4GB31

Human coxsackievirus b3 strain rd coat protein
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
273
structure length
273
Chain Sequence
AAIGRVADTVGTGPTNSEAIPALTAAETGHTSQVVPGDTMQTRHVKNYHSRSESTIENFLCRSACVYFTEYENSGAKRYAEWVITPRQAAQLRRKLEFFTYVRFDLELTFVITSTQQPSTTQNQDAQILTHQIMYVPPGGPVPDKVDSYVWQTSTNPSVFWTEGNAPPRMSIPFLSIGNAYSNFYDGWSEFSRNGVYGINTLNNMGTLYARHVNAGSTGPIKSTIRIYFKPKHVKAWIPRPPRLCQYEKAKNVNFQPSGVTTTRQSITTMTNT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords coat protein 1
publication title The Crystal Structure of a Coxsackievirus B3-RD Variant and a Refined 9-Angstrom Cryo-Electron Microscopy Reconstruction of the Virus Complexed with Decay-Accelerating Factor (DAF) Provide a New Footprint of DAF on the Virus Surface.
pubmed doi rcsb
molecule tags Virus
total genus 49
structure length 273
sequence length 273
ec nomenclature
pdb deposition date 2012-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4gb3100
5ACA1 5AC92 2R062 4RS5A 1B35A 1BBT2 1FMD2 1NCRA 1HXS1 1C8NA 4QPGB 3VBUC 2ZTNA 3VBFB 2HWC3 2XBO2 1VB4A 2WS93 1E57A 2WFF1 4QPGA 1HRV2 2HWF3 4GMP3 3TN93 1DDLA 1COV2 3VBFA 1RUH1 4WM7B 3JD72 1NOVA 1VBE3 3J8F3 3IDEA 2RMU2 2R072 3FBMA 4AEDC 1AR72 1VBD3 4RQPC 4WM7A 1ASJ2 1NCQB 1BEV1 1MEC2 4RHV2 1B35C 2PLV2 1TME2 1PVC1 1QJU3 1D4M2 5D8AB 1V9U1 1NCQA 1WCDJ 5C8CB 2RS11 1EAH1 5L7OB 1POV3 1QJX2 1R1A1 4QPGC 4YVSC 1A6CA 3VBSB 2ZAHA 5D8AA 1VBC1 5C8CA 5ACA2 1ZBE1 5L7OA 1VRH3 1PIV1 3VBSA 4PDWB 1AYN1 4Y5Z0 4GMP0 1AYM2 2VQ0A 1AL23 1FOD2 4PDWA 2BFUS 1X36A 1NY71 4NWWA 1QQP2 1SMVA 4Q4X3 4JGYC 5D8AC 1RUG1 1PO21 1AR91 2HWD1 4RFT0 5L7OC 5A33B 4N43B 4CDXC 4CDQB 5JZGB 2FZ2A 1PVC2 2HWE2 1RUC3 1VBA2 4GB33 5A33A 1RVF1 4IV1B 5C4WC 1BBT1 1PGL1 1FMD1 4N43A 5JZGA 4CDQA 1R1A2 1RUJ3 2XBO1 4IV1A 4JGZB 1HRV1 3M8LA 4LLFA 2RM21 1HRI3 1COV1 2BBVA 1AYN2 1HXS3 3JD71 4JGZA 1X33A 2BPA2 5BNPC 5C9AC 1AR71 5FOJB 2WFF3 2RR12 1NG0A 1MEC1 1NY72 4RR3B 5DDJ3 1RMU3 1RUH3 1TME1 4CDQC 5FMOL 1C8M3 3VDDB 3JBG2 4RQPB 4RR3A 4IV1C 2HWD2 1AUYA 1GFF2 1FPN3 1OOPB 3VDDA 1VBE2 4Q4V2 1Z7S1 4RQPA 1VBD2 4JGZC 2WWSA 1OOPA 1RVF2 1R083 2RS13 1PGL2 1RUE1 1AYM1 1ND2C 1MQTC 4YVSB 3VBOB 4Q4Y2 1ZBA1 1FOD1 1VBC3 1ZBE3 1PGW2 1PIV3 2BUKA 2TBVA 3VBOA 4YVSA 2RM22 3HAGA 4RR3C 3VBRC 1RUF2 1QQP1 4FTBA 3VDDC 1CJDA 1TMF2 1AR83 5ABJC 1R091 1RUI1 4WM8C 3NAPC 1OOPC 3ZFGC 1VBB3 1H8TC 4Z92B 2HWE1 1RUD2 1VBA1 4JGYB 2XPJA 1RUG3 1PO23 1AR93 1QJY3 3VBOC 2MEV2 2HWB3 4CEYC 1OPOA 4JGYA 4CDXB 2RS53 2GSYA 3DPRB 1VB2A 1PO12 5AC93 1Z7S2 4QPIB 4FTEA 1NA1B 2R063 2BFUL 5C4WB 1BBT3 4CDXA 1FMD3 3DPRA 1RUE2 4QPIA 1NA1A 1RHI2 1ZBA2 5C4WA 4IV3C 2R042 1QJZA 5LK7B 2RR11 4Q4W2 2HWC1 2WZR2 1AR62 2WS91 2RMU3 1VAKA 2R073 5BNPB 5C9AB 1AR73 3JBG1 1EV13 4GMP1 5K0UB 1HRI2 1R092 1ASJ3 1K5MC 1RUI2 1MEC3 1VBE1 4RHV3 1POV0 4Q4V1 5BNPA 2PLV3 1TME3 4EJRA 5C9AA 3DPRC 3ZFEC 1VBD1 1D4M3 5K0UA 4QPIC 1NA1C 4NWVA 5DDJ2 1RMU2 1QJX3 1HX6A 4Q4Y1 2RS32 4FTSA 5CFDB 5ACA3 1PGW1 4Y4YA 2X5IC 1RUF1 2IZWA 5CFDA 1ND2B 1MQTB 1VRH1 1TMF1 1FOD3 3JB4C 3ZXAC 2ZZQA 2DF7A 5K0UC 1ND2A 1MQTA 2WLPA 3VBRB 1AL21 1QQP3 2FZ1A 2HWC2 1RUD1 5BNNC 2WS92 1BMV2 5ABJB 3VBRA 2HWF2 4CDUB 3TN92 4CEWC 4CDWC 4WM8B 3NAPB 1BEV3 2MEV1 3ZFGB 5CFCB 1H8TB 3J8F2 1PO11 5ABJA 5CFDC 1PVC3 4CDUA 1VBA3 4WM8A 1V9U3 3NAPA 3ZFGA 5BNOC 5CFCA 1EAH3 1H8TA 1VBB2 1R1A3 1RHI1 1QJU2 4CEYB 2R041 4YVWC 4Q4W1 4CEYA 1RUJ1 1OHFA 1AYN3 5FMOS 2WZR1 4N53B 1AR61 1VRH2 4IV3B 1HRI1 4CDUC 1W39A 2RR13 4N53A 1AL22 4IV3A 5CFCC 3JB8A 3CJIC 3JBG3 2HWD3 1RMU1 5DDJ1 1K5MB 4AEDA 1C8M1 2RS31 1F2NA 4Q4V3 4Q4X2 3ZFEB 3VBHB 1EV12 1ND3B 1K5MA 1RVF3 1FPN1 4RS5C 4FSJA 3ZFEA 1NCRC 3VBHA 4Q4Y3 4N53C 1ND3A 5A32B 1RUC2 2XBO3 5J98B 4GB32 1R081 2X5IB 1IHMA 1HRV3 2RM23 1AL0G 1RUJ2 1COV3 1RUF3 5J96B 5A32A 3VBFC 3JD73 2X5IA 1BMV1 1TMF3 1RB8G 1M06G 2HWF1 1HQNA 3TN91 1HXS2 4WM7C 1F8VA 3J8F1 4SBVA 4GH4B 1AR81 1RUD3 3VBHC 5BNNB 1CD3G 1ND3C 2WFF2 1NCQC 4CEWB 4CDWB 1VBB1 4BCUA 4GH4A 1RUH2 2GH8A 1QJU1 2MEV3 1C8M2 5BNNA 2Y26A 1PO13 1Z7S3 4CEWA 5C8CC 4CDWA 1POV1 1QJY1 1BEV2 1FPN2 2HWB1 5BNOB 2RS51 3VBSC 1RUE3 1AYM3 5AC91 1RHI3 3S6PA 5GKAC 1ZBA3 3ZFFB 2R061 1V9U2 4YVWB 2R043 5BNOA 1R082 2RS12 4PDWC 1EAH2 4Q4W3 3ZFFA 2WZR3 1VBC2 4YVWA 4GH4C 1AR63 1ZBE2 1PIV2 1R093 1RUI3 3VBUB 4Q4X1 2RMU1 2R071 1AR82 1EV11 2HWE3 3LOBA 3CJIB 3VBUA 1ASJ1 4RHV1 2PLV1 4N43C 5JZGC 1D4M1 2RS33 3CJIA 1RUC1 3ZFFC 4GB31 4AEDB 2QQPA 1RUG2 1PO22 1AR92 1QJX1 1QJY2 4RS5B 1B35B 2HWB2 2RS52 1NCRB
chains in the Genus database with same CATH superfamily
1K42A 5GZDA 1LOGA 1VALA 1OBNA 1JW6A 3ON7A 5E6HA 1JTZX 2UYAA 4OI4A 5L9BA 2VU9A 5KHKA 5LRSA 1W8WA 1IPSA 4XZPA 1WLWA 1B35A 4K8FA 2C9AA 4S2FA 1WD3A 4XQWA 1FMD2 5JOYA 1YFUA 3VBUC 2ZTNA 3WUDA 1ENSA 3VBFB 2PHLA 1CR7A 1V6LA 1VB4A 1VPHA 5DZFA 4FBFA 2W92A 1S0IA 2QQIA 2WS93 5FZCA 4YM2A 2WFF1 4QPGA 3FFQA 3I2FA 3SXWA 5F9TA 1COV2 2VZUA 1UOFA 2E32A 3OBTA 1DDLA 2XMLA 4Y3OA 3WNMA 2XONA 3O0WA 5FR3A 3AP9A 5KXCA 4UWDA 3IDEA 3FBMA 1XNBA 4HG6B 4FPFA 2OX0A 3MIGA 4HKLA 1AR72 4QAWA 4AEDC 4BB3A 3VKLA 2AENA 2VM9A 4K1ZA 1JH5A 3ZN5A 2CL2A 1ASJ2 5KHHA 3WW2A 1SZBA 4RHV2 1B35C 3ACFA 4BXFA 1TME2 4N90A 1HQLA 2W94A 4OVEA 2JDAA 2G1MA 5I0UA 3EHKA 1VR3A 4C1XA 1JZ7A 2D97A 3H1YA 1V9U1 1G9DA 5JPMB 4JQTA 1YWKA 4ZXEA 3MV11 2RS11 2WT0A 5BXXA 4PHZA 1QJX2 4ZKTB 5E89A 4QPGC 3KWVA 4YVSC 1A6CA 1C57A 1W9WA 2ZMKA 3MHZA 3OGRA 5D8AA 3IIIA 3ECQA 5EFUA 5FPZA 3AYCA 3KF3A 2ZX4A 3UETA 4XF0A 2Z42A 4FFHA 1KITA 4HXCA 5CVRA 1QXRA 3LA3A 5C3SA 1XNKA 4PDWB 2Q8OA 1JN2P 1X9PA 4ES8A 5LA1A 4Y5Z0 3PUHA 3HIFA 4GMP0 2ZGMA 1W6NB 2VQ0A 1AL23 2E7QA 1UKGA 5FDBA 4NHLA 4URAA 1C3HA 2LRPA 3T4HB 3NV4A 2ID4A 3T0AA 1GYKA 3GCWA 1RUOA 4NIAA 3JU9A 5HCAA 2VULA 4PJYA 4QB2A 4Q4X3 1C1FA 2N7GA 1J3QA 3M3OA 4LMFA 4XJUA 2DTYA 5D8AC 5FYBA 1DQ2A 1AR91 1X82A 2WNUC 4RFT0 4YLZA 1LOBA 2VJXA 3UGGA 5JXGA 3O1RA 1RGSA 5F32A 4N43B 3PMSA 4KWUA 5F7UA 3U4SA 2XKPA 2XLGA 1H4HA 1RUC3 1S0GA 5B2GB 1VBA2 1UPIA 1SQ4A 1JZ6A 2DVAA 3BCWA 2A6XA 3B9CA 4MGZE 5IUQA 4LO7A 2Y60A 4JVAA 4EROA 1PX3A 4MXWA 1HDKA 5A3WA 2WQZC 2YG0A 2CDOA 1GZTA 4AOCA 1VJ2A 2WYFA 1CAWA 4NHMA 4R4ZA 2ZKNA 4IV1A 4M0HA 1CAVB 4XABA 2B45X 4CSWA 4JGZB 1H6XA 4R9BA 5FUNA 1HRV1 3U0ZA 3VUOA 3C7GA 2CDPA 2RM21 1QOSA 2QBXA 1HB1A 4R52A 1LOFA 1AYN2 2GC2A 2QQOA 5C3RA 4R4XA 5FTTC 1X33A 3OPTA 1LJ7A 4LQRA 1KS4A 4MO3M 5T5LA 3BVCA 3OGJA 4LBQD 3MEPA 2WFF3 1POQA 1OLRA 3VDAA 4L97A 1LHOA 2Y6JA 2XHNA 3DEMA 3MPBA 1FYUA 5F39A 3AL5A 3WQBA 1W8OA 1GP5A 4CCKA 3JXSA 4RQPB 2Q8DA 4IV1C 4NN0A 1WA6X 1UN1A 1YI9A 2WZ8A 2G9FA 1AUYA 4D6SA 3ZDVA 1WD4A 2BNNA 1LOFC 2YV8A 2BW8A 2TUNA 1GOGA 1HB2A 1OMIA 3CJXA 4OI2A 4QDQA 1W04A 4EV0A 2BDRA 1R083 1PK6A 3WW3A 2RS13 4Z2AA 3ORJA 1JYNA 1PGL2 1ND2C 2NLRA 1UMIA 4R9CA 4AHYA 3N7LA 1FOD1 3E5XA 4FOQA 3AKTA 5DAVA 2RDSA 2ZMLA 2IC1A 2KM2A 1NYWA 5LB6A 1Y9QA 4E8DA 4MX3A 1WCSA 2D7FA 4AYUA 4XQDA 4YWAA 3VBRC 1RUF2 1QQP1 2GDFA 3THDA 4C91A 4E2QA 1DFQA 1VRBA 1XSRA 5FO7B 3S30A 4OZXA 4BIFA 1URXA 1JS9A 2CU5A 3WHTA 3BKZA 5ABJC 1R091 4DXRA 3AP6A 4CCNA 3W5MA 4XFHA 3WY6A 3ZFGC 3PIJA 4MLOA 1ZA7A 2XHKA 2W5FA 3JQWA 1H8TC 3ZMOA 1N47A 3M1HA 4WVMA 3Q8BA 4RYDA 1PZ7A 2HWE1 1O91A 1RUD2 4UF0B 5FZFA 1UOJA 4NPMA 3DKWA 2AH2A 1HQWA 1AR93 2ZEYA 3ZVXA 4IGPA 1OPMA 5SV8A 5KHJA 1W8HA 4JGYA 1FNYA 4CDXB 2Y33A 1XQNA 2B7YA 4G3YC 4TLFA 1NT0A 1VB2A 1PO12 4YW6A 1ZZCA 4FTEA 4FPCA 1UMHA 3ZXKA 4YW1A 3HQUA 5CG8A 4A44A 2HLEA 3PUQA 4MGTA 4PLMA 1QOOA 1Y4WA 3WW1A 3WP5A 3RYRA 1UU4A 1C5IA 1W9FA 1G8WA 5APAA 1NA1A 4Q0QA 3ACIA 5FXVA 4B1LA 5K9YA 1W6MB 1ZBA2 2VMGA 3N9OA 5AFEA 2JG9B 1SLAA 5L36A 3POGA 1FT9A 3O1MA 5JXHA 5I93A 1NQDA 1UIJA 4HN0A 1UKRA 4KI5M 4DUVA 2ARBA 1TNRA 5K8SA 4XHXA 4PF5A 3O1OA 2FDGA 4HBNA 4YW3A 1AR62 4YM1A 4PLOA 5CBLA 5A3NA 3KVAA 1S2BA 2YC0A 2E53A 2LTNA 5LY2A 3GJBA 4GMP1 1BYHA 1DG6A 3KZ4C 4XTMA 3U75A 1J1TA 3BU0A 1WW7A 3HEIA 4I3PA 1XE7A 4XMAA 3RGBA 2A3WA 2VMHA 5A6ZA 3H3LA 2A6VA 1D4M3 5ANQA 1NA1C 1V6IA 3PU8A 5BPXA 3FE5A 4AAPA 3BI3A 2GN7A 2XR4A 1UAIA 4NWVA 3NJZA 1HX6A 2WNVC 1PZ8A 2YC2A 3K46A 4IEPA 2WUHA 2Y64A 3ZYBA 1RITA 2KA3A 1CAUA 2OKXA 3IB3A 3SQOA 1NUKA 3SH4A 3SKJE 2X5IC 1ZVFA 5H9SA 1GICA 4LA2A 4HKOA 2ZEXA 1LCLA 1XB9A 2XB6C 3ILFA 5DUXA 1O5LA 5DZGA 1MS0A 5DUWA 3G7DA 1MQTB 4CTEA 3GHNA 1XSQA 1GZCA 4DXTA 4PI0A 1VRH1 5FYCA 1FOD3 3ZDSA 2SBAA 5HCBA 2GNTA 4H3WA 2C0ZA 3AKRA 3WDWA 3AMNA 2XXZA 4MUVA 2W46A 2WLPA 5AVPA 1RXFA 4YG6A 2V09A 1LOAA 1V0AA 1QQP3 4A2UA 1A78A 2HWC2 5KC6A 4OZOA 2YY1A 3OCPA 4K3UA 5T5PA 4OI1A 4XDOA 5E16A 1DHKB 1LEDA 1QJEA 1Z0HA 4KG8A 4PT6A 3TN92 2K2SA 3WNXA 4CDUB 4CEWC 2IXLA 4LULA 4WM8B 5FMCA 4HSJA 3SEEA 3NAPB 1JZ2A 2UWCA 2GZWA 1Y9MA 4KBBA 4A6OA 1O59A 5GZCA 1YQ6A 4K7JA 2BERA 4P08A 1BK1A 1MZFA 4YW7A 4AQ2A 4Y22B 1IOAA 1MS5A 4DS0A 2HEVF 3GHMA 3PTRB 2WDBA 2ZKLA 3N7JA 5BNOC 3KHCA 1OH3A 2ZMNA 1R1A3 2F17A 3E5UA 1SLLA 4R8HA 2BBAA 2ZHNA 5I0SA 3T30A 4QXKA 4NO4A 2B8MA 1JYCA 1KQRA 4CU6A 5JXIA 2DVFA 2PHFA 3S5AA 4CEYA 1HB3A 1QWRA 4CXWA 3AK0A 2OZ6A 1VLNA 1W2NA 3IT8A 3NMBA 1J83A 2P3JA 2JD9A 1LESA 1KS5A 4YZ1A 1HRI1 3VHNA 4UI9L 4LO6B 2Z2SB 4LIUA 2WFPA 1I5ZA 1A8MA 4LKFA 3JQXA 2XWJB 2BWAA 3EMRA 4CP9B 1O8SA 4IV3A 4AVBA 3IAQA 3JB8A 1Q8QA 4OFGA 3CJIC 5IVEA 3ZSMA 4FFFA 5JOXA 5KHIA 1LHWA 2HWD3 2QTWB 4ZY9A 3WR0A 3AFKA 1E5RA 2YB7A 5EPAA 3I59B 2RS31 4XFIA 1T2XA 3KS7A 3ZFEB 5FIXA 5IVFA 1DU3D 2XUEA 2VZPA 4A6SA 2RDQA 5FY5A 1FPN1 2PHTA 4RS5C 2DDUA 1G6NA 3WHUA 2ARAA 1L3JA 5J09A 1L7RA 5F3GA 2PN5A 3FLPA 4BJ0A 4C90A 1OFSA 4AEKA 4QM8A 2UWBA 4UBGA 3R4DB 4GB32 4B4QA 3CQOA 5FY4A 4BLJA 1DQ1A 2I74A 2QQWA 3EQEA 3HNMA 2D43A 4FCAA 2B46X 3HBKA 4JHTA 4O9EA 4YGBA 3TAYA 4IETA 3LZZA 3DGTA 2WL1A 5J96B 2NYYA 1IS5A 2D3RA 4IE4A 3VBFC 3JD73 1LGNA 4F7ZA 2VG9A 5KXBA 5JVVA 1K45A 3SKVA 2PAKA 1RB8G 2HWF1 4DY3A 2QDRA 2VPVA 2BNMA 5J48A 1JOBA 1W6OA 1HXS2 3RMXA 2DFCA 1XJAA 2GNMA 5D2AA 1UXXX 3ZSKA 1F8VA 2AGSA 2J1RA 2Y6LA 2BRTA 1ONAA 2QUOA 3WQ7A 2E7TA 3J8F1 4KG0A 4R9AA 2D6MA 4S2GA 4GH4B 4SBVA 2R0FA 3HT2A 2ARXA 4WVZA 4OQ9A 4ES9A 3USUB 3OBRA 2Y0OA 3VB9A 2BU9A 3SMHA 1C8M2 4ZZ5A 3UKNA 5CZKA 2GC3A 3VHOA 1Z7S3 3ES1A 3Q8AA 4I0WB 4SLIA 2P3YA 3HWJA 3NJYA 4B3NA 1R64A 3POBA 1QJY1 5CNAA 3K4DA 1DCSA 4Y1XA 3MW4A 3J7MA 4YPJA 2ZGTA 2RS51 4LKEA 4IE6A 5F5CA 4YW4A 1AYM3 2XH6A 3AZZA 4XF3A 5FJHA 2LROA 4XETA 3ZFFB 2CYFA 1YQ5A 4IGQA 2EXHA 1W3XA 4XF9A 5FLJA 1KGYA 5IAXA 4QHZA 2JG8A 4PDWC 4ZONA 3ZXFA 5A70A 1OURA 1DYKA 4ZS3A 4DINB 4JDOA 2FCUA 1NLQA 3UGFA 2FHRA 1K12A 4YVWA 3GBGA 5F2SA 1ZBE2 5HI0A 1PIV2 3W21A 3VKMA 1RL3A 1YJLA 3KM5A 5F37A 4EE2A 2QJVA 1GKBA 1RUI3 1QEXA 5A3PA 4GJYA 4JKLA 1KJRA 2A3YA 2JIGA 4YNIA 1ZNPA 2XJVA 1SBEA 2VZTA 3LDRA 3LOBA 1ASJ1 1KEXA 3UGHA 1GQPA 2ENRA 4LHKA 4N9HA 4RHV1 3T0BA 3T2PA 3WLUA 4N43C 1IG3A 3OD4A 2J1AA 4Z1VA 2RS33 1LODA 2Z79A 1LB2A 4D7SA 4LORA 5I8SA 1PNFA 5JOZA 1OFNA 4Q29A 4E27A 5KC5A 3QCWA 1QJX1 3RDIA 1F35A 1DZTA 1S2KA 1W8FA 2HWB2 3H1WA 5CKMA 1W8UA 1JUHA 1NCRB 2PHDA 2VCCA 2VAUA 4JTNA 1NXD1 3OY8B 4YGCA 4BA6A 4EN0A 1HN1A 5AC92 2R062 2ZHLA 4LNVA 2WAOA 1F4AA 1Y43B 1GMMA 3WNKA 1S0JA 2V73A 3AM2A 3ZSEA 5A1AA 1C8NA 1K5JA 3K3OA 2VZOA 3AL6A 5JI9A 2YBSA 2WO7A 2J42A 4WZFA 3TB0A 4B4PA 3INAA 5H9QA 3C2UA 1SLTA 3VDCA 2HWF3 4NUBA 1RUH1 1UZZA 2NZ9A 1YHFA 3MLJA 4WM7B 3WCSA 3JD72 1NOVA 1Q43A 3MO4A 3J8F3 1VMHA 3IPVB 2RMU2 2R072 4BQ3A 4FOWA 1VBD3 1H2NA 4GWMA 4RQPC 2V5DA 3K2OA 4HPKA 5FLIA 4META 4I2OA 5HPOA 1OD5A 4AWDA 2XVGA 1W0PA 2YBKA 5FUPA 2FMYA 1SPPA 5FZGA 4MOAA 3PJYA 3AZVA 3HNYM 2NN8A 4JRLA 5EXOA 1NCQA 5CAZA 4XCAA 3T2OA 1H9WA 5C8CB 2PFWA 2JDPA 5L7OB 3LCPA 5JCTA 1NZIA 1DQ0A 2WABA 5LEJA 4XJWA 2X29A 3O7OA 1ZRRA 3N9LA 3VBSB 2NMOA 2ZAHA 3HR9A 1UD1A 4UFMA 4AHXA 5ACA2 4IEOA 1BKZA 3J9SA 4ZS2A 1W0NA 1AX0A 2XJSA 1Q8VA 3WG2A 3NV2A 4AVVA 2Y6HA 3SCGA 4E4DX 3NVCA 5C6CA 4EZHA 1DGLA 1UX7A 1AYN1 1BHGA 1WMFA 2DFBA 1AYM2 1N1VA 4CYDA 1DQ5A 3G6JB 5T5OA 5JSRA 4XFCA 4FO9A 3C7HA 3AJZA 4AW7A 5J36A 3I3QA 3FFZA 2WA4A 3CO2A 1SDWA 5BUVA 2CGPA 4AAXA 3HVDA 4QU2A 3UNPA 3H9AA 5FZ1A 5B4XA 1CIWA 3DUIA 2IFWA 1UXZA 1DQ6A 3B9IA 1X8MA 1ZX5A 3J7NA 3POWA 1SHWB 3LGRA 3I3EA 3OBAA 3I97A 2F4PA 3KCXA 2XQXA 3R4SA 4OHZA 1PO21 5D1IA 3U78A 3NKTA 3ZN6A 4DRVA 3IN9A 2HEWF 1XE8A 4GA9A 2QVSB 4EZ4A 3POYA 5E1RA 1V00A 3MYXA 4CDQB 4KWKA 4XILA 5CU1A 4CDXC 5JZGB 2YMZA 1ACCA 2W0XA 2VTFA 1PVC2 4HSLA 1RJ8A 2H6CA 5A33A 3TNPB 1CX1A 5ISLA 1XNAA 1ULFA 1SDDB 1BBT1 2R0HA 5FXZA 2GU9A 3WW4A 3WV6A 1PGL1 3RNSA 2XVKA 2XG3A 3ZYFA 2E33A 1ZZBA 4YFZA 1RUJ3 3V0AB 2YFUA 3PJQA 2E26A 3I54A 1ZREA 2XBO1 4QT6A 1H2MA 2JG9C 3QH7A 3RQ0A 1UZWA 1NE4A 2VOWA 3DL3A 2WBKA 4PCRA 1ULOA 3M8LA 5DMYA 1PX4A 4AI1A 1D0GA 1OD3A 2HH9A 1WW5A 1ZZ8A 1ZRDA 2TNFA 5FRAA 4H7LA 2ZGKA 1QIQA 4LHSA 3CU7A 3C8XA 5EYYA 5FZOA 4YZ3A 1P8JA 2BPA2 5FQ0A 4ZXKA 2VE1A 5T3NA 3WNNA 2XL7A 2JWPA 4LBLA 3S7EA 4N7UA 3SLIA 3OYWB 3KLSA 1MEC1 1W2UA 4RR3B 4XUPA 1YQ2A 5FZ7A 2PAMA 1RMU3 5I0DA 1RUH3 3ZKYA 5A7SA 4CUAA 5L73A 2IFRA 1H6YA 1XYOA 1AX2A 3I2GA 1QH7A 2MHFA 4XJZA 2WQ4A 4RSUA 4CVUA 1AXKA 1PMHX 3JBG2 2PQSA 2BEOA 3CMGA 4HKWA 2RE9A 1GFF2 5FYZA 4EN8B 1BXHA 2GH2A 3KSCA 4TSVA 3VDDA 4ATFA 4BK4A 3VZNA 5LBBA 1VBD2 5C8WA 3O14A 2WWSA 1C1LA 4XIKA 1OOPA 3OBZA 3ZXEA 1RVF2 2WN3A 4CCDA 3GGLA 1UU6A 3GBFA 3BTYA 3VBOB 1MQTC 5C7GA 5LCWL 3FL7A 2ZHMA 4Q4Y2 1F31A 1N3OA 1ZBA1 3VGIA 3SCHA 2O1QA 3GZTB 4ZZ8A 5A3TA 2VW1A 4LR4A 2RVAA 3LB9A 2EIEA 1K3IA 2BUKA 4FOVA 4YVSA 1EP0A 3HAGA 1S1AA 1W06A 2G19A 5JWPA 2H6BA 2Q8CA 3FBYA 4FTBA 4EYUA 4XUNA 3NW4A 3WDXA 1O3QA 2WC2A 4KNCA 3NNLA 1QNWA 3VDDC 4BDVB 1CJDA 3RFRA 1TMF2 1AR83 3KV5A 2GNDA 2QQVA 2F4LA 3DYPA 2VOTA 4WM8C 3VV1A 1MZ5A 3NAPC 4IGOA 1OOPC 2EF6A 2JEMA 1JHNA 3PIGA 4Y20A 4EN6B 2YGMA 2VL4A 3NV3A 2W1QA 3ILNA 4YM3A 2ZS6B 1MZ6A 2ZGRA 3F95A 1PO23 4RA0A 5A7WB 3RZLA 2XUMA 3W59A 3SCFA 4D69A 4UT5A 4ARYA 1UZYA 4O7XA 4XMIA 3U1XA 2ET7A 3J7LA 5FBZA 2W2IA 1OPOA 2GSYA 4UAPA 3DPRB 1ZRFA 2WSVA 4QPIB 2WNUA 4LBKA 2RJ2A 4NOTA 1EYBA 3V0BA 2BP6A 2BFUL 5C4WB 3ZXLA 2R1DA 1BBT3 4DY5A 5FXWA 3MIBA 2D98A 4XZUG 4UFJA 5GZGA 1RUE2 4BE3A 2JXAA 4XYXA 4P02B 1L7QA 1WCQA 3WOGA 1IKPA 3APBA 3NNMA 3LKJA 5J1XA 3CKHA 2R042 1I9RA 1REEA 1QJZA 4CXXA 5JSPA 5LK7B 3KQ4B 3RZHA 4XAAA 2RR11 4PQQA 4Q4W2 3VL8A 3D6EA 2HYKA 3IZOA 2X05A 4YG0A 2D5FA 1XOYA 2JE7A 5K7PA 2HWC1 3CDZB 2JDMA 3POJA 4AF9A 2WZR2 3LE0A 3F2ZA 1NX9A 1ZA4A 2Q4SA 3LEGA 5A7PA 4YRDA 3QOPA 1AHSA 2EXJA 2OW4A 5BNPB 5C9AB 2WO3A 1EV13 4R9DA 3ALQA 4CA9A 4DIQA 1LECA 3GZUC 4XDPA 4URTA 1MEC3 3P3PA 1OLME 1UOBA 1VBE1 4LKSA 4QGLA 1POV0 4Q4V1 2PLV3 4EJRA 5FZDA 5KXEA 3ZFEC 4ORFA 5K0UA 4XUTA 1JI6A 5CIRA 3QLQA 5JXJA 3IAPA 4HL0A 1EUTA 4I30A 3WNLA 4I3GA 4L0PA 1F5JA 3MIHA 4Y26A 4H7MA 1RMU2 1SG3A 2D3SA 5FJKA 3C7FA 4XUOA 2IXCA 2W87A 5A7OA 5CFDB 3OJBA 2UWAA 1PGW1 2VZVA 4EWEA 3ZXGA 2Z5WA 2BVVA 1JZ4A 3B00A 4Z8BA 2IZWA 5E8AA 2QE3A 4OCTA 1XBFA 3HN1A 2L9LA 3KD4A 1MS1A 3S0MA 4D94A 2G9GA 2AEYA 1JBCA 3PL0A 2QQJA 2ORZA 4JZRA 3ZXAC 2ZZQA 5K0UC 1H2LA 3HOBA 1ND2A 4QX8A 4AVCA 2CHHA 4BXSV 5L9VA 4LO8A 3ZYPA 4BQ4A 1W6PB 4MXVA 4IDZA 4IEXA 2WS92 4S2DA 3S5QA 2ZGPA 3VBRA 4B4RA 1J1LA 3RJRA 4IE7A 5IHRA 4GAZA 2W1SA 2UYBA 2VCAA 2IXIA 3FC0A 1BVP1 2MEV1 5H9PA 4QWNA 3UJOA 5FP7A 1GWLA 5FPAA 5HBAA 1SCSA 3CIHA 5ABJA 4CU9A 4NIHA 1VP6A 1O4ZA 2DBNA 1W6QA 4OMCA 4QX2A 5CYYA 5FPBA 1V9U3 1G9FA 4PBPA 2NMNA 3BALA 1SCRA 3QH6A 3TEXA 3ZFGA 5CFCA 3RWNA 1H8TA 4XJAA 2D6KA 3LPGA 4UYBA 4CUCA 1RHI1 1ULEA 4QDSA 2JKBA 4LUKA 2OYZA 2ADDA 4A7YA 3OGGA 4OHXA 4QQLA 3M3EA 2A6WA 4QM9A 2XJPA 2VBPA 2YROA 3LEKA 1G7YA 2JB8A 1XYPA 1PZ9A 4H55A 1JYIA 1OHFA 5FYHA 1LGBA 3MLLA 1YLLA 1GLHA 4RD7A 5FMOS 4ONUA 4JAAA 2HBTA 4KQ7A 4WVWA 3ROUA 4HVQA 5EJZB 4NAMA 4OUMA 3LFMA 3IKWA 4ARXA 4I0AA 1GWKA 1W39A 2P3IA 4KWJA 5FKCA 2RR13 4N53A 4COVA 1WZXA 4GIQA 2BGPA 1DYPA 4LO4B 1AL22 1GZWB 5DUVA 5CFCC 5EWSA 2E6VA 5LZ6A 3E6CC 2ZX0A 5LA9A 3FJSA 2R6QA 5A3LA 5JIUA 4YW2A 4Y5TA 1LTEA 4Z82A 3TEZA 4KGQA 5IWFA 4DOUA 1VAMA 5DDJ1 4M3CB 1K5MB 2WO2A 1F5FA 1H4GA 1C8M1 1OUXA 2A6ZA 2PHUA 3BB6A 1O5UA 1F2NA 2VD7A 4L99A 4U2AA 5FP4A 4Q4V3 4Q4X2 2WNEA 4XACA 3VL9A 1WBLA 2VQUA 2WYSA 3VBHB 3DXUA 3UKVA 5FXXA 1EV12 3DCQA 1XNDA 4G9SB 3AYAA 4W6YA 3FX3A 3BIWE 2QQLA 2WNOA 3Q8CA 4FSJA 1YNAA 2OQ7A 4JRAA 1UOGA 1YJKA 1CZSA 1NCRC 1Y7BA 4OMDA 2WAAA 3NJXA 3BOWA 4N53C 5FMBA 3T4VA 3H8RA 1ND3A 5C5TA 3NNJA 1RUC2 4XE9A 4QB1A 3HBZA 1UPSA 1U0AA 3WF0A 4AFAA 4O61A 2PHRA 1YIPA 3WDTA 1IHMA 3ZOIA 2ZABA 2WNVA 5FPXA 1G9CA 1HRV3 2RM23 3AX4A 2WZPP 1G86A 2YHJA 1IQAA 1BJQA 4LHNA 2D6OX 4JKKA 2VNGA 4XOGA 4DRRA 5A32A 1H1IA 4KWLA 1QXPA 2X5IA 3UESA 1BMV1 3W58A 1Y3TA 2R1BA 2JDHA 4M00A 1AJKA 2I2SA 3WDUA 3ACLA 2PMWB 4XBNA 1AJOA 4WM7C 1LAJA 4XCBA 1T6GC 3WP4A 2UY9A 2Z4FA 3V64A 1MACA 2Y0IA 1OLMA 5BNNB 1CAXB 1TEIA 1CD3G 5JPNB 3VD3A 5LY1A 1ND3C 2J1TA 4LOSA 1RC6A 1ULPA 2WFF2 4YG3A 3W9AA 4COZA 2GMEA 3AXEA 2W68A 2J1VA 5E88A 4BM8A 4C0BA 4CDWB 4CPBD 1VBB1 4IEUA 5SV5A 2GMMA 2MEV3 1QJU1 1QOTA 2P1BA 3EJKA 2Y26A 3U37A 1S0CA 2C6SA 4B29A 4E2SA 4AVSA 2YU2A 3IDBB 4D8MA 1N1TA 4CEWA 2Y8KA 2WR9A 5C8CC 2H0BA 4HVRA 5A3OA 1POV1 2ZGSA 1JUIA 4H14A 5A6QA 4FPKA 5LATA 2HWB1 1WA4A 2DUPA 2ZZJA 2WRAA 3VBSC 5A3MA 5AC91 2OUJA 3BUCA 1RHI3 2JENA 2PYTA 2FDKA 5L9RA 1IS3A 2HEYF 2R061 3R05A 1WCUA 2VW0A 4D6RA 1V9U2 4ZU7A 4IEVA 5BNOA 3WEZA 4CCJA 1R082 5KWRA 1YFXA 2P37A 2RS12 1JODA 4P9GA 3OUIA 5BYNA 3VD9A 5FYUA 5A80A 5ANNA 3FHQA 4P9YA 3PLQA 3LIHA 3MIEA 3VZKA 4D0QA 2JICA 3BPSA 4RFRB 1OC1A 2CGNA 5CB7A 1FNZA 1OLQA 1R093 3H8UA 1LRHA 4LXLA 4TLGA 4AFBA 1US2A 3LSEA 3VBUB 1HKDA 1REDA 4QDRA 4AHWA 1JZ3A 4QGMA 3FLRA 3DXTA 2RMU1 1DQ4A 2R071 2OXBA 2VOXA 5G04L 4AQ6A 3AKSA 2O8QA 2HWE3 4BYYA 3ZPOA 2Q30A 1QDOA 4YW5A 3CZJA 4XFAA 5FUIA 1YUDA 1OF4A 1ZRIA 3NRUA 3SHRA 2DVDA 4QKFA 5JZGC 4XQ4A 2C9KA 4LBQA 1XU1A 5GJ6A 5IT6A 3N3HA 3CJIA 2JIJA 3U10A 3A22A 5EJ3A 2GP3A 5J37A 3LWCA 4AEDB 4LK7A 3RWKX 2R16A 4LKDA 1AR92 3MI8A 2WQ8A 3RMYA 4LA3A 2QQMA 3JZVA 3RZJA 3I8TA 4MSVA 3C3VA 1B35B 4INDA 1O8PA 3DECA 4UW6A 4L2NA 2QQKA 5ACA1 3TNQA 3SC7X 4TYSA 3EYPA 4E4HA 1EUUA 1OQ1A 1GU3A 4RS5A 2VMCA 2ZAAA 1BVVA 1NXMA 3HQXA 3LIGA 1A8DA 2VNVA 3O1UA 4QPGB 1U5ZA 2XQRA 2W39A 4NPLA 3S57A 2Y34A 3ZSLA 1SFNA 5CA6A 2BV4A 4O65A 3M3IA 1E57A 1QU0A 1HRV2 4GMP3 4Q0PA 1I6XA 4D3WA 1RIRA 3VBFA 3FZ3A 5LASA 4UW3A 1E5HA 5FP9A 3C7EA 1V70A 1S0FA 3LAGA 5LK5A 2EA7A 2CY6A 2A75A 2WZEA 3DN7A 4YSFA 2MPFA 1PVXA 2AC1A 3PHMA 1YI7A 1BEV1 3A21A 3HNBM 5FMDA 3RS6A 4XW3A 3ZIXA 3KMHA 1PVC1 1QJU3 3ZYIB 1CWPA 1D4M2 1HV0A 5D8AB 2Y6GA 1YCIA 2JJ6A 2KD7A 3H42B 2ATFA 4M0NA 3ZM8A 1WCDJ 5F5QA 2PQQA 4BLIA 1JMUB 1EAH1 1GNHA 1POV3 1SBDA 4LE4A 3SITA 4DMIA 1OQDA 1WLDA 5EYXA 1OSGA 4MGIE 2EXIA 1VBC1 1WWYA 4I09A 4JDMA 2DCYA 4JX0A 4NAOA 3IBMA 3JCIA 1VRH3 3QD6A 4NPRA 3ZXDA 3I3DA 4AFMA 2ET1A 2RG4A 2A6YA 5LRRA 1JHJA 1JU3A 2EIGA 2K46A 1IGOA 2VW2A 1NKGA 4PF1A 2CAUA 1FOD2 3A0KA 2JDYA 3NSTA 2W9XA 4PDWA 2BFUS 3WQ1A 1X36A 2XVLA 1PHMA 5T54A 1W6NA 4NWWA 5FZMA 3MZHA 5IK4A 2R7EB 1QQP2 3ZO0B 3BODA 1LOEA 3UJQA 4MV2A 2DCZA 3WF1A 4IL7A 1D2SA 2HBUA 5F5IA 4AGVA 3T0DA 3WF2A 4OI0A 1RUG1 1QH6A 2ZA9A 2B9UA 4M4PA 5DXDA 5FZKA 1DGRA 4XBLA 4JDNA 4F83A 4Y5SA 4Q27A 2D3PA 1J58A 2YU1A 1GBGA 4MXWB 2HWE2 1GV9A 1UU5A 1LOCA 4A3XA 2JE8A 4PIZA 1CAWB 3SEPA 1UYXA 1RINA 1RVF1 4IV1B 5C4WC 1C5HA 1FMD1 4N43A 4GWNA 1R1A2 5EV7A 5C33A 2ZGNA 1LU2A 3HMYA 4V2VA 2B42B 3KCCA 2B39A 4J25A 4PIYA 1VMJA 4LBOA 4JKMA 3WX5A 4LLFA 3NNFA 3CHXA 4JV4A 4C8DA 3WDVA 1HRI3 4BHPA 1COV1 4FAGA 1YFWA 5EP9A 1JYVA 1CAVA 4JQRA 4JGZA 4Q26A 1TE1B 3B93A 4ISRA 4LOTA 3B01A 4GXLA 5BNPC 5C9AC 1HLCA 1AR71 4RN5A 5JIAA 5KBFA 2VXJA 3AMPA 5FP8A 5FY8A 4D6QA 2A70A 3PTYA 3TOJA 3O1PA 5FOJB 2NP0A 3PNAA 1NG0A 1NY72 5A7QA 3EB7A 4NRQA 3AJYA 1TME1 5IW0A 5FMOL 2WO1A 4AGRA 3MUZ1 2GC1A 3IM0A 4JCKA 5HXMA 2BYVE 1YXWA 3PMEA 2RJLA 3WD5A 4JC1A 2HWD2 3IMNA 4QD2A 4IERA 1UZVA 1FPN3 1KDMA 2OVUA 4H2AA 1PK6B 4NR1A 4P9IA 4RQPA 4BISA 2A3XA 5FK8A 4JGZC 1JZ8A 2IXJA 1SLCA 2VGDA 4XEZA 5FLHA 3J26N 4DFSA 1QNYA 5FZ9A 1QJFA 1RUE1 3ST7A 3THTA 2CWSA 3I2IA 1QHDA 4B7KA 4AR2A 2Q5TA 5JDBA 1S0DA 5I0TA 1VBC3 4X6QB 4QX0A 5H9RA 4BQ5A 2P34A 3GJAA 3ZPYA 5FBJA 2KR2A 5T55A 3OGSA 3T3YA 1PM4A 2BQPA 1YQCA 4XTPA 5C70A 2JX9A 2VUCA 3KV4A 4DQAA 3WXPA 4WVMB 1X9TA 2C26A 1O6UA 4UOJA 1JOJA 1AX1A 5JMOA 1YRZA 4Y4RA 4I0BA 2EALA 2JKXA 1N1SA 1QKQA 1W0OA 3OEAA 2EAAA 3ELNA 3ME2A 4KMQA 4AZZA 3KHBA 3AP5A 5JUVA 4DUWA 2D40A 5GZFA 1VBA1 4IXLA 2QZ2A 4JGYB 3KV9A 4LUMA 2ZX1A 4QQOA 3VN4A 4NIDA 1RUG3 1F4HA 2D5HA 3WNOA 4C0HA 1QJY3 2RDRA 3LSDA 2IUWA 3OTFA 1IPKA 4MH0E 4UF0A 2W1UA 2RS53 4BWOA 1JYXA 3SH3A 3VD4A 1WUVA 1Z7S2 2HYXA 3MFCA 1NA1B 1G9AA 2FDJA 4XFBA 4P9JA 2VQTA 1X50A 1ULCA 1WGPA 3LOIA 2JE9A 3RG0A 5FY1A 3E6BA 2VZRA 1YEWA 1H1MA 4CDXA 1FMD3 3SNMA 2CGOA 2AACA 5FREA 3PVNA 3RI8A 4ET7A 3I3MA 5LW9A 1MVQA 3VDBA 5C71A 1D4VB 1YC61 3M7AA 1W3VA 2CV6A 2RJKA 3ACHA 4AE2A 1DZRA 4BQ2A 2UURA 1OT5A 2ZGOA 1V6JA 1W6MA 2PHWA 2JG9A 1H2KA 4QPYA 1XRUA 4AK3A 1KJLA 3PDQA 5GALA 3M3CA 2WS91 3L9JT 2WINB 4Z2WA 3R4UA 2CTVA 4CCEA 1VAKA 4TXWA 3T1MA 1GNYA 1YO8A 3U07A 1AR73 3VZLA 1CPNA 1HRI2 2Y6FA 4DO0A 3MBWA 1WLTA 2ZPXA 1ASJ3 1K5MC 1NZCA 1RUI2 3CBNA 4AI0A 2AREA 2Q1MA 4RHV3 4Z92B 4X8NA 4TZDA 5FZLA 1XC6A 4AEMA 1TME3 4P5HA 1W28A 3N35A 2ZX3A 3AYDA 4P5YA 4QX7A 1CAUB 4V2WA 2D44A 4DZGA 2CAVA 4LITA 3FLTA 4MHRA 1LHUA 3U4XA 1FX5A 3NWKA 3Q8FA 1DZQA 1W99A 4CZSA 4J1WA 1UIKA 3V65A 1QJX3 5EIYB 3O1SA 4CUGA 2BOIA 2AEZA 2RS32 4OYUA 2OS2A 4K40A 4Q2FA 4MGYE 3H8OA 2WT1A 3DKQA 3HT1A 5A3UA 3I2OA 1CIYA 1ZZ9A 2VZSA 1ODMA 4W65A 3OOXA 2GMPA 4K20A 5BNQA 1OA4A 4HMZA 1GANA 1RUF1 4Y33A 4EWDA 2XJTA 3OG2A 1AXZA 3O0XA 4DB5A 1A34A 3NNGA 1VMFA 3PUAA 5FZ4A 1KDKA 2DF7A 4W4ZA 4OQ8A 1MQTA 2BVBA 2H0VA 2JD4A 3B69A 5KR7A 3KT1A 4QHBA 1AL21 5GLUA 2VMFA 1DGWX 3OPZA 1LR5A 1TQ5A 1RUD1 3IDCB 2VBBA 4IE0A 4FAHA 5BNNC 5KHGA 4XXPA 3QACA 4GKYA 4K1YA 5GM0A 4E9KA 2HWF2 3IDAA 5IVYA 2X10A 3S7IA 4BMBA 5FYTA 4QX5A 4QGNA 4ASMB 4CDWC 4FI9A 1OH4A 4RGAA 2G9ZA 2WJSA 4FVVA 1US3A 3J8F2 1PO11 2DU1A 1RTVA 2ZXQA 3NO8A 3MDPA 4COWA 4F8AA 4CDUA 1VBA3 2C5DA 2YDEA 4WM8A 3NAPA 3IMMA 4QQHA 2K9ZA 1FXZA 3HD8B 3J4UH 4M01A 4CEYB 2J22A 3ETQA 5F6KA 2E9QA 4Y22A 4PQ9A 4LJHA 4P9LA 3WUCA 4XVHA 4FPYA 1X8EA 2J1SA 2WLQA 1VE0A 1WLCA 2Y6KA 4ISQA 5FPVA 3MV01 4AL9A 3LF7A 3A4UA 1AYN3 3H7JA 3OPWA 4Q5OA 2P5BA 3D0JA 4EQVA 1AR61 1ZYBA 2VVEA 2BWCA 2BJSA 4W6WA 2FD8A 4IV3B 3MICA 2F6BA 2XJUA 4RL7A 2DVBA 4AGGA 3ACGA 1TZOA 4CDUC 3CEWA 3ZN4A 1J59A 4MZUA 5FWJA 2JB4A 4GD4A 4UFHA 5ERLA 5FZ6A 5KXDA 4AI8A 1ENQA 2O8OA 4GJZA 3RI9A 1IG0A 4FPOB 4MGQA 1R1ZA 4EN9B 5FZ3A 1V6MA 1MS9A 1HIXA 1XU2A 4QKBA 4CP9A 3GDBA 4GQ7A 5FO8B 3ITQA 3URFA 2DWRA 1UY4A 1IS6A 2I45A 4P9WA 1XE0A 2V5YA 4CP1A 4DPNA 2VUJA 3LD8A 1NLRA 3K48A 2DVGA 3NKGA 3HPNA 1W9YA 3I59A 4L9BA 1U5IA 4TWTA 5BV6A 2ZBJA 1Q5OA 3DF0A 2EIDA 2JDZA 3PVOA 4E2GA 3ZFEA 2P6HA 3P1IA 2ZGQA 2X8KA 1UYZA 1JYWA 1O4TA 2Q1FA 1PMJX 2XBO3 5J98B 1R081 3GCXA 4A41A 3POIA 3GXUA 5FYIA 3WINE 4YARA 4CU8A 2ZEZA 1MR5A 4GZ9A 4N8MA 1AL0G 1RUJ2 1RUF3 3KQRA 4J6GA 1W6OB 4XXAA 5G05L 5HV4A 4Q8KA 5DPNA 3MFAA 1RYYA 5FZEA 3VKFC 4QB6A 4UFKA 1UMZA 4XAEA 5DAQA 3TN91 1RJ7A 3POSA 1CGPA 4BK5A 2C24A 5DZEA 5FPLA 3BIEA 4QPWA 1J3RA 4LHLA 4KBZA 4MGKE 4S2HA 4CCLA 4DXSA 5FO9B 5A1LA 1NQJA 4UFIA 1RUD3 4LBMA 4COUA 5JAXA 5AVAA 4WVVA 4IEQA 4ATEA 3PURA 1W05A 2XJRA 1W8NA 3AFGA 1Q8PA 3K77A 4GH4A 1RUH2 3RZMA 2GAUA 2GH8A 1IKQA 2ZGLA 1PO13 5F6LB 2WN2A 3PVEA 1HB4A 3USUA 1LULA 5JI7A 1LGCA 5C3OA 3H0OA 1QY4A 2R32A 4X8PA 5JR7B 2JDNA 4G4FA 3AB0A 2WWJA 3MGUA 1QMJA 2WSUA 3ILRA 2DBIA 1MZEA 2JG8B 4AEJA 5FP3A 3FHIB 2W47A 4KH9A 5IFPA 4Y1UA 3S6PA 1EY2A 3TWIA 1UQXA 1QGLA 1ZBA3 5GKAC 2ZX2A 3AC0A 5IVJA 2NPIA 5FK7A 4YVWB 2X09A 4X6RB 3VHPA 2EXKA 1ZZ6A 2VNOA 4OHWA 3N9NA 5D21A 3I2JA 3ZFFA 3ZMNA 5CKQA 4A45A 3WF4A 2CWMA 3CF6E 4GH4C 1AR63 1MPXA 5IAVA 3VKOA 1MS4A 4U36A 5B4NA 2BGCA 3T2QA 4MYEA 4IQPA 4QXBA 4CUBA 1LHNA 2E63A 4YYOA 5JLVA 1XXNA 1H30A 3MLKA 5FY7A 5DUUA 2VUDA 1CVNA 2J7MA 2QDNA 4L92A 2WKKA 3MF9A 3CZUA 4Q1PA 1WW6A 4L11A 1AR82 3OEBA 1NE6A 1JOPA 4FPEA 1W8TA 4J1XA 1KD7A 3N9PA 1CPMA 1PGSA 5FOBB 3L2HA 2Q1ZB 4I01A 4HONA 2E51A 2XJQA 5AFBA 4HFSA 2AZ5A 3LEIA 4D7YA 2XKOA 1D4M1 4NRMA 5FYVA 1NAEA 1JZ5A 3ZFFC 1DYOA 1NLSA 3R0RA 3O0VA 2V72A 4GB31 5F5AA 1OKOA 1FV3A 2QQPA 1PO22 3DV8A 2OZJA 2Q8EA 1BLZA 2VVFA 3K75B 3RZGA 1ZZ7A 2VMEA 3GZAA 2FQPA 5DG2A 3WG3A 3BOPA 3DYMA 3VZOA 3HN3A 3TEWA 4GWJA 4F3JA 1QXJA 5DAXA 2SLIA 2JDUA 2FBEA 3MW3A 3VHRA 2I07B 2QKDA 2QFEA 1BBT2 2VTXJ 2KXLA 4LLOA 4Q0UA 4YGEA 5FKBA 1NCRA 1HXS1 1OKQA 2VOKA 4DEQA 4JTOA 2VZ1A 2HKXA 3OY8A 4K6BA 4LBJA 1UF2C 2C4XA 2BTVC 4HT1T 1GP4A 4YM0A 2HWC3 1SLBA 2YYOA 3GF6A 2XBO2 3ZYHA 1W9SA 3MPPG 4IUGA 1ULDA 1I5PA 1SFYA 2GP5A 2LW8A 2VMIA 3W20A 3FWEA 1D0HA 2J1UA 3TN93 3WVJA 4OUSA 4HPKB 1N3QA 2PAEA 1DGRN 5FV3A 1DLLA 1OF3A 1LENA 4LEJA 1VBE3 1WBFA 2VVDA 3RYKA 3ZX7A 3ES4A 1WMXA 3AVRA 3OUJA 3E97A 3Q8EA 3POEA 4HANA 1FV2A 5FZ0A 4BQWA 1SPPB 5DN2A 3D0SA 1UY3A 3MF6A 1JXNA 4WM7A 3TRSB 1NCQB 1LEMA 2W91A 3L2YA 1MEC2 3CNAA 2A73B 3IPVA 1PK6C 3EXUA 1SACA 2PLV2 2ZACA 3H50A 2DUOA 3U14A 4EN7B 1O3TA 3D5OA 1OUSA 3V56A 4DEVA 2XGXA 5FAXA 1HJGA 5DQ0A 3OF1A 1J3PA 1U12A 1R1A1 3TBDA 2QZ3A 3ZYGA 4LIVA 2LM3A 3AXDA 1LNSA 4E4SA 3GYDA 3H3ZA 3RYPA 1ZBE1 1REFA 3BGAA 5C8CA 2RHPA 5L7OA 1AZDA 2D93A 3KGZA 3RZZA 1PIV1 3WZ1A 1GSLA 3VBSA 2JECA 1V6NA 4PIXA 2PXJA 4UXAA 3USSA 1ODNA 3WG1A 2VCBA 5FWEA 4CP2A 1GNZA 4D7TA 3FUOA 5FZHA 3AKPA 4GKXA 1ALYA 2OPKA 1NY71 3ASIA 5LEKA 2IXKA 3ZN6B 3BTAA 1I1EA 2ETEA 4HETA 5A6XA 4JHZA 5LBEA 1SMVA 4K21A 4LTAA 4JGYC 3WSOA 4FPLA 1S2EA 1XYNA 3M2MA 5EHDA 2HWD1 1HV1A 5L7OC 2AR6A 5A33B 4HN1A 3T09A 2V4AA 3SISA 4NROA 3UL2A 2HJIA 4FXKB 4B7EA 2FZ2A 2W95A 3M70A 3A7QA 1D7PM 1JU4A 2VXRA 5C3PA 1XNCA 2QQNA 1HN0A 4GB33 4UW4A 2YC4A 1C4RA 4KU8A 1LKNA 4DNYA 3AMHA 5IK5A 5JZGA 1DP0A 4CDQA 1UYPA 1H9PA 1RUNA 1MVEA 4Q8LA 3JUUA 3KF5A 4NE9A 2W52A 2OT7A 1ZM1A 3X29B 1H1AA 1W9TA 3O1TA 1ULGA 5I8YA 4P14A 5FZOB 3LFIA 5FQ0B 5F3CA 3R6SA 4EWAA 3V0AA 3KB5A 2VBDA 4A42A 4COYA 2BBVA 1F9KA 2IWGB 4DXZA 3I2HA 3W5NA 3WP6A 1HXS3 4BQ1A 4HK8A 3WNPA 3JD71 4C1WA 3N7MA 4A7KA 2VR4A 3P6BA 1GOFA 2PA7A 5FPUA 3FMGA 3SH5A 4PLNA 5I91A 4LBNA 5IVVA 3ENRA 1IS4A 2RR12 1Q56A 4HVOA 3KT7A 1AF9A 2UU8A 2W1WA 3ETPA 1DIWA 5DDJ3 1KFUL 4CDQC 1C8M3 2XL9A 3VDDB 4A7ZA 4XURA 1S0EA 5IVBA 1UYYA 5M0TA 3OYWA 4OLLA 3RPQA 4RR3A 4MHUA 2DU0A 4KL1A 4CCMA 2TEPA 4DUXA 2VZ3A 1OOPB 4L8QA 4AFCA 1VBE2 4XJ8A 1PMIA 1LHVA 3ZLIA 4LE3A 2VOVA 4Q4V2 1Z7S1 3MUY1 4FPGA 1OA3A 4OUEA 5CKNA 1GZ9A 2ARCA 3AZXA 3VLBB 1UNBA 5DAWA 5LA2A 2D6PA 2D6LX 2DTWA 4FXGB 1N3PA 2VQAA 4FPHA 5FZBA 5FZAA 4QXHA 4AI3A 3BTXA 3K3NA 2VCMA 1AYM1 4YVSB 1B09A 4Q0SA 4WBBA 2P2KA 5F1RA 3I2DA 4IEYA 4YZ4A 2ADEA 1ZBE3 2YPDA 1SFPA 4BOWA 3OUHA 1PGW2 4YFWA 2WWUA 4W6XA 1PIV3 2TBVA 3BYWA 4WZCA 5LBFA 3VBOA 4QX3A 4WV8A 1OQEA 4TTGA 2RM22 2ZOEB 4CXYA 4RR3C 4CU7A 5A6YA 5IYYA 4Y1YA 4Y20B 5FYSA 4CRQA 1BCXA 3I3BA 4AVTA 1I3HA 4IESA 1G9BA 2NQYA 3KV6A 2FCVA 3BPZA 1PM7A 5DG1A 1H0BA 1RUI1 4IE5A 5GLWA 4P9XA 2BNOA 2ILMA 4QQPA 3A23A 4KGGA 1VBB3 3AMMA 3H8XA 4IEZA 4RGKA 1EPWA 3C7OA 3LA7A 1WCKA 2XPJA 3GM8A 3N9QA 3THCA 4K9SA 2WNUB 1QDCA 3J7HA 3PU3A 4UW5A 4ZU4A 2YPJA 3V0BB 5FYYA 2BGOA 2YXSA 2YBPA 3VBOC 2MEV2 2HWB3 4CEYC 5J3UA 1MS3A 2ERFA 4M3CE 1QF3A 3E5QA 1Y9GA 4AG4A 3AZYA 5AC93 5FCCA 5A7WA 1APNA 2R063 5C3QA 3OB8A 1YQ8A 3AVSA 1OVPA 4OHVA 3TYJA 4MG2A 2DYCA 5IJRA 4QQ2A 3DPRA 4N9IA 4QPIA 1KXGA 2W08A 1RHI2 4UBHA 1RXGA 1WMDA 5C4WA 4IV3C 3GZEA 4TN7A 1O7FA 5JSOA 3O1VA 3D82A 2NM1A 5HCFA 1L7LA 5CEHA 1KRIA 4FQZA 1H8VA 2PTMA 5IK7A 1EPZA 3UK9A 2IXHA 3N36A 1DF0A 2WA3A 4XF1A 1E5SA 4FOYA 1OVSA 3GALA 2RMU3 2R073 2EAKA 4QMAA 3JBG1 1YIFA 5K4LA 5K0UB 1R092 4XUQA 3FUQA 2FDHA 4Q1RA 5HCHA 3B3QE 3ZYRA 2ZCWA 2GNBA 2QCSB 3M4FA 2OQ6A 2Z69A 1Q8SA 5BNPA 5C9AA 1TG7A 4XC9A 1TVGA 2P4EA 3DPRC 4CE8A 2DCTA 1VBD1 5LWBA 3I7DA 4K8RB 3NL1A 4QPIC 1ENRA 1WKYA 1FAYA 3K51A 1GQHA 1UY2A 4LK6A 2IVIB 3I49A 4P00B 2DUQA 5IVCA 4ZHNA 4Z07A 3PVBB 5FZ8A 2VO5A 5DDJ2 3RSJA 1BK0A 4QKDA 4AHZA 3HQRA 4XDQA 1F15A 4Q4Y1 4YZ5A 4AI9A 1S55A 4FTSA 4CPBA 2GN3A 3P5BA 5ACA3 3O5SA 4FPJA 1LU1A 4Y4YA 4KU7A 1CZTA 2FCTA 3WG4A 3PUSA 5JR2A 3BN6A 1W03A 3B02A 3KGLA 1YFYA 1IZ3A 1Z78A 1ND2B 5CFDA 5T50A 2K0GA 1O3RA 3H1MA 3UT0A 2EICA 1CESA 2ZHKA 1TMF1 2LUWA 3D8CA 3JB4C 2UY8A 3LA2A 3LDKA 5EQUA 3AP4A 4RGGA 2AUYA 2Q0AA 2VMDA 1DGWA 3GNEA 3POFA 3VBRB 3T08A 2FZ1A 3H7YA 4Y1VA 5J7MA 4Q0VA 3BU7A 1CZVA 3I4IA 2DCJA 4LT5A 1CJPA 1BMV2 4HK9A 4AXOA 4ZPIA 5ABJB 1IPJA 3U11A 1W6PA 2OUHA 5A7NA 2CSGA 1W6QB 4NHYA 4AQTA 1BEV3 3KCYA 3K4AA 5T5JA 2BZDA 2P3KA 3ZFGB 3NQHA 5CFCB 2OA2A 1E5IA 1H8TB 5F3EA 1UL9A 1PVC3 2A71A 3NJVA 5CFDC 1FI2A 2VY0A 4CCOA 3LQCA 1GP6A 4MADA 3D3AA 3IWZA 1SLIA 4QU1A 1IQDC 2ZEWA 4GWIA 4CCCA 3AKQA 4ASLA 2FDIA 1GWMA 1EAH3 2B4KA 2DCKA 1CX4A 2YGLA 1VBB2 3ABZA 2JG8C 3EO6A 3MIDA 2EIBA 2G4IA 4XFGA 4A3ZA 1QJU2 2GALA 2A5ZA 3B5LB 2X53S 4NHKA 3IIAA 2O14A 2R041 3N7KA 4YVWC 5FFOC 3UV9A 3ZXJA 4V1PA 2DV9A 1U5YA 3LEMA 4Q4W1 1WW4A 4A4AA 2PHXA 1V6OA 1RUJ1 2CNAA 2OIIA 1UY0A 2YUEA 3QBQA 5FYMA 3A0NA 3VD7A 2VTXA 4BPZA 3BTZA 2WZR1 1AXYA 4E8CA 2R30A 4M3CF 4N53B 1W2AX 1S0BA 1BZWA 2VUAA 3FHAA 4NRPA 1VRH2 2WT2A 1W90A 4MVTA 4IEWA 5FY0A 5TSWA 3RZKA 3N4MA 5I8TA 1BQPA 1S4CA 3K4ZA 4FFIA 2E31A 4XBQA 2ZGUA 1ST8A 3MIFA 2RDNA 3M3QA 5F2WA 3ZR5A 4HLTA 1UY1A 2IVJA 3DYOA 3JBG3 5IFTA 3LPFA 1N1YA 3OSDA 3LDBA 1VIWB 1GZWA 1OI6A 3D4KA 1AVBA 1RMU1 5DAPA 2VECA 5L19A 5LBCA 2EVXA 5F8PA 3ZYJB 2YFZA 4AEDA 2V4VA 2XWBB 4OHYA 4E4ZA 3WDYA 1UW8A 1O3SA 5CISA 5I0RA 1C28A 3CLPA 3VD5A 4BH9A 4UFLA 4O9GA 3MW2A 1ND3B 3OD0A 1K5MA 4M3CA 2VZQA 1RVF3 3ZIWA 2PELA 3O12A 2O0OA 1X7NA 3H3UA 3VZMA 2WNVB 4HZFA 3VBHA 4LO5B 4Q4Y3 4BZ4A 1CONA 2XDVA 5A32B 5CADA 4Y24A 5DABA 1WMEA 3P3NA 5FY9A 3RRDA 2X5IB 4NJ4A 4FQ4A 5GLZA 4ASKA 4PI2A 4BMEA 4N7IA 4FP2A 4QKNA 3AP7A 1HJFA 1Q3EA 1COV3 1GUIA 2R49A 2XLAA 1A3KA 2LS6A 5EZWA 3ZR6A 2RV9A 2JDKA 3RJ2X 3WP3A 4XF4A 1MS8A 3FN9A 4Y1ZA 5JOWA 1TMF3 1M06G 4NVPA 1UCXA 2ORXA 4XJ9A 1HQNA 3N9MA 3GBWA 2XLFA 5IK8A 1O4YA 4AVAA 2FDFA 1AR81 4B1MA 1GQGA 1Q8OA 3VBHC 4AI2A 4NMIA 2VH9A 1ENXA 5IATA 1VAVA 4ITCA 1NCQC 3ATGA 4CEWB 4LPLA 4QHOA 1DBNA 2DURA 4BCUA 5GZEA 3E1F1 3WF3A 5BNNA 1CAXA 4OULA 4FT8A 1SBFA 3WT3A 2WIIB 3OGVA 3KVBA 2J1EA 1GR3A 1W2TA 5T52A 4B8EA 4BQXA 3KT4A 5HXVA 4XPVA 4NIIA 4AQSA 4CDWA 3HJRA 2B5HA 2E7AA 1PNGA 5FZIA 3RVHA 1BEV2 1FPN2 2D6NA 5BNOB 1M4WA 1DLCA 4QX1A 1RUE3 1STMA 3I2KA 4YGDA 3Q9OA 4NHXA 1OA2A 2B9VA 1OXCA 1SEFA 3ZKUA 2VNRA 2VC9A 2BOJA 3UYJA 2XOMA 2R043 4BIOA 4PBOA 3VZJA 1D2QA 1CQ9A 1EAH2 5HV0A 4Q4W3 5A1FA 5BY5A 3TEYA 2MNGA 4BQYA 2P6CA 2W3JA 4FFGA 4GULA 5EJ1B 2WZR3 1V6KA 1VBC2 2A7AA 3T2TA 3AMQA 1KFXL 3NV1A 4IW3A 4BU2A 3CL1A 2Y38A 5GLTA 5JMCA 1CN1A 1T6BX 1UO9A 4I02A 4NIGA 1W2OA 5F3IA 4HOOA 4AFDA 2YZ4A 5C5UA 4YZ2A 1UZ0A 2LALA 4XIOA 4Q4X1 3WQ0A 2FMDA 1UWWA 2C1FA 3EBRA 4XHBA 5LA0A 3WCRA 1EV11 4LBQB 3THPA 3AZWA 3CJIB 1U5XA 3AYEA 1XNTA 3B7MA 4XFFA 3VBUA 1ZRCA 1GOHA 2QNKA 4FP3A 4ZU5A 3ZSJA 1FATA 2PLV1 1TNFA 1UX6A 2ZJCA 5CG9A 3B94A 2A1XA 1RUC1 4W8JA 1J84A 1HW5A 1YYNA 2ES3A 2QQUA 2OPWA 4M4RA 1RUG2 3VKNA 3PUIA 3E6DA 2P17A 4QXCA 3T1LA 3UKTA 4W50A 1QJY2 4RS5B 4CP0A 4GALA 1XPWA 5GLVA 1W8ZA 4MGSA 1JYTA 2RS52 2AYHA 2GC0A
chains in the Genus database with same CATH topology
5GZDA 1LOGA 1VALA 1JW6A 1JTZX 2UYAA 4OI4A 2VU9A 5KHKA 5LRSA 4XZPA 1WLWA 1B35A 4K8FA 2C9AA 4S2FA 1WD3A 4XQWA 1FMD2 5JOYA 1YFUA 3VBUC 2ZTNA 3WUDA 1ENSA 3VBFB 2PHLA 1CR7A 1V6LA 1VB4A 5DZFA 4FBFA 1S0IA 2WS93 4YM2A 2WFF1 4QPGA 3FFQA 3SXWA 5F9TA 1DDLA 1COV2 3OBTA 3O0WA 5KXCA 3AP9A 3IDEA 3FBMA 1XNBA 4FPFA 3MIGA 4HKLA 4AEDC 1AR72 3VKLA 2AENA 4K1ZA 1JH5A 3ZN5A 2CL2A 1ASJ2 5KHHA 3WW2A 4RHV2 1B35C 1TME2 4N90A 1HQLA 4OVEA 5I0UA 3EHKA 1VR3A 4C1XA 2D97A 3H1YA 1V9U1 1G9DA 5JPMB 1YWKA 2RS11 2WT0A 5BXXA 1QJX2 4ZKTB 5E89A 4QPGC 4YVSC 1A6CA 1C57A 2ZMKA 5FPZA 5D8AA 5BNQA 3ECQA 5EFUA 3AYCA 2ZX4A 2Z42A 1KITA 5CVRA 1QXRA 3LA3A 1XNKA 4PDWB 2Q8OA 1JN2P 4ES8A 4Y5Z0 4GMP0 3HIFA 2ZGMA 1W6NB 2VQ0A 1AL23 2E7QA 1UKGA 5FDBA 4NHLA 1C3HA 3NV4A 1GYKA 1RUOA 3JU9A 5HCAA 2VULA 4PJYA 4Q4X3 1C1FA 2N7GA 1J3QA 3M3OA 4XJUA 5D8AC 2DTYA 1DQ2A 1AR91 1X82A 2WNUC 4RFT0 4YLZA 1LOBA 1RGSA 4N43B 3PMSA 2XKPA 2XLGA 1H4HA 1RUC3 1S0GA 1VBA2 1UPIA 1SQ4A 2DVAA 3BCWA 2A6XA 3B9CA 4MGZE 5IUQA 4LO7A 4JVAA 4EROA 4MXWA 1HDKA 2WQZC 1VJ2A 1CAWA 4NHMA 4R4ZA 2ZKNA 4IV1A 4M0HA 1CAVB 2B45X 4JGZB 4R9BA 3U0ZA 1HRV1 3VUOA 2RM21 1QOSA 4R52A 1LOFA 1AYN2 2GC2A 4R4XA 5FTTC 1X33A 1LJ7A 1KS4A 5T5LA 3OGJA 4LBQD 3MEPA 2WFF3 1OLRA 4L97A 1LHOA 3MPBA 1FYUA 4RQPB 4IV1C 4NN0A 1UN1A 1YI9A 2G9FA 1AUYA 1WD4A 2BNNA 1LOFC 2YV8A 2BW8A 2TUNA 1OMIA 3CJXA 4OI2A 4EV0A 1R083 1PK6A 3WW3A 2RS13 1PGL2 1ND2C 2NLRA 4R9CA 4AHYA 3N7LA 1FOD1 3E5XA 4FOQA 3AKTA 2ZMLA 2IC1A 2KM2A 1NYWA 1Y9QA 4MX3A 1WCSA 2D7FA 4AYUA 4XQDA 3VBRC 1RUF2 1QQP1 2GDFA 4C91A 4E2QA 1DFQA 5FO7B 3S30A 4OZXA 4BIFA 1URXA 3WHTA 5ABJC 1R091 3AP6A 4XFHA 3WY6A 3ZFGC 4MLOA 2XHKA 3JQWA 1H8TC 3ZMOA 1N47A 3M1HA 4WVMA 4Z92B 1PZ7A 2HWE1 1O91A 1RUD2 3DKWA 2AH2A 1HQWA 1AR93 3ZVXA 1OPMA 5SV8A 5KHJA 4JGYA 1FNYA 4CDXB 4G3YC 1XQNA 2B7YA 4TLFA 1VB2A 1PO12 1ZZCA 4FTEA 4FPCA 3ZXKA 4YW1A 5CG8A 4PLMA 1QOOA 3WW1A 3WP5A 3RYRA 1UU4A 1C5IA 1G8WA 1NA1A 4Q0QA 5K9YA 1W6MB 1ZBA2 2VMGA 5AFEA 5L36A 2JG9B 1SLAA 1FT9A 5I93A 1NQDA 1UIJA 4HN0A 1UKRA 2ARBA 1TNRA 5K8SA 4XHXA 4PF5A 4HBNA 4YW3A 1AR62 4YM1A 4PLOA 5CBLA 1S2BA 2YC0A 2E53A 2LTNA 4GMP1 1BYHA 1DG6A 3KZ4C 4XTMA 1J1TA 1WW7A 4I3PA 1XE7A 4XMAA 2A3WA 2VMHA 2A6VA 1D4M3 1NA1C 1V6IA 5BPXA 3FE5A 2GN7A 1UAIA 4NWVA 3NJZA 1HX6A 2WNVC 1PZ8A 4IEPA 1RITA 2KA3A 1CAUA 3SH4A 2X5IC 1ZVFA 5H9SA 1GICA 4LA2A 4HKOA 1LCLA 2XB6C 3ILFA 5DUXA 1O5LA 5DZGA 1MS0A 5DUWA 3G7DA 1MQTB 4CTEA 3GHNA 1GZCA 1VRH1 1FOD3 3ZDSA 2SBAA 5HCBA 2GNTA 4H3WA 2C0ZA 3AKRA 3WDWA 3AMNA 4MUVA 5AVPA 2WLPA 4YG6A 2V09A 1LOAA 1QQP3 4A2UA 1A78A 2HWC2 5KC6A 2YY1A 3OCPA 4K3UA 5T5PA 4OI1A 5E16A 1DHKB 1LEDA 1Z0HA 4KG8A 3TN92 3WNXA 2K2SA 4CDUB 4CEWC 2IXLA 4LULA 4WM8B 4HSJA 3NAPB 2UWCA 2GZWA 4KBBA 5GZCA 4K7JA 1BK1A 1MZFA 4AQ2A 4Y22B 1IOAA 1MS5A 4DS0A 2HEVF 3GHMA 2ZKLA 3N7JA 5BNOC 2ZMNA 1R1A3 3E5UA 1SLLA 4R8HA 2ZHNA 5I0SA 4QXKA 4NO4A 2B8MA 1JYCA 1KQRA 2DVFA 2PHFA 4CEYA 1QWRA 3AK0A 2OZ6A 1VLNA 3IT8A 2P3JA 1LESA 1KS5A 4YZ1A 1HRI1 3VHNA 4LO6B 2Z2SB 2WFPA 1I5ZA 1A8MA 3JQXA 2XWJB 2BWAA 4IV3A 4AVBA 3JB8A 1Q8QA 4OFGA 3CJIC 3ZSMA 5JOXA 5KHIA 1LHWA 2HWD3 3WR0A 3AFKA 3I59B 2RS31 4XFIA 3KS7A 3ZFEB 1DU3D 1FPN1 2PHTA 4RS5C 3WHUA 1G6NA 1L3JA 5J09A 2PN5A 3FLPA 4C90A 1OFSA 4AEKA 4QM8A 2UWBA 4UBGA 3R4DB 4GB32 4B4QA 4BLJA 1DQ1A 2I74A 4FCAA 3EQEA 4O9EA 2D43A 4YGBA 2B46X 3TAYA 5J96B 4IETA 3LZZA 3DGTA 2WL1A 2NYYA 1IS5A 2D3RA 3VBFC 3JD73 1LGNA 4F7ZA 2VG9A 5KXBA 5JVVA 2PAKA 1RB8G 2HWF1 4DY3A 2QDRA 2VPVA 2BNMA 5J48A 1W6OA 1HXS2 3RMXA 2DFCA 2GNMA 3ZSKA 1F8VA 2AGSA 1ONAA 2QUOA 3WQ7A 2E7TA 3J8F1 4KG0A 4R9AA 2D6MA 4S2GA 4GH4B 4SBVA 2R0FA 3HT2A 2ARXA 4WVZA 4ES9A 3USUB 3OBRA 2Y0OA 3SMHA 1C8M2 3UKNA 2GC3A 3VHOA 1Z7S3 3ES1A 4I0WB 4SLIA 3HWJA 4B3NA 1QJY1 5CNAA 4Y1XA 3MW4A 2ZGTA 2RS51 4YW4A 1AYM3 2XH6A 3AZZA 4XF3A 4XETA 3ZFFB 2CYFA 2EXHA 4XF9A 5FLJA 2JG8A 4PDWC 1DYKA 4DINB 4JDOA 2FHRA 4YVWA 3GBGA 1ZBE2 5HI0A 1PIV2 3VKMA 1RL3A 1YJLA 3KM5A 2QJVA 1GKBA 1RUI3 1KJRA 2A3YA 4YNIA 1ZNPA 2XJVA 1SBEA 3LOBA 1ASJ1 2ENRA 4LHKA 4N9HA 4RHV1 3WLUA 4N43C 3OD4A 4Z1VA 2RS33 1LODA 2Z79A 1LB2A 4D7SA 5I8SA 1PNFA 5JOZA 1OFNA 4Q29A 4E27A 5KC5A 3QCWA 1QJX1 3RDIA 1DZTA 1S2KA 2HWB2 3H1WA 1JUHA 1NCRB 2PHDA 4JTNA 4BA6A 4YGCA 1NXD1 3OY8B 4EN0A 5AC92 2R062 2ZHLA 4LNVA 1Y43B 1S0JA 2V73A 3AM2A 3ZSEA 1C8NA 5JI9A 3TB0A 4WZFA 4B4PA 3INAA 5H9QA 3C2UA 1SLTA 2HWF3 1RUH1 1UZZA 2NZ9A 1YHFA 3MLJA 4WM7B 3WCSA 3JD72 1NOVA 1Q43A 3J8F3 3IPVB 2RMU2 2R072 4FOWA 1VBD3 1H2NA 4GWMA 4RQPC 4HPKA 5FLIA 4META 4I2OA 1OD5A 4AWDA 2XVGA 1W0PA 2FMYA 3PJYA 3AZVA 2NN8A 4JRLA 5EXOA 1NCQA 5CAZA 5C8CB 1H9WA 2PFWA 5L7OB 3LCPA 5JCTA 1DQ0A 5LEJA 4XJWA 2X29A 3O7OA 1ZRRA 3VBSB 2NMOA 2ZAHA 3HR9A 1UD1A 4AHXA 5ACA2 4IEOA 1BKZA 3J9SA 3WG2A 1AX0A 2XJSA 1Q8VA 3NV2A 4AVVA 3SCGA 4E4DX 3NVCA 5C6CA 1DGLA 2DFBA 1AYN1 1WMFA 1AYM2 1N1VA 4CYDA 1DQ5A 3G6JB 5T5OA 5JSRA 4XFCA 4FO9A 4AW7A 3AJZA 5J36A 3FFZA 5BUVA 2WA4A 3CO2A 1SDWA 2CGPA 4QU2A 3H9AA 1CIWA 3DUIA 2IFWA 1DQ6A 3B9IA 1X8MA 1ZX5A 3POWA 3LGRA 2F4PA 3KCXA 3R4SA 4OHZA 1PO21 5D1IA 3ZN6A 3NKTA 4DRVA 3IN9A 2HEWF 1XE8A 4GA9A 2QVSB 3POYA 5E1RA 1V00A 3MYXA 4CDQB 4KWKA 4XILA 5CU1A 4CDXC 5JZGB 2YMZA 2W0XA 1PVC2 4HSLA 1RJ8A 2H6CA 5A33A 3TNPB 3WW4A 1ULFA 1BBT1 2R0HA 1PGL1 2GU9A 3WV6A 3RNSA 2XVKA 2XG3A 4YFZA 1ZZBA 1RUJ3 3V0AB 3PJQA 3I54A 1ZREA 2XBO1 4QT6A 1H2MA 2JG9C 3QH7A 3RQ0A 1NE4A 2VOWA 3DL3A 4PCRA 3M8LA 4AI1A 1D0GA 1WW5A 1ZZ8A 1ZRDA 2TNFA 5FRAA 4H7LA 2ZGKA 3CU7A 5EYYA 4YZ3A 2BPA2 5FQ0A 4ZXKA 5T3NA 2XL7A 4LBLA 3S7EA 4N7UA 3SLIA 3OYWB 3KLSA 1MEC1 1W2UA 4RR3B 2PAMA 1RMU3 1RUH3 5L73A 2IFRA 1XYOA 1AX2A 1QH7A 2MHFA 4XJZA 2WQ4A 4RSUA 1AXKA 3JBG2 2BEOA 4HKWA 2RE9A 1GFF2 4EN8B 1BXHA 2GH2A 3KSCA 4TSVA 3VDDA 4ATFA 3VZNA 1VBD2 5C8WA 3O14A 2WWSA 1C1LA 4XIKA 1OOPA 3ZXEA 1RVF2 1UU6A 3GBFA 3VBOB 1MQTC 2ZHMA 4Q4Y2 1F31A 1N3OA 1ZBA1 3VGIA 3SCHA 2O1QA 3GZTB 2VW1A 4LR4A 3LB9A 2BUKA 4FOVA 4YVSA 1EP0A 3HAGA 1S1AA 2H6BA 3FBYA 4FTBA 3WDXA 3NW4A 1O3QA 2WC2A 4KNCA 1QNWA 3VDDC 1CJDA 1TMF2 1AR83 2GNDA 4WM8C 3VV1A 1MZ5A 3NAPC 1OOPC 2EF6A 2JEMA 1JHNA 4Y20A 4EN6B 2YGMA 3NV3A 4YM3A 3ILNA 2ZS6B 1MZ6A 2ZGRA 1PO23 4RA0A 2XUMA 3W59A 3SCFA 4D69A 1UZYA 4XMIA 2ET7A 5FBZA 1OPOA 2GSYA 3DPRB 1ZRFA 2WSVA 4QPIB 2WNUA 4LBKA 4NOTA 1EYBA 3V0BA 2BFUL 5C4WB 3ZXLA 2R1DA 1BBT3 4DY5A 3MIBA 2D98A 5GZGA 1RUE2 4BE3A 2JXAA 4XYXA 3WOGA 1IKPA 3APBA 3LKJA 2R042 1I9RA 1REEA 1QJZA 5JSPA 5LK7B 2RR11 4Q4W2 3VL8A 3D6EA 2HYKA 4YG0A 2D5FA 2JE7A 5K7PA 2HWC1 4AF9A 2WZR2 1ZA4A 2Q4SA 4YRDA 3QOPA 1AHSA 2EXJA 2OW4A 5BNPB 5C9AB 1EV13 4R9DA 3ALQA 1LECA 3GZUC 4URTA 1MEC3 3P3PA 4QGLA 1VBE1 1POV0 4Q4V1 2PLV3 4EJRA 5KXEA 3ZFEC 4ORFA 5K0UA 5CIRA 3QLQA 4HL0A 4I30A 4I3GA 4Y26A 1F5JA 3MIHA 4H7MA 1RMU2 2D3SA 2IXCA 5CFDB 3OJBA 2UWAA 1PGW1 4EWEA 3ZXGA 2Z5WA 2BVVA 3B00A 4Z8BA 2IZWA 5E8AA 2QE3A 3HN1A 3KD4A 1MS1A 3S0MA 4D94A 2G9GA 1JBCA 3ZXAC 2ZZQA 5K0UC 1H2LA 1ND2A 4AVCA 4LO8A 3ZYPA 1W6PB 4MXVA 4IEXA 2WS92 4S2DA 2ZGPA 3VBRA 4B4RA 1J1LA 3RJRA 2UYBA 3FC0A 2IXIA 1BVP1 2MEV1 5H9PA 5HBAA 1SCSA 5ABJA 1VP6A 1O4ZA 3RYPA 1W6QA 1V9U3 1G9FA 4PBPA 2NMNA 3BALA 1SCRA 3QH6A 3ZFGA 5CFCA 3RWNA 1H8TA 4XJAA 2D6KA 1RHI1 1ULEA 2JKBA 4LUKA 2OYZA 4A7YA 3OGGA 4OHXA 4QQLA 3M3EA 2A6WA 4QM9A 2XJPA 2YROA 1G7YA 1XYPA 1PZ9A 4H55A 1JYIA 1OHFA 1LGBA 3MLLA 1YLLA 1GLHA 4RD7A 5FMOS 4ONUA 4JAAA 4HVQA 4KQ7A 4WVWA 3ROUA 4OUMA 3IKWA 4I0AA 1W39A 2P3IA 4KWJA 2RR13 4N53A 4COVA 4GIQA 4LO4B 1DYPA 1AL22 1GZWB 5DUVA 5CFCC 5EWSA 2E6VA 3E6CC 2ZX0A 3FJSA 2R6QA 5A3LA 5JIUA 4YW2A 1LTEA 4Z82A 4KGQA 4DOUA 1VAMA 5DDJ1 4M3CB 1K5MB 1F5FA 1H4GA 1C8M1 2A6ZA 2PHUA 3BB6A 4L99A 1O5UA 1F2NA 4QX5A 4U2AA 4XF0A 3UJOA 4Q4V3 4Q4X2 2WNEA 3VL9A 1WBLA 3VBHB 3UKVA 1EV12 1XNDA 4G9SB 3AYAA 4W6YA 3FX3A 3BIWE 4FSJA 1YNAA 4JRAA 1YJKA 1NCRC 1Y7BA 3BOWA 4N53C 1ND3A 4XE9A 1RUC2 3HBZA 1UPSA 1U0AA 4AFAA 1G9CA 2PHRA 1YIPA 3WDTA 1IHMA 5FPXA 2ZABA 2WNVA 1HRV3 2RM23 3AX4A 2WZPP 1G86A 2YHJA 1IQAA 1BJQA 4LHNA 2D6OX 4XOGA 2VNGA 4DRRA 5A32A 1H1IA 4KWLA 1QXPA 2X5IA 1BMV1 3W58A 1Y3TA 2R1BA 4M00A 1AJKA 2I2SA 3WDUA 3ACLA 4XBNA 1AJOA 4WM7C 1T6GC 3WP4A 2UY9A 3V64A 1MACA 2Y0IA 5BNNB 1CAXB 1TEIA 1CD3G 5JPNB 1ND3C 4YG3A 1RC6A 2WFF2 5B2GB 5I91A 3W9AA 4COZA 2GMEA 3AXEA 2W68A 4C0BA 5E88A 4BM8A 4CDWB 1VBB1 4IEUA 5SV5A 2GMMA 2MEV3 1QJU1 1QOTA 3EJKA 4B29A 2Y26A 1S0CA 4E2SA 4AVSA 3IDBB 1N1TA 4CEWA 5C8CC 2H0BA 4HVRA 1POV1 2ZGSA 1JUIA 4H14A 4FPKA 2HWB1 1WA4A 2DUPA 2ZZJA 3VBSC 5A3MA 5AC91 2OUJA 1RHI3 2JENA 2PYTA 1IS3A 2HEYF 2R061 3R05A 2VW0A 1V9U2 4ZU7A 4IEVA 5BNOA 5KWRA 1R082 1YFXA 2P37A 2RS12 4P9GA 5BYNA 4P9YA 3PLQA 3MIEA 3VZKA 2JICA 2CGNA 5CB7A 1FNZA 1OLQA 1R093 3H8UA 1LRHA 4AFBA 3LSEA 3VBUB 1HKDA 1REDA 4AHWA 4QGMA 3FLRA 2RMU1 1DQ4A 2R071 4AQ6A 2VOXA 4BYYA 3AKSA 2O8QA 2HWE3 2Q30A 1QDOA 4YW5A 4XFAA 1YUDA 3SHRA 2DVDA 5JZGC 4XQ4A 4LBQA 5IT6A 1XU1A 5GJ6A 3N3HA 3CJIA 3U10A 5J37A 5EJ3A 3LWCA 4AEDB 2R16A 1AR92 3MI8A 3RMYA 4LA3A 3JZVA 3I8TA 4MSVA 3C3VA 1B35B 4INDA 4UW6A 4L2NA 5ACA1 3TNQA 4TYSA 1OQ1A 4RS5A 2ZAAA 1BVVA 1NXMA 3HQXA 1A8DA 4QPGB 1U5ZA 2W39A 3ZSLA 1SFNA 5CA6A 3M3IA 1E57A 1QU0A 1HRV2 4GMP3 4Q0PA 1I6XA 4D3WA 1RIRA 3VBFA 3FZ3A 4UW3A 1V70A 1S0FA 3LAGA 5LK5A 2EA7A 2CY6A 2A75A 3DN7A 4YSFA 2MPFA 1PVXA 3PHMA 1YI7A 1BEV1 3RS6A 4XW3A 3ZIXA 3KMHA 1PVC1 1QJU3 3ZYIB 1D4M2 1HV0A 5D8AB 1YCIA 2JJ6A 4M0NA 3ZXFA 2ATFA 1WCDJ 5F5QA 2PQQA 4BLIA 1EAH1 1GNHA 1POV3 1SBDA 4LE4A 3SITA 4DMIA 1OQDA 1WLDA 5EYXA 1OSGA 4MGIE 2EXIA 1VBC1 4I09A 4JDMA 2DCYA 3IBMA 3JCIA 1VRH3 3QD6A 4NPRA 3ZXDA 4AFMA 2ET1A 2A6YA 5LRRA 2EIGA 2VW2A 1IGOA 2CAUA 1FOD2 3A0KA 3NSTA 4PDWA 2BFUS 3WQ1A 1X36A 2XVLA 1PHMA 5T54A 1W6NA 4NWWA 3MZHA 5IK4A 1QQP2 3ZO0B 3BODA 1LOEA 3UJQA 4MV2A 2DCZA 4IL7A 1D2SA 4AGVA 4OI0A 1RUG1 1QH6A 2ZA9A 2B9UA 5DXDA 1DGRA 4XBLA 4JDNA 4F83A 4Q27A 2D3PA 1J58A 1GBGA 4MXWB 2HWE2 1GV9A 1UU5A 1LOCA 4A3XA 4PIZA 1CAWB 1RINA 1RVF1 4IV1B 5C4WC 1C5HA 1FMD1 4N43A 4GWNA 1R1A2 5EV7A 5C33A 2ZGNA 1LU2A 3HMYA 2B42B 3KCCA 2B39A 4PIYA 4LBOA 3WX5A 4LLFA 4JV4A 3WDVA 1HRI3 4BHPA 1COV1 4FAGA 1YFWA 1CAVA 4JQRA 4JGZA 4Q26A 1TE1B 3B93A 4ISRA 3B01A 4GXLA 5BNPC 5C9AC 1HLCA 1AR71 5JIAA 5KBFA 3AMPA 2A70A 3PTYA 3TOJA 5FOJB 2NP0A 3PNAA 1NG0A 1NY72 3AJYA 1TME1 5FMOL 4AGRA 2GC1A 3IM0A 4JCKA 2BYVE 1YXWA 3PMEA 2RJLA 3WD5A 4JC1A 2HWD2 3IMNA 4QD2A 4IERA 1FPN3 1KDMA 2OVUA 1PK6B 4NR1A 4P9IA 4RQPA 2A3XA 4JGZC 2IXJA 1SLCA 2VGDA 4XEZA 5FLHA 3J26N 4DFSA 1QNYA 1RUE1 3ST7A 3THTA 2CWSA 1QHDA 4B7KA 2Q5TA 5JDBA 1S0DA 5I0TA 1VBC3 4X6QB 5H9RA 2P34A 3ZPYA 5T55A 2BQPA 4XTPA 2JX9A 4DQAA 3WXPA 4WVMB