1ND2C

The structure of rhinovirus 16
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
238
structure length
238
Chain Sequence
GLPVYVTPGSGQFMTTDDMQSPCALPWYHPTKEIFIPGEVKNLIEMCQVDTLIPINSTQSNIGNVSMYTVTLSPQTKLAEEIFAIKVDIASHPLATTLIGEIASYFTHWTGSLRFSFMFCGTANTTLKVLLAYTPPGIGKPRSRKEAMLGTHVVWDVGLQSTVSLVVPWISASQYRFTTPDTYSSAGYITCWYQTNFVVPPNTPNTAEMLCFVSGCKDFCLRMARDTDLHKQTGPITQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and virological studies of the stages of virus replication that are affected by antirhinovirus compounds
pubmed doi rcsb
molecule tags Virus
molecule keywords coat protein VP1
total genus 41
structure length 238
sequence length 238
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2002-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1nd2C00
1ZBA3 4QPIA 3VBSC 1TME3 4N53B 4Q4V1 4RS5B 4IV3A 4CEYA 5JZGC 1EAH1 1BEV1 4GH4C 2WLPA 1F8VA 1QJU2 1ZBE2 4IV1A 1VRH1 1MEC3 4CDQC 1HX6A 2XBO1 4CDWA 4JGZA 2X5IA 2MEV1 1RHI2 1CJDA 2WFF3 3ZFEC 1QJZA 1RUE2 2HWF1 4Q4Y2 1RUJ2 1ASJ2 3JBG3 2MEV3 4AEDB 1AYN2 1PVC3 5K0UB 1C8M3 2Y26A 5LK7B 2R043 2BPA2 2BUKA 1C8M2 1EV13 1EAH3 1AR61 1HRV2 5C8CC 1HQNA 1VBD3 4CEWC 3NAPB 1HXS2 2VQ0A 4SBVA 1VBA3 4Q4W2 1W39A 1RUH1 1RUD1 1RB8G 3JBG2 4YVWA 3VBHA 2QQPA 1DDLA 5GKAC 4GB33 1AYM1 1PGL1 3CJIC 3VBUA 5J96B 1R1A2 1RMU2 4N53C 4Q4W1 4Q4V3 4CDXC 4RQPC 4JGZB 1ZBA1 1R1A3 4RR3C 2HWD1 4RQPB 2WS92 1RHI1 1EV11 1VBA2 1H8TB 1PIV3 4RHV3 1FMD3 1RUF3 2R041 2TBVA 4GMP1 5ABJB 4RHV2 4BCUA 1PVC1 1NY72 3JB8A 1NG0A 5CFCB 1ND2A 1R082 5D8AC 1PVC2 1AYN3 1VBE3 1E57A 4QPIB 4QPGA 2FZ2A 1ND2C 2HWC3 4RR3A 1R081 1AL23 4JGYC 1RUE3 1AL0G 1VBC3 3CJIA 5ACA3 1AR81 1V9U1 1TMF2 1VBC2 4CDQA 1NA1A 1F2NA 1M06G 1RMU1 2WFF1 3HAGA 2RS32 2BFUS 1OHFA 1AR71 1PO23 1OPOA 1VBE2 4JGZC 1BMV2 4YVSB 1RUG2 1A6CA 4N53A 2RM21 1D4M1 4PDWB 1CD3G 1B35A 4WM8C 1AR72 2PLV3 1AUYA 4IV1C 3ZFFB 5CFDB 1ND3C 1PIV2 4CDUB 1QQP1 1MQTC 5C9AC 3DPRA 5K0UC 1HRI1 1RUI3 4PDWC 2HWB3 5C8CA 5L7OA 5ABJC 1QJY3 4CEYC 1ASJ1 1VBB3 2R062 2RS53 1AR62 1QJY2 1RVF3 1HRI2 5AC91 5BNPC 4GB31 2RS51 1VBB1 2WZR1 1RUC1 1ND3B 3JD71 1QJY1 1PO13 2FZ1A 3VDDA 3ZFEA 1PO12 4WM8B 5DDJ1 1RUI1 1TMF3 1NCQB 1VBD1 1QQP3 3JD72 5C4WA 2HWF2 1COV3 1NCRA 3VBRB 1VBB2 2BFUL 3J8F3 4IV3C 1R091 5BNPA 4CEWB 2RM23 3VBFB 4RS5C 1NOVA 2XPJA 1FPN3 2RMU2 4GH4B 1H8TC 5BNOA 4CEYB 1VAKA 1AR73 2PLV2 5L7OC 2MEV2 1X36A 1K5MC 2ZZQA 3VBOA 2RR13 1ZBE3 1K5MB 1MQTA 3VBSA 1FOD2 2RR12 1VB4A 4CDUC 5C9AB 4QPIC 5CFDC 1VBC1 3ZFGC 1RUG3 3DPRB 1FOD3 4CDUA 4JGYB 3VBFC 1OOPA 1MEC1 1QJX2 2RR11 1MQTB 1RVF2 4WM7A 1B35B 1K5MA 2WS93 3TN91 1VBE1 5A33A 5D8AB 4PDWA 3S6PA 1FMD2 1RUF2 2HWE3 1FPN1 1TMF1 1NCQC 5DDJ3 4GMP0 5J98B 4YVSC 1QJU3 1HXS1 5BNNB 1POV1 4Q4X3 1R093 2R042 1NCRC 2WFF2 5C4WC 1R092 1QJX3 3CJIB 4FTEA 2HWD3 4WM7B 1RUJ3 2RMU1 1ASJ3 1POV3 2HWD2 1PGW1 4Q4W3 1RUJ1 2RMU3 1ND3A 1AYM3 1C8NA 1X33A 4GB32 1ND2B 2WZR2 1BEV2 5CFCA 2RS33 1EV12 1EAH2 5A32B 2HWC2 3VBRC 2GH8A 4FTBA 4Q4X1 5ABJA 1HXS3 3NAPC 5A32A 1D4M3 1IHMA 5C8CB 1HRV3 2BBVA 3DPRC 4Z92B 4N43B 4Q4Y3 4NWWA 1RUH2 4RQPA 1POV0 2R073 5JZGB 1AYM2 4CDXB 4WM8A 2WWSA 3ZFEB 1B35C 1RMU3 5AC92 3JBG1 1PO22 2R071 4N43A 5FOJB 1VB2A 4RFT0 3JB4C 1RUG1 1RUE1 2R063 1PO21 3VDDB 1ZBE1 5D8AA 1NA1C 3J8F1 2RS12 1AYN1 3ZFFC 2HWE2 5L7OB 1AR83 5CFCC 4LLFA 5BNNC 4Q4Y1 4EJRA 4Y5Z0 4JGYA 1MEC2 1R083 3LOBA 4Q4V2 3ZFFA 4FSJA 1BBT1 2HWC1 4AEDA 4FTSA 4QPGC 3JD73 1BEV3 1Z7S3 4QPGB 4AEDC 1COV1 2IZWA 1QJX1 1BBT2 1RVF1 3VBSB 1VRH2 5BNNA 1VBD2 3VBOB 1AR82 2X5IB 1FPN2 1PO11 1QJU1 4YVSA 1FMD1 1RUC3 1RUF1 4GMP3 5ACA2 4CDQB 1COV2 3TN92 2R072 1RUC2 1RUD3 3ZXAC 5C4WB 4IV1B 2X5IC 1VBA1 1RUD2 4CEWA 2PLV1 1Z7S1 4CDWC 1WCDJ 4Y4YA 2RM22 3FBMA 1ZBA2 4N43C 4CDXA 5JZGA 1BBT3 3VBUC 3VBRA 1GFF2 1NY71 3VBUB 1FOD1 1HRI3 1PGL2 4YVWC 3VBHC 2ZAHA 1RUH3 5FMOS 1SMVA 4IV3B 2HWE1 2RS13 1AR92 2WS91 3TN93 2GSYA 4GH4A 5BNOB 3NAPA 1AR63 1H8TA 2R061 2HWF3 1TME2 4Q4X2 3VBFA 1AL21 1C8M1 3ZFGA 5BNPB 5CFDA 2RS52 2XBO3 1NCRB 3M8LA 1AL22 1V9U3 3VBOC 5DDJ2 1NCQA 5ACA1 1RUI2 1V9U2 1HRV1 2RS11 3J8F2 1Z7S2 4CDWB 1PIV1 4YVWB 3VBHB 1RHI3 1NA1B 2RS31 2ZTNA 2XBO2 1VRH3 1D4M2 2DF7A 5A33B 1R1A1 3ZFGB 1BMV1 1AR91 1OOPB 2HWB1 3IDEA 4RHV1 2WZR3 4NWVA 4WM7C 3VDDC 1QQP2 5BNOC 5AC93 5K0UA 1AR93 1OOPC 5C9AA 5FMOL 1TME1 1PGW2 4RS5A 4RR3B 2HWB2
chains in the Genus database with same CATH superfamily
5DAWA 1PZ7A 1ZBA3 2DVAA 4PCRA 3HQXA 4NPMA 5F7UA 2AENA 1SDDB 3NKGA 4FOYA 4HSLA 1STMA 4RS5B 5IHRA 4CEYA 5HCAA 3MIBA 5DPNA 4LNVA 1EAH1 1HJGA 3BKZA 1LGNA 2CSGA 2IVJA 4LBNA 3KSCA 2PFWA 3A22A 2EIEA 2WINB 1YQ5A 3MV11 1OUSA 4JKLA 2FMYA 5FCCA 3UESA 1QJU2 4IGPA 1MZ5A 2G19A 3OPZA 2NZ9A 4LEJA 4YZ5A 5IK5A 3M1HA 1HX6A 3GZAA 5A3OA 1LU2A 4HMZA 4CDWA 5FZ6A 5IUQA 3KCXA 3AMHA 2X5IA 1JH5A 4FVVA 1NKGA 4LOTA 1CJDA 5DAQA 5FZ7A 4CUAA 1LEDA 4FCAA 2XHNA 1RUE2 1W9TA 2F4LA 5I8YA 5IVJA 1UIKA 4GWMA 3BIWE 4FPKA 1W3VA 3BOWA 4YLZA 5FYTA 1ULGA 1R1ZA 3AJZA 2VXRA 5HPOA 2K46A 4XBQA 2IXCA 2OQ6A 2ZGPA 3I7DA 4B7KA 5KXBA 1O3SA 4CXXA 1JYIA 2D6MA 5K0UB 1XYPA 1UZ0A 4AL9A 4C1WA 1HLCA 3POYA 1J59A 1MVEA 4CU7A 4ES8A 2BUKA 5B4NA 1OT5A 2X29A 2ZBJA 2V5DA 4DOUA 3VN4A 1HQNA 4YGCA 2AYHA 1W2OA 1W8ZA 2XDVA 1VBD3 4TSVA 4CEWC 2WT0A 2DDUA 1HXS2 4Y22B 3H8UA 3ZN5A 4IE7A 3HJRA 4OLLA 2AR6A 2HYXA 2VTFA 3WP5A 3I49A 5IAXA 3ETQA 4CP2A 3N9NA 2QQPA 3BUCA 4DPNA 4GB33 1AYM1 1QDCA 3KHBA 2YPDA 5A7WB 5FREA 2AGSA 1DQ0A 1S0IA 3VBUA 3WDVA 1O7FA 4TLFA 2C24A 1XC6A 1A34A 3CMGA 2G9GA 1ZBA1 2GP3A 4LULA 5FLJA 2OX0A 5FZOB 4ATEA 2VCCA 4QT6A 2FD8A 2VR4A 1QXPA 1LNSA 1W2AX 5DG2A 3SLIA 1GZCA 1O3TA 2WS92 4LO4B 4QM9A 1EV11 1LEMA 2JIGA 3AMQA 3NV3A 1PIV3 1FMD3 1RUF3 3UYJA 3RZJA 4QXHA 2Y6LA 4RHV2 1LHOA 1PVC1 4X6RB 1OUXA 1NZIA 1ZZ7A 5K4LA 4QX0A 1JZ7A 2YY1A 2P3JA 2BNMA 2PQQA 1K12A 2VUCA 1S0BA 4JDNA 4PT6A 4UW3A 5CFCB 1H6XA 3ILRA 4DEQA 3RDIA 4R52A 1FX5A 2D5HA 2VOWA 3ENRA 3HN3A 4JV4A 1SACA 1CWPA 5D1IA 2YU2A 2FZ2A 3KT7A 5HCBA 3Q8EA 2HWC3 2Q30A 2J1EA 4PBOA 3AP6A 3BVCA 2A6WA 3U10A 1RTVA 1R081 2WYSA 1AL23 4XUQA 5LRRA 4AFDA 2IXHA 1SBDA 4F8AA 5F37A 1GZTA 4PLOA 2H6CA 1DQ5A 4YPJA 5GZDA 3KVBA 1W2UA 5F32A 2PXJA 3L2YA 5FZEA 4AR2A 4GWJA 4AG4A 1KRIA 1CZSA 4PF5A 2WJSA 4CUBA 2RS32 2ZGSA 3ZXDA 5C70A 1HB4A 3OY8B 2FDHA 4MOAA 3WP3A 1VBE2 3I54A 4SLIA 1I5PA 1UY1A 4MGTA 1UMHA 5T50A 2BVVA 2CGOA 4E8DA 3TOJA 4JVAA 2CY6A 3VZMA 2YFZA 3NJYA 1FXZA 3AKTA 3MIEA 1Q5OA 1AR72 2PLV3 4P9XA 4UT5A 3T1MA 5A6ZA 1W9SA 1XSRA 4J1WA 5CFDB 3WNPA 2XJTA 1RUNA 4CDUB 1OBNA 2Z5WA 4H14A 4BQ5A 4A7YA 4RSUA 2W91A 3OD4A 3AXDA 4E9KA 2HWB3 2WABA 1CX1A 3A21A 1UYYA 2VUDA 3RG0A 1NQJA 1PHMA 2Z42A 4OZXA 2BWAA 3ACLA 2DCZA 3URFA 2ZZJA 2WZPP 3ES1A 1AR62 1PM7A 1GYKA 1QJY2 1SCSA 2VZPA 2OPWA 4L8QA 4LUMA 3RJ2X 5IVCA 2D6LX 5J7MA 1DBNA 2B8MA 2W95A 1GICA 4H2AA 5FZLA 2E6VA 4GB31 3K51A 3PJYA 3WNKA 5BNPC 2WZR1 5FO9B 3W5NA 2Q1MA 1ND3B 1V6MA 1HV0A 1H9PA 1MR5A 1AX2A 1J58A 1TG7A 3KV5A 1WMEA 2XL9A 4C90A 5GLVA 5FXZA 3GJAA 5E89A 1SLCA 4V1PA 3R4SA 3R4DB 2WYFA 1VBD1 1O6UA 4IE5A 2YXSA 3W5MA 1UCXA 4HPKA 2NQYA 1H0BA 4RGKA 4EZHA 2EXKA 1S1AA 1CESA 1IPJA 4IV3C 4QX2A 4XHBA 1R091 4RL7A 5BY5A 3GM8A 4W6XA 5FO7B 5BNPA 2RG4A 4K8FA 2VVEA 3GGLA 4QAWA 4BM8A 5EHDA 5G05L 3BTYA 2PN5A 4RS5C 2XJSA 5C3OA 2RDSA 2PAKA 2WQ4A 3VHNA 1FPN3 3ELNA 3WNNA 1BXHA 3USUA 2ZX2A 4I30A 3ST7A 1H8TC 1RXFA 1V6OA 3C7OA 3MLKA 2IWGB 1MS0A 2ZGUA 1VAMA 5T52A 1WCQA 4QD2A 4LHKA 4QHOA 1Q8QA 3WR0A 1TZOA 2W5FA 4XIKA 1J3PA 5C9AB 5JIUA 3Q8AA 3TNPB 4LBKA 5F3EA 5CFDC 5L9VA 3OD0A 3LOIA 1KGYA 4GQ7A 2Q8CA 1WLWA 3WNXA 2JJ6A 4XBLA 4CPBD 4LKSA 3VBFC 4FP3A 4YNIA 1VIWB 5AVAA 4J1XA 1X8MA 3M3QA 4OFGA 2RR11 5FZ9A 2FBEA 4WM7A 1B35B 1NXD1 1BQPA 2GC2A 3UKNA 3AX4A 4A44A 1YCIA 2HWE3 2HJIA 2WNUB 3JQWA 4LBLA 2AC1A 3NMBA 1S0FA 3O1RA 4NRQA 1TMF1 3H42B 4H7MA 4OHZA 2JKBA 4XQ4A 1V70A 4Z2AA 3Q8BA 4YVSC 4GKXA 4B1MA 5FUIA 4HVQA 3B7MA 5LA0A 4Q4X3 4EN7B 5FXVA 3HVDA 3ZPYA 1ZRRA 4KBZA 5A6YA 1KJLA 3LD8A 5HCHA 4LOSA 4QPWA 5T54A 4B7EA 1J1LA 2VZQA 5CVRA 2PHDA 1ODMA 1ZVFA 4FTEA 4UFHA 2WWUA 2WNVA 1J83A 4NVPA 2HWD2 5FPUA 2JECA 4LKFA 1LOFC 4A7KA 2YGLA 1ND3A 5GLUA 1AYM3 3N9PA 1C8NA 1LENA 3POFA 1JYWA 2J1SA 1W6OB 5HCFA 4IETA 4W6WA 3AJYA 4O9GA 5FK7A 3VBRC 1HKDA 2GH8A 4F7ZA 1QWRA 4DQAA 3PHMA 5JMOA 2JE7A 5ABJA 1HXS3 3NAPC 2ZKLA 2PHTA 3PDQA 4E4DX 2WN2A 2VZVA 1NQDA 3FL7A 3FMGA 4P9YA 3TNQA 1DHKB 2BBVA 4HN1A 2XMLA 1XYOA 3TEYA 1GKBA 4BISA 4WZCA 3ZYPA 3BODA 5LWBA 2B5HA 1YWKA 5LY1A 1S2BA 4BHPA 5F3IA 4BZ4A 1OI6A 2WWSA 1OD3A 5AC92 5LASA 2VH9A 1F9KA 1QF3A 2P3IA 2WA4A 2QQKA 3ZYHA 5HI0A 1MACA 2XKPA 1Y7BA 2ZACA 2C1FA 2YPJA 4FFHA 5IT6A 1EPZA 3KCCA 3JB4C 1RUG1 4AK3A 1CAUB 3WQ1A 4E2GA 1RUE1 3Q8FA 4L9BA 4BB3A 2UYAA 4CSWA 2Q8OA 2R063 3IIIA 1JBCA 2ZOEB 4KG0A 3VZJA 4OI1A 2PHFA 4MX3A 2EALA 1NA1C 4R8HA 3V0AB 2RS12 5FYSA 1IZ3A 1SLAA 2A6XA 1W3XA 2WL1A 2CV6A 1AR83 4X8PA 2QJVA 2QE3A 1TE1B 4Z8BA 2R7EB 1CIYA 5K9YA 1UN1A 4CP1A 2DUPA 4FSJA 2YBKA 2BJSA 4YWAA 2LALA 2AZ5A 4AEDA 5I0SA 1RIRA 2Y38A 2WC2A 2YYOA 4IEUA 1MZ6A 3WLUA 4CYDA 2PELA 1XNTA 1OD5A 4FPYA 4GAZA 1GZWB 3CNAA 3BTXA 1NYWA 1COV1 2R0HA 4YARA 2JDAA 1ULDA 5HBAA 4IQPA 4B1LA 1BBT2 4XF9A 3VLBB 3VBSB 1LU1A 3MFCA 3N3HA 1LRHA 3AYDA 3MLJA 1VRH2 4Y26A 1CAWB 1VBD2 3POSA 1MS1A 2GNTA 4BXSV 1S0GA 3U75A 1W6PA 5LBFA 3POGA 4XIOA 3ZR6A 5ACA2 1UO9A 1W2TA 3A23A 4RN5A 4WVVA 1GZ9A 4J6GA 4COWA 4DS0A 3AZXA 1CAUA 2R072 1CGPA 3K75B 1RUD3 2PAEA 3H3LA 4BMBA 1O59A 5DUUA 4AHZA 4EZ4A 5E1RA 2VUAA 2Z2SB 2PLV1 1Z7S1 4NAOA 2RM22 4XOGA 5A7OA 4D94A 1S4CA 1GWLA 1DGWX 1QJFA 2V5YA 3ABZA 1VMHA 1WLCA 3DCQA 3VBRA 3BPZA 1SG3A 5KHHA 1S2KA 5JPNB 3VBUB 1FOD1 1PGL2 2ZAHA 5JCTA 4D7TA 2YZ4A 1RUH3 5FMOS 1QKQA 1DCSA 3NJZA 2RJLA 4IEQA 3OYWA 4ISRA 2NMNA 2FCVA 2UYBA 3H7JA 5FPZA 4L99A 4MXWA 3CZUA 4HK9A 5L36A 1AR92 4S2HA 5FP3A 3TN93 3WHUA 2HEVF 1US3A 1ULCA 5FZMA 4XQDA 4BLJA 2E7QA 2NM1A 4Y22A 1FATA 3W20A 3WP6A 1W6OA 1AR63 4BQ4A 2YGMA 1QH7A 2BOIA 4D7YA 1DGWA 4DEVA 4UW4A 2VQTA 3TB0A 2WN3A 1AL21 1C8M1 5APAA 4TTGA 3ZFGA 5DZFA 4XFCA 5FDBA 2JDUA 2A5ZA 3DN7A 5F5IA 1NCRB 4XAEA 4PQQA 1APNA 2Z79A 1AL22 1V9U3 3LCPA 4LE3A 5KHJA 2J22A 1JUIA 3RZHA 3MZHA 1JHNA 5DDJ2 1YQCA 3AP9A 2R0FA 2JDMA 4AFCA 3GBFA 3RI9A 5LA2A 4PBPA 2D97A 2VW2A 2R49A 2E7TA 2RS11 3HWJA 2VQUA 3IDAA 3S30A 3RYPA 4KWJA 4P9LA 1Q43A 4CDWB 2B39A 1PIV1 4W8JA 2VGDA 3I2KA 3LSEA 4A42A 2VD7A 2JE9A 1F15A 2RS31 2ZTNA 3NV2A 3HNBM 2XBO2 3IT8A 5FY8A 3EQEA 1SLTA 5DAXA 1ZA7A 2CDPA 2DF7A 4Z82A 4IEVA 4DMIA 3PIGA 1LOBA 4ZPIA 2ENRA 1HDKA 4ATFA 4AFBA 3WV6A 2GMEA 5T3NA 2YDEA 1AXYA 3IDEA 4RHV1 1IKQA 2DBNA 1BZWA 3MF6A 3V0BA 3VDDC 1SCRA 3PUHA 5KC5A 1R64A 3NSTA 3B3QE 3WF1A 5HV0A 5C9AA 4XDQA 1TME1 2H0BA 4ZY9A 5J09A 4CU9A 4M0HA 5T5OA 1PGW2 3E6DA 4RGAA 4RS5A 4NUBA 4A3ZA 2HWB2 4AI2A 3LFIA 4AOCA 3GALA 3T1LA 5DZGA 5SV5A 3LA7A 4Y5TA 3LSDA 3EBRA 1E5IA 1GANA 1CX4A 1TME3 3VBSC 4BXFA 1U0AA 4IV3A 1DGLA 2EIBA 2LTNA 2RJ2A 2JD4A 5FP9A 2D3SA 3BCWA 3OGGA 4RFRB 3ZLIA 4Z2WA 3A4UA 4GH4C 2IXLA 2TEPA 3DYPA 4XACA 1W05A 5FZ3A 2CGPA 1XNCA 1U5YA 1GLHA 3PIJA 4CCNA 4F83A 1AF9A 3OF1A 1X7NA 2XB6C 1CQ9A 5FO8B 2P3YA 5IK7A 5F39A 1ZBE2 5F8PA 4IV1A 2YV8A 3CZJA 5FZ1A 4EE2A 2QUOA 4KU7A 4Y3OA 5FPBA 5FZFA 3U4XA 1H1AA 2O8QA 3WW4A 1YJLA 3BALA 1W8UA 3PU8A 5ANNA 4BE3A 2D6NA 2JDYA 1W8OA 3AP4A 3NW4A 3X29B 4H7LA 2DURA 1H1MA 4JGZA 2BTVC 1KFUL 3BB6A 1JHJA 3S5AA 3L9JT 1BVP1 4Q26A 4ASMB 4CCKA 5ABJB 3ZFEC 5AFBA 4AEKA 4CVUA 3AFKA 4Q4Y2 5FPLA 4P9WA 1O8SA 3TEXA 2DCKA 3POJA 4PI0A 3ZO0B 5I0DA 3JBG3 3K46A 3VDCA 4A45A 5JXHA 2EIGA 5FY4A 4AE2A 3VHPA 4XPVA 2QQMA 2VC9A 1C8M3 1LGBA 3WNLA 1UMIA 5LEKA 4XILA 4Q27A 4M3CA 3A7QA 1CAVA 4R4ZA 4XFFA 3ZXEA 1EAH3 1D2QA 2EA7A 3DKQA 5CAZA 1AR61 1UXXX 5LCWL 3WOGA 3ZR5A 4AGGA 5DMYA 1W6MA 1W8WA 1JOPA 1W99A 2I2SA 2WUHA 2Y64A 3ACGA 2JXAA 3NAPB 2JB8A 4I02A 4K1ZA 5T5LA 4JTOA 3B69A 3PMEA 3B9CA 4SBVA 4DXSA 5A1FA 1VBA3 3GCWA 4YZ2A 3PL0A 4Q4W2 4ZXEA 1F5JA 1Y9QA 2AACA 4D7SA 1RUH1 5H9PA 1W03A 2FCTA 1D4VB 2XR4A 3UT0A 1A3KA 1SLIA 4HETA 1FAYA 1SLBA 4LXLA 1EYBA 3MICA 4FOWA 3SITA 1PGL1 2QQNA 3P6BA 5J96B 1R1A2 3VZKA 1RMU2 3W59A 4Q4V3 3WDXA 5J36A 3RS6A 3HPNA 1YYNA 4FPCA 5C6CA 3HNYM 3K77A 2HWD1 2C0ZA 1PMIA 2P37A 3M3IA 4B4QA 4Y1UA 1UF2C 1KD7A 1YUDA 2A3YA 3N35A 5EYYA 4Q0QA 2GMMA 1K42A 3PU3A 5IAVA 2R041 4DO0A 1HN1A 2G9ZA 2C5DA 2R1DA 1AX0A 3MW3A 1PNGA 3PMSA 4JQRA 1ZZBA 1AX1A 3SEPA 2ZXQA 3K4AA 4LHNA 4BCUA 3LWCA 5LZ6A 2DVGA 2ZEWA 4QWNA 2DFCA 1NY72 4AFMA 4COZA 1ZZ6A 2VZSA 4Q0UA 2CTVA 3QH7A 4QKBA 3ROUA 1YRZA 1NG0A 3BTAA 4LBJA 1ND2A 1R082 5I93A 5EYXA 1PK6B 3VDAA 1AYN3 1JU4A 1LESA 1TNRA 4J25A 4KBBA 1YJKA 5A7PA 2XG3A 4QPGA 4CRQA 3Q9OA 4JDOA 3OUHA 4NHMA 2VBPA 2MHFA 2VECA 2WT2A 5F1RA 2VCBA 1LULA 2FHRA 3AP5A 4C91A 1P8JA 2VW1A 2CNAA 4AI8A 4KWUA 2WO7A 5ACA3 2BGPA 1AR81 2WNEA 1L7RA 4IE0A 5C3QA 4L11A 1C3HA 4Q8KA 2ZMLA 1FV2A 1M06G 3OPTA 3B9IA 4M0NA 1PMHX 4XCBA 5KHGA 1YLLA 2XVLA 3FJSA 1RMU1 2WQZC 3HAGA 4G9SB 5FZOA 3A0KA 5L9RA 2BFUS 3RI8A 5IVVA 1AR71 4LKDA 2HYKA 3C3VA 4XUNA 3VKMA 4HANA 4JDMA 3KGZA 2FDJA 4JGZC 4AQ2A 4N8MA 1BMV2 4YVSB 5I8SA 1RUG2 4N53A 4I01A 4RA0A 4YGDA 4PDWB 4DUWA 2CAUA 1SBFA 3D5OA 4EROA 4HG6B 4K9SA 2AEZA 1J3QA 4WM8C 4ORFA 2CWSA 4HKWA 3WDTA 1O4YA 4IV1C 3ZFFB 4Y4RA 5FZDA 3FLPA 1I9RA 1SLLA 4FPLA 1X82A 4IERA 5EJ1B 4CTEA 5C9AC 2XH6A 1NT0A 2VOTA 3DPRA 3MV01 3SQOA 1G8WA 2YG0A 1E5HA 1HRI1 1SHWB 5J37A 4PDWC 1L3JA 3SH5A 3V65A 3W58A 5FFOC 2RHPA 3FHIB 3LEGA 4I3PA 1W9WA 4UOJA 4LHSA 2WSUA 5FMDA 3LEKA 3KB5A 3KMHA 2X05A 3IAQA 3SNMA 4AHWA 5C8CA 5L7OA 3ZYFA 1GOGA 2A70A 1OVSA 2R062 3PVBB 2P34A 4QX3A 2VZOA 5T5JA 2Q8DA 1H2KA 3T2OA 3P3NA 4CXWA 5FR3A 5FWJA 1Y9GA 3OYWB 1HRI2 3U1XA 4HFSA 5F6KA 5LK5A 1J3RA 1QXJA 3VD5A 4M4PA 3CLPA 4S2FA 1RUC1 1EY2A 5IJRA 3VDDA 1QJY1 5E16A 1RJ7A 3T0AA 3U14A 1DGRN 4EN9B 5A1AA 2C26A 4UF0B 5FP8A 1W9FA 2XWJB 1NX9A 5DDJ1 1RUI1 1DYKA 2K0GA 3GNEA 4QU2A 1NCQB 1XE7A 4NN0A 4XQWA 4XFIA 4AGRA 1QQP3 2VMFA 2QCSB 2YU1A 2ZEYA 4QGLA 1JYCA 2BYVE 4B8EA 1T6GC 2HEWF 1SPPB 3J8F3 5T55A 5CB7A 2TNFA 2GC0A 3RGBA 3UJOA 4CEWB 3I2DA 2KD7A 2RM23 1MZFA 1ALYA 4Y24A 2VNGA 4MG2A 3UNPA 1JZ2A 1LTEA 4QB1A 1IG0A 1NOVA 3EJKA 3UV9A 4UFIA 2XPJA 2VCMA 1JYNA 3WDYA 1QOOA 2ZA9A 4GH4B 2C9AA 2W94A 3WY6A 1VAKA 3N7LA 3WNOA 4CEYB 2XUEA 2MEV2 1X36A 1G7YA 1GZWA 3B94A 3ZXLA 4NOTA 2RR13 2VU9A 1K5MB 1VPHA 2EXHA 3HT1A 4EYUA 1O3QA 1MQTA 3ZKUA 1SZBA 1ZZCA 2P5BA 1FOD2 1WMFA 4IE6A 4PIXA 3TWIA 2VZTA 4FFIA 3ZFGC 2DUQA 2NN8A 5EIYB 1Q8VA 2UWAA 2JWPA 3M3OA 3ORJA 4AVBA 1YNAA 1OOPA 2VVFA 2RDRA 3NNLA 1MEC1 3M4FA 5FZAA 1RVF2 4KMQA 2B9UA 3TN91 3V0AA 1VBE1 1LJ7A 3OGVA 2NLRA 3LA2A 5A33A 1NUKA 3VHRA 5CA6A 1UPSA 3NL1A 4QX8A 3S6PA 2DYCA 3WHTA 5BPXA 3N9MA 3PVNA 2ORXA 5IVBA 1FPN1 3BOPA 1LODA 2D43A 1W28A 3KS7A 5DDJ3 2EIDA 4JX0A 4XFHA 3FFZA 3RQ0A 2R6QA 1O5LA 2YFUA 5A3LA 2FCUA 1IS6A 1PMJX 4AI9A 4FPOB 1R093 2V4AA 1YQ8A 4JZRA 3N9LA 1Q8SA 3NVCA 1SFNA 5C7GA 2ZX4A 4E8CA 5KBFA 2KXLA 4TN7A 1JI6A 1PX3A 3CJIB 3KF3A 3ITQA 3ZSLA 3GCXA 1F5FA 4WVZA 1O4TA 2RMU1 2E9QA 4NJ4A 4Q1RA 5FAXA 2CU5A 1OH3A 4UI9L 3NKTA 2CWMA 3C7GA 4YW2A 2ZEXA 1PGW1 4BOWA 3NRUA 3NWKA 4TXWA 4PJYA 1RUJ1 3R05A 3S57A 1CZTA 1RXGA 4FPEA 1VMJA 4YG6A 4COUA 5FYZA 2QKDA 4GB32 4I09A 4CCMA 4XUTA 4CE8A 1V6KA 3QCWA 4MXVA 2Y6GA 2P1BA 3GZEA 4P02B 1EAH2 4XAAA 4P14A 5A32B 4IW3A 4P5YA 5D2AA 4CP9B 2FDIA 1JZ4A 4FTBA 3ACHA 2W08A 2DFBA 2ARAA 3PJQA 4B4PA 3HNMA 1DQ2A 3KV6A 1QDOA 5CKMA 2WAOA 1IHMA 2C9KA 2BW8A 2D3PA 5DUXA 3FHQA 1E5RA 3NNGA 3DPRC 1V6NA 4N43B 4OUMA 3W9AA 3CL1A 2WNUC 4NWWA 2VTXJ 2AH2A 1POV0 4RQPA 2R073 1AYM2 5E6HA 4WM8A 4CDXB 3ZFEB 1RMU3 2ZMNA 3H1MA 2JG9B 3I59A 3ZVXA 2N7GA 5FY5A 2WKKA 4JHZA 1U5IA 4ISQA 2GN3A 2R071 2AREA 3BYWA 1AVBA 1GU3A 3OCPA 5FOJB 3HD8B 3LIGA 3AL5A 3WG1A 2BGOA 4AVAA 1GMMA 2JDZA 1XB9A 2YROA 3OBTA 3ECQA 2P6CA 1H2MA 2ZGKA 5FYHA 4D6QA 3VDDB 1AJOA 1AHSA 4CUGA 4QB2A 1ZBE1 2EICA 4LORA 3FZ3A 5KXDA 1QHDA 2ZX3A 1UZVA 3T2TA 1AYN1 3ZFFC 1DFQA 1RITA 2W1WA 3D4KA 2ZAAA 3IPVA 2SBAA 4LLFA 1OXCA 5KHKA 4AI0A 4OUSA 4Y5Z0 4EJRA 2VG9A 1C1FA 4LTAA 4FOQA 4XJWA 2Y6FA 1R083 3MBWA 4QDQA 3FBYA 5LW9A 3J4UH 2XJRA 1LOFA 4XURA 1QU0A 2HWC1 4QPGC 4G3YC 4QQPA 4W4ZA 2PMWB 2ERFA 3CO2A 4O65A 2W46A 4KL1A 4MLOA 3T30A 1W8NA 2UURA 4K6BA 3WW2A 3M7AA 4ZKTB 2DVDA 2E51A 1LGCA 1ODNA 1WWYA 2JG8C 3USUB 3H8OA 3UK9A 1TEIA 3GF6A 1K45A 2W52A 5BNNA 1GOHA 3VBOB 1AR82 5HXMA 1UU6A 2VVDA 4CZSA 1PO11 3H8RA 4YZ1A 1OLRA 4YVSA 1FMD1 1RUF1 1E5SA 4CDQB 2JG8B 1OKQA 5FYVA 3ZXAC 2XVGA 1XJAA 4LA3A 1VBA1 1RUD2 5F3CA 2ADDA 1W6QB 1DG6A 2ZJCA 3FBMA 1ZBA2 1KFXL 4N43C 5JZGA 4W6YA 1BBT3 4DZGA 4URAA 5J48A 1DF0A 2GNMA 1HB3A 1OKOA 1NY71 2QNKA 5DAPA 4I0AA 3ZYRA 1XE8A 4FPGA 2V4VA 5FRAA 1SMVA 2K9ZA 3WNMA 1N3OA 2HWE1 3CQOA 5EWSA 1W8HA 1WKYA 2ORZA 1ZRFA 5E88A 4LJHA 1UY0A 4YGBA 4LK6A 3FWEA 4D0QA 1NLRA 3H9AA 3I4IA 5BNOB 1GBGA 4TLGA 5I8TA 1OF3A 2Y0OA 3BN6A 1H8TA 2Q5TA 4AAPA 3ZXGA 1Z0HA 1TME2 5CNAA 5FWEA 4WVMA 3VBFA 5L9BA 1GP5A 4HVOA 3QACA 4Q0VA 4CCCA 3AFGA 1G9BA 4LT5A 3GZUC 4BQYA 1WGPA 5CFDA 2BOJA 2RS52 1VLNA 2V73A 1JYXA 3BGAA 5DG1A 3POBA 1WA4A 3GHMA 3UETA 4FQ4A 1WW6A 2TUNA 2Q1ZB 4NHXA 1JTZX 3M8LA 3UGHA 1KS5A 1OQEA 2EVXA 3T4VA 4XC9A 2WRAA 3U37A 3MUZ1 1RUI2 5J1XA 1V9U2 3VD3A 3E5QA 1HRV1 1M4WA 2ES3A 4IEPA 3J8F2 4JKKA 1I6XA 1Z7S2 1LB2A 4HLTA 5AVPA 3FHAA 3KGLA 1TQ5A 2WQ8A 3VD7A 4MGSA 3SXWA 1A8MA 1V6IA 4QX1A 2ZGQA 2ZHNA 1X9PA 2R1BA 1WCSA 3ME2A 3MFAA 4AVSA 3KHCA 4LIUA 5BUVA 1UZYA 1VR3A 2IXIA 2VJXA 5GLWA 3S7IA 2VMEA 4IEXA 1N47A 1OLME 1VRBA 4QMAA 3ZN6B 4P00B 4AGVA 4C0BA 4DFSA 4EN0A 2I74A 2WZR3 2R16A 2BU9A 1EPWA 3CU7A 4KNCA 4S2GA 1D2SA 3VKFC 4AQ6A 5A3MA 4A2UA 4XJZA 5I0UA 2JEMA 1W6NA 5FMOL 3HMYA 2JIJA 3GZTB 3I3EA 4RR3B 3H7YA 4BQXA 3TAYA 1JOJA 1YIPA 4AQTA 2IFWA 4QPIA 4AYUA 3O1PA 3POIA 3AXEA 5HV4A 3N7MA 4H3WA 3A0NA 4Z1VA 2WR9A 2XKOA 4PQ9A 2X8KA 2DWRA 3FC0A 4DXZA 1BEV1 3GXUA 1TNFA 4QGMA 3RSJA 1SFPA 4Y20A 4YFZA 1FV3A 1YQ2A 2BNNA 3WXPA 3DGTA 1F8VA 5ANQA 1H4GA 2O1QA 4I2OA 1XXNA 5FKBA 3USSA 2QFEA 4K40A 4COVA 2YB7A 4MGYE 1J84A 3H1WA 3ZYIB 1VAVA 3N9OA 2A3XA 1YIFA 2G1MA 3PLQA 5FY0A 4XMAA 2ATFA 4V2VA 3H50A 5FQ0B 4AQSA 4UBGA 4JCKA 5A7WA 5AFEA 4K7JA 5LA9A 4OMDA 1HQLA 3PUQA 1OVPA 1QOSA 2MEV1 2E31A 1RHI2 1SDWA 4ZS3A 5JOZA 3THDA 5JSOA 2Q0AA 1XPWA 1QJZA 2VMCA 4JTNA 1V6JA 2PAMA 4UFLA 3VL9A 4ZZ8A 4NIIA 2ARBA 5CG8A 4QQOA 1RUJ2 2DTYA 5GZCA 1D0HA 5I0RA 3UGGA 1WBLA 3AMPA 1DZQA 4N9HA 3APBA 2V72A 1X8EA 2LUWA 5FZKA 4LKEA 2MEV3 2XOMA 1AYN2 3C7FA 3OBAA 4MGZE 2Y26A 2VAUA 2R043 3ACFA 2PQSA 2X09A 1UU4A 1QMJA 1UY4A 1C8M2 1NE6A 5FYYA 3AZYA 3O0XA 3FLRA 5JOWA 4NPRA 3OG2A 4QB6A 2VO5A 2B46X 1O4ZA 1FI2A 1W0NA 3CKHA 5F2WA 3TBDA 3AM2A 4E4ZA 2ZCWA 5FY9A 2HEYF 5FXWA 3FFQA 4I0BA 1RUD1 4MGIE 1RB8G 3TEZA 1REFA 2EXIA 3JBG2 1S55A 3VZNA 3NNMA 5GKAC 3HQRA 3WINE 3MIHA 3RWNA 1ZM1A 5CBLA 5DXDA 3WEZA 3ZMOA 4Q4W1 2O14A 4HBNA 1BCXA 1UKRA 1R1A3 4M00A 4HN0A 2ET7A 4LBQB 4XW3A 4BK5A 2OUHA 4RQPB 2CL2A 3I2JA 5A7NA 2QQOA 4IEZA 3G7DA 2G4IA 4FOVA 4R9AA 1UX6A 1ZRCA 2V09A 3DV8A 2HBTA 5C8WA 1RHI1 1VBA2 3E1F1 4AHYA 4GMP1 1RYYA 1XNKA 5IWFA 4CPBA 4DIQA 1GOFA 5A3WA 2XLGA 3I3QA 4XTPA 1JMUB 4NIGA 1U5ZA 5A70A 1UOGA 3JB8A 5CADA 2A6ZA 3IMNA 2HKXA 1GR3A 1DYPA 3MI8A 5F5CA 4ZU7A 1UL9A 2VMGA 4Z07A 4XBNA 1C28A 4ZXKA 3RNSA 4XFBA 1WLTA 1PVC2 1CPNA 4Q8LA 4FBFA 3O1SA 4QPIB 3MHZA 2D6KA 3OEBA 2D7FA 4RR3A 1U5XA 5IATA 2KA3A 5FPXA 4GWNA 4NWVA 4IEWA 1W6NB 4DRRA 1BVVA 2J42A 1QY4A 5C5TA 2QZ3A 1RUE3 2J1VA 5IW0A 1XNBA 2WDBA 1VBC3 3LQCA 4FXGB 4WVWA 3RYKA 2OQ7A 2WO1A 3CJIA 3K3NA 3KZ4C 1ZA4A 2BERA 4KGQA 5FXXA 1NA1A 1T2XA 2CDOA 1GWKA 2W39A 3D8CA 4NMIA 5FZIA 5FLHA 3ZN6A 5L19A 4OULA 3VKNA 4Y20B 1OHFA 4INDA 4JRLA 2DU1A 4YG0A 3M2MA 3RVHA 1OPOA 3PURA 4RYDA 4IUGA 1IS3A 4QXBA 4EN8B 3OBRA 1A6CA 2FDKA 4NRPA 1W6PB 1LHWA 1W04A 4Y1YA 1REDA 4D6SA 1CD3G 1CAWA 1XE0A 1JW6A 1Y4WA 3C7EA 3NNJA 2DCYA 5FLIA 5LB6A 1OH4A 3DYOA 3HBZA 1OA3A 4YM0A 3T0BA 2LS6A 5I91A 5JDBA 5FMCA 3S0MA 1AUYA 1WMXA 1B09A 4PI2A 2WZEA 5E8AA 2ZPXA 3AMMA 1ND3C 2WLQA 4N9IA 2RDQA 3ZSMA 3NV4A 3ZYBA 4HSJA 3DF0A 2A6YA 5DABA 5H9SA 1ONAA 2CGNA 2LM3A 3V56A 1UQXA 5TSWA 5ABJC 2Y34A 1H1IA 2XGXA 4CEYC 3N9QA 3KLSA 1VBB3 3NQHA 1DZTA 2RS53 4IGQA 4R9CA 4MHRA 4XTMA 4ZS2A 4E4SA 4BQWA 1BYHA 1F4HA 1RVF3 1XQNA 1KJRA 4EWEA 2VOVA 4IGOA 3M3CA 2QZ2A 4EWAA 3RZLA 3AVRA 4WM7C 5AC91 3UJQA 2RS51 2MNGA 3ZXKA 1VBB1 4IL7A 1FT9A 4BJ0A 3JD71 5A6XA 1PO13 2ZHLA 3KQRA 3SISA 4E4HA 2WT1A 4YM1A 2VNOA 2ZABA 4K21A 1GNHA 1A8DA 3ILFA 3IMMA 5FP4A 1TMF3 2PHUA 3SH3A 1ZX5A 1UYPA 4ITCA 5JR7B 3OOXA 2JDKA 3K3OA 2HWF2 5FZ4A 5LBEA 1UYZA 4LBQD 3SMHA 1IPSA 4Y1VA 1CVNA 1YFWA 5LBBA 4LLOA 4KGGA 3CDZB 2BZDA 1G9CA 1UIJA 3CJXA 3MGUA 2VBBA 3HT2A 4WVMB 4XYXA 2O8OA 3VBFB 3WG2A 2Z69A 4ASLA 3LZZA 5FYUA 1UX7A 1DLCA 4QX7A 2E63A 5A3NA 4XZUG 4Q5OA 5BNOA 1N1TA 1GWMA 3IB3A 2JD9A 1QXRA 1W2NA 2VL4A 2A71A 2ADEA 5FUNA 1S0CA 3VBOA 4UFJA 2ZKNA 3I2IA 4BQ1A 4Q0PA 1ZBE3 4LR4A 1LCLA 2OA2A 4GA9A 2NYYA 4DY3A 5DUWA 5C71A 3EO6A 1JZ8A 2ET1A 2RR12 1VB4A 5KHIA 3JU9A 4QPIC 4LQRA 4FPJA 1VBC1 3PNAA 5GZFA 3AYCA 4Q29A 4QKNA 3ACIA 2F17A 2GN7A 1FOD3 1PK6C 2LRPA 3DPRB 2VNRA 1IQDC 1BKZA 3EHKA 4JGYB 3I2OA 3HEIA 3MPBA 1GQPA 4P5HA 3QBQA 4Q1PA 1QJX2 1YI9A 5JI7A 4DINB 1JZ6A 2YC0A 4X8NA 4BU2A 3U4SA 4S2DA 3SKJE 1W9YA 4QM8A 4NIDA 4IE4A 5D8AB 4PDWA 4A7ZA 4CU8A 2PYTA 1YFUA 5FIXA 3VD4A 3TRSB 4OZOA 4KWLA 1NCQC 1QH6A 1WLDA 4WZFA 4PHZA 4LITA 2DCJA 2BRTA 4BWOA 1POQA 1GNZA 4QKFA 3S5QA 5BNNB 4ONUA 1POV1 1ULFA 3MIDA 4BA6A 1GQHA 2ID4A 4BQ2A 1R092 3THTA 4QKDA 4YZ3A 2A6VA 3LGRA 1OPMA 4JAAA 4WM7B 1RUJ3 3WCSA 4L92A 2CYFA 2W9XA 3I59B 3P1IA 1POV3 5A3PA 2Y33A 2R30A 2W68A 4Q4W3 4XF1A 2JDPA 1PX4A 1ZZ8A 4K20A 2RMU3 2SLIA 3MPPG 1UZWA 3AKQA 1ULPA 1X33A 2ZGOA 1ND2B 3RZKA 2WZR2 3MF9A 3MIGA 2XONA 3KWVA 3POEA 1N3QA 5DQ0A 5JR2A 3RPQA 5FMBA 3PTRB 4YYOA 3J7MA 3KV4A 5IK4A 4CA9A 4XVHA 2VM9A 3SEEA 2P2KA 3AL6A 4PIZA 1PM4A 1YQ6A 5A32A 4EWDA 5C3SA 2PA7A 2BNOA 1FYUA 5FKCA 2BEOA 1HRV3 4KG8A 2RV9A 2UWCA 3I97A 1URXA 2ARXA 3DXUA 4AZZA 4Z92B 4W50A 1HV1A 4LO8A 5H9RA 1RUH2 2VMIA 3WF2A 3MIFA 1G9AA 4IESA 3RWKX 2BBAA 1LOGA 1H8VA 3LDRA 2K2SA 5HXVA 1YFYA 3EB7A 1CN1A 1PO22 3O5SA 1HN0A 4GZ9A 1ZYBA 3WG4A 4CU6A 1QGLA 1WUVA 4YW3A 4N43A 5F2SA 3QOPA 1VALA 1RL3A 1UOBA 3UL2A 1RC6A 4RFT0 5FUPA 3IDBB 4LBOA 4OVEA 5GZGA 3ZMNA 2UU8A 1GP6A 2P4EA 1ENSA 2YBSA 4MVTA 1PO21 4UW5A 4A3XA 4KWKA 1XBFA 3OGSA 3QD6A 1XOYA 4OCTA 4P08A 4PIYA 4IXLA 1HW5A 3T09A 5JI9A 3J7NA 2QQLA 1BJQA 4NHLA 3NO8A 3O12A 4LMFA 3I2GA 1CPMA 5FK8A 1AJKA 2HWE2 2DCTA 2BGCA 4XJ8A 4NRMA 3SHRA 4XUPA 1OFSA 5CFCC 5BNNC 2H6BA 4Q4Y1 5F9TA 5A7SA 1PNFA 1AXKA 5FYCA 2VCAA 3VGIA 4ET7A 2E7AA 4QHZA 1SFYA 2ZGTA 3U0ZA 4XMIA 2E53A 4N90A 1BBT1 4RD7A 3M70A 2HLEA 4G4FA 2A1XA 3INAA 3JD73 3PVOA 3O1OA 1LOCA 2JX9A 1XSQA 1BEV3 1WW7A 3ZDVA 4GALA 4MSVA 4DB5A 4CCEA 2DBIA 5CEHA 1UD1A 3AKPA 4A6OA 4YSFA 3OUJA 2VOKA 1RVF1 4LO7A 4Q0SA 4MH0E 1UXZA 2F4PA 5LEJA 1WD3A 1WCKA 2O0OA 5LY2A 4XXPA 2W92A 1O5UA 1NXMA 2Y6JA 2NP0A 3WG3A 1U12A 2D40A 1RUC3 4XF3A 5CKNA 1WA6X 1F4AA 3I3BA 4D69A 3N36A 2DVBA 1COV2 2VPVA 3EYPA 4HKOA 4NROA 5JAXA 4FAHA 1DLLA 2XQXA 5C4WB 3OSDA 1H6YA 2B45X 3L2HA 4FFGA 3O1MA 2W3JA 4IV1B 4MO3M 4CEWA 4LO5B 1OF4A 4GJZA 2I45A 4Y4YA 5BXXA 1XYNA 4QHBA 3R4UA 1K5JA 3AZWA 1QOTA 4UW6A 3VBUC 1V00A 1Q3EA 3BIEA 5CU1A 4U36A 2Y0IA 3BPSA 4UAPA 5FZGA 1GFF2 1J1TA 2LW8A 4K1YA 3VL8A 3ZKYA 1HRI3 4C8DA 1MS5A 1FNZA 1Y9MA 5FYIA 2JICA 1UNBA 4IV3B 1KDMA 5LATA 3IM0A 4JC1A 3K4ZA 4UF0A 4YW5A 4URTA 3JUUA 2Z4FA 2WS91 4FXKB 2Y8KA 1S0EA 2IUWA 4Y1XA 2GSYA 4B3NA 4GH4A 1I5ZA 5J3UA 2D3RA 4OHXA 2XLAA 3GYDA 3O7OA 3U78A 2JDNA 2VULA 5LBCA 2Q4SA 3O14A 3WF0A 4OMCA 4P9IA 1DQ4A 1DQ6A 4COYA 1JZ3A 1MVQA 3D6EA 3WCRA 3MDPA 2DVFA 1YXWA 1SPPA 5JXGA 2PHRA 2WFPA 4XEZA 5EJZB 1OLQA 5M0TA 3AYEA 1X50A 4NAMA 3E5UA 3O1TA 3WQ7A 3R0RA 1NCQA 3T2PA 5ACA1 2D6PA 4ZU4A 1LHVA 2OT7A 3CBNA 3JQXA 3O0WA 4AEJA 3B02A 1RINA 4MV2A 4CCDA 4IDZA 2J7MA 2C6SA 3V64A 2QDRA 1G9FA 1N1YA 2KM2A 2IXJA 4GD4A 3LF7A 3FUQA 1GNYA 5C5UA 3C7HA 1RHI3 5FV3A 1PGSA 5JXJA 2WA3A 1XNAA 3UKTA 3NV1A 4M3CE 5IVFA 1VRH3 5LA1A 1D4M2 1ULEA 3EMRA 4QDRA 2YUEA 1ZNPA 4W65A 4XHXA 4Y33A 1R1A1 3ON7A 4DXTA 2EAAA 4YM2A 2XQRA 1WMDA 3ZFGB 2XJUA 1NLSA 1BMV1 1AR91 2HWB1 1QEXA 3AZVA 3DEMA 1OMIA 4HVRA 1KQRA 1MZEA 2W47A 3C8XA 3KV9A 4O9EA 4R4XA 4YW7A 5BNOC 4B4RA 5K0UA 5FZ8A 1Q8OA 1OOPC 4DUVA 5LRSA 3G6JB 4CUCA 3WDUA 2NMOA 4MUVA 4MXWB 2B4KA 5JSPA 5K8SA 1L7QA 3I3DA 4N53B 4Q4V1 4XJAA 3O1VA 3DKWA 3U11A 5JZGC 2GALA 5JXIA 5F5AA 4M01A 4QQLA 1AZDA 1XU1A 5FQ0A 2UWBA 1IGOA 3ZSKA 3VDBA 4IEOA 5L73A 2BP6A 2F6BA 2WLPA 4KU8A 2NPIA 2B9VA 3HR9A 4RGGA 5DZEA 4YW4A 3E6CC 3P5BA 1ENRA 1KS4A 3LDBA 4L97A 3WQBA 2D5FA 4UFKA 4OQ8A 2Y6KA 2GAUA 1VRH1 3LIHA 4XDOA 1MEC3 4BQ3A 3F2ZA 2B7YA 4XJ9A 4CDQC 3CHXA 4FP2A 3ZYGA 3ZOIA 2OZJA 1AXZA 4META 1GV9A 4P9JA 4AI1A 4BLIA 2J1RA 3LKJA 2XBO1 3MUY1 3IZOA 5IVYA 5F5QA 4JHTA 4HONA 4C0HA 2FQPA 1UY2A 2H0VA 2WFF3 4BPZA 1X9TA 2VE1A 1OQDA 3AZZA 3PVEA 1OFNA 1S0DA 2ZHKA 3ES4A 1DGRA 3SCFA 4XFAA 2HWF1 4AEMA 3U07A 2VY0A 4N7IA 3B5LB 2YMZA 4NIAA 3JCIA 1ASJ2 3LE0A 4N7UA 3MYXA 4GKYA 2IVIB 3AB0A 1Y3TA 2GMPA 3CEWA 1VMFA 4NR1A 4AEDB 1PVC3 5FP7A 4FT8A 1KEXA 3VKLA 5LK7B 1BLZA 1EUUA 1RJ8A 1SQ4A 3E6BA 3IBMA 3DL3A 2BPA2 3ZN4A 3ZDSA 1DQ1A 1EV13 2CHHA 2OS2A 2W1UA 5IVEA 1HRV2 4I0WB 3VKOA 5C8CC 2GNBA 1DZRA 1OA2A 3OBZA 4AF9A 1HB1A 2WO3A 1C5HA 4NE9A 1QJEA 1YHFA 4QXCA 3J26N 3GHNA 2W0XA 1EP0A 2VQ0A 4HKLA 1UW8A 4QXKA 1O91A 2ETEA 1W39A 2QVSB 4QQ2A 5KWRA 3WX5A 1JODA 5CG9A 1VP6A 1YO8A 3THCA 4YVWA 3VBHA 2X53S 2ZGNA 5SV8A 1DDLA 3VHOA 3D3AA 4JRAA 5FZHA 3WT3A 3FUOA 3KT4A 3CJIC 3MW4A 2Q1FA 4XZPA 4AVTA 4N53C 4CDXC 1GUIA 2ZMKA 3MO4A 1F35A 2XVKA 4RQPC 4JGZB 4XE9A 4CXYA 5JVVA 3O1UA 4QGNA 5KR7A 3B93A 5FZBA 4RR3C 1W6QA 3NNFA 4LK7A 4XJUA 1DU3D 1D0GA 2GDFA 3IDCB 3KT1A 1MS3A 2DV9A 2QBXA 3OB8A 3Q8CA 3M3EA 3PUAA 2GU9A 1F31A 2BWCA 1Y43B 4A41A 1H8TB 2PHWA 4RHV3 2TBVA 3I3MA 3KVAA 5EP9A 3S7EA 1N1SA 2X10A 4KH9A 1I3HA 2XL7A 2ZGRA 1LHNA 2YHJA 3CF6E 2QQVA 4MYEA 4O61A 2L9LA 4CCOA 5FY1A 1IS4A 3ASIA 3GJBA 4FPHA 5FPAA 2HBUA 2WBKA 3ZXFA 1WD4A 3I2HA 5GLTA 2GH2A 2VUJA 5D8AC 1SBEA 2GP5A 3LPFA 1VBE3 1E57A 2BQPA 3KQ4B 3RRDA 1N1VA 4A6SA 2IFRA 1ND2C 3C2UA 2ZX0A 3WD5A 4EV0A 1L7LA 4HOOA 4OI0A 5C33A 2WO2A 4IEYA 3GBWA 2QQJA 4JGYC 4NHYA 4BDVB 4OHYA 1AL0G 4NHKA 5D21A 3T08A 2IXKA 3J7LA 4BIFA 5IFPA 5GJ6A 5EPAA 3V0BB 4LIVA 1UZZA 1V9U1 1TMF2 1VBC2 3OEAA 2OKXA 3VZOA 4CDQA 1F2NA 1C5IA 3EXUA 4LBQA 1KXGA 2WFF1 4GWIA 1H2NA 4HXCA 3WF3A 5A6QA 3SH4A 5JMCA 3N7JA 3KM5A 1PO23 1D7PM 2DUOA 3CIHA 4YG3A 5BNQA 1VE0A 1K3IA 4C1XA 2GNDA 2XJVA 4R9DA 1JYVA 2OZ6A 4UXAA 3WDWA 3P3PA 5FPVA 5BV6A 1UY3A 2RM21 1D4M1 3IAPA 5DUVA 2FDFA 4TYSA 3D82A 1ZREA 4XXAA 5G04L 2RDNA 3ILNA 1A78A 1B35A 1LR5A 5BYNA 4BYYA 2DTWA 3DUIA 4KI5M 3J7HA 2FDGA 2JG9A 3FLTA 4D3WA 5A3TA 4MGQA 1I1EA 1ACCA 2VZUA 1NZCA 1PIV2 3UGFA 1QQP1 1MQTC 4ASKA 2A7AA 1T6BX 4QDSA 5ERLA 3N7KA 3SCHA 5K0UC 1RUI3 2JB4A 1CAXA 5FTTC 3IPVB 4XUOA 5A3UA 5EQUA 2P17A 1QJY3 4AVVA 4ZU5A 1ASJ1 1V0AA 5CZKA 1VJ2A 3TYJA 5IK8A 5B2GB 1ENXA 3VD9A 1WZXA 3WUDA 4YRDA 4FQZA 4V2WA 2UY8A 2W2IA 1BK0A 1CIWA 2VW0A 1JS9A 3I8TA 4P9GA 1RUOA 2AEYA 2FZ1A 2A73B 1OC1A 4O7XA 2JE8A 4ARYA 3ZFEA 3DYMA 1PO12 4FFFA 3AKSA 2XLFA 3OPWA 4WM8B 5FBJA 4TWTA 3VB9A 3HQUA 4UFMA 2RJKA 3H3UA 5FYBA 4NIHA 3LA3A 4CCJA 5JOXA 3JD72 5C4WA 1COV3 1NCRA 1ULOA 3VBRB 4DY5A 1VBB2 3LEMA 2BFUL 2BVBA 4AI3A 4L2NA 1H9WA 2Q8EA 4DNYA 2VMDA 3QLQA 5IYYA 2OPKA 1UAIA 2IC1A 4BH9A 1UMZA 2E33A 3HBKA 4MADA 3OGJA 5CISA 1W8FA 2QQIA 2OVUA 2ZHMA 2OIIA 3WW1A 2DU0A 2RMU2 3MEPA 3MLLA 5JIAA 5B4XA 1AR73 2PLV2 5FOBB 4ZONA 5L7OC 4QPYA 1O8PA 1O3RA 3DECA 1K5MC 3SC7X 2ZZQA 3T4HB 4MHUA 2OW4A 1UOFA 1W8TA 2EAKA 3VBSA 3POWA 1MPXA 2VXJA 4FI9A 2R32A 4CDUC 2XHKA 4MGKE 2OUJA 3K4DA 1NE4A 3MW2A 4XF0A 1RUG3 5KXEA 3KCYA 2ZS6B 2J1AA 4CDUA 2WIIB 3LPGA 4LBMA 5CKQA 3JZVA 4LPLA 4MZUA 4WBBA 1SEFA 2JDHA 2B42B 4BMEA 1MQTB 2G9FA 2VOXA 1K5MA 2WS93 2VMHA 4GIQA 4QU1A 4NPLA 1LOEA 1OA4A 1FMD2 1RUF2 1UU5A 1ST8A 2XXZA 2P3KA 4HZFA 4F3JA 3NJVA 1ENQA 3T3YA 3OGRA 1H2LA 1HB2A 3O0VA 4XABA 3IN9A 5FY7A 4WV8A 4AW7A 4GMP0 4KQ7A 1IPKA 1UKGA 2JENA 1DP0A 3OY8A 5J98B 1QJU3 5JSRA 1HXS1 5C3PA 1C57A 3HIFA 4AVCA 1OQ1A 4A4AA 5EJ3A 2EXJA 2R042 3ALQA 1NCRC 4LUKA 2WFF2 5C4WC 3VUOA 3H8XA 3KF5A 1QJX3 3DXTA 2HWD3 4JKMA 4Y1ZA 3RZMA 2GC1A 4M3CF 5JUVA 1ASJ3 1W90A 2WWJA 1H4HA 1OSGA 1QIQA 2VNVA 1TVGA 3BI3A 1BK1A 2C4XA 3AVSA 1JZ5A 2OXBA 1WCUA 2YC4A 3TEWA 4K3UA 2JG9C 1BEV2 4E27A 4XCAA 5CFCA 2RS33 4E2SA 3LDKA 1EV12 4YGEA 1ZZ9A 1WBFA 4AAXA 2FMDA 2HWC2 2ZGLA 3FX3A 3ZIWA 1HJFA 4Q4X1 2VZ3A 3VV1A 3ZX7A 2WSVA 1JXNA 1IS5A 2PTMA 4DRVA 3ZM8A 4XDPA 4OHVA 1IOAA 1D4M3 1G6NA 2QTWB 1S2EA 3BU7A 5C8CB 3AMNA 3R6SA 4ES9A 4XETA 5C3RA 4Q4Y3 3B01A 1JYTA 2JKXA 1XNDA 3J9SA 3QH6A 4LO6B 4BK4A 4DXRA 2W87A 4UWDA 3T2QA 4AXOA 5JZGB 3RZGA 1B35C 2D93A 2ZEZA 3JBG1 4XF4A 5A7QA 3WUCA 1KITA 4GXLA 5GM0A 5FBZA 5F6LB 3ZIXA 4AHXA 1CONA 4OYUA 4QX5A 1QNYA 5H9QA 4E2QA 1VB2A 4TZDA 2JG8A 2EF6A 5FZ0A 1PVXA 3WQ0A 1GP4A 1UWWA 4UYBA 2BDRA 1MS8A 1BHGA 1RGSA 1IKPA 5DN2A 4L0PA 5D8AA 2ILMA 3H1YA 3E5XA 5A1LA 4HL0A 2VQAA 3J8F1 2MPFA 3OTFA 2OYZA 3RJRA 5L7OB 5IFTA 1XRUA 2GZWA 3RFRA 4OQ9A 2W1QA 4YW6A 5A80A 4Y5SA 3WSOA 4JGYA 1MEC2 1NLQA 1W0OA 3LOBA 1V6LA 4D6RA 5K7PA 2Y6HA 4Q4V2 1UYXA 3H3ZA 3ZFFA 2J1UA 2P6HA 4AFAA 4FTSA 3RMYA 2WNVB 4U2AA 1W06A 1CAXB 1C1LA 1W0PA 1Z78A 1Z7S3 4QPGB 5CIRA 4QQHA 4CP0A 4DUXA 2ARCA 4K8RB 4PLNA 2QQUA 4AEDC 2IZWA 3NJXA 5EFUA 1QJX1 2VTXA 4YFWA 5CYYA 2YBPA 3ZSEA 2X5IB 2XWBB 1FPN2 1MS4A 4M4RA 1CZVA 1QJU1 2Y60A 1NAEA 3IKWA 4FAGA 2GC3A 1LKNA 4GMP3 1YFXA 1OLMA 1PZ8A 5F3GA 3ZPOA 1CR7A 5GALA 1ZRDA 2ZGMA 1IQAA 2KR2A 5I0TA 3F95A 2QDNA 2WNUA 3TN92 1RUC2 1JU3A 4GJYA 3AYAA 4PLMA 4OI2A 2PHLA 3ETPA 1ZRIA 1KDKA 3PTYA 1IG3A 2WAAA 5GZEA 2X5IC 3UKVA 3LAGA 1GQGA 2LROA 1WCDJ 1XU2A 5DAVA 4CDWC 1YEWA 4HT1T 1G9DA 1EUTA 2PHXA 4CDXA 2VZRA 3E97A 3THPA 4HPKB 2VBDA 1DIWA 3K48A 3VZLA 2E32A 2QQWA 3RYRA 4LE4A 5T5PA 3KD4A 1JUHA 3N4MA 1PK6A 4YVWC 2UY9A 3D0SA 3VBHC 3WVJA 1DYOA 4ARXA 1YC61 4ZHNA 4Q2FA 2A3WA 1US2A 2E26A 1LHUA 3HN1A 3BU0A 2RS13 1CJPA 2YC2A 1JOBA 3B00A 1GSLA 4CP9A 4H55A 1HQWA 3D0JA 1QNWA 3JXSA 3NAPA 3T0DA 1S0JA 4FPFA 1W6MB 2R061 4B29A 3ZSJA 2HWF3 2WZ8A 3OJBA 5JPMB 3FN9A 3H0OA 4Q4X2 2RE9A 2XJPA 3AC0A 3WF4A 2CAVA 4D8MA 5EV7A 3WP4A 3AKRA 3PUSA 3RZZA 3OUIA 5BNPB 1OURA 1PZ9A 4HK8A 3HOBA 5JWPA 2XBO3 3IWZA 1YI7A 2HH9A 3K2OA 4YW1A 4NO4A 2D6OX 4OUEA 5FJKA 1MS9A 1N3PA 5EZWA 5FZCA 2BV4A 3VBOC 3WW3A 4BIOA 4LA2A 5KC6A 2WNVC 2XUMA 5ISLA 4YZ4A 2WNOA 5FJHA 3AP7A 3I2FA 5FYMA 4JQTA 3LFMA 5EXOA 4UBHA 4LHLA 1Q8PA 2ZX1A 3SKVA 3IIAA 1LECA 2D44A 2A75A 2I07B 2VZ1A 4YM3A 4YVWB 3VBHB 3BTZA 1NA1B 4OHWA 1JN2P 3ZXJA 3SCGA 1LAJA 1C4RA 4AWDA 4CCLA 1CAVB 3LB9A 4M3CB 2RVAA 4GULA 5A33B 4FO9A 3FE5A 4R9BA 4X6QB 4EQVA 3WZ1A 4ZZ5A 1UPIA 3ZYJB 3GDBA 5JOYA 1Q56A 1REEA 1OOPB 2W1SA 4XFGA 3RMXA 5KXCA 4I3GA 1FNYA 2AUYA 1G86A 1HIXA 1WW4A 2J1TA 2XJQA 3LEIA 3GBGA 1QQP2 3ATGA 4PF1A 5GLZA 5AC93 1LOAA 1WW5A 4EN6B 2D98A 4OI4A 3W21A 1UOJA 1AR93 5JLVA 1H30A 3AK0A 3PUIA
chains in the Genus database with same CATH topology
1PZ7A 1ZBA3 2DVAA 4PCRA 3HQXA 2AENA 3NKGA 4FOYA 4HSLA 4RS5B 4CEYA 5HCAA 3MIBA 4LNVA 1EAH1 1LGNA 4LBNA 3KSCA 2PFWA 2WINB 5FCCA 2FMYA 1QJU2 1MZ5A 3OPZA 2NZ9A 4LEJA 4YZ5A 5IK5A 3M1HA 1HX6A 3GZAA 4CDWA 1LU2A 4HMZA 5IUQA 3KCXA 3AMHA 2X5IA 1JH5A 4FVVA 1CJDA 1LEDA 4FCAA 1RUE2 5I8YA 1UIKA 4GWMA 3BIWE 4FPKA 3BOWA 4YLZA 1ULGA 1R1ZA 3AJZA 2VXRA 1O3SA 4XBQA 2IXCA 2ZGPA 4B7KA 3I7DA 5KXBA 1JYIA 2D6MA 5K0UB 1XYPA 4C1WA 1HLCA 3POYA 1J59A 1MVEA 4ES8A 2BUKA 2X29A 2ZBJA 4DOUA 3VN4A 1HQNA 4YGCA 2AYHA 1VBD3 4TSVA 4CEWC 2WT0A 1HXS2 4Y22B 3H8UA 3ZN5A 4OLLA 2AR6A 3WP5A 3ETQA 4CP2A 2QQPA 4DPNA 4GB33 1AYM1 1QDCA 5FREA 2AGSA 1DQ0A 1S0IA 3VBUA 3WDVA 1O7FA 4TLFA 2G9GA 1ZBA1 5FLJA 4LULA 4ATEA 4QT6A 1QXPA 5DG2A 1O3TA 3SLIA 1GZCA 2WS92 4LO4B 4QM9A 1EV11 1LEMA 3NV3A 3AMQA 1PIV3 1FMD3 1RUF3 4RHV2 1LHOA 1PVC1 4X6RB 1ZZ7A 2YY1A 2P3JA 2BNMA 2PQQA 4JDNA 1S0BA 5CFCB 4UW3A 3ILRA 3RDIA 4R52A 1FX5A 2D5HA 2VOWA 3ENRA 4JV4A 1SACA 5D1IA 2FZ2A 3KT7A 5HCBA 2HWC3 2Q30A 4PBOA 3AP6A 2A6WA 3U10A 1RTVA 1R081 5LRRA 1AL23 4AFDA 2IXHA 1SBDA 4F8AA 4PLOA 2H6CA 1DQ5A 5GZDA 1W2UA 3L2YA 4AG4A 1KRIA 4PF5A 2WJSA 2RS32 2ZGSA 3ZXDA 3OY8B 3WP3A 1VBE2 3I54A 4SLIA 5T50A 2BVVA 2CGOA 3TOJA 4JVAA 2CY6A 3VZMA 1FXZA 3AKTA 3MIEA 1Q5OA 1AR72 2PLV3 4P9XA 3T1MA 4J1WA 5CFDB 1RUNA 2XJTA 4CDUB 4H14A 2Z5WA 4A7YA 4RSUA 3OD4A 3AXDA 4E9KA 2HWB3 3RG0A 1NQJA 1PHMA 2Z42A 4OZXA 2BWAA 3ACLA 2DCZA 3URFA 2ZZJA 2WZPP 3ES1A 1AR62 1PM7A 1GYKA 1QJY2 1SCSA 4L8QA 4LUMA 3RJ2X 2D6LX 5J7MA 1DBNA 2B8MA 1GICA 5BNPC 2E6VA 4GB31 3K51A 3PJYA 5FO9B 2WZR1 2Q1MA 1ND3B 1V6MA 1MR5A 1H9PA 1HV0A 1AX2A 1J58A 1WMEA 2XL9A 4C90A 5GLVA 5E89A 1SLCA 4V1PA 3R4SA 3R4DB 1VBD1 2YXSA 1UCXA 4HPKA 2NQYA 1H0BA 2EXKA 1S1AA 1CESA 1IPJA 4IV3C 5BY5A 4XHBA 1R091 4RL7A 4W6XA 5FO7B 5BNPA 4K8FA 2VVEA 4BM8A 2PN5A 4RS5C 2XJSA 2PAKA 2WQ4A 3VHNA 1FPN3 3ELNA 1BXHA 3USUA 2ZX2A 4I30A 3ST7A 1H8TC 1V6OA 3MLKA 2IWGB 1MS0A 2ZGUA 1VAMA 5T52A 4QD2A 4LHKA 1Q8QA 3WR0A 4XIKA 1J3PA 5C9AB 5JIUA 3TNPB 4LBKA 5CFDC 3OD0A 3LOIA 4GQ7A 1WLWA 3WNXA 2JJ6A 4XBLA 3VBFC 4FP3A 4YNIA 1VIWB 5AVAA 4J1XA 1X8MA 3M3QA 4OFGA 2RR11 2FBEA 4WM7A 1B35B 1NXD1 1BQPA 2GC2A 3UKNA 3AX4A 1YCIA 2HWE3 2HJIA 2WNUB 3JQWA 4LBLA 1S0FA 1TMF1 4H7MA 4OHZA 2JKBA 4XQ4A 1V70A 4YVSC 4GKXA 4HVQA 3B7MA 4Q4X3 4EN7B 3ZPYA 1ZRRA 1KJLA 5T54A 4B7EA 1J1LA 5CVRA 2PHDA 1ZVFA 4FTEA 2WNVA 4NVPA 2HWD2 2JECA 1LOFC 4A7KA 2YGLA 1ND3A 5GLUA 1AYM3 1C8NA 1LENA 1W6OB 5HCFA 4IETA 4W6WA 3AJYA 4O9GA 3VBRC 1HKDA 2GH8A 4F7ZA 1QWRA 4DQAA 3PHMA 2JE7A 5ABJA 1HXS3 3NAPC 2ZKLA 2PHTA 4E4DX 1NQDA 3FMGA 4P9YA 3TNQA 1DHKB 2BBVA 4HN1A 1XYOA 1GKBA 4WZCA 3ZYPA 3BODA 2B5HA 1YWKA 1S2BA 4BHPA 4BZ4A 1OI6A 2WWSA 5AC92 2VH9A 1F9KA 1QF3A 2P3IA 2WA4A 5HI0A 1MACA 2XKPA 1Y7BA 2ZACA 2C1FA 2YPJA 5IT6A 1EPZA 3KCCA 3JB4C 1RUG1 4AK3A 1CAUB 3WQ1A 4E2GA 1RUE1 4L9BA 2UYAA 2Q8OA 2R063 1JBCA 2ZOEB 4KG0A 3VZJA 4OI1A 2PHFA 4MX3A 2EALA 1NA1C 4R8HA 3V0AB 2RS12 1IZ3A 1SLAA 2A6XA 2WL1A 2CV6A 1AR83 4X8PA 2QJVA 2QE3A 1TE1B 4Z8BA 5K9YA 1UN1A 4CP1A 2DUPA 4FSJA 2LALA 2AZ5A 4AEDA 5I0SA 1RIRA 2Y38A 2YYOA 2WC2A 4IEUA 1MZ6A 3WLUA 4CYDA 2PELA 1OD5A 4FPYA 1GZWB 3CNAA 1NYWA 1COV1 2R0HA 4YARA 1ULDA 5HBAA 4IQPA 1BBT2 4XF9A 3VLBB 3VBSB 1LU1A 3MFCA 3N3HA 1LRHA 3AYDA 3MLJA 1VRH2 4Y26A 1CAWB 1VBD2 3POSA 1MS1A 2GNTA 1S0GA 1W6PA 4XIOA 5ACA2 4WVVA 4DS0A 1GZ9A 4J6GA 4COWA 1CGPA 3AZXA 1CAUA 2R072 1RUD3 2PAEA 4BMBA 5DUUA 4AHZA 5E1RA 2VUAA 2Z2SB 2PLV1 1Z7S1 2RM22 4XOGA 4D94A 1DGWX 2V5YA 1WLCA 3VBRA 3BPZA 5KHHA 1S2KA 5JPNB 3VBUB 1FOD1 1PGL2 2ZAHA 5JCTA 4D7TA 2YZ4A 1RUH3 5FMOS 1QKQA 3NJZA 2RJLA 4IEQA 3OYWA 4ISRA 2NMNA 2UYBA 3H7JA 5FPZA 4L99A 4MXWA 4HK9A 5L36A 1AR92 4S2HA 3TN93 3WHUA 2HEVF 1ULCA 4XQDA 4BLJA 2E7QA 2NM1A 4Y22A 1FATA 1W6OA 1AR63 2YGMA 1QH7A 4D7YA 1DGWA 4UW4A 3TB0A 1AL21 1C8M1 3ZFGA 5DZFA 4XFCA 5FDBA 2A5ZA 3DN7A 1NCRB 1APNA 2Z79A 1AL22 1V9U3 3LCPA 4LE3A 5KHJA 3MZHA 1JUIA 1JHNA 5DDJ2 3AP9A 2R0FA 4AFCA 3GBFA 3RI9A 4PBPA 2D97A 2VW2A 2R49A 2E7TA 2RS11 3HWJA 3S30A 3RYPA 4KWJA 4P9LA 1Q43A 4CDWB 2B39A 1PIV1 2VGDA 3LSEA 2JE9A 2RS31 2ZTNA 3NV2A 3IT8A 2XBO2 3EQEA 1SLTA 2DF7A 4Z82A 4IEVA 4DMIA 1LOBA 2ENRA 1HDKA 4ATFA 4AFBA 3WV6A 2GMEA 5T3NA 2YDEA 1AXYA 3IDEA 4RHV1 1IKQA 1BZWA 3MF6A 3V0BA 3VDDC 1SCRA 5KC5A 3NSTA 3B3QE 5C9AA 4XDQA 1TME1 2H0BA 5J09A 4M0HA 5T5OA 1PGW2 3E6DA 4RGAA 4RS5A 4AI2A 5JSPA 2HWB2 3GALA 3T1LA 5DZGA 5SV5A 3LA7A 3LSDA 3EBRA 1GANA 1TME3 1CX4A 3VBSC 1U0AA 4IV3A 1DGLA 2LTNA 2JD4A 2D3SA 3BCWA 3OGGA 4Z2WA 3A4UA 4GH4C 2IXLA 2TEPA 2CGPA 1XNCA 1U5YA 1GLHA 4F83A 1AF9A 3OF1A 1X7NA 2XB6C 1CQ9A 5FO8B 5IK7A 1ZBE2 4IV1A 2YV8A 2QUOA 4KU7A 3U4XA 1H1AA 2O8QA 3WW4A 1YJLA 3BALA 4BE3A 2D6NA 3AP4A 3NW4A 3X29B 4H7LA 1H1MA 2DURA 4JGZA 2BTVC 1KFUL 3BB6A 3L9JT 1BVP1 4Q26A 4ASMB 3ZFEC 5AFBA 4AEKA 3AFKA 4Q4Y2 4P9WA 2DCKA 3ZO0B 3JBG3 2EIGA 4AE2A 3VHPA 4XPVA 1C8M3 1LGBA 5LEKA 4XILA 4Q27A 4M3CA 1CAVA 4R4ZA 4XFFA 3ZXEA 1EAH3 1D2QA 2EA7A 5CAZA 1AR61 3WOGA 4AGGA 1W6MA 2I2SA 4I02A 4K1ZA 3NAPB 2JXAA 5T5LA 4JTOA 3B69A 3PMEA 3B9CA 4SBVA 1VBA3 4YZ2A 4Q4W2 1F5JA 1Y9QA 4D7SA 1RUH1 5H9PA 1D4VB 1A3KA 1SLIA 4HETA 1FAYA 1SLBA 1EYBA 3MICA 4FOWA 3SITA 1PGL1 5J96B 1R1A2 3VZKA 1RMU2 3W59A 4Q4V3 3WDXA 5J36A 3RS6A 1YYNA 4FPCA 5C6CA 2HWD1 2C0ZA 1PMIA 2P37A 3M3IA 4B4QA 4Y1UA 1UF2C 1KD7A 1YUDA 2A3YA 3N35A 5EYYA 4Q0QA 2GMMA 2R041 2R1DA 2C5DA 1AX0A 3MW3A 1PNGA 3PMSA 4JQRA 1ZZBA 1AX1A 4AVBA 4LHNA 4BCUA 3LWCA 2DVGA 2DFCA 1NY72 4AFMA 4COZA 1ZZ6A 4Q0UA 2CTVA 3QH7A 3ROUA 1YRZA 1NG0A 3BTAA 4LBJA 1ND2A 1R082 5I93A 5EYXA 1PK6B 1AYN3 1LESA 1TNRA 4KBBA 1YJKA 2XG3A 4QPGA 4CRQA 3Q9OA 4JDOA 4NHMA 2MHFA 2VECA 2WT2A 5F1RA 1LULA 2FHRA 3AP5A 4C91A 2VW1A 2CNAA 4AI8A 5ACA3 1AR81 2WNEA 4L11A 1C3HA 4Q8KA 2ZMLA 1FV2A 1M06G 3B9IA 4M0NA 5KHGA 1YLLA 2XVLA 3FJSA 1RMU1 2WQZC 3HAGA 4G9SB 3A0KA 2BFUS 3RI8A 1AR71 2HYKA 3C3VA 3VKMA 4HANA 4JDMA 3KGZA 4JGZC 4AQ2A 1BMV2 4YVSB 5I8SA 1RUG2 4N53A 4I01A 4RA0A 4YGDA 4PDWB 2CAUA 1SBFA 3D5OA 4EROA 4K9SA 1J3QA 4WM8C 4ORFA 2CWSA 4HKWA 3WDTA 1O4YA 4IV1C 3ZFFB 3FLPA 1I9RA 1SLLA 4FPLA 1X82A 4IERA 4CTEA 5C9AC 2XH6A 3DPRA 1G8WA 1HRI1 5J37A 4PDWC 1L3JA 3SH5A 3V65A 3W58A 5FFOC 2RHPA 3FHIB 4I3PA 2WSUA 5C8CA 5L7OA 3KB5A 3KMHA 3SNMA 4AHWA 2A70A 2R062 3PVBB 2P34A 5T5JA 1H2KA 3P3NA 3OYWB 1HRI2 4HFSA 5F6KA 5LK5A 1J3RA 1QXJA 3CLPA 4S2FA 1RUC1 1EY2A 4EN9B 3VDDA 1QJY1 5E16A 1RJ7A 1DGRN 2XWJB 5DDJ1 4AQTA 1RUI1 1DYKA 2K0GA 3GNEA 4QU2A 1NCQB 1XE7A 4NN0A 4XQWA 4XFIA 4AGRA 1QQP3 2QCSB 4QGLA 1JYCA 2BYVE 4B8EA 1T6GC 2HEWF 3J8F3 5T55A 5CB7A 2TNFA 2GC0A 3UJOA 4CEWB 3I2DA 2RM23 1MZFA 1ALYA 4Y24A 2VNGA 1LTEA 1NOVA 3EJKA 3UV9A 2XPJA 3WDYA 1QOOA 2ZA9A 4GH4B 2C9AA 3WY6A 4CEYB 1VAKA 3N7LA 2MEV2 1X36A 1G7YA 1GZWA 3B94A 3ZXLA 4NOTA 2RR13 2VU9A 1K5MB 2EXHA 3HT1A 1O3QA 1MQTA 1ZZCA 1FOD2 1WMFA 4PIXA 3TWIA 3ZFGC 2DUQA 2NN8A 1Q8VA 2UWAA 3M3OA 1YNAA 1OOPA 2VVFA 1MEC1 3M4FA 1RVF2 2B9UA 3TN91 3V0AA 1VBE1 1LJ7A 5A33A 2NLRA 3LA2A 3VHRA 5CA6A 1UPSA 3NL1A 3S6PA 3WHTA 2DYCA 5BPXA 3PVNA 1FPN1 3BOPA 1LODA 2D43A 3KS7A 5DDJ3 4XFHA 3FFZA 3RQ0A 2R6QA 1O5LA 5A3LA 1IS6A 4FPOB 1R093 3NVCA 1Q8SA 1SFNA 2ZX4A 5KBFA 2KXLA 3CJIB 3ZSLA 4WVZA 1F5FA 1O4TA 2RMU1 2E9QA 4Q1RA 5FAXA 3NKTA 2CWMA 4YW2A 1PGW1 4BOWA 3NWKA 4PJYA 1RUJ1 3R05A 4YG6A 4FPEA 4COUA 2QKDA 4GB32 4I09A 1V6KA 3QCWA 4MXVA 1EAH2 5A32B 4P14A 4FTBA 2W08A 2DFBA 3PJQA 4B4PA 1DQ2A 1QDOA 1IHMA 2BW8A 2D3PA 5DUXA 3DPRC 1V6NA 4N43B 4OUMA 3W9AA 3CL1A 2WNUC 4NWWA 2AH2A 1POV0 4RQPA 2R073 1AYM2 4CDXB 4WM8A 3ZFEB 1RMU3 2ZMNA 3H1MA 2JG9B 3I59A 3ZVXA 2N7GA 2WKKA 1U5IA 4ISQA 2GN3A 2R071 2AREA 1AVBA 3OCPA 5FOJB 3HD8B 3WG1A 4AVAA 2JDZA 2YROA 3OBTA 3ECQA 1H2MA 2ZGKA 3VDDB 1AJOA 1AHSA 1ZBE1 3FZ3A 5KXDA 1QHDA 2ZX3A 3T2TA 1AYN1 3ZFFC 1DFQA 1RITA 3D4KA 2ZAAA 3IPVA 2SBAA 4LLFA 5KHKA 4AI0A 4OUSA 4Y5Z0 4EJRA 2VG9A 1C1FA 4LTAA 4FOQA 4XJWA 1R083 3FBYA 3J4UH 2XJRA 1LOFA 1QU0A 2HWC1 4QPGC 4G3YC 4QQPA 2ERFA 3CO2A 4KL1A 4MLOA 2UURA 4K6BA 3WW2A 3M7AA 4ZKTB 2DVDA 2E51A 1LGCA 2JG8C 3USUB 3UK9A 1TEIA 3GF6A 2W52A 5BNNA 3VBOB 1AR82 1UU6A 2VVDA 4CZSA 1PO11 4YZ1A 1OLRA 4YVSA 1FMD1 1RUF1 4CDQB 2JG8B 1OKQA 3ZXAC 2XVGA 4LA3A 1VBA1 1RUD2 1W6QB 1DG6A 2ZJCA 3FBMA 1ZBA2 1KFXL 4N43C 5JZGA 4W6YA 1BBT3 4DZGA 5J48A 1DF0A 2GNMA 2QNKA 3ZYRA 1NY71 4I0AA 1XE8A 4FPGA 5FRAA 1SMVA 2K9ZA 1N3OA 2HWE1 5EWSA 1ZRFA 5E88A 4YGBA 3FWEA 1NLRA 3H9AA 3I4IA 5BNOB 1GBGA 5I8TA 2Y0OA 1H8TA 2Q5TA 3ZXGA 1Z0HA 1TME2 5CNAA 4WVMA 3VBFA 4HVOA 3QACA 4Q0VA 1G9BA 3AFGA 4LT5A 3GZUC 1WGPA 5CFDA 2RS52 1VLNA 2V73A 5DG1A 1WA4A 3GHMA 4FQ4A 1WW6A 2TUNA 2Q1ZB 1JTZX 3M8LA 1KS5A 1OQEA 2EVXA 1RUI2 1V9U2 3E5QA 1HRV1 1M4WA 2ES3A 4IEPA 3J8F2 1I6XA 1Z7S2 1LB2A 4HLTA 5AVPA 3KGLA 1TQ5A 3SXWA 1A8MA 1V6IA 2ZGQA 2ZHNA 2R1BA 1WCSA 3ME2A 3MFAA 4AVSA 5BUVA 1UZYA 1VR3A 2IXIA 5GLWA 3S7IA 4IEXA 1N47A 4QMAA 3ZN6B 4AGVA 4C0BA 4DFSA 4EN0A 2I74A 2WZR3 2R16A 1EPWA 3CU7A 4KNCA 4S2GA 3VKFC 1D2SA 4AQ6A 5A3MA 4A2UA 4XJZA 5I0UA 2JEMA 1W6NA 5FMOL 3HMYA 3GZTB 4RR3B 3H7YA 3TAYA 1JOJA 1YIPA 2IFWA 4QPIA 4AYUA 3AXEA 3N7MA 4H3WA 3A0NA 4Z1VA 2XKOA 4PQ9A 2X8KA 2DWRA 3FC0A 4DXZA 1BEV1 1TNFA 4QGMA 3RSJA 4Y20A 4YFZA 1FV3A 2BNNA 3WXPA 1F8VA 3DGTA 1H4GA 2O1QA 4I2OA 1XXNA 3USSA 2QFEA 4K40A 4COVA 4MGYE 3H1WA 3ZYIB 1VAVA 3PLQA 2A3XA 1YIFA 4XMAA 2ATFA 3H50A 5FQ0B 4AQSA 4UBGA 4JCKA 5AFEA 4K7JA 1HQLA 1QOSA 2MEV1 5JOZA 1RHI2 1SDWA 5JSOA 2Q0AA 1QJZA 4JTNA 3VL9A 1V6JA 2PAMA 2ARBA 5CG8A 4QQOA 1RUJ2 2DTYA 5GZCA 1D0HA 5I0RA 1WBLA 3AMPA 1DZQA 4N9HA 3APBA 1X8EA 2LUWA 2MEV3 1AYN2 4MGZE 2Y26A 2R043 1UU4A 1QMJA 1C8M2 1NE6A 3AZYA 3O0XA 3FLRA 5JOWA 4NPRA 2B46X 1O4ZA 1FI2A 3TBDA 3AM2A 4E4ZA 2ZCWA 2HEYF 3FFQA 4I0BA 1RUD1 4MGIE 1RB8G 1REFA 2EXIA 3JBG2 1S55A 3VZNA 5GKAC 3WINE 3MIHA 3RWNA 1ZM1A 5CBLA 5DXDA 3ZMOA 4Q4W1 4HBNA 1BCXA 1UKRA 1R1A3 4M00A 4HN0A 2ET7A 4LBQB 4XW3A 2OUHA 4RQPB 2CL2A 4IEZA 3G7DA 2G4IA 4FOVA 4R9AA 1UX6A 1ZRCA 2V09A 3DV8A 5C8WA 1RHI1 1VBA2 4AHYA 4GMP1 1XNKA 2XLGA 4XTPA 1U5ZA 3JB8A 5CADA 2A6ZA 3IMNA 2HKXA 1GR3A 1DYPA 3MI8A 4ZU7A 1UL9A 2VMGA 4Z07A 4XBNA 1C28A 4ZXKA 3RNSA 4XFBA 1WLTA 1PVC2 1CPNA 4Q8LA 4FBFA 4QPIB 2D6KA 2D7FA 4RR3A 1U5XA 2KA3A 5FPXA 4GWNA 4IEWA 1W6NB 4DRRA 1BVVA 1QY4A 2QZ3A 1RUE3 3RYKA 1XNBA 1VBC3 4FXGB 4WVWA 3CJIA 3KZ4C 1ZA4A 4KGQA 1NA1A 2W39A 3D8CA 3ZN6A 5L19A 5FLHA 4OULA 3VKNA 4Y20B 1OHFA 4INDA 4JRLA 2DU1A 4YG0A 3M2MA 1OPOA 1IS3A 4EN8B 3OBRA 1A6CA 1W6PB 1LHWA 4Y1YA 1REDA 1CD3G 1CAWA 5FLIA 1JW6A 2DCYA 3HBZA 1OA3A 4YM0A 5I91A 5JDBA 3S0MA 1AUYA 1B09A 5E8AA 2ZPXA 3AMMA 1ND3C 2WLQA 4N9IA 3ZSMA 3NV4A 4HSJA