4IESA

Cys-persulfenate bound cysteine dioxygenase at ph 6.2 in the presence of cys
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
186
structure length
186
Chain Sequence
ELLKPRTLADLIRILHELFAGDEVNVEEVQAVLEAYESNPAEWALYAKFDQYRYTRNLVDQGNGKFNLMILCWGEGHGSSIHDHTDSHCFLKLLQGNLKETLFDWPDKKSNEMIKKSERTLRENQCAYINDSIGLHRVENVSHTEPAVSLHLYSPPFDTCHAFDQRTGHKNKVTMTFHSKFGIRTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Cysteine dioxygenase type 1
publication title Cysteine Dioxygenase Structures from pH4 to 9: Consistent Cys-Persulfenate Formation at Intermediate pH and a Cys-Bound Enzyme at Higher pH.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 55
structure length 186
sequence length 186
ec nomenclature ec 1.13.11.20: Cysteine dioxygenase.
pdb deposition date 2012-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05995 CDO_I Cysteine dioxygenase type I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4iesA00
3H1MA 3MPBA 2Z69A 4UXAA 1YUDA 4XF4A 3FWEA 2P17A 1TQ5A 5K8SA 5CADA 5FLHA 3EQEA 4XFHA 4XFBA 4A2UA 1X8EA 3IDBB 1FI2A 5FLIA 2GZWA 4XFIA 5I8SA 2OPKA 3B02A 1ZRDA 4EROA 3ROUA 4PIZA 4Q0PA 4OFGA 4LEJA 3ZDSA 4ONUA 4JTOA 4LTAA 4BYYA 4X6RB 4KWJA 4Z07A 4L2NA 4BIFA 1EY2A 1J3PA 2K0GA 2PYTA 4EV0A 4FAHA 5FCCA 3RYKA 3I59B 1UW8A 2GAUA 1CAVB 2D93A 3N4MA 2Q1ZB 3SCHA 3D0SA 4QGLA 3NL1A 4MGIE 1NYWA 3D0JA 1J3RA 1OI6A 4E2SA 1PMIA 4LA2A 5KHKA 3PNAA 2PTMA 1WGPA 3LA7A 3BALA 4HVQA 1QXRA 3H3UA 2H6BA 4FAGA 4YNIA 5CU1A 4META 3DN7A 3WW1A 1G6NA 4HN1A 2Z2SB 3NSTA 4ZU4A 3M70A 1XRUA 3NJZA 3CL1A 3H1YA 4WVZA 2VPVA 3CO2A 3FE5A 3H8UA 3DL3A 3NW4A 3RPQA 4D7SA 1EYBA 2PHLA 4TLFA 3H3ZA 1O7FA 3UKVA 1YWKA 3QOPA 2Q30A 4F8AA 5I93A 1X8MA 2XHKA 4B29A 3HIFA 5FLJA 4K8FA 1PM7A 5HI0A 5AVPA 1YLLA 4XETA 1NXMA 3U0ZA 2KXLA 4KL1A 4XFCA 3H7YA 4N9HA 5JSOA 1LB2A 5JSPA 3EO6A 3FHIB 2GC0A 5I0SA 4PIYA 3VHRA 1O5LA 1CAXB 4UBHA 4ORFA 3E5QA 1ZNPA 5I8YA 4MGZE 1Y9QA 4IETA 4LUMA 1CGPA 5KHHA 2CAVA 5FPZA 5EFUA 1CAUB 2CV6A 4L11A 1CAWA 1RTVA 5JR7B 1O3TA 4HLTA 4JTNA 5D1IA 3WW2A 1O4TA 3KSCA 1UD1A 2IXIA 2F4PA 4QGMA 3BPZA 2E9QA 1QWRA 4O9GA 1ZZ9A 3JZVA 3TNPB 2O8QA 2ETEA 2PFWA 3OTFA 4YSFA 2WC2A 2I45A 2MHFA 4KWKA 1SQ4A 5I91A 1SFNA 3IWZA 2IXKA 4OLLA 4AQ2A 5I8TA 1VR3A 4MH0E 1J3QA 2UYAA 3UKNA 1VJ2A 1JUHA 1DZTA 1VP6A 1H1MA 3NVCA 3S0MA 4MGKE 2FMYA 4HMZA 2IXHA 4WZCA 1UIJA 4GULA 5BV6A 2QNKA 4PJYA 2FQPA 2XLFA 1Q5OA 3OGJA 4YARA 4IEZA 4XF0A 2VQAA 2CGPA 2ATFA 3E6DA 4HBNA 4LLOA 4XFFA 1UIKA 2EVXA 2IXLA 3CEWA 5LRRA 2ET1A 1YFYA 1CAUA 3LA2A 4Z82A 4IEWA 3CF6E 3USSA 4I0AA 1ZZ6A 4LULA 3OCPA 3RYRA 5E16A 1O3QA 2OZ6A 3KGLA 2PHDA 4KU7A 1I5ZA 3FJSA 2GH2A 4N9IA 4QXKA 3RZZA 3MZHA 2PA7A 2XLAA 5LEJA 3RYPA 5FQ0A 3KCCA 1IPKA 1QXJA 1ZVFA 5I0UA 3WW4A 5KBFA 1YFWA 4DINB 2EA7A 4AQ6A 2UYBA 2BEOA 1J58A 4HN0A 3PLQA 1LRHA 2IXCA 2BNNA 3UKTA 1YFXA 1OD5A 2XKPA 2MNGA 1RGSA 3HT1A 3FFQA 1L3JA 3MYXA 3R6SA 1EPZA 4IESA 3H1WA 4IERA 4MGYE 5JSRA 5KHGA 4AVAA 3QACA 2PAMA 1SEFA 3OF1A 4HVRA 2HKXA 4I3PA 4CYDA 5EZWA 4YYOA 4MUVA 3BCWA 3BB6A 2OA2A 4IEXA 2PAKA 4QM8A 1NE6A 1NZCA 4I02A 4AVCA 1LR5A 2ZKLA 4Q0SA 2B8MA 3L2HA 3I59A 1H1IA 1CAVA 2HJIA 3HQXA 1O3SA 4IEQA 3DKWA 4I09A 5LEKA 4D7TA 3C3VA 5JAXA 1X7NA 4BH9A 1Q43A 1YHFA 2MPFA 2BGCA 3ES4A 4KWLA 1ZREA 4XEZA 4MZUA 3RNSA 2K9ZA 2D5FA 4HZFA 4AVBA 4KU8A 2GU9A 5CVRA 3KMHA 5T3NA 3MDPA 4J1XA 2O1QA 2WFPA 4X6QB 4F7ZA 2OYZA 3NKTA 3RDIA 2QCSB 1DZRA 3SXWA 2XGXA 4R52A 2XLGA 4WBBA 2Y0OA 1HW5A 1RUOA 1RUNA 2Q4SA 5KHIA 3G7DA 3EHKA 5J7MA 2D5HA 1ZRCA 2DCTA 3IBMA 3WW3A 4ZU7A 2C0ZA 4IEUA 2V09A 5E1RA 4XFAA 3IIAA 1U12A 1X82A 4EWEA 2IC1A 3ES1A 4HSLA 1CAXA 2PQQA 3EJKA 4BHPA 5BPXA 3SMHA 1XE8A 1O3RA 4IEPA 4IEOA 3E5XA 4XF3A 3E6CC 2GC3A 3H7JA 3I54A 4LUKA 5C6CA 3DV8A 4P9GA 4Q0UA 4JV4A 3OD0A 1QY4A 1UCXA 1FT9A 3LWCA 4MX3A 3ST7A 4PIXA 3ACLA 5LRSA 2UY8A 5I0RA 4XF1A 1WLTA 2BYVE 3FX3A 3SCGA 2UY9A 4IEYA 5FPXA 5BUVA 1EP0A 3IDCB 2H0VA 1GQGA 3LOIA 5J48A 4NVPA 3PVBB 1ZZBA 2B9UA 4RD7A 2QJVA 3H9AA 5FDBA 3ELNA 5KHJA 4XFGA 1CAWB 1ZZCA 1Q3EA 3LAGA 4YRDA 2XKOA 4AXOA 4XF9A 3FZ3A 4QM9A 1ZZ8A 2BNMA 4MV2A 2BNOA 4E2QA 2CAUA 4EWDA 1YFUA 2EAAA 5F1RA 2ET7A 5C8WA 3EBRA 4I01A 3S7IA 3U11A 5J3UA 4IEVA 3E6BA 1NE4A 2D40A 1Y3TA 1RC6A 2VECA 2PAEA 3CJXA 1ZZ7A 1DGRA 2IXJA 3H50A 4QGNA 3SCFA 3S7EA 4FT8A 3E5UA 4UBGA 4R8HA 2Q0AA 5BY5A 4HSJA 2GC1A 5BXXA 1ZRFA 2B5HA 3M3IA 1OFNA 3E97A 1CX4A 1LKNA 3SHRA 3TNQA 1O5UA 4HVOA 3LZZA 5I0TA 3GBFA 4JVAA 1J1LA 4FBFA 1IPJA 1RL3A 3GYDA 4LA3A 3BU7A 4I2OA 4EWAA 4QX5A 1GQHA 4Q0QA 1FXZA 3D82A 2N7GA 2ZCWA 1UPIA 3U10A 1OMIA 2QDRA 3LA3A 4Q29A 3O14A 4H7LA 3ETQA 4E2GA 3I7DA 1ZRRA 4ZU5A 4J1WA 1DGWA 1ZX5A 5JCTA 4QMAA 4O9EA 1XE7A 2XL7A 1V70A 4Q0VA 2XL9A 3KGZA 5FQ0B 2GC2A 3HT2A 1WA4A 1I6XA 2H6CA 2OZJA 4I0BA 3CLPA 2QVSB 1J59A
chains in the Genus database with same CATH superfamily
3USUB 1RUC1 3CJIB 3HNYM 4LHNA 1ZBA1 2Z69A 3WR0A 3WHTA 2DFBA 4DQAA 3H0OA 3O1PA 2V5YA 2XR4A 1YQ2A 2YV8A 2GMEA 3VBFC 4DY3A 1TQ5A 5BNOB 1V9U1 4L92A 4NRPA 3V56A 5CADA 3EQEA 4XJWA 5KXEA 2IZWA 4C0HA 1Y43B 1X8EA 3B93A 4JDNA 5FLIA 1GP6A 5I8SA 1KS5A 1FV3A 2OPKA 1JOJA 4N8MA 4AVTA 4EN0A 4EROA 5FP8A 1XNBA 2KR2A 5A3OA 1QQP3 1DF0A 3KD4A 4PIZA 1OHFA 4Q0PA 4QPGB 1VMJA 4OFGA 2A5ZA 1JXNA 2VTXA 4JTOA 5B4XA 4CUBA 1WZXA 1HB1A 1EAH2 3AMMA 4KWJA 2Q8EA 1QDCA 1B35B 4YG0A 4BIFA 4XHBA 2V73A 4CP2A 2BVVA 1LENA 4AAXA 2VZTA 4EV0A 5JI9A 4P9YA 4Q5OA 1UNBA 1UMHA 1ASJ1 1QQP2 2DURA 1UW8A 1CAVB 3N4MA 3PJYA 3TN91 3SCHA 5FP3A 5L36A 4QGLA 2VM9A 3OYWA 1OPMA 2YHJA 5F5IA 4CCLA 1NYWA 5FZ0A 3WP6A 3WXPA 2ZEYA 4B7KA 3WF2A 4CCOA 2WUHA 4LO7A 1SBDA 1PMIA 2R071 1JU3A 5CZKA 3INAA 2W39A 2WNEA 2JJ6A 4XMIA 1VB2A 3BALA 4Y1XA 1GANA 2OW4A 2W5FA 4QU1A 3SEEA 5CBLA 2HWB1 1QXRA 3H3UA 2H6BA 1GP5A 4RSUA 5LCWL 1HQLA 4META 4P00B 2RMU1 4FP2A 3WW1A 4CA9A 5FK8A 1GBGA 2WINB 4GAZA 3M70A 4H7MA 4ZU4A 4AFDA 3CL1A 4E4ZA 4WM8A 1POV1 2NP0A 1UMZA 4UFJA 3WNNA 3H8UA 3PUHA 1BLZA 5C3PA 2E7AA 2Z4FA 1JUIA 2WA4A 2YC0A 1FNZA 3MLLA 4OHZA 1LHWA 3B69A 1QJY3 1BKZA 2PHLA 5A33A 2R32A 4BWOA 4XAEA 2VW1A 1VPHA 5FPUA 1YWKA 1C8M3 2JB4A 4IE0A 4QDSA 4F8AA 2A3WA 2GP5A 4WM7A 3RZLA 2EICA 3PL0A 1ND2B 1ULCA 4BMEA 1NOVA 1KJRA 5FLJA 1QJY2 5CB7A 4AHYA 1QJZA 4LBQB 5AVPA 1YLLA 4AG4A 4GWIA 3RZGA 1W6QA 4XPVA 1C28A 4YM2A 4IV1A 2KXLA 2CY6A 4G4FA 2FCVA 1UQXA 1C8M2 1UX7A 4KL1A 4OUSA 4XBLA 4XFCA 4XTPA 4C1XA 4MSVA 1N1YA 4QQPA 2JIJA 1LOEA 1RUD1 3WF3A 2NM1A 2SLIA 4KG8A 3J7NA 1G9FA 2QQNA 3AP9A 4E4HA 4BQ4A 4U2AA 4A4AA 2RDRA 3B5LB 3FHIB 1VBB3 4YFZA 5T52A 3NO8A 1ULPA 4AW7A 5F3CA 3ME2A 2TEPA 3POSA 2ZGPA 4N43C 2C6SA 1ALYA 1WCQA 3N3HA 5I8YA 4JKMA 4LPLA 1YIPA 2JIGA 4IETA 5KHHA 1EAH1 2ZGRA 2CAVA 2B42B 4XAAA 1RJ8A 5H9QA 3ZPYA 5EFUA 2GMMA 1RHI3 5SV5A 5A7OA 3OY8A 1YQ5A 4L11A 3AKPA 3OGRA 1Q8QA 5CNAA 5FYHA 1Q56A 1RTVA 5LATA 3RWNA 3ZKYA 2JDMA 1PVC2 5E8AA 4TYSA 4JTNA 1GP4A 4ZS3A 3O1OA 1O4TA 5FZLA 4Q26A 2BGOA 5CFCC 4R9CA 4LO6B 4M3CB 5GLTA 5K0UC 4Q4Y3 1RHI2 2TBVA 2W9XA 3ZFGC 4QGMA 3VV1A 2EIDA 1KS4A 1IKPA 4O9GA 2VOXA 4D6SA 2ZS6B 4KG0A 1O91A 2I45A 2MHFA 1GQPA 4Q4Y2 2VH9A 1RB8G 5ERLA 4GQ7A 4RQPA 4PQ9A 3VN4A 5F3EA 4CUAA 5FYYA 4ITCA 1OUSA 3VD3A 4Z1VA 3K2OA 3I2FA 3JD73 2VMFA 1NCQC 3MUY1 1PGW1 4YGEA 2WWSA 1CVNA 2UYAA 4D7YA 3UKNA 2WO2A 5LWBA 1JUHA 1DZTA 2FHRA 3VKMA 3O7OA 2QQLA 4PDWC 4QX2A 3VDDA 3KS7A 3WF4A 1CIWA 4XZPA 2VMDA 1H8VA 1MS1A 5A1LA 4Q4W3 4GULA 4OMDA 1OOPC 2G1MA 4RHV3 3MGUA 3RMXA 3ZLIA 1KFUL 5FZ4A 4YARA 2VZVA 1XPWA 2QQWA 1SPPA 2VQAA 4XF0A 5FY4A 4BM8A 1S2EA 1UPSA 2ATFA 2RR13 3E6DA 1RUF3 1AL0G 2JDNA 5JZGB 3WDTA 4M3CF 1J83A 2G9ZA 3MW2A 5JMCA 1OA3A 2EVXA 1KFXL 2XJSA 4RHV2 5LBEA 3CNAA 2WKKA 1TG7A 4N90A 4M3CE 5LRRA 2D98A 4QT6A 4CDUA 2ZABA 1LHNA 1ND3A 2BZDA 5F7UA 3M3OA 4Z82A 1PMHX 4NPLA 5EHDA 2WRAA 5FZKA 5KWRA 3WCSA 4AI3A 1RUF2 3BPSA 3M7AA 3WINE 3I3BA 1ZZ6A 1UF2C 2JG8C 1K42A 5LA9A 3OCPA 3RYRA 4NE9A 2OZ6A 5IJRA 1BHGA 2PHDA 4NAOA 1YEWA 3LIHA 1LOFA 4Q1PA 4AE2A 2BJSA 1EV13 2GH2A 2VNVA 4N9IA 1ZYBA 3NAPC 1PVC1 2VVDA 2PA7A 2WYSA 2QQMA 5IK8A 4B3NA 3NNGA 1CPNA 5HCBA 1XYOA 3C7HA 3CMGA 4YPJA 1JYIA 1VBE1 3A7QA 1E5RA 1S0DA 1RHI1 4Y20B 5FY9A 1CJPA 1EV12 4XJUA 1PK6C 1SG3A 1XJAA 3LSDA 4AAPA 4AQ6A 2NZ9A 2BEOA 4YWAA 3BU0A 1W9WA 3MFCA 2JECA 5KHJA 1J58A 4HN0A 2XWBB 5ANNA 3PLQA 3JU9A 1LRHA 2RDNA 2YPJA 4ASMB 5CISA 2VXRA 2WIIB 1DQ1A 1XOYA 2V5DA 4Q4Y1 4UWDA 3UKTA 3RVHA 3AP5A 1PNFA 3GM8A 4GMP0 1RGSA 2HEWF 2HWD1 2SBAA 2B9VA 2BOJA 3MYXA 4XJ8A 2WNVA 3R6SA 4TTGA 1FPN3 4IESA 3ZFFB 1VRBA 3ZFEB 1AL23 4CP9B 1OD3A 5HBAA 5KHGA 5FYCA 1SEFA 4QXHA 1COV3 5A6QA 5C8CA 1OF3A 1YQ8A 4I3PA 3POWA 5EZWA 4LE3A 5A3WA 2ARCA 1R091 3DGTA 5F2WA 1FPN2 4IEXA 1OVSA 2E32A 4DXRA 3HQRA 2VTXJ 3T0BA 3ILRA 1COV2 1NLRA 4YZ5A 5JXIA 1LR5A 2ZKLA 5IAXA 4WV8A 1C5HA 2R062 3OPWA 4YGCA 4NIDA 2BP6A 5JOYA 1PZ8A 1D4VB 2WNUA 2BBAA 2WZR3 1OBNA 4RHV1 5CG9A 2GNTA 2OS2A 4JGYC 4NHXA 5JAXA 4B8EA 4UFIA 3HAGA 2DCZA 4N53C 1H8TA 2MPFA 1CIYA 4EE2A 4BB3A 1LU2A 4KH9A 4IL7A 4AEDC 2XWJB 4FP3A 4QKNA 4KWLA 1ZREA 4XEZA 4DS0A 2XBO3 2RM22 3RNSA 1K3IA 2K9ZA 3VL9A 2D5FA 2VZ3A 2OQ7A 1WMXA 5FOBB 5F5QA 2WR9A 5GZGA 2NMOA 1IG0A 3IZOA 1X9TA 1Y7BA 5LK5A 2ZX3A 4RA0A 3HNMA 1D7PM 1TME3 4DUVA 1AVBA 4RGKA 1D0GA 3IAQA 4OZOA 2O1QA 3GF6A 4JGZC 4LBQD 4CDWC 3OYWB 3TBDA 5DN2A 4BDVB 1POV0 1RJ7A 3RMYA 3NNFA 4DOUA 2QCSB 4FFHA 3I2HA 3SXWA 3RWKX 5KC6A 2XLGA 1R082 4WBBA 1YXWA 2Y0OA 1REFA 2BFUL 1TME2 4IGPA 1UYYA 4M4PA 2JDKA 3NV1A 4YW4A 3SNMA 1N1SA 4NAMA 5C9AC 3DYMA 4XJZA 5J7MA 5JXJA 3W58A 3WNOA 2WJSA 5LA2A 2E51A 2C0ZA 3UNPA 5L7OC 4P5YA 1UYXA 4WM8B 3GZUC 1ZRIA 3AZYA 3H42B 3IIAA 2O0OA 4GWNA 1IPSA 4URAA 3O0WA 1VE0A 3OGGA 3MIEA 5FYIA 2WABA 1C1FA 4EZHA 5A33B 1CD3G 1A8DA 3ZXFA 1H9WA 1CAXA 3ZXJA 4Y5Z0 3MIDA 2EIEA 5GZEA 2RJLA 2VO5A 4H3WA 3E5XA 1DZQA 1NY72 4GJYA 4DB5A 3S6PA 2DV9A 1US3A 2ZEZA 1QIQA 1LHOA 1COV1 3H7JA 3DV8A 2HBTA 1LESA 2R061 2YDEA 3MFAA 1W6QB 4W65A 1SACA 2ZMNA 3DXUA 1QY4A 4IV1B 4ATFA 4DIQA 2WDBA 1PO23 1RYYA 1W2UA 2GH8A 4UYBA 1JN2P 4BXFA 1FYUA 2OUJA 4OMCA 5LRSA 2FMDA 5JPMB 1H6XA 2J1EA 2BYVE 3FX3A 4OHWA 1XU2A 1W6PA 4LQRA 5EWSA 2FBEA 4CVUA 2W95A 3VKNA 1OLRA 5FP4A 1IS3A 1RUH3 2DU0A 1AYN3 4KQ7A 4N43A 4B4QA 2XVGA 2RM21 1YNAA 2BRTA 3RZJA 2KA3A 3N9LA 1W2OA 4RD7A 2HWC2 3HQUA 2E31A 3OSDA 2RVAA 4KGGA 1RUH2 2YGMA 4XFGA 5DDJ3 3WHUA 2G9GA 1MACA 1AYN2 1ZZCA 2WWUA 1F9KA 5AC91 2HEVF 1K5MA 1Q3EA 4AFBA 5C4WB 4AXOA 1XNCA 3IM0A 4A7YA 1K5JA 3FZ3A 1O4YA 3PMEA 4I0WB 1JOBA 1WKYA 2HWF3 2RG4A 5K0UA 1HV1A 2ZX4A 1DCSA 1NKGA 1R081 2BNOA 4E2QA 2CAUA 4YVSC 4SLIA 4IV3A 1TME1 3POGA 3IPVB 2HWE3 4D0QA 1A34A 3HN1A 4ATEA 3ZYPA 1TNRA 5I0DA 3RZKA 4BLJA 3WNKA 2W91A 4IEVA 2W08A 3E6BA 5FP9A 2CGOA 3ILNA 2YG0A 2HWF2 1ZZ7A 3CJXA 4RQPB 2CL2A 2IXJA 1H2KA 5T50A 3H50A 2OXBA 1WLWA 4QGNA 3SCFA 2VOTA 2HWE2 3FC0A 3S7EA 1MPXA 4FT8A 1JTZX 5DAWA 3KV5A 3WP5A 1UX6A 2GNDA 5LB6A 1J1TA 4FVVA 3WDUA 5BY5A 4LKFA 1TMF3 4AYUA 1NY71 1YQCA 4PDWA 1PNGA 2YC4A 2WL1A 3B94A 2GC1A 1XNDA 1F31A 3MW4A 4RGAA 5BXXA 3VDDB 2Q1FA 2Q8OA 5H9PA 1W3XA 2DUPA 3E97A 3NJXA 4HT1T 3SHRA 3TNQA 3KQRA 4HVOA 4OHXA 1SPPB 1TMF2 4ES8A 5CFDA 2A6VA 1J1LA 3LKJA 3PUAA 4FBFA 5EYYA 3VKLA 1W2TA 1G9CA 3HR9A 3BU7A 5ABJA 2XJUA 4CDUB 2P3JA 4KNCA 2A3YA 1ND3B 5IHRA 1VBA3 5EJ3A 2JDUA 2ZHNA 1DFQA 2PQSA 4B1LA 4HKWA 2ZCWA 1RMU3 3K48A 1AXZA 3U10A 1OMIA 1RUJ1 1R1A3 1NCRA 3MF6A 4Q8KA 3J8F3 3HBZA 2VXJA 2JICA 3BKZA 4E2GA 3JUUA 3I7DA 2HWC1 5CAZA 1VBA2 3PIGA 4IE6A 2QBXA 3ABZA 3AJYA 4W4ZA 2Q8DA 4LBNA 1V6NA 4O9EA 1RMU2 5A7WB 2OUHA 3AFKA 4QX8A 1R1A2 4G3YC 3KGZA 3J8F2 1UL9A 5FMDA 1WA4A 4AFMA 4RN5A 2OZJA 2H6CA 2WFF2 4XZUG 3CLPA 2ZHKA 2DVFA 3BN6A 4OYUA 3UYJA 4GH4A 4D3WA 2AGSA 4RR3A 4D6RA 4XF4A 4DZGA 3WSOA 1W6OA 2BPA2 3N7MA 3RQ0A 3UGFA 2VCMA 4XILA 1UU6A 4XFHA 4A7ZA 2HWE1 2R49A 3JQWA 4PLNA 4YW6A 4A2UA 3IDBB 2WNVB 3NRUA 1CN1A 2X05A 3B01A 5FZHA 3WLUA 1HB3A 4YFWA 5IW0A 1RXGA 1US2A 4XUNA 3B02A 1PO11 2IWGB 5C8CB 5KHIA 1SLAA 1MS3A 4YW1A 5FAXA 5FMOS 2CDOA 2JKBA 4LEJA 5JPNB 3B00A 4ZZ8A 4BYYA 4L2NA 2ZBJA 1EY2A 1LOCA 1O8PA 1MR5A 2VBDA 3CBNA 4L99A 4LBJA 3AZZA 4WVMA 5FCCA 5T54A 2K2SA 1M4WA 1TMF1 5GLZA 2D7FA 3LIGA 5IVYA 1BK1A 2Q1ZB 2OIIA 3I2IA 3PTRB 5FXZA 5A80A 2WNUB 3NL1A 2A75A 2YU2A 4FQZA 4L8QA 2VNOA 4FCAA 4MGIE 5FZIA 3D0JA 1FOD1 3V0AA 4R9DA 4E2SA 4GMP3 4RYDA 3IMNA 1CESA 2VMGA 4Q2FA 4LA2A 5L9VA 1PGL1 1GZCA 1HN0A 2VW2A 2ZGTA 1RUC3 2CU5A 1H8TB 4SBVA 1ZBA3 4CZSA 4HVQA 3PMSA 2DTWA 1NLSA 5IVEA 2VL4A 4RS5B 5CU1A 4K9SA 1V9U3 4LNVA 3NSTA 5IAVA 2B7YA 1XRUA 1RUG2 3ZXLA 3H1YA 2JDYA 4UT5A 1VBA1 5FK7A 2VPVA 1GOFA 3NW4A 2AACA 3DL3A 3V0BB 1W90A 1IHMA 1Q8PA 1Y9GA 2E7TA 3RPQA 2MEV1 5J09A 3VZLA 3A21A 3K4DA 3JB8A 2QQPA 3VB9A 1V9U2 3J8F1 1UZYA 2VY0A 4D8MA 2W3JA 2WFF1 3WCRA 1O7FA 2WZ8A 3AKSA 4EN8B 1F8VA 1W0PA 1DBNA 2LM3A 1NXD1 1AJKA 4UF0A 3ZSJA 2VUAA 3LEGA 5I93A 2AUYA 1LHVA 2XHKA 1H4GA 5T55A 1RUE3 1LOAA 1PM7A 4K8FA 3WD5A 5GZCA 4BMBA 5HI0A 4XETA 2XJQA 1U5ZA 1ASJ3 2KM2A 1SLBA 1WMFA 3IKWA 1N3OA 1UMIA 2VUJA 3U0ZA 3DPRA 2PXJA 3VLBB 4K20A 4IGQA 4QX0A 4AWDA 5JSOA 2YZ4A 3SC7X 2DVDA 4KBBA 4ASLA 2Y6FA 1W2AX 1RUE2 5ACA3 5JSPA 2JD4A 5HV4A 3U4XA 3Q8EA 3A22A 3NV2A 3P6BA 5I0SA 1GNZA 1QJFA 1ASJ2 1SZBA 4JDOA 1HQWA 3K51A 1VRH1 2BBVA 2HWB3 1CAXB 5FWEA 3S5AA 1ZNPA 4LIVA 1FX5A 1GWMA 4MGZE 2RMU3 2PHRA 2XVKA 5A3MA 5ACA2 3RZMA 1NAEA 2AC1A 4FPYA 1POV3 3THPA 1PVXA 1XSRA 2ZGSA 2ZX0A 4MOAA 1MZ5A 1CAWA 2LALA 4FTSA 3WX5A 2HWB2 2UWBA 1JZ7A 4HLTA 2H0BA 3FHAA 1DYPA 3WDYA 3ZYIB 3WW2A 3M4FA 2KD7A 4MADA 2A3XA 1DQ0A 2RMU2 3AZXA 3KSCA 2O14A 1KGYA 5FZMA 4BISA 5LBBA 4Z2AA 1W0NA 2IXIA 4DNYA 1LNSA 2WQ8A 3ZDVA 1UZVA 4RFT0 1JI6A 2F4PA 1W6PB 5FKBA 2ZMKA 5IFPA 2QQUA 2VQUA 2O8QA 5AFEA 2PFWA 1S1AA 5DG1A 3CU7A 3WNPA 5FOJB 3JQXA 4LITA 1WLCA 2WC2A 5A7PA 3VBHC 2Y38A 1RUG1 2RJ2A 4OI2A 1JYNA 3TEZA 3LQCA 2VC9A 1JYVA 1RUD3 1XQNA 3ACHA 2JE8A 4LKSA 4Y3OA 5EJZB 4UW4A 5I8TA 3R05A 3AXEA 2PELA 2XQXA 3OB8A 5A7NA 1K5MB 4ARXA 3DKQA 2ENRA 3FUOA 4QPIA 1R1ZA 4YVWA 1F4HA 3ACGA 3NVCA 4IW3A 1SBFA 1H9PA 1PZ9A 2YROA 3OBTA 1RUD2 2XJTA 4MGKE 1QJEA 4HMZA 2IXHA 1NQJA 1DLCA 1EAH3 4JHTA 5FYVA 4BK4A 5BNNC 2DYCA 2EIBA 3VUOA 4IV3B 2ZHMA 1XC6A 1A78A 2Y0IA 5F2SA 4PJYA 4L97A 2XLFA 1Q5OA 3AL6A 3OGJA 3ZYGA 5IYYA 4PI2A 2YMZA 1VMHA 4LLOA 2CGNA 5DUWA 1AX0A 1HJFA 4CDQA 1XBFA 3CIHA 1NUKA 4NN0A 1BVP1 1UYPA 1RUE1 2IXLA 2YYOA 1JODA 2ET1A 4LIUA 4YGBA 3N9PA 1YFYA 4O7XA 1CAUA 1HB4A 1HJGA 1FAYA 4FXGB 1RUI2 3ZSMA 4GWJA 2ZKNA 1DHKB 2A6YA 5K9YA 3VBOC 3USSA 3TEWA 5ACA1 1WBLA 4LULA 4S2HA 4KU7A 3U07A 1I5ZA 1F5JA 2JXAA 3VBSB 3GGLA 4XACA 3RZZA 3THDA 2J1VA 3Q8AA 4QDQA 1T6BX 1RXFA 2XLAA 5LEJA 1W03A 2VCAA 1F5FA 1GKBA 1IPKA 1QXJA 3AJZA 4DXSA 1GR3A 5FXXA 5ABJB 3N7JA 5KBFA 1OQEA 1VB4A 4DINB 3ZO0B 1OA4A 3VZMA 4CDXC 1MS8A 2DCJA 4ZPIA 5D8AA 4AHZA 5A6XA 1YQ6A 3WDVA 1PGW2 3L9JT 1RVF1 2ZGOA 2P1BA 2IXCA 4FPCA 3HMYA 1MQTC 3BVCA 1PGSA 3IB3A 5FMOL 4AL9A 1NCRB 3VZJA 5C3RA 4J6GA 1VLNA 1GWLA 1K12A 3HT1A 1FATA 4K1YA 3LDRA 3K3NA 1EPZA 2J1RA 1DGWX 4MGYE 1TNFA 4CEWA 2JEMA 4NO4A 5JSRA 2YU1A 3QACA 4LBMA 4M0HA 3TAYA 4XYXA 1XE0A 2JX9A 2XONA 3THTA 4CEYA 1JZ8A 4D6QA 3K75B 4C8DA 4P9JA 3GZAA 1YCIA 1G8WA 1W05A 2GP3A 1YIFA 3TEXA 3SH5A 3BCWA 3C8XA 1C4RA 2W47A 3BB6A 4LO4B 4CUGA 2UURA 4GH4B 2VVEA 3WV6A 1NZCA 2BFUS 4NIGA 4MG2A 3GBGA 2RJKA 4RR3B 5CIRA 4AR2A 1GSLA 3POBA 1G9AA 4Q0SA 5L73A 4V1PA 2W1SA 3L2HA 1DGRN 1PVC3 3M1HA 3S30A 4TSVA 2J1UA 1O8SA 1W6OB 2HJIA 3MPPG 2OKXA 4KI5M 1O3SA 1V6KA 1LECA 3KZ4C 1QKQA 3DKWA 1VBE3 3M3QA 2JG9A 5IK4A 2R0HA 4P9XA 4L9BA 2VMHA 1ODMA 2Z79A 4XBNA 5LEKA 3LB9A 1RUI1 1SDDB 3P3NA 1V6MA 3A23A 3ZN5A 1YHFA 3WOGA 2LS6A 4BQ2A 3O0VA 1VBE2 2D3RA 2V72A 1PIV2 3N35A 4LLFA 4AFAA 4MZUA 2HWD3 4HZFA 2QDNA 4OUEA 5FZDA 1QMJA 4AVBA 1E5IA 4CCEA 4WVMB 2WT1A 5DZEA 2FZ2A 3PJQA 3GALA 4PBOA 2WN2A 3CJIC 4KU8A 4YG6A 3WF1A 1LAJA 1MEC2 5T3NA 5BNOC 4XDQA 1V6OA 4E27A 1UOGA 4C1WA 1AR72 3MF9A 3J7MA 2QZ3A 2OYZA 2ZX2A 3NKTA 4XUOA 2HWD2 4YLZA 1KDMA 3GCWA 1R093 2I2SA 3RDIA 5C3OA 1DZRA 3V0AB 5FZ7A 3AX4A 3LGRA 1HW5A 3ASIA 3GZTB 3OPZA 4C91A 4AI0A 1Q8VA 3BI3A 3LDKA 2EALA 3G7DA 1UY1A 3ZPOA 1S0GA 5IK5A 1ZRCA 3KF3A 3OG2A 2DCTA 4OVEA 1R092 3GZEA 3KV6A 3VZOA 3WW3A 4QQHA 4ZU7A 4QPGC 5E1RA 5FUNA 2ZEXA 5A32B 2RHPA 4TLGA 3LPFA 5BNPA 1X82A 2ZA9A 1B35C 5FZ3A 2G4IA 4U36A 4EWEA 4CP0A 2WYFA 1BCXA 2VMCA 4LXLA 3WQ1A 3WG3A 1UY4A 1URXA 5BNQA 4COVA 1O3RA 2BW8A 4IEOA 3OBRA 3V65A 3FN9A 2O8OA 4UF0B 1FNYA 4ET7A 2Y60A 1HRV1 4UW5A 1AHSA 1RITA 2GC3A 4P02B 1NA1A 5F6KA 2QE3A 3R4DB 5EJ1B 3UJQA 4Q0UA 2VE1A 1EPWA 3AB0A 1XSQA 5FXVA 3ETPA 3VBRB 5JR2A 4F83A 3DPRB 4X8NA 3CQOA 3ST7A 2LUWA 4PIXA 4DXTA 2BOIA 5FJHA 3F2ZA 5A3NA 1H2NA 1WLTA 4QAWA 1H0BA 3E1F1 5FYUA 2R16A 3SCGA 4BQXA 2XHNA 4W6WA 3BODA 4FFGA 1KQRA 4Y33A 5BUVA 1SLTA 5GLUA 2WLPA 3A0KA 5H9RA 4C0BA 3HD8B 1PIV1 1DQ2A 1GNYA 5LW9A 4O65A 1KEXA 4NVPA 1KD7A 4B7EA 4QB2A 4A6OA 3H3LA 4YZ1A 1FV2A 2WS92 5T5PA 4AVSA 1ZZBA 3VBUB 5FDBA 1ND2C 5FFOC 1CAWB 2EIGA 1PX3A 3PTYA 5JOXA 2D3SA 4AQTA 5FPLA 1MEC1 1OVPA 3LAGA 1AR71 1TE1B 1TEIA 2VUCA 2XKOA 4XF9A 4CU8A 3ZYBA 4IE4A 3APBA 1IZ3A 2E33A 1DIWA 4MV2A 1VBC2 4NROA 1H2LA 2JENA 3WG4A 1WCKA 4D94A 4Y22A 2EAAA 1VMFA 2QQVA 3T4VA 4NOTA 4HL0A 4FPFA 1HKDA 2TUNA 2OQ6A 3EBRA 3ON7A 2R063 2AYHA 4I01A 5FZBA 3S7IA 3U37A 2P34A 4AHWA 2AZ5A 2D40A 3I2KA 1Z7S2 2PAEA 1DGRA 3KHBA 2X5IA 4XCBA 2CDPA 1SFPA 1PX4A 4QQLA 3FMGA 1S0IA 4A6SA 3C7FA 2CWMA 4AOCA 5FRAA 3Q8FA 4UBGA 3VBFA 4R8HA 1ZA7A 4CE8A 2D6KA 4QPIB 4YVWB 1ONAA 5IVFA 4HSJA 4LHSA 3AVRA 4K3UA 4LO5B 2RM23 1CZVA 3M3IA 4Q4X1 2X53S 3AYEA 5A3TA 3WG2A 2ZGMA 1S0FA 1CX4A 1WD4A 2R0FA 1O5UA 3LZZA 5AC93 5J37A 2HLEA 4A44A 3GBFA 4N7UA 1FMD1 2QQIA 3IT8A 4FOYA 1GZ9A 1L7RA 4URTA 4CDQB 5C5UA 1IPJA 2WT0A 2RS51 4Z2WA 4OZXA 5FY5A 1R083 4I3GA 5HCHA 4ZZ5A 1B09A 1IG3A 4BCUA 1GQHA 1IKQA 5AC92 3ZIXA 2E53A 2N7GA 3KWVA 5TSWA 3VHPA 4CTEA 1SLCA 1UPIA 3TWIA 3VKFC 2HH9A 3GJAA 3LA3A 3FBYA 4CCDA 2WS91 3AXDA 4UI9L 3FLPA 1LOBA 4NWVA 1AF9A 1E57A 1ZRRA 3D3AA 4S2DA 4B4PA 5FZCA 1DGWA 4DUWA 4IE5A 3AP7A 3POEA 5FTTC 4QHBA 4E8DA 2OT7A 4ISRA 4FO9A 4Q0VA 1SCRA 1JS9A 5FXWA 1LGCA 2GC2A 2AREA 3HT2A 2IVIB 4NIIA 4Q27A 3X29B 5FR3A 1AXYA 5A7SA 2C4XA 2ZHLA 1VBC1 5JZGC 4OQ8A 1MS0A 3OPTA 2DUQA 1J59A 1V0AA 4NWWA 3DEMA 1Z78A 4CXWA 3H1MA 4LBLA 5D8AB 3UK9A 3O12A 4A3XA 2XJVA 3FWEA 3ENRA 2P17A 2XUEA 3R4UA 1Z7S1 2VOVA 2YFUA 3WEZA 5FO7B 4WM7B 3KVBA 2D43A 1VAVA 5KXDA 4XFBA 5APAA 4AVVA 4S2FA 5GALA 2I07B 3VZKA 1FI2A 3J4UH 4O61A 2R041 5JOZA 3UV9A 2D3PA 4CEWB 4MHRA 3I2DA 3Q9OA 5DAQA 1Y4WA 2VJXA 5DPNA 1N3QA 1F4AA 1WA6X 3AMPA 4CEYB 4NHKA 3OGVA 3BTZA 4PHZA 5ANQA 2C5DA 3F95A 4BE3A 4PF5A 2IVJA 1GOGA 1RUJ3 3RFRA 5JIUA 3NV3A 4ONUA 3RJRA 5HCAA 4P9LA 3VDBA 3LFMA 3FBMA 2HWC3 2X09A 2PYTA 5G04L 3WNXA 3RYKA 3TRSB 3ZXAC 5FZFA 2VCCA 4J25A 1YRZA 4FFIA 3O1RA 2GAUA 1AYM1 4LMFA 1EUUA 2D93A 2UWCA 1RUJ2 3D0SA 2X29A 3GXUA 2A70A 2XVLA 1J3RA 4BA6A 4QX3A 4OUMA 1SFYA 3RJ2X 2JG9B 3O1TA 1HX6A 3OY8B 1WGPA 3ZFFC 3ZFEC 2Y6HA 4RL7A 2ADDA 4JRAA 1AR61 1QOTA 2I74A 4FAGA 2ARXA 5CFCA 3LPGA 3DN7A 5LBCA 4DO0A 1IGOA 2Z2SB 4AGRA 1GOHA 5F37A 2W92A 2NN8A 3NJZA 1CZTA 3QBQA 4P9IA 1LCLA 4QWNA 4WVZA 3ZFGA 3FE5A 3CO2A 1G7YA 4HK9A 2PHTA 2R6QA 1SDWA 5SV8A 3RGBA 2ZEWA 4AZZA 4XQ4A 4D7SA 1EYBA 1PO13 3M3CA 5KR7A 3H3ZA 1WCSA 4E8CA 5IFTA 3B7MA 3ZYHA 3N9OA 3UKVA 1BMV2 3ZXKA 4QKFA 1JZ2A 1W39A 3FLTA 3QOPA 1BEV2 2Q30A 2BGPA 4XVHA 2WZEA 3WT3A 4GKYA 1X8MA 4CXXA 3UESA 1I5PA 1MVQA 1NCQA 2ORZA 2B45X 2FCUA 1PO12 1OF4A 1DU3D 4X8PA 4H2AA 1OLMA 2P5BA 4UFKA 1W9TA 4PT6A 2R30A 5L9BA 1DG6A 2F6BA 1O4ZA 2WNOA 5K4LA 3DCQA 3CDZB 4CCCA 2YY1A 4ZONA 1FOD3 3VL8A 3AZWA 5BNPB 5F6LB 1OOPA 3EO6A 4HXCA 3NNLA 2R1DA 3U14A 5LY2A 4OCTA 4A41A 1F15A 1HDKA 3ATGA 2PHWA 2VZSA 1LU1A 2VAUA 5H9SA 3E5QA 1BXHA 3MV01 3OD4A 4LUMA 1FOD2 5FYTA 1SHWB 2UU8A 2QKDA 3ZSLA 2BDRA 2E6VA 3AC0A 5CA6A 1PGL2 3KV4A 1NA1B 3AM2A 4G9SB 2FDHA 2CV6A 4FOVA 3VD7A 3ZN6A 3IMMA 2XJPA 1NLQA 2MEV3 2XQRA 2XPJA 1O3TA 3SH4A 4COUA 3L2YA 3T30A 2JG8A 4HOOA 3I49A 1U0AA 2JDPA 2WFF3 3O0XA 1UD1A 4WM8C 3KCYA 4UFMA 4GIQA 2ERFA 3NAPA 3QCWA 1QU0A 2MEV2 3RRDA 5IVCA 1POQA 3TNPB 1ZZ9A 1F2NA 1GZTA 3GDBA 4YGDA 2GDFA 5DXDA 5GM0A 4CU7A 5A6ZA 1LOGA 1WW6A 4YSFA 4YM0A 3AZVA 2ZGNA 4KWKA 4MO3M 5F9TA 2Q8CA 3PIJA 5DQ0A 5I91A 2ZOEB 1SFNA 1ODNA 2IXKA 3IWZA 1WCUA 1ULEA 1PK6A 4OLLA 4QKDA 3ZR5A 3AYCA 3O1UA 1VR3A 3LSEA 1EUTA 4MH0E 1J3QA 1ND2A 1WMDA 2NQYA 2DFCA 3VZNA 1VJ2A 1VRH3 4UFHA 5GZFA 1VP6A 1PM4A 2D44A 3C7OA 4KGQA 1MS9A 2AEZA 4IV1C 1BMV1 4COWA 2FDKA 1BEV1 5IATA 4P14A 3S0MA 4QPYA 3P3PA 1JH5A 4WZCA 3KM5A 4OHYA 1HV0A 1UIJA 4Y22B 1N47A 5BV6A 3AP4A 1MZFA 1XNAA 1VRH2 1GMMA 2Y6LA 3K46A 1P8JA 4QB6A 1KITA 5G05L 2X8KA 3JB4C 4GWMA 1L7LA 1UIKA 2X5IB 3T0AA 5FREA 4AQSA 5F39A 3CEWA 4EQVA 1OH3A 1SCSA 2VOKA 3M3EA 2OPWA 1UOJA 1UZZA 3EMRA 4MXWA 5FUIA 5FY8A 3T08A 3LA2A 3T2OA 4BQ1A 3WUCA 4YM1A 3D8CA 4NIAA 1ZBE1 3VBFB 3UJOA 4IEWA 3CF6E 4HPKA 5C4WC 4NJ4A 4CCMA 1C1LA 4I0AA 3ZYRA 4BIOA 2PHFA 2RS31 2YBKA 4FTBA 4XMAA 1UY2A 3J26N 5E16A 3URFA 1RUG3 4AGVA 4JGYA 2VGDA 4LBKA 1QNYA 1UY0A 3DF0A 5A6YA 3HBKA 3FJSA 4CP1A 5LY1A 3RZHA 3SISA 4N53A 4LJHA 3MZHA 2XB6C 3MI8A 1XB9A 5F32A 4HETA 3RYPA 2DWRA 4YM3A 4AEDA 3ZSEA 1GYKA 3KCCA 2GNBA 3RG0A 4K21A 3AYDA 2EF6A 1ZVFA 3KHCA 1QJX1 2AH2A 4GD4A 3W9AA 4RQPC 5I0UA 1AR91 1DDLA 3OEAA 2EA7A 2YC2A 2UYBA 3K4AA 2LROA 2XG3A 2RDQA 3KT7A 3VKOA 3OJBA 3ILFA 3VD5A 5FV3A 1STMA 1DP0A 3GBWA 5A1FA 2EAKA 4JGZA 5LBFA 4CDWA 3IAPA 5F5AA 5FMBA 1YFXA 1OD5A 3JBG1 2XKPA 4INDA 1L3JA 3HN3A 3VDDC 2DBNA 2GSYA 5FYSA 4QQOA 2P3YA 3OBAA 5IVVA 4AVAA 5EV7A 2ZZQA 2PAMA 5C9AA 3C2UA 3VD9A 4HVRA 1W6NA 2BV4A 3M8LA 4LKEA 4PF1A 2DVBA 2YBPA 2WAAA 3POFA 1OKQA 3KVAA 3NNMA 4MUVA 4FOQA 4XTMA 5L7OA 1QDOA 1LGNA 2W2IA 3KT1A 5CKMA 1D4M1 1BK0A 3RSJA 1NE6A 1YYNA 3SKJE 4I02A 2QQKA 5FZ8A 1QXPA 4AVCA 4CDUC 1Y9MA 1ND3C 1CR7A 2PLV1 2B8MA 2WAOA 3I59A 1H30A 1SLLA 1H1IA 3MLJA 1QGLA 2VBPA 4M4RA 5EYXA 5JWPA 3AYAA 1OLQA 3HQXA 1D2QA 4M00A 1QOOA 2BVBA 4PLOA 4CCJA 2ID4A 4XJAA 1V6IA 3QD6A 5IT6A 4I09A 5ISLA 3H8OA 1DQ5A 4OI1A 3I2JA 4DRRA 5JIAA 3HPNA 3Q8BA 5GLVA 4Q1RA 4D7TA 5JLVA 1JOPA 2CWSA 1HRI1 4CU6A 1Q43A 2BU9A 3B9IA 2QQJA 2WSUA 1RVF3 4COYA 2Y34A 3LFIA 4Q4V3 4DEQA 4E4SA 3PHMA 5KXCA 2P37A 4ES9A 2ADEA 1NT0A 4R4XA 2WQ4A 2HBUA 1QJU3 2A7AA 3I2GA 5JUVA 4QXBA 2GU9A 3ACFA 1RVF2 2ZXQA 4N43B 4Q4V2 3I8TA 4QX7A 2E63A 2D6PA 3ECQA 3KMHA 5CVRA 3MDPA 3OUJA 4J1XA 1APNA 3DYPA 3O1MA 4V2WA 1UKGA 2FDIA 3GHMA 3OUIA 3AK0A 3TOJA 5HPOA 1QJU2 3BOPA 2XGXA 2DTYA 4R52A 1LJ7A 3MEPA 4XURA 1IOAA 2WNVC 2FDJA 4HFSA 3DECA 3WG1A 3T1LA 3PDQA 1RUNA 3ZFFA 2WO1A 2D97A 3ZFEA 5LASA 5J1XA 1O59A 3U75A 3N7KA 5C8CC 2D5HA 3R4SA 1Q8OA 5CFCB 2B4KA 3T2QA 3W5MA 2NMNA 5K0UB 2DCKA 5GLWA 4ZKTB 4XIOA 2V09A 1I1EA 3ZFGB 4YVSA 3WZ1A 4XC9A 5EQUA 5DZGA 4UW6A 4BOWA 3D5OA 1QHDA 3UGHA 5FO9B 4BQYA 2D6OX 2IC1A 2ES3A 1CJDA 1RUI3 3ORJA 4GA9A 4IXLA 4HSLA 3GJBA 1LODA 4B1MA 5HXMA 4XW3A 3EJKA 4DXZA 1JZ5A 1XE8A 1W8FA 4BQ5A 1KXGA 2FZ1A 2WNUC 4Y1VA 3QH6A 3I3EA 3Q8CA 1UKRA 2XDVA 3HNBM 4FFFA 4EN7B 4XF3A 2GMPA 3E6CC 1AR81 4W8JA 1LTEA 1NCQB 4LUKA 5FZAA 5C6CA 1YJLA 4JDMA 1H8TC 3MICA 3OD0A 1C5IA 1AUYA 1BBT3 2A6ZA 3LWCA 4PDWB 4MX3A 4RS5C 3IDAA 2E26A 4XUPA 4XXAA 5DUXA 4EJRA 3ACLA 2ORXA 1S0BA 1IS4A 5I0RA 3LCPA 4XF1A 4JX0A 3ALQA 3I3MA 1OOPB 5DABA 1IQDC 1CWPA 2DUOA 3FUQA 3JXSA 3WQBA 1OH4A 3N7LA 4FXKB 5CFDB 1BBT2 3OEBA 5DG2A 1QH7A 2H0VA 4DFSA 2YB7A 4GB31 5LA1A 3WP4A 1GQGA 4QX1A 2D6MA 1DLLA 4M0NA 1JZ4A 4XOGA 3B3QE 4JKKA 4A42A 3PVBB 3NMBA 4HKOA 2B9UA 3W20A 5DZFA 2FDGA 1R64A 5JXHA 2QJVA 1JYTA 3BGAA 3ELNA 1G9DA 2QFEA 3KLSA 3ZN6B 5L19A 4Q4V1 3MIBA 2ILMA 3D6EA 3I2OA 3PVEA 2JWPA 2WWJA 4YRDA 2JG8B 4DPNA 1JHNA 5A3PA 4P9WA 2Y33A 1QJU1 5FP7A 1XNKA 2P3IA 2Y64A 4H14A 1D0HA 1YJKA 1HRV3 3AVSA 3NAPB 2EXKA 3AP6A 3MBWA 4QB1A 4CPBD 2ET7A 2RDSA 4LK6A 5CEHA 1UO9A 1UAIA 3U11A 3SKVA 2RS11 3HVDA 5FYMA 1Y3TA 1RC6A 3WNLA 4ZHNA 2C24A 3ZYFA 4FPKA 1UY3A 1OLME 3TB0A 1VIWB 2WLQA 2ZGUA 3OBZA 1HRV2 1PK6B 4ZS2A 2V4VA 1NZIA 3MHZA 2RV9A 1ZM1A 5T5JA 4MGQA 4I30A 4D69A 4Z8BA 4P08A 3EB7A 2Z5WA 2R7EB 1JYCA 3LEIA 3AMNA 3KCXA 4GZ9A 1DYKA 4QPWA 1PIV3 4PI0A 3PVNA 4QHOA 5F8PA 4YZ3A 2JKXA 1OFNA 5EIYB 2XH6A 3RI9A 5DUUA 2B39A 1LKNA 1PMJX 3ZXEA 1T6GC 1GICA 3S57A 3J7HA 1MEC3 5I0TA 2AR6A 4RGGA 1M06G 2GNMA 1AR73 1L7QA 2VVFA 3VHNA 3ZMOA 1UYZA 4MGTA 1RL3A 5IVBA 1AJOA 1MS5A 1OQ1A 3GYDA 4LA3A 4AF9A 4AI2A 4I2OA 5D2AA 4MXWB 2VMEA 3J7LA 1VBB2 4AI9A 1W8ZA 4FSJA 1BBT1 1HQNA 1FXZA 2L9LA 2P3KA 2ZACA 1S4CA 3FFZA 1BYHA 1QQP1 3K3OA 4HPKB 3AL5A 1K5MC 1TZOA 5C4WA 1UXZA 1X50A 2QDRA 1UWWA 2A6XA 4YW3A 3VDCA 3ETQA 4JGYB 4YG3A 3O1VA 2VZPA 2J1TA 4ZU5A 1BJQA 4J1WA 2EXJA 2JDZA 4IV3C 4N53B 5B2GB 4QMAA 3IPVA 1XE7A 4AEDB 1V70A 3BTAA 3W5NA 1ENRA 1MVEA 4AFCA 4PBPA 4NUBA 3WUDA 3IN9A 1SMVA 1GV9A 2CYFA 1GZWA 5A1AA 3C7EA 1QOSA 5A3LA 4K8RB 3MPBA 4Q4X3 4Y24A 1VBD3 3G6JB 3KV9A 1LHUA 1YUDA 2Y6JA 3EYPA 2QZ2A 1WBFA 3I4IA 3LF7A 2VCBA 4H55A 4IUGA 1ULDA 4JGZB 4LHLA 4NRMA 4CDWB 4DY5A 5K8SA 2PHXA 1N3PA 1S0JA 5FLHA 1FMD3 1V00A 3WDXA 1D2SA 1XNTA 2OX0A 4WVWA 1GU3A 2VW0A 2RS53 4Q4X2 2IFWA 3HEIA 4XE9A 2GZWA 4XFIA 2XOMA 1WUVA 1CQ9A 1VBD2 3JD72 3VBSC 1QJY1 3KF5A 5C9AB 1ZRDA 3U78A 2DU1A 1V6JA 1W6NB 3ROUA 3AMQA 5DAPA 1FMD2 3CZJA 1VAMA 1HN1A 4V2VA 1C8M1 5L7OB 4MGSA 2RS52 2VQTA 1NG0A 3ZDSA 3OUHA 2DVAA 4LTAA 1DYOA 4QD2A 5E6HA 4X6RB 2WS93 3NKGA 5ABJC 4Z07A 5FBZA 2D6LX 4Q4W2 1JZ6A 1J3PA 1GFF2 2K0GA 4FAHA 1KJLA 1C3HA 1V6LA 5JOWA 3I59B 5EPAA 5KXBA 2DCYA 1U5XA 2RR12 2W68A 3MIFA 3LD8A 4RFRB 3LEKA 4CUCA 3NQHA 3WQ7A 1NCRC 1GNHA 2VZUA 4JHZA 2YGLA 4IE7A 3IIIA 1OI6A 4IDZA 1LULA 4XCAA 1VBC3 2A6WA 3KQ4B 1VBB1 4Y4YA 4CU9A 5KHKA 3PNAA 5LK7B 2PTMA 3LA7A 1GWKA 1E5SA 1OXCA 2RE9A 4OI4A 4BXSV 1UZWA 3K4ZA 4YNIA 2VOWA 1IS6A 1LEMA 3IDEA 5A7WA 1O6UA 1Z7S3 1G6NA 4HN1A 4ASKA 4BQ3A 4S2GA 4AGGA 4A7KA 3D4KA 5DAXA 5FY1A 3M2MA 5FZ9A 1AX1A 4BJ0A 1U5IA 4LO8A 2VZQA 2W1WA 2F4LA 2W46A 4UXAA 4GH4C 1ULGA 3J9SA 4AEKA 2R043 2NYYA 5F3IA 1PZ7A 4RR3C 3HOBA 5CKQA 4JQTA 1W6MA 4XHXA 4BPZA 1CPMA 4GJZA 4TLFA 3RS6A 3T1MA 3VBHA 5C3QA 2WQZC 1BZWA 4CPBA 3ZOIA 2XMLA 1WWYA 3LE0A 2D6NA 2QQOA 2W1UA 2R042 3PU8A 4B29A 2W94A 3HIFA 3BIWE 5CG8A 1IQAA 1XU1A 3MIHA 3DXTA 4W6YA 2YBSA 2VBBA 1A6CA 2LW8A 2C9KA 2CSGA 3VHOA 1NXMA 1AYM3 3ZX7A 4Y26A 3H7YA 5IWFA 1ACCA 4N9HA 2NLRA 4XDOA 5BNNA 4CCNA 4YVSB 1LB2A 4QU2A 2F17A 1VBD1 3JD71 1A3KA 2YXSA 2VTFA 2R1BA 4MVTA 1AL22 4LHKA 2GC0A 5C70A 1REEA 2ZAHA 2IUWA 3LEMA 4PIYA 5C3SA 5JDBA 1AYM2 3VHRA 4Y5SA 1OA2A 3VD4A 1O5LA 4EZ4A 1AR63 4UBHA 5KC5A 4ORFA 3GHNA 5IUQA 2WZPP 2Q1MA 3LOBA 3AFGA 1Y9QA 3ZSKA 2QUOA 2ZJCA 1CGPA 4GALA 2C9AA 5FPZA 1HIXA 4Q4W1 1CAUB 1BVVA 4Y4RA 1ULFA 3ZXGA 5JR7B 1X36A 4N7IA 3WQ0A 2DDUA 1AR62 2RR11 5D1IA 1JYXA 1RUF1 4Y1YA 3VBOA 2G19A 4CCKA 4RS5A 4E9KA 1AXKA 5FKCA 4B4RA 2CHHA 4TXWA 2WZR2 3OOXA 3KT4A 1H2MA 3T2TA 3CKHA 4NIHA 3BPZA 2E9QA 1UOBA 2W52A 3PUSA 1QWRA 3JZVA 3V0BA 2VQ0A 4A45A 4XJ9A 2ETEA 2ZMLA 3OTFA 3VDAA 3TYJA 3POJA 1W8HA 4PCRA 3W21A 2Y8KA 1SQ4A 2Q5TA 1UZ0A 2XXZA 1F35A 3MW3A 1E5HA 4EN9B 2XBO2 2P2KA 1EV11 3BUCA 1SLIA 4ISQA 4AQ2A 4CDXA 3H8RA 1OKOA 3GCXA 4DUXA 4PQQA 4QDRA 4BU2A 2A71A 3BYWA 1YC61 1H4HA 1MQTA 1CZSA 1H1MA 2NPIA 4QHZA 2BTVC 5E89A 3VBRC 4AI8A 3AMHA 3DPRC 1C8NA 2FMYA 3UETA 1OQDA 2C1FA 1QF3A 4FPEA 2VNRA 1WD3A 2A1XA 1YI7A 3WP3A 3PURA 4FTEA 5FPAA 5FZ6A 2AEYA 2QNKA 2UWAA 2FQPA 4GKXA 4IEZA 3N9MA 1N1VA 5HXVA 2CGPA 4UW3A 3AKQA 1T2XA 4BK5A 4HBNA 4XFFA 4UOJA 1Q8SA 2XUMA 4OI0A 1MZEA 2LRPA 5FZOA 3KB5A 1UXXX 1FPN1 1XYNA 2J7MA 1AL21 5AVAA 1VAKA 2J42A 2BUKA 3ZYJB 3VBUC 1LGBA 2ARBA 4FPLA 5EXOA 5HCFA 5CKNA 5LA0A 4OULA 4QQ2A 5FBJA 5FYBA 2W1QA 1BQPA 3EXUA 1O3QA 3KGLA 5DUVA 3SQOA 5C5TA 1NQDA 3T09A 4ZXEA 4ARYA 1S55A 1I3HA 2P6HA 2WO7A 4P5HA 3SITA 1OSGA 4QXKA 3NJYA 3ZR6A 1ZA4A 1MS4A 2GALA 1OC1A 5FQ0A 5FO8B 4C90A 3O5SA 1PO22 3ZIWA 2ZGKA 3AKRA 5FMCA 2WZR1 1BEV3 1REDA 2DBIA 5E88A 3WW4A 5D21A 1YFWA 2ZAAA 3N9QA 4W50A 3ZMNA 3ZKUA 4PLMA 3USUA 3PUQA 4AI1A 1X9PA 3CJIA 1JZ3A 5DAVA 4XDPA 3JCIA 4K40A 5BNOA 5FWJA 2K46A 2BNNA 4QPIC 3I3DA 4YVWC 2XBO1 2MNGA 2AENA 5FZ1A 1W8WA 3FFQA 1ENSA 3WVJA 1A8MA 2JE9A 1UN1A 1CONA 2JDAA 3N9NA 4W6XA 4CRQA 1CX1A 1W2NA 1S0EA 3H1WA 4IERA 1DGLA 5DDJ2 3ZVXA 2A73B 2BWCA 2WA3A 3OF1A 4FPOB 1OUXA 1ZBE3 2HKXA 4XQDA 4CYDA 4YZ2A 4YYOA 4XIKA 3NNJA 2J1AA 4LOTA 4QPGA 3T3YA 4CDQC 2RS33 2VR4A 5GJ6A 5GKAC 1HXS3 2OA2A 3MUZ1 1GZWB 2PAKA 4HONA 4QM8A 4ZXKA 5A3UA 1B35A 4WZFA 5IK7A 1U5YA 1W8TA 1ZBE2 4KBZA 3V64A 4Y1ZA 3WDWA 3ZM8A 1CAVA 1W06A 2GN7A 2V4AA 3ZXDA 2JD9A 4A3ZA 1G9BA 1VALA 1JMUB 2RS32 5FYZA 2Y26A 1HXS2 4IEQA 2WT2A 1NX9A 1QJX3 4NR1A 2FCTA 3PUIA 4JCKA 3MV11 1AR93 5EP9A 3UGGA 4JQRA 4JZRA 1W0OA 3C3VA 4JC1A 4YW2A 3VBSA 1X7NA 3P1IA 4BH9A 4JRLA 1JBCA 2OVUA 2BGCA 2W0XA 3LDBA 3ES4A 1QJX2 2JB8A 2CTVA 2EXHA 1W8NA 1OPOA 5T5OA 1C57A 3JBG3 1AR92 2E7QA 3WNMA 1G86A 1W04A 5F3GA 2YFZA 2VG9A 5D8AC 5FJKA 2WSVA 4FPGA 4NHMA 5M0TA 2VULA 4DEVA 2ZX1A 4BQWA 1PO21 1Z0HA 2WFPA 4FQ4A 3JBG2 4LBOA 4X6QB 1J84A 3THCA 2PN5A 4F7ZA 3BOWA 1H1AA 3N36A 4WM7C 3MO4A 3U1XA 3WY6A 3WF0A 4EN6B 1D4M3 3MIGA 3P5BA 1RUOA 1QNWA 3VGIA 4LBQA 4CEWC 1RUH1 2QTWB 4Y5TA 4YZ4A 2Q4SA 1AYN1 5JMOA 1WMEA 1WW4A 2PLV3 3EHKA 4OHVA 3HJRA 4CEYC 2WN3A 4E4DX 2WBKA 4MYEA 2ZZJA 4MLOA 1S0CA 3IBMA 3T0DA 3CHXA 1AZDA 4IEUA 5DMYA 2VD7A 4XFAA 1D4M2 1JU4A 3SLIA 4LKDA 4R9AA 4JKLA 1HB2A 2LTNA 2ZGLA 3ITQA 5DDJ1 1U12A 1W99A 3SEPA 2VZOA 5J36A 2PLV2 3ES1A 4HKLA 2JDHA 4R9BA 1HRI3 1S2KA 1W6MB 1XXNA 2VNGA 4TZDA 5F5CA 4XBQA 3VBHB 2W87A 2PQQA 5T5LA 4BHPA 5BPXA 3SMHA 5CYYA 4IEPA 2HWF1 2X10A 4K6BA 4BLIA 2VUDA 5BYNA 1WW7A 5J96B 5FZGA 4NPMA 1ST8A 2DVGA 2JG9C 3I54A 4L0PA 4NHYA 1K45A 4NMIA 4MXVA 1HRI2 1KDKA 3DYOA 4FPJA 4P9GA 4K1ZA 4CXYA 4JV4A 4DRVA 1WCDJ 4MHUA 1UU5A 2P4EA 3RI8A 2HEYF 2G9FA 1UCXA 2HYXA 3BTXA 1FT9A 1IS5A 1OT5A 1HXS1 2EXIA 4LR4A 4M3CA 1UU4A 3PU3A 5BNNB 2VU9A 1I9RA 1DQ4A 2Y6KA 4QKBA 5B4NA 5K7PA 5CFDC 2UY8A 2YPDA 4LK7A 3A4UA 5FIXA 2CNAA 2PHUA 2UY9A 4IEYA 5LZ6A 4TN7A 5FY0A 5FPXA 3BTYA 1EP0A 3IDCB 1W3VA 2ZGQA 5C33A 3LOIA 4F3JA 5J48A 1X33A 3H8XA 3ZN4A 1UOFA 1N1TA 2J1SA 1W28A 1RIRA 5J98B 1ENQA 2HYKA 3H9AA 2B46X 5FPBA 4Y1UA 1HLCA 1YO8A 1H6YA 4XXPA 4JAAA 1S2BA 4FOWA 4LT5A 4XUQA 3VBOB 5A70A 2ZPXA 2JE7A 1OURA 4IGOA 4QXCA 4QM9A 1ZZ8A 1W9SA 3OGSA 4OQ9A 1GLHA 2VZRA 2BNMA 3K77A 3FHQA 4HK8A 2WO3A 4R4ZA 4UFLA 4AEMA 5A32A 4AEJA 1YFUA 1AR83 4EWDA 5BNPC 4LOSA 4COZA 5F1RA 1ENXA 1RUC2 5C8WA 1ZBA2 5J3UA 3HWJA 1QEXA 1RMU1 4NPRA 1W9FA 2Y6GA 4HANA 1R1A1 4AK3A 4CSWA 1NE4A 2VECA 3I97A 1SBEA 3QH7A 5FZEA 3NWKA 5JZGA 3R0RA 4BZ4A 2XJRA 1AR82 5A7QA 3U4SA 2VMIA 3PVOA 3POYA 4CDXB 4XQWA 1NA1C 3C7GA 4FI9A 3T4HB 3E5UA 3GNEA 3UT0A 3ACIA 1ULOA 5FPVA 1MQTB 3MLKA 2BERA 2Q0AA 1OFSA 4GB33 3VBRA 3TN93 1LOFC 5JVVA 2VZ1A 5FUPA 1ZRFA 2B5HA 4LE4A 4YW5A 4KMQA 2GN3A 3A0NA 5GZDA 3CZUA 2DF7A 5JXGA 2R073 1YI9A 4HG6B 4GB32 4M01A 3T2PA 3FLRA 1W9YA 4JVAA 4LORA 3TN92 3TEYA 4UAPA 4ZY9A 2BQPA 3O1SA 1TVGA 1W8UA 4Y20A 3POIA 5FZOB 2Z42A 4DMIA 3AKTA 4Z92B 3UL2A 1AX2A 2FDFA 5C71A 4EWAA 1MZ6A 4QX5A 3FL7A 2R072 4AHXA 4Q0QA 3VBUA 2FD8A 2TNFA 3BIEA 3D82A 2PMWB 4EYUA 4NRQA 4K7JA 2P6CA 1WLDA 5HV0A 2ZTNA 2RS13 2YUEA 4Q29A 4XABA 4IQPA 3O14A 5AFBA 4H7LA 3NJVA 2C26A 4WVVA 4YW7A 5FY7A 4FPHA 5JI7A 1RINA 3NV4A 1DQ6A 3B9CA 5C7GA 2IFRA 5IVJA 5JCTA 1ZX5A 1QH6A 1W8OA 2J22A 4XUTA 4CP9A 3S5QA 4KWUA 1JYWA 2BWAA 2RS12 2XL7A 4TWTA 5FQ0B 2XL9A 1PHMA 1WW5A 1JW6A 1GUIA 5L9RA 3W59A 3SH3A 1I6XA 4NHLA 4GXLA 4I0BA 1XYPA 4Q8LA 1JHJA 3DUIA 2ARAA 2QVSB 2X5IC 3I3QA 3QLQA 4GMP1 1LEDA 1KRIA
chains in the Genus database with same CATH topology
3USUB 1RUC1 3CJIB 4LHNA 3WR0A 1ZBA1 2Z69A 3WHTA 2DFBA 4DQAA 3H0OA 2V5YA 2YV8A 5BNOB 5IT6A 2GMEA 3VBFC 4DY3A 1TQ5A 1V9U1 4L92A 3V56A 5CADA 3EQEA 4XJWA 5KXEA 2IZWA 4C0HA 1Y43B 1X8EA 3B93A 4JDNA 5FLIA 5I8SA 1KS5A 1FV3A 2OPKA 1JOJA 4AVTA 4EN0A 4EROA 1XNBA 1QQP3 1DF0A 3KD4A 4PIZA 1OHFA 4Q0PA 4QPGB 4OFGA 2A5ZA 1JXNA 4JTOA 1EAH2 3AMMA 4KWJA 1QDCA 1B35B 4YG0A 4BIFA 4XHBA 2V73A 4CP2A 2BVVA 1LENA 4EV0A 5JI9A 4P9YA 1ASJ1 1QQP2 2DURA 1UW8A 1CAVB 3N4MA 3PJYA 3TN91 3SCHA 5L36A 4QGLA 3OYWA 1OPMA 2YHJA 1NYWA 3WP6A 3WXPA 4B7KA 4LO7A 1SBDA 1PMIA 2R071 3INAA 2W39A 2WNEA 2JJ6A 4XMIA 1VB2A 3BALA 4Y1XA 1GANA 2OW4A 5CBLA 2HWB1 1QXRA 3H3UA 2H6BA 4RSUA 1HQLA 4META 3WW1A 2RMU1 4FP2A 1GBGA 2WINB 4H7MA 3M70A 4ZU4A 4E4ZA 4AFDA 3CL1A 4WM8A 1POV1 2NP0A 1UMZA 3H8UA 2E7AA 2WA4A 1JUIA 2YC0A 1FNZA 4OHZA 1LHWA 3B69A 1QJY3 1BKZA 2PHLA 5A33A 2R32A 4BWOA 2VW1A 1YWKA 1C8M3 4F8AA 2A3WA 4WM7A 1ND2B 1ULCA 4BMEA 1NOVA 1KJRA 5FLJA 1QJY2 5CB7A 4AHYA 1QJZA 4LBQB 5AVPA 1YLLA 4AG4A 1W6QA 4XPVA 1C28A 4YM2A 4IV1A 2KXLA 2CY6A 4G4FA 4KL1A 4XBLA 1C8M2 4XFCA 4OUSA 4XTPA 4C1XA 4MSVA 1N1YA 4QQPA 1LOEA 1RUD1 2NM1A 2SLIA 4KG8A 1G9FA 3AP9A 4U2AA 3B5LB 3FHIB 1VBB3 4YFZA 5T52A 3NO8A 4AW7A 5JDBA 3ME2A 2TEPA 3POSA 2ZGPA 4N43C 1ALYA 3N3HA 5I8YA 1YIPA 4IETA 5KHHA 1EAH1 2ZGRA 2CAVA 2B42B 5H9QA 1RJ8A 3ZPYA 5EFUA 2GMMA 1RHI3 5SV5A 3OY8A 4L11A 5CNAA 3AKPA 1Q8QA 3RWNA 1Q56A 1RTVA 1PVC2 5E8AA 4TYSA 4JTNA 1O4TA 4Q26A 5CFCC 4R9CA 4LO6B 4M3CB 5GLTA 5K0UC 4Q4Y3 1RHI2 2TBVA 3ZFGC 4QGMA 3VV1A 1KS4A 1IKPA 4O9GA 2VOXA 2ZS6B 4KG0A 1O91A 2I45A 2MHFA 4Q4Y2 2VH9A 1RB8G 4GQ7A 4RQPA 4PQ9A 3VN4A 4ITCA 4Z1VA 3JD73 1NCQC 4YGEA 1PGW1 2WWSA 1CVNA 2UYAA 4D7YA 3UKNA 1JUHA 1DZTA 2FHRA 3VKMA 3O7OA 4PDWC 3VDDA 3KS7A 1CIWA 4XZPA 1H8VA 1MS1A 4Q4W3 4GULA 1OOPC 4RHV3 3MGUA 3RMXA 1KFUL 4YARA 4XF0A 2VQAA 5CFDC 1UPSA 2RR13 2ATFA 3E6DA 1RUF3 1AL0G 5JZGB 3WDTA 4M3CF 5JMCA 3MW2A 1OA3A 2EVXA 1KFXL 2XJSA 4RHV2 5LRRA 3CNAA 2WKKA 4N90A 4CDUA 4M3CE 3LOBA 2D98A 4QT6A 2ZABA 1LHNA 1ND3A 3M3OA 4Z82A 5KWRA 3WCSA 4AI3A 1RUF2 3M7AA 3WINE 1ZZ6A 1UF2C 2JG8C 3OCPA 3RYRA 2OZ6A 2PHDA 4Q1PA 1LOFA 4AE2A 1EV13 2GH2A 4N9IA 1ZYBA 3NAPC 1PVC1 2VVDA 2PA7A 5IK8A 4B3NA 1CPNA 5HCBA 1XYOA 1JYIA 1VBE1 1S0DA 1RHI1 4Y20B 1CJPA 1EV12 4XJUA 1PK6C 3LSDA 4AQ6A 2NZ9A 2BEOA 3MFCA 2JECA 1J58A 4HN0A 2XWBB 3PLQA 3JU9A 1LRHA 2YPJA 4ASMB 2VXRA 2WIIB 1DQ1A 4Q4Y1 3UKTA 3AP5A 1PNFA 4GMP0 1RGSA 2HEWF 2HWD1 2SBAA 3MYXA 4XJ8A 2WNVA 3R6SA 1FPN3 4IESA 3ZFFB 3ZFEB 1AL23 5HBAA 5KHGA 1SEFA 1COV3 5C8CA 4I3PA 3POWA 5EZWA 4LE3A 1R091 3DGTA 1FPN2 4IEXA 3ILRA 1COV2 1NLRA 4YZ5A 1LR5A 2ZKLA 4WV8A 1C5HA 2R062 4YGCA 5JOYA 1PZ8A 1D4VB 2WNUA 2WZR3 4RHV1 5CG9A 2GNTA 4JGYC 5JAXA 4B8EA 3HAGA 2DCZA 4N53C 1H8TA 2MPFA 1LU2A 4KH9A 4IL7A 4AEDC 2XWJB 4FP3A 4KWLA 1ZREA 4XEZA 4DS0A 2XBO3 2RM22 3RNSA 2K9ZA 3VL9A 2D5FA 5FOBB 5F5QA 5GZGA 2NMOA 1Y7BA 5LK5A 2ZX3A 4RA0A 1TME3 1AVBA 1D0GA 2O1QA 3GF6A 4JGZC 4LBQD 4CDWC 3OYWB 3TBDA 1POV0 1RJ7A 3RMYA 4DOUA 2QCSB 3SXWA 5KC6A 2XLGA 1R082 4WBBA 1YXWA 2Y0OA 1REFA 2BFUL 1TME2 3NV1A 4YW4A 3SNMA 5C9AC 1N1SA 5KHIA 5J7MA 4XJZA 3W58A 2WJSA 2E51A 2C0ZA 5L7OC 4WM8B 3GZUC 3AZYA 3IIAA 2O0OA 4GWNA 3O0WA 3OGGA 3MIEA 1C1FA 5A33B 1CD3G 1A8DA 3ZXFA 1H9WA 1CAXA 3ZXJA 4Y5Z0 3MIDA 5GZEA 2RJLA 4H3WA 3E5XA 1DZQA 1NY72 4DB5A 3S6PA 2DV9A 1LHOA 1COV1 3H7JA 3DV8A 1LESA 2R061 2YDEA 3MFAA 1W6QB 4W65A 1SACA 2ZMNA 1QY4A 4IV1B 4ATFA 1PO23 1W2UA 2GH8A 1JN2P 1FYUA 2OUJA 5LRSA 2FMDA 5JPMB 4OHWA 2BYVE 3FX3A 1XU2A 1W6PA 5EWSA 2FBEA 3VKNA 1OLRA 1IS3A 1RUH3 2DU0A 1AYN3 4KQ7A 4N43A 4B4QA 2XVGA 2RM21 1YNAA 2KA3A 4RD7A 2HWC2 4KGGA 5DDJ3 4XFGA 5KHJA 1RUH2 2YGMA 3WHUA 2G9GA 1MACA 1AYN2 1ZZCA 5AC91 1F9KA 5C4WB 2HEVF 1K5MA 1Q3EA 4AFBA 4OI0A 4AXOA 1XNCA 3IM0A 4A7YA 3FZ3A 1O4YA 3PMEA 4I0WB 2HWF3 5K0UA 1HV1A 2ZX4A 1R081 2BNOA 4E2QA 2CAUA 4YVSC 4SLIA 4IV3A 1TME1 3IPVB 2HWE3 3HN1A 4ATEA 3ZYPA 1TNRA 4BLJA 4IEVA 2W08A 3E6BA 2CGOA 3ILNA 2HWF2 1ZZ7A 3CJXA 4RQPB 2CL2A 2IXJA 1H2KA 5T50A 3H50A 4QGNA 1WLWA 3SCFA 2HWE2 3FC0A 3S7EA 4FT8A 1JTZX 3WP5A 1UX6A 2GNDA 1J1TA 4FVVA 3WDUA 5BY5A 1TMF3 4AYUA 1NY71 4PDWA 1PNGA 3B94A 2WL1A 2GC1A 1XNDA 1F31A 3MW4A 4RGAA 5BXXA 3VDDB 2Q8OA 5H9PA 2DUPA 3E97A 4HT1T 3SHRA 3TNQA 3KQRA 4HVOA 4OHXA 1TMF2 4ES8A 5CFDA 2A6VA 1J1LA 3LKJA 4FBFA 5EYYA 3VKLA 1G9CA 3HR9A 3BU7A 5ABJA 2XJUA 4CDUB 2P3JA 4KNCA 2A3YA 1ND3B 1VBA3 5EJ3A 2ZHNA 1DFQA 4HKWA 2ZCWA 1RMU3 3K48A 1AXZA 3U10A 1OMIA 1RUJ1 1R1A3 1NCRA 3MF6A 4Q8KA 3J8F3 3HBZA 2JICA 4E2GA 3JUUA 3I7DA 2HWC1 5CAZA 1VBA2 3AJYA 4LBNA 1V6NA 4O9EA 1RMU2 2OUHA 3AFKA 1R1A2 4G3YC 3KGZA 3J8F2 1UL9A 1WA4A 4AFMA 2OZJA 2H6CA 2WFF2 3CLPA 2ZHKA 2DVFA 4GH4A 4D3WA 2AGSA 4RR3A 4XF4A 4DZGA 1W6OA 2BPA2 3N7MA 3RQ0A 4XILA 1UU6A 4XFHA 4A7ZA 2HWE1 2R49A 3JQWA 4PLNA 4A2UA 3IDBB 2WNVB 1CN1A 3B01A 3WLUA 4YFWA 3B02A 1PO11 2IWGB 5C8CB 1SLAA 1MS3A 4YW1A 5FAXA 5FMOS 2JKBA 4LEJA 5JPNB 3B00A 4BYYA 4L2NA 2ZBJA 1EY2A 1LOCA 4LBJA 1MR5A 4L99A 4WVMA 3AZZA 5FCCA 5T54A 2K2SA 1M4WA 1TMF1 5GLZA 2D7FA 1BK1A 2Q1ZB 2OIIA 2WNUB 3NL1A 2A75A 4FQZA 4L8QA 4MGIE 2VNOA 4FCAA 2XPJA 3D0JA 1FOD1 3V0AA 4R9DA 4E2SA 4GMP3 3IMNA 1CESA 2VMGA 4Q2FA 4LA2A 1PGL1 1GZCA 2VW2A 2ZGTA 1RUC3 4SBVA 1H8TB 4CZSA 1ZBA3 4HVQA 3PMSA 2DTWA 1NLSA 4RS5B 5CU1A 4K9SA 1V9U3 4LNVA 3NSTA 2B7YA 1XRUA 1RUG2 3ZXLA 3H1YA 1VBA1 2VPVA 3NW4A 3DL3A 3V0BB 1IHMA 1Q8PA 2E7TA 3RPQA 2MEV1 5J09A 3VZLA 3JB8A 2QQPA 1V9U2 3J8F1 1UZYA 2VY0A 2WFF1 3WCRA 1O7FA 3AKSA 4EN8B 1F8VA 1W0PA 1DBNA 2LM3A 1NXD1 1AJKA 3ZSJA 2VUAA 5I93A 2AUYA 1LHVA 2XHKA 1H4GA 5T55A 1RUE3 1LOAA 1PM7A 4K8FA 3WD5A 5GZCA 4BMBA 5HI0A 4XETA 2XJQA 1U5ZA 1ASJ3 2KM2A 1SLBA 1WMFA 3IKWA 1N3OA 3U0ZA 2VUJA 3DPRA 3VLBB 4K20A 5JSOA 4AWDA 2YZ4A 2DVDA 4KBBA 4ASLA 5ACA3 1RUE2 5JSPA 2JD4A 3U4XA 3NV2A 5I0SA 1GNZA 4JDOA 1ASJ2 1HQWA 3K51A 1VRH1 2BBVA 2HWB3 1CAXB 1ZNPA 1FX5A 4MGZE 2RMU3 2PHRA 2XVKA 5A3MA 5ACA2 4FPYA 1POV3 3THPA 1PVXA 2ZGSA 2ZX0A 1MZ5A 1CAWA 2LALA 4FTSA 3WX5A 2HWB2 2UWBA 4HLTA 2H0BA 3WDYA 1DYPA 3ZYIB 3WW2A 3M4FA 2A3XA 1DQ0A 2RMU2 3AZXA 3KSCA 2IXIA 4DNYA 4RFT0 2F4PA 1W6PB 2ZMKA 2O8QA 5AFEA 2PFWA 1S1AA 5DG1A 3CU7A 5FOJB 3JQXA 1WLCA 2WC2A 3VBHC 2Y38A 1RUG1 4OI2A 1RUD3 1XQNA 5I8TA 4UW4A 3R05A 3AXEA 2PELA 1K5MB 2ENRA 3FUOA 4QPIA 1R1ZA 4YVWA 3NVCA 1SBFA 1H9PA 1PZ9A 2YROA 3OBTA 1RUD2 2XJTA 4MGKE 5BNNC 4HMZA 2IXHA 1NQJA 1EAH3 3VUOA 2DYCA 4IV3B 2ZHMA 1A78A 2Y0IA 4PJYA 4L97A 2XLFA 1Q5OA 3ZYGA 3OGJA 2YMZA 4LLOA 2CGNA 5DUWA 1AX0A 4CDQA 4NN0A 1BVP1 1RUE1 2IXLA 2YYOA 2ET1A 4YGBA 1YFYA 1CAUA 1FAYA 4FXGB 1RUI2 3ZSMA 2ZKNA 1DHKB 2A6YA 5K9YA 3VBOC 3USSA 5ACA1 1WBLA 4LULA 4S2HA 4KU7A 3U07A 1I5ZA 1F5JA 2JXAA 3VBSB 3RZZA 2XLAA 5LEJA 1F5FA 1GKBA 1IPKA 1QXJA 3AJZA 1GR3A 5ABJB 3N7JA 5KBFA 1OQEA 1VB4A 4DINB 3ZO0B 1OA4A 3VZMA 4CDXC 1MS8A 2DCJA 5D8AA 4AHZA 3WDVA 1PGW2 3L9JT 1RVF1 2ZGOA 2IXCA 4FPCA 3HMYA 1MQTC 1PGSA 5FMOL 1NCRB 3VZJA 4J6GA 1VLNA 3HT1A 1FATA 4K1YA 1EPZA 1DGWX 4MGYE 1TNFA 4CEWA 2JEMA 4NO4A 5JSRA 3QACA 4LBMA 4M0HA 4CEYA 4XYXA 3THTA 2JX9A 4P9JA 3GZAA 1YCIA 1G8WA 1YIFA 3SH5A 3BCWA 1C4RA 3BB6A 4LO4B 2UURA 4GH4B 2VVEA 3WV6A 1NZCA 2BFUS 3GBGA 2RJKA 4RR3B 5CIRA 1GSLA 1G9AA 4Q0SA 5L73A 4V1PA 3L2HA 1DGRN 1PVC3 3M1HA 3S30A 4TSVA 1W6OB 2HJIA 3MPPG 1O3SA 1V6KA 1LECA 3KZ4C 1QKQA 3DKWA 1VBE3 3M3QA 2JG9A 5IK4A 2R0HA 4P9XA 4L9BA 2VMHA 4XBNA 2Z79A 5LEKA 3LB9A 1RUI1 3P3NA 1V6MA 3ZN5A 1YHFA 3WOGA 3O0VA 1VBE2 2D3RA 3N35A 1PIV2 4LLFA 4AFAA 4MZUA 2HWD3 4HZFA 2QDNA 4AVBA 1QMJA 4WVMB 2WT1A 5DZEA 2FZ2A 3PJQA 3GALA 4PBOA 3CJIC 4KU8A 4YG6A 1MEC2 5T3NA 5BNOC 4XDQA 1V6OA 4E27A 4C1WA 1AR72 3MF9A 2QZ3A 2OYZA 2ZX2A 3NKTA 4YLZA 2HWD2 1KDMA 3RDIA 1R093 2I2SA 3V0AB 1DZRA 3AX4A 3LGRA 1HW5A 3ASIA 3GZTB 3OPZA 4C91A 4AI0A 1Q8VA 2EALA 3G7DA 1S0GA 5IK5A 1ZRCA 2DCTA 4OVEA 1R092 3VZOA 3WW3A 4ZU7A 4QQHA 4QPGC 5E1RA 5A32B 2RHPA 5BNPA 1X82A 2ZA9A 1B35C 2G4IA 4U36A 4EWEA 4CP0A 1BCXA 3WQ1A 3WG3A 1URXA 5BNQA 4COVA 1O3RA 2BW8A 4IEOA 3OBRA 3V65A 2O8OA 1FNYA 1HRV1 4UW5A 1AHSA 1RITA 2GC3A 1NA1A 5F6KA 2QE3A 3R4DB 3UJQA 4Q0UA 1EPWA 3AB0A 3VBRB 4F83A 3DPRB 4X8NA 3ST7A 2LUWA 4PIXA 1H2NA 1WLTA 1H0BA 3SCGA 2R16A 4W6WA 3BODA 1KQRA 5BUVA 1SLTA 5GLUA 2WLPA 3A0KA 5H9RA 4C0BA 3HD8B 1PIV1 1DQ2A 4NVPA 1KD7A 4B7EA 4YZ1A 1FV2A 2WS92 5T5PA 4AVSA 1ZZBA 3VBUB 5FDBA 1ND2C 5FFOC 1CAWB 2EIGA 3PTYA 5JOXA 2D3SA 4AQTA 1MEC1 3LAGA 1AR71 1TE1B 1TEIA 2XKOA 4XF9A 3APBA 1IZ3A 1DIWA 4MV2A 1VBC2 1H2LA 2JENA 3WG4A 1WCKA 4D94A 4Y22A 2EAAA 4NOTA 4HL0A 4FPFA 1HKDA 2TUNA 3EBRA 4I01A 3S7IA 2R063 2AYHA 4AHWA 2P34A 2AZ5A 2D40A 1Z7S2 2PAEA 1DGRA 2X5IA 4QQLA 3FMGA 1S0IA 2CWMA 5FRAA 4UBGA 3VBFA 4R8HA 2D6KA 4QPIB 4YVWB 1ONAA 4HSJA 4K3UA 4LO5B 2RM23 3M3IA 4Q4X1 2X53S 3AYEA 3WG2A 2ZGMA 1S0FA 1CX4A 1WD4A 2R0FA 1O5UA 3LZZA 5AC93 5J37A 3GBFA 4N7UA 1FMD1 3IT8A 4FOYA 1GZ9A 4URTA 4CDQB 1IPJA 2WT0A 2RS51 4Z2WA 4OZXA 1R083 4I3GA 1B09A 4BCUA 1GQHA 1IKQA 5AC92 3ZIXA 2E53A 2N7GA 5TSWA 3VHPA 1SLCA 1UPIA 3TWIA 3VKFC 3LA3A 3FBYA 2WS91 3AXDA 3FLPA 1LOBA 4NWVA 1AF9A 1E57A 1ZRRA 4S2DA 4B4PA 1DGWA 3AP7A 5FTTC 4ISRA 4FO9A 4Q0VA 1SCRA 1LGCA 2GC2A 2AREA 3HT2A 4Q27A 3X29B 1AXYA 2ZHLA 1VBC1 5JZGC 1MS0A 2DUQA 1J59A 4NWWA 1Z78A 3H1MA 4LBLA 5D8AB 3UK9A 3O12A 4A3XA 2XJVA 3FWEA 3ENRA 2P17A 3R4UA 1Z7S1 2VOVA 5FO7B 4WM7B 2D43A 1VAVA 5KXDA 4XFBA 4AVVA 4S2FA 5GALA 2I07B 3VZKA 1FI2A 3J4UH 2R041 5JOZA 3UV9A 2D3PA 4CEWB 3I2DA 3Q9OA 1N3QA 3AMPA 4CEYB 4NHKA 2C5DA 4BE3A 4PF5A 1RUJ3 5JIUA 3NV3A 4ONUA 3RJRA 5HCAA 4P9LA 3FBMA 2HWC3 3WNXA 2PYTA 3RYKA 3TRSB 3ZXAC 1YRZA 2GAUA 1AYM1 2D93A 2UWCA 1RUJ2 3D0SA 2X29A 2A70A 2XVLA 1J3RA 4BA6A 4OUMA 1SFYA 3RJ2X 2JG9B 1HX6A 3OY8B 1WGPA 3ZFFC 3ZFEC 4RL7A 4JRAA 1AR61 1QOTA 2I74A 4FAGA 2ARXA 5CFCA 3DN7A 1IGOA 2Z2SB 4AGRA 3NJZA 2NN8A 3QBQA 4BM8A 4P9IA 4WVZA 1LCLA 3ZFGA 3FE5A 3CO2A 1G7YA 4HK9A 2PHTA 2R6QA 1SDWA 5SV8A 4XQ4A 4D7SA 1EYBA 1PO13 3M3CA 3H3ZA 1WCSA 3B7MA 1BMV2 3UKVA 3ZXKA 1W39A 3FLTA 3QOPA 1BEV2 2Q30A 3WT3A 4GKYA 1X8MA 1MVQA 1NCQA 2B45X 1PO12 1DU3D 4X8PA 2R30A 1DG6A 2F6BA 1O4ZA 2YY1A 1FOD3 3VL8A 3AZWA 5BNPB 5F6LB 1OOPA 3EO6A 2R1DA 1HDKA 3ATGA 2PHWA 1LU1A 5H9SA 3E5QA 1BXHA 3OD4A 4LUMA 1FOD2 2UU8A 2QKDA 3ZSLA 2E6VA 5CA6A 1PGL2 4G9SB 1NA1B 3AM2A 2CV6A 4FOVA 3ZN6A 2XJPA 2MEV3 1O3TA