3O1OA

Iron-catalyzed oxidation intermediates captured in a dna repair dioxygenase
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
201
structure length
201
Chain Sequence
b'PLAAGAVILRRFAFNAAEQLIRDINDVASQSPFRQMVTPGGYTMSVAMTNCGHLGWTTHRQGYLYSPIDPQTNKPWPAMPQSFHNLCQRAATAAGYPDFQPDACLINRYAPGAKLCLHQDKDEPDLRAPIVSVSLGLPAIFQFGGLKRNDPLKRLLLEHGDVVVWGGESRLFYHGIQPLKAGFHPLTIDCRYNLTFRQAGK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alpha-ketoglutarate-dependent dioxygenase AlkB
publication title Iron-catalysed oxidation intermediates captured in a DNA repair dioxygenase
pubmed rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 47
structure length 201
sequence length 201
ec nomenclature ec 1.14.11.33: DNA oxidative demethylase.
pdb deposition date 2010-07-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.590 Mainly Beta Sandwich Jelly Rolls Alpha-ketoglutarate-dependent dioxygenase AlkB-like 3o1oA00
3S57A 3T4HB 4MGTA 3BTYA 4RFRB 4O7XA 4NROA 5F8PA 3KHBA 3RZKA 4QKFA 4NRMA 4NJ4A 3O1OA 3O1MA 4QKBA 5DABA 2FDIA 4ZS2A 2IUWA 3I3QA 3KHCA 4NIDA 3I2OA 4IE7A 3RZGA 3S5AA 3RZJA 4O61A 4MG2A 4ZS3A 3BUCA 3H8OA 4OCTA 4NIHA 3T4VA 3BKZA 4NPMA 2FDKA 4IE6A 3H8RA 3O1VA 3LFMA 4NIGA 3O1PA 4CXWA 3BIEA 4CXYA 3I3MA 4QKNA 4IE0A 2FDJA 4NPLA 3O1TA 2FDGA 3BU0A 4NRQA 3BTZA 3T3YA 3O1SA 4QHOA 3O1RA 4IDZA 2FDHA 3BI3A 3RZHA 4IE4A 3BTXA 3I49A 3O1UA 4JHTA 2FDFA 4NRPA 3RZLA 4QKDA 3H8XA 4NIIA 2FD8A 4IE5A 4CXXA 3RZMA 4ZHNA
chains in the Genus database with same CATH superfamily
1WW5A 4DZGA 2BEOA 4YW3A 5C4WB 3LWCA 4PT6A 5L7OC 1RVF2 2XKPA 1F4HA 4Y26A 3P3NA 5FZKA 1R081 2OVUA 1ULCA 3NJZA 2A75A 4MO3M 4Q1RA 5GZDA 3BOPA 4BH9A 1LHOA 1RL3A 1Y9MA 5C9AA 2YPJA 5B4XA 2QQUA 1SFYA 3MIEA 3CMGA 1CESA 2JDAA 1RUI3 2Y6HA 4YZ5A 2Y6FA 2ZGTA 4YW1A 5CAZA 3IZOA 2GAUA 2V4VA 4H7LA 2WNUA 3VD5A 1C5IA 2Z69A 3I54A 3L2YA 1ZA7A 1NYWA 5J36A 5JOYA 4ASKA 5IVVA 1CIYA 5BNOC 1S2EA 2AEYA 4ORFA 2OUJA 4R9CA 1FYUA 5F2SA 3RWNA 3SNMA 2D5FA 3ZOIA 2BOJA 4BQ3A 5ISLA 2W92A 3C7HA 4QQHA 4CCNA 1OURA 2FQPA 2RJKA 3EQEA 4H55A 1Q56A 2EF6A 3D5OA 2YROA 3PUAA 4M4PA 1OFSA 5FZ7A 2OA2A 2E51A 2O1QA 2PA7A 3R4SA 4IL7A 2NM1A 4E8DA 2RS33 2JX9A 4YNIA 5IVCA 4WZFA 2VECA 5FXZA 1HJGA 2ZTNA 1VBD2 1RYYA 3NAPB 5CG8A 3CDZB 4LTAA 2B5HA 1S0CA 4NE9A 3POBA 3U0ZA 1OLMA 4AGGA 5HBAA 3GALA 3MUY1 3LDKA 3MPBA 4A7KA 1YQ2A 2XBO1 1HN0A 2JE9A 5FBJA 3IB3A 5JZGB 1RUD1 1ND3C 2DVAA 1JZ7A 2O8OA 2XOMA 3ON7A 1AX0A 1W0PA 4IV1B 4TN7A 5F37A 2NZ9A 3ZSKA 2A6WA 2D44A 3SMHA 1OD3A 3CEWA 4YWAA 4IE0A 4M0NA 4YRDA 4MH0E 5EPAA 4E8CA 3ZFGC 1OA4A 1AR83 3VBUC 3CHXA 1B35A 1C8M1 4ASLA 1TQ5A 1DHKB 1G8WA 5FLHA 3IN9A 2HWE1 2YC0A 4EWDA 4I0WB 1RUD2 5FZAA 2CWMA 3MHZA 3QACA 2YB7A 2ZGLA 4DXRA 4M3CF 5ERLA 1A3KA 2GH8A 3SKVA 4LE3A 2GC1A 3RVHA 5FMCA 4ATFA 1NLQA 2W39A 1IGOA 1IOAA 4WV8A 2VZUA 2AH2A 3H7YA 3A21A 5F6LB 3OUJA 3JXSA 4V2VA 1YIFA 4BJ0A 4BQ1A 3ZKYA 1SBDA 2ZGSA 3IAPA 3ST7A 1ZREA 2YZ4A 1AL21 2X5IC 4JKMA 1C8M2 4BXFA 3J7NA 4XF0A 4XJ8A 2HWE2 1GNZA 3VV1A 5JR2A 4PDWA 5CNAA 2ZX4A 4ZPIA 5EJZB 1AUYA 3VN4A 3IWZA 2HWB3 3AXEA 4RN5A 1CX1A 1WBFA 1PM7A 3HBKA 5FWJA 2P5BA 1QQP1 3E6CC 2VOKA 3QLQA 3VL8A 3FMGA 4D8MA 2QQPA 2EAAA 5FXXA 3T0BA 1GZWA 4OQ8A 1GOGA 3M1HA 4AWDA 4FBFA 1RC6A 4LQRA 1ZM1A 4LOTA 4XW3A 4GWJA 3CJIA 3PTRB 5JLVA 4Q4X1 1CR7A 4DXTA 2AYHA 2C26A 4C1XA 2IC1A 4K3UA 2VQ0A 1OQ1A 4DS0A 3LKJA 3Q8BA 5BYNA 4HK8A 4QKFA 5CG9A 3E1F1 1DZQA 1UU6A 1BEV1 1RJ7A 3MIFA 3D6EA 5AFBA 1QQP2 1WW7A 2P4EA 2VZRA 1SQ4A 2A1XA 2K0GA 3U11A 3I8TA 4ES8A 4FPOB 3WP6A 1UYZA 3MF9A 5FP8A 5H9RA 1XSRA 2VOVA 4QQLA 2DF7A 5CZKA 3H8UA 3PU3A 4CUBA 3I3QA 4Q4X2 3FLRA 1R093 2LM3A 3TEWA 4CE8A 5JPNB 1CAXB 5JR7B 3WW3A 2EIBA 4XQ4A 5JUVA 3OGJA 2A3YA 1BEV2 4Y1VA 3T1LA 3WVJA 3RZGA 3VD3A 3FUOA 1UOFA 2QTWB 2RJLA 1GU3A 4JGYB 4UFMA 3VBHC 4URTA 5F3CA 4PI2A 4CZSA 2YFZA 1G9BA 3MF6A 1AYM1 2KD7A 3VBSA 5KHHA 2I2SA 4URAA 3RNSA 3U10A 5FP4A 1GQGA 3ELNA 1Q8SA 3TBDA 2D6LX 3WNPA 3ZXGA 4CDXA 3VD9A 1XC6A 1OOPB 5FZIA 3DUIA 1BBT1 3ZMNA 3GDBA 1UZWA 1VAKA 5EP9A 1C28A 1QJZA 2A3WA 2D5HA 3AP4A 5C7GA 1WLCA 2NLRA 1KS5A 3I97A 3M7AA 3OBZA 2JIJA 4N43B 4AFMA 4XXAA 1RVF3 4CP9A 2DURA 1XJAA 4HONA 5FY1A 2WZPP 1I5PA 1HB1A 1AYM2 3ABZA 3JCIA 4QQPA 4AAPA 4E4SA 5I0SA 4NPRA 3UV9A 5E6HA 1Z0HA 4TLFA 4YVWB 3TAYA 1VBE3 1J3QA 1JZ3A 2PXJA 1BBT2 3IIAA 3M3QA 4MZUA 5JDBA 2IXIA 2A7AA 3JB8A 3ZXFA 2ZX0A 1KDKA 3WDWA 4AEJA 3W5NA 2WR9A 1VMFA 3V0AB 1OH4A 1OI6A 5JVVA 5KC6A 4XC9A 4LXLA 4F83A 1OLQA 2CTVA 1V6OA 1W6NA 1R083 5CBLA 3WNLA 4F7ZA 3O1RA 2FDHA 1UZVA 3WG2A 4EZ4A 5G05L 1SG3A 2W1SA 3OPZA 5BNQA 2CGNA 2GMMA 4XVHA 3VZLA 2W94A 1U5XA 3MLLA 3WT3A 1REEA 2XUMA 3AB0A 3ZN6B 1STMA 1XNTA 1S0IA 3AKSA 3HIFA 1PZ7A 4QQOA 4YW5A 3VBOB 1OLRA 4XAEA 1YQ6A 4LE4A 5GZGA 4XJ9A 4QGMA 1LNSA 3QH7A 3WV6A 2VO5A 2RG4A 5CFDC 1GV9A 1H4HA 4LBQA 1W6MB 5D8AB 2Y6JA 1TNRA 4DB5A 2ORZA 3HPNA 5I0RA 3PUIA 3ZFFA 4UXAA 4CUAA 3WNMA 4UAPA 2N7GA 5C4WA 3T4HB 4DFSA 2VCMA 1PGW1 2VMHA 4RL7A 5LA2A 4EQVA 5FDBA 2EXJA 3ZIXA 3WNXA 4MV2A 2RMU1 3H0OA 5F8PA 2VZ3A 4YW7A 1KQRA 3SHRA 5DAQA 4HKLA 4YM1A 1T6BX 3UJQA 3NO8A 2VBBA 4NJ4A 4FOVA 4HLTA 1YNAA 3THPA 3WNKA 4NAMA 4XCAA 2EIGA 2H6CA 3GGLA 2VNGA 4CEWB 3FHIB 2HBUA 2VW1A 5FO7B 2ZZQA 4HVQA 5J1XA 4CDQA 3IKWA 4LO6B 2XBO3 5HXVA 1RUD3 4ZU5A 3OTFA 1PMJX 4HSJA 4EE2A 4ZZ5A 1LU1A 1NCQB 5IW0A 4FT8A 4BISA 5IYYA 1C1FA 1W8OA 2YBSA 3AP7A 1JXNA 5A3TA 2JDUA 2ZXQA 4QX0A 3LOBA 1KJRA 2AREA 3VZJA 1SDDB 1NZCA 4YVSA 4OHVA 4GIQA 2HWE3 1QJX3 4GAZA 4LK6A 5FY5A 3THDA 3ORJA 3WX5A 2DU0A 2CSGA 2QFEA 4BIFA 1E5IA 1GP4A 4LKDA 1EAH1 3TN93 1PGL1 3AXDA 4LK7A 2UWBA 3NAPA 3TOJA 4I3PA 1DGRA 3GJBA 1LHUA 4CDWB 1IPJA 1DF0A 3RWKX 1UNBA 2VJXA 2HBTA 1TNFA 1HW5A 1AL23 4ARYA 5JZGA 4R4ZA 1QHDA 5K8SA 3WW4A 1GOHA 5C8WA 3GCWA 1FNZA 1C8NA 4CP2A 1SBEA 1VBA1 2OQ7A 1PGL2 1BXHA 2R30A 1PMIA 4FXKB 4DO0A 3VZNA 4AHZA 2DCKA 5FMOL 3AP9A 4AFDA 4D7YA 4P00B 4FPGA 1QQP3 1Y9QA 2HWC1 2VM9A 5JI9A 4K21A 3BU0A 2VTXJ 3EBRA 1ASJ3 3CJXA 2B39A 1LESA 5SV5A 1IS5A 3IM0A 1H8VA 4OULA 4BQXA 5CISA 1Y3TA 4FSJA 2ES3A 4DUVA 1NE6A 4YGBA 4XF1A 2Q8DA 4Q4X3 4W6YA 2PQQA 4BHPA 1VBA2 1WGPA 2B9VA 3ME2A 1W2AX 1GICA 1BEV3 3GZTB 1U0AA 1J84A 3CKHA 1E5SA 2UY9A 1O3QA 2C4XA 3AFGA 4JHTA 4UFKA 5T5OA 1A8DA 4AEDA 1EYBA 5I8TA 4DXZA 2Z4FA 4XFCA 2P34A 1ULFA 3FLTA 1OHFA 1GOFA 3N9OA 1QMJA 2EIEA 5DAWA 2F17A 3VBRA 1MS0A 1MZ5A 5K7PA 1REDA 3LSEA 3S57A 4DIQA 1AR71 1H8TA 5K9YA 5FZBA 4UFLA 1AZDA 2HEYF 5FXWA 3UGGA 1PZ8A 3N4MA 1GMMA 5T55A 4XE9A 3VKLA 1AYM3 2R071 2D93A 2A6YA 2XXZA 3VHOA 1Y43B 1COV3 3NV3A 1NAEA 1MS3A 1QDOA 3AK0A 4NWWA 1BBT3 1XXNA 1JUIA 3TB0A 1RITA 2ADDA 4HKOA 5A6YA 4DQAA 1G9DA 1AR72 3K4DA 4IEZA 2RS11 1SDWA 3M3CA 3VDDC 4Y22A 1UY3A 4QXHA 5GZEA 4Q5OA 1LHVA 4PLMA 3LD8A 2R072 2GNTA 4CEYB 3M3IA 1KJLA 3B7MA 1PHMA 1YRZA 3I2OA 3J7MA 3PJQA 4NHKA 4CYDA 2FMDA 1JZ8A 2I74A 2R16A 1GANA 1AR61 3EJKA 4Q0SA 3BIWE 5F6KA 2LS6A 5FY0A 4DMIA 2VUAA 1ZBE1 2P3JA 1V9U1 2VBPA 4GKXA 4JTOA 3QOPA 1XYOA 4RGKA 1DZTA 4DY5A 3DYMA 3W58A 1GWMA 4LO8A 1UMZA 2YBKA 4LULA 2OX0A 4LHSA 3THTA 5C9AB 4Y1XA 2EALA 5IVEA 2A6XA 4EN9B 1ND2B 1OOPA 2PTMA 3LSDA 2YU2A 4JGZA 3S7IA 3DXTA 1WCSA 2V5YA 3D3AA 4QPWA 5J7MA 2WNUB 3GZEA 3MFCA 3HVDA 3WP3A 4A41A 1E57A 5FPUA 2Z79A 2ZGKA 1ZBE2 1XNBA 5JOWA 3DGTA 3KVBA 1KD7A 2BV4A 4RR3C 1VR3A 1CJDA 3ZSLA 3TYJA 3WNOA 3I3MA 1NA1A 4D6SA 2PAKA 4YVWA 3W5MA 2JKBA 2G4IA 4Q4W2 3PVBB 4EZHA 2MPFA 2GMEA 1DQ4A 4QDQA 3H42B 1XE8A 1W6OB 1T6GC 2JG9B 1OKQA 4E4ZA 1ZNPA 3V0AA 2ZGRA 4QU2A 2R1DA 2XWJB 4J1XA 2O14A 3KGLA 3N7MA 1XNAA 4MGYE 4XJUA 1W8WA 2D3PA 3K75B 1VALA 1HIXA 3AMPA 5F5IA 5IUQA 5CADA 5F1RA 2RV9A 2RDQA 5DAXA 1MZEA 5D21A 1VPHA 2RMU3 4IDZA 1GQPA 4OZXA 3MYXA 2UURA 4FTBA 1SFPA 3NJXA 4OI1A 4RHV1 2DVFA 4XUOA 5A6QA 3ZYPA 1HKDA 1S0BA 2PQSA 3E6BA 5B4NA 3WP5A 1ENQA 1YEWA 3EYPA 4ZXEA 2YHJA 3B93A 2DCZA 1QEXA 3DV8A 4OZOA 2A3XA 1PX4A 5C71A 2FD8A 2BTVC 3MZHA 2AACA 5D8AA 4H7MA 1R1A1 1UY4A 4IE5A 5FUNA 1BYHA 2C9AA 2AEZA 3U37A 3ZPYA 4FOQA 4JKLA 3HEIA 1OMIA 1U5IA 4RHV2 2XJSA 1MPXA 1WUVA 4GQ7A 4MGTA 1RUH1 2WUHA 2FHRA 3DXUA 4P9YA 5LW9A 3H7JA 4MGZE 4E2GA 3DCQA 4RSUA 3IMMA 5FP3A 1Q3EA 2B8MA 2BUKA 3MFAA 2BQPA 1VBB1 2XHNA 3NJVA 5FYVA 4COVA 3OY8A 2VOTA 3BYWA 5IFPA 1ZZ6A 5KC5A 4R9BA 5J48A 3WDUA 1EAH3 5LRSA 2WC2A 4NN0A 2ZEWA 1L7QA 3D8CA 4PDWB 1XU1A 1X8EA 1V6IA 1X9TA 2IXCA 3DYPA 3OD4A 3POYA 2GMPA 2ZAHA 2NYYA 2Y8KA 1K5MA 1RUH2 1ENRA 3U14A 1F5JA 2DBNA 3T09A 4OYUA 4QM8A 2R49A 1GWKA 4QHBA 4YG0A 3H3UA 5A7WB 1H2MA 3A7QA 5K0UC 3ZM8A 1GZWB 5BUVA 4FPKA 3U07A 1IG3A 1VBA3 2JG8C 4QPGA 4CDXC 2V73A 3POIA 1PO23 5I0DA 5JOXA 3RZJA 5GM0A 4XJWA 3CJIB 3V0BA 3NMBA 4YW2A 5CIRA 2G9GA 3Q8CA 4ZS3A 1W9FA 5DAVA 2HWC3 5L9VA 3ZYIB 2EVXA 1H6YA 4META 2PHTA 2QQMA 3H9AA 4P14A 5FZDA 2AENA 3G6JB 2DYCA 3AKRA 3FFQA 5FKBA 3RMYA 3VB9A 1DU3D 4MHRA 5JMCA 4B4PA 3KCYA 1BJQA 3MV01 4QAWA 2Z42A 5BNNA 3KV6A 4CDWA 5JWPA 2PLV1 1L7LA 3OBRA 1KEXA 5LEJA 1MEC1 2W0XA 4Z07A 3LF7A 1TVGA 1YHFA 1SEFA 3D0SA 3USSA 4FOWA 3USUB 4G4FA 5FZHA 2AGSA 1UY2A 2I45A 2RS51 3U1XA 4XXPA 5FV3A 2D3SA 1CWPA 4TXWA 1TME1 3NNGA 4BQ5A 3K46A 1XE0A 5BXXA 5LCWL 2PLV2 2XR4A 5CVRA 1AR73 3FLPA 3J4UH 3VZKA 2C24A 4L2NA 5DZEA 2VXJA 5A7OA 5FY4A 1JZ4A 1WD4A 1BZWA 4HOOA 3ILFA 4BPZA 1YYNA 2ARCA 1PK6A 4JX0A 2ZHKA 4Y5Z0 2R061 4CP9B 2RS52 2WABA 4N53C 1QXJA 4QD2A 4LIVA 5I93A 1QJY1 3O7OA 1TME2 1PIV1 4FPEA 4EWEA 1R091 1YFUA 1A6CA 3ACHA 4KWJA 4HN0A 3ACGA 3P6BA 4Q4V3 1IS4A 3PURA 5K4LA 3UT0A 3MDPA 1UY1A 5J96B 2EA7A 5C4WC 2WIIB 1QWRA 1HRI3 3ILRA 2RS13 4NHLA 4UFJA 4XILA 1F9KA 3AYEA 1GUIA 5EHDA 5FZ3A 4S2FA 3NSTA 2XJPA 2IXKA 3KCXA 1YFYA 1NZIA 2D40A 2VG9A 4UW4A 2XUEA 3OOXA 2ET7A 2R062 2XVGA 5FY7A 1GLHA 2A6VA 2IVJA 5FCCA 3OGVA 1GP5A 1QJY2 2WNVB 2PAEA 5C6CA 2ZEXA 5H9SA 1R092 3NV2A 4MLOA 1AR63 1HV0A 1UYYA 5E88A 4BE3A 1V9U3 4BK5A 3MUZ1 4QPIA 5F5QA 3FX3A 5EJ1B 3IDCB 3VBFB 4CVUA 5A3WA 1TMF1 2VCAA 5HCFA 3LZZA 2P3IA 2BPA2 3T0AA 1AX2A 3KB5A 3WW2A 1ZA4A 2BGOA 2WA3A 4YFWA 4A4AA 4I0AA 2JDPA 4QKBA 2E7QA 4J1WA 4X8NA 5JMOA 2Y38A 1JUHA 5DUVA 5FWEA 4LBQB 4DUXA 2OPWA 3PUQA 5FZFA 3ZIWA 4IETA 1XNDA 4JVAA 5LB6A 1QY4A 1YLLA 4WM8A 4ZS2A 4L99A 3UK9A 1DLLA 1VB2A 4ZU7A 2E9QA 4EN6B 2BFUS 4CEYA 3NJYA 4NIDA 4PLNA 1TMF2 1IHMA 3N3HA 4GZ9A 5DN2A 1LOAA 3OGRA 2W3JA 4D6RA 4IE7A 4MGIE 3O0VA 3M3OA 2ZX3A 4PLOA 2LUWA 2NPIA 4NOTA 1EY2A 4OHWA 3GBWA 4AG4A 3NAPC 2JKXA 1QXRA 1VBE2 2RVAA 4OFGA 2XMLA 1AX1A 2PFWA 2XJUA 4GJZA 4A6SA 2WS91 1Z7S1 2CYFA 3H1YA 1GZTA 2I07B 2WA4A 2ZHMA 5KHGA 2JWPA 4JAAA 3TWIA 4KWUA 5JZGC 1BQPA 1ND2A 4KNCA 2Y0IA 1S0JA 4IV1C 3I2KA 2EIDA 5KBFA 2VMFA 2E26A 2EXIA 4EROA 2WZR1 1IQAA 4GWMA 1J3PA 2XQXA 3OPWA 4YGEA 4YPJA 1LULA 1QDCA 1R082 3JBG3 3R0RA 3S6PA 5AFEA 2JXAA 4RHV3 3O1VA 4Y1UA 3TEXA 1Y4WA 2AR6A 3WDVA 4A6OA 4LORA 3KS7A 2WS92 1Z7S2 2ZX2A 5LBEA 2AC1A 1R64A 2VZ1A 1DQ5A 4CU9A 2BYVE 4Q27A 5A7PA 3ROUA 1EUTA 1UD1A 1R1A3 4QT6A 4YVSB 3ENRA 2E32A 3ALQA 2JENA 1L7RA 5FYSA 1F2NA 2WJSA 1W6OA 4UYBA 2WZR2 3RI8A 1NUKA 4K9SA 2JG9A 4Y1YA 3S7EA 4XOGA 4FPCA 3T08A 3WF1A 3I2IA 1PM4A 3HQRA 4QQ2A 3LDRA 4MVTA 1RUH3 4B7EA 2W68A 2BP6A 1SHWB 3B69A 5BY5A 4DXSA 1S0EA 1UOJA 3W21A 1OVPA 2EXHA 5FZOA 4QX8A 1OQDA 1VBB3 4JKKA 3NNMA 2LRPA 3I2DA 3N7LA 3FJSA 3VKNA 3NKGA 2HH9A 3LA2A 4AFCA 4S2HA 3N35A 2QBXA 1I6XA 2VL4A 3WQ1A 1DFQA 3J7LA 1XOYA 5IK8A 4QM9A 3WG1A 3V64A 4HPKA 5AVPA 1C1LA 1UWWA 3FZ3A 1TEIA 4PJYA 3R4DB 4NMIA 3WR0A 3HNBM 3O0XA 3N9LA 3ZLIA 1V70A 3HMYA 4WVZA 5T50A 1QJX1 2VAUA 3GYDA 1RJ8A 2XBO2 1RUOA 4OLLA 4K6BA 4ZHNA 2QZ3A 1A78A 3TN91 5A3PA 1NOVA 4CDUA 4OQ9A 1OFNA 4XFIA 4RFRB 4BDVB 1LOGA 2P6HA 4NROA 1OXCA 3B5LB 1CAUA 4XABA 3A0NA 3I59B 4AHXA 2SLIA 3WF2A 3ZXLA 4AQTA 3RZKA 2CU5A 1UX6A 4OVEA 3KD4A 1PVC1 3HNMA 3P3PA 4CPBD 4AAXA 2QE3A 5C8CC 4AEDB 1QJX2 1S1AA 5T5JA 5FJKA 2BERA 3V56A 5A3LA 4TZDA 1HRV3 4AZZA 1ST8A 2D97A 2P2KA 3TN92 4Y24A 1LGCA 3WF0A 1W99A 4JDOA 4KWKA 4JGYC 4PBOA 2PLV3 3PDQA 4C1WA 2HLEA 4XIOA 5A7WA 1CONA 1AXYA 1OPOA 1MEC3 3VBRB 3IMNA 1LODA 3ATGA 3C3VA 1ASJ1 4D7TA 1O3SA 5LRRA 1H4GA 1H8TB 1AL22 1PVC2 1CAVB 4BQ2A 4LR4A 2RS53 2PHLA 1OOPC 5FYBA 1YC61 1TME3 2FCVA 2W9XA 3AVSA 5FOBB 4HFSA 2VMGA 3GHNA 4XAAA 1F4AA 1DGLA 4FTEA 1AJKA 3TNQA 3R4UA 3H8OA 1W8UA 4Y5SA 5LZ6A 4KG0A 4N43C 2QJVA 2QKDA 2EAKA 4D0QA 4G9SB 2QQJA 1ASJ2 3JD71 1OA2A 1GBGA 4FQZA 4FPLA 1BVVA 4SLIA 1W0OA 2R063 5FZCA 1VE0A 4Y22B 4E9KA 1QJY3 1ZYBA 4GH4A 4YW4A 1PIV3 3P1IA 5A32B 1H0BA 2H0BA 4QB6A 2WZ8A 1WMDA 1UZYA 2PAMA 2V5DA 2XDVA 4IV3A 5FQ0A 3Q9OA 4IEPA 1ENXA 4NIGA 4RGAA 2DCYA 3SEEA 3BIEA 1RUC1 4ISQA 4CXYA 3USUA 1DYPA 3B00A 1JW6A 1WW4A 4K7JA 4CDQB 2E6VA 3JD72 2FDJA 1VP6A 3H50A 1ZRIA 1ULDA 1UOBA 1LOFA 4TWTA 1V00A 3S5QA 2WN3A 4CCMA 1CZSA 1Q8PA 2HWD1 1U5YA 1COV1 1MS1A 3WHUA 2VCCA 2W52A 5T54A 4QDRA 2CGPA 1SBFA 1JYTA 1WMXA 4JGZB 2ZHLA 4FP3A 3ZFEA 1W2OA 5EIYB 3VBOC 4GB31 4PI0A 1DQ1A 1RUNA 4RS5B 1RUC2 3PUHA 2FMYA 1V6MA 4DNYA 3ZXDA 1E5RA 2ZX1A 4LOSA 1ZVFA 4EJRA 1TMF3 4MGQA 1LEMA 5D8AC 1APNA 1LRHA 2VY0A 4KGGA 3OSDA 4PF5A 1NA1B 4Y5TA 3X29B 4V2WA 1ACCA 5FUIA 3IDBB 1A8MA 1UMIA 2CV6A 3IT8A 1COV2 3PNAA 4B1LA 4B8EA 2FDFA 1W06A 1ODNA 4TYSA 1JS9A 4XTPA 3VDAA 4CUGA 1FMD1 1N1VA 2DVGA 1YO8A 2ATFA 2E31A 4GB32 1LB2A 1HX6A 1DP0A 2IXHA 5JAXA 1W8FA 3SISA 3WG3A 1BMV1 1AVBA 2UWCA 1Q8OA 2FZ1A 2WNVA 1UZ0A 3VZOA 5JSRA 4IXLA 4CEWC 1ZZCA 5L36A 2JDMA 4LKEA 1FXZA 4MUVA 4AXOA 2WS93 1Z7S3 4O65A 1WBLA 2HYKA 3HR9A 3VBFA 2JECA 2GDFA 2LALA 2FCUA 5JXJA 1C3HA 5AVAA 4A7YA 5KHKA 4AL9A 3AZYA 1UF2C 1BMV2 2WN2A 1H1MA 2X10A 3JZVA 1NCQC 2HEWF 2WZR3 1WD3A 2LROA 3ITQA 3LQCA 4NHXA 4D94A 2VNVA 1LCLA 2XJRA 3EB7A 4RGGA 2VQAA 2F4PA 4XCBA 5A70A 4P02B 1RUG1 3GXUA 4HBNA 1E5HA 2D6OX 4CTEA 4AI1A 2Q4SA 2ZGPA 2O0OA 3HWJA 1SLIA 2WINB 3MO4A 4XTMA 5FK7A 5IK7A 4LT5A 4XQWA 2ZEYA 3HN1A 5LA1A 1W2NA 2O8QA 4Q4Y1 3I3BA 3WG4A 2R041 1DG6A 2HEVF 3OY8B 2Y60A 5FPBA 4MYEA 4CDWC 1Y9GA 1JOJA 2VULA 2WSUA 3B3QE 2ORXA 4ONUA 4WM7A 4W4ZA 4IEQA 3PIGA 1O4YA 4OCTA 1MS4A 1FOD1 1JMUB 1O5UA 2F4LA 3BTAA 4WZCA 2F6BA 4CRQA 3DECA 4LA2A 2VBDA 1K5MB 1PGW2 4XHBA 3NRUA 3ETQA 1XU2A 3LB9A 4UT5A 3KSCA 2RMU2 3JB4C 2D3RA 5HCHA 3OYWA 4RQPC 1UU5A 2D6MA 4CU8A 3MIGA 1US2A 3VLBB 4XBQA 1NCRB 2D98A 2E7AA 2WZEA 3DPRA 4QPGB 4Q8KA 4Z2WA 2ZPXA 5FLIA 5FXVA 3T30A 1DGWX 2K46A 3V0BB 5A1LA 1FOD2 2VE1A 1P8JA 2CDOA 3FFZA 4L9BA 5F39A 4ZY9A 3BODA 1FPN1 2D6NA 4YZ4A 4MGKE 4LKSA 2G9ZA 2Y33A 3POGA 1QNWA 3OUIA 4AHWA 1ENSA 5FO8B 3AKTA 2OYZA 3PTYA 1DGWA 1PO11 5JCTA 1UO9A 2GALA 1QGLA 2ARXA 1ZZ9A 3UJOA 5BNNB 5DMYA 3TEZA 4CCCA 4AGVA 1UW8A 3SXWA 5IK4A 2EICA 2VZVA 1N3OA 5C3SA 4QX1A 1FPN2 1PVC3 2XJVA 2BBAA 3LPGA 3ZYRA 1GFF2 1RHI1 3CBNA 5J09A 2W1QA 2DWRA 4L92A 4MXVA 3IDEA 4GJYA 1EAH2 3DL3A 4U36A 5EQUA 1PO21 1CD3G 1RUJ1 1PO12 1SMVA 5FREA 3Q8AA 1IS6A 2R1BA 3WDTA 3ZSJA 2R0HA 4EWAA 3BCWA 2ZOEB 3HOBA 3U4SA 4IEYA 4DRVA 5F5AA 2PHWA 1YXWA 1KITA 1HXS1 3H1MA 2ZGOA 3WOGA 1RHI2 5LBCA 3IPVB 2IWGB 1B09A 1X33A 5A33A 3BTYA 1PK6B 4FVVA 2TEPA 3VKMA 4XDQA 3BPSA 1VRBA 1PO22 1D7PM 3I2HA 3I59A 5EV7A 1WCUA 4XF9A 2XWBB 2GN7A 1W6QA 2HWC2 2YGMA 5FZ9A 3S0MA 1DLCA 1JODA 3JD73 4CEYC 4I09A 3IAQA 1MQTB 4BK4A 1UX7A 4P5YA 3O12A 3B9CA 4XBLA 2G9FA 2DCJA 2XLGA 5HV0A 4A2UA 4LO7A 3T1MA 1PZ9A 3AZWA 2GH2A 4WVVA 3TNPB 3W9AA 3THCA 3CZJA 3NKTA 2J7MA 2VGDA 1RUC3 4Q0QA 5FZ1A 5C9AC 1ODMA 3GJAA 3LPFA 1JHNA 3VL9A 4XDOA 3ASIA 1CAVA 3TRSB 3FE5A 1ND2C 2VQUA 2P17A 4QPIB 3IBMA 3RDIA 4AEKA 1SZBA 3JUUA 4L97A 2J42A 3T2QA 2LTNA 2BDRA 2WNUC 4HSLA 3O0WA 1J83A 3BUCA 2HWD3 2WWSA 3ES1A 1AYN1 2R6QA 4AYUA 2RDRA 2BJSA 3RRDA 5FYIA 4Q4V1 1ND3A 1YJKA 4GB33 4XDPA 3SQOA 4NIHA 3WF3A 4AE2A 5FMBA 1HRI1 1DQ0A 4HG6B 2BNOA 4WM8B 3KT1A 1UQXA 3ZFGA 4AVCA 1AF9A 1HQNA 5A32A 1SPPA 3VBUA 2A73B 5IVYA 4CSWA 5I0UA 4PHZA 3WF4A 3OF1A 2JG9C 3G7DA 5F3EA 2UYAA 4LLOA 3UKTA 3WHTA 4WVWA 1AYN2 4JV4A 1FMD3 2VZOA 4Z8BA 2WQZC 4Q4V2 4BQYA 3KZ4C 5A80A 1OD5A 3IDAA 4XFGA 5IFTA 4LBQD 1JYXA 2BVBA 1K42A 1QNYA 1HRI2 3L2HA 5SV8A 2RS12 1K5JA 4IESA 1HQLA 1SLTA 4R9AA 4NHYA 1UAIA 2AUYA 4AVBA 2ZABA 3N36A 2OXBA 3AM2A 1N1YA 4QHOA 1I5ZA 2J1EA 3SC7X 5C3OA 2JD4A 4RS5A 3AL5A 4Y20A 5FPXA 3ZO0B 2D6PA 3LOIA 1N1SA 3BOWA 4HMZA 3A0KA 3INAA 5J98B 2JB4A 1AR62 1JYVA 2R7EB 3RZZA 1XYNA 4GWNA 4WVMA 1V9U2 3AMQA 1DQ6A 4IGOA 1B35C 2OZJA 3RG0A 5A3MA 5DAPA 1O3TA 1BLZA 1NE4A 4KU8A 1NG0A 2XG3A 3A22A 2GU9A 4QXKA 4XJAA 4A3XA 1YQ8A 4BMEA 2VC9A 3ES4A 2JIGA 5FRAA 5HXMA 5FFOC 2CDPA 1RUG3 5FTTC 4P9XA 4B29A 1HQWA 3RZMA 1UXZA 2VVFA 2BFUL 4NO4A 4QB1A 2D43A 3K3OA 3ZYFA 5FIXA 3DKWA 3E6DA 4EV0A 2Y6GA 3ZXKA 4DUWA 4YM3A 1NY71 4BB3A 5C5TA 1OUSA 1HB2A 4TTGA 4Q4Y3 4PDWC 2Q8CA 1M06G 5IHRA 2R043 5FZOB 2ZGQA 1QH7A 1MS5A 4D7SA 4YZ3A 4HN1A 4JZRA 3JBG1 1G86A 2WLPA 3J9SA 1FOD3 2RE9A 3C7OA 3D0JA 4M3CB 5DDJ1 1AJOA 4BWOA 2ZJCA 5GJ6A 2BGPA 4HPKB 4PQQA 1CAWA 1NY72 4O9EA 1SFNA 1N1TA 4W50A 4WBBA 1D0GA 3VBHA 3UYJA 3WCSA 2ZKNA 3CJIC 3VKFC 2VCBA 5FPZA 5KHJA 2DUPA 4UW3A 3I2GA 3B9IA 3H3ZA 2B9UA 3JBG2 1V6NA 2GNDA 3I3EA 4XACA 5C33A 3N7KA 4CDUB 2VVEA 1LECA 2ZBJA 1Y7BA 5FAXA 2W2IA 5FZGA 1BCXA 5ABJB 2IZWA 1JYNA 5EYYA 2ZGNA 1FPN3 5IT6A 1CAUB 1UPIA 2VMEA 1SLBA 4C90A 2BW8A 4Q26A 2XPJA 4MG2A 2VR4A 3RPQA 4Q8LA 1R1A2 2NMNA 4JQTA 1TE1B 3M8LA 1ZBA1 1PO13 1RUE1 5FK8A 3NW4A 2B45X 4FFIA 5I8YA 3WNNA 2W1UA 2WT0A 4H3WA 4Q2FA 5BPXA 3WUCA 4A3ZA 4BLJA 1FI2A 2CY6A 2VTFA 5E1RA 5IVJA 1OSGA 3AVRA 4QB2A 3BKZA 5FPAA 1ZZ8A 4QX3A 3H8RA 1YJLA 1V6JA 4PIZA 1RHI3 1JH5A 2WWJA 1VBB2 3C8XA 4M3CE 1QOTA 3AP6A 3VBSC 4P5HA 3OUHA 4LHKA 1NCRA 4MADA 5FLJA 3O1PA 5FYZA 2VNOA 4BQWA 3LAGA 1G9FA 1VRH1 1RUJ3 1LTEA 3K4AA 1GP6A 3MI8A 4AVSA 2OZ6A 4D3WA 1JI6A 1QH6A 2GP5A 1G6NA 1VB4A 2IXLA 3RQ0A 5A3UA 5FPVA 3A4UA 2GZWA 5F5CA 4IEXA 5FMOS 4QX5A 4HL0A 3K77A 5DG1A 5C70A 1HXS3 5FZ0A 1AR93 4Y4YA 3RS6A 2K9ZA 4FP2A 1HRV1 2RDNA 4Q0VA 3SCHA 3KQRA 4H2AA 2H0VA 1VRH2 1FATA 4HXCA 3I2JA 4GH4B 4BIOA 2WO2A 3R6SA 2ZGMA 4KMQA 2NQYA 4IV3B 3GCXA 5FQ0B 1UY0A 4RFT0 2ET1A 5FKCA 3FBYA 2YU1A 4A7ZA 2JE8A 4CCOA 1YUDA 1LHWA 1NT0A 2Q5TA 3T2TA 1KFUL 4M4RA 2QQLA 2VU9A 1HRV2 3H8XA 3PMEA 2QCSB 4IUGA 1VBC1 4NVPA 3VBFC 2R0FA 4Z92B 3J8F1 1EV11 2YC4A 3ZFEB 1MEC2 3HJRA 3ACFA 1IKPA 3MPPG 2P37A 3IPVA 4PF1A 2WWUA 3MLJA 2E53A 4XFBA 1OVSA 2UU8A 3H1WA 1RUF1 5I8SA 3I4IA 3SH5A 1HB4A 1XSQA 3AZVA 2OIIA 2DTWA 5JSPA 1AYN3 4QGNA 5A6ZA 3VZMA 3OBAA 3AKQA 4MHUA 3ZFFC 3IIIA 5FP7A 2J22A 3I3DA 1U12A 3PHMA 1MQTA 2B7YA 3J8F2 5DABA 1EV12 4AR2A 1NQDA 5CKMA 4XJZA 4CCEA 4ES9A 5GKAC 3MIDA 5JOZA 2Y6KA 4PIYA 4YG6A 1OKOA 2W08A 2E63A 4R4XA 3AL6A 3CQOA 3OEBA 1RUF2 3RYKA 2IUWA 3AZZA 3ZYBA 1O59A 1PIV2 1OBNA 3KHCA 1OF3A 2VMIA 2HKXA 2J1VA 2YGLA 1BVP1 4COYA 2QQWA 4AI3A 1RGSA 3U75A 3S5AA 2ZS6B 3AFKA 2UYBA 1XYPA 4GMP1 4O61A 4ARXA 4DEVA 4F3JA 5FOJB 1O6UA 4CDQC 1WZXA 2PN5A 5IJRA 5A7QA 2Z5WA 4XMAA 2C9KA 4L0PA 1WMEA 3DKQA 1LGBA 4NPMA 1LENA 1WW6A 4FFHA 4BA6A 1QKQA 2GC3A 2VW0A 3D4KA 2FDKA 2XHKA 2KM2A 1H2LA 4AQ6A 1GZCA 2VH9A 2XQRA 1POV0 4YVSC 4XUTA 1AHSA 4JHZA 5IVFA 3C7EA 4UW6A 2D6KA 1IG0A 3MEPA 4LIUA 1ULOA 3QCWA 4AI8A 3WDXA 5FYCA 3DF0A 5KXCA 1D4M1 1UXXX 3KQ4B 4QXCA 1W39A 1YWKA 3VDCA 4CU6A 1MS8A 4QPYA 4D69A 1S4CA 4BYYA 2NN8A 3FN9A 4N53B 4WM7B 3WDYA 4N9HA 4C0HA 4CCJA 3CLPA 1RB8G 2JDNA 2YMZA 4FQ4A 3FWEA 1O4TA 2GNMA 1S0FA 2PELA 1H1IA 2CWSA 2WNOA 1WWYA 3MW4A 5M0TA 1ZRCA 2X29A 4JCKA 3OYWB 4E2QA 4M00A 3DYOA 1D4M2 2B46X 3CO2A 4NHMA 2AZ5A 3WXPA 2XLAA 1HLCA 5DDJ3 4COWA 5LY1A 3DPRB 4FTSA 1YFWA 3NL1A 2A71A 3ZPOA 2XJTA 5ANNA 5CFCB 1WLDA 1YIPA 3M70A 5HV4A 2VUCA 3J7HA 3LDBA 1ONAA 1CPMA 4X6QB 2FBEA 4CXXA 4FI9A 3SCFA 1SLLA 2W91A 4FPHA 3LEKA 1DQ2A 1J59A 1MVEA 5DUUA 3CL1A 2VZQA 3B94A 4AF9A 5KR7A 4JC1A 1W2UA 3HT1A 1VBD1 4C8DA 4AEDC 2MHFA 2DUOA 4ITCA 4J25A 2K2SA 5GLWA 4ZKTB 5BNPB 4OHXA 4B1MA 4XFHA 3VDDA 4QDSA 1WCKA 4KBZA 5DZFA 5B2GB 1ZBA3 1BK0A 1RXGA 4CU7A 3VBRC 1RUE3 4M3CA 1IQDC 2PHDA 3AP5A 3AX4A 2VMCA 3O5SA 4AGRA 5L7OB 3O1MA 3ZMOA 1H8TC 2QQVA 3SCGA 1LHNA 1YI7A 1LKNA 2ZCWA 1YQ5A 1URXA 3SLIA 3HN3A 4P9IA 3UL2A 1A34A 2VXRA 3GZAA 5A1AA 4W65A 4ZU4A 3SKJE 4QHZA 3UGHA 2WLQA 2VOXA 5GZCA 1VRH3 1WKYA 3WSOA 3ZSEA 1JZ6A 5A33B 1DIWA 4W6WA 4FCAA 4BM8A 5IVBA 4LBNA 3WQBA 5ABJA 2ILMA 5CKNA 4FXGB 4LBOA 3GZUC 3PJYA 1JOBA 4K8RB 1DYKA 1GNHA 1SCRA 1YFXA 3K48A 4L8QA 1ULGA 4NWVA 4U2AA 3AMHA 4QX7A 4W8JA 1W6QB 4AI9A 1JHJA 4RR3A 1WLTA 5BNOB 3JQWA 5HI0A 5DQ0A 4CCDA 1G7YA 3JU9A 4RD7A 3WLUA 3KWVA 4ET7A 4DOUA 1X9PA 1OUXA 3HNYM 4NR1A 3ZN4A 3WP4A 4CUCA 2NP0A 1HV1A 3WQ0A 1EUUA 2WAOA 1OH3A 3PMSA 4YSFA 2IFRA 4QU1A 4E4HA 1NQJA 4E2SA 3SH3A 5AC93 5DXDA 3VUOA 4TSVA 2WKKA 5A6XA 5FYHA 4N8MA 4COUA 2BOIA 3LFMA 1J3RA 4CXWA 5A3NA 5LBFA 2JICA 4LUKA 3E5UA 4HVOA 4JGZC 5KWRA 3D82A 1OPMA 4RS5C 5F3GA 2QQNA 3MGUA 1VBC3 2VZTA 3MIHA 3R05A 1FNYA 3OJBA 4NPLA 3O1TA 2FDGA 1T2XA 3J8F3 4FAHA 1EV13 4A44A 1ND3B 4NRQA 3KF5A 2YFUA 2ZMKA 3NQHA 5BV6A 1QJU1 1LEDA 1PNGA 5LY2A 1NA1C 3ZDSA 4BLIA 3VGIA 3O1SA 2D7FA 4JDMA 3NV1A 2H6BA 4M0HA 4YVWC 2PHXA 1RUF3 1FAYA 1GWLA 2BWAA 3KT7A 2CL2A 3ZFGB 4C91A 1HN1A 2VPVA 1QOOA 1SPPB 2B4KA 3PUSA 2VOWA 2MEV3 2BGCA 3VBUB 1UZZA 2DBIA 2Y6LA 3PIJA 4UF0A 5FZ8A 5LA9A 2OKXA 5CU1A 5JPMB 1XQNA 1HJFA 1CGPA 4Y1ZA 3M4FA 2WYSA 1POV1 2YUEA 3CU7A 1C5HA 4GD4A 3CZUA 4KWLA 4MX3A 2BNMA 4QWNA 4SBVA 3VHNA 5FR3A 5I91A 1ZRFA 1QJU2 1ULEA 1TZOA 2WL1A 3P5BA 2ADEA 4IEUA 2XKOA 5EZWA 4HETA 5C3QA 4GA9A 3V65A 5JIAA 1RXFA 2RR11 4AFAA 2OPKA 1UN1A 2Q30A 3PVEA 4YM2A 4GWIA 1K3IA 3BPZA 1VLNA 2QZ2A 2X5IB 4GALA 5E89A 1JOPA 1W0NA 5C8CB 4Y20B 2WO3A 1CQ9A 4GMP3 3T0DA 5TSWA 1JYCA 4YGCA 1CZTA 4WVMB 4HVRA 2YV8A 4CA9A 4DEQA 2HJIA 4XFAA 4FFGA 1NX9A 1PX3A 5GLUA 1DCSA 2RR12 2ZKLA 2W46A 4UWDA 5K0UA 5ACA1 2HWD2 2VVDA 2DTYA 3LE0A 1W6PA 1W8NA 1W8HA 1WCQA 2JG8A 2XH6A 1UIKA 1VIWB 2RDSA 1OC1A 4P9LA 5A7SA 1J58A 4L11A 3WCRA 3ZDVA 2IFWA 4JRAA 3POEA 4K8FA 1PGSA 1V6LA 1XNKA 2BZDA 3OD0A 5KXEA 2TBVA 2WNEA 1MS9A 2QNKA 5F9TA 2WBKA 4YZ1A 3LEGA 2JD9A 3N9MA 5ACA2 1D4M3 3BB6A 1D4VB 4RA0A 4TLGA 5J37A 1D2QA 2RHPA 1GSLA 1K5MC 4R52A 1FMD2 5GALA 3NV4A 2YPDA 2YXSA 4N90A 5FZLA 3I7DA 1NLSA 1Q43A 5LASA 2OUHA 1MACA 4X8PA 1MVQA 5F2WA 3AMMA 5I0TA 1C4RA 2Q8EA 1CAWB 1NCRC 4IERA 4QPGC 4DY3A 3E5XA 5JXIA 1W9WA 4V1PA 3VBHB 1GR3A 1PNFA 2RJ2A 5F7UA 5HCAA 1GQHA 2VQTA 3C7FA 5LATA 2Y34A 4YYOA 2VMDA 4UOJA 2OT7A 4UFIA 2Q0AA 1U5ZA 4EN8B 1FV2A 2E7TA 1LGNA 4XUPA 2ZACA 1J1LA 1K45A 3LGRA 4PIXA 2WQ4A 3A23A 1CN1A 5FZMA 3K3NA 3ACIA 2HWF1 3J26N 1EP0A 1S55A 1W3VA 1V0AA 3FHQA 5FY9A 4C0BA 4EN0A 1KDMA 5KXDA 3VDBA 2JDYA 4QKNA 3K51A 5BNNC 5LA0A 3ZVXA 4FO9A 5LK7B 3RGBA 1NXMA 5FO9B 4N53A 5EJ3A 3MBWA 1RUG2 2DCTA 5C5UA 5FYMA 3W20A 3BTZA 1KXGA 1S0DA 3Q8FA 1VBD3 1GYKA 4KI5M 1XE7A 3T3YA 2BVVA 3GNEA 3N9NA 3NVCA 5GLZA 2C0ZA 2ETEA 1H2NA 1H9WA 3L9JT 2HWF2 4Q4Y2 2VTXA 2ZZJA 2R042 1R1ZA 3RFRA 1O5LA 5ANQA 1FX5A 1W28A 1GKBA 4HK9A 3O1UA 1POQA 4IEOA 4ISRA 2DV9A 2XB6C 5CEHA 1WCDJ 3M3EA 3UKNA 2DVBA 2QVSB 5CFCA 1WA4A 3LIHA 4D6QA 3RZLA 4N7UA 5JSOA 2LW8A 3KMHA 1PK6C 4NIAA 3WUDA 5FYYA 2WFPA 1LU2A 1REFA 1PMHX 1S0GA 1Z78A 1IZ3A 4Z82A 3HBZA 4I3GA 2WT2A 3ZN5A 4OI0A 4KG8A 4IEVA 5G04L 3HQXA 1N3PA 3DEMA 2P3YA 2ZAAA 3WW1A 4FPJA 2JE7A 5CFDB 4XZPA 3WZ1A 1MQTC 2QQOA 3ZYHA 2ZHNA 4NUBA 4O7XA 4XQDA 4KU7A 4AHYA 1IPSA 2ERFA 5BNPA 3KLSA 1GNYA 2XVKA 5HCBA 2UWAA 2ZMLA 1O91A 4LLFA 5DUWA 2DVDA 1C8M3 4R8HA 4XBNA 4NRMA 3GM8A 5H9QA 3BGAA 4BMBA 3AYCA 3MICA 5L7OA 2DDUA 2PHFA 3VD4A 2ID4A 2FDIA 5C3PA 2QQKA 1RMU1 3LA7A 4LO4B 2YBPA 4QPIC 1JYIA 2OQ6A 4OHYA 4CP1A 2DUQA 4CP0A 2YG0A 5JI7A 2GP3A 2Y0OA 3U78A 3UESA 3GF6A 1ZRDA 3EXUA 5CB7A 5FPLA 1AR91 2P1BA 1XRUA 3KT4A 1YQCA 5FMDA 1H1AA 1Q8VA 4YARA 2Q1ZB 1CJPA 2PHUA 3HT2A 1Q8QA 2G19A 4Y33A 1QJEA 4FOYA 4JRLA 5GLVA 1SLCA 4IV1A 3T2PA 2A6ZA 4UI9L 1W05A 1RUJ2 3ZR6A 2JDZA 4Q0UA 2ARBA 2MNGA 4PBPA 5IATA 1W9YA 4WM8C 1RMU2 3FHAA 4RQPB 2Q1FA 2R32A 4XIKA 4A42A 4DPNA 1D2SA 1Q5OA 2YDEA 1AXKA 1QJU3 1UPSA 2JEMA 2Z2SB 3KV9A 5LEKA 3HAGA 5BNOA 4FAGA 3T2OA 1HXS2 3I2FA 2VD7A 1AR92 4ATEA 4MOAA 1LR5A 4LUMA 1W9TA 4UBHA 1LAJA 3PVOA 4IE6A 1UOGA 1JZ5A 3ZXEA 2QUOA 4XEZA 1JYWA 3VHPA 5KHIA 1POV3 2GC2A 2WFF1 3MIBA 1F5FA 1WMFA 1NKGA 4ZONA 3S30A 1H30A 4I2OA 1EPWA 3LCPA 3N9QA 4COZA 3UGFA 2RR13 1J1TA 1EPZA 4AVVA 4YW6A 3RI9A 4HZFA 1X8MA 5IAVA 1OT5A 5JIUA 5JXHA 1GZ9A 4K40A 5FYUA 3N7JA 4LBMA 2WFF2 5D1IA 2J1RA 4JDNA 4AW7A 2G1MA 2WAAA 4OMDA 4YG3A 4B7KA 4YFZA 1BHGA 1KFXL 2CAUA 1UU4A 3OGGA 4LKFA 1F15A 1F35A 2W1WA 4AQ2A 1LOCA 1HDKA 1W8TA 5KXBA 3DN7A 3E5QA 3H3LA 5ACA3 3AZXA 5F32A 1VAMA 2XONA 4MSVA 3NNFA 4BOWA 2OS2A 2J1UA 5C3RA 5EWSA 2E33A 5DPNA 1W90A 1KGYA 2GNBA 1JTZX 3LA3A 4XURA 2WYFA 1US3A 4Q1PA 1RTVA 1ZRRA 4O9GA 3NNLA 4FPYA 1JU3A 3NWKA 4S2DA 3UETA 2ZEZA 2X09A 3ZSMA 1UKRA 3WY6A 4MXWB 5CYYA 4IGPA 3AYAA 1S2BA 1CVNA 1JU4A 1UMHA 4XYXA 3WD5A 1X36A 2X5IA 1QIQA 2V4AA 3LIGA 1D0HA 5C8CA 3PVNA 4XPVA 2QDRA 2GN3A 1CAXA 3WEZA 1ULPA 4K20A 1UYPA 2VUDA 3PLQA 5CKQA 3RJRA 3WINE 1G9AA 5FZ6A 4JGYA 1F31A 3VKOA 1I9RA 4OMCA 2J1TA 3OBTA 3Q8EA 4LMFA 2WDBA 4AVTA 1PVXA 3KV5A 4S2GA 5D2AA 3OGSA 3APBA 1LJ7A 3URFA 4CDUC 4XHXA 3GBFA 3PL0A 4QMAA 3ILNA 3HQUA 2A5ZA 4Q4W1 4LITA 5ABJC 4JTNA 4I0BA 4KGQA 4RYDA 2JJ6A 5DG2A 1WA6X 2XJQA 5LK5A 5FUPA 2NMOA 1QU0A 2YYOA 1JBCA 4XETA 2P6CA 4GMP0 4ASMB 2QDNA 4N43A 3SITA 2HWF3 1JN2P 2RM21 5FP9A 4E27A 4OI2A 1CPNA 3GBGA 1QOSA 2KXLA 1QXPA 4I01A 3BU7A 3EHKA 2A70A 4LBJA 3WQ7A 4DINB 3VDDB 2YY1A 3C2UA 2W5FA 3TEYA 2XLFA 4QX2A 1FV3A 1N3QA 2Y64A 5L73A 3RMXA 2Q1MA 4LO5B 4W6XA 1DGRN 2ZA9A 1UKGA 1ALYA 4A45A 4YLZA 2GSYA 3AJZA 3EO6A 1SLAA 2C5DA 2W95A 3F2ZA 2TUNA 4CCLA 3RYRA 1X50A 2RM22 3KGZA 4JQRA 3ETPA 2X05A 1RUI1 4QGLA 4XUNA 5FZEA 3F95A 3ZYGA 5IK5A 5FJHA 1X7NA 1QF3A 3VD7A 3ZXAC 4BCUA 2WSVA 4OHZA 3O14A 4OUMA 3GHMA 1N47A 3AMNA 4IGQA 4XF3A 3B02A 3K2OA 4Y4RA 2JB8A 4OUSA 3FBMA 5DDJ2 1UIJA 4OUEA 4PCRA 3ZN6A 4XZUG 5GZFA 1I1EA 4XF4A 2HYXA 1S2KA 3VBOA 5L19A 1O8SA 4LBKA 4J6GA 5DUXA 1KS4A 2PHRA 1W04A 5JXGA 4GH4C 3POWA 2Q8OA 1RUI2 2L9LA 3E97A 1BK1A 1RIRA 1VMHA 1W6MA 4RR3B 1B35B 1AL0G 1ZX5A 2DFBA 2WT1A 2ZGUA 3N9PA 3POSA 4IV3C 4NAOA 1FT9A 3ACLA 4IW3A 4F8AA 1XPWA 3QH6A 4Z1VA 2RS31 2IXJA 2J1AA 4AQSA 5IAXA 2BU9A 2JDHA 4H14A 2VZPA 5F3IA 4KQ7A 3FL7A 4M01A 4R9DA 5APAA 1LOFC 2BNNA 5FZ4A 4I02A 4K1YA 3BTXA 5IWFA 4DRRA 2OW4A 1H9PA 5L9RA 2WQ8A 3I49A 1F8VA 1ZBA2 2C6SA 4BXSV 4FFFA 2BBVA 3ZFEC 1RUE2 2PMWB 2CGOA 4NRPA 3OG2A 1QJFA 1RMU3 2CAVA 2RS32 3BALA 4UBGA 1VJ2A 4QKDA 4G3YC 4UW5A 3RJ2X 1OLME 2WO7A 3MW2A 5DZGA 4CEWA 4GXLA 4LNVA 3POFA 5GLTA 4N9IA 1CZVA 2KR2A 1AR81 4XUQA 4LBLA 3W59A 5CA6A 4OI4A 2SBAA 3AC0A 3MW3A 1H6XA 1WLWA 1VMJA 2DFCA 5CFDA 3QD6A 1NCQA 3CIHA 5FYTA 1W8ZA 1M4WA 3KHBA 3KM5A 4UF0B 4EN7B 4AI2A 5LWBA 4B3NA 5AC91 1W3XA 2BRTA 2XVLA 2W87A 5EXOA 2WNVC 3KV4A 4B4RA 1AR82 1LOEA 3O1OA 3AYDA 2P3KA 1H2KA 2EXKA 2J1SA 3CF6E 4B4QA 4HKWA 4BQ4A 3FUQA 2Y26A 3LEMA 3ECQA 1HB3A 3BVCA 3ZXJA 4YZ2A 2TNFA 4ZXKA 5T5PA 1C57A 2WFF3 2XL9A 2HWB1 4N7IA 3POJA 1O3RA 1XBFA 2X53S 4AVAA 1VAVA 3OCPA 3BN6A 4LHLA 5AC92 2IVIB 2JDKA 4AEMA 4BZ4A 4QXBA 2XGXA 2FZ2A 4EYUA 3AKPA 1G9CA 3VHRA 3QBQA 2QQIA 3ZYJB 1W2TA 2MEV1 5LBBA 1V6KA 2V72A 2YC2A 4INDA 4RQPA 5K0UB 1OQEA 2VNRA 3C7GA 4P08A 1OF4A 1VBC2 3VBSB 2GC0A 1W6PB 4CPBA 4X6RB 2HWB2 2JG8B 4CDXB 2FCTA 3T4VA 4I30A 3M2MA 5H9PA 1ZZ7A 2VZSA 1K12A 2ARAA 1W9SA 3MV11 1XNCA 3RSJA 3LEIA 1X82A 2VUJA 5T5LA 4GULA 4ZZ8A 5FY8A 2R073 3KVAA 4HT1T 1UCXA 2KA3A 3HD8B 1IKQA 5T3NA 1XB9A 4WM7C 3SEPA 2MEV2 5T52A 2C1FA 3UKVA 1DZRA 4GKYA 4CCKA 1TG7A 5A1FA 4P9GA 1AXZA 1LOBA 1O4ZA 2WRAA 5FBZA 5HPOA 4LEJA 2UY8A 4LJHA 2W47A 5A7NA 1DDLA 2VW2A 4IQPA 4IEWA 2CHHA 1SCSA 4E4DX 2X8KA 3OEAA 4P9WA 2CNAA 5E8AA 3LFIA 4LA3A 2ZMNA 1I3HA 4Q0PA 3RYPA 3U4XA 3DPRC 3K4ZA 3EMRA 4AK3A 1KRIA 1O8PA 4YGDA 5EFUA 1CIWA 3OPTA 5EYXA 1W6NB 5CFCC 2XL7A 3BI3A 3SH4A 1L3JA 1NXD1 3NNJA 5L9BA 2PYTA 1MZ6A 4LPLA 1ZBE3 4KH9A 5J3UA 3RZHA 1OA3A 1SACA 4IE4A 4KBBA 1CX4A 2DU1A 3OB8A 4KL1A 3ZX7A 2V09A 1DBNA 3B01A 4MGSA 3ZR5A 4Y3OA 4P9JA 1YCIA 3KF3A 3PU8A 1RVF1 4HANA 5E16A 3ZKUA 4AFBA 4YM0A 1ZZBA 4Q4W3 1JZ2A 1IPKA 4XMIA 1BKZA 4K1ZA 4AOCA 3JQXA 4XFFA 2BWCA 1VBE1 4PQ9A 3FC0A 4NIIA 1RINA 3UNPA 1W03A 1MR5A 1YI9A 4UFHA 5BNPC 3AJYA 1NLRA 4MXWA 4FPFA 3CNAA 4AI0A 4BU2A 1DYOA 1MZFA 2ENRA 4LHNA 4Z2AA 1IS3A 2RM23 1UL9A 2B42B 2WO1A 3KCCA 1UYXA 1O7FA 4Q29A 3ZFFB 3MLKA 5A3OA
chains in the Genus database with same CATH topology
3S57A 3T4HB 4MGTA 3BTYA 4RFRB 4O7XA 4NROA 5F8PA 3KHBA 3RZKA 4QKFA 4NRMA 4NJ4A 3O1OA 3O1MA 4QKBA 5DABA 2FDIA 4ZS2A 2IUWA 3I3QA 3KHCA 4NIDA 3I2OA 4IE7A 3RZGA 3S5AA 3RZJA 4O61A 4MG2A 4ZS3A 3BUCA 3H8OA 4OCTA 4NIHA 3T4VA 3BKZA 4NPMA 2FDKA 4IE6A 3H8RA 3O1VA 3LFMA 4NIGA 3O1PA 4CXWA 3BIEA 4CXYA 3I3MA 4QKNA 4IE0A 2FDJA 4NPLA 3O1TA 2FDGA 3BU0A 4NRQA 3BTZA 3T3YA 3O1SA 4QHOA 3O1RA 4IDZA 2FDHA 3BI3A 3RZHA 4IE4A 3BTXA 3I49A 3O1UA 4JHTA 2FDFA 4NRPA 3RZLA 4QKDA 3H8XA 4NIIA 2FD8A 4IE5A 4CXXA 3RZMA 4ZHNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S57 A;  3T4H B;  4MGT A;  3BTY A;  4RFR B;  4O7X A;  4NRO A;  5F8P A;  3KHB A;  3RZK A;  4QKF A;  4NRM A;  4NJ4 A;  3O1O A;  3O1M A;  4QKB A;  5DAB A;  2FDI A;  4ZS2 A;  2IUW A;  3I3Q A;  3KHC A;  4NID A;  3I2O A;  4IE7 A;  3RZG A;  3S5A A;  3RZJ A;  4O61 A;  4MG2 A;  4ZS3 A;  3BUC A;  3H8O A;  4OCT A;  4NIH A;  3T4V A;  3BKZ A;  4NPM A;  2FDK A;  4IE6 A;  3H8R A;  3O1V A;  3LFM A;  4NIG A;  3O1P A;  4CXW A;  3BIE A;  4CXY A;  3I3M A;  4QKN A;  4IE0 A;  2FDJ A;  4NPL A;  3O1T A;  2FDG A;  3BU0 A;  4NRQ A;  3BTZ A;  3T3Y A;  3O1S A;  4QHO A;  3O1R A;  4IDZ A;  2FDH A;  3BI3 A;  3RZH A;  4IE4 A;  3BTX A;  3I49 A;  3O1U A;  4JHT A;  2FDF A;  4NRP A;  3RZL A;  4QKD A;  3H8X A;  4NII A;  2FD8 A;  4IE5 A;  4CXX A;  3RZM A;  4ZHN A; 
#chains in the Genus database with same CATH topology
 1WW5 A;  4DZG A;  2BEO A;  4YW3 A;  5C4W B;  3LWC A;  4PT6 A;  5L7O C;  1RVF 2;  2XKP A;  1F4H A;  4Y26 A;  3P3N A;  5FZK A;  1R08 1;  2OVU A;  1ULC A;  3NJZ A;  2A75 A;  4MO3 M;  4Q1R A;  5GZD A;  3BOP A;  4BH9 A;  1LHO A;  1RL3 A;  1Y9M A;  5C9A A;  2YPJ A;  5B4X A;  2QQU A;  1SFY A;  3MIE A;  3CMG A;  1CES A;  2JDA A;  1RUI 3;  2Y6H A;  4YZ5 A;  2Y6F A;  2ZGT A;  4YW1 A;  5CAZ A;  3IZO A;  2GAU A;  2V4V A;  4H7L A;  2WNU A;  3VD5 A;  1C5I A;  2Z69 A;  3I54 A;  3L2Y A;  1ZA7 A;  1NYW A;  5J36 A;  5JOY A;  4ASK A;  5IVV A;  1CIY A;  5BNO C;  1S2E A;  2AEY A;  4ORF A;  2OUJ A;  4R9C A;  1FYU A;  5F2S A;  3RWN A;  3SNM A;  2D5F A;  3ZOI A;  2BOJ A;  4BQ3 A;  5ISL A;  2W92 A;  3C7H A;  4QQH A;  4CCN A;  1OUR A;  2FQP A;  2RJK A;  3EQE A;  4H55 A;  1Q56 A;  2EF6 A;  3D5O A;  2YRO A;  3PUA A;  4M4P A;  1OFS A;  5FZ7 A;  2OA2 A;  2E51 A;  2O1Q A;  2PA7 A;  3R4S A;  4IL7 A;  2NM1 A;  4E8D A;  2RS3 3;  2JX9 A;  4YNI A;  5IVC A;  4WZF A;  2VEC A;  5FXZ A;  1HJG A;  2ZTN A;  1VBD 2;  1RYY A;  3NAP B;  5CG8 A;  3CDZ B;  4LTA A;  2B5H A;  1S0C A;  4NE9 A;  3POB A;  3U0Z A;  1OLM A;  4AGG A;  5HBA A;  3GAL A;  3MUY 1;  3LDK A;  3MPB A;  4A7K A;  1YQ2 A;  2XBO 1;  1HN0 A;  2JE9 A;  5FBJ A;  3IB3 A;  5JZG B;  1RUD 1;  1ND3 C;  2DVA A;  1JZ7 A;  2O8O A;  2XOM A;  3ON7 A;  1AX0 A;  1W0P A;  4IV1 B;  4TN7 A;  5F37 A;  2NZ9 A;  3ZSK A;  2A6W A;  2D44 A;  3SMH A;  1OD3 A;  3CEW A;  4YWA A;  4IE0 A;  4M0N A;  4YRD A;  4MH0 E;  5EPA A;  4E8C A;  3ZFG C;  1OA4 A;  1AR8 3;  3VBU C;  3CHX A;  1B35 A;  1C8M 1;  4ASL A;  1TQ5 A;  1DHK B;  1G8W A;  5FLH A;  3IN9 A;  2HWE 1;  2YC0 A;  4EWD A;  4I0W B;  1RUD 2;  5FZA A;  2CWM A;  3MHZ A;  3QAC A;  2YB7 A;  2ZGL A;  4DXR A;  4M3C F;  5ERL A;  1A3K A;  2GH8 A;  3SKV A;  4LE3 A;  2GC1 A;  3RVH A;  5FMC A;  4ATF A;  1NLQ A;  2W39 A;  1IGO A;  1IOA A;  4WV8 A;  2VZU A;  2AH2 A;  3H7Y A;  3A21 A;  5F6L B;  3OUJ A;  3JXS A;  4V2V A;  1YIF A;  4BJ0 A;  4BQ1 A;  3ZKY A;  1SBD A;  2ZGS A;  3IAP A;  3ST7 A;  1ZRE A;  2YZ4 A;  1AL2 1;  2X5I C;  4JKM A;  1C8M 2;  4BXF A;  3J7N A;  4XF0 A;  4XJ8 A;  2HWE 2;  1GNZ A;  3VV1 A;  5JR2 A;  4PDW A;  5CNA A;  2ZX4 A;  4ZPI A;  5EJZ B;  1AUY A;  3VN4 A;  3IWZ A;  2HWB 3;  3AXE A;  4RN5 A;  1CX1 A;  1WBF A;  1PM7 A;  3HBK A;  5FWJ A;  2P5B A;  1QQP 1;  3E6C C;  2VOK A;  3QLQ A;  3VL8 A;  3FMG A;  4D8M A;  2QQP A;  2EAA A;  5FXX A;  3T0B A;  1GZW A;  4OQ8 A;  1GOG A;  3M1H A;  4AWD A;  4FBF A;  1RC6 A;  4LQR A;  1ZM1 A;  4LOT A;  4XW3 A;  4GWJ A;  3CJI A;  3PTR B;  5JLV A;  4Q4X 1;  1CR7 A;  4DXT A;  2AYH A;  2C26 A;  4C1X A;  2IC1 A;  4K3U A;  2VQ0 A;  1OQ1 A;  4DS0 A;  3LKJ A;  3Q8B A;  5BYN A;  4HK8 A;  4QKF A;  5CG9 A;  3E1F 1;  1DZQ A;  1UU6 A;  1BEV 1;  1RJ7 A;  3MIF A;  3D6E A;  5AFB A;  1QQP 2;  1WW7 A;  2P4E A;  2VZR A;  1SQ4 A;  2A1X A;  2K0G A;  3U11 A;  3I8T A;  4ES8 A;  4FPO B;  3WP6 A;  1UYZ A;  3MF9 A;  5FP8 A;  5H9R A;  1XSR A;  2VOV A;  4QQL A;  2DF7 A;  5CZK A;  3H8U A;  3PU3 A;  4CUB A;  3I3Q A;  4Q4X 2;  3FLR A;  1R09 3;  2LM3 A;  3TEW A;  4CE8 A;  5JPN B;  1CAX B;  5JR7 B;  3WW3 A;  2EIB A;  4XQ4 A;  5JUV A;  3OGJ A;  2A3Y A;  1BEV 2;  4Y1V A;  3T1L A;  3WVJ A;  3RZG A;  3VD3 A;  3FUO A;  1UOF A;  2QTW B;  2RJL A;  1GU3 A;  4JGY B;  4UFM A;  3VBH C;  4URT A;  5F3C A;  4PI2 A;  4CZS A;  2YFZ A;  1G9B A;  3MF6 A;  1AYM 1;  2KD7 A;  3VBS A;  5KHH A;  2I2S A;  4URA A;  3RNS A;  3U10 A;  5FP4 A;  1GQG A;  3ELN A;  1Q8S A;  3TBD A;  2D6L X;  3WNP A;  3ZXG A;  4CDX A;  3VD9 A;  1XC6 A;  1OOP B;  5FZI A;  3DUI A;  1BBT 1;  3ZMN A;  3GDB A;  1UZW A;  1VAK A;  5EP9 A;  1C28 A;  1QJZ A;  2A3W A;  2D5H A;  3AP4 A;  5C7G A;  1WLC A;  2NLR A;  1KS5 A;  3I97 A;  3M7A A;  3OBZ A;  2JIJ A;  4N43 B;  4AFM A;  4XXA A;  1RVF 3;  4CP9 A;  2DUR A;  1XJA A;  4HON A;  5FY1 A;  2WZP P;  1I5P A;  1HB1 A;  1AYM 2;  3ABZ A;  3JCI A;  4QQP A;  4AAP A;  4E4S A;  5I0S A;  4NPR A;  3UV9 A;  5E6H A;  1Z0H A;  4TLF A;  4YVW B;  3TAY A;  1VBE 3;  1J3Q A;  1JZ3 A;  2PXJ A;  1BBT 2;  3IIA A;  3M3Q A;  4MZU A;  5JDB A;  2IXI A;  2A7A A;  3JB8 A;  3ZXF A;  2ZX0 A;  1KDK A;  3WDW A;  4AEJ A;  3W5N A;  2WR9 A;  1VMF A;  3V0A B;  1OH4 A;  1OI6 A;  5JVV A;  5KC6 A;  4XC9 A;  4LXL A;  4F83 A;  1OLQ A;  2CTV A;  1V6O A;  1W6N A;  1R08 3;  5CBL A;  3WNL A;  4F7Z A;  3O1R A;  2FDH A;  1UZV A;  3WG2 A;  4EZ4 A;  5G05 L;  1SG3 A;  2W1S A;  3OPZ A;  5BNQ A;  2CGN A;  2GMM A;  4XVH A;  3VZL A;  2W94 A;  1U5X A;  3MLL A;  3WT3 A;  1REE A;  2XUM A;  3AB0 A;  3ZN6 B;  1STM A;  1XNT A;  1S0I A;  3AKS A;  3HIF A;  1PZ7 A;  4QQO A;  4YW5 A;  3VBO B;  1OLR A;  4XAE A;  1YQ6 A;  4LE4 A;  5GZG A;  4XJ9 A;  4QGM A;  1LNS A;  3QH7 A;  3WV6 A;  2VO5 A;  2RG4 A;  5CFD C;  1GV9 A;  1H4H A;  4LBQ A;  1W6M B;  5D8A B;  2Y6J A;  1TNR A;  4DB5 A;  2ORZ A;  3HPN A;  5I0R A;  3PUI A;  3ZFF A;  4UXA A;  4CUA A;  3WNM A;  4UAP A;  2N7G A;  5C4W A;  3T4H B;  4DFS A;  2VCM A;  1PGW 1;  2VMH A;  4RL7 A;  5LA2 A;  4EQV A;  5FDB A;  2EXJ A;  3ZIX A;  3WNX A;  4MV2 A;  2RMU 1;  3H0O A;  5F8P A;  2VZ3 A;  4YW7 A;  1KQR A;  3SHR A;  5DAQ A;  4HKL A;  4YM1 A;  1T6B X;  3UJQ A;  3NO8 A;  2VBB A;  4NJ4 A;  4FOV A;  4HLT A;  1YNA A;  3THP A;  3WNK A;  4NAM A;  4XCA A;  2EIG A;  2H6C A;  3GGL A;  2VNG A;  4CEW B;  3FHI B;  2HBU A;  2VW1 A;  5FO7 B;  2ZZQ A;  4HVQ A;  5J1X A;  4CDQ A;  3IKW A;  4LO6 B;  2XBO 3;  5HXV A;  1RUD 3;  4ZU5 A;  3OTF A;  1PMJ X;  4HSJ A;  4EE2 A;  4ZZ5 A;  1LU1 A;  1NCQ B;  5IW0 A;  4FT8 A;  4BIS A;  5IYY A;  1C1F A;  1W8O A;  2YBS A;  3AP7 A;  1JXN A;  5A3T A;  2JDU A;  2ZXQ A;  4QX0 A;  3LOB A;  1KJR A;  2ARE A;  3VZJ A;  1SDD B;  1NZC A;  4YVS A;  4OHV A;  4GIQ A;  2HWE 3;  1QJX 3;  4GAZ A;  4LK6 A;  5FY5 A;  3THD A;  3ORJ A;  3WX5 A;  2DU0 A;  2CSG A;  2QFE A;  4BIF A;  1E5I A;  1GP4 A;  4LKD A;  1EAH 1;  3TN9 3;  1PGL 1;  3AXD A;  4LK7 A;  2UWB A;  3NAP A;  3TOJ A;  4I3P A;  1DGR A;  3GJB A;  1LHU A;  4CDW B;  1IPJ A;  1DF0 A;  3RWK X;  1UNB A;  2VJX A;  2HBT A;  1TNF A;  1HW5 A;  1AL2 3;  4ARY A;  5JZG A;  4R4Z A;  1QHD A;  5K8S A;  3WW4 A;  1GOH A;  5C8W A;  3GCW A;  1FNZ A;  1C8N A;  4CP2 A;  1SBE A;  1VBA 1;  2OQ7 A;  1PGL 2;  1BXH A;  2R30 A;  1PMI A;  4FXK B;  4DO0 A;  3VZN A;  4AHZ A;  2DCK A;  5FMO L;  3AP9 A;  4AFD A;  4D7Y A;  4P00 B;  4FPG A;  1QQP 3;  1Y9Q A;  2HWC 1;  2VM9 A;  5JI9 A;  4K21 A;  3BU0 A;  2VTX J;  3EBR A;  1ASJ 3;  3CJX A;  2B39 A;  1LES A;  5SV5 A;  1IS5 A;  3IM0 A;  1H8V A;  4OUL A;  4BQX A;  5CIS A;  1Y3T A;  4FSJ A;  2ES3 A;  4DUV A;  1NE6 A;  4YGB A;  4XF1 A;  2Q8D A;  4Q4X 3;  4W6Y A;  2PQQ A;  4BHP A;  1VBA 2;  1WGP A;  2B9V A;  3ME2 A;  1W2A X;  1GIC A;  1BEV 3;  3GZT B;  1U0A A;  1J84 A;  3CKH A;  1E5S A;  2UY9 A;  1O3Q A;  2C4X A;  3AFG A;  4JHT A;  4UFK A;  5T5O A;  1A8D A;  4AED A;  1EYB A;  5I8T A;  4DXZ A;  2Z4F A;  4XFC A;  2P34 A;  1ULF A;  3FLT A;  1OHF A;  1GOF A;  3N9O A;  1QMJ A;  2EIE A;  5DAW A;  2F17 A;  3VBR A;  1MS0 A;  1MZ5 A;  5K7P A;  1RED A;  3LSE A;  3S57 A;  4DIQ A;  1AR7 1;  1H8T A;  5K9Y A;  5FZB A;  4UFL A;  1AZD A;  2HEY F;  5FXW A;  3UGG A;  1PZ8 A;  3N4M A;  1GMM A;  5T55 A;  4XE9 A;  3VKL A;  1AYM 3;  2R07 1;  2D93 A;  2A6Y A;  2XXZ A;  3VHO A;  1Y43 B;  1COV 3;  3NV3 A;  1NAE A;  1MS3 A;  1QDO A;  3AK0 A;  4NWW A;  1BBT 3;  1XXN A;  1JUI A;  3TB0 A;  1RIT A;  2ADD A;  4HKO A;  5A6Y A;  4DQA A;  1G9D A;  1AR7 2;  3K4D A;  4IEZ A;  2RS1 1;  1SDW A;  3M3C A;  3VDD C;  4Y22 A;  1UY3 A;  4QXH A;  5GZE A;  4Q5O A;  1LHV A;  4PLM A;  3LD8 A;  2R07 2;  2GNT A;  4CEY B;  3M3I A;  1KJL A;  3B7M A;  1PHM A;  1YRZ A;  3I2O A;  3J7M A;  3PJQ A;  4NHK A;  4CYD A;  2FMD A;  1JZ8 A;  2I74 A;  2R16 A;  1GAN A;  1AR6 1;  3EJK A;  4Q0S A;  3BIW E;  5F6K A;  2LS6 A;  5FY0 A;  4DMI A;  2VUA A;  1ZBE 1;  2P3J A;  1V9U 1;  2VBP A;  4GKX A;  4JTO A;  3QOP A;  1XYO A;  4RGK A;  1DZT A;  4DY5 A;  3DYM A;  3W58 A;  1GWM A;  4LO8 A;  1UMZ A;  2YBK A;  4LUL A;  2OX0 A;  4LHS A;  3THT A;  5C9A B;  4Y1X A;  2EAL A;  5IVE A;  2A6X A;  4EN9 B;  1ND2 B;  1OOP A;  2PTM A;  3LSD A;  2YU2 A;  4JGZ A;  3S7I A;  3DXT A;  1WCS A;  2V5Y A;  3D3A A;  4QPW A;  5J7M A;  2WNU B;  3GZE A;  3MFC A;  3HVD A;  3WP3 A;  4A41 A;  1E57 A;  5FPU A;  2Z79 A;  2ZGK A;  1ZBE 2;  1XNB A;  5JOW A;  3DGT A;  3KVB A;  1KD7 A;  2BV4 A;  4RR3 C;  1VR3 A;  1CJD A;  3ZSL A;  3TYJ A;  3WNO A;  3I3M A;  1NA1 A;  4D6S A;  2PAK A;  4YVW A;  3W5M A;  2JKB A;  2G4I A;  4Q4W 2;  3PVB B;  4EZH A;  2MPF A;  2GME A;  1DQ4 A;  4QDQ A;  3H42 B;  1XE8 A;  1W6O B;  1T6G C;  2JG9 B;  1OKQ A;  4E4Z A;  1ZNP A;  3V0A A;  2ZGR A;  4QU2 A;  2R1D A;  2XWJ B;  4J1X A;  2O14 A;  3KGL A;  3N7M A;  1XNA A;  4MGY E;  4XJU A;  1W8W A;  2D3P A;  3K75 B;  1VAL A;  1HIX A;  3AMP A;  5F5I A;  5IUQ A;  5CAD A;  5F1R A;  2RV9 A;  2RDQ A;  5DAX A;  1MZE A;  5D21 A;  1VPH A;  2RMU 3;  4IDZ A;  1GQP A;  4OZX A;  3MYX A;  2UUR A;  4FTB A;  1SFP A;  3NJX A;  4OI1 A;  4RHV 1;  2DVF A;  4XUO A;  5A6Q A;  3ZYP A;  1HKD A;  1S0B A;  2PQS A;  3E6B A;  5B4N A;  3WP5 A;  1ENQ A;  1YEW A;  3EYP A;  4ZXE A;  2YHJ A;  3B93 A;  2DCZ A;  1QEX A;  3DV8 A;  4OZO A;  2A3X A;  1PX4 A;  5C71 A;  2FD8 A;  2BTV C;  3MZH A;  2AAC A;  5D8A A;  4H7M A;  1R1A 1;  1UY4 A;  4IE5 A;  5FUN A;  1BYH A;  2C9A A;  2AEZ A;  3U37 A;  3ZPY A;  4FOQ A;  4JKL A;  3HEI A;  1OMI A;  1U5I A;  4RHV 2;  2XJS A;  1MPX A;  1WUV A;  4GQ7 A;  4MGT A;  1RUH 1;  2WUH A;  2FHR A;  3DXU A;  4P9Y A;  5LW9 A;  3H7J A;  4MGZ E;  4E2G A;  3DCQ A;  4RSU A;  3IMM A;  5FP3 A;  1Q3E A;  2B8M A;  2BUK A;  3MFA A;  2BQP A;  1VBB 1;  2XHN A;  3NJV A;  5FYV A;  4COV A;  3OY8 A;  2VOT A;  3BYW A;  5IFP A;  1ZZ6 A;  5KC5 A;  4R9B A;  5J48 A;  3WDU A;  1EAH 3;  5LRS A;  2WC2 A;  4NN0 A;  2ZEW A;  1L7Q A;  3D8C A;  4PDW B;  1XU1 A;  1X8E A;  1V6I A;  1X9T A;  2IXC A;  3DYP A;  3OD4 A;  3POY A;  2GMP A;  2ZAH A;  2NYY A;  2Y8K A;  1K5M A;  1RUH 2;  1ENR A;  3U14 A;  1F5J A;  2DBN A;  3T09 A;  4OYU A;  4QM8 A;  2R49 A;  1GWK A;  4QHB A;  4YG0 A;  3H3U A;  5A7W B;  1H2M A;  3A7Q A;  5K0U C;  3ZM8 A;  1GZW B;  5BUV A;  4FPK A;  3U07 A;  1IG3 A;  1VBA 3;  2JG8 C;  4QPG A;  4CDX C;  2V73 A;  3POI A;  1PO2 3;  5I0D A;  5JOX A;  3RZJ A;  5GM0 A;  4XJW A;  3CJI B;  3V0B A;  3NMB A;  4YW2 A;  5CIR A;  2G9G A;  3Q8C A;  4ZS3 A;  1W9F A;  5DAV A;  2HWC 3;  5L9V A;  3ZYI B;  2EVX A;  1H6Y A;  4MET A;  2PHT A;  2QQM A;  3H9A A;  4P14 A;  5FZD A;  2AEN A;  3G6J B;  2DYC A;  3AKR A;  3FFQ A;  5FKB A;  3RMY A;  3VB9 A;  1DU3 D;  4MHR A;  5JMC A;  4B4P A;  3KCY A;  1BJQ A;  3MV0 1;  4QAW A;  2Z42 A;  5BNN A;  3KV6 A;  4CDW A;  5JWP A;  2PLV 1;  1L7L A;  3OBR A;  1KEX A;  5LEJ A;  1MEC 1;  2W0X A;  4Z07 A;  3LF7 A;  1TVG A;  1YHF A;  1SEF A;  3D0S A;  3USS A;  4FOW A;  3USU B;  4G4F A;  5FZH A;  2AGS A;  1UY2 A;  2I45 A;  2RS5 1;  3U1X A;  4XXP A;  5FV3 A;  2D3S A;  1CWP A;  4TXW A;  1TME 1;  3NNG A;  4BQ5 A;  3K46 A;  1XE0 A;  5BXX A;  5LCW L;  2PLV 2;  2XR4 A;  5CVR A;  1AR7 3;  3FLP A;  3J4U H;  3VZK A;  2C24 A;  4L2N A;  5DZE A;  2VXJ A;  5A7O A;  5FY4 A;  1JZ4 A;  1WD4 A;  1BZW A;  4HOO A;  3ILF A;  4BPZ A;  1YYN A;  2ARC A;  1PK6 A;  4JX0 A;  2ZHK A;  4Y5Z 0;  2R06 1;  4CP9 B;  2RS5 2;  2WAB A;  4N53 C;  1QXJ A;  4QD2 A;  4LIV A;  5I93 A;  1QJY 1;  3O7O A;  1TME 2;  1PIV 1;  4FPE A;  4EWE A;  1R09 1;  1YFU A;  1A6C A;  3ACH A;  4KWJ A;  4HN0 A;  3ACG A;  3P6B A;  4Q4V 3;  1IS4 A;  3PUR A;  5K4L A;  3UT0 A;  3MDP A;  1UY1 A;  5J96 B;  2EA7 A;  5C4W C;  2WII B;  1QWR A;  1HRI 3;  3ILR A;  2RS1 3;  4NHL A;  4UFJ A;  4XIL A;  1F9K A;  3AYE A;  1GUI A;  5EHD A;  5FZ3 A;  4S2F A;  3NST A;  2XJP A;  2IXK A;  3KCX A;  1YFY A;  1NZI A;  2D40 A;  2VG9 A;  4UW4 A;  2XUE A;  3OOX A;  2ET7 A;  2R06 2;  2XVG A;  5FY7 A;  1GLH A;  2A6V A;  2IVJ A;  5FCC A;  3OGV A;  1GP5 A;  1QJY 2;  2WNV B;  2PAE A;  5C6C A;  2ZEX A;  5H9S A;  1R09 2;  3NV2 A;  4MLO A;  1AR6 3;  1HV0 A;  1UYY A;  5E88 A;  4BE3 A;  1V9U 3;  4BK5 A;  3MUZ 1;  4QPI A;  5F5Q A;  3FX3 A;  5EJ1 B;  3IDC B;  3VBF B;  4CVU A;  5A3W A;  1TMF 1;  2VCA A;  5HCF A;  3LZZ A;  2P3I A;  2BPA 2;  3T0A A;  1AX2 A;  3KB5 A;  3WW2 A;  1ZA4 A;  2BGO A;  2WA3 A;  4YFW A;  4A4A A;  4I0A A;  2JDP A;  4QKB A;  2E7Q A;  4J1W A;  4X8N A;  5JMO A;  2Y38 A;  1JUH A;  5DUV A;  5FWE A;  4LBQ B;  4DUX A;  2OPW A;  3PUQ A;  5FZF A;  3ZIW A;  4IET A;  1XND A;  4JVA A;  5LB6 A;  1QY4 A;  1YLL A;  4WM8 A;  4ZS2 A;  4L99 A;  3UK9 A;  1DLL A;  1VB2 A;  4ZU7 A;  2E9Q A;  4EN6 B;  2BFU S;  4CEY A;  3NJY A;  4NID A;  4PLN A;  1TMF 2;  1IHM A;  3N3H A;  4GZ9 A;  5DN2 A;  1LOA A;  3OGR A;  2W3J A;  4D6R A;  4IE7 A;  4MGI E;  3O0V A;  3M3O A;  2ZX3 A;  4PLO A;  2LUW A;  2NPI A;  4NOT A;  1EY2 A;  4OHW A;  3GBW A;  4AG4 A;  3NAP C;  2JKX A;  1QXR A;  1VBE 2;  2RVA A;  4OFG A;  2XML A;  1AX1 A;  2PFW A;  2XJU A;  4GJZ A;  4A6S A;  2WS9 1;  1Z7S 1;  2CYF A;  3H1Y A;  1GZT A;  2I07 B;  2WA4 A;  2ZHM A;  5KHG A;  2JWP A;  4JAA A;  3TWI A;  4KWU A;  5JZG C;  1BQP A;  1ND2 A;  4KNC A;  2Y0I A;  1S0J A;  4IV1 C;  3I2K A;  2EID A;  5KBF A;  2VMF A;  2E26 A;  2EXI A;  4ERO A;  2WZR 1;  1IQA A;  4GWM A;  1J3P A;  2XQX A;  3OPW A;  4YGE A;  4YPJ A;  1LUL A;  1QDC A;  1R08 2;  3JBG 3;  3R0R A;  3S6P A;  5AFE A;  2JXA A;  4RHV 3;  3O1V A;  4Y1U A;  3TEX A;  1Y4W A;  2AR6 A;  3WDV A;  4A6O A;  4LOR A;  3KS7 A;  2WS9 2;  1Z7S 2;  2ZX2 A;  5LBE A;  2AC1 A;  1R64 A;  2VZ1 A;  1DQ5 A;  4CU9 A;  2BYV E;  4Q27 A;  5A7P A;  3ROU A;  1EUT A;  1UD1 A;  1R1A 3;  4QT6 A;  4YVS B;  3ENR A;  2E32 A;  3ALQ A;  2JEN A;  1L7R A;  5FYS A;  1F2N A;  2WJS A;  1W6O A;  4UYB A;  2WZR 2;  3RI8 A;  1NUK A;  4K9S A;  2JG9 A;  4Y1Y A;  3S7E A;  4XOG A;  4FPC A;  3T08 A;  3WF1 A;  3I2I A;  1PM4 A;  3HQR A;  4QQ2 A;  3LDR A;  4MVT A;  1RUH 3;  4B7E A;  2W68 A;  2BP6 A;  1SHW B;  3B69 A;  5BY5 A;  4DXS A;  1S0E A;  1UOJ A;  3W21 A;  1OVP A;  2EXH A;  5FZO A;  4QX8 A;  1OQD A;  1VBB 3;  4JKK A;  3NNM A;  2LRP A;  3I2D A;  3N7L A;  3FJS A;  3VKN A;  3NKG A;  2HH9 A;  3LA2 A;  4AFC A;  4S2H A;  3N35 A;  2QBX A;  1I6X A;  2VL4 A;  3WQ1 A;  1DFQ A;  3J7L A;  1XOY A;  5IK8 A;  4QM9 A;  3WG1 A;  3V64 A;  4HPK A;  5AVP A;  1C1L A;  1UWW A;  3FZ3 A;  1TEI A;  4PJY A;  3R4D B;  4NMI A;  3WR0 A;  3HNB M;  3O0X A;  3N9L A;  3ZLI A;  1V70 A;  3HMY A;  4WVZ A;  5T50 A;  1QJX 1;  2VAU A;  3GYD A;  1RJ8 A;  2XBO 2;  1RUO A;  4OLL A;  4K6B A;  4ZHN A;  2QZ3 A;  1A78 A;  3TN9 1;  5A3P A;  1NOV A;  4CDU A;  4OQ9 A;  1OFN A;  4XFI A;  4RFR B;  4BDV B;  1LOG A;  2P6H A;  4NRO A;  1OXC A;  3B5L B;  1CAU A;  4XAB A;  3A0N A;  3I59 B;  4AHX A;  2SLI A;  3WF2 A;  3ZXL A;  4AQT A;  3RZK A;  2CU5 A;  1UX6 A;  4OVE A;  3KD4 A;  1PVC 1;  3HNM A;  3P3P A;  4CPB D;  4AAX A;  2QE3 A;  5C8C C;  4AED B;  1QJX 2;  1S1A A;  5T5J A;  5FJK A;  2BER A;  3V56 A;  5A3L A;  4TZD A;  1HRV 3;  4AZZ A;  1ST8 A;  2D97 A;  2P2K A;  3TN9 2;  4Y24 A;  1LGC A;  3WF0 A;  1W99 A;  4JDO A;  4KWK A;  4JGY C;  4PBO A;  2PLV 3;  3PDQ A;  4C1W A;  2HLE A;  4XIO A;  5A7W A;  1CON A;  1AXY A;  1OPO A;  1MEC 3;  3VBR B;  3IMN A;  1LOD A;  3ATG A;  3C3V A;  1ASJ 1;  4D7T A;  1O3S A;  5LRR A;  1H4G A;  1H8T B;  1AL2 2;  1PVC 2;  1CAV B;  4BQ2 A;  4LR4 A;  2RS5 3;  2PHL A;  1OOP C;  5FYB A;  1YC6 1;  1TME 3;  2FCV A;  2W9X A;  3AVS A;  5FOB B;  4HFS A;  2VMG A;  3GHN A;  4XAA A;  1F4A A;  1DGL A;  4FTE A;  1AJK A;  3TNQ A;  3R4U A;  3H8O A;  1W8U A;  4Y5S A;  5LZ6 A;  4KG0 A;  4N43 C;  2QJV A;  2QKD A;  2EAK A;  4D0Q A;  4G9S B;  2QQJ A;  1ASJ 2;  3JD7 1;  1OA2 A;  1GBG A;  4FQZ A;  4FPL A;  1BVV A;  4SLI A;  1W0O A;  2R06 3;  5FZC A;  1VE0 A;  4Y22 B;  4E9K A;  1QJY 3;  1ZYB A;  4GH4 A;  4YW4 A;  1PIV 3;  3P1I A;  5A32 B;  1H0B A;  2H0B A;  4QB6 A;  2WZ8 A;  1WMD A;  1UZY A;  2PAM A;  2V5D A;  2XDV A;  4IV3 A;  5FQ0 A;  3Q9O A;  4IEP A;  1ENX A;  4NIG A;  4RGA A;  2DCY A;  3SEE A;  3BIE A;  1RUC 1;  4ISQ A;  4CXY A;  3USU A;  1DYP A;  3B00 A;  1JW6 A;  1WW4 A;  4K7J A;  4CDQ B;  2E6V A;  3JD7 2;  2FDJ A;  1VP6 A;  3H50 A;  1ZRI A;  1ULD A;  1UOB A;  1LOF A;  4TWT A;  1V00 A;  3S5Q A;  2WN3 A;  4CCM A;  1CZS A;  1Q8P A;  2HWD 1;  1U5Y A;  1COV 1;  1MS1 A;  3WHU A;  2VCC A;  2W52 A;  5T54 A;  4QDR A;  2CGP A;  1SBF A;  1JYT A;  1WMX A;  4JGZ B;  2ZHL A;  4FP3 A;  3ZFE A;  1W2O A;  5EIY B;  3VBO C;  4GB3 1;  4PI0 A;  1DQ1 A;  1RUN A;  4RS5 B;  1RUC 2;  3PUH A;  2FMY A;  1V6M A;  4DNY A;  3ZXD A;  1E5R A;  2ZX1 A;  4LOS A;  1ZVF A;  4EJR A;  1TMF 3;  4MGQ A;  1LEM A;  5D8A C;  1APN A;  1LRH A;  2VY0 A;  4KGG A;  3OSD A;  4PF5 A;  1NA1 B;  4Y5T A;  3X29 B;  4V2W A;  1ACC A;  5FUI A;  3IDB B;  1A8M A;  1UMI A;  2CV6 A;  3IT8 A;  1COV 2;  3PNA A;  4B1L A;  4B8E A;  2FDF A;  1W06 A;  1ODN A;  4TYS A;  1JS9 A;  4XTP A;  3VDA A;  4CUG A;  1FMD 1;  1N1V A;  2DVG A;  1YO8 A;  2ATF A;  2E31 A;  4GB3 2;  1LB2 A;  1HX6 A;  1DP0 A;  2IXH A;  5JAX A;  1W8F A;  3SIS A;  3WG3 A;  1BMV 1;  1AVB A;  2UWC A;  1Q8O A;  2FZ1 A;  2WNV A;  1UZ0 A;  3VZO A;  5JSR A;  4IXL A;  4CEW C;  1ZZC A;  5L36 A;  2JDM A;  4LKE A;  1FXZ A;  4MUV A;  4AXO A;  2WS9 3;  1Z7S 3;  4O65 A;  1WBL A;  2HYK A;  3HR9 A;  3VBF A;  2JEC A;  2GDF A;  2LAL A;  2FCU A;  5JXJ A;  1C3H A;  5AVA A;  4A7Y A;  5KHK A;  4AL9 A;  3AZY A;  1UF2 C;  1BMV 2;  2WN2 A;  1H1M A;  2X10 A;  3JZV A;  1NCQ C;  2HEW F;  2WZR 3;  1WD3 A;  2LRO A;  3ITQ A;  3LQC A;  4NHX A;  4D94 A;  2VNV A;  1LCL A;  2XJR A;  3EB7 A;  4RGG A;  2VQA A;  2F4P A;  4XCB A;  5A70 A;  4P02 B;  1RUG 1;  3GXU A;  4HBN A;  1E5H A;  2D6O X;  4CTE A;  4AI1 A;  2Q4S A;  2ZGP A;  2O0O A;  3HWJ A;  1SLI A;  2WIN B;  3MO4 A;  4XTM A;  5FK7 A;  5IK7 A;  4LT5 A;  4XQW A;  2ZEY A;  3HN1 A;  5LA1 A;  1W2N A;  2O8Q A;  4Q4Y 1;  3I3B A;  3WG4 A;  2R04 1;  1DG6 A;  2HEV F;  3OY8 B;  2Y60 A;  5FPB A;  4MYE A;  4CDW C;  1Y9G A;  1JOJ A;  2VUL A;  2WSU A;  3B3Q E;  2ORX A;  4ONU A;  4WM7 A;  4W4Z A;  4IEQ A;  3PIG A;  1O4Y A;  4OCT A;  1MS4 A;  1FOD 1;  1JMU B;  1O5U A;  2F4L A;  3BTA A;  4WZC A;  2F6B A;  4CRQ A;  3DEC A;  4LA2 A;  2VBD A;  1K5M B;  1PGW 2;  4XHB A;  3NRU A;  3ETQ A;  1XU2 A;  3LB9 A;  4UT5 A;  3KSC A;  2RMU 2;  3JB4 C;  2D3R A;  5HCH A;  3OYW A;  4RQP C;  1UU5 A;  2D6M A;  4CU8 A;  3MIG A;  1US2 A;  3VLB B;  4XBQ A;  1NCR B;  2D98 A;  2E7A A;  2WZE A;  3DPR A;  4QPG B;  4Q8K A;  4Z2W A;  2ZPX A;  5FLI A;  5FXV A;  3T30 A;  1DGW X;  2K46 A;  3V0B B;  5A1L A;  1FOD 2;  2VE1 A;  1P8J A;  2CDO A;  3FFZ A;  4L9B A;  5F39 A;  4ZY9 A;  3BOD A;  1FPN 1;  2D6N A;  4YZ4 A;  4MGK E;  4LKS A;  2G9Z A;  2Y33 A;  3POG A;  1QNW A;  3OUI A;  4AHW A;  1ENS A;  5FO8 B;  3AKT A;  2OYZ A;  3PTY A;  1DGW A;  1PO1 1;  5JCT A;  1UO9 A;  2GAL A;  1QGL A;  2ARX A;  1ZZ9 A;  3UJO A;  5BNN B;  5DMY A;  3TEZ A;  4CCC A;  4AGV A;  1UW8 A;  3SXW A;  5IK4 A;  2EIC A;  2VZV A;  1N3O A;  5C3S A;  4QX1 A;  1FPN 2;  1PVC 3;  2XJV A;  2BBA A;  3LPG A;  3ZYR A;  1GFF 2;  1RHI 1;  3CBN A;  5J09 A;  2W1Q A;  2DWR A;  4L92 A;  4MXV A;  3IDE A;  4GJY A;  1EAH 2;  3DL3 A;  4U36 A;  5EQU A;  1PO2 1;  1CD3 G;  1RUJ 1;  1PO1 2;  1SMV A;  5FRE A;  3Q8A A;  1IS6 A;  2R1B A;  3WDT A;  3ZSJ A;  2R0H A;  4EWA A;  3BCW A;  2ZOE B;  3HOB A;  3U4S A;  4IEY A;  4DRV A;  5F5A A;  2PHW A;  1YXW A;  1KIT A;  1HXS 1;  3H1M A;  2ZGO A;  3WOG A;  1RHI 2;  5LBC A;  3IPV B;  2IWG B;  1B09 A;  1X33 A;  5A33 A;  3BTY A;  1PK6 B;  4FVV A;  2TEP A;  3VKM A;  4XDQ A;  3BPS A;  1VRB A;  1PO2 2;  1D7P M;  3I2H A;  3I59 A;  5EV7 A;  1WCU A;  4XF9 A;  2XWB B;  2GN7 A;  1W6Q A;  2HWC 2;  2YGM A;  5FZ9 A;  3S0M A;  1DLC A;  1JOD A;  3JD7 3;  4CEY C;  4I09 A;  3IAQ A;  1MQT B;  4BK4 A;  1UX7 A;  4P5Y A;  3O12 A;  3B9C A;  4XBL A;  2G9F A;  2DCJ A;  2XLG A;  5HV0 A;  4A2U A;  4LO7 A;  3T1M A;  1PZ9 A;  3AZW A;  2GH2 A;  4WVV A;  3TNP B;  3W9A A;  3THC A;  3CZJ A;  3NKT A;  2J7M A;  2VGD A;  1RUC 3;  4Q0Q A;  5FZ1 A;  5C9A C;  1ODM A;  3GJA A;  3LPF A;  1JHN A;  3VL9 A;  4XDO A;  3ASI A;  1CAV A;  3TRS B;  3FE5 A;  1ND2 C;  2VQU A;  2P17 A;  4QPI B;  3IBM A;  3RDI A;  4AEK A;  1SZB A;  3JUU A;  4L97 A;  2J42 A;  3T2Q A;  2LTN A;  2BDR A;  2WNU C;  4HSL A;  3O0W A;  1J83 A;  3BUC A;  2HWD 3;  2WWS A;  3ES1 A;  1AYN 1;  2R6Q A;  4AYU A;  2RDR A;  2BJS A;  3RRD A;  5FYI A;  4Q4V 1;  1ND3 A;  1YJK A;  4GB3 3;  4XDP A;  3SQO A;  4NIH A;  3WF3 A;  4AE2 A;  5FMB A;  1HRI 1;  1DQ0 A;  4HG6 B;  2BNO A;  4WM8 B;  3KT1 A;  1UQX A;  3ZFG A;  4AVC A;  1AF9 A;  1HQN A;  5A32 A;  1SPP A;  3VBU A;  2A73 B;  5IVY A;  4CSW A;  5I0U A;  4PHZ A;  3WF4 A;  3OF1 A;  2JG9 C;  3G7D A;  5F3E A;  2UYA A;  4LLO A;  3UKT A;  3WHT A;  4WVW A;  1AYN 2;  4JV4 A;  1FMD 3;  2VZO A;  4Z8B A;  2WQZ C;  4Q4V 2;  4BQY A;  3KZ4 C;  5A80 A;  1OD5 A;  3IDA A;  4XFG A;  5IFT A;  4LBQ D;  1JYX A;  2BVB A;  1K42 A;  1QNY A;  1HRI 2;  3L2H A;  5SV8 A;  2RS1 2;  1K5J A;  4IES A;  1HQL A;  1SLT A;  4R9A A;  4NHY A;  1UAI A;  2AUY A;  4AVB A;  2ZAB A;  3N36 A;  2OXB A;  3AM2 A;  1N1Y A;  4QHO A;  1I5Z A;  2J1E A;  3SC7 X;  5C3O A;  2JD4 A;  4RS5 A;  3AL5 A;  4Y20 A;  5FPX A;  3ZO0 B;  2D6P A;  3LOI A;  1N1S A;  3BOW A;  4HMZ A;  3A0K A;  3INA A;  5J98 B;  2JB4 A;  1AR6 2;  1JYV A;  2R7E B;  3RZZ A;  1XYN A;  4GWN A;  4WVM A;  1V9U 2;  3AMQ A;  1DQ6 A;  4IGO A;  1B35 C;  2OZJ A;  3RG0 A;  5A3M A;  5DAP A;  1O3T A;  1BLZ A;  1NE4 A;  4KU8 A;  1NG0 A;  2XG3 A;  3A22 A;  2GU9 A;  4QXK A;  4XJA A;  4A3X A;  1YQ8 A;  4BME A;  2VC9 A;  3ES4 A;  2JIG A;  5FRA A;  5HXM A;  5FFO C;  2CDP A;  1RUG 3;  5FTT C;  4P9X A;  4B29 A;  1HQW A;  3RZM A;  1UXZ A;  2VVF A;  2BFU L;  4NO4 A;  4QB1 A;  2D43 A;  3K3O A;  3ZYF A;  5FIX A;  3DKW A;  3E6D A;  4EV0 A;  2Y6G A;  3ZXK A;  4DUW A;  4YM3 A;  1NY7 1;  4BB3 A;  5C5T A;  1OUS A;  1HB2 A;  4TTG A;  4Q4Y 3;  4PDW C;  2Q8C A;  1M06 G;  5IHR A;  2R04 3;  5FZO B;  2ZGQ A;  1QH7 A;  1MS5 A;  4D7S A;  4YZ3 A;  4HN1 A;  4JZR A;  3JBG 1;  1G86 A;  2WLP A;  3J9S A;  1FOD 3;  2RE9 A;  3C7O A;  3D0J A;  4M3C B;  5DDJ 1;  1AJO A;  4BWO A;  2ZJC A;  5GJ6 A;  2BGP A;  4HPK B;  4PQQ A;  1CAW A;  1NY7 2;  4O9E A;  1SFN A;  1N1T A;  4W50 A;  4WBB A;  1D0G A;  3VBH A;  3UYJ A;  3WCS A;  2ZKN A;  3CJI C;  3VKF C;  2VCB A;  5FPZ A;  5KHJ A;  2DUP A;  4UW3 A;  3I2G A;  3B9I A;  3H3Z A;  2B9U A;  3JBG 2;  1V6N A;  2GND A;  3I3E A;  4XAC A;  5C33 A;  3N7K A;  4CDU B;  2VVE A;  1LEC A;  2ZBJ A;  1Y7B A;  5FAX A;  2W2I A;  5FZG A;  1BCX A;  5ABJ B;  2IZW A;  1JYN A;  5EYY A;  2ZGN A;  1FPN 3;  5IT6 A;  1CAU B;  1UPI A;  2VME A;  1SLB A;  4C90 A;  2BW8 A;  4Q26 A;  2XPJ A;  4MG2 A;  2VR4 A;  3RPQ A;  4Q8L A;  1R1A 2;  2NMN A;  4JQT A;  1TE1 B;  3M8L A;  1ZBA 1;  1PO1 3;  1RUE 1;  5FK8 A;  3NW4 A;  2B45 X;  4FFI A;  5I8Y A;  3WNN A;  2W1U A;  2WT0 A;  4H3W A;  4Q2F A;  5BPX A;  3WUC A;  4A3Z A;  4BLJ A;  1FI2 A;  2CY6 A;  2VTF A;  5E1R A;  5IVJ A;  1OSG A;  3AVR A;  4QB2 A;  3BKZ A;  5FPA A;  1ZZ8 A;  4QX3 A;  3H8R A;  1YJL A;  1V6J A;  4PIZ A;  1RHI 3;  1JH5 A;  2WWJ A;  1VBB 2;  3C8X A;  4M3C E;  1QOT A;  3AP6 A;  3VBS C;  4P5H A;  3OUH A;  4LHK A;  1NCR A;  4MAD A;  5FLJ A;  3O1P A;  5FYZ A;  2VNO A;  4BQW A;  3LAG A;  1G9F A;  1VRH 1;  1RUJ 3;  1LTE A;  3K4A A;  1GP6 A;  3MI8 A;  4AVS A;  2OZ6 A;  4D3W A;  1JI6 A;  1QH6 A;  2GP5 A;  1G6N A;  1VB4 A;  2IXL A;  3RQ0 A;  5A3U A;  5FPV A;  3A4U A;  2GZW A;  5F5C A;  4IEX A;  5FMO S;  4QX5 A;  4HL0 A;  3K77 A;  5DG1 A;  5C70 A;  1HXS 3;  5FZ0 A;  1AR9 3;  4Y4Y A;  3RS6 A;  2K9Z A;  4FP2 A;  1HRV 1;  2RDN A;  4Q0V A;  3SCH A;  3KQR A;  4H2A A;  2H0V A;  1VRH 2;  1FAT A;  4HXC A;  3I2J A;  4GH4 B;  4BIO A;  2WO2 A;  3R6S A;  2ZGM A;  4KMQ A;  2NQY A;  4IV3 B;  3GCX A;  5FQ0 B;  1UY0 A;  4RFT 0;  2ET1 A;  5FKC A;  3FBY A;  2YU1 A;  4A7Z A;  2JE8 A;  4CCO A;  1YUD A;  1LHW A;  1NT0 A;  2Q5T A;  3T2T A;  1KFU L;  4M4R A;  2QQL A;  2VU9 A;  1HRV 2;  3H8X A;  3PME A;  2QCS B;  4IUG A;  1VBC 1;  4NVP A;  3VBF C;  2R0F A;  4Z92 B;  3J8F 1;  1EV1 1;  2YC4 A;  3ZFE B;  1MEC 2;  3HJR A;  3ACF A;  1IKP A;  3MPP G;  2P37 A;  3IPV A;  4PF1 A;  2WWU A;  3MLJ A;  2E53 A;  4XFB A;  1OVS A;  2UU8 A;  3H1W A;  1RUF 1;  5I8S A;  3I4I A;  3SH5 A;  1HB4 A;  1XSQ A;  3AZV A;  2OII A;  2DTW A;  5JSP A;  1AYN 3;  4QGN A;  5A6Z A;  3VZM A;  3OBA A;  3AKQ A;  4MHU A;  3ZFF C;  3III A;  5FP7 A;  2J22 A;  3I3D A;  1U12 A;  3PHM A;  1MQT A;  2B7Y A;  3J8F 2;  5DAB A;  1EV1 2;  4AR2 A;  1NQD A;  5CKM A;  4XJZ A;  4CCE A;  4ES9 A;  5GKA C;  3MID A;  5JOZ A;  2Y6K A;  4PIY A;  4YG6 A;  1OKO A;  2W08 A;  2E63 A;  4R4X A;  3AL6 A;  3CQO A;  3OEB A;  1RUF 2;  3RYK A;  2IUW A;  3AZZ A;  3ZYB A;  1O59 A;  1PIV 2;  1OBN A;  3KHC A;  1OF3 A;  2VMI A;  2HKX A;  2J1V A;  2YGL A;  1BVP 1;  4COY A;  2QQW A;  4AI3 A;  1RGS A;  3U75 A;  3S5A A;  2ZS6 B;  3AFK A;  2UYB A;  1XYP A;  4GMP 1;  4O61 A;  4ARX A;  4DEV A;  4F3J A;  5FOJ B;  1O6U A;  4CDQ C;  1WZX A;  2PN5 A;  5IJR A;  5A7Q A;  2Z5W A;  4XMA A;  2C9K A;  4L0P A;  1WME A;  3DKQ A;  1LGB A;  4NPM A;  1LEN A;  1WW6 A;  4FFH A;  4BA6 A;  1QKQ A;  2GC3 A;  2VW0 A;  3D4K A;  2FDK A;  2XHK A;  2KM2 A;  1H2L A;  4AQ6 A;  1GZC A;  2VH9 A;  2XQR A;  1POV 0;  4YVS C;  4XUT A;  1AHS A;  4JHZ A;  5IVF A;  3C7E A;  4UW6 A;  2D6K A;  1IG0 A;  3MEP A;  4LIU A;  1ULO A;  3QCW A;  4AI8 A;  3WDX A;  5FYC A;  3DF0 A;  5KXC A;  1D4M 1;  1UXX X;  3KQ4 B;  4QXC A;  1W39 A;  1YWK A;  3VDC A;  4CU6 A;  1MS8 A;  4QPY A;  4D69 A;  1S4C A;  4BYY A;  2NN8 A;  3FN9 A;  4N53 B;  4WM7 B;  3WDY A;  4N9H A;  4C0H A;  4CCJ A;  3CLP A;  1RB8 G;  2JDN A;  2YMZ A;  4FQ4 A;  3FWE A;  1O4T A;  2GNM A;  1S0F A;  2PEL A;  1H1I A;  2CWS A;  2WNO A;  1WWY A;  3MW4 A;  5M0T A;  1ZRC A;  2X29 A;  4JCK A;  3OYW B;  4E2Q A;  4M00 A;  3DYO A;  1D4M 2;  2B46 X;  3CO2 A;  4NHM A;  2AZ5 A;  3WXP A;  2XLA A;  1HLC A;  5DDJ 3;  4COW A;  5LY1 A;  3DPR B;  4FTS A;  1YFW A;  3NL1 A;  2A71 A;  3ZPO A;  2XJT A;  5ANN A;  5CFC B;  1WLD A;  1YIP A;  3M70 A;  5HV4 A;  2VUC A;  3J7H A;  3LDB A;  1ONA A;  1CPM A;  4X6Q B;  2FBE A;  4CXX A;  4FI9 A;  3SCF A;  1SLL A;  2W91 A;  4FPH A;  3LEK A;  1DQ2 A;  1J59 A;  1MVE A;  5DUU A;  3CL1 A;  2VZQ A;  3B94 A;  4AF9 A;  5KR7 A;  4JC1 A;  1W2U A;  3HT1 A;  1VBD 1;  4C8D A;  4AED C;  2MHF A;  2DUO A;  4ITC A;  4J25 A;  2K2S A;  5GLW A;  4ZKT B;  5BNP B;  4OHX A;  4B1M A;  4XFH A;  3VDD A;  4QDS A;  1WCK A;  4KBZ A;  5DZF A;  5B2G B;  1ZBA 3;  1BK0 A;  1RXG A;  4CU7 A;  3VBR C;  1RUE 3;  4M3C A;  1IQD C;  2PHD A;  3AP5 A;  3AX4 A;  2VMC A;  3O5S A;  4AGR A;  5L7O B;  3O1M A;  3ZMO A;  1H8T C;  2QQV A;  3SCG A;  1LHN A;  1YI7 A;  1LKN A;  2ZCW A;  1YQ5 A;  1URX A;  3SLI A;  3HN3 A;  4P9I A;  3UL2 A;  1A34 A;  2VXR A;  3GZA A;  5A1A A;  4W65 A;  4ZU4 A;  3SKJ E;  4QHZ A;  3UGH A;  2WLQ A;  2VOX A;  5GZC A;  1VRH 3;  1WKY A;  3WSO A;  3ZSE A;  1JZ6 A;  5A33 B;  1DIW A;  4W6W A;  4FCA A;  4BM8 A;  5IVB A;  4LBN A;  3WQB A;  5ABJ A;  2ILM A;  5CKN A;  4FXG B;  4LBO A;  3GZU C;  3PJY A;  1JOB A;  4K8R B;  1DYK A;  1GNH A;  1SCR A;  1YFX A;  3K48 A;  4L8Q A;  1ULG A;  4NWV A;  4U2A A;  3AMH A;  4QX7 A;  4W8J A;  1W6Q B;  4AI9 A;  1JHJ A;  4RR3 A;  1WLT A;  5BNO B;  3JQW A;  5HI0 A;  5DQ0 A;  4CCD A;  1G7Y A;  3JU9 A;  4RD7 A;  3WLU A;  3KWV A;  4ET7 A;  4DOU A;  1X9P A;  1OUX A;  3HNY M;  4NR1 A;  3ZN4 A;  3WP4 A;  4CUC A;  2NP0 A;  1HV1 A;  3WQ0 A;  1EUU A;  2WAO A;  1OH3 A;  3PMS A;  4YSF A;  2IFR A;  4QU1 A;  4E4H A;  1NQJ A;  4E2S A;  3SH3 A;  5AC9 3;  5DXD A;  3VUO A;  4TSV A;  2WKK A;  5A6X A;  5FYH A;  4N8M A;  4COU A;  2BOI A;  3LFM A;  1J3R A;  4CXW A;  5A3N A;  5LBF A;  2JIC A;  4LUK A;  3E5U A;  4HVO A;  4JGZ C;  5KWR A;  3D82 A;  1OPM A;  4RS5 C;  5F3G A;  2QQN A;  3MGU A;  1VBC 3;  2VZT A;  3MIH A;  3R05 A;  1FNY A;  3OJB A;  4NPL A;  3O1T A;  2FDG A;  1T2X A;  3J8F 3;  4FAH A;  1EV1 3;  4A44 A;  1ND3 B;  4NRQ A;  3KF5 A;  2YFU A;  2ZMK A;  3NQH A;  5BV6 A;  1QJU 1;  1LED A;  1PNG A;  5LY2 A;  1NA1 C;  3ZDS A;  4BLI A;  3VGI A;  3O1S A;  2D7F A;  4JDM A;  3NV1 A;  2H6B A;  4M0H A;  4YVW C;  2PHX A;  1RUF 3;  1FAY A;  1GWL A;  2BWA A;  3KT7 A;  2CL2 A;  3ZFG B;  4C91 A;  1HN1 A;  2VPV A;  1QOO A;  1SPP B;  2B4K A;  3PUS A;  2VOW A;  2MEV 3;  2BGC A;  3VBU B;  1UZZ A;  2DBI A;  2Y6L A;  3PIJ A;  4UF0 A;  5FZ8 A;  5LA9 A;  2OKX A;  5CU1 A;  5JPM B;  1XQN A;  1HJF A;  1CGP A;  4Y1Z A;  3M4F A;  2WYS A;  1POV 1;  2YUE A;  3CU7 A;  1C5H A;  4GD4 A;  3CZU A;  4KWL A;  4MX3 A;  2BNM A;  4QWN A;  4SBV A;  3VHN A;  5FR3 A;  5I91 A;  1ZRF A;  1QJU 2;  1ULE A;  1TZO A;  2WL1 A;  3P5B A;  2ADE A;  4IEU A;  2XKO A;  5EZW A;  4HET A;  5C3Q A;  4GA9 A;  3V65 A;  5JIA A;  1RXF A;  2RR1 1;  4AFA A;  2OPK A;  1UN1 A;  2Q30 A;  3PVE A;  4YM2 A;  4GWI A;  1K3I A;  3BPZ A;  1VLN A;  2QZ2 A;  2X5I B;  4GAL A;  5E89 A;  1JOP A;  1W0N A;  5C8C B;  4Y20 B;  2WO3 A;  1CQ9 A;  4GMP 3;  3T0D A;  5TSW A;  1JYC A;  4YGC A;  1CZT A;  4WVM B;  4HVR A;  2YV8 A;  4CA9 A;  4DEQ A;  2HJI A;  4XFA A;  4FFG A;  1NX9 A;  1PX3 A;  5GLU A;  1DCS A;  2RR1 2;  2ZKL A;  2W46 A;  4UWD A;  5K0U A;  5ACA 1;  2HWD 2;  2VVD A;  2DTY A;  3LE0 A;  1W6P A;  1W8N A;  1W8H A;  1WCQ A;  2JG8 A;  2XH6 A;  1UIK A;  1VIW B;  2RDS A;  1OC1 A;  4P9L A;  5A7S A;  1J58 A;  4L11 A;  3WCR A;  3ZDV A;  2IFW A;  4JRA A;  3POE A;  4K8F A;  1PGS A;  1V6L A;  1XNK A;  2BZD A;  3OD0 A;  5KXE A;  2TBV A;  2WNE A;  1MS9 A;  2QNK A;  5F9T A;  2WBK A;  4YZ1 A;  3LEG A;  2JD9 A;  3N9M A;  5ACA 2;  1D4M 3;  3BB6 A;  1D4V B;  4RA0 A;  4TLG A;  5J37 A;  1D2Q A;  2RHP A;  1GSL A;  1K5M C;  4R52 A;  1FMD 2;  5GAL A;  3NV4 A;  2YPD A;  2YXS A;  4N90 A;  5FZL A;  3I7D A;  1NLS A;  1Q43 A;  5LAS A;  2OUH A;  1MAC A;  4X8P A;  1MVQ A;  5F2W A;  3AMM A;  5I0T A;  1C4R A;  2Q8E A;  1CAW B;  1NCR C;  4IER A;  4QPG C;  4DY3 A;  3E5X A;  5JXI A;  1W9W A;  4V1P A;  3VBH B;  1GR3 A;  1PNF A;  2RJ2 A;  5F7U A;  5HCA A;  1GQH A;  2VQT A;  3C7F A;  5LAT A;  2Y34 A;  4YYO A;  2VMD A;  4UOJ A;  2OT7 A;  4UFI A;  2Q0A A;  1U5Z A;  4EN8 B;  1FV2 A;  2E7T A;  1LGN A;  4XUP A;  2ZAC A;  1J1L A;  1K45 A;  3LGR A;  4PIX A;  2WQ4 A;  3A23 A;  1CN1 A;  5FZM A;  3K3N A;  3ACI A;  2HWF 1;  3J26 N;  1EP0 A;  1S55 A;  1W3V A;  1V0A A;  3FHQ A;  5FY9 A;  4C0B A;  4EN0 A;  1KDM A;  5KXD A;  3VDB A;  2JDY A;  4QKN A;  3K51 A;  5BNN C;  5LA0 A;  3ZVX A;  4FO9 A;  5LK7 B;  3RGB A;  1NXM A;  5FO9 B;  4N53 A;  5EJ3 A;  3MBW A;  1RUG 2;  2DCT A;  5C5U A;  5FYM A;  3W20 A;  3BTZ A;  1KXG A;  1S0D A;  3Q8F A;  1VBD 3;  1GYK A;  4KI5 M;  1XE7 A;  3T3Y A;  2BVV A;  3GNE A;  3N9N A;  3NVC A;  5GLZ A;  2C0Z A;  2ETE A;  1H2N A;  1H9W A;  3L9J T;  2HWF 2;  4Q4Y 2;  2VTX A;  2ZZJ A;  2R04 2;  1R1Z A;  3RFR A;  1O5L A;  5ANQ A;  1FX5 A;  1W28 A;  1GKB A;  4HK9 A;  3O1U A;  1POQ A;  4IEO A;  4ISR A;  2DV9 A;  2XB6 C;  5CEH A;  1WCD J;  3M3E A;  3UKN A;  2DVB A;  2QVS B;  5CFC A;  1WA4 A;  3LIH A;  4D6Q A;  3RZL A;  4N7U A;  5JSO A;  2LW8 A;  3KMH A;  1PK6 C;  4NIA A;  3WUD A;  5FYY A;  2WFP A;  1LU2 A;  1REF A;  1PMH X;  1S0G A;  1Z78 A;  1IZ3 A;  4Z82 A;  3HBZ A;  4I3G A;  2WT2 A;  3ZN5 A;  4OI0 A;  4KG8 A;  4IEV A;  5G04 L;  3HQX A;  1N3P A;  3DEM A;  2P3Y A;  2ZAA A;  3WW1 A;  4FPJ A;  2JE7 A;  5CFD B;  4XZP A;  3WZ1 A;  1MQT C;  2QQO A;  3ZYH A;  2ZHN A;  4NUB A;  4O7X A;  4XQD A;  4KU7 A;  4AHY A;  1IPS A;  2ERF A;  5BNP A;  3KLS A;  1GNY A;  2XVK A;  5HCB A;  2UWA A;  2ZML A;  1O91 A;  4LLF A;  5DUW A;  2DVD A;  1C8M 3;  4R8H A;  4XBN A;  4NRM A;  3GM8 A;  5H9Q A;  3BGA A;  4BMB A;  3AYC A;  3MIC A;  5L7O A;  2DDU A;  2PHF A;  3VD4 A;  2ID4 A;  2FDI A;  5C3P A;  2QQK A;  1RMU 1;  3LA7 A;  4LO4 B;  2YBP A;  4QPI C;  1JYI A;  2OQ6 A;  4OHY A;  4CP1 A;  2DUQ A;  4CP0 A;  2YG0 A;  5JI7 A;  2GP3 A;  2Y0O A;  3U78 A;  3UES A;  3GF6 A;  1ZRD A;  3EXU A;  5CB7 A;  5FPL A;  1AR9 1;  2P1B A;  1XRU A;  3KT4 A;  1YQC A;  5FMD A;  1H1A A;  1Q8V A;  4YAR A;  2Q1Z B;  1CJP A;  2PHU A;  3HT2 A;  1Q8Q A;  2G19 A;  4Y33 A;  1QJE A;  4FOY A;  4JRL A;  5GLV A;  1SLC A;  4IV1 A;  3T2P A;  2A6Z A;  4UI9 L;  1W05 A;  1RUJ 2;  3ZR6 A;  2JDZ A;  4Q0U A;  2ARB A;  2MNG A;  4PBP A;  5IAT A;  1W9Y A;  4WM8 C;  1RMU 2;  3FHA A;  4RQP B;  2Q1F A;  2R32 A;  4XIK A;  4A42 A;  4DPN A;  1D2S A;  1Q5O A;  2YDE A;  1AXK A;  1QJU 3;  1UPS A;  2JEM A;  2Z2S B;  3KV9 A;  5LEK A;  3HAG A;  5BNO A;  4FAG A;  3T2O A;  1HXS 2;  3I2F A;  2VD7 A;  1AR9 2;  4ATE A;  4MOA A;  1LR5 A;  4LUM A;  1W9T A;  4UBH A;  1LAJ A;  3PVO A;  4IE6 A;  1UOG A;  1JZ5 A;  3ZXE A;  2QUO A;  4XEZ A;  1JYW A;  3VHP A;  5KHI A;  1POV 3;  2GC2 A;  2WFF 1;  3MIB A;  1F5F A;  1WMF A;  1NKG A;  4ZON A;  3S30 A;  1H30 A;  4I2O A;  1EPW A;  3LCP A;  3N9Q A;  4COZ A;  3UGF A;  2RR1 3;  1J1T A;  1EPZ A;  4AVV A;  4YW6 A;  3RI9 A;  4HZF A;  1X8M A;  5IAV A;  1OT5 A;  5JIU A;  5JXH A;  1GZ9 A;  4K40 A;  5FYU A;  3N7J A;  4LBM A;  2WFF 2;  5D1I A;  2J1R A;  4JDN A;  4AW7 A;  2G1M A;  2WAA A;  4OMD A;  4YG3 A;  4B7K A;  4YFZ A;  1BHG A;  1KFX L;  2CAU A;  1UU4 A;  3OGG A;  4LKF A;  1F15 A;  1F35 A;  2W1W A;  4AQ2 A;  1LOC A;  1HDK A;  1W8T A;  5KXB A;  3DN7 A;  3E5Q A;  3H3L A;  5ACA 3;  3AZX A;  5F32 A;  1VAM A;  2XON A;  4MSV A;  3NNF A;  4BOW A;  2OS2 A;  2J1U A;  5C3R A;  5EWS A;  2E33 A;  5DPN A;  1W90 A;  1KGY A;  2GNB A;  1JTZ X;  3LA3 A;  4XUR A;  2WYF A;  1US3 A;  4Q1P A;  1RTV A;  1ZRR A;  4O9G A;  3NNL A;  4FPY A;  1JU3 A;  3NWK A;  4S2D A;  3UET A;  2ZEZ A;  2X09 A;  3ZSM A;  1UKR A;  3WY6 A;  4MXW B;  5CYY A;  4IGP A;  3AYA A;  1S2B A;  1CVN A;  1JU4 A;  1UMH A;  4XYX A;  3WD5 A;  1X36 A;  2X5I A;  1QIQ A;  2V4A A;  3LIG A;  1D0H A;  5C8C A;  3PVN A;  4XPV A;  2QDR A;  2GN3 A;  1CAX A;  3WEZ A;  1ULP A;  4K20 A;  1UYP A;  2VUD A;  3PLQ A;  5CKQ A;  3RJR A;  3WIN E;  1G9A A;  5FZ6 A;  4JGY A;  1F31 A;  3VKO A;  1I9R A;  4OMC A;  2J1T A;  3OBT A;  3Q8E A;  4LMF A;  2WDB A;  4AVT A;  1PVX A;  3KV5 A;  4S2G A;  5D2A A;  3OGS A;  3APB A;  1LJ7 A;  3URF A;  4CDU C;  4XHX A;  3GBF A;  3PL0 A;  4QMA A;  3ILN A;  3HQU A;  2A5Z A;  4Q4W 1;  4LIT A;  5ABJ C;  4JTN A;  4I0B A;  4KGQ A;  4RYD A;  2JJ6 A;  5DG2 A;  1WA6 X;  2XJQ A;  5LK5 A;  5FUP A;  2NMO A;  1QU0 A;  2YYO A;  1JBC A;  4XET A;  2P6C A;  4GMP 0;  4ASM B;  2QDN A;  4N43 A;  3SIT A;  2HWF 3;  1JN2 P;  2RM2 1;  5FP9 A;  4E27 A;  4OI2 A;  1CPN A;  3GBG A;  1QOS A;  2KXL A;  1QXP A;  4I01 A;  3BU7 A;  3EHK A;  2A70 A;  4LBJ A;  3WQ7 A;  4DIN B;  3VDD B;  2YY1 A;  3C2U A;  2W5F A;  3TEY A;  2XLF A;  4QX2 A;  1FV3 A;  1N3Q A;  2Y64 A;  5L73 A;  3RMX A;  2Q1M A;  4LO5 B;  4W6X A;  1DGR N;  2ZA9 A;  1UKG A;  1ALY A;  4A45 A;  4YLZ A;  2GSY A;  3AJZ A;  3EO6 A;  1SLA A;  2C5D A;  2W95 A;  3F2Z A;  2TUN A;  4CCL A;  3RYR A;  1X50 A;  2RM2 2;  3KGZ A;  4JQR A;  3ETP A;  2X05 A;  1RUI 1;  4QGL A;  4XUN A;  5FZE A;  3F95 A;  3ZYG A;  5IK5 A;  5FJH A;  1X7N A;  1QF3 A;  3VD7 A;  3ZXA C;  4BCU A;  2WSV A;  4OHZ A;  3O14 A;  4OUM A;  3GHM A;  1N47 A;  3AMN A;  4IGQ A;  4XF3 A;  3B02 A;  3K2O A;  4Y4R A;  2JB8 A;  4OUS A;  3FBM A;  5DDJ 2;  1UIJ A;  4OUE A;  4PCR A;  3ZN6 A;  4XZU G;  5GZF A;  1I1E A;  4XF4 A;  2HYX A;  1S2K A;  3VBO A;  5L19 A;  1O8S A;  4LBK A;  4J6G A;  5DUX A;  1KS4 A;  2PHR A;  1W04 A;  5JXG A;  4GH4 C;  3POW A;  2Q8O A;  1RUI 2;  2L9L A;  3E97 A;  1BK1 A;  1RIR A;  1VMH A;  1W6M A;  4RR3 B;  1B35 B;  1AL0 G;  1ZX5 A;  2DFB A;  2WT1 A;  2ZGU A;  3N9P A;  3POS A;  4IV3 C;  4NAO A;  1FT9 A;  3ACL A;  4IW3 A;  4F8A A;  1XPW A;  3QH6 A;  4Z1V A;  2RS3 1;  2IXJ A;  2J1A A;  4AQS A;  5IAX A;  2BU9 A;  2JDH A;  4H14 A;  2VZP A;  5F3I A;  4KQ7 A;  3FL7 A;  4M01 A;  4R9D A;  5APA A;  1LOF C;  2BNN A;  5FZ4 A;  4I02 A;  4K1Y A;  3BTX A;  5IWF A;  4DRR A;  2OW4 A;  1H9P A;  5L9R A;  2WQ8 A;  3I49 A;  1F8V A;  1ZBA 2;  2C6S A;  4BXS V;  4FFF A;  2BBV A;  3ZFE C;  1RUE 2;  2PMW B;  2CGO A;  4NRP A;  3OG2 A;  1QJF A;  1RMU 3;  2CAV A;  2RS3 2;  3BAL A;  4UBG A;  1VJ2 A;  4QKD A;  4G3Y C;  4UW5 A;  3RJ2 X;  1OLM E;  2WO7 A;  3MW2 A;  5DZG A;  4CEW A;  4GXL A;  4LNV A;  3POF A;  5GLT A;  4N9I A;  1CZV A;  2KR2 A;  1AR8 1;  4XUQ A;  4LBL A;  3W59 A;  5CA6 A;  4OI4 A;  2SBA A;  3AC0 A;  3MW3 A;  1H6X A;  1WLW A;  1VMJ A;  2DFC A;  5CFD A;  3QD6 A;  1NCQ A;  3CIH A;  5FYT A;  1W8Z A;  1M4W A;  3KHB A;  3KM5 A;  4UF0 B;  4EN7 B;  4AI2 A;  5LWB A;  4B3N A;  5AC9 1;  1W3X A;  2BRT A;  2XVL A;  2W87 A;  5EXO A;  2WNV C;  3KV4 A;  4B4R A;  1AR8 2;  1LOE A;  3O1O A;  3AYD A;  2P3K A;  1H2K A;  2EXK A;  2J1S A;  3CF6 E;  4B4Q A;  4HKW A;  4BQ4 A;  3FUQ A;  2Y26 A;  3LEM A;  3ECQ A;  1HB3 A;  3BVC A;  3ZXJ A;  4YZ2 A;  2TNF A;  4ZXK A;  5T5P A;  1C57 A;  2WFF 3;  2XL9 A;  2HWB 1;  4N7I A;  3POJ A;  1O3R A;  1XBF A;  2X53 S;  4AVA A;  1VAV A;  3OCP A;  3BN6 A;  4LHL A;  5AC9 2;  2IVI B;  2JDK A;  4AEM A;  4BZ4 A;  4QXB A;  2XGX A;  2FZ2 A;  4EYU A;  3AKP A;  1G9C A;  3VHR A;  3QBQ A;  2QQI A;  3ZYJ B;  1W2T A;  2MEV 1;  5LBB A;  1V6K A;  2V72 A;  2YC2 A;  4IND A;  4RQP A;  5K0U B;  1OQE A;  2VNR A;  3C7G A;  4P08 A;  1OF4 A;  1VBC 2;  3VBS B;  2GC0 A;  1W6P B;  4CPB A;  4X6R B;  2HWB 2;  2JG8 B;  4CDX B;  2FCT A;  3T4V A;  4I30 A;  3M2M A;  5H9P A;  1ZZ7 A;  2VZS A;  1K12 A;  2ARA A;  1W9S A;  3MV1 1;  1XNC A;  3RSJ A;  3LEI A;  1X82 A;  2VUJ A;  5T5L A;  4GUL A;  4ZZ8 A;  5FY8 A;  2R07 3;  3KVA A;  4HT1 T;  1UCX A;  2KA3 A;  3HD8 B;  1IKQ A;  5T3N A;  1XB9 A;  4WM7 C;  3SEP A;  2MEV 2;  5T52 A;  2C1F A;  3UKV A;  1DZR A;  4GKY A;  4CCK A;  1TG7 A;  5A1F A;  4P9G A;  1AXZ A;  1LOB A;  1O4Z A;  2WRA A;  5FBZ A;  5HPO A;  4LEJ A;  2UY8 A;  4LJH A;  2W47 A;  5A7N A;  1DDL A;  2VW2 A;  4IQP A;  4IEW A;  2CHH A;  1SCS A;  4E4D X;  2X8K A;  3OEA A;  4P9W A;  2CNA A;  5E8A A;  3LFI A;  4LA3 A;  2ZMN A;  1I3H A;  4Q0P A;  3RYP A;  3U4X A;  3DPR C;  3K4Z A;  3EMR A;  4AK3 A;  1KRI A;  1O8P A;  4YGD A;  5EFU A;  1CIW A;  3OPT A;  5EYX A;  1W6N B;  5CFC C;  2XL7 A;  3BI3 A;  3SH4 A;  1L3J A;  1NXD 1;  3NNJ A;  5L9B A;  2PYT A;  1MZ6 A;  4LPL A;  1ZBE 3;  4KH9 A;  5J3U A;  3RZH A;  1OA3 A;  1SAC A;  4IE4 A;  4KBB A;  1CX4 A;  2DU1 A;  3OB8 A;  4KL1 A;  3ZX7 A;  2V09 A;  1DBN A;  3B01 A;  4MGS A;  3ZR5 A;  4Y3O A;  4P9J A;  1YCI A;  3KF3 A;  3PU8 A;  1RVF 1;  4HAN A;  5E16 A;  3ZKU A;  4AFB A;  4YM0 A;  1ZZB A;  4Q4W 3;  1JZ2 A;  1IPK A;  4XMI A;  1BKZ A;  4K1Z A;  4AOC A;  3JQX A;  4XFF A;  2BWC A;  1VBE 1;  4PQ9 A;  3FC0 A;  4NII A;  1RIN A;  3UNP A;  1W03 A;  1MR5 A;  1YI9 A;  4UFH A;  5BNP C;  3AJY A;  1NLR A;  4MXW A;  4FPF A;  3CNA A;  4AI0 A;  4BU2 A;  1DYO A;  1MZF A;  2ENR A;  4LHN A;  4Z2A A;  1IS3 A;  2RM2 3;  1UL9 A;  2B42 B;  2WO1 A;  3KCC A;  1UYX A;  1O7F A;  4Q29 A;  3ZFF B;  3MLK A;  5A3O A; 
#chains in the Genus database with same CATH homology
 3S57 A;  3T4H B;  4MGT A;  3BTY A;  4RFR B;  4O7X A;  4NRO A;  5F8P A;  3KHB A;  3RZK A;  4QKF A;  4NRM A;  4NJ4 A;  3O1O A;  3O1M A;  4QKB A;  5DAB A;  2FDI A;  4ZS2 A;  2IUW A;  3I3Q A;  3KHC A;  4NID A;  3I2O A;  4IE7 A;  3RZG A;  3S5A A;  3RZJ A;  4O61 A;  4MG2 A;  4ZS3 A;  3BUC A;  3H8O A;  4OCT A;  4NIH A;  3T4V A;  3BKZ A;  4NPM A;  2FDK A;  4IE6 A;  3H8R A;  3O1V A;  3LFM A;  4NIG A;  3O1P A;  4CXW A;  3BIE A;  4CXY A;  3I3M A;  4QKN A;  4IE0 A;  2FDJ A;  4NPL A;  3O1T A;  2FDG A;  3BU0 A;  4NRQ A;  3BTZ A;  3T3Y A;  3O1S A;  4QHO A;  3O1R A;  4IDZ A;  2FDH A;  3BI3 A;  3RZH A;  4IE4 A;  3BTX A;  3I49 A;  3O1U A;  4JHT A;  2FDF A;  4NRP A;  3RZL A;  4QKD A;  3H8X A;  4NII A;  2FD8 A;  4IE5 A;  4CXX A;  3RZM A;  4ZHN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...