1ND2C

The structure of rhinovirus 16
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
238
structure length
238
Chain Sequence
GLPVYVTPGSGQFMTTDDMQSPCALPWYHPTKEIFIPGEVKNLIEMCQVDTLIPINSTQSNIGNVSMYTVTLSPQTKLAEEIFAIKVDIASHPLATTLIGEIASYFTHWTGSLRFSFMFCGTANTTLKVLLAYTPPGIGKPRSRKEAMLGTHVVWDVGLQSTVSLVVPWISASQYRFTTPDTYSSAGYITCWYQTNFVVPPNTPNTAEMLCFVSGCKDFCLRMARDTDLHKQTGPITQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords coat protein VP1
publication title Structural and virological studies of the stages of virus replication that are affected by antirhinovirus compounds
pubmed doi rcsb
molecule tags Virus
total genus 41
structure length 238
sequence length 238
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2002-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1nd2C00
2WS91 4IV1A 1AR63 1OOPC 5CFCC 1NCRB 1K5MB 5ACA3 1AR83 4AEDA 1POV3 1ASJ2 3VBSA 1NA1A 2Y26A 2BUKA 2RS32 3VBRB 1NCQB 4JGYA 4FTSA 1PO11 1RUJ2 5CFDC 1TMF1 1HX6A 1V9U2 2R072 5ABJB 2X5IA 5AC93 5D8AC 3JBG2 4Q4V3 1POV0 3FBMA 2RS11 5C4WA 1H8TC 1ZBA3 1MQTB 4IV1C 1AYM3 2HWB3 2RM23 3JB8A 4Q4W1 2WLPA 4NWWA 1BEV2 4RR3A 4GMP1 1FPN3 4AEDC 2QQPA 1QJX2 5FMOL 3VBSC 1R1A1 1NOVA 2RMU1 1NA1C 4WM8A 1RMU3 1PGW2 1VB4A 1RUG1 4CDWA 4JGYC 2HWC2 4Q4X2 1VBD1 1VBE2 1HRV2 1AR62 2RR13 1VRH3 1C8M3 2WFF3 2X5IC 5ACA2 1AR82 2HWE1 4CDXB 1RUC1 1W39A 4N43A 5GKAC 1Z7S1 2ZTNA 3CJIB 5AC91 5C4WC 1PVC1 4RQPA 1ZBE1 2RS33 1ND3B 2PLV2 1EV11 4IV3B 4WM7A 5C9AB 2R043 1TME3 4RR3C 3JD72 5DDJ1 4GH4A 1COV3 1B35B 3VBHA 3J8F3 4Y4YA 4WM8C 1PIV3 2DF7A 5JZGB 2HWF3 3IDEA 1GFF2 4CDWC 4JGZA 1RUF3 2ZZQA 1MEC3 1AYN1 4Q4V2 1D4M3 1NY72 4CEWB 5BNOC 1RUI3 4PDWC 1ZBA2 1AYM2 2HWB2 2RM22 3M8LA 4N53A 1RUE3 5L7OA 1FPN2 5J96B 4N43C 3ZFFA 1F8VA 2R063 4QPGA 4RHV3 4SBVA 5C8CA 4RQPC 1RMU2 2BFUS 1RHI2 1ASJ1 4FTEA 2WZR3 4GH4C 1CJDA 2RS31 3VBHC 1VBE3 1AL23 1RUJ1 2RR12 1VRH2 1C8M2 2WFF2 2GH8A 4JGZC 2RS53 1NCRA 1K5MA 1QJY2 1HQNA 1V9U1 2R071 4YVSB 4FSJA 3VBUB 1VBA3 5A33A 3JBG1 2PLV3 2R042 1AR93 2ZAHA 1TME2 4N53C 3JD73 3VBRA 5L7OC 3ZFFC 1COV2 1X33A 4QPGC 3J8F2 3DPRB 4AEDB 4CDUA 1BEV1 5C8CC 1PIV2 1QQP2 4CDQB 1QJX1 1NA1B 2HWF2 1RUF2 5ABJA 1MEC2 4GB33 1D4M2 1PGW1 1BMV2 1RUI2 4Q4Y2 3NAPB 1RUH3 2HWC1 4Q4X1 1VBE1 1RUE2 1HRV1 1NCRC 1K5MC 1AR61 2R062 1FMD3 4RHV2 5ACA1 1AR81 1SMVA 4Z92B 1POV1 1RHI3 2WZR2 4RS5B 1R083 3ZFEB 3VBOB 3VBRC 2HWD3 5BNOA 2PLV1 4PDWA 1AL22 4CDUC 2BFUL 3JD71 4QPIB 1E57A 5J98B 4Y5Z0 5A32B 3ZFGB 2RS52 5ABJC 1QJY3 1EAH2 3VDDB 1NG0A 1VBB3 1RUD3 2XBO3 5BNNB 1VBA2 3CJIA 4Q4V1 2XPJA 1WCDJ 1HRI3 1NY71 5K0UB 4LLFA 5LK7B 1AR92 1RVF2 3S6PA 1ZBA1 1ND3A 2FZ1A 1HXS3 4IV3A 1AYM1 2HWB1 2RM21 1RUH1 5C9AA 2MEV3 4N43B 3TN93 1B35A 1FPN1 1AR72 1QQP3 2IZWA 4YVWA 1QJU3 5JZGA 4CEYB 1BBT3 4GB32 5BNPB 4WM7B 1PGL2 1RMU1 1VBC2 1RHI1 1PO23 4Q4Y3 4GH4B 2WS93 3VBFB 1RUH2 3LOBA 1OOPB 5CFCB 2RR11 1VRH1 1ND2A 1FMD2 4CDXC 1C8M1 2WFF1 3CJIC 1QJY1 1F2NA 1PO13 1R082 1AUYA 1ND3C 4IV3C 2HWD2 5C9AC 5L7OB 1TMF3 3ZFFB 2R041 1B35C 1TME1 5CFDB 1COV1 3J8F1 1RB8G 1OPOA 4YVWC 4FTBA 1IHMA 5JZGC 1EAH3 4BCUA 5D8AB 1PIV1 1QQP1 2HWF1 2RS13 1VBB2 1RUD2 2XBO2 1RUF1 4CEWC 1MEC1 1H8TB 1D4M1 4Q4W3 1HRI2 3VBUA 4IV1B 1RVF3 1BMV1 1RUI1 4Q4Y1 1DDLA 4GMP3 1FOD2 1HXS2 1NCQA 1A6CA 1R1A3 1ND2C 2MEV2 2RMU3 3TN92 1RUE1 1AR73 3VBSB 3DPRA 2R061 5A33B 1RUG3 4RHV1 4CDQA 1QJU2 1BBT2 4JGYB 1VBC3 1PO22 1VBD3 2WS92 2WZR1 1AL0G 4CDUB 1MQTA 3NAPA 1AL21 2HWE3 4GMP0 1RUC3 2X5IB 1Z7S3 2WWSA 1C8NA 1PVC3 2RS51 4YVSC 1VAKA 1EAH1 1ZBE3 5C4WB 3VBUC 1EV13 1PO12 1VBA1 5DDJ3 1NCQC 4RR3B 3ZFEA 4RS5A 3VBOA 1TMF2 1AR91 1RVF1 3DPRC 4WM8B 2FZ2A 4QPIA 4CDQC 1R093 1AYN3 1AR71 4CDWB 5A32A 3ZFGA 4CDXA 1VB2A 2RS12 4NWVA 3VDDA 5BNOB 4GB31 1X36A 4PDWB 4Q4W2 1PGL1 1VBC1 5BNNA 1MQTC 3NAPC 1FOD3 5K0UA 2BBVA 2TBVA 1R1A2 2RMU2 1M06G 3ZXAC 1ASJ3 1RUG2 1FMD1 4RQPB 1QJZA 1OHFA 3ZFEC 4RS5C 4CEYA 1VBD2 3VBOC 5BNPA 4CEWA 3VBHB 1R081 4EJRA 2HWD1 1RUJ3 3VBFA 4QPIC 2HWE2 1RUC2 1V9U3 2R073 1OOPA 4JGZB 1Z7S2 4YVWB 5CFCA 3ZFGC 5AC92 3VDDC 1PVC2 3JB4C 3HAGA 3JBG3 1R091 1ZBE2 5BNNC 1EV12 5FMOS 1VBB1 1RUD1 2XBO1 5DDJ2 5K0UC 4N53B 1HRI1 1CD3G 1BEV3 4QPGB 1FOD1 1HXS1 1ND2B 5C8CB 1QJX3 5CFDA 2MEV1 3TN91 2VQ0A 1R092 1AYN2 2GSYA 4RFT0 4CEYC 5BNPC 4WM7C 5D8AA 2BPA2 4YVSA 1QJU1 5FOJB 1BBT1 2HWC3 1PO21 4Q4X3 3VBFC 1H8TA 1HRV3
chains in the Genus database with same CATH superfamily
1OURA 4IL7A 1AR63 1EY2A 4A3ZA 4D8MA 4ZXEA 2X09A 5C5TA 1K5MB 4M3CE 1W9WA 5ACA3 1AR83 2WBKA 1AZDA 1POV3 4BIOA 2VW0A 3LA7A 4B3NA 2JD4A 1RGSA 4R9AA 4LK7A 1S0IA 5T50A 4KGGA 4COVA 5DUWA 2Y26A 4AW7A 4YW2A 1YI9A 2HBUA 3GJAA 5FLIA 2D6PA 3VBRB 3RMYA 3WHUA 4FTSA 1OQ1A 3DKQA 3CF6E 4OHWA 3PUHA 1J3RA 1EUUA 1RUJ2 2JE8A 2WFPA 2JDMA 5GALA 3ZM8A 3NO8A 1W6OB 2PA7A 1ZNPA 2CL2A 1VMFA 5DAQA 1HB2A 1QDOA 3SITA 5FWJA 2V4VA 3O14A 3BU7A 3UV9A 4JKKA 5D8AC 5IWFA 2ZGQA 4AG4A 1RYYA 3VKOA 2D5FA 3C7GA 4HVRA 3ZYHA 1O4ZA 2UWAA 3P5BA 2EAAA 5EZWA 4QQ2A 1SFPA 4XUNA 1ZBA3 2TEPA 1GU3A 5FO9B 2OT7A 2VBBA 2EA7A 4XDOA 3W58A 4NUBA 1A8MA 2VXJA 3RDIA 1F35A 2XH6A 4HOOA 1PMHX 2QBXA 2OW4A 3WDWA 3PUAA 3AXDA 3FZ3A 4N7UA 2VBDA 3PIJA 3FN9A 4YZ1A 3MLKA 2WN3A 1RUNA 3NKTA 4CDWA 1W6PA 2F4LA 3FFQA 4JZRA 2B39A 5LW9A 2BJSA 1OH3A 2J1VA 3GYDA 4AEKA 2ZOEB 4YM1A 2WNUB 4Q4X2 3K4AA 5FY7A 3RVHA 3S57A 1OPMA 1E5SA 4LHLA 3PUSA 4XEZA 1AR62 4PIZA 1ENSA 4HG6B 5I0UA 3ZXEA 1C8M3 5ACA2 5JXHA 1AR82 4DPNA 2E32A 3TBDA 3ZDVA 2XLFA 4Z2AA 3KGZA 1OF3A 2KXLA 2J1TA 3CJIB 1UX7A 4YGBA 3WP3A 2OIIA 3AKRA 3WW1A 1MVEA 5GLVA 1EP0A 4EN6B 1HLCA 1W6NB 2VUAA 1W3XA 2ZGTA 2ZX1A 2QDNA 3MLLA 4XJ9A 3IIAA 2WNVA 3U75A 3I3BA 3LCPA 4JQTA 3WDYA 2R043 1D0GA 4LR4A 2ATFA 2JDHA 4L99A 4AQ6A 5T3NA 5B4NA 4P9YA 1SLBA 2JDYA 1LGNA 2K9ZA 1J3PA 3VBHA 3J8F3 1JZ6A 1UZVA 5EP9A 2XJQA 2I07B 2XJUA 4Y4YA 4CP2A 1WA4A 2RV9A 4QU2A 3VKNA 1PIV3 3QLQA 5JOZA 4F8AA 1OVPA 1GFF2 2WZPP 4CDWC 5IVEA 4XF0A 2J1SA 1GNZA 2ZZQA 5F39A 2I74A 1D4M3 2ZGUA 4CSWA 1W03A 3PUQA 3KCXA 3ENRA 5BNOC 3ORJA 1JU3A 1ZBA2 3OPZA 5H9SA 5BXXA 1GZCA 4ZU7A 4ZXKA 2E9QA 4IEOA 1SDDB 2PXJA 4Y24A 2FHRA 3WZ1A 1VP6A 2W95A 4PQQA 1O3RA 1GOGA 2ZKLA 3KT4A 3RZZA 3WNKA 2IXJA 3C7HA 3I2IA 3WNLA 4K6BA 4R9BA 5I0SA 4FQZA 4QPGA 3E6BA 5IFPA 3N7MA 5HXMA 1CJPA 1ZREA 4XXPA 1V6OA 2QQMA 1MS3A 4KI5M 2A3XA 3GZUC 1UN1A 4XURA 1OLMA 2VXRA 2WNVC 2YGMA 4YZ2A 4ASMB 2JE7A 2Q1MA 5FXZA 4Z1VA 1FAYA 3VBHC 2VZQA 1RUOA 3OB8A 4TWTA 4CU7A 2Q1FA 2XXZA 1GOHA 1RUJ1 3BCWA 3RZGA 1PZ8A 2K0GA 5GM0A 1C8M2 3ZYJB 4DUWA 2O0OA 1OXCA 2OS2A 2RS53 2VCMA 2P3IA 1LHVA 2B46X 2CDPA 2ARBA 3AMPA 3MV11 3O5SA 1D4VB 1DBNA 4QKDA 5FO8B 2V5DA 2AGSA 4FPJA 1KFXL 4QM9A 3RFRA 3VBUB 1S0BA 3H42B 1OSGA 4Y1VA 1AVBA 1SHWB 1O7FA 5IVVA 3OY8A 1CAUB 2R042 3M4FA 1LGBA 2HYXA 3QH6A 3AJZA 3JD73 4G9SB 5I8YA 5A80A 2TNFA 1O5LA 1G86A 4DB5A 1LB2A 3WDVA 5DAVA 4QPGC 3J8F2 4HT1T 3ZXLA 4NPMA 5FUPA 4AEDB 1CGPA 4IETA 2JJ6A 1AHSA 2XDVA 3ME2A 4LHKA 5FFOC 3B02A 1UXZA 1PIV2 4Q26A 1UOBA 4EV0A 1WWYA 3H50A 1US2A 2J22A 2NN8A 2VNVA 3INAA 4COUA 5FY5A 1FXZA 4E2GA 5FY4A 2UWBA 4GAZA 2QZ3A 3AK0A 1T2XA 4Q0UA 2XL9A 1LNSA 1D4M2 1GUIA 4E8CA 1Q43A 4DZGA 4Q27A 2E33A 2PHXA 1DF0A 1W2OA 4JC1A 1ENXA 4XC9A 3LF7A 4XPVA 1X82A 3WOGA 5FXWA 3K3NA 3WF1A 3O1TA 5DZGA 5LZ6A 3PMEA 2Y6FA 4Q4X1 4YWAA 4KQ7A 4BDVB 3U0ZA 4TSVA 3ZN6A 3ZYIB 1AR61 5J3UA 2Q8OA 1SFNA 2JIJA 1J83A 2B5HA 2BWAA 5ACA1 1AR81 3IAQA 1H1IA 3C7FA 1IZ3A 1POV1 3UGGA 3VHOA 2Y6GA 4FO9A 1YFYA 3EO6A 2JE9A 4PCRA 2NYYA 1CVNA 4PLMA 3IZOA 2HWD3 1AXYA 3TEZA 3KV4A 1ZZCA 1DHKB 2NM1A 4PDWA 5JPNB 3FUOA 1DG6A 1BVP1 4XUOA 4OHYA 5DAPA 4BQ1A 4AVBA 1OQEA 2VOXA 3HT1A 4FPLA 4Y3OA 4AVTA 3QBQA 1LRHA 2YPJA 4UOJA 5FPBA 4XCBA 5JI9A 4BK4A 5CNAA 2A6XA 4K1ZA 2RS52 1QJY3 2ZEXA 4N90A 5FZHA 1HJFA 2R30A 3DECA 4MSVA 5LA0A 5IK8A 1QXJA 1UF2C 2LS6A 4BYYA 4W8JA 3ZYFA 1ULCA 4OUEA 3H1MA 2VNRA 1H4GA 1ZBA1 3GCWA 3LQCA 3VDAA 1K5JA 1DQ2A 5C9AA 3H7YA 4Q8KA 1URXA 2WRAA 3WNOA 2MEV3 3U10A 4N43B 4BOWA 4MGYE 2WO1A 5KXEA 1B35A 4DO0A 2EXHA 1P8JA 2QFEA 1MACA 1NXD1 3PDQA 5JMCA 1JS9A 1UMZA 5C3SA 4LKSA 2IZWA 3IPVB 4XQWA 1CR7A 4WVMB 1WLDA 5JZGA 1RJ7A 2W39A 4CA9A 1DYOA 3UK9A 1N1SA 4G3YC 3UL2A 5KBFA 5IYYA 4AAPA 1PK6A 3NQHA 5FAXA 1TVGA 2ZZJA 3KGLA 3MF9A 3OOXA 2BEOA 2VMHA 3LOBA 5FZKA 2ENRA 4WVWA 1OOPB 3TRSB 5CFCB 2DVBA 4QHBA 1Y3TA 1C4RA 2EALA 5JOXA 1CZTA 1H1AA 1OC1A 1PX3A 4JRLA 1C8M1 4LITA 1WLTA 4OYUA 5JWPA 5JUVA 1N1TA 5CU1A 2A71A 4L0PA 2K46A 5L9RA 4AE2A 5KXCA 2FDHA 3KB5A 2E26A 2WZ8A 4DRRA 3PU8A 1UXXX 3LEKA 3KD4A 5FJHA 4CPBA 1U5IA 1PO13 4XE9A 3RNSA 4H14A 5T55A 3VDBA 2HWD2 2CAUA 5C9AC 3MHZA 4LBJA 2RDNA 5FO7B 3I59B 2F17A 1KJRA 3ZIWA 2R041 5HCHA 1B35C 5CFDB 1Y9GA 1NLSA 4HETA 4PIYA 3AX4A 4AFCA 1S0FA 1XNAA 2VW1A 2YU2A 2VMDA 3J8F1 1A78A 2QUOA 1OPOA 4FTBA 1IHMA 5JZGC 4M00A 4XMIA 1UY2A 5A1LA 3JQWA 1PIV1 5DN2A 3VZNA 3T1MA 2RS13 3J7LA 3QOPA 5FYUA 3HD8B 1PK6C 4EN9B 4Z2WA 1D4M1 4Q4W3 1HIXA 5ISLA 3A0NA 1PM4A 4I0BA 1ZVFA 5M0TA 2XMLA 1NCQA 1DZTA 1OH4A 2V72A 5IVJA 4DQAA 1R1A3 2MEV2 2ZS6B 4HKWA 2VM9A 4ATEA 1Q5OA 1UOGA 1TE1B 4E9KA 1W2TA 4BISA 3ECQA 1IKPA 2P3JA 2A3YA 3AB0A 5A33B 1RUG3 2W94A 1EPWA 1UKGA 2YBKA 3ZR6A 5C3QA 5IK4A 3MIEA 5FZMA 1VAVA 5JAXA 2XQRA 3ES4A 4CUCA 4K8RB 4Q1RA 2VC9A 3J26N 4AI8A 3K75B 2CY6A 2YUEA 3EHKA 4XBNA 4YZ3A 4YGDA 3TOJA 3K4DA 4MVTA 5A3LA 4QB6A 4UFKA 1XB9A 1WKYA 1QXRA 4GJZA 2HWE3 4GMP0 2CNAA 4CP1A 3BTZA 1Q8PA 2GNBA 2X5IB 3V65A 2DVGA 3HQUA 1A3KA 4TN7A 3Q8EA 2ZAAA 5C70A 3S5AA 2X8KA 4X6QB 1VALA 4XAAA 4AGGA 1C8NA 5LBEA 5A3PA 3DYOA 2AREA 3CJXA 2RS51 3P1IA 1ALYA 1SCSA 5C4WB 4RN5A 1M4WA 4LUKA 3VZOA 1FNYA 3ZIXA 3WQ7A 1PO12 4F7ZA 2BNMA 1PMJX 2VVFA 5DDJ3 1NCQC 2Y64A 1J58A 1YFXA 2VD7A 4RR3B 5KWRA 5DZFA 1GP5A 3NL1A 3BOWA 1F31A 1AXKA 4UBHA 4BXFA 3FE5A 1SLLA 4NRMA 3VD9A 1Q56A 3RWKX 1DLLA 2XHKA 4JRAA 5E1RA 4Q0QA 4BB3A 1U5XA 2R6QA 3AVSA 3AKTA 2BTVC 2VQTA 2CV6A 3ZFGA 5C6CA 1LOBA 5EQUA 2EXIA 2GN3A 2RS12 1GWLA 5G04L 5FZBA 4NIIA 3O7OA 2OZ6A 4QGLA 4MGIE 5FP8A 1X36A 4OQ9A 4Q4W2 4K8FA 4OHZA 4FPGA 4K3UA 4C1WA 4P9GA 1CN1A 3WT3A 4QQOA 4RL7A 4YPJA 3KF3A 5K0UA 5FLHA 1GZTA 3A0KA 5LBBA 1W8FA 3VDCA 4CUBA 2WJSA 1AX0A 1R1A2 3HPNA 1W6QA 4XF3A 4CZSA 1W99A 1J1LA 2VTXJ 3THDA 1XRUA 3WVJA 3GNEA 4A45A 1RUG2 4RQPB 1YC61 3O12A 5E8AA 3OBTA 3LOIA 2A73B 1G8WA 2J7MA 1DQ4A 5JXJA 3LIHA 3LA2A 4CEWA 3AYDA 2F4PA 1LHUA 4EJRA 5KHGA 1ODMA 2HWD1 3AVRA 1LHWA 2VCCA 4AAXA 2R7EB 3D82A 3VBFA 1NZCA 1OFNA 2DCYA 1TEIA 4D7SA 2HWE2 1D2SA 1UQXA 1XE7A 3B3QE 1REEA 3KLSA 2R073 4JGZB 4YVWB 4CVUA 2UU8A 3ZFGC 1I6XA 2Y6HA 2YGLA 2X05A 2CGOA 3VHNA 4COYA 1RIRA 1WD4A 4E2SA 1JH5A 1W9FA 4OHXA 5LBFA 4AR2A 3PIGA 1SCRA 5F5QA 5DDJ2 3S0MA 2O8QA 3RS6A 5K0UC 4UXAA 4AF9A 4NHXA 3KCYA 3OYWB 5G05L 3IMNA 2ZHNA 4CRQA 2PAMA 5CYYA 3FMGA 2ZX2A 1GZ9A 1KGYA 1WBFA 5C8CB 1N3QA 4FI9A 4XXAA 4UFLA 2MEV1 4IGPA 2QCSB 5ANQA 2JECA 1KDMA 1ONAA 4OI1A 2EIBA 3M3EA 1ULFA 4NRPA 2GALA 2I2SA 1BKZA 4MH0E 3Q8BA 4YGEA 5FZAA 2JB8A 4CU8A 2HWC3 4Y20A 2QJVA 3S7EA 4ZS2A 1NLQA 3NNLA 3VBFC 4BQ4A 1X8EA 3CQOA 2IUWA 4P08A 1DQ6A 2ZJCA 3ZDSA 1DYKA 1I5ZA 1W3VA 5FYCA 1SACA 3R4UA 4ONUA 3H8RA 1L7QA 3MIBA 1H1MA 1NCRB 4IW3A 2VQAA 2XR4A 1L3JA 2OKXA 3RZKA 3WQ0A 3VBSA 4KWUA 2YV8A 2VO5A 5HI0A 5FZOB 1JYVA 1XU2A 1H2NA 2JDPA 2YYOA 3V0AB 2BUKA 2QQJA 3DF0A 1GP4A 1N3PA 1UX6A 2W68A 1L7LA 1XYOA 2VL4A 3HNBM 2WA3A 3FHQA 3ILNA 3J7MA 1PO11 3OGRA 5A7OA 1PZ7A 4IEXA 4YW4A 5LATA 4MGTA 2WL1A 2DVAA 4LA2A 4Q8LA 2ARAA 1IPJA 2EAKA 2GU9A 3RPQA 2VOWA 5FZ1A 5FZ3A 5JXIA 2QQOA 3CZUA 2FCTA 2R072 4W6YA 4P9WA 4DY5A 4EZHA 5LA1A 4CCNA 4LA3A 4AI3A 4IEWA 1CPMA 1W8NA 4G4FA 4TTGA 1ODNA 3DN7A 2ETEA 2Q4SA 2VU9A 2NPIA 3E6DA 4LPLA 5FZEA 3VLBB 3A7QA 4SLIA 4D94A 1AJKA 3C8XA 5FXXA 3RG0A 4HZFA 5K7PA 2RS11 3Q8CA 2E7AA 3PJQA 1PHMA 3VHPA 4Q4W1 1UPSA 2YFUA 4DXRA 4DOUA 3I7DA 2ZGRA 1UAIA 2DFCA 3D6EA 1NUKA 5KHIA 1UY1A 4E2QA 5A3MA 2J1AA 5FBJA 3RI9A 1PZ9A 1CZSA 1R1A1 3VBSC 2VW2A 3R05A 3URFA 4C0HA 3VUOA 4WM8A 2ZMLA 5E88A 1GP6A 4KBZA 4KH9A 3UT0A 3HR9A 1VB4A 1ULPA 3BKZA 2DUPA 4KL1A 1RUG1 3MFCA 3POSA 1O3QA 5FYSA 1SG3A 2BNOA 4ET7A 4L97A 5LA2A 2HWC2 3FBYA 3GJBA 4QX1A 2OUJA 2WINB 4Q0SA 2PHDA 1VBE2 5LB6A 1OT5A 5CVRA 1OF4A 3NV2A 4R8HA 3ATGA 3K46A 3T3YA 1K42A 2VMFA 5A6YA 1DZRA 2AEYA 1XNCA 3GBWA 1J3QA 1C5HA 5JI7A 3WP6A 4AFAA 2Y34A 3IM0A 4MADA 2HWE1 4NN0A 4CDXB 1JYXA 1GZWB 1LU1A 2ARCA 2BZDA 5F32A 4D3WA 1GMMA 1WMXA 2VZTA 1OBNA 3A22A 4AI1A 4DRVA 4XFHA 2Q5TA 1MZ5A 3FWEA 5FUIA 3LPGA 3ZLIA 2PLV2 2BW8A 4IV3B 4WM7A 3SMHA 2A3WA 5F6KA 5A70A 2VZPA 5DDJ1 1J59A 4I0AA 1MZEA 1COV3 4XBLA 3ETQA 2WAOA 1GLHA 1YUDA 3VKFC 2WDBA 4YG3A 3H9AA 4WM8C 1WBLA 3NV3A 5T54A 1UPIA 2HWF3 2GC3A 3LGRA 2RJLA 3EYPA 4OHVA 3TEWA 3WG3A 4B4RA 1O5UA 1BQPA 1IKQA 1QJEA 2W46A 2Z2SB 3OF1A 5FYIA 1NY72 1YFUA 4AQ2A 3AXEA 4P9LA 4MOAA 3UNPA 3VHRA 4ZU4A 5EJ1B 2XLAA 2BYVE 4AHWA 4R52A 1G6NA 1W8UA 4RFRB 3OSDA 3I4IA 1VR3A 3O0WA 3POYA 4N53A 4ZZ8A 1BXHA 1MS4A 3NMBA 5A3TA 5HV4A 3ZFFA 2XQXA 5FZFA 1GR3A 3I2FA 3A23A 5IUQA 4JQRA 4RHV3 1CAXA 2XKPA 4SBVA 3BUCA 1Z78A 4QGMA 2J1EA 1PM7A 4M0HA 4MO3M 5F1RA 1RHI2 3ACGA 1YWKA 4QX5A 4V1PA 1CZVA 1LAJA 2ZACA 5FP4A 1CJDA 4Y5SA 4LO7A 4CCMA 5K8SA 4EWAA 1LOEA 4TYSA 4A6OA 4D6QA 3IKWA 1UYZA 4OMCA 1SPPB 3O1RA 2O1QA 1JXNA 1SLAA 2QQVA 3I2GA 3JZVA 3N9QA 5L9VA 4OI4A 1JODA 3VB9A 4KG0A 5FZ6A 2ZGKA 3M3CA 2GH8A 1UD1A 4GKXA 2WUHA 4QPWA 3A4UA 1K5MA 1V6LA 1VIWB 1HQNA 2OX0A 2R071 2DUQA 2YC0A 3KS7A 4D7YA 2ZGNA 4YVSB 5F8PA 2VAUA 4YG6A 2VMEA 1EUTA 4P9XA 1QOTA 1PMIA 1GWMA 4KBBA 4L92A 2YPDA 4Q29A 3UJOA 3BPSA 4J1WA 4XJUA 4ZHNA 3ZN4A 4FFFA 4LE3A 2ZAHA 5LEJA 1UOJA 4N53C 5FMCA 2VVEA 3VBRA 4OUMA 1OVSA 3LFIA 3ZFFC 1COV2 1X33A 4FBFA 4P5HA 3W5NA 2Z69A 1F4HA 1QDCA 5F5AA 3AKQA 3ST7A 4C8DA 2A5ZA 2CWMA 2D40A 1QQP2 2WSUA 3DV8A 4AFBA 4AI0A 2HWF2 4CDQB 2Y33A 4ARYA 2F6BA 2Z5WA 3NWKA 3POBA 4FXGB 2XONA 1O3SA 4R9DA 1L7RA 4H3WA 4NAOA 4BK5A 5CA6A 1BMV2 2UY9A 4PQ9A 3NAPB 5EV7A 2A7AA 2HWC1 5IATA 2BBAA 1BCXA 5EIYB 2MNGA 1VBE1 1XNBA 5FWEA 3BVCA 2N7GA 1S0GA 2OPKA 4IEUA 2W08A 2VOKA 2RDQA 4M3CB 4QX3A 1K5MC 5A3WA 5KHJA 1LKNA 1HQLA 4FFHA 4RHV2 4LUMA 1QIQA 2V5YA 2VCAA 4KNCA 2XJPA 5HBAA 4UT5A 1DZQA 1G9FA 1O59A 3LE0A 4CCJA 2ID4A 4IE6A 2BP6A 2EXKA 1MPXA 3ZO0B 2B4KA 3ZFEB 4S2GA 3VBOB 3VBRC 1DIWA 4RGGA 1UYYA 5FY8A 5K9YA 4ORFA 5BNOA 2PLV1 2BVBA 2OA2A 1U5YA 2X29A 4LO5B 3BTYA 1LU2A 3FL7A 4GIQA 4QWNA 1CX4A 1QMJA 2Y8KA 2ZMNA 3ES1A 3E1F1 4MX3A 5GJ6A 3BB6A 4Y5Z0 3KF5A 5A32B 1O4YA 2HLEA 5DG1A 5FZ7A 4LBQA 4LORA 1W2UA 3N9OA 2ZPXA 3VD7A 2E53A 3OEBA 2DTWA 4CXXA 3O1OA 1NAEA 4AFDA 1VBB3 2ZGMA 5FPAA 2R0HA 3B01A 3CJIA 1V6NA 2XPJA 1H9PA 4RA0A 5IK5A 1HRI3 1NY71 4YZ5A 1HB4A 3N3HA 3RZJA 1YIPA 5JLVA 4LLFA 3P3PA 1OD3A 2L9LA 1RVF2 5A1AA 5JOWA 4ATFA 4LOTA 5FZ8A 4XOGA 3WSOA 3CHXA 2JDNA 4HSLA 4IEVA 3TN93 1CX1A 3LA3A 5CZKA 4W6WA 1JZ2A 4LIUA 1W28A 1HN0A 1XE8A 2W1QA 1OLME 3BYWA 1NX9A 4FP3A 2WWJA 1DQ0A 1QJU3 3Q8AA 4XFCA 5LY2A 3BI3A 3LDBA 1VBC2 1W6MB 1RHI1 4K1YA 3TWIA 3VN4A 5C7GA 2XVGA 2ZHKA 2B9UA 2WS93 1LR5A 2EIDA 4MGSA 1JYTA 1AXZA 5D2AA 1LENA 3M3QA 1G9AA 2VJXA 3HN3A 5E89A 1A8DA 2J1UA 5CISA 4XQ4A 3OBAA 1IG3A 1FX5A 1BHGA 1NT0A 2JENA 5CBLA 3D0JA 4J1XA 2XUMA 4WZCA 5FY1A 1GQPA 5IJRA 3WV6A 1ND2A 4QGNA 1VRBA 5CG8A 2BWCA 3NNGA 4FVVA 3CJIC 2QKDA 3AFKA 4PBOA 1JHJA 4GALA 2OQ7A 4FPOB 1BVVA 3KM5A 4DXTA 2BRTA 5LRRA 3PNAA 1ZZBA 1UYPA 1UYXA 5IVCA 1TMF3 3O1MA 2PHWA 2VTXA 3TB0A 2FDJA 4QM8A 4HK8A 1COV1 1H9WA 1RB8G 3SCGA 3WW3A 4P14A 5H9RA 1C3HA 3DEMA 3I3QA 1QQP1 2HWF1 2ORXA 2BGOA 4FOWA 3POEA 2UYAA 1VBB2 4HFSA 4LKDA 4QXKA 4AHZA 2GP3A 4JKLA 4W50A 4ES9A 4XIOA 4XACA 5A6ZA 1H8TB 5A7WB 1HRI2 2JG8A 5A7PA 4IV1B 3UGFA 3VBUA 1GANA 4WBBA 1BMV1 4N7IA 1ULGA 1DGWA 2SBAA 4HPKA 4GMP3 2H6BA 5T52A 4D69A 2Z42A 1CAUA 3R4DB 3AMMA 3HNYM 5F3IA 5T5OA 3N4MA 1ND2C 2C9KA 3NRUA 1V0AA 3OBRA 4K40A 3AZYA 3NJXA 3OEAA 3TN92 3WNMA 5F3CA 5FPXA 2DU1A 3GF6A 1S2KA 4UFIA 4HMZA 1S0EA 3NVCA 2QQIA 2WSVA 5A6XA 1Q8SA 4RHV1 1WCKA 4D0QA 1X8MA 1QJU2 2YFZA 4NHYA 4JGYB 3IIIA 1W8TA 3OY8B 4BJ0A 1DGRA 1UKRA 4M4PA 5FLJA 3VV1A 5GZFA 2VCBA 3MYXA 4FCAA 4XETA 4YRDA 3O1PA 2WS92 5BYNA 1D2QA 1AL0G 5HCFA 3UKNA 1V70A 3WCRA 1MQTA 2ZHLA 3RYPA 1DGWX 4FPEA 4IDZA 4U36A 3SHRA 4W4ZA 1OUXA 1VMJA 4XUQA 3PVNA 2OXBA 2VZ1A 2D6KA 2WWSA 5CADA 2XWBB 5APAA 4M01A 3CDZB 1VAKA 1XSRA 2JG8C 3VBUC 1EV13 4YGCA 1LOFA 1JOPA 2DURA 4OULA 2GNTA 3IBMA 3RZLA 4Q1PA 2BNNA 4P00B 3W21A 3VD5A 1TMF2 1RVF1 1SLCA 1UCXA 2XOMA 4CCLA 4PF5A 4OUSA 1NLRA 1S0DA 3LEMA 1HQWA 4X8NA 1S1AA 5F2SA 5CAZA 1JYNA 2FBEA 1VMHA 2FZ2A 1CAWA 2VZUA 3E5XA 1YO8A 2OUHA 1QH6A 4FPKA 5BV6A 3BIEA 2ADEA 1OKOA 1LGCA 2JDAA 2W92A 4NIDA 4UW5A 2A6ZA 1VB2A 4Y5TA 5FCCA 2E7TA 3AMQA 4L9BA 4KU8A 4PDWB 2WA4A 4RYDA 4UFHA 2ZGSA 1VBC1 4HSJA 1EPZA 1ENRA 1MQTC 2KR2A 2ZMKA 4NHKA 4QT6A 5B2GB 2UWCA 3V0BA 3PMSA 3ZXKA 1E5HA 1Q8QA 1QHDA 2BBVA 3QH7A 5LA9A 1WGPA 3QCWA 2E7QA 5FY0A 3UESA 1LULA 2JG9B 2PHFA 1OI6A 5FY9A 3WG4A 3ACIA 1ASJ3 3J4UH 5FYZA 1XBFA 3AMNA 5A7QA 1LOFC 1W90A 3IPVA 3MZHA 2E63A 2FMDA 2JWPA 1F9KA 2G19A 4LTAA 3MIGA 1QF3A 3OG2A 4JAAA 2IFRA 2WIIB 5JIUA 2DV9A 3K77A 4P9JA 3UKTA 3MDPA 3U07A 1QH7A 4RSUA 5FMDA 4DXSA 4DIQA 2BOIA 4AFMA 4A3XA 1SDWA 1S4CA 1Y9MA 4Q2FA 3MI8A 4UYBA 4XUPA 2XB6C 1OOPA 2WO2A 5CFCA 1A34A 3H8UA 1WW6A 4OLLA 2VZVA 2ES3A 4LOSA 3LB9A 5AC92 3RYRA 3G6JB 5AFBA 2NMOA 1ULOA 3GHNA 5FV3A 3ELNA 4IEPA 1EV12 2LW8A 1HV0A 4AHYA 1ZRIA 3AKPA 1VBB1 4FOVA 2C26A 1OFSA 1I9RA 3LDRA 3A21A 2G1MA 2GZWA 1HRI1 4PBPA 1E5RA 2X53S 1REFA 1Y7BA 1IPSA 1CD3G 1BEV3 3ZVXA 3MBWA 3I59A 3RJ2X 3PUIA 1GV9A 3C7EA 5CFDA 1W8ZA 1D7PM 5A3OA 4CCEA 3TN91 1J1TA 4CCDA 4C0BA 4I0WB 5A7SA 4GA9A 3ZXGA 4XJAA 2BVVA 3USUB 4NRQA 5CKNA 4XHXA 1JU4A 1QJU1 3OUHA 3PURA 1GICA 3E97A 3M3OA 4GJYA 4L2NA 3SCHA 2ZCWA 4E4SA 4PHZA 5T5PA 1UOFA 5FKCA 2W1UA 1YCIA 5FZ4A 1HRV3 2VMCA 2WS91 3SISA 5CEHA 2R1BA 3VL9A 5J09A 5J7MA 5FYTA 1T6GC 1OOPC 2WO3A 3OUJA 5CFCC 3I2DA 3M7AA 1OA2A 3ZPYA 3MV01 3WY6A 4ISQA 5FTTC 5FIXA 4CYDA 2GDFA 4QX7A 1ASJ2 2OZJA 3W59A 3GZAA 1OLRA 1NA1A 1NXMA 1NKGA 1RINA 4LBKA 2RS32 3RSJA 1UY3A 2HKXA 2XKOA 4LJHA 3ACLA 3RJRA 2R0FA 5SV8A 1NCQB 4YW1A 1X9TA 4AEMA 4AGRA 3O0XA 1TQ5A 2JXAA 4QX2A 4PLNA 3CLPA 1W8WA 4JX0A 2ILMA 3G7DA 2CYFA 2QNKA 5LASA 5CFDC 2P34A 2Y6KA 4Y1XA 3W20A 1TMF1 1MS0A 3WUCA 3WX5A 4FPHA 1MZ6A 1HX6A 1QXPA 4C91A 4MXWA 5ABJB 1BK1A 2X5IA 1XSQA 1HKDA 4Q0VA 4Z8BA 3KV9A 4B4QA 2R32A 4CP0A 3AKSA 3W5MA 2AR6A 4L11A 2WYFA 1JMUB 2XLGA 1POQA 2Z4FA 4YARA 5C4WA 3HBZA 5C3OA 3OBZA 1JZ4A 4CXYA 4XIKA 1AYM3 2HWB3 1PGSA 1LHOA 2E51A 1WLCA 2ZBJA 3WD5A 5I8SA 3J7NA 2WLPA 5GZCA 4FPFA 4NWWA 1BEV2 4RR3A 4XDQA 4UFJA 4GMP1 4BU2A 3ETPA 5IVYA 1ZRRA 3OD4A 3FC0A 4OZOA 3J7HA 3CNAA 3MIHA 1G9BA 5EYYA 2D97A 1W8HA 5F2WA 2PAEA 1NA1C 2HEYF 5FK8A 2IXKA 4FAHA 5IT6A 4D6SA 4DS0A 1REDA 4Y1UA 2D6LX 4QQLA 1HB1A 3DXUA 4I01A 4LK6A 3I2JA 1AX2A 3AZVA 3GZTB 1R1ZA 2YU1A 3LIGA 3MW4A 5T5LA 3VD3A 3GDBA 4OFGA 1H0BA 1HRV2 4UI9L 1PNFA 1VRH3 2VGDA 4KMQA 2CGNA 3Q9OA 2X5IC 2WFF3 3RMXA 3CL1A 3BIWE 3OD0A 5K4LA 3RGBA 4NROA 2VG9A 3GXUA 4M3CF 4XAEA 4Y22A 2C0ZA 5C5UA 4BM8A 1O91A 2DYCA 5AC91 2QQWA 5C4WC 2J42A 5JSRA 4LO6B 2PTMA 4RGKA 4RQPA 3QD6A 5C33A 4QKBA 4RD7A 1ND3B 4HVOA 1EV11 4JTNA 4YNIA 5KXDA 1C5IA 1LEMA 1JZ7A 4RR3C 3POJA 4QQPA 2HH9A 4GH4A 5AVPA 1ZX5A 2VTFA 4OI2A 1EYBA 4URAA 3H1YA 1UZ0A 2DCTA 3PVOA 4OMDA 5FQ0B 2QQKA 4AOCA 1YQ6A 2JDZA 3DUIA 3T2OA 3I2OA 4JDNA 2NLRA 2UY8A 4JGZA 1Q8VA 1RUF3 2DBIA 3MW2A 4XYXA 1MEC3 4E8DA 4CEWB 4I3GA 4B8EA 1CAVB 3WXPA 4LHSA 2VULA 4BHPA 1AYM2 2HWB2 3MPPG 1RTVA 2VR4A 1KRIA 1HDKA 1RUE3 1NYWA 4IE0A 5L7OA 2A1XA 2VBPA 4QXHA 4URTA 1F8VA 2R063 4BQXA 4DEVA 1V00A 4IE7A 5C8CA 3WF3A 2GNDA 2ZA9A 2V09A 4RQPC 1DCSA 1ASJ1 1LTEA 4CPBD 2VMIA 1XPWA 3NJZA 4Y1YA 5JMOA 3L9JT 1UIKA 4FTEA 1DGLA 2WZR3 1IQDC 3GBGA 2PHLA 1YNAA 4GH4C 4WVZA 2RS31 4O61A 1BJQA 1VBE3 2DBNA 4XZUG 4JDMA 1KFUL 2XVLA 3THPA 4BPZA 1GYKA 1H2KA 2W9XA 3NV1A 4ITCA 1LECA 5F3GA 5I8TA 3IT8A 1VRH2 3LFMA 2WFF2 2D6MA 4JGZC 3KQ4B 4AHXA 1NCRA 3UGHA 4WZFA 1WD3A 4IEZA 5FP9A 3T0AA 5L9BA 5DUXA 1SBEA 3LWCA 3PLQA 3WNXA 4QAWA 1UU4A 5LWBA 2W2IA 4MZUA 1GNYA 3V64A 3ZSMA 4FOQA 4Z07A 2W52A 4TZDA 1MS8A 5GZDA 2PLV3 2XJVA 5FZOA 1I3HA 3ITQA 5FZCA 5H9QA 5JOYA 2XVKA 1FT9A 2YZ4A 3V0AA 4DUXA 1UMIA 5L7OC 4L8QA 2OQ6A 3SQOA 1F4AA 4QHOA 5GZGA 1JBCA 5BNQA 1CESA 4NIGA 3FLRA 3DPRB 3HWJA 4CDUA 3KHCA 1BEV1 4JTOA 3WHTA 5C8CC 4TLGA 5KXBA 2FDIA 3CIHA 3FHAA 3I2HA 3WG2A 1QKQA 1RUF2 1BK0A 4FAGA 1MEC2 4EROA 2IFWA 1XYPA 5FDBA 4INDA 1UY4A 4Q4Y2 5ERLA 4LO8A 3C2UA 3OTFA 4NIHA 4A4AA 1KDKA 3B9CA 1WW7A 1RUE2 1HRV1 4YW5A 4PI2A 1NCRC 2D5HA 2HYKA 4NAMA 1LODA 1V6JA 2R062 1W8OA 3GCXA 3FLPA 4IXLA 4LKFA 2DDUA 2QZ2A 2ZX3A 2RHPA 4RGAA 2YY1A 3U37A 1RHI3 1I1EA 2XJSA 1G7YA 1WW5A 4X6RB 3CZJA 3K2OA 3I49A 2WZR2 4RS5B 5JIAA 5F3EA 1WMEA 2P37A 3VZKA 3DKWA 3RRDA 1KJLA 3IAPA 4N9HA 3ZSJA 3S7IA 4CDUC 2H0BA 4BQWA 4I02A 2BFUL 2ARXA 2YG0A 3ZYGA 5FBZA 4QPIB 1E57A 2IXIA 3KMHA 2C5DA 5J98B 3MO4A 3T2QA 2C9AA 2JKXA 1EAH2 4YG0A 3VDDB 5JCTA 3BU0A 1V6IA 1OA4A 2R1DA 5DABA 1GZWA 4ZKTB 2K2SA 2VZ3A 2JKBA 5BNNB 4HLTA 1RJ8A 2WT2A 4COWA 1YQ8A 3AP5A 1WCDJ 4FFIA 1MZFA 2AENA 4MGZE 4XF4A 4B29A 4QU1A 4OCTA 2FZ1A 3PHMA 1DYPA 4IV3A 1AYM1 1OUSA 1VJ2A 1RUH1 2HWB1 1O8SA 4XTPA 3ZSEA 1APNA 3IMMA 3MIFA 2XG3A 4AVCA 4K7JA 1AR72 1RC6A 1QQP3 4UF0B 4H7LA 4CEYB 2NMNA 4CCCA 5BNPB 4WM7B 4IGQA 1PO23 4XFFA 5L19A 2AEZA 1GWKA 1TNRA 5FOBB 2LTNA 5LRSA 2H0VA 3NJVA 4ZS3A 3GHMA 4FT8A 1US3A 3UETA 4CP9A 4K9SA 3M70A 4NHMA 5CG9A 4E4ZA 1VRH1 3SKJE 4CDXC 2WFF1 2AH2A 5FP7A 4XUTA 2NZ9A 4LXLA 2Q1ZB 4XJZA 1O6UA 2YMZA 3MF6A 1LJ7A 4IE4A 4CU6A 2XGXA 3AZZA 3P3NA 1XNDA 1AUYA 4Y4RA 4IV3C 3NV4A 4A7ZA 3PTRB 3THCA 3WW4A 3ZFFB 3OGSA 3AYCA 3N9NA 4J6GA 1IS4A 4JKMA 1GSLA 2E6VA 4IE5A 3T0DA 3F2ZA 1YI7A 3O1VA 1FV3A 1H2MA 1KITA 1IPKA 1SBFA 5D8AB 1QY4A 1IS6A 5F9TA 1YQ5A 1XC6A 5ANNA 1RITA 1RUF1 1MEC1 4BMEA 1H2LA 3KZ4C 1RVF3 2D6OX 4Q4Y1 1GQHA 4R4ZA 1FOD2 5LCWL 5L73A 1A6CA 2ZGLA 3TEXA 3ILFA 2LALA 2RMU3 1RUE1 5FUNA 4E27A 4GWIA 2JIGA 3D0SA 2WO7A 4YW6A 2YBSA 2YHJA 3NSTA 2R061 1JN2P 4MXVA 1W6OA 1X50A 2VZRA 3ZOIA 3MLJA 4QPYA 3B93A 4CDQA 3B7MA 5FR3A 5IAXA 1VBC3 3HEIA 4QD2A 3TYJA 1PO22 3NNJA 1WCSA 1VBD3 2WT0A 3MPBA 5FPZA 4B1LA 3ZXDA 2WZR1 4AVVA 2QQUA 2VE1A 2D98A 1K45A 1SBDA 2DTYA 1CONA 2ERFA 1OQDA 3NAPA 3NNFA 4XQDA 3SNMA 1JW6A 3ZXJA 2WNEA 2ZEWA 5FYMA 4A7KA 4HL0A 1RUC3 2CTVA 3UKVA 4XF9A 1RXGA 2WC2A 5CIRA 5FYVA 1CIWA 1Z7S3 1NZIA 1K12A 4M3CA 5FP3A 4HKOA 3KHBA 4J25A 4XFIA 3R6SA 4F83A 1PVC3 5FYYA 3MEPA 1AF9A 2W0XA 4YVSC 3U11A 2P4EA 1EAH1 1ZBE3 1UIJA 1QOOA 2YDEA 3C7OA 1W06A 3KVBA 2EF6A 3BPZA 3DXTA 3T30A 4QHZA 3MW3A 5DAWA 4V2VA 3NJYA 3E5QA 3O1SA 3ZFEA 1FATA 5B4XA 5J36A 4UW6A 3VBOA 2GMMA 4XCAA 3WDXA 5DXDA 4ISRA 2WQ8A 1U12A 4QDSA 2WNUA 5DMYA 4OQ8A 3JXSA 2CHHA 2P2KA 2WYSA 2ZEYA 1W9SA 3P6BA 4IQPA 3RQ0A 1TZOA 3AL5A 5JPMB 3N9PA 4FOYA 4UWDA 4IUGA 4CDQC 2WWUA 3BN6A 1AYN3 1AR71 2GC0A 5DPNA 3T2PA 4CDWB 5A32A 1W6PB 4CUGA 1QWRA 3ACHA 1C57A 4XILA 1DLCA 3VZJA 1ZRDA 4BMBA 1ST8A 5BNOB 3ZXFA 3R4SA 1AJOA 2FMYA 2JDUA 1UNBA 2D6NA 2QDRA 3NAPC 4AXOA 1W6NA 3K4ZA 2FD8A 3IDCB 5A3UA 2DFBA 5F5CA 4GXLA 1UU6A 3PL0A 2OPWA 2TBVA 4DFSA 1HN1A 2HEWF 3HOBA 2DUOA 4LBQB 3POGA 3IDAA 2RMU2 3VGIA 1DFQA 4AL9A 1XU1A 3ZXAC 3B00A 4A6SA 3D8CA 5AVAA 2PQSA 3LSEA 1ZZ8A 1OHFA 2YXSA 4EN0A 1DGRN 4GKYA 1YQ2A 2DU0A 2WNVB 5FREA 3I3DA 4AVSA 3ZFEC 4HKLA 5H9PA 1FNZA 1VBD2 3VBOC 1W6MA 1JOJA 2BU9A 2WNUC 2PHRA 3VBHB 1H30A 1JUIA 3WDUA 4EQVA 3K51A 4BQ5A 4CU9A 3S5QA 1LOAA 5JVVA 2P3KA 1XE0A 3KV6A 4CUAA 2DVFA 3PU3A 5JXGA 4DEQA 3SCFA 4FP2A 1O8PA 1RUC2 4H55A 1V9U3 4IGOA 3SC7X 1Z7S2 2QE3A 1S55A 2AUYA 1VAMA 4DINB 5JSOA 3KWVA 1Y43B 5IVFA 5GLTA 2D93A 4I2OA 3AP6A 1PVC2 3JB4C 3JBG3 4KWLA 4A41A 4S2HA 1R091 1ZBE2 2VUJA 2ZKNA 4LQRA 1H6XA 2LUWA 5AFEA 2GH2A 3WNPA 1JYCA 1ZZ6A 1K3IA 3SH3A 3E5UA 1N47A 2FCUA 3ASIA 3Q8FA 3L2YA 3DYPA 3N9LA 3VKMA 2B8MA 5BY5A 3QACA 3FHIB 3PTYA 5F5IA 4D6RA 4QPGB 2FDFA 1FOD1 1ND2B 1WA6X 1ZA7A 3JUUA 1QJX3 5C71A 3AL6A 2PMWB 3HMYA 4AZZA 3WF4A 4LLOA 1BZWA 4MUVA 3POIA 4FPYA 4YW3A 3WW2A 5FKBA 4BLIA 3GZEA 1AYN2 4QX8A 2Q8DA 5C3RA 4KWKA 2EICA 2WQZC 4LBNA 3B9IA 1UU5A 5DG2A 3HVDA 4WV8A 4XJ8A 4IERA 3D4KA 2G4IA 1G9CA 2KD7A 1PO21 5EJ3A 1VPHA 3CO2A 1H8TA 5A7WA 2MHFA 4IV1A 4XFAA 3FJSA 3ZYBA 3ON7A 1ZYBA 2PAKA 2ZX4A 5KC5A 4PLOA 1YRZA 3APBA 4NMIA 3WNNA 1B09A 4AEDA 1D0HA 1VLNA 4BWOA 4ES8A 3VD4A 2WLQA 4W65A 4EN8B 5KHKA 1STMA 2RG4A 1PVXA 1C1FA 2JG8B 1V6MA 4HN1A 4YM3A 5LY1A 4HPKB 1MS1A 3UJQA 2AC1A 4LO4B 4JGYA 5FPLA 2FQPA 4DUVA 2D44A 3C3VA 3H8OA 3AM2A 5HPOA 4M4RA 5JDBA 4UW3A 4H7MA 3FX3A 3IWZA 3I54A 1FI2A 1JTZX 1V9U2 3ACFA 3EMRA 2XWJB 1YJLA 3EQEA 4QXBA 4AGVA 3MICA 1S0CA 2VPVA 4GWMA 4BQ2A 2G9GA 5AC93 2Q30A 2DCKA 2AZ5A 1OD5A 1QEXA 3JBG2 4PIXA 4V2WA 2ZGOA 3O0VA 4Q4V3 1POV0 2IC1A 3FBMA 3GGLA 3T4VA 2CGPA 3FFZA 2FCVA 3M2MA 2A75A 1ZM1A 4LMFA 5FZIA 1H8TC 3OPTA 4DMIA 3KV5A 2GC2A 1MQTB 4IV1C 1IQAA 2RM23 2Y38A 3JB8A 1WMDA 3HT2A 4UBGA 4EZ4A 1FYUA 3ZN6B 1Y9QA 5L36A 5HCAA 3CMGA 3ZKYA 1FPN3 2QTWB 4AEDC 2QQPA 3LEGA 3AMHA 1QJX2 4QX0A 5KR7A 5FMOL 3NKGA 1NOVA 2RMU1 2RE9A 4LBMA 4B7EA 1GBGA 1RMU3 1PGW2 1GNHA 2Y60A 4X8PA 4YFWA 1YFWA 4GZ9A 4QXCA 3BOPA 2JDKA 4JGYC 5CKQA 3LKJA 2QVSB 3W9AA 3N7KA 4LNVA 4FPCA 5J48A 3T1LA 1VBD1 3DGTA 2D3PA 4Y26A 4CE8A 5FYBA 1CAWB 2EXJA 2RR13 4S2FA 3HN1A 4LBQD 4O9EA 4O65A 1RUC1 1W39A 4N43A 5GKAC 4B7KA 3TNQA 2DCZA 1Z7S1 3EBRA 2JG9A 1S2EA 2ZTNA 3RYKA 1YLLA 2HJIA 1Y4WA 2H6CA 4KU7A 1PVC1 3E6CC 2ZHMA 2RJKA 4PI0A 1BLZA 1ZBE1 2RS33 4WVMA 3T08A 4PT6A 3OJBA 4O7XA 4XFBA 3V0BB 4NVPA 2B7YA 2BOJA 5C9AB 3MIDA 1TME3 1R64A 2Y0OA 2LROA 3JD72 4QB1A 1B35B 2DWRA 3KQRA 2YC2A 2EVXA 4GULA 4ZU5A 4DNYA 5TSWA 1E5IA 4UFMA 4YLZA 2MPFA 3J9SA 5DZEA 5GLWA 1O4TA 1ZZ9A 2DF7A 3AC0A 5JZGB 3IDEA 2BQPA 3SEPA 3ZX7A 5HCBA 1JZ8A 4HANA 4BE3A 1OLQA 1JUHA 1JYWA 1V6KA 1AYN1 2P6CA 3L2HA 4Q4V2 2Q8EA 4BQ3A 1QNWA 3CBNA 5DUUA 1PK6B 3ZYPA 3MUY1 4HN0A 1RUI3 5I0RA 2XJTA 4PDWC 4XHBA 5I93A 5EFUA 2RM22 4EWEA 1SZBA 1WCUA 1YQCA 3M8LA 1IS3A 1ZRCA 4NOTA 2QQNA 5GZEA 4IEYA 4MG2A 2C6SA 2WKKA 3T2TA 3THTA 1MR5A 4MV2A 4R4XA 4XTMA 3VKLA 1XOYA 1FPN2 4B1MA 2RVAA 5J96B 3IB3A 4N43C 1Q8OA 4JVAA 5FJKA 2VUCA 2JG9C 4EWDA 2LRPA 3F95A 4KWJA 1IS5A 1DU3D 3I97A 1DQ5A 3LPFA 4A2UA 1RMU2 2BFUS 2A70A 2JX9A 2PQQA 4PJYA 5I0DA 2P5BA 3USSA 2BGPA 4LEJA 3I3MA 2KA3A 1I5PA 3OCPA 3USUA 2D43A 3N36A 2V73A 2IXHA 1X9PA 5FK7A 5KC6A 1AL23 4BIFA 2G9FA 1QGLA 1PNGA 1JHNA 4LKEA 1LOCA 3T0BA 5FMBA 2UURA 4HONA 3N9MA 2JD9A 2VOTA 2RR12 3LDKA 4QKNA 2GN7A 1MS5A 3X29B 2EIGA 1CWPA 4LBLA 1ENQA 4AQTA 1ZRFA 1H6YA 2P6HA 1QJY2 1HB3A 1V9U1 2XL7A 3EXUA 2ZABA 3M1HA 3OPWA 5FZ0A 3EJKA 2Y0IA 5JSPA 1UY0A 4FSJA 1XNKA 1VBA3 2BGCA 2W91A 1W9YA 3JBG1 5A33A 1LHNA 3NNMA 4S2DA 4KG8A 5T5JA 1TG7A 1UO9A 1SLTA 1AR93 1N3OA 1TME2 2C4XA 2PELA 4YM2A 3BALA 1TNFA 4LULA 3SH5A 5EXOA 3WF0A 3B5LB 4OI0A 2ET1A 3ILRA 4IESA 1G9DA 1JYIA 1HW5A 2VNGA 1CQ9A 4XZPA 2ZEZA 3AFGA 1QJX1 1NA1B 2VZSA 3ZKUA 1GQGA 1S0JA 1CIYA 3HQRA 4GQ7A 4N8MA 1YIFA 3TEYA 5E16A 5ABJA 1H8VA 3LD8A 4XBQA 4GB33 2D7FA 2WABA 4TLFA 5IW0A 1PGW1 2PHUA 1S2BA 1OMIA 1QU0A 1RUI2 3POWA 3AP7A 4GWNA 2G9ZA 5C8WA 3ZMOA 1RUH3 1ULDA 2A6WA 4MLOA 1RXFA 1UZYA 1WCQA 2B9VA 4XABA 4FQ4A 4QQHA 3WP5A 3PVBB 1SEFA 4QB2A 4MXWB 1WZXA 4NHLA 5DAXA 4PF1A 4Z82A 4LBOA 5CB7A 4GD4A 3ZN5A 4EN7B 2YB7A 3WG1A 5HXVA 4D7TA 5IFTA 1FMD3 1KS5A 2RDSA 2ZX0A 1W2NA 3DYMA 3LAGA 2OYZA 2JEMA 1SMVA 4Z92B 2IVJA 1OKQA 4O9GA 1SQ4A 2E31A 1MS9A 4LIVA 4NPLA 3ZMNA 1R083 1XJAA 1AX1A 4A7YA 1QOSA 1W9TA 2JB4A 3HQXA 2FDGA 5SV5A 3LZZA 3TAYA 4HVQA 3S30A 3CU7A 4C90A 1UWWA 2PHTA 1AL22 5CKMA 3JD71 4NJ4A 5BUVA 5IHRA 3WUDA 2P17A 3RZHA 3ALQA 3ZFGB 3RWNA 5ABJC 4XDPA 2O8OA 1U0AA 4C1XA 2WR9A 1SFYA 1NG0A 1ZA4A 1RUD3 1RL3A 2XBO3 1VBA2 3MUZ1 2D3RA 4CCOA 2VZOA 2GC1A 5A6QA 3I3EA 4NE9A 4Q4V1 4ZONA 5F37A 1F5JA 5K0UB 2IWGB 5LK7B 2BERA 1AR92 1FV2A 3JU9A 4FXKB 4P9IA 3S6PA 5DUVA 4YSFA 3RZMA 1ND3A 1IGOA 1HXS3 5LEKA 1W6QB 2RM21 3N7JA 2GMEA 4LHNA 2YC4A 3H3ZA 4A44A 4I30A 2YBPA 3U14A 2BDRA 3VZMA 3CEWA 2ZGPA 3AP4A 3AZXA 4Y22B 5EHDA 2BPA2 1FPN1 3WP4A 4AQSA 4XF1A 1WUVA 3T09A 5FQ0A 3CKHA 4AK3A 3BGAA 2TUNA 5DQ0A 4YVWA 5FYHA 4I3PA 1WW4A 5HV0A 2ET7A 1BBT3 3D5OA 4GB32 3IDBB 1PGL2 3ZPOA 1RMU1 3OGVA 4QDQA 4MGKE 2R49A 2Y6LA 4U2AA 4DXZA 1T6BX 4Q4Y3 1YXWA 1UZZA 4GH4B 4BH9A 2A6YA 3D3AA 4YM0A 3VL8A 4K20A 4MGQA 1RUH2 3VBFB 2OVUA 2KM2A 1HV1A 1CAVA 4JDOA 3AYEA 4ZPIA 1BYHA 3OYWA 3AP9A 3WEZA 1YYNA 5EWSA 2C1FA 2W47A 2B45X 2RR11 5FXVA 1FMD2 1LESA 3HBKA 4Q5OA 4ZY9A 3BODA 3HIFA 1KS4A 5LBCA 5E6HA 3K48A 1QJY1 3H1WA 1F2NA 5BPXA 1YJKA 2I45A 4F3JA 3RI8A 2D3SA 5F6LB 1R082 2LM3A 1NE4A 1ND3C 1IG0A 2RDRA 4NPRA 2CU5A 3WCSA 5L7OB 2Q0AA 1TME1 4AWDA 4OVEA 1LEDA 3U1XA 3POFA 4IEQA 1C28A 4TXWA 1SLIA 4A42A 3MGUA 3FLTA 4YVWC 1ULEA 2HEVF 1EAH3 5EYXA 5FPVA 4BCUA 4E4HA 2W5FA 3EB7A 2ZXQA 1NQDA 2GP5A 3ROUA 4BZ4A 4FFGA 4Y20B 1RUD2 2XBO2 3H0OA 2V4AA 4XVHA 5D1IA 3DCQA 4CEWC 2NQYA 4R9CA 3AJYA 4MHRA 2C24A 5I0TA 1N1VA 1KQRA 1RUI1 4XW3A 1DDLA 5FZGA 2VMGA 1HXS2 2PN5A 3OGGA 4UW4A 5A7NA 4AVAA 3T4HB 1UMHA 2VY0A 2XHNA 3AYAA 3TNPB 3N7LA 1UZWA 3U78A 3JQXA 1GOFA 4Y33A 1AR73 3VBSB 2P1BA 3M3IA 1GKBA 2VOVA 2ORZA 2WZEA 1Z0HA 3DPRA 5EPAA 3SXWA 5C3PA 3SLIA 4YFZA 1XNTA 3SEEA 2QQLA 1OA3A 2VECA 1UL9A 1BBT2 1W0PA 4JV4A 3KT1A 5A3NA 4YW7A 1JOBA 4B4PA 1JI6A 3KVAA 2IVIB 1C1LA 1F5FA 2W1SA 4M0NA 3JCIA 3KCCA 2XUEA 3SKVA 4DY3A 2VVDA 4CDUB 4META 1QJFA 3UYJA 5J1XA 3SH4A 5FPUA 2AACA 2UYBA 1AL21 4ZZ5A 4NR1A 1ZZ7A 2VUDA 4QDRA 2Q8CA 4CCKA 3KSCA 3V56A 5IVBA 1KXGA 3WR0A 3H7JA 4WVVA 5GLZA 1XYNA 3H3LA 3ZYRA 3HNMA 2FDKA 2WAAA 4YZ4A 3K3OA 2WQ4A 2YROA 1VBA1 3PJYA 3GM8A 4OZXA 2W1WA 4N9IA 3NW4A 4RS5A 4Y1ZA 2W87A 4YYOA 1AR91 3U4SA 3HJRA 3B69A 4E4DX 4JHTA 3MFAA 3ZR5A 2Z79A 3DPRC 4H2AA 3B94A 4QMAA 4WM8B 1U5ZA 2RJ2A 1DP0A 3IN9A 3LEIA 4QPIA 2GMPA 4AEJA 2J1RA 1R093 1CPNA 1MVQA 4CDXA 2VNOA 4JCKA 1VE0A 1WLWA 2BV4A 2PYTA 3FUQA 4NWVA 5D21A 3VDDA 4AYUA 2ADDA 4GB31 3GBFA 4Q0PA 1JZ5A 2XJRA 1PGL1 5BNNA 4KGQA 5FZDA 4NIAA 4NO4A 4XJWA 4P5YA 3DL3A 2PFWA 4BA6A 2CAVA 1FOD3 3H8XA 4GWJA 3LSDA 4W6XA 2A6VA 5KHHA 4I09A 2DVDA 1W04A 1WMFA 3H3UA 3I2KA 3WF2A 1M06G 1W0NA 5IAVA 1FMD1 2WNOA 3ZSLA 2CDOA 1QJZA 4UF0A 1DQ1A 2WT1A 1HJGA 3KT7A 3O1UA 2WN2A 3ABZA 3VZLA 4ARXA 1XQNA 3I8TA 4RS5C 4CEYA 4CTEA 5EJZB 5BNPA 2Y6JA 1R081 1KD7A 1XXNA 1JZ3A 4LT5A 4JHZA 1RUJ3 1N1YA 2P3YA 2GNMA 4AI2A 1KEXA 2O14A 2VQUA 3N35A 4QPIC 4BLJA 2SLIA 4UAPA 5GLUA 4MYEA 4HXCA 2HBTA 4P02B 2VH9A 1X7NA 3WLUA 3VDDC 1J84A 4HBNA 3R0RA 3HAGA 1NQJA 5J37A 3WDTA 2B42B 3WINE 4XMAA 4LE4A 5LK5A 5BNNC 1LOGA 1ACCA 5FMOS 1NE6A 1RUD1 3OGJA 2AYHA 2XBO1 5JR2A 1W0OA 3WQBA 1QNYA 4N53B 2NP0A 3PVEA 4K21A 3GALA 4CP9B 1H4HA 2EIEA 3BTXA 4ASKA 1YHFA 2GAUA 5FRAA 4QKFA 5I91A 2IXLA 4XFGA 4AI9A 5IK7A 2CWSA 1HXS1 1CAXB 1SPPA 2JICA 1W2AX 3WQ1A 4COZA 4CXWA 2CSGA 1F15A 5A1FA 2VQ0A 4MHUA 1IOAA 1R092 5JR7B 1YEWA 4EYUA 4ASLA 2DCJA 2GSYA 2R16A 4RFT0 4BXSV 1UW8A 2W3JA 3U4XA 4CEYC 1Q3EA 5BNPC 4WM7C 1LCLA 2X10A 3AZWA 5D8AA 4YVSA 3ZSKA 1PX4A 4EE2A 4BQYA 1BBT1 5FOJB 3OUIA 5FZLA 4HK9A 5F7UA 2IXCA 4Q4X3 5FZ9A 1O3TA 3BTAA 1W05A
chains in the Genus database with same CATH topology
4IL7A 1AR63 1EY2A 1K5MB 4M3CE 5ACA3 1AR83 1AZDA 1POV3 4BIOA 2VW0A 3LA7A 4B3NA 2JD4A 1RGSA 4R9AA 1S0IA 5T50A 4KGGA 4COVA 5DUWA 2Y26A 4AW7A 4YW2A 1YI9A 3VBRB 5FLIA 3WHUA 2D6PA 4FTSA 3RMYA 1OQ1A 3CF6E 4OHWA 1J3RA 1RUJ2 2WFPA 5GALA 3NO8A 1W6OB 2PA7A 1ZNPA 2CL2A 1QDOA 3SITA 3O14A 3BU7A 3UV9A 5D8AC 2ZGQA 4AG4A 3VKOA 2D5FA 4HVRA 1O4ZA 2UWAA 5EZWA 2EAAA 4QQ2A 1ZBA3 2TEPA 5FO9B 2EA7A 3W58A 1A8MA 3RDIA 2XH6A 2OW4A 3WDWA 3AXDA 3FZ3A 4N7UA 4YZ1A 3MLKA 1RUNA 3NKTA 4CDWA 1W6PA 3FFQA 2B39A 3GYDA 4AEKA 2ZOEB 4YM1A 2WNUB 4Q4X2 1OPMA 4LHLA 4XEZA 1AR62 4PIZA 1ENSA 5I0UA 3ZXEA 1C8M3 5ACA2 1AR82 4DPNA 3TBDA 2XLFA 3KGZA 2KXLA 3CJIB 4YGBA 3WP3A 2OIIA 3AKRA 3WW1A 1MVEA 5GLVA 1EP0A 4EN6B 1HLCA 1W6NB 2VUAA 2ZX1A 2ZGTA 4XJ9A 2QDNA 3MLLA 3IIAA 2WNVA 3LCPA 3WDYA 2R043 1D0GA 4LR4A 2ATFA 4AQ6A 4L99A 5T3NA 4P9YA 1SLBA 2K9ZA 1LGNA 3VBHA 1J3PA 5IK7A 3J8F3 2XJQA 2I07B 2XJUA 4Y4YA 4CP2A 1WA4A 4QU2A 3VKNA 1PIV3 3QLQA 5JOZA 4F8AA 1GFF2 2WZPP 4CDWC 4XF0A 1GNZA 2ZZQA 2I74A 1D4M3 2ZGUA 5BNOC 3KCXA 3ENRA 1ZBA2 3OPZA 5H9SA 5BXXA 1GZCA 4ZU7A 4ZXKA 2E9QA 4IEOA 4Y24A 2FHRA 3WZ1A 1VP6A 1O3RA 2ZKLA 3KT4A 3RZZA 2IXJA 4K6BA 4R9BA 5I0SA 4FQZA 4QPGA 3E6BA 3N7MA 1CJPA 1ZREA 4XXPA 1V6OA 1MS3A 2A3XA 3GZUC 1UN1A 2WNVC 2VXRA 2YGMA 4YZ2A 4ASMB 2JE7A 2Q1MA 4Z1VA 1FAYA 3VBHC 1RUOA 4TWTA 1RUJ1 3BCWA 1PZ8A 2K0GA 5GM0A 1C8M2 3ZYJB 2O0OA 2RS53 2P3IA 1LHVA 2B46X 3O5SA 2ARBA 3AMPA 3WG1A 5FO8B 1D4VB 1DBNA 2AGSA 4FPJA 1KFXL 4QM9A 3VBUB 1S0BA 1OSGA 4Y1VA 1AVBA 1O7FA 3OY8A 1CAUB 2R042 3M4FA 1LGBA 3QH6A 4G9SB 3AJZA 3JD73 5I8YA 2TNFA 1O5LA 1G86A 4DB5A 1LB2A 3WDVA 4QPGC 3J8F2 4HT1T 3ZXLA 4AEDB 1CGPA 4IETA 2JJ6A 1AHSA 3ME2A 4LHKA 5FFOC 3B02A 1PIV2 4Q26A 4EV0A 3H50A 3INAA 2NN8A 4COUA 4E2GA 1FXZA 2UWBA 2QZ3A 3AK0A 4Q0UA 2XL9A 1D4M2 1Q43A 4DZGA 4Q27A 2PHXA 1DF0A 4JC1A 1ENXA 4XPVA 1X82A 3WOGA 5DZGA 3PMEA 4Q4X1 4KQ7A 3U0ZA 4TSVA 3ZN6A 3ZYIB 1AR61 5J3UA 2Q8OA 1SFNA 2B5HA 2BWAA 5ACA1 1AR81 1H1IA 1IZ3A 1POV1 3VHOA 4FO9A 1YFYA 3EO6A 2JE9A 4PCRA 2NYYA 1CVNA 4PLMA 2HWD3 1AXYA 1ZZCA 1DHKB 2NM1A 4PDWA 5JPNB 3FUOA 1DG6A 1BVP1 4OHYA 4BQ1A 4AVBA 1OQEA 2VOXA 3HT1A 4FPLA 4AVTA 3QBQA 1LRHA 2YPJA 5JI9A 5CNAA 2A6XA 4K1ZA 2RS52 1QJY3 4N90A 2R30A 4MSVA 5IK8A 1QXJA 1UF2C 4BYYA 1ULCA 3H1MA 2VNRA 1H4GA 1ZBA1 1DQ2A 5C9AA 3H7YA 4Q8KA 1URXA 2MEV3 3U10A 4N43B 4BOWA 4MGYE 5KXEA 1B35A 2EXHA 2QFEA 1MACA 1NXD1 5JMCA 1UMZA 2IZWA 3IPVB 4XQWA 1CR7A 4WVMB 1WLDA 5JZGA 1RJ7A 2W39A 3UK9A 1N1SA 4G3YC 3UL2A 5KBFA 1PK6A 5FAXA 2ZZJA 3MF9A 3KGLA 2BEOA 2VMHA 3LOBA 2ENRA 4WVWA 1OOPB 3TRSB 5CFCB 2DVBA 4QHBA 1Y3TA 1C4RA 2EALA 5JOXA 1H1AA 4JRLA 5JWPA 1C8M1 1WLTA 1N1TA 5CU1A 2A71A 4AE2A 5KXCA 3KB5A 4DRRA 3KD4A 1U5IA 1PO13 4XE9A 3RNSA 4H14A 5T55A 2HWD2 2CAUA 5C9AC 4LBJA 5FO7B 3I59B 1KJRA 3ZIWA 2R041 1B35C 5CFDB 1NLSA 4HETA 4PIYA 3AX4A 4AFCA 1S0FA 2VW1A 3J8F1 1A78A 2QUOA 1OPOA 4FTBA 1IHMA 5JZGC 4M00A 4XMIA 3JQWA 1PIV1 3VZNA 3T1MA 2RS13 3QOPA 3HD8B 1PK6C 4EN9B 4Z2WA 1D4M1 4Q4W3 1HIXA 3A0NA 4I0BA 1ZVFA 1NCQA 1DZTA 4DQAA 1R1A3 2MEV2 2ZS6B 4HKWA 4ATEA 1Q5OA 1TE1B 4E9KA 3ECQA 1IKPA 2P3JA 2A3YA 3AB0A 5A33B 1RUG3 1EPWA 1UKGA 5JAXA 5IK4A 3MIEA 1VAVA 3ES4A 4Q1RA 4AI8A 3J26N 2CY6A 2YUEA 3EHKA 4XBNA 4YZ3A 4YGDA 3TOJA 4MVTA 5A3LA 1QXRA 4CP1A 2HWE3 4GMP0 2CNAA 1Q8PA 2GNBA 2X5IB 3V65A 2DVGA 1A3KA 2ZAAA 2X8KA 4X6QB 1VALA 4AGGA 1C8NA 2AREA 3CJXA 2RS51 1ALYA 1SCSA 5C4WB 1M4WA 4LUKA 3VZOA 1FNYA 3ZIXA 3WQ7A 1PO12 4F7ZA 2BNMA 2VVFA 5DDJ3 1NCQC 1J58A 1YFXA 5KWRA 4RR3B 5DZFA 3NL1A 3BOWA 1F31A 1AXKA 4UBHA 3FE5A 1SLLA 1Q56A 1DLLA 2XHKA 4JRAA 5E1RA 4Q0QA 1U5XA 2R6QA 3AKTA 2BTVC 2CV6A 3ZFGA 5C6CA 1LOBA 2EXIA 2GN3A 2RS12 3O7OA 2OZ6A 4QGLA 4MGIE 1X36A 4Q4W2 4K8FA 4OHZA 4FPGA 4K3UA 4C1WA 4P9GA 1CN1A 3WT3A 4QQOA 4RL7A 5K0UA 5FLHA 3A0KA 2WJSA 1AX0A 1R1A2 1W6QA 4XF3A 4CZSA 1J1LA 3WVJA 1XRUA 3GNEA 1RUG2 4RQPB 3O12A 5E8AA 3OBTA 3LOIA 2A73B 1G8WA 1DQ4A 3LA2A 4CEWA 3AYDA 1LHUA 2F4PA 4EJRA 5KHGA 2HWD1 1LHWA 3D82A 3VBFA 1NZCA 1OFNA 2DCYA 1TEIA 4D7SA 2HWE2 1D2SA 1XE7A 3B3QE 1REEA 3KLSA 2R073 4JGZB 4YVWB 2UU8A 3ZFGC 1I6XA 2YGLA 2CGOA 3VHNA 4COYA 1RIRA 1WD4A 4E2SA 1JH5A 4OHXA 1SCRA 5F5QA 5DDJ2 3S0MA 2O8QA 3RS6A 5K0UC 4UXAA 4AF9A 3KCYA 3OYWB 3IMNA 2ZHNA 4CRQA 2PAMA 3FMGA 2ZX2A 1GZ9A 1WBFA 5C8CB 1N3QA 4XXAA 2MEV1 2QCSB 2JECA 1KDMA 1ONAA 4OI1A 3M3EA 1ULFA 2GALA 2I2SA 1BKZA 4MH0E 4YGEA 2HWC3 4Y20A 2QJVA 3S7EA 3VBFC 1X8EA 1DQ6A 2ZJCA 3ZDSA 1DYKA 1I5ZA 1SACA 3R4UA 4ONUA 3MIBA 1H1MA 1NCRB 2VQAA 1L3JA 3WQ0A 3VBSA 2YV8A 5HI0A 1XU2A 1H2NA 2YYOA 3V0AB 2BUKA 3DF0A 1N3PA 1UX6A 2W68A 1XYOA 2WA3A 3ILNA 1PO11 1PZ7A 4IEXA 4YW4A 2WL1A 2DVAA 4LA2A 4Q8LA 1IPJA 2EAKA 2GU9A 3RPQA 2VOWA 2R072 4W6YA 4P9WA 4DY5A 4LA3A 4AI3A 4IEWA 1CPMA 4G4FA 3DN7A 2ETEA 2Q4SA 2VU9A 2NPIA 3E6DA 3VLBB 4D94A 4SLIA 1AJKA 3RG0A 4HZFA 5K7PA 2RS11 2E7AA 3PJQA 1PHMA 3VHPA 4Q4W1 1UPSA 4DOUA 3I7DA 2ZGRA 1UAIA 2DFCA 3D6EA 5KHIA 4E2QA 5A3MA 3RI9A 1PZ9A 3VBSC 1R1A1 4C0HA 2VW2A 3R05A 3URFA 3VUOA 4WM8A 2ZMLA 5E88A 4KH9A 3HR9A 1VB4A 2DUPA 4KL1A 1RUG1 3MFCA 3POSA 1O3QA 2BNOA 4L97A 2HWC2 3FBYA 2OUJA 2WINB 4Q0SA 2PHDA 1VBE2 5CVRA 3NV2A 4R8HA 3ATGA 1DZRA 3GBWA 1XNCA 3WP6A 1J3QA 1C5HA 5JI7A 4AFAA 3IM0A 2HWE1 4NN0A 4CDXB 1GZWB 1LU1A 4D3WA 4AI1A 4DRVA 4XFHA 2Q5TA 1MZ5A 3FWEA 2PLV2 2BW8A 4IV3B 4WM7A 3SMHA 2A3WA 5F6KA 5DDJ1 1J59A 4I0AA 1MZEA 1COV3 4XBLA 3ETQA 1GLHA 1YUDA 3VKFC 4YG3A 3H9AA 4WM8C 1WBLA 3NV3A 5T54A 1UPIA 2HWF3 2GC3A 3LGRA 2RJLA 4OHVA 3WG3A 4B4RA 1O5UA 1BQPA 1IKQA 2Z2SB 3OF1A 1NY72 1YFUA 4AQ2A 3AXEA 4P9LA 3VHRA 4ZU4A 2XLAA 2BYVE 4AHWA 4R52A 1G6NA 3I4IA 1VR3A 3O0WA 3POYA 4N53A 1BXHA 1MS4A 3ZFFA 1GR3A 5IUQA 4JQRA 4RHV3 1CAXA 2XKPA 4SBVA 1Z78A 4QGMA 1PM7A 4M0HA 5F1RA 1RHI2 1YWKA 4QX5A 4V1PA 2ZACA 1CJDA 5K8SA 4LO7A 4EWAA 1LOEA 4TYSA 3IKWA 2O1QA 1JXNA 1SLAA 3JZVA 4OI4A 4KG0A 2ZGKA 3M3CA 2GH8A 1UD1A 4GKXA 3A4UA 1K5MA 2YC0A 1V6LA 1HQNA 1VIWB 2R071 2DUQA 4D7YA 3KS7A 2ZGNA 4YVSB 4YG6A 4P9XA 1QOTA 1PMIA 4KBBA 4L92A 4Q29A 3UJOA 4J1WA 4XJUA 3ZN4A 4LE3A 2ZAHA 5LEJA 4N53C 2VVEA 3VBRA 4OUMA 4FBFA 3ZFFC 1COV2 1X33A 4P5HA 2Z69A 1QDCA 3AKQA 3ST7A 2A5ZA 2CWMA 2D40A 1QQP2 2WSUA 3DV8A 4AFBA 4AI0A 2HWF2 4CDQB 2F6BA 2Z5WA 3NWKA 4FXGB 1O3SA 4R9DA 4H3WA 5CA6A 1BMV2 2UY9A 4PQ9A 3NAPB 5EV7A 2A7AA 2HWC1 1BCXA 2MNGA 1VBE1 1XNBA 2N7GA 1S0GA 2OPKA 4IEUA 2W08A 2VOKA 4M3CB 5KHJA 1K5MC 1LKNA 1HQLA 4RHV2 4LUMA 2V5YA 4KNCA 5HBAA 2XJPA 1DZQA 1G9FA 2EXKA 3ZO0B 3ZFEB 4S2GA 3VBOB 3VBRC 1DIWA 4RGGA 5K9YA 4ORFA 5BNOA 2PLV1 2BVBA 2OA2A 1U5YA 2X29A 4LO5B 1LU2A 4GIQA 1CX4A 1QMJA 2ZMNA 3ES1A 4MX3A 5GJ6A 3BB6A 4Y5Z0 5A32B 1O4YA 5DG1A 4LBQA 1W2UA 2ZPXA 2E53A 2DTWA 4AFDA 1VBB3 2ZGMA 2R0HA 3B01A 3CJIA 1V6NA 2XPJA 1H9PA 4RA0A 5IK5A 1HRI3 1NY71 4YZ5A 3N3HA 1YIPA 5JLVA 4LLFA 3P3PA 1RVF2 5JOWA 4ATFA 4XOGA 4HSLA 4IEVA 3TN93 3LA3A 4W6WA 1XE8A 4FP3A 1DQ0A 1QJU3 4XFCA 1VBC2 1W6MB 1RHI1 4K1YA 3TWIA 3VN4A 2XVGA 2ZHKA 2B9UA 2WS93 1LR5A 1AXZA 1LENA 3M3QA 1G9AA 5E89A 1A8DA 4XQ4A 1FX5A 5CBLA 2JENA 3D0JA 4J1XA 2XUMA 4WZCA 3WV6A 1ND2A 4QGNA 5CG8A 2BWCA 4FVVA 3CJIC 2QKDA 3AFKA 4PBOA 4GALA 4FPOB 3KM5A 5LRRA 3PNAA 1ZZBA 1TMF3 2PHWA 3TB0A 4QM8A 4HK8A 1COV1 1H9WA 1RB8G 3SCGA 3WW3A 4P14A 5H9RA 1C3HA 1QQP1 2HWF1 4FOWA 4HFSA 2UYAA 1VBB2 4QXKA 4AHZA 4ES9A 4XIOA 1H8TB 1HRI2 2JG8A 3VBUA 4IV1B 1GANA 4WBBA 1BMV1 4N7IA 1ULGA 1DGWA 2SBAA 4HPKA 4GMP3 2H6BA 5T52A 4D69A 2Z42A 1CAUA 3R4DB 3AMMA 5T5OA 3N4MA 1ND2C 3OBRA 4K40A 3TN92 3AZYA 5FPXA 2DU1A 3GF6A 1S2KA 4HMZA 1S0EA 3NVCA 2WSVA 1Q8SA 4RHV1 1WCKA 1X8MA 1QJU2 4JGYB 3OY8B 1DGRA 1UKRA 3VV1A 5FLJA 5GZFA 4FCAA 3MYXA 4XETA 4YRDA 2WS92 5BYNA 1D2QA 1AL0G 5HCFA 3UKNA 1V70A 3WCRA 1MQTA 2ZHLA 3RYPA 1DGWX 4FPEA 4U36A 3SHRA 3PVNA 2WWSA 2D6KA 5CADA 2XWBB 4M01A 1VAKA 2JG8C 3VBUC 1EV13 4YGCA 1LOFA 2DURA 4OULA 2GNTA 3IBMA 4Q1PA 2BNNA 1TMF2 1RVF1 1SLCA 1UCXA 4PF5A 4OUSA 1NLRA 1S0DA 5CAZA 1HQWA 4X8NA 1S1AA 2FBEA 2FZ2A 1CAWA 3E5XA 1YO8A 2OUHA 1QH6A 4FPKA 5BV6A 1LGCA 4UW5A 2A6ZA 1VB2A 5FCCA 2E7TA 3AMQA 4L9BA 4KU8A 4PDWB 2WA4A 2ZGSA 1VBC1 4HSJA 1EPZA 1ENRA 1MQTC 2ZMKA 4NHKA 4QT6A 5B2GB 2UWCA 3V0BA 3PMSA 3ZXKA 1QHDA 1Q8QA 2BBVA 3QH7A 1WGPA 3QCWA 2E7QA 1LULA 2JG9B 2PHFA 1OI6A 3WG4A 1ASJ3 3J4UH 3AMNA 1LOFC 3IPVA 3MZHA 2E63A 2FMDA 1F9KA 4LTAA 3MIGA 1QF3A 4JAAA 2IFRA 2WIIB 5JIUA 2DV9A 4P9JA 3UKTA 3MDPA 3U07A 1QH7A 4RSUA 4AFMA 4A3XA 1SDWA 4Q2FA 3MI8A 2XB6C 1OOPA 5CFCA 3H8UA 1WW6A 4OLLA 2ES3A 3LB9A 5AC92 3RYRA 3G6JB 5AFBA 2NMOA 3GHNA 3ELNA 4IEPA 1EV12 1HV0A 4AHYA 3AKPA 1VBB1 4FOVA 1OFSA 1I9RA 2GZWA 1HRI1 4PBPA 2X53S 1REFA 1Y7BA 1CD3G 1BEV3 3ZVXA 3RJ2X 3I59A 1GV9A 5CFDA 3TN91 1J1TA 4C0BA 4I0WB 4GA9A 3ZXGA 4XJAA 2BVVA 3USUB 4XHXA 1QJU1 1GICA 3E97A 3M3OA 4L2NA 3SCHA 2ZCWA 4E4SA 5T5PA 1YCIA 1HRV3 2WS91 3SISA 2R1BA 3VL9A 5J09A 5J7MA 1T6GC 1OOPC 5CFCC 3I2DA 3M7AA 1OA2A 3ZPYA 3WY6A 4ISQA 5FTTC 4CYDA 2GDFA 1ASJ2 2OZJA 3W59A 3GZAA 1OLRA 1NA1A 1NXMA 1RINA 4LBKA 2RS32 3RSJA 4AWDA 2HKXA 2XKOA 3RJRA 3ACLA 4AEMA 2R0FA 5SV8A 1NCQB 4YW1A 4AGRA 3O0XA 1TQ5A 2JXAA 4PLNA 3CLPA 2ILMA 3G7DA 2CYFA 2QNKA 5CFDC 2P34A 4Y1XA 3WUCA 1TMF1 1MS0A 3WX5A 4FPHA 1MZ6A 1HX6A 1QXPA 4C91A 4MXWA 5ABJB 1BK1A 2X5IA 4Q0VA 1HKDA 4Z8BA 4B4QA 2R32A 4CP0A 3AKSA 2AR6A 4L11A 2XLGA 4YARA 5C4WA 3HBZA 4XIKA 1AYM3 2HWB3 1PGSA 1LHOA 2E51A 1WLCA 2ZBJA 3WD5A 5I8SA 2WLPA 5GZCA 4FPFA 4NWWA 1BEV2 4RR3A 4XDQA 4GMP1 1ZRRA 3OD4A 3FC0A 1G9BA 3CNAA 3MIHA 5EYYA 2D97A 2PAEA 1NA1C 2HEYF 2IXKA 4FAHA 5IT6A 4DS0A 1REDA 4Y1UA 2D6LX 4QQLA 4I01A 1AX2A 3AZVA 3GZTB 1R1ZA 3MW4A 5T5LA 4OFGA 1H0BA 1HRV2 1PNFA 1VRH3 2VGDA 2CGNA 3Q9OA 2X5IC 2WFF3 3RMXA 3CL1A 3BIWE 3OD0A 4Y22A 2VG9A 4M3CF 2C0ZA 4BM8A 1O91A 2DYCA 5AC91 5C4WC 5JSRA 4LO6B 2PTMA 4RQPA 3QD6A 5C33A 4RD7A 1ND3B 4HVOA 1EV11 4JTNA 4YNIA 5KXDA 1C5IA 1LEMA 4RR3C 4QQPA 4GH4A 5AVPA 1ZX5A 4OI2A 1EYBA 3H1YA 2DCTA 3PVOA 5FQ0B 3DUIA 2JDZA 4JDNA 2NLRA 2UY8A 4JGZA 1Q8VA 1RUF3 3MW2A 4XYXA 1MEC3 4CEWB 4I3GA 4B8EA 1CAVB 3WXPA 2VULA 4BHPA 1AYM2 2HWB2 3MPPG 1RTVA 1KRIA 1HDKA 1RUE3 1NYWA 5L7OA 4URTA 1F8VA 2R063 1V00A 5C8CA 2GNDA 2ZA9A 2V09A 4RQPC 1ASJ1 1LTEA 2VMIA 3NJZA 4Y1YA 3L9JT 1UIKA 4FTEA 1DGLA 2WZR3 3GBGA 2PHLA 1YNAA 4GH4C 4WVZA 2RS31 1BJQA 1VBE3 4JDMA 1KFUL 2XVLA 3THPA 4BPZA 1GYKA 1H2KA 3NV1A 4ITCA 1LECA 5I8TA 3IT8A 1VRH2 2WFF2 2D6MA 4JGZC 4AHXA 1NCRA 4WZFA 1WD3A 4IEZA 5DUXA 1SBEA 3LWCA 3PLQA 3WNXA 1UU4A 4MZUA 3V64A 3ZSMA 4TZDA 4FOQA 4Z07A 2W52A 1MS8A 5GZDA 2PLV3 2XJVA 5H9QA 1I3HA 5JOYA 2XVKA 1FT9A 2YZ4A 3V0AA 5L7OC 4L8QA 5GZGA 1JBCA 5BNQA 1CESA 3FLRA 3DPRB 3HWJA 4CDUA 1BEV1 4J