3O1OA

Iron-catalyzed oxidation intermediates captured in a dna repair dioxygenase
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
201
structure length
201
Chain Sequence
PLAAGAVILRRFAFNAAEQLIRDINDVASQSPFRQMVTPGGYTMSVAMTNCGHLGWTTHRQGYLYSPIDPQTNKPWPAMPQSFHNLCQRAATAAGYPDFQPDACLINRYAPGAKLCLHQDKDEPDLRAPIVSVSLGLPAIFQFGGLKRNDPLKRLLLEHGDVVVWGGESRLFYHGIQPLKAGFHPLTIDCRYNLTFRQAGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Alpha-ketoglutarate-dependent dioxygenase AlkB
publication title Iron-catalysed oxidation intermediates captured in a DNA repair dioxygenase
pubmed rcsb
source organism Escherichia coli
total genus 47
structure length 201
sequence length 201
ec nomenclature ec 1.14.11.33: DNA oxidative demethylase.
pdb deposition date 2010-07-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.590 Mainly Beta Sandwich Jelly Rolls Alpha-ketoglutarate-dependent dioxygenase AlkB-like 3o1oA00
3S57A 4QHOA 4JHTA 5F8PA 3O1VA 3BIEA 3T3YA 4NJ4A 3BTYA 3H8RA 4NIGA 2FDGA 3I2OA 4O61A 2IUWA 3BTZA 2FDHA 3O1PA 3O1TA 4NPLA 4CXWA 4QKDA 3RZMA 3BU0A 3O1MA 4IE5A 4OCTA 2FDIA 2FDJA 3RZGA 4RFRB 4NRMA 4CXYA 4NIDA 2FDKA 4IE7A 4QKFA 3RZLA 3KHBA 3O1SA 3I3QA 3O1RA 3S5AA 2FDFA 4ZHNA 3I49A 4IE0A 3BKZA 4NRPA 4ZS2A 3RZJA 4MGTA 4QKNA 3KHCA 4QKBA 4IE4A 3BI3A 3I3MA 3H8OA 4IE6A 3LFMA 3T4HB 5DABA 4CXXA 3RZHA 4NRQA 3O1OA 2FD8A 4NPMA 3O1UA 4NIHA 3H8XA 4NROA 4MG2A 3BUCA 4IDZA 3RZKA 3BTXA 4NIIA 4ZS3A 4O7XA 3T4VA
chains in the Genus database with same CATH superfamily
3CZJA 3A21A 3WUCA 1D7PM 4P9IA 4WM8A 1DIWA 2RM23 2VTFA 3WF4A 3CJIB 1YYNA 4GB33 4BWOA 2GP5A 1BEV2 5LRSA 1CAVA 3T0AA 3IIIA 4PJYA 1ASJ2 2VZTA 5JSOA 1JU3A 2WQZC 4KBZA 2RDNA 5CIRA 1SDDB 5FYBA 2QE3A 1JBCA 3MIHA 1U5IA 1JYCA 4Y5Z0 3V56A 1S4CA 2LS6A 1BVP1 5CYYA 4AI8A 1BXHA 1NAEA 3FX3A 2WZ8A 4KGQA 1V6IA 5EIYB 4ASMB 1W3VA 2DURA 4MGSA 3G6JB 3J8F2 4W6YA 3PUIA 4Y5SA 5A7NA 4CP0A 1ZRRA 4QDRA 5FZMA 1FPN1 4YARA 4JX0A 5F5AA 1C57A 1XNKA 1IG3A 2TEPA 2GC3A 1YQ6A 2IFRA 3GCWA 3GCXA 5FPUA 1PZ9A 4XABA 1RUG1 3AKSA 4DMIA 1MVEA 5E89A 2DVDA 5HXVA 2OPWA 1GZWA 1ZBE1 3LEMA 1NY72 1BMV2 1KJRA 4FQZA 2WS91 4A4AA 2J22A 4RR3B 5IVFA 2Q1MA 3PNAA 4JDNA 2WQ4A 2HWE2 3H9AA 2YC0A 2A6ZA 1MPXA 4S2HA 4CDQB 3VKOA 5D1IA 1CD3G 3OPZA 3O1SA 4OI2A 4GALA 5FZOA 3WVJA 2C5DA 1AX2A 1DQ1A 1TG7A 3CZUA 4XF9A 1KRIA 2K2SA 1JZ5A 3RRDA 3UKTA 3J4UH 3JD73 1MZEA 1MS3A 3T0DA 1F35A 1WMEA 1W99A 5EZWA 1DGWA 1UXXX 1Y9MA 2PMWB 3KV5A 2UYAA 3QH7A 3TN93 4A7YA 4UYBA 1YJLA 3NJZA 3J7LA 4ZS2A 1H2NA 3AYDA 1RUE2 4HL0A 5A33B 3JCIA 1NCRA 4RL7A 1I5PA 3LKJA 3WG2A 5JOWA 2VNVA 4MYEA 5BNNB 1I6XA 4LA3A 2XLFA 1RTVA 5EJ3A 1U5ZA 3AB0A 4QKBA 5ACA2 4LO5B 2MPFA 2ORZA 3NKTA 1H1AA 2QQVA 4IXLA 2YC2A 1JZ4A 4JGZC 2IZWA 4YYOA 1RUOA 3MV01 3ZFGC 1GZCA 2OA2A 1SZBA 3SNMA 1RIRA 1CX1A 1ZX5A 1PGSA 2WWJA 4CDXA 3VHOA 3OGRA 5E88A 2WAAA 4AWDA 1EV11 2JG9C 1ACCA 3ZXJA 2VPVA 2IXIA 4UF0A 3LIGA 1TQ5A 2A3WA 3THTA 3VGIA 5KXBA 2W52A 4YM1A 5GLZA 2J1EA 3SH4A 4KNCA 3OEAA 1QJX2 3WX5A 1TME2 4RGKA 2PAKA 4Q26A 5LA2A 2ARCA 2YHJA 4GAZA 4IDZA 3VKFC 2LTNA 2VMDA 1RUC3 2ZHNA 4Q4X3 3ZR6A 2JB8A 3I8TA 2QQWA 3QD6A 5HBAA 2VUAA 4Y1ZA 4Z8BA 2XKOA 1W8ZA 3VZNA 1O3TA 5F3IA 1J3PA 2NMOA 3V65A 4O65A 2Y6HA 2D6MA 2NMNA 4XPVA 4C90A 4YZ2A 4BYYA 1REDA 3WNLA 3WP5A 4JZRA 1RHI3 1G8WA 5L7OB 2O1QA 3VZMA 2VOKA 2BU9A 3AK0A 4AEDC 5F5QA 3ACIA 5JR7B 5EV7A 3I59A 3L9JT 4I3GA 4OI4A 1I3HA 3SH3A 5L36A 4YGDA 2ZABA 2ORXA 3DL3A 3RMYA 2JG8B 1UOJA 2VAUA 1US3A 3FUOA 1WBLA 1HXS2 2JENA 3D82A 5FZEA 2OUHA 1BZWA 4WM8C 3A4UA 2D6OX 1I5ZA 4CCDA 1WCQA 1UXZA 4E27A 1IGOA 2WO2A 4NE9A 2E7QA 1SLIA 3JBG3 4PLOA 3VZOA 1GFF2 4N43B 3RGBA 4K1YA 3H8UA 4WZFA 2BERA 5DDJ2 5EWSA 4XDPA 1PHMA 1UCXA 2RJ2A 4AQ6A 4AE2A 2PQSA 4CXYA 1U12A 4I0BA 4UOJA 1YO8A 3IN9A 2XJSA 1D4M3 4QPWA 3WQ7A 2EIEA 4AFAA 5A3LA 1Y3TA 2PN5A 1GWMA 2BBVA 4Y4YA 3VDDA 3VHPA 3ZYJB 4I3PA 3Q8FA 1OFSA 1RUD2 3K4ZA 5KBFA 3S5AA 5KHGA 2WN2A 4XCBA 2VQTA 5LEKA 2PLV2 3ILFA 3KQ4B 1XYNA 3ZYFA 2R0HA 4ET7A 3POWA 1AR73 4WBBA 1PVC3 2EAKA 5DUWA 1WKYA 2GNBA 4C1XA 5CNAA 1X9TA 3GBGA 3P6BA 4XUTA 3DN7A 4S2GA 1SEFA 1GQGA 3V64A 2R30A 5AC92 3HNMA 1HRV2 1QQP2 1KD7A 1WLDA 4MOAA 3JZVA 5DUUA 1DG6A 5FLHA 5GJ6A 2XR4A 2NP0A 4AQ2A 2HWF2 4L8QA 3S5QA 3WF2A 5GKAC 2XL9A 3VV1A 1RMU3 3JUUA 4QWNA 3O14A 1X82A 2BRTA 1VBE2 4P5HA 3B7MA 1K45A 5FY0A 5C71A 4G4FA 1XU2A 3D4KA 4EZHA 5BNPB 3P5BA 5C4WB 3I2KA 5J3UA 4WVMB 2XDVA 2Y33A 4CUBA 1O8SA 3E5UA 4NVPA 2ZX3A 3ZSLA 4B7EA 1JTZX 1OOPB 3WD5A 3BOWA 5B4XA 4D6SA 3RZHA 1YIPA 4Y1VA 3SMHA 3P3NA 1HX6A 5EPAA 3CJIC 2VVFA 5A3UA 1LGNA 5C6CA 3VD7A 4ES9A 2ADDA 1GSLA 4GD4A 3CHXA 4I02A 4LQRA 3O5SA 2VZOA 3BIWE 2L9LA 3RZKA 4NHXA 5FUNA 2WYSA 4AHXA 3RQ0A 4BQ3A 4LTAA 2W1UA 2D40A 1AXZA 2VUDA 3NAPC 5A3OA 1LR5A 3D0SA 4K8RB 4M00A 4LORA 4QD2A 1PO13 4WV8A 4AGGA 1XQNA 5LY2A 2DU0A 4LO7A 1EAH2 4P9GA 3WINE 2QQOA 3T4VA 4AGVA 3KCXA 5DG1A 2BGPA 1FT9A 3AL6A 3VHRA 4CDXC 2VCCA 1LEMA 3OF1A 5JI9A 2OPKA 2DDUA 2P3JA 1H2MA 2ZGTA 2A3YA 1SPPA 1UOGA 1ZA4A 5ANQA 5H9SA 3ZFEC 4ZZ5A 2V4VA 1HKDA 1YI7A 1OVSA 1LB2A 3H8RA 4FT8A 2FMDA 4XBQA 5A7WA 2GSYA 3VBHB 1V70A 3LA2A 3BGAA 1LAJA 2FDHA 1H8VA 5DZEA 5IWFA 4UI9L 2X5IA 4DO0A 5B2GB 1CIYA 4YWAA 3ZIWA 1ZM1A 1ZBE2 5CEHA 4RR3C 2DTWA 2JD9A 5I0RA 1UY2A 1ZNPA 4CUAA 3W5MA 2VMHA 2QJVA 2VH9A 1W90A 2VGDA 1UPIA 3UJOA 1XNBA 1JZ7A 5A80A 1VLNA 5FP9A 5FZ9A 4CDQC 4QB6A 4XUOA 4YZ5A 2JEMA 5A1LA 4XC9A 2C24A 1ZRIA 2DTYA 2QFEA 4QXKA 3V0AB 4G9SB 4OHVA 4ZU5A 1O3QA 3LDBA 1ODMA 1RUF3 2VZSA 2MEV3 1N1SA 3FHQA 4UW5A 4YG3A 3RVHA 1NT0A 2EICA 1I9RA 2D43A 1QGLA 4YFWA 1PGW1 3HN1A 3WNNA 4A2UA 4OI0A 4MADA 1AF9A 2HWB2 4P9LA 3MDPA 3WF1A 1FV3A 2RS31 2A3XA 2WKKA 5CBLA 4IGPA 5I0UA 1IS4A 4INDA 3VD5A 3OTFA 4LUKA 3O1RA 2DVAA 1XE8A 1UY1A 2WDBA 5I0TA 1Z7S3 4AF9A 4D7SA 4DINB 1L7QA 4FFGA 1PM4A 2VXRA 5EYYA 3RI8A 4LE4A 4K6BA 3ZMNA 1B35A 1NLQA 1XYOA 3IB3A 4WM7A 5BNNC 2W1QA 2WFF2 3T1MA 1DP0A 3O0XA 5C8WA 1H1IA 5BYNA 2UYBA 1RUC1 2WNVA 2ZOEB 3IZOA 4HN1A 3RZJA 1JS9A 1VMHA 3FBMA 1AHSA 4WZCA 4BXSV 1XYPA 2JDMA 3DEMA 3KGLA 3ZOIA 4BK5A 3GF6A 3NNLA 4NR1A 1JI6A 2PHFA 3D3AA 1DYKA 4IESA 4WVVA 4DEVA 4PHZA 2YYOA 5JUVA 3NVCA 3C7OA 3FZ3A 2EXJA 3NKGA 1C5HA 4LBQD 3QBQA 4LBOA 2XBO1 2YBKA 2EAAA 3FN9A 3MIBA 4EN9B 1EV12 4JKMA 4ZXEA 4DRVA 4AL9A 1OLQA 1TZOA 1L3JA 4UFJA 4D94A 4D0QA 2Y26A 1YI9A 1A8MA 3VKLA 4V1PA 1UY0A 4XFBA 1VMFA 3M70A 1V9U1 3MGUA 5C9AA 4CDWB 2QQPA 5JXJA 2TUNA 4AAXA 1SFYA 1WLTA 5BNQA 3TEZA 2WLPA 3R4DB 1QKQA 1G9AA 3MUZ1 3T09A 5BNOC 3IAQA 1FXZA 1N3OA 2XJTA 1XXNA 3NQHA 1CWPA 4OZOA 1VRH3 4KU7A 2D98A 3NNJA 4BQXA 1OT5A 3IPVB 3VBOA 1XRUA 2Q8DA 4DUXA 3NV2A 4AFBA 4K1ZA 4I09A 1GOGA 4YW3A 5DUXA 1VAMA 1G9FA 5JZGA 4LT5A 1H6XA 2GAUA 2LALA 5JSRA 1FNYA 2CU5A 3W58A 1J83A 5F2WA 3KGZA 3TNQA 2WWSA 2JG8C 1XE0A 1R083 4EWEA 3J7MA 2JDUA 3BIEA 3SCFA 3HT2A 3I2HA 1X9PA 3MLLA 3N7KA 1UX7A 2DVGA 5FPVA 1IPSA 2IXHA 3BTZA 1UF2C 4AVCA 1AR71 1TMF2 1PVC1 3HNBM 1BK1A 3H3UA 1QDOA 2CWSA 3ZXFA 1VBD2 2RDSA 3N9PA 4GIQA 1J3RA 1HV1A 1MZFA 5I8TA 4LBNA 1NA1A 4RHV1 5JOYA 5K0UA 1UKRA 3O12A 1HLCA 3JB4C 4N53A 4ISRA 3WHTA 4QM9A 3ZKYA 3HT1A 2HEYF 4JCKA 1RMU1 3D8CA 3T30A 1CAWA 1RUH1 2QQIA 1MACA 4M4RA 1Y4WA 4QX2A 5FYSA 1U5YA 5I91A 1JYIA 4CCJA 1V6MA 4QDQA 3PUSA 3POBA 1F31A 3ST7A 3SHRA 5CFDC 1VBC2 4NHLA 1OA2A 1QJZA 4X6QB 4X8NA 3KHBA 2HBUA 4BQWA 2A73B 1PK6A 3GZTB 1R092 1S0DA 1I1EA 1GR3A 4FCAA 4Y20B 5FPXA 2E6VA 3AMQA 4R9AA 3VBUB 5LWBA 2FDFA 1WCSA 2LM3A 1LECA 4K7JA 3AJYA 2D6NA 4YG0A 5FFOC 1W0PA 3NRUA 5FY7A 4AHZA 5LBEA 1LU2A 5A32A 3ECQA 1UMHA 1GNZA 3Q9OA 2ZAAA 1HB3A 2B9VA 3KWVA 3TNPB 1T2XA 1SCSA 1RVF1 5FDBA 1W6PA 2VZRA 3VZLA 4D8MA 4J1XA 2QCSB 4TSVA 1POV0 2P2KA 4FPJA 3AP7A 1YEWA 3MW2A 4W8JA 2OX0A 1MEC2 2ZGUA 1NE6A 1QXJA 4HBNA 1AYM2 1ZBA3 4XIKA 4NWVA 5FP7A 2VM9A 3VBFA 4DXSA 2C9KA 2ZX2A 1RB8G 1AR91 2H6BA 4QPYA 4E9KA 3MEPA 3EO6A 3ETPA 2ZJCA 4KWLA 4PLNA 2A6VA 2PA7A 2UWCA 2YBSA 4P9WA 2Y0OA 4CEYA 5DMYA 2AGSA 2YBPA 1MS4A 2JDKA 2XMLA 2WT0A 4FFHA 4R52A 4WM7C 1Q5OA 1C4RA 1O5UA 5FZIA 2NLRA 1JH5A 4COWA 1QDCA 2WNVC 4ORFA 3V0BB 2XOMA 4A7KA 1H0BA 1AR61 5GALA 1ALYA 1V00A 3LPFA 4YZ4A 4YGCA 2AYHA 5DZGA 4YW2A 1QOSA 2R6QA 1GZ9A 3PIGA 4PF1A 3H8XA 3CQOA 5FXVA 1FV2A 4H2AA 2YG0A 3KF3A 1W6QA 4LA2A 4AGRA 1O59A 1KEXA 1OQ1A 2GH8A 4CP9B 4XQDA 1LGCA 2ZPXA 2WYFA 4QMAA 5IK4A 1ND2A 4K20A 5FZ4A 1W9TA 5LEJA 2Q8OA 2D6KA 2DVBA 2OXBA 2VMCA 1ONAA 2VBDA 4HONA 3VBHC 3E6CC 5FAXA 2MEV1 4OHZA 5JVVA 3U4SA 1ZZ7A 2V4AA 2P3IA 2W46A 2ZX0A 4CUCA 2ZGMA 3OYWB 2VCAA 1O4YA 3PTYA 4PDWA 5F9TA 2B8MA 2JDHA 2RS13 4YZ3A 4KQ7A 1PGL1 4CDUA 2WC2A 1Z7S1 4D3WA 3MIFA 4LUMA 4XMIA 5F3GA 4FOQA 5FOJB 4FO9A 1M4WA 3AMHA 3QCWA 5IVYA 1W2NA 4JGZB 4XTMA 3OGGA 2Q5TA 3AZWA 5GLUA 5BPXA 1UYXA 3S6PA 3VBOC 4TWTA 4LKFA 2E53A 2IC1A 3M3QA 3VLBB 3BOPA 1DLLA 5EFUA 4IEYA 4LOTA 2JG9B 1QNWA 1FYUA 3NV4A 5FPBA 2JDPA 1JZ3A 1LESA 1HRI2 4XUQA 2P6HA 4QKDA 3HVDA 5FZ3A 2BDRA 5IK7A 2YZ4A 1C8M3 4EN0A 2ZX1A 4XHBA 5JSPA 2RS32 3AFKA 3OB8A 4IE5A 1W28A 1YQCA 4QX0A 1OSGA 1F5FA 3I97A 3PVOA 2HWB3 5FZ0A 3ZXGA 1KGYA 4QQOA 2O0OA 2OQ6A 2Y60A 1GP6A 3EQEA 2PAEA 2AH2A 3ON7A 4L9BA 1NCQB 5SV8A 1BLZA 2Y6GA 4RD7A 2Z4FA 4XZPA 1Y9GA 4AXOA 4EE2A 4Z82A 2Y64A 2DUPA 2HWC1 1CJPA 1EUTA 2CSGA 1NA1C 3H1WA 5K0UC 1OQEA 2QVSB 3I2DA 3MHZA 3FFQA 4EWAA 5LY1A 5CFCA 1CZTA 3ES1A 1J59A 1CESA 1DLCA 4FOYA 2YU1A 4LULA 2RMU3 3PUQA 1ZZ6A 2ZGPA 1B09A 4M3CB 1CAXB 5FYUA 1VRH1 3NJVA 4FPKA 5FBZA 1PO21 2VJXA 3HQXA 1IHMA 2F4LA 1ND3B 2XBO2 2VC9A 4QPGA 1AL23 3M3OA 3TYJA 1AYN2 5FMOS 4E8DA 1JYXA 1DF0A 3S7IA 4BMEA 1Q8VA 4GJYA 4WVZA 4DQAA 1PZ8A 2ZAHA 1WMFA 4WM8B 1RUJ2 4LITA 1BQPA 1CAVB 2AACA 2P34A 3KT1A 4CDWC 1R081 2AC1A 4IETA 1V9U2 4IUGA 4HKLA 2WNUA 5E6HA 4DZGA 4Q1RA 1VPHA 2WRAA 3VZKA 2VW1A 4CYDA 3WXPA 1OD5A 2DF7A 4TLFA 1IG0A 1W2TA 2R49A 3N9QA 4LJHA 1M06G 3OPWA 1RC6A 5IK8A 3KCYA 2A75A 3HBKA 3BCWA 3KS7A 2ZKLA 1WW5A 4HK9A 4W6XA 4XACA 4LIVA 2WIIB 4QQPA 4E2SA 1YWKA 2WT2A 2ZHLA 4S2DA 4EN6B 1W8WA 3ACGA 1FMD2 2E9QA 1HDKA 4GWNA 3KSCA 2WA4A 4W4ZA 2RV9A 2VNOA 2VUJA 1GZWB 1N47A 3C7FA 4FPFA 3UT0A 1F4AA 4FPCA 2BEOA 2ET7A 2VE1A 4M0NA 3A22A 4PIXA 2CV6A 4Z2AA 2KM2A 5L9RA 3ZXEA 3FMGA 5LA0A 1LOCA 3FLTA 4H3WA 3H3LA 3IMNA 3HPNA 3KV4A 4A44A 5FZOB 3POGA 4M0HA 2GMEA 1VBB2 4RHV2 4HVRA 4MHRA 3U78A 1DGWX 1RUI1 2VMIA 4UFIA 3PTRB 1VBD3 4P9JA 3SITA 5FZ6A 5C7GA 1YQ8A 2VZPA 2ZEZA 1REFA 3O1TA 1RUH2 1OLME 3G7DA 3L2HA 4IV3A 4NHKA 2CAUA 4FXGB 3FLRA 1O4ZA 3ZFFC 3BTAA 5C8CA 5J1XA 3UNPA 3VB9A 2F4PA 3CLPA 1HQLA 3RJRA 3EXUA 2E7AA 4V2WA 3PDQA 4BQ5A 4E4HA 2PTMA 1JW6A 1ZA7A 3RZMA 2VNGA 1R1A2 1MQTA 3LSEA 1FNZA 1GLHA 2WNOA 5KC6A 4CDUC 2ZHMA 4OZXA 3VBUC 1NE4A 1W8FA 3WNOA 4B4QA 3NAPB 5T5LA 2WL1A 1FOD3 4SBVA 3K2OA 4EQVA 4QKFA 3RZLA 1FAYA 3B9CA 4MO3M 3OUHA 4JRLA 4QX3A 4COZA 4CDXB 2C9AA 1KDKA 2GC0A 2R071 2OKXA 5JPMB 4ITCA 1RVF2 3LPGA 3M2MA 3DXUA 4PT6A 4MGYE 4ZHNA 2ZGQA 2YV8A 4ZONA 3FWEA 2DCYA 3ZFEB 4ASKA 4CU7A 4OUMA 2R32A 4Q27A 4MHUA 5KXDA 4XJAA 4RQPA 2R7EB 2BP6A 4FFFA 1S0FA 2R061 1MR5A 3M3IA 3EJKA 3APBA 3MI8A 4R9DA 1QJU3 2BWAA 2WZPP 1DDLA 1AR92 1DZRA 4FXKB 1WA6X 1ULGA 4MXWA 1MEC3 5FWJA 5FIXA 1YFXA 4BDVB 3CEWA 3WSOA 1DGRA 4FPHA 1JXNA 4K9SA 2VBBA 4XTPA 2Q1ZB 1DBNA 4QPIA 2WZR1 2RS11 4Q4V2 1GU3A 3RFRA 3WQBA 3DKQA 5JAXA 2Q30A 4IV1A 1DZTA 2CHHA 5T5JA 1AR62 2I2SA 4OMCA 1N3QA 2CAVA 3OGVA 3RZZA 1AR82 3O0VA 5A3NA 3NJXA 1UYZA 4JTNA 4XVHA 2ES3A 3MLKA 1HV0A 3R4SA 4IE6A 3UYJA 3I59B 4TTGA 4DUWA 1S55A 1VRBA 2HWD3 5AFBA 3VDAA 5LBBA 3VN4A 4YGBA 1UYYA 2XL7A 3AM2A 1DZQA 3THCA 1UY4A 4COVA 4NROA 4YPJA 4C1WA 5FQ0B 3RI9A 5A6ZA 3VKNA 1COV1 1E5SA 2Y6KA 5F5CA 1F2NA 4CP1A 1DHKB 4QHBA 3RYKA 2B46X 3LGRA 3QOPA 5FZHA 4JHTA 4BLIA 4CU9A 4Q4Y3 4HMZA 1OD3A 2W47A 4EN7B 5KXEA 3CMGA 2BVVA 4JGYA 3KCCA 3DYMA 3ILNA 4XFCA 2ZZJA 4AI3A 1G9BA 3MIDA 1NZCA 2VZ1A 3T3YA 2JECA 3GHMA 4XETA 1PIV3 4HPKA 1UIKA 3VDDB 1LHNA 5FZGA 3VD4A 4NIGA 5FUIA 1QJY1 4FOVA 1BBT2 1OBNA 1REEA 1ZZCA 5I8SA 2RMU1 4H7MA 2OUJA 4D7TA 4EWDA 3AP6A 2E26A 4ZU7A 5C33A 1W06A 1GZTA 3MFAA 4FPLA 4L0PA 2RS51 5FCCA 3M7AA 1YUDA 4P08A 1QY4A 2W3JA 1AL21 5KHHA 2VW2A 1EYBA 4M01A 4R9CA 5I0SA 3M4FA 2WAOA 1NCQC 2VTXJ 5FYCA 4CXWA 2PXJA 2W9XA 4GKXA 4E2QA 4LMFA 1UL9A 3VDCA 5BNOB 1W6MA 3O1MA 3WW3A 1E5RA 3WQ0A 1UMIA 3C7GA 4GQ7A 2HWC2 3MF9A 2IXLA 1GQHA 4P00B 1OH3A 5T55A 2WNEA 3LF7A 4HG6B 3WF3A 1PVXA 2F17A 3J9SA 3S30A 5LBFA 1TEIA 1NYWA 4IE7A 4LR4A 3OGJA 4OHYA 2BFUS 1ND3C 1JODA 3I3QA 4DXZA 2W08A 5IFTA 2ZGRA 1PO22 2KR2A 4PQ9A 1JN2P 3WDYA 5F5IA 1S0EA 2C0ZA 4Q4W3 4D6RA 4NHYA 1OLMA 1UU6A 5C8CC 3BB6A 2FZ2A 3DPRA 4PF5A 4I01A 4IERA 1PX4A 2GNMA 2JE8A 4FSJA 1JOPA 4QB1A 1J3QA 2VQUA 1J1TA 4AVVA 3VBSA 2DFBA 3P1IA 4OI1A 3MF6A 1EUUA 2LW8A 2W95A 4JV4A 4YW4A 3ZYBA 1CX4A 3WHUA 4NAOA 2WWUA 4AG4A 1WWYA 5FY9A 1GICA 4NAMA 5DXDA 1KS4A 3ZX7A 1SACA 1UO9A 2KA3A 4ASLA 4QKNA 3USUA 2ZMLA 3H1MA 4GWIA 1OMIA 3BODA 5HV0A 2BBAA 3U10A 3U1XA 3MW3A 4ES8A 5ACA1 3AKQA 1DQ2A 3A0KA 5D8AA 2EF6A 4HANA 5FZ1A 3LB9A 3IAPA 5H9PA 3CKHA 1SPPB 1WA4A 4BOWA 2CGPA 1LHUA 3PIJA 4GMP3 4HVQA 3LZZA 4TLGA 2R043 1MZ5A 4GH4A 5A7WB 4CEWA 5D2AA 2WO3A 1YRZA 4Q2FA 5CFDB 4QT6A 5BXXA 4XILA 3O0WA 4QQ2A 2VTXA 3U0ZA 1SLLA 2X5IB 1WLCA 2BNNA 4HSLA 4PCRA 4ATFA 5JXHA 5LW9A 4NPMA 2RM21 3VBRA 4GB31 3BUCA 1ZRDA 3T08A 3KM5A 5DAVA 1CPMA 2Z42A 3ZPOA 5F3CA 1J1LA 2HEWF 3ASIA 3WDTA 3X29B 3BTYA 2IWGB 5JMOA 2AUYA 2RR12 4IV1C 3K3OA 4QHOA 1CQ9A 1SFPA 1HN1A 2HYXA 5D21A 1O3RA 1GOFA 1Q8SA 4KWJA 2XJUA 5HCHA 4OHWA 1VBA3 1FOD1 1RUI2 1IPKA 5IAVA 5IYYA 3AC0A 1NKGA 2BNOA 3MPBA 3IBMA 3T2TA 2XB6C 4IGQA 5FWEA 4JAAA 4A45A 3CDZB 4MV2A 2BGOA 5ABJA 2TNFA 1XBFA 3ZN4A 2HEVF 1W6NA 1NCRC 3SKJE 3LFIA 2ENRA 2ZA9A 1MS9A 3VKMA 2F6BA 2OZ6A 2Y6JA 1MS0A 3WW4A 3R4UA 1B35B 4WM7B 1APNA 3ZYGA 4CUGA 4HXCA 3FE5A 1SG3A 3PMSA 1BKZA 4E4SA 2EIGA 2WNVB 1BEV3 2QUOA 3C7HA 5CKNA 4LEJA 1ASJ3 3KB5A 4JVAA 4RS5A 3DYOA 2D93A 1G86A 1V6KA 1X7NA 2MNGA 3N35A 4UAPA 4OFGA 2VCMA 2X53S 5DN2A 1R1ZA 3OPTA 4Y1UA 2BVBA 3N3HA 4UFMA 2OZJA 5GLWA 4FTSA 1AJOA 1FPN2 3PMEA 2R072 5FZKA 4R4ZA 4XFHA 1E5HA 1CGPA 2J1SA 3J8F3 2YFUA 3JD71 5GZFA 2ZACA 1D0GA 4XAEA 1RUG2 3GDBA 3U07A 1GMMA 1QWRA 4JDMA 3GNEA 3TN91 4AYUA 5FZCA 2R062 3AP5A 5C9AB 3PU8A 2G19A 1FX5A 4XQWA 5HI0A 2WS92 2V72A 1F4HA 1RJ8A 1VIWB 4TN7A 4KU8A 2JIGA 2EXIA 1IKPA 3C3VA 5HCBA 1SLBA 2WZR2 3BKZA 4A3XA 1ZRFA 1CR7A 3EMRA 2D6LX 3OD0A 4KBBA 3VBOB 1WGPA 3A7QA 3WF0A 5LK7B 2BUKA 2HWE3 2ZEYA 5JZGB 1KS5A 4OMDA 5KXCA 4A41A 1T6BX 1CVNA 4NPRA 3PU3A 1LHOA 4E4DX 3ZIXA 5A3MA 3INAA 3N36A 5EQUA 2LROA 1PIV1 3DPRC 1UYPA 2VNRA 2V73A 1OPOA 4LHLA 4Q0SA 2WINB 4MVTA 1AUYA 2BV4A 4N8MA 3PUAA 5C4WA 4A3ZA 2JIJA 2XVGA 1XNDA 3UJQA 4B7KA 4Q4X1 1COV2 4QGNA 4RYDA 1RUE3 2W1SA 1GANA 2VZQA 2RDQA 1OOPA 3DGTA 3O1UA 3URFA 2XJVA 1NA1B 1O91A 1POQA 5K0UB 3IKWA 1OUXA 3AZZA 2OT7A 4RSUA 5GZDA 4N53B 1ENSA 3RS6A 5F39A 5ACA3 5FYTA 1STMA 1TNRA 1A3KA 4FI9A 4WVWA 1RHI1 4YW5A 3VDDC 3IM0A 3OOXA 2VO5A 2K46A 3S57A 2DCTA 1G9DA 3GJBA 3JXSA 4XMAA 1LKNA 5FZ8A 3A0NA 1OLRA 4P9YA 3AP4A 3ME2A 3BVCA 4GH4C 1C8NA 2BTVC 3IIAA 1K42A 1LOFA 1XSRA 4NHMA 2JE9A 4JQTA 4Q0VA 4KGGA 5JOZA 5A1AA 2C4XA 2I07B 3S7EA 2ZGOA 4PBPA 1W0OA 2RS52 2HLEA 3OGSA 3OSDA 2CWMA 4Q4W1 5JCTA 1QJX3 1TME3 2E7TA 2NM1A 3HEIA 2Q8EA 2NZ9A 4UBGA 2FDGA 2PHRA 2WR9A 3Q8EA 5J96B 3NV1A 1VAKA 1JUIA 2VOVA 2WA3A 4GKYA 1OURA 5A32B 3JBG1 4RGGA 2ZTNA 2Y8KA 2EVXA 1NXD1 2UWBA 3KV6A 4A6OA 3TEXA 4M4PA 4X6RB 4LXLA 1QJEA 1W6PB 1GNYA 3E5XA 2LRPA 4KMQA 5JXGA 2I45A 4BH9A 5DZFA 1D4M1 1UOBA 3BU0A 3KD4A 1ZZBA 3AZYA 3W20A 2FDJA 4AZZA 3QLQA 1ZZ8A 5BUVA 5LA1A 3VBFB 4BCUA 3ROUA 5K8SA 1CONA 1IS5A 3ZXAC 4EV0A 1CPNA 5A7PA 1UU4A 3KZ4C 4GMP1 3GZEA 3LSDA 2R041 1ULDA 4LHKA 2X05A 3WG1A 4HOOA 1DU3D 1HXS3 3RDIA 1LHVA 2WO7A 1JYTA 4C0BA 1W0NA 4E2GA 4CCNA 4Q1PA 5IVJA 5A3WA 3I3EA 4B1LA 4LLFA 3TRSB 4CE8A 1F5JA 1ZZ9A 5DQ0A 3ZXKA 4NIAA 2V09A 5JOXA 4LBQA 4NN0A 2UY9A 3L2YA 2VUCA 1W6QB 3GBFA 3IDEA 4XOGA 5DDJ3 1LU1A 2P4EA 2SLIA 2B5HA 4Q0UA 4BIOA 1W2AX 3E6BA 5FZDA 4XZUG 4QX1A 5FR3A 3AKPA 2D44A 4XFGA 1ND2B 2R16A 2VMEA 4UFKA 1EPZA 4F83A 2W91A 4Z92B 5CADA 3ZFFB 1BVVA 3FL7A 4ZKTB 3HD8B 4AVTA 4EYUA 2G9FA 3KHCA 4G3YC 3AYEA 5T5OA 1PMIA 1JHJA 1S0GA 5JI7A 1RUD3 4PDWB 3KT4A 2X5IC 4Y3OA 4AEJA 1WCDJ 4HLTA 5K4LA 5FBJA 1WW7A 2PLV3 4P14A 3B02A 4CDUB 1RINA 5GZGA 1DYOA 2P17A 1IPJA 2BW8A 2RM22 3N7MA 3WNXA 4GB32 5DG2A 2AREA 4N9IA 4O9GA 5G05L 5AC93 4ATEA 1HRV3 1QQP3 1W8HA 4LKSA 2PHDA 1HB4A 2CY6A 2VBPA 3POYA 4XXAA 1HQNA 1PO11 4XFAA 2HWF3 1ASJ1 4Z07A 1CZVA 2BOJA 4XW3A 5FYVA 5FXXA 1VBE3 2DBNA 3AXEA 2JB4A 3QH6A 3POJA 4OHXA 3ZYIB 3FUQA 2AENA 4O7XA 1BK0A 5GM0A 1LHWA 1OF4A 1L7LA 2DV9A 1ULPA 1VB4A 3B69A 3WQ1A 2VQ0A 3J8F1 4B8EA 5A6YA 1UY3A 4AQTA 4QU2A 3HQUA 4FOWA 1B35C 1ULEA 2VD7A 2FZ1A 4NO4A 3DCQA 4HSJA 3SEEA 2GZWA 1UU5A 5JIUA 1NG0A 2PHWA 1LOGA 4XXPA 3MW4A 2D3SA 4K40A 2W2IA 4L2NA 5FTTC 3H42B 5F2SA 3OBZA 3I2OA 3IDCB 3LEIA 4O61A 4YVWA 3T1LA 3W59A 2IUWA 5CFCB 1DQ5A 3M8LA 5IHRA 4ZPIA 4DY5A 3MUY1 4KH9A 4CU6A 4I2OA 3RJ2X 1EAH3 3ABZA 4E8CA 4QPGB 5DPNA 2VQAA 4GWJA 1RUF1 2D97A 2HWE1 4F8AA 3I4IA 4XAAA 3CU7A 3JD72 4LNVA 4DOUA 5FY4A 5KHIA 4FTBA 1RXFA 1H8TA 5EXOA 5C9AC 1LGBA 1W05A 2CDOA 3MIEA 4MLOA 1Q56A 4OCTA 5FMDA 3TN92 4DNYA 4DPNA 1XNTA 1EY2A 5FK8A 2QQKA 5HCAA 2JDAA 5A70A 5KC5A 2QQUA 4R4XA 3N7LA 1DQ6A 3WV6A 1LULA 5CZKA 1IOAA 1Z0HA 4YRDA 4YW7A 4C0HA 1CZSA 1GWLA 1AX1A 1ZBE3 5FMOL 2C26A 4CCEA 1WW4A 2YB7A 2D3PA 1RUE1 3JQXA 4D69A 4Y5TA 2XLGA 1UN1A 1PNFA 5JZGC 3N9NA 1LNSA 3Q8BA 5BY5A 2BGCA 4XBLA 2BJSA 5F32A 1OA3A 2DCJA 3ZVXA 4BZ4A 4N7IA 2EALA 1PGW2 3IT8A 3U37A 4IE0A 1AX0A 4XFIA 4CPBD 1QH6A 3MO4A 2OIIA 4NRPA 4AI9A 5JR2A 4QGMA 2DVFA 2KXLA 1YNAA 2VG9A 2XONA 3AVRA 4LO8A 4GZ9A 3UGHA 5EHDA 5H9RA 1XE7A 1K5MA 3PJQA 3RWNA 3ZKUA 4FAGA 2JKXA 3N9OA 5JPNB 2ERFA 2A6WA 2VZVA 3NWKA 1SFNA 3N9MA 3T0BA 5A7QA 3ACHA 4NOTA 2R1BA 3GZUC 4Q5OA 1CAUA 3FHIB 4HKWA 1GUIA 2JXAA 4XDQA 3HNYM 5IVEA 1UZ0A 4HT1T 1RUC2 2QQNA 4IE4A 4Q4X2 4QB2A 1JZ6A 4RN5A 1TVGA 3CF6E 4YNIA 3U4XA 4MGZE 4M3CF 2WFF3 1WMXA 2FCVA 2VMGA 4N53C 3OUIA 1S0CA 5APAA 1UPSA 3ILRA 3SISA 4AI2A 4UW3A 4XJZA 2PFWA 2B9UA 3RG0A 5I0DA 3KV9A 1RHI2 3O1OA 1U5XA 1PMHX 3H3ZA 3PVNA 4PLMA 2Z69A 2XWJB 4IV3B 4NIHA 3B3QE 4NMIA 4MG2A 5C8CB 2ZS6B 1V6LA 4KWKA 4BQ2A 3H0OA 4OQ8A 4A7ZA 1SBEA 2R0FA 2G1MA 1AVBA 1EV13 2CDPA 5IVBA 4PI0A 1MQTB 1E57A 1ST8A 1UD1A 1PK6C 2JX9A 2VOWA 3WNMA 1W9SA 4FP2A 1UOFA 3AKTA 2GDFA 4URTA 5LK5A 3RWKX 4AAPA 2IVJA 4XJ8A 1O7FA 1XPWA 1YC61 1ZYBA 2ZGLA 1JYWA 3UL2A 2D5HA 1H6YA 1LOEA 1V6NA 3UETA 2YPJA 4RGAA 1LOBA 3LOBA 3ZR5A 3FJSA 1HXS1 1LRHA 4HZFA 3WP6A 2RVAA 3JBG2 1OFNA 1J58A 3OY8A 2Y0IA 3HBZA 3ZDVA 5AFEA 3Q8CA 3AYAA 5K7PA 4MZUA 4Y1YA 4ZXKA 3BYWA 2FCTA 3LWCA 3I3BA 2Z2SB 4Q0QA 4UWDA 4X8PA 4B4PA 1DGLA 1HN0A 1W3XA 3HMYA 1RUNA 1D4M2 1WD3A 2BZDA 3VBFC 4W50A 5LASA 4NUBA 4JGZA 4YGEA 4XEZA 4CCOA 2GMPA 2GMMA 2YROA 3JB8A 4R8HA 3ZFGA 3ZXDA 2Q8CA 4MXWB 4CEYC 3LEKA 4EN8B 4YFZA 2YY1A 3K75B 1UZZA 2BYVE 4KG8A 1AR72 1RUD1 1PVC2 4AFCA 3K51A 2FDIA 3LA3A 4I0AA 3AXDA 2DCKA 2PLV1 2ZZQA 4IV1B 4NRMA 2D7FA 3NNFA 2SBAA 1TMF3 4XF1A 1OI6A 2XWBB 4IEPA 4YVWC 3POSA 4B3NA 4PBOA 4XDOA 4YSFA 1QQP1 3HWJA 1RMU2 3SQOA 1ND2C 2ATFA 2CNAA 3CNAA 2HWF1 2J1AA 2UY8A 2WSVA 2TBVA 1IQAA 1VJ2A 1VBE1 5LBCA 1HJGA 1NCRB 4PDWC 3DYPA 1H8TC 4Y22A 2C6SA 2Y38A 3AP9A 1ZBA1 4QX5A 2PHTA 4MGTA 4XBNA 1LJ7A 2VOXA 4AEDA 4Y4RA 1VBC3 2YGLA 2XPJA 4CU8A 3WP3A 3AMPA 2H6CA 4BPZA 1GP5A 3PUHA 4S2FA 1PZ7A 1TNFA 3E5QA 1R093 5FO8B 2E63A 3AMNA 2O8QA 3PLQA 5F6KA 1X33A 4DB5A 3BI3A 1ENXA 4AFDA 3CJXA 2FHRA 5JDBA 4HPKB 3H8OA 1PO12 5ANNA 3W5NA 1RL3A 4UF0B 5FLIA 1CN1A 2X10A 1NQJA 4YVSA 5IVCA 3VL8A 1NOVA 1L7RA 4LBLA 4DIQA 3RNSA 4FPOB 4HETA 3WDUA 4TZDA 5T3NA 1D2QA 3MLJA 1QHDA 1EAH1 1K5MC 4QU1A 2PQQA 3AL5A 4AEKA 1GQPA 1AYM3 3CO2A 2XQXA 1W6OA 4F3JA 1YQ2A 5FV3A 4AVAA 5L9VA 1PMJX 3WW1A 2XUEA 3H7JA 4YM2A 3GZAA 4LBKA 3EB7A 4Y26A 1ODNA 1W6MB 4ZU4A 5H9QA 5L73A 5LATA 2ARXA 3VZJA 3NW4A 2VXJA 2KD7A 4BB3A 2EXHA 1C1FA 5J37A 1EP0A 2BQPA 5CFCC 3GM8A 5LA9A 2WUHA 1OA4A 3SCGA 2GALA 3AZVA 3NV3A 3ENRA 3ZN6A 2HKXA 1U0AA 2X8KA 4QPGC 4LBJA 1VP6A 1DFQA 4N9HA 2CL2A 1RUF2 1RYYA 2MEV2 3DPRB 1WCUA 1S0JA 2YDEA 5KHJA 1FI2A 1A6CA 1C8M1 1OKQA 2ZMNA 4IEQA 1QXRA 5EYXA 4HKOA 1MS5A 5CG9A 1KFXL 4XE9A 1GP4A 3VBSB 3VUOA 1NQDA 2WNUC 1PGL2 1Z7S2 1EPWA 2HWB1 1G7YA 1K3IA 1UZWA 3C7EA 3TAYA 1SHWB 2BFUL 3CL1A 3WLUA 5FXZA 1AL0G 1S1AA 1ZRCA 5FJKA 4ZZ8A 3USUB 5F7UA 2W5FA 5IJRA 3LIHA 3J26N 4XJWA 3CJIA 4J1WA 3K4DA 1UKGA 3KVAA 5D8AB 2GN3A 1MS8A 1JZ8A 4C91A 2JWPA 2WFF1 1RXGA 3R0RA 3FC0A 2ZGSA 4L11A 3ZSJA 2XLAA 4AK3A 1MZ6A 1C5IA 4XJUA 3I3DA 4MXVA 4UW4A 1IS3A 4GH4B 4CEWB 3KQRA 4Q8KA 3WUDA 3NAPA 4BQ4A 2W0XA 2R1DA 1CIWA 2B45X 5IVVA 3IDBB 1KXGA 3I54A 4FTEA 1HRI3 2AZ5A 3ACLA 1A78A 1OHFA 3EBRA 5I8YA 1W8NA 4OUEA 5FMBA 5C3RA 4FPGA 2BPA2 3OD4A 2RS33 2VULA 3VBRB 1DGRN 1HB2A 3EHKA 2XJPA 3RMXA 3ZFEA 2VU9A 2P5BA 1LOAA 2P3YA 3C8XA 2Y34A 1GV9A 3WDXA 3JU9A 3BN6A 3GJAA 5F3EA 3H1YA 1IQDC 1ULFA 2Z79A 3I7DA 1F9KA 3W21A 2OW4A 5FYZA 3WDWA 1YCIA 2W68A 1HJFA 1QOTA 2VZUA 4GJZA 1W9YA 3KF5A 2J1TA 1T6GC 1NUKA 3WT3A 4BLJA 1VRH2 2E32A 4RR3A 3LEGA 5LB6A 4IV3C 4KG0A 1XC6A 4A6SA 2K9ZA 2YUEA 3I3MA 1BYHA 3WZ1A 3SEPA 5ABJB 1KITA 2BWCA 4CDQA 3R05A 3DV8A 1NXMA 1W6NB 1HQWA 4QX7A 1OVPA 3CBNA 2XBO3 1UAIA 1MQTC 3I2GA 5JLVA 1AYN3 1BCXA 1GYKA 1C1LA 4NRQA 1K12A 5T50A 5A7SA 1R082 4FP3A 4JKLA 4H7LA 2HH9A 5CAZA 1RUJ3 1FATA 1W2UA 4HFSA 1UIJA 1X8MA 1PNGA 2ZEXA 1QIQA 3OBAA 3ZDSA 1J84A 2GC1A 3LQCA 4RS5B 1V9U3 5JWPA 2HBTA 3HN3A 5J36A 4ZS3A 2YU2A 2G9ZA 3ZSKA 3DF0A 5A33A 1SQ4A 5T54A 4IEWA 3AFGA 5FQ0A 2NYYA 3T2OA 3GXUA 2GNDA 1TMF1 4LHNA 5FZFA 5BNNA 4YVSC 3ZO0B 3D0JA 1O5LA 2RE9A 1VBD1 2ZGKA 4LIUA 4RQPC 4F7ZA 2AEZA 4LKEA 5BV6A 4QAWA 1Y7BA 4JKKA 4B4RA 1WMDA 2DU1A 2ZXQA 2VVEA 4PI2A 1UWWA 4FBFA 1OKOA 4URAA 4AI0A 2QDRA 1FMD3 3GGLA 1H9WA 4J6GA 4P02B 1D2SA 3I2IA 4QPIC 2XQRA 4QXBA 3O1PA 2DFCA 1K5JA 3TEWA 4EJRA 1A8DA 2VCBA 3DECA 3ETQA 1POV3 1X36A 3OBRA 3LA7A 2CTVA 1VBC1 1BJQA 3T2PA 3U14A 5C3QA 3WR0A 3M3CA 3KVBA 2J1VA 1R091 4E4ZA 2IXJA 4XCAA 5GZEA 3CIHA 1JOBA 2DWRA 4JQRA 3OG2A 1VBB3 1W8UA 4RHV3 1AJKA 1RGSA 2NN8A 3WOGA 2RJKA 4RFRB 1W9FA 3ZSEA 5BNOA 3NO8A 2ZBJA 3GALA 1SLCA 2VECA 3PHMA 3K46A 2VW0A 4Z2WA 3PURA 1RUH3 5L7OA 1WD4A 2O8OA 1R64A 3TWIA 5CB7A 1S2BA 1ZBA2 4JHZA 2J42A 3MICA 1QJU1 2A5ZA 2A6XA 2WQ8A 5GLVA 3K4AA 2FMYA 5FO9B 1MEC1 2PHXA 3FFZA 5FPAA 4CCCA 1R1A3 3N9LA 1AYM1 5FZLA 4Y1XA 5B4NA 2JG8A 4JGYC 5KWRA 4UFLA 3WDVA 5J09A 3BPZA 1Y9QA 2JDZA 2WSUA 4MGQA 4BXFA 1YFYA 4GXLA 4QQLA 2YGMA 2DUQA 1H30A 3UKVA 4LOSA 1JYVA 3POIA 3PVEA 4BK4A 1C28A 3MYXA 1G9CA 5M0TA 1XNAA 1VAVA 2D6PA 2Y6FA 1O4TA 3B00A 1MVQA 4N43A 2XVKA 3HR9A 1H2LA 1YLLA 1WW6A 4QHZA 5F37A 2XHNA 2XXZA 5LRRA 2ZX4A 5CISA 1RVF3 1RJ7A 2QZ3A 1LODA 2X29A 4PIYA 4AEMA 3QACA 2HWD1 4C8DA 5JIAA 5DUVA 1Q8OA 4META 1YHFA 1XOYA 1SBFA 1W2OA 1S0IA 3DKWA 1JHNA 2EA7A 3KMHA 4Q8LA 2PHLA 3VL9A 2QBXA 1S2KA 3SLIA 1OF3A 2XGXA 4KL1A 1W8OA 2ZGNA 3OEBA 4GWMA 1AR93 3MIGA 4AFMA 4YW6A 4AVSA 2RS12 1O3SA 2CGNA 2P37A 3NNMA 4RFT0 4CTEA 2QQJA 3HIFA 5CFDA 4YZ1A 1Q8PA 4Q4Y1 3FLPA 5ISLA 4LKDA 4Q4V3 1N1TA 3K77A 2ET1A 1LEDA 2IXKA 2XKPA 3C2UA 3AJZA 4J25A 4LPLA 4MGIE 1AR63 3E97A 2AR6A 1AR83 2UU8A 4D7YA 4Z1VA 2ZKNA 5AVPA 3THPA 4A42A 1OH4A 1DQ4A 1OC1A 5F8PA 2ETEA 5JXIA 3IDAA 3NJYA 2IXCA 4MH0E 4YLZA 2VZ3A 1KJLA 5FREA 2GH2A 5BNPA 5FJHA 2XUMA 5J48A 2GNTA 3LAGA 1C8M2 4MUVA 5FZ7A 1BHGA 2YPDA 1LTEA 1UZYA 1NX9A 3E1F1 4LBMA 4WVMA 3VBSC 5FPLA 1X8EA 1HRI1 4LK7A 4L92A 2E33A 3IMMA 3SCHA 2QTWB 1F8VA 4LBQB 1N1YA 1NLSA 2W94A 1WCKA 4W65A 5FP4A 4QQHA 5D8AC 5KR7A 1CAWB 2NPIA 4IQPA 2ZMKA 3VD9A 2WBKA 5AVAA 5IT6A 3ZYPA 1QJY2 2A1XA 4LE3A 5CU1A 4CEWC 1V0AA 5CVRA 2RMU2 5GLTA 4Y33A 1ENRA 3W9AA 5FMCA 1O6UA 4N90A 1N1VA 2H0BA 3ZM8A 2CYFA 2DCZA 4OULA 3OCPA 1BBT3 1AL22 1PK6B 1W8TA 1JU4A 3GHNA 1AXKA 5CA6A 3PL0A 3VBRC 2XVLA 3AVSA 1SDWA 1P8JA 2QQMA 4BM8A 3NMBA 3WW2A 4MGKE 3DXTA 1UZVA 1AYN1 1NZIA 3U75A 5T52A 4CZSA 3O7OA 5C3PA 3ITQA 3VBHA 3SKVA 4BIFA 1V6JA 1RUJ1 2OQ7A 3I49A 3WY6A 4GA9A 4HK8A 4YW1A 5FP8A 2J7MA 3DUIA 3S0MA 4PQQA 5DAXA 2PHUA 3B5LB 4FAHA 2HWC3 2LUWA 2UURA 3D5OA 5ABJC 5BNPC 5IAXA 1JOJA 4UT5A 3SC7X 4KI5M 3BALA 5HCFA 3U11A 2I74A 2QNKA 2RJLA 4CEYB 5L7OC 1PO23 3V0AA 1ENQA 2VR4A 2B4KA 4JDOA 4K8FA 4XF4A 4OVEA 1Q43A 4AHYA 1DCSA 5FUPA 4DUVA 1JZ2A 5HPOA 4FPYA 4OLLA 2E31A 3TEYA 4RS5C 3VD3A 1FMD1 5FZAA 3OJBA 3T4HB 4YVWB 1JMUB 5DABA 3LOIA 4QGLA 3SH5A 2VY0A 4IL7A 4AI1A 5HV4A 3KT7A 3IWZA 2FD8A 4LHSA 1POV1 2PAMA 1UNBA 4GULA 4CP2A 3VHNA 4N43C 2FCUA 2G9GA 4YG6A 4Y24A 1VBA1 1MS1A 3BTXA 5IFPA 5FO7B 4JTOA 1ZVFA 4FPEA 4IEOA 4PIZA 4XHXA 3HJRA 1H8TB 3UESA 1VBB1 1Z78A 2W39A 2P3KA 5G04L 5FXWA 3POFA 5DAPA 4UFHA 2VMFA 4BMBA 1UX6A 3ZYRA 2J1RA 3O1VA 2WN3A 3LDRA 3OUJA 1KDMA 1IZ3A 2QQLA 3F95A 3ZXLA 2WZEA 3ALQA 3GYDA 4ISQA 4R9BA 4B29A 4DXRA 3T2QA 1VR3A 3M3EA 3MPPG 1WBFA 2XJRA 3D6EA 2H0VA 3RYRA 5EJZB 1E5IA 1BEV1 2JE7A 3AMMA 1NLRA 4K21A 1IS6A 1D0HA 1R1A1 3N7JA 2DUOA 4GMP0 2K0GA 4CDWA 1SBDA 2RR13 1PX3A 1JUHA 2WABA 1FOD2 2XJQA 5C3SA 5I93A 3B94A 3ZLIA 3TB0A 2JDYA 3TBDA 3P3PA 4XYXA 4B1MA 3NL1A 4P5YA 1A34A 3ATGA 1RUI3 1GBGA 4AHWA 1K5MB 3PJYA 3UGFA 4NPLA 1GNHA 2GN7A 2B7YA 4MSVA 3IPVA 5FP3A 1H2KA 2YXSA 1KQRA 3J7HA 4XURA 2OVUA 4DXTA 3WCRA 5TSWA 1SMVA 1N3PA 1UMZA 2W92A 3M1HA 4EZ4A 5C4WC 1CAUB 1QXPA 5E1RA 4I30A 4XFFA 5FYIA 5FYHA 4IEVA 4BU2A 3R6SA 3RZGA 5E16A 3ZYHA 1QJU2 1OOPC 1ULOA 1W9WA 1CJDA 4UW6A 4CVUA 1O8PA 3BU7A 4CCMA 1PM7A 2HJIA 5E8AA 2FDKA 3E6DA 1OQDA 5T5PA 4CRQA 4CA9A 1IKQA 3MFCA 3ZMOA 1NY71 3I2FA 4ARXA 4YM3A 1SLTA 3VDBA 1Q8QA 1BMV1 5FKBA 1XB9A 4BJ0A 4BQYA 1KFUL 2PELA 1H1MA 4DFSA 1XNCA 3MV11 3B01A 2V5DA 4KWUA 2RDRA 2EIBA 3K48A 5IK5A 4Q4V1 2G4IA 2NQYA 1OPMA 1LOFC 1YFWA 2ZHKA 3HOBA 4XJ9A 5FLJA 1S2EA 2YFZA 2A6YA 1FPN3 2Q4SA 1G6NA 2R073 4JC1A 4AQSA 1AR81 3GBWA 4XUNA 2WT1A 5FRAA 5FKCA 1US2A 2HWD2 3USSA 2ARAA 1ULCA 1W03A 2EIDA 4IEUA 4M3CE 2ADEA 4IW3A 1LENA 1UW8A 2WNUB 5FY5A 1S0BA 3EYPA 4ZY9A 1RUG3 4ARYA 4DY3A 2OS2A 5LZ6A 2R063 4FQ4A 1SLAA 3LE0A 2Y6LA 1SCRA 1YQ5A 4K3UA 2P6CA 2IVIB 2WS93 4LLOA 4XF0A 2OYZA 3ZFFA 2A7AA 2GC2A 2MHFA 3AKRA 2Q1FA 5CKMA 3OY8B 2WLQA 1AZDA 4XF3A 2W87A 1VALA 2WZR3 4Q4Y2 4YM0A 4TXWA 5J98B 4BQ1A 4BISA 1QMJA 4LK6A 1QU0A 4CXXA 2VL4A 3KLSA 1QF3A 4Y20A 1QOOA 1W04A 3VBUA 1PIV2 3AZXA 5FK7A 4XQ4A 4RA0A 1VMJA 5C5TA 3ZN5A 4AW7A 4LO6B 1V6OA 2GP3A 4BHPA 1YXWA 2B42B 3ZFGB 1OXCA 2WFPA 3LDKA 3NNGA 5C5UA 1YIFA 3WG4A 2D5FA 5A3TA 5DAWA 1XJAA 2XHKA 4Q0PA 3UKNA 2EXKA 5JMCA 1QJFA 3J7NA 2O14A 2QKDA 4LO4B 4L99A 2BNMA 1BBT1 2WJSA 1QJX1 1TME1 3RSJA 4XUPA 1GKBA 5IUQA 2YC4A 3WCSA 2E51A 3B9IA 1COV3 1OUSA 4L97A 4HN0A 2N7GA 1UQXA 4AR2A 2A71A 5L19A 3HAGA 4NJ4A 3LCPA 5SV5A 3UV9A 3H50A 3PVBB 5A6XA 4OQ9A 1WUVA 5C3OA 4QX8A 3UK9A 1F15A 4UBHA 5A7OA 3MZHA 3V0BA 1WLWA 4BA6A 1QEXA 1XSQA 4DRRA 4FVVA 4OYUA 1H4GA 5HXMA 4BE3A 1H4HA 2JJ6A 3I2JA 2ILMA 4Y22B 1DQ0A 1QJY3 5K9YA 5FOBB 4Q4W2 2ARBA 1H9PA 4IEZA 4AEDB 4OUSA 1AXYA 4CP9A 5CG8A 3NSTA 5A3PA 1VE0A 2RS53 3SXWA 2WO1A 4AVBA 2A70A 3F2ZA 4MX3A 1C3HA 2JDNA 2Q0AA 4P9XA 3K3NA 5EJ1B 3WG3A 1DYPA 2CGOA 1HW5A 2HYKA 2J1UA 3OYWA 3FBYA 4UXAA 5DAQA 3ZPYA 2FBEA 3HQRA 4CPBA 4NIDA 1TE1B 4TYSA 1ZREA 4SLIA 4XIOA 5GZCA 2Z5WA 4YVSB 3WNKA 2JD4A 4I0WB 2PYTA 5DDJ1 1HB1A 3AX4A 1XU1A 4RQPB 3WNPA 2GU9A 4DEQA 1QH7A 2JICA 5L9BA 5IATA 2V5YA 4U2AA 4IEXA 2RHPA 5IW0A 5F1RA 5C70A 4ONUA 1W39A 4H14A 4CCKA 4QDSA 5FY8A 2R042 2P1BA 4QXHA 4COYA 4CCLA 3AYCA 1X50A 1Q3EA 1W6OB 2DBIA 4FFIA 4IGOA 4V2VA 2JG9A 4QPIB 5A1FA 1QNYA 3POEA 2BOIA 4QM8A 5FYMA 5KHKA 3ORJA 4COUA 1YFUA 1GOHA 2XH6A 3ZSMA 4DS0A 3WEZA 2DYCA 4NWWA 1Y43B 2ZEWA 4HVOA 5FY1A 3TOJA 4EROA 5AC91 1HRV1 2JKBA 3FHAA 2AEYA 3WP4A 3BPSA 3ZN6B 2IFWA 3JQWA 1WZXA 1HIXA 4O9EA 3THDA 1NCQA 3OBTA 4AOCA 1JYNA 1LCLA 2D3RA 4H55A 2UWAA 5F6LB 1URXA 3LFMA 4U36A 2FQPA 2X09A 4D6QA 2QZ2A 2C1FA 2RR11 1VBA2 2ID4A 3A23A 5EP9A 3LD8A 5FYYA 3UGGA 4JRAA 3ELNA 5FPZA 3B93A 4N7UA 5ERLA 2RG4A 4CSWA 2B39A 2QDNA 3RPQA 2ZCWA 3RYPA 3MBWA 5CKQA 2XG3A 5LCWL 1RITA 4Q29A 3N4MA 2VOTA 4M3CA 1CAXA 5J7MA 2W1WA 3ES4A 4W6WA 1GWKA 2VVDA 5FZBA 1VB2A 1ND3A 1YJKA 3H7YA 2YMZA 1D4VB 3ACFA 3Q8AA 4NIIA 5A6QA 4JGYB 4QXCA
chains in the Genus database with same CATH topology
3S57A 4QHOA 4JHTA 5F8PA 3O1VA 3BIEA 3T3YA 4NJ4A 3BTYA 3H8RA 4NIGA 2FDGA 3I2OA 4O61A 2IUWA 3BTZA 2FDHA 3O1PA 3O1TA 4NPLA 4CXWA 4QKDA 3RZMA 3BU0A 3O1MA 4IE5A 4OCTA 2FDIA 2FDJA 3RZGA 4RFRB 4NRMA 4CXYA 4NIDA 2FDKA 4IE7A 4QKFA 3RZLA 3KHBA 3O1SA 3I3QA 3O1RA 3S5AA 2FDFA 4ZHNA 3I49A 4IE0A 3BKZA 4NRPA 4ZS2A 3RZJA 4MGTA 4QKNA 3KHCA 4QKBA 4IE4A 3BI3A 3I3MA 3H8OA 4IE6A 3LFMA 3T4HB 5DABA 4CXXA 3RZHA 4NRQA 3O1OA 2FD8A 4NPMA 3O1UA 4NIHA 3H8XA 4NROA 4MG2A 3BUCA 4IDZA 3RZKA 3BTXA 4NIIA 4ZS3A 4O7XA 3T4VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S57 A;  4QHO A;  4JHT A;  5F8P A;  3O1V A;  3BIE A;  3T3Y A;  4NJ4 A;  3BTY A;  3H8R A;  4NIG A;  2FDG A;  3I2O A;  4O61 A;  2IUW A;  3BTZ A;  2FDH A;  3O1P A;  3O1T A;  4NPL A;  4CXW A;  4QKD A;  3RZM A;  3BU0 A;  3O1M A;  4IE5 A;  4OCT A;  2FDI A;  2FDJ A;  3RZG A;  4RFR B;  4NRM A;  4CXY A;  4NID A;  2FDK A;  4IE7 A;  4QKF A;  3RZL A;  3KHB A;  3O1S A;  3I3Q A;  3O1R A;  3S5A A;  2FDF A;  4ZHN A;  3I49 A;  4IE0 A;  3BKZ A;  4NRP A;  4ZS2 A;  3RZJ A;  4MGT A;  4QKN A;  3KHC A;  4QKB A;  4IE4 A;  3BI3 A;  3I3M A;  3H8O A;  4IE6 A;  3LFM A;  3T4H B;  5DAB A;  4CXX A;  3RZH A;  4NRQ A;  3O1O A;  2FD8 A;  4NPM A;  3O1U A;  4NIH A;  3H8X A;  4NRO A;  4MG2 A;  3BUC A;  4IDZ A;  3RZK A;  3BTX A;  4NII A;  4ZS3 A;  4O7X A;  3T4V A; 
#chains in the Genus database with same CATH topology
 3CZJ A;  3A21 A;  3WUC A;  1D7P M;  4P9I A;  4WM8 A;  1DIW A;  2RM2 3;  2VTF A;  3WF4 A;  3CJI B;  1YYN A;  4GB3 3;  4BWO A;  2GP5 A;  1BEV 2;  5LRS A;  1CAV A;  3T0A A;  3III A;  4PJY A;  1ASJ 2;  2VZT A;  5JSO A;  1JU3 A;  2WQZ C;  4KBZ A;  2RDN A;  5CIR A;  1SDD B;  5FYB A;  2QE3 A;  1JBC A;  3MIH A;  1U5I A;  1JYC A;  4Y5Z 0;  3V56 A;  1S4C A;  2LS6 A;  1BVP 1;  5CYY A;  4AI8 A;  1BXH A;  1NAE A;  3FX3 A;  2WZ8 A;  4KGQ A;  1V6I A;  5EIY B;  4ASM B;  1W3V A;  2DUR A;  4MGS A;  3G6J B;  3J8F 2;  4W6Y A;  3PUI A;  4Y5S A;  5A7N A;  4CP0 A;  1ZRR A;  4QDR A;  5FZM A;  1FPN 1;  4YAR A;  4JX0 A;  5F5A A;  1C57 A;  1XNK A;  1IG3 A;  2TEP A;  2GC3 A;  1YQ6 A;  2IFR A;  3GCW A;  3GCX A;  5FPU A;  1PZ9 A;  4XAB A;  1RUG 1;  3AKS A;  4DMI A;  1MVE A;  5E89 A;  2DVD A;  5HXV A;  2OPW A;  1GZW A;  1ZBE 1;  3LEM A;  1NY7 2;  1BMV 2;  1KJR A;  4FQZ A;  2WS9 1;  4A4A A;  2J22 A;  4RR3 B;  5IVF A;  2Q1M A;  3PNA A;  4JDN A;  2WQ4 A;  2HWE 2;  3H9A A;  2YC0 A;  2A6Z A;  1MPX A;  4S2H A;  4CDQ B;  3VKO A;  5D1I A;  1CD3 G;  3OPZ A;  3O1S A;  4OI2 A;  4GAL A;  5FZO A;  3WVJ A;  2C5D A;  1AX2 A;  1DQ1 A;  1TG7 A;  3CZU A;  4XF9 A;  1KRI A;  2K2S A;  1JZ5 A;  3RRD A;  3UKT A;  3J4U H;  3JD7 3;  1MZE A;  1MS3 A;  3T0D A;  1F35 A;  1WME A;  1W99 A;  5EZW A;  1DGW A;  1UXX X;  1Y9M A;  2PMW B;  3KV5 A;  2UYA A;  3QH7 A;  3TN9 3;  4A7Y A;  4UYB A;  1YJL A;  3NJZ A;  3J7L A;  4ZS2 A;  1H2N A;  3AYD A;  1RUE 2;  4HL0 A;  5A33 B;  3JCI A;  1NCR A;  4RL7 A;  1I5P A;  3LKJ A;  3WG2 A;  5JOW A;  2VNV A;  4MYE A;  5BNN B;  1I6X A;  4LA3 A;  2XLF A;  1RTV A;  5EJ3 A;  1U5Z A;  3AB0 A;  4QKB A;  5ACA 2;  4LO5 B;  2MPF A;  2ORZ A;  3NKT A;  1H1A A;  2QQV A;  4IXL A;  2YC2 A;  1JZ4 A;  4JGZ C;  2IZW A;  4YYO A;  1RUO A;  3MV0 1;  3ZFG C;  1GZC A;  2OA2 A;  1SZB A;  3SNM A;  1RIR A;  1CX1 A;  1ZX5 A;  1PGS A;  2WWJ A;  4CDX A;  3VHO A;  3OGR A;  5E88 A;  2WAA A;  4AWD A;  1EV1 1;  2JG9 C;  1ACC A;  3ZXJ A;  2VPV A;  2IXI A;  4UF0 A;  3LIG A;  1TQ5 A;  2A3W A;  3THT A;  3VGI A;  5KXB A;  2W52 A;  4YM1 A;  5GLZ A;  2J1E A;  3SH4 A;  4KNC A;  3OEA A;  1QJX 2;  3WX5 A;  1TME 2;  4RGK A;  2PAK A;  4Q26 A;  5LA2 A;  2ARC A;  2YHJ A;  4GAZ A;  4IDZ A;  3VKF C;  2LTN A;  2VMD A;  1RUC 3;  2ZHN A;  4Q4X 3;  3ZR6 A;  2JB8 A;  3I8T A;  2QQW A;  3QD6 A;  5HBA A;  2VUA A;  4Y1Z A;  4Z8B A;  2XKO A;  1W8Z A;  3VZN A;  1O3T A;  5F3I A;  1J3P A;  2NMO A;  3V65 A;  4O65 A;  2Y6H A;  2D6M A;  2NMN A;  4XPV A;  4C90 A;  4YZ2 A;  4BYY A;  1RED A;  3WNL A;  3WP5 A;  4JZR A;  1RHI 3;  1G8W A;  5L7O B;  2O1Q A;  3VZM A;  2VOK A;  2BU9 A;  3AK0 A;  4AED C;  5F5Q A;  3ACI A;  5JR7 B;  5EV7 A;  3I59 A;  3L9J T;  4I3G A;  4OI4 A;  1I3H A;  3SH3 A;  5L36 A;  4YGD A;  2ZAB A;  2ORX A;  3DL3 A;  3RMY A;  2JG8 B;  1UOJ A;  2VAU A;  1US3 A;  3FUO A;  1WBL A;  1HXS 2;  2JEN A;  3D82 A;  5FZE A;  2OUH A;  1BZW A;  4WM8 C;  3A4U A;  2D6O X;  1I5Z A;  4CCD A;  1WCQ A;  1UXZ A;  4E27 A;  1IGO A;  2WO2 A;  4NE9 A;  2E7Q A;  1SLI A;  3JBG 3;  4PLO A;  3VZO A;  1GFF 2;  4N43 B;  3RGB A;  4K1Y A;  3H8U A;  4WZF A;  2BER A;  5DDJ 2;  5EWS A;  4XDP A;  1PHM A;  1UCX A;  2RJ2 A;  4AQ6 A;  4AE2 A;  2PQS A;  4CXY A;  1U12 A;  4I0B A;  4UOJ A;  1YO8 A;  3IN9 A;  2XJS A;  1D4M 3;  4QPW A;  3WQ7 A;  2EIE A;  4AFA A;  5A3L A;  1Y3T A;  2PN5 A;  1GWM A;  2BBV A;  4Y4Y A;  3VDD A;  3VHP A;  3ZYJ B;  4I3P A;  3Q8F A;  1OFS A;  1RUD 2;  3K4Z A;  5KBF A;  3S5A A;  5KHG A;  2WN2 A;  4XCB A;  2VQT A;  5LEK A;  2PLV 2;  3ILF A;  3KQ4 B;  1XYN A;  3ZYF A;  2R0H A;  4ET7 A;  3POW A;  1AR7 3;  4WBB A;  1PVC 3;  2EAK A;  5DUW A;  1WKY A;  2GNB A;  4C1X A;  5CNA A;  1X9T A;  3GBG A;  3P6B A;  4XUT A;  3DN7 A;  4S2G A;  1SEF A;  1GQG A;  3V64 A;  2R30 A;  5AC9 2;  3HNM A;  1HRV 2;  1QQP 2;  1KD7 A;  1WLD A;  4MOA A;  3JZV A;  5DUU A;  1DG6 A;  5FLH A;  5GJ6 A;  2XR4 A;  2NP0 A;  4AQ2 A;  2HWF 2;  4L8Q A;  3S5Q A;  3WF2 A;  5GKA C;  2XL9 A;  3VV1 A;  1RMU 3;  3JUU A;  4QWN A;  3O14 A;  1X82 A;  2BRT A;  1VBE 2;  4P5H A;  3B7M A;  1K45 A;  5FY0 A;  5C71 A;  4G4F A;  1XU2 A;  3D4K A;  4EZH A;  5BNP B;  3P5B A;  5C4W B;  3I2K A;  5J3U A;  4WVM B;  2XDV A;  2Y33 A;  4CUB A;  1O8S A;  3E5U A;  4NVP A;  2ZX3 A;  3ZSL A;  4B7E A;  1JTZ X;  1OOP B;  3WD5 A;  3BOW A;  5B4X A;  4D6S A;  3RZH A;  1YIP A;  4Y1V A;  3SMH A;  3P3N A;  1HX6 A;  5EPA A;  3CJI C;  2VVF A;  5A3U A;  1LGN A;  5C6C A;  3VD7 A;  4ES9 A;  2ADD A;  1GSL A;  4GD4 A;  3CHX A;  4I02 A;  4LQR A;  3O5S A;  2VZO A;  3BIW E;  2L9L A;  3RZK A;  4NHX A;  5FUN A;  2WYS A;  4AHX A;  3RQ0 A;  4BQ3 A;  4LTA A;  2W1U A;  2D40 A;  1AXZ A;  2VUD A;  3NAP C;  5A3O A;  1LR5 A;  3D0S A;  4K8R B;  4M00 A;  4LOR A;  4QD2 A;  1PO1 3;  4WV8 A;  4AGG A;  1XQN A;  5LY2 A;  2DU0 A;  4LO7 A;  1EAH 2;  4P9G A;  3WIN E;  2QQO A;  3T4V A;  4AGV A;  3KCX A;  5DG1 A;  2BGP A;  1FT9 A;  3AL6 A;  3VHR A;  4CDX C;  2VCC A;  1LEM A;  3OF1 A;  5JI9 A;  2OPK A;  2DDU A;  2P3J A;  1H2M A;  2ZGT A;  2A3Y A;  1SPP A;  1UOG A;  1ZA4 A;  5ANQ A;  5H9S A;  3ZFE C;  4ZZ5 A;  2V4V A;  1HKD A;  1YI7 A;  1OVS A;  1LB2 A;  3H8R A;  4FT8 A;  2FMD A;  4XBQ A;  5A7W A;  2GSY A;  3VBH B;  1V70 A;  3LA2 A;  3BGA A;  1LAJ A;  2FDH A;  1H8V A;  5DZE A;  5IWF A;  4UI9 L;  2X5I A;  4DO0 A;  5B2G B;  1CIY A;  4YWA A;  3ZIW A;  1ZM1 A;  1ZBE 2;  5CEH A;  4RR3 C;  2DTW A;  2JD9 A;  5I0R A;  1UY2 A;  1ZNP A;  4CUA A;  3W5M A;  2VMH A;  2QJV A;  2VH9 A;  1W90 A;  2VGD A;  1UPI A;  3UJO A;  1XNB A;  1JZ7 A;  5A80 A;  1VLN A;  5FP9 A;  5FZ9 A;  4CDQ C;  4QB6 A;  4XUO A;  4YZ5 A;  2JEM A;  5A1L A;  4XC9 A;  2C24 A;  1ZRI A;  2DTY A;  2QFE A;  4QXK A;  3V0A B;  4G9S B;  4OHV A;  4ZU5 A;  1O3Q A;  3LDB A;  1ODM A;  1RUF 3;  2VZS A;  2MEV 3;  1N1S A;  3FHQ A;  4UW5 A;  4YG3 A;  3RVH A;  1NT0 A;  2EIC A;  1I9R A;  2D43 A;  1QGL A;  4YFW A;  1PGW 1;  3HN1 A;  3WNN A;  4A2U A;  4OI0 A;  4MAD A;  1AF9 A;  2HWB 2;  4P9L A;  3MDP A;  3WF1 A;  1FV3 A;  2RS3 1;  2A3X A;  2WKK A;  5CBL A;  4IGP A;  5I0U A;  1IS4 A;  4IND A;  3VD5 A;  3OTF A;  4LUK A;  3O1R A;  2DVA A;  1XE8 A;  1UY1 A;  2WDB A;  5I0T A;  1Z7S 3;  4AF9 A;  4D7S A;  4DIN B;  1L7Q A;  4FFG A;  1PM4 A;  2VXR A;  5EYY A;  3RI8 A;  4LE4 A;  4K6B A;  3ZMN A;  1B35 A;  1NLQ A;  1XYO A;  3IB3 A;  4WM7 A;  5BNN C;  2W1Q A;  2WFF 2;  3T1M A;  1DP0 A;  3O0X A;  5C8W A;  1H1I A;  5BYN A;  2UYB A;  1RUC 1;  2WNV A;  2ZOE B;  3IZO A;  4HN1 A;  3RZJ A;  1JS9 A;  1VMH A;  3FBM A;  1AHS A;  4WZC A;  4BXS V;  1XYP A;  2JDM A;  3DEM A;  3KGL A;  3ZOI A;  4BK5 A;  3GF6 A;  3NNL A;  4NR1 A;  1JI6 A;  2PHF A;  3D3A A;  1DYK A;  4IES A;  4WVV A;  4DEV A;  4PHZ A;  2YYO A;  5JUV A;  3NVC A;  3C7O A;  3FZ3 A;  2EXJ A;  3NKG A;  1C5H A;  4LBQ D;  3QBQ A;  4LBO A;  2XBO 1;  2YBK A;  2EAA A;  3FN9 A;  3MIB A;  4EN9 B;  1EV1 2;  4JKM A;  4ZXE A;  4DRV A;  4AL9 A;  1OLQ A;  1TZO A;  1L3J A;  4UFJ A;  4D94 A;  4D0Q A;  2Y26 A;  1YI9 A;  1A8M A;  3VKL A;  4V1P A;  1UY0 A;  4XFB A;  1VMF A;  3M70 A;  1V9U 1;  3MGU A;  5C9A A;  4CDW B;  2QQP A;  5JXJ A;  2TUN A;  4AAX A;  1SFY A;  1WLT A;  5BNQ A;  3TEZ A;  2WLP A;  3R4D B;  1QKQ A;  1G9A A;  3MUZ 1;  3T09 A;  5BNO C;  3IAQ A;  1FXZ A;  1N3O A;  2XJT A;  1XXN A;  3NQH A;  1CWP A;  4OZO A;  1VRH 3;  4KU7 A;  2D98 A;  3NNJ A;  4BQX A;  1OT5 A;  3IPV B;  3VBO A;  1XRU A;  2Q8D A;  4DUX A;  3NV2 A;  4AFB A;  4K1Z A;  4I09 A;  1GOG A;  4YW3 A;  5DUX A;  1VAM A;  1G9F A;  5JZG A;  4LT5 A;  1H6X A;  2GAU A;  2LAL A;  5JSR A;  1FNY A;  2CU5 A;  3W58 A;  1J83 A;  5F2W A;  3KGZ A;  3TNQ A;  2WWS A;  2JG8 C;  1XE0 A;  1R08 3;  4EWE A;  3J7M A;  2JDU A;  3BIE A;  3SCF A;  3HT2 A;  3I2H A;  1X9P A;  3MLL A;  3N7K A;  1UX7 A;  2DVG A;  5FPV A;  1IPS A;  2IXH A;  3BTZ A;  1UF2 C;  4AVC A;  1AR7 1;  1TMF 2;  1PVC 1;  3HNB M;  1BK1 A;  3H3U A;  1QDO A;  2CWS A;  3ZXF A;  1VBD 2;  2RDS A;  3N9P A;  4GIQ A;  1J3R A;  1HV1 A;  1MZF A;  5I8T A;  4LBN A;  1NA1 A;  4RHV 1;  5JOY A;  5K0U A;  1UKR A;  3O12 A;  1HLC A;  3JB4 C;  4N53 A;  4ISR A;  3WHT A;  4QM9 A;  3ZKY A;  3HT1 A;  2HEY F;  4JCK A;  1RMU 1;  3D8C A;  3T30 A;  1CAW A;  1RUH 1;  2QQI A;  1MAC A;  4M4R A;  1Y4W A;  4QX2 A;  5FYS A;  1U5Y A;  5I91 A;  1JYI A;  4CCJ A;  1V6M A;  4QDQ A;  3PUS A;  3POB A;  1F31 A;  3ST7 A;  3SHR A;  5CFD C;  1VBC 2;  4NHL A;  1OA2 A;  1QJZ A;  4X6Q B;  4X8N A;  3KHB A;  2HBU A;  4BQW A;  2A73 B;  1PK6 A;  3GZT B;  1R09 2;  1S0D A;  1I1E A;  1GR3 A;  4FCA A;  4Y20 B;  5FPX A;  2E6V A;  3AMQ A;  4R9A A;  3VBU B;  5LWB A;  2FDF A;  1WCS A;  2LM3 A;  1LEC A;  4K7J A;  3AJY A;  2D6N A;  4YG0 A;  5FFO C;  1W0P A;  3NRU A;  5FY7 A;  4AHZ A;  5LBE A;  1LU2 A;  5A32 A;  3ECQ A;  1UMH A;  1GNZ A;  3Q9O A;  2ZAA A;  1HB3 A;  2B9V A;  3KWV A;  3TNP B;  1T2X A;  1SCS A;  1RVF 1;  5FDB A;  1W6P A;  2VZR A;  3VZL A;  4D8M A;  4J1X A;  2QCS B;  4TSV A;  1POV 0;  2P2K A;  4FPJ A;  3AP7 A;  1YEW A;  3MW2 A;  4W8J A;  2OX0 A;  1MEC 2;  2ZGU A;  1NE6 A;  1QXJ A;  4HBN A;  1AYM 2;  1ZBA 3;  4XIK A;  4NWV A;  5FP7 A;  2VM9 A;  3VBF A;  4DXS A;  2C9K A;  2ZX2 A;  1RB8 G;  1AR9 1;  2H6B A;  4QPY A;  4E9K A;  3MEP A;  3EO6 A;  3ETP A;  2ZJC A;  4KWL A;  4PLN A;  2A6V A;  2PA7 A;  2UWC A;  2YBS A;  4P9W A;  2Y0O A;  4CEY A;  5DMY A;  2AGS A;  2YBP A;  1MS4 A;  2JDK A;  2XML A;  2WT0 A;  4FFH A;  4R52 A;  4WM7 C;  1Q5O A;  1C4R A;  1O5U A;  5FZI A;  2NLR A;  1JH5 A;  4COW A;  1QDC A;  2WNV C;  4ORF A;  3V0B B;  2XOM A;  4A7K A;  1H0B A;  1AR6 1;  5GAL A;  1ALY A;  1V00 A;  3LPF A;  4YZ4 A;  4YGC A;  2AYH A;  5DZG A;  4YW2 A;  1QOS A;  2R6Q A;  1GZ9 A;  3PIG A;  4PF1 A;  3H8X A;  3CQO A;  5FXV A;  1FV2 A;  4H2A A;  2YG0 A;  3KF3 A;  1W6Q A;  4LA2 A;  4AGR A;  1O59 A;  1KEX A;  1OQ1 A;  2GH8 A;  4CP9 B;  4XQD A;  1LGC A;  2ZPX A;  2WYF A;  4QMA A;  5IK4 A;  1ND2 A;  4K20 A;  5FZ4 A;  1W9T A;  5LEJ A;  2Q8O A;  2D6K A;  2DVB A;  2OXB A;  2VMC A;  1ONA A;  2VBD A;  4HON A;  3VBH C;  3E6C C;  5FAX A;  2MEV 1;  4OHZ A;  5JVV A;  3U4S A;  1ZZ7 A;  2V4A A;  2P3I A;  2W46 A;  2ZX0 A;  4CUC A;  2ZGM A;  3OYW B;  2VCA A;  1O4Y A;  3PTY A;  4PDW A;  5F9T A;  2B8M A;  2JDH A;  2RS1 3;  4YZ3 A;  4KQ7 A;  1PGL 1;  4CDU A;  2WC2 A;  1Z7S 1;  4D3W A;  3MIF A;  4LUM A;  4XMI A;  5F3G A;  4FOQ A;  5FOJ B;  4FO9 A;  1M4W A;  3AMH A;  3QCW A;  5IVY A;  1W2N A;  4JGZ B;  4XTM A;  3OGG A;  2Q5T A;  3AZW A;  5GLU A;  5BPX A;  1UYX A;  3S6P A;  3VBO C;  4TWT A;  4LKF A;  2E53 A;  2IC1 A;  3M3Q A;  3VLB B;  3BOP A;  1DLL A;  5EFU A;  4IEY A;  4LOT A;  2JG9 B;  1QNW A;  1FYU A;  3NV4 A;  5FPB A;  2JDP A;  1JZ3 A;  1LES A;  1HRI 2;  4XUQ A;  2P6H A;  4QKD A;  3HVD A;  5FZ3 A;  2BDR A;  5IK7 A;  2YZ4 A;  1C8M 3;  4EN0 A;  2ZX1 A;  4XHB A;  5JSP A;  2RS3 2;  3AFK A;  3OB8 A;  4IE5 A;  1W28 A;  1YQC A;  4QX0 A;  1OSG A;  1F5F A;  3I97 A;  3PVO A;  2HWB 3;  5FZ0 A;  3ZXG A;  1KGY A;  4QQO A;  2O0O A;  2OQ6 A;  2Y60 A;  1GP6 A;  3EQE A;  2PAE A;  2AH2 A;  3ON7 A;  4L9B A;  1NCQ B;  5SV8 A;  1BLZ A;  2Y6G A;  4RD7 A;  2Z4F A;  4XZP A;  1Y9G A;  4AXO A;  4EE2 A;  4Z82 A;  2Y64 A;  2DUP A;  2HWC 1;  1CJP A;  1EUT A;  2CSG A;  1NA1 C;  3H1W A;  5K0U C;  1OQE A;  2QVS B;  3I2D A;  3MHZ A;  3FFQ A;  4EWA A;  5LY1 A;  5CFC A;  1CZT A;  3ES1 A;  1J59 A;  1CES A;  1DLC A;  4FOY A;  2YU1 A;  4LUL A;  2RMU 3;  3PUQ A;  1ZZ6 A;  2ZGP A;  1B09 A;  4M3C B;  1CAX B;  5FYU A;  1VRH 1;  3NJV A;  4FPK A;  5FBZ A;  1PO2 1;  2VJX A;  3HQX A;  1IHM A;  2F4L A;  1ND3 B;  2XBO 2;  2VC9 A;  4QPG A;  1AL2 3;  3M3O A;  3TYJ A;  1AYN 2;  5FMO S;  4E8D A;  1JYX A;  1DF0 A;  3S7I A;  4BME A;  1Q8V A;  4GJY A;  4WVZ A;  4DQA A;  1PZ8 A;  2ZAH A;  1WMF A;  4WM8 B;  1RUJ 2;  4LIT A;  1BQP A;  1CAV B;  2AAC A;  2P34 A;  3KT1 A;  4CDW C;  1R08 1;  2AC1 A;  4IET A;  1V9U 2;  4IUG A;  4HKL A;  2WNU A;  5E6H A;  4DZG A;  4Q1R A;  1VPH A;  2WRA A;  3VZK A;  2VW1 A;  4CYD A;  3WXP A;  1OD5 A;  2DF7 A;  4TLF A;  1IG0 A;  1W2T A;  2R49 A;  3N9Q A;  4LJH A;  1M06 G;  3OPW A;  1RC6 A;  5IK8 A;  3KCY A;  2A75 A;  3HBK A;  3BCW A;  3KS7 A;  2ZKL A;  1WW5 A;  4HK9 A;  4W6X A;  4XAC A;  4LIV A;  2WII B;  4QQP A;  4E2S A;  1YWK A;  2WT2 A;  2ZHL A;  4S2D A;  4EN6 B;  1W8W A;  3ACG A;  1FMD 2;  2E9Q A;  1HDK A;  4GWN A;  3KSC A;  2WA4 A;  4W4Z A;  2RV9 A;  2VNO A;  2VUJ A;  1GZW B;  1N47 A;  3C7F A;  4FPF A;  3UT0 A;  1F4A A;  4FPC A;  2BEO A;  2ET7 A;  2VE1 A;  4M0N A;  3A22 A;  4PIX A;  2CV6 A;  4Z2A A;  2KM2 A;  5L9R A;  3ZXE A;  3FMG A;  5LA0 A;  1LOC A;  3FLT A;  4H3W A;  3H3L A;  3IMN A;  3HPN A;  3KV4 A;  4A44 A;  5FZO B;  3POG A;  4M0H A;  2GME A;  1VBB 2;  4RHV 2;  4HVR A;  4MHR A;  3U78 A;  1DGW X;  1RUI 1;  2VMI A;  4UFI A;  3PTR B;  1VBD 3;  4P9J A;  3SIT A;  5FZ6 A;  5C7G A;  1YQ8 A;  2VZP A;  2ZEZ A;  1REF A;  3O1T A;  1RUH 2;  1OLM E;  3G7D A;  3L2H A;  4IV3 A;  4NHK A;  2CAU A;  4FXG B;  3FLR A;  1O4Z A;  3ZFF C;  3BTA A;  5C8C A;  5J1X A;  3UNP A;  3VB9 A;  2F4P A;  3CLP A;  1HQL A;  3RJR A;  3EXU A;  2E7A A;  4V2W A;  3PDQ A;  4BQ5 A;  4E4H A;  2PTM A;  1JW6 A;  1ZA7 A;  3RZM A;  2VNG A;  1R1A 2;  1MQT A;  3LSE A;  1FNZ A;  1GLH A;  2WNO A;  5KC6 A;  4CDU C;  2ZHM A;  4OZX A;  3VBU C;  1NE4 A;  1W8F A;  3WNO A;  4B4Q A;  3NAP B;  5T5L A;  2WL1 A;  1FOD 3;  4SBV A;  3K2O A;  4EQV A;  4QKF A;  3RZL A;  1FAY A;  3B9C A;  4MO3 M;  3OUH A;  4JRL A;  4QX3 A;  4COZ A;  4CDX B;  2C9A A;  1KDK A;  2GC0 A;  2R07 1;  2OKX A;  5JPM B;  4ITC A;  1RVF 2;  3LPG A;  3M2M A;  3DXU A;  4PT6 A;  4MGY E;  4ZHN A;  2ZGQ A;  2YV8 A;  4ZON A;  3FWE A;  2DCY A;  3ZFE B;  4ASK A;  4CU7 A;  4OUM A;  2R32 A;  4Q27 A;  4MHU A;  5KXD A;  4XJA A;  4RQP A;  2R7E B;  2BP6 A;  4FFF A;  1S0F A;  2R06 1;  1MR5 A;  3M3I A;  3EJK A;  3APB A;  3MI8 A;  4R9D A;  1QJU 3;  2BWA A;  2WZP P;  1DDL A;  1AR9 2;  1DZR A;  4FXK B;  1WA6 X;  1ULG A;  4MXW A;  1MEC 3;  5FWJ A;  5FIX A;  1YFX A;  4BDV B;  3CEW A;  3WSO A;  1DGR A;  4FPH A;  1JXN A;  4K9S A;  2VBB A;  4XTP A;  2Q1Z B;  1DBN A;  4QPI A;  2WZR 1;  2RS1 1;  4Q4V 2;  1GU3 A;  3RFR A;  3WQB A;  3DKQ A;  5JAX A;  2Q30 A;  4IV1 A;  1DZT A;  2CHH A;  5T5J A;  1AR6 2;  2I2S A;  4OMC A;  1N3Q A;  2CAV A;  3OGV A;  3RZZ A;  1AR8 2;  3O0V A;  5A3N A;  3NJX A;  1UYZ A;  4JTN A;  4XVH A;  2ES3 A;  3MLK A;  1HV0 A;  3R4S A;  4IE6 A;  3UYJ A;  3I59 B;  4TTG A;  4DUW A;  1S55 A;  1VRB A;  2HWD 3;  5AFB A;  3VDA A;  5LBB A;  3VN4 A;  4YGB A;  1UYY A;  2XL7 A;  3AM2 A;  1DZQ A;  3THC A;  1UY4 A;  4COV A;  4NRO A;  4YPJ A;  4C1W A;  5FQ0 B;  3RI9 A;  5A6Z A;  3VKN A;  1COV 1;  1E5S A;  2Y6K A;  5F5C A;  1F2N A;  4CP1 A;  1DHK B;  4QHB A;  3RYK A;  2B46 X;  3LGR A;  3QOP A;  5FZH A;  4JHT A;  4BLI A;  4CU9 A;  4Q4Y 3;  4HMZ A;  1OD3 A;  2W47 A;  4EN7 B;  5KXE A;  3CMG A;  2BVV A;  4JGY A;  3KCC A;  3DYM A;  3ILN A;  4XFC A;  2ZZJ A;  4AI3 A;  1G9B A;  3MID A;  1NZC A;  2VZ1 A;  3T3Y A;  2JEC A;  3GHM A;  4XET A;  1PIV 3;  4HPK A;  1UIK A;  3VDD B;  1LHN A;  5FZG A;  3VD4 A;  4NIG A;  5FUI A;  1QJY 1;  4FOV A;  1BBT 2;  1OBN A;  1REE A;  1ZZC A;  5I8S A;  2RMU 1;  4H7M A;  2OUJ A;  4D7T A;  4EWD A;  3AP6 A;  2E26 A;  4ZU7 A;  5C33 A;  1W06 A;  1GZT A;  3MFA A;  4FPL A;  4L0P A;  2RS5 1;  5FCC A;  3M7A A;  1YUD A;  4P08 A;  1QY4 A;  2W3J A;  1AL2 1;  5KHH A;  2VW2 A;  1EYB A;  4M01 A;  4R9C A;  5I0S A;  3M4F A;  2WAO A;  1NCQ C;  2VTX J;  5FYC A;  4CXW A;  2PXJ A;  2W9X A;  4GKX A;  4E2Q A;  4LMF A;  1UL9 A;  3VDC A;  5BNO B;  1W6M A;  3O1M A;  3WW3 A;  1E5R A;  3WQ0 A;  1UMI A;  3C7G A;  4GQ7 A;  2HWC 2;  3MF9 A;  2IXL A;  1GQH A;  4P00 B;  1OH3 A;  5T55 A;  2WNE A;  3LF7 A;  4HG6 B;  3WF3 A;  1PVX A;  2F17 A;  3J9S A;  3S30 A;  5LBF A;  1TEI A;  1NYW A;  4IE7 A;  4LR4 A;  3OGJ A;  4OHY A;  2BFU S;  1ND3 C;  1JOD A;  3I3Q A;  4DXZ A;  2W08 A;  5IFT A;  2ZGR A;  1PO2 2;  2KR2 A;  4PQ9 A;  1JN2 P;  3WDY A;  5F5I A;  1S0E A;  2C0Z A;  4Q4W 3;  4D6R A;  4NHY A;  1OLM A;  1UU6 A;  5C8C C;  3BB6 A;  2FZ2 A;  3DPR A;  4PF5 A;  4I01 A;  4IER A;  1PX4 A;  2GNM A;  2JE8 A;  4FSJ A;  1JOP A;  4QB1 A;  1J3Q A;  2VQU A;  1J1T A;  4AVV A;  3VBS A;  2DFB A;  3P1I A;  4OI1 A;  3MF6 A;  1EUU A;  2LW8 A;  2W95 A;  4JV4 A;  4YW4 A;  3ZYB A;  1CX4 A;  3WHU A;  4NAO A;  2WWU A;  4AG4 A;  1WWY A;  5FY9 A;  1GIC A;  4NAM A;  5DXD A;  1KS4 A;  3ZX7 A;  1SAC A;  1UO9 A;  2KA3 A;  4ASL A;  4QKN A;  3USU A;  2ZML A;  3H1M A;  4GWI A;  1OMI A;  3BOD A;  5HV0 A;  2BBA A;  3U10 A;  3U1X A;  3MW3 A;  4ES8 A;  5ACA 1;  3AKQ A;  1DQ2 A;  3A0K A;  5D8A A;  2EF6 A;  4HAN A;  5FZ1 A;  3LB9 A;  3IAP A;  5H9P A;  3CKH A;  1SPP B;  1WA4 A;  4BOW A;  2CGP A;  1LHU A;  3PIJ A;  4GMP 3;  4HVQ A;  3LZZ A;  4TLG A;  2R04 3;  1MZ5 A;  4GH4 A;  5A7W B;  4CEW A;  5D2A A;  2WO3 A;  1YRZ A;  4Q2F A;  5CFD B;  4QT6 A;  5BXX A;  4XIL A;  3O0W A;  4QQ2 A;  2VTX A;  3U0Z A;  1SLL A;  2X5I B;  1WLC A;  2BNN A;  4HSL A;  4PCR A;  4ATF A;  5JXH A;  5LW9 A;  4NPM A;  2RM2 1;  3VBR A;  4GB3 1;  3BUC A;  1ZRD A;  3T08 A;  3KM5 A;  5DAV A;  1CPM A;  2Z42 A;  3ZPO A;  5F3C A;  1J1L A;  2HEW F;  3ASI A;  3WDT A;  3X29 B;  3BTY A;  2IWG B;  5JMO A;  2AUY A;  2RR1 2;  4IV1 C;  3K3O A;  4QHO A;  1CQ9 A;  1SFP A;  1HN1 A;  2HYX A;  5D21 A;  1O3R A;  1GOF A;  1Q8S A;  4KWJ A;  2XJU A;  5HCH A;  4OHW A;  1VBA 3;  1FOD 1;  1RUI 2;  1IPK A;  5IAV A;  5IYY A;  3AC0 A;  1NKG A;  2BNO A;  3MPB A;  3IBM A;  3T2T A;  2XB6 C;  4IGQ A;  5FWE A;  4JAA A;  4A45 A;  3CDZ B;  4MV2 A;  2BGO A;  5ABJ A;  2TNF A;  1XBF A;  3ZN4 A;  2HEV F;  1W6N A;  1NCR C;  3SKJ E;  3LFI A;  2ENR A;  2ZA9 A;  1MS9 A;  3VKM A;  2F6B A;  2OZ6 A;  2Y6J A;  1MS0 A;  3WW4 A;  3R4U A;  1B35 B;  4WM7 B;  1APN A;  3ZYG A;  4CUG A;  4HXC A;  3FE5 A;  1SG3 A;  3PMS A;  1BKZ A;  4E4S A;  2EIG A;  2WNV B;  1BEV 3;  2QUO A;  3C7H A;  5CKN A;  4LEJ A;  1ASJ 3;  3KB5 A;  4JVA A;  4RS5 A;  3DYO A;  2D93 A;  1G86 A;  1V6K A;  1X7N A;  2MNG A;  3N35 A;  4UAP A;  4OFG A;  2VCM A;  2X53 S;  5DN2 A;  1R1Z A;  3OPT A;  4Y1U A;  2BVB A;  3N3H A;  4UFM A;  2OZJ A;  5GLW A;  4FTS A;  1AJO A;  1FPN 2;  3PME A;  2R07 2;  5FZK A;  4R4Z A;  4XFH A;  1E5H A;  1CGP A;  2J1S A;  3J8F 3;  2YFU A;  3JD7 1;  5GZF A;  2ZAC A;  1D0G A;  4XAE A;  1RUG 2;  3GDB A;  3U07 A;  1GMM A;  1QWR A;  4JDM A;  3GNE A;  3TN9 1;  4AYU A;  5FZC A;  2R06 2;  3AP5 A;  5C9A B;  3PU8 A;  2G19 A;  1FX5 A;  4XQW A;  5HI0 A;  2WS9 2;  2V72 A;  1F4H A;  1RJ8 A;  1VIW B;  4TN7 A;  4KU8 A;  2JIG A;  2EXI A;  1IKP A;  3C3V A;  5HCB A;  1SLB A;  2WZR 2;  3BKZ A;  4A3X A;  1ZRF A;  1CR7 A;  3EMR A;  2D6L X;  3OD0 A;  4KBB A;  3VBO B;  1WGP A;  3A7Q A;  3WF0 A;  5LK7 B;  2BUK A;  2HWE 3;  2ZEY A;  5JZG B;  1KS5 A;  4OMD A;  5KXC A;  4A41 A;  1T6B X;  1CVN A;  4NPR A;  3PU3 A;  1LHO A;  4E4D X;  3ZIX A;  5A3M A;  3INA A;  3N36 A;  5EQU A;  2LRO A;  1PIV 1;  3DPR C;  1UYP A;  2VNR A;  2V73 A;  1OPO A;  4LHL A;  4Q0S A;  2WIN B;  4MVT A;  1AUY A;  2BV4 A;  4N8M A;  3PUA A;  5C4W A;  4A3Z A;  2JIJ A;  2XVG A;  1XND A;  3UJQ A;  4B7K A;  4Q4X 1;  1COV 2;  4QGN A;  4RYD A;  1RUE 3;  2W1S A;  1GAN A;  2VZQ A;  2RDQ A;  1OOP A;  3DGT A;  3O1U A;  3URF A;  2XJV A;  1NA1 B;  1O91 A;  1POQ A;  5K0U B;  3IKW A;  1OUX A;  3AZZ A;  2OT7 A;  4RSU A;  5GZD A;  4N53 B;  1ENS A;  3RS6 A;  5F39 A;  5ACA 3;  5FYT A;  1STM A;  1TNR A;  1A3K A;  4FI9 A;  4WVW A;  1RHI 1;  4YW5 A;  3VDD C;  3IM0 A;  3OOX A;  2VO5 A;  2K46 A;  3S57 A;  2DCT A;  1G9D A;  3GJB A;  3JXS A;  4XMA A;  1LKN A;  5FZ8 A;  3A0N A;  1OLR A;  4P9Y A;  3AP4 A;  3ME2 A;  3BVC A;  4GH4 C;  1C8N A;  2BTV C;  3IIA A;  1K42 A;  1LOF A;  1XSR A;  4NHM A;  2JE9 A;  4JQT A;  4Q0V A;  4KGG A;  5JOZ A;  5A1A A;  2C4X A;  2I07 B;  3S7E A;  2ZGO A;  4PBP A;  1W0O A;  2RS5 2;  2HLE A;  3OGS A;  3OSD A;  2CWM A;  4Q4W 1;  5JCT A;  1QJX 3;  1TME 3;  2E7T A;  2NM1 A;  3HEI A;  2Q8E A;  2NZ9 A;  4UBG A;  2FDG A;  2PHR A;  2WR9 A;  3Q8E A;  5J96 B;  3NV1 A;  1VAK A;  1JUI A;  2VOV A;  2WA3 A;  4GKY A;  1OUR A;  5A32 B;  3JBG 1;  4RGG A;  2ZTN A;  2Y8K A;  2EVX A;  1NXD 1;  2UWB A;  3KV6 A;  4A6O A;  3TEX A;  4M4P A;  4X6R B;  4LXL A;  1QJE A;  1W6P B;  1GNY A;  3E5X A;  2LRP A;  4KMQ A;  5JXG A;  2I45 A;  4BH9 A;  5DZF A;  1D4M 1;  1UOB A;  3BU0 A;  3KD4 A;  1ZZB A;  3AZY A;  3W20 A;  2FDJ A;  4AZZ A;  3QLQ A;  1ZZ8 A;  5BUV A;  5LA1 A;  3VBF B;  4BCU A;  3ROU A;  5K8S A;  1CON A;  1IS5 A;  3ZXA C;  4EV0 A;  1CPN A;  5A7P A;  1UU4 A;  3KZ4 C;  4GMP 1;  3GZE A;  3LSD A;  2R04 1;  1ULD A;  4LHK A;  2X05 A;  3WG1 A;  4HOO A;  1DU3 D;  1HXS 3;  3RDI A;  1LHV A;  2WO7 A;  1JYT A;  4C0B A;  1W0N A;  4E2G A;  4CCN A;  4Q1P A;  5IVJ A;  5A3W A;  3I3E A;  4B1L A;  4LLF A;  3TRS B;  4CE8 A;  1F5J A;  1ZZ9 A;  5DQ0 A;  3ZXK A;  4NIA A;  2V09 A;  5JOX A;  4LBQ A;  4NN0 A;  2UY9 A;  3L2Y A;  2VUC A;  1W6Q B;  3GBF A;  3IDE A;  4XOG A;  5DDJ 3;  1LU1 A;  2P4E A;  2SLI A;  2B5H A;  4Q0U A;  4BIO A;  1W2A X;  3E6B A;  5FZD A;  4XZU G;  4QX1 A;  5FR3 A;  3AKP A;  2D44 A;  4XFG A;  1ND2 B;  2R16 A;  2VME A;  4UFK A;  1EPZ A;  4F83 A;  2W91 A;  4Z92 B;  5CAD A;  3ZFF B;  1BVV A;  3FL7 A;  4ZKT B;  3HD8 B;  4AVT A;  4EYU A;  2G9F A;  3KHC A;  4G3Y C;  3AYE A;  5T5O A;  1PMI A;  1JHJ A;  1S0G A;  5JI7 A;  1RUD 3;  4PDW B;  3KT4 A;  2X5I C;  4Y3O A;  4AEJ A;  1WCD J;  4HLT A;  5K4L A;  5FBJ A;  1WW7 A;  2PLV 3;  4P14 A;  3B02 A;  4CDU B;  1RIN A;  5GZG A;  1DYO A;  2P17 A;  1IPJ A;  2BW8 A;  2RM2 2;  3N7M A;  3WNX A;  4GB3 2;  5DG2 A;  2ARE A;  4N9I A;  4O9G A;  5G05 L;  5AC9 3;  4ATE A;  1HRV 3;  1QQP 3;  1W8H A;  4LKS A;  2PHD A;  1HB4 A;  2CY6 A;  2VBP A;  3POY A;  4XXA A;  1HQN A;  1PO1 1;  4XFA A;  2HWF 3;  1ASJ 1;  4Z07 A;  1CZV A;  2BOJ A;  4XW3 A;  5FYV A;  5FXX A;  1VBE 3;  2DBN A;  3AXE A;  2JB4 A;  3QH6 A;  3POJ A;  4OHX A;  3ZYI B;  3FUQ A;  2AEN A;  4O7X A;  1BK0 A;  5GM0 A;  1LHW A;  1OF4 A;  1L7L A;  2DV9 A;  1ULP A;  1VB4 A;  3B69 A;  3WQ1 A;  2VQ0 A;  3J8F 1;  4B8E A;  5A6Y A;  1UY3 A;  4AQT A;  4QU2 A;  3HQU A;  4FOW A;  1B35 C;  1ULE A;  2VD7 A;  2FZ1 A;  4NO4 A;  3DCQ A;  4HSJ A;  3SEE A;  2GZW A;  1UU5 A;  5JIU A;  1NG0 A;  2PHW A;  1LOG A;  4XXP A;  3MW4 A;  2D3S A;  4K40 A;  2W2I A;  4L2N A;  5FTT C;  3H42 B;  5F2S A;  3OBZ A;  3I2O A;  3IDC B;  3LEI A;  4O61 A;  4YVW A;  3T1L A;  3W59 A;  2IUW A;  5CFC B;  1DQ5 A;  3M8L A;  5IHR A;  4ZPI A;  4DY5 A;  3MUY 1;  4KH9 A;  4CU6 A;  4I2O A;  3RJ2 X;  1EAH 3;  3ABZ A;  4E8C A;  4QPG B;  5DPN A;  2VQA A;  4GWJ A;  1RUF 1;  2D97 A;  2HWE 1;  4F8A A;  3I4I A;  4XAA A;  3CU7 A;  3JD7 2;  4LNV A;  4DOU A;  5FY4 A;  5KHI A;  4FTB A;  1RXF A;  1H8T A;  5EXO A;  5C9A C;  1LGB A;  1W05 A;  2CDO A;  3MIE A;  4MLO A;  1Q56 A;  4OCT A;  5FMD A;  3TN9 2;  4DNY A;  4DPN A;  1XNT A;  1EY2 A;  5FK8 A;  2QQK A;  5HCA A;  2JDA A;  5A70 A;  5KC5 A;  2QQU A;  4R4X A;  3N7L A;  1DQ6 A;  3WV6 A;  1LUL A;  5CZK A;  1IOA A;  1Z0H A;  4YRD A;  4YW7 A;  4C0H A;  1CZS A;  1GWL A;  1AX1 A;  1ZBE 3;  5FMO L;  2C26 A;  4CCE A;  1WW4 A;  2YB7 A;  2D3P A;  1RUE 1;  3JQX A;  4D69 A;  4Y5T A;  2XLG A;  1UN1 A;  1PNF A;  5JZG C;  3N9N A;  1LNS A;  3Q8B A;  5BY5 A;  2BGC A;  4XBL A;  2BJS A;  5F32 A;  1OA3 A;  2DCJ A;  3ZVX A;  4BZ4 A;  4N7I A;  2EAL A;  1PGW 2;  3IT8 A;  3U37 A;  4IE0 A;  1AX0 A;  4XFI A;  4CPB D;  1QH6 A;  3MO4 A;  2OII A;  4NRP A;  4AI9 A;  5JR2 A;  4QGM A;  2DVF A;  2KXL A;  1YNA A;  2VG9 A;  2XON A;  3AVR A;  4LO8 A;  4GZ9 A;  3UGH A;  5EHD A;  5H9R A;  1XE7 A;  1K5M A;  3PJQ A;  3RWN A;  3ZKU A;  4FAG A;  2JKX A;  3N9O A;  5JPN B;  2ERF A;  2A6W A;  2VZV A;  3NWK A;  1SFN A;  3N9M A;  3T0B A;  5A7Q A;  3ACH A;  4NOT A;  2R1B A;  3GZU C;  4Q5O A;  1CAU A;  3FHI B;  4HKW A;  1GUI A;  2JXA A;  4XDQ A;  3HNY M;  5IVE A;  1UZ0 A;  4HT1 T;  1RUC 2;  2QQN A;  4IE4 A;  4Q4X 2;  4QB2 A;  1JZ6 A;  4RN5 A;  1TVG A;  3CF6 E;  4YNI A;  3U4X A;  4MGZ E;  4M3C F;  2WFF 3;  1WMX A;  2FCV A;  2VMG A;  4N53 C;  3OUI A;  1S0C A;  5APA A;  1UPS A;  3ILR A;  3SIS A;  4AI2 A;  4UW3 A;  4XJZ A;  2PFW A;  2B9U A;  3RG0 A;  5I0D A;  3KV9 A;  1RHI 2;  3O1O A;  1U5X A;  1PMH X;  3H3Z A;  3PVN A;  4PLM A;  2Z69 A;  2XWJ B;  4IV3 B;  4NIH A;  3B3Q E;  4NMI A;  4MG2 A;  5C8C B;  2ZS6 B;  1V6L A;  4KWK A;  4BQ2 A;  3H0O A;  4OQ8 A;  4A7Z A;  1SBE A;  2R0F A;  2G1M A;  1AVB A;  1EV1 3;  2CDP A;  5IVB A;  4PI0 A;  1MQT B;  1E57 A;  1ST8 A;  1UD1 A;  1PK6 C;  2JX9 A;  2VOW A;  3WNM A;  1W9S A;  4FP2 A;  1UOF A;  3AKT A;  2GDF A;  4URT A;  5LK5 A;  3RWK X;  4AAP A;  2IVJ A;  4XJ8 A;  1O7F A;  1XPW A;  1YC6 1;  1ZYB A;  2ZGL A;  1JYW A;  3UL2 A;  2D5H A;  1H6Y A;  1LOE A;  1V6N A;  3UET A;  2YPJ A;  4RGA A;  1LOB A;  3LOB A;  3ZR5 A;  3FJS A;  1HXS 1;  1LRH A;  4HZF A;  3WP6 A;  2RVA A;  3JBG 2;  1OFN A;  1J58 A;  3OY8 A;  2Y0I A;  3HBZ A;  3ZDV A;  5AFE A;  3Q8C A;  3AYA A;  5K7P A;  4MZU A;  4Y1Y A;  4ZXK A;  3BYW A;  2FCT A;  3LWC A;  3I3B A;  2Z2S B;  4Q0Q A;  4UWD A;  4X8P A;  4B4P A;  1DGL A;  1HN0 A;  1W3X A;  3HMY A;  1RUN A;  1D4M 2;  1WD3 A;  2BZD A;  3VBF C;  4W50 A;  5LAS A;  4NUB A;  4JGZ A;  4YGE A;  4XEZ A;  4CCO A;  2GMP A;  2GMM A;  2YRO A;  3JB8 A;  4R8H A;  3ZFG A;  3ZXD A;  2Q8C A;  4MXW B;  4CEY C;  3LEK A;  4EN8 B;  4YFZ A;  2YY1 A;  3K75 B;  1UZZ A;  2BYV E;  4KG8 A;  1AR7 2;  1RUD 1;  1PVC 2;  4AFC A;  3K51 A;  2FDI A;  3LA3 A;  4I0A A;  3AXD A;  2DCK A;  2PLV 1;  2ZZQ A;  4IV1 B;  4NRM A;  2D7F A;  3NNF A;  2SBA A;  1TMF 3;  4XF1 A;  1OI6 A;  2XWB B;  4IEP A;  4YVW C;  3POS A;  4B3N A;  4PBO A;  4XDO A;  4YSF A;  1QQP 1;  3HWJ A;  1RMU 2;  3SQO A;  1ND2 C;  2ATF A;  2CNA A;  3CNA A;  2HWF 1;  2J1A A;  2UY8 A;  2WSV A;  2TBV A;  1IQA A;  1VJ2 A;  1VBE 1;  5LBC A;  1HJG A;  1NCR B;  4PDW C;  3DYP A;  1H8T C;  4Y22 A;  2C6S A;  2Y38 A;  3AP9 A;  1ZBA 1;  4QX5 A;  2PHT A;  4MGT A;  4XBN A;  1LJ7 A;  2VOX A;  4AED A;  4Y4R A;  1VBC 3;  2YGL A;  2XPJ A;  4CU8 A;  3WP3 A;  3AMP A;  2H6C A;  4BPZ A;  1GP5 A;  3PUH A;  4S2F A;  1PZ7 A;  1TNF A;  3E5Q A;  1R09 3;  5FO8 B;  2E63 A;  3AMN A;  2O8Q A;  3PLQ A;  5F6K A;  1X33 A;  4DB5 A;  3BI3 A;  1ENX A;  4AFD A;  3CJX A;  2FHR A;  5JDB A;  4HPK B;  3H8O A;  1PO1 2;  5ANN A;  3W5N A;  1RL3 A;  4UF0 B;  5FLI A;  1CN1 A;  2X10 A;  1NQJ A;  4YVS A;  5IVC A;  3VL8 A;  1NOV A;  1L7R A;  4LBL A;  4DIQ A;  3RNS A;  4FPO B;  4HET A;  3WDU A;  4TZD A;  5T3N A;  1D2Q A;  3MLJ A;  1QHD A;  1EAH 1;  1K5M C;  4QU1 A;  2PQQ A;  3AL5 A;  4AEK A;  1GQP A;  1AYM 3;  3CO2 A;  2XQX A;  1W6O A;  4F3J A;  1YQ2 A;  5FV3 A;  4AVA A;  5L9V A;  1PMJ X;  3WW1 A;  2XUE A;  3H7J A;  4YM2 A;  3GZA A;  4LBK A;  3EB7 A;  4Y26 A;  1ODN A;  1W6M B;  4ZU4 A;  5H9Q A;  5L73 A;  5LAT A;  2ARX A;  3VZJ A;  3NW4 A;  2VXJ A;  2KD7 A;  4BB3 A;  2EXH A;  1C1F A;  5J37 A;  1EP0 A;  2BQP A;  5CFC C;  3GM8 A;  5LA9 A;  2WUH A;  1OA4 A;  3SCG A;  2GAL A;  3AZV A;  3NV3 A;  3ENR A;  3ZN6 A;  2HKX A;  1U0A A;  2X8K A;  4QPG C;  4LBJ A;  1VP6 A;  1DFQ A;  4N9H A;  2CL2 A;  1RUF 2;  1RYY A;  2MEV 2;  3DPR B;  1WCU A;  1S0J A;  2YDE A;  5KHJ A;  1FI2 A;  1A6C A;  1C8M 1;  1OKQ A;  2ZMN A;  4IEQ A;  1QXR A;  5EYX A;  4HKO A;  1MS5 A;  5CG9 A;  1KFX L;  4XE9 A;  1GP4 A;  3VBS B;  3VUO A;  1NQD A;  2WNU C;  1PGL 2;  1Z7S 2;  1EPW A;  2HWB 1;  1G7Y A;  1K3I A;  1UZW A;  3C7E A;  3TAY A;  1SHW B;  2BFU L;  3CL1 A;  3WLU A;  5FXZ A;  1AL0 G;  1S1A A;  1ZRC A;  5FJK A;  4ZZ8 A;  3USU B;  5F7U A;  2W5F A;  5IJR A;  3LIH A;  3J26 N;  4XJW A;  3CJI A;  4J1W A;  3K4D A;  1UKG A;  3KVA A;  5D8A B;  2GN3 A;  1MS8 A;  1JZ8 A;  4C91 A;  2JWP A;  2WFF 1;  1RXG A;  3R0R A;  3FC0 A;  2ZGS A;  4L11 A;  3ZSJ A;  2XLA A;  4AK3 A;  1MZ6 A;  1C5I A;  4XJU A;  3I3D A;  4MXV A;  4UW4 A;  1IS3 A;  4GH4 B;  4CEW B;  3KQR A;  4Q8K A;  3WUD A;  3NAP A;  4BQ4 A;  2W0X A;  2R1D A;  1CIW A;  2B45 X;  5IVV A;  3IDB B;  1KXG A;  3I54 A;  4FTE A;  1HRI 3;  2AZ5 A;  3ACL A;  1A78 A;  1OHF A;  3EBR A;  5I8Y A;  1W8N A;  4OUE A;  5FMB A;  5C3R A;  4FPG A;  2BPA 2;  3OD4 A;  2RS3 3;  2VUL A;  3VBR B;  1DGR N;  1HB2 A;  3EHK A;  2XJP A;  3RMX A;  3ZFE A;  2VU9 A;  2P5B A;  1LOA A;  2P3Y A;  3C8X A;  2Y34 A;  1GV9 A;  3WDX A;  3JU9 A;  3BN6 A;  3GJA A;  5F3E A;  3H1Y A;  1IQD C;  1ULF A;  2Z79 A;  3I7D A;  1F9K A;  3W21 A;  2OW4 A;  5FYZ A;  3WDW A;  1YCI A;  2W68 A;  1HJF A;  1QOT A;  2VZU A;  4GJZ A;  1W9Y A;  3KF5 A;  2J1T A;  1T6G C;  1NUK A;  3WT3 A;  4BLJ A;  1VRH 2;  2E32 A;  4RR3 A;  3LEG A;  5LB6 A;  4IV3 C;  4KG0 A;  1XC6 A;  4A6S A;  2K9Z A;  2YUE A;  3I3M A;  1BYH A;  3WZ1 A;  3SEP A;  5ABJ B;  1KIT A;  2BWC A;  4CDQ A;  3R05 A;  3DV8 A;  1NXM A;  1W6N B;  1HQW A;  4QX7 A;  1OVP A;  3CBN A;  2XBO 3;  1UAI A;  1MQT C;  3I2G A;  5JLV A;  1AYN 3;  1BCX A;  1GYK A;  1C1L A;  4NRQ A;  1K12 A;  5T50 A;  5A7S A;  1R08 2;  4FP3 A;  4JKL A;  4H7L A;  2HH9 A;  5CAZ A;  1RUJ 3;  1FAT A;  1W2U A;  4HFS A;  1UIJ A;  1X8M A;  1PNG A;  2ZEX A;  1QIQ A;  3OBA A;  3ZDS A;  1J84 A;  2GC1 A;  3LQC A;  4RS5 B;  1V9U 3;  5JWP A;  2HBT A;  3HN3 A;  5J36 A;  4ZS3 A;  2YU2 A;  2G9Z A;  3ZSK A;  3DF0 A;  5A33 A;  1SQ4 A;  5T54 A;  4IEW A;  3AFG A;  5FQ0 A;  2NYY A;  3T2O A;  3GXU A;  2GND A;  1TMF 1;  4LHN A;  5FZF A;  5BNN A;  4YVS C;  3ZO0 B;  3D0J A;  1O5L A;  2RE9 A;  1VBD 1;  2ZGK A;  4LIU A;  4RQP C;  4F7Z A;  2AEZ A;  4LKE A;  5BV6 A;  4QAW A;  1Y7B A;  4JKK A;  4B4R A;  1WMD A;  2DU1 A;  2ZXQ A;  2VVE A;  4PI2 A;  1UWW A;  4FBF A;  1OKO A;  4URA A;  4AI0 A;  2QDR A;  1FMD 3;  3GGL A;  1H9W A;  4J6G A;  4P02 B;  1D2S A;  3I2I A;  4QPI C;  2XQR A;  4QXB A;  3O1P A;  2DFC A;  1K5J A;  3TEW A;  4EJR A;  1A8D A;  2VCB A;  3DEC A;  3ETQ A;  1POV 3;  1X36 A;  3OBR A;  3LA7 A;  2CTV A;  1VBC 1;  1BJQ A;  3T2P A;  3U14 A;  5C3Q A;  3WR0 A;  3M3C A;  3KVB A;  2J1V A;  1R09 1;  4E4Z A;  2IXJ A;  4XCA A;  5GZE A;  3CIH A;  1JOB A;  2DWR A;  4JQR A;  3OG2 A;  1VBB 3;  1W8U A;  4RHV 3;  1AJK A;  1RGS A;  2NN8 A;  3WOG A;  2RJK A;  4RFR B;  1W9F A;  3ZSE A;  5BNO A;  3NO8 A;  2ZBJ A;  3GAL A;  1SLC A;  2VEC A;  3PHM A;  3K46 A;  2VW0 A;  4Z2W A;  3PUR A;  1RUH 3;  5L7O A;  1WD4 A;  2O8O A;  1R64 A;  3TWI A;  5CB7 A;  1S2B A;  1ZBA 2;  4JHZ A;  2J42 A;  3MIC A;  1QJU 1;  2A5Z A;  2A6X A;  2WQ8 A;  5GLV A;  3K4A A;  2FMY A;  5FO9 B;  1MEC 1;  2PHX A;  3FFZ A;  5FPA A;  4CCC A;  1R1A 3;  3N9L A;  1AYM 1;  5FZL A;  4Y1X A;  5B4N A;  2JG8 A;  4JGY C;  5KWR A;  4UFL A;  3WDV A;  5J09 A;  3BPZ A;  1Y9Q A;  2JDZ A;  2WSU A;  4MGQ A;  4BXF A;  1YFY A;  4GXL A;  4QQL A;  2YGM A;  2DUQ A;  1H30 A;  3UKV A;  4LOS A;  1JYV A;  3POI A;  3PVE A;  4BK4 A;  1C28 A;  3MYX A;  1G9C A;  5M0T A;  1XNA A;  1VAV A;  2D6P A;  2Y6F A;  1O4T A;  3B00 A;  1MVQ A;  4N43 A;  2XVK A;  3HR9 A;  1H2L A;  1YLL A;  1WW6 A;  4QHZ A;  5F37 A;  2XHN A;  2XXZ A;  5LRR A;  2ZX4 A;  5CIS A;  1RVF 3;  1RJ7 A;  2QZ3 A;  1LOD A;  2X29 A;  4PIY A;  4AEM A;  3QAC A;  2HWD 1;  4C8D A;  5JIA A;  5DUV A;  1Q8O A;  4MET A;  1YHF A;  1XOY A;  1SBF A;  1W2O A;  1S0I A;  3DKW A;  1JHN A;  2EA7 A;  3KMH A;  4Q8L A;  2PHL A;  3VL9 A;  2QBX A;  1S2K A;  3SLI A;  1OF3 A;  2XGX A;  4KL1 A;  1W8O A;  2ZGN A;  3OEB A;  4GWM A;  1AR9 3;  3MIG A;  4AFM A;  4YW6 A;  4AVS A;  2RS1 2;  1O3S A;  2CGN A;  2P37 A;  3NNM A;  4RFT 0;  4CTE A;  2QQJ A;  3HIF A;  5CFD A;  4YZ1 A;  1Q8P A;  4Q4Y 1;  3FLP A;  5ISL A;  4LKD A;  4Q4V 3;  1N1T A;  3K77 A;  2ET1 A;  1LED A;  2IXK A;  2XKP A;  3C2U A;  3AJZ A;  4J25 A;  4LPL A;  4MGI E;  1AR6 3;  3E97 A;  2AR6 A;  1AR8 3;  2UU8 A;  4D7Y A;  4Z1V A;  2ZKN A;  5AVP A;  3THP A;  4A42 A;  1OH4 A;  1DQ4 A;  1OC1 A;  5F8P A;  2ETE A;  5JXI A;  3IDA A;  3NJY A;  2IXC A;  4MH0 E;  4YLZ A;  2VZ3 A;  1KJL A;  5FRE A;  2GH2 A;  5BNP A;  5FJH A;  2XUM A;  5J48 A;  2GNT A;  3LAG A;  1C8M 2;  4MUV A;  5FZ7 A;  1BHG A;  2YPD A;  1LTE A;  1UZY A;  1NX9 A;  3E1F 1;  4LBM A;  4WVM A;  3VBS C;  5FPL A;  1X8E A;  1HRI 1;  4LK7 A;  4L92 A;  2E33 A;  3IMM A;  3SCH A;  2QTW B;  1F8V A;  4LBQ B;  1N1Y A;  1NLS A;  2W94 A;  1WCK A;  4W65 A;  5FP4 A;  4QQH A;  5D8A C;  5KR7 A;  1CAW B;  2NPI A;  4IQP A;  2ZMK A;  3VD9 A;  2WBK A;  5AVA A;  5IT6 A;  3ZYP A;  1QJY 2;  2A1X A;  4LE3 A;  5CU1 A;  4CEW C;  1V0A A;  5CVR A;  2RMU 2;  5GLT A;  4Y33 A;  1ENR A;  3W9A A;  5FMC A;  1O6U A;  4N90 A;  1N1V A;  2H0B A;  3ZM8 A;  2CYF A;  2DCZ A;  4OUL A;  3OCP A;  1BBT 3;  1AL2 2;  1PK6 B;  1W8T A;  1JU4 A;  3GHN A;  1AXK A;  5CA6 A;  3PL0 A;  3VBR C;  2XVL A;  3AVS A;  1SDW A;  1P8J A;  2QQM A;  4BM8 A;  3NMB A;  3WW2 A;  4MGK E;  3DXT A;  1UZV A;  1AYN 1;  1NZI A;  3U75 A;  5T52 A;  4CZS A;  3O7O A;  5C3P A;  3ITQ A;  3VBH A;  3SKV A;  4BIF A;  1V6J A;  1RUJ 1;  2OQ7 A;  3I49 A;  3WY6 A;  4GA9 A;  4HK8 A;  4YW1 A;  5FP8 A;  2J7M A;  3DUI A;  3S0M A;  4PQQ A;  5DAX A;  2PHU A;  3B5L B;  4FAH A;  2HWC 3;  2LUW A;  2UUR A;  3D5O A;  5ABJ C;  5BNP C;  5IAX A;  1JOJ A;  4UT5 A;  3SC7 X;  4KI5 M;  3BAL A;  5HCF A;  3U11 A;  2I74 A;  2QNK A;  2RJL A;  4CEY B;  5L7O C;  1PO2 3;  3V0A A;  1ENQ A;  2VR4 A;  2B4K A;  4JDO A;  4K8F A;  4XF4 A;  4OVE A;  1Q43 A;  4AHY A;  1DCS A;  5FUP A;  4DUV A;  1JZ2 A;  5HPO A;  4FPY A;  4OLL A;  2E31 A;  3TEY A;  4RS5 C;  3VD3 A;  1FMD 1;  5FZA A;  3OJB A;  3T4H B;  4YVW B;  1JMU B;  5DAB A;  3LOI A;  4QGL A;  3SH5 A;  2VY0 A;  4IL7 A;  4AI1 A;  5HV4 A;  3KT7 A;  3IWZ A;  2FD8 A;  4LHS A;  1POV 1;  2PAM A;  1UNB A;  4GUL A;  4CP2 A;  3VHN A;  4N43 C;  2FCU A;  2G9G A;  4YG6 A;  4Y24 A;  1VBA 1;  1MS1 A;  3BTX A;  5IFP A;  5FO7 B;  4JTO A;  1ZVF A;  4FPE A;  4IEO A;  4PIZ A;  4XHX A;  3HJR A;  1H8T B;  3UES A;  1VBB 1;  1Z78 A;  2W39 A;  2P3K A;  5G04 L;  5FXW A;  3POF A;  5DAP A;  4UFH A;  2VMF A;  4BMB A;  1UX6 A;  3ZYR A;  2J1R A;  3O1V A;  2WN3 A;  3LDR A;  3OUJ A;  1KDM A;  1IZ3 A;  2QQL A;  3F95 A;  3ZXL A;  2WZE A;  3ALQ A;  3GYD A;  4ISQ A;  4R9B A;  4B29 A;  4DXR A;  3T2Q A;  1VR3 A;  3M3E A;  3MPP G;  1WBF A;  2XJR A;  3D6E A;  2H0V A;  3RYR A;  5EJZ B;  1E5I A;  1BEV 1;  2JE7 A;  3AMM A;  1NLR A;  4K21 A;  1IS6 A;  1D0H A;  1R1A 1;  3N7J A;  2DUO A;  4GMP 0;  2K0G A;  4CDW A;  1SBD A;  2RR1 3;  1PX3 A;  1JUH A;  2WAB A;  1FOD 2;  2XJQ A;  5C3S A;  5I93 A;  3B94 A;  3ZLI A;  3TB0 A;  2JDY A;  3TBD A;  3P3P A;  4XYX A;  4B1M A;  3NL1 A;  4P5Y A;  1A34 A;  3ATG A;  1RUI 3;  1GBG A;  4AHW A;  1K5M B;  3PJY A;  3UGF A;  4NPL A;  1GNH A;  2GN7 A;  2B7Y A;  4MSV A;  3IPV A;  5FP3 A;  1H2K A;  2YXS A;  1KQR A;  3J7H A;  4XUR A;  2OVU A;  4DXT A;  3WCR A;  5TSW A;  1SMV A;  1N3P A;  1UMZ A;  2W92 A;  3M1H A;  4EZ4 A;  5C4W C;  1CAU B;  1QXP A;  5E1R A;  4I30 A;  4XFF A;  5FYI A;  5FYH A;  4IEV A;  4BU2 A;  3R6S A;  3RZG A;  5E16 A;  3ZYH A;  1QJU 2;  1OOP C;  1ULO A;  1W9W A;  1CJD A;  4UW6 A;  4CVU A;  1O8P A;  3BU7 A;  4CCM A;  1PM7 A;  2HJI A;  5E8A A;  2FDK A;  3E6D A;  1OQD A;  5T5P A;  4CRQ A;  4CA9 A;  1IKQ A;  3MFC A;  3ZMO A;  1NY7 1;  3I2F A;  4ARX A;  4YM3 A;  1SLT A;  3VDB A;  1Q8Q A;  1BMV 1;  5FKB A;  1XB9 A;  4BJ0 A;  4BQY A;  1KFU L;  2PEL A;  1H1M A;  4DFS A;  1XNC A;  3MV1 1;  3B01 A;  2V5D A;  4KWU A;  2RDR A;  2EIB A;  3K48 A;  5IK5 A;  4Q4V 1;  2G4I A;  2NQY A;  1OPM A;  1LOF C;  1YFW A;  2ZHK A;  3HOB A;  4XJ9 A;  5FLJ A;  1S2E A;  2YFZ A;  2A6Y A;  1FPN 3;  2Q4S A;  1G6N A;  2R07 3;  4JC1 A;  4AQS A;  1AR8 1;  3GBW A;  4XUN A;  2WT1 A;  5FRA A;  5FKC A;  1US2 A;  2HWD 2;  3USS A;  2ARA A;  1ULC A;  1W03 A;  2EID A;  4IEU A;  4M3C E;  2ADE A;  4IW3 A;  1LEN A;  1UW8 A;  2WNU B;  5FY5 A;  1S0B A;  3EYP A;  4ZY9 A;  1RUG 3;  4ARY A;  4DY3 A;  2OS2 A;  5LZ6 A;  2R06 3;  4FQ4 A;  1SLA A;  3LE0 A;  2Y6L A;  1SCR A;  1YQ5 A;  4K3U A;  2P6C A;  2IVI B;  2WS9 3;  4LLO A;  4XF0 A;  2OYZ A;  3ZFF A;  2A7A A;  2GC2 A;  2MHF A;  3AKR A;  2Q1F A;  5CKM A;  3OY8 B;  2WLQ A;  1AZD A;  4XF3 A;  2W87 A;  1VAL A;  2WZR 3;  4Q4Y 2;  4YM0 A;  4TXW A;  5J98 B;  4BQ1 A;  4BIS A;  1QMJ A;  4LK6 A;  1QU0 A;  4CXX A;  2VL4 A;  3KLS A;  1QF3 A;  4Y20 A;  1QOO A;  1W04 A;  3VBU A;  1PIV 2;  3AZX A;  5FK7 A;  4XQ4 A;  4RA0 A;  1VMJ A;  5C5T A;  3ZN5 A;  4AW7 A;  4LO6 B;  1V6O A;  2GP3 A;  4BHP A;  1YXW A;  2B42 B;  3ZFG B;  1OXC A;  2WFP A;  3LDK A;  3NNG A;  5C5U A;  1YIF A;  3WG4 A;  2D5F A;  5A3T A;  5DAW A;  1XJA A;  2XHK A;  4Q0P A;  3UKN A;  2EXK A;  5JMC A;  1QJF A;  3J7N A;  2O14 A;  2QKD A;  4LO4 B;  4L99 A;  2BNM A;  1BBT 1;  2WJS A;  1QJX 1;  1TME 1;  3RSJ A;  4XUP A;  1GKB A;  5IUQ A;  2YC4 A;  3WCS A;  2E51 A;  3B9I A;  1COV 3;  1OUS A;  4L97 A;  4HN0 A;  2N7G A;  1UQX A;  4AR2 A;  2A71 A;  5L19 A;  3HAG A;  4NJ4 A;  3LCP A;  5SV5 A;  3UV9 A;  3H50 A;  3PVB B;  5A6X A;  4OQ9 A;  1WUV A;  5C3O A;  4QX8 A;  3UK9 A;  1F15 A;  4UBH A;  5A7O A;  3MZH A;  3V0B A;  1WLW A;  4BA6 A;  1QEX A;  1XSQ A;  4DRR A;  4FVV A;  4OYU A;  1H4G A;  5HXM A;  4BE3 A;  1H4H A;  2JJ6 A;  3I2J A;  2ILM A;  4Y22 B;  1DQ0 A;  1QJY 3;  5K9Y A;  5FOB B;  4Q4W 2;  2ARB A;  1H9P A;  4IEZ A;  4AED B;  4OUS A;  1AXY A;  4CP9 A;  5CG8 A;  3NST A;  5A3P A;  1VE0 A;  2RS5 3;  3SXW A;  2WO1 A;  4AVB A;  2A70 A;  3F2Z A;  4MX3 A;  1C3H A;  2JDN A;  2Q0A A;  4P9X A;  3K3N A;  5EJ1 B;  3WG3 A;  1DYP A;  2CGO A;  1HW5 A;  2HYK A;  2J1U A;  3OYW A;  3FBY A;  4UXA A;  5DAQ A;  3ZPY A;  2FBE A;  3HQR A;  4CPB A;  4NID A;  1TE1 B;  4TYS A;  1ZRE A;  4SLI A;  4XIO A;  5GZC A;  2Z5W A;  4YVS B;  3WNK A;  2JD4 A;  4I0W B;  2PYT A;  5DDJ 1;  1HB1 A;  3AX4 A;  1XU1 A;  4RQP B;  3WNP A;  2GU9 A;  4DEQ A;  1QH7 A;  2JIC A;  5L9B A;  5IAT A;  2V5Y A;  4U2A A;  4IEX A;  2RHP A;  5IW0 A;  5F1R A;  5C70 A;  4ONU A;  1W39 A;  4H14 A;  4CCK A;  4QDS A;  5FY8 A;  2R04 2;  2P1B A;  4QXH A;  4COY A;  4CCL A;  3AYC A;  1X50 A;  1Q3E A;  1W6O B;  2DBI A;  4FFI A;  4IGO A;  4V2V A;  2JG9 A;  4QPI B;  5A1F A;  1QNY A;  3POE A;  2BOI A;  4QM8 A;  5FYM A;  5KHK A;  3ORJ A;  4COU A;  1YFU A;  1GOH A;  2XH6 A;  3ZSM A;  4DS0 A;  3WEZ A;  2DYC A;  4NWW A;  1Y43 B;  2ZEW A;  4HVO A;  5FY1 A;  3TOJ A;  4ERO A;  5AC9 1;  1HRV 1;  2JKB A;  3FHA A;  2AEY A;  3WP4 A;  3BPS A;  3ZN6 B;  2IFW A;  3JQW A;  1WZX A;  1HIX A;  4O9E A;  3THD A;  1NCQ A;  3OBT A;  4AOC A;  1JYN A;  1LCL A;  2D3R A;  4H55 A;  2UWA A;  5F6L B;  1URX A;  3LFM A;  4U36 A;  2FQP A;  2X09 A;  4D6Q A;  2QZ2 A;  2C1F A;  2RR1 1;  1VBA 2;  2ID4 A;  3A23 A;  5EP9 A;  3LD8 A;  5FYY A;  3UGG A;  4JRA A;  3ELN A;  5FPZ A;  3B93 A;  4N7U A;  5ERL A;  2RG4 A;  4CSW A;  2B39 A;  2QDN A;  3RPQ A;  2ZCW A;  3RYP A;  3MBW A;  5CKQ A;  2XG3 A;  5LCW L;  1RIT A;  4Q29 A;  3N4M A;  2VOT A;  4M3C A;  1CAX A;  5J7M A;  2W1W A;  3ES4 A;  4W6W A;  1GWK A;  2VVD A;  5FZB A;  1VB2 A;  1ND3 A;  1YJK A;  3H7Y A;  2YMZ A;  1D4V B;  3ACF A;  3Q8A A;  4NII A;  5A6Q A;  4JGY B;  4QXC A; 
#chains in the Genus database with same CATH homology
 3S57 A;  4QHO A;  4JHT A;  5F8P A;  3O1V A;  3BIE A;  3T3Y A;  4NJ4 A;  3BTY A;  3H8R A;  4NIG A;  2FDG A;  3I2O A;  4O61 A;  2IUW A;  3BTZ A;  2FDH A;  3O1P A;  3O1T A;  4NPL A;  4CXW A;  4QKD A;  3RZM A;  3BU0 A;  3O1M A;  4IE5 A;  4OCT A;  2FDI A;  2FDJ A;  3RZG A;  4RFR B;  4NRM A;  4CXY A;  4NID A;  2FDK A;  4IE7 A;  4QKF A;  3RZL A;  3KHB A;  3O1S A;  3I3Q A;  3O1R A;  3S5A A;  2FDF A;  4ZHN A;  3I49 A;  4IE0 A;  3BKZ A;  4NRP A;  4ZS2 A;  3RZJ A;  4MGT A;  4QKN A;  3KHC A;  4QKB A;  4IE4 A;  3BI3 A;  3I3M A;  3H8O A;  4IE6 A;  3LFM A;  3T4H B;  5DAB A;  4CXX A;  3RZH A;  4NRQ A;  3O1O A;  2FD8 A;  4NPM A;  3O1U A;  4NIH A;  3H8X A;  4NRO A;  4MG2 A;  3BUC A;  4IDZ A;  3RZK A;  3BTX A;  4NII A;  4ZS3 A;  4O7X A;  3T4V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...