 3WDYA 3E5XA 1PNFA 5A33B 2CL2A 4QPGC 2OYZA 3SCFA 2RM22 1RUC2 4XTPA 3B01A 4Q1PA 4BLIA 3OBRA 4XTMA 3ZYRA 2DFCA 4R8HA 3KGZA 5DDJ3 2DURA 4TWTA 2ZAAA 4GXLA 4BWOA 2EXJA 3O14A 5LEKA 1AR62 2D6LX 4CDXB 4LULA 4YZ4A 1O3QA 1PVC3 4PDWA 4OHVA 2EF6A 4CRQA 3S7EA 4FCAA 4TSVA 1NYWA 3B69A 1BCXA 1W6PB 3RDIA 3WXPA 1R1ZA 4ISRA 2WQZC 3H8UA 1Y3TA