1ND2C

The structure of rhinovirus 16
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
238
structure length
238
Chain Sequence
GLPVYVTPGSGQFMTTDDMQSPCALPWYHPTKEIFIPGEVKNLIEMCQVDTLIPINSTQSNIGNVSMYTVTLSPQTKLAEEIFAIKVDIASHPLATTLIGEIASYFTHWTGSLRFSFMFCGTANTTLKVLLAYTPPGIGKPRSRKEAMLGTHVVWDVGLQSTVSLVVPWISASQYRFTTPDTYSSAGYITCWYQTNFVVPPNTPNTAEMLCFVSGCKDFCLRMARDTDLHKQTGPITQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords coat protein VP1
publication title Structural and virological studies of the stages of virus replication that are affected by antirhinovirus compounds
pubmed doi rcsb
total genus 41
structure length 238
sequence length 238
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2002-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1nd2C00
3VBOC 5C4WA 1RUF3 1AR73 1RMU3 1TMF2 3VBFC 5A33B 1HXS1 1DDLA 1ND2C 3ZFEC 1R083 3JBG2 5ACA3 1QQP1 1ZBA1 4RS5A 1FOD2 1VBB3 1AYM1 2R062 1PIV3 2BBVA 5CFCC 1VBC2 1AR62 1IHMA 3DPRB 1RUH2 4RR3B 1PVC3 2RS31 4IV1A 1D4M2 1PO13 1BBT2 3VBUC 5C4WC 1RUD1 5K0UA 1BEV3 2HWE3 2RMU2 1ND3B 1RUJ1 4CDXA 4CEWC 4EJRA 5JZGB 3ZFGB 2BPA2 2WZR1 2RR12 1NA1B 1MQTA 1EAH3 1EV12 1PGW1 1RVF1 5GKAC 4N43A 3VBRC 5J98B 1R1A2 4GMP3 1ZBE1 2HWD1 1VRH1 1HRV1 1FPN2 3VBHA 4JGZB 1HRI1 4Q4Y2 2HWC1 4Y4YA 1AL21 1VB4A 5FMOL 1RUF2 1AR72 1RMU2 4GB33 2IZWA 5D8AA 4CEYC 1QJX1 1R082 4JGYA 1VBD3 1K5MB 1BMV2 1OHFA 5ACA2 4AEDA 1QJY1 2R071 2RS53 1VBB2 4Q4X3 3VBSB 1PIV2 4SBVA 2RS11 4QPGB 1RB8G 4YVSB 4CDUB 1RUI3 1NG0A 1PVC2 1AR83 5BNNC 1NY71 3CJIB 1PO12 3VDDC 1BEV2 5D8AC 2HWE2 1C8M3 2X5IA 1PGL2 1OOPB 4JGYC 5CFDA 1HXS3 5DDJ1 4AEDC 1POV1 5L7OC 2PLV1 1OPOA 2WFF1 1QQP3 1EAH2 1ZBA3 1NCQB 1AYM3 1RUG1 4CDQB 5C8CA 2WLPA 4CDWB 5A32A 1TME1 2WS91 4FTBA 4WM8C 2RS33 3VBOA 4Q4V1 3VBFA 1RUD3 2X5IC 4NWVA 2WWSA 4PDWC 5CFDC 1ND2A 3ZFEA 1COV1 1NCRB 1RUJ3 2ZTNA 1CJDA 5BNOC 3TN91 4GB32 2WZR3 1X33A 5CFCA 1POV0 1QJU1 1VBD2 5C9AC 1RVF3 3NAPA 1AYN2 1VBA1 2RS52 4Q4X2 3VBUA 1ASJ1 1ZBE3 2HWD3 1VRH3 1B35B 1HRV3 5ABJC 1H8TA 1RUI2 4IV3A 4CEWA 2RM21 1AR82 2TBVA 1HRI3 2HWC3 1RHI1 1AL23 1C8M2 2R041 4Q4W1 3DPRC 4RR3C 1HXS2 1QJX3 3NAPC 4N53A 3VBRA 3VBOB 3ZFFB 1AR91 1QQP2 1QJY3 1ZBA2 2R073 1ND3C 1AYM2 1D4M1 1H8TC 4IV3C 2RS13 4RQPB 3ZFEB 3JD71 2HWB1 4QPIC 2RS32 1RUD2 4CEYA 5BNPC 4WM7C 1RUE1 5FOJB 3S6PA 2XBO1 1RUJ2 4N53C 4YVWC 4GH4B 5DDJ3 5C4WB 1POV3 2PLV3 4NWWA 2WZR2 4JGZC 2WFF3 1RUG3 1RVF2 1PGW2 2HWF1 4RS5B 1TME3 1W39A 1HQNA 5BNNA 3HAGA 3VDDA 1R091 2WS93 1ZBE2 2HWD2 1VRH2 1C8NA 1FMD1 1HRV2 4Q4V3 1K5MC 4IV1B 3VBRB 1AYN3 5L7OA 1COV3 1HRI2 1MEC1 1RUC1 4RHV1 3VBSC 5K0UB 2HWC2 1AL22 4QPGC 4CDXB 4YVSC 4CDUC 3TN93 1QJX2 1VBE1 4FSJA 1QJU3 3CJIC 4WM8A 4LLFA 1MQTB 4FTEA 5AC91 1QJY2 2R072 1VBA3 2BFUL 1CD3G 1ASJ3 1OOPC 1F8VA 5FMOS 1PO21 2RS12 4PDWA 4N43B 2XPJA 1NOVA 3IDEA 3JB4C 5BNOA 2RM23 1VB2A 1NY72 3VBHB 1NCQC 4CDQC 3M8LA 1RHI3 3J8F1 2R043 4Q4W3 5C9AA 5DDJ2 2VQ0A 2MEV1 5D8AB 2PLV2 1F2NA 5A33A 1AR93 2WFF2 4JGYB 1NCRC 5ABJA 1RUG2 4AEDB 1TME2 3JD73 1E57A 2HWB3 1V9U1 2WS92 4RFT0 1GFF2 3DPRA 4Q4V2 1AUYA 4RR3A 1RUE3 1COV2 2XBO3 1Z7S1 2ZAHA 1M06G 2X5IB 1ND3A 3TN92 2FZ2A 4PDWB 5CFDB 5JZGA 1TMF1 1QJU2 4QPIA 5BNOB 2HWF3 2GH8A 1VBA2 3JBG1 5C8CB 1R093 1ASJ2 5BNPA 4WM7A 5A32B 1FOD1 2R061 5C9AB 1FMD3 4YVWA 1VBC1 3ZFFC 1AR61 4Z92B 2RM22 3VBFB 1RUH1 1MEC3 1RUC3 4RHV3 4JGZA 1RHI2 4RQPC 1ND2B 5ABJB 1BBT1 5JZGC 2R042 3FBMA 4Q4W2 3ZFGC 2RMU1 2Y26A 1NA1C 1VBE3 3LOBA 5CFCB 1AR92 5AC93 1A6CA 2RR11 1K5MA 3NAPB 4Y5Z0 3ZXAC 4GH4C 1PO23 3JD72 1EV11 3VBUB 2HWB2 3VBSA 4QPGA 4YVSA 1H8TB 1R1A1 4IV3B 4CDUA 4CEWB 4BCUA 3J8F3 1FPN1 4RS5C 1RUE2 4QPIB 3CJIA 2XBO2 1HX6A 4GH4A 2DF7A 4Q4Y1 5BNPB 2MEV3 4WM7B 2FZ1A 1OOPA 4IV1C 1RUF1 4N53B 1AR71 1RMU1 4YVWB 5K0UC 2HWF2 1R081 4CDXC 1BMV1 1NCQA 5ACA1 4CDQA 1V9U3 1R092 4CDWA 1VBB1 1FMD2 1PIV1 1VAKA 1MQTC 1Z7S3 1MEC2 1RUC2 1PVC1 4RHV2 4CEYB 1QJZA 4N43C 5LK7B 1PO11 1NCRA 2ZZQA 1BEV1 2HWE1 1PGL1 4FTSA 1TMF3 1VBE2 3JB8A 3VBHC 5AC92 4CDWC 3JBG3 1EAH1 1PO22 5BNNB 1FOD3 2R063 3VDDB 1VBC3 1AR63 5J96B 1B35A 4GMP1 1RUH3 3J8F2 2BFUS 1D4M3 5L7OB 1BBT3 2RMU3 2QQPA 1SMVA 2MEV2 1AL0G 4GB31 4WM8B 2RR13 3ZFFA 1VBD1 1EV13 1B35C 1V9U2 1AYN1 4RQPA 2RS51 4Q4X1 1R1A3 3ZFGA 1NA1A 1FPN3 1RUI1 2BUKA 1WCDJ 1Z7S2 5C8CC 4GMP0 1X36A 1AR81 2GSYA 4Q4Y3 1C8M1
chains in the Genus database with same CATH superfamily
1JMUB 3AB0A 3HOBA 3KLSA 4CP0A 2VJXA 5I8TA 5A33B 1HXS1 3WQBA 2NYYA 3KHBA 1QIQA 3ZFEC 1GOHA 3AP9A 3AZZA 3JBG2 1EY2A 4NRMA 4E2SA 2DV9A 2JG8A 1XPWA 2VTXA 5T5PA 2OXBA 2UWBA 4ZZ8A 3WP5A 2XKOA 4CYDA 1LTEA 1VBC2 4LK7A 3H1MA 1AR62 5LBBA 1W9FA 2WYFA 4A7ZA 3RQ0A 4LA2A 5A1FA 2CAUA 2A6VA 4MXWA 1AX0A 3OY8A 3LGRA 4KI5M 4YNIA 2NPIA 3BTZA 1NQJA 2XXZA 3WQ0A 2W08A 3H50A 2MHFA 2RMU2 3WG4A 4D69A 3LEKA 2A6ZA 2BOIA 4DXSA 2WO1A 3WW2A 4INDA 4R9CA 4EJRA 1DQ2A 4CE8A 2BPA2 4AFAA 5HCAA 2IUWA 4AF9A 5EYXA 1S0GA 5FO8B 1IG3A 2XVGA 2VBDA 3BYWA 4QX7A 3MDPA 2FDIA 5H9RA 1ULDA 2W46A 1QGLA 5F32A 2Q30A 4UW5A 1XNTA 1LOBA 4RA0A 3PLQA 3AX4A 2W1SA 1IPKA 2Y64A 4KG8A 4AL9A 1FPN2 5LW9A 4CP1A 4B1MA 1UOBA 1GP5A 1WLWA 1WCUA 4L9BA 4E8CA 2YROA 3BI3A 1OBNA 4Q4Y2 2JG8B 1LOFC 2OQ6A 2P1BA 1VMFA 2QQUA 4XBQA 4W6YA 3X29B 1UZVA 3I2FA 1N1TA 2XB6C 3E1F1 4XQDA 4AE2A 2H0BA 3KV6A 5D1IA 2PXJA 2B7YA 1P8JA 4CEYC 5J3UA 1QJX1 1JZ6A 4YZ3A 5I0UA 4E4DX 1JI6A 1VBD3 2GC1A 3FHAA 4Y1ZA 3T08A 1BMV2 1YQ2A 2DVGA 3LSEA 4AEMA 4AEDA 4M3CA 4NE9A 2O14A 2RS53 3UJOA 4I09A 3WF3A 1JYXA 4SBVA 2RS11 3AL6A 4TLFA 2BOJA 1RB8G 2YZ4A 1TVGA 1WD4A 5HXMA 3ES4A 3DKWA 5EP9A 4G4FA 1F4AA 4QGMA 3WNMA 4DEVA 2GC0A 1HB4A 2LRPA 1Q8QA 1S55A 2VZUA 5JMOA 1K45A 2C26A 1OLQA 4OHVA 2C0ZA 5D8AC 1GSLA 4BM8A 1UF2C 4MO3M 1C5HA 5IK7A 3O1OA 2X5IA 5C71A 4QX2A 4ASKA 1SZBA 3NJVA 1EP0A 5FP8A 5DUVA 2C4XA 3ACFA 2ZGKA 2QNKA 4D94A 5LA2A 2XVKA 2JWPA 2PQQA 4H3WA 5APAA 3N35A 5JOXA 2DCYA 3B00A 1OPOA 1Q8SA 2GMMA 2WFF1 5JI7A 3VDAA 5IVBA 5FY4A 3K77A 5FP4A 4PLOA 1Q8VA 4JQTA 5KC5A 3ZSJA 4AXOA 3VL9A 3BIWE 3FFQA 4WM8C 3T2PA 1N3PA 3SITA 1XNKA 4XF4A 3VBOA 1GLHA 3I4IA 2YGMA 1MS5A 4NAOA 1QOOA 1SFPA 3AC0A 3MV01 4XETA 5CFDC 4V2VA 5AVPA 2ZOEB 1ZRIA 2Z2SB 5CADA 1CJDA 3UK9A 1NLSA 3ZXGA 3M3EA 1PMHX 3POWA 2IFRA 1WZXA 4FOVA 3M3IA 5BNOC 3RZMA 1D4VB 2WC2A 5F5QA 2X09A 4CXXA 1JTZX 3S0MA 3KHCA 2WZR3 4K1YA 5BV6A 1XBFA 3KF5A 4K3UA 4IUGA 5DXDA 4COZA 3S57A 4XF0A 1VBD2 3ZM8A 1TE1B 4JV4A 1RVF3 1UOFA 5A80A 1VE0A 2RDRA 4V2WA 4LK6A 1VBA1 1WLDA 2RS52 2W68A 2B8MA 3AZYA 4L97A 2OT7A 4M0HA 3MFCA 2HWD3 2ZGNA 1WMFA 4BB3A 1O3SA 2XLGA 3PUAA 4HT1T 5E88A 1ZZ8A 4CEWA 4YARA 1QHDA 4CP9A 1UZZA 2ATFA 2HWC3 2GMPA 5LWBA 1RUOA 2EA7A 2MPFA 3ZN6B 4JKMA 2IVIB 5FTTC 2A3WA 4Y22A 5FYBA 3PIGA 3A21A 2R041 4P5YA 3WQ7A 4DRVA 2DFBA 2HYXA 4Q4W1 2WNUC 3PNAA 4WZFA 5FZ7A 3HBKA 5ANNA 3J4UH 5GLWA 4AQ6A 2FDFA 2JG9A 3VB9A 1GQPA 2WAAA 5GJ6A 4PT6A 4B29A 4R4ZA 3VBOB 1Z0HA 1G9DA 5FWEA 3AP7A 1VR3A 2RV9A 5KXBA 1JZ2A 1CWPA 4NRQA 5J7MA 1D4M1 1H8TC 4IV3C 2W87A 4RQPB 1WCSA 3EQEA 2XJUA 3JD71 5FYTA 4S2FA 4AR2A 4XE9A 4XTPA 3MFAA 2XMLA 3IT8A 5GZCA 4QX5A 1PNGA 4O9GA 4EV0A 4CCOA 1W2UA 5BNPC 3OUIA 1W0NA 2VBPA 5H9QA 5CISA 5IFTA 4K6BA 3CL1A 2XBO1 4BZ4A 2C1FA 2ZHLA 5D2AA 1XSQA 5A3OA 2W5FA 1GOGA 5HCBA 3RMYA 5C4WB 4AI2A 1AX2A 3ZXEA 3OUHA 2PLV3 3K4DA 2B4KA 4AI3A 1ZA4A 2WZR2 3A4UA 4JGZC 2LS6A 1PM4A 4J6GA 1XE0A 3KGLA 4C91A 1W8ZA 3F95A 4IEVA 2V5YA 5FXXA 1RVF2 4Q0QA 1UW8A 4NR1A 5F37A 3UGFA 1Q8OA 2BNOA 5BNNA 1HQNA 4HZFA 1OQEA 5FK8A 3VDDA 2WS93 4XQWA 3FBYA 1CAVA 2HEWF 4DS0A 3O0XA 2HWD2 3ENRA 4QX3A 2GZWA 4QQOA 3M2MA 4COVA 4S2DA 1DQ4A 1VMHA 1TG7A 3LSDA 5T5OA 5EIYB 1G9AA 3D0JA 3WHTA 3KGZA 4DEQA 1W6QA 3PUSA 1MEC1 1RUC1 3ZN5A 4PF1A 4FBFA 2A73B 2HWC2 3NKGA 3WP4A 2ARBA 3W59A 2RDNA 1REFA 1M4WA 4OMCA 4P5HA 1JYCA 1IZ3A 5T50A 1PVXA 1GANA 4FPLA 4FSJA 1LKNA 1QJU3 3CJIC 3ZKUA 5KR7A 4IERA 1OVPA 2YY1A 2ZEWA 5KHKA 3RG0A 1U0AA 3E6CC 4YM1A 5C8CA 5JPNB 1N1YA 4UFMA 1OOPC 4Y20A 1H1MA 5LA1A 1PO21 1S0EA 1DGLA 3KCCA 4ES9A 1NOVA 1KQRA 4FFIA 4EN9B 4I0BA 5IK4A 3IDEA 4KU7A 1UZYA 4R9AA 5JAXA 2WT2A 2J1RA 2RM23 1CGPA 1QXJA 1LOGA 4LXLA 2VMGA 1WWYA 2VZ3A 4MHUA 1WUVA 1H8VA 2OW4A 3HT1A 2D5HA 3N4MA 4IEZA 2C6SA 3MIEA 2VXRA 2WABA 1OQ1A 5LASA 3B5LB 4NHKA 3MW3A 4Q1PA 4YGEA 2PLV2 2VXJA 4N9IA 2XG3A 4AI9A 4META 3CBNA 1C3HA 4I02A 1ZNPA 4JGYB 1YHFA 3I2GA 4MVTA 4MGTA 1UZWA 5EJ3A 5FJHA 1CAXB 2YBKA 1V9U1 2WS92 3DV8A 4FOYA 2D43A 4RFT0 4D0QA 1UXXX 2E26A 5DABA 4IEYA 1ZRDA 3NL1A 3C7GA 4UW6A 3LFMA 1JBCA 4RR3A 1GV9A 1OA4A 2WQ4A 3N9OA 1OLMA 1ULPA 5A7QA 3NNMA 2VZTA 2ZAHA 3E5UA 3RPQA 4P9JA 2DWRA 4UFJA 1M06G 4KGQA 1XYNA 2IXHA 2DUOA 1VP6A 3DYPA 4HKWA 1W8HA 1UMHA 3O14A 2QDNA 3RMXA 1Y9GA 4GA9A 3MW4A 1AHSA 1QJU2 1UKRA 5F2SA 1ZZBA 2HWF3 3KD4A 4QDSA 2GH8A 2VUCA 3H1YA 5FFOC 2P3YA 1V6JA 3JBG1 4ATEA 3HQXA 4NPMA 1W8FA 2H0VA 5IWFA 2Y6JA 5A32B 5KHHA 4K21A 1KJLA 1JU3A 3ZSMA 4XF9A 4E2QA 1DYKA 3GGLA 3U0ZA 4XACA 4IGQA 1VBC1 5L9RA 2AH2A 1AR61 3WP6A 4Z92B 5L19A 2JDKA 4D3WA 2RM22 2HBUA 2VNVA 2QE3A 2VZVA 3C7HA 1GWLA 3PUIA 1MS9A 4RHV3 3V0BB 2C24A 5CBLA 2DVDA 4X6RB 3LF7A 5A7WA 3ZYFA 4CSWA 1UPSA 4H55A 2NMNA 4LHLA 4A6OA 1DF0A 4UOJA 3Q8BA 2RMU1 5JXJA 2HEVF 4ZXKA 5LEJA 4E8DA 4H7MA 4QPYA 4Y24A 4I3PA 3POSA 4AFMA 4G9SB 4UYBA 4NHXA 3TOJA 4YW6A 4Q26A 1W6OA 3MHZA 4NROA 3VKLA 5IAVA 1K5MA 1RXGA 1PX3A 3WUDA 2EXHA 1YQ5A 5CYYA 3ZXAC 2WYSA 3A0KA 5FK7A 1RJ8A 4ONUA 3VBSA 2CYFA 4QB2A 1JUIA 2D44A 1SBEA 3LIHA 3N9MA 4LORA 4QPGA 1Y4WA 4IE7A 1MPXA 4CDUA 2JG8C 2OUJA 5F3EA 1MS0A 1FPN1 4IW3A 5LK5A 1AXKA 4Q5OA 3VGIA 2RJLA 2YV8A 1HX6A 4FCAA 1UMZA 4HN1A 3ZR5A 4Q4Y1 5EHDA 3I2OA 4IQPA 1PX4A 1DG6A 3D0SA 4RD7A 3R4SA 4ARXA 1FNYA 4N53B 1Q56A 1S0DA 3PTYA 1PK6A 1QY4A 2JX9A 1PMJX 3WHUA 4XIOA 2PAEA 2HWF2 3ZYRA 1UY2A 1EPZA 2Y0OA 1BMV1 1NCQA 5A7WB 1ZYBA 3HT2A 1UX6A 1YWKA 1SLBA 2R1BA 1B09A 1NE4A 3LA2A 4HK8A 1HLCA 2ZGPA 5T5LA 2GC2A 3POIA 3ZIWA 3MPBA 3P3PA 4AGRA 1VALA 4DNYA 4LNVA 5ERLA 3FLTA 1CAWA 1BYHA 3RZJA 1IQAA 1XU1A 3AKQA 3FLPA 4Y4RA 3ATGA 4RHV2 1MZFA 4CEYB 4L0PA 1UYPA 2K46A 3AZWA 5LK7B 2J7MA 2CGPA 1K3IA 3SCHA 1SCRA 2PQSA 4NPRA 1SFYA 2BGCA 4L99A 3WW4A 2ZX0A 4HOOA 2BDRA 2EICA 2QQVA 3CO2A 3I8TA 1QEXA 4FQZA 3IIIA 5AVAA 4LBLA 2P3KA 4AK3A 3OGRA 4X8PA 4R8HA 3EBRA 4YG6A 4UFKA 1OKQA 4PIXA 4OI1A 5LRSA 2V72A 3H8UA 2K0GA 1AXZA 3V0AA 4L11A 3UYJA 3NWKA 1JXNA 4DIQA 1QMJA 4EN8B 2NZ9A 3KB5A 4E2GA 1BXHA 4FOWA 4LOTA 2AGSA 3POBA 3MLLA 2XHKA 2XKPA 3DXUA 3VZMA 3WW3A 2Q1ZB 3FHIB 1PK6B 2E6VA 1D4M3 5FKCA 3RI8A 2DYCA 3U4SA 5CKMA 4XZUG 3OBAA 1G9FA 2VULA 2HEYF 4AHWA 2G9FA 5F3IA 1O4YA 5FY9A 1AF9A 2LUWA 4QX0A 3VV1A 5FZKA 4XC9A 4AHXA 4RN5A 3OYWB 4FPKA 4YZ1A 2ZMNA 4RGGA 4WM8B 4B3NA 3ZFFA 4OI0A 1GR3A 2YPJA 4DXTA 3PL0A 3N9QA 1VBD1 4YW5A 1EV13 2ENRA 1V70A 4UFHA 2E53A 3H8OA 2PAMA 5FZOA 3LIGA 2W92A 2RS51 3FHQA 4JQRA 4BH9A 1R1A3 3UKVA 5A7OA 1A8DA 4GALA 4NN0A 4LKEA 2WZPP 1F5JA 3GZEA 4YWAA 5KXDA 4NMIA 1X36A 3WDWA 1NZIA 1V6NA 4XJ8A 1E5RA 1IPSA 1L7LA 3JZVA 4GH4A 1GP6A 1L3JA 3I59A 3VBOC 1AR73 1RMU3 1UQXA 1KS4A 3ALQA 3AFKA 2BGPA 2D6MA 2PAKA 5ACA3 1C28A 1LENA 4Q29A 4RS5A 3ON7A 4XQ4A 5FJKA 2BP6A 3ETPA 1X9TA 1JZ5A 5CVRA 4JZRA 3FN9A 2I07B 2JDUA 1FX5A 4TXWA 3AMMA 3VZLA 4RYDA 1BKZA 3DEMA 4OUEA 2WNUB 2YG0A 2ZJCA 4HVQA 1HIXA 4IV1A 4ISQA 3I2KA 1D4M2 3A23A 1PO13 4KBBA 1X82A 5FUIA 4HKLA 2YC4A 5C4WC 1BQPA 2BBAA 3IIAA 5FBJA 2QQLA 2O8QA 2ORXA 3UT0A 4QXKA 2QTWB 4XJUA 5FZ9A 2B5HA 4CEWC 1W6MA 2E7AA 5FQ0A 3USUA 4I01A 3NQHA 3WDUA 2X05A 2WZR1 3T1MA 4XFCA 1QNWA 4PBPA 4Y33A 3OBTA 1EAH3 4C1XA 1REDA 1DLCA 1RIRA 2XWBB 1XNCA 2J1UA 3N7MA 1T2XA 2FBEA 1EV12 1RVF1 3K48A 4MX3A 5JXIA 2WQZC 1ZVFA 1WCKA 2JG9C 2V4AA 3O1SA 3MI8A 4E9KA 1R1A2 2O1QA 2VE1A 1S2EA 4GMP3 2HWD1 4KWKA 5FY5A 1LU2A 3LA7A 4Z2WA 3GJAA 3BUCA 2X8KA 2V5DA 3VBHA 3MIDA 4JGZB 3MUZ1 5FZDA 2ZX1A 3B9IA 2Z4FA 3IDCB 4KWLA 5FZIA 4A45A 4OULA 4YFWA 5I0RA 2HWC1 1YRZA 1AX1A 1S4CA 3K2OA 5I0SA 2Y0IA 4FP2A 1XJAA 1WBFA 5CEHA 1JZ8A 4HETA 4LKFA 1AR72 1RMU2 1XB9A 2IWGB 5FYIA 5A70A 5C70A 1GZCA 3UKNA 2WLQA 2VCMA 2YYOA 4QXHA 4LT5A 3HQRA 3WG1A 5ACA2 4OQ8A 3LQCA 1NKGA 3T3YA 3V64A 5IVCA 3Q8EA 2JKXA 3PTRB 4NAMA 4BE3A 3W20A 2HYKA 4MUVA 4YRDA 2R49A 1MS8A 1SQ4A 1W6MB 1Y7BA 2RE9A 2VPVA 2BERA 1OQDA 4LBQA 5BNNC 3WCSA 4QGLA 3CJIB 1PO12 2XL7A 3D5OA 1C5IA 5T3NA 3VDDC 4HK9A 1N47A 4YW7A 1YUDA 2GMEA 2TNFA 1RGSA 3MBWA 5AFEA 1HW5A 3BTAA 1D0GA 1OOPB 2GALA 4JGYC 2GNDA 1GZWB 1YLLA 3I97A 4ZONA 5JDBA 3RZKA 2QVSB 5DMYA 4GD4A 5CB7A 3WF4A 2PLV1 3N7JA 2FCUA 2P5BA 2R30A 1ZZ6A 2Y8KA 4QKBA 2GDFA 4K20A 5HCFA 5JOWA 2E63A 5T54A 2VZSA 1EAH2 1ZBA3 2R32A 3U10A 2Y33A 4JKKA 2XJSA 1RTVA 3MPPG 3SEEA 4AEJA 1O59A 2WLPA 3UGGA 3WF0A 4CDWB 5I93A 4HSJA 1GKBA 3RNSA 4P9YA 4CPBD 2WS91 2ZGMA 4XJ9A 1JU4A 5FDBA 2ZEZA 3RI9A 3VBFA 1QJFA 2GAUA 3OF1A 4ZZ5A 1S2KA 3NMBA 2JEMA 2UYAA 1RUJ3 1A3KA 5K8SA 2OA2A 2CTVA 2OPKA 2DFCA 3INAA 4V1PA 3U1XA 4F83A 1IS3A 3SCGA 4QHZA 2XUEA 2ZEYA 1J83A 1UIKA 4BHPA 3HN3A 1POV0 1QJU1 4Q1RA 1YEWA 1UNBA 3NAPA 1YFUA 4I30A 2VMFA 1SBDA 5C6CA 4HLTA 5C3PA 4NIHA 1HB1A 4COYA 1ZBE3 5KHIA 1TEIA 4XAAA 1HRV3 1LJ7A 2ZGUA 5I8YA 4N7UA 2QUOA 1QKQA 1J58A 2DTWA 4QU1A 3BTYA 2RM21 4MGZE 3GBFA 5G05L 2XGXA 3LPFA 2WFPA 3EB7A 4DRRA 1OH3A 2XVLA 3ST7A 2JB4A 3A0NA 1GP4A 1YC61 1G86A 2WBKA 4J25A 5HV0A 2CAVA 4PIZA 5DZGA 4QM8A 1W3XA 4RR3C 4JAAA 5FZAA 5LRRA 2Q8EA 4QAWA 1W8WA 3ZXKA 4XFIA 2ZXQA 3VBRA 4NO4A 2PHFA 1K12A 1ACCA 1J3RA 4TN7A 1Z78A 1ZBA2 2R073 5FPZA 5FYYA 5LY2A 4DXRA 3AMHA 2XLFA 1DQ0A 2BJSA 4FO9A 2E9QA 1XE7A 4JHZA 2A75A 5GZEA 1DFQA 2XJVA 5C5UA 3MV11 5A1AA 1S0CA 2DCKA 4XBLA 3ZYIB 1VJ2A 4EN7B 1CAUB 3WINE 4ZU7A 1LHOA 2SLIA 2BNNA 2D3SA 3SQOA 3KSCA 2DVFA 3O1VA 1X8MA 1NE6A 1LU1A 2DU1A 4GWMA 4XFGA 1UY0A 2UWCA 5JIUA 3ABZA 2ZEXA 4Q0SA 3THCA 5DG2A 3KVAA 2AC1A 1RUJ2 4YGBA 3LE0A 3AJZA 4FFGA 4N53C 3P5BA 2QQKA 3L2YA 3B93A 3CF6E 3HWJA 2EIBA 2R16A 1ULCA 4SLIA 4NWWA 3GHNA 1AVBA 4I3GA 4Y1YA 4P9GA 2MNGA 4QMAA 5F3GA 3VHOA 3NJZA 4A7YA 4ASMB 5BYNA 2ARAA 1RXFA 2GU9A 4XW3A 1RUG3 1PGW2 2EXIA 2HWF1 4MADA 4XAEA 1W39A 5FY7A 2NLRA 1W2OA 3HAGA 4AGVA 1IPJA 1ZBE2 4YPJA 4HVOA 3TNQA 4LO8A 1OMIA 1HRV2 1XXNA 3GYDA 4B4QA 1K5MC 2Y6HA 5HBAA 4O65A 3VBRB 2W2IA 4MXWB 2GC3A 5JOZA 2AENA 3OY8B 5JR7B 3W5MA 1QH7A 3T0AA 3VBSC 4RHV1 3AXDA 3N9LA 3CHXA 3BPZA 4W4ZA 2EALA 3FX3A 4QPGC 3ILRA 3WNKA 3LFIA 4CXWA 2BZDA 3NJXA 1JYNA 4CDUC 5DAQA 3TN93 1HB2A 1X50A 5DUXA 4CUGA 5LA0A 3O1PA 1W9TA 1HDKA 3AP6A 1J59A 1EUTA 2RJKA 5G04L 1UYZA 3VHNA 2AEZA 4FTEA 1C1LA 4X6QB 2VG9A 5DAPA 4BQYA 2R072 3UETA 4IE6A 4D7YA 1ODNA 3AYDA 3WP3A 3EYPA 1ASJ3 3MIGA 4QT6A 5DQ0A 1G9CA 4C1WA 1F8VA 2BRTA 4PDWA 1FT9A 1HB3A 4HBNA 1H2MA 3HNMA 4LUMA 1PK6C 4BQ2A 3FE5A 3WF1A 2ZMKA 3OGSA 4MGSA 3RWNA 2WKKA 1NCQC 4AAPA 5CG8A 4LIVA 1RHI3 4CCEA 1VAMA 2G9ZA 2VR4A 5FKBA 4JRAA 5IK8A 2UYBA 5FZ1A 3WLUA 2OKXA 5C3QA 4HVRA 4DUWA 1YQ6A 2GNMA 2VMEA 2ILMA 4XFAA 1NZCA 2J1VA 2JDMA 4LEJA 1AR93 1C1FA 4ZXEA 5ABJA 1OLME 1RUG2 4GQ7A 1HJGA 4AEDB 4UBHA 5E6HA 3U4XA 4M3CB 2R0FA 3ZN4A 5IK5A 5FXZA 2ET1A 3OEBA 4CUAA 1SLTA 4F8AA 2CHHA 3LWCA 3DPRA 1AUYA 1LGNA 1MACA 1NXMA 5EWSA 4R9DA 2EXJA 2B9UA 4QX1A 5FPVA 2B9VA 1QOTA 1XC6A 2VL4A 2XLAA 3J7LA 4XF3A 3WEZA 3LDRA 3VZJA 1UY1A 2X5IB 1ND3A 5FCCA 1W8NA 3TN92 2FZ2A 4PDWB 1OPMA 3FZ3A 4AEKA 1GQHA 5C8WA 5FAXA 5JZGA 4LQRA 5JMCA 3OGVA 4QGNA 4XPVA 1WKYA 1KDMA 1XRUA 2VTFA 4P9LA 2WNVA 4K8FA 4DXZA 1LECA 3FJSA 4W6WA 2C9KA 5FYZA 5IFPA 2VUAA 4LE4A 3LPGA 4OHWA 1STMA 1ASJ2 4OMDA 1BLZA 3DGTA 5DN2A 1I5PA 1REEA 1W99A 3CEWA 2W95A 3ZFFC 2G1MA 1LOAA 1U5XA 4O7XA 4AFBA 2P17A 2X53S 5A6XA 4I0WB 2W1WA 3V65A 2VVFA 1RHI2 1DLLA 1LEMA 3NSTA 4UW3A 5FUPA 4AVVA 5ABJB 1ZM1A 2QZ2A 4MYEA 4ZPIA 2Y26A 4MGKE 4Y5SA 1WD3A 1VBE3 3LOBA 5FLJA 4CUCA 2TUNA 1AR92 3R05A 3Q9OA 4YZ4A 5AC93 1IS6A 1XQNA 1A6CA 4LULA 4XHXA 4Y5Z0 4FFFA 4FPEA 1W8TA 2ZGOA 1SEFA 1SHWB 4GH4C 3ETQA 4Q8LA 1H9WA 4PCRA 1A78A 2GP3A 3N9PA 5FZ3A 1EV11 2PFWA 1UOJA 1W03A 3WXPA 1H30A 2VOXA 5A7NA 5FLHA 3RFRA 2CGNA 3E5XA 2JDNA 4M3CF 5FUNA 3VKNA 4CPBA 2FMDA 3C7FA 4YVSA 4YGDA 1R1A1 3GCWA 4LO4B 4CEWB 2ZMLA 4AGGA 5M0TA 3U75A 4DY3A 4RS5C 4CP9B 1LODA 3ZSKA 1ZZ9A 1N1SA 2WNVB 4LOSA 1Y9QA 5LY1A 3AFGA 5JR2A 4Y22B 5FRAA 2OZJA 1SPPA 2YBPA 3GXUA 4FPCA 1O5UA 5FWJA 2FZ1A 5FP9A 2ARXA 5K4LA 1OA2A 1W6NA 4IV1C 2P2KA 1BK1A 2JG9B 1AR71 1RMU1 4IEOA 4LUKA 3AKPA 2WT0A 3ZOIA 2FD8A 2ZGLA 4BU2A 1H4GA 1HQWA 1H6XA 5FP7A 3DN7A 1OUSA 2P37A 2A1XA 3BPSA 3C7EA 3KCYA 4CRQA 5ACA1 5LEKA 4CDQA 3RZGA 1F9KA 1SLLA 1RITA 2JDPA 4CZSA 1OFNA 2W52A 3ZYHA 5JSOA 2A7AA 1WA4A 4XXAA 1VAKA 3ACGA 1UX7A 1UZ0A 4XCBA 3JU9A 2RDSA 2VOVA 4PI2A 1LB2A 2EIDA 3JQXA 3W21A 1SFNA 3MW2A 3CU7A 5A3LA 3GF6A 4Q27A 1PO11 4E4SA 4IXLA 2YXSA 1NCRA 1GU3A 2CU5A 4X8NA 4A42A 5L9VA 5JI9A 2WT1A 4P14A 3I2IA 2DBNA 3O0WA 1GMMA 2D97A 3WDXA 3RRDA 4FTSA 4WVWA 1VBE2 5C3OA 3VBHC 4J1WA 2WN3A 1WMDA 5AC92 2QQOA 5DUWA 3ACLA 5BUVA 4CDWC 4K7JA 5KXCA 1R1ZA 1EAH1 2R6QA 4QKDA 1O6UA 5BNNB 1WLCA 1FOD3 3HBZA 4G3YC 3VDDB 4MOAA 4BXFA 2FMYA 1CAVB 3J9SA 1ST8A 3VKFC 1SPPB 1B35A 2AREA 2SBAA 2EXKA 2WSVA 4WVVA 1S0IA 4GMP1 5FPBA 1O3QA 1TQ5A 4OLLA 1W6QB 5F9TA 4ET7A 5I0TA 1FXZA 2Z69A 1H2KA 3MIFA 2OX0A 1W90A 2I74A 2VZ1A 2QZ3A 4TSVA 5FYCA 5GLVA 4ASLA 4BIOA 3U78A 2ZGSA 2GNBA 2DCJA 2E32A 4YW2A 4OCTA 1CONA 5LZ6A 4EWDA 1JYVA 4BPZA 1XU2A 4NIAA 4TZDA 3VD4A 3Q8FA 1VMJA 3GBWA 4QWNA 2VUDA 2KA3A 2ADDA 5KHJA 4H14A 1RC6A 1LHWA 3LDBA 1Q5OA 4XZPA 4DUXA 1J3PA 3APBA 4Y20B 2FCVA 3IPVA 1W6PA 2PHLA 3L2HA 3ZYPA 3SLIA 2QJVA 3D6EA 2ARCA 2Z5WA 4EE2A 5BNQA 4B7EA 4XBNA 1NA1A 4JHTA 4QKNA 3L9JT 2XJRA 4P08A 2OS2A 3HVDA 1WCDJ 3OOXA 5JPMB 3Q8CA 1KD7A 3CNAA 3WZ1A 2F4LA 3N36A 3PURA 3K3OA 5CA6A 2VNGA 3AYAA 4ORFA 1O91A 4BIFA 1Y9MA 3USSA 4FP3A 5FR3A 2XQRA 5ANQA 4XXPA 4DY5A 1JODA 1UU5A 3KQRA 3VBFC 3VDBA 1DDLA 1WLTA 4FT8A 3PUHA 5FZ8A 1YI7A 2WUHA 4NHMA 3GJBA 4OUMA 4QXBA 4CU7A 3I54A 1ZBA1 2F4PA 2D98A 3BGAA 3OGGA 3JUUA 4IL7A 3IAQA 1FOD2 1VBB3 3KS7A 1Q3EA 1PIV3 1CVNA 2BBVA 4AVBA 1O4ZA 4IEXA 2PHDA 1IHMA 4AVCA 2P34A 4RR3B 3E5QA 1PVC3 2Z42A 1GICA 2YB7A 5BPXA 4P02B 1YFYA 4XFBA 4WV8A 4DUVA 1L7RA 1JYIA 3N3HA 1JH5A 5K0UA 3BOPA 4BQWA 1RUNA 4H7LA 4GKXA 1RUJ1 2VCBA 3IPVB 4C0BA 1W6PB 5EJ1B 4CDXA 1W0PA 3D4KA 2D6NA 2K2SA 4BQXA 1LNSA 1DGRA 4P9IA 3VDCA 4C8DA 5JCTA 3AM2A 1NA1B 2DVBA 1MQTA 3OUJA 2VH9A 4BQ1A 1W9WA 3BALA 4M0NA 4Y26A 1PGW1 2B46X 5IW0A 5F5IA 2QQNA 5GKAC 2BU9A 2Y6LA 3HR9A 4AHYA 4N43A 3VBRC 3I49A 4PLMA 1ZBE1 4B4RA 4MXVA 1IG0A 1HRV1 3IWZA 5C33A 1DYOA 1EUUA 2B42B 1GNYA 2OPWA 3AVSA 4NIIA 1OH4A 1YQ8A 2BVBA 4CCJA 4I0AA 3RWKX 1TNRA 1UKGA 3VLBB 3DUIA 3QOPA 2JB8A 2VMIA 2OUHA 1CJPA 5FMOL 1JHNA 2L9LA 4GB33 3OG2A 5D8AA 4NJ4A 1OD5A 5IYYA 5H9SA 3MLJA 4MG2A 1W6OB 4XJWA 4OYUA 3TYJA 1K5MB 4Z8BA 1H1IA 5I0DA 2P6HA 4CCLA 1BVP1 2R071 3PU8A 2TEPA 3VZOA 4Q4X3 1VBB2 2Q1FA 3LDKA 3VBSB 2LW8A 1PIV2 1VPHA 4QPGB 1X7NA 1W8OA 3H7YA 1OXCA 1VLNA 3GZTB 5DAVA 4CDUB 1KGYA 5IVYA 1IS5A 3FWEA 1NG0A 1PVC2 4AAXA 3M3QA 2H6BA 1MR5A 3KV5A 4HMZA 3J26N 2VMDA 2D93A 4BXSV 1C8M3 4FPOB 3PVEA 1A34A 3OBRA 5CFDA 3THPA 3WDVA 4AEDC 4M01A 4Z07A 1SCSA 3DECA 4K8RB 4KG0A 4NVPA 3TBDA 4E4ZA 1QQP3 2DURA 2PTMA 1ZX5A 3OJBA 4OI4A 4ZS3A 2LTNA 1YO8A 3IMNA 4FPHA 2Q8OA 1NCQB 1AYM3 1RUG1 4LHNA 4MHRA 1IOAA 4RSUA 1EPWA 2ZBJA 1YNAA 3AKTA 1W8UA 3RYRA 1GOFA 5FMDA 5A3NA 1CX1A 1UWWA 5I8SA 5F3CA 2JKBA 1WA6X 2CDPA 3ACIA 1ENQA 4KH9A 2RS33 4IETA 1CAWB 4XMIA 5FIXA 3O1UA 1YYNA 1V6MA 1QH6A 4XDPA 1ULFA 1RUD3 2X5IC 4FPYA 4IE0A 4HONA 4NWVA 3ZVXA 3E6DA 3POFA 1Y3TA 4PDWC 1ND2A 2G4IA 5FYUA 5F7UA 1Q43A 1KFUL 5FZFA 2Y38A 5FV3A 5LBFA 3G6JB 1YCIA 2ZKLA 3POGA 3N7KA 2A6WA 2J1EA 3TN91 1APNA 2HH9A 4GB32 3VL8A 1X33A 5CFCA 5JVVA 4JX0A 2YDEA 4AFCA 4HN0A 2V73A 4KGGA 2WO7A 5F5CA 4KBZA 1CIWA 2VZPA 3KF3A 1DGRN 3ZSEA 2JDHA 1AYN2 3LD8A 3V0AB 5GZFA 3FUQA 4Q4X2 3VBUA 1ASJ1 4E27A 3AJYA 3VHRA 1VRH3 1JOBA 5ABJC 1H8TA 1QDCA 4IV3A 4JTOA 5FYVA 5KBFA 4W65A 1LHUA 3ILNA 3M4FA 3VD3A 1HN0A 3NV3A 1HRI3 1RHI1 1AL23 4R4XA 3DYMA 3M7AA 1DU3D 1H6YA 1C8M2 1K5JA 2P3JA 2YGLA 3KCXA 5LBCA 2JJ6A 3DPRC 3T2OA 1YFWA 1QDOA 4ZKTB 1V6LA 2J22A 2IVJA 3AP5A 3SKJE 3K51A 3NNFA 1WMEA 4OHZA 3ZFFB 1AR91 4BQ5A 5JLVA 1QQP2 4LBOA 1QJY3 3C2UA 2R0HA 5KXEA 1ND3C 5EQUA 2AYHA 1AYM2 3JQWA 3R4UA 4MH0E 5FZOB 3WD5A 1T6BX 1NQDA 1XNAA 3H42B 1JYWA 4D8MA 4LKSA 4K40A 2WNVC 2ZHMA 2GNTA 2RS32 1HV0A 1IS4A 3BKZA 1SLCA 3WY6A 5A1LA 1RUD2 1E5IA 4JVAA 1POQA 2PN5A 3D3AA 3GHMA 5FOJB 2VVDA 2IC1A 3S6PA 2J1TA 4CU8A 2PELA 3MO4A 5IVEA 2Y34A 4GH4B 3BCWA 5DDJ3 3I59B 2XJPA 3LEMA 5FYMA 1POV3 2CGOA 3O1MA 2WINB 2QQJA 3NNGA 1W3VA 4HG6B 4XCAA 3ZXFA 3IKWA 2QFEA 2VY0A 4O61A 3K75B 3W5NA 4M3CE 4YG0A 3RYPA 1HJFA 3MEPA 4RS5B 1TME3 2VZRA 3NKTA 1LOEA 4M00A 5E1RA 2X10A 3C8XA 5LCWL 5CU1A 5J1XA 1LGCA 4GAZA 2V09A 1LRHA 2PHWA 1VRH2 1C8NA 3N9NA 3AMNA 4IEPA 4Q4V3 5IAXA 3LEGA 3ZXLA 4IV1B 2BV4A 2E31A 3CMGA 3DYOA 1C4RA 3KV4A 1GUIA 2VVEA 1COV3 3AXEA 4UAPA 1HRI2 2HKXA 4ATFA 5L7OA 1LEDA 4KMQA 1AL22 1J84A 1XSRA 2CY6A 3IN9A 4RGAA 2JECA 4YVSC 3HIFA 2WIIB 2VNOA 3PDQA 2O8OA 2BW8A 2WAOA 4HSLA 5FQ0B 3USUB 2JD4A 1VBE1 1OT5A 2GH2A 2XHNA 3ORJA 4A6SA 3AYEA 2LM3A 4C0HA 1GZ9A 2CV6A 2VOWA 5AC91 5F1RA 4MLOA 4MV2A 5FZHA 1QJY2 4NUBA 5CNAA 3T30A 3D82A 4I2OA 1CD3G 1CPMA 2WSUA 5FMOS 1UYXA 1OVSA 1LHVA 2XPJA 2XONA 2W47A 3T0BA 1BK0A 1YIPA 4H2AA 2Q1MA 4QB6A 2NM1A 3JB4C 2Y6KA 3KT4A 1VB2A 1NY72 3VBHB 1QNYA 3ITQA 4CDQC 4YW3A 3M8LA 1ZA7A 4XF1A 1QF3A 3TEXA 1J1TA 1D0HA 4JDOA 1DZTA 3M3OA 1JOPA 2O0OA 3N7LA 3PJQA 4Q0UA 5C9AA 5DDJ2 5IHRA 4CCDA 3POEA 4Y1UA 1FATA 5A33A 5HCHA 5BY5A 2KXLA 3H3UA 2Q5TA 3I3DA 4AVAA 1NCRC 3KM5A 4OVEA 2VW1A 3C7OA 2OVUA 4LKDA 4RL7A 4CU9A 1TME2 4ZS2A 2JIGA 4YG3A 1U12A 2HWB3 3IBMA 1L7QA 4IE4A 4PLNA 5FXVA 2WQ8A 5A7SA 1I3HA 1NX9A 2OYZA 4CXYA 3T4HB 4LJHA 4DFSA 1FYUA 5JWPA 3I3EA 3PMEA 4Q4V2 1F15A 1V0AA 3HEIA 4LBQB 4XEZA 2PYTA 1DP0A 1HV1A 1OC1A 2CWMA 1OF3A 1RUE3 1V00A 4QKFA 4UFLA 3TEYA 1COV2 5ISLA 4EZHA 2XJQA 4BWOA 4QHOA 2VAUA 3WW1A 4AQSA 1YIFA 1UMIA 4LHSA 1W2AX 3U11A 1UXZA 5GLZA 3SH4A 4ARYA 4YZ2A 2UURA 1V6IA 5HV4A 4QPIA 4XYXA 2RHPA 2VZOA 3NV2A 3OB8A 1W28A 4IESA 1YQCA 1R093 1Y43B 4GJZA 4WM7A 4PBOA 1WGPA 4Q0VA 3WG3A 2FDGA 1FOD1 5C9AB 2ZZJA 3KT1A 3U07A 1FMD3 2QQIA 1DQ5A 2WRAA 3OD0A 4YVWA 5F6KA 5FPAA 1GZTA 4WVMA 3UJQA 2VZQA 2W0XA 4YZ5A 1FNZA 5FLIA 4EZ4A 3VBFB 4CP2A 4Y5TA 1JZ4A 4Q8KA 2B39A 1ENXA 2WNOA 1MZ6A 4XOGA 4RGKA 3TRSB 4EWEA 4ITCA 4DB5A 4Z1VA 3RZZA 1NA1C 5KC6A 4XUQA 5EFUA 3TAYA 1NLRA 3WUCA 3ROUA 5FZMA 2VCAA 2KR2A 3NAPB 2WZ8A 4XMAA 3CZJA 1SDWA 1ULGA 4IE5A 5FMCA 2HJIA 3WSOA 3B94A 3IAPA 1SLIA 1H2LA 2HWB2 5FY0A 3AKRA 1UN1A 2NP0A 1YJKA 2JE8A 1JN2P 1MS1A 3RGBA 1BHGA 3NVCA 1US2A 4BCUA 3WNPA 4FPGA 3J8F3 3A22A 4NPLA 3GNEA 1RUE2 4QPIB 5L36A 2WJSA 1C57A 3PU3A 4F7ZA 4F3JA 5A6ZA 3BU7A 5C5TA 1ZRCA 4BQ3A 1UU4A 5HPOA 2MEV3 3HMYA 4MGIE 4MSVA 4QM9A 4WM7B 4WZCA 2I45A 5J37A 2W9XA 4YVWB 4NRPA 4B7KA 5LBEA 3V56A 2QDRA 2WZEA 1Q8PA 4WVMB 2C5DA 4UBGA 4YM2A 5FZ4A 4DPNA 5K0UC 1NT0A 1BVVA 3AMPA 5EJZB 5EZWA 4CDXC 3SH5A 4FI9A 1UOGA 3HD8B 4YM0A 1R092 1VBB1 4UXAA 1FMD2 1MZEA 1CX4A 1PIV1 2YBSA 2VOTA 1MQTC 4YFZA 1UY4A 4UWDA 3MF6A 1H4HA 1YXWA 4KU8A 1Z7S3 4BK5A 1PVC1 5E8AA 2IXKA 1UYYA 1QJZA 2DVAA 4OZXA 2N7GA 2ID4A 4N43C 2OIIA 1BJQA 3B3QE 2ZZQA 2D6KA 3IDAA 2ERFA 2E33A 3FFZA 1SDDB 1TMF3 1G7YA 4ZU5A 2CWSA 3JB8A 4BDVB 2VO5A 5K9YA 3ECQA 4L92A 1O3TA 2GN7A 5FP3A 5T5JA 4P9WA 4BLJA 3I3QA 1SG3A 4ES8A 2FDHA 2EIGA 3BB6A 1TNFA 3BN6A 5FZGA 4A2UA 1F35A 1NXD1 4KQ7A 2R063 4LIUA 4QPWA 4YYOA 3ELNA 5F6LB 4MGQA 4LBKA 4PQ9A 1XOYA 2FQPA 3HPNA 4U36A 1UPIA 1DQ1A 3P1IA 3SMHA 3O7OA 1RUH3 1S2BA 3OD4A 3AZVA 4JTNA 3J8F2 2VTXJ 5A3WA 5E16A 1BBT3 1T6GC 4AOCA 4AQTA 2A3YA 3T0DA 4HKOA 1GYKA 1XYPA 3H3ZA 3ZN6A 2QQPA 1SMVA 4XJZA 1U5YA 3R4DB 2MEV2 4ZY9A 1AL0G 3ZX7A 4CCNA 1DQ6A 4PJYA 5DAXA 2DTYA 4GB31 4DMIA 2RJ2A 2RR13 1KEXA 1OFSA 3E6BA 1QJEA 2NQYA 2VQAA 1LGBA 1W06A 5FPUA 3H8XA 1YFXA 1CZTA 4AI1A 5GLUA 3S30A 1AYN1 4GWIA 4RQPA 2DCZA 4Q4X1 1AJOA 2A3XA 3I3BA 5JXHA 3ZFGA 3QACA 3THTA 3OBZA 1US3A 5IVJA 3O1RA 3WNOA 2BUKA 5C8CC 1Z7S2 3P6BA 5EV7A 5JXGA 1MVQA 5DZFA 3BU0A 5CG9A 3ASIA 5FYHA 2A70A 1LCLA 1X9PA 3WF2A 2KD7A 5HXVA 1C8M1 2YU2A 3SH3A 1PNFA 3A7QA 4LPLA 4LO7A 5C4WA 1RUF3 4XTMA 1TMF2 4BMBA 3SHRA 3VD5A 1A8MA 1ONAA 5E89A 4EQVA 3K46A 3NW4A 4BA6A 2FCTA 1ND2C 1VRBA 3KT7A 1R083 2W91A 4LA3A 4A3ZA 1SLAA 2WWJA 2LALA 4OQ9A 4CCKA 1AZDA 1QQP1 2G19A 3THDA 1ENRA 5T52A 3VKMA 4FAGA 3OSDA 5B4NA 2R062 1AYM1 1ZREA 1VIWB 3O0VA 1OUXA 3BIEA 3AYCA 4COUA 2AZ5A 2BTVC 2UY8A 5CFCC 3BOWA 4LO6B 4XURA 1W05A 3DPRB 2QBXA 1RUH2 2JDZA 5FOBB 2RS31 4R52A 1IKQA 3S7IA 4YW4A 3FMGA 1F4HA 1BBT2 1ZZCA 2JENA 3VBUC 1RUD1 2YU1A 3VZKA 3ZXDA 4B4PA 1BEV3 2XOMA 4GULA 2HWE3 2Q8CA 1DZQA 2W94A 4LMFA 3VZNA 4BK4A 3OPTA 1ND3B 4XVHA 3DCQA 2JIJA 3ACHA 2R7EB 4LBJA 4KWJA 5DAWA 5FBZA 4AG4A 4BOWA 1X8EA 2UY9A 5JZGB 5SV5A 4UT5A 2FDKA 3MIHA 4Y1XA 5FYSA 3ZFGB 1OURA 2WR9A 3HQUA 3WNNA 4GXLA 3I2HA 2RR12 1RL3A 3I2DA 3OGJA 2EIEA 5IVVA 2YFUA 2WA3A 4NHLA 4XUOA 3RS6A 1CR7A 1H2NA 2LROA 2IXLA 4HANA 3MICA 4K1ZA 5F39A 3AKSA 4GIQA 5DZEA 5FY8A 3CDZB 3WT3A 5B4XA 5GM0A 3DXTA 3O12A 4AVTA 5EYYA 5J98B 3PVOA 3RDIA 4P9XA 3T09A 4W50A 1U5IA 1VRH1 3F2ZA 2D6PA 4N7IA 3MIBA 4QU2A 5HI0A 3PMSA 3SEPA 1ZRRA 3NRUA 3PVNA 1KDKA 3SNMA 2DCTA 2F6BA 1HRI1 1OD3A 5K7PA 4OZOA 4Y4YA 1AL21 4QDRA 3ZYBA 1CESA 5CKQA 1VB4A 1RUF2 2A6XA 2IZWA 4NHYA 4FAHA 3J7MA 3WQ1A 2A6YA 2DBIA 2ZX4A 1GBGA 1R082 2JE9A 4JGYA 5FZ6A 1OHFA 3BVCA 4QQHA 2AUYA 3FLRA 4NOTA 3ZYGA 4XABA 1QJY1 1UAIA 4LBMA 3WVJA 2OZ6A 3KVBA 1JYTA 1CAXA 2ZCWA 4OI2A 4ISRA 1E5SA 2ZA9A 3RSJA 3M1HA 2VM9A 4QD2A 4YVSB 4Z82A 4D6SA 1RUI3 4BQ4A 2D5FA 3VHPA 2Y60A 2D3RA 3MZHA 2BGOA 4A7KA 1ENSA 4BISA 1AR83 2BYVE 2HBTA 1NY71 4FXKB 2YC0A 4UFIA 2VD7A 2XUMA 1DHKB 4MZUA 3U37A 1BEV2 4W8JA 3ZO0B 4EYUA 2HWE2 2JDYA 3SISA 2CNAA 5IVFA 1PGL2 1DGWX 3H0OA 4XUNA 3QCWA 1V6OA 4LLOA 1ZRFA 1W6NB 1HXS3 1LR5A 5DDJ1 2ZAAA 4Y1VA 1WMXA 1POV1 3I3MA 4YSFA 3J7HA 5L7OC 4YGCA 3QBQA 3AMQA 5IATA 2VBBA 1W0OA 3DKQA 3H9AA 3H8RA 4L8QA 4KWUA 1OKOA 3UL2A 4D7TA 3QH7A 4IEUA 4CDQB 3HN1A 2VU9A 1HN1A 5A32A 1TME1 3GBGA 2UU8A 3T4VA 2V4VA 2JXAA 4DZGA 1UCXA 4FTBA 1KXGA 3H7JA 5T55A 2ET7A 1GNHA 1LHNA 3TB0A 4A41A 2HLEA 4Q4V1 2Q4SA 3IDBB 4R9BA 4IGOA 3V0BA 2WWSA 3DL3A 2WL1A 1COV1 3CLPA 1NCRB 4YLZA 3ZFEA 2ZTNA 2PA7A 4ZU4A 1PZ8A 1O4TA 5IJRA 4JCKA 2IFWA 2IXJA 3ZXJA 1CQ9A 1O8SA 3UNPA 2R1DA 2VECA 3OCPA 3VD9A 1V6KA 5F2WA 1I9RA 1QU0A 1WBLA 4XDQA 5F5AA 5J09A 1OI6A 5J48A 3JCIA 2J42A 2K9ZA 2WO2A 2VOKA 4A3XA 5C9AC 3H3LA 1DGWA 1XYOA 4EN0A 5CAZA 2D6OX 3S5QA 4O9EA 4AFDA 3H1WA 1RJ7A 4HFSA 3NJYA 2QKDA 1B35B 3WV6A 5DUUA 4EN6B 1RUI2 1DYPA 2FHRA 2ADEA 3MF9A 4CUBA 1NUKA 1W9SA 2KM2A 5JOYA 3UESA 1AR82 1PZ9A 2TBVA 3IM0A 3VUOA 4A4AA 2YHJA 1I5ZA 2W1UA 3AL5A 4D6QA 3EMRA 4C90A 2NMOA 4EWAA 3PIJA 3SCFA 1N1VA 1HXS2 1UIJA 1QJX3 3NAPC 4JDMA 4FFHA 4TWTA 2ZGTA 4N53A 3URFA 4FXGB 4LBQD 3B9CA 5H9PA 2QQMA 5A7PA 3LB9A 3ZFEB 1JZ7A 2RS13 3MUY1 5I91A 1JOJA 4A44A 2I2SA 3GALA 1GNZA 1JZ3A 2HWB1 1LOFA 4GWJA 1DZRA 4QPIC 1F31A 4QHBA 2QCSB 2VNRA 3R6SA 1S0FA 3EJKA 3CIHA 4QB1A 1OA3A 3T1LA 4AYUA 4CEYA 2XQXA 4WM7C 3NV4A 5A6YA 1RUE1 1UO9A 2WN2A 3O1TA 4LITA 5EXOA 2ZPXA 4IGPA 4YVWC 1EYBA 1IQDC 3NV1A 4QQLA 4QXCA 1G8WA 1H1AA 3FUOA 4B1LA 2P4EA 4QX8A 3M70A 5BXXA 3IMMA 1GWKA 2BWAA 2ZX2A 2WFF3 2JD9A 5A3TA 5DG1A 2ZABA 1N3OA 3WDYA 2A5ZA 5IUQA 4DOUA 5JSPA 1R091 2EF6A 3PVBB 4GZ9A 2BVVA 4Z2AA 2W3JA 1MVEA 2D3PA 3B01A 3D8CA 3K3NA 5CZKA 3RJRA 1FMD1 3MGUA 3OPZA 1OF4A 3NO8A 1F5FA 1AXYA 1AYN3 2VMCA 4AW7A 5K0UB 3LCPA 3K4ZA 4FVVA 3PHMA 3ZMOA 5CKNA 4CDXB 1O8PA 5C3SA 3GZAA 4LBNA 2DUPA 2JDAA 4Y3OA 1LOCA 2PHTA 1QJX2 4LE3A 1LESA 4UW4A 3MLKA 2GP5A 3OYWA 5JIAA 4D6RA 4M4PA 1FI2A 2W1QA 4AZZA 5GZDA 4WM8A 4LLFA 1BZWA 1G9BA 1MQTB 1G6NA 1ULOA 3PJYA 3B02A 1VBA3 2BFUL 1S0BA 2D6LX 4HXCA 1J3QA 5GZGA 1URXA 4FQ4A 1JS9A 2RS12 3G7DA 4AWDA 5A6QA 4N43B 2XDVA 1WW4A 3UGHA 3JXSA 4AQ2A 2XR4A 2ZS6B 3ZPYA 5BNOA 2RDQA 4B8EA 1CPNA 4BMEA 3CKHA 4NIGA 1UY3A 3J8F1 3I2JA 2VQTA 5FZLA 2R043 4IEWA 4Q4W3 1WCQA 4URAA 5FXWA 5KWRA 2XL9A 2VW2A 3BTXA 3EO6A 3RJ2X 3GZUC 3KMHA 1OSGA 2VQ0A 2MEV1 3P3NA 3WCRA 1JHJA 1GWMA 2Y6GA 1F2NA 5D8AB 3UKTA 2CL2A 2E7TA 1ODMA 3QH6A 4EROA 2WFF2 4XIKA 5L73A 4PHZA 5JSRA 4BLIA 3ME2A 3PUQA 4XUPA 2AEYA 3K4AA 1IKPA 3QLQA 1CZSA 3RVHA 3WR0A 3GM8A 1KRIA 1O7FA 3JD73 1E57A 1E5HA 3AVRA 3EXUA 4URTA 4LO5B 4QDQA 5A3UA 1GFF2 1JW6A 1SBFA 1PM7A 2BEOA 2WNUA 3RZHA 2VGDA 1I6XA 2VQUA 2ES3A 3SC7X 5A3PA 4M4RA 2WO3A 2J1AA 2ZKNA 4E4HA 2XBO3 1Z7S1 3IB3A 2WNEA 4PIYA 1PMIA 1QXPA 3VKOA 3KQ4B 1W2TA 2EAAA 4RFRB 3WNXA 3WG2A 4IEQA 4LHKA 2Q8DA 4NIDA 5CFDB 1HKDA 1FAYA 1FV2A 3UV9A 3T2TA 1XNBA 3VD7A 1S1AA 2AACA 3HNYM 1TMF1 2X29A 3OEAA 4TLGA 5LA9A 5BNOB 5TSWA 1N3QA 3ZDSA 4DINB 1PGSA 2ZHKA 4XFHA 2ZACA 1VBA2 5C8CB 1LULA 1O3RA 3T2QA 5BNPA 5FZEA 3O5SA 1CN1A 1D2SA 5FO9B 2R061 4FPJA 5J36A 5LB6A 1KFXL 3ILFA 3KZ4C 4OUSA 1WW6A 3KWVA 3WDTA 5CIRA 4L2NA 1RUH1 1MEC3 1NAEA 1RUC3 4JGZA 4RQPC 1ND2B 4XFFA 1BBT1 2DDUA 5D21A 4AHZA 4CTEA 5JZGC 2R042 3AZXA 3FBMA 2YPDA 4PQQA 4Q4W2 2G9GA 2WDBA 4S2HA 2PHRA 3VN4A 2AR6A 3ZFGC 3J7NA 3CQOA 3U14A 2IXCA 2ZHNA 1TZOA 4UF0A 3RYKA 1ZZ7A 1WW7A 2E51A 3CJXA 1OLRA 5CFCB 2H6CA 5EPAA 3ZDVA 3LAGA 2PHUA 3LKJA 2D40A 1FV3A 2RR11 4WVZA 5A3MA 2XWJB 5FMBA 3WX5A 1QOSA 5FZ0A 1PO23 2VCCA 4ZHNA 1J1LA 3JD72 4QQPA 3VBUB 2B45X 4FPFA 1VAVA 2ETEA 2GN3A 3ZSLA 1DBNA 4KL1A 3B69A 3MYXA 1W2NA 2BNMA 4OFGA 2CSGA 2VMHA 5FZCA 1XE8A 3E97A 2BQPA 1DCSA 1H8TB 4IV3B 2ORZA 1D7PM 5DPNA 4CVUA 3AP4A 2JICA 2QQWA 1MS4A 3B7MA 5IT6A 5FZBA 2PHXA 3CJIA 2XBO2 3DF0A 4UI9L 2DF7A 3SXWA 5C3RA 4HL0A 2VW0A 5F8PA 3TEWA 4JRLA 5FPLA 5BNPB 2Z79A 3GCXA 1OOPA 2XH6A 1GZWA 4DO0A 3I7DA 2XJTA 1RYYA 1RUF1 2DUQA 5FY1A 1K42A 4CCCA 4AI0A 4TTGA 3W58A 1YJLA 2WA4A 3POJA 4OHXA 4OHYA 4CU6A 1R081 2J1SA 4CA9A 3LEIA 3CZUA 4QQ2A 3POYA 1LAJA 1H0BA 1V9U3 4PF5A 2F17A 1ALYA 4CDWA 5KHGA 2A71A 4JKLA 4K9SA 2ZGQA 3S5AA 1SACA 4JC1A 1KJRA 1UL9A 5B2GB 4Q2FA 2EAKA 1WW5A 3HNBM 2D7FA 4W6XA 4UF0B 1NYWA 2DU0A 3QD6A 1W04A 1CIYA 1MEC2 1RUC2 3GDBA 3NNJA 3ZMNA 1NLQA 4IDZA 4JDNA 3BODA 1BEV1 2W39A 4HPKA 2HWE1 4GWNA 3C3VA 5L9BA 3S7EA 4Q0PA 1DIWA 1PGL1 1AJKA 3ZLIA 3FC0A 1CZVA 4DQAA 1JUHA 4P00B 4YW1A 4YM3A 1H9PA 3HJRA 3OTFA 4AI8A 4KNCA 3JBG3 1IGOA 4XILA 1GQGA 1O5LA 4AVSA 2YFZA 1PO22 1BCXA 1KS5A 3M3CA 4WBBA 4TYSA 3ZPOA 2ZGRA 2NN8A 2YUEA 2EVXA 4U2AA 1QXRA 1VBC3 2C9AA 1AR63 2OQ7A 4FOQA 3LOIA 2JE7A 3R0RA 4GKYA 5J96B 4BYYA 4XJAA 2VC9A 1UU6A 5GALA 3AK0A 2PMWB 4XHBA 3ZYJB 3ES1A 1MZ5A 2P3IA 3TWIA 2YC2A 5JUVA 2BFUS 5L7OB 2CDOA 3ZR6A 2E7QA 2IXIA 3NNLA 4LR4A 2ZX3A 3W9AA 2UWAA 1QWRA 1YI9A 3EHKA 2RMU3 5AFBA 1UD1A 3SKVA 1PZ7A 1D2QA 3KV9A 5C7GA 3TEZA 4N9HA 3ZIXA 4CCMA 1I1EA 2RG4A 5LATA 4LTAA 1W9YA 4N90A 1MS3A 5FPXA 3WOGA 1XNDA 2VUJA 4N8MA 1RINA 2RVAA 5SV8A 1KITA 3ZKYA 4XDOA 2Y6FA 2FDJA 1ULEA 1B35C 4MGYE 2BWCA 1S0JA 1V9U2 3IZOA 4BJ0A 4S2GA 2P6CA 3LA3A 4HPKB 5GLTA 2YMZA 1CAUA 3Q8AA 3TNPB 1PHMA 5FREA 4J1XA 1FPN3 1U5ZA 1RUI1 3RZLA 3WNLA 3OPWA 4XUTA 3FL7A 4GMP0 4PI0A 1AR81 2GSYA 1HQLA 4COWA 3LZZA 4GJYA 4Q4Y3 5FO7B 4D7SA 1R64A 2WWUA 2Q0AA
chains in the Genus database with same CATH topology
4CP0A 3AB0A 3KLSA 5I8TA 5A33B 1HXS1 2NYYA 3ZFEC 3AP9A 3AZZA 3JBG2 1EY2A 4E2SA 2DV9A 2JG8A 5T5PA 2UWBA 3WP5A 2XKOA 4CYDA 1LTEA 1VBC2 3H1MA 1AR62 4A7ZA 3RQ0A 4LA2A 2CAUA 2A6VA 4MXWA 1AX0A 3OY8A 3LGRA 4YNIA 2NPIA 1NQJA 3WQ0A 2W08A 3H50A 2MHFA 2RMU2 3WG4A 4D69A 2A6ZA 3WW2A 4INDA 4R9CA 4EJRA 1DQ2A 2BPA2 4AFAA 5HCAA 4AF9A 5EYXA 1S0GA 5FO8B 2XVGA 3MDPA 5H9RA 1ULDA 1QGLA 2Q30A 4UW5A 1LOBA 4RA0A 3PLQA 3AX4A 1IPKA 4KG8A 1FPN2 4CP1A 1WLWA 4L9BA 2YROA 4Q4Y2 2JG8B 1LOFC 3X29B 4XBQA 4W6YA 1N1TA 2XB6C 4XQDA 4AE2A 2H0BA 5D1IA 2B7YA 4CEYC 5J3UA 1QJX1 4YZ3A 5I0UA 4E4DX 1VBD3 2GC1A 1BMV2 4Y1ZA 2DVGA 4AEDA 3LSEA 4AEMA 4M3CA 2RS53 3UJOA 4I09A 4SBVA 2RS11 4TLFA 1RB8G 2YZ4A 1WD4A 3ES4A 3DKWA 4G4FA 4QGMA 2GC0A 1Q8QA 1S55A 4OHVA 1OLQA 2C0ZA 5D8AC 1GSLA 4BM8A 1UF2C 1C5HA 5IK7A 2X5IA 1EP0A 5DUVA 2ZGKA 2QNKA 4D94A 2XVKA 2PQQA 4H3WA 3N35A 5JOXA 2DCYA 3B00A 1OPOA 1Q8SA 2GMMA 2WFF1 5JI7A 4PLOA 1Q8VA 5KC5A 3ZSJA 4AXOA 3VL9A 3BIWE 3FFQA 4WM8C 1N3PA 3SITA 1XNKA 4XF4A 3VBOA 1GLHA 3I4IA 2YGMA 1MS5A 1QOOA 4XETA 5CFDC 5AVPA 2ZOEB 2Z2SB 5CADA 1CJDA 3UK9A 1NLSA 3ZXGA 3M3EA 3POWA 4FOVA 2IFRA 5BNOC 3M3IA 1D4VB 2WC2A 5F5QA 3S0MA 1JTZX 2WZR3 4K1YA 5BV6A 4K3UA 5DXDA 4XF0A 1VBD2 1TE1B 4JV4A 1RVF3 1VBA1 1WLDA 2RS52 2W68A 2B8MA 3AZYA 4L97A 4M0HA 3MFCA 2HWD3 2ZGNA 1WMFA 1O3SA 2XLGA 4HT1T 5E88A 1ZZ8A 4CEWA 4YARA 1QHDA 1UZZA 2ATFA 2HWC3 2GMPA 1RUOA 2EA7A 2MPFA 3ZN6B 5FTTC 4DRVA 2A3WA 4Y22A 3WQ7A 2R041 2DFBA 4Q4W1 2WNUC 3PNAA 4WZFA 3J4UH 5GLWA 4AQ6A 2JG9A 5GJ6A 4B29A 4R4ZA 3VBOB 1Z0HA 1G9DA 3AP7A 1VR3A 5KXBA 5J7MA 1D4M1 1H8TC 4IV3C 4RQPB 1WCSA 3EQEA 2XJUA 3JD71 4S2FA 4XE9A 4XTPA 3MFAA 3IT8A 5GZCA 4QX5A 1PNGA 4O9GA 4EV0A 1W2UA 5BNPC 5H9QA 4K6BA 3CL1A 2XBO1 4BZ4A 2C1FA 2ZHLA 5HCBA 3RMYA 5C4WB 4AI2A 1AX2A 3ZXEA 2PLV3 4AI3A 1ZA4A 2WZR2 3A4UA 4JGZC 4J6GA 3KGLA 4C91A 4IEVA 2V5YA 1RVF2 4Q0QA 1UW8A 4NR1A 1Q8OA 2BNOA 5BNNA 1HQNA 4HZFA 1OQEA 3VDDA 2WS93 4XQWA 3FBYA 1CAVA 2HEWF 4DS0A 3O0XA 2HWD2 3ENRA 2GZWA 4QQOA 3M2MA 4COVA 4S2DA 1DQ4A 3LSDA 5T5OA 1G9AA 3D0JA 3WHTA 3KGZA 4FBFA 1W6QA 1MEC1 1RUC1 3ZN5A 2A73B 2HWC2 3NKGA 3WP4A 2ARBA 3W59A 1REFA 1M4WA 5T50A 4P5HA 1JYCA 1IZ3A 1PVXA 1GANA 4FPLA 4FSJA 1LKNA 1QJU3 3CJIC 4IERA 2YY1A 5KHKA 3RG0A 1U0AA 3E6CC 4YM1A 5JPNB 1N1YA 4Y20A 1OOPC 1H1MA 1PO21 1S0EA 1DGLA 3KCCA 4ES9A 1NOVA 1KQRA 4EN9B 4I0BA 5IK4A 3IDEA 4KU7A 1UZYA 4R9AA 5JAXA 2WT2A 1CGPA 2RM23 1QXJA 1LOGA 2VMGA 1WUVA 1H8VA 2OW4A 3HT1A 2D5HA 3N4MA 4IEZA 3MIEA 2VXRA 1OQ1A 3B5LB 4NHKA 3MW3A 4Q1PA 4YGEA 2PLV2 4N9IA 2XG3A 4META 1C3HA 4I02A 1ZNPA 4JGYB 1YHFA 4MVTA 5EJ3A 1CAXB 1V9U1 2WS92 3DV8A 4FOYA 2D43A 4RFT0 4IEYA 1ZRDA 3NL1A 4UW6A 1JBCA 4RR3A 1GV9A 1OA4A 2WQ4A 2ZAHA 3E5UA 3RPQA 4P9JA 2DWRA 1M06G 4KGQA 1XYNA 2IXHA 2DUOA 1VP6A 4HKWA 3O14A 2QDNA 3RMXA 4GA9A 3MW4A 1AHSA 1QJU2 1UKRA 1ZZBA 2HWF3 3KD4A 2GH8A 3H1YA 5FFOC 3JBG1 1V6JA 4ATEA 3HQXA 2H0VA 5A32B 5KHHA 4K21A 1KJLA 3ZSMA 4XF9A 4E2QA 1DYKA 3U0ZA 1VBC1 2AH2A 1AR61 3WP6A 4Z92B 5L19A 4D3WA 2RM22 2QE3A 1MS9A 4RHV3 3V0BB 5CBLA 2DVDA 4X6RB 1UPSA 4H55A 2NMNA 4LHLA 1DF0A 2RMU1 2HEVF 4ZXKA 5LEJA 4H7MA 4QPYA 4Y24A 4I3PA 3POSA 4AFMA 4G9SB 3TOJA 4Q26A 1W6OA 3VKLA 1K5MA 3WUDA 2EXHA 3ZXAC 3A0KA 1RJ8A 4ONUA 3VBSA 2CYFA 1JUIA 2D44A 1SBEA 4QPGA 4CDUA 2JG8C 2OUJA 1MS0A 1FPN1 5LK5A 1AXKA 3VGIA 2RJLA 2YV8A 1HX6A 4FCAA 1UMZA 4HN1A 4Q4Y1 4IQPA 3D0SA 1DG6A 4RD7A 3R4SA 1FNYA 4N53B 1Q56A 1S0DA 3PTYA 1PK6A 1QY4A 2JX9A 3WHUA 4XIOA 2PAEA 2HWF2 3ZYRA 1EPZA 2Y0OA 1BMV1 1NCQA 1ZYBA 3HT2A 1UX6A 1YWKA 1SLBA 2R1BA 1B09A 1NE4A 3LA2A 4HK8A 1HLCA 2ZGPA 5T5LA 2GC2A 3ZIWA 3MPBA 3P3PA 4AGRA 1VALA 4DNYA 4LNVA 3FLTA 1CAWA 1BYHA 1IQAA 1XU1A 3AKQA 3FLPA 3ATGA 4RHV2 1MZFA 4CEYB 3AZWA 5LK7B 2CGPA 3SCHA 1SCRA 4NPRA 1SFYA 2BGCA 4L99A 3WW4A 2ZX0A 5AVAA 3CO2A 3I8TA 4FQZA 4LBLA 2P3KA 4AK3A 4X8PA 4R8HA 3EBRA 4YG6A 1OKQA 4PIXA 4OI1A 5LRSA 3H8UA 2K0GA 1AXZA 3V0AA 4L11A 3NWKA 1JXNA 4EN8B 1QMJA 2NZ9A 3KB5A 4E2GA 1BXHA 4FOWA 2AGSA 3MLLA 2XHKA 2XKPA 3VZMA 3WW3A 2Q1ZB 3FHIB 1PK6B 2E6VA 1D4M3 3RI8A 2DYCA 1G9FA 2VULA 2HEYF 4AHWA 2G9FA 1O4YA 1AF9A 2LUWA 3VV1A 4AHXA 3OYWB 4FPKA 4YZ1A 2ZMNA 4RGGA 4WM8B 4B3NA 3ZFFA 4OI0A 1GR3A 2YPJA 1VBD1 4YW5A 1EV13 2ENRA 1V70A 2E53A 2PAMA 2RS51 4JQRA 4BH9A 1R1A3 3UKVA 1A8DA 4GALA 4NN0A 2WZPP 1F5JA 5KXDA 1X36A 3WDWA 1V6NA 4XJ8A 3JZVA 4GH4A 1L3JA 3I59A 3VBOC 1AR73 1RMU3 1KS4A 3ALQA 3AFKA 2D6MA 2PAKA 5ACA3 1C28A 1LENA 4Q29A 4RS5A 4XQ4A 5CVRA 2I07B 1FX5A 3AMMA 3VZLA 1BKZA 2WNUB 2ZJCA 4HVQA 1HIXA 4IV1A 4ISQA 1D4M2 1PO13 4KBBA 1X82A 4HKLA 5C4WC 1BQPA 3IIAA 2O8QA 4QXKA 4XJUA 2B5HA 4CEWC 1W6MA 2E7AA 5FQ0A 3USUA 4I01A 3WDUA 2WZR1 3T1MA 4XFCA 1QNWA 4PBPA 3OBTA 1EAH3 4C1XA 1REDA 1RIRA 2XWBB 1XNCA 3N7MA 2FBEA 1EV12 1RVF1 3K48A 4MX3A 2WQZC 1ZVFA 1WCKA 2JG9C 3MI8A 4E9KA 1R1A2 2O1QA 4GMP3 2HWD1 4KWKA 1LU2A 3LA7A 4Z2WA 2X8KA 3VBHA 3MIDA 4JGZB 2ZX1A 3B9IA 3IDCB 4KWLA 4OULA 4YFWA 5I0RA 2HWC1 1YRZA 1AX1A 5I0SA 2Y0IA 4FP2A 1WBFA 4HETA 1AR72 1RMU2 2IWGB 1GZCA 3UKNA 2WLQA 2YYOA 4LT5A 3WG1A 5ACA2 3V64A 4BE3A 2HYKA 4MUVA 4YRDA 2R49A 1MS8A 1SQ4A 1W6MB 1Y7BA 2RE9A 2VPVA 1OQDA 4LBQA 5BNNC 3WCSA 4QGLA 3CJIB 1PO12 2XL7A 3D5OA 1C5IA 5T3NA 3VDDC 4HK9A 1N47A 1YUDA 2GMEA 2TNFA 1RGSA 5AFEA 1HW5A 3BTAA 1D0GA 1OOPB 2GALA 4JGYC 2GNDA 1GZWB 1YLLA 5JDBA 2QVSB 5CB7A 2PLV1 3N7JA 2R30A 5HCFA 5JOWA 1ZZ6A 2GDFA 4K20A 2E63A 5T54A 3U10A 1EAH2 1ZBA3 2R32A 2XJSA 1RTVA 3MPPG 4AEJA 2WLPA 4CDWB 5I93A 4HSJA 1GKBA 3RNSA 4P9YA 2WS91 2ZGMA 4XJ9A 5FDBA 3RI9A 3VBFA 2GAUA 3OF1A 1S2KA 2JEMA 2UYAA 1RUJ3 1A3KA 5K8SA 2OA2A 2CTVA 2OPKA 2DFCA 3INAA 4V1PA 4F83A 1IS3A 3SCGA 1UIKA 4BHPA 4Q1RA 1POV0 1QJU1 3NAPA 1YFUA 4I30A 1SBDA 5C6CA 4HLTA 4COYA 1ZBE3 5KHIA 1TEIA 1HRV3 1LJ7A 2ZGUA 5I8YA 4N7UA 2QUOA 1QKQA 1J58A 2DTWA 2RM21 4MGZE 3GBFA 2XGXA 2WFPA 4DRRA 2XVLA 3ST7A 3A0NA 1G86A 2CAVA 4PIZA 5DZGA 4QM8A 4RR3C 5LRRA 4JAAA 5JSRA 3ZXKA 4XFIA 3VBRA 4NO4A 2PHFA 1J3RA 1Z78A 1ZBA2 2R073 5FPZA 3AMHA 2XLFA 1DQ0A 4FO9A 2E9QA 1XE7A 5GZEA 2A75A 1DFQA 2XJVA 1S0CA 2DCKA 4XBLA 3ZYIB 1VJ2A 4EN7B 1CAUB 3WINE 4ZU7A 1LHOA 2SLIA 2BNNA 2D3SA 3KSCA 2DVFA 1X8MA 1NE6A 1LU1A 2DU1A 4GWMA 4XFGA 2UWCA 5JIUA 4Q0SA 5DG2A 1RUJ2 4YGBA 3AJZA 4N53C 3L2YA 3B93A 3CF6E 3HWJA 2R16A 1ULCA 4SLIA 4NWWA 3GHNA 1AVBA 4I3GA 4Y1YA 4P9GA 2MNGA 4QMAA 4COWA 3VHOA 3NJZA 4A7YA 4ASMB 5BYNA 2GU9A 4XW3A 1RUG3 1PGW2 2EXIA 2HWF1 1W39A 2NLRA 3HAGA 4AGVA 1IPJA 1ZBE2 3TNQA 4HVOA 4LO8A 1OMIA 1HRV2 1XXNA 3GYDA 4B4QA 1K5MC 5HBAA 3VBRB 4MXWB 2GC3A 5JOZA 2AENA 3OY8B 5JR7B 1QH7A 3VBSC 4RHV1 3AXDA 3BPZA 2EALA 3FX3A 4QPGC 3ILRA 4CDUC 3TN93 1X50A 5DUXA 1HDKA 3AP6A 1J59A 2RJKA 3VHNA 4FTEA 1C1LA 4X6QB 2VG9A 2R072 4D7YA 3AYDA 3WP3A 1ASJ3 3MIGA 4QT6A 1G9CA 1F8VA 4C1WA 4PDWA 1FT9A 4HBNA 4LUMA 1H2MA 1PK6C 3FE5A 2ZMKA 3RWNA 2WKKA 1NCQC 5CG8A 1RHI3 1VAMA 4JRAA 5IK8A 2UYBA 3WLUA 4HVRA 2GNMA 4XFAA 2ILMA 1NZCA 4LEJA 1AR93 1C1FA 5ABJA 1RUG2 4GQ7A 4AEDB 4UBHA 3U4XA 4M3CB 2R0FA 3ZN4A 5IK5A 2ET1A 1SLTA 4F8AA 3LWCA 3DPRA 1AUYA 1LGNA 1MACA 1NXMA 5EWSA 4R9DA 2EXJA 2B9UA 2XLAA 1QOTA 4XF3A 3VZJA 2X5IB 5FCCA 1ND3A 3TN92 2FZ2A 4PDWB 1OPMA 3FZ3A 4AEKA 1GQHA 5C8WA 5FAXA 5JZGA 5JMCA 4QGNA 4XPVA 1KDMA 1XRUA 4P9LA 2WNVA 4K8FA 4DXZA 1LECA 3FJSA 4W6WA 2VUAA 4LE4A 4OHWA 1ASJ2 3DGTA 1REEA 3CEWA 3ZFFC 1LOAA 1U5XA 4AFBA 2P17A 2X53S 4I0WB 3V65A 2VVFA 1RHI2 1DLLA 1LEMA 3NSTA 4UW3A 4AVVA 5ABJB 1ZM1A 2QZ2A 4MYEA 2Y26A 4MGKE 1WD3A 1VBE3 3LOBA 5FLJA 2TUNA 1AR92 3R05A 3Q9OA 4YZ4A 5AC93 1IS6A 1XQNA 1A6CA 4LULA 4XHXA 4Y5Z0 3TBDA 4FPEA 2ZGOA 4Q8LA 1SEFA 4GH4C 3ETQA 1H9WA 4PCRA 1A78A 1EV11 2PFWA 3WXPA 1H30A 2VOXA 5FLHA 2CGNA 3E5XA 4M3CF 3VKNA 2FMDA 4YVSA 4YGDA 1R1A1 4LO4B 4CEWB 2ZMLA 4AGGA 4DY3A 4RS5C 1LODA 3ZSKA 1ZZ9A 1N1SA 2WNVB 1Y9QA 3AFGA 4Y22B 5FRAA 2OZJA 4FPCA 1O5UA 2FZ1A 2ARXA 1OA2A 1W6NA 4IV1C 2P2KA 1BK1A 2JG9B 1AR71 1RMU1 4IEOA 4LUKA 3AKPA 2WT0A 2ZGLA 1H4GA 1HQWA 3DN7A 2P37A 3KCYA 4CRQA 5LEKA 5ACA1 4CDQA 1F9KA 1SLLA 1RITA 4CZSA 1OFNA 2W52A 5JSOA 2A7AA 1WA4A 4XXAA 1VAKA 3JU9A 2VOVA 1LB2A 3JQXA 1SFNA 3MW2A 3CU7A 5A3LA 3GF6A 4Q27A 1PO11 4E4SA 4IXLA 2YXSA 1NCRA 4X8NA 5JI9A 2WT1A 4P14A 3O0WA 2D97A 3WDXA 3RRDA 4FTSA 4WVWA 1VBE2 3VBHC 4J1WA 1WMDA 5AC92 5DUWA 3ACLA 5BUVA 4CDWC 4K7JA 5KXCA 1R1ZA 1EAH1 2R6QA 5BNNB 1WLCA 1FOD3 3HBZA 4G3YC 3VDDB 2FMYA 1CAVB 3J9SA 3VKFC 1B35A 2AREA 2SBAA 2EXKA 2WSVA 4WVVA 1S0IA 4GMP1 1O3QA 1TQ5A 4OLLA 1W6QB 5F9TA 5I0TA 1FXZA 2Z69A 1H2KA 3MIFA 2I74A 4TSVA 2QZ3A 4ASLA 5GLVA 4BIOA 4COZA 2ZGSA 2GNBA 2DCJA 4YW2A 1CONA 4TZDA 4EWDA 4BPZA 1XU2A 3GBWA 2KA3A 5KHJA 4H14A 1RC6A 1LHWA 1Q5OA 4XZPA 1J3PA 3APBA 4Y20B 3IPVA 1W6PA 2PHLA 3L2HA 3ZYPA 3SLIA 2QJVA 3D6EA 2Z5WA 5BNQA 4B7EA 4XBNA 1NA1A 3L9JT 2XJRA 1WCDJ 5JPMB 1KD7A 3CNAA 3WZ1A 3N36A 5CA6A 2VNGA 3AYAA 4ORFA 1O91A 4BIFA 3USSA 4FP3A 4XXPA 4DY5A 1UU5A 3KQRA 3VBFC 1DDLA 1WLTA 4FT8A 1YI7A 4NHMA 4OUMA 3I54A 1ZBA1 2F4PA 2D98A 3OGGA 4IL7A 3JUUA 1FOD2 1VBB3 3KS7A 1Q3EA 1PIV3 1CVNA 2BBVA 4AVBA 1O4ZA 4IEXA 2PHDA 1IHMA 4AVCA 2P34A 4RR3B 3E5QA 1PVC3 2Z42A 1GICA 5BPXA 1YFYA 4XFBA 4WV8A 1JYIA 3N3HA 1JH5A 5K0UA 3BOPA 1RUNA 4H7LA 4GKXA 1RUJ1 3IPVB 4CDXA 4C0BA 1W6PB 1W0PA 3D4KA 2D6NA 2K2SA 1DGRA 4P9IA 5JCTA 3AM2A 1NA1B 2DVBA 1MQTA 2VH9A 4BQ1A 3BALA 4M0NA 4Y26A 1PGW1 2B46X 5GKAC 3HR9A 4AHYA 4N43A 3VBRC 4PLMA 1ZBE1 4B4RA 4MXVA 1HRV1 3IWZA 5C33A 2B42B 2BVBA 4I0AA 1TNRA 1UKGA 3VLBB 3DUIA 3QOPA 2VMIA 2OUHA 1CJPA 5FMOL 1JHNA 4GB33 5D8AA 1OD5A 5H9SA 3MLJA 1W6OB 4XJWA 3TYJA 1K5MB 4Z8BA 1H1IA 1BVP1 2R071 2TEPA 3VZOA 4Q4X3 1VBB2 3VBSB 1PIV2 4QPGB 1X7NA 3H7YA 1VLNA 3GZTB 4CDUB 1IS5A 3FWEA 1NG0A 1PVC2 3M3QA 2H6BA 1MR5A 4HMZA 3J26N 2D93A 1C8M3 4FPOB 3PVEA 3OBRA 5CFDA 3THPA 3WDVA 4AEDC 4M01A 4Z07A 1SCSA 4KG0A 4NVPA 4E4ZA 1QQP3 2DURA 2PTMA 1ZX5A 3OJBA 4OI4A 2Q8OA 2LTNA 1YO8A 3IMNA 4FPHA 1NCQB 1AYM3 1RUG1 4LHNA 4RSUA 1IOAA 3RYRA 1EPWA 2ZBJA 1YNAA 3AKTA 5C8CA 5I8SA 2JKBA 1ENQA 4KH9A 2RS33 4IETA 1CAWB 4XMIA 1YYNA 1V6MA 1QH6A 1ULFA 1RUD3 2X5IC 4FPYA 4NWVA 3ZVXA 3E6DA 1Y3TA 4PDWC 1ND2A 2G4IA 1Q43A 1KFUL 2Y38A 3G6JB 1YCIA 2ZKLA 3N7KA 2A6WA 3TN91 1APNA 4GB32 3VL8A 1X33A 5CFCA 5JVVA 4AFCA 2YDEA 4HN0A 2V73A 4KGGA 1CIWA 3ZSEA 1DGRN 1AYN2 3V0AB 5GZFA 3FUQA 4Q4X2 3VBUA 1ASJ1 4E27A 3AJYA 3VHRA 1VRH3 5ABJC 1H8TA 1QDCA 4IV3A 4JTOA 5KBFA 4W65A 1LHUA 3ILNA 3M4FA 3NV3A 1HRI3 1RHI1 1AL23 4R4XA 3M7AA 1DU3D 1C8M2 2YGLA 2P3JA 3KCXA 2JJ6A 3DPRC 1YFWA 1QDOA 4ZKTB 1V6LA 3AP5A 3K51A 1WMEA 4OHZA 3ZFFB 1AR91 5JLVA 1QQP2 4LBOA 1QJY3 3C2UA 2R0HA 5KXEA 1ND3C 2AYHA 1AYM2 3JQWA 3R4UA 4MH0E