5FZGA

Crystal structure of the catalytic domain of human jarid1b in complex with mc3948
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
462
structure length
455
Chain Sequence
SMFLPPPECPVFEPSWEEFADPFAFIHKIRPIAEQTGICKVRPPPDWQPPFACDVDKLHFTPRIQRLNELEAQTRVKARDYTLRTFGEMADAFKSDYFNMPVHMVPTELVEKEFWRLVSTIEEDVTVEYGADIASKEFGSGFPVRDIKLSPEEEEYLDSGWNLNNMPVMEQSVLAHITADICGMKLPWLYVGMCFSSFCWHIEDHWSYSINYLHWGEPKTWYGVPGYAAEQLENVMKKLAPELFVSQPDLLHQLVTIMNPNTLMTHEVPVYRTNQCAGEFVITFPRAYHSGFNQGFNFAEAVNFCTVDWLPLGRQCVEHYRLLHRYCVFSHDEMICKMASKADVLDVVVASTVQKDMAIMIEDEKALRETVRKLGVIDSERMDFELLPDDERQCVKCKTTCFMSAISCSCKPGLLVCLHHVKELCSCPPYKYKLRYRYTLDDLYPMMNALKLRAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LYSINE-SPECIFIC DEMETHYLASE 5B
publication title Crystal Structure of the Catalytic Domain of Human Jarid1B in Complex with Mc3948
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 143
structure length 455
sequence length 462
ec nomenclature ec 1.14.11.-:
pdb deposition date 2016-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF02375 JmjN jmjN domain
A PF02928 zf-C5HC2 C5HC2 zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 5fzgA01
2YU1A 3AL5A 4IGQA 5IVYA 5FYZA 4CCLA 5FZ4A 4IGOA 2VD7A 5F3EA 5FYHA 2XDVA 3PURA 5FUPA 4CCMA 4CCKA 5LW9A 2XXZA 4GD4A 5FZHA 5A3TA 4AAPA 5F3IA 5FXWA 4LIUA 4LITA 4NUBA 3PUSA 5FZ8A 5FZMA 4CSWA 5IVJA 5F5IA 5IVEA 3LDBA 5FP8A 4EZ4A 4Y33A 4V2VA 3NJYA 4V2WA 5FY9A 5FYTA 4BISA 3OPTA 5FWJA 2XMLA 5FP9A 3K3OA 5A7WA 3N9PA 5A7OA 5A7WB 5FPUA 4GJYA 4QU1A 4HOOA 5FZLA 2Q8DA 5A80A 2OQ7A 3PUAA 4DIQA 5FZ7A 3N9QA 2Q8CA 4QX8A 2P5BA 3UYJA 2OX0A 5A1FA 4DO0A 5LY1A 5A1LA 5FYBA 3N9LA 3PTRB 4EZHA 3KV4A 3KVBA 5FZ9A 3K2OA 4UF0A 5FY4A 2PXJA 4UF0B 5FZGA 4BU2A 5F32A 5F5AA 5FV3A 4QX7A 5FUNA 5F37A 2YPDA 3DXUA 3KV5A 5ANQA 5FZ3A 4TN7A 5FP7A 5FYUA 2YBPA 4XDOA 3PU3A 5F3GA 4IGPA 5FP3A 5FZOA 5FZKA 5FZOB 5FYVA 5FY1A 3AL6A 4C8DA 5FZBA 5LY2A 3PUQA 5FZ6A 3PU8A 5FZCA 5FXVA 4CUGA 3U78A 3KV6A 3AVRA 5IW0A 5FY5A 3ZPOA 5CEHA 5FPLA 3U4SA 2OS2A 5IWFA 4D6RA 5IVVA 5FY0A 4CCNA 4D6QA 1VRBA 5K4LA 5FPBA 5FP4A 5ISLA 4AI9A 5IVBA 3RVHA 3N9NA 2YBSA 5A3NA 3AVSA 4HONA 4QXBA 2YBKA 5F5CA 5FZ0A 5FY8A 3LD8A 4GAZA 5FZIA 2Q8EA 5LWBA 3N9OA 5FBJA 2WWUA 5FWEA 4QWNA 4Y4RA 5IVFA 5FYYA 5FY7A 5FPAA 4ASKA 5FXZA 5A7NA 2W2IA 3K3NA 5E6HA 4EYUA 2XUEA 5FPVA 5A3WA 4QXCA 3DXTA 3N9MA 5IVCA 3OPWA 5FJHA 5FYCA 5A7SA 2GP3A 5FZEA 4URAA 4LXLA 4Y3OA 3ZLIA 5FZFA 5FXXA 5F2WA 5FYMA 4CCOA 2OT7A 4BXFA 5FJKA 5F2SA 3KV9A 2GP5A 5FYIA 5FZAA 2YU2A 4E4HA 4QXHA 5FZ1A 5F3CA 5KR7A 5F39A 2WWJA 2OQ6A 5FZDA 4LIVA 4XDPA 5A7QA 3PDQA 4D6SA 5A3PA 4GJZA 5A7PA 5FYSA 3KVAA 4CCJA
chains in the Genus database with same CATH superfamily
4FQ4A 5K0UA 1JYXA 4AI2A 3HT1A 2NYYA 1N1YA 2Y6HA 2WAOA 5F3EA 4H7MA 1REEA 2VMIA 2VZRA 1AR71 1Q43A 3LKJA 3LPGA 5GKAC 4FOQA 3VD9A 4P9YA 4UFJA 4S2FA 2R6QA 3D0JA 5GM0A 3ZMNA 3IDEA 3DYMA 1YRZA 2A70A 3RRDA 1EP0A 1ST8A 1RMU1 2VUDA 4XUNA 3KHBA 5F5IA 1YIPA 1IGOA 1R1A2 2VZ1A 3ZR6A 4UWDA 5C8CB 2R071 5A7WA 1VBB1 3HVDA 4NHKA 1XRUA 4IL7A 5GLUA 1SLBA 4KBBA 1Q3EA 4M4RA 1AUYA 5A3OA 5A80A 3PUAA 4JTOA 4Z82A 4YGCA 1TME3 1DGLA 2X5IB 1CPNA 4CTEA 1CONA 2DVAA 3UYJA 4F3JA 1IPJA 3BOPA 2Y6FA 3FUOA 4LBKA 2CGPA 1XYPA 3CNAA 4GMP0 2VMGA 1JUIA 3M4FA 1V9U2 4QHOA 2P2KA 5FV3A 4B7KA 1LESA 1A78A 1SFNA 3ZO0B 4Q1PA 5EJZB 1JYVA 5J37A 1UMIA 5IHRA 2VQUA 3Q8FA 4NHXA 5T5JA 3WF4A 4HMZA 1W0OA 4JHTA 2A6WA 4QX2A 4GH4A 3RSJA 2ET7A 5GZCA 2R043 5FXVA 3H8OA 2B4KA 2CDOA 2UY8A 3U78A 4QM8A 5J09A 1OA3A 1QJY3 3RMXA 5CEHA 4ATFA 2Y0IA 2ZGSA 4OHZA 1TEIA 4RYDA 4Z2WA 1OA4A 1PK6B 1XE8A 5IVBA 5EIYB 1AXKA 3EBRA 2W95A 1H1AA 3HJRA 2JECA 3MV11 3OBRA 4QPIC 2UYBA 3LA3A 1X9TA 1CR7A 5C8CC 2ZX4A 3LD8A 3WVJA 5FO8B 2WYSA 2TEPA 3PVNA 1O8PA 4JHZA 2WSVA 1N1TA 4Z07A 5GZFA 2FD8A 2UY9A 2ZHKA 1S2BA 4ZS2A 1J1TA 2VMCA 1F5FA 1FOD1 3ZXFA 2J1UA 2UWAA 1PHMA 1C8M2 3I2JA 2JEMA 5J48A 5C70A 3ZIWA 1C3HA 3AYEA 4XF1A 1YYNA 4DY5A 4XXAA 4YFZA 1SBEA 5A7SA 2HWB1 1CAXB 3S5QA 4AK3A 3ZYHA 3MF9A 4NHMA 3GJBA 1HRV2 4ITCA 1AL0G 3ZKYA 1JHNA 1B09A 1GWLA 2VTXA 4P00B 4FPEA 3UNPA 1OH4A 3GYDA 4LUKA 5KR7A 2Y6KA 4XHXA 4DB5A 3KS7A 2OVUA 1UYYA 2Y26A 2VXJA 4LBQA 4YGBA 1ZZ8A 3MIGA 3OCPA 4LIVA 3VZOA 3ZXKA 2RS51 2VNRA 4XJAA 5T54A 2XKOA 4LT5A 1BBT2 1H2KA 1GNYA 1WLCA 4AF9A 1PO23 3T2TA 1G9CA 4Q4W1 4AQ2A 1PK6C 2WUHA 5FK8A 1VRH1 2R32A 1CIYA 3FN9A 1BVP1 4CDUA 4LHLA 2XKPA 4ISRA 5A3UA 1UY4A 2EAAA 5AC92 1YLLA 1X9PA 2XJPA 4JRAA 1NLRA 2B9VA 2I74A 2QQOA 3N7MA 3H7JA 2Y6GA 1ZRRA 1DQ1A 2DBIA 3U11A 5HBAA 4Q0UA 2HWF3 3SKVA 1DGRA 3LEIA 3OPTA 4P5YA 4U2AA 2XMLA 4AEKA 2E9QA 2Z69A 5SV8A 2AEYA 3BALA 1S0BA 1PVC1 3BOWA 4W8JA 2EIDA 2EXIA 2HWE2 2ZHMA 4MGSA 4DS0A 2E63A 2QZ2A 2Y60A 2W68A 3CF6E 2CTVA 4PF1A 3RS6A 5ABJA 3AZYA 2XBO3 4YW6A 3BYWA 2OX0A 1ENRA 1WGPA 3HWJA 4IV3B 4AQSA 2C4XA 3RWNA 4G3YC 3WF0A 2B5HA 3ZDVA 2CDPA 5BNNA 1NA1B 1W8TA 2VCBA 3C7HA 4NHYA 4YZ4A 2VUAA 2BP6A 5LA2A 3JB4C 2WABA 4AQ6A 2QCSB 2BTVC 1V6LA 4XJUA 3SHRA 5F3GA 1PIV2 2CAUA 3SKJE 1ND3B 2AGSA 2VH9A 1GKBA 2W1WA 1BK1A 1RUH1 1W03A 2E7QA 3JUUA 5H9RA 2WN2A 1VPHA 2KXLA 2RE9A 2VG9A 5C3RA 5EYXA 4XCBA 3V56A 3VBHA 4XHBA 1OF4A 2DV9A 1POV0 4Y1ZA 5IWFA 3I2FA 5ABJB 1UZZA 5FREA 1LAJA 1AL21 1WBFA 3MI8A 4GWIA 4ZONA 3AB0A 3RYPA 2NM1A 3H7YA 3N9NA 3T0AA 4K8FA 1JZ6A 1EUTA 2VZPA 4YZ5A 5SV5A 2VVEA 2OUHA 3OF1A 4KG0A 5FRAA 2JB4A 3ZXLA 5ACA2 4XOGA 1RUI1 2UWBA 2D5HA 4X6QB 3BPZA 1MZEA 4Y4RA 2RDSA 4YG0A 4Q0VA 2QUOA 2ZAAA 5IJRA 4CU9A 4DQAA 2Y6JA 1XXNA 3AKRA 2YYOA 5JPMB 1XNCA 5CB7A 4AGGA 4NAMA 5FK7A 3I49A 1NXMA 5K7PA 4QPWA 4META 2HYKA 3CBNA 1X50A 3VBHB 1NA1C 1KJLA 1UY0A 2VZSA 1UZVA 3BVCA 5DG1A 4CCEA 4Q0PA 2VM9A 2VECA 2ZA9A 3BB6A 4BXFA 5GZDA 2P3YA 2YG0A 4MGIE 1ZRDA 4ZZ5A 1QJU1 3OB8A 4HT1T 1OLQA 4XURA 4WM8A 1D4M1 3NV1A 5HCBA 3WCSA 1ND3C 2ATFA 2WWJA 5DDJ2 4OCTA 3OEAA 4JQTA 5CKQA 1QQP3 4Q29A 4XBLA 3RI8A 2HWB3 2ZGKA 1DGWA 4OQ9A 3KGZA 2PAKA 2CY6A 2ZMNA 5C71A 3VBRB 3IDBB 2P6HA 4GJZA 4W65A 3T2PA 1DQ6A 2ZEZA 5GLWA 3WP6A 1E5IA 2OZ6A 4NWVA 1JXNA 5ABJC 2UYAA 4D7YA 3H8UA 4IGQA 3WQ7A 3OGSA 3KB5A 2QVSB 3I3QA 3QACA 3CL1A 3KHCA 4RL7A 2JICA 1SHWB 1GMMA 3ZYFA 5D21A 3J7NA 4XJ8A 5FMDA 2WNUB 5C3OA 1HV0A 2WZR3 1VBA2 3QOPA 4LE3A 4X8PA 1W28A 4GIQA 1ACCA 2WA3A 4AHZA 4F83A 3KMHA 1H9PA 3W5MA 4BISA 3DEMA 5KC6A 4CEYB 2W1SA 5A7OA 5JSPA 1VRH3 4XIOA 4FPHA 5EZWA 4E27A 5BYNA 5FZLA 3VBHC 3WG4A 4CYDA 1LHVA 4O7XA 5FZ7A 4QX8A 1ZVFA 2VW1A 2WT2A 3AZZA 2HJIA 4IE6A 3IM0A 3TBDA 5FYBA 1BVVA 3VBFB 5EV7A 4UF0A 1W2TA 1D0HA 3CEWA 5CZKA 5F5QA 1ZRFA 4BMEA 1PM4A 5FKBA 3RZLA 1F5JA 3ZSJA 3ZXDA 4NAOA 5DABA 1UL9A 1PVC3 1UY3A 4D3WA 1STMA 1W39A 2R1BA 2W52A 3ZSMA 4XTMA 1YFWA 2WR9A 1A8DA 4I02A 3VBRC 1S55A 4F7ZA 5JDBA 3WP5A 3S0MA 2J42A 3TRSB 2XJVA 4WVZA 2VMEA 4S2GA 4OHWA 1ODNA 1YHFA 4NIAA 1TZOA 1VBE1 3ITQA 4Q4X3 3VUOA 1N1VA 3ME2A 3W9AA 2J1EA 1CPMA 2WNUC 4E4ZA 1ODMA 4IESA 1WW7A 1O6UA 1OFNA 3EQEA 3IBMA 4WM8C 3MPPG 3MDPA 2ID4A 2R061 1EAH2 3WG3A 4O9EA 3OTFA 1RUD1 3AC0A 2VE1A 3LF7A 1IS6A 4L2NA 3SCHA 4CEYC 2W08A 1KQRA 5IVFA 3MV01 2X53S 4N8MA 1DG6A 1QXPA 5JVVA 5A7NA 2BQPA 4JDNA 4YZ3A 1FMD2 3HOBA 5I8TA 2DWRA 2XUEA 1VJ2A 2BGOA 2CSGA 3KSCA 4LQRA 3H8RA 2EF6A 2WFF2 1GZTA 4Y22B 4BJ0A 5L7OA 3DXTA 3DPRA 3AP5A 1FXZA 5FYCA 3VZJA 4URAA 1JZ8A 2HWC2 2HEWF 1RUI3 4FP2A 3ZLIA 5CG8A 4XFIA 2RR12 3POEA 4KL1A 4GWNA 2D43A 4HN0A 1N47A 3ZFGA 3DECA 1H2LA 1REDA 4HSJA 4TXWA 4QXHA 1RUE1 4CUBA 5JXHA 4N9IA 3LEMA 2BNOA 4TLFA 4N53A 3S57A 1MEC2 1Q8QA 1RUJ2 1YXWA 2JG8A 5F8PA 1XSRA 1OFSA 2PHLA 2Q1MA 4K7JA 4Y5TA 4AEDB 1TNFA 3OY8B 4TYSA 3GNEA 1PX4A 3O12A 4KMQA 3AP4A 2WA4A 1HXS1 1V70A 3IKWA 5FYSA 1K5MA 4QQ2A 4XF3A 4CCJA 4JVAA 3H42B 1O4YA 3AL5A 1C1FA 1D4M3 4UW3A 1A3KA 1LR5A 2XL7A 3MIHA 3PJQA 4GMP3 3RPQA 3J8F2 2WS92 4LK7A 2XDVA 3M3OA 1UNBA 4CCMA 4HSLA 3WDTA 5FZHA 4E4DX 2DBNA 2P34A 2ZCWA 1D2QA 1ZYBA 4NUBA 3ZFGB 4YSFA 5HXVA 5J36A 3RFRA 4CPBD 5IVJA 3SCFA 4BXSV 4O9GA 3BKZA 5FP8A 2ILMA 5LASA 4LLFA 4LJHA 1Q8PA 1ZBA1 1LOFC 3M2MA 5FPUA 1AR81 2Y38A 2JIGA 3D4KA 3AJYA 3UKVA 3LEKA 1UMHA 1LOEA 5JLVA 2YGMA 2VOKA 1QXJA 3POBA 4EN6B 1IHMA 1RTVA 4DEVA 4FCAA 1U5ZA 5CFDB 2MEV2 5T5PA 4YZ1A 5HCAA 2SLIA 3HBZA 5FLHA 4E8CA 5F5AA 4C90A 3B01A 4D0QA 1VBC2 3O1PA 2BPA2 3AP9A 2H6CA 1HQNA 4EWEA 1AYN1 1JHJA 2AEZA 2CWSA 2GZWA 4RSUA 3WUCA 2EA7A 4AE2A 2GAUA 4R4ZA 2GH8A 3RMYA 4A4AA 1Y9QA 4EWAA 2R30A 5FBZA 4OHXA 4RQPA 3P3PA 2BYVE 4NRMA 2Q8OA 3FBYA 3SNMA 5L7OC 3UGHA 4Q8KA 3VBUA 3ILNA 1TMF2 2RMU2 3G7DA 1EUUA 4COUA 4YRDA 1LB2A 4WZFA 1Z7S1 4XBQA 4DXTA 2VCMA 1VRBA 1Z78A 2ZXQA 3CLPA 4QHBA 4RHV3 4XW3A 3ZFGC 4JQRA 3R4UA 2Q4SA 5IATA 2V72A 3POFA 4GB31 4ZKTB 1B35B 1L7LA 4LMFA 2E53A 2JG8C 1R091 1XOYA 1Q8OA 5IK7A 4Y1UA 4LUMA 2GMPA 3ATGA 3MUY1 2CV6A 4GULA 4URTA 4AFAA 1LGBA 2ZGLA 2C26A 4JAAA 3TEYA 2JDUA 3SH4A 3WP3A 1DBNA 1HN1A 1YNAA 3PLQA 1I6XA 3N9MA 2PTMA 5EYYA 4LBJA 5L9BA 1IG3A 2BNMA 2V73A 4OLLA 4NIIA 2VMHA 1RUD3 2RVAA 2W87A 3DL3A 4L11A 5CFDC 4QGNA 2VNGA 1TME2 1UOJA 5CFCB 2AREA 1PO13 1COV1 3SXWA 3BTXA 4UFLA 1R081 5LATA 2AH2A 1S2KA 2A71A 2E51A 1GZWA 1L3JA 1OC1A 4KG8A 4XF0A 3WSOA 2Q5TA 5GLZA 2X05A 1EV13 1YFXA 3USSA 4B4RA 2QNKA 4OUEA 2WJSA 5DUUA 5FTTC 4MGTA 3JCIA 2IZWA 3ELNA 3R4SA 1QNYA 3U10A 5A7QA 1YEWA 4D6SA 5A3PA 1DU3D 1O3SA 1W6NA 1W6MB 1SLLA 4CDQB 1AX1A 4CE8A 5CU1A 3WEZA 2R042 4A7ZA 1PZ8A 4E2QA 3ACHA 4PLNA 4LKFA 2VCCA 1GV9A 1LULA 1QJY2 2D40A 3JD73 1S1AA 2BGPA 1I3HA 2ZPXA 1B35C 1QH6A 4O61A 2YUEA 1PGL1 2PHUA 1D4VB 2XONA 5KHIA 1LEMA 5A3TA 4FFGA 3FZ3A 4LHNA 4QQHA 3I2DA 1W0NA 5BNQA 5C5UA 4QB2A 1KJRA 1UCXA 3LFIA 5B2GB 4AVBA 3DN7A 1UOBA 2VGDA 3I54A 4RQPC 5EJ1B 4XF4A 3MLJA 3L2HA 3T09A 2BGCA 4RFRB 1QDOA 1HB2A 1MS8A 2J1SA 2Q8CA 3Q8AA 5CFCC 2QDNA 2OUJA 1WA4A 4OFGA 3ETPA 1RUF1 4P9XA 3FMGA 2VTXJ 1SFYA 2G9GA 3CJIA 3LOBA 2AR6A 1OSGA 2ZGPA 3HMYA 2Q1FA 5FY4A 2JXAA 4YM2A 1G7YA 1PMIA 3NV2A 2ENRA 2WKKA 1AR93 1G9BA 2ZMKA 4FP3A 2VOXA 5FAXA 2WBKA 3O1SA 2PYTA 4CPBA 4R4XA 3JBG1 3AKPA 5DZGA 4XUQA 1DP0A 3LIHA 5FZOB 4R8HA 1NZCA 1WLDA 3CO2A 3T2OA 1SEFA 3OYWB 2ZAHA 4XACA 2PAMA 4HZFA 2VJXA 4CDQC 5A33A 4CP1A 3NO8A 4SBVA 1OD3A 3ABZA 3BIWE 1QOSA 4FBFA 1SQ4A 1NKGA 2LROA 1LJ7A 4L92A 4NROA 2CHHA 3ZIXA 1G8WA 2G19A 1KEXA 1XNBA 1PO22 5JIAA 1JOJA 4N7UA 2Y6LA 1IKPA 2YB7A 3JQXA 5BNOA 5K4LA 1UYXA 4BA6A 1OF3A 3USUB 4QXBA 5F5CA 4W4ZA 4BWOA 5FY8A 4RGKA 4BK4A 3HQXA 1LODA 2OZJA 2PLV3 1J59A 5FYYA 4S2DA 2GMMA 4C91A 3M3EA 1SDWA 3C7GA 2GU9A 4HPKB 2HWF2 2VTFA 1G86A 3KQ4B 1O3TA 4IV1B 4E9KA 2P4EA 1URXA 2QQJA 1NQDA 4QXCA 4BQ4A 5I91A 3DCQA 2XL9A 4YGEA 2CWMA 1NCRB 3N7KA 3ZSKA 2DUOA 1W04A 4UOJA 2D93A 2ZKLA 1NUKA 1QH7A 1R093 2I07B 4Y3OA 3FUQA 5F2WA 3MIDA 4F8AA 2XBO2 1QJX3 2CNAA 1RGSA 1YJLA 2JD4A 3EB7A 2WO1A 3V0AA 4XQWA 3VBSA 4HK8A 5FLIA 5KXDA 4OVEA 2JB8A 4OI1A 4NJ4A 5E8AA 5A3LA 3UK9A 1EY2A 2RS11 1K5JA 2R1DA 3R0RA 1BEV2 1RHI1 4XETA 4A7YA 3H8XA 3WG1A 3MW3A 3P1IA 1SPPB 3IMMA 1Y43B 3HIFA 3VL9A 5JR7B 2AC1A 2WINB 2HWD1 3T30A 3BTAA 5G05L 4PI0A 4AFBA 2ZABA 4BB3A 3F2ZA 1H1MA 4MGZE 4ZPIA 5T3NA 4ES9A 3GXUA 2XXZA 4MHUA 3ALQA 4GD4A 4UYBA 1US2A 4L8QA 4XQ4A 2E32A 4ZY9A 4CDWB 3DYOA 1QEXA 2JIJA 4Q4V1 3NL1A 3E5UA 1GICA 2A7AA 1WWYA 5EFUA 5C8CA 3I4IA 1MQTA 2VC9A 3HBKA 3ZYRA 3K3OA 1UU4A 4MG2A 1GLHA 1WBLA 3PHMA 4IXLA 1NCRC 1W6OB 2R7EB 3KF5A 4QT6A 4AR2A 3VD4A 3VKFC 2YC0A 1VR3A 1W8UA 2X5IA 1UY1A 4UT5A 2J1AA 2DTYA 5BNOC 1OA2A 1UWWA 1ZA4A 3ASIA 3CU7A 5C8WA 2BUKA 5A6QA 5JSOA 5M0TA 1H2MA 2RS33 1H8VA 1TNRA 1GBGA 3J9SA 4FOWA 5FZGA 5LZ6A 1IQDC 1ZRCA 2PA7A 4DZGA 1R1ZA 4IEZA 1XNDA 3W58A 3LAGA 2ZBJA 5E16A 3MW4A 1S2EA 5AVAA 5JXJA 4XMAA 2G9FA 3HQRA 2BWAA 4ONUA 1BK0A 3FLPA 2V4VA 4IUGA 1MQTB 3HNYM 3OOXA 4C8DA 1QQP2 1ZZBA 2HWB2 3C2UA 2H0VA 4R9DA 3OGVA 4TZDA 3D8CA 1AR61 1NX9A 2H6BA 2IXHA 3KM5A 3M3IA 4YNIA 4A3ZA 5IFPA 5CADA 1PK6A 2ARBA 1CAVB 4I30A 4Y1YA 3LGRA 4EN8B 3VBSC 1W05A 4PI2A 1DYPA 2IFWA 3AVSA 5FZ0A 1IPSA 2B9UA 3GBGA 4K3UA 2NPIA 2WZR2 4Q0SA 1GUIA 2BFUS 1HRI3 1UOGA 4M3CB 1AYM1 4EJRA 3WT3A 1H6XA 5C9AA 1IZ3A 4Y20A 4MADA 3AM2A 5E6HA 5DUXA 4L0PA 2Y0OA 3TEZA 5EHDA 1VRH2 3RYKA 2BVBA 3OUIA 4H2AA 1CAXA 1OKQA 3HT2A 4MV2A 2PQSA 4YGDA 2B7YA 4JGYB 1LGCA 2P3JA 4R52A 1ASJ1 2VVDA 2JG9B 3ZX7A 2YFUA 1W2UA 4HL0A 2D6PA 3I2OA 2A3XA 1VAVA 1VMJA 3PJYA 2WWSA 4QKFA 5L36A 1MQTC 1RVF1 3VHOA 5LRSA 4NR1A 1PVC2 1IS4A 2A1XA 1J84A 3AZWA 3K51A 1QOTA 1ZBE1 5C9AB 4Y20B 1X82A 1NY71 4FO9A 2FDHA 3T1LA 2X5IC 2P3IA 1ULDA 2VBBA 1F31A 2D6OX 3U1XA 2ZZQA 5IVYA 4XAEA 2Q30A 4EN7B 2XWBB 4Q4X2 4EWDA 1GNHA 3ACGA 2RS13 3IAPA 4IDZA 2A6ZA 1RUG3 5F3IA 5FXWA 3S30A 4L99A 5GLVA 4BK5A 5IFTA 1O8SA 2XJUA 3IB3A 1SCSA 4LHKA 2YFZA 2WAAA 4BIFA 3LDBA 3VKMA 4CUCA 5JPNB 2PFWA 4V2VA 2GC1A 3UETA 3TN91 4BE3A 1JTZX 2PHTA 2PHWA 4CUAA 3ZM8A 2DVFA 4DY3A 3A23A 3WNLA 4JGYC 2YXSA 2K0GA 2JG9C 4BLIA 2N7GA 1RXFA 4IV3A 4AVCA 2ORXA 4XQDA 2WQ8A 1NA1A 1PVXA 1UYZA 2PN5A 1PGW1 2WO3A 1RUI2 2E33A 2PXJA 4XJWA 1C5HA 1QMJA 5I0UA 3WG2A 1ENXA 4BU2A 1SACA 5FUNA 1JZ5A 4HETA 1GZ9A 1V00A 2CL2A 2YPDA 3OGJA 2OKXA 1V9U1 2IVIB 1LOBA 1UD1A 1W8FA 2YZ4A 4KH9A 3SH5A 3BIEA 5DUWA 1ND3A 5C9AC 2D6KA 5DPNA 1W9SA 1AR73 4YM0A 4IE4A 3FFZA 2WZPP 4YG6A 3B02A 3V64A 1HB3A 2VBPA 2Y33A 4XILA 4CP2A 1ND2B 4NE9A 3KZ4C 4C0HA 3P5BA 5C4WB 4QGMA 2OPWA 3VHPA 1D0GA 1VB4A 1RMU3 1Y7BA 1D4M2 1ZZ7A 3HR9A 3POSA 5IUQA 3VZLA 5KWRA 3FL7A 1K42A 1VAMA 2MNGA 2WZ8A 3NV3A 2R073 4JV4A 2PQQA 2BERA 5T50A 1VBB3 1J58A 5GALA 4IEVA 1US3A 4E4SA 3U14A 4P9WA 4PF5A 4KU8A 1UO9A 5F6KA 1NOVA 1S0FA 1U5XA 1LHNA 3K3NA 5KHKA 2JDHA 4DXRA 2FCVA 3KCXA 2D3PA 3LZZA 4ZHNA 1RB8G 1WCQA 2JX9A 4BQXA 2IUWA 1C8M1 3VD5A 2ZEYA 3VBOB 2CGOA 2ET1A 1UPIA 1O5LA 3BCWA 2OXBA 5HPOA 1WLTA 1AYM3 2WO7A 3M3QA 4PIZA 5F2SA 5JOZA 3UGGA 3NNMA 1HRV1 4CXYA 1WW4A 4XXPA 2GNDA 5J98B 1N3QA 2WIIB 2WFPA 3ZDSA 1Q56A 3HD8B 4GA9A 2QDRA 4X6RB 3CZUA 3NAPB 3LSEA 3OD4A 5JOYA 1CAWB 1WMFA 2KD7A 3D6EA 3ZOIA 4D8MA 4YM3A 3VBRA 4BPZA 3NVCA 1LOCA 1ND2C 3OGGA 1RUOA 1SDDB 2K9ZA 2FDIA 1NXD1 1W2AX 3OGRA 1SLCA 2YU1A 2D6NA 1VAKA 1GOGA 3AMPA 1LU2A 1HW5A 4IV3C 1DLLA 1BBT1 4YVSB 2TBVA 2WC2A 4DINB 4P9LA 1U5YA 1UYPA 1U0AA 1DLCA 4KWKA 4XFHA 4BQ2A 5LW9A 4CU6A 2WNUA 3UESA 3WXPA 2JDAA 4ZXKA 3ZYGA 4FOYA 1DGWX 5CVRA 3RJRA 5B4NA 1OQ1A 3GM8A 4RHV2 1ZBE3 2PELA 1PNFA 1FOD3 3HAGA 5AC91 3RJ2X 2NN8A 3WUDA 1NCQB 2BW8A 1QY4A 1LRHA 2DFCA 4CEYA 3ENRA 4XMIA 4FPCA 2QQUA 1AJKA 2ERFA 4LR4A 4XTPA 3MPBA 3BUCA 1MZ5A 1PNGA 5APAA 5LBEA 1YJKA 1WKYA 3H0OA 2IXKA 1GP5A 3DKQA 3VBOC 3N4MA 2JE7A 2ZHNA 1OT5A 3FLRA 3I8TA 2HWE1 4DO0A 3ST7A 1XU2A 3FHIB 4WVMB 3VBFA 3WDUA 3I3EA 1N3PA 1F4HA 3E1F1 1RUD2 3K2OA 3TN93 1DHKB 3I3DA 4DUXA 3N7JA 4MGKE 2RS53 3AYDA 1PO12 4QX7A 4Q0QA 2C9AA 3O1TA 3NAPC 2D5FA 3DF0A 4TN7A 2FHRA 2B39A 2VBDA 3BN6A 1RINA 1G9FA 1EV12 3O14A 2HYXA 5FYVA 3NQHA 4Q4W3 2CYFA 4MO3M 1PIV1 1OI6A 1XJAA 2OYZA 3WF3A 2WNVB 4YVSC 1CJDA 2VPVA 1DFQA 1CESA 3SC7X 1OXCA 3THDA 3T2QA 3IT8A 3RI9A 3NNLA 1DYKA 1MZ6A 4WV8A 4COZA 1OKOA 4MLOA 1RUNA 1GQPA 4CCNA 3H1MA 1VP6A 3WW2A 3R4DB 5FPBA 4JZRA 3MIBA 3QLQA 4Q4Y1 4W6WA 5E89A 4BCUA 1WA6X 1WCSA 4QDRA 4TTGA 1NCQC 3JD72 4FFFA 4HKOA 1OQEA 4LO8A 4UI9L 4XZPA 4AQTA 4AFDA 2ES3A 4HXCA 3WF2A 4FTEA 1AX2A 1IQAA 4QWNA 1UAIA 5ACA1 3TNQA 5T52A 4MX3A 3Q8EA 5EQUA 5KXCA 1YFUA 3WNPA 4D7SA 1W90A 5FQ0B 4RFT0 4LEJA 4Y22A 1LOFA 1MS4A 1KS5A 1NE4A 2ZX1A 3AMHA 3DYPA 1HIXA 4JDOA 4BOWA 2A6YA 1FNYA 2JDNA 1N3OA 1NG0A 2I45A 1JZ2A 3KGLA 1JOBA 3ZXAC 1W9TA 4EROA 4ATEA 1O4TA 4LO4B 3MUZ1 2QE3A 3LCPA 4OYUA 4W6YA 1PZ7A 4YFWA 3IPVA 1AX0A 4HVRA 4AVTA 5L19A 1YCIA 4OUMA 5H9PA 1RUH3 4C1WA 1AR92 1ENQA 2WLQA 4AFCA 4AEDA 2WNVC 4YYOA 4IEWA 3OY8A 5DDJ1 3FWEA 5JZGB 2VZUA 3ZN5A 3BTYA 3WF1A 1WCDJ 4Y33A 1AL23 4PIYA 2W2IA 5A7PA 1SLAA 2XVKA 3PUIA 3Q8CA 4LA2A 4JC1A 2VZ3A 4FFHA 1WCUA 1XU1A 2XHKA 4YW7A 3AFKA 2I2SA 5A32B 1BZWA 1BYHA 4IERA 5FYZA 3VBFC 5BNPB 1DQ4A 2ZGMA 3GBWA 4TSVA 3VDCA 3ACFA 4RGAA 1SMVA 2VW2A 3BTZA 4LBLA 2GN3A 4NOTA 3IPVB 3JB8A 2DTWA 4PDWB 5FZ8A 3B7MA 4YG3A 4YW4A 5T55A 4OI0A 3E97A 4IETA 3SEPA 1BMV2 3I3BA 5FY9A 4ORFA 4B29A 4YZ2A 1XNKA 3N9PA 1JUHA 4XFBA 4AEJA 1TE1B 2PLV2 4GJYA 4IEXA 4CU8A 5JI7A 1QXRA 3OBZA 1UKRA 3FBMA 5BY5A 1QJU3 1KS4A 3D3AA 3IIIA 3NJVA 1XC6A 3PIGA 4B7EA 2XLGA 1A6CA 4QPGB 2A6VA 5A1LA 2NLRA 1CN1A 1OURA 4MH0E 4QXKA 3ZXGA 3WW4A 5CFDA 4AYUA 1CQ9A 4ISQA 3H3UA 1R092 1UIKA 2DCZA 4K1ZA 5ANQA 5FZ3A 1QJX2 3T4VA 1W6QB 2PHXA 2YBPA 4XDOA 4PBOA 1IOAA 2UWCA 5JZGC 3CJXA 1LTEA 4A2UA 4CCDA 2DCYA 2QQWA 4WM7A 1S0EA 4K21A 4Y5SA 5DG2A 5FY1A 5JOXA 3PVEA 5HI0A 2R0FA 2UU8A 3AJZA 3CQOA 3D0SA 3PUQA 2LS6A 2OW4A 3K4AA 4QD2A 1GQGA 1PMJX 4CDXB 2WT0A 5BNPC 4XFCA 3ZXJA 3AVRA 3X29B 3NKTA 5FPLA 5CISA 3LEGA 3PIJA 4UFIA 1G6NA 2ARCA 4N43B 4MSVA 5FMBA 1RUC1 3ACLA 1LKNA 4IQPA 5GLTA 1DZRA 3M3CA 4PQQA 3WQ1A 4UFKA 1Q8VA 1O7FA 2YBSA 2F17A 1S4CA 4DUVA 3O0XA 1B35A 2WZEA 1OD5A 4AEDC 3MF6A 2P1BA 3N9OA 1EAH1 1QIQA 4LHSA 3RNSA 2WSUA 2W1UA 5FDBA 1YQ6A 2JENA 3WHTA 5FPAA 4QDSA 1M06G 3VL8A 4WM7B 3S5AA 1K12A 2VO5A 4EYUA 3LIGA 5J96B 4FFIA 2C5DA 1MS3A 3FHQA 4I01A 4Q4Y3 1FMD1 4XZUG 4A6OA 2VNVA 3CDZB 2A3WA 2HH9A 4MOAA 4LKEA 4A6SA 2JD9A 5D8AB 2WFF1 4QX1A 1QJFA 5CYYA 2VY0A 3LA2A 3SMHA 5CFCA 1SLTA 3RYRA 4OI4A 3INAA 2HWC1 3K75B 1XBFA 5B4XA 1H4GA 3CZJA 5DXDA 2RR11 2V5YA 5FMOS 5CBLA 1D2SA 2RJ2A 2RM21 4UBGA 4P08A 3J7LA 3SLIA 1YC61 2RS32 1W8HA 2BDRA 5JSRA 4ASMB 1YI7A 3D5OA 4LOSA 5T5LA 3TNPB 4EE2A 1VBE3 5LK7B 4RD7A 2OQ6A 5C3PA 2QQLA 2RDRA 2VR4A 3BI3A 5FO7B 5I93A 5FFOC 2GNTA 1MEC1 1RUJ1 4K8RB 4CDXC 1UQXA 1T6GC 4LTAA 3MICA 4XUTA 1W6MA 3O1VA 4AW7A 4CDQA 4DRRA 1AJOA 1CJPA 4N43C 4JX0A 1L7QA 4J6GA 4U36A 5FLJA 5AVPA 2QQPA 2R063 4OMCA 5C3SA 3LPFA 1QJZA 3B3QE 3LE0A 4GALA 1SCRA 5JAXA 4CCKA 2VOVA 3IMNA 2IFRA 1PMHX 2WL1A 1YUDA 2XQXA 3FFQA 4YW1A 1QDCA 4LITA 3E6BA 2A75A 5FZMA 4CSWA 3OPZA 1EPWA 4B4QA 1JMUB 2WO2A 1WW5A 3DUIA 4WM7C 4Y1XA 4MXWB 3EO6A 4YLZA 1RC6A 2W91A 2VNOA 4IE7A 2YPJA 1HRI2 1W6PB 2RDQA 4D7TA 4AGVA 4DIQA 5AFBA 5I0TA 4XPVA 4CU7A 2AENA 4QDQA 3RZGA 3VDDA 1RUE3 3H9AA 4XFGA 5JI9A 2IXJA 4EZHA 4PBPA 2DFBA 3MLKA 1YI9A 3ZSEA 1V0AA 2WYFA 4ARXA 3OSDA 5LK5A 5HV0A 2YGLA 1YFYA 1CWPA 3H1YA 5IYYA 2ZMLA 3KV5A 1AXYA 1MVEA 4FOVA 4GKXA 2XJSA 1HXS3 3G6JB 3ZYBA 1WUVA 1CX1A 1ZREA 3PU3A 2XUMA 1VBC1 5FZOA 1S0JA 2XJQA 1SZBA 1DIWA 4AVAA 3OYWA 1JZ7A 5LA0A 5FZBA 5LY2A 3KT7A 2A73B 4GXLA 1OVSA 1X8EA 5A3MA 1QJEA 2VU9A 5CNAA 1HB4A 4GQ7A 4NO4A 3J7HA 3KV6A 1OLMA 4LO5B 4QAWA 1MS9A 1GNZA 4P9IA 4ZU5A 5C5TA 1TMF1 2RMU1 3VDDB 4YVWA 4LO7A 1DZQA 1HJFA 3RDIA 5KXBA 1VMHA 3USUA 1HLCA 5A3NA 4SLIA 5FPZA 2W5FA 2RS12 1O59A 1ZBA3 2B45X 1RUG2 3OUJA 3HN3A 5LBBA 3T08A 1AR83 1FV2A 1UU6A 2VXRA 4ZXEA 1AZDA 4NRPA 4R9BA 2XVLA 2DURA 3JZVA 5FWEA 2FMDA 2J22A 4KGQA 4DXSA 4COYA 1REFA 4HPKA 5CAZA 4YW3A 1AVBA 1I9RA 1V6MA 4QX5A 1UW8A 1RUC3 4IV1A 3RGBA 1UIJA 1TQ5A 3ORJA 5FPVA 3RZKA 1NCRA 4UXAA 5J3UA 1GANA 1JH5A 1C28A 5GZEA 5FZEA 3KT1A 3PVBB 4CP9A 5FZFA 2AZ5A 5HCHA 4IEPA 1AYN3 3R05A 2GNMA 3ZKUA 1WZXA 4YVWB 1TME1 5L73A 4FSJA 5E88A 4H55A 4S2HA 2GH2A 1W9WA 3DGTA 5FIXA 4XJ9A 1ULCA 2EIEA 3HNMA 4AOCA 4CXXA 4XABA 4H14A 3DKWA 1VMFA 1FI2A 2QQVA 3FHAA 3PTYA 5HXMA 4NIDA 3MBWA 1QOOA 4FPYA 1SPPA 1Z7S3 5L9VA 1MS0A 4MUVA 1CVNA 3C7EA 2Y64A 3SISA 1AR72 3NNJA 2RM23 5KBFA 3VDDC 1RJ7A 4LORA 2XHNA 4GB33 4XYXA 3ON7A 4LO6B 2QQMA 4D94A 2YY1A 1NE6A 1EPZA 1FYUA 2R041 5FZ4A 3ZFFA 4CP9B 1XNAA 2KM2A 2PHRA 5J1XA 3T0DA 1MPXA 4BQ3A 1RMU2 5F9TA 1W99A 1KD7A 2XJTA 4UAPA 4LIUA 3L2YA 4CDWA 2V09A 4RS5B 4BIOA 2R072 4A7KA 1U5IA 2J1TA 2JDMA 3SH3A 3I2IA 1UY2A 1VBB2 1Y9MA 2ZTNA 3MFAA 2CGNA 1JI6A 2W92A 4HFSA 1NLSA 2D44A 1OOPA 3LWCA 2RJLA 3A22A 1W6OA 4HOOA 3ZN6B 2BRTA 2EXKA 1COV3 1YO8A 2W47A 2ZEXA 5KHHA 4ES8A 1R083 3H3LA 1JYIA 3N9QA 1Y9GA 3POYA 4P02B 4WVVA 2R49A 3B9CA 4YVWC 2EVXA 3DV8A 4Z2AA 2VMDA 3MO4A 4FAGA 1AF9A 2O14A 3ZFFB 3U4XA 1GP4A 5T5OA 1ENSA 1S0GA 5F32A 2FDFA 4J1WA 4YW5A 5LA9A 2QTWB 1AYM2 3VKLA 2W46A 1AHSA 4COVA 2EAKA 5LA1A 2MHFA 2FDJA 1GOFA 2B8MA 1GWMA 1LENA 4NPLA 4XBNA 3E6CC 2XLFA 4IV1C 1OOPB 4PT6A 1MACA 5KHJA 4DOUA 2F4LA 1DQ5A 1ZX5A 5BV6A 3MLLA 2GMEA 3KQRA 2YROA 4QQLA 5IW0A 1JYNA 3MEPA 5FY5A 1OMIA 3TYJA 3V0BB 1UZ0A 1H4HA 4Y4YA 4L97A 3WNKA 5IVVA 2A5ZA 1CAVA 1UN1A 2HBUA 2ZOEB 3MYXA 4GKYA 4K1YA 3VZKA 1W0PA 5ISLA 1PO21 1JN2P 1NLQA 2P3KA 4FAHA 4AI1A 2EXJA 4H7LA 3F95A 4ZU7A 1ZBE2 4M3CA 3I97A 1FOD2 4P5HA 1FPN1 4ASKA 3ZYPA 4Z1VA 1OLRA 2J1RA 2VQAA 1RUF3 1G9DA 4OI2A 2ZGRA 4I3GA 5A3WA 2ZGUA 3J26N 4BQ1A 4AFMA 2HWF1 2VUCA 1CAUA 4QKBA 2ZGNA 2C9KA 4BMBA 5DAVA 4JGYA 3ZFFC 3POJA 2JG9A 5DQ0A 5FXXA 4CCOA 2OT7A 4OHYA 1UKGA 3JBG3 5FUIA 3WV6A 3NV4A 2VAUA 1XYNA 2Y34A 3C8XA 3S6PA 4CDWC 1JBCA 3O1OA 2LUWA 2WQZC 2XBO1 3C7FA 1ZZ6A 3ETQA 3EYPA 4TWTA 4B3NA 3TN92 3LFMA 4QPIB 2RS52 2Z79A 4RR3A 3VD7A 1JW6A 1OOPC 3WQ0A 1J3PA 4W6XA 1BXHA 1HB1A 4Q5OA 4LBMA 1WMXA 5F6LB 4EN0A 1BEV1 2YDEA 1OQDA 3RG0A 3NNGA 3K46A 4Q4W2 4XIKA 3WNXA 4EQVA 3GGLA 5FOBB 5HV4A 2ADDA 5K0UB 5IK5A 4G4FA 1CAUB 1PGW2 1VBD1 1MZFA 1LGNA 2GN7A 1JZ4A 5A6YA 3CIHA 3IAQA 3NWKA 4NIHA 2NMNA 1DQ2A 3TB0A 4YARA 4OZOA 4ZZ8A 2EIBA 1V6NA 3QBQA 4A3XA 4MXVA 3PUSA 2B46X 3ILFA 2VQ0A 4CZSA 1OVPA 4PLOA 4Y24A 3GF6A 2Q1ZB 4M01A 1JZ3A 2E31A 4RR3B 5CKMA 5CKNA 1LHWA 4DRVA 4OULA 3LDRA 5A7WB 2J7MA 3Q8BA 3I7DA 2D6MA 2WNEA 1ONAA 3NRUA 4Y5Z0 1I1EA 3R6SA 2BBAA 2DVBA 2HBTA 4LPLA 3BU0A 1LOGA 1J3QA 1N1SA 2P5BA 4KI5M 4PHZA 2JDYA 1JS9A 4AI8A 2YC4A 1FX5A 2O8OA 5H9QA 1ZZ9A 1L7RA 2XOMA 2YHJA 5FCCA 1XE7A 3WLUA 3H3ZA 1UOFA 3GZTB 4KU7A 2WLPA 2ZS6B 1JODA 3B5LB 3KLSA 3VB9A 1RHI3 2AUYA 3SCGA 1JOPA 2AYHA 2WQ4A 4ZU4A 3OBTA 2VOWA 2RJKA 3ZYIB 5FYUA 3WDWA 4I09A 1YQ5A 4LK6A 2D6LX 2TNFA 1ULGA 2Y8KA 5A70A 1RUH2 2HWD3 4I0AA 5JWPA 3SQOA 1IS5A 5BPXA 5K0UC 5FZ6A 1R1A1 1Q5OA 1UPSA 4GH4B 4MHRA 4EN9B 1F8VA 1UU5A 3I2GA 2Z2SB 1ND2A 5JMOA 3AMMA 1QQP1 3K48A 5CIRA 1AL22 1MS5A 4NVPA 2VOTA 5C4WA 3VZMA 3ZN4A 1WW6A 2E6VA 2JDPA 1GU3A 3AKTA 3B69A 3LA7A 4FPJA 1BJQA 1D7PM 4M00A 4Q4V3 4QMAA 5FY0A 4IE5A 1WMDA 2XR4A 4FPLA 1SLIA 4AI9A 4RA0A 4IE0A 2XVGA 4N90A 3MZHA 3A21A 4Z92B 2LRPA 4FT8A 4Q1RA 2Q0AA 2KA3A 3QH6A 1NT0A 2W94A 3GBFA 3AX4A 4GAZA 4RR3C 4ZS3A 5FZIA 2Z4FA 2JKXA 4XUOA 5JXIA 2IXLA 3N35A 4I2OA 2WZR1 1VIWB 1GZCA 3M8LA 4QB1A 5DAPA 1ZRIA 5GJ6A 1KDMA 3CMGA 4QGLA 4HG6B 5HCFA 2EALA 3W59A 3VV1A 1XPWA 3WNOA 1ZZCA 3VBOA 1H8TA 2L9LA 4D69A 1HQWA 2JKBA 3UV9A 1QJU2 1J1LA 1YWKA 4Z8BA 3BGAA 1FPN3 1OLME 2SBAA 1LHUA 2W3JA 1VB2A 3KV9A 3MIFA 3WDVA 2QQKA 3RZJA 3KCYA 2QFEA 5DAQA 1BQPA 1RJ8A 2FCTA 2GC0A 3N7LA 5DN2A 2W9XA 2AACA 3U0ZA 4DUWA 2BFUL 5G04L 2ARAA 3NAPA 3AK0A 3O1RA 1W9FA 4LBQB 1CAWA 1F4AA 3KCCA 4GH4C 1AR63 4XDPA 1HN0A 1KFUL 3TEWA 1U12A 5JXGA 5LCWL 1GYKA 4AXOA 2BNNA 4BQYA 1V6KA 3I2HA 2FBEA 2G1MA 4K6BA 4YVSA 4KNCA 1H9WA 3JXSA 1H8TB 2VD7A 3VHRA 2VMFA 2VULA 3U75A 3ROUA 4BZ4A 2GDFA 2VZTA 4Q4X1 4CDUB 1G9AA 3O0WA 4QPYA 2F6BA 3LB9A 2D98A 4IEOA 4KWLA 4FXKB 1BEV3 2C1FA 3VHNA 5FR3A 1NCQA 4UFHA 4AVVA 4E8DA 2X09A 1A8MA 2LTNA 3GHNA 4V2WA 3UJOA 1F15A 5DZEA 1E5HA 3WCRA 1VBD3 4P9GA 2JE8A 5FP9A 3C7OA 3S7EA 3N3HA 5FKCA 3LSDA 1ASJ3 3O7OA 2IWGB 2FZ1A 2YV8A 5C4WC 4IW3A 1LCLA 1FATA 1IS3A 4AWDA 1S0IA 4PJYA 4Q4Y2 1KDKA 1XE0A 4HANA 4HBNA 1GFF2 1GWKA 4CA9A 5LY1A 1X33A 4WVMA 4IEQA 1H30A 1NAEA 3THCA 3VZNA 1C57A 5H9SA 3KVBA 3UKTA 1RVF3 1OH3A 5BNNB 5C7GA 4XC9A 1WLWA 4QM9A 4UW4A 1OHFA 2D3SA 2MPFA 2NQYA 3DXUA 4MGYE 4B1LA 5C33A 4J25A 5DZFA 4I3PA 4YWAA 3W5NA 3AKSA 1RYYA 1K3IA 4XJZA 4UBHA 5FP3A 4IGPA 4A45A 2CAVA 2ZKNA 2NMOA 3WP4A 2XH6A 1IPKA 3HQUA 2QKDA 3TEXA 3WW3A 5JUVA 1VBE2 2DVDA 2WNVA 2ZX2A 2P37A 3U07A 3M7AA 1GOHA 4CUGA 3UGFA 1FV3A 2WRAA 1H8TC 2XB6C 1V6IA 4FPKA 4CDUC 2HEVF 2OS2A 4UW5A 3VN4A 4COWA 1H0BA 3JU9A 4QB6A 4BH9A 1J3RA 4MZUA 1E57A 2R062 3RVHA 2C24A 4QX0A 3OBAA 4I0WB 1PX3A 3E5XA 1DQ0A 4HKWA 1R1A3 2ZX3A 3FJSA 1KRIA 2J1VA 4GMP1 2RHPA 3A4UA 4LNVA 1XSQA 2K46A 4GWMA 1ZNPA 5FBJA 5FPXA 5LWBA 1ULPA 2WWUA 4A41A 4AVSA 3GJAA 1APNA 4M0NA 2VCAA 3KF3A 1ULEA 1I5ZA 2B42B 1F9KA 4JTNA 2JJ6A 5FQ0A 2Z42A 4JDMA 1QF3A 2BZDA 2K2SA 3GCWA 4KGGA 3TWIA 1X36A 4UFMA 2V4AA 4EV0A 4IEYA 5BNNC 1VALA 1V9U3 3FX3A 1TG7A 5EJ3A 3RZMA 4XAAA 3I2KA 2CU5A 1RUE2 4FI9A 4PCRA 2GP5A 1YQCA 4YW2A 2R0HA 1HKDA 4CEWA 2BEOA 3QCWA 4WM8B 2O8QA 3AMQA 3WNMA 5A6ZA 4MGQA 4QQOA 5K8SA 5E1RA 3ECQA 2HLEA 4LBOA 2ZEWA 3WZ1A 1POQA 1S0CA 3LQCA 5FZDA 3POIA 2PAEA 1W2NA 1HXS2 1RIRA 1BKZA 1IKQA 1E5SA 1LOAA 3NMBA 4WVWA 5JZGA 3PDQA 2GC3A 3POWA 1OBNA 5LBFA 5F3CA 4HVOA 4M3CE 4FPGA 3WQBA 5A32A 1YIFA 3A0KA 1MS1A 1YQ2A 3E5QA 1UMZA 3RZHA 5BNPA 4LLOA 4IGOA 4H3WA 4BHPA 4JKLA 1LEDA 4ASLA 3EHKA 5IAVA 4PLMA 5KXEA 4L9BA 3NSTA 3IN9A 4N7IA 4LKSA 4PDWA 4B4PA 1SG3A 1XQNA 4CEWB 3HN1A 2WNOA 3S7IA 1JU4A 1CX4A 4RHV1 4EZ4A 1ZBA2 5I8YA 3LOIA 3NJYA 3V65A 1C8M3 1XB9A 5FWJA 1AR82 2VL4A 1EYBA 1UX7A 1W9YA 3PMEA 3GZUC 1NYWA 3AXEA 3WHUA 3ES4A 4QU1A 4AI0A 2E7AA 5IK8A 1HX6A 1KGYA 3FE5A 1UXZA 2PHDA 4BQ5A 1RUC2 2VQTA 1HRV3 4P14A 4WBBA 3UKNA 1KFXL 3AKQA 4QPGA 2ZJCA 3AP7A 1A34A 4K40A 1NQJA 5A1FA 1O3RA 1O5UA 2HKXA 2BJSA 2DUQA 3KV4A 5FZ9A 3AMNA 1YQ8A 1H2NA 2X10A 2DUPA 4I0BA 4UF0B 4FTSA 1IG0A 1AYN2 1C5IA 4FPFA 3WDYA 5F37A 1MR5A 2QBXA 3NKGA 1DCSA 1W6QA 2YMZA 5C6CA 5EP9A 3UT0A 1JYWA 1PO11 1VBA1 1V6OA 1Z0HA 2GALA 2RV9A 1RXGA 3M70A 4NN0A 3N36A 3WNNA 3ZR5A 1PM7A 1BBT3 5IK4A 3AL6A 3P3NA 1EV11 2ADEA 3PU8A 5EPAA 2EICA 2BBVA 1WMEA 2DU0A 4UW6A 1KXGA 2E7TA 5F1RA 2F4PA 2EXHA 4CDXA 1W06A 3MHZA 3OUHA 4PQ9A 1Z7S2 3ZPOA 1LNSA 2H0BA 4XF9A 4LKDA 4JRLA 4JKMA 4N43A 3WD5A 4X8NA 5A1AA 5AC93 2RM22 5FO9B 1SBFA 2BWCA 3M1HA 4GB32 4CEWC 2OA2A 3OD0A 3D82A 4OZXA 1Y3TA 3MW2A 1UF2C 3VKOA 1O3QA 4ET7A 5A6XA 1C1LA 3B9IA 4OUSA 4QHZA 4IEUA 4JKKA 4AHYA 5F7UA 4E2GA 3JD71 4AI3A 2RDNA 4DNYA 3BPSA 3Q9OA 2W39A 5FY7A 3H50A 4JGZA 2OPKA 1QWRA 5FXZA 1VE0A 1QGLA 2HWE3 2LM3A 2VZVA 4KWJA 4CVUA 1XYOA 1GQHA 2NZ9A 5LBCA 3VDBA 5L7OB 3GZEA 1Q8SA 3RWKX 4BYYA 3DPRB 5D8AA 2X8KA 2ZACA 3QH7A 1COV2 5FJHA 5IVCA 2FDKA 3POGA 1R082 4O65A 1ZM1A 3A0NA 1UXXX 3LDKA 1POV1 1DDLA 1T6BX 3BU7A 2QQIA 3J4UH 2ZGOA 4PDWC 3PL0A 5FYIA 5FZAA 5JIUA 4AHXA 5DUVA 1PIV3 2ZGQA 3ZPYA 1C8NA 2W0XA 2XJRA 5FZ1A 5AFEA 4OMDA 4KQ7A 4DPNA 3APBA 4N53B 2JG8B 1HQLA 2JDKA 3CKHA 2TUNA 1KITA 3ZVXA 4K9SA 1AR91 1AXZA 2VVFA 3ILRA 4J1XA 4JGZB 3B93A 3KVAA 2ARXA 1K5MB 2G9ZA 2WT1A 1DYOA 5CG9A 4QPGC 5KHGA 5DAWA 2IXIA 3WY6A 4QX3A 2EIGA 5J7MA 4CCLA 1PGL2 4HVQA 3PURA 4XCAA 5FUPA 3THPA 5LEJA 4BDVB 1NZIA 1R64A 5ACA3 4R9CA 4B1MA 5GZGA 3KD4A 2PMWB 3ES1A 4CCCA 4FPOB 4XEZA 4PIXA 4XFAA 3MIEA 4LULA 3K77A 1CIWA 4Q26A 4AAXA 1V6JA 4Q2FA 4MXWA 4FXGB 4FVVA 4M4PA 5FYTA 2ORZA 1T2XA 3K4DA 3P6BA 3O5SA 3ZSLA 1W3XA 3TAYA 2JDZA 1W6PA 1K45A 1F35A 3EJKA 1BMV1 1QHDA 2XLAA 3DPRC 1O4ZA 5C3QA 2Q8DA 4XUPA 4OQ8A 1RUF2 1W8NA 2PLV1 1JYTA 3GDBA 5EWSA 2QQNA 3OEBA 3OG2A 1LHOA 4FTBA 2UURA 2RG4A 2W1QA 1BCXA 4KBZA 4BLJA 3PTRB 4AZZA 3EXUA 2FCUA 3O0VA 1CZTA 3B00A 3O1MA 1ULOA 1W8WA 5DDJ3 3J8F1 2WS91 2ZZJA 4N53C 1M4WA 3JBG2 5FP7A 4Q8LA 3FLTA 3UJQA 1QJX1 3ACIA 4JGZC 3UL2A 1K5MC 3A7QA 4AHWA 2DU1A 4LA3A 4CP0A 1XNTA 1GP6A 4RQPB 3TOJA 1CD3G 5JCTA 1QU0A 3L9JT 2QZ3A 4M0HA 3HNBM 2R16A 1W8OA 4R9AA 4XVHA 5D8AC 3VBUB 3ZYJB 4C1XA 4DEQA 5I0RA 4D6RA 1VBA3 4OHVA 3SITA 4A42A 4D6QA 5FP4A 2FDGA 1JU3A 1X8MA 1W8ZA 2D7FA 2G4IA 3AXDA 3T0BA 4BM8A 3GALA 2A3YA 4HKLA 1BHGA 4HONA 4QQPA 2YBKA 3OJBA 5I0DA 4TLGA 4Y1VA 3JQWA 3HEIA 4CRQA 2MEV1 3EMRA 3E6DA 4GZ9A 1C4RA 2DVGA 3I59A 3VKNA 2LALA 1MVQA 3NJZA 4JCKA 5JMCA 1BLZA 1SBDA 1O91A 3I3MA 3WDXA 4BQWA 4HK9A 2OIIA 4NHLA 4XE9A 3WR0A 3AZXA 4DMIA 4ARYA 4HLTA 4LXLA 2VW0A 3IWZA 4MVTA 4MYEA 3AYCA 3SEEA 1E5RA 2D97A 2P6CA 3B94A 1FNZA 4NRQA 5FJKA 3ZFEA 4Q27A 3H1WA 1QNWA 3ZXEA 2PHFA 4NIGA 1GZWB 3C3VA 1OUXA 2E26A 2YU2A 5CA6A 2GSYA 4Y26A 5F39A 2D3RA 1OPOA 1RHI2 1S0DA 2DCKA 2IXCA 2DCTA 2IC1A 2VUJA 3PMSA 4QU2A 4NWWA 2RS31 4INDA 4G9SB 5IAXA 3I59B 1OUSA 2VZQA 4QKNA 5LEKA 1HDKA 2C6SA 4RGGA 3VBUC 2HWD2 1CZVA 5ANNA 1Y4WA 1POV3 1W6NB 3T4HB 1ALYA 1WD4A 3IZOA 2FQPA 2JWPA 2WDBA 2XGXA 1I5PA 1HJGA 4LE4A 4WZCA 3T3YA 2V5DA 1HV1A 3IDCB 4GWJA 5FYHA 1EAH3 3CHXA 4K20A 5FMOL 1ZA7A 2BU9A 3KWVA 1WCKA 5I8SA 4Q4V2 3ZFEB 4AAPA 3W21A 2DDUA 4RS5A 2Z5WA 1GSLA 3MGUA 3PUHA 4LOTA 1FAYA 5IVEA 5DAXA 2FZ2A 1FMD3 5L9RA 2DF7A 3WINE 3T1MA 2WFF3 3ZN6A 2C0ZA 4XDQA 2HWC3 2OQ7A 1HRI1 2BV4A 2P17A 3THTA 3U37A 2RR13 2LW8A 1ULFA 5D2AA 4W50A 1CZSA 1DZTA 3N9LA 5K9YA 1JYCA 3O1UA 2HEYF 3CJIB 3PVOA 3URFA 2XG3A 1OPMA 1UZYA 2ZX0A 3VD3A 1MEC3 1RUJ3 1QJY1 2X29A 1F2NA 2XQRA 3VDAA 4AGRA 1FPN2 2BOIA 3RQ0A 4P9JA 2IVJA 3GHMA 4V1PA 5LB6A 4RN5A 5FZKA 4NPRA 2YC2A 4AG4A 2NP0A 5KC5A 2ZGTA 5FZCA 4AL9A 5A33B 1VLNA 1AR62 5TSWA 3AZVA 2WS93 3J8F3 4N9HA 4KWUA 4YM1A 3RZZA 3V0BA 3GZAA 3U4SA 2O0OA 4M3CF 3KT4A 3VGIA 3WW1A 5FOJB 2XWJB 5DMYA 3ZFEC 5D1IA 5BNOB 3PNAA 2O1QA 5ERLA 3WX5A 3VLBB 3ZMOA 5BXXA 1WD3A 1FT9A 3WOGA 4YPJA 1GR3A 3J7MA 2GC2A 2FMYA 1TVGA 1RL3A 5BUVA 3QD6A 1DGRN 2Q8EA 4LBQD 1H6YA 1QKQA 4NPMA 4NMIA 2QJVA 2BVVA 1RUG1 1W3VA 5EXOA 1PZ9A 4A44A 2KR2A 3AP6A 3NNFA 1P8JA 3W20A 3AFGA 2BOJA 2DCJA 5LRRA 2A6XA 1VBD2 2ETEA 3NJXA 1CGPA 1DF0A 1RITA 3AYAA 5FMCA 1ASJ2 1LU1A 4FQZA 3OPWA 4AEMA 4DXZA 5JR2A 2GP3A 2WN3A 3CJIC 2MEV3 3BODA 3IIAA 5FYMA 1UX6A 2GNBA 4HN1A 4C0BA 1VBC3 3IDAA 2DYCA 3K4ZA 2ZHLA 1X7NA 3FC0A 5I0SA 4RS5C 3NW4A 4DFSA 3MFCA 2VZOA 3GCXA 3V0AB 5IT6A 2XPJA 1RVF2 4LBNA 3VBSB 4B8EA 4E4HA 1SFPA 3HPNA 4QPIA 1UZWA 4XFFA 5JOWA 2JE9A 1PGSA 4QKDA 1LECA 1NY72 1J83A 1W2OA 4E2SA 1H1IA 1TMF3 2RMU3 4CXWA
chains in the Genus database with same CATH topology
2YU1A 3AL5A 4IGQA 5IVYA 5FYZA 4CCLA 5FZ4A 4IGOA 2VD7A 5F3EA 5FYHA 2XDVA 3PURA 5FUPA 4CCMA 4CCKA 5LW9A 2XXZA 4GD4A 5FZHA 5A3TA 4AAPA 5F3IA 5FXWA 4LIUA 4LITA 4NUBA 3PUSA 5FZ8A 5FZMA 4CSWA 5IVJA 5F5IA 5IVEA 3LDBA 5FP8A 4EZ4A 4Y33A 4V2VA 3NJYA 4V2WA 5FY9A 5FYTA 4BISA 3OPTA 5FWJA 2XMLA 5FP9A 3K3OA 5A7WA 3N9PA 5A7OA 5A7WB 5FPUA 4GJYA 4QU1A 4HOOA 5FZLA 2Q8DA 5A80A 2OQ7A 3PUAA 4DIQA 5FZ7A 3N9QA 2Q8CA 4QX8A 2P5BA 3UYJA 2OX0A 5A1FA 4DO0A 5LY1A 5A1LA 5FYBA 3N9LA 3PTRB 4EZHA 3KV4A 3KVBA 5FZ9A 3K2OA 4UF0A 5FY4A 2PXJA 4UF0B 5FZGA 4BU2A 5F32A 5F5AA 5FV3A 4QX7A 5FUNA 5F37A 2YPDA 3DXUA 3KV5A 5ANQA 5FZ3A 4TN7A 5FP7A 5FYUA 2YBPA 4XDOA 3PU3A 5F3GA 4IGPA 5FP3A 5FZOA 5FZKA 5FZOB 5FYVA 5FY1A 3AL6A 4C8DA 5FZBA 5LY2A 3PUQA 5FZ6A 3PU8A 5FZCA 5FXVA 4CUGA 3U78A 3KV6A 3AVRA 5IW0A 5FY5A 3ZPOA 5CEHA 5FPLA 3U4SA 2OS2A 5IWFA 4D6RA 5IVVA 5FY0A 4CCNA 4D6QA 1VRBA 5K4LA 5FPBA 5FP4A 5ISLA 4AI9A 5IVBA 3RVHA 3N9NA 2YBSA 5A3NA 3AVSA 4HONA 4QXBA 2YBKA 5F5CA 5FZ0A 5FY8A 3LD8A 4GAZA 5FZIA 2Q8EA 5LWBA 3N9OA 5FBJA 2WWUA 5FWEA 4QWNA 4Y4RA 5IVFA 5FYYA 5FY7A 5FPAA 4ASKA 5FXZA 5A7NA 2W2IA 3K3NA 5E6HA 4EYUA 2XUEA 5FPVA 5A3WA 4QXCA 3DXTA 3N9MA 5IVCA 3OPWA 5FJHA 5FYCA 5A7SA 2GP3A 5FZEA 4URAA 4LXLA 4Y3OA 3ZLIA 5FZFA 5FXXA 5F2WA 5FYMA 4CCOA 2OT7A 4BXFA 5FJKA 5F2SA 3KV9A 2GP5A 5FYIA 5FZAA 2YU2A 4E4HA 4QXHA 5FZ1A 5F3CA 5KR7A 5F39A 2WWJA 2OQ6A 5FZDA 4LIVA 4XDPA 5A7QA 3PDQA 4D6SA 5A3PA 4GJZA 5A7PA 5FYSA 3KVAA 4CCJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YU1 A;  3AL5 A;  4IGQ A;  5IVY A;  5FYZ A;  4CCL A;  5FZ4 A;  4IGO A;  2VD7 A;  5F3E A;  5FYH A;  2XDV A;  3PUR A;  5FUP A;  4CCM A;  4CCK A;  5LW9 A;  2XXZ A;  4GD4 A;  5FZH A;  5A3T A;  4AAP A;  5F3I A;  5FXW A;  4LIU A;  4LIT A;  4NUB A;  3PUS A;  5FZ8 A;  5FZM A;  4CSW A;  5IVJ A;  5F5I A;  5IVE A;  3LDB A;  5FP8 A;  4EZ4 A;  4Y33 A;  4V2V A;  3NJY A;  4V2W A;  5FY9 A;  5FYT A;  4BIS A;  3OPT A;  5FWJ A;  2XML A;  5FP9 A;  3K3O A;  5A7W A;  3N9P A;  5A7O A;  5A7W B;  5FPU A;  4GJY A;  4QU1 A;  4HOO A;  5FZL A;  2Q8D A;  5A80 A;  2OQ7 A;  3PUA A;  4DIQ A;  5FZ7 A;  3N9Q A;  2Q8C A;  4QX8 A;  2P5B A;  3UYJ A;  2OX0 A;  5A1F A;  4DO0 A;  5LY1 A;  5A1L A;  5FYB A;  3N9L A;  3PTR B;  4EZH A;  3KV4 A;  3KVB A;  5FZ9 A;  3K2O A;  4UF0 A;  5FY4 A;  2PXJ A;  4UF0 B;  5FZG A;  4BU2 A;  5F32 A;  5F5A A;  5FV3 A;  4QX7 A;  5FUN A;  5F37 A;  2YPD A;  3DXU A;  3KV5 A;  5ANQ A;  5FZ3 A;  4TN7 A;  5FP7 A;  5FYU A;  2YBP A;  4XDO A;  3PU3 A;  5F3G A;  4IGP A;  5FP3 A;  5FZO A;  5FZK A;  5FZO B;  5FYV A;  5FY1 A;  3AL6 A;  4C8D A;  5FZB A;  5LY2 A;  3PUQ A;  5FZ6 A;  3PU8 A;  5FZC A;  5FXV A;  4CUG A;  3U78 A;  3KV6 A;  3AVR A;  5IW0 A;  5FY5 A;  3ZPO A;  5CEH A;  5FPL A;  3U4S A;  2OS2 A;  5IWF A;  4D6R A;  5IVV A;  5FY0 A;  4CCN A;  4D6Q A;  1VRB A;  5K4L A;  5FPB A;  5FP4 A;  5ISL A;  4AI9 A;  5IVB A;  3RVH A;  3N9N A;  2YBS A;  5A3N A;  3AVS A;  4HON A;  4QXB A;  2YBK A;  5F5C A;  5FZ0 A;  5FY8 A;  3LD8 A;  4GAZ A;  5FZI A;  2Q8E A;  5LWB A;  3N9O A;  5FBJ A;  2WWU A;  5FWE A;  4QWN A;  4Y4R A;  5IVF A;  5FYY A;  5FY7 A;  5FPA A;  4ASK A;  5FXZ A;  5A7N A;  2W2I A;  3K3N A;  5E6H A;  4EYU A;  2XUE A;  5FPV A;  5A3W A;  4QXC A;  3DXT A;  3N9M A;  5IVC A;  3OPW A;  5FJH A;  5FYC A;  5A7S A;  2GP3 A;  5FZE A;  4URA A;  4LXL A;  4Y3O A;  3ZLI A;  5FZF A;  5FXX A;  5F2W A;  5FYM A;  4CCO A;  2OT7 A;  4BXF A;  5FJK A;  5F2S A;  3KV9 A;  2GP5 A;  5FYI A;  5FZA A;  2YU2 A;  4E4H A;  4QXH A;  5FZ1 A;  5F3C A;  5KR7 A;  5F39 A;  2WWJ A;  2OQ6 A;  5FZD A;  4LIV A;  4XDP A;  5A7Q A;  3PDQ A;  4D6S A;  5A3P A;  4GJZ A;  5A7P A;  5FYS A;  3KVA A;  4CCJ A; 
#chains in the Genus database with same CATH topology
 4FQ4 A;  5K0U A;  1JYX A;  4AI2 A;  3HT1 A;  2NYY A;  1N1Y A;  2Y6H A;  2WAO A;  5F3E A;  4H7M A;  1REE A;  2VMI A;  2VZR A;  1AR7 1;  1Q43 A;  3LKJ A;  3LPG A;  5GKA C;  4FOQ A;  3VD9 A;  4P9Y A;  4UFJ A;  4S2F A;  2R6Q A;  3D0J A;  5GM0 A;  3ZMN A;  3IDE A;  3DYM A;  1YRZ A;  2A70 A;  3RRD A;  1EP0 A;  1ST8 A;  1RMU 1;  2VUD A;  4XUN A;  3KHB A;  5F5I A;  1YIP A;  1IGO A;  1R1A 2;  2VZ1 A;  3ZR6 A;  4UWD A;  5C8C B;  2R07 1;  5A7W A;  1VBB 1;  3HVD A;  4NHK A;  1XRU A;  4IL7 A;  5GLU A;  1SLB A;  4KBB A;  1Q3E A;  4M4R A;  1AUY A;  5A3O A;  5A80 A;  3PUA A;  4JTO A;  4Z82 A;  4YGC A;  1TME 3;  1DGL A;  2X5I B;  1CPN A;  4CTE A;  1CON A;  2DVA A;  3UYJ A;  4F3J A;  1IPJ A;  3BOP A;  2Y6F A;  3FUO A;  4LBK A;  2CGP A;  1XYP A;  3CNA A;  4GMP 0;  2VMG A;  1JUI A;  3M4F A;  1V9U 2;  4QHO A;  2P2K A;  5FV3 A;  4B7K A;  1LES A;  1A78 A;  1SFN A;  3ZO0 B;  4Q1P A;  5EJZ B;  1JYV A;  5J37 A;  1UMI A;  5IHR A;  2VQU A;  3Q8F A;  4NHX A;  5T5J A;  3WF4 A;  4HMZ A;  1W0O A;  4JHT A;  2A6W A;  4QX2 A;  4GH4 A;  3RSJ A;  2ET7 A;  5GZC A;  2R04 3;  5FXV A;  3H8O A;  2B4K A;  2CDO A;  2UY8 A;  3U78 A;  4QM8 A;  5J09 A;  1OA3 A;  1QJY 3;  3RMX A;  5CEH A;  4ATF A;  2Y0I A;  2ZGS A;  4OHZ A;  1TEI A;  4RYD A;  4Z2W A;  1OA4 A;  1PK6 B;  1XE8 A;  5IVB A;  5EIY B;  1AXK A;  3EBR A;  2W95 A;  1H1A A;  3HJR A;  2JEC A;  3MV1 1;  3OBR A;  4QPI C;  2UYB A;  3LA3 A;  1X9T A;  1CR7 A;  5C8C C;  2ZX4 A;  3LD8 A;  3WVJ A;  5FO8 B;  2WYS A;  2TEP A;  3PVN A;  1O8P A;  4JHZ A;  2WSV A;  1N1T A;  4Z07 A;  5GZF A;  2FD8 A;  2UY9 A;  2ZHK A;  1S2B A;  4ZS2 A;  1J1T A;  2VMC A;  1F5F A;  1FOD 1;  3ZXF A;  2J1U A;  2UWA A;  1PHM A;  1C8M 2;  3I2J A;  2JEM A;  5J48 A;  5C70 A;  3ZIW A;  1C3H A;  3AYE A;  4XF1 A;  1YYN A;  4DY5 A;  4XXA A;  4YFZ A;  1SBE A;  5A7S A;  2HWB 1;  1CAX B;  3S5Q A;  4AK3 A;  3ZYH A;  3MF9 A;  4NHM A;  3GJB A;  1HRV 2;  4ITC A;  1AL0 G;  3ZKY A;  1JHN A;  1B09 A;  1GWL A;  2VTX A;  4P00 B;  4FPE A;  3UNP A;  1OH4 A;  3GYD A;  4LUK A;  5KR7 A;  2Y6K A;  4XHX A;  4DB5 A;  3KS7 A;  2OVU A;  1UYY A;  2Y26 A;  2VXJ A;  4LBQ A;  4YGB A;  1ZZ8 A;  3MIG A;  3OCP A;  4LIV A;  3VZO A;  3ZXK A;  2RS5 1;  2VNR A;  4XJA A;  5T54 A;  2XKO A;  4LT5 A;  1BBT 2;  1H2K A;  1GNY A;  1WLC A;  4AF9 A;  1PO2 3;  3T2T A;  1G9C A;  4Q4W 1;  4AQ2 A;  1PK6 C;  2WUH A;  5FK8 A;  1VRH 1;  2R32 A;  1CIY A;  3FN9 A;  1BVP 1;  4CDU A;  4LHL A;  2XKP A;  4ISR A;  5A3U A;  1UY4 A;  2EAA A;  5AC9 2;  1YLL A;  1X9P A;  2XJP A;  4JRA A;  1NLR A;  2B9V A;  2I74 A;  2QQO A;  3N7M A;  3H7J A;  2Y6G A;  1ZRR A;  1DQ1 A;  2DBI A;  3U11 A;  5HBA A;  4Q0U A;  2HWF 3;  3SKV A;  1DGR A;  3LEI A;  3OPT A;  4P5Y A;  4U2A A;  2XML A;  4AEK A;  2E9Q A;  2Z69 A;  5SV8 A;  2AEY A;  3BAL A;  1S0B A;  1PVC 1;  3BOW A;  4W8J A;  2EID A;  2EXI A;  2HWE 2;  2ZHM A;  4MGS A;  4DS0 A;  2E63 A;  2QZ2 A;  2Y60 A;  2W68 A;  3CF6 E;  2CTV A;  4PF1 A;  3RS6 A;  5ABJ A;  3AZY A;  2XBO 3;  4YW6 A;  3BYW A;  2OX0 A;  1ENR A;  1WGP A;  3HWJ A;  4IV3 B;  4AQS A;  2C4X A;  3RWN A;  4G3Y C;  3WF0 A;  2B5H A;  3ZDV A;  2CDP A;  5BNN A;  1NA1 B;  1W8T A;  2VCB A;  3C7H A;  4NHY A;  4YZ4 A;  2VUA A;  2BP6 A;  5LA2 A;  3JB4 C;  2WAB A;  4AQ6 A;  2QCS B;  2BTV C;  1V6L A;  4XJU A;  3SHR A;  5F3G A;  1PIV 2;  2CAU A;  3SKJ E;  1ND3 B;  2AGS A;  2VH9 A;  1GKB A;  2W1W A;  1BK1 A;  1RUH 1;  1W03 A;  2E7Q A;  3JUU A;  5H9R A;  2WN2 A;  1VPH A;  2KXL A;  2RE9 A;  2VG9 A;  5C3R A;  5EYX A;  4XCB A;  3V56 A;  3VBH A;  4XHB A;  1OF4 A;  2DV9 A;  1POV 0;  4Y1Z A;  5IWF A;  3I2F A;  5ABJ B;  1UZZ A;  5FRE A;  1LAJ A;  1AL2 1;  1WBF A;  3MI8 A;  4GWI A;  4ZON A;  3AB0 A;  3RYP A;  2NM1 A;  3H7Y A;  3N9N A;  3T0A A;  4K8F A;  1JZ6 A;  1EUT A;  2VZP A;  4YZ5 A;  5SV5 A;  2VVE A;  2OUH A;  3OF1 A;  4KG0 A;  5FRA A;  2JB4 A;  3ZXL A;  5ACA 2;  4XOG A;  1RUI 1;  2UWB A;  2D5H A;  4X6Q B;  3BPZ A;  1MZE A;  4Y4R A;  2RDS A;  4YG0 A;  4Q0V A;  2QUO A;  2ZAA A;  5IJR A;  4CU9 A;  4DQA A;  2Y6J A;  1XXN A;  3AKR A;  2YYO A;  5JPM B;  1XNC A;  5CB7 A;  4AGG A;  4NAM A;  5FK7 A;  3I49 A;  1NXM A;  5K7P A;  4QPW A;  4MET A;  2HYK A;  3CBN A;  1X50 A;  3VBH B;  1NA1 C;  1KJL A;  1UY0 A;  2VZS A;  1UZV A;  3BVC A;  5DG1 A;  4CCE A;  4Q0P A;  2VM9 A;  2VEC A;  2ZA9 A;  3BB6 A;  4BXF A;  5GZD A;  2P3Y A;  2YG0 A;  4MGI E;  1ZRD A;  4ZZ5 A;  1QJU 1;  3OB8 A;  4HT1 T;  1OLQ A;  4XUR A;  4WM8 A;  1D4M 1;  3NV1 A;  5HCB A;  3WCS A;  1ND3 C;  2ATF A;  2WWJ A;  5DDJ 2;  4OCT A;  3OEA A;  4JQT A;  5CKQ A;  1QQP 3;  4Q29 A;  4XBL A;  3RI8 A;  2HWB 3;  2ZGK A;  1DGW A;  4OQ9 A;  3KGZ A;  2PAK A;  2CY6 A;  2ZMN A;  5C71 A;  3VBR B;  3IDB B;  2P6H A;  4GJZ A;  4W65 A;  3T2P A;  1DQ6 A;  2ZEZ A;  5GLW A;  3WP6 A;  1E5I A;  2OZ6 A;  4NWV A;  1JXN A;  5ABJ C;  2UYA A;  4D7Y A;  3H8U A;  4IGQ A;  3WQ7 A;  3OGS A;  3KB5 A;  2QVS B;  3I3Q A;  3QAC A;  3CL1 A;  3KHC A;  4RL7 A;  2JIC A;  1SHW B;  1GMM A;  3ZYF A;  5D21 A;  3J7N A;  4XJ8 A;  5FMD A;  2WNU B;  5C3O A;  1HV0 A;  2WZR 3;  1VBA 2;  3QOP A;  4LE3 A;  4X8P A;  1W28 A;  4GIQ A;  1ACC A;  2WA3 A;  4AHZ A;  4F83 A;  3KMH A;  1H9P A;  3W5M A;  4BIS A;  3DEM A;  5KC6 A;  4CEY B;  2W1S A;  5A7O A;  5JSP A;  1VRH 3;  4XIO A;  4FPH A;  5EZW A;  4E27 A;  5BYN A;  5FZL A;  3VBH C;  3WG4 A;  4CYD A;  1LHV A;  4O7X A;  5FZ7 A;  4QX8 A;  1ZVF A;  2VW1 A;  2WT2 A;  3AZZ A;  2HJI A;  4IE6 A;  3IM0 A;  3TBD A;  5FYB A;  1BVV A;  3VBF B;  5EV7 A;  4UF0 A;  1W2T A;  1D0H A;  3CEW A;  5CZK A;  5F5Q A;  1ZRF A;  4BME A;  1PM4 A;  5FKB A;  3RZL A;  1F5J A;  3ZSJ A;  3ZXD A;  4NAO A;  5DAB A;  1UL9 A;  1PVC 3;  1UY3 A;  4D3W A;  1STM A;  1W39 A;  2R1B A;  2W52 A;  3ZSM A;  4XTM A;  1YFW A;  2WR9 A;  1A8D A;  4I02 A;  3VBR C;  1S55 A;  4F7Z A;  5JDB A;  3WP5 A;  3S0M A;  2J42 A;  3TRS B;  2XJV A;  4WVZ A;  2VME A;  4S2G A;  4OHW A;  1ODN A;  1YHF A;  4NIA A;  1TZO A;  1VBE 1;  3ITQ A;  4Q4X 3;  3VUO A;  1N1V A;  3ME2 A;  3W9A A;  2J1E A;  1CPM A;  2WNU C;  4E4Z A;  1ODM A;  4IES A;  1WW7 A;  1O6U A;  1OFN A;  3EQE A;  3IBM A;  4WM8 C;  3MPP G;  3MDP A;  2ID4 A;  2R06 1;  1EAH 2;  3WG3 A;  4O9E A;  3OTF A;  1RUD 1;  3AC0 A;  2VE1 A;  3LF7 A;  1IS6 A;  4L2N A;  3SCH A;  4CEY C;  2W08 A;  1KQR A;  5IVF A;  3MV0 1;  2X53 S;  4N8M A;  1DG6 A;  1QXP A;  5JVV A;  5A7N A;  2BQP A;  4JDN A;  4YZ3 A;  1FMD 2;  3HOB A;  5I8T A;  2DWR A;  2XUE A;  1VJ2 A;  2BGO A;  2CSG A;  3KSC A;  4LQR A;  3H8R A;  2EF6 A;  2WFF 2;  1GZT A;  4Y22 B;  4BJ0 A;  5L7O A;  3DXT A;  3DPR A;  3AP5 A;  1FXZ A;  5FYC A;  3VZJ A;  4URA A;  1JZ8 A;  2HWC 2;  2HEW F;  1RUI 3;  4FP2 A;  3ZLI A;  5CG8 A;  4XFI A;  2RR1 2;  3POE A;  4KL1 A;  4GWN A;  2D43 A;  4HN0 A;  1N47 A;  3ZFG A;  3DEC A;  1H2L A;  1RED A;  4HSJ A;  4TXW A;  4QXH A;  1RUE 1;  4CUB A;  5JXH A;  4N9I A;  3LEM A;  2BNO A;  4TLF A;  4N53 A;  3S57 A;  1MEC 2;  1Q8Q A;  1RUJ 2;  1YXW A;  2JG8 A;  5F8P A;  1XSR A;  1OFS A;  2PHL A;  2Q1M A;  4K7J A;  4Y5T A;  4AED B;  1TNF A;  3OY8 B;  4TYS A;  3GNE A;  1PX4 A;  3O12 A;  4KMQ A;  3AP4 A;  2WA4 A;  1HXS 1;  1V70 A;  3IKW A;  5FYS A;  1K5M A;  4QQ2 A;  4XF3 A;  4CCJ A;  4JVA A;  3H42 B;  1O4Y A;  3AL5 A;  1C1F A;  1D4M 3;  4UW3 A;  1A3K A;  1LR5 A;  2XL7 A;  3MIH A;  3PJQ A;  4GMP 3;  3RPQ A;  3J8F 2;  2WS9 2;  4LK7 A;  2XDV A;  3M3O A;  1UNB A;  4CCM A;  4HSL A;  3WDT A;  5FZH A;  4E4D X;  2DBN A;  2P34 A;  2ZCW A;  1D2Q A;  1ZYB A;  4NUB A;  3ZFG B;  4YSF A;  5HXV A;  5J36 A;  3RFR A;  4CPB D;  5IVJ A;  3SCF A;  4BXS V;  4O9G A;  3BKZ A;  5FP8 A;  2ILM A;  5LAS A;  4LLF A;  4LJH A;  1Q8P A;  1ZBA 1;  1LOF C;  3M2M A;  5FPU A;  1AR8 1;  2Y38 A;  2JIG A;  3D4K A;  3AJY A;  3UKV A;  3LEK A;  1UMH A;  1LOE A;  5JLV A;  2YGM A;  2VOK A;  1QXJ A;  3POB A;  4EN6 B;  1IHM A;  1RTV A;  4DEV A;  4FCA A;  1U5Z A;  5CFD B;  2MEV 2;  5T5P A;  4YZ1 A;  5HCA A;  2SLI A;  3HBZ A;  5FLH A;  4E8C A;  5F5A A;  4C90 A;  3B01 A;  4D0Q A;  1VBC 2;  3O1P A;  2BPA 2;  3AP9 A;  2H6C A;  1HQN A;  4EWE A;  1AYN 1;  1JHJ A;  2AEZ A;  2CWS A;  2GZW A;  4RSU A;  3WUC A;  2EA7 A;  4AE2 A;  2GAU A;  4R4Z A;  2GH8 A;  3RMY A;  4A4A A;  1Y9Q A;  4EWA A;  2R30 A;  5FBZ A;  4OHX A;  4RQP A;  3P3P A;  2BYV E;  4NRM A;  2Q8O A;  3FBY A;  3SNM A;  5L7O C;  3UGH A;  4Q8K A;  3VBU A;  3ILN A;  1TMF 2;  2RMU 2;  3G7D A;  1EUU A;  4COU A;  4YRD A;  1LB2 A;  4WZF A;  1Z7S 1;  4XBQ A;  4DXT A;  2VCM A;  1VRB A;  1Z78 A;  2ZXQ A;  3CLP A;  4QHB A;  4RHV 3;  4XW3 A;  3ZFG C;  4JQR A;  3R4U A;  2Q4S A;  5IAT A;  2V72 A;  3POF A;  4GB3 1;  4ZKT B;  1B35 B;  1L7L A;  4LMF A;  2E53 A;  2JG8 C;  1R09 1;  1XOY A;  1Q8O A;  5IK7 A;  4Y1U A;  4LUM A;  2GMP A;  3ATG A;  3MUY 1;  2CV6 A;  4GUL A;  4URT A;  4AFA A;  1LGB A;  2ZGL A;  2C26 A;  4JAA A;  3TEY A;  2JDU A;  3SH4 A;  3WP3 A;  1DBN A;  1HN1 A;  1YNA A;  3PLQ A;  1I6X A;  3N9M A;  2PTM A;  5EYY A;  4LBJ A;  5L9B A;  1IG3 A;  2BNM A;  2V73 A;  4OLL A;  4NII A;  2VMH A;  1RUD 3;  2RVA A;  2W87 A;  3DL3 A;  4L11 A;  5CFD C;  4QGN A;  2VNG A;  1TME 2;  1UOJ A;  5CFC B;  2ARE A;  1PO1 3;  1COV 1;  3SXW A;  3BTX A;  4UFL A;  1R08 1;  5LAT A;  2AH2 A;  1S2K A;  2A71 A;  2E51 A;  1GZW A;  1L3J A;  1OC1 A;  4KG8 A;  4XF0 A;  3WSO A;  2Q5T A;  5GLZ A;  2X05 A;  1EV1 3;  1YFX A;  3USS A;  4B4R A;  2QNK A;  4OUE A;  2WJS A;  5DUU A;  5FTT C;  4MGT A;  3JCI A;  2IZW A;  3ELN A;  3R4S A;  1QNY A;  3U10 A;  5A7Q A;  1YEW A;  4D6S A;  5A3P A;  1DU3 D;  1O3S A;  1W6N A;  1W6M B;  1SLL A;  4CDQ B;  1AX1 A;  4CE8 A;  5CU1 A;  3WEZ A;  2R04 2;  4A7Z A;  1PZ8 A;  4E2Q A;  3ACH A;  4PLN A;  4LKF A;  2VCC A;  1GV9 A;  1LUL A;  1QJY 2;  2D40 A;  3JD7 3;  1S1A A;  2BGP A;  1I3H A;  2ZPX A;  1B35 C;  1QH6 A;  4O61 A;  2YUE A;  1PGL 1;  2PHU A;  1D4V B;  2XON A;  5KHI A;  1LEM A;  5A3T A;  4FFG A;  3FZ3 A;  4LHN A;  4QQH A;  3I2D A;  1W0N A;  5BNQ A;  5C5U A;  4QB2 A;  1KJR A;  1UCX A;  3LFI A;  5B2G B;  4AVB A;  3DN7 A;  1UOB A;  2VGD A;  3I54 A;  4RQP C;  5EJ1 B;  4XF4 A;  3MLJ A;  3L2H A;  3T09 A;  2BGC A;  4RFR B;  1QDO A;  1HB2 A;  1MS8 A;  2J1S A;  2Q8C A;  3Q8A A;  5CFC C;  2QDN A;  2OUJ A;  1WA4 A;  4OFG A;  3ETP A;  1RUF 1;  4P9X A;  3FMG A;  2VTX J;  1SFY A;  2G9G A;  3CJI A;  3LOB A;  2AR6 A;  1OSG A;  2ZGP A;  3HMY A;  2Q1F A;  5FY4 A;  2JXA A;  4YM2 A;  1G7Y A;  1PMI A;  3NV2 A;  2ENR A;  2WKK A;  1AR9 3;  1G9B A;  2ZMK A;  4FP3 A;  2VOX A;  5FAX A;  2WBK A;  3O1S A;  2PYT A;  4CPB A;  4R4X A;  3JBG 1;  3AKP A;  5DZG A;  4XUQ A;  1DP0 A;  3LIH A;  5FZO B;  4R8H A;  1NZC A;  1WLD A;  3CO2 A;  3T2O A;  1SEF A;  3OYW B;  2ZAH A;  4XAC A;  2PAM A;  4HZF A;  2VJX A;  4CDQ C;  5A33 A;  4CP1 A;  3NO8 A;  4SBV A;  1OD3 A;  3ABZ A;  3BIW E;  1QOS A;  4FBF A;  1SQ4 A;  1NKG A;  2LRO A;  1LJ7 A;  4L92 A;  4NRO A;  2CHH A;  3ZIX A;  1G8W A;  2G19 A;  1KEX A;  1XNB A;  1PO2 2;  5JIA A;  1JOJ A;  4N7U A;  2Y6L A;  1IKP A;  2YB7 A;  3JQX A;  5BNO A;  5K4L A;  1UYX A;  4BA6 A;  1OF3 A;  3USU B;  4QXB A;  5F5C A;  4W4Z A;  4BWO A;  5FY8 A;  4RGK A;  4BK4 A;  3HQX A;  1LOD A;  2OZJ A;  2PLV 3;  1J59 A;  5FYY A;  4S2D A;  2GMM A;  4C91 A;  3M3E A;  1SDW A;  3C7G A;  2GU9 A;  4HPK B;  2HWF 2;  2VTF A;  1G86 A;  3KQ4 B;  1O3T A;  4IV1 B;  4E9K A;  2P4E A;  1URX A;  2QQJ A;  1NQD A;  4QXC A;  4BQ4 A;  5I91 A;  3DCQ A;  2XL9 A;  4YGE A;  2CWM A;  1NCR B;  3N7K A;  3ZSK A;  2DUO A;  1W04 A;  4UOJ A;  2D93 A;  2ZKL A;  1NUK A;  1QH7 A;  1R09 3;  2I07 B;  4Y3O A;  3FUQ A;  5F2W A;  3MID A;  4F8A A;  2XBO 2;  1QJX 3;  2CNA A;  1RGS A;  1YJL A;  2JD4 A;  3EB7 A;  2WO1 A;  3V0A A;  4XQW A;  3VBS A;  4HK8 A;  5FLI A;  5KXD A;  4OVE A;  2JB8 A;  4OI1 A;  4NJ4 A;  5E8A A;  5A3L A;  3UK9 A;  1EY2 A;  2RS1 1;  1K5J A;  2R1D A;  3R0R A;  1BEV 2;  1RHI 1;  4XET A;  4A7Y A;  3H8X A;  3WG1 A;  3MW3 A;  3P1I A;  1SPP B;  3IMM A;  1Y43 B;  3HIF A;  3VL9 A;  5JR7 B;  2AC1 A;  2WIN B;  2HWD 1;  3T30 A;  3BTA A;  5G05 L;  4PI0 A;  4AFB A;  2ZAB A;  4BB3 A;  3F2Z A;  1H1M A;  4MGZ E;  4ZPI A;  5T3N A;  4ES9 A;  3GXU A;  2XXZ A;  4MHU A;  3ALQ A;  4GD4 A;  4UYB A;  1US2 A;  4L8Q A;  4XQ4 A;  2E32 A;  4ZY9 A;  4CDW B;  3DYO A;  1QEX A;  2JIJ A;  4Q4V 1;  3NL1 A;  3E5U A;  1GIC A;  2A7A A;  1WWY A;  5EFU A;  5C8C A;  3I4I A;  1MQT A;  2VC9 A;  3HBK A;  3ZYR A;  3K3O A;  1UU4 A;  4MG2 A;  1GLH A;  1WBL A;  3PHM A;  4IXL A;  1NCR C;  1W6O B;  2R7E B;  3KF5 A;  4QT6 A;  4AR2 A;  3VD4 A;  3VKF C;  2YC0 A;  1VR3 A;  1W8U A;  2X5I A;  1UY1 A;  4UT5 A;  2J1A A;  2DTY A;  5BNO C;  1OA2 A;  1UWW A;  1ZA4 A;  3ASI A;  3CU7 A;  5C8W A;  2BUK A;  5A6Q A;  5JSO A;  5M0T A;  1H2M A;  2RS3 3;  1H8V A;  1TNR A;  1GBG A;  3J9S A;  4FOW A;  5FZG A;  5LZ6 A;  1IQD C;  1ZRC A;  2PA7 A;  4DZG A;  1R1Z A;  4IEZ A;  1XND A;  3W58 A;  3LAG A;  2ZBJ A;  5E16 A;  3MW4 A;  1S2E A;  5AVA A;  5JXJ A;  4XMA A;  2G9F A;  3HQR A;  2BWA A;  4ONU A;  1BK0 A;  3FLP A;  2V4V A;  4IUG A;  1MQT B;  3HNY M;  3OOX A;  4C8D A;  1QQP 2;  1ZZB A;  2HWB 2;  3C2U A;  2H0V A;  4R9D A;  3OGV A;  4TZD A;  3D8C A;  1AR6 1;  1NX9 A;  2H6B A;  2IXH A;  3KM5 A;  3M3I A;  4YNI A;  4A3Z A;  5IFP A;  5CAD A;  1PK6 A;  2ARB A;  1CAV B;  4I30 A;  4Y1Y A;  3LGR A;  4EN8 B;  3VBS C;  1W05 A;  4PI2 A;  1DYP A;  2IFW A;  3AVS A;  5FZ0 A;  1IPS A;  2B9U A;  3GBG A;  4K3U A;  2NPI A;  2WZR 2;  4Q0S A;  1GUI A;  2BFU S;  1HRI 3;  1UOG A;  4M3C B;  1AYM 1;  4EJR A;  3WT3 A;  1H6X A;  5C9A A;  1IZ3 A;  4Y20 A;  4MAD A;  3AM2 A;  5E6H A;  5DUX A;  4L0P A;  2Y0O A;  3TEZ A;  5EHD A;  1VRH 2;  3RYK A;  2BVB A;  3OUI A;  4H2A A;  1CAX A;  1OKQ A;  3HT2 A;  4MV2 A;  2PQS A;  4YGD A;  2B7Y A;  4JGY B;  1LGC A;  2P3J A;  4R52 A;  1ASJ 1;  2VVD A;  2JG9 B;  3ZX7 A;  2YFU A;  1W2U A;  4HL0 A;  2D6P A;  3I2O A;  2A3X A;  1VAV A;  1VMJ A;  3PJY A;  2WWS A;  4QKF A;  5L36 A;  1MQT C;  1RVF 1;  3VHO A;  5LRS A;  4NR1 A;  1PVC 2;  1IS4 A;  2A1X A;  1J84 A;  3AZW A;  3K51 A;  1QOT A;  1ZBE 1;  5C9A B;  4Y20 B;  1X82 A;  1NY7 1;  4FO9 A;  2FDH A;  3T1L A;  2X5I C;  2P3I A;  1ULD A;  2VBB A;  1F31 A;  2D6O X;  3U1X A;  2ZZQ A;  5IVY A;  4XAE A;  2Q30 A;  4EN7 B;  2XWB B;  4Q4X 2;  4EWD A;  1GNH A;  3ACG A;  2RS1 3;  3IAP A;  4IDZ A;  2A6Z A;  1RUG 3;  5F3I A;  5FXW A;  3S30 A;  4L99 A;  5GLV A;  4BK5 A;  5IFT A;  1O8S A;  2XJU A;  3IB3 A;  1SCS A;  4LHK A;  2YFZ A;  2WAA A;  4BIF A;  3LDB A;  3VKM A;  4CUC A;  5JPN B;  2PFW A;  4V2V A;  2GC1 A;  3UET A;  3TN9 1;  4BE3 A;  1JTZ X;  2PHT A;  2PHW A;  4CUA A;  3ZM8 A;  2DVF A;  4DY3 A;  3A23 A;  3WNL A;  4JGY C;  2YXS A;  2K0G A;  2JG9 C;  4BLI A;  2N7G A;  1RXF A;  4IV3 A;  4AVC A;  2ORX A;  4XQD A;  2WQ8 A;  1NA1 A;  1PVX A;  1UYZ A;  2PN5 A;  1PGW 1;  2WO3 A;  1RUI 2;  2E33 A;  2PXJ A;  4XJW A;  1C5H A;  1QMJ A;  5I0U A;  3WG2 A;  1ENX A;  4BU2 A;  1SAC A;  5FUN A;  1JZ5 A;  4HET A;  1GZ9 A;  1V00 A;  2CL2 A;  2YPD A;  3OGJ A;  2OKX A;  1V9U 1;  2IVI B;  1LOB A;  1UD1 A;  1W8F A;  2YZ4 A;  4KH9 A;  3SH5 A;  3BIE A;  5DUW A;  1ND3 A;  5C9A C;  2D6K A;  5DPN A;  1W9S A;  1AR7 3;  4YM0 A;  4IE4 A;  3FFZ A;  2WZP P;  4YG6 A;  3B02 A;  3V64 A;  1HB3 A;  2VBP A;  2Y33 A;  4XIL A;  4CP2 A;  1ND2 B;  4NE9 A;  3KZ4 C;  4C0H A;  3P5B A;  5C4W B;  4QGM A;  2OPW A;  3VHP A;  1D0G A;  1VB4 A;  1RMU 3;  1Y7B A;  1D4M 2;  1ZZ7 A;  3HR9 A;  3POS A;  5IUQ A;  3VZL A;  5KWR A;  3FL7 A;  1K42 A;  1VAM A;  2MNG A;  2WZ8 A;  3NV3 A;  2R07 3;  4JV4 A;  2PQQ A;  2BER A;  5T50 A;  1VBB 3;  1J58 A;  5GAL A;  4IEV A;  1US3 A;  4E4S A;  3U14 A;  4P9W A;  4PF5 A;  4KU8 A;  1UO9 A;  5F6K A;  1NOV A;  1S0F A;  1U5X A;  1LHN A;  3K3N A;  5KHK A;  2JDH A;  4DXR A;  2FCV A;  3KCX A;  2D3P A;  3LZZ A;  4ZHN A;  1RB8 G;  1WCQ A;  2JX9 A;  4BQX A;  2IUW A;  1C8M 1;  3VD5 A;  2ZEY A;  3VBO B;  2CGO A;  2ET1 A;  1UPI A;  1O5L A;  3BCW A;  2OXB A;  5HPO A;  1WLT A;  1AYM 3;  2WO7 A;  3M3Q A;  4PIZ A;  5F2S A;  5JOZ A;  3UGG A;  3NNM A;  1HRV 1;  4CXY A;  1WW4 A;  4XXP A;  2GND A;  5J98 B;  1N3Q A;  2WII B;  2WFP A;  3ZDS A;  1Q56 A;  3HD8 B;  4GA9 A;  2QDR A;  4X6R B;  3CZU A;  3NAP B;  3LSE A;  3OD4 A;  5JOY A;  1CAW B;  1WMF A;  2KD7 A;  3D6E A;  3ZOI A;  4D8M A;  4YM3 A;  3VBR A;  4BPZ A;  3NVC A;  1LOC A;  1ND2 C;  3OGG A;  1RUO A;  1SDD B;  2K9Z A;  2FDI A;  1NXD 1;  1W2A X;  3OGR A;  1SLC A;  2YU1 A;  2D6N A;  1VAK A;  1GOG A;  3AMP A;  1LU2 A;  1HW5 A;  4IV3 C;  1DLL A;  1BBT 1;  4YVS B;  2TBV A;  2WC2 A;  4DIN B;  4P9L A;  1U5Y A;  1UYP A;  1U0A A;  1DLC A;  4KWK A;  4XFH A;  4BQ2 A;  5LW9 A;  4CU6 A;  2WNU A;  3UES A;  3WXP A;  2JDA A;  4ZXK A;  3ZYG A;  4FOY A;  1DGW X;  5CVR A;  3RJR A;  5B4N A;  1OQ1 A;  3GM8 A;  4RHV 2;  1ZBE 3;  2PEL A;  1PNF A;  1FOD 3;  3HAG A;  5AC9 1;  3RJ2 X;  2NN8 A;  3WUD A;  1NCQ B;  2BW8 A;  1QY4 A;  1LRH A;  2DFC A;  4CEY A;  3ENR A;  4XMI A;  4FPC A;  2QQU A;  1AJK A;  2ERF A;  4LR4 A;  4XTP A;  3MPB A;  3BUC A;  1MZ5 A;  1PNG A;  5APA A;  5LBE A;  1YJK A;  1WKY A;  3H0O A;  2IXK A;  1GP5 A;  3DKQ A;  3VBO C;  3N4M A;  2JE7 A;  2ZHN A;  1OT5 A;  3FLR A;  3I8T A;  2HWE 1;  4DO0 A;  3ST7 A;  1XU2 A;  3FHI B;  4WVM B;  3VBF A;  3WDU A;  3I3E A;  1N3P A;  1F4H A;  3E1F 1;  1RUD 2;  3K2O A;  3TN9 3;  1DHK B;  3I3D A;  4DUX A;  3N7J A;  4MGK E;  2RS5 3;  3AYD A;  1PO1 2;  4QX7 A;  4Q0Q A;  2C9A A;  3O1T A;  3NAP C;  2D5F A;  3DF0 A;  4TN7 A;  2FHR A;  2B39 A;  2VBD A;  3BN6 A;  1RIN A;  1G9F A;  1EV1 2;  3O14 A;  2HYX A;  5FYV A;  3NQH A;  4Q4W 3;  2CYF A;  4MO3 M;  1PIV 1;  1OI6 A;  1XJA A;  2OYZ A;  3WF3 A;  2WNV B;  4YVS C;  1CJD A;  2VPV A;  1DFQ A;  1CES A;  3SC7 X;  1OXC A;  3THD A;  3T2Q A;  3IT8 A;  3RI9 A;  3NNL A;  1DYK A;  1MZ6 A;  4WV8 A;  4COZ A;  1OKO A;  4MLO A;  1RUN A;  1GQP A;  4CCN A;  3H1M A;  1VP6 A;  3WW2 A;  3R4D B;  5FPB A;  4JZR A;  3MIB A;  3QLQ A;  4Q4Y 1;  4W6W A;  5E89 A;  4BCU A;  1WA6 X;  1WCS A;  4QDR A;  4TTG A;  1NCQ C;  3JD7 2;  4FFF A;  4HKO A;  1OQE A;  4LO8 A;  4UI9 L;  4XZP A;  4AQT A;  4AFD A;  2ES3 A;  4HXC A;  3WF2 A;  4FTE A;  1AX2 A;  1IQA A;  4QWN A;  1UAI A;  5ACA 1;  3TNQ A;  5T52 A;  4MX3 A;  3Q8E A;  5EQU A;  5KXC A;  1YFU A;  3WNP A;  4D7S A;  1W90 A;  5FQ0 B;  4RFT 0;  4LEJ A;  4Y22 A;  1LOF A;  1MS4 A;  1KS5 A;  1NE4 A;  2ZX1 A;  3AMH A;  3DYP A;  1HIX A;  4JDO A;  4BOW A;  2A6Y A;  1FNY A;  2JDN A;  1N3O A;  1NG0 A;  2I45 A;  1JZ2 A;  3KGL A;  1JOB A;  3ZXA C;  1W9T A;  4ERO A;  4ATE A;  1O4T A;  4LO4 B;  3MUZ 1;  2QE3 A;  3LCP A;  4OYU A;  4W6Y A;  1PZ7 A;  4YFW A;  3IPV A;  1AX0 A;  4HVR A;  4AVT A;  5L19 A;  1YCI A;  4OUM A;  5H9P A;  1RUH 3;  4C1W A;  1AR9 2;  1ENQ A;  2WLQ A;  4AFC A;  4AED A;  2WNV C;  4YYO A;  4IEW A;  3OY8 A;  5DDJ 1;  3FWE A;  5JZG B;  2VZU A;  3ZN5 A;  3BTY A;  3WF1 A;  1WCD J;  4Y33 A;  1AL2 3;  4PIY A;  2W2I A;  5A7P A;  1SLA A;  2XVK A;  3PUI A;  3Q8C A;  4LA2 A;  4JC1 A;  2VZ3 A;  4FFH A;  1WCU A;  1XU1 A;  2XHK A;  4YW7 A;  3AFK A;  2I2S A;  5A32 B;  1BZW A;  1BYH A;  4IER A;  5FYZ A;  3VBF C;  5BNP B;  1DQ4 A;  2ZGM A;  3GBW A;  4TSV A;  3VDC A;  3ACF A;  4RGA A;  1SMV A;  2VW2 A;  3BTZ A;  4LBL A;  2GN3 A;  4NOT A;  3IPV B;  3JB8 A;  2DTW A;  4PDW B;  5FZ8 A;  3B7M A;  4YG3 A;  4YW4 A;  5T55 A;  4OI0 A;  3E97 A;  4IET A;  3SEP A;  1BMV 2;  3I3B A;  5FY9 A;  4ORF A;  4B29 A;  4YZ2 A;  1XNK A;  3N9P A;  1JUH A;  4XFB A;  4AEJ A;  1TE1 B;  2PLV 2;  4GJY A;  4IEX A;  4CU8 A;  5JI7 A;  1QXR A;  3OBZ A;  1UKR A;  3FBM A;  5BY5 A;  1QJU 3;  1KS4 A;  3D3A A;  3III A;  3NJV A;  1XC6 A;  3PIG A;  4B7E A;  2XLG A;  1A6C A;  4QPG B;  2A6V A;  5A1L A;  2NLR A;  1CN1 A;  1OUR A;  4MH0 E;  4QXK A;  3ZXG A;  3WW4 A;  5CFD A;  4AYU A;  1CQ9 A;  4ISQ A;  3H3U A;  1R09 2;  1UIK A;  2DCZ A;  4K1Z A;  5ANQ A;  5FZ3 A;  1QJX 2;  3T4V A;  1W6Q B;  2PHX A;  2YBP A;  4XDO A;  4PBO A;  1IOA A;  2UWC A;  5JZG C;  3CJX A;  1LTE A;  4A2U A;  4CCD A;  2DCY A;  2QQW A;  4WM7 A;  1S0E A;  4K21 A;  4Y5S A;  5DG2 A;  5FY1 A;  5JOX A;  3PVE A;  5HI0 A;  2R0F A;  2UU8 A;  3AJZ A;  3CQO A;  3D0S A;  3PUQ A;  2LS6 A;  2OW4 A;  3K4A A;  4QD2 A;  1GQG A;  1PMJ X;  4CDX B;  2WT0 A;  5BNP C;  4XFC A;  3ZXJ A;  3AVR A;  3X29 B;  3NKT A;  5FPL A;  5CIS A;  3LEG A;  3PIJ A;  4UFI A;  1G6N A;  2ARC A;  4N43 B;  4MSV A;  5FMB A;  1RUC 1;  3ACL A;  1LKN A;  4IQP A;  5GLT A;  1DZR A;  3M3C A;  4PQQ A;  3WQ1 A;  4UFK A;  1Q8V A;  1O7F A;  2YBS A;  2F17 A;  1S4C A;  4DUV A;  3O0X A;  1B35 A;  2WZE A;  1OD5 A;  4AED C;  3MF6 A;  2P1B A;  3N9O A;  1EAH 1;  1QIQ A;  4LHS A;  3RNS A;  2WSU A;  2W1U A;  5FDB A;  1YQ6 A;  2JEN A;  3WHT A;  5FPA A;  4QDS A;  1M06 G;  3VL8 A;  4WM7 B;  3S5A A;  1K12 A;  2VO5 A;  4EYU A;  3LIG A;  5J96 B;  4FFI A;  2C5D A;  1MS3 A;  3FHQ A;  4I01 A;  4Q4Y 3;  1FMD 1;  4XZU G;  4A6O A;  2VNV A;  3CDZ B;  2A3W A;  2HH9 A;  4MOA A;  4LKE A;  4A6S A;  2JD9 A;  5D8A B;  2WFF 1;  4QX1 A;  1QJF A;  5CYY A;  2VY0 A;  3LA2 A;  3SMH A;  5CFC A;  1SLT A;  3RYR A;  4OI4 A;  3INA A;  2HWC 1;  3K75 B;  1XBF A;  5B4X A;  1H4G A;  3CZJ A;  5DXD A;  2RR1 1;  2V5Y A;  5FMO S;  5CBL A;  1D2S A;  2RJ2 A;  2RM2 1;  4UBG A;  4P08 A;  3J7L A;  3SLI A;  1YC6 1;  2RS3 2;  1W8H A;  2BDR A;  5JSR A;  4ASM B;  1YI7 A;  3D5O A;  4LOS A;  5T5L A;  3TNP B;  4EE2 A;  1VBE 3;  5LK7 B;  4RD7 A;  2OQ6 A;  5C3P A;  2QQL A;  2RDR A;  2VR4 A;  3BI3 A;  5FO7 B;  5I93 A;  5FFO C;  2GNT A;  1MEC 1;  1RUJ 1;  4K8R B;  4CDX C;  1UQX A;  1T6G C;  4LTA A;  3MIC A;  4XUT A;  1W6M A;  3O1V A;  4AW7 A;  4CDQ A;  4DRR A;  1AJO A;  1CJP A;  4N43 C;  4JX0 A;  1L7Q A;  4J6G A;  4U36 A;  5FLJ A;  5AVP A;  2QQP A;  2R06 3;  4OMC A;  5C3S A;  3LPF A;  1QJZ A;  3B3Q E;  3LE0 A;  4GAL A;  1SCR A;  5JAX A;  4CCK A;  2VOV A;  3IMN A;  2IFR A;  1PMH X;  2WL1 A;  1YUD A;  2XQX A;  3FFQ A;  4YW1 A;  1QDC A;  4LIT A;  3E6B A;  2A75 A;  5FZM A;  4CSW A;  3OPZ A;  1EPW A;  4B4Q A;  1JMU B;  2WO2 A;  1WW5 A;  3DUI A;  4WM7 C;  4Y1X A;  4MXW B;  3EO6 A;  4YLZ A;  1RC6 A;  2W91 A;  2VNO A;  4IE7 A;  2YPJ A;  1HRI 2;  1W6P B;  2RDQ A;  4D7T A;  4AGV A;  4DIQ A;  5AFB A;  5I0T A;  4XPV A;  4CU7 A;  2AEN A;  4QDQ A;  3RZG A;  3VDD A;  1RUE 3;  3H9A A;  4XFG A;  5JI9 A;  2IXJ A;  4EZH A;  4PBP A;  2DFB A;  3MLK A;  1YI9 A;  3ZSE A;  1V0A A;  2WYF A;  4ARX A;  3OSD A;  5LK5 A;  5HV0 A;  2YGL A;  1YFY A;  1CWP A;  3H1Y A;  5IYY A;  2ZML A;  3KV5 A;  1AXY A;  1MVE A;  4FOV A;  4GKX A;  2XJS A;  1HXS 3;  3G6J B;  3ZYB A;  1WUV A;  1CX1 A;  1ZRE A;  3PU3 A;  2XUM A;  1VBC 1;  5FZO A;  1S0J A;  2XJQ A;  1SZB A;  1DIW A;  4AVA A;  3OYW A;  1JZ7 A;  5LA0 A;  5FZB A;  5LY2 A;  3KT7 A;  2A73 B;  4GXL A;  1OVS A;  1X8E A;  5A3M A;  1QJE A;  2VU9 A;  5CNA A;  1HB4 A;  4GQ7 A;  4NO4 A;  3J7H A;  3KV6 A;  1OLM A;  4LO5 B;  4QAW A;  1MS9 A;  1GNZ A;  4P9I A;  4ZU5 A;  5C5T A;  1TMF 1;  2RMU 1;  3VDD B;  4YVW A;  4LO7 A;  1DZQ A;  1HJF A;  3RDI A;  5KXB A;  1VMH A;  3USU A;  1HLC A;  5A3N A;  4SLI A;  5FPZ A;  2W5F A;  2RS1 2;  1O59 A;  1ZBA 3;  2B45 X;  1RUG 2;  3OUJ A;  3HN3 A;  5LBB A;  3T08 A;  1AR8 3;  1FV2 A;  1UU6 A;  2VXR A;  4ZXE A;  1AZD A;  4NRP A;  4R9B A;  2XVL A;  2DUR A;  3JZV A;  5FWE A;  2FMD A;  2J22 A;  4KGQ A;  4DXS A;  4COY A;  1REF A;  4HPK A;  5CAZ A;  4YW3 A;  1AVB A;  1I9R A;  1V6M A;  4QX5 A;  1UW8 A;  1RUC 3;  4IV1 A;  3RGB A;  1UIJ A;  1TQ5 A;  3ORJ A;  5FPV A;  3RZK A;  1NCR A;  4UXA A;  5J3U A;  1GAN A;  1JH5 A;  1C28 A;  5GZE A;  5FZE A;  3KT1 A;  3PVB B;  4CP9 A;  5FZF A;  2AZ5 A;  5HCH A;  4IEP A;  1AYN 3;  3R05 A;  2GNM A;  3ZKU A;  1WZX A;  4YVW B;  1TME 1;  5L73 A;  4FSJ A;  5E88 A;  4H55 A;  4S2H A;  2GH2 A;  1W9W A;  3DGT A;  5FIX A;  4XJ9 A;  1ULC A;  2EIE A;  3HNM A;  4AOC A;  4CXX A;  4XAB A;  4H14 A;  3DKW A;  1VMF A;  1FI2 A;  2QQV A;  3FHA A;  3PTY A;  5HXM A;  4NID A;  3MBW A;  1QOO A;  4FPY A;  1SPP A;  1Z7S 3;  5L9V A;  1MS0 A;  4MUV A;  1CVN A;  3C7E A;  2Y64 A;  3SIS A;  1AR7 2;  3NNJ A;  2RM2 3;  5KBF A;  3VDD C;  1RJ7 A;  4LOR A;  2XHN A;  4GB3 3;  4XYX A;  3ON7 A;  4LO6 B;  2QQM A;  4D94 A;  2YY1 A;  1NE6 A;  1EPZ A;  1FYU A;  2R04 1;  5FZ4 A;  3ZFF A;  4CP9 B;  1XNA A;  2KM2 A;  2PHR A;  5J1X A;  3T0D A;  1MPX A;  4BQ3 A;  1RMU 2;  5F9T A;  1W99 A;  1KD7 A;  2XJT A;  4UAP A;  4LIU A;  3L2Y A;  4CDW A;  2V09 A;  4RS5 B;  4BIO A;  2R07 2;  4A7K A;  1U5I A;  2J1T A;  2JDM A;  3SH3 A;  3I2I A;  1UY2 A;  1VBB 2;  1Y9M A;  2ZTN A;  3MFA A;  2CGN A;  1JI6 A;  2W92 A;  4HFS A;  1NLS A;  2D44 A;  1OOP A;  3LWC A;  2RJL A;  3A22 A;  1W6O A;  4HOO A;  3ZN6 B;  2BRT A;  2EXK A;  1COV 3;  1YO8 A;  2W47 A;  2ZEX A;  5KHH A;  4ES8 A;  1R08 3;  3H3L A;  1JYI A;  3N9Q A;  1Y9G A;  3POY A;  4P02 B;  4WVV A;  2R49 A;  3B9C A;  4YVW C;  2EVX A;  3DV8 A;  4Z2A A;  2VMD A;  3MO4 A;  4FAG A;  1AF9 A;  2O14 A;  3ZFF B;  3U4X A;  1GP4 A;  5T5O A;  1ENS A;  1S0G A;  5F32 A;  2FDF A;  4J1W A;  4YW5 A;  5LA9 A;  2QTW B;  1AYM 2;  3VKL A;  2W46 A;  1AHS A;  4COV A;  2EAK A;  5LA1 A;  2MHF A;  2FDJ A;  1GOF A;  2B8M A;  1GWM A;  1LEN A;  4NPL A;  4XBN A;  3E6C C;  2XLF A;  4IV1 C;  1OOP B;  4PT6 A;  1MAC A;  5KHJ A;  4DOU A;  2F4L A;  1DQ5 A;  1ZX5 A;  5BV6 A;  3MLL A;  2GME A;  3KQR A;  2YRO A;  4QQL A;  5IW0 A;  1JYN A;  3MEP A;  5FY5 A;  1OMI A;  3TYJ A;  3V0B B;  1UZ0 A;  1H4H A;  4Y4Y A;  4L97 A;  3WNK A;  5IVV A;  2A5Z A;  1CAV A;  1UN1 A;  2HBU A;  2ZOE B;  3MYX A;  4GKY A;  4K1Y A;  3VZK A;  1W0P A;  5ISL A;  1PO2 1;  1JN2 P;  1NLQ A;  2P3K A;  4FAH A;  4AI1 A;  2EXJ A;  4H7L A;  3F95 A;  4ZU7 A;  1ZBE 2;  4M3C A;  3I97 A;  1FOD 2;  4P5H A;  1FPN 1;  4ASK A;  3ZYP A;  4Z1V A;  1OLR A;  2J1R A;  2VQA A;  1RUF 3;  1G9D A;  4OI2 A;  2ZGR A;  4I3G A;  5A3W A;  2ZGU A;  3J26 N;  4BQ1 A;  4AFM A;  2HWF 1;  2VUC A;  1CAU A;  4QKB A;  2ZGN A;  2C9K A;  4BMB A;  5DAV A;  4JGY A;  3ZFF C;  3POJ A;  2JG9 A;  5DQ0 A;  5FXX A;  4CCO A;  2OT7 A;  4OHY A;  1UKG A;  3JBG 3;  5FUI A;  3WV6 A;  3NV4 A;  2VAU A;  1XYN A;  2Y34 A;  3C8X A;  3S6P A;  4CDW C;  1JBC A;  3O1O A;  2LUW A;  2WQZ C;  2XBO 1;  3C7F A;  1ZZ6 A;  3ETQ A;  3EYP A;  4TWT A;  4B3N A;  3TN9 2;  3LFM A;  4QPI B;  2RS5 2;  2Z79 A;  4RR3 A;  3VD7 A;  1JW6 A;  1OOP C;  3WQ0 A;  1J3P A;  4W6X A;  1BXH A;  1HB1 A;  4Q5O A;  4LBM A;  1WMX A;  5F6L B;  4EN0 A;  1BEV 1;  2YDE A;  1OQD A;  3RG0 A;  3NNG A;  3K46 A;  4Q4W 2;  4XIK A;  3WNX A;  4EQV A;  3GGL A;  5FOB B;  5HV4 A;  2ADD A;  5K0U B;  5IK5 A;  4G4F A;  1CAU B;  1PGW 2;  1VBD 1;  1MZF A;  1LGN A;  2GN7 A;  1JZ4 A;  5A6Y A;  3CIH A;  3IAQ A;  3NWK A;  4NIH A;  2NMN A;  1DQ2 A;  3TB0 A;  4YAR A;  4OZO A;  4ZZ8 A;  2EIB A;  1V6N A;  3QBQ A;  4A3X A;  4MXV A;  3PUS A;  2B46 X;  3ILF A;  2VQ0 A;  4CZS A;  1OVP A;  4PLO A;  4Y24 A;  3GF6 A;  2Q1Z B;  4M01 A;  1JZ3 A;  2E31 A;  4RR3 B;  5CKM A;  5CKN A;  1LHW A;  4DRV A;  4OUL A;  3LDR A;  5A7W B;  2J7M A;  3Q8B A;  3I7D A;  2D6M A;  2WNE A;  1ONA A;  3NRU A;  4Y5Z 0;  1I1E A;  3R6S A;  2BBA A;  2DVB A;  2HBT A;  4LPL A;  3BU0 A;  1LOG A;  1J3Q A;  1N1S A;  2P5B A;  4KI5 M;  4PHZ A;  2JDY A;  1JS9 A;  4AI8 A;  2YC4 A;  1FX5 A;  2O8O A;  5H9Q A;  1ZZ9 A;  1L7R A;  2XOM A;  2YHJ A;  5FCC A;  1XE7 A;  3WLU A;  3H3Z A;  1UOF A;  3GZT B;  4KU7 A;  2WLP A;  2ZS6 B;  1JOD A;  3B5L B;  3KLS A;  3VB9 A;  1RHI 3;  2AUY A;  3SCG A;  1JOP A;  2AYH A;  2WQ4 A;  4ZU4 A;  3OBT A;  2VOW A;  2RJK A;  3ZYI B;  5FYU A;  3WDW A;  4I09 A;  1YQ5 A;  4LK6 A;  2D6L X;  2TNF A;  1ULG A;  2Y8K A;  5A70 A;  1RUH 2;  2HWD 3;  4I0A A;  5JWP A;  3SQO A;  1IS5 A;  5BPX A;  5K0U C;  5FZ6 A;  1R1A 1;  1Q5O A;  1UPS A;  4GH4 B;  4MHR A;  4EN9 B;  1F8V A;  1UU5 A;  3I2G A;  2Z2S B;  1ND2 A;  5JMO A;  3AMM A;  1QQP 1;  3K48 A;  5CIR A;  1AL2 2;  1MS5 A;  4NVP A;  2VOT A;  5C4W A;  3VZM A;  3ZN4 A;  1WW6 A;  2E6V A;  2JDP A;  1GU3 A;  3AKT A;  3B69 A;  3LA7 A;  4FPJ A;  1BJQ A;  1D7P M;  4M00 A;  4Q4V 3;  4QMA A;  5FY0 A;  4IE5 A;  1WMD A;  2XR4 A;  4FPL A;  1SLI A;  4AI9 A;  4RA0 A;  4IE0 A;  2XVG A;  4N90 A;  3MZH A;  3A21 A;  4Z92 B;  2LRP A;  4FT8 A;  4Q1R A;  2Q0A A;  2KA3 A;  3QH6 A;  1NT0 A;  2W94 A;  3GBF A;  3AX4 A;  4GAZ A;  4RR3 C;  4ZS3 A;  5FZI A;  2Z4F A;  2JKX A;  4XUO A;  5JXI A;  2IXL A;  3N35 A;  4I2O A;  2WZR 1;  1VIW B;  1GZC A;  3M8L A;  4QB1 A;  5DAP A;  1ZRI A;  5GJ6 A;  1KDM A;  3CMG A;  4QGL A;  4HG6 B;  5HCF A;  2EAL A;  3W59 A;  3VV1 A;  1XPW A;  3WNO A;  1ZZC A;  3VBO A;  1H8T A;  2L9L A;  4D69 A;  1HQW A;  2JKB A;  3UV9 A;  1QJU 2;  1J1L A;  1YWK A;  4Z8B A;  3BGA A;  1FPN 3;  1OLM E;  2SBA A;  1LHU A;  2W3J A;  1VB2 A;  3KV9 A;  3MIF A;  3WDV A;  2QQK A;  3RZJ A;  3KCY A;  2QFE A;  5DAQ A;  1BQP A;  1RJ8 A;  2FCT A;  2GC0 A;  3N7L A;  5DN2 A;  2W9X A;  2AAC A;  3U0Z A;  4DUW A;  2BFU L;  5G04 L;  2ARA A;  3NAP A;  3AK0 A;  3O1R A;  1W9F A;  4LBQ B;  1CAW A;  1F4A A;  3KCC A;  4GH4 C;  1AR6 3;  4XDP A;  1HN0 A;  1KFU L;  3TEW A;  1U12 A;  5JXG A;  5LCW L;  1GYK A;  4AXO A;  2BNN A;  4BQY A;  1V6K A;  3I2H A;  2FBE A;  2G1M A;  4K6B A;  4YVS A;  4KNC A;  1H9W A;  3JXS A;  1H8T B;  2VD7 A;  3VHR A;  2VMF A;  2VUL A;  3U75 A;  3ROU A;  4BZ4 A;  2GDF A;  2VZT A;  4Q4X 1;  4CDU B;  1G9A A;  3O0W A;  4QPY A;  2F6B A;  3LB9 A;  2D98 A;  4IEO A;  4KWL A;  4FXK B;  1BEV 3;  2C1F A;  3VHN A;  5FR3 A;  1NCQ A;  4UFH A;  4AVV A;  4E8D A;  2X09 A;  1A8M A;  2LTN A;  3GHN A;  4V2W A;  3UJO A;  1F15 A;  5DZE A;  1E5H A;  3WCR A;  1VBD 3;  4P9G A;  2JE8 A;  5FP9 A;  3C7O A;  3S7E A;  3N3H A;  5FKC A;  3LSD A;  1ASJ 3;  3O7O A;  2IWG B;  2FZ1 A;  2YV8 A;  5C4W C;  4IW3 A;  1LCL A;  1FAT A;  1IS3 A;  4AWD A;  1S0I A;  4PJY A;  4Q4Y 2;  1KDK A;  1XE0 A;  4HAN A;  4HBN A;  1GFF 2;  1GWK A;  4CA9 A;  5LY1 A;  1X33 A;  4WVM A;  4IEQ A;  1H30 A;  1NAE A;  3THC A;  3VZN A;  1C57 A;  5H9S A;  3KVB A;  3UKT A;  1RVF 3;  1OH3 A;  5BNN B;  5C7G A;  4XC9 A;  1WLW A;  4QM9 A;  4UW4 A;  1OHF A;  2D3S A;  2MPF A;  2NQY A;  3DXU A;  4MGY E;  4B1L A;  5C33 A;  4J25 A;  5DZF A;  4I3P A;  4YWA A;  3W5N A;  3AKS A;  1RYY A;  1K3I A;  4XJZ A;  4UBH A;  5FP3 A;  4IGP A;  4A45 A;  2CAV A;  2ZKN A;  2NMO A;  3WP4 A;  2XH6 A;  1IPK A;  3HQU A;  2QKD A;  3TEX A;  3WW3 A;  5JUV A;  1VBE 2;  2DVD A;  2WNV A;  2ZX2 A;  2P37 A;  3U07 A;  3M7A A;  1GOH A;  4CUG A;  3UGF A;  1FV3 A;  2WRA A;  1H8T C;  2XB6 C;  1V6I A;  4FPK A;  4CDU C;  2HEV F;  2OS2 A;  4UW5 A;  3VN4 A;  4COW A;  1H0B A;  3JU9 A;  4QB6 A;  4BH9 A;  1J3R A;  4MZU A;  1E57 A;  2R06 2;  3RVH A;  2C24 A;  4QX0 A;  3OBA A;  4I0W B;  1PX3 A;  3E5X A;  1DQ0 A;  4HKW A;  1R1A 3;  2ZX3 A;  3FJS A;  1KRI A;  2J1V A;  4GMP 1;  2RHP A;  3A4U A;  4LNV A;  1XSQ A;  2K46 A;  4GWM A;  1ZNP A;  5FBJ A;  5FPX A;  5LWB A;  1ULP A;  2WWU A;  4A41 A;  4AVS A;  3GJA A;  1APN A;  4M0N A;  2VCA A;  3KF3 A;  1ULE A;  1I5Z A;  2B42 B;  1F9K A;  4JTN A;  2JJ6 A;  5FQ0 A;  2Z42 A;  4JDM A;  1QF3 A;  2BZD A;  2K2S A;  3GCW A;  4KGG A;  3TWI A;  1X36 A;  4UFM A;  2V4A A;  4EV0 A;  4IEY A;  5BNN C;  1VAL A;  1V9U 3;  3FX3 A;  1TG7 A;  5EJ3 A;  3RZM A;  4XAA A;  3I2K A;  2CU5 A;  1RUE 2;  4FI9 A;  4PCR A;  2GP5 A;  1YQC A;  4YW2 A;  2R0H A;  1HKD A;  4CEW A;  2BEO A;  3QCW A;  4WM8 B;  2O8Q A;  3AMQ A;  3WNM A;  5A6Z A;  4MGQ A;  4QQO A;  5K8S A;  5E1R A;  3ECQ A;  2HLE A;  4LBO A;  2ZEW A;  3WZ1 A;  1POQ A;  1S0C A;  3LQC A;  5FZD A;  3POI A;  2PAE A;  1W2N A;  1HXS 2;  1RIR A;  1BKZ A;  1IKQ A;  1E5S A;  1LOA A;  3NMB A;  4WVW A;  5JZG A;  3PDQ A;  2GC3 A;  3POW A;  1OBN A;  5LBF A;  5F3C A;  4HVO A;  4M3C E;  4FPG A;  3WQB A;  5A32 A;  1YIF A;  3A0K A;  1MS1 A;  1YQ2 A;  3E5Q A;  1UMZ A;  3RZH A;  5BNP A;  4LLO A;  4IGO A;  4H3W A;  4BHP A;  4JKL A;  1LED A;  4ASL A;  3EHK A;  5IAV A;  4PLM A;  5KXE A;  4L9B A;  3NST A;  3IN9 A;  4N7I A;  4LKS A;  4PDW A;  4B4P A;  1SG3 A;  1XQN A;  4CEW B;  3HN1 A;  2WNO A;  3S7I A;  1JU4 A;  1CX4 A;  4RHV 1;  4EZ4 A;  1ZBA 2;  5I8Y A;  3LOI A;  3NJY A;  3V65 A;  1C8M 3;  1XB9 A;  5FWJ A;  1AR8 2;  2VL4 A;  1EYB A;  1UX7 A;  1W9Y A;  3PME A;  3GZU C;  1NYW A;  3AXE A;  3WHU A;  3ES4 A;  4QU1 A;  4AI0 A;  2E7A A;  5IK8 A;  1HX6 A;  1KGY A;  3FE5 A;  1UXZ A;  2PHD A;  4BQ5 A;  1RUC 2;  2VQT A;  1HRV 3;  4P14 A;  4WBB A;  3UKN A;  1KFX L;  3AKQ A;  4QPG A;  2ZJC A;  3AP7 A;  1A34 A;  4K40 A;  1NQJ A;  5A1F A;  1O3R A;  1O5U A;  2HKX A;  2BJS A;  2DUQ A;  3KV4 A;  5FZ9 A;  3AMN A;  1YQ8 A;  1H2N A;  2X10 A;  2DUP A;  4I0B A;  4UF0 B;  4FTS A;  1IG0 A;  1AYN 2;  1C5I A;  4FPF A;  3WDY A;  5F37 A;  1MR5 A;  2QBX A;  3NKG A;  1DCS A;  1W6Q A;  2YMZ A;  5C6C A;  5EP9 A;  3UT0 A;  1JYW A;  1PO1 1;  1VBA 1;  1V6O A;  1Z0H A;  2GAL A;  2RV9 A;  1RXG A;  3M70 A;  4NN0 A;  3N36 A;  3WNN A;  3ZR5 A;  1PM7 A;  1BBT 3;  5IK4 A;  3AL6 A;  3P3N A;  1EV1 1;  2ADE A;  3PU8 A;  5EPA A;  2EIC A;  2BBV A;  1WME A;  2DU0 A;  4UW6 A;  1KXG A;  2E7T A;  5F1R A;  2F4P A;  2EXH A;  4CDX A;  1W06 A;  3MHZ A;  3OUH A;  4PQ9 A;  1Z7S 2;  3ZPO A;  1LNS A;  2H0B A;  4XF9 A;  4LKD A;  4JRL A;  4JKM A;  4N43 A;  3WD5 A;  4X8N A;  5A1A A;  5AC9 3;  2RM2 2;  5FO9 B;  1SBF A;  2BWC A;  3M1H A;  4GB3 2;  4CEW C;  2OA2 A;  3OD0 A;  3D82 A;  4OZX A;  1Y3T A;  3MW2 A;  1UF2 C;  3VKO A;  1O3Q A;  4ET7 A;  5A6X A;  1C1L A;  3B9I A;  4OUS A;  4QHZ A;  4IEU A;  4JKK A;  4AHY A;  5F7U A;  4E2G A;  3JD7 1;  4AI3 A;  2RDN A;  4DNY A;  3BPS A;  3Q9O A;  2W39 A;  5FY7 A;  3H50 A;  4JGZ A;  2OPK A;  1QWR A;  5FXZ A;  1VE0 A;  1QGL A;  2HWE 3;  2LM3 A;  2VZV A;  4KWJ A;  4CVU A;  1XYO A;  1GQH A;  2NZ9 A;  5LBC A;  3VDB A;  5L7O B;  3GZE A;  1Q8S A;  3RWK X;  4BYY A;  3DPR B;  5D8A A;  2X8K A;  2ZAC A;  3QH7 A;  1COV 2;  5FJH A;  5IVC A;  2FDK A;  3POG A;  1R08 2;  4O65 A;  1ZM1 A;  3A0N A;  1UXX X;  3LDK A;  1POV 1;  1DDL A;  1T6B X;  3BU7 A;  2QQI A;  3J4U H;  2ZGO A;  4PDW C;  3PL0 A;  5FYI A;  5FZA A;  5JIU A;  4AHX A;  5DUV A;  1PIV 3;  2ZGQ A;  3ZPY A;  1C8N A;  2W0X A;  2XJR A;  5FZ1 A;  5AFE A;  4OMD A;  4KQ7 A;  4DPN A;  3APB A;  4N53 B;  2JG8 B;  1HQL A;  2JDK A;  3CKH A;  2TUN A;  1KIT A;  3ZVX A;  4K9S A;  1AR9 1;  1AXZ A;  2VVF A;  3ILR A;  4J1X A;  4JGZ B;  3B93 A;  3KVA A;  2ARX A;  1K5M B;  2G9Z A;  2WT1 A;  1DYO A;  5CG9 A;  4QPG C;  5KHG A;  5DAW A;  2IXI A;  3WY6 A;  4QX3 A;  2EIG A;  5J7M A;  4CCL A;  1PGL 2;  4HVQ A;  3PUR A;  4XCA A;  5FUP A;  3THP A;  5LEJ A;  4BDV B;  1NZI A;  1R64 A;  5ACA 3;  4R9C A;  4B1M A;  5GZG A;  3KD4 A;  2PMW B;  3ES1 A;  4CCC A;  4FPO B;  4XEZ A;  4PIX A;  4XFA A;  3MIE A;  4LUL A;  3K77 A;  1CIW A;  4Q26 A;  4AAX A;  1V6J A;  4Q2F A;  4MXW A;  4FXG B;  4FVV A;  4M4P A;  5FYT A;  2ORZ A;  1T2X A;  3K4D A;  3P6B A;  3O5S A;  3ZSL A;  1W3X A;  3TAY A;  2JDZ A;  1W6P A;  1K45 A;  1F35 A;  3EJK A;  1BMV 1;  1QHD A;  2XLA A;  3DPR C;  1O4Z A;  5C3Q A;  2Q8D A;  4XUP A;  4OQ8 A;  1RUF 2;  1W8N A;  2PLV 1;  1JYT A;  3GDB A;  5EWS A;  2QQN A;  3OEB A;  3OG2 A;  1LHO A;  4FTB A;  2UUR A;  2RG4 A;  2W1Q A;  1BCX A;  4KBZ A;  4BLJ A;  3PTR B;  4AZZ A;  3EXU A;  2FCU A;  3O0V A;  1CZT A;  3B00 A;  3O1M A;  1ULO A;  1W8W A;  5DDJ 3;  3J8F 1;  2WS9 1;  2ZZJ A;  4N53 C;  1M4W A;  3JBG 2;  5FP7 A;  4Q8L A;  3FLT A;  3UJQ A;  1QJX 1;  3ACI A;  4JGZ C;  3UL2 A;  1K5M C;  3A7Q A;  4AHW A;  2DU1 A;  4LA3 A;  4CP0 A;  1XNT A;  1GP6 A;  4RQP B;  3TOJ A;  1CD3 G;  5JCT A;  1QU0 A;  3L9J T;  2QZ3 A;  4M0H A;  3HNB M;  2R16 A;  1W8O A;  4R9A A;  4XVH A;  5D8A C;  3VBU B;  3ZYJ B;  4C1X A;  4DEQ A;  5I0R A;  4D6R A;  1VBA 3;  4OHV A;  3SIT A;  4A42 A;  4D6Q A;  5FP4 A;  2FDG A;  1JU3 A;  1X8M A;  1W8Z A;  2D7F A;  2G4I A;  3AXD A;  3T0B A;  4BM8 A;  3GAL A;  2A3Y A;  4HKL A;  1BHG A;  4HON A;  4QQP A;  2YBK A;  3OJB A;  5I0D A;  4TLG A;  4Y1V A;  3JQW A;  3HEI A;  4CRQ A;  2MEV 1;  3EMR A;  3E6D A;  4GZ9 A;  1C4R A;  2DVG A;  3I59 A;  3VKN A;  2LAL A;  1MVQ A;  3NJZ A;  4JCK A;  5JMC A;  1BLZ A;  1SBD A;  1O91 A;  3I3M A;  3WDX A;  4BQW A;  4HK9 A;  2OII A;  4NHL A;  4XE9 A;  3WR0 A;  3AZX A;  4DMI A;  4ARY A;  4HLT A;  4LXL A;  2VW0 A;  3IWZ A;  4MVT A;  4MYE A;  3AYC A;  3SEE A;  1E5R A;  2D97 A;  2P6C A;  3B94 A;  1FNZ A;  4NRQ A;  5FJK A;  3ZFE A;  4Q27 A;  3H1W A;  1QNW A;  3ZXE A;  2PHF A;  4NIG A;  1GZW B;  3C3V A;  1OUX A;  2E26 A;  2YU2 A;  5CA6 A;  2GSY A;  4Y26 A;  5F39 A;  2D3R A;  1OPO A;  1RHI 2;  1S0D A;  2DCK A;  2IXC A;  2DCT A;  2IC1 A;  2VUJ A;  3PMS A;  4QU2 A;  4NWW A;  2RS3 1;  4IND A;  4G9S B;  5IAX A;  3I59 B;  1OUS A;  2VZQ A;  4QKN A;  5LEK A;  1HDK A;  2C6S A;  4RGG A;  3VBU C;  2HWD 2;  1CZV A;  5ANN A;  1Y4W A;  1POV 3;  1W6N B;  3T4H B;  1ALY A;  1WD4 A;  3IZO A;  2FQP A;  2JWP A;  2WDB A;  2XGX A;  1I5P A;  1HJG A;  4LE4 A;  4WZC A;  3T3Y A;  2V5D A;  1HV1 A;  3IDC B;  4GWJ A;  5FYH A;  1EAH 3;  3CHX A;  4K20 A;  5FMO L;  1ZA7 A;  2BU9 A;  3KWV A;  1WCK A;  5I8S A;  4Q4V 2;  3ZFE B;  4AAP A;  3W21 A;  2DDU A;  4RS5 A;  2Z5W A;  1GSL A;  3MGU A;  3PUH A;  4LOT A;  1FAY A;  5IVE A;  5DAX A;  2FZ2 A;  1FMD 3;  5L9R A;  2DF7 A;  3WIN E;  3T1M A;  2WFF 3;  3ZN6 A;  2C0Z A;  4XDQ A;  2HWC 3;  2OQ7 A;  1HRI 1;  2BV4 A;  2P17 A;  3THT A;  3U37 A;  2RR1 3;  2LW8 A;  1ULF A;  5D2A A;  4W50 A;  1CZS A;  1DZT A;  3N9L A;  5K9Y A;  1JYC A;  3O1U A;  2HEY F;  3CJI B;  3PVO A;  3URF A;  2XG3 A;  1OPM A;  1UZY A;  2ZX0 A;  3VD3 A;  1MEC 3;  1RUJ 3;  1QJY 1;  2X29 A;  1F2N A;  2XQR A;  3VDA A;  4AGR A;  1FPN 2;  2BOI A;  3RQ0 A;  4P9J A;  2IVJ A;  3GHM A;  4V1P A;  5LB6 A;  4RN5 A;  5FZK A;  4NPR A;  2YC2 A;  4AG4 A;  2NP0 A;  5KC5 A;  2ZGT A;  5FZC A;  4AL9 A;  5A33 B;  1VLN A;  1AR6 2;  5TSW A;  3AZV A;  2WS9 3;  3J8F 3;  4N9H A;  4KWU A;  4YM1 A;  3RZZ A;  3V0B A;  3GZA A;  3U4S A;  2O0O A;  4M3C F;  3KT4 A;  3VGI A;  3WW1 A;  5FOJ B;  2XWJ B;  5DMY A;  3ZFE C;  5D1I A;  5BNO B;  3PNA A;  2O1Q A;  5ERL A;  3WX5 A;  3VLB B;  3ZMO A;  5BXX A;  1WD3 A;  1FT9 A;  3WOG A;  4YPJ A;  1GR3 A;  3J7M A;  2GC2 A;  2FMY A;  1TVG A;  1RL3 A;  5BUV A;  3QD6 A;  1DGR N;  2Q8E A;  4LBQ D;  1H6Y A;  1QKQ A;  4NPM A;  4NMI A;  2QJV A;  2BVV A;  1RUG 1;  1W3V A;  5EXO A;  1PZ9 A;  4A44 A;  2KR2 A;  3AP6 A;  3NNF A;  1P8J A;  3W20 A;  3AFG A;  2BOJ A;  2DCJ A;  5LRR A;  2A6X A;  1VBD 2;  2ETE A;  3NJX A;  1CGP A;  1DF0 A;  1RIT A;  3AYA A;  5FMC A;  1ASJ 2;  1LU1 A;  4FQZ A;  3OPW A;  4AEM A;  4DXZ A;  5JR2 A;  2GP3 A;  2WN3 A;  3CJI C;  2MEV 3;  3BOD A;  3IIA A;  5FYM A;  1UX6 A;  2GNB A;  4HN1 A;  4C0B A;  1VBC 3;  3IDA A;  2DYC A;  3K4Z A;  2ZHL A;  1X7N A;  3FC0 A;  5I0S A;  4RS5 C;  3NW4 A;  4DFS A;  3MFC A;  2VZO A;  3GCX A;  3V0A B;  5IT6 A;  2XPJ A;  1RVF 2;  4LBN A;  3VBS B;  4B8E A;  4E4H A;  1SFP A;  3HPN A;  4QPI A;  1UZW A;  4XFF A;  5JOW A;  2JE9 A;  1PGS A;  4QKD A;  1LEC A;  1NY7 2;  1J83 A;  1W2O A;  4E2S A;  1H1I A;  1TMF 3;  2RMU 3;  4CXW A; 
#chains in the Genus database with same CATH homology
 2YU1 A;  3AL5 A;  4IGQ A;  5IVY A;  5FYZ A;  4CCL A;  5FZ4 A;  4IGO A;  2VD7 A;  5F3E A;  5FYH A;  2XDV A;  3PUR A;  5FUP A;  4CCM A;  4CCK A;  5LW9 A;  2XXZ A;  4GD4 A;  5FZH A;  5A3T A;  4AAP A;  5F3I A;  5FXW A;  4LIU A;  4LIT A;  4NUB A;  3PUS A;  5FZ8 A;  5FZM A;  4CSW A;  5IVJ A;  5F5I A;  5IVE A;  3LDB A;  5FP8 A;  4EZ4 A;  4Y33 A;  4V2V A;  3NJY A;  4V2W A;  5FY9 A;  5FYT A;  4BIS A;  3OPT A;  5FWJ A;  2XML A;  5FP9 A;  3K3O A;  5A7W A;  3N9P A;  5A7O A;  5A7W B;  5FPU A;  4GJY A;  4QU1 A;  4HOO A;  5FZL A;  2Q8D A;  5A80 A;  2OQ7 A;  3PUA A;  4DIQ A;  5FZ7 A;  3N9Q A;  2Q8C A;  4QX8 A;  2P5B A;  3UYJ A;  2OX0 A;  5A1F A;  4DO0 A;  5LY1 A;  5A1L A;  5FYB A;  3N9L A;  3PTR B;  4EZH A;  3KV4 A;  3KVB A;  5FZ9 A;  3K2O A;  4UF0 A;  5FY4 A;  2PXJ A;  4UF0 B;  5FZG A;  4BU2 A;  5F32 A;  5F5A A;  5FV3 A;  4QX7 A;  5FUN A;  5F37 A;  2YPD A;  3DXU A;  3KV5 A;  5ANQ A;  5FZ3 A;  4TN7 A;  5FP7 A;  5FYU A;  2YBP A;  4XDO A;  3PU3 A;  5F3G A;  4IGP A;  5FP3 A;  5FZO A;  5FZK A;  5FZO B;  5FYV A;  5FY1 A;  3AL6 A;  4C8D A;  5FZB A;  5LY2 A;  3PUQ A;  5FZ6 A;  3PU8 A;  5FZC A;  5FXV A;  4CUG A;  3U78 A;  3KV6 A;  3AVR A;  5IW0 A;  5FY5 A;  3ZPO A;  5CEH A;  5FPL A;  3U4S A;  2OS2 A;  5IWF A;  4D6R A;  5IVV A;  5FY0 A;  4CCN A;  4D6Q A;  1VRB A;  5K4L A;  5FPB A;  5FP4 A;  5ISL A;  4AI9 A;  5IVB A;  3RVH A;  3N9N A;  2YBS A;  5A3N A;  3AVS A;  4HON A;  4QXB A;  2YBK A;  5F5C A;  5FZ0 A;  5FY8 A;  3LD8 A;  4GAZ A;  5FZI A;  2Q8E A;  5LWB A;  3N9O A;  5FBJ A;  2WWU A;  5FWE A;  4QWN A;  4Y4R A;  5IVF A;  5FYY A;  5FY7 A;  5FPA A;  4ASK A;  5FXZ A;  5A7N A;  2W2I A;  3K3N A;  5E6H A;  4EYU A;  2XUE A;  5FPV A;  5A3W A;  4QXC A;  3DXT A;  3N9M A;  5IVC A;  3OPW A;  5FJH A;  5FYC A;  5A7S A;  2GP3 A;  5FZE A;  4URA A;  4LXL A;  4Y3O A;  3ZLI A;  5FZF A;  5FXX A;  5F2W A;  5FYM A;  4CCO A;  2OT7 A;  4BXF A;  5FJK A;  5F2S A;  3KV9 A;  2GP5 A;  5FYI A;  5FZA A;  2YU2 A;  4E4H A;  4QXH A;  5FZ1 A;  5F3C A;  5KR7 A;  5F39 A;  2WWJ A;  2OQ6 A;  5FZD A;  4LIV A;  4XDP A;  5A7Q A;  3PDQ A;  4D6S A;  5A3P A;  4GJZ A;  5A7P A;  5FYS A;  3KVA A;  4CCJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...