3O1OA

Iron-catalyzed oxidation intermediates captured in a dna repair dioxygenase
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
201
structure length
201
Chain Sequence
PLAAGAVILRRFAFNAAEQLIRDINDVASQSPFRQMVTPGGYTMSVAMTNCGHLGWTTHRQGYLYSPIDPQTNKPWPAMPQSFHNLCQRAATAAGYPDFQPDACLINRYAPGAKLCLHQDKDEPDLRAPIVSVSLGLPAIFQFGGLKRNDPLKRLLLEHGDVVVWGGESRLFYHGIQPLKAGFHPLTIDCRYNLTFRQAGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alpha-ketoglutarate-dependent dioxygenase AlkB
publication title Iron-catalysed oxidation intermediates captured in a DNA repair dioxygenase
pubmed rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 47
structure length 201
sequence length 201
ec nomenclature ec 1.14.11.33: DNA oxidative demethylase.
pdb deposition date 2010-07-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.590 Mainly Beta Sandwich Jelly Rolls Alpha-ketoglutarate-dependent dioxygenase AlkB-like 3o1oA00
3O1RA 2FDFA 4RFRB 3O1VA 4CXYA 3RZHA 3H8XA 4IE6A 4OCTA 3O1UA 5F8PA 3RZMA 2FDJA 4IE7A 3RZJA 3S57A 4NPLA 4IE0A 4QKDA 3KHBA 2FDKA 3KHCA 4QKNA 4IE5A 4ZS2A 3T3YA 3O1MA 2FDGA 3RZKA 4NIHA 3BTZA 3BU0A 4JHTA 3O1SA 3RZLA 3O1OA 3BTXA 4QHOA 3H8RA 3BTYA 4O61A 4ZS3A 4CXXA 3I49A 3I3MA 4QKBA 4ZHNA 3BKZA 4MGTA 5DABA 4NRMA 3T4HB 4IE4A 4NROA 3BI3A 3BIEA 2FD8A 3LFMA 2IUWA 2FDIA 4O7XA 3H8OA 3RZGA 4NJ4A 3O1PA 2FDHA 4NIGA 4NIDA 3BUCA 3I2OA 3T4VA 4IDZA 4CXWA 3I3QA 4QKFA 4MG2A 4NIIA 3S5AA 3O1TA 4NRQA 4NPMA 4NRPA
chains in the Genus database with same CATH superfamily
5FZFA 1XNBA 4YW3A 4E4SA 3FZ3A 4CU6A 4BISA 5C9AB 3HMYA 3FBYA 4GWJA 4YZ5A 4RFRB 1MQTB 1ZBA3 4YGBA 4Y24A 5C3OA 4D94A 3ZYHA 5C3SA 2EIBA 2IVIB 3LEIA 4LITA 1O7FA 2VCMA 2DCKA 3AZWA 4R9AA 4YG0A 3I3BA 5F9TA 2D43A 4Q4X2 5BNNA 2WL1A 2PHUA 1I1EA 1FPN2 4LIVA 5DAXA 3I3DA 3USUB 5I0RA 1XPWA 2BOJA 1LOEA 4G9SB 2WO1A 1TZOA 4FTSA 1HW5A 3ILRA 5JDBA 5JMCA 1OFSA 3I4IA 2EICA 2ADEA 4AI2A 1OH3A 3DN7A 3I2FA 3Q8BA 2A6YA 4KWUA 1HRI2 1JW6A 2CGOA 1UY3A 1UZYA 4QKDA 4MADA 5ERLA 5LA9A 2R0FA 4YVWC 1PGL2 1XXNA 2FMYA 4OI4A 3S7EA 4BIFA 2CWMA 2BGOA 2HWC2 3O1MA 3N9LA 3UJOA 1URXA 4FOYA 1OA4A 4JHTA 2XMLA 1SCSA 1VPHA 5T50A 3N9NA 3O0VA 4A4AA 1O4ZA 2O8OA 4ZY9A 5FMCA 4QGMA 2QTWB 4BXFA 5T52A 4P08A 3C7HA 4AG4A 4MGIE 1OLMA 1UIKA 1H1IA 2CY6A 3QH6A 2DCTA 1XE7A 2XVGA 3SNMA 3V0BB 1GNZA 4AQTA 4COZA 4FPLA 3AMQA 4KNCA 5D8AC 3POGA 1VBD1 2X5IC 5C71A 3ZYIB 4Y1YA 5H9QA 3NAPA 4QPYA 4OYUA 1KFXL 2R7EB 2VY0A 2X5IA 1FAYA 3UJQA 4GKYA 3N9MA 3N9OA 4JRAA 5CFCC 1F4HA 4R4XA 3D0JA 4NROA 2A3XA 2WNVC 3MF6A 3MW3A 2HWF1 1W6QB 3PIGA 1CAUA 1BZWA 4AQSA 2Q5TA 1PO12 4B8EA 3AYDA 4ASKA 1WMEA 4Z2WA 1KD7A 5F6KA 1XJAA 3W59A 3LWCA 4LUKA 2ORZA 4D3WA 1Q8QA 2WQ4A 1IS6A 2BBVA 3RRDA 4DPNA 3K48A 2WS93 1XSQA 3RZZA 4GWNA 4RS5A 5LATA 1XNTA 1QHDA 1W2NA 4CP1A 2P3YA 4HG6B 3CL1A 1K12A 1G9FA 3ALQA 4UXAA 5LZ6A 2R6QA 3AK0A 2WFF2 4Q8KA 2B9UA 3RQ0A 3QACA 3UT0A 2HLEA 4YZ1A 3EYPA 5FQ0B 4UFIA 1YCIA 1LGCA 2PN5A 4XFBA 5LRRA 4Y5TA 3CU7A 1QDOA 5FWJA 4Y4YA 3NKGA 3ZYRA 3CJIB 4PLNA 1TME3 4ISRA 4XUOA 3RSJA 3VD4A 1PK6B 3UNPA 3V64A 3K3OA 1VP6A 4XDQA 3R0RA 1N1SA 1MZEA 1VBA1 1SDWA 4NPMA 4YVSA 5EFUA 5A7OA 2E6VA 2JG9B 3RNSA 2I07B 3CO2A 3GYDA 1HRV1 2EIGA 3GGLA 3ORJA 3E5UA 3N4MA 1SLLA 2VZSA 1XYPA 5IK7A 1RHI3 1RIRA 1KDKA 3FHIB 1WLTA 2IWGB 3OGGA 1YQCA 4AHWA 4GH4A 2NPIA 1UN1A 2VBBA 5KHGA 3ASIA 5A32A 1W8ZA 5ISLA 1U5ZA 4XF3A 3A4UA 3K3NA 2WWUA 3O1UA 2KD7A 2IXJA 3KWVA 3NL1A 4GB33 1CESA 2IXHA 2DFBA 5LW9A 1OKQA 2HEVF 4Q0UA 2XJSA 3ZXFA 3ZFFB 4NPLA 4GZ9A 4PT6A 1PIV1 1U0AA 1S0IA 2HWE2 1HDKA 2PHDA 5C8CC 1BKZA 1PVC3 2RS33 1Q8SA 1JZ6A 3MIEA 1GZ9A 3ZSLA 3ZMOA 3AP9A 4OHYA 1OD3A 1LOAA 3WDTA 5IATA 3BTZA 4JAAA 1QH6A 2ES3A 3I3EA 1MS5A 3I7DA 4MYEA 5FUIA 3RZLA 1QQP1 1UYZA 4PBOA 1L3JA 2EALA 1R1ZA 2Z69A 2VMIA 4XTMA 4NVPA 5FZDA 2DV9A 4N7UA 3P1IA 2VVEA 3I3MA 1JI6A 1GBGA 2VCBA 1ULCA 2DCYA 4WVMB 5LEJA 1J59A 5LCWL 4LLOA 1XSRA 1CVNA 4CCOA 1RUF1 2H6CA 4AVSA 4AI3A 3WCSA 1AXKA 4YYOA 1HXS2 1ULOA 4H55A 2YGMA 2C9AA 4LO6B 1ZM1A 2KXLA 2ZEYA 2R1BA 4P9WA 5AFBA 2HBUA 1JOJA 3OGJA 1QKQA 2ZA9A 5FKCA 3RJRA 2B45X 4AZZA 2WN3A 3M3EA 1DLLA 1CJDA 2W08A 3OF1A 3QD6A 4H7MA 5DZGA 3GJAA 4BQ3A 5IFTA 4AAXA 1O91A 4EZ4A 2YPDA 1AR61 1PNGA 2NP0A 2Z5WA 3VGIA 2IXIA 1KS4A 4JTOA 2XBO2 3U07A 3CLPA 3IDCB 4AHZA 1BBT2 3SH4A 3FFQA 3Q8CA 3ST7A 4DINB 3J7LA 2ZGLA 3IAPA 5F39A 2XJRA 1AR72 5IVCA 4E2SA 4FO9A 4HONA 4MOAA 5G05L 4XW3A 4XABA 1WA6X 3I3QA 4HETA 5D8AB 2VBPA 1O5UA 3JQXA 4GJYA 1PO21 3N3HA 2X5IB 4Q4W2 3HQRA 5DZEA 4AVBA 3AXEA 4Y4RA 1UY1A 1SZBA 4W8JA 1YFXA 1G6NA 4XDOA 2OQ6A 3ILFA 3GCXA 5CFCB 4GIQA 2VZUA 1CAUB 1I5PA 2LS6A 2WLQA 2PLV1 3VBRC 2WNVB 4YFWA 5FBZA 2PQQA 3B9IA 4Y33A 2JECA 2KR2A 2FZ1A 1UU5A 4F3JA 1H0BA 2W1UA 2VNVA 5IW0A 1WBFA 3GBFA 2ARBA 4L2NA 2R062 5CAZA 1C5HA 1MEC1 4FOVA 1F2NA 1D4M1 2BW8A 2DTWA 1Q56A 1JU3A 2HWB3 4J1XA 4XXPA 3UGGA 3VDCA 3WHTA 4CDQC 4OLLA 1JZ2A 1UOBA 2B4KA 3NQHA 3EQEA 4CDQA 1VIWB 2RG4A 1P8JA 3ACGA 3HNMA 2AC1A 1N3OA 1W9TA 2D40A 5HCHA 3DXTA 4TN7A 4K8RB 4LK6A 4QM8A 5KR7A 1X33A 1QJY1 1KRIA 4NAOA 5I0DA 3HNYM 2F4PA 5BNOC 2ARXA 4HPKA 1VBB1 4LJHA 5F5AA 4N9IA 2XBO3 4AQ6A 4Y1ZA 2D6PA 3VBFC 4OUEA 3ZSEA 5J98B 5J7MA 4XQ4A 4PIZA 4RN5A 4IE5A 4FQ4A 1W8WA 1MVEA 1T6GC 4KQ7A 4IEVA 1GU3A 4LE4A 2R071 4YVSB 5E1RA 5FIXA 4FOWA 4IGQA 4MXVA 4HN0A 3THCA 1AR83 1E5RA 1REEA 3FJSA 4PLMA 4Y22A 1YC61 4XCAA 5T5LA 2ARCA 1VMJA 1R091 2W95A 3MPBA 4JTNA 5FZGA 4BQ5A 5LK7B 2IZWA 3GNEA 4ZS3A 1ODNA 5GLVA 2YC4A 1RITA 5A32B 4B1LA 2VAUA 3KF3A 3C2UA 4RQPC 4EN6B 4XFIA 5IVEA 2A3YA 1S0BA 3OOXA 4CA9A 1NAEA 5AFEA 3ZYBA 1W0NA 1EUUA 2PTMA 1RUG1 3H3ZA 3NWKA 1AX2A 4RQPA 4FPGA 3D82A 4TYSA 2HH9A 3M3QA 5DAVA 4A7KA 4Z1VA 1W6PA 2B7YA 2VUAA 1NCRA 2B5HA 1FMD1 3NV2A 4Q26A 1M06G 2JIGA 1BVVA 1AX0A 1U12A 4QQPA 3I2GA 2OA2A 3VV1A 2XH6A 4GMP0 2P6CA 1WCSA 5ACA3 1G7YA 1RMU3 2BQPA 4YG6A 3VL8A 5C8CB 1CGPA 2Y33A 3BCWA 4N90A 1H2KA 4XUPA 4KU7A 1JZ7A 3VD3A 4AFMA 1PZ7A 3N36A 3OGSA 1VALA 2Q1MA 3LZZA 3HBKA 3ILNA 4A3XA 5HBAA 2VQTA 1TMF3 3VHNA 2O0OA 4IETA 5GZCA 3B3QE 1JBCA 2X09A 2RM21 4KL1A 4FT8A 5FYZA 3KLSA 1LECA 1V70A 2QBXA 4I30A 4WM7C 1X7NA 2J1VA 3OBTA 3ZXKA 1AR93 4Q2FA 5C5TA 3B02A 1OVSA 4FFIA 4JVAA 1W2AX 5FY5A 1VAMA 4E8DA 3F2ZA 1LCLA 1MVQA 1OH4A 2WSUA 3APBA 3I2KA 4JX0A 3VKLA 1VBC1 1RUJ3 3AL6A 4UF0A 4QKFA 1QY4A 3ZFEC 1VBE1 3KV9A 5IHRA 4MG2A 4XJAA 3POJA 4HXCA 2QQNA 5FPUA 2V72A 3DV8A 1GWKA 3LE0A 3VZLA 3B01A 1NXMA 1UYYA 1ENXA 2RMU1 4LBLA 5FUPA 4CDUA 4ZZ8A 4TWTA 2RS53 1NCQC 1J84A 1A34A 3LD8A 4NO4A 1VB4A 1W6MB 5BPXA 3H7JA 1NCQA 2PAEA 3GBWA 4GA9A 4W6WA 2VW0A 5FPZA 1FV3A 3RG0A 2MHFA 3O1VA 2GN7A 3WCRA 1O3QA 4CXYA 1POV1 5TSWA 2QQWA 2CYFA 1DYKA 4IL7A 4YRDA 1RUH3 3WY6A 4LO4B 5FK8A 2RJLA 1RUD1 3LSEA 3U0ZA 2E51A 1O3SA 1RUI1 1AVBA 1ND3C 4WVZA 3AKSA 3ZPYA 3E5QA 4NMIA 4YM0A 5F2WA 3WW4A 3WXPA 5ABJC 4XJ9A 4FAHA 4QPGC 4IGOA 3KD4A 4C1WA 1JZ4A 3U75A 2JDKA 2HJIA 2P6HA 1VBD2 3SH5A 4PF5A 2W91A 2Z79A 3T0BA 1QXJA 1FX5A 3I54A 1C4RA 1REDA 2J1TA 3K4AA 3KQRA 2BP6A 4QX8A 4ES9A 3IDAA 2CGPA 5FDBA 4META 1Z78A 3W20A 1DU3D 3MIGA 1WCUA 3VKOA 4HSJA 3ZIXA 3EB7A 3H7YA 3CDZB 1KS5A 1RUE1 4QKNA 2HWF2 1QOTA 3U11A 4UOJA 5A1AA 3GCWA 1NQDA 1KFUL 4G3YC 5J09A 2JG8C 4ZXEA 3ZIWA 4TZDA 4QQLA 5FMOL 4CVUA 1GWMA 1N3QA 2ZGQA 3T0DA 2BRTA 4DXZA 2JG8A 3C3VA 3TWIA 5EYXA 4LBOA 3CZJA 4Q4Y3 4QHOA 5EQUA 3BU7A 5DXDA 5EWSA 2VTXA 2RS11 2P3JA 5LY2A 3C7GA 3H8UA 5APAA 1D2SA 4AE2A 5FYTA 5KXDA 2GSYA 1J1LA 1C8NA 2WT2A 3IZOA 5DUWA 5FJKA 4CEYC 3LEGA 4CDQB 1RUOA 5CADA 3OPWA 2VCCA 5JXGA 2FBEA 1XE8A 2SBAA 4CEYA 3BOPA 3V65A 3LPGA 4AEJA 3BPSA 3ENRA 4XTPA 4YG3A 1EAH3 5AC91 1JYNA 1QNYA 4HPKB 3ZM8A 1H6YA 3K4ZA 2YY1A 4XMIA 5DG1A 1W9WA 3WDXA 2GH2A 4WZFA 3SXWA 1DQ2A 3B69A 4XPVA 2W92A 4M00A 4CCJA 2BPA2 3NNMA 2WZ8A 5EYYA 4M0NA 5FZ9A 3KS7A 3DL3A 3WQ0A 1D0GA 4AQ2A 2E53A 1VBA2 3IMMA 4FTBA 1S1AA 2AYHA 2D3SA 5CNAA 4CPBA 2Q8EA 3I2IA 4UWDA 4BK4A 2RR13 2JIJA 1HRV2 1MR5A 1ODMA 1VAKA 4Y22B 4B29A 2ZGUA 1DGWX 1SDDB 2NMOA 3SEEA 4MH0E 5DZFA 4QX3A 5A3PA 2WINB 1NT0A 1H6XA 3WR0A 3H42B 4AGRA 1W03A 1GQGA 3PU3A 4QT6A 5L9RA 1V6OA 1W04A 3TBDA 3N7LA 1GQHA 1AYN3 1T6BX 3M3OA 3UKNA 1US2A 1MPXA 4RQPB 3UESA 1F15A 4IV3C 4KGQA 4XXAA 4KMQA 1CX4A 5E88A 5FV3A 4JCKA 1W6PB 1NCRB 3B7MA 2VZRA 2GNMA 4LKEA 4IV3A 3IBMA 2YG0A 3MLJA 1JUIA 4P9GA 1MQTA 1AJKA 4CTEA 1PIV2 1ALYA 2VUDA 4TTGA 1PZ9A 2B8MA 1H8TC 1SEFA 3KQ4B 5HCFA 3N35A 4K8FA 2WAAA 4BWOA 2Y6KA 3EHKA 5L9BA 4IEQA 3NW4A 1H8TA 1YQ5A 4EWAA 3B5LB 3CEWA 4K7JA 1A8DA 1RVF3 4CDXC 2HYXA 4LK7A 1QQP2 1UY0A 2WRAA 4GQ7A 2MEV1 4Q4V3 3JD71 4XFGA 4EWEA 3EXUA 5FFOC 5A70A 1JYIA 2JDMA 4CDXA 4OZXA 1UX6A 2JDHA 3BIWE 1GNYA 1OFNA 1R64A 2WA4A 2YBKA 4URTA 1PX3A 1W28A 4XDPA 3JBG1 1YFYA 3DPRC 1CZTA 3KB5A 2JDPA 5JOXA 3SQOA 1RUF2 1R1A1 1ZZ8A 4HOOA 3KHBA 4M3CF 2QQPA 3DPRA 3A22A 3PMSA 4RGAA 4Z2AA 5B4XA 5IK4A 4QX7A 4RD7A 3ZSKA 3ZFEB 4UFKA 1HV1A 1H4GA 1LGBA 2VJXA 4CDUB 1YI7A 2XJPA 3LIGA 4HSLA 2Q4SA 2WZR3 2VU9A 5M0TA 3BTAA 4V2WA 3UKVA 3BTXA 4XOGA 5KXEA 1NCQB 1KITA 5C70A 1YLLA 1ASJ3 3ZOIA 1AR62 5I8SA 2RHPA 4F7ZA 1YQ2A 2OKXA 2VOVA 2VNOA 3WG2A 5A6ZA 1NG0A 3H50A 1UWWA 3H1YA 5DABA 5A7PA 1QGLA 1DP0A 2VVDA 2JX9A 4KU8A 3VZNA 3AMMA 4COYA 1ZA4A 1V00A 5IVBA 2CWSA 5LB6A 3WP6A 3ZN6B 5ABJB 2ZGPA 4QPGB 3PUIA 1XB9A 3POFA 4P9LA 1PO22 1QF3A 5A3OA 2QQVA 3LGRA 4QWNA 1PVXA 5FRAA 3OD0A 2EXIA 4OUMA 4YGCA 2RVAA 2V5YA 5JIAA 2VZ1A 2JWPA 2PLV2 1EYBA 4OI2A 4LBKA 1VRH1 4EN0A 2G1MA 5FZ6A 4IQPA 2GDFA 1CJPA 2JG8B 3AVRA 4AHYA 5LASA 1HJGA 2WWSA 5J3UA 4TSVA 2E7QA 1W3VA 1FXZA 4ORFA 3SLIA 3O1PA 2XLFA 4B4RA 4W6YA 2WZPP 1MEC2 4CEWC 5KC6A 1D4M2 4QQHA 5FYYA 4YFZA 4NIDA 1LB2A 3I2OA 4YSFA 4EWDA 1R081 1ULGA 2HEYF 1H30A 4CEWA 5KXBA 4XACA 2F17A 4RR3C 4HVOA 5FY1A 4CEYB 1LTEA 2E33A 2R043 2UWAA 4BLJA 1IHMA 1CPMA 4MZUA 3J8F3 4OQ9A 3MV01 3LA3A 2Y6JA 4RR3A 1QJY2 2P3IA 4N7IA 2YV8A 2C9KA 4YW4A 1JYWA 3OBZA 4AFBA 1FOD1 1VBB2 4IUGA 1DQ5A 5HCAA 2YROA 4GMP1 1W2TA 1NA1C 1PMHX 3FLTA 4XAEA 3B00A 1IS4A 2WAOA 1OT5A 2F6BA 3AKTA 2JKBA 2J22A 1QH7A 1AZDA 3PTYA 3WEZA 2R072 2WC2A 2WABA 3BALA 2ZKLA 4ZU7A 5DAPA 1IS5A 2CV6A 3V0AA 1W0PA 5E89A 3VN4A 1UNBA 5CFDC 3AZZA 3IN9A 1Q5OA 5F8PA 2YFUA 3FX3A 1XNDA 3PJQA 3MW4A 4ES8A 3WNXA 1SCRA 5CFDA 5GLUA 3PVEA 3U78A 1BVP1 3ZN4A 4IE7A 5GZDA 4ZPIA 4Q8LA 2QKDA 2ZEXA 1Q3EA 2A71A 4P9JA 1U5YA 3HT1A 3CNAA 2D6LX 1E5SA 4N43C 4QXHA 4PIXA 1RUG2 5FP9A 3RMYA 1K42A 1LHOA 3HR9A 2YBSA 3BN6A 3VD9A 5ANQA 1FMD2 1KEXA 1JN2P 3A0KA 4IEXA 2H6BA 4IV3B 3NSTA 2RDSA 2C24A 5FP7A 3WDWA 1E5IA 1W9SA 4A42A 3M4FA 1QJZA 1VAVA 2ZGKA 2GNBA 3EBRA 5F5QA 3THDA 4V2VA 1COV3 4WVMA 3O1OA 3RS6A 4QAWA 5FY8A 2I2SA 3WQ1A 1H8TB 1YO8A 1AYM1 1SBEA 2YZ4A 3QH7A 5LBCA 4EN9B 2A6XA 3I49A 2ZGTA 4CCDA 5A3LA 3S5QA 4LPLA 3MICA 4BIOA 5C4WC 1VBB3 1PMIA 4KWLA 1TG7A 2MPFA 2VZTA 3KM5A 2BBAA 2VZQA 1OPMA 5CB7A 3E5XA 3OBRA 5FZ4A 2OIIA 3HBZA 1V6JA 3HT2A 3VHRA 4YM3A 1QJX1 1W6NA 5C4WA 2RM22 2Z42A 3M70A 1Y43B 3CZUA 1FATA 4WVVA 2XKOA 4I0AA 4UAPA 3UETA 1C8M3 2ZZQA 4YVWA 1OA3A 3LDKA 4NHMA 2ZJCA 4H3WA 4QB2A 1V6KA 1LOFC 1VBC2 1EUTA 3ZFGC 3DPRB 3LIHA 5FP8A 4DUXA 1VBE2 1LHWA 1OF3A 1QJU1 4MGQA 2QDRA 1UOFA 2J1RA 3P5BA 1D0HA 2BERA 2IFRA 3ZFGA 5C3RA 2W46A 5I0UA 2RMU2 3J7NA 4BM8A 3L2HA 4FFFA 3LB9A 1VLNA 2EAAA 2YMZA 2ERFA 1NYWA 1X50A 3AFGA 2PHFA 3LA7A 5D8AA 4HANA 4I01A 4NHXA 4DEVA 2BOIA 1NUKA 1ZBE1 2YFZA 3VL9A 4TLFA 3BOWA 2X8KA 2KA3A 1C5IA 3WW2A 4AI9A 2JDAA 1RTVA 1RUD2 4FPCA 1RUI2 5CFCA 3DF0A 2IFWA 2WNVA 1FT9A 5IK8A 4Q4X3 4ZU4A 2ZHKA 4UBGA 1FPN3 4CUCA 1LEDA 1RJ7A 4D6SA 2GP5A 1O5LA 1DFQA 1UKRA 1XNCA 2SLIA 2Q1ZB 4XBQA 2VMFA 1AXZA 1WW6A 2DFCA 2VMDA 4NRPA 1POV0 4FP3A 1O4YA 1LENA 1OLQA 3PDQA 1MZ6A 4I0BA 3RFRA 1HRI3 1I5ZA 1RUE2 1OQ1A 1APNA 1GOGA 4UFJA 1JZ3A 4AI1A 3A7QA 3C7FA 2JDYA 3MZHA 2HWC3 3LKJA 1PM7A 4V1PA 4LBQA 3VZOA 1GUIA 3ETPA 4IE6A 4OCTA 1PGSA 3CIHA 5FY0A 5A33B 3SHRA 2RS12 1ZA7A 2TUNA 2VMGA 2UYBA 4XILA 4CDXB 2ORXA 5C7GA 4XF0A 2XUMA 4CCMA 3RZJA 2CDOA 4CEWB 4A3ZA 2ZX0A 4QX0A 3O14A 3ELNA 1ND2C 4LKFA 4CU9A 5T54A 4PLOA 2XJTA 4RR3B 1M4WA 5AC92 1JZ8A 4GXLA 4UBHA 2NQYA 3ZPOA 3U4SA 1WBLA 3LPFA 3MGUA 5C5UA 3O1SA 1V0AA 2HWD1 2DWRA 5EXOA 5JSOA 3OTFA 2OZJA 5JZGC 4DFSA 1WA4A 1F5JA 1PO13 4UFLA 4XHBA 4P9XA 5FWEA 4F8AA 4TXWA 1FI2A 3TEYA 1ENQA 1S0DA 3NNFA 3PU8A 4QM9A 5CZKA 4XBNA 5FZIA 3WNNA 1FV2A 3TNQA 2E31A 2XHKA 3V0AB 5DMYA 1CZSA 3RDIA 2R49A 3A21A 1V9U1 3MI8A 1OQEA 3D5OA 4NOTA 2C4XA 2LROA 1WMFA 1HQLA 2PFWA 2YU2A 3FUOA 4NRMA 3T30A 5JPNB 5CFDB 3Q8AA 3UK9A 3KGLA 3MUY1 1ULFA 3PJYA 1EPWA 5I0TA 2WFF3 2Z4FA 5C8CA 1LOBA 1O8SA 1ULDA 1WUVA 4XYXA 1H8VA 1MS1A 1VRBA 5IAXA 1UMIA 2OYZA 2L9LA 2W87A 1YJKA 1UXZA 2WNUC 4CP2A 3WW1A 1JH5A 1UX7A 1GKBA 4FVVA 2C5DA 4HKOA 3H9AA 4R8HA 2G9ZA 4QHBA 3S0MA 4IEOA 4COVA 1UY2A 1U5XA 2Y0OA 1QWRA 3FHQA 4U2AA 4K6BA 1LU1A 4XAAA 1JUHA 1LESA 2WT0A 1GANA 4Y1XA 4AXOA 3KCCA 2ZEZA 3BUCA 2LUWA 3JQWA 1JYXA 1UYXA 2VOTA 5CKQA 2MEV2 3NNGA 3JD72 1Q43A 4R9CA 1GICA 4K9SA 4IDZA 3H0OA 4SBVA 2B42B 2PYTA 5FO7B 1W6NB 5C4WB 4LHNA 4GKXA 1JYVA 2E9QA 2OUHA 5F3GA 4AWDA 1W6MA 5F1RA 1BJQA 2DDUA 3UGHA 1BEV1 3JBG2 2ZS6B 4Y5Z0 4DB5A 4YVWB 2WO3A 1R1A2 3LF7A 3P3NA 5F5IA 3TN91 2NMNA 2DBNA 2QCSB 1HX6A 4XE9A 2HWE3 4MSVA 4P14A 4LO7A 3SC7X 3ZFGB 2W2IA 3TNPB 2P37A 1S0GA 5DAWA 5FXVA 3IIAA 2ARAA 4N53C 4P00B 1ZYBA 4FPOB 5DDJ1 4O9GA 4C0BA 1GMMA 3HVDA 3AX4A 3OEAA 1EV11 4NE9A 4DO0A 4XFFA 3WW3A 3RZHA 3M2MA 5CKMA 1Z7S1 1C1FA 2W3JA 1D2QA 1F4AA 3FUQA 4KG0A 2VNGA 3ZDSA 5J36A 4ZXKA 1AUYA 3LEKA 1C57A 1YQ8A 2EIDA 3NO8A 4E8CA 5JSRA 2D7FA 4YARA 2YB7A 5GKAC 2Y60A 1AL21 1N3PA 3J9SA 4JGZC 4UW6A 4CDWC 1OD5A 5JR7B 3HN3A 3MIDA 4DNYA 3W5NA 5T5OA 2QFEA 1AHSA 1JU4A 3VBRA 3NMBA 3KHCA 4QU2A 4XQWA 3I59B 5HCBA 3MDPA 4K3UA 4OHXA 4RHV1 4D7YA 3J4UH 1HXS3 2CTVA 3PHMA 4NIHA 1YQ6A 4AL9A 3SITA 1DIWA 2WKKA 4JC1A 4OFGA 4LR4A 1B35C 3I2HA 3OSDA 5FZ7A 1C28A 3BTYA 1PMJX 2LM3A 5FMBA 3WT3A 1YIPA 1QEXA 3URFA 5JAXA 1VRH2 1YIFA 5C8WA 2W47A 4BQ4A 1W8NA 4LBQB 2VNRA 2A1XA 5FP3A 3TAYA 3KMHA 4ZHNA 4IGPA 2DCZA 3WDVA 1QOOA 4IEPA 1GYKA 5BNOA 3T4HB 1UW8A 1BBT3 2Q8OA 1ZBA1 4OMDA 2TEPA 3POBA 3HN1A 1R082 1AR73 2V4VA 4QPIC 3BIEA 5FPXA 2W39A 2QUOA 5JUVA 5IYYA 1SG3A 2UU8A 5GLZA 3PUSA 2ET7A 1H4HA 2A6VA 3D0SA 4Q4W3 4QGNA 2DCJA 3IB3A 1PGW1 3OCPA 2PAKA 3WP3A 3AJYA 2VG9A 2XQRA 4LQRA 2VQAA 4DUVA 5K7PA 2D6KA 1LHVA 4MV2A 4UFHA 3VBUC 4EN7B 1FOD2 3C7OA 2ADDA 1LGNA 2ZXQA 3PUAA 3VBUA 4U36A 1VB2A 5CA6A 4QXCA 2AEZA 4M01A 2XGXA 2QZ2A 3ZSMA 1W06A 2ZGOA 2ATFA 1RUNA 4XF4A 3WZ1A 4OHVA 2R063 5FYHA 2QQIA 1OHFA 2DVGA 3T4VA 1SLAA 2VGDA 1DQ0A 3MO4A 4CCNA 2IXCA 2ZEWA 1HJFA 2XXZA 3OY8A 3E6DA 1ZZCA 1JZ5A 2AH2A 2W1WA 3HIFA 4XZPA 3KT7A 5FLHA 5F32A 5FP4A 1STMA 3WF0A 2ET1A 3ZYJB 4COUA 2A5ZA 2VECA 4BQYA 3S5AA 4NRQA 4OMCA 3ACHA 5D2AA 4ET7A 3VKMA 4YW1A 4H2AA 2XR4A 1GLHA 3ZYFA 5CG9A 4F83A 3WNMA 3I8TA 3NJXA 4XJWA 5FMDA 4NHYA 4BA6A 2VZOA 2HEWF 1HN0A 5HV4A 5C33A 4UYBA 2WNUB 2QQKA 2V09A 4XBLA 3HNBM 2BVVA 1RUC1 2JDNA 4M3CB 3THPA 4B4PA 4BCUA 4FTEA 1OOPC 1AJOA 2UURA 4NWWA 1ZRCA 3VBSC 4HFSA 1DQ4A 4B7KA 5JCTA 4WM7A 1AYM2 1DQ6A 4OQ8A 1FNZA 4NR1A 3VBOC 3E6BA 2Y6GA 5LEKA 1Y4WA 3O7OA 2A6ZA 1KXGA 3ZFEA 1D4VB 2O1QA 1ZNPA 2WS91 3RWKX 3K77A 1QJX2 4XJUA 4URAA 4FOQA 2HYKA 1ZZ9A 2CAVA 1AXYA 2J1SA 4KWJA 4S2FA 3BPZA 3VZKA 1TNRA 2PAMA 5A1LA 2GC0A 2Y6HA 2XHNA 3HEIA 2YGLA 5JWPA 1I6XA 2WO7A 1GWLA 5FZMA 4HL0A 5F2SA 1QJU2 4D6QA 3PURA 5FZAA 1V6IA 4PJYA 3TEXA 5J37A 1TME1 3AFKA 1ND3A 4UW5A 3DEMA 3ZN6A 5ABJA 4JQTA 3P6BA 4QPGA 5GJ6A 4Y20A 3SKVA 2PXJA 3F95A 5FYUA 3ZVXA 3JB4C 4K40A 4EE2A 1A3KA 1CPNA 1ZBE2 4QDRA 4NIAA 3DXUA 4I3PA 1RHI1 3P3PA 2X29A 1N47A 3WG3A 4XQDA 4RA0A 2WWJA 1LNSA 2ZKNA 3I2JA 4Q1PA 1NOVA 2XB6C 3ZR5A 2VPVA 1G9CA 5T5JA 5BNPC 3VD5A 2DVBA 3LFMA 4JGZB 4CDWB 3VBRB 1CAVA 2IUWA 1ENSA 5FZEA 5BNPA 1SBDA 4GB31 4LA3A 3T1MA 4ZZ5A 3WUCA 3VBHC 4AR2A 4Z8BA 2AR6A 3CMGA 1OVPA 5A80A 2TBVA 4UW4A 4E27A 3DKWA 1UD1A 1NE4A 4YPJA 5JI9A 5KXCA 4AGVA 1PVC1 1F5FA 2RS31 4NJ4A 4MGKE 1KJLA 1S55A 2QQOA 5I91A 5A3WA 2FDHA 1Q8OA 5EJ3A 1UPIA 1BMV1 4XETA 4MVTA 3N7JA 4UI9L 5LA0A 1DGRA 1WD4A 1DYPA 2ZX4A 1W2UA 2GC3A 2WQ8A 1UZVA 3RVHA 4QXBA 1G8WA 4MGZE 2JKXA 2ZGSA 4L8QA 5BNOB 3UGFA 5GZFA 2D3PA 5IFPA 4NIIA 5K8SA 4CRQA 2TNFA 4BYYA 3WNPA 5FYBA 2Y6LA 3G6JB 4LO8A 1MS3A 1VBD3 3N9QA 4JHZA 4M3CE 5KC5A 4JZRA 1NZCA 2BUKA 4QPIB 2J42A 1LEMA 5J96B 4QHZA 4DS0A 2CU5A 2OW4A 3RYRA 5I8TA 1POQA 3AYCA 3IDEA 4ARXA 3AJZA 4XCBA 4G4FA 1TE1B 2HWF3 3ATGA 4M4PA 4Q5OA 2HWD2 2GNDA 1YYNA 2JEMA 4KBBA 5B2GB 2R30A 3VBUB 5K9YA 3IT8A 5JVVA 3SCFA 3IWZA 1UZZA 5LBEA 5BUVA 5JOZA 3ACLA 4LOTA 3RZMA 1MS9A 2WSVA 3GJBA 1IPKA 5GLTA 2YXSA 2ZAAA 2OUJA 4Y1UA 2QDNA 1CR7A 1H1MA 1KGYA 1W8FA 3NJVA 4INDA 4RYDA 2R0HA 4XIKA 4DQAA 2DUQA 1V9U2 5GZGA 1S0EA 2ZACA 3K2OA 3OY8B 4EZHA 5FR3A 1IQAA 1HKDA 4I2OA 2BU9A 2JD4A 2XJVA 1I3HA 5H9SA 1K45A 2DBIA 5CVRA 4XUNA 4L97A 5FZ8A 2V5DA 1UPSA 2R1DA 1SFPA 4ZS2A 3GDBA 3NNLA 4DY5A 4Q0QA 3BU0A 4ARYA 1ST8A 4BU2A 1WW5A 4AW7A 2YBPA 2I74A 2RE9A 4IW3A 2BZDA 4UT5A 2ZGMA 1UIJA 1ZZBA 2A70A 2Q0AA 1CZVA 5IAVA 4EYUA 5ANNA 1IQDC 1JHNA 2VOWA 3WDYA 1TNFA 4AEDC 5C3PA 2W0XA 4MGTA 1VBA3 3OG2A 3KZ4C 4LMFA 4WM7B 1OOPB 4LULA 4AVAA 1HRV3 1O4TA 1PNFA 2G4IA 3JXSA 4MLOA 2KM2A 1H2MA 3VBOB 5FO8B 4BK5A 5C3QA 2OPWA 2OS2A 3N7KA 2HWB1 2E7TA 3WP4A 4QPWA 3I97A 3PVOA 1REFA 3PVBB 3AB0A 4DMIA 2FZ2A 1DG6A 4AFDA 5KHHA 4DXRA 1BEV2 2C26A 4LBNA 1W6OA 3OGVA 3SCGA 4D7TA 1XYNA 2E32A 3RJ2X 3TN92 4BDVB 1W3XA 2E63A 4WBBA 1AX1A 5GLWA 2JXAA 4CYDA 1PIV3 2XBO1 1O8PA 1TQ5A 2BDRA 5FXXA 2XVLA 5FLIA 5EIYB 5FZOA 5JMOA 4MHUA 1GZTA 1ND3B 2OVUA 1K5JA 5DDJ2 5E6HA 4D69A 1UYPA 3TEWA 4WV8A 1EV12 1BK1A 1J83A 4IEUA 3WG4A 4Y20B 3FLRA 1Z7S2 2CHHA 1OKOA 1AR81 1QQP3 3FHAA 2D6MA 3QLQA 1SBFA 5F3IA 2X05A 1C3HA 1XU1A 2FHRA 2QQJA 2ZX2A 2W5FA 4FFHA 4FPJA 4LKSA 4LEJA 5IWFA 4ATFA 4O65A 1RC6A 5SV8A 3LSDA 1CX1A 3WOGA 4PQ9A 3FE5A 1AL22 1SQ4A 1UU6A 4OHWA 3ZXEA 2AUYA 3AC0A 5FJHA 4JKKA 1CAVB 5IVYA 1VMHA 1RUF3 2BFUS 2A3WA 1BK0A 1DCSA 1HIXA 5BNPB 3O1RA 2P3KA 1DGWA 4RHV2 5A33A 3Q8FA 2GMMA 3NNJA 1XC6A 4H7LA 1SLTA 4HZFA 4XC9A 3HD8B 4RFT0 1KJRA 4E4DX 1KDMA 3B94A 1UOJA 4A6SA 1OPOA 3VBHB 2QJVA 2OXBA 1NX9A 1DZTA 2XWBB 5E8AA 4AAPA 1FYUA 3WNKA 4CP9A 1W39A 1YUDA 5ACA1 1CAXA 1RMU1 4XEZA 2V73A 1W2OA 2VOXA 1JOPA 2Q30A 4YM2A 1JTZX 3FLPA 1AR63 1WMDA 4LBMA 1G9AA 3Q8EA 1SLCA 3W5MA 3U14A 2I45A 3CJIC 4CU8A 2VUCA 4LUMA 1G9DA 5IT6A 1XQNA 2JICA 5JXJA 1PK6C 1TMF1 2EXKA 3DYOA 3WF1A 2FDKA 2ZBJA 3WV6A 5DAQA 4E4HA 2BNNA 1ZBA2 1F9KA 3JU9A 2WN2A 2E7AA 4OUSA 1NLQA 1NA1A 1DZQA 1K5MC 2D5FA 1YXWA 2JG9C 4A44A 4C91A 5F3EA 1OXCA 3NVCA 1AR91 1GNHA 4YLZA 1ULPA 5EP9A 4ASLA 5F6LB 1NLSA 1NQJA 1PO23 1PGW2 1Q8PA 4ISQA 1RUJ1 1Z0HA 1R092 3U37A 3A0NA 4GD4A 1YI9A 3B93A 2OZ6A 1X8MA 2NN8A 3C7EA 3CJXA 3JZVA 4JGYC 4L11A 4LHKA 4S2HA 1CAWA 2QNKA 3WP5A 3A23A 5BY5A 2VMCA 2PLV3 2QVSB 2YDEA 1SLBA 4C1XA 2RS51 2AZ5A 4EQVA 1CWPA 4FP2A 3D8CA 5JOWA 5A6XA 2UY9A 3ZXLA 3RI9A 1QOSA 2P4EA 5K0UC 2IXLA 3AP7A 5FO9B 2W1QA 3OGRA 3ZYPA 2VZ3A 5HI0A 4N43A 3VDDC 4ONUA 1IS3A 1MEC3 4FFGA 1D4M3 3W58A 1RUH1 3MLKA 3GM8A 5A3TA 4LHLA 2VVFA 2XWJB 4QDQA 2QQMA 5SV5A 4L92A 2BWAA 3WF4A 4LO5B 5FREA 4L9BA 1X36A 1UXXX 2FQPA 1GOFA 2O14A 1DF0A 1V6MA 5GALA 1O3RA 2JE7A 5F3CA 2FCVA 3INAA 3J7MA 3MF9A 3SISA 1QJY3 2ZHNA 4JV4A 2Y6FA 2J1AA 2X53S 1HB3A 2XOMA 1HB4A 5I0SA 1N1TA 1QXPA 4XMAA 5JXIA 5T55A 4PI0A 3RZGA 1QJFA 2GZWA 2OX0A 2EXHA 1NY71 3MHZA 4OZOA 1F35A 1RUC2 3T1LA 5BNNC 3KGZA 3ZXAC 1VMFA 2R073 4FPHA 5DPNA 1WCQA 3V56A 3WQBA 4AEDB 2WNEA 2RJKA 1TVGA 4IV1C 3GZEA 1GZWA 1QIQA 1UMZA 3BYWA 4HLTA 1V6LA 3K46A 5T5PA 4Q4Y1 2WA3A 3VKFC 1R093 4HN1A 4IV1A 1LOFA 2DU1A 3RYKA 2Y26A 3OYWA 3MYXA 3PIJA 3KV4A 4IEYA 4A41A 5FOJB 3R6SA 2K0GA 2WS92 3PUHA 4W4ZA 4QX2A 2VTFA 3QOPA 5HXVA 3MUZ1 3D3AA 4YZ2A 1GQPA 5LY1A 2IXKA 1IPSA 1BCXA 2D93A 3O12A 3VZJA 1WCDJ 2OQ7A 1RUG3 1RYYA 3ZXDA 2YYOA 3KV5A 2FDFA 1W6OB 3POWA 1E5HA 4JRLA 1EAH1 1Y9GA 1YNAA 1LOCA 5IVFA 5FYIA 1FMD3 5FCCA 1OUSA 2VD7A 2O8QA 5DUUA 4X6QB 3IDBB 2DUOA 3RYPA 5L7OC 2D44A 3MV11 5FZOB 1TME2 3DECA 1CIYA 2FCTA 5FPBA 4HKLA 5E16A 2VR4A 1QXRA 5L7OA 3MIBA 3NKTA 4LT5A 3B9CA 3I59A 3NAPC 1JXNA 3AL5A 3LDRA 4CUGA 3HQUA 3SH3A 4K1ZA 3ES4A 3NV1A 1RXFA 3E1F1 2RR11 5FAXA 1DYOA 3EJKA 1XBFA 3NV3A 2JDZA 3W9AA 2XKPA 1UQXA 4YW6A 2AREA 2JJ6A 3DCQA 1RHI2 4YM1A 3AYAA 3O5SA 2K46A 4W50A 2VC9A 2DTYA 2RM23 3MBWA 3WINE 5LRSA 4DEQA 2GU9A 1RUC3 3RZKA 2EA7A 3VDBA 4CZSA 1G9BA 4IERA 4LBJA 5AVPA 2VQ0A 1AYN1 4COWA 2NYYA 5FUNA 2BV4A 2VL4A 1IZ3A 1VBC3 1WW4A 1G86A 1NXD1 1VBE3 4GB32 4LA2A 2D97A 4LE3A 2J1UA 4RS5C 3WHUA 2Q1FA 4AI8A 2RMU3 3PLQA 3N9PA 3AZVA 4A45A 2DU0A 3HQXA 2HKXA 1KQRA 4CP9B 1E57A 1PVC2 2RS32 4D8MA 1CAXB 3KT1A 3ZX7A 2ETEA 4CCCA 4DXTA 3MLLA 1IG0A 2NLRA 5BV6A 3ZR6A 1GOHA 1DLCA 3BGAA 1NZIA 3C8XA 1BLZA 5K4LA 2XQXA 3ETQA 5J1XA 5BNQA 2CSGA 1BMV2 3IAQA 4DXSA 2LALA 2VZPA 1POV3 1ND2A 1UAIA 1RVF1 2ZAHA 3R05A 4QB6A 5FZ3A 2FD8A 4N9HA 3GHNA 3AVSA 5DUXA 4Q4V1 1AF9A 1RUD3 2DVDA 4KG8A 2B9VA 4QD2A 3VBFA 1RUI3 5KHKA 5KWRA 1O3TA 1YRZA 2PHRA 4YVSC 2VQUA 3S30A 5JLVA 1NA1B 5JZGA 1BHGA 4AFAA 5IVJA 1L7RA 2VOKA 2VM9A 4S2DA 5CIRA 5G04L 4CE8A 2C1FA 2DURA 1ONAA 3K4DA 1LULA 1K5MB 4PBPA 3ZKYA 1FNYA 4NHLA 5H9PA 4DIQA 3UL2A 3ITQA 3G7DA 4GH4C 1ACCA 3OPTA 5LK5A 5A1FA 4YW7A 2K9ZA 1RUE3 4MHRA 1CAWB 2WQZC 5KHJA 4P02B 1O59A 3IIIA 4BXSV 4JGYB 4E4ZA 3QCWA 4ASMB 2A75A 3KVBA 3VB9A 2WZR1 1YJLA 4FQZA 1UOGA 4JKLA 2ZX1A 3LAGA 4YW5A 3GALA 3WUDA 4HKWA 4QB1A 1ASJ1 4N43B 4BJ0A 5K0UB 1ZZ7A 2RS13 1DGRN 4YW2A 3O1TA 3X29B 3AKRA 2WNUA 4BQ1A 3VDDB 4RGKA 4MGSA 1GZCA 4M3CA 3MIFA 2VW2A 1W9FA 3M3CA 3USSA 1NKGA 2EXJA 4PDWC 3VKNA 2ZMLA 1PHMA 3AP6A 5FPAA 2BWCA 5AC93 3RI8A 4PDWA 4P9YA 1LRHA 5CISA 1X9PA 5FYMA 5AVAA 1OQDA 4PCRA 2FCUA 1Y9QA 4CPBD 1ZX5A 5A7SA 1QU0A 2JDUA 1BQPA 2Y64A 1WZXA 2FDJA 2VE1A 1ZRRA 3H1WA 2EIEA 1IGOA 5BYNA 3T2OA 1A6CA 2ZMKA 2E26A 2GMPA 2AGSA 3M7AA 2YUEA 2D5HA 2IC1A 5BNNB 2ZPXA 1GZWB 2JB8A 3Q9OA 3VLBB 1OI6A 4D7SA 2XJUA 3H3LA 1PX4A 4FI9A 1I9RA 4IV1B 1VJ2A 1GP6A 3R4UA 3L9JT 4HBNA 3H1MA 3OYWB 4IEZA 1LR5A 2QQUA 2HWB2 3I2DA 4N8MA 2H0BA 2XPJA 3KT4A 4B3NA 3CF6E 5FPVA 4YZ4A 3DKQA 4N53A 3WVJA 2VMEA 2N7GA 4PIYA 2R041 4B4QA 3MFAA 3J8F1 3MIHA 4BPZA 1HQWA 5DUVA 5A3MA 1IKPA 1OURA 5CBLA 1WCKA 1IOAA 1ULEA 1YFUA 3ABZA 2ZHLA 5B4NA 2CNAA 1DDLA 1UU4A 2F4LA 2AENA 1HB1A 4IESA 2B46X 4UW3A 4BQWA 1OLRA 2BNOA 3ACFA 4JGZA 4CDWA 1RINA 2BGCA 3LQCA 1IKQA 5L7OB 2EF6A 2PA7A 5FBJA 5FZCA 2ZGNA 1SHWB 5JI7A 1OUXA 1XE0A 1YWKA 5DG2A 1WWYA 4C90A 5I93A 4XFAA 1AR82 5JPMB 3NAPB 2MEV3 3JD73 3R4SA 1U5IA 3IMNA 4PF1A 4KH9A 4Q27A 2X10A 1ZVFA 3AMNA 3PVNA 4O7XA 3MPPG 4MUVA 4DZGA 1J3PA 4L0PA 3RMXA 4AYUA 2WUHA 1B35A 1MZ5A 3JBG3 2GH8A 1J1TA 2IVJA 4FAGA 5FY9A 3HJRA 1R1A3 4AFCA 5D21A 3CKHA 3ZSJA 3KVAA 3W21A 1W8TA 4XJZA 3WX5A 2XJQA 1RB8G 3VHOA 3POEA 1GP4A 4GWMA 4FCAA 4X8PA 1H9WA 1QJEA 1XU2A 3WQ7A 1X8EA 3E6CC 2P17A 4RS5B 2BVBA 3KSCA 4LIUA 2BJSA 3BVCA 1COV1 4YZ3A 5ACA2 1RMU2 2LTNA 5EZWA 2XL9A 2CAUA 4QPIA 1ZREA 1OSGA 3AP5A 3RWNA 3EO6A 2ENRA 2C6SA 4CCEA 2JE8A 1XOYA 1ND2B 3ACIA 3PMEA 3L2YA 4FPYA 1VR3A 2P5BA 4WM8C 4XVHA 3ZXGA 1L7LA 1J3RA 4BB3A 1JODA 2W1SA 3VBFB 4QMAA 4HK9A 4WM8A 1TMF2 4LXLA 4OI1A 4DRRA 4PQQA 4YNIA 4DUWA 3SKJE 5JZGB 2WO2A 5LWBA 4I0WB 5A7QA 1AR92 2EVXA 1C8M1 3AMPA 4J6GA 2R16A 3LOBA 3IKWA 3J7HA 3FFZA 1RUJ2 4I3GA 1V6NA 3KV6A 2XONA 5EJZB 1GSLA 4MO3M 5HXMA 5T3NA 3ZMNA 2P1BA 4GH4B 3ME2A 5F7UA 1XYOA 1SPPA 2ZZJA 3SMHA 1F8VA 5DQ0A 4AI0A 4OVEA 1VRH3 2P2KA 2RS52 1H9PA 3FWEA 4XJ8A 4AVTA 1MZFA 3U10A 3HPNA 4IE0A 1MS4A 1GFF2 2PHLA 1NCRC 2Y0IA 4AOCA 4OULA 1ZRIA 4Q0SA 2ZX3A 5JSPA 2AEYA 5FXZA 2WFPA 3QBQA 2UYAA 2YU1A 3PUQA 4XUTA 3O0XA 2D6NA 2GC1A 1J58A 3BODA 1UKGA 2FDGA 4BHPA 1EPZA 3T2TA 1RUH2 2DVAA 5FZ0A 2MNGA 4AEMA 2LRPA 2XLAA 3SCHA 3ZXJA 1R083 1XNAA 3GZUC 2XL7A 2YC2A 3PL0A 3WF3A 1OC1A 2PHWA 1OLME 4Q4X1 4GAZA 1OOPA 3UV9A 4BZ4A 4R4ZA 1FPN1 3VBSA 3TYJA 4Q0VA 4IEWA 4XZUG 2RDQA 4S2GA 4PDWB 2W68A 4L99A 3GBGA 3VBOA 1FOD3 2D3RA 4E2GA 1LODA 4GMP3 1NE6A 3K51A 2GN3A 2WDBA 4YGDA 1HRI1 1NY72 2BGPA 4YGEA 4E9KA 3WNOA 2K2SA 1IG3A 3GZTB 4NHKA 2Q8CA 4J1WA 5HV0A 1PGL1 1S0JA 2JENA 3POIA 4DY3A 1OMIA 3FN9A 5CYYA 3U1XA 5KBFA 2HWC1 2A6WA 4KBZA 1CN1A 3FMGA 3J26N 1YHFA 1DQ1A 1W8OA 4Q4Y2 1S0CA 4B7EA 1T2XA 2BEOA 3OUJA 4HMZA 1N1VA 4NPRA 5FKBA 4FPFA 1HN1A 1TEIA 1A78A 4PHZA 3RGBA 2RDNA 4A7YA 4CDUC 1L7QA 3VHPA 3FL7A 4HVQA 1Y3TA 3DYMA 2GP3A 3MW2A 4D6RA 3RPQA 4Y26A 4M4RA 4AVVA 4N53B 1JOBA 1W8UA 4AK3A 1DZRA 3HAGA 4LKDA 1BYHA 3VD7A 4JQRA 1EAH2 1NLRA 3T09A 5FOBB 2XVKA 3JUUA 5L36A 4FBFA 1RJ8A 1AL0G 1QMJA 3AXDA 3EMRA 1RXGA 5H9RA 4CXWA 4LORA 4JDOA 2RV9A 5FMOS 4QGLA 3TB0A 4LLFA 1PO11 3AYEA 1W0OA 4Q1RA 3LFIA 2BYVE 3OUHA 4Y5SA 1AYM3 2WYFA 1RGSA 2WT1A 3NJZA 2VH9A 2PMWB 4DRVA 3WD5A 3KF5A 1HLCA 2ZHMA 1GP5A 4W6XA 4BQ2A 1Y7BA 2D98A 3HOBA 4EV0A 3E97A 3HWJA 2UY8A 1CIWA 2PELA 2RR12 2W9XA 5I8YA 2WBKA 4XF1A 4AF9A 2GC2A 3H3UA 2J1EA 3VBHA 5L19A 3T0AA 1SFNA 4K1YA 4CCLA 1QJX3 4AVCA 1C1LA 4FPEA 4CP0A 2W94A 1ENRA 1HQNA 1LKNA 1B35B 1WLDA 2WFF1 3ZDVA 4WZCA 3M3IA 3UKTA 2OPKA 4XFCA 4OHZA 2C0ZA 1AYN2 1WLWA 5LBFA 1Y9MA 5LA2A 2VCAA 4LNVA 3ES1A 1ZRDA 1OA2A 5FYVA 3S6PA 2Y8KA 3KCYA 3ROUA 3TRSB 1QJU3 3T2PA 3UYJA 3ZYGA 4E2QA 5EJ1B 3SEPA 2HBTA 4YWAA 3WG1A 3OBAA 5A6QA 2WZEA 4ITCA 3U4XA 4NAMA 4FSJA 1S2BA 5FTTC 1LJ7A 2WLPA 3DYPA 3POYA 1H2NA 1HV0A 3T08A 3NJYA 2XDVA 1JMUB 5DN2A 2CGNA 5HPOA 3WSOA 1JYCA 1S4CA 1ZBE3 2D6OX 4CU7A 4Y3OA 4XFHA 1RVF2 1SACA 4Z92B 2AACA 5CKNA 4DOUA 4Q29A 4Q4V2 2CL2A 2ZOEB 5A7WA 4QDSA 4WM8B 4ATEA 2DF7A 1OBNA 5FPLA 1SFYA 4MX3A 2Y38A 3IPVA 1ZZ6A 1US3A 5LA1A 4P9IA 2ZCWA 4BOWA 2NM1A 2PQSA 2GMEA 4MXWA 1MS8A 2XLGA 4NWVA 4QXKA 2PHXA 4M0HA 3TOJA 2B39A 4CCKA 3AM2A 1JS9A 1CONA 3D6EA 3LA2A 5BXXA 5EV7A 1BXHA 1MACA 2VULA 1UL9A 1GV9A 2HWE1 2RJ2A 4LBQD 2WNOA 4QU1A 2EAKA 3ZO0B 3VUOA 1SLIA 2Y34A 2CDPA 4IE4A 1SPPB 5F5CA 3CHXA 4WVWA 3ECQA 2VXRA 2ZTNA 2WZR2 3MEPA 4QQ2A 4A6OA 5A3NA 5FY7A 2BTVC 5C9AC 5JXHA 4FXGB 1VE0A 4H14A 4BE3A 1ASJ2 1MQTC 2FMDA 2FDIA 5C9AA 4GALA 2A7AA 3LOIA 1UZ0A 1H2LA 4NN0A 2VZVA 2ZABA 3FC0A 4EJRA 3GZAA 1UY4A 2Q8DA 1K3IA 1MS0A 1W9YA 5FZLA 1WW7A 3O0WA 3H8OA 4C8DA 5IUQA 4KGGA 4AEDA 4BQXA 3WNLA 3VBSB 4ZU5A 2P34A 2YPJA 3USUA 3LDBA 2UWBA 4NIGA 1HXS1 3AP4A 4I02A 4MGYE 1JHJA 4QX5A 2VXJA 5GZEA 1WD3A 2HWD3 2JE9A 1X9TA 1W99A 4X8NA 5FXWA 4AEKA 4RSUA 3THTA 4QX1A 1LAJA 4XHXA 5A3UA 3OJBA 1UMHA 3JB8A 2QZ3A 3GXUA 4P5HA 1EP0A 1YEWA 1A8MA 2R32A 3AZXA 2PHTA 4KI5M 4A7ZA 1GR3A 2DUPA 2ZGRA 4UF0B 4PI2A 1V9U3 2GALA 2QE3A 4LTAA 1QDCA 3GHMA 4R9DA 1WLCA 5EHDA 5FY4A 2W52A 1UF2C 1UZWA 5FZKA 1BBT1 2BNMA 4BH9A 5FLJA 3R4DB 3V0BA 1AR71 2DYCA 1DGLA 3CQOA 5FYCA 5JOYA 2H0VA 1S2EA 3CBNA 4Q0PA 1PZ8A 4R9BA 3H8XA 2NZ9A 2R042 4OI0A 4GJZA 4I09A 2ILMA 3J8F2 4Q4W1 1W8HA 3WF2A 1WGPA 4JKMA 2XUEA 5F37A 2LW8A 1CQ9A 4LOSA 5A7NA 3TEZA 2A73B 2OT7A 1XNKA 2VTXJ 3AKQA 3JCIA 3OD4A 3ON7A 4J25A 3BB6A 3MFCA 2VBDA 4QQOA 1W6QA 3VZMA 2G9GA 1J3QA 3S57A 5L73A 2J7MA 5KHIA 2Z2SB 4BMEA 4BMBA 2DVFA 2YHJA 4D0QA 4KWKA 4XUQA 1D7PM 2V4AA 4CSWA 5FYSA 3GF6A 4SLIA 1LHUA 3NV4A 3T3YA 4O9EA 4TLGA 4XF9A 4JDNA 3OPZA 3S7IA 2R061 4UFMA 4RGGA 5JR2A 2ID4A 4FPKA 3M8LA 4X6RB 3KCXA 1B09A 4NUBA 3AKPA 5CG8A 4GWIA 2VO5A 3M1HA 5CEHA 3LEMA 3OUIA 3N7MA 3H8RA 1XRUA 4HVRA 1QNWA 2VW1A 4O61A 4A2UA 5J48A 1BEV3 4CXXA 1EY2A 4QKBA 2WR9A 1WKYA 2WYSA 4Y1VA 5CU1A 3BKZA 5C6CA 4XURA 5FQ0A 2BFUL 3TN93 1CD3G 1JYTA 1S2KA 4LHSA 1UCXA 5L9VA 3OEBA 1PM4A 1WMXA 3DGTA 4W65A 2GNTA 4R52A 4XIOA 1DHKB 3ZN5A 3CJIA 5FZ1A 3OB8A 2G19A 4AHXA 3BI3A 1W05A 1PK6A 5DDJ3 3IM0A 3AZYA 4Z82A 1EV13 1COV2 1OF4A 5D1IA 2G9FA 5JIUA 1O6UA 1Z7S3 2JG9A 1K5MA 1N1YA 2JB4A 3DUIA 1IPJA 4EROA 3PNAA 4CUAA 4P5YA 4RL7A 3FBMA 1W90A 1LHNA 3D4KA 5A6YA 5IK5A 2UWCA 4ZKTB 4FXKB 3T2QA 5A7WB 3WDUA 1AL23 2WIIB 2ZMNA 3K75B 1Q8VA 2GAUA 5IJRA 3WLUA 4JGYA 4AGGA 4C0HA 1HB2A 2WJSA 1H1AA 2YC0A 3IPVB 1LOGA 3AMHA 3PTRB 3ZLIA 4Z07A 4K20A 5EPAA 2QQLA 2JD9A 2RDRA 1F31A 2VMHA 3POSA 4MXWB 5FZBA 3ZFFC 4HT1T 1C8M2 4RHV3 1S0FA 4K21A 5K0UA 4BLIA 5LBBA 1X82A 1YFWA 4JDMA 1ZRFA 5IVVA 5FK7A 3ZFFA 5GM0A 4HK8A 1DBNA 3VDDA 4IXLA 4CUBA 3ZKUA 5FZHA 1RL3A 1SMVA 2XG3A 4EN8B 4ZONA 1LU2A 3NRUA 4GULA 3VDAA 4B1MA 1UO9A 3LCPA 2VUJA
chains in the Genus database with same CATH topology
3O1RA 2FDFA 4RFRB 3O1VA 4CXYA 3RZHA 3H8XA 4IE6A 4OCTA 3O1UA 5F8PA 3RZMA 2FDJA 4IE7A 3RZJA 3S57A 4NPLA 4IE0A 4QKDA 3KHBA 2FDKA 3KHCA 4QKNA 4IE5A 4ZS2A 3T3YA 3O1MA 2FDGA 3RZKA 4NIHA 3BTZA 3BU0A 4JHTA 3O1SA 3RZLA 3O1OA 3BTXA 4QHOA 3H8RA 3BTYA 4O61A 4ZS3A 4CXXA 3I49A 3I3MA 4QKBA 4ZHNA 3BKZA 4MGTA 5DABA 4NRMA 3T4HB 4IE4A 4NROA 3BI3A 3BIEA 2FD8A 3LFMA 2IUWA 2FDIA 4O7XA 3H8OA 3RZGA 4NJ4A 3O1PA 2FDHA 4NIGA 4NIDA 3BUCA 3I2OA 3T4VA 4IDZA 4CXWA 3I3QA 4QKFA 4MG2A 4NIIA 3S5AA 3O1TA 4NRQA 4NPMA 4NRPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O1R A;  2FDF A;  4RFR B;  3O1V A;  4CXY A;  3RZH A;  3H8X A;  4IE6 A;  4OCT A;  3O1U A;  5F8P A;  3RZM A;  2FDJ A;  4IE7 A;  3RZJ A;  3S57 A;  4NPL A;  4IE0 A;  4QKD A;  3KHB A;  2FDK A;  3KHC A;  4QKN A;  4IE5 A;  4ZS2 A;  3T3Y A;  3O1M A;  2FDG A;  3RZK A;  4NIH A;  3BTZ A;  3BU0 A;  4JHT A;  3O1S A;  3RZL A;  3O1O A;  3BTX A;  4QHO A;  3H8R A;  3BTY A;  4O61 A;  4ZS3 A;  4CXX A;  3I49 A;  3I3M A;  4QKB A;  4ZHN A;  3BKZ A;  4MGT A;  5DAB A;  4NRM A;  3T4H B;  4IE4 A;  4NRO A;  3BI3 A;  3BIE A;  2FD8 A;  3LFM A;  2IUW A;  2FDI A;  4O7X A;  3H8O A;  3RZG A;  4NJ4 A;  3O1P A;  2FDH A;  4NIG A;  4NID A;  3BUC A;  3I2O A;  3T4V A;  4IDZ A;  4CXW A;  3I3Q A;  4QKF A;  4MG2 A;  4NII A;  3S5A A;  3O1T A;  4NRQ A;  4NPM A;  4NRP A; 
#chains in the Genus database with same CATH topology
 5FZF A;  1XNB A;  4YW3 A;  4E4S A;  3FZ3 A;  4CU6 A;  4BIS A;  5C9A B;  3HMY A;  3FBY A;  4GWJ A;  4YZ5 A;  4RFR B;  1MQT B;  1ZBA 3;  4YGB A;  4Y24 A;  5C3O A;  4D94 A;  3ZYH A;  5C3S A;  2EIB A;  2IVI B;  3LEI A;  4LIT A;  1O7F A;  2VCM A;  2DCK A;  3AZW A;  4R9A A;  4YG0 A;  3I3B A;  5F9T A;  2D43 A;  4Q4X 2;  5BNN A;  2WL1 A;  2PHU A;  1I1E A;  1FPN 2;  4LIV A;  5DAX A;  3I3D A;  3USU B;  5I0R A;  1XPW A;  2BOJ A;  1LOE A;  4G9S B;  2WO1 A;  1TZO A;  4FTS A;  1HW5 A;  3ILR A;  5JDB A;  5JMC A;  1OFS A;  3I4I A;  2EIC A;  2ADE A;  4AI2 A;  1OH3 A;  3DN7 A;  3I2F A;  3Q8B A;  2A6Y A;  4KWU A;  1HRI 2;  1JW6 A;  2CGO A;  1UY3 A;  1UZY A;  4QKD A;  4MAD A;  5ERL A;  5LA9 A;  2R0F A;  4YVW C;  1PGL 2;  1XXN A;  2FMY A;  4OI4 A;  3S7E A;  4BIF A;  2CWM A;  2BGO A;  2HWC 2;  3O1M A;  3N9L A;  3UJO A;  1URX A;  4FOY A;  1OA4 A;  4JHT A;  2XML A;  1SCS A;  1VPH A;  5T50 A;  3N9N A;  3O0V A;  4A4A A;  1O4Z A;  2O8O A;  4ZY9 A;  5FMC A;  4QGM A;  2QTW B;  4BXF A;  5T52 A;  4P08 A;  3C7H A;  4AG4 A;  4MGI E;  1OLM A;  1UIK A;  1H1I A;  2CY6 A;  3QH6 A;  2DCT A;  1XE7 A;  2XVG A;  3SNM A;  3V0B B;  1GNZ A;  4AQT A;  4COZ A;  4FPL A;  3AMQ A;  4KNC A;  5D8A C;  3POG A;  1VBD 1;  2X5I C;  5C71 A;  3ZYI B;  4Y1Y A;  5H9Q A;  3NAP A;  4QPY A;  4OYU A;  1KFX L;  2R7E B;  2VY0 A;  2X5I A;  1FAY A;  3UJQ A;  4GKY A;  3N9M A;  3N9O A;  4JRA A;  5CFC C;  1F4H A;  4R4X A;  3D0J A;  4NRO A;  2A3X A;  2WNV C;  3MF6 A;  3MW3 A;  2HWF 1;  1W6Q B;  3PIG A;  1CAU A;  1BZW A;  4AQS A;  2Q5T A;  1PO1 2;  4B8E A;  3AYD A;  4ASK A;  1WME A;  4Z2W A;  1KD7 A;  5F6K A;  1XJA A;  3W59 A;  3LWC A;  4LUK A;  2ORZ A;  4D3W A;  1Q8Q A;  2WQ4 A;  1IS6 A;  2BBV A;  3RRD A;  4DPN A;  3K48 A;  2WS9 3;  1XSQ A;  3RZZ A;  4GWN A;  4RS5 A;  5LAT A;  1XNT A;  1QHD A;  1W2N A;  4CP1 A;  2P3Y A;  4HG6 B;  3CL1 A;  1K12 A;  1G9F A;  3ALQ A;  4UXA A;  5LZ6 A;  2R6Q A;  3AK0 A;  2WFF 2;  4Q8K A;  2B9U A;  3RQ0 A;  3QAC A;  3UT0 A;  2HLE A;  4YZ1 A;  3EYP A;  5FQ0 B;  4UFI A;  1YCI A;  1LGC A;  2PN5 A;  4XFB A;  5LRR A;  4Y5T A;  3CU7 A;  1QDO A;  5FWJ A;  4Y4Y A;  3NKG A;  3ZYR A;  3CJI B;  4PLN A;  1TME 3;  4ISR A;  4XUO A;  3RSJ A;  3VD4 A;  1PK6 B;  3UNP A;  3V64 A;  3K3O A;  1VP6 A;  4XDQ A;  3R0R A;  1N1S A;  1MZE A;  1VBA 1;  1SDW A;  4NPM A;  4YVS A;  5EFU A;  5A7O A;  2E6V A;  2JG9 B;  3RNS A;  2I07 B;  3CO2 A;  3GYD A;  1HRV 1;  2EIG A;  3GGL A;  3ORJ A;  3E5U A;  3N4M A;  1SLL A;  2VZS A;  1XYP A;  5IK7 A;  1RHI 3;  1RIR A;  1KDK A;  3FHI B;  1WLT A;  2IWG B;  3OGG A;  1YQC A;  4AHW A;  4GH4 A;  2NPI A;  1UN1 A;  2VBB A;  5KHG A;  3ASI A;  5A32 A;  1W8Z A;  5ISL A;  1U5Z A;  4XF3 A;  3A4U A;  3K3N A;  2WWU A;  3O1U A;  2KD7 A;  2IXJ A;  3KWV A;  3NL1 A;  4GB3 3;  1CES A;  2IXH A;  2DFB A;  5LW9 A;  1OKQ A;  2HEV F;  4Q0U A;  2XJS A;  3ZXF A;  3ZFF B;  4NPL A;  4GZ9 A;  4PT6 A;  1PIV 1;  1U0A A;  1S0I A;  2HWE 2;  1HDK A;  2PHD A;  5C8C C;  1BKZ A;  1PVC 3;  2RS3 3;  1Q8S A;  1JZ6 A;  3MIE A;  1GZ9 A;  3ZSL A;  3ZMO A;  3AP9 A;  4OHY A;  1OD3 A;  1LOA A;  3WDT A;  5IAT A;  3BTZ A;  4JAA A;  1QH6 A;  2ES3 A;  3I3E A;  1MS5 A;  3I7D A;  4MYE A;  5FUI A;  3RZL A;  1QQP 1;  1UYZ A;  4PBO A;  1L3J A;  2EAL A;  1R1Z A;  2Z69 A;  2VMI A;  4XTM A;  4NVP A;  5FZD A;  2DV9 A;  4N7U A;  3P1I A;  2VVE A;  3I3M A;  1JI6 A;  1GBG A;  2VCB A;  1ULC A;  2DCY A;  4WVM B;  5LEJ A;  1J59 A;  5LCW L;  4LLO A;  1XSR A;  1CVN A;  4CCO A;  1RUF 1;  2H6C A;  4AVS A;  4AI3 A;  3WCS A;  1AXK A;  4YYO A;  1HXS 2;  1ULO A;  4H55 A;  2YGM A;  2C9A A;  4LO6 B;  1ZM1 A;  2KXL A;  2ZEY A;  2R1B A;  4P9W A;  5AFB A;  2HBU A;  1JOJ A;  3OGJ A;  1QKQ A;  2ZA9 A;  5FKC A;  3RJR A;  2B45 X;  4AZZ A;  2WN3 A;  3M3E A;  1DLL A;  1CJD A;  2W08 A;  3OF1 A;  3QD6 A;  4H7M A;  5DZG A;  3GJA A;  4BQ3 A;  5IFT A;  4AAX A;  1O91 A;  4EZ4 A;  2YPD A;  1AR6 1;  1PNG A;  2NP0 A;  2Z5W A;  3VGI A;  2IXI A;  1KS4 A;  4JTO A;  2XBO 2;  3U07 A;  3CLP A;  3IDC B;  4AHZ A;  1BBT 2;  3SH4 A;  3FFQ A;  3Q8C A;  3ST7 A;  4DIN B;  3J7L A;  2ZGL A;  3IAP A;  5F39 A;  2XJR A;  1AR7 2;  5IVC A;  4E2S A;  4FO9 A;  4HON A;  4MOA A;  5G05 L;  4XW3 A;  4XAB A;  1WA6 X;  3I3Q A;  4HET A;  5D8A B;  2VBP A;  1O5U A;  3JQX A;  4GJY A;  1PO2 1;  3N3H A;  2X5I B;  4Q4W 2;  3HQR A;  5DZE A;  4AVB A;  3AXE A;  4Y4R A;  1UY1 A;  1SZB A;  4W8J A;  1YFX A;  1G6N A;  4XDO A;  2OQ6 A;  3ILF A;  3GCX A;  5CFC B;  4GIQ A;  2VZU A;  1CAU B;  1I5P A;  2LS6 A;  2WLQ A;  2PLV 1;  3VBR C;  2WNV B;  4YFW A;  5FBZ A;  2PQQ A;  3B9I A;  4Y33 A;  2JEC A;  2KR2 A;  2FZ1 A;  1UU5 A;  4F3J A;  1H0B A;  2W1U A;  2VNV A;  5IW0 A;  1WBF A;  3GBF A;  2ARB A;  4L2N A;  2R06 2;  5CAZ A;  1C5H A;  1MEC 1;  4FOV A;  1F2N A;  1D4M 1;  2BW8 A;  2DTW A;  1Q56 A;  1JU3 A;  2HWB 3;  4J1X A;  4XXP A;  3UGG A;  3VDC A;  3WHT A;  4CDQ C;  4OLL A;  1JZ2 A;  1UOB A;  2B4K A;  3NQH A;  3EQE A;  4CDQ A;  1VIW B;  2RG4 A;  1P8J A;  3ACG A;  3HNM A;  2AC1 A;  1N3O A;  1W9T A;  2D40 A;  5HCH A;  3DXT A;  4TN7 A;  4K8R B;  4LK6 A;  4QM8 A;  5KR7 A;  1X33 A;  1QJY 1;  1KRI A;  4NAO A;  5I0D A;  3HNY M;  2F4P A;  5BNO C;  2ARX A;  4HPK A;  1VBB 1;  4LJH A;  5F5A A;  4N9I A;  2XBO 3;  4AQ6 A;  4Y1Z A;  2D6P A;  3VBF C;  4OUE A;  3ZSE A;  5J98 B;  5J7M A;  4XQ4 A;  4PIZ A;  4RN5 A;  4IE5 A;  4FQ4 A;  1W8W A;  1MVE A;  1T6G C;  4KQ7 A;  4IEV A;  1GU3 A;  4LE4 A;  2R07 1;  4YVS B;  5E1R A;  5FIX A;  4FOW A;  4IGQ A;  4MXV A;  4HN0 A;  3THC A;  1AR8 3;  1E5R A;  1REE A;  3FJS A;  4PLM A;  4Y22 A;  1YC6 1;  4XCA A;  5T5L A;  2ARC A;  1VMJ A;  1R09 1;  2W95 A;  3MPB A;  4JTN A;  5FZG A;  4BQ5 A;  5LK7 B;  2IZW A;  3GNE A;  4ZS3 A;  1ODN A;  5GLV A;  2YC4 A;  1RIT A;  5A32 B;  4B1L A;  2VAU A;  3KF3 A;  3C2U A;  4RQP C;  4EN6 B;  4XFI A;  5IVE A;  2A3Y A;  1S0B A;  3OOX A;  4CA9 A;  1NAE A;  5AFE A;  3ZYB A;  1W0N A;  1EUU A;  2PTM A;  1RUG 1;  3H3Z A;  3NWK A;  1AX2 A;  4RQP A;  4FPG A;  3D82 A;  4TYS A;  2HH9 A;  3M3Q A;  5DAV A;  4A7K A;  4Z1V A;  1W6P A;  2B7Y A;  2VUA A;  1NCR A;  2B5H A;  1FMD 1;  3NV2 A;  4Q26 A;  1M06 G;  2JIG A;  1BVV A;  1AX0 A;  1U12 A;  4QQP A;  3I2G A;  2OA2 A;  3VV1 A;  2XH6 A;  4GMP 0;  2P6C A;  1WCS A;  5ACA 3;  1G7Y A;  1RMU 3;  2BQP A;  4YG6 A;  3VL8 A;  5C8C B;  1CGP A;  2Y33 A;  3BCW A;  4N90 A;  1H2K A;  4XUP A;  4KU7 A;  1JZ7 A;  3VD3 A;  4AFM A;  1PZ7 A;  3N36 A;  3OGS A;  1VAL A;  2Q1M A;  3LZZ A;  3HBK A;  3ILN A;  4A3X A;  5HBA A;  2VQT A;  1TMF 3;  3VHN A;  2O0O A;  4IET A;  5GZC A;  3B3Q E;  1JBC A;  2X09 A;  2RM2 1;  4KL1 A;  4FT8 A;  5FYZ A;  3KLS A;  1LEC A;  1V70 A;  2QBX A;  4I30 A;  4WM7 C;  1X7N A;  2J1V A;  3OBT A;  3ZXK A;  1AR9 3;  4Q2F A;  5C5T A;  3B02 A;  1OVS A;  4FFI A;  4JVA A;  1W2A X;  5FY5 A;  1VAM A;  4E8D A;  3F2Z A;  1LCL A;  1MVQ A;  1OH4 A;  2WSU A;  3APB A;  3I2K A;  4JX0 A;  3VKL A;  1VBC 1;  1RUJ 3;  3AL6 A;  4UF0 A;  4QKF A;  1QY4 A;  3ZFE C;  1VBE 1;  3KV9 A;  5IHR A;  4MG2 A;  4XJA A;  3POJ A;  4HXC A;  2QQN A;  5FPU A;  2V72 A;  3DV8 A;  1GWK A;  3LE0 A;  3VZL A;  3B01 A;  1NXM A;  1UYY A;  1ENX A;  2RMU 1;  4LBL A;  5FUP A;  4CDU A;  4ZZ8 A;  4TWT A;  2RS5 3;  1NCQ C;  1J84 A;  1A34 A;  3LD8 A;  4NO4 A;  1VB4 A;  1W6M B;  5BPX A;  3H7J A;  1NCQ A;  2PAE A;  3GBW A;  4GA9 A;  4W6W A;  2VW0 A;  5FPZ A;  1FV3 A;  3RG0 A;  2MHF A;  3O1V A;  2GN7 A;  3WCR A;  1O3Q A;  4CXY A;  1POV 1;  5TSW A;  2QQW A;  2CYF A;  1DYK A;  4IL7 A;  4YRD A;  1RUH 3;  3WY6 A;  4LO4 B;  5FK8 A;  2RJL A;  1RUD 1;  3LSE A;  3U0Z A;  2E51 A;  1O3S A;  1RUI 1;  1AVB A;  1ND3 C;  4WVZ A;  3AKS A;  3ZPY A;  3E5Q A;  4NMI A;  4YM0 A;  5F2W A;  3WW4 A;  3WXP A;  5ABJ C;  4XJ9 A;  4FAH A;  4QPG C;  4IGO A;  3KD4 A;  4C1W A;  1JZ4 A;  3U75 A;  2JDK A;  2HJI A;  2P6H A;  1VBD 2;  3SH5 A;  4PF5 A;  2W91 A;  2Z79 A;  3T0B A;  1QXJ A;  1FX5 A;  3I54 A;  1C4R A;  1RED A;  2J1T A;  3K4A A;  3KQR A;  2BP6 A;  4QX8 A;  4ES9 A;  3IDA A;  2CGP A;  5FDB A;  4MET A;  1Z78 A;  3W20 A;  1DU3 D;  3MIG A;  1WCU A;  3VKO A;  4HSJ A;  3ZIX A;  3EB7 A;  3H7Y A;  3CDZ B;  1KS5 A;  1RUE 1;  4QKN A;  2HWF 2;  1QOT A;  3U11 A;  4UOJ A;  5A1A A;  3GCW A;  1NQD A;  1KFU L;  4G3Y C;  5J09 A;  2JG8 C;  4ZXE A;  3ZIW A;  4TZD A;  4QQL A;  5FMO L;  4CVU A;  1GWM A;  1N3Q A;  2ZGQ A;  3T0D A;  2BRT A;  4DXZ A;  2JG8 A;  3C3V A;  3TWI A;  5EYX A;  4LBO A;  3CZJ A;  4Q4Y 3;  4QHO A;  5EQU A;  3BU7 A;  5DXD A;  5EWS A;  2VTX A;  2RS1 1;  2P3J A;  5LY2 A;  3C7G A;  3H8U A;  5APA A;  1D2S A;  4AE2 A;  5FYT A;  5KXD A;  2GSY A;  1J1L A;  1C8N A;  2WT2 A;  3IZO A;  5DUW A;  5FJK A;  4CEY C;  3LEG A;  4CDQ B;  1RUO A;  5CAD A;  3OPW A;  2VCC A;  5JXG A;  2FBE A;  1XE8 A;  2SBA A;  4CEY A;  3BOP A;  3V65 A;  3LPG A;  4AEJ A;  3BPS A;  3ENR A;  4XTP A;  4YG3 A;  1EAH 3;  5AC9 1;  1JYN A;  1QNY A;  4HPK B;  3ZM8 A;  1H6Y A;  3K4Z A;  2YY1 A;  4XMI A;  5DG1 A;  1W9W A;  3WDX A;  2GH2 A;  4WZF A;  3SXW A;  1DQ2 A;  3B69 A;  4XPV A;  2W92 A;  4M00 A;  4CCJ A;  2BPA 2;  3NNM A;  2WZ8 A;  5EYY A;  4M0N A;  5FZ9 A;  3KS7 A;  3DL3 A;  3WQ0 A;  1D0G A;  4AQ2 A;  2E53 A;  1VBA 2;  3IMM A;  4FTB A;  1S1A A;  2AYH A;  2D3S A;  5CNA A;  4CPB A;  2Q8E A;  3I2I A;  4UWD A;  4BK4 A;  2RR1 3;  2JIJ A;  1HRV 2;  1MR5 A;  1ODM A;  1VAK A;  4Y22 B;  4B29 A;  2ZGU A;  1DGW X;  1SDD B;  2NMO A;  3SEE A;  4MH0 E;  5DZF A;  4QX3 A;  5A3P A;  2WIN B;  1NT0 A;  1H6X A;  3WR0 A;  3H42 B;  4AGR A;  1W03 A;  1GQG A;  3PU3 A;  4QT6 A;  5L9R A;  1V6O A;  1W04 A;  3TBD A;  3N7L A;  1GQH A;  1AYN 3;  1T6B X;  3M3O A;  3UKN A;  1US2 A;  1MPX A;  4RQP B;  3UES A;  1F15 A;  4IV3 C;  4KGQ A;  4XXA A;  4KMQ A;  1CX4 A;  5E88 A;  5FV3 A;  4JCK A;  1W6P B;  1NCR B;  3B7M A;  2VZR A;  2GNM A;  4LKE A;  4IV3 A;  3IBM A;  2YG0 A;  3MLJ A;  1JUI A;  4P9G A;  1MQT A;  1AJK A;  4CTE A;  1PIV 2;  1ALY A;  2VUD A;  4TTG A;  1PZ9 A;  2B8M A;  1H8T C;  1SEF A;  3KQ4 B;  5HCF A;  3N35 A;  4K8F A;  2WAA A;  4BWO A;  2Y6K A;  3EHK A;  5L9B A;  4IEQ A;  3NW4 A;  1H8T A;  1YQ5 A;  4EWA A;  3B5L B;  3CEW A;  4K7J A;  1A8D A;  1RVF 3;  4CDX C;  2HYX A;  4LK7 A;  1QQP 2;  1UY0 A;  2WRA A;  4GQ7 A;  2MEV 1;  4Q4V 3;  3JD7 1;  4XFG A;  4EWE A;  3EXU A;  5FFO C;  5A70 A;  1JYI A;  2JDM A;  4CDX A;  4OZX A;  1UX6 A;  2JDH A;  3BIW E;  1GNY A;  1OFN A;  1R64 A;  2WA4 A;  2YBK A;  4URT A;  1PX3 A;  1W28 A;  4XDP A;  3JBG 1;  1YFY A;  3DPR C;  1CZT A;  3KB5 A;  2JDP A;  5JOX A;  3SQO A;  1RUF 2;  1R1A 1;  1ZZ8 A;  4HOO A;  3KHB A;  4M3C F;  2QQP A;  3DPR A;  3A22 A;  3PMS A;  4RGA A;  4Z2A A;  5B4X A;  5IK4 A;  4QX7 A;  4RD7 A;  3ZSK A;  3ZFE B;  4UFK A;  1HV1 A;  1H4G A;  1LGB A;  2VJX A;  4CDU B;  1YI7 A;  2XJP A;  3LIG A;  4HSL A;  2Q4S A;  2WZR 3;  2VU9 A;  5M0T A;  3BTA A;  4V2W A;  3UKV A;  3BTX A;  4XOG A;  5KXE A;  1NCQ B;  1KIT A;  5C70 A;  1YLL A;  1ASJ 3;  3ZOI A;  1AR6 2;  5I8S A;  2RHP A;  4F7Z A;  1YQ2 A;  2OKX A;  2VOV A;  2VNO A;  3WG2 A;  5A6Z A;  1NG0 A;  3H50 A;  1UWW A;  3H1Y A;  5DAB A;  5A7P A;  1QGL A;  1DP0 A;  2VVD A;  2JX9 A;  4KU8 A;  3VZN A;  3AMM A;  4COY A;  1ZA4 A;  1V00 A;  5IVB A;  2CWS A;  5LB6 A;  3WP6 A;  3ZN6 B;  5ABJ B;  2ZGP A;  4QPG B;  3PUI A;  1XB9 A;  3POF A;  4P9L A;  1PO2 2;  1QF3 A;  5A3O A;  2QQV A;  3LGR A;  4QWN A;  1PVX A;  5FRA A;  3OD0 A;  2EXI A;  4OUM A;  4YGC A;  2RVA A;  2V5Y A;  5JIA A;  2VZ1 A;  2JWP A;  2PLV 2;  1EYB A;  4OI2 A;  4LBK A;  1VRH 1;  4EN0 A;  2G1M A;  5FZ6 A;  4IQP A;  2GDF A;  1CJP A;  2JG8 B;  3AVR A;  4AHY A;  5LAS A;  1HJG A;  2WWS A;  5J3U A;  4TSV A;  2E7Q A;  1W3V A;  1FXZ A;  4ORF A;  3SLI A;  3O1P A;  2XLF A;  4B4R A;  4W6Y A;  2WZP P;  1MEC 2;  4CEW C;  5KC6 A;  1D4M 2;  4QQH A;  5FYY A;  4YFZ A;  4NID A;  1LB2 A;  3I2O A;  4YSF A;  4EWD A;  1R08 1;  1ULG A;  2HEY F;  1H30 A;  4CEW A;  5KXB A;  4XAC A;  2F17 A;  4RR3 C;  4HVO A;  5FY1 A;  4CEY B;  1LTE A;  2E33 A;  2R04 3;  2UWA A;  4BLJ A;  1IHM A;  1CPM A;  4MZU A;  3J8F 3;  4OQ9 A;  3MV0 1;  3LA3 A;  2Y6J A;  4RR3 A;  1QJY 2;  2P3I A;  4N7I A;  2YV8 A;  2C9K A;  4YW4 A;  1JYW A;  3OBZ A;  4AFB A;  1FOD 1;  1VBB 2;  4IUG A;  1DQ5 A;  5HCA A;  2YRO A;  4GMP 1;  1W2T A;  1NA1 C;  1PMH X;  3FLT A;  4XAE A;  3B00 A;  1IS4 A;  2WAO A;  1OT5 A;  2F6B A;  3AKT A;  2JKB A;  2J22 A;  1QH7 A;  1AZD A;  3PTY A;  3WEZ A;  2R07 2;  2WC2 A;  2WAB A;  3BAL A;  2ZKL A;  4ZU7 A;  5DAP A;  1IS5 A;  2CV6 A;  3V0A A;  1W0P A;  5E89 A;  3VN4 A;  1UNB A;  5CFD C;  3AZZ A;  3IN9 A;  1Q5O A;  5F8P A;  2YFU A;  3FX3 A;  1XND A;  3PJQ A;  3MW4 A;  4ES8 A;  3WNX A;  1SCR A;  5CFD A;  5GLU A;  3PVE A;  3U78 A;  1BVP 1;  3ZN4 A;  4IE7 A;  5GZD A;  4ZPI A;  4Q8L A;  2QKD A;  2ZEX A;  1Q3E A;  2A71 A;  4P9J A;  1U5Y A;  3HT1 A;  3CNA A;  2D6L X;  1E5S A;  4N43 C;  4QXH A;  4PIX A;  1RUG 2;  5FP9 A;  3RMY A;  1K42 A;  1LHO A;  3HR9 A;  2YBS A;  3BN6 A;  3VD9 A;  5ANQ A;  1FMD 2;  1KEX A;  1JN2 P;  3A0K A;  4IEX A;  2H6B A;  4IV3 B;  3NST A;  2RDS A;  2C24 A;  5FP7 A;  3WDW A;  1E5I A;  1W9S A;  4A42 A;  3M4F A;  1QJZ A;  1VAV A;  2ZGK A;  2GNB A;  3EBR A;  5F5Q A;  3THD A;  4V2V A;  1COV 3;  4WVM A;  3O1O A;  3RS6 A;  4QAW A;  5FY8 A;  2I2S A;  3WQ1 A;  1H8T B;  1YO8 A;  1AYM 1;  1SBE A;  2YZ4 A;  3QH7 A;  5LBC A;  4EN9 B;  2A6X A;  3I49 A;  2ZGT A;  4CCD A;  5A3L A;  3S5Q A;  4LPL A;  3MIC A;  4BIO A;  5C4W C;  1VBB 3;  1PMI A;  4KWL A;  1TG7 A;  2MPF A;  2VZT A;  3KM5 A;  2BBA A;  2VZQ A;  1OPM A;  5CB7 A;  3E5X A;  3OBR A;  5FZ4 A;  2OII A;  3HBZ A;  1V6J A;  3HT2 A;  3VHR A;  4YM3 A;  1QJX 1;  1W6N A;  5C4W A;  2RM2 2;  2Z42 A;  3M70 A;  1Y43 B;  3CZU A;  1FAT A;  4WVV A;  2XKO A;  4I0A A;  4UAP A;  3UET A;  1C8M 3;  2ZZQ A;  4YVW A;  1OA3 A;  3LDK A;  4NHM A;  2ZJC A;  4H3W A;  4QB2 A;  1V6K A;  1LOF C;  1VBC 2;  1EUT A;  3ZFG C;  3DPR B;  3LIH A;  5FP8 A;  4DUX A;  1VBE 2;  1LHW A;  1OF3 A;  1QJU 1;  4MGQ A;  2QDR A;  1UOF A;  2J1R A;  3P5B A;  1D0H A;  2BER A;  2IFR A;  3ZFG A;  5C3R A;  2W46 A;  5I0U A;  2RMU 2;  3J7N A;  4BM8 A;  3L2H A;  4FFF A;  3LB9 A;  1VLN A;  2EAA A;  2YMZ A;  2ERF A;  1NYW A;  1X50 A;  3AFG A;  2PHF A;  3LA7 A;  5D8A A;  4HAN A;  4I01 A;  4NHX A;  4DEV A;  2BOI A;  1NUK A;  1ZBE 1;  2YFZ A;  3VL9 A;  4TLF A;  3BOW A;  2X8K A;  2KA3 A;  1C5I A;  3WW2 A;  4AI9 A;  2JDA A;  1RTV A;  1RUD 2;  4FPC A;  1RUI 2;  5CFC A;  3DF0 A;  2IFW A;  2WNV A;  1FT9 A;  5IK8 A;  4Q4X 3;  4ZU4 A;  2ZHK A;  4UBG A;  1FPN 3;  4CUC A;  1LED A;  1RJ7 A;  4D6S A;  2GP5 A;  1O5L A;  1DFQ A;  1UKR A;  1XNC A;  2SLI A;  2Q1Z B;  4XBQ A;  2VMF A;  1AXZ A;  1WW6 A;  2DFC A;  2VMD A;  4NRP A;  1POV 0;  4FP3 A;  1O4Y A;  1LEN A;  1OLQ A;  3PDQ A;  1MZ6 A;  4I0B A;  3RFR A;  1HRI 3;  1I5Z A;  1RUE 2;  1OQ1 A;  1APN A;  1GOG A;  4UFJ A;  1JZ3 A;  4AI1 A;  3A7Q A;  3C7F A;  2JDY A;  3MZH A;  2HWC 3;  3LKJ A;  1PM7 A;  4V1P A;  4LBQ A;  3VZO A;  1GUI A;  3ETP A;  4IE6 A;  4OCT A;  1PGS A;  3CIH A;  5FY0 A;  5A33 B;  3SHR A;  2RS1 2;  1ZA7 A;  2TUN A;  2VMG A;  2UYB A;  4XIL A;  4CDX B;  2ORX A;  5C7G A;  4XF0 A;  2XUM A;  4CCM A;  3RZJ A;  2CDO A;  4CEW B;  4A3Z A;  2ZX0 A;  4QX0 A;  3O14 A;  3ELN A;  1ND2 C;  4LKF A;  4CU9 A;  5T54 A;  4PLO A;  2XJT A;  4RR3 B;  1M4W A;  5AC9 2;  1JZ8 A;  4GXL A;  4UBH A;  2NQY A;  3ZPO A;  3U4S A;  1WBL A;  3LPF A;  3MGU A;  5C5U A;  3O1S A;  1V0A A;  2HWD 1;  2DWR A;  5EXO A;  5JSO A;  3OTF A;  2OZJ A;  5JZG C;  4DFS A;  1WA4 A;  1F5J A;  1PO1 3;  4UFL A;  4XHB A;  4P9X A;  5FWE A;  4F8A A;  4TXW A;  1FI2 A;  3TEY A;  1ENQ A;  1S0D A;  3NNF A;  3PU8 A;  4QM9 A;  5CZK A;  4XBN A;  5FZI A;  3WNN A;  1FV2 A;  3TNQ A;  2E31 A;  2XHK A;  3V0A B;  5DMY A;  1CZS A;  3RDI A;  2R49 A;  3A21 A;  1V9U 1;  3MI8 A;  1OQE A;  3D5O A;  4NOT A;  2C4X A;  2LRO A;  1WMF A;  1HQL A;  2PFW A;  2YU2 A;  3FUO A;  4NRM A;  3T30 A;  5JPN B;  5CFD B;  3Q8A A;  3UK9 A;  3KGL A;  3MUY 1;  1ULF A;  3PJY A;  1EPW A;  5I0T A;  2WFF 3;  2Z4F A;  5C8C A;  1LOB A;  1O8S A;  1ULD A;  1WUV A;  4XYX A;  1H8V A;  1MS1 A;  1VRB A;  5IAX A;  1UMI A;  2OYZ A;  2L9L A;  2W87 A;  1YJK A;  1UXZ A;  2WNU C;  4CP2 A;  3WW1 A;  1JH5 A;  1UX7 A;  1GKB A;  4FVV A;  2C5D A;  4HKO A;  3H9A A;  4R8H A;  2G9Z A;  4QHB A;  3S0M A;  4IEO A;  4COV A;  1UY2 A;  1U5X A;  2Y0O A;  1QWR A;  3FHQ A;  4U2A A;  4K6B A;  1LU1 A;  4XAA A;  1JUH A;  1LES A;  2WT0 A;  1GAN A;  4Y1X A;  4AXO A;  3KCC A;  2ZEZ A;  3BUC A;  2LUW A;  3JQW A;  1JYX A;  1UYX A;  2VOT A;  5CKQ A;  2MEV 2;  3NNG A;  3JD7 2;  1Q43 A;  4R9C A;  1GIC A;  4K9S A;  4IDZ A;  3H0O A;  4SBV A;  2B42 B;  2PYT A;  5FO7 B;  1W6N B;  5C4W B;  4LHN A;  4GKX A;  1JYV A;  2E9Q A;  2OUH A;  5F3G A;  4AWD A;  1W6M A;  5F1R A;  1BJQ A;  2DDU A;  3UGH A;  1BEV 1;  3JBG 2;  2ZS6 B;  4Y5Z 0;  4DB5 A;  4YVW B;  2WO3 A;  1R1A 2;  3LF7 A;  3P3N A;  5F5I A;  3TN9 1;  2NMN A;  2DBN A;  2QCS B;  1HX6 A;  4XE9 A;  2HWE 3;  4MSV A;  4P14 A;  4LO7 A;  3SC7 X;  3ZFG B;  2W2I A;  3TNP B;  2P37 A;  1S0G A;  5DAW A;  5FXV A;  3IIA A;  2ARA A;  4N53 C;  4P00 B;  1ZYB A;  4FPO B;  5DDJ 1;  4O9G A;  4C0B A;  1GMM A;  3HVD A;  3AX4 A;  3OEA A;  1EV1 1;  4NE9 A;  4DO0 A;  4XFF A;  3WW3 A;  3RZH A;  3M2M A;  5CKM A;  1Z7S 1;  1C1F A;  2W3J A;  1D2Q A;  1F4A A;  3FUQ A;  4KG0 A;  2VNG A;  3ZDS A;  5J36 A;  4ZXK A;  1AUY A;  3LEK A;  1C57 A;  1YQ8 A;  2EID A;  3NO8 A;  4E8C A;  5JSR A;  2D7F A;  4YAR A;  2YB7 A;  5GKA C;  2Y60 A;  1AL2 1;  1N3P A;  3J9S A;  4JGZ C;  4UW6 A;  4CDW C;  1OD5 A;  5JR7 B;  3HN3 A;  3MID A;  4DNY A;  3W5N A;  5T5O A;  2QFE A;  1AHS A;  1JU4 A;  3VBR A;  3NMB A;  3KHC A;  4QU2 A;  4XQW A;  3I59 B;  5HCB A;  3MDP A;  4K3U A;  4OHX A;  4RHV 1;  4D7Y A;  3J4U H;  1HXS 3;  2CTV A;  3PHM A;  4NIH A;  1YQ6 A;  4AL9 A;  3SIT A;  1DIW A;  2WKK A;  4JC1 A;  4OFG A;  4LR4 A;  1B35 C;  3I2H A;  3OSD A;  5FZ7 A;  1C28 A;  3BTY A;  1PMJ X;  2LM3 A;  5FMB A;  3WT3 A;  1YIP A;  1QEX A;  3URF A;  5JAX A;  1VRH 2;  1YIF A;  5C8W A;  2W47 A;  4BQ4 A;  1W8N A;  4LBQ B;  2VNR A;  2A1X A;  5FP3 A;  3TAY A;  3KMH A;  4ZHN A;  4IGP A;  2DCZ A;  3WDV A;  1QOO A;  4IEP A;  1GYK A;  5BNO A;  3T4H B;  1UW8 A;  1BBT 3;  2Q8O A;  1ZBA 1;  4OMD A;  2TEP A;  3POB A;  3HN1 A;  1R08 2;  1AR7 3;  2V4V A;  4QPI C;  3BIE A;  5FPX A;  2W39 A;  2QUO A;  5JUV A;  5IYY A;  1SG3 A;  2UU8 A;  5GLZ A;  3PUS A;  2ET7 A;  1H4H A;  2A6V A;  3D0S A;  4Q4W 3;  4QGN A;  2DCJ A;  3IB3 A;  1PGW 1;  3OCP A;  2PAK A;  3WP3 A;  3AJY A;  2VG9 A;  2XQR A;  4LQR A;  2VQA A;  4DUV A;  5K7P A;  2D6K A;  1LHV A;  4MV2 A;  4UFH A;  3VBU C;  4EN7 B;  1FOD 2;  3C7O A;  2ADD A;  1LGN A;  2ZXQ A;  3PUA A;  3VBU A;  4U36 A;  1VB2 A;  5CA6 A;  4QXC A;  2AEZ A;  4M01 A;  2XGX A;  2QZ2 A;  3ZSM A;  1W06 A;  2ZGO A;  2ATF A;  1RUN A;  4XF4 A;  3WZ1 A;  4OHV A;  2R06 3;  5FYH A;  2QQI A;  1OHF A;  2DVG A;  3T4V A;  1SLA A;  2VGD A;  1DQ0 A;  3MO4 A;  4CCN A;  2IXC A;  2ZEW A;  1HJF A;  2XXZ A;  3OY8 A;  3E6D A;  1ZZC A;  1JZ5 A;  2AH2 A;  2W1W A;  3HIF A;  4XZP A;  3KT7 A;  5FLH A;  5F32 A;  5FP4 A;  1STM A;  3WF0 A;  2ET1 A;  3ZYJ B;  4COU A;  2A5Z A;  2VEC A;  4BQY A;  3S5A A;  4NRQ A;  4OMC A;  3ACH A;  5D2A A;  4ET7 A;  3VKM A;  4YW1 A;  4H2A A;  2XR4 A;  1GLH A;  3ZYF A;  5CG9 A;  4F83 A;  3WNM A;  3I8T A;  3NJX A;  4XJW A;  5FMD A;  4NHY A;  4BA6 A;  2VZO A;  2HEW F;  1HN0 A;  5HV4 A;  5C33 A;  4UYB A;  2WNU B;  2QQK A;  2V09 A;  4XBL A;  3HNB M;  2BVV A;  1RUC 1;  2JDN A;  4M3C B;  3THP A;  4B4P A;  4BCU A;  4FTE A;  1OOP C;  1AJO A;  2UUR A;  4NWW A;  1ZRC A;  3VBS C;  4HFS A;  1DQ4 A;  4B7K A;  5JCT A;  4WM7 A;  1AYM 2;  1DQ6 A;  4OQ8 A;  1FNZ A;  4NR1 A;  3VBO C;  3E6B A;  2Y6G A;  5LEK A;  1Y4W A;  3O7O A;  2A6Z A;  1KXG A;  3ZFE A;  1D4V B;  2O1Q A;  1ZNP A;  2WS9 1;  3RWK X;  3K77 A;  1QJX 2;  4XJU A;  4URA A;  4FOQ A;  2HYK A;  1ZZ9 A;  2CAV A;  1AXY A;  2J1S A;  4KWJ A;  4S2F A;  3BPZ A;  3VZK A;  1TNR A;  2PAM A;  5A1L A;  2GC0 A;  2Y6H A;  2XHN A;  3HEI A;  2YGL A;  5JWP A;  1I6X A;  2WO7 A;  1GWL A;  5FZM A;  4HL0 A;  5F2S A;  1QJU 2;  4D6Q A;  3PUR A;  5FZA A;  1V6I A;  4PJY A;  3TEX A;  5J37 A;  1TME 1;  3AFK A;  1ND3 A;  4UW5 A;  3DEM A;  3ZN6 A;  5ABJ A;  4JQT A;  3P6B A;  4QPG A;  5GJ6 A;  4Y20 A;  3SKV A;  2PXJ A;  3F95 A;  5FYU A;  3ZVX A;  3JB4 C;  4K40 A;  4EE2 A;  1A3K A;  1CPN A;  1ZBE 2;  4QDR A;  4NIA A;  3DXU A;  4I3P A;  1RHI 1;  3P3P A;  2X29 A;  1N47 A;  3WG3 A;  4XQD A;  4RA0 A;  2WWJ A;  1LNS A;  2ZKN A;  3I2J A;  4Q1P A;  1NOV A;  2XB6 C;  3ZR5 A;  2VPV A;  1G9C A;  5T5J A;  5BNP C;  3VD5 A;  2DVB A;  3LFM A;  4JGZ B;  4CDW B;  3VBR B;  1CAV A;  2IUW A;  1ENS A;  5FZE A;  5BNP A;  1SBD A;  4GB3 1;  4LA3 A;  3T1M A;  4ZZ5 A;  3WUC A;  3VBH C;  4AR2 A;  4Z8B A;  2AR6 A;  3CMG A;  1OVP A;  5A80 A;  2TBV A;  4UW4 A;  4E27 A;  3DKW A;  1UD1 A;  1NE4 A;  4YPJ A;  5JI9 A;  5KXC A;  4AGV A;  1PVC 1;  1F5F A;  2RS3 1;  4NJ4 A;  4MGK E;  1KJL A;  1S55 A;  2QQO A;  5I91 A;  5A3W A;  2FDH A;  1Q8O A;  5EJ3 A;  1UPI A;  1BMV 1;  4XET A;  4MVT A;  3N7J A;  4UI9 L;  5LA0 A;  1DGR A;  1WD4 A;  1DYP A;  2ZX4 A;  1W2U A;  2GC3 A;  2WQ8 A;  1UZV A;  3RVH A;  4QXB A;  1G8W A;  4MGZ E;  2JKX A;  2ZGS A;  4L8Q A;  5BNO B;  3UGF A;  5GZF A;  2D3P A;  5IFP A;  4NII A;  5K8S A;  4CRQ A;  2TNF A;  4BYY A;  3WNP A;  5FYB A;  2Y6L A;  3G6J B;  4LO8 A;  1MS3 A;  1VBD 3;  3N9Q A;  4JHZ A;  4M3C E;  5KC5 A;  4JZR A;  1NZC A;  2BUK A;  4QPI B;  2J42 A;  1LEM A;  5J96 B;  4QHZ A;  4DS0 A;  2CU5 A;  2OW4 A;  3RYR A;  5I8T A;  1POQ A;  3AYC A;  3IDE A;  4ARX A;  3AJZ A;  4XCB A;  4G4F A;  1TE1 B;  2HWF 3;  3ATG A;  4M4P A;  4Q5O A;  2HWD 2;  2GND A;  1YYN A;  2JEM A;  4KBB A;  5B2G B;  2R30 A;  3VBU B;  5K9Y A;  3IT8 A;  5JVV A;  3SCF A;  3IWZ A;  1UZZ A;  5LBE A;  5BUV A;  5JOZ A;  3ACL A;  4LOT A;  3RZM A;  1MS9 A;  2WSV A;  3GJB A;  1IPK A;  5GLT A;  2YXS A;  2ZAA A;  2OUJ A;  4Y1U A;  2QDN A;  1CR7 A;  1H1M A;  1KGY A;  1W8F A;  3NJV A;  4IND A;  4RYD A;  2R0H A;  4XIK A;  4DQA A;  2DUQ A;  1V9U 2;  5GZG A;  1S0E A;  2ZAC A;  3K2O A;  3OY8 B;  4EZH A;  5FR3 A;  1IQA A;  1HKD A;  4I2O A;  2BU9 A;  2JD4 A;  2XJV A;  1I3H A;  5H9S A;  1K45 A;  2DBI A;  5CVR A;  4XUN A;  4L97 A;  5FZ8 A;  2V5D A;  1UPS A;  2R1D A;  1SFP A;  4ZS2 A;  3GDB A;  3NNL A;  4DY5 A;  4Q0Q A;  3BU0 A;  4ARY A;  1ST8 A;  4BU2 A;  1WW5 A;  4AW7 A;  2YBP A;  2I74 A;  2RE9 A;  4IW3 A;  2BZD A;  4UT5 A;  2ZGM A;  1UIJ A;  1ZZB A;  2A70 A;  2Q0A A;  1CZV A;  5IAV A;  4EYU A;  5ANN A;  1IQD C;  1JHN A;  2VOW A;  3WDY A;  1TNF A;  4AED C;  5C3P A;  2W0X A;  4MGT A;  1VBA 3;  3OG2 A;  3KZ4 C;  4LMF A;  4WM7 B;  1OOP B;  4LUL A;  4AVA A;  1HRV 3;  1O4T A;  1PNF A;  2G4I A;  3JXS A;  4MLO A;  2KM2 A;  1H2M A;  3VBO B;  5FO8 B;  4BK5 A;  5C3Q A;  2OPW A;  2OS2 A;  3N7K A;  2HWB 1;  2E7T A;  3WP4 A;  4QPW A;  3I97 A;  3PVO A;  1REF A;  3PVB B;  3AB0 A;  4DMI A;  2FZ2 A;  1DG6 A;  4AFD A;  5KHH A;  4DXR A;  1BEV 2;  2C26 A;  4LBN A;  1W6O A;  3OGV A;  3SCG A;  4D7T A;  1XYN A;  2E32 A;  3RJ2 X;  3TN9 2;  4BDV B;  1W3X A;  2E63 A;  4WBB A;  1AX1 A;  5GLW A;  2JXA A;  4CYD A;  1PIV 3;  2XBO 1;  1O8P A;  1TQ5 A;  2BDR A;  5FXX A;  2XVL A;  5FLI A;  5EIY B;  5FZO A;  5JMO A;  4MHU A;  1GZT A;  1ND3 B;  2OVU A;  1K5J A;  5DDJ 2;  5E6H A;  4D69 A;  1UYP A;  3TEW A;  4WV8 A;  1EV1 2;  1BK1 A;  1J83 A;  4IEU A;  3WG4 A;  4Y20 B;  3FLR A;  1Z7S 2;  2CHH A;  1OKO A;  1AR8 1;  1QQP 3;  3FHA A;  2D6M A;  3QLQ A;  1SBF A;  5F3I A;  2X05 A;  1C3H A;  1XU1 A;  2FHR A;  2QQJ A;  2ZX2 A;  2W5F A;  4FFH A;  4FPJ A;  4LKS A;  4LEJ A;  5IWF A;  4ATF A;  4O65 A;  1RC6 A;  5SV8 A;  3LSD A;  1CX1 A;  3WOG A;  4PQ9 A;  3FE5 A;  1AL2 2;  1SQ4 A;  1UU6 A;  4OHW A;  3ZXE A;  2AUY A;  3AC0 A;  5FJH A;  4JKK A;  1CAV B;  5IVY A;  1VMH A;  1RUF 3;  2BFU S;  2A3W A;  1BK0 A;  1DCS A;  1HIX A;  5BNP B;  3O1R A;  2P3K A;  1DGW A;  4RHV 2;  5A33 A;  3Q8F A;  2GMM A;  3NNJ A;  1XC6 A;  4H7L A;  1SLT A;  4HZF A;  4XC9 A;  3HD8 B;  4RFT 0;  1KJR A;  4E4D X;  1KDM A;  3B94 A;  1UOJ A;  4A6S A;  1OPO A;  3VBH B;  2QJV A;  2OXB A;  1NX9 A;  1DZT A;  2XWB B;  5E8A A;  4AAP A;  1FYU A;  3WNK A;  4CP9 A;  1W39 A;  1YUD A;  5ACA 1;  1CAX A;  1RMU 1;  4XEZ A;  2V73 A;  1W2O A;  2VOX A;  1JOP A;  2Q30 A;  4YM2 A;  1JTZ X;  3FLP A;  1AR6 3;  1WMD A;  4LBM A;  1G9A A;  3Q8E A;  1SLC A;  3W5M A;  3U14 A;  2I45 A;  3CJI C;  4CU8 A;  2VUC A;  4LUM A;  1G9D A;  5IT6 A;  1XQN A;  2JIC A;  5JXJ A;  1PK6 C;  1TMF 1;  2EXK A;  3DYO A;  3WF1 A;  2FDK A;  2ZBJ A;  3WV6 A;  5DAQ A;  4E4H A;  2BNN A;  1ZBA 2;  1F9K A;  3JU9 A;  2WN2 A;  2E7A A;  4OUS A;  1NLQ A;  1NA1 A;  1DZQ A;  1K5M C;  2D5F A;  1YXW A;  2JG9 C;  4A44 A;  4C91 A;  5F3E A;  1OXC A;  3NVC A;  1AR9 1;  1GNH A;  4YLZ A;  1ULP A;  5EP9 A;  4ASL A;  5F6L B;  1NLS A;  1NQJ A;  1PO2 3;  1PGW 2;  1Q8P A;  4ISQ A;  1RUJ 1;  1Z0H A;  1R09 2;  3U37 A;  3A0N A;  4GD4 A;  1YI9 A;  3B93 A;  2OZ6 A;  1X8M A;  2NN8 A;  3C7E A;  3CJX A;  3JZV A;  4JGY C;  4L11 A;  4LHK A;  4S2H A;  1CAW A;  2QNK A;  3WP5 A;  3A23 A;  5BY5 A;  2VMC A;  2PLV 3;  2QVS B;  2YDE A;  1SLB A;  4C1X A;  2RS5 1;  2AZ5 A;  4EQV A;  1CWP A;  4FP2 A;  3D8C A;  5JOW A;  5A6X A;  2UY9 A;  3ZXL A;  3RI9 A;  1QOS A;  2P4E A;  5K0U C;  2IXL A;  3AP7 A;  5FO9 B;  2W1Q A;  3OGR A;  3ZYP A;  2VZ3 A;  5HI0 A;  4N43 A;  3VDD C;  4ONU A;  1IS3 A;  1MEC 3;  4FFG A;  1D4M 3;  3W58 A;  1RUH 1;  3MLK A;  3GM8 A;  5A3T A;  4LHL A;  2VVF A;  2XWJ B;  4QDQ A;  2QQM A;  5SV5 A;  4L92 A;  2BWA A;  3WF4 A;  4LO5 B;  5FRE A;  4L9B A;  1X36 A;  1UXX X;  2FQP A;  1GOF A;  2O14 A;  1DF0 A;  1V6M A;  5GAL A;  1O3R A;  2JE7 A;  5F3C A;  2FCV A;  3INA A;  3J7M A;  3MF9 A;  3SIS A;  1QJY 3;  2ZHN A;  4JV4 A;  2Y6F A;  2J1A A;  2X53 S;  1HB3 A;  2XOM A;  1HB4 A;  5I0S A;  1N1T A;  1QXP A;  4XMA A;  5JXI A;  5T55 A;  4PI0 A;  3RZG A;  1QJF A;  2GZW A;  2OX0 A;  2EXH A;  1NY7 1;  3MHZ A;  4OZO A;  1F35 A;  1RUC 2;  3T1L A;  5BNN C;  3KGZ A;  3ZXA C;  1VMF A;  2R07 3;  4FPH A;  5DPN A;  1WCQ A;  3V56 A;  3WQB A;  4AED B;  2WNE A;  2RJK A;  1TVG A;  4IV1 C;  3GZE A;  1GZW A;  1QIQ A;  1UMZ A;  3BYW A;  4HLT A;  1V6L A;  3K46 A;  5T5P A;  4Q4Y 1;  2WA3 A;  3VKF C;  1R09 3;  4HN1 A;  4IV1 A;  1LOF A;  2DU1 A;  3RYK A;  2Y26 A;  3OYW A;  3MYX A;  3PIJ A;  3KV4 A;  4IEY A;  4A41 A;  5FOJ B;  3R6S A;  2K0G A;  2WS9 2;  3PUH A;  4W4Z A;  4QX2 A;  2VTF A;  3QOP A;  5HXV A;  3MUZ 1;  3D3A A;  4YZ2 A;  1GQP A;  5LY1 A;  2IXK A;  1IPS A;  1BCX A;  2D93 A;  3O12 A;  3VZJ A;  1WCD J;  2OQ7 A;  1RUG 3;  1RYY A;  3ZXD A;  2YYO A;  3KV5 A;  2FDF A;  1W6O B;  3POW A;  1E5H A;  4JRL A;  1EAH 1;  1Y9G A;  1YNA A;  1LOC A;  5IVF A;  5FYI A;  1FMD 3;  5FCC A;  1OUS A;  2VD7 A;  2O8Q A;  5DUU A;  4X6Q B;  3IDB B;  2DUO A;  3RYP A;  5L7O C;  2D44 A;  3MV1 1;  5FZO B;  1TME 2;  3DEC A;  1CIY A;  2FCT A;  5FPB A;  4HKL A;  5E16 A;  2VR4 A;  1QXR A;  5L7O A;  3MIB A;  3NKT A;  4LT5 A;  3B9C A;  3I59 A;  3NAP C;  1JXN A;  3AL5 A;  3LDR A;  4CUG A;  3HQU A;  3SH3 A;  4K1Z A;  3ES4 A;  3NV1 A;  1RXF A;  3E1F 1;  2RR1 1;  5FAX A;  1DYO A;  3EJK A;  1XBF A;  3NV3 A;  2JDZ A;  3W9A A;  2XKP A;  1UQX A;  4YW6 A;  2ARE A;  2JJ6 A;  3DCQ A;  1RHI 2;  4YM1 A;  3AYA A;  3O5S A;  2K46 A;  4W50 A;  2VC9 A;  2DTY A;  2RM2 3;  3MBW A;  3WIN E;  5LRS A;  4DEQ A;  2GU9 A;  1RUC 3;  3RZK A;  2EA7 A;  3VDB A;  4CZS A;  1G9B A;  4IER A;  4LBJ A;  5AVP A;  2VQ0 A;  1AYN 1;  4COW A;  2NYY A;  5FUN A;  2BV4 A;  2VL4 A;  1IZ3 A;  1VBC 3;  1WW4 A;  1G86 A;  1NXD 1;  1VBE 3;  4GB3 2;  4LA2 A;  2D97 A;  4LE3 A;  2J1U A;  4RS5 C;  3WHU A;  2Q1F A;  4AI8 A;  2RMU 3;  3PLQ A;  3N9P A;  3AZV A;  4A45 A;  2DU0 A;  3HQX A;  2HKX A;  1KQR A;  4CP9 B;  1E57 A;  1PVC 2;  2RS3 2;  4D8M A;  1CAX B;  3KT1 A;  3ZX7 A;  2ETE A;  4CCC A;  4DXT A;  3MLL A;  1IG0 A;  2NLR A;  5BV6 A;  3ZR6 A;  1GOH A;  1DLC A;  3BGA A;  1NZI A;  3C8X A;  1BLZ A;  5K4L A;  2XQX A;  3ETQ A;  5J1X A;  5BNQ A;  2CSG A;  1BMV 2;  3IAQ A;  4DXS A;  2LAL A;  2VZP A;  1POV 3;  1ND2 A;  1UAI A;  1RVF 1;  2ZAH A;  3R05 A;  4QB6 A;  5FZ3 A;  2FD8 A;  4N9H A;  3GHN A;  3AVS A;  5DUX A;  4Q4V 1;  1AF9 A;  1RUD 3;  2DVD A;  4KG8 A;  2B9V A;  4QD2 A;  3VBF A;  1RUI 3;  5KHK A;  5KWR A;  1O3T A;  1YRZ A;  2PHR A;  4YVS C;  2VQU A;  3S30 A;  5JLV A;  1NA1 B;  5JZG A;  1BHG A;  4AFA A;  5IVJ A;  1L7R A;  2VOK A;  2VM9 A;  4S2D A;  5CIR A;  5G04 L;  4CE8 A;  2C1F A;  2DUR A;  1ONA A;  3K4D A;  1LUL A;  1K5M B;  4PBP A;  3ZKY A;  1FNY A;  4NHL A;  5H9P A;  4DIQ A;  3UL2 A;  3ITQ A;  3G7D A;  4GH4 C;  1ACC A;  3OPT A;  5LK5 A;  5A1F A;  4YW7 A;  2K9Z A;  1RUE 3;  4MHR A;  1CAW B;  2WQZ C;  5KHJ A;  4P02 B;  1O59 A;  3III A;  4BXS V;  4JGY B;  4E4Z A;  3QCW A;  4ASM B;  2A75 A;  3KVB A;  3VB9 A;  2WZR 1;  1YJL A;  4FQZ A;  1UOG A;  4JKL A;  2ZX1 A;  3LAG A;  4YW5 A;  3GAL A;  3WUD A;  4HKW A;  4QB1 A;  1ASJ 1;  4N43 B;  4BJ0 A;  5K0U B;  1ZZ7 A;  2RS1 3;  1DGR N;  4YW2 A;  3O1T A;  3X29 B;  3AKR A;  2WNU A;  4BQ1 A;  3VDD B;  4RGK A;  4MGS A;  1GZC A;  4M3C A;  3MIF A;  2VW2 A;  1W9F A;  3M3C A;  3USS A;  1NKG A;  2EXJ A;  4PDW C;  3VKN A;  2ZML A;  1PHM A;  3AP6 A;  5FPA A;  2BWC A;  5AC9 3;  3RI8 A;  4PDW A;  4P9Y A;  1LRH A;  5CIS A;  1X9P A;  5FYM A;  5AVA A;  1OQD A;  4PCR A;  2FCU A;  1Y9Q A;  4CPB D;  1ZX5 A;  5A7S A;  1QU0 A;  2JDU A;  1BQP A;  2Y64 A;  1WZX A;  2FDJ A;  2VE1 A;  1ZRR A;  3H1W A;  2EIE A;  1IGO A;  5BYN A;  3T2O A;  1A6C A;  2ZMK A;  2E26 A;  2GMP A;  2AGS A;  3M7A A;  2YUE A;  2D5H A;  2IC1 A;  5BNN B;  2ZPX A;  1GZW B;  2JB8 A;  3Q9O A;  3VLB B;  1OI6 A;  4D7S A;  2XJU A;  3H3L A;  1PX4 A;  4FI9 A;  1I9R A;  4IV1 B;  1VJ2 A;  1GP6 A;  3R4U A;  3L9J T;  4HBN A;  3H1M A;  3OYW B;  4IEZ A;  1LR5 A;  2QQU A;  2HWB 2;  3I2D A;  4N8M A;  2H0B A;  2XPJ A;  3KT4 A;  4B3N A;  3CF6 E;  5FPV A;  4YZ4 A;  3DKQ A;  4N53 A;  3WVJ A;  2VME A;  2N7G A;  4PIY A;  2R04 1;  4B4Q A;  3MFA A;  3J8F 1;  3MIH A;  4BPZ A;  1HQW A;  5DUV A;  5A3M A;  1IKP A;  1OUR A;  5CBL A;  1WCK A;  1IOA A;  1ULE A;  1YFU A;  3ABZ A;  2ZHL A;  5B4N A;  2CNA A;  1DDL A;  1UU4 A;  2F4L A;  2AEN A;  1HB1 A;  4IES A;  2B46 X;  4UW3 A;  4BQW A;  1OLR A;  2BNO A;  3ACF A;  4JGZ A;  4CDW A;  1RIN A;  2BGC A;  3LQC A;  1IKQ A;  5L7O B;  2EF6 A;  2PA7 A;  5FBJ A;  5FZC A;  2ZGN A;  1SHW B;  5JI7 A;  1OUX A;  1XE0 A;  1YWK A;  5DG2 A;  1WWY A;  4C90 A;  5I93 A;  4XFA A;  1AR8 2;  5JPM B;  3NAP B;  2MEV 3;  3JD7 3;  3R4S A;  1U5I A;  3IMN A;  4PF1 A;  4KH9 A;  4Q27 A;  2X10 A;  1ZVF A;  3AMN A;  3PVN A;  4O7X A;  3MPP G;  4MUV A;  4DZG A;  1J3P A;  4L0P A;  3RMX A;  4AYU A;  2WUH A;  1B35 A;  1MZ5 A;  3JBG 3;  2GH8 A;  1J1T A;  2IVJ A;  4FAG A;  5FY9 A;  3HJR A;  1R1A 3;  4AFC A;  5D21 A;  3CKH A;  3ZSJ A;  3KVA A;  3W21 A;  1W8T A;  4XJZ A;  3WX5 A;  2XJQ A;  1RB8 G;  3VHO A;  3POE A;  1GP4 A;  4GWM A;  4FCA A;  4X8P A;  1H9W A;  1QJE A;  1XU2 A;  3WQ7 A;  1X8E A;  3E6C C;  2P17 A;  4RS5 B;  2BVB A;  3KSC A;  4LIU A;  2BJS A;  3BVC A;  1COV 1;  4YZ3 A;  5ACA 2;  1RMU 2;  2LTN A;  5EZW A;  2XL9 A;  2CAU A;  4QPI A;  1ZRE A;  1OSG A;  3AP5 A;  3RWN A;  3EO6 A;  2ENR A;  2C6S A;  4CCE A;  2JE8 A;  1XOY A;  1ND2 B;  3ACI A;  3PME A;  3L2Y A;  4FPY A;  1VR3 A;  2P5B A;  4WM8 C;  4XVH A;  3ZXG A;  1L7L A;  1J3R A;  4BB3 A;  1JOD A;  2W1S A;  3VBF B;  4QMA A;  4HK9 A;  4WM8 A;  1TMF 2;  4LXL A;  4OI1 A;  4DRR A;  4PQQ A;  4YNI A;  4DUW A;  3SKJ E;  5JZG B;  2WO2 A;  5LWB A;  4I0W B;  5A7Q A;  1AR9 2;  2EVX A;  1C8M 1;  3AMP A;  4J6G A;  2R16 A;  3LOB A;  3IKW A;  3J7H A;  3FFZ A;  1RUJ 2;  4I3G A;  1V6N A;  3KV6 A;  2XON A;  5EJZ B;  1GSL A;  4MO3 M;  5HXM A;  5T3N A;  3ZMN A;  2P1B A;  4GH4 B;  3ME2 A;  5F7U A;  1XYO A;  1SPP A;  2ZZJ A;  3SMH A;  1F8V A;  5DQ0 A;  4AI0 A;  4OVE A;  1VRH 3;  2P2K A;  2RS5 2;  1H9P A;  3FWE A;  4XJ8 A;  4AVT A;  1MZF A;  3U10 A;  3HPN A;  4IE0 A;  1MS4 A;  1GFF 2;  2PHL A;  1NCR C;  2Y0I A;  4AOC A;  4OUL A;  1ZRI A;  4Q0S A;  2ZX3 A;  5JSP A;  2AEY A;  5FXZ A;  2WFP A;  3QBQ A;  2UYA A;  2YU1 A;  3PUQ A;  4XUT A;  3O0X A;  2D6N A;  2GC1 A;  1J58 A;  3BOD A;  1UKG A;  2FDG A;  4BHP A;  1EPZ A;  3T2T A;  1RUH 2;  2DVA A;  5FZ0 A;  2MNG A;  4AEM A;  2LRP A;  2XLA A;  3SCH A;  3ZXJ A;  1R08 3;  1XNA A;  3GZU C;  2XL7 A;  2YC2 A;  3PL0 A;  3WF3 A;  1OC1 A;  2PHW A;  1OLM E;  4Q4X 1;  4GAZ A;  1OOP A;  3UV9 A;  4BZ4 A;  4R4Z A;  1FPN 1;  3VBS A;  3TYJ A;  4Q0V A;  4IEW A;  4XZU G;  2RDQ A;  4S2G A;  4PDW B;  2W68 A;  4L99 A;  3GBG A;  3VBO A;  1FOD 3;  2D3R A;  4E2G A;  1LOD A;  4GMP 3;  1NE6 A;  3K51 A;  2GN3 A;  2WDB A;  4YGD A;  1HRI 1;  1NY7 2;  2BGP A;  4YGE A;  4E9K A;  3WNO A;  2K2S A;  1IG3 A;  3GZT B;  4NHK A;  2Q8C A;  4J1W A;  5HV0 A;  1PGL 1;  1S0J A;  2JEN A;  3POI A;  4DY3 A;  1OMI A;  3FN9 A;  5CYY A;  3U1X A;  5KBF A;  2HWC 1;  2A6W A;  4KBZ A;  1CN1 A;  3FMG A;  3J26 N;  1YHF A;  1DQ1 A;  1W8O A;  4Q4Y 2;  1S0C A;  4B7E A;  1T2X A;  2BEO A;  3OUJ A;  4HMZ A;  1N1V A;  4NPR A;  5FKB A;  4FPF A;  1HN1 A;  1TEI A;  1A78 A;  4PHZ A;  3RGB A;  2RDN A;  4A7Y A;  4CDU C;  1L7Q A;  3VHP A;  3FL7 A;  4HVQ A;  1Y3T A;  3DYM A;  2GP3 A;  3MW2 A;  4D6R A;  3RPQ A;  4Y26 A;  4M4R A;  4AVV A;  4N53 B;  1JOB A;  1W8U A;  4AK3 A;  1DZR A;  3HAG A;  4LKD A;  1BYH A;  3VD7 A;  4JQR A;  1EAH 2;  1NLR A;  3T09 A;  5FOB B;  2XVK A;  3JUU A;  5L36 A;  4FBF A;  1RJ8 A;  1AL0 G;  1QMJ A;  3AXD A;  3EMR A;  1RXG A;  5H9R A;  4CXW A;  4LOR A;  4JDO A;  2RV9 A;  5FMO S;  4QGL A;  3TB0 A;  4LLF A;  1PO1 1;  3AYE A;  1W0O A;  4Q1R A;  3LFI A;  2BYV E;  3OUH A;  4Y5S A;  1AYM 3;  2WYF A;  1RGS A;  2WT1 A;  3NJZ A;  2VH9 A;  2PMW B;  4DRV A;  3WD5 A;  3KF5 A;  1HLC A;  2ZHM A;  1GP5 A;  4W6X A;  4BQ2 A;  1Y7B A;  2D98 A;  3HOB A;  4EV0 A;  3E97 A;  3HWJ A;  2UY8 A;  1CIW A;  2PEL A;  2RR1 2;  2W9X A;  5I8Y A;  2WBK A;  4XF1 A;  4AF9 A;  2GC2 A;  3H3U A;  2J1E A;  3VBH A;  5L19 A;  3T0A A;  1SFN A;  4K1Y A;  4CCL A;  1QJX 3;  4AVC A;  1C1L A;  4FPE A;  4CP0 A;  2W94 A;  1ENR A;  1HQN A;  1LKN A;  1B35 B;  1WLD A;  2WFF 1;  3ZDV A;  4WZC A;  3M3I A;  3UKT A;  2OPK A;  4XFC A;  4OHZ A;  2C0Z A;  1AYN 2;  1WLW A;  5LBF A;  1Y9M A;  5LA2 A;  2VCA A;  4LNV A;  3ES1 A;  1ZRD A;  1OA2 A;  5FYV A;  3S6P A;  2Y8K A;  3KCY A;  3ROU A;  3TRS B;  1QJU 3;  3T2P A;  3UYJ A;  3ZYG A;  4E2Q A;  5EJ1 B;  3SEP A;  2HBT A;  4YWA A;  3WG1 A;  3OBA A;  5A6Q A;  2WZE A;  4ITC A;  3U4X A;  4NAM A;  4FSJ A;  1S2B A;  5FTT C;  1LJ7 A;  2WLP A;  3DYP A;  3POY A;  1H2N A;  1HV0 A;  3T08 A;  3NJY A;  2XDV A;  1JMU B;  5DN2 A;  2CGN A;  5HPO A;  3WSO A;  1JYC A;  1S4C A;  1ZBE 3;  2D6O X;  4CU7 A;  4Y3O A;  4XFH A;  1RVF 2;  1SAC A;  4Z92 B;  2AAC A;  5CKN A;  4DOU A;  4Q29 A;  4Q4V 2;  2CL2 A;  2ZOE B;  5A7W A;  4QDS A;  4WM8 B;  4ATE A;  2DF7 A;  1OBN A;  5FPL A;  1SFY A;  4MX3 A;  2Y38 A;  3IPV A;  1ZZ6 A;  1US3 A;  5LA1 A;  4P9I A;  2ZCW A;  4BOW A;  2NM1 A;  2PQS A;  2GME A;  4MXW A;  1MS8 A;  2XLG A;  4NWV A;  4QXK A;  2PHX A;  4M0H A;  3TOJ A;  2B39 A;  4CCK A;  3AM2 A;  1JS9 A;  1CON A;  3D6E A;  3LA2 A;  5BXX A;  5EV7 A;  1BXH A;  1MAC A;  2VUL A;  1UL9 A;  1GV9 A;  2HWE 1;  2RJ2 A;  4LBQ D;  2WNO A;  4QU1 A;  2EAK A;  3ZO0 B;  3VUO A;  1SLI A;  2Y34 A;  2CDP A;  4IE4 A;  1SPP B;  5F5C A;  3CHX A;  4WVW A;  3ECQ A;  2VXR A;  2ZTN A;  2WZR 2;  3MEP A;  4QQ2 A;  4A6O A;  5A3N A;  5FY7 A;  2BTV C;  5C9A C;  5JXH A;  4FXG B;  1VE0 A;  4H14 A;  4BE3 A;  1ASJ 2;  1MQT C;  2FMD A;  2FDI A;  5C9A A;  4GAL A;  2A7A A;  3LOI A;  1UZ0 A;  1H2L A;  4NN0 A;  2VZV A;  2ZAB A;  3FC0 A;  4EJR A;  3GZA A;  1UY4 A;  2Q8D A;  1K3I A;  1MS0 A;  1W9Y A;  5FZL A;  1WW7 A;  3O0W A;  3H8O A;  4C8D A;  5IUQ A;  4KGG A;  4AED A;  4BQX A;  3WNL A;  3VBS B;  4ZU5 A;  2P34 A;  2YPJ A;  3USU A;  3LDB A;  2UWB A;  4NIG A;  1HXS 1;  3AP4 A;  4I02 A;  4MGY E;  1JHJ A;  4QX5 A;  2VXJ A;  5GZE A;  1WD3 A;  2HWD 3;  2JE9 A;  1X9T A;  1W99 A;  4X8N A;  5FXW A;  4AEK A;  4RSU A;  3THT A;  4QX1 A;  1LAJ A;  4XHX A;  5A3U A;  3OJB A;  1UMH A;  3JB8 A;  2QZ3 A;  3GXU A;  4P5H A;  1EP0 A;  1YEW A;  1A8M A;  2R32 A;  3AZX A;  2PHT A;  4KI5 M;  4A7Z A;  1GR3 A;  2DUP A;  2ZGR A;  4UF0 B;  4PI2 A;  1V9U 3;  2GAL A;  2QE3 A;  4LTA A;  1QDC A;  3GHM A;  4R9D A;  1WLC A;  5EHD A;  5FY4 A;  2W52 A;  1UF2 C;  1UZW A;  5FZK A;  1BBT 1;  2BNM A;  4BH9 A;  5FLJ A;  3R4D B;  3V0B A;  1AR7 1;  2DYC A;  1DGL A;  3CQO A;  5FYC A;  5JOY A;  2H0V A;  1S2E A;  3CBN A;  4Q0P A;  1PZ8 A;  4R9B A;  3H8X A;  2NZ9 A;  2R04 2;  4OI0 A;  4GJZ A;  4I09 A;  2ILM A;  3J8F 2;  4Q4W 1;  1W8H A;  3WF2 A;  1WGP A;  4JKM A;  2XUE A;  5F37 A;  2LW8 A;  1CQ9 A;  4LOS A;  5A7N A;  3TEZ A;  2A73 B;  2OT7 A;  1XNK A;  2VTX J;  3AKQ A;  3JCI A;  3OD4 A;  3ON7 A;  4J25 A;  3BB6 A;  3MFC A;  2VBD A;  4QQO A;  1W6Q A;  3VZM A;  2G9G A;  1J3Q A;  3S57 A;  5L73 A;  2J7M A;  5KHI A;  2Z2S B;  4BME A;  4BMB A;  2DVF A;  2YHJ A;  4D0Q A;  4KWK A;  4XUQ A;  1D7P M;  2V4A A;  4CSW A;  5FYS A;  3GF6 A;  4SLI A;  1LHU A;  3NV4 A;  3T3Y A;  4O9E A;  4TLG A;  4XF9 A;  4JDN A;  3OPZ A;  3S7I A;  2R06 1;  4UFM A;  4RGG A;  5JR2 A;  2ID4 A;  4FPK A;  3M8L A;  4X6R B;  3KCX A;  1B09 A;  4NUB A;  3AKP A;  5CG8 A;  4GWI A;  2VO5 A;  3M1H A;  5CEH A;  3LEM A;  3OUI A;  3N7M A;  3H8R A;  1XRU A;  4HVR A;  1QNW A;  2VW1 A;  4O61 A;  4A2U A;  5J48 A;  1BEV 3;  4CXX A;  1EY2 A;  4QKB A;  2WR9 A;  1WKY A;  2WYS A;  4Y1V A;  5CU1 A;  3BKZ A;  5C6C A;  4XUR A;  5FQ0 A;  2BFU L;  3TN9 3;  1CD3 G;  1JYT A;  1S2K A;  4LHS A;  1UCX A;  5L9V A;  3OEB A;  1PM4 A;  1WMX A;  3DGT A;  4W65 A;  2GNT A;  4R52 A;  4XIO A;  1DHK B;  3ZN5 A;  3CJI A;  5FZ1 A;  3OB8 A;  2G19 A;  4AHX A;  3BI3 A;  1W05 A;  1PK6 A;  5DDJ 3;  3IM0 A;  3AZY A;  4Z82 A;  1EV1 3;  1COV 2;  1OF4 A;  5D1I A;  2G9F A;  5JIU A;  1O6U A;  1Z7S 3;  2JG9 A;  1K5M A;  1N1Y A;  2JB4 A;  3DUI A;  1IPJ A;  4ERO A;  3PNA A;  4CUA A;  4P5Y A;  4RL7 A;  3FBM A;  1W90 A;  1LHN A;  3D4K A;  5A6Y A;  5IK5 A;  2UWC A;  4ZKT B;  4FXK B;  3T2Q A;  5A7W B;  3WDU A;  1AL2 3;  2WII B;  2ZMN A;  3K75 B;  1Q8V A;  2GAU A;  5IJR A;  3WLU A;  4JGY A;  4AGG A;  4C0H A;  1HB2 A;  2WJS A;  1H1A A;  2YC0 A;  3IPV B;  1LOG A;  3AMH A;  3PTR B;  3ZLI A;  4Z07 A;  4K20 A;  5EPA A;  2QQL A;  2JD9 A;  2RDR A;  1F31 A;  2VMH A;  3POS A;  4MXW B;  5FZB A;  3ZFF C;  4HT1 T;  1C8M 2;  4RHV 3;  1S0F A;  4K21 A;  5K0U A;  4BLI A;  5LBB A;  1X82 A;  1YFW A;  4JDM A;  1ZRF A;  5IVV A;  5FK7 A;  3ZFF A;  5GM0 A;  4HK8 A;  1DBN A;  3VDD A;  4IXL A;  4CUB A;  3ZKU A;  5FZH A;  1RL3 A;  1SMV A;  2XG3 A;  4EN8 B;  4ZON A;  1LU2 A;  3NRU A;  4GUL A;  3VDA A;  4B1M A;  1UO9 A;  3LCP A;  2VUJ A; 
#chains in the Genus database with same CATH homology
 3O1R A;  2FDF A;  4RFR B;  3O1V A;  4CXY A;  3RZH A;  3H8X A;  4IE6 A;  4OCT A;  3O1U A;  5F8P A;  3RZM A;  2FDJ A;  4IE7 A;  3RZJ A;  3S57 A;  4NPL A;  4IE0 A;  4QKD A;  3KHB A;  2FDK A;  3KHC A;  4QKN A;  4IE5 A;  4ZS2 A;  3T3Y A;  3O1M A;  2FDG A;  3RZK A;  4NIH A;  3BTZ A;  3BU0 A;  4JHT A;  3O1S A;  3RZL A;  3O1O A;  3BTX A;  4QHO A;  3H8R A;  3BTY A;  4O61 A;  4ZS3 A;  4CXX A;  3I49 A;  3I3M A;  4QKB A;  4ZHN A;  3BKZ A;  4MGT A;  5DAB A;  4NRM A;  3T4H B;  4IE4 A;  4NRO A;  3BI3 A;  3BIE A;  2FD8 A;  3LFM A;  2IUW A;  2FDI A;  4O7X A;  3H8O A;  3RZG A;  4NJ4 A;  3O1P A;  2FDH A;  4NIG A;  4NID A;  3BUC A;  3I2O A;  3T4V A;  4IDZ A;  4CXW A;  3I3Q A;  4QKF A;  4MG2 A;  4NII A;  3S5A A;  3O1T A;  4NRQ A;  4NPM A;  4NRP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...