4GB31

Human coxsackievirus b3 strain rd coat protein
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
273
structure length
273
Chain Sequence
AAIGRVADTVGTGPTNSEAIPALTAAETGHTSQVVPGDTMQTRHVKNYHSRSESTIENFLCRSACVYFTEYENSGAKRYAEWVITPRQAAQLRRKLEFFTYVRFDLELTFVITSTQQPSTTQNQDAQILTHQIMYVPPGGPVPDKVDSYVWQTSTNPSVFWTEGNAPPRMSIPFLSIGNAYSNFYDGWSEFSRNGVYGINTLNNMGTLYARHVNAGSTGPIKSTIRIYFKPKHVKAWIPRPPRLCQYEKAKNVNFQPSGVTTTRQSITTMTNT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords coat protein 1
publication title The Crystal Structure of a Coxsackievirus B3-RD Variant and a Refined 9-Angstrom Cryo-Electron Microscopy Reconstruction of the Virus Complexed with Decay-Accelerating Factor (DAF) Provide a New Footprint of DAF on the Virus Surface.
pubmed doi rcsb
total genus 49
structure length 273
sequence length 273
ec nomenclature
pdb deposition date 2012-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4gb3100
2WS91 1MEC1 4Q4V1 4LLFA 1R082 1VRH2 1D4M1 2RS51 1R1A2 3ZFFC 1BMV1 4N53A 1HQNA 5CFCA 1SMVA 1RHI2 1K5MB 1RMU2 2ZAHA 1K5MC 2RMU2 4GB31 3LOBA 4QPIA 4CDUB 2HWB2 4CDUC 1RUD1 1AYN2 5FMOL 5D8AC 1BEV2 4AEDB 3JBG1 3JB8A 4AEDC 1PGW2 1HXS1 1HRV1 1V9U2 2RM22 1HRI2 4GMP0 2FZ2A 1AR93 1AR82 1R083 4QPGB 4QPGC 5L7OB 2PLV2 1R091 3JD72 1FOD1 1VBA2 4GMP3 4GH4A 2GSYA 2XBO3 2RMU3 1PO23 1HX6A 1RUE1 1RUG3 5BNPA 2R071 1X36A 4RQPC 1ZBE1 4CEWA 1QJX3 3ZFGB 4Z92B 4RR3A 1Z7S2 1RUH1 3ZFEB 3VBFB 1AR83 3VBUC 1RVF1 2WZR1 1FPN3 5DDJ3 1BBT2 4N43B 1TMF1 1VBA3 1H8TB 1H8TC 1C8M1 1NCRC 1EAH2 1QJU3 2TBVA 3VBRA 2R062 1AL22 2DF7A 4N53B 1PO13 2RS13 4N53C 5ABJA 4Q4V3 5CFCB 5CFCC 4Q4Y1 4WM8A 1Z7S3 4YVSC 4QPIB 5BNNA 1PVC2 4Q4X2 4GB33 2FZ1A 4IV1A 1AR63 4YVWA 4RHV1 3J8F3 3ZFFA 3DPRC 4FTSA 5C8CA 1K5MA 1PGL2 4GH4B 1A6CA 5D8AA 4RS5C 1AR91 1R081 2BFUL 5BNPB 1VRH1 1PVC3 4CDXB 4CEWB 4CDXC 4CEWC 1RUE3 4RR3B 4RR3C 5AC93 2HWD2 2RMU1 1PO21 1NA1A 2Y26A 1AYN1 1COV2 1RUH3 1VAKA 2WFF2 1BEV1 2WWSA 1PGW1 1QJX1 1HRI1 2WZR3 1CJDA 3VBRB 4RQPA 1AR81 3VBRC 5ABJB 5ABJC 1RUJ2 1EV12 1FPN1 2R043 3VBHA 3JD71 5FMOS 5DDJ1 4WM8B 4WM8C 1VBA1 1QQP2 2ZZQA 1ASJ2 3VBUA 2XPJA 2HWD3 4FTEA 4CDQA 5BNNB 5BNNC 1QJU1 4Q4Y3 1POV0 1RUC3 1H8TA 1COV3 1PO11 2RS11 1NCRA 2HWF2 4IV1B 1GFF2 4IV1C 4YVWB 2MEV2 4YVWC 1Z7S1 3S6PA 1RUI3 1POV3 3ZFFB 1ND3C 5FOJB 5C8CB 5C8CC 4RHV3 1VBE2 4YVSA 1EV13 5A32A 1QJZA 5D8AB 1F8VA 1AR61 1FMD2 3J8F1 1EAH1 4FTBA 2BPA2 1AYM2 2R061 3VBSC 1VRH3 2MEV3 1B35C 3DPRA 1R1A3 1NA1B 1NA1C 4JGYA 4CEYC 1C8NA 5ACA2 1RHI3 1PVC1 1RMU3 1VBE3 1AR72 4RS5A 1WCDJ 1TME2 2HWB3 1AYN3 3TN92 5AC91 2RR12 1FMD3 4EJRA 1BEV3 4RQPB 1VB4A 1QJY2 4CDXA 1V9U3 2RM23 1X33A 1HRI3 3VBHB 3VBHC 1PGL1 3VBUB 4Q4W2 1VBD2 2PLV3 4CDQB 3JD73 4CDQC 2HWC2 1NCRB 2R041 1NCQC 2WS92 1MEC2 1F2NA 2RS32 2HWD1 3VBOC 1D4M2 1CD3G 4YVSB 5A32B 1RUC1 1BMV2 1COV1 1NY71 2WFF1 3NAPC 1RUI1 1POV1 1RUD2 1BBT3 2X5IC 1RUJ1 1EAH3 1EV11 1HRV2 1HXS2 1ND3A 3DPRB 1QQP1 4FSJA 5C9AC 2R063 1AL23 2ZTNA 4JGYB 4JGYC 1RUF2 1R092 3VDDA 5JZGC 4RS5B 2GH8A 1FOD2 2HWF1 4Q4X3 2MEV1 3VBSA 1R1A1 2R072 1NG0A 1ND2C 1RHI1 1RMU1 4IV3C 1ZBE2 1B35A 1VBE1 4Y5Z0 3ZXAC 1VBB2 2HWB1 4CEYA 1FMD1 1MQTC 1PIV2 1V9U1 1RUF3 1RVF2 2RM21 3IDEA 2QQPA 4JGZA 1AYM1 1TMF2 2HWE2 1VBC2 1C8M2 4WM7C 5K0UC 2PLV1 5A33A 5ACA1 3HAGA 4CDWC 1VBB3 3TN91 2RR11 2WFF3 1PIV3 1QJY1 1NCQA 5CFDC 1ND3B 4PDWC 2HWE3 1VBC3 2BBVA 3VBOA 1RUJ3 3VDDB 3VDDC 2HWC1 1BBT1 1QQP3 1ASJ3 3NAPA 4NWWA 2X5IA 1M06G 2RS31 3VBSB 1AL21 1AR92 2HWF3 5J98B 5BNOA 1B35B 1OOPA 5C9AA 4CEYB 1OPOA 1AUYA 2XBO2 5JZGA 4Q4X1 1DDLA 1PO22 3JB4C 1RUG2 4JGZB 3FBMA 4JGZC 1QJX2 1ND2A 1AYM3 4IV3A 1E57A 5L7OC 4BCUA 5A33B 1RUF1 1FPN2 5DDJ2 1W39A 1IHMA 1MQTA 5ACA3 1ZBA2 1AR73 1QJU2 1NCQB 1TME3 1PO12 2RS12 4WM7A 4Q4V2 5K0UA 3TN93 2RR13 1QJY3 3VBOB 3ZFGC 1OHFA 1VBB1 2RS52 2BFUS 3ZFEC 3VBFC 4CDWA 1PIV1 5LK7B 1VB2A 4GB32 4Q4W3 1VBD3 3NAPB 2HWC3 4N43C 2HWE1 2X5IB 1VBC1 2IZWA 1AR62 3J8F2 1RB8G 3JBG2 5CFDA 1ZBA3 5C4WA 5BNOB 4PDWA 5BNOC 2WS93 1MEC3 1OOPB 2RS33 1OOPC 5C9AB 1ASJ1 3CJIA 5JZGB 1D4M3 4QPIC 2RS53 4Y4YA 1AL0G 1RUE2 1RUD3 1ND2B 5AC92 4IV3B 3JBG3 1HXS3 1HRV3 1RUH2 1MQTB 3M8LA 1NOVA 4GH4C 4CDUA 1R093 2WZR2 4NWVA 1FOD3 4AEDA 5BNPC 4WM7B 5K0UB 2R042 5GKAC 5J96B 4QPGA 5L7OA 2R073 4GMP1 2XBO1 1ZBE3 4CDWB 1AR71 4Q4Y2 1RUG1 1RUC2 1TME1 2BUKA 2VQ0A 1NY72 4SBVA 2WLPA 1RVF3 5CFDB 1RUI2 5C4WB 4PDWB 5C4WC 1TMF3 3ZFGA 1C8M3 4Q4W1 4RFT0 1VBD1 3CJIB 4RHV2 3CJIC 3ZFEA 3VBFA 1ZBA1 4N43A
chains in the Genus database with same CATH superfamily
2C9AA 1Y9QA 2WS91 2PHWA 5C70A 1R082 3ASIA 4R4ZA 1JS9A 1VRH2 1BJQA 4C0HA 1KFXL 2VJXA 3HT2A 3LKJA 1KS5A 2IXCA 4L9BA 4LE4A 5FY9A 1BMV1 4LO5B 4NN0A 3NO8A 5I91A 1SMVA 1RMU2 2NPIA 3UESA 1K5MC 2P34A 4CA9A 1JOBA 3LOBA 4QPIA 2LALA 1JBCA 5FAXA 5IYYA 3IZOA 2HWB2 4CDUC 1RUD1 3G7DA 4P9JA 1NLRA 3O0VA 2D98A 3JBG1 4XETA 4AEDC 3BIWE 1RUOA 4MGSA 1HXS1 1HRV1 2RM22 4U36A 1HRI2 2HJIA 4BLIA 1JI6A 1GR3A 1LU1A 2DUOA 3ACIA 1Q8PA 3K3NA 3MFAA 3LZZA 4GMP0 1AR93 4KI5M 4Q1RA 4QPGC 1D2SA 1FNYA 2P37A 4FPFA 4FFFA 3URFA 3WG4A 3D0SA 2WZ8A 3ABZA 1FOD1 4XMAA 1DQ4A 4KBBA 2XBO3 2K9ZA 2RMU3 2ZX1A 4ONUA 4ET7A 3MI8A 1YFXA 1PO23 1RUE1 3MPPG 4KWKA 4XBNA 2G9GA 1K42A 1X36A 2JDYA 4I3GA 3ST7A 1DGWA 3AP5A 4XABA 5CBLA 2WSVA 1JZ6A 4N9IA 5IFPA 1IS5A 3PHMA 5EYYA 1E5HA 3ZFEB 2BTVC 2J1RA 4IEQA 5FZEA 1W8UA 1IS3A 2UU8A 5F5AA 3QACA 4FFIA 1YO8A 1UPIA 1F4AA 1UY1A 2VD7A 4N43B 1BHGA 4XDPA 1YI9A 1H8TC 2D5FA 1UOFA 2RJKA 3KD4A 1LOGA 4YZ1A 5CKMA 2BWAA 5IATA 3SEPA 1DU3D 4E4ZA 2WYFA 1AHSA 4PF1A 2TBVA 2Z2SB 2R062 3ZSJA 2XKOA 4LKFA 2J1EA 1N1YA 4Q4V3 4LORA 4AAPA 1W6QA 2IFWA 3V0AB 2XJRA 1JTZX 2JKBA 1J84A 3LEIA 1HJFA 5D21A 1Z7S3 2RDQA 3PUHA 1PX4A 4OMDA 4YVSC 1CESA 1HB3A 1XNDA 2VOVA 3J7MA 3GJAA 1PZ8A 2YY1A 2IVIB 2BVBA 4KNCA 1LOFA 1PVXA 4QPWA 5FZGA 1R1ZA 4MGYE 1GWLA 3SLIA 5A3OA 2FZ1A 2ORXA 3Q8BA 3PJYA 4QX2A 4NMIA 1G86A 3LPFA 1YQ2A 2D93A 3DPRC 4ASMB 5JMOA 5H9SA 2XONA 3PUQA 2O14A 1MS5A 4GH4B 1A6CA 2G4IA 1WMFA 1VE0A 5D8AA 3SXWA 4RS5C 4I09A 4NPRA 1ZA4A 5JOZA 1G9FA 1AR91 1QEXA 3N4MA 3POSA 1Q56A 1ULFA 3NL1A 4FPOB 3VZLA 4GAZA 4CDXC 5LBCA 2DYCA 3GBWA 4RR3B 3H8UA 4LHKA 4Y4RA 3I2GA 5I8TA 2HKXA 1J83A 4YYOA 4CXYA 3PMEA 5DMYA 2RMU1 1X8MA 4IEZA 2WSUA 2WBKA 1PO21 1NA1A 1XJAA 1AYN1 4ZXEA 1H0BA 1OXCA 1OQ1A 1RUH3 3ZO0B 2WFF2 1LOEA 1BEV1 1GUIA 1PM7A 3PUSA 5GJ6A 2PHTA 4DY5A 1Y9MA 1U5IA 2C26A 2I74A 3AP7A 3I3BA 3EJKA 5JWPA 4CPBA 3AVSA 1WLDA 4RQPA 1PZ7A 1RUJ2 3B7MA 3M7AA 2Q8OA 2WN2A 3BYWA 2A1XA 4L92A 5FMOS 4BIFA 3KMHA 4WVMA 5FZ9A 2HWD3 4NRPA 3MICA 4JVAA 5FZLA 5HCBA 3RWKX 3BGAA 3HN3A 3IWZA 4Q4Y3 1LOFC 1POV0 1RUC3 3MLJA 4BQ3A 2F6BA 4PQQA 5FK8A 3EBRA 1ENSA 4K1YA 2ZGLA 4CCJA 3J7HA 4YVWB 4LHLA 1Z7S1 4RA0A 3S6PA 4YG6A 1V6LA 1AXKA 1W8NA 4QAWA 3HJRA 3T0BA 3ZYBA 3I54A 2VMIA 3MZHA 1RXFA 3ON7A 1BXHA 4QKNA 2P3YA 1LESA 3SQOA 4BXFA 5HI0A 4AVTA 4LMFA 5JOWA 1F8VA 1FMD2 5F3CA 2ENRA 1WGPA 4FTBA 4ORFA 4JZRA 3MFCA 5GZEA 3AYAA 5LY2A 2W9XA 4AW7A 1TEIA 1JHNA 3ZIXA 3PUIA 4HANA 3VBSC 4CP9B 1WMDA 3HNYM 1ZX5A 1KDKA 4UBHA 2RJLA 2VCMA 1VAMA 4NAOA 4FPKA 4ISRA 5HBAA 4L2NA 2QNKA 1OF4A 3PJQA 5A3PA 1HKDA 5DUVA 3ME2A 1NA1C 4D6RA 3IBMA 5F1RA 5EIYB 1YLLA 4CU8A 1RHI3 2JG9C 3FWEA 1GZTA 3DL3A 4GWNA 1SCSA 1AR72 2RVAA 3AXDA 5K7PA 1F5JA 3POEA 1UMZA 3POFA 3WHUA 4ZY9A 3MV01 5A1AA 1VB4A 1QJY2 1ODMA 4Z82A 1V9U3 2ZBJA 3WUCA 3LE0A 3KV9A 2RDNA 4O9GA 4BIOA 4W8JA 1YCIA 4ZKTB 5BYNA 5E16A 2ZKLA 1CAXA 3VBUB 1PHMA 3K77A 4YW1A 1YQ6A 4CDQB 3JD73 1HV0A 4TYSA 1JYNA 5JDBA 1GKBA 1VRBA 2VMHA 1O7FA 1UF2C 1DZQA 1WLTA 3PUAA 1NCQC 3BTYA 1OKQA 4AGGA 4Q8KA 2WS92 2Q1ZB 2RS32 4L11A 3OY8B 4UAPA 2HWD1 4K8RB 2EIBA 1OFNA 1W2UA 1CD3G 1RUC1 2R16A 2WO2A 1LENA 2GC1A 5FDBA 1BMV2 1IPKA 1NY71 4MSVA 4KG0A 4YZ2A 4JRLA 3NVCA 1WW6A 4AK3A 1SHWB 4DXSA 4K40A 1UX6A 3V0BA 4MXWB 2XGXA 5KXCA 5JUVA 3I7DA 1RUD2 1CX4A 2FDGA 1V6OA 3LWCA 1BCXA 1H6YA 1FXZA 3MUY1 1HXS2 1HRV2 1ZZCA 2JDHA 3CDZB 1ND3A 2P17A 4XUPA 4ZZ5A 1H1AA 4C91A 3ES1A 1QQP1 3ZYHA 1IPJA 2ZZJA 3CLPA 1KD7A 4LBLA 1RUF2 2WNUA 4AOCA 3HWJA 3O5SA 4ASLA 4IEYA 2XLGA 1FOD2 3OPWA 3MIEA 4XF3A 2HWF1 1G9AA 2VNOA 2Y34A 4Q4X3 1WLCA 3M2MA 2BNNA 5FUNA 4RSUA 1PMIA 4LUKA 1W99A 3C7EA 3RZHA 3OGGA 2BEOA 2VH9A 1PNFA 4CCLA 3ZXDA 1RHI1 3AYEA 1SBFA 3JCIA 4Y5Z0 3LSDA 1QMJA 1UCXA 4PT6A 3ZXAC 3U4SA 3KLSA 3FLRA 2I45A 4IETA 2PELA 1LGCA 4CCCA 5FP8A 5KXEA 4G4FA 1V9U1 3D4KA 1E5IA 2Q30A 2QFEA 5F9TA 2HBTA 4P9IA 1AYM1 1CPNA 1RUNA 3ZKYA 4EYUA 2HWE2 1VBC2 4B8EA 2PN5A 1HQWA 2WZPP 2VMFA 3TOJA 4Y1VA 3H8RA 4NE9A 4AE2A 1UN1A 5A33A 2F17A 5FZHA 1GWKA 3H7JA 4QXCA 4YZ5A 2VO5A 1VBB3 1SPPB 3DYMA 1L7QA 4RGGA 4DXZA 1UOGA 2AH2A 1AX0A 1D7PM 3VHRA 4MLOA 3IKWA 1YXWA 3NJZA 4IEOA 2ES3A 5FQ0A 4YGCA 2BBVA 3VBOA 1K45A 1F5FA 4COUA 2JB4A 2HWC1 3F2ZA 2WNUC 3I2FA 3LEGA 5A7NA 1DZTA 3WNPA 2VW0A 3RZKA 1LGBA 3A23A 5FMCA 5K8SA 5FYHA 1X9TA 2WA4A 4XTMA 3D8CA 4UFMA 1M06G 2A6ZA 3IMNA 4DEQA 4GWIA 2V72A 2P6CA 1AR92 2Y8KA 3JU9A 4META 4UW3A 3UT0A 3QBQA 3VDCA 3ZN5A 3VZOA 3RZMA 4LIVA 5IWFA 1LHWA 4CP2A 5BNOA 3QLQA 2EXHA 4I02A 2D3RA 1OOPA 1N1TA 2WR9A 3NV4A 1GZWA 4CEYB 5DQ0A 4CCOA 4JKKA 1AUYA 2XBO2 4NPLA 4IE6A 4Q4X1 3SMHA 1PO22 2XG3A 1W8WA 3T3YA 4D7TA 1XRUA 2D3PA 3M3EA 3NW4A 4J1WA 2K46A 3HEIA 4COZA 4JV4A 2Y0OA 5IFTA 3B02A 4AFCA 3MEPA 5A7OA 4TSVA 4CXWA 3R4UA 3OYWB 4D94A 1OUXA 1E57A 5L7OC 4NOTA 5I0TA 4TLFA 5HCFA 1UY0A 4BCUA 4F8AA 3ACLA 5LY1A 2QKDA 1XE8A 2VZUA 3CZUA 3K4DA 3T1LA 4H14A 4CUCA 2P3JA 3CEWA 5ACA3 3LFIA 1GBGA 4NJ4A 1ZBA2 3LDKA 3VV1A 2Q1FA 3JUUA 5BNQA 3ZSKA 1US3A 2YBKA 4FXGB 4MYEA 3KCCA 3USUA 4DNYA 5ISLA 1OD3A 4Q4V2 5K0UA 3TN93 5BY5A 4LT5A 2WA3A 4FAGA 4UFIA 5IVVA 3ZFGC 4Y24A 2PHDA 1VBB1 2RS52 4XJUA 2XVLA 3IDCB 5T5PA 1GNZA 1CZSA 5F2SA 2ZGKA 1H9WA 4CDWA 3BVCA 5F37A 5JCTA 2AR6A 4MADA 3NAPB 2ET1A 3BCWA 4Q8LA 1H2LA 1FX5A 4LBKA 2X5IB 4OLLA 4HETA 5LBEA 2ZX2A 3UYJA 3WEZA 5A1FA 3GBFA 5CKNA 2QQLA 3CIHA 5EV7A 5I0RA 2Q8EA 5BNOC 4PBOA 4CE8A 3AMMA 1OOPC 4G9SB 4YW2A 5CG8A 4Q0SA 1TNFA 2E63A 2DFCA 4K1ZA 5JZGB 2ILMA 4Q0VA 1OSGA 4AYUA 1UIKA 1O91A 2UWAA 4XJ9A 5HXMA 2A6WA 2XWJB 4BU2A 2VUCA 2W92A 4K9SA 3ZYJB 2KM2A 1ND2B 1XU2A 2WWUA 3APBA 4M3CA 3VKFC 4IV3B 4A7YA 3OEBA 2VOXA 3RG0A 3B9IA 5C3QA 4COYA 3WNLA 4RYDA 4QXHA 4YW6A 5A3MA 1E5RA 1W6NA 3SCFA 3WNNA 1RUH2 4B4QA 1QH7A 3BTAA 3TEZA 1DYKA 1MQTB 1PM4A 2PHXA 3AKSA 4TN7A 1DQ2A 3M8LA 5FPBA 3NJXA 4CUAA 3P3NA 3ACGA 1S1AA 1W6MA 4PF5A 3VL8A 4HKWA 4YW5A 2QQKA 5BNPC 1WZXA 2QZ2A 4WZFA 4AWDA 3WUDA 2C0ZA 4MHRA 5GM0A 5BV6A 2R073 2W3JA 4I01A 4OHXA 4BLJA 3NJVA 2W46A 4PIZA 4AFAA 1X82A 1NZIA 3KT4A 4LBJA 4Q4Y2 4HOOA 1LHVA 1RUC2 1NY72 2B9VA 4XF1A 4P9GA 5FYCA 1ZRFA 3VUOA 3UV9A 2OQ7A 4K7JA 3WQ0A 4X6QB 1MS1A 4BYYA 4A2UA 5CFDB 4LHNA 1CGPA 1SLTA 4FI9A 4PDWB 4FP2A 4QX5A 4I2OA 4D6SA 2W1WA 2VQAA 3VHNA 2CV6A 4IW3A 1C8M3 3HPNA 3CJIB 5HV0A 4D8MA 4HN1A 3VBFA 3HN1A 1RTVA 2QQOA 2VUDA 5FZAA 3IT8A 2HYKA 4V2WA 5I0SA 2BOJA 1REFA 4Q27A 4LPLA 2VXJA 3UKTA 1V6IA 2VU9A 3MIDA 4LLFA 4XJZA 4AFBA 2FMYA 4NIDA 2W94A 2CSGA 1UY3A 3SCHA 2BP6A 2WNEA 3MHZA 2WLQA 5CA6A 1BK0A 1IGOA 1O3RA 4LKEA 3WQ1A 3ZFFC 4W4ZA 3N35A 4N53A 4LNVA 5T5OA 2BRTA 2OW4A 2WINB 5CFCA 1AF9A 2ZAHA 1RHI2 1K5MB 3N7KA 4LBOA 4GB31 4NR1A 5FJHA 5FK7A 1WA4A 2H0VA 5DZGA 2E53A 4LBQB 1T2XA 4CDUB 3RZGA 2I2SA 1XNKA 1ZYBA 2ZGPA 3IM0A 3KVBA 3GDBA 3MF9A 5FKCA 4AAXA 2C24A 3CKHA 3FL7A 4NIAA 4CYDA 4NRMA 2D6KA 4AEDB 3JB8A 1JHJA 3SNMA 4OHWA 1PGW2 2RJ2A 1V9U2 5F8PA 4R9DA 2FDKA 1O5LA 4B4RA 4DMIA 1HB1A 3UJQA 1FYUA 4PIYA 4QDRA 5CVRA 4QPGB 1AR82 5A6ZA 4PIXA 2QDRA 4YM2A 2NMNA 3GHNA 4LE3A 1O3SA 5SV5A 1OA4A 3JD72 5B4XA 1CN1A 2YGMA 4QQ2A 1VBA2 1F35A 2LS6A 4NUBA 4GMP3 2OIIA 2B42B 2LM3A 2VL4A 2VCCA 3HQUA 2ERFA 1CAUB 2YB7A 3P1IA 2R071 4A7KA 1OH4A 2GP3A 1JZ5A 1H1IA 1W0NA 5FLJA 3IPVB 2J22A 3WF0A 1QY4A 1XYPA 1UZZA 2GC3A 3HR9A 3MW2A 4M4PA 1TVGA 2I07B 5KHJA 1CAVA 2WZR1 2DU1A 1FPN3 3P5BA 4DRVA 3WNXA 4I0AA 1XNCA 2DWRA 3TRSB 1H8TB 2Y60A 4W6XA 4Y33A 5EJZB 1SFNA 1C8M1 1NCRC 3A0KA 3GZAA 2J1SA 5FP4A 4OI1A 1KFUL 3I97A 4EV0A 1GP4A 2DVDA 1QJU3 3AP4A 3KT7A 4K21A 1QHDA 2ADDA 5ABJA 2DF7A 1UYPA 2ORZA 2ZCWA 5E89A 4N53C 5FWJA 2D7FA 4QMAA 3FLTA 4QM9A 5CFCC 3N3HA 5FBZA 2B46X 4QPIB 1W2TA 1HB4A 1Y7BA 4FP3A 5I8SA 5E8AA 3RRDA 3JQWA 2PQQA 4HBNA 1PVC2 4Q4X2 2ARBA 3MW3A 4DUVA 2JD4A 2J1VA 2YU1A 4XQ4A 2VC9A 1S2EA 3KF5A 3BI3A 5CIRA 1NUKA 4YGDA 4IV1A 2ZGRA 1URXA 1Q8QA 4RHV1 3J8F3 4OHYA 2XJQA 1NAEA 1FATA 1EPWA 1MS8A 1Q43A 2HEVF 4N9HA 5FY0A 3KQRA 3W21A 5AVAA 2VQTA 2ZX0A 3B5LB 4FTSA 1K5MA 1PK6A 2WQ8A 2Q1MA 4LBQA 2WL1A 3SHRA 5T55A 1BZWA 5DUXA 2V09A 4QD2A 1SLAA 3BTZA 1C57A 4CDXB 3PU3A 3WR0A 4F3JA 5J1XA 4P5HA 1RUE3 2E51A 2R0HA 2V4AA 1VR3A 3QH7A 5KWRA 2BBAA 2RHPA 2D6MA 4IEWA 4Y20A 5F5CA 2DVGA 4XZUG 4IESA 4OHZA 1KXGA 2VECA 1JZ8A 4XW3A 1GANA 4NVPA 2W95A 3WF1A 1COV2 1N3OA 4QB6A 2Q8CA 1US2A 3NV1A 2O8OA 3Q8EA 2Y64A 1RXGA 3PMSA 4DS0A 3OGRA 3ZPYA 4XBLA 3AMHA 3B9CA 2EXJA 2EF6A 2DBIA 4QQLA 4C1WA 4DXTA 1JODA 5ABJC 3S30A 2JG8A 3RSJA 3OGJA 1EV12 1FPN1 1N1VA 1DF0A 1W6QB 3VBHA 1W9YA 2DFBA 1JYXA 3FFZA 1UWWA 1YRZA 3R6SA 2JDKA 3PDQA 5FZOA 2XJPA 4ZS2A 4V1PA 5JMCA 3GZTB 2B39A 4I3PA 4FTEA 5KC6A 1LOCA 1QJU1 5HCAA 3I2KA 1GU3A 2ZHKA 3VD7A 4LOTA 1H8TA 3CF6E 4JCKA 2AENA 1KEXA 2IFRA 3NSTA 1GFF2 4IV1C 5DUUA 4ZU5A 1LNSA 2MEV2 4Y1XA 5JOYA 1RINA 2CAVA 4OHVA 5FIXA 1RUI3 1POV3 3MIHA 3VHPA 1UYXA 1FV2A 2YGLA 1YNAA 4H55A 4E8DA 5DUWA 1LHNA 1QNWA 4P08A 1PK6C 2PAKA 5A32A 1VBE2 4YVSA 2O0OA 5F2WA 4JQRA 5D8AB 4URAA 2DUQA 4RD7A 1YQ5A 2JXAA 3LF7A 3J8F1 1EAH1 5KXDA 4LO6B 1VIWB 4Y3OA 4EE2A 2BPA2 4ARXA 1XE0A 2Z69A 2D97A 3GXUA 1WWYA 2CL2A 4URTA 5DAPA 3AZXA 3J4UH 3DECA 4YFZA 3ZX7A 1B35C 3DPRA 3PTYA 5T3NA 5F5QA 3UJOA 1NA1B 3H3ZA 5F6LB 2VMCA 3OTFA 2W39A 1CZVA 4JGYA 3WP6A 4Z1VA 1C8NA 1W90A 5ACA2 5A3WA 1DLLA 1KITA 1Y9GA 1XC6A 3GJBA 4MOAA 4RS5A 1YEWA 4KWJA 4RGKA 1AYN3 1BLZA 5C6CA 1C4RA 4CPBD 3TN92 2IVJA 4EJRA 2DCKA 1BEV3 4HVOA 4RQPB 4CDXA 2WNVC 1MZEA 2VMGA 2JG8C 5J36A 5LBBA 5C5TA 4EZ4A 3VBHC 5IVYA 5FYSA 3FUOA 4D6QA 5C3RA 1PGL1 2JIGA 3H50A 4AEKA 1JOPA 3H42B 1IZ3A 1KJRA 4WVMB 2PLV3 2DV9A 3I3DA 4JC1A 2W0XA 4BQ5A 2CNAA 1G9DA 2VZSA 4AHYA 4NIHA 4AI3A 2D6OX 3H0OA 3QH6A 4NHXA 4CSWA 2UURA 1JZ4A 3C7HA 4I30A 2QQIA 1PGSA 1H9PA 3M3QA 5FJKA 3ZDVA 3ZXEA 2XR4A 3B01A 1I3HA 2X8KA 4E8CA 4OUSA 2C4XA 3N9MA 4UW4A 1F15A 1NZCA 1DFQA 3LQCA 1BK1A 1RGSA 3AKTA 4XFHA 5EQUA 4A7ZA 2VZ3A 2Y38A 4FFHA 3POJA 2J1TA 2QVSB 3AZWA 3ZMOA 2VMEA 3A4UA 2XQRA 5H9RA 1RUI1 1POV1 3PNAA 2ZX4A 3K46A 4FOYA 4QU1A 5E88A 2JD9A 4FFGA 1XYOA 1UZVA 2YBSA 1APNA 3J7LA 3S5AA 4YM1A 2VOWA 4XUTA 2HBUA 5CYYA 3OGVA 4LKDA 4R8HA 5H9QA 2ZHLA 3NV2A 1HDKA 1XXNA 1Q5OA 4LK6A 2CDPA 5C9AC 5EPAA 1AL23 1H2NA 3S57A 4JGYC 4FPHA 4Q0PA 2QQNA 3UL2A 3N9QA 3VDDA 4XQDA 1S0FA 1UX7A 4LJHA 2OYZA 4GA9A 3VLBB 3OB8A 1KGYA 4BQWA 4FVVA 4TZDA 4JQTA 1ZM1A 2VG9A 1Z78A 1G6NA 4PBPA 3VBSA 3ILFA 1K3IA 2R072 3HQXA 4UW6A 5FYYA 1NG0A 3KGLA 1WCQA 2L9LA 3T4HB 1WD3A 4D69A 3ALQA 1W2AX 3E6DA 1TNRA 4QX8A 1S55A 1YFUA 3LIHA 1CAXB 5FZ7A 5IJRA 4AVVA 5JI9A 1I5PA 3K75B 4JTOA 5I0DA 3I3MA 1GLHA 4GWJA 3WDWA 3OUJA 1NX9A 2JG9A 5FZCA 1W2OA 4Z8BA 1LHUA 1PIV2 1H8VA 1STMA 1GOGA 1UMHA 1XSRA 1PNGA 2CAUA 2VCAA 2OXBA 4JGZA 4JAAA 5EZWA 4A3ZA 4A6OA 2CWSA 1CX1A 1LECA 1C8M2 4WM7C 4A41A 1X50A 2PLV1 3WP5A 1CPMA 2QQJA 3WHTA 3K48A 4AG4A 4MGKE 4ITCA 2WQZC 4PI2A 1YFWA 5CADA 2VUJA 2ZGTA 2YV8A 2P1BA 5DABA 4CCMA 2ZS6B 4XVHA 3WDUA 4RL7A 5DZFA 3PVEA 3WNMA 1DHKB 2VPVA 4PHZA 4ZZ8A 3OPTA 3V0BB 2XDVA 1GV9A 4IDZA 4S2HA 5FXXA 1O4TA 2RR11 4LEJA 3OBAA 3LD8A 1AJOA 2JDAA 4LA2A 3SH3A 5I93A 5A7PA 1NCQA 2VNRA 3O1UA 1I5ZA 1GSLA 3RMXA 1WW5A 2RDRA 1HQLA 3FHQA 4HT1T 1ND3B 4IERA 1PMJX 4EWDA 1GMMA 4W6WA 2VMDA 1C5HA 4KWUA 1OQDA 1XNAA 4LITA 2C9KA 1U12A 2WNUB 3VDDC 4XCAA 4ATFA 3PURA 3B94A 2UYAA 1HN0A 1NLQA 1QQP3 4HZFA 3THPA 3UGHA 1ASJ3 3TBDA 3EMRA 4AI0A 3WW1A 4AQSA 1S0EA 5ANNA 4HVQA 2QTWB 4AI9A 1YJKA 2XVGA 3C8XA 4NWWA 1VJ2A 1AL21 1CWPA 4JDNA 2XWBB 2VUAA 1YIFA 2HWF3 5I8YA 1SG3A 1W8FA 2JKXA 3RYPA 5FO8B 4GXLA 2HEWF 1FAYA 2XUMA 3K4AA 1W06A 1OPOA 2NN8A 2VVFA 1DP0A 2VM9A 3FMGA 1L3JA 1XU1A 4K6BA 3SKJE 2BVVA 1QOTA 1Z0HA 1KJLA 3O0XA 2E9QA 1KDMA 1OH3A 3J7NA 5FKBA 3FBMA 4JGZC 3T0AA 4FO9A 5C7GA 1UIJA 2GNMA 1D0GA 4DINB 1XB9A 2BU9A 1W3VA 2WO1A 1H2MA 1W8ZA 1OLMA 1WCSA 4DUWA 3DYOA 1AYM3 2VW2A 2CGNA 4G3YC 3MV11 2CTVA 3FN9A 1DYPA 4KQ7A 5DZEA 3AKPA 5FZ1A 5KHHA 5A33B 3AC0A 4R9AA 1FPN2 4QU2A 1J1LA 5IVCA 1IHMA 2W47A 4QKBA 1GZCA 2ET7A 3GALA 1Y43B 3N9OA 2PMWB 2QUOA 3RYKA 2Q0AA 2R49A 1QJU2 2EICA 5EFUA 2GN7A 2R1BA 4DEVA 3WP3A 4NAMA 1E5SA 3OF1A 4DPNA 2QZ3A 4OZOA 5FPXA 1GNHA 1ODNA 1UO9A 2CDOA 3WZ1A 1OI6A 4L0PA 5FQ0B 3TEYA 3VBOB 4QT6A 2FCUA 3H1MA 3O1TA 1OLQA 4GKXA 1ULGA 2BFUS 3ZFEC 3BUCA 1I6XA 1LR5A 2J1UA 3U14A 3KVAA 4Q4W3 1VBD3 4UFLA 3T2TA 1U0AA 2VOKA 3MIFA 3UKNA 4M0HA 4AI1A 1LKNA 5C3SA 2HWC3 4N43C 2EXKA 3J8F2 4YGEA 3JBG2 3EQEA 5IK7A 2YPDA 3LSEA 1WW4A 2YXSA 3MPBA 5C4WA 5BNOB 3R4DB 2ARAA 1MEC3 1OOPB 3LDBA 4D7SA 2TUNA 1ASJ1 1GZWB 3ZSLA 4HK9A 3O12A 4EN9B 2FDJA 2XQXA 4AQ6A 4XZPA 2ETEA 2QQMA 2XKPA 4BQ1A 4XDQA 4C1XA 3BN6A 2VAUA 4BDVB 1UXXX 1GQPA 2UY9A 2DCJA 2PHUA 3USSA 3U0ZA 1RUE2 1U5ZA 3FBYA 1ZVFA 2BDRA 2XJVA 4D3WA 5GZCA 5EJ1B 1U5YA 3I59A 3LA7A 2EXIA 3AXEA 4OI4A 2CYFA 1W6OA 3AMPA 1OURA 4HL0A 5D1IA 4A42A 2WT1A 4DRRA 3TWIA 4CP1A 3U75A 5IK5A 3OCPA 2EAKA 1NOVA 2OZ6A 2O1QA 2GC0A 4GH4C 1OA2A 2DBNA 4Z2AA 5IT6A 2PHRA 3ZXFA 2TNFA 4P9YA 3R4SA 3WF4A 1QWRA 4NHKA 3USUB 1J1TA 4CCDA 4WVZA 1OMIA 3KS7A 5K0UB 3S7IA 1UAIA 1LEDA 3KSCA 5GKAC 3ECQA 1WMEA 5L7OA 4HFSA 2Y6KA 4QGMA 3VKMA 3E5XA 5EWSA 4BISA 2XLAA 4COWA 2R7EB 2EVXA 3BALA 4NHYA 5DG1A 2GNDA 4CDWB 2IXJA 1RUG1 4Y1YA 3ZPOA 3HMYA 3RZLA 3MBWA 2FQPA 1AVBA 4SBVA 4MVTA 5ANQA 4ES8A 4YARA 3E6BA 1DGWX 3MDPA 3AJZA 1QIQA 5FUPA 2PFWA 1T6GC 2A6VA 2KR2A 4IXLA 1RUI2 2GU9A 4HPKA 4JKMA 4Y1ZA 5I0UA 2ZEWA 4H7MA 1V70A 4QDSA 5C4WC 3JXSA 3ZXGA 2ATFA 4Y5TA 1J3PA 3ZFGA 4Q4W1 1WCUA 1VALA 1VBD1 3WW4A 5FY7A 3HT1A 3WD5A 3H3LA 1FV3A 4N7UA 4BQYA 4BQ4A 3GCWA 2OX0A 1ZRRA 1MVQA 2IXLA 2XHKA 3N7MA 3RPQA 4V2VA 3C2UA 2QDNA 3U4XA 2EALA 4UW5A 1MEC1 2ZX3A 1GQHA 4FOWA 4KL1A 5A6XA 2OKXA 4OYUA 4GZ9A 3J9SA 4M3CB 5T54A 1B09A 3W58A 2N7GA 2GALA 4EN0A 4HN0A 2Y6FA 4LOSA 1SLBA 2Y6GA 2W08A 2E7AA 5FOBB 1J3RA 1HQNA 1PMHX 4FQZA 1SEFA 1W6NB 3DN7A 3KV6A 4XUOA 3W9AA 1SZBA 3BOPA 4P9XA 1UW8A 2RMU2 5FREA 5AFEA 4TWTA 5FYUA 3OOXA 4YG3A 4LBMA 3U78A 2P2KA 1JYWA 2WJSA 1AYN2 5FMOL 1F31A 1LJ7A 1W6MB 4NROA 3DXUA 2FMDA 4W6YA 3R0RA 2QQWA 1XE7A 1BEV2 2AREA 1IS4A 4ZXKA 5FXWA 1QOOA 3WXPA 1W0PA 3ZMNA 1YIPA 4W65A 3ACFA 3I49A 3OPZA 2FBEA 3D3AA 4P9LA 4WV8A 1R083 2FZ2A 2YG0A 1ENQA 2G19A 3SEEA 3FE5A 2PLV2 2WRAA 2ZKNA 3WY6A 1BQPA 3BPZA 1A8DA 2AUYA 5A80A 3AZYA 2GSYA 3VGIA 3I2HA 5KHGA 4XXPA 5DAVA 1HX6A 3VHOA 1S0CA 4WZCA 5A70A 1MR5A 5BNPA 3LGRA 2QE3A 3D0JA 1KRIA 3AFGA 2E33A 2Y33A 1QJX3 3C7FA 3WF3A 4CEWA 4Z92B 5FY5A 1Z7S2 2ZABA 1OF3A 2GP5A 4UFHA 4CUBA 2D6PA 2VZVA 4M4RA 2W5FA 3VBFB 4L8QA 1LOBA 1EUUA 2OQ6A 4Q26A 3VBUC 3KV4A 2XJUA 2RDSA 4YW4A 2NQYA 1QXJA 3LA3A 3K51A 3GYDA 2JDZA 3M1HA 1J58A 3ZXKA 2D5HA 3VKNA 4MX3A 4ZONA 3VKOA 5IVBA 4HSLA 2PA7A 1RIRA 1Q8OA 3VBRA 1AL22 1JH5A 4N53B 1PO13 2RS13 1FI2A 2A3YA 5CFCB 3H3UA 4ZU7A 4MXVA 1NKGA 1UOBA 2A3WA 4WM8A 4CRQA 3AL5A 5A1LA 4EN8B 4Y22B 4MZUA 2VY0A 4LQRA 4CCKA 5BNNA 4UF0A 5JXGA 3OBTA 4GB33 4QB1A 1W9SA 4B1MA 1S0IA 2GN3A 5A7QA 4YNIA 1O5UA 2X05A 4BOWA 2DTYA 2XVKA 1H30A 4NHMA 3ETPA 4ASKA 3RZZA 3O1OA 5L9BA 4IEVA 1AR63 1HW5A 3ZFFA 4LR4A 1DZRA 1NXMA 1WMXA 2KD7A 3BPSA 2XXZA 2DCZA 4YM0A 1W03A 1LULA 4YZ4A 5C8CA 4KGQA 4HMZA 3KHBA 4Q0UA 4CCNA 4YG0A 5HPOA 1A3KA 1OQEA 1UKGA 1SDWA 1W2NA 3PL0A 3WVJA 4AVAA 5FO7B 1Q8SA 1R081 2BFUL 5FUIA 2SLIA 5FWEA 5JAXA 5JXJA 3O1MA 1VRH1 5FP9A 5LWBA 2VE1A 3V65A 3TNPB 3DXTA 3J26N 4CEWC 4NPMA 2YBPA 1ENRA 1JMUB 4IGPA 4XE9A 4JDOA 2GMMA 1JYCA 2HWD2 5FZMA 5APAA 3U07A 5C33A 3OD4A 1CAVB 1F4HA 2Y26A 1J3QA 3K4ZA 5JIUA 3M4FA 1JOJA 1VAKA 1XPWA 3A0NA 4LK7A 4RN5A 5LW9A 1JZ2A 3LEMA 2WWSA 4ATEA 1QJX1 1QF3A 4AHWA 3H1WA 1HRI1 1Y4WA 4A4AA 2WZR3 3SISA 1CJDA 3TNQA 3S7EA 3PU8A 3VBRC 4CTEA 5ABJB 3WF2A 4QXBA 3T0DA 2LW8A 1CONA 3AFKA 4XBQA 5A7WA 1IOAA 1YC61 1ZZ9A 5K9YA 2KA3A 2WC2A 4BMEA 3PVBB 4WM8C 1QQP2 3NNLA 5DG2A 5FY1A 1ASJ2 2PQSA 2ZACA 1JYTA 2BGPA 5IUQA 5FMBA 4XIOA 3ZLIA 3WDXA 5BNNC 5J7MA 4HKLA 3W59A 3WCSA 2UWCA 4AGRA 5FRAA 1PO11 2RS11 1JU3A 1NCRA 4Q0QA 1GP6A 2HWF2 5JOXA 4IV1B 4BQXA 2ZA9A 1R64A 4BQ2A 3NRUA 4FPLA 3T2QA 3AVRA 3V64A 3MUZ1 4QPYA 2GDFA 4LHSA 2X10A 2BJSA 5KXBA 1PK6B 4FAHA 5C8CC 3G6JB 4RHV3 1QDOA 3WNKA 4LBQD 4M0NA 2WDBA 2NP0A 1W6PA 2IC1A 4I0BA 3ZR6A 4C0BA 2ARXA 2V5DA 2QBXA 4Y22A 2ADEA 1AR61 4IEXA 4B7EA 2WO7A 2VBBA 2FCVA 3ENRA 1OLME 4QQHA 3T08A 2XL9A 1AYM2 1SFPA 1EPZA 2R061 2JDPA 3OBRA 2FHRA 2W87A 2WYSA 1OFSA 4KMQA 2F4LA 3IAPA 3HIFA 1BVP1 4Y20B 2VZOA 2EA7A 3ZXLA 1QJFA 2XJSA 3DV8A 4IE0A 2AACA 5FYVA 3TAYA 3VL9A 1R1A3 2EIEA 5FY4A 4C90A 2ID4A 4CEYC 5EHDA 5DAXA 2IWGB 3NWKA 4PI0A 4YRDA 4AVSA 1LEMA 4RGAA 2AC1A 4XC9A 5EP9A 1WCDJ 3AP9A 4YW7A 5AVPA 4OI2A 4BXSV 3N9NA 5J37A 2Z5WA 4YZ3A 1FMD3 2NYYA 3BODA 4PLNA 1SBEA 5DAWA 2JG8B 4LO4B 2A70A 3VBHB 5F5IA 1D0HA 2VNGA 2E31A 4ZU4A 2VQUA 3Q8AA 5FZOB 4Q4W2 1VBD2 4UYBA 2GNTA 4OUEA 2HWC2 3IN9A 3Q8FA 1AJKA 1ENXA 1V00A 2YYOA 2W1UA 1W8OA 2H0BA 3CNAA 1UU5A 1UOJA 2ARCA 3P6BA 1MS3A 3VZNA 2FDIA 4MGQA 4GULA 2Y6LA 1UY4A 5EYXA 1MEC2 1OVSA 4XPVA 1F2NA 1LHOA 3WW3A 5FYMA 4P00B 5K4LA 5C71A 4OUMA 4P5YA 3T30A 4LTAA 2R1DA 3CMGA 4YVSB 5A32B 2QQPA 1QXPA 3FUQA 2R6QA 2WFF1 3RJRA 3H8OA 2IXHA 2CY6A 5FBJA 5JPMB 1QOSA 3NAPC 2JENA 3IIIA 2LROA 4PLOA 1BBT3 1UKRA 2X5IC 1XOYA 5LBFA 1LOAA 3I4IA 5IW0A 2DURA 1RUJ1 1EAH3 1UYZA 1SDDB 2JDNA 4HVRA 2GH2A 4AHXA 3DPRB 3N7JA 4XUNA 4FSJA 3M70A 4ARYA 2ZTNA 4JGYB 1C28A 1W9FA 1OD5A 2AGSA 5JZGC 3POBA 3AYDA 2WN3A 4D0QA 3L2HA 4RS5B 1IKPA 4UFKA 4XXAA 2GH8A 3DGTA 2VZ1A 4J25A 2ZEZA 3EHKA 2BERA 5B4NA 3AMQA 2C5DA 4YSFA 1RITA 3INAA 4OFGA 4QHBA 4DXRA 1R1A1 3ZN6A 3C3VA 5FFOC 1UU4A 3ILNA 3KT1A 1ND2C 5KHKA 1WUVA 4YM3A 4IV3C 1B35A 1VMJA 3MO4A 3A21A 1VBB2 1XQNA 5FZBA 3RFRA 4Q1PA 4AHZA 3NNJA 3RI9A 2CU5A 1FMD1 1MQTC 3JZVA 5E6HA 3SC7X 4XACA 2OVUA 3U11A 1RUF3 3IDEA 1OBNA 5LA0A 1D2QA 3OUIA 4Y1UA 3AK0A 1XNTA 3WG1A 2WNVA 3AKRA 3FJSA 1M4WA 3MLLA 3RS6A 2G9ZA 1IS6A 1CZTA 3WW2A 2HEYF 4K20A 4YGBA 2A71A 4P9WA 5FLHA 3HAGA 2E32A 1CAWA 1FT9A 2VTFA 1YHFA 3LFMA 5BUVA 3RVHA 2ZGNA 3IDBB 3NNGA 1A34A 5LA9A 5AFBA 1QJY1 1JXNA 3DCQA 5FYBA 5CFDC 2F4PA 1PZ9A 1HJGA 5FZIA 1JYVA 3KF3A 4PDWC 4TLGA 2HWE3 1WCKA 4FCAA 1VBC3 2AEZA 3H1YA 3FFQA 4DIQA 2BNMA 5JSRA 4CU6A 3E5UA 4BPZA 4N8MA 4UWDA 4K3UA 2AEYA 2Q5TA 3VDDB 1BBT1 3RI8A 4GWMA 3O1PA 3Q9OA 1IQDC 1ZRIA 3PTRB 1ULCA 2OUHA 5JXHA 2VCBA 1C3HA 3GCXA 5T50A 5LB6A 4AFDA 2RS31 3VBSB 1CQ9A 4MH0E 5FO9B 4FQ4A 2Y6HA 3AX4A 2Q4SA 3I8TA 3NJYA 3VD3A 2VVDA 4QHZA 2HH9A 3ZYGA 5C9AA 3LDRA 1XBFA 5E1RA 2G1MA 5CISA 1AXZA 2JG9B 1DDLA 1NQDA 1UU6A 3JB4C 1ULOA 2B9UA 4EWEA 4JGZB 5L36A 1VPHA 3CQOA 3ZYRA 1NXD1 3WNOA 3IMMA 1VLNA 3LA2A 1UY2A 1QJX2 4N90A 3MGUA 3RQ0A 5LK5A 3VD5A 4HK8A 3NNFA 1EY2A 1GZ9A 1RJ7A 3K3OA 2W2IA 3POYA 1RUF1 1LB2A 4IE5A 4OZXA 3ES4A 1S0JA 3OBZA 3LCPA 1W39A 2JE9A 1D4VB 5BPXA 3KB5A 3VN4A 3ETQA 1WBFA 2R30A 2R32A 4H7LA 2GAUA 1QKQA 3E5QA 4BA6A 4DO0A 4GD4A 1KQRA 5A6QA 3BU0A 1LRHA 1MS9A 3AL6A 2JEMA 1NCQB 4M01A 3GF6A 5TSWA 3VD4A 1TME3 5H9PA 1PO12 2RS12 5JR2A 4WM7A 5LASA 2RR13 5IHRA 3AYCA 2VTXJ 5F3EA 3VZMA 3K2OA 1OHFA 3IDAA 4MGZE 3E1F1 2HLEA 1EUTA 1DIWA 5GLVA 1Q3EA 1H4HA 1NLSA 2OPKA 4GB32 4GJZA 4AI2A 3THDA 4DQAA 1BKZA 1F9KA 4QGNA 3UETA 3ZYFA 3RYRA 2OUJA 5FP7A 3TYJA 1H4GA 2HWE1 1QH6A 1VBC1 2CWMA 4M3CE 4RFRB 5LEKA 1I1EA 1AR62 4BK5A 1ULDA 1W05A 5D2AA 3KM5A 1ZBA3 3DUIA 3Q8CA 1NT0A 5FPLA 2ZEYA 2GNBA 4IE7A 5FYIA 1SACA 2ZAAA 3HNMA 4QDQA 2VBDA 4XFAA 1VP6A 4XURA 5C8WA 4WVWA 4XYXA 1W9TA 1D4M3 1QXRA 4QPIC 2RS53 4Q2FA 1XNBA 1W3XA 3NKTA 1OUSA 4Y4YA 1AL0G 1GICA 3E97A 5GLTA 4EROA 1ACCA 1W04A 1OPMA 4O9EA 4Y26A 3THTA 2AZ5A 5C3PA 3TEWA 4EWAA 2ZJCA 2CGPA 3GBGA 4GJYA 4KBZA 4XEZA 5JR7B 2ZHNA 3RWNA 2XLFA 3BKZA 2LRPA 2VTXA 4CXXA 2LTNA 5FTTC 2R0FA 4AQTA 2DVBA 5FPZA 3POIA 4JHTA 1MZ6A 2DTWA 1R093 2WZR2 4FXKB 4NWVA 1J59A 5LCWL 4LIUA 1SQ4A 2X09A 2MNGA 3MW4A 1DQ1A 4HSJA 1BVVA 1O3QA 2BNOA 4FPEA 5FZDA 2VBPA 5T5LA 5J96B 1O59A 2WZEA 4QX7A 5FZ4A 5GLZA 3EXUA 4OULA 5JSOA 2JWPA 2E26A 2OPWA 2B7YA 1HN1A 1MACA 2XBO1 2XL7A 4ISQA 2B45X 1P8JA 1ZBE3 2WNOA 5GZFA 4MG2A 4X8PA 1LAJA 1TME1 2BUKA 2VQ0A 3MIBA 4K8FA 2B4KA 3CJXA 2OZJA 2WLPA 4LO8A 5FZKA 3UKVA 1YYNA 3QD6A 4DY3A 1X7NA 3VZKA 1RVF3 4M00A 3AZVA 5LEJA 1GYKA 5C3OA 5C4WB 5F7UA 1LCLA 1TMF3 1ULPA 3T2PA 1C1FA 4RHV2 2RV9A 1SBDA 1UNBA 4KU8A 1LODA 3ZFEA 4EZHA 2V73A 3C7OA 2QCSB 5A3UA 1DQ6A 3FHAA 4XFIA 5FXVA 5B2GB 4MHUA 4XOGA 1YWKA 1IPSA 1ZBA1 4P14A 1O3TA 4Z2WA 1WD4A 3I3EA 4N43A 3O7OA 3GZEA 1WLWA 4Q4V1 2W91A 4O65A 4E27A 5GLWA 5F6KA 3VKLA 4XF9A 3AKQA 3DF0A 4AVCA 3I59B 1D4M1 2YHJA 2RS51 1R1A2 5DAQA 2OA2A 3LEKA 3AP6A 1W6OB 3N36A 3ZYPA 2WT0A 3V0AA 4XJAA 4DB5A 5T5JA 3MYXA 3L2YA 4BHPA 1SCRA 2IUWA 4BE3A 1W0OA 5DXDA 5IAXA 5FY8A 4OVEA 5D8AC 2BZDA 1UZ0A 4BH9A 1AX2A 2X53S 1K12A 4CP0A 1XSQA 3PLQA 4KGGA 3B3QE 4LO7A 4X6RB 2XUEA 3ZKUA 2WT2A 4JTNA 5KR7A 4QX0A 1EYBA 5JPNB 1GP5A 5L7OB 2A73B 2YDEA 2JICA 2XJTA 2J1AA 4E4DX 1R091 4O7XA 1QJEA 2C1FA 3S0MA 2HYXA 2W1QA 2GZWA 5IVJA 1ZZ8A 4GH4A 4YFWA 4LXLA 3BIEA 2J7MA 2YFZA 3DEMA 2GC2A 4XJWA 4DZGA 1RUG3 3D82A 1TG7A 1VMFA 3FX3A 4HPKB 4QQOA 3WLUA 2P3IA 4E2GA 3BB6A 2JECA 4RQPC 1K5JA 1ZBE1 4FOQA 3ZFGB 4RR3A 1RUH1 2WAAA 3MIGA 2WKKA 1OA3A 3LOIA 4UI9L 3I2OA 1AR83 5KBFA 5GALA 2GMEA 1RVF1 4IQPA 3IB3A 4S2DA 5DDJ3 1BBT2 1DG6A 1TMF1 1VBA3 4XMIA 1TE1B 3O1VA 1DGRA 5GZDA 4TTGA 1EAH2 4XUQA 1SLIA 4UBGA 1SLCA 1ZNPA 2BWCA 1OLRA 4R9BA 2ZGQA 2ZGOA 2QQVA 3FC0A 4P02B 1JZ3A 3O14A 5F3GA 3T2OA 4Q4Y1 2CGOA 1KS4A 4CZSA 3ZVXA 1WW7A 5L9RA 1S4CA 2P6HA 4LULA 4IGQA 3SH4A 4GKYA 4YW3A 1V6MA 5SV8A 4FT8A 2FDFA 4L99A 4HKOA 3CO2A 3OEAA 4PJYA 2VOTA 1S0DA 1OC1A 1O8PA 2YPJA 4YVWA 4XQWA 5FYTA 3D5OA 1UQXA 4O61A 1JUHA 2P5BA 3B00A 3I2DA 5L19A 1PGL2 3NNMA 5KHIA 3U1XA 2JJ6A 3B93A 4A44A 3W5NA 5BNPB 4E4HA 1PVC3 4OCTA 3RMYA 4CEWB 2A5ZA 4OQ9A 4CP9A 3RJ2X 2G9FA 2D43A 4PQ9A 4RR3C 1ZRCA 1UD1A 2W68A 5LATA 3ZSMA 2NZ9A 1NE6A 4GALA 5AC93 4NO4A 3HVDA 3WSOA 3NMBA 5FPUA 2BGCA 5A7SA 4OMCA 5LRSA 2XH6A 1DGRN 1FNZA 1PGW1 4FOVA 3T1MA 1DQ5A 1N3QA 4UFJA 5CEHA 3H7YA 5FR3A 5IVEA 5JLVA 1YI7A 1DBNA 5EJ3A 3VBRB 5J09A 1AR81 5IAVA 3ZXJA 3WG3A 3E6CC 4IEPA 4XILA 4QM8A 1JUIA 4W50A 4CCEA 2XOMA 5FPAA 2R043 2W1SA 3JD71 4HG6B 4Z07A 2FDHA 5DDJ1 5FZFA 2VZPA 4WM8B 3ZDSA 1I9RA 1SFYA 1VBA1 2VNVA 2ZZQA 4UT5A 3VBUA 3A22A 2JX9A 2XPJA 3WINE 2EIDA 3ATGA 4CDQA 2DVAA 5BNNB 4UF0B 3ZR5A 2DVFA 2P3KA 1N1SA 4XAAA 4I0WB 3DKWA 5T52A 2B5HA 3AB0A 1COV3 4B7KA 3IAQA 3I3QA 3KV5A 1MZFA 3KZ4C 3WQ7A 1TZOA 3ITQA 1G8WA 4YVWC 3CZJA 3ZFFB 1ND3C 3OY8A 3TEXA 1IG0A 1JYIA 3L9JT 4AZZA 5FOJB 5C8CB 3OJBA 1EV13 1TQ5A 2ZPXA 5BXXA 1QJZA 2YU2A 1N3PA 4XFCA 4E2QA 1YUDA 4MGIE 3WT3A 2YFUA 4MXWA 3WX5A 4AL9A 1OVPA 5EXOA 3HBKA 2XHNA 5G04L 1UYYA 5CB7A 2V4VA 4CU7A 2RG4A 3M3OA 2VVEA 4KWLA 1A78A 1VRH3 4R9CA 2ZHMA 2MEV3 4PCRA 2D6NA 1X9PA 3N9PA 3F95A 3O0WA 4LKSA 2VZQA 1RMU3 1PVC1 1O8SA 3VB9A 2WO3A 1VBE3 1A8MA 5DPNA 4BK4A 3GZUC 1YQCA 2FCTA 1W9WA 2BGOA 1TME2 2HWB3 3VDAA 3RNSA 1RL3A 5J48A 5AC91 2RR12 2C6SA 4JKLA 3WV6A 4AGVA 3U37A 2RM23 5A7WB 1X33A 1HRI3 1O4ZA 2WAOA 4N7IA 1RC6A 4XHBA 3UGGA 5JSPA 3H9AA 4IGOA 3SKVA 4XJ8A 4YPJA 1CR7A 4WVVA 5A6YA 2D40A 4NRQA 4TXWA 4CDQC 4CVUA 4FPYA 4A45A 4QQPA 1NCRB 5FPVA 3EB7A 1NYWA 2R041 5L9VA 1ZZ7A 4JX0A 3BTXA 3FZ3A 2VR4A 4KG8A 3ILRA 4QHOA 4ZPIA 5KC5A 4F83A 1H2KA 5L73A 3DYPA 2XB6C 2D3SA 4H2AA 2NLRA 3VBOC 3ORJA 1D4M2 3AMNA 1ST8A 1OKOA 4S2GA 1ZZ6A 1U5XA 1W6PB 4MUVA 1COV1 4BZ4A 1RYYA 2A75A 2Z79A 4FPGA 1ZREA 2WQ4A 1G9CA 1N47A 1UZWA 5JVVA 2DUPA 3C7GA 1SPPA 2PTMA 5GZGA 3RGBA 2NM1A 3WCRA 5C5UA 1SLLA 1QNYA 3HBZA 4BMBA 4XFBA 3WG2A 1S0BA 1W28A 4QB2A 1EV11 1JN2P 2D6LX 4IE4A 3EYPA 4PLMA 2ZGUA 4NIIA 3T4VA 3TB0A 2V5YA 1G7YA 2ZEXA 2OT7A 3S5QA 2BQPA 2R063 5JXIA 1ZZBA 1HV1A 1REEA 1UPSA 5LRRA 3MF6A 4YLZA 2VXRA 1R092 1UMIA 1WBLA 4NIGA 2Z42A 2ZOEB 3CU7A 1POQA 4HLTA 2O8QA 4XFGA 3WOGA 1V6KA 2IXIA 2PHLA 4QX1A 3HNBM 5FYZA 4MO3M 1AXYA 1AZDA 2K2SA 4S2FA 2BV4A 2MEV1 2UY8A 5FCCA 1MVEA 5IVFA 1ONAA 4QX3A 4H3WA 4X8NA 1UL9A 3JQXA 1VAVA 1RMU1 1MZ5A 1ZBE2 5CZKA 1VBE1 1LU2A 5FZ3A 3OSDA 3POWA 2A6YA 2HWB1 5CAZA 4CEYA 2GMPA 2JE8A 1IKQA 4COVA 1G9BA 2QQUA 4MV2A 2EIGA 5F32A 3WDVA 4A3XA 1UXZA 1RVF2 2RM21 3R05A 3POGA 2NMOA 2H6BA 1MS0A 1AX1A 3ZM8A 1TMF2 3ZSEA 2VZTA 3D6EA 1O6UA 1W8HA 4QWNA 1ALYA 5K0UC 1GWMA 2J42A 2K0GA 3OG2A 2H6CA 4E2SA 4EQVA 3OYWA 2AYHA 1UZYA 3THCA 4CUGA 4QKFA 1NQJA 1S2BA 5ACA1 3QCWA 5IK4A 3FLPA 1Q8VA 5F39A 5HCHA 5FXZA 4CDWC 1JW6A 1HIXA 1ZA7A 2UWBA 3A7QA 4JRAA 2UYBA 3DKQA 3KGZA 3OD0A 4AQ2A 1L7LA 3WP4A 4ZS3A 2DCTA 1MS4A 3TN91 1HLCA 2DCYA 2WFF3 1EP0A 1PIV3 1S2KA 2DU0A 4AFMA 2SBAA 2A6XA 2E6VA 3HD8B 3UK9A 3ACHA 4ZHNA 4DOUA 4UOJA 4LUMA 1RUJ3 4JDMA 3O1SA 4NHLA 2A7AA 4MGTA 4IL7A 1WA6X 1JZ7A 2JIJA 3VD9A 3NAPA 3O1RA 1RJ8A 4LBNA 2X5IA 1HB2A 1V6JA 1YFYA 3PVOA 3ZN6B 1X8EA 3KCXA 2E7TA 2RE9A 4XF0A 5J98B 4BB3A 4U2AA 1YJLA 5JIAA 1V0AA 1B35B 2PAMA 2JDUA 3VDBA 4DFSA 2YC4A 5ERLA 2Q8DA 2KXLA 4XCBA 5JZGA 5GLUA 3FHIB 3UGFA 3W20A 5JI7A 5IK8A 1RUG2 4IEUA 4FPCA 4WBBA 4XTPA 1PX3A 3ZYIB 2WNVB 3KQ4B 1H1MA 1QGLA 2VGDA 1ND2A 2YC0A 2YC2A 4KH9A 1ZRDA 1ULEA 2BOIA 2VULA 3CHXA 4IV3A 3WDTA 5FLIA 3MLKA 4M3CF 4AI8A 1VMHA 2PHFA 2WUHA 1CAWB 2JB8A 3N7LA 3BU7A 5DDJ2 3VZJA 4AF9A 1MQTA 4AVBA 1DGLA 3OGSA 3WDYA 3H8XA 4OI0A 2PYTA 5A3LA 4HXCA 4B4PA 1YQ8A 1AR73 3N9LA 4XIKA 5HXVA 2Y0IA 2Y6JA 3HQRA 2FD8A 1GOFA 3IIAA 4EN7B 5G05L 1QJY3 2WFPA 5LZ6A 3U10A 4R4XA 4ES9A 4QKDA 4KU7A 4UXAA 1QU0A 3VBFC 5J3UA 3SH5A 3CBNA 1PIV1 4HONA 5LK7B 1VB2A 2ZGMA 3B69A 5M0TA 1DYOA 2EAAA 5FZ6A 3RZJA 2JE7A 2IZWA 5CG9A 4QXKA 1LTEA 3LB9A 1RB8G 2VZRA 3PVNA 1V6NA 5CFDA 4OQ8A 2BW8A 4FBFA 2WIIB 4PDWA 4J1XA 1CIWA 2WS93 3LPGA 2RS33 5C9AB 4XAEA 3NKGA 2OS2A 2JDMA 2YROA 3BOWA 3CJIA 5A3TA 4SLIA 3X29B 1IG3A 4B3NA 2A3XA 4BM8A 3RDIA 4A6SA 2CHHA 2WABA 4LA3A 1LGNA 2ZMLA 3OUHA 2PAEA 1CVNA 3SITA 2X29A 1DQ0A 1WKYA 4EN6B 1RUD3 2WWJA 1C5IA 3GM8A 3I2IA 3KWVA 5AC92 4J6GA 3GNEA 4B1LA 1O4YA 3JBG3 5F3IA 1JU4A 3PIJA 1HXS3 1HRV3 4E4SA 3ZIWA 4AR2A 3KCYA 2DDUA 2MPFA 4B29A 3ZN4A 4BWOA 5LA1A 3NQHA 1BYHA 3ELNA 4LLOA 4XHXA 2YUEA 5FV3A 5FZ8A 4AEMA 4R52A 3HOBA 4JHZA 4CDUA 4D7YA 4AEJA 1QDCA 4DUXA 4Y5SA 3AZZA 3WQBA 1DLCA 2D44A 3GGLA 3LIGA 2MHFA 1FOD3 4XDOA 2Z4FA 5CNAA 5DN2A 3V56A 4AEDA 4F7ZA 2YZ4A 4WM7B 2R042 1Y3TA 2P4EA 2QJVA 1CIYA 1L7RA 1DCSA 3P3PA 3KHCA 4QPGA 2B8MA 2BYVE 4GMP1 3UNPA 4IUGA 4GIQA 4QGLA 5FMDA 2ZGSA 1W8TA 3M3CA 2YMZA 5FP3A 4BJ0A 3W5MA 1AR71 4Q5OA 3LAGA 2LUWA 2E7QA 4AXOA 2XMLA 1GNYA 4CU9A 3GHMA 1MPXA 3EO6A 1NE4A 1GQGA 4GQ7A 4XFFA 5LA2A 4FPJA 4INDA 1CAUA 2IXKA 3CL1A 1XYNA 2ZMKA 3SCGA 5CKQA 5HV4A 3NV3A 1T6BX 3I2JA 5CU1A 1GOHA 3AM2A 1C1LA 3AJYA 4RFT0 3T09A 4C8DA 3CJIC 4XF4A 2PXJA 4L97A 2VW1A 3ZOIA 2TEPA 3IPVA 1H6XA 3QOPA 1OT5A 3M3IA 4Q29A 2ZXQA 4E9KA 3ROUA 1IQAA 2W52A 2ZMNA 5FZ0A 1CJPA 1REDA 4YWAA 5A3NA 3PIGA 1S0GA
chains in the Genus database with same CATH topology
2C9AA 1Y9QA 2WS91 2PHWA 1R082 3ASIA 4R4ZA 1VRH2 1BJQA 4C0HA 1KFXL 3HT2A 3LKJA 1KS5A 2IXCA 4L9BA 4LE4A 1BMV1 4LO5B 4NN0A 3NO8A 5I91A 1SMVA 1RMU2 2NPIA 1K5MC 2P34A 3LOBA 4QPIA 2LALA 1JBCA 5FAXA 2HWB2 4CDUC 1RUD1 3G7DA 4P9JA 1NLRA 3O0VA 2D98A 3JBG1 4XETA 4AEDC 3BIWE 1RUOA 1HXS1 1HRV1 2RM22 4U36A 1HRI2 2HJIA 4BLIA 1GR3A 1LU1A 2DUOA 1Q8PA 3MFAA 4GMP0 3LZZA 4Q1RA 1AR93 4QPGC 1D2SA 1FNYA 2P37A 4FPFA 3URFA 3WG4A 3D0SA 1FOD1 4XMAA 1DQ4A 4KBBA 2XBO3 2K9ZA 2RMU3 2ZX1A 4ONUA 3MI8A 1YFXA 1PO23 1RUE1 3MPPG 4KWKA 4XBNA 2G9GA 1X36A 4I3GA 3ST7A 1DGWA 3AP5A 5CBLA 2WSVA 4N9IA 1IS5A 3PHMA 5EYYA 3ZFEB 2BTVC 4IEQA 1IS3A 2UU8A 3QACA 1YO8A 1UPIA 4N43B 1YI9A 1H8TC 2D5FA 2RJKA 3KD4A 1LOGA 4YZ1A 2BWAA 1DU3D 4E4ZA 1AHSA 2TBVA 2Z2SB 2R062 3ZSJA 2XKOA 1N1YA 4Q4V3 1W6QA 2IFWA 3V0AB 2XJRA 1JTZX 2JKBA 1Z7S3 4YVSC 1CESA 2VOVA 1XNDA 1PZ8A 2YY1A 2BVBA 4KNCA 1LOFA 1PVXA 1R1ZA 4MGYE 3SLIA 2FZ1A 3PJYA 1G86A 2D93A 3DPRC 4ASMB 5H9SA 1MS5A 4GH4B 1A6CA 2G4IA 1WMFA 5D8AA 3SXWA 4RS5C 4I09A 4NPRA 1ZA4A 5JOZA 1G9FA 1AR91 3N4MA 3POSA 1Q56A 1ULFA 3NL1A 4FPOB 3VZLA 4CDXC 2DYCA 3GBWA 4RR3B 3H8UA 4LHKA 5I8TA 2HKXA 4YYOA 3PMEA 2RMU1 1X8MA 4IEZA 2WSUA 1PO21 1NA1A 1AYN1 1H0BA 1OQ1A 1RUH3 3ZO0B 2WFF2 1LOEA 1BEV1 1PM7A 5GJ6A 4DY5A 2PHTA 1U5IA 2I74A 3AP7A 5JWPA 3EJKA 4RQPA 1WLDA 1PZ7A 1RUJ2 3B7MA 3M7AA 2Q8OA 4L92A 5FMOS 4BIFA 3KMHA 4WVMA 2HWD3 3MICA 4JVAA 5HCBA 3IWZA 4Q4Y3 1LOFC 1POV0 1RUC3 3MLJA 2F6BA 3EBRA 1ENSA 4K1YA 2ZGLA 4YVWB 4LHLA 1Z7S1 4RA0A 3S6PA 4YG6A 1V6LA 1AXKA 3I54A 2VMIA 3MZHA 1BXHA 5HI0A 1LESA 4AVTA 5JOWA 1F8VA 1FMD2 2ENRA 1WGPA 4FTBA 4ORFA 3MFCA 5GZEA 3AYAA 4AW7A 1TEIA 1JHNA 3ZIXA 4HANA 3VBSC 1WMDA 1ZX5A 1KDKA 4UBHA 2RJLA 1VAMA 4FPKA 4ISRA 5HBAA 4L2NA 2QNKA 3PJQA 1HKDA 5DUVA 3ME2A 1NA1C 5F1RA 3IBMA 1YLLA 1RHI3 2JG9C 3FWEA 3DL3A 4GWNA 1SCSA 1AR72 3AXDA 5K7PA 1F5JA 1UMZA 3WHUA 1VB4A 1QJY2 4Z82A 3WUCA 1V9U3 2ZBJA 4O9GA 4BIOA 1YCIA 4ZKTB 5BYNA 5E16A 2ZKLA 1CAXA 3VBUB 1PHMA 4YW1A 4CDQB 3JD73 1HV0A 4TYSA 5JDBA 1GKBA 2VMHA 1O7FA 1UF2C 1DZQA 1WLTA 1NCQC 1OKQA 4AGGA 4Q8KA 2WS92 2Q1ZB 2RS32 4L11A 3OY8B 2HWD1 1OFNA 1W2UA 1CD3G 1RUC1 2R16A 5FDBA 1LENA 2GC1A 1BMV2 1IPKA 1NY71 4MSVA 4KG0A 4YZ2A 4JRLA 3NVCA 1WW6A 4AK3A 3V0BA 4K40A 1UX6A 4MXWB 2XGXA 5KXCA 3I7DA 1RUD2 1CX4A 1V6OA 3LWCA 1BCXA 1FXZA 1HXS2 1HRV2 1ZZCA 1ND3A 2P17A 1H1AA 4C91A 3ES1A 1QQP1 1IPJA 2ZZJA 3CLPA 1KD7A 4LBLA 1RUF2 2WNUA 3HWJA 3O5SA 4ASLA 4IEYA 2XLGA 1FOD2 3MIEA 4XF3A 2HWF1 1G9AA 2VNOA 4Q4X3 1WLCA 3M2MA 2BNNA 4RSUA 1PMIA 4LUKA 3OGGA 2BEOA 2VH9A 1PNFA 3ZXDA 1RHI1 3AYEA 1SBFA 3JCIA 4Y5Z0 3LSDA 1QMJA 1UCXA 3ZXAC 3KLSA 3FLRA 2I45A 4IETA 2PELA 1LGCA 5KXEA 4G4FA 1V9U1 3D4KA 2Q30A 2QFEA 5F9TA 4P9IA 1AYM1 1CPNA 1RUNA 2HWE2 1VBC2 4B8EA 2PN5A 1HQWA 2WZPP 3TOJA 4Y1VA 4AE2A 1UN1A 5A33A 3H7JA 4YZ5A 1VBB3 4RGGA 4DXZA 2AH2A 1AX0A 3VHRA 4MLOA 3IKWA 1YXWA 3NJZA 4IEOA 2ES3A 5FQ0A 4YGCA 2BBVA 3VBOA 1F5FA 4COUA 2HWC1 2WNUC 1DZTA 2VW0A 1LGBA 5K8SA 2WA4A 4XTMA 3D8CA 1M06G 2A6ZA 3IMNA 1AR92 3JU9A 4META 4UW3A 3ZN5A 3QBQA 3VZOA 1LHWA 4CP2A 5BNOA 3QLQA 2EXHA 4I02A 2D3RA 1OOPA 1N1TA 3NV4A 1GZWA 4CEYB 1AUYA 2XBO2 4Q4X1 3SMHA 1PO22 2XG3A 4D7TA 1XRUA 2D3PA 3M3EA 3NW4A 4J1WA 4COZA 4JV4A 2Y0OA 3B02A 4AFCA 3MEPA 4TSVA 3R4UA 3OYWB 4D94A 1E57A 5L7OC 4NOTA 5I0TA 4TLFA 5HCFA 4BCUA 4F8AA 3ACLA 2QKDA 1XE8A 3T1LA 4H14A 2P3JA 3CEWA 5ACA3 1GBGA 3VV1A 1ZBA2 3JUUA 5BNQA 3ZSKA 4FXGB 4MYEA 3KCCA 3USUA 4DNYA 4Q4V2 5K0UA 3TN93 5BY5A 4LT5A 2WA3A 4FAGA 3ZFGC 4Y24A 2PHDA 1VBB1 2RS52 4XJUA 2XVLA 3IDCB 5T5PA 1GNZA 2ZGKA 1H9WA 4CDWA 5JCTA 2AR6A 3NAPB 2ET1A 3BCWA 4Q8LA 1H2LA 1FX5A 4LBKA 2X5IB 4OLLA 4HETA 2ZX2A 3GBFA 5EV7A 5I0RA 5BNOC 4PBOA 3AMMA 1OOPC 4G9SB 4YW2A 5CG8A 4Q0SA 1TNFA 2E63A 2DFCA 4K1ZA 5JZGB 2ILMA 4Q0VA 1OSGA 4AYUA 1UIKA 1O91A 2UWAA 4XJ9A 2A6WA 2XWJB 4K9SA 3ZYJB 2KM2A 1ND2B 1XU2A 3APBA 4M3CA 3VKFC 4A7YA 4IV3B 2VOXA 3RG0A 3B9IA 4COYA 5A3MA 1W6NA 3SCFA 4B4QA 1RUH2 1QH7A 3BTAA 1DYKA 1MQTB 2PHXA 3AKSA 1DQ2A 3M8LA 3P3NA 1S1AA 1W6MA 4PF5A 3VL8A 4HKWA 4YW5A 5BNPC 2QZ2A 4WZFA 4AWDA 3WUDA 2C0ZA 5GM0A 5BV6A 2R073 4I01A 4OHXA 4BLJA 4PIZA 4AFAA 1X82A 3KT4A 4Q4Y2 4LBJA 1LHVA 1RUC2 1NY72 4XF1A 4P9GA 1ZRFA 3VUOA 3UV9A 4K7JA 3WQ0A 4X6QB 1MS1A 4BYYA 4A2UA 5CFDB 4LHNA 1CGPA 1SLTA 4PDWB 4FP2A 4QX5A 4I2OA 2VQAA 3VHNA 2CV6A 1C8M3 3CJIB 4HN1A 3VBFA 3HN1A 1RTVA 3IT8A 2HYKA 5I0SA 1REFA 4Q27A 3UKTA 1V6IA 2VU9A 3MIDA 4LLFA 4XJZA 4AFBA 2FMYA 3SCHA 2WNEA 2WLQA 5CA6A 1IGOA 1O3RA 3WQ1A 3ZFFC 3N35A 4N53A 4LNVA 5T5OA 2OW4A 2WINB 5CFCA 1AF9A 2ZAHA 1RHI2 1K5MB 3N7KA 4LBOA 4GB31 4NR1A 1WA4A 2H0VA 5DZGA 2E53A 4LBQB 4CDUB 2I2SA 1XNKA 1ZYBA 2ZGPA 3IM0A 3MF9A 4CYDA 2D6KA 4AEDB 3JB8A 3SNMA 4OHWA 1PGW2 1V9U2 4R9DA 1O5LA 4B4RA 4DMIA 3UJQA 1FYUA 4PIYA 5CVRA 4QPGB 1AR82 4PIXA 2QDRA 4YM2A 2NMNA 3GHNA 4LE3A 1O3SA 5SV5A 1OA4A 3JD72 1CN1A 2YGMA 4QQ2A 1VBA2 4GMP3 2OIIA 2B42B 2LM3A 2ERFA 1CAUB 4A7KA 2R071 1H1IA 5FLJA 3IPVB 1QY4A 1XYPA 1UZZA 2GC3A 3HR9A 3MW2A 2I07B 5KHJA 1CAVA 2WZR1 2DU1A 1FPN3 4DRVA 3WNXA 4I0AA 1XNCA 2DWRA 3TRSB 1H8TB 4W6XA 1SFNA 1C8M1 1NCRC 3A0KA 3GZAA 4OI1A 1KFUL 4EV0A 3AP4A 2DVDA 1QJU3 3KT7A 4K21A 1QHDA 5ABJA 2DF7A 2ZCWA 5E89A 4N53C 2D7FA 4QMAA 3FLTA 4QM9A 5CFCC 3N3HA 5FBZA 2B46X 4QPIB 1Y7BA 4FP3A 5I8SA 5E8AA 3RRDA 3JQWA 2PQQA 4HBNA 1PVC2 4Q4X2 2ARBA 3MW3A 2JD4A 4XQ4A 5CIRA 4YGDA 4IV1A 2ZGRA 1URXA 1Q8QA 4RHV1 3J8F3 4OHYA 2XJQA 1FATA 1EPWA 1MS8A 1Q43A 2HEVF 4N9HA 3KQRA 5AVAA 2ZX0A 3B5LB 4FTSA 1K5MA 1PK6A 2Q1MA 4LBQA 2WL1A 3SHRA 5T55A 1BZWA 5DUXA 2V09A 4QD2A 1SLAA 1C57A 4CDXB 4F3JA 4P5HA 1RUE3 2E51A 2R0HA 1VR3A 3QH7A 5KWRA 2RHPA 4IEWA 2D6MA 4Y20A 2DVGA 4IESA 4OHZA 1KXGA 2VECA 4XW3A 1GANA 4NVPA 1COV2 1N3OA 3NV1A 2O8OA 3PMSA 4DS0A 3ZPYA 4XBLA 3AMHA 3B9CA 2EXJA 2EF6A 4QQLA 4C1WA 5ABJC 3S30A 2JG8A 3RSJA 3OGJA 1EV12 1FPN1 1N1VA 1DF0A 1W6QB 3VBHA 2DFBA 3FFZA 1YRZA 3R6SA 2XJPA 5JMCA 4V1PA 3GZTB 2B39A 4I3PA 4FTEA 5KC6A 1LOCA 1QJU1 5HCAA 2ZHKA 1H8TA 3CF6E 4JCKA 2AENA 2IFRA 3NSTA 1GFF2 4IV1C 5DUUA 4ZU5A 5JOYA 2MEV2 4Y1XA 1RINA 2CAVA 4OHVA 3VHPA 1RUI3 1POV3 3MIHA 4H55A 1FV2A 2YGLA 1YNAA 5DUWA 1LHNA 1QNWA 1PK6C 2PAKA 5A32A 1VBE2 4YVSA 2O0OA 4JQRA 5D8AB 2DUQA 4RD7A 2JXAA 3J8F1 1EAH1 5KXDA 4LO6B 1VIWB 2BPA2 2Z69A 2D97A 2CL2A 4URTA 3AZXA 3J4UH 4YFZA 3ZX7A 1B35C 3DPRA 3PTYA 5T3NA 5F5QA 3UJOA 1NA1B 3H3ZA 5F6LB 3OTFA 3WR0A 2W39A 4JGYA 3WP6A 4Z1VA 1C8NA 5ACA2 1DLLA 1KITA 4RS5A 4KWJA 1AYN3 5C6CA 1C4RA 3TN92 4EJRA 2DCKA 1BEV3 4HVOA 4RQPB 4CDXA 2WNVC 1MZEA 2VMGA 2JG8C 5J36A 3VBHC 3FUOA 1PGL1 3H50A 4AEKA 1IZ3A 1KJRA 4WVMB 2PLV3 2DV9A 4JC1A 2W0XA 2CNAA 1G9DA 4AHYA 4AI3A 2D6OX 3H0OA 3QH6A 2UURA 4I30A 1PGSA 1H9PA 3M3QA 3ZXEA 3B01A 1I3HA 2X8KA 4OUSA 4UW4A 4XFHA 1NZCA 1DFQA 1BK1A 1RGSA 3AKTA 4A7ZA 2Y38A 2QVSB 3AZWA 3ZMOA 3A4UA 5H9RA 1RUI1 1POV1 3PNAA 2ZX4A 4FOYA 5E88A 1XYOA 1APNA 4YM1A 2VOWA 4R8HA 5H9QA 2ZHLA 3NV2A 1HDKA 1XXNA 1Q5OA 5C9AC 1AL23 1H2NA 4JGYC 4FPHA 4Q0PA 3UL2A 3VDDA 4XQDA 1S0FA 2OYZA 3VLBB 4GA9A 4FVVA 4TZDA 1ZM1A 2VG9A 1Z78A 1G6NA 4PBPA 3VBSA 3ILFA 2R072 3HQXA 4UW6A 1NG0A 3KGLA 4D69A 1WD3A 3ALQA 3E6DA 1TNRA 1S55A 1YFUA 1CAXB 4AVVA 5JI9A 4JTOA 1GLHA 3WDWA 2JG9A 4Z8BA 1LHUA 1PIV2 1H8VA 2CAUA 4JAAA 2QQPA 1PNGA 4JGZA 5EZWA 2CWSA 1LECA 1C8M2 4WM7C 1X50A 2PLV1 3WP5A 1CPMA 3WHTA 3K48A 4AG4A 4MGKE 4ITCA 2WQZC 5CADA 1YFWA 2VUJA 2ZGTA 2YV8A 2ZS6B 3WDUA 4RL7A 5DZFA 3PVEA 1DHKB 2VPVA 3V0BB 1GV9A 4S2HA 1O4TA 2RR11 4LEJA 1AJOA 4LA2A 3SH3A 5I93A 1NCQA 2VNRA 1I5ZA 1GSLA 3RMXA 1WW5A 1HQLA 4IERA 4HT1T 1ND3B 4EWDA 4W6WA 1C5HA 1OQDA 1U12A 2WNUB 3VDDC 4ATFA 3B94A 2UYAA 1QQP3 4HZFA 3THPA 4AI0A 1ASJ3 3TBDA 4AQSA 3WW1A 1S0EA 4HVQA 1YJKA 2XVGA 4NWWA 1VJ2A 1AL21 4JDNA 2XWBB 2VUAA 1YIFA 2HWF3 5I8YA 5FO8B 3RYPA 4GXLA 2HEWF 1FAYA 2XUMA 1OPOA 2NN8A 2VVFA 3FMGA 4K6BA 1L3JA 1XU1A 2BVVA 1QOTA 1Z0HA 1KJLA 3O0XA 2E9QA 1KDMA 3FBMA 4JGZC 4FO9A 1UIJA 2GNMA 1D0GA 4DINB 1H2MA 1WCSA 1AYM3 2VW2A 2CGNA 4G3YC 2CTVA 4KQ7A 1DYPA 5DZEA 5A33B 3AKPA 5KHHA 4R9AA 1FPN2 4QU2A 1J1LA 1IHMA 1GZCA 2ET7A 3GALA 1Y43B 2QUOA 3RYKA 2Q0AA 2R49A 1QJU2 5EFUA 2GN7A 2R1BA 3WP3A 3OF1A 4DPNA 2QZ3A 5FPXA 1GNHA 3WZ1A 1OI6A 5FQ0B 3VBOB 4QT6A 3H1MA 1OLQA 4GKXA 1ULGA 2BFUS 3ZFEC 1I6XA 1LR5A 4Q4W3 1VBD3 3T2TA 1U0AA 2VOKA 3MIFA 3UKNA 4M0HA 4AI1A 1LKNA 2HWC3 4N43C 2EXKA 3J8F2 4YGEA 3JBG2 3EQEA 5IK7A 3LSEA 1WW4A 2YXSA 3MPBA 5C4WA 5BNOB 3R4DB 1MEC3 1OOPB 4D7SA 2TUNA 1ASJ1 1GZWB 3ZSLA 4HK9A 3O12A 4EN9B 4AQ6A 4XZPA 2ETEA 2XKPA 4BQ1A 4XDQA 4C1XA 2UY9A 2DCJA 2PHUA 3USSA 3U0ZA 1RUE2 1U5ZA 3FBYA 1ZVFA 2XJVA 4D3WA 5GZCA 1U5YA 3I59A 3LA7A 2EXIA 3AXEA 4OI4A 2CYFA 1W6OA 3AMPA 4HL0A 5D1IA 4DRRA 2WT1A 3TWIA 4CP1A 5IK5A 3OCPA 2EAKA 1NOVA 2OZ6A 2O1QA 2GC0A 4GH4C 1OA2A 5IT6A 2PHRA 3ZXFA 2TNFA 4P9YA 3R4SA 1QWRA 4NHKA 3USUB 1J1TA 4WVZA 1OMIA 3KS7A 5K0UB 3S7IA 1UAIA 1LEDA 3KSCA 5GKAC 3ECQA 1WMEA 5L7OA 4HFSA 4QGMA 3VKMA 3E5XA 5EWSA 4COWA 2XLAA 2EVXA 3BALA 4CDWB 5DG1A 2GNDA 2IXJA 1RUG1 4Y1YA 3HMYA 2FQPA 1AVBA 4SBVA 4MVTA 4ES8A 4YARA 3E6BA 1DGWX 3MDPA 3AJZA 2PFWA 1T6GC 2A6VA 4IXLA 1RUI2 2GU9A 4HPKA 4Y1ZA 5I0UA 4H7MA 1V70A 5C4WC 3ZXGA 2ATFA 1J3PA 3ZFGA 4Q4W1 1VALA 1VBD1 3WW4A 3HT1A 3WD5A 1FV3A 4N7UA 1ZRRA 1MVQA 2IXLA 2XHKA 3N7MA 3RPQA 3C2UA 2QDNA 3U4XA 2EALA 4UW5A 1MEC1 2ZX3A 1GQHA 4FOWA 4KL1A 3J9SA 4M3CB 5T54A 1B09A 3W58A 2N7GA 2GALA 4EN0A 4HN0A 1SLBA 5FOBB 2W08A 2E7AA 1J3RA 1HQNA 4FQZA 1SEFA 1W6NB 3DN7A 3W9AA 3BOPA 4P9XA 1UW8A 2RMU2 5FREA 5AFEA 4TWTA 4YG3A 4LBMA 2P2KA 2WJSA 1AYN2 5FMOL 1F31A 1LJ7A 1W6MB 4W6YA 2FMDA 3R0RA 1XE7A 1BEV2 2AREA 1IS4A 4ZXKA 1QOOA 3WXPA 1W0PA 3ZMNA 1YIPA 4W65A 3OPZA 2FBEA 4P9LA 4WV8A 1R083 2FZ2A 1ENQA 3FE5A 2PLV2 2ZKNA 3WY6A 1BQPA 3BPZA 1A8DA 2AUYA 3AZYA 2GSYA 3VGIA 5KHGA 4XXPA 3VHOA 1HX6A 1S0CA 4WZCA 1MR5A 5BNPA 3LGRA 2QE3A 3D0JA 1KRIA 3AFGA 4CEWA 1QJX3 4Z92B 1Z7S2 2ZABA 2D6PA 3VBFB 4L8QA 1LOBA 4Q26A 3VBUC 2XJUA 4YW4A 2NQYA 1QXJA 3LA3A 3K51A 3GYDA 2JDZA 3M1HA 1J58A 3ZXKA 2D5HA 3VKNA 4MX3A 3VKOA 4HSLA 2PA7A 1RIRA 1Q8OA 3VBRA 1AL22 1JH5A 4N53B 1PO13 2RS13 1FI2A 2A3YA 5CFCB 3H3UA 4ZU7A 4MXVA 4CRQA 2A3WA 4WM8A 4EN8B 4Y22B 4MZUA 2VY0A 5BNNA 3OBTA 4GB33 1S0IA 2GN3A 4YNIA 1O5UA 4BOWA 2DTYA 2XVKA 1H30A 4NHMA 3RZZA 4IEVA 1AR63 1HW5A 3ZFFA 4LR4A 1DZRA 1NXMA 2DCZA 4YM0A 1LULA 4YZ4A 5C8CA 4KGQA 4HMZA 4Q0UA 4YG0A 1A3KA 1OQEA 1UKGA 1SDWA 4AVAA 3WVJA 5FO7B 1Q8SA 1R081 2BFUL 5JAXA 2SLIA 1VRH1 3V65A 3TNPB 3J26N 4CEWC 1ENRA 4XE9A 4JDOA 2GMMA 1JYCA 2HWD2 3U07A 5C33A 3OD4A 1CAVB 2Y26A 1J3QA 5JIUA 3M4FA 1JOJA 1VAKA 3A0NA 2WWSA 4ATEA 1QJX1 1Q