2XLAA

Structure and metal-loading of a soluble periplasm cupro-protein: cu- cuca-closed
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
233
structure length
233
Chain Sequence
HTFDDIPMPKLADPLLIYTPANEIFDIASCSAKDIGFAIAHAQIPPGGGPMPHIHYFINEWFWTPEGGIELFHSTKQYPNMDELPVVGGAGRGDLYSIQSEPKQLIYSPNHYMHGFVNPTDKTLPIVFVWMRNEVAPDFPYHDGGMREYFQAVGPRITDLNNLPELTNAQRAAFASEAPKYGINQSSYFMEYVNTISDKLPAQIAKLKNDKDLERMVEVIEAFNRGDKSVTCS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and Metal Loading of a Soluble Periplasm Cuproprotein.
pubmed doi rcsb
source organism Synechocystis sp. pcc 6803
molecule tags Metal binding protein
molecule keywords SLL1785 PROTEIN
total genus 63
structure length 233
sequence length 233
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-07-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2xlaA00
1J58A 4LUMA 4MGKE 2OA2A 2GC1A 2BNMA 4XFBA 5CVRA 4Q0UA 4BIFA 3FHIB 3E97A 3H50A 2XGXA 5E16A 4UXAA 4Z07A 4AQ6A 4JV4A 1YLLA 3KCCA 4RD7A 2K9ZA 4D7SA 2D5HA 1VR3A 3NKTA 4IEWA 2Z2SB 5FLIA 5J7MA 4AQ2A 4QGMA 5I8TA 4META 3I59A 3KGLA 4I3PA 2V09A 4YRDA 4FAHA 3E5UA 5C8WA 2IXKA 1DGRA 3IBMA 4HZFA 4PIXA 4CYDA 1CAWA 3QACA 1QXRA 2BYVE 1H1MA 1O3QA 4IETA 4PJYA 3SCHA 5F1RA 3LA2A 3QOPA 3O14A 1UIJA 3SXWA 3H1WA 1ZRDA 3CL1A 3M70A 4LEJA 1O4TA 4ZU4A 2F4PA 2CV6A 3D0JA 3N4MA 1YFUA 4MUVA 4XFCA 4QGNA 1CAXB 1RUOA 3HIFA 3D82A 4XF1A 5FPXA 2XKOA 1QY4A 2KXLA 2UY8A 3B02A 5D1IA 2XLAA 4MZUA 1ZREA 5LRSA 3UKNA 2Y0OA 4JVAA 4LA2A 1LKNA 1TQ5A 3I54A 2B5HA 1ZVFA 4FAGA 1SQ4A 3RYPA 1EY2A 5I0TA 3DN7A 2VPVA 5EZWA 4N9IA 3ST7A 3I59B 2FQPA 2PAKA 1NE4A 2ETEA 3RNSA 5I0SA 3BCWA 3BPZA 3ES4A 1Y9QA 4JTNA 1X8MA 4HBNA 4MH0E 4MGIE 2H0VA 2H6CA 1FI2A 1YHFA 5I8SA 4X6QB 5I91A 4KWKA 3S7IA 2PQQA 3MDPA 2EVXA 4TLFA 3CEWA 1RGSA 4XFGA 2VECA 4KWJA 2OPKA 5LEKA 3NL1A 4EWDA 2QDRA 1PM7A 1YFXA 1UW8A 4JTOA 3USSA 2N7GA 1VP6A 1J3RA 4LLOA 2GAUA 2MNGA 3IDBB 3LZZA 1ZZ8A 2XHKA 3OTFA 3CF6E 4DINB 3H1YA 3RPQA 4IEOA 2OZJA 4IEQA 2QVSB 4B29A 3JZVA 2GU9A 3HQXA 3U10A 3ZDSA 3SMHA 2UY9A 5KHKA 1LR5A 1XE7A 3ES1A 4QX5A 1YFYA 2BGCA 3IWZA 4YYOA 2Q0AA 5HI0A 3FE5A 4R52A 1UCXA 4WVZA 3H7YA 4IEPA 5EFUA 2D5FA 4Q0QA 4UBHA 4NVPA 3ETQA 3FJSA 3HT1A 4KU7A 1IPJA 2C0ZA 4Q0VA 1DZTA 1V70A 2HKXA 1XE8A 3CJXA 3G7DA 2Q4SA 2E9QA 4Q0PA 3E5XA 1CAVB 1CAUB 2ZCWA 5I0RA 3HT2A 4QM9A 5KHHA 3PNAA 5CU1A 2IXIA 3H9AA 4YSFA 2OYZA 3NSTA 1X82A 5JSRA 2EAAA 2GC3A 5AVPA 5BV6A 4WBBA 3R6SA 1NZCA 4EROA 4AVBA 5KBFA 1ZZ6A 4L11A 1O3RA 2I45A 1CGPA 3RYKA 2CAVA 4ZU5A 1O3TA 1O3SA 1LB2A 5FQ0A 3OCPA 3EO6A 1ZNPA 3DL3A 2IC1A 4MX3A 5JR7B 2UYBA 3OF1A 4BYYA 5KHGA 4BH9A 2GH2A 5FDBA 1QWRA 4XETA 3MZHA 1QXJA 1UIKA 5LEJA 5JSPA 5KHIA 4EWEA 1OMIA 4HN0A 1WA4A 3RDIA 1GQHA 5JSOA 2PA7A 4XF0A 5I0UA 1UPIA 4XEZA 4AVCA 4KU8A 4I0BA 3S0MA 2O1QA 2PAEA 4YNIA 5BPXA 3RZZA 1SEFA 1RL3A 4E2QA 4Z82A 1UD1A 4XFFA 1OD5A 2FMYA 2H6BA 1YWKA 2D93A 4A2UA 3OGJA 2IXJA 3NVCA 2GZWA 3KGZA 4AXOA 4XF3A 4IERA 2ET1A 4EV0A 2PHDA 4EWAA 2PFWA 3H3UA 2QNKA 4IEXA 4LULA 2XKPA 3E6BA 1RUNA 4XFHA 1DZRA 4XF4A 1U12A 3KMHA 4E2SA 2IXLA 4IESA 1DGWA 2EA7A 4GULA 2VQAA 1Q3EA 1WLTA 4OLLA 1OFNA 4O9EA 2MHFA 2IXCA 3D0SA 3IDCB 3BALA 1VJ2A 5K8SA 4Q29A 5FQ0B 1Q43A 4I02A 4BHPA 2Q30A 4QGLA 4HSJA 4F8AA 3WW3A 3VHRA 3H1MA 3EBRA 1LRHA 5JCTA 2IXHA 3I7DA 4PIZA 5FPZA 3H8UA 4AVAA 1X8EA 5JAXA 4ONUA 4HN1A 3EJKA 2DCTA 1ZZBA 4J1XA 2PAMA 4L2NA 4F7ZA 1ZRCA 1L3JA 2ATFA 3PLQA 1GQGA 5T3NA 2BNNA 4KL1A 2OZ6A 2PYTA 3E5QA 3H7JA 4XFAA 5CADA 5J3UA 4K8FA 1CAVA 3WW2A 1ZZCA 1YFWA 3WW4A 1RC6A 3C3VA 3RYRA 5KHJA 3MYXA 5BUVA 5LRRA 3MPBA 2UYAA 2CGPA 3FFQA 4QMAA 4IEUA 4MGZE 5FLHA 2K0GA 3E6CC 1JUHA 4I2OA 3UKVA 4E2GA 5C6CA 3ROUA 3U11A 4D7TA 4IEYA 4H7LA 1YUDA 4UBGA 1J1LA 1O5LA 4XFIA 2WFPA 2XL7A 4J1WA 1NE6A 1O5UA 4LTAA 2WC2A 4HVRA 3TNPB 2O8QA 3S7EA 4I0AA 3LA3A 3WW1A 1ZZ9A 4IEVA 4I01A 1I6XA 1FT9A 3GBFA 4HMZA 2ZKLA 1H1IA 1Y3TA 1ZZ7A 4IEZA 5I8YA 2XLGA 3NW4A 2GC2A 4HSLA 3SCFA 3LAGA 2Q1ZB 2CAUA 1J3PA 2B8MA 2Z69A 4O9GA 3EHKA 3TNQA 4PIYA 3GYDA 2D40A 5J48A 1ZX5A 3E6DA 4FT8A 4N9HA 3CO2A 4I09A 3M3IA 3CLPA 2HJIA 1FXZA 1I5ZA 4QM8A 1SFNA 3BU7A 4WZCA 3DV8A 3OD0A 2MPFA 2P17A 5E1RA 3L2HA 4XF9A 1X7NA 1WGPA 4LUKA 2B9UA 1PMIA 2BEOA 4LA3A 4OFGA 4P9GA 5BXXA 3FZ3A 3U0ZA 2QCSB 4MGYE 3SCGA 1EP0A 4KWLA 3LA7A 2BNOA 5BY5A 4R8HA 1G6NA 3UKTA 2ET7A 1NYWA 3KSCA 3DKWA 3FWEA 3FX3A 4HLTA 1EYBA 3SHRA 1NXMA 1IPKA 3EQEA 1O7FA 2XLFA 5FCCA 1OI6A 1CX4A 3NJZA 1ZRFA 2PTMA 4HVOA 4HVQA 4MV2A 1HW5A 2GC0A 1Q5OA 1J59A 5FLJA 3BB6A 1CAXA 4ZU7A 4QXKA 3ELNA 2XL9A 3IIAA 3LWCA 4YARA 2PHLA 5I93A 2QJVA 4Q0SA 4ORFA 1CAUA 1RTVA 4X6RB 3PVBB 1XRUA 4FBFA 1EPZA 1CAWB 3LOIA 1ZRRA 3H3ZA 3ACLA 1J3QA
chains in the Genus database with same CATH superfamily
4C0BA 1RUD1 4I30A 5E8AA 4AEMA 2WNUB 1Y9MA 3NKGA 1UNBA 3POSA 3PUSA 1D4VB 4H14A 3FL7A 5C3QA 2NN8A 4EQVA 4XFBA 1F5JA 1W6MA 3FHIB 4X8PA 4BIFA 2X29A 3RZMA 1SLIA 2ZAAA 3SEEA 2WDBA 3I4IA 4Z07A 2VOKA 4JV4A 1FOD2 2LALA 2D3RA 5FK8A 5BNOC 1IKPA 1IG0A 3KCCA 4WVWA 4DO0A 4LE3A 2BJSA 1NY71 2VMEA 1EAH3 2D5HA 5AFBA 1ALYA 4IEWA 3JB8A 2Z2SB 5FLIA 1OLQA 1PGW2 1RUE2 2A71A 1LCLA 1GNZA 4QPGB 2JEMA 2VMIA 1VBD3 3KGLA 4MXVA 3ZM8A 3J4UH 2BUKA 4XIOA 3KB5A 1HDKA 3E5UA 3ZXDA 1YNAA 5C8WA 1PIV3 4LBNA 1JYTA 1KJRA 5GKAC 4CDXC 4PIXA 4CYDA 3QACA 1QXRA 4PLNA 3B00A 1UQXA 5FZFA 1H1MA 2E33A 4A42A 3WVJA 1G9CA 2IZWA 3UETA 1O3QA 3SCHA 2FBEA 1CVNA 2EIDA 1ZRDA 1UOGA 1X9TA 5C5UA 1MVQA 1O4TA 4XC9A 5JOZA 2RJKA 5J98B 3ZSLA 2B4KA 4NRMA 4AEDB 1QJY2 2CV6A 1GQPA 3D0JA 5FY4A 3N4MA 5JWPA 2AENA 2G9ZA 3I2GA 3WLUA 1VBB3 1ULGA 5BNOA 4XFCA 1XU1A 2PXJA 2YROA 4K6BA 1RVF2 1RMU1 3DECA 3AFGA 3ZXJA 2RS12 3KLSA 4QX1A 3RMYA 3LSEA 3HBKA 1QY4A 2KXLA 4FPLA 5LASA 4CP2A 5DDJ3 5D1IA 5CEHA 4NJ4A 5A7QA 1W6PA 4MZUA 3VZOA 1OH4A 1VAKA 2Y0OA 4W6WA 4JVAA 4FPHA 2HWF3 2WN2A 1TQ5A 2DWRA 2B5HA 1RUJ1 4KQ7A 4JRLA 4RR3B 3NRUA 5EWSA 4A6SA 4DY3A 1ODMA 2WS91 2FDGA 2R49A 4UW3A 1EY2A 1MQTB 1AVBA 2E6VA 1TMF3 5I0TA 5DABA 3AYCA 3M3EA 4AOCA 1V6MA 4FP2A 2VPVA 1YYNA 5M0TA 2D6NA 2ORXA 3BYWA 2FQPA 3I59B 4A3XA 1APNA 1QOTA 2WBKA 2PAKA 1RHI1 1UN1A 1W6PB 1UKGA 2ETEA 3JQXA 3NNMA 3OBAA 4KNCA 4MSVA 5HXVA 2MEV1 4CE8A 2R063 5HV0A 1Y9QA 3GJAA 2A70A 1PNFA 3S6PA 2VMDA 2EF6A 2YGLA 1OA2A 4HBNA 4MH0E 4N7IA 2ZX1A 2WR9A 1YHFA 4LO8A 4NAOA 1FNZA 3MV01 4IGQA 2VZRA 4X6QB 5FZEA 5I8SA 5BNOB 1EPWA 5FR3A 4HL0A 4L99A 4JKLA 3WNLA 5FZ9A 1DFQA 1RGSA 1OPMA 5FYBA 1T6BX 3BPSA 4QKBA 2OT7A 1RMU2 3VN4A 1W3VA 2RDNA 4KWJA 3MIBA 3OBRA 1PZ8A 5FMOS 3BI3A 4QPWA 2ZAHA 4YZ2A 1CONA 1JOJA 2R7EB 5FPVA 1MS4A 2GNTA 3VBOA 3JU9A 3NJXA 4XJ8A 2J1VA 4WZFA 1PM7A 1YFXA 1CZSA 1TME1 3U4XA 5B4NA 1O8SA 4JTOA 4Q26A 4NIHA 1UYZA 2N7GA 4AFBA 3A4UA 1NKGA 3O1VA 2VZTA 2WS92 2D6MA 4LHKA 4LLOA 5FPBA 2NP0A 2WAAA 1E5RA 1AR73 1JOPA 3IDBB 2RMU1 4HPKA 1W39A 4BB3A 3WF2A 5BYNA 3CF6E 1JS9A 3WF4A 5DQ0A 5FRAA 4TTGA 3ZIWA 1JZ8A 4OZXA 1XYNA 5FMBA 4IEOA 1MS3A 2OZJA 2RV9A 4CCNA 3QH6A 4RHV2 2EIEA 1OSGA 4BQ2A 4UOJA 5FZAA 3ZDSA 1FPN1 2XUMA 5FZ3A 2X10A 4YVSB 1XE7A 2ZHKA 4DUWA 2UWBA 1DQ2A 2BGCA 2WNVA 3IWZA 1UOBA 5T5JA 2WN3A 3AKQA 2QQVA 4CTEA 2JG8B 2Q0AA 2VOWA 4DS0A 4XJ9A 4WVZA 3U14A 3WINE 3KWVA 4DXRA 5IVJA 5GZDA 3H7YA 4IEPA 2BU9A 5A3OA 3VBOC 2WNUA 1C8M1 5KC5A 2D5FA 2LTNA 4ZS3A 1GWKA 2ZJCA 3N9NA 4HANA 1V9U3 3FJSA 3OBTA 4JC1A 1RJ8A 1POV0 1Z78A 1ZYBA 4Q0VA 3INAA 1SBDA 1AXYA 1LHVA 4YFZA 2VVEA 3B9IA 1VAVA 4Y4YA 4JGYA 5GLUA 5FWJA 5FY9A 1YJLA 3E5XA 1CAUB 2DCKA 4PT6A 4RHV3 2GNMA 1XPWA 4XCAA 3WHUA 1A8MA 2RDSA 4MGQA 3PVNA 2L9LA 2W1UA 4QX3A 3VD7A 4BJ0A 2OIIA 5C33A 5LY1A 2HWB2 3O1OA 2D7FA 3NJVA 4Y1VA 1OLME 2AACA 5ACA1 3IAPA 2VVDA 3H9AA 4YSFA 2OYZA 3F95A 1WCDJ 3NSTA 2WWUA 3WCSA 1TNFA 4CU7A 5A3LA 4E4ZA 1LHNA 5DAQA 4GH4A 3UGHA 2WA4A 3J7MA 4INDA 4XBNA 2QQMA 3R6SA 2XJUA 1NZCA 4EROA 4GMP1 5KBFA 4QB1A 2P3YA 2ZMNA 1F4AA 1I9RA 1LOFA 1UZZA 2WNUC 1LEMA 2R062 2WO3A 5D8AC 4MG2A 2RS33 2JDNA 3FBMA 2CAVA 3HQRA 3CJIA 4XDQA 3W5MA 5FP7A 2ZGLA 2VNOA 4QB6A 5FP9A 5A7SA 3LDKA 4JGYC 2RMU3 3ZYPA 5FQ0A 1ZNPA 1H6XA 2Q8OA 2IC1A 1GP6A 4MX3A 1H6YA 1W8ZA 4OHYA 4JGZA 3TOJA 1FATA 3TN91 4CDWA 3THDA 4BH9A 4YPJA 1REEA 4P02B 1HV0A 5JI7A 3CHXA 2TEPA 3MIHA 1QWRA 2G1MA 3T1LA 3MZHA 3V0BA 1UIKA 1WWYA 3IT8A 4K20A 4EN0A 4A45A 2W1SA 2XJTA 4XAAA 4GB31 5FFOC 2J7MA 3D3AA 4FQZA 3DXUA 4HN0A 3RDIA 1A6CA 2DBNA 5JSOA 5CG8A 4QWNA 1Z7S2 1GWLA 1UPIA 3EXUA 3OUIA 5T5OA 4CCOA 4D8MA 1U5XA 2O1QA 4R9CA 3WDUA 1CJPA 4YNIA 4PDWA 5BPXA 3VKFC 3GGLA 3PTRB 4COZA 1KEXA 3K3OA 4Z82A 5GZCA 4IV1A 1LGCA 5DDJ2 4DQAA 1D4M3 4IE5A 1CN1A 4XFFA 1OD5A 1S0CA 2FMYA 1OKQA 3AX4A 2VW2A 4R9AA 4YG0A 4EN7B 3CJIC 3OGJA 2JD4A 3NVCA 2VUCA 2QQPA 2JDAA 2YDEA 3AYEA 4NUBA 1KRIA 4IERA 4SLIA 5FZBA 4EV0A 5CISA 4GH4B 2QNKA 4IEXA 4HOOA 4LULA 4DMIA 2D6OX 4NHYA 4I0WB 4LKFA 1W9TA 3B7MA 2RS53 4CDWC 5IFTA 1WCSA 2ZGPA 3KMHA 5IW0A 3ZFEB 2EA7A 1PVC2 3IPVB 4H2AA 5F3EA 3CIHA 1Q3EA 4D7YA 4LBQD 3THPA 4XOGA 5A3PA 3U37A 1C3HA 1WLTA 1RUE3 2ZBJA 1HJFA 2ZABA 1C8NA 5KXEA 5FKBA 3ZFGB 1I1EA 3TEZA 3D0SA 3AVRA 3IDCB 5DUVA 3VBFA 4P9XA 3R0RA 5FP8A 3MUZ1 3ITQA 2VCCA 4OCTA 3OPZA 3B9CA 3VZKA 4K3UA 4NROA 2RHPA 1YQ8A 2Q30A 1IG3A 1ND3A 1X9PA 4CXWA 4FI9A 4PDWC 3X29B 2XOMA 1SLCA 4EZ4A 4F8AA 3WW3A 1BHGA 5L7OB 4IV1C 2AREA 5DG2A 5FPZA 2W91A 1UOJA 2BWCA 1LRHA 4BK5A 3EMRA 4CUGA 3PMEA 3WNKA 3I7DA 1ND3B 4PIZA 3WF0A 4AVAA 2C9AA 4XVHA 4XJUA 3HMYA 5JAXA 3T2OA 4ONUA 4HN1A 1FOD3 5H9QA 3VBSA 2GN7A 3I8TA 3ZN6B 1L3JA 3PLQA 2WFF1 1K12A 1G7YA 3AP6A 1MEC3 2W0XA 3MIDA 5EJZB 4YVSA 1PO11 4A7KA 4CDXB 3IPVA 5FTTC 1XXNA 1HQWA 1W2OA 2JE8A 1H1AA 3AP9A 2XQXA 4XILA 4A4AA 4MGSA 4AG4A 4N53C 2XDVA 2RE9A 4HPKB 4JHZA 4IW3A 3WQ7A 2JB8A 4XDPA 1ZZCA 2VZ1A 5C8CC 1H8TA 4LJHA 3ZYBA 1V0AA 2JG9B 3IZOA 3LEMA 4Y1XA 4HK9A 1RUF3 5A3TA 1W6OA 1XNCA 5JIUA 4JCKA 4XAEA 5F6KA 1G9FA 1RUG2 4MVTA 5FY0A 2OXBA 3GM8A 4Y4RA 1AL21 1XNAA 2HWD3 4KG0A 4XMIA 5EHDA 5A3WA 3T4VA 4Y1UA 3E6CC 4D0QA 3UKVA 3CDZB 1R64A 4GWNA 3ROUA 3ZN5A 1KXGA 1N1SA 2BGPA 3NWKA 5CB7A 5IVCA 1AR61 4IEYA 4H7LA 2OW4A 4YGCA 1VBC2 1YUDA 3LPFA 4J25A 2VJXA 5IVYA 3LEGA 4NWVA 5IHRA 4YVSC 4LO5B 3HNMA 3HBZA 5CA6A 5A1LA 2O8QA 5FY5A 4P9JA 2A3XA 2VOVA 3IDAA 1BCXA 1AYM2 1F9KA 3MPPG 4CCEA 3OBZA 2ES3A 3APBA 4NO4A 4RS5A 4QX7A 1BLZA 5D2AA 5KR7A 4FFIA 2YU1A 1DGLA 1R093 2JE7A 1I6XA 1S0BA 3GBFA 4AR2A 2PQSA 4J6GA 2ZKLA 1H1IA 1ZZ7A 5I8YA 2A3WA 1C57A 1DLLA 3SCFA 3U78A 1OQEA 4Q5OA 3ACHA 2BOIA 3PJQA 1LOAA 5B2GB 4ZXKA 2AEYA 2NMOA 3BTZA 3VBUC 4PIYA 1WA6X 1U5ZA 5JLVA 5FK7A 1AYN3 4QX8A 4U36A 1ZX5A 4CPBD 1HLCA 1WZXA 1YCIA 4N9HA 2YFZA 4I09A 2GNBA 2DCZA 5F32A 2IWGB 4COVA 1GZWB 1W9SA 5J09A 3C7GA 4R9BA 1DQ4A 4YZ1A 2MEV2 3K77A 1I5ZA 2DURA 4ZKTB 2HEVF 4QHZA 2NPIA 1IS3A 3DV8A 3OD0A 3V65A 1PK6B 1RUH3 4ASKA 4LKSA 4AEDA 4XQ4A 1DU3D 1X36A 2WLPA 1S4CA 2YMZA 3FUQA 1RUH1 3L2HA 4XF9A 1OA4A 5DXDA 3RZHA 2BEOA 4LA3A 3T0AA 5L9RA 3M3CA 2DCJA 4ZONA 2ARAA 5KC6A 2X05A 3VBHA 2HLEA 1ENQA 1SG3A 1E57A 2D43A 4YW4A 4LO4B 3TEXA 5JR2A 3BKZA 3LA7A 2E26A 1S0FA 3PU8A 4B7EA 3OB8A 2Z79A 1RUF1 2F6BA 3KM5A 4RGKA 3VLBB 3OGVA 3POGA 4R8HA 5HCBA 3UKTA 3KSCA 1N47A 4QPIC 3FWEA 4QPYA 2ZGOA 4PI2A 5DAPA 1IPKA 1RUC1 4IGOA 1O7FA 3OPTA 4OMDA 4ZY9A 1CX4A 2YC2A 3NJZA 2Q8CA 1JI6A 1Z0HA 2NMNA 2VCMA 3VD4A 3ZO0B 1WLWA 2WSVA 4YVWC 4AVTA 1HW5A 1Q5OA 1J83A 4Y5TA 3DYPA 1CAXA 3ZVXA 4L92A 1IS4A 1LHUA 2DUOA 5ANQA 1EV11 4RQPC 4COWA 3IIAA 4RFRB 4WM8C 1W2NA 1QJU3 3GJBA 1H4GA 4CDQC 3NMBA 1W6MB 3CBNA 1S0IA 4QKNA 1HN1A 1XYPA 3BTAA 4Y33A 5F6LB 1XNKA 4AI8A 2XBO3 4DB5A 3EYPA 5HPOA 3ZYJB 1AR93 4KH9A 3ZFGA 1KJLA 1KFXL 3ZSKA 1W06A 4BK4A 2D6KA 2VUDA 4FBFA 1W8FA 4XYXA 4AAXA 3VB9A 3B93A 4AVSA 4CDUC 3ACLA 3B5LB 2XJQA 1TG7A 2BV4A 1GKBA 5BNQA 3AC0A 4QXCA 3CU7A 4JKMA 1PVC3 4MGKE 2W1QA 2OA2A 1OF4A 2JXAA 3WNOA 5F37A 4GB32 5GLWA 5IVBA 5CVRA 4FCAA 5IK5A 2B39A 1ZRIA 1K5MC 1DF0A 2W92A 4P9YA 3LFIA 1N1YA 5CFCA 2CYFA 4AQ6A 5FZ4A 3WQ1A 1PO23 2RJ2A 4IV1B 4BQWA 3ZYRA 4RD7A 2K9ZA 4HKLA 5EJ1B 4KGGA 2BDRA 3AZZA 1LOEA 1WKYA 3A0KA 2DF7A 1NT0A 1R083 4GMP3 1FPN3 4URTA 3ZSEA 4BM8A 2P3IA 3ILNA 5FMDA 2VMFA 4CEYB 5I8TA 5IATA 1LHWA 1JUIA 1UZWA 3K4DA 4OMCA 3I59A 5TSWA 2FDFA 2E63A 3AKRA 3IMMA 3P1IA 2V09A 4LKDA 4LR4A 4YRDA 3VDDB 5A32A 5A6XA 3O1MA 2A6YA 5FJHA 5A3UA 3OGGA 2HYXA 3RWNA 1VRH2 3SNMA 4AGRA 3WNPA 4ATEA 1AL0G 1UY1A 2G9FA 3FHQA 5FYMA 3ZFEC 5SV8A 4CDUA 4CCLA 1NA1C 3RZGA 1RUI2 4YM0A 2FCVA 2J1AA 2Q8EA 1DQ1A 4IETA 2E32A 4BCUA 3O0XA 4KBZA 1ASJ2 1GZTA 2LUWA 4PJYA 1SLTA 4PF1A 3QOPA 2VZPA 5F1RA 4O61A 2WQZC 5FIXA 4NPRA 2CDOA 2YV8A 1W2UA 2DFCA 3MHZA 1KITA 1ENRA 5ABJA 1W8OA 3BVCA 5FO7B 3ZFFA 1YFUA 4MUVA 1MR5A 3CJIB 4C1WA 1DIWA 2RDQA 3HOBA 1OQDA 4D6SA 3UJOA 5IYYA 1NLQA 4LO6B 4FPEA 2RS32 1OLRA 2DUPA 3W21A 4LOTA 2XKOA 2QDNA 1AYM1 1EV13 2UY8A 1E5SA 2FDJA 3FMGA 3ALQA 1UY0A 3K48A 5BNPB 1LGBA 2W39A 1ZBE1 4P9IA 5LBCA 3UKNA 3S57A 3J7HA 4LA2A 4YW3A 4DPNA 1ND2C 1LKNA 1PMJX 3MBWA 3UYJA 2IUWA 3S5QA 4LBJA 1D2QA 1BBT2 2VU9A 4LLFA 4QDSA 3POFA 5DG1A 1OLMA 4C0HA 1S55A 3GZUC 1UX7A 1JOBA 4UW6A 4B4RA 5ISLA 3CQOA 3L9JT 4Q1RA 4AGGA 2HWC1 5DN2A 3AMNA 1TE1B 1RINA 1EV12 3PVEA 2JICA 4BMEA 4ZZ5A 4QPGA 5I0SA 1DZQA 1UMHA 3ACFA 2BTVC 3BPZA 4D6QA 4FPGA 3ES4A 4NMIA 4JGYB 4JTNA 4RYDA 4B4QA 4ZS2A 4ZZ8A 5ABJC 2XJPA 2DVFA 1T2XA 3ZFFC 3GBGA 2WT0A 5L9BA 3S7IA 1DBNA 1C1FA 3MDPA 3IB3A 1QJX2 3VHPA 2WZPP 5FYIA 4KWUA 3MF6A 4XFGA 2BOJA 1V9U2 2VECA 3AL6A 1VIWB 1PMHX 2R16A 2WNVB 2WZR3 1QHDA 1UKRA 3NL1A 3ZXGA 5FUIA 4C90A 1AR62 2WNOA 2Y60A 4P14A 2AR6A 3FHAA 5T55A 2VC9A 1SHWB 1VRH3 3RJ2X 4COUA 1UW8A 1ZBE2 2WIIB 2D44A 1JMUB 1RHI3 5FZGA 1PX4A 1AYN1 4NIIA 3USSA 1KD7A 2Y6LA 1WMFA 1VP6A 2EIGA 1CZVA 2DYCA 2A3YA 2GAUA 3AKTA 5IFPA 1NG0A 1ZZ8A 2XHKA 1UOFA 3OTFA 2QFEA 4GMP0 4GXLA 2RR13 3H1YA 1QF3A 4M00A 2RS13 2W08A 1AXZA 1W8NA 2W9XA 3GHMA 3AYDA 4OHVA 1GBGA 1HKDA 1MQTC 1OQ1A 3LB9A 1H9WA 5C4WB 1QJY3 4Y5SA 5CFDB 1VMJA 1RB8G 3IKWA 4BQYA 1HB1A 2OQ7A 3VZNA 1OF3A 2QBXA 2R0FA 4YGBA 4GB33 5HXMA 1W2AX 5F8PA 1RUI1 5HI0A 3FE5A 4DEVA 1S2BA 2GMPA 3M7AA 4XUOA 2VZQA 3PVOA 2W95A 1LOGA 2WRAA 4OHWA 1NCQB 3WNXA 1CIWA 2RVAA 4QQ2A 4KMQA 4NVPA 2J42A 2V4AA 3HT1A 4COYA 1UXXX 1YI7A 1RUC3 2BVVA 3PHMA 4KU7A 5HCHA 1AR92 5EIYB 3FN9A 1RUD3 1RUG1 2HKXA 1XE8A 1HRI2 3V0AB 1VBD2 2ZGMA 4MO3M 2VM9A 2W47A 5B4XA 2BFUL 3KD4A 1S1AA 2PHUA 5FZCA 2P37A 3BIWE 2R041 4A3ZA 4QM9A 5KHHA 3M3QA 2J22A 5C7GA 4MOAA 4BQ1A 3A0NA 5FYVA 5FYSA 5FZ7A 5H9SA 5CU1A 1MQTA 3R05A 3ORJA 4BU2A 3PMSA 1SACA 2IXIA 2FZ1A 1WD4A 5D8AB 4UFKA 2C6SA 3DYOA 3FFZA 4P08A 2HWE2 5AVPA 1GNHA 5IVVA 5JZGB 4IDZA 4CEYA 4GIQA 3ZKYA 2LS6A 2GMEA 1ZZ6A 5FUPA 3TEWA 2VMGA 2K46A 1GLHA 4L11A 4DRRA 2PN5A 1JU3A 3DEMA 2WZR1 1MVEA 1RIRA 1WBFA 1VE0A 3GNEA 2DV9A 5F5IA 5CFCB 3RYKA 4YM3A 4K1ZA 4YW7A 1FMD1 3RQ0A 4QHBA 5J96B 3W58A 1O3TA 3ATGA 4NHXA 1O3SA 2A6XA 1COV3 1QJX1 1G9DA 1S0JA 3EO6A 3OGRA 3WZ1A 3ETPA 4B8EA 3DL3A 2W5FA 1TNRA 1PO21 1R1ZA 1MS9A 3P3PA 1PO13 4L8QA 3IMNA 2C4XA 2CU5A 2GDFA 2YY1A 4XETA 1QJY1 1WD3A 1QXJA 1W8HA 4JZRA 4O65A 5ERLA 4URAA 2VCAA 5C9AB 1YXWA 4D3WA 1NCRB 4EWEA 5JSPA 5KHIA 5LEJA 2JB4A 4QB2A 1OMIA 3TYJA 2DTYA 1WA4A 1XNTA 1AYN2 1GQHA 3F2ZA 3ZLIA 4XF0A 2VQ0A 1BMV2 1GANA 1IQDC 1C5HA 4AVCA 3S0MA 3S5AA 3A23A 3HEIA 2J1UA 3GXUA 5E88A 3URFA 1EUTA 1V6KA 3ZOIA 1LESA 4E8DA 3MICA 2XUEA 2A7AA 2P3KA 1AXKA 3N9MA 1BBT1 2WLQA 1YWKA 1EAH2 1W8TA 1GOHA 2D93A 1B09A 1RUJ2 3VL9A 5LB6A 1WCKA 4KBBA 5FZ8A 4A2UA 2G4IA 3ZYIB 4BPZA 1BMV1 1HXS3 3UESA 3V0AA 1PGL2 2OVUA 4FP3A 4EWAA 3H3UA 2ZA9A 5APAA 3OSDA 4XQWA 4FFHA 1TVGA 4XJZA 3KZ4C 4R4ZA 2GSYA 4XFHA 1DZRA 1RYYA 2YZ4A 5EPAA 1U12A 3J7LA 1RXGA 2KM2A 4IESA 3VHOA 4DUXA 1WCUA 3I3EA 2VQAA 4LHNA 1AR83 5FBZA 2WL1A 3AKPA 4UF0B 4AW7A 1QQP3 4CP9A 2YPDA 1FYUA 2XWJB 3K4ZA 3U4SA 4XUPA 2IXCA 3VBHB 4AF9A 4ASLA 1MPXA 3HNBM 3VBRA 2WT1A 4OQ8A 2XJVA 4JDOA 5F3IA 5FWEA 4I02A 2WZ8A 4BXSV 5LBEA 3VKNA 2VL4A 2RM21 5LZ6A 2AH2A 5J1XA 3EBRA 1RUC2 4Y24A 2BBAA 4TZDA 3VUOA 2PLV2 4PQQA 4PF5A 3KV4A 4GA9A 3I2DA 1UU6A 3H8UA 2QQKA 1GZWA 2ARBA 1D2SA 1B35A 3LF7A 4H3WA 1X8EA 4IV3B 4XACA 5GLTA 3ZYGA 1W6QB 2W68A 3BN6A 4K21A 1QKQA 4JKKA 4BMBA 2OUHA 2RM22 4FPOB 3BOWA 4BXFA 4D94A 3TWIA 1QQP1 1YRZA 1IHMA 3JBG2 5T3NA 1UF2C 2WQ8A 3T09A 2DFBA 2JG9C 2X53S 2OS2A 2XVGA 4XHBA 4MGTA 5FREA 3NNGA 1LEDA 2PYTA 4HFSA 4XHXA 1W99A 3KT7A 2ZGNA 3H7JA 3R4UA 4NIGA 5F2WA 5CADA 3B69A 5EJ3A 5A6ZA 1CAVA 4P9WA 5FYYA 3T0BA 4RN5A 4CEWA 2W52A 3VBRC 1YFWA 3ZSMA 5FY7A 3AMMA 3WW4A 1UY4A 2J1RA 3DF0A 3T0DA 5AC93 1ULEA 5LRRA 4Z92B 5BNNA 1GWMA 3IAQA 4QMAA 2XVKA 1DHKB 4IEUA 2TUNA 4MGZE 3VD9A 4M3CF 4P5HA 3T2TA 4BLJA 3AMPA 1JUHA 4E2GA 2QQWA 4XCBA 5FYUA 1ZM1A 2X5IB 3Q9OA 3U11A 5K9YA 4Q4V1 5FMOL 2UWCA 5IK8A 2VUJA 5E6HA 4QKFA 2Y34A 4UBGA 1YQCA 4LK6A 4XFIA 5BNPA 2IVIB 2ERFA 2XL7A 2C26A 4J1WA 5HBAA 1MS0A 1O5UA 2WC2A 4LTAA 3PUIA 5A80A 1OUSA 4Q4W3 3TNPB 3S7EA 5A3MA 2JG9A 4I0AA 4LORA 5H9PA 3WW1A 4B7KA 4GKYA 2LROA 3ZIXA 1OC1A 4O7XA 1BEV2 1R1A1 5A32B 2JDHA 2JD9A 3CZJA 3Q8CA 5C3PA 1G9BA 1EAH1 4H7MA 1UZVA 4CEWC 1Q56A 5DUXA 3AP4A 4HMZA 4IEZA 1Y3TA 2YC4A 3AZWA 1UU5A 2XLGA 1H2KA 3I3DA 1D4M2 3PURA 4QQLA 3H8RA 2A5ZA 4YW1A 1AF9A 1H0BA 2CAUA 3J8F1 2WYFA 3WX5A 1UU4A 4AVVA 3EHKA 2FHRA 4D6RA 3TNQA 1W8WA 2R061 4QQOA 5A1AA 5LA1A 1Z7S3 4Y20A 2D40A 3E6DA 4WV8A 3T08A 4Q4Y3 3CO2A 3M3IA 2JG8C 4FQ4A 1OOPB 2D3PA 2DVAA 4IE0A 4IV3C 4LITA 4BOWA 5EYYA 1BK0A 4M0HA 2HJIA 1HV1A 1F15A 2D98A 1WW6A 2ZGKA 3FC0A 3PU3A 5C9AC 1PZ7A 2J1EA 5L7OA 5DAWA 1K45A 3C7EA 4Y26A 2VO5A 3WDXA 4HXCA 5HV4A 3M4FA 1X7NA 1WGPA 3WY6A 4L0PA 5JXJA 1SDWA 1YJKA 2JJ6A 1PMIA 3VBFB 2HYKA 1W9YA 2YB7A 4E8CA 4ES9A 4UAPA 2ZHMA 3POEA 2ZEWA 5DMYA 3D6EA 4LBKA 2BNOA 2R042 1Z7S1 1UMIA 2P6CA 3MIEA 4BQXA 2XWBB 2ET7A 1H4HA 1XOYA 3DKWA 4MXWB 4WVMB 1O6UA 1LJ7A 3KV9A 1UWWA 3SHRA 2JIJA 1NXMA 3N9LA 1ZBA3 2VXRA 3EQEA 1YEWA 5JPNB 5JXHA 1MZEA 5CYYA 5GZEA 2YHJA 2QQNA 2VZ3A 1ZRFA 3QCWA 1VAMA 3VGIA 4HVQA 2YU2A 4MHRA 2V4VA 1LENA 1WUVA 3LSDA 2DUQA 2GP5A 5A7WB 1J59A 5L19A 4Q8LA 1R082 3BB6A 2QTWB 5G05L 3N36A 3THTA 1N3QA 4BISA 1W3XA 3ELNA 5JXGA 3GCWA 5L7OC 1LOBA 3LKJA 2Q1MA 2VXJA 3FUOA 4PDWB 1PVXA 2VNVA 1PHMA 3GBWA 1G8WA 2PHLA 1V6IA 2E31A 5FZLA 1L7LA 2Z5WA 2HBTA 1BK1A 3MW3A 1SBEA 3PUHA 4EE2A 2G9GA 4QXHA 3VD5A 3WF3A 4QAWA 1AL23 3OUHA 3THCA 4NAMA 4NR1A 1QDOA 1CAWB 2ZZJA 2UWAA 2VTXA 2VZSA 1M4WA 4DINB 3H3ZA 4UYBA 3KHCA 3MFAA 4JGZB 4JQTA 1J58A 3K3NA 2XXZA 4G9SB 3T3YA 4NRQA 1MZ6A 3WG4A 1SLBA 1W9WA 2E53A 3VDCA 3MW4A 2BNMA 5JUVA 3J9SA 1BVP1 2XBO2 4FOQA 5L36A 1UPSA 3E1F1 3E97A 5DUUA 3H50A 2XGXA 1LNSA 5E16A 5CFDC 1QJU2 4YW5A 1EUUA 4TYSA 1YLLA 3NV4A 2PMWB 1VR3A 1MS1A 3HQUA 3NKTA 1POV1 2HH9A 3HNYM 4YZ3A 5LWBA 2BVBA 3KT1A 3OJBA 4AHWA 2FDKA 5FZHA 4Z2AA 3ASIA 5DPNA 4FAHA 3N9OA 2R071 1SCRA 5JPMB 2DVBA 5T5PA 4FOWA 4CCMA 2IXKA 2PHWA 1DGRA 4M4RA 3M2MA 3IBMA 5AVAA 1WW7A 1GOFA 3AK0A 4HZFA 1CAWA 1GICA 2CGOA 4YW6A 3WUCA 2BYVE 2GP3A 3MLJA 3PIJA 4TWTA 2ADEA 2Y6GA 3AB0A 5DZGA 3VKMA 3LA2A 1OURA 4AWDA 4QX0A 4Z2WA 4AI9A 3H1WA 2I74A 3HPNA 1K5JA 4LEJA 3WDYA 4A7YA 3O0WA 4ZU4A 2WJSA 4YM1A 2HWC3 4LBQA 3K51A 3ME2A 4DEQA 4EN9B 1RUH2 4A7ZA 5EXOA 4QGNA 4AI0A 3POBA 3LD8A 1XBFA 4YGEA 4KI5M 2CTVA 3ZYFA 1RUOA 3HIFA 2R073 3D82A 5FZIA 1BYHA 3DCQA 3B02A 3LEIA 2JDZA 4CUAA 1ZREA 4XIKA 3JXSA 4U2AA 5F2SA 2ZGQA 3I2IA 3RI8A 1S2KA 1OA3A 1UYXA 2K2SA 4XPVA 2XQRA 5FPAA 3I54A 4UF0A 3AKSA 3RI9A 1C8M3 3OEAA 4WVMA 1G86A 3GF6A 4Q4X3 4FAGA 3PUQA 4CDXA 3GZTB 4S2HA 3ZXEA 1F31A 1GZ9A 3DN7A 3WD5A 1PGW1 5EZWA 4N9IA 1VBA2 2ZMLA 3N7JA 2GMMA 1CZTA 1KS4A 4I3GA 4QXBA 3VBSB 3BCWA 2X8KA 1UX6A 2Y38A 1XU2A 1RVF3 2XJSA 3PL0A 2P34A 5FUNA 1U5YA 1L7QA 3USUB 5CBLA 2H0VA 4RR3C 3B3QE 1IGOA 5I91A 4B1LA 2SBAA 3BODA 4BDVB 1GP4A 2WWJA 4JDNA 3VBOB 4TLFA 4LBQB 4E9KA 3CEWA 3JBG3 4HKWA 2WSUA 2ARXA 1IZ3A 2Y64A 3I3BA 1FMD2 4NIDA 1JW6A 2Y6JA 2RM23 1OVPA 2XMLA 2OPKA 3OGSA 5HCFA 3VDBA 1BKZA 2VOXA 4PQ9A 4EWDA 5T5LA 1S0DA 4KG8A 1QH6A 4BQ4A 2Y0IA 4MHUA 1CR7A 2WQ4A 3W59A 2HWD2 1V6NA 2YXSA 3V64A 1AJKA 3AP7A 5SV5A 2HWE1 3MIFA 1COV2 1M06G 2EIBA 1J3RA 3AFKA 4JX0A 2MNGA 1MZ5A 1N1VA 1T6GC 4CP0A 4CU8A 1GOGA 3HAGA 3MW2A 3RPQA 5LY2A 4IEQA 1D0HA 2YYOA 2QVSB 2VGDA 3DPRB 5FZOB 5FZ1A 3VZJA 2VMCA 4B29A 4KGQA 1C1LA 4CZSA 3JZVA 4IE6A 4AZZA 1Y7BA 2GU9A 5FV3A 3U10A 1AR82 4RR3A 2ZKNA 3CNAA 5A6QA 5KHKA 1LR5A 5J37A 3WP5A 1H9PA 3RZKA 1C5IA 2XB6C 4YYOA 2OKXA 5AC91 1HRV2 2J1SA 2VOTA 1I5PA 3C7FA 1VRH1 5FZ0A 4AK3A 2CHHA 1VMHA 1UCXA 4YGDA 1Q8PA 5JIAA 4QDQA 4UFLA 1PM4A 3VHNA 2V72A 1ENSA 2I2SA 2JDKA 3OOXA 1Q8SA 4LHLA 5EFUA 1IKQA 3SQOA 2VG9A 1RUJ3 2FMDA 5D8AA 5FXVA 4Q0QA 3WCRA 4CUCA 3V0BB 4UBHA 4AFAA 4DIQA 1VMFA 4DXZA 2EAKA 1HRV1 4YZ4A 1OD3A 1Y43B 1BXHA 2FDHA 4S2FA 3DYMA 5FPLA 1HRI3 2YBPA 3CJXA 2P2KA 4LBLA 1OBNA 4UFJA 5C8CB 2Q4SA 4Q0PA 1CAVB 5L73A 5I0RA 2RS51 4HK8A 4NHMA 4OI1A 3MLKA 4HONA 4PHZA 4JAAA 1DQ0A 3RRDA 4GD4A 5FOJB 3RJRA 3ZKUA 3OY8B 3T4HB 3PNAA 3Q8BA 3Q8EA 2IVJA 5JOXA 4M4PA 4OI2A 3WG1A 1SLLA 3AZVA 3FLPA 1GNYA 5LATA 5FZ6A 3WXPA 5JSRA 1OOPC 4PLOA 2YFUA 5KXBA 5F3GA 2GC3A 2KA3A 4W4ZA 2WNVC 2ZGUA 1X50A 4QKDA 1W0NA 5FZDA 1I3HA 1UAIA 4ATFA 1B35B 4WM7A 4E4SA 2YC0A 5CNAA 2P5BA 1O3RA 3PUAA 2D97A 2XHNA 3RG0A 2I45A 3ZXFA 1TME3 1CD3G 2RR12 1CGPA 1VBE2 5C3RA 2DDUA 2V5DA 1A8DA 1D0GA 2CDPA 5CKMA 3AZXA 2JX9A 3FLRA 5A6YA 1VBA3 4BE3A 4ZU5A 1QNWA 2P3JA 2JWPA 2NYYA 1OUXA 3GZEA 5F3CA 3C2UA 3OCPA 1Y9GA 4EJRA 4ES8A 4FXKB 1WMEA 3WG2A 1C8M2 2UYBA 3PIGA 1HQLA 4LHSA 1JTZX 2VQTA 3OF1A 1CX1A 5KHGA 4CP9B 2ZEZA 3SISA 1AR63 3OUJA 1AX1A 4IL7A 4XXPA 3GDBA 2GH2A 1JZ6A 2C9KA 3ZN4A 3NV1A 4LPLA 2GH8A 4Y3OA 1LU2A 1D7PM 4G4FA 1JU4A 2QZ2A 4FPFA 4UW5A 2ZXQA 5AFEA 3LOBA 3K75B 1DCSA 1RJ7A 1JYVA 3PTYA 4AAPA 1QMJA 1OOPA 1VBB1 2JKBA 5A7NA 1JH5A 4Q4X2 4GH4C 2PA7A 2KR2A 5IUQA 1W28A 3A22A 5I0UA 4XEZA 3KF5A 4KU8A 3C7OA 1HJGA 1ND3C 4BZ4A 2HWB1 4XJAA 3NO8A 4NE9A 2XBO1 1SEFA 1ULOA 4WM7C 4NPMA 2OPWA 3VBUB 2WO1A 4E2QA 1GUIA 1UD1A 1LOFC 2GN3A 2WAOA 3WP6A 3LCPA 3TB0A 1SFPA 2LW8A 3LQCA 1OHFA 3DKQA 4CVUA 1POQA 1S0GA 3ABZA 3R4DB 4FPCA 4HT1T 4WM7B 2I07B 2RR11 1GP5A 4RL7A 1QU0A 4FTBA 4M3CB 2R30A 3VBSC 5CG9A 1YI9A 3KQRA 2ET1A 1HX6A 3Q8FA 1MS8A 2PHDA 4G3YC 4BQ3A 3IIIA 5CIRA 5C5TA 2VZVA 3ON7A 4AQSA 4OUMA 1Y4WA 3FLTA 1RUNA 1O8PA 1US3A 4JGZC 3WP4A 4XUQA 1GMMA 4QPIB 4XF4A 4OQ9A 1NA1B 2IXLA 4E2SA 4GULA 3ZR5A 3HVDA 4B4PA 1MEC1 3QD6A 1XNDA 2HWB3 5T52A 4N53A 4O9EA 3LIHA 1XQNA 5KWRA 2R32A 1SFYA 3BALA 1VJ2A 3WG3A 2ZOEB 5C8CA 1F4HA 2X5IA 3WQ0A 3U07A 2DCYA 1JHJA 5G04L 2NZ9A 4PLMA 4HSJA 4AE2A 5IWFA 1DDLA 3H8XA 3B94A 1AJOA 2B46X 1HRI1 2FCUA 4BQ5A 3H1MA 5D21A 3BIEA 3O7OA 3TRSB 1H30A 5JCTA 4P5YA 1O59A 3DGTA 1ASJ3 4P00B 1UYYA 1DYPA 1COV1 3WV6A 3EJKA 1ZZBA 4L2NA 1ZRCA 4LNVA 4F7ZA 5JMCA 5FY8A 3LIGA 2ATFA 5FXXA 4CCKA 5FYHA 5ACA3 4N53B 3BGAA 1RUE1 4GZ9A 4UFIA 2DVGA 3RWKX 4CDUB 5DZFA 5C4WC 2XR4A 5CKNA 4GWJA 1TEIA 1WW4A 4X8NA 2QQLA 3E5QA 2PHXA 1A34A 4XFAA 3RGBA 1W6NA 1JYIA 1NUKA 3VBFC 1LECA 1QNYA 2ZTNA 5T50A 3WUDA 2X5IC 3J7NA 3MLLA 1AR72 5KHJA 1QOSA 1UMZA 3MYXA 4CDQB 1OVSA 1OXCA 4ARXA 2CGPA 4V2WA 3NAPA 3O5SA 4QX2A 5FYTA 4OI0A 1FNYA 5A1FA 1F2NA 3VBUA 4CA9A 3ZDVA 4DUVA 1W03A 2W1WA 2BBVA 4OVEA 2AUYA 1ULFA 4QQHA 4QT6A 2LM3A 5GZGA 1AX0A 2CL2A 2D3SA 1V00A 2PHTA 2RS11 4D7TA 1X33A 5I0DA 1NAEA 2FDIA 2XG3A 3I3QA 1RMU3 2CY6A 2HEWF 2R043 3VDAA 3I3MA 3GZAA 2WO7A 3CZUA 3ENRA 1NE6A 1Q8VA 5C4WA 4ISQA 2WYSA 4A44A 5KXDA 3RZJA 4ITCA 5LA2A 1XSQA 3LA3A 4AEDC 4TXWA 1NZIA 5LA9A 3ZMOA 4XMAA 1NY72 4BA6A 5F5AA 3JBG1 5K4LA 3PJYA 3VBHC 4CRQA 4AI3A 3SEPA 1DQ5A 1H8TC 1FT9A 2VW1A 3POIA 2GC2A 3NJYA 4HSLA 4LIVA 4NRPA 2Q1ZB 1VLNA 3NAPC 4XQDA 1GV9A 4AFDA 2Z69A 2CNAA 3O1PA 1JYNA 1NQDA 1GSLA 1NOVA 2NM1A 2VQUA 3U1XA 5J48A 1NLRA 4FT8A 3POJA 1W0PA 1PZ9A 2BGOA 2VY0A 3O0VA 3CLPA 2NQYA 2HEYF 1UZYA 1UYPA 2IFWA 5FO9B 1FXZA 4QM8A 1K3IA 2Y26A 1SFNA 3BU7A 3NNLA 5FXZA 5JOWA 2D6LX 1VB2A 4EZHA 1BVVA 4RQPA 2P17A 3DPRC 3OY8A 3N35A 4WM8A 5E1RA 1W04A 4CDQA 1OKOA 5IAVA 4LUKA 4GJZA 3N9QA 1JODA 1MS5A 3R4SA 4RS5C 1SPPB 3FZ3A 3RNSA 2YBSA 4YG6A 3VZLA 2QKDA 4Z8BA 3SCGA 1EP0A 3ZFGC 1UY2A 5C3OA 1OH3A 4Y22A 4IQPA 2B7YA 5BY5A 1WLDA 1WMXA 2O0OA 4Z1VA 1W2TA 2VMHA 4LXLA 2Q5TA 3FX3A 1JYCA 1YIPA 2R6QA 3NV3A 4A6OA 4LT5A 1SCSA 4YFWA 4YW2A 2DVDA 5DUWA 5E89A 5FCCA 4Q4W2 3ZX7A 2OX0A 1OI6A 4M0NA 1YC61 1NX9A 3KCXA 3T2QA 5JZGA 2PTMA 2EALA 5GJ6A 1YQ6A 1H8VA 1K5MA 4N43B 4MV2A 5A3NA 5A7PA 5ACA2 2ARCA 1Q8QA 2G19A 1ACCA 4ZU7A 4N7UA 4QXKA 1HB4A 3O1TA 4FTEA 4K1YA 1MZFA 2XL9A 2OUJA 4NOTA 2V5YA 3MEPA 2W87A 2D6PA 3DPRA 3OD4A 2TBVA 4XABA 4XDOA 4XBQA 3ZFFB 2VR4A 1E5HA 1W05A 1QGLA 1S0EA 3AXEA 4LBOA 4PCRA 5GLVA 5T54A 2E51A 1AYM3 3POWA 4S2DA 2QJVA 4AEJA 4AI2A 1HIXA 2QZ3A 3SH5A 1RTVA 1JZ2A 2BERA 4QD2A 4X6RB 4DXTA 2HBUA 5LW9A 3PVBB 4E4HA 4JHTA 1BZWA 1VBE3 1XRUA 2KD7A 1QIQA 3WNMA 1EPZA 1REFA 4ZHNA 1IPSA 1VBC3 2QQJA 3K2OA 3LGRA 1NA1A 2Y33A 4AFCA 4QPIA 1RITA 1TMF1 1NCQA 2ZX0A 5FOBB 2EXJA 3FBYA 2JDPA 2DBIA 1XC6A 3CMGA 4FOVA 4LUMA 4Y5Z0 5GM0A 1DG6A 2PLV3 2JE9A 3KQ4B 2GC1A 4GWMA 3TAYA 1CPNA 1STMA 4NHKA 4DXSA 4Q0UA 4UFMA 5JZGC 1JN2P 2B45X 4M3CA 1CESA 2R0HA 1RUF2 4YVWA 4W6XA 5LBFA 4OHZA 4XE9A 4UXAA 4ARYA 2AGSA 5GLZA 1W6OB 2YUEA 3WSOA 3AYAA 3LDBA 1UL9A 2ZHNA 1LGNA 4D7SA 2ILMA 3AZYA 3N7MA 1F8VA 5FJKA 3BU0A 1W9FA 1QQP2 2H0BA 4AQ2A 4QGMA 3MF9A 1R081 1W0OA 4META 2CWSA 3V56A 4I3PA 3UT0A 1DP0A 2E7AA 2BZDA 2E7TA 1SBFA 3RFRA 1AX2A 2R1DA 4MXWA 4LBMA 5F5CA 5FYCA 2QE3A 3HN3A 2C1FA 2P6HA 1DYKA 1N3PA 3WP3A 1HXS2 1LU1A 5C71A 1NCQC 2ZS6B 3P6BA 3O1RA 1GFF2 3RVHA 4CCDA 3O14A 1HRV3 1UIJA 1R092 4QPGC 4XW3A 3CL1A 3SXWA 3M70A 1V6LA 2W2IA 2F4PA 2CSGA 1US2A 4QHOA 3H8OA 4OULA 4DZGA 1PK6C 1LTEA 3ZXKA 5C3SA 3KV6A 5CFCC 2ZHLA 1LHOA 4CU9A 3VL8A 1NLSA 4Q8KA 4L9BA 1CAXB 1OPOA 5JMOA 3KV5A 1VALA 2BQPA 2VVFA 2DU0A 3POYA 1TME2 4XF1A 5FY1A 5FPXA 1CJDA 1MACA 2A6VA 4C91A 3AMHA 1PIV1 2XLAA 1QJU1 1PNGA 4CSWA 4Y20B 1WLCA 2Q8DA 4AFMA 5LRSA 5EP9A 2X09A 3VV1A 2RS52 1R1A3 1OT5A 1VBE1 2O14A 4R4XA 3T1MA 4QDRA 2VNRA 4XJWA 1JYWA 3ACIA 3ZYHA 1ZVFA 2AEZA 1QJZA 2YPJA 3ZFEA 1BEV1 1R1A2 1SQ4A 3RYPA 3S30A 1QJEA 5FP4A 4NN0A 2E7QA 2VZOA 3AP5A 3B01A 2EICA 3ST7A 3J8F2 3VDDC 3GHNA 3RMXA 1FMD3 1NE4A 4Y1ZA 3M1HA 1URXA 3UGFA 4OHXA 1IS6A 3I2JA 1TZOA 3N7LA 4QU1A 4JQRA 1YQ2A 1X8MA 1VB4A 1AR71 1PK6A 2TNFA 3I49A 3LEKA 4MGIE 2H6CA 1FI2A 4KWKA 2PQQA 2BWAA 3NQHA 4N90A 5L9VA 2EVXA 4BIOA 1AR91 1SDDB 1MEC2 1SMVA 1WCQA 2FCTA 4XUTA 2V73A 2EXIA 4LMFA 1RXFA 1VBD1 5LEKA 4XTMA 1O91A 1AUYA 1NQJA 3JD73 2QDRA 1ND2A 1V6JA 2JIGA 2WFF2 3W5NA 2A6WA 2GNDA 2HWE3 5BNNB 5JXIA 2RS31 4RFT0 4A41A 2ZMKA 2ZX4A 5FZOA 2GALA 1RVF1 1KGYA 1AHSA 1RUD2 5F5QA 3VDDA 1J84A 4CEWB 3LZZA 3JCIA 3TN93 5LK7B 1XYOA 1QH7A 4L97A 4RS5B 4EYUA 5H9RA 3H3LA 4UWDA 4CPBA 4W50A 4JDMA 2VNGA 5FKCA 2SLIA 1E5IA 1DYOA 5JOYA 2Y8KA 4FPKA 5IVFA 3HQXA 2BPA2 1PX3A 3VKLA 5IK4A 3SMHA 2HWC2 2UY9A 3LDRA 3U75A 5CAZA 3ES1A 4MLOA 4QX5A 5F39A 2UURA 1YFYA 4BLIA 4GKXA 3HR9A 2P1BA 2Q1FA 1VPHA 5IVEA 4CEYC 1W6QA 1F5FA 1LULA 4LKEA 4R52A 4TSVA 1XB9A 2C5DA 3RS6A 2VCBA 2FD8A 1U0AA 3SH3A 1R091 4F83A 1ONAA 1GR3A 3IN9A 1H2LA 3BOPA 4XZUG 4AQTA 2YG0A 3ETQA 4GALA 4R9DA 1SZBA 3P5BA 2ZGTA 3USUA 1IPJA 2C0ZA 2HWF1 3UNPA 3OYWA 1V9U1 4UFHA 3TBDA 1DZTA 4Q4X1 4CXXA 1V70A 4XTPA 1ULDA 1JYXA 3G7DA 2W94A 1H8TB 3D4KA 4Q4V3 2E9QA 3KVBA 1CQ9A 2ZCWA 2F17A 2VW0A 4CU6A 4UW4A 3ZMNA 1NCRC 3HT2A 3J26N 4Q2FA 2NLRA 1HN0A 1FOD1 1P8JA 3QH7A 1ST8A 2WZEA 2C24A 3AXDA 3LFMA 4HKOA 4AI1A 1DLCA 2UU8A 4FFFA 2A1XA 4YM2A 1JHNA 1W90A 2XONA 1X82A 1HQNA 5FP3A 1RHI2 3HD8B 1ZBE3 2F4LA 2EAAA 4WVVA 3SH4A 3W9AA 2VBBA 2WINB 5BV6A 3ZN6A 4OYUA 3GALA 2WKKA 4WBBA 2A75A 1HB3A 4GAZA 3ILFA 1QDCA 3PDQA 5LK5A 2XPJA 2RMU2 4AVBA 4IUGA 1POV3 4LK7A 4CP1A 2WZR2 1KDKA 2ZX3A 4HETA 3DXTA 2WUHA 4MYEA 3ZPOA 2AC1A 1VBA1 2R072 4S2GA 5IAXA 2DTWA 1AZDA 5FXWA 4DOUA 4UT5A 3KHBA 5CZKA 1QJX3 1JBCA 4XUNA 1LOCA 5K7PA 1KDMA 1LB2A 1WMDA 2JDYA 1IS5A 5EV7A 3WDTA 4P9LA 2VBDA 3O1UA 1BBT3 3KCYA 5JR7B 2P4EA 1NCRA 5GZFA 2YGMA 4BYYA 1W8UA 3OYWB 1JZ7A 5LA0A 3I2KA 3WEZA 5FDBA 1IOAA 2BW8A 2Y6FA 5JDBA 3UGGA 1LODA 3ZXAC 2ZPXA 3C7HA 4NIAA 2ZEXA 4B1MA 4FPYA 4GQ7A 3WNNA 5FMCA 5FZMA 3D8CA 2W3JA 4I0BA 2PAEA 1V6OA 3UK9A 3ECQA 3JUUA 3RZZA 4IE4A 1C4RA 1RL3A 1REDA 1QEXA 2RDRA 2W46A 4V1PA 4CUBA 5IT6A 4TN7A 2H6BA 4PI0A 2QQOA 1KS5A 4C8DA 5C70A 2IXJA 1B35C 4PBPA 4N43A 3M3OA 2GZWA 5A70A 3KGZA 4AXOA 4LIUA 3O12A 2JECA 4XF3A 5LBBA 3W20A 4FFGA 2RJLA 4DNYA 4CCJA 2PFWA 3ZR6A 3NV2A 1DQ6A 2XKPA 3JB4C 3WHTA 3O1SA 3E6BA 1N3OA 5FAXA 1UZ0A 2WO2A 1WW5A 4C1XA 3KVAA 4W6YA 4FVVA 1FV3A 4D69A 2WABA 4GJYA 1DGWA 3CKHA 2VE1A 4Y22B 4OLLA 1ND2B 2EXKA 3GCXA 2CGNA 1RUI3 1FPN2 4M01A 1OFNA 1JZ3A 3RZLA 2MHFA 4ISRA 1SPPA 2ZGSA 5K8SA 1AL22 3OG2A 4GWIA 4H55A 5A7OA 4Q29A 5FQ0B 1PO22 2B42B 3A7QA 3I2FA 1ODNA 3QLQA 4QU2A 1Q43A 4DRVA 2QQIA 4Q4V2 4RA0A 4BHPA 5FPUA 5KXCA 2WS93 4WM8B 4QGLA 5BNNC 2XJRA 1U5IA 2VTFA 2O8OA 1VBC1 1O4YA 3VHRA 2PLV1 2LRPA 2BRTA 2ID4A 1ASJ1 1FV2A 3JD71 3WDWA 2Z4FA 2IXHA 3KT4A 3ACGA 3UV9A 4AGVA 4Y1YA 5A7WA 4W8JA 3N3HA 1ENXA 4N43C 5ANNA 3IDEA 1K42A 2DCTA 4J1XA 5DZEA 2PAMA 4Q4Y1 4IXLA 2HWD1 2ZX2A 4EN8B 1PIV2 4LOSA 1GQGA 4AHZA 2EXHA 4MADA 4XURA 3SKJE 4JRAA 2BNNA 2Y6HA 4K40A 4KL1A 2ADDA 2OZ6A 4YG3A 1GYKA 2VZUA 2XVLA 3BTXA 4IGPA 1LAJA 2VBPA 1ZBA2 4OZOA 3JQWA 4YZ5A 4K9SA 3AL5A 1CPMA 3I2OA 4ET7A 3G6JB 4EN6B 5J3UA 4K8FA 1S2EA 2PELA 1YO8A 5FBJA 3WW2A 2JDMA 3TN92 2AYHA 3IM0A 1RC6A 3A21A 3QBQA 3ZSJA 3ILRA 3C3VA 3RYRA 4ASMB 3C8XA 5BUVA 3MPBA 1WBLA 2UYAA 5HCAA 2BP6A 3FFQA 1TMF2 1HB2A 4Q1PA 5FLHA 2BFUS 2RG4A 5AC92 3H42B 3HN1A 2WFF3 2K0GA 2HWF2 4I2OA 1YQ5A 1HXS1 4FPJA 4OUEA 5C6CA 3JD72 3MFCA 3SLIA 2JG8A 4SBVA 3VKOA 1G9AA 3M8LA 1H2MA 1VRBA 1J1LA 1O5LA 2WFPA 3WT3A 3WOGA 3MI8A 4Q4Y2 4B3NA 5C9AA 2PHRA 2ORZA 4RSUA 3NAPB 4AYUA 4HVRA 3RSJA 2QUOA 4AL9A 1VBB2 3TEYA 3WQBA 2PHFA 1BJQA 4Q4W1 2ZZQA 5FO8B 1ZZ9A 1AR81 4IEVA 5F7UA 3AVSA 2VAUA 2ENRA 1DGRN 1W6NB 4I01A 5GALA 1QXPA 1D4M1 2QQUA 3N7KA 5FZKA 4Q27A 3HWJA 3VD3A 5A33B 3Q8AA 4CXYA 1H2NA 3J8F3 3NW4A 1ZA7A 2A6ZA 4LO7A 2VULA 1PGL1 3LE0A 3LAGA 5J7MA 1BEV3 1A78A 1KFUL 1C28A 4IE7A 3UJQA 1J3PA 2WA3A 1IQAA 2B8MA 4O9GA 2AZ5A 5DAVA 3H0OA 4DY5A 4OI4A 1J1TA 4M3CE 5K0UB 1UY3A 4YVWB 1PGSA 3GYDA 2DU1A 5FYZA 4YLZA 4E27A 2WWSA 2MEV3 1SLAA 4NWWA 5EYXA 3ZXLA 5K0UC 3LPGA 1XE0A 5CKQA 1O4ZA 3OPWA 5BNPC 1L7RA 3VZMA 4F3JA 5JI9A 1XSRA 4RGGA 3T2PA 4WZCA 2MPFA 4AHYA 3MGUA 4XXAA 4AHXA 4CDWB 4N8MA 5ABJB 1JZ4A 3D5OA 2WT2A 4YWAA 4FO9A 3N9PA 5JVVA 2B9UA 2A73B 4P9GA 4OFGA 5BXXA 2JKXA 3U0ZA 4CCCA 2QCSB 3WDVA 4FSJA 4HG6B 4MGYE 2YBKA 1JZ5A 4DFSA 5J36A 1ULPA 4KWLA 5DDJ1 1N1TA 1QJFA 2ZEYA 3KS7A 3WF1A 1Q8OA 3MV11 3OEBA 1F35A 1UXZA 2B9VA 1G6NA 1A3KA 1NYWA 2Y6KA 4ZXEA 5DAXA 1JXNA 3WR0A 3ZPYA 4HLTA 1FAYA 1EYBA 1XJAA 2WNEA 4K7JA 4LE4A 3NNFA 1QOOA 2XH6A 3EB7A 2XLFA 4FOYA 4LQRA 1K5MB 1ZBA1 1ZA4A 1XNBA 2R1BA 3MIGA 4K8RB 3BTYA 1RUG3 4PBOA 5IJRA 3L2YA 4HVOA 3HJRA 1CWPA 2Z42A 4BWOA 4RHV1 3I2HA 2GC0A 4IV3A 1DGWX 2VUAA 5K0UA 5CFDA 1PVC1 1YIFA 5FLJA 4FTSA 5IK7A 3MUY1 4V2VA 4ZPIA 3I97A 3AJYA 2J1TA 3KF3A 4NHLA 5EQUA 3SITA 1PO12 3SKVA 5LCWL 3T30A 1OFSA 4NPLA 5F9TA 3DUIA 2JENA 2JDUA 3AM2A 3MO4A 3LWCA 3K4AA 4YARA 4TLGA 2FZ2A 4XZPA 5A33A 1UO9A 2VTXJ 4FXGB 5I93A 1BQPA 1ULCA 1NXD1 2ZACA 4Q0SA 3VBRB 4ORFA 1CAUA 1CIYA 1FX5A 4XBLA 3UL2A 1GU3A 3AMQA 1KQRA 2VH9A 2ZGRA 3K46A 4AEKA 4E4DX 2IFRA 3NNJA 2VD7A 4QQPA 3P3NA 3SC7X 2OQ6A 3BUCA 4RQPB 2CWMA 3LOIA 4UI9L 4RGAA 1ZRRA 4W65A 3AJZA 4OUSA 1J3QA 1GZCA
chains in the Genus database with same CATH topology
4C0BA 1RUD1 4I30A 5E8AA 4AEMA 2WNUB 3NKGA 3POSA 1D4VB 4H14A 2NN8A 4XFBA 1F5JA 1W6MA 3FHIB 4X8PA 4BIFA 2X29A 1SLIA 2ZAAA 3I4IA 4Z07A 2VOKA 4JV4A 1FOD2 2LALA 2D3RA 5BNOC 1IKPA 3KCCA 4WVWA 4LE3A 1NY71 1EAH3 2D5HA 5AFBA 1ALYA 4IEWA 3JB8A 2Z2SB 5FLIA 1OLQA 1PGW2 1RUE2 2A71A 1LCLA 1GNZA 4QPGB 2JEMA 2VMIA 1VBD3 3KGLA 4MXVA 3J4UH 2BUKA 4XIOA 3KB5A 1HDKA 3E5UA 3ZXDA 1YNAA 5C8WA 1PIV3 4LBNA 1KJRA 5GKAC 4CDXC 4PIXA 4CYDA 3QACA 1QXRA 4PLNA 3B00A 1H1MA 1G9CA 3WVJA 1O3QA 2IZWA 3SCHA 2FBEA 1CVNA 1ZRDA 1MVQA 1O4TA 2RJKA 5J98B 3ZSLA 4AEDB 1QJY2 2CV6A 3D0JA 3N4MA 5JWPA 2AENA 3WLUA 1VBB3 1ULGA 5BNOA 4XFCA 1XU1A 4K6BA 2YROA 1RVF2 1RMU1 3AFGA 3ZXJA 2RS12 3KLSA 3RMYA 3LSEA 1QY4A 2KXLA 4FPLA 4CP2A 5DDJ3 5D1IA 1W6PA 4MZUA 3VZOA 1VAKA 2Y0OA 4W6WA 4JVAA 4FPHA 2HWF3 1TQ5A 2DWRA 2B5HA 1RUJ1 4KQ7A 4JRLA 4RR3B 5EWSA 4DY3A 2WS91 2R49A 4UW3A 1EY2A 1MQTB 1AVBA 2E6VA 1TMF3 5I0TA 3AYCA 3M3EA 1V6MA 4FP2A 2VPVA 1YYNA 2D6NA 3I59B 2FQPA 4A3XA 1APNA 1QOTA 2PAKA 1RHI1 1UN1A 1W6PB 1UKGA 2ETEA 3JQXA 4KNCA 4MSVA 3RNSA 5HXVA 2MEV1 2R063 1Y9QA 2A70A 1PNFA 3S6PA 2EF6A 2YGLA 1OA2A 4HBNA 4MH0E 4N7IA 2ZX1A 4LO8A 1YHFA 5I8SA 5BNOB 1FNZA 4X6QB 1EPWA 4HL0A 4L99A 1DFQA 1RGSA 1OPMA 1RMU2 3VN4A 4KWJA 3MIBA 3OBRA 1PZ8A 5FMOS 2ZAHA 4YZ2A 1CONA 1JOJA 3VBOA 1MS4A 2GNTA 3JU9A 4XJ8A 4WZFA 1PM7A 1YFXA 1TME1 3U4XA 4JTOA 4Q26A 2N7GA 4AFBA 3A4UA 2WS92 4LLOA 2D6MA 4LHKA 2NP0A 3IDBB 1AR73 2RMU1 4HPKA 1W39A 5BYNA 3CF6E 5FRAA 3ZIWA 4OZXA 1XYNA 4IEOA 1MS3A 2OZJA 3QH6A 4RHV2 1OSGA 3ZDSA 1FPN1 2XUMA 4YVSB 1XE7A 2ZHKA 2UWBA 1DQ2A 2BGCA 2WNVA 3IWZA 5T5JA 3AKQA 4CTEA 2JG8B 2Q0AA 2VOWA 4DS0A 4XJ9A 4WVZA 3WINE 5GZDA 3H7YA 4IEPA 3VBOC 2WNUA 1C8M1 5KC5A 2D5FA 2LTNA 2ZJCA 4HANA 1V9U3 3FJSA 3OBTA 4JC1A 1RJ8A 1POV0 1Z78A 1ZYBA 4Q0VA 3INAA 1SBDA 1AXYA 1LHVA 4YFZA 2VVEA 3B9IA 1VAVA 4Y4YA 4JGYA 5GLUA 1YJLA 3E5XA 1CAUB 2DCKA 4RHV3 2GNMA 3WHUA 1A8MA 3PVNA 2OIIA 5C33A 2HWB2 2D7FA 4Y1VA 5ACA1 2VVDA 3H9AA 4YSFA 2OYZA 3WCSA 1WCDJ 3NSTA 1TNFA 5A3LA 4E4ZA 1LHNA 4GH4A 2WA4A 4INDA 4XBNA 3R6SA 2XJUA 1NZCA 4EROA 4GMP1 5KBFA 2ZMNA 1I9RA 1LOFA 1UZZA 2WNUC 1LEMA 2R062 5D8AC 2RS33 3FBMA 2CAVA 3CJIA 4XDQA 2ZGLA 2VNOA 4JGYC 2RMU3 3ZYPA 5FQ0A 1ZNPA 2Q8OA 2IC1A 4MX3A 4OHYA 4JGZA 3TOJA 1FATA 3TN91 4CDWA 4BH9A 1REEA 1HV0A 5JI7A 2TEPA 3MIHA 1QWRA 3T1LA 3MZHA 3V0BA 1UIKA 3IT8A 4K20A 4EN0A 2XJTA 4GB31 5FFOC 4FQZA 4HN0A 3RDIA 1A6CA 5JSOA 5CG8A 1Z7S2 3EXUA 1UPIA 5JOZA 5T5OA 1U5XA 2O1QA 4R9CA 3WDUA 1CJPA 4YNIA 4PDWA 5BPXA 3VKFC 4COZA 5GZCA 4Z82A 4IV1A 1LGCA 5DDJ2 4DQAA 1D4M3 1CN1A 4XFFA 1OD5A 1S0CA 2FMYA 1OKQA 3AX4A 2VW2A 4R9AA 4YG0A 4EN7B 3CJIC 3OGJA 2JD4A 3NVCA 2QQPA 2YDEA 3AYEA 1KRIA 4IERA 4SLIA 4EV0A 4GH4B 2QNKA 4IEXA 4LULA 4DMIA 2D6OX 4I0WB 3B7MA 2RS53 4CDWC 1WCSA 2ZGPA 3KMHA 3ZFEB 2EA7A 1PVC2 3IPVB 1Q3EA 4D7YA 4LBQD 3THPA 4XOGA 1C3HA 1WLTA 1RUE3 2ZBJA 2ZABA 1C8NA 5KXEA 3ZFGB 1I1EA 3D0SA 3IDCB 5DUVA 3VBFA 4P9XA 3R0RA 3OPZA 3B9CA 3VZKA 4K3UA 2RHPA 2Q30A 1ND3A 4PDWC 3X29B 1SLCA 4F8AA 3WW3A 5L7OB 4IV1C 2AREA 5DG2A 2BWCA 1LRHA 3PMEA 3I7DA 1ND3B 4PIZA 4AVAA 2C9AA 4XJUA 3HMYA 5JAXA 4ONUA 4HN1A 1FOD3 5H9QA 3VBSA 2GN7A 3I8TA 3ZN6B 1L3JA 3PLQA 2WFF1 3AP6A 1G7YA 1MEC3 2W0XA 3MIDA 4YVSA 1PO11 4A7KA 4CDXB 3IPVA 5FTTC 1XXNA 1HQWA 1H1AA 3AP9A 4XILA 4AG4A 4N53C 2RE9A 4HPKB 3WQ7A 1ZZCA 5C8CC 1H8TA 2JG9B 4Y1XA 4HK9A 1RUF3 1W6OA 1XNCA 5JIUA 4JCKA 5F6KA 1G9FA 1RUG2 4MVTA 3ZPYA 1AL21 2HWD3 4KG0A 4XMIA 4Y1UA 3E6CC 3UKVA 4GWNA 3ROUA 3ZN5A 1KXGA 1N1SA 5CB7A 3NWKA 1AR61 4IEYA 4H7LA 2OW4A 4YGCA 1VBC2 1YUDA 4NWVA 4YVSC 4LO5B 3HBZA 5CA6A 2O8QA 4P9JA 2A3XA 2VOVA 1BCXA 1AYM2 1F9KA 3MPPG 2ES3A 3APBA 4NO4A 4RS5A 1DGLA 1R093 2JE7A 1I6XA 1S0BA 3GBFA 4J6GA 2ZKLA 1H1IA 1ZZ7A 5I8YA 2A3WA 1C57A 1DLLA 3SCFA 1OQEA 3PJQA 1LOAA 5B2GB 4ZXKA 2NMOA 3VBUC 4PIYA 1U5ZA 5JLVA 1AYN3 4U36A 1ZX5A 1HLCA 1YCIA 4N9HA 4I09A 2GNBA 2DCZA 2IWGB 4COVA 1GZWB 5J09A 4R9BA 1DQ4A 4YZ1A 2MEV2 1I5ZA 2DURA 4ZKTB 2HEVF 2NPIA 1IS3A 3DV8A 3OD0A 3V65A 1PK6B 1RUH3 4AEDA 1GZCA 4XQ4A 1DU3D 1X36A 2WLPA 2YMZA 3L2HA 3FUQA 1RUH1 4XF9A 5DXDA 1OA4A 2BEOA 4LA3A 3M3CA 2DCJA 5KC6A 3VBHA 4YW4A 1ENQA 1E57A 2D43A 4LO4B 3LA7A 1S0FA 4B7EA 2Z79A 1RUF1 2F6BA 3KM5A 3VLBB 4R8HA 5HCBA 3UKTA 3KSCA 1N47A 4QPIC 3FWEA 4QPYA 2ZGOA 1IPKA 1RUC1 1O7FA 1CX4A 3NJZA 1Z0HA 2NMNA 3ZO0B 1WLWA 2WSVA 4YVWC 4AVTA 1HW5A 1Q5OA 1CAXA 3ZVXA 4L92A 1IS4A 1LHUA 2DUOA 1EV11 4RQPC 4COWA 3IIAA 4WM8C 1QJU3 1H4GA 4CDQC 1W6MB 1S0IA 1XYPA 3BTAA 5F6LB 4AI8A 1XNKA 2XBO3 4DB5A 3ZYJB 1AR93 4KH9A 3ZFGA 1KJLA 1KFXL 3ZSKA 2D6KA 4FBFA 4XYXA 4AVSA 4CDUC 3ACLA 3B5LB 2XJQA 1GKBA 5BNQA 3CU7A 1PVC3 4MGKE 2OA2A 2JXAA 4GB32 5GLWA 5CVRA 4FCAA 5IK5A 2B39A 1K5MC 1DF0A 4P9YA 1N1YA 5CFCA 2CYFA 4AQ6A 3WQ1A 1PO23 4IV1B 3ZYRA 4RD7A 2K9ZA 4HKLA 4KGGA 3AZZA 1LOEA 3A0KA 2DF7A 1R083 4GMP3 3ZSEA 1FPN3 4URTA 4BM8A 4CEYB 2P3IA 3ILNA 5J7MA 1PGL1 5I8TA 1LHWA 1JUIA 5TSWA 3I59A 2E63A 3AKRA 3VDDB 5A32A 2V09A 4LR4A 4YRDA 2A6YA 3OGGA 3RWNA 1VRH2 3SNMA 4AGRA 4ATEA 1AL0G 2G9FA 3ZFEC 5SV8A 4CDUA 1NA1C 1RUI2 4YM0A 1DQ1A 4IETA 4BCUA 5BNPB 3O0XA 4PJYA 1ASJ2 5F1RA 2LUWA 1SLTA 3QOPA 2WQZC 4NPRA 2YV8A 1W2UA 2DFCA 1KITA 1ENRA 5ABJA 5FO7B 3ZFFA 1YFUA 4MUVA 1MR5A 3CJIB 4C1WA 1DIWA 1OQDA 3UJOA 4LO6B 4FPEA 2RS32 1OLRA 2DUPA 2XKOA 2QDNA 1AYM1 1EV13 2UY8A 3FMGA 3ALQA 3K48A 1LGBA 2W39A 1ZBE1 4P9IA 3UKNA 4LA2A 4DPNA 4YW3A 1ND2C 1LKNA 4LBJA 1D2QA 1BBT2 2VU9A 4LLFA 5DG1A 4C0HA 1S55A 3GZUC 4UW6A 4B4RA 3L9JT 4Q1RA 4AGGA 2HWC1 3AMNA 1TE1B 1RINA 1EV12 3PVEA 2JICA 4BMEA 4QPGA 5I0SA 1DZQA 2BTVC 3BPZA 4FPGA 3ES4A 4JGYB 4JTNA 4B4QA 5ABJC 2XJPA 2DVFA 3ZFFC 3GBGA 2WT0A 3S7IA 1DBNA 1C1FA 3MDPA 1QJX2 3VHPA 2WZPP 3MF6A 4XFGA 1V9U2 2VECA 1VIWB 2R16A 2WNVB 2WZR3 1QHDA 1UKRA 3NL1A 3ZXGA 4C90A 1AR62 4P14A 2AR6A 5T55A 1VRH3 3RJ2X 4COUA 1UW8A 1ZBE2 2WIIB 2D44A 1RHI3 1AYN1 3USSA 1KD7A 1WMFA 1VP6A 2EIGA 2DYCA 2A3YA 2GAUA 3AKTA 1NG0A 1ZZ8A 2XHKA 3OTFA 2QFEA 4GMP0 4GXLA 2RR13 3H1YA 1QF3A 4M00A 2RS13 2W08A 1AXZA 3GHMA 3AYDA 4OHVA 1GBGA 1HKDA 1MQTC 1OQ1A 3LB9A 1H9WA 5C4WB 1QJY3 5CFDB 1RB8G 3IKWA 3VZNA 4YGBA 2R0FA 4GB33 1RUI1 5HI0A 3FE5A 1S2BA 2GMPA 3M7AA 3PVOA 1LOGA 4OHWA 1NCQB 3WNXA 1CIWA 4QQ2A 4NVPA 3HT1A 4COYA 1YI7A 4KU7A 1RUC3 2BVVA 3PHMA 1AR92 1RUD3 1RUG1 2HKXA 1XE8A 1HRI2 3V0AB 1VBD2 2ZGMA 2BFUL 3KD4A 1S1AA 2PHUA 2P37A 3BIWE 2R041 4QM9A 5KHHA 3M3QA 4BQ1A 3A0NA 5H9SA 5CU1A 1MQTA 3R05A 3PMSA 1SACA 2IXIA 2FZ1A 1WD4A 5D8AB 3FFZA 2HWE2 5AVPA 1GNHA 5JZGB 4CEYA 4GIQA 2GMEA 1ZZ6A 2VMGA 1GLHA 4L11A 4DRRA 2PN5A 2WZR1 1MVEA 1RIRA 1WBFA 3GNEA 2DV9A 5CFCB 3RYKA 4YM3A 4K1ZA 1FMD1 3RQ0A 4QHBA 5J96B 3W58A 1O3TA 3ATGA 1O3SA 2A6XA 1COV3 1QJX1 1G9DA 1S0JA 3EO6A 3WZ1A 4B8EA 3DL3A 1TNRA 1PO21 1R1ZA 1MS9A 3P3PA 1PO13 4L8QA 3IMNA 2GDFA 2YY1A 4XETA 1QJY1 1WD3A 1QXJA 5C9AB 5LEJA 1YXWA 4D3WA 1NCRB 4EWEA 5JSPA 5KHIA 1OMIA 3TYJA 2DTYA 1WA4A 1AYN2 1GQHA 4XF0A 2VQ0A 1BMV2 1GANA 1C5HA 4AVCA 3S0MA 5E88A 3URFA 1V6KA 1LESA 3MICA 2A7AA 2P3KA 1AXKA 1BBT1 2WLQA 1EAH2 1YWKA 2D93A 4A2UA 1B09A 1RUJ2 3VL9A 4BPZA 1WCKA 4KBBA 1BMV1 2G4IA 3ZYIB 1HXS3 1PGL2 2OVUA 4FP3A 4EWAA 3H3UA 2ZA9A 4XQWA 4XJZA 3KZ4C 4R4ZA 2GSYA 4XFHA 1DZRA 2YZ4A 1U12A 2KM2A 4IESA 3VHOA 4LHNA 5FBZA 2VQAA 1AR83 2WL1A 3AKPA 4AW7A 1QQP3 1FYUA 2XWJB 2IXCA 3VBHB 4AF9A 4ASLA 3VBRA 2WT1A 2XJVA 4JDOA 4I02A 3VKNA 2RM21 2AH2A 3EBRA 1RUC2 4Y24A 4TZDA 3VUOA 2PLV2 4PF5A 4GA9A 3I2DA 1UU6A 3H8UA 4H3WA 1GZWA 2ARBA 1D2SA 1B35A 4IV3B 5FPZA 1X8EA 5GLTA 3ZYGA 1W6QB 2W68A 4K21A 1QKQA 4BMBA 2OUHA 2RM22 4FPOB 3BOWA 4D94A 3TWIA 1QQP1 1YRZA 1IHMA 3JBG2 5T3NA 1UF2C 2DFBA 2JG9C 2X53S 4XHBA 2XVGA 5FREA 1LEDA 2PYTA 4HFSA 4XHXA 3KT7A 2ZGNA 3H7JA 3R4UA 5CADA 3B69A 5EJ3A 1CAVA 4P9WA 4CEWA 2W52A 3VBRC 1YFWA 3ZSMA 3AMMA 3WW4A 3DF0A 5AC93 1ULEA 5LRRA 4Z92B 5BNNA 4QMAA 2XVKA 1DHKB 4IEUA 2TUNA 4MGZE 4M3CF 4P5HA 3T2TA 4BLJA 3AMPA 1JUHA 4E2GA 1ZM1A 2X5IB 3Q9OA 3U11A 5K9YA 4Q4V1 5FMOL 2UWCA 5IK8A 2VUJA 4UBGA 4XFIA 5BNPA 2ERFA 2XL7A 4J1WA 5HBAA 1MS0A 1O5UA 2WC2A 4LTAA 4Q4W3 3TNPB 3S7EA 5A3MA 2JG9A 4I0AA 4B7KA 5H9PA 3WW1A 4GKYA 3ZIXA 1BEV2 1R1A1 5A32B 1G9BA 1EAH1 4H7MA 4CEWC 1Q56A 5DUXA 3AP4A 4HMZA 4IEZA 3AZWA 1Y3TA 1UU5A 2XLGA 1H2KA 1D4M2 4QQLA 2A5ZA 4YW1A 1AF9A 1H0BA 2CAUA 3J8F1 3WX5A 1UU4A 4AVVA 3EHKA 2FHRA 3TNQA 2R061 4QQOA 1Z7S3 4Y20A 2D40A 3E6DA 4WV8A 4Q4Y3 3CO2A 3M3IA 2JG8C 4FQ4A 1OOPB 2D3PA 2DVAA 4BOWA 4IV3C 5EYYA 4M0HA 2HJIA 1HV1A 2D98A 1WW6A 2ZGKA 3FC0A 5C9AC 1PZ7A 5L7OA 4Y26A 3WDXA 3M4FA 1X7NA 1WGPA 3WY6A 1SDWA 1YJKA 2JJ6A 1PMIA 3VBFB 2HYKA 4ES9A 2ZHMA 3D6EA 4LBKA 2BNOA 2R042 1Z7S1 3MIEA 2XWBB 2ET7A 1H4HA 3DKWA 4MXWB 4WVMB 1LJ7A 3SHRA 1NXMA 1ZBA3 2VXRA 3EQEA 5JPNB 1MZEA 5GZEA 2YHJA 1ZRFA 3QCWA 1VAMA 3VGIA 4HVQA 1LENA 1WUVA 3LSDA 2DUQA 1J59A 5L19A 4Q8LA 1R082 3BB6A 3N36A 3THTA 1N3QA 3ELNA 5L7OC 1LOBA 3LKJA 2Q1MA 3FUOA 4PDWB 1PVXA 1PHMA 3GBWA 1G8WA 2PHLA 1V6IA 2Z5WA 1BK1A 3MW3A 1SBEA 2G9GA 1AL23 4NR1A 1QDOA 1CAWB 2ZZJA 2UWAA 1M4WA 4DINB 3H3ZA 3MFAA 4JGZB 1J58A 4G9SB 1MZ6A 3WG4A 1SLBA 2E53A 3MW4A 2BNMA 3J9SA 1BVP1 2XBO2 4FOQA 5L36A 1UPSA 3E97A 5DUUA 3H50A 2XGXA 5E16A 5CFDC 1QJU2 4YW5A 4TYSA 1YLLA 3NV4A 1VR3A 1MS1A 3NKTA 1POV1 4YZ3A 2BVBA 3KT1A 3OJBA 4AHWA 3ASIA 4FAHA 2R071 1SCRA 5JPMB 2DVBA 5T5PA 4FOWA 2IXKA 2PHWA 1DGRA 5AVAA 3M2MA 3IBMA 1WW7A 3AK0A 4HZFA 1CAWA 1GICA 2CGOA 3WUCA 2BYVE 3MLJA 4TWTA 3AB0A 5DZGA 3VKMA 3LA2A 4AWDA 4Z2WA 3H1WA 2I74A 4LEJA 3WDYA 4A7YA 3O0WA 4ZU4A 2WJSA 4YM1A 2HWC3 4LBQA 3K51A 3ME2A 4EN9B 1RUH2 4A7ZA 5EXOA 4QGNA 4AI0A 4YGEA 2CTVA 1RUOA 3HIFA 2R073 3D82A 1BYHA 3B02A 2JDZA 1ZREA 4XIKA 4U2AA 2ZGQA 3RI8A 1S2KA 1OA3A 2K2SA 4XPVA 3I54A 3AKSA 3RI9A 1C8M3 4WVMA 1G86A 3GF6A 4Q4X3 4FAGA 4CDXA 3GZTB 4S2HA 3ZXEA 1F31A 1GZ9A 3DN7A 3WD5A 1PGW1 5EZWA 4N9IA 1VBA2 2ZMLA 3N7JA 2GMMA 1KS4A 4I3GA 3VBSB 3BCWA 2X8KA 1UX6A 2Y38A 1XU2A 1RVF3 2XJSA 2P34A 1U5YA 3USUB 5CBLA 2H0VA 4RR3C 3B3QE 1IGOA 5I91A 2SBAA 3BODA 4JDNA 3VBOB 4TLFA 4LBQB 4E9KA 3CEWA 3JBG3 4HKWA 2WSUA 1IZ3A 2ARXA 1FMD2 1JW6A 2RM23 2OPKA 5HCFA 1BKZA 2VOXA 4PQ9A 4EWDA 5T5LA 1S0DA 4KG8A 1QH6A 2Y0IA 1CR7A 2WQ4A 3W59A 2HWD2 1V6NA 2YXSA 3V64A 1AJKA 3AP7A 5SV5A 2HWE1 3MIFA 1COV2 1M06G 1J3RA 3AFKA 2MNGA 1MZ5A 1N1VA 1T6GC 4CP0A 3HAGA 3MW2A 3RPQA 4IEQA 1D0HA 2YYOA 2QVSB 2VGDA 3DPRB