2XLAA

Structure and metal-loading of a soluble periplasm cupro-protein: cu- cuca-closed
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
233
structure length
233
Chain Sequence
b'HTFDDIPMPKLADPLLIYTPANEIFDIASCSAKDIGFAIAHAQIPPGGGPMPHIHYFINEWFWTPEGGIELFHSTKQYPNMDELPVVGGAGRGDLYSIQSEPKQLIYSPNHYMHGFVNPTDKTLPIVFVWMRNEVAPDFPYHDGGMREYFQAVGPRITDLNNLPELTNAQRAAFASEAPKYGINQSSYFMEYVNTISDKLPAQIAKLKNDKDLERMVEVIEAFNRGDKSVTCS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SLL1785 PROTEIN
publication title Structure and Metal Loading of a Soluble Periplasm Cuproprotein.
pubmed doi rcsb
source organism Synechocystis sp. pcc 6803
molecule tags Metal binding protein
total genus 63
structure length 233
sequence length 233
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-07-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2xlaA00
4I0BA 1ZZ7A 3KGZA 4HSLA 3WW3A 5HI0A 5FPXA 4D7TA 5JSPA 5KHHA 4BHPA 4KWLA 4JTNA 2PAKA 3E5XA 4UBHA 1CX4A 3OD0A 3QOPA 1ZRCA 3DN7A 1CAVB 1SFNA 4ZU5A 1RL3A 5D1IA 4LA2A 1J1LA 2HJIA 4IEYA 2B9UA 1GQGA 3MYXA 1O3QA 3D0SA 3N4MA 4MGYE 5EZWA 3NSTA 1ZX5A 4MGKE 2MPFA 2WC2A 4MGIE 1YFYA 1ZRDA 1Y3TA 1UPIA 4HVOA 4META 3PNAA 1CAUB 4Q0QA 3H50A 3M70A 2IXKA 3O14A 1ZRRA 4I0AA 2IXLA 4EROA 4IEWA 4H7LA 3LA7A 4IETA 3EQEA 5CVRA 2XLFA 1CGPA 4AXOA 3CO2A 1V70A 2I45A 4TLFA 4XFIA 3D0JA 3RYPA 4XFGA 2DCTA 4IEZA 1I6XA 3JZVA 4UBGA 4AVBA 1QXRA 5I0RA 2VPVA 3KSCA 4O9GA 2ET7A 1J3QA 4AQ2A 3ELNA 4Z07A 5BUVA 1J59A 1Q43A 4Q0UA 4XF4A 3IWZA 3C3VA 3BALA 4L2NA 4MZUA 5FLJA 5J3UA 1HW5A 1O4TA 3H1MA 4YYOA 3WW4A 5C6CA 2XKOA 2EAAA 4FAHA 4IEUA 2PAMA 1ZRFA 4BIFA 3WW2A 1XE8A 3GBFA 3L2HA 3SCFA 4A2UA 4EV0A 1LB2A 1YHFA 4XFAA 3I7DA 3RDIA 4F8AA 5KHJA 2HKXA 4QMAA 4AVAA 5CU1A 4HSJA 3PVBB 3FJSA 1ZZ8A 3ZDSA 2PHLA 4MGZE 1SQ4A 1VR3A 4IEXA 1ZZCA 2IXJA 1XRUA 1O5UA 4K8FA 4LTAA 3HT1A 3H1YA 4LEJA 2P17A 4UXAA 4MUVA 4WBBA 1FI2A 1ZREA 3U0ZA 4QGMA 5AVPA 3I59A 5JSOA 3HQXA 3LA3A 3M3IA 1J58A 2H6BA 4N9HA 4R52A 4QX5A 4QM8A 5JAXA 3CEWA 3VHRA 3LOIA 5LRSA 2OPKA 3SCHA 1PMIA 5I8TA 4QM9A 4OFGA 1SEFA 5J7MA 1NE4A 5LEJA 2Q30A 3ROUA 4XF3A 4LUMA 2B8MA 3TNQA 3NJZA 3EO6A 1CAXA 4ORFA 4I01A 4JV4A 5E16A 1L3JA 1X82A 3FHIB 3OCPA 1ZZBA 3HIFA 4HN0A 1H1IA 1VJ2A 5LRRA 2PTMA 1OFNA 2XGXA 2EA7A 2VQAA 2CAUA 1X7NA 3IIAA 2UY9A 4QXKA 4AVCA 2QJVA 4IEVA 2K9ZA 4KU8A 1LRHA 1O3SA 4B29A 5I0SA 4YARA 1UD1A 3E5QA 3KMHA 5BXXA 1RC6A 4LUKA 4PJYA 3DV8A 4RD7A 1UIJA 3FE5A 3SCGA 3WW1A 1QY4A 3EBRA 2PYTA 1OD5A 4ZU4A 1UIKA 3RPQA 2Q4SA 2B5HA 4Q0VA 3TNPB 5CADA 3UKTA 1QXJA 4FAGA 4QGLA 3H7JA 4J1XA 2QDRA 4PIXA 1XE7A 4IERA 5FPZA 5KHGA 4F7ZA 5FLIA 4MX3A 1DZRA 4CYDA 3UKNA 1EY2A 1ZVFA 3MPBA 1UW8A 4HVRA 3OF1A 1ZNPA 3D82A 2FQPA 3BPZA 1CAWB 1DGWA 4WZCA 1LR5A 4D7SA 2D40A 5KHIA 1ZZ9A 2XKPA 5KHKA 3CLPA 4KL1A 4YNIA 5BY5A 4XFFA 3I59B 3H3UA 2OA2A 4HLTA 2ET1A 1WA4A 4LULA 3ETQA 2UYAA 4E2GA 2ETEA 1U12A 4IEOA 4FBFA 1G6NA 3NL1A 3PLQA 3FWEA 2Y0OA 3U10A 2PAEA 1O3RA 4J1WA 4YSFA 2XLAA 3CL1A 2ZKLA 3EHKA 4LLOA 3ST7A 1EPZA 4E2QA 3FFQA 2QNKA 3H1WA 4I2OA 2EVXA 2Z2SB 3MZHA 1NE6A 4XFCA 2WFPA 1CAWA 2IXHA 1CAXB 4X6QB 3SMHA 4YRDA 2F4PA 1Y9QA 4GULA 5JCTA 1TQ5A 3FZ3A 4XF9A 4XFBA 1I5ZA 1NXMA 3B02A 4BYYA 1O3TA 3E6CC 3H3ZA 3DL3A 1EP0A 3U11A 4IEPA 4Z82A 3R6SA 3SXWA 2IXIA 2H0VA 1Q3EA 2XL7A 2GZWA 4WVZA 3E6BA 4ONUA 1J3PA 5T3NA 1H1MA 2Z69A 1QWRA 2UYBA 4KWJA 4EWDA 5FQ0A 3OTFA 1X8EA 3S0MA 1FXZA 2D93A 3LWCA 4HMZA 2CAVA 3H7YA 1RTVA 2K0GA 3E5UA 3NKTA 3LAGA 2PFWA 2GH2A 5BV6A 1FT9A 3G7DA 1RGSA 4NVPA 2O8QA 3ACLA 5I93A 1WGPA 1YFWA 2O1QA 5BPXA 4N9IA 1JUHA 3NVCA 1Q5OA 4LA3A 1YFXA 5J48A 3HT2A 2BGCA 3H9AA 2BEOA 3OGJA 4L11A 2OZ6A 1OMIA 2PQQA 3NW4A 2ATFA 3BCWA 1X8MA 5KBFA 3I54A 2D5HA 2GC3A 2GU9A 3KCCA 4HZFA 4AQ6A 4EWAA 4ZU7A 1YLLA 3BU7A 5FDBA 4MV2A 2IXCA 2MNGA 3CF6E 4IESA 4HN1A 3RZZA 4PIZA 3ES1A 4MH0E 2KXLA 2GC1A 4JVAA 2CGPA 3MDPA 1NZCA 3SHRA 1WLTA 1DGRA 1RUOA 1J3RA 2BYVE 1DZTA 1CAVA 4IEQA 2XHKA 2Q0AA 2GC2A 4Q29A 2OYZA 1ZZ6A 1OI6A 2C0ZA 2GC0A 1YWKA 3KGLA 4KU7A 5FCCA 2PHDA 4DINB 2QCSB 4QGNA 4XFHA 2BNOA 5I91A 1UCXA 1PM7A 3RYKA 1CAUA 2PA7A 4EWEA 2N7GA 4HVQA 3E6DA 4R8HA 3IDCB 4I09A 3IDBB 4Q0SA 3DKWA 1IPJA 3QACA 3IBMA 4PIYA 2MHFA 5I0UA 4Q0PA 4BH9A 3S7EA 5F1RA 2D5FA 5FQ0B 3RYRA 1IPKA 3ES4A 4E2SA 4OLLA 5K8SA 5FLHA 3EJKA 4FT8A 3USSA 5LEKA 2Q1ZB 2VECA 1NYWA 4I3PA 4X6RB 4XF1A 5E1RA 2FMYA 1GQHA 1VP6A 1YFUA 3CJXA 3LZZA 2UY8A 2H6CA 1YUDA 2BNNA 2E9QA 5JR7B 4HBNA 2QVSB 4XETA 5I0TA 5JSRA 2CV6A 4XF0A 3S7IA 3FX3A 2BNMA 3H8UA 4XEZA 5EFUA 3BB6A 5C8WA 2XLGA 1O5LA 3RNSA 2ZCWA 3GYDA 1RUNA 2XL9A 4O9EA 3LA2A 5I8YA 4JTOA 1LKNA 5I8SA 4P9GA 2V09A 3E97A 2GAUA 2IC1A 2OZJA 1EYBA 1O7FA 4KWKA 3UKVA 4I02A
chains in the Genus database with same CATH superfamily
1W0PA 3AP7A 1CD3G 1OHFA 4MHUA 3KT4A 3JBG3 5BNNC 1S2BA 1VBB1 4I0BA 1ZZ7A 3ZFGA 3WW3A 5FPXA 2OQ6A 3M7AA 5C9AA 2Q8DA 4LBLA 1V9U2 4E4ZA 3UNPA 1YJLA 5FY5A 1MACA 1U5YA 2JG9B 2R061 4L97A 3VZLA 2RS52 3AJYA 4ES9A 2ZEWA 1LJ7A 1K42A 1YC61 1SFNA 5FZAA 5GLUA 3BOWA 4DEVA 1RL3A 1IS4A 4LA2A 5D1IA 2DF7A 5ERLA 3T3YA 1QOSA 4ASMB 1CWPA 3AXEA 1ASJ1 4RN5A 1QU0A 3JQXA 3HQRA 2GNBA 2X09A 5D8AA 2A6YA 2ZGKA 1K5MB 1BEV2 4MGKE 2WLPA 3R4DB 4A41A 1MZEA 1X36A 3QH7A 4DFSA 1QXPA 1Y3TA 5JOWA 1UPIA 3CJIA 4HVOA 2DBIA 3Q9OA 3QLQA 4Q0QA 3H50A 4DO0A 1BYHA 1CQ9A 3WDWA 4I0AA 2HYKA 1UMZA 3VBHA 5FZ4A 2XUEA 4CXWA 1U5ZA 3VBFB 1VBB2 3K3OA 3LA7A 1HQWA 5CVRA 1DQ5A 5F9TA 3CHXA 4PF5A 4JC1A 4IV1B 3CO2A 1V70A 3BODA 3NNMA 4M0NA 2R071 1X33A 2R062 3DCQA 2FDHA 5LB6A 2NZ9A 3POBA 2LTNA 5DUVA 2HLEA 3RYPA 4XFGA 4IEZA 1WCUA 3BTZA 3WT3A 1OPOA 1QXRA 3N7KA 1C5HA 3BI3A 3KSCA 3AYDA 1LOFA 2VM9A 2XBO3 5C5UA 4CEYA 4Y33A 5FWEA 5A80A 4XF4A 4BLJA 3A23A 1QJX1 4C1XA 5E8AA 1VBD1 5G04L 4DUVA 5FLJA 1O4TA 1XNBA 3Q8AA 1C8NA 5C6CA 4MO3M 4DMIA 3TWIA 1RUF1 2XKOA 3KF5A 4CE8A 5C3SA 4FAHA 5A33A 5CA6A 1CZTA 3FLRA 1PX3A 2QDNA 4N53A 5EQUA 4BQ4A 3IAPA 4FPKA 2YU2A 3I2IA 1RXGA 5J36A 4BIFA 3WZ1A 3L2HA 4XABA 5H9RA 3SCFA 2VGDA 4JGZB 1YCIA 1CPMA 1W2NA 2FMDA 2R072 1YHFA 4UFMA 2WINB 4GMP3 3I7DA 3U14A 3CQOA 3T2PA 4HK9A 3WNPA 2ZOEB 3J4UH 1SPPB 4Q1RA 3ZN6A 5KHJA 3VZOA 4YM3A 5CU1A 4HSJA 3FJSA 2ZGOA 1A34A 4QQHA 4LBMA 1SQ4A 1APNA 2K2SA 4W4ZA 3C7GA 1VMJA 1O5UA 3SEPA 2Y6JA 4NHKA 4LTAA 5DZGA 2RM23 1QJX2 3H1YA 2WZPP 5BNNA 1VBD2 2VC9A 4LEJA 1YQ6A 4UXAA 3VDDB 1FI2A 2D43A 1OUXA 1G9CA 3U78A 5L9VA 2B42B 4RQPB 4YZ1A 4QGMA 1OQ1A 4AI1A 1RUF2 1FOD3 3CBNA 3J7MA 5GLZA 3O0WA 4Q4Y3 2EIGA 2P4EA 1S2EA 3M3IA 4LT5A 3M2MA 2BERA 3MO4A 4QX5A 3ZXKA 4XUTA 3WNOA 4CDQC 1MEC3 4JDOA 1QJY3 2A71A 3ZX7A 5LRSA 2BPA2 1SMVA 4QD2A 3SCHA 2Y0IA 1PMIA 4AG4A 1NZIA 4RFRB 3ZR5A 1ZYBA 1QDCA 1SEFA 5LWBA 1BVVA 3SQOA 2R043 5ANNA 2YYOA 3JQWA 5JOYA 4RHV3 3PIGA 3ZO0B 5ACA1 2E33A 4FPCA 3LSDA 3NJZA 1Y7BA 2NQYA 3ZSMA 3AMNA 4K9SA 1JYWA 3THDA 1L3JA 3T4HB 2Z79A 1ZZBA 1WMFA 5KXCA 1H1IA 3PJQA 5HV0A 5DDJ3 1ULFA 2VZQA 1JH5A 2WFF1 2PTMA 3DYMA 4E4SA 3OUJA 4A7KA 5CKMA 3A4UA 4FPOB 1M4WA 3VD3A 1UMIA 4FVVA 3ZKUA 5A1LA 2QJVA 1Q56A 2UWCA 4IEVA 4IGQA 4PQQA 4DXRA 1B35A 3ZM8A 5IHRA 1AYM3 4LQRA 1E57A 2RR11 4Q4W1 1F9KA 4NAMA 4KBBA 1RJ7A 2BGPA 3RMYA 4CCCA 2V5DA 5IVBA 1UQXA 4LK6A 3MLJA 1W6OB 4YARA 1W9TA 3PVOA 3SEEA 3RVHA 3E5QA 2GALA 3KMHA 2FCTA 5IVCA 2NLRA 4GH4C 1Z78A 5J09A 4LUKA 2Q1MA 4NIGA 4AQTA 5FZBA 2QQVA 1UIJA 5ACA2 3FE5A 1XE0A 5GZEA 3SCGA 1FAYA 1DGWX 5FY4A 1YI9A 1QY4A 3UYJA 4NE9A 4CU8A 2FZ2A 4NJ4A 2AYHA 2Q8EA 1UOGA 3VGIA 3UESA 2X05A 1JS9A 4MLOA 2XWJB 1UIKA 1KXGA 5CADA 2QQUA 4YW4A 2DU1A 1W0NA 4AI2A 2LM3A 2AEYA 2IVJA 2WFF2 3N9OA 1OOPA 3UJQA 3T2OA 5GZCA 4PIXA 5EJ3A 2PQSA 1IS3A 1XE7A 5FY0A 5KHGA 4F7ZA 1DF0A 4PI2A 4KI5M 4FTSA 3A22A 4RQPC 1DZRA 2AC1A 2V72A 4Q4W2 2RR12 2V4AA 1M06G 2VAUA 4OHZA 1EY2A 1RUH2 1ZVFA 2D6PA 3OF1A 2JE7A 1S0DA 3MIHA 1UOBA 3PMEA 3NAPC 1VMFA 5FYVA 1HB1A 4HK8A 1R1A3 4AVVA 1AR81 4PQ9A 4D7SA 3BN6A 3RI9A 1ODMA 3T0DA 4KL1A 1RXFA 5BY5A 3MPPG 1UU4A 1AHSA 1RUC1 1W9FA 4WM8B 3AP4A 4XFFA 4CCEA 1V6LA 3I49A 2WA4A 5FPAA 4CPBD 4LULA 1QJZA 2Y38A 3ETQA 3POWA 1PVC1 2UYAA 5JOZA 4JZRA 3VD7A 2JDAA 2P6HA 3EB7A 5FPBA 3TAYA 1EUTA 2VBPA 5L7OC 1G6NA 5IJRA 2ZGMA 2CDPA 3O7OA 1AYN3 4CDQA 1PK6C 2D6OX 3D6EA 5FZOA 2XLAA 5KC6A 3IIIA 4H14A 5FZ9A 5H9QA 4Q8LA 3KS7A 4MXWA 1VAVA 2D44A 2VG9A 1E5HA 1HRV3 1NE6A 1PMJX 1MZ5A 1RB8G 1HJGA 5LBBA 3X29B 2W0XA 4X6QB 1UF2C 3SMHA 2JD9A 2YC0A 4YRDA 4D8MA 1AR82 3AJZA 4R4ZA 3RJRA 2HEWF 3W21A 1NXMA 4P9LA 4EZHA 4CRQA 1RUC2 4QHBA 3APBA 2CSGA 2X5IB 2ZEXA 3GBWA 1AR91 1IS6A 1PVC2 4K6BA 4Y1XA 3U11A 3UGHA 4AVSA 1W05A 3N7MA 4Z82A 4K7JA 1F2NA 1AL21 4B8EA 2VH9A 1COV1 1RUG3 1UZWA 4WVZA 5IWFA 3SH4A 1SFYA 4ONUA 3DPRB 5FMOS 4CCOA 5F6LB 4ARXA 2Z69A 1QWRA 1HXS3 1N1TA 1XOYA 4P9JA 4RGGA 4B3NA 4CP2A 5HBAA 2QBXA 3T1LA 3FHAA 5EXOA 3OSDA 4OZOA 3S0MA 1VALA 3OPTA 2D93A 3S6PA 4P9WA 1SCSA 2CAVA 1G9DA 1B09A 4QAWA 1RTVA 2D3PA 3CDZB 3NNGA 2G1MA 3E5UA 3HJRA 4UAPA 2C1FA 4LBKA 1GNYA 5K0UB 2PFWA 2UU8A 3JB8A 5KC5A 1LECA 2F4LA 5FP3A 4C0HA 2JX9A 5FZ6A 5EHDA 4AAPA 5FBZA 3G7DA 4NRPA 2JE9A 1RGSA 4BXSV 1IKQA 3ASIA 2ZTNA 1WZXA 4Q4V3 1WGPA 3D4KA 2O1QA 4XXAA 5EJZB 1W28A 3H0OA 3IT8A 1NG0A 4CCLA 2RVAA 5BPXA 3ILNA 4GB31 4MGTA 1JUHA 4LBOA 2BZDA 2NMOA 4N7IA 2WUHA 4YVSB 1XYPA 3WP4A 4Y20B 3NVCA 1AL22 4XZUG 4S2HA 4LA3A 1COV2 1EAH2 3IDEA 1E5RA 2XWBB 3HT2A 4RGAA 4WM8C 1K45A 5FV3A 3IMNA 3BTAA 1VBE1 2BGCA 1JOPA 1SDWA 5HPOA 5H9PA 3ZMOA 2YXSA 2YZ4A 4LHNA 4L11A 3POYA 3NAPA 2WS91 1PVXA 3WG4A 4XMAA 4QPYA 2PQQA 4JQRA 1PGW1 3NW4A 2SLIA 1RHI1 1N1SA 3TN93 2GP5A 2LALA 1ZBE1 3K51A 2W91A 2JG8C 5KBFA 3BTXA 5FK7A 2D5HA 1GWKA 5LBEA 1NOVA 1S0FA 1CIYA 1H0BA 2G9ZA 4IE6A 2W68A 2VMEA 4UW4A 2MNGA 4AGGA 2G4IA 4EE2A 1RUD2 1G7YA 4O7XA 5FXZA 3VBOB 4CU7A 1ODNA 4QX8A 4ZHNA 2BV4A 1PK6A 2R30A 4GKYA 5A32A 3O1SA 1AJOA 5A7WB 4GB32 3RSJA 4JVAA 2X8KA 2VZ1A 4ATEA 1AR73 5HCBA 3W58A 4BJ0A 4G9SB 4TWTA 3SHRA 3D3AA 1DGRA 1O6UA 4Q4X1 4PLOA 5IK4A 3VDCA 3GNEA 1DZTA 1VBE2 3ME2A 3S57A 1PZ8A 4QX7A 2X5IC 2XHKA 4COYA 2WNEA 3DXUA 4TTGA 4N7UA 3AKQA 1K3IA 1N3QA 4JHZA 2WNVA 2WS92 4XW3A 1DIWA 1QNYA 4QB2A 5IAVA 1PGW2 4AL9A 3J8F3 5DUWA 2BGOA 4AWDA 4CDWB 1RHI2 4DINB 1ULOA 1PO23 4FQ4A 4WVWA 1ZBE2 3ZYHA 2WO7A 4I0WB 1YEWA 5I91A 1WCSA 1LCLA 1PM7A 1WMXA 2NP0A 2LRPA 1YIPA 2WDBA 2W08A 3QCWA 4X8NA 4I09A 4AEDA 3ATGA 1BQPA 1OFSA 5L19A 4NAOA 1I1EA 4FOYA 4LOTA 4Q0PA 2XH6A 3U4SA 3VD5A 3K4ZA 5GJ6A 4FSJA 2VUAA 4E2SA 4LBQD 1UO9A 4FT8A 3J7NA 4IGPA 2B4KA 2XJVA 2ZX3A 2Q1ZB 3B3QE 2VECA 4IGOA 1TMF3 3FMGA 4NIIA 4I3PA 5BNOB 1LOBA 4BQ1A 4FTBA 4P5YA 4HFSA 5F2WA 1XC6A 3VB9A 3IAQA 2Y6HA 1VP6A 3PJYA 5E6HA 5LCWL 4MGSA 4LO6B 1QKQA 1YFUA 2Y33A 4BQWA 4JHTA 4P02B 3ZFFA 1R083 3WEZA 5JR7B 2QVSB 4AFMA 3MW4A 5I0TA 3IZOA 5FP9A 3HBZA 1W2TA 3AZXA 1FYUA 2G19A 1LOCA 1MQTB 4XF0A 1WBFA 1JXNA 2P5BA 1YIFA 5LW9A 1G9BA 1IG3A 1SCRA 1Z7S3 3H8UA 2W1UA 2WNUB 2XHNA 5EV7A 5C8WA 1EUUA 1QDOA 2D6NA 2WIIB 4GAZA 2QQIA 3H8RA 1ZA4A 5JXJA 4HPKA 3RNSA 4UFLA 2Y6FA 2ZCWA 1FPN3 1ACCA 1POV3 2YHJA 4XILA 3VDBA 4QPGC 2B7YA 2JDPA 3K48A 3JBG1 4L92A 4RFT0 1QNWA 2D7FA 3FBYA 1VB4A 5FZDA 3VBOC 5C8CA 4P9GA 3V65A 2YGMA 2GAUA 4Y1ZA 2OZJA 2GMMA 2JG8A 4IQPA 2WQ4A 4KWKA 3UKVA 1QJU3 3TRSB 3AB0A 4NIAA 1ZBA3 4YVWC 3NNFA 5FYYA 1UY0A 4L99A 5GZFA 4AK3A 3I2KA 1BVP1 4CDXA 1SLLA 1CPNA 4D7TA 5KHHA 3PTYA 4BHPA 2QZ3A 2ZHMA 4JTNA 2PAKA 5AC93 5AFBA 5FWJA 2IFWA 3E5XA 5FYSA 4IW3A 5F3CA 3QOPA 3KV9A 1XSRA 2LUWA 1CAVB 4CDUB 4ZU5A 1REFA 1C1FA 4XIOA 4MGQA 3LQCA 2EXHA 2B9UA 2TNFA 2QFEA 4OHXA 2BVBA 2E7QA 4XCAA 1SHWB 1OVPA 2BU9A 2WJSA 3N4MA 1NKGA 2TUNA 3JBG2 2BTVC 3NSTA 1AZDA 5IK8A 1SFPA 1MS9A 2WC2A 3AP5A 4MGIE 1BKZA 2WBKA 2PLV2 4RS5A 4META 5DG2A 2VNGA 3TBDA 1WW6A 2DVDA 1W2OA 4LO8A 5FY9A 5L9BA 2IXKA 2KA3A 5F37A 4HETA 4PBOA 1DZQA 1FX5A 2ZZQA 4FP2A 4IEWA 4B4RA 5T50A 5C4WC 2UURA 3INAA 2H0BA 5A33B 4ZXEA 4EZ4A 1OA2A 2VQUA 2XLFA 2E7AA 1A8DA 4AGVA 2BOJA 1KITA 2JDMA 5FZGA 3PDQA 3W9AA 3K4DA 2XBO1 5G05L 3HD8B 3IPVB 4Z2WA 2YMZA 3WP6A 2GNTA 4TLFA 3AFGA 3FN9A 2JDNA 1JUIA 4XFIA 2D97A 5EWSA 4YW2A 3DEMA 3I3QA 4CXXA 3WF0A 4YGDA 1TME3 3GF6A 5GKAC 3T08A 3ACGA 3MIBA 4AVBA 4UBGA 2D6KA 3USUB 4AI9A 4CP1A 3HVDA 1BHGA 3M1HA 1J3QA 3ELNA 3O0XA 2VW2A 5T5PA 2XQRA 2A70A 1Q43A 1W6NA 4QPIC 5LY2A 1ND2A 1R1ZA 2WNUC 4ATFA 2DURA 5KXDA 3BALA 1HN1A 3PU3A 2W94A 4L2NA 1HW5A 5L73A 4YLZA 4YYOA 3WW4A 2DV9A 4GMP1 5FZEA 4CCNA 4H3WA 4CCDA 2A6XA 1S0CA 3UV9A 2DCYA 1PO13 4QXHA 4XDPA 1SACA 3WW2A 1XE8A 4AFBA 3QBQA 4A2UA 2XBO2 1LB2A 4HOOA 3NMBA 3HMYA 3VBSA 4I3GA 1RUJ1 4MXVA 4W50A 1PIV3 2RM21 2ZHKA 4N43B 4QPGA 3H8OA 2BWAA 1FMD2 4AVAA 1Q8SA 2E31A 3PVBB 1JYNA 3P6BA 4QU1A 3ZDSA 2Z42A 3V0BB 5KXBA 2C24A 4LPLA 4WVMA 4IEXA 1ZZCA 1FOD1 2GH8A 3WSOA 3OGSA 1KS5A 1ONAA 4LE4A 4K8FA 4Q4Y1 1GNZA 4CEWB 1W39A 1OLRA 3HT1A 3A0KA 4YGCA 4YVWA 5F32A 5LA9A 2Q1FA 3Q8EA 4BMBA 4MUVA 4WBBA 3ETPA 4EQVA 4C91A 1MEC1 2JB8A 4A6OA 1QJY1 3ZYIB 5IVVA 5LA1A 1U0AA 3FLTA 3I59A 3IDAA 3HQXA 3AM2A 3AZYA 1D2QA 3LEKA 3N36A 2HWB1 5A6ZA 2H6BA 4N9HA 3ZLIA 4FFGA 3T30A 5FR3A 4UF0A 2R041 3I2GA 4R52A 4QM8A 3ZXLA 3BTYA 2GDFA 2TBVA 2ZGQA 4RHV1 2W3JA 3VHRA 1B35B 1RUJ2 1WLWA 2OPKA 1I3HA 2RM22 1XU1A 3I2HA 3KQ4B 2Z4FA 2Y64A 3B01A 4OFGA 5FZ8A 4P14A 1KFXL 4BQ3A 1XSQA 1C57A 5GLVA 4IV3A 2Q30A 1Q8VA 2VMDA 1F31A 2ZS6B 1E5IA 4CUCA 4QKDA 5DDJ1 3T0BA 5A70A 3GZTB 5F2SA 1XNCA 1W06A 3R0RA 1UMHA 2ZA9A 3EO6A 3OPZA 2JIJA 4DXTA 2W95A 4NWVA 5FY1A 4QQ2A 5C4WA 1POQA 4EN6B 1ULEA 3L2YA 4JV4A 3DYOA 3PIJA 3HNMA 3MIEA 1MEC2 1QJY2 1QF3A 3POJA 4UI9L 3HR9A 4JGYC 2YFUA 3N9MA 1UZYA 1VMHA 4WM7B 4BA6A 2HWB2 1O4ZA 1QOOA 2XGXA 4URAA 2CAUA 1OOPB 1X7NA 1NCRB 1LU2A 2R042 2UY9A 1C3HA 3GGLA 4V2VA 1NLQA 3RI8A 4AVCA 4QDSA 2VOTA 3ZFEA 2O0OA 1XNDA 2DWRA 4KU8A 2VZVA 2DU0A 1AR61 1LRHA 2GMEA 2YGLA 4QKBA 1O3SA 4XDOA 1BCXA 4B29A 3CU7A 4QXCA 4XUPA 4QPIA 1CZSA 4KH9A 4AHXA 1PGL2 1D7PM 3PUAA 2JD4A 3SNMA 1UAIA 4CP9A 1RC6A 3AZZA 4A7ZA 1ULGA 4CSWA 5JPNB 3DV8A 2QZ2A 5DDJ2 2VE1A 3J26N 5JDBA 3I3EA 3RFRA 4M3CA 3WW1A 4LBNA 3OYWA 4XTPA 1ULCA 4E27A 4OI0A 1GLHA 1RITA 1KJLA 3OOXA 4GD4A 1OD5A 4ZU4A 4QQLA 3BPSA 2Q4SA 2B5HA 3WNMA 3UKTA 1ENSA 4FAGA 4QGLA 5I0DA 5JR2A 1ASJ2 2R1DA 3AYEA 3CKHA 2IWGB 3FUOA 3VKLA 1UKRA 4BQXA 3PMSA 2CY6A 2JWPA 2A3XA 2XJUA 4MX3A 5FBJA 4GJYA 5ABJB 3RWNA 3POFA 2VCMA 2GSYA 3VV1A 1AR62 3MPBA 4HVRA 4NUBA 5BNPA 2VXJA 1OH3A 1W8NA 3AVRA 4IE7A 4OUEA 1DGWA 1R093 1JW6A 4NPMA 3HNYM 4WZCA 1CR7A 4XBLA 5CIRA 1LR5A 5F7UA 3S30A 3AKPA 3V64A 2VVDA 2WZ8A 4XQDA 4V1PA 5C5TA 4M01A 2OA2A 1OLMA 2JJ6A 5FYIA 4RR3A 4M0HA 1OD3A 5FOBB 5FK8A 2F17A 5D2AA 2A6ZA 1RUI3 2VMFA 3LB9A 3OY8A 5CB7A 4AHZA 1U12A 4E2GA 3ZXGA 2WQ8A 4BK4A 1HRV1 1I9RA 1NA1A 1DDLA 1OURA 3EYPA 3N9PA 4XBNA 5EYXA 4A45A 1SLBA 3WX5A 4Y4YA 4K8RB 1RINA 4KNCA 4EN8B 2D6LX 3UGFA 2OQ7A 2E7TA 4I2OA 2JG9C 3OGRA 4FPEA 2J1VA 4DZGA 4FFFA 3IN9A 1H9PA 2YFZA 1CAWA 2ZJCA 1CAXB 4YG3A 4LHSA 3FLPA 4IDZA 3I3BA 3FZ3A 4BK5A 1NCRC 1GQPA 1IPSA 4NHYA 1I5ZA 1UY3A 1GANA 4ET7A 3AMMA 3F95A 1K5MC 4UW6A 3ZYPA 5FP4A 3E6CC 5JXGA 3ILRA 4QDQA 5A7QA 4DRRA 1W6QA 4JGYA 3IMMA 3MLLA 1HXS1 3A21A 3VUOA 1RMU3 1W6MB 3O1OA 1OBNA 5FZHA 1YQ5A 1HRV2 2IXIA 2FDJA 4IE5A 5DUUA 5FPLA 2ORZA 5IAXA 1F15A 4K40A 2XL7A 2GZWA 3VBFC 3LEMA 4K1YA 2P3YA 4KGGA 1STMA 5T3NA 1J83A 5FY7A 3RZLA 2E6VA 1AXYA 2PELA 5AVAA 3W5NA 4XURA 3GM8A 4IV1C 4GJZA 2ENRA 1F4AA 2UYBA 3B94A 3C7EA 2ZMKA 1LTEA 1UOFA 4EWDA 3ZVXA 4XJZA 4PHZA 1FXZA 2HWD3 2J1AA 1DQ1A 3WHTA 1LGCA 1XNAA 1F5JA 1VRH3 2K0GA 1TNFA 2RMU3 3LIHA 4NHMA 5GALA 4BXFA 5FZ3A 2RS53 1ENXA 2XB6C 5LY1A 4XPVA 2WT2A 3KV6A 2PHWA 1NLSA 5BV6A 2XPJA 2FDFA 5ABJC 2ZZJA 2O8QA 3ACLA 2ZXQA 2HWC3 4JDMA 2JDYA 5GLTA 3WOGA 5C70A 4MG2A 3LPFA 2VMIA 1WLCA 4CUGA 2UWAA 3I2JA 4N9IA 1YYNA 2W87A 1NX9A 3OBTA 1VPHA 1QEXA 4BIOA 1E5SA 5IK7A 3PHMA 4C0BA 2EIEA 1BK0A 3GHNA 1Q8OA 3TN91 3ZSKA 2VOWA 1MS1A 4CP0A 3RZGA 2RV9A 3H9AA 5HCHA 1LNSA 4Q26A 2YC2A 3GZUC 4L9BA 2CGOA 1D4VB 4JGZC 3RQ0A 2BDRA 1TZOA 2XVKA 4LHLA 4Q8KA 1OMIA 4KWUA 4KGQA 2VUCA 2XMLA 3N9NA 3C7HA 1JYXA 1VBA3 4OI4A 5FUIA 4Y1YA 1JZ8A 4QKFA 1GSLA 1J1TA 2OT7A 3KF3A 2ZKNA 1W8WA 1AR71 4AQSA 3ZDVA 4Z2AA 2GC3A 2QTWB 2RHPA 4HZFA 1RYYA 2W39A 2XJPA 1HDKA 2Y6LA 4AQ6A 4CTEA 1GOHA 1UY1A 3BU7A 3SITA 5C3RA 1VLNA 3CF6E 4IESA 5JMOA 5FUPA 1OXCA 4YZ3A 3ES1A 4MH0E 1LGNA 3VDDC 1MPXA 3PVNA 2HWF3 2BBAA 1QIQA 3POEA 1YI7A 1UOJA 2KD7A 4YW3A 5L9RA 3MDPA 4MVTA 1NZCA 2YDEA 4QXBA 3TN92 3ZXAC 2VZ3A 1PO21 2E63A 4Y22B 2ZGPA 3DXTA 4E8CA 1W90A 5F3IA 2C4XA 1L7QA 3KCYA 3M3EA 5A1AA 1OI6A 3RS6A 2ZGNA 1W8HA 5LK7B 1D4M3 4KU7A 2XR4A 1H4HA 4FPYA 1W6PA 1K5MA 1RJ8A 1SZBA 1DYKA 2W47A 1DGRN 1H8TB 4AI0A 1OUSA 2DFBA 4XFHA 1AR72 2LROA 1GNHA 2O14A 3I2DA 2DFCA 4AW7A 3VKNA 5ANQA 1YRZA 2F6BA 3VHPA 5A3OA 4D6RA 4R8HA 3IDCB 1JHNA 4JRAA 3SKJE 3VBRB 1A78A 1IZ3A 1TMF1 2Q8CA 4IUGA 5GZDA 1IPJA 3VBFA 4DOUA 3QACA 1GZCA 2MHFA 4XQWA 4BWOA 3S7EA 5F1RA 4F83A 2A7AA 4NIHA 1QJX3 1H6XA 1IPKA 2AZ5A 5FQ0B 4BMEA 3ES4A 1HB4A 4OMCA 4OLLA 2RE9A 1J84A 3EJKA 4LBQB 1XXNA 2BRTA 5K8SA 1FNZA 1R081 2RJ2A 1SLTA 2Y34A 3AKRA 3FBMA 4QQPA 4S2GA 4YZ4A 4QU2A 3ZMNA 4COZA 4W65A 2OKXA 3NV2A 3LCPA 2B39A 5J98B 1GQHA 1LEMA 3KVBA 4LORA 1Z7S1 3LZZA 4AEKA 2UY8A 2H6CA 4BDVB 4UOJA 5BYNA 2JE8A 2BNNA 5A3MA 1GP6A 1LESA 4HKWA 4XETA 1GMMA 2DVFA 4PLMA 3AKSA 2MEV3 2J1RA 1AL0G 1FPN1 4J25A 4NPLA 1POV1 5A1FA 5FZFA 4Y1VA 3FX3A 2A1XA 1F5FA 3RZMA 2D6MA 2BNMA 2A6WA 2QQNA 4LKEA 5EFUA 3I3DA 1BBT3 5FYHA 4XJ8A 3WNKA 4Y3OA 3KT7A 2DDUA 2QQOA 3URFA 1X50A 4GH4A 5HV4A 1O5LA 1QJU1 5FYUA 3VBUB 2VNVA 2ZPXA 3JXSA 3T4VA 3ZSJA 2VU9A 1XB9A 2XL9A 2YY1A 1ZBA1 1C8M3 5I8YA 1R082 4B7KA 3AMQA 2ZBJA 1HV1A 3MBWA 5I8SA 3V0AB 4ZS2A 3WNLA 1SPPA 1BK1A 1OQDA 2HBTA 2IC1A 5A7OA 5FJKA 1DP0A 3N35A 2YBKA 4N8MA 5AC91 1XQNA 4I02A 3R4UA 2AR6A 1W04A 1Z7S2 3S5QA 1YNAA 1G9AA 4NROA 3ZXEA 1AR92 1IQAA 4JX0A 5DG1A 4C1WA 1CJDA 1OQEA 1XU2A 1F35A 3KGZA 1AX2A 4HSLA 4JDNA 5A3UA 5A3PA 5DMYA 5JSPA 4NIDA 1FPN2 5F5QA 1LOEA 4KWLA 4RQPA 3BIEA 4XVHA 3KT1A 1SDDB 1RIRA 1S55A 2VY0A 4LMFA 4UBHA 4XE9A 3OD0A 1YQ2A 4LIVA 3WDXA 3DN7A 5J1XA 3ACIA 1IQDC 1V6JA 2XVGA 1HLCA 4DXSA 1NCQB 1VE0A 4Y24A 5ACA3 2WWSA 1J1LA 3KQRA 2QKDA 4A4AA 1GQGA 3CMGA 1QJU2 1V6OA 3D0SA 2WNOA 5B4NA 2X53S 1ZBA2 3AK0A 3TOJA 5DPNA 2PHTA 2R6QA 2J1TA 5JVVA 3MI8A 5CAZA 2XG3A 5L7OA 4NN0A 1IKPA 1CAUB 1YJKA 1MS3A 1REDA 2CTVA 2EICA 4NRQA 5AC92 2C9AA 5FYCA 4YW5A 5CKQA 1ZRRA 2VW0A 3ORJA 4PDWB 3PVEA 2IXLA 1ND3B 3LFIA 4C8DA 2E51A 2FD8A 1UZ0A 4MSVA 1LGBA 3EQEA 4LKDA 1HB2A 1RUH3 1JBCA 4AI8A 1UYYA 4AXOA 2P1BA 4XUQA 3O1PA 1MZFA 4GWJA 4GWNA 5SV5A 1ZRCA 5FO8B 2I45A 3U1XA 1HV0A 2ARCA 2XDVA 5CFCB 1QHDA 2GN3A 4MHRA 2DTWA 4UW5A 1OKQA 2VCAA 4D6SA 2C5DA 2DCTA 3B7MA 4AHYA 4M3CF 5JZGB 4FOVA 2VPVA 3O12A 2A73B 4AF9A 1K5JA 1F8VA 2ET7A 3VKOA 4TXWA 3WDTA 3WG3A 4AR2A 4AQ2A 4Z07A 5BUVA 1J59A 3DPRC 1TG7A 4ZZ8A 3Q8FA 1PO11 4PBPA 5I0RA 1ALYA 3VD4A 1UX7A 1L7LA 1W6OA 4GIQA 2VOXA 3C3VA 2EXJA 1GUIA 5JWPA 3P1IA 3PUSA 3ZXDA 4AEJA 3I4IA 1ZRFA 2R0FA 4F3JA 3BYWA 1NQJA 1YQCA 1RVF3 2HEYF 3POIA 3ZSLA 2PXJA 5CISA 5IVFA 1PIV1 2EAAA 4DB5A 2A6VA 1S1AA 2YB7A 4IEUA 1CIWA 4BQ2A 4XJUA 5K9YA 2VTFA 4TYSA 5K0UC 1JZ3A 3HBKA 1ULDA 3WNNA 4CCJA 5CYYA 4EYUA 2EF6A 4YZ5A 3AC0A 2ZX1A 2LS6A 4Q4X2 1GZWB 4HONA 3VL8A 1PGSA 4NRMA 5GLWA 3IB3A 5LBFA 3U07A 3HNBM 4XBQA 1H2MA 1KDMA 3ZKYA 3RDIA 4F8AA 1RUC3 5DZEA 5CFDB 5KXEA 1REEA 4QMAA 2VCBA 1F4HA 2ORXA 4YVSC 2I74A 2PHLA 3ZYJB 2WWJA 1WMEA 2IXJA 2D3SA 1KFUL 1XRUA 3OGVA 1G8WA 5DAXA 1UY4A 3ZIXA 3KM5A 2VL4A 4Y5Z0 4BB3A 1N3OA 2VCCA 3ZFGB 4V2WA 2P17A 3OEBA 5CZKA 5C9AB 1W2UA 1FV2A 3RG0A 3VZKA 1GV9A 1RUE1 1GOFA 4WM8A 1PIV2 3M4FA 3UGGA 3A0NA 1DFQA 3LA3A 4AFDA 1C5IA 1U5IA 3DF0A 5D21A 1J58A 1PZ7A 1VBC1 4FPGA 3WNXA 4AEMA 1XBFA 1AVBA 3M3CA 4IE4A 5JAXA 2ZX2A 5B4XA 2DUPA 3CEWA 3LFMA 5D8AB 3WV6A 4R9BA 5FYZA 1AXZA 1ND3C 4BM8A 1DLLA 3C7OA 2JDZA 3CJIB 2EALA 4UFJA 4JKKA 5J7MA 1NE4A 5F6KA 2WR9A 4H2AA 5LEJA 1LODA 4M3CE 2WZR3 2Z5WA 4XHBA 2GP3A 2VOKA 3VBHB 1JZ4A 4IL7A 1EPWA 5T54A 3UK9A 3LSEA 2YROA 4XF3A 4LUMA 1AL23 3ITQA 5JI9A 1EAH3 1HX6A 5E16A 1X82A 4Y5TA 3TEXA 1S0EA 5C3OA 3PURA 1RUE2 2E32A 4RA0A 3WR0A 4CDWC 4DRVA 4GZ9A 4YGEA 1HRI3 5FPVA 3LE0A 2C26A 4LNVA 1OFNA 2DUOA 1V6IA 2X5IA 2YC4A 1QH6A 1VBC2 2VQAA 1UZVA 2RS33 4E4HA 2FBEA 2NMNA 3WUDA 4KBZA 1OA3A 5KWRA 4WVVA 2RJKA 3ZR6A 4B7EA 1QGLA 2K9ZA 2W2IA 2IFRA 2JB4A 3RZHA 4CEYB 2KM2A 3NO8A 4LO5B 1YO8A 5DUXA 3C8XA 3DPRA 2Y8KA 5HXMA 4L8QA 2DUQA 3AX4A 1RUD3 3MIDA 4YW6A 2OUJA 3MW2A 1OLME 3AMHA 1VAKA 3IKWA 1W99A 3B9CA 4FI9A 1XYOA 3DUIA 4XDQA 2IUWA 5BNOC 3WF4A 2BFUL 4N53B 3EBRA 3WF1A 2CHHA 3W5MA 3ZYGA 3KD4A 5K0UA 3RZKA 2A5ZA 2JKXA 3KVAA 3L9JT 4CA9A 2J42A 2JDHA 3OY8B 2XVLA 3RPQA 2DBNA 2P37A 4Q1PA 4Q0VA 1HB3A 3MV11 2WABA 1NA1B 4FO9A 3TNPB 4A44A 3KLSA 1QXJA 5E88A 2WS93 3O5SA 3TEZA 2WLQA 3H7JA 4U36A 4ASLA 4SLIA 3ZN6B 1KRIA 4IERA 2CWSA 1MQTC 1SBDA 1H2LA 1ZM1A 3ON7A 5FKCA 4DPNA 4YVSA 5IT6A 2WZEA 1LULA 2AEZA 2L9LA 4M4RA 1OF3A 4Y20A 4YPJA 3ECQA 1IOAA 3K4AA 3UKNA 1LHVA 1O8PA 3WP3A 3BPZA 3D82A 3MFCA 3LF7A 5BNNB 2ARBA 4ITCA 4LO7A 1CAWB 2OW4A 1UYZA 3NWKA 2ARAA 3OUHA 4HT1T 2D40A 5KHIA 2XKPA 3CLPA 1MVEA 1W9YA 1KGYA 2HWE3 3PUIA 4W6XA 4YNIA 4CCKA 3OEAA 1GBGA 3H3UA 2QQLA 2ET1A 4P00B 1WA4A 4FCAA 1JYTA 1LHOA 1S0BA 4XHXA 3AYCA 1W6QB 2ETEA 3T0AA 3BVCA 4IEOA 4QQOA 4YGBA 2XXZA 2YG0A 3GDBA 1O59A 5LZ6A 3MHZA 5LBCA 4FBFA 3PLQA 3FWEA 2Y0OA 3U10A 2PAEA 4KG8A 4OHVA 3T2QA 1T6GC 3WF2A 4J1WA 5A3LA 4YSFA 3O1VA 3OB8A 2GN7A 3CL1A 3VBOA 1IHMA 2VOVA 2ZKLA 3M8LA 2YV8A 3MW3A 4JKLA 1GU3A 1T2XA 3THPA 3H8XA 1V6NA 3T1MA 4LK7A 5A7WA 2Y6KA 3UL2A 2X10A 3OG2A 4E2QA 3P3NA 3R05A 2XOMA 1SBEA 2QNKA 3H1WA 1WW4A 4O65A 1QQP3 4CU6A 2DTYA 4LITA 4XFCA 2WFPA 4CDUC 4OQ9A 1LOAA 3GCXA 1MR5A 4YM2A 4LKFA 3I8TA 5C71A 2R16A 3K2OA 1RMU1 4GWMA 2F4PA 4WZFA 5JCTA 1TQ5A 4JRLA 3NJXA 3B02A 2RG4A 4ISRA 3J7LA 1O3TA 4ARYA 4CEYC 2BUKA 4CDWA 5FZMA 5CKNA 4OCTA 4NO4A 1ZA7A 2JXAA 4DUWA 1GFF2 1MS5A 5FYMA 4BQ5A 3MV01 2CNAA 1GR3A 3VZJA 2FCVA 1S0JA 5T5LA 5JOXA 2HWD1 1Q3EA 3WP5A 2VBBA 4FFHA 3E6BA 5FP8A 2EIBA 5FO7B 1VRH1 5GZGA 2RMU1 4Z1VA 3LDBA 4N53C 2RS51 3WXPA 4GWIA 4K1ZA 2BP6A 1CZVA 2W9XA 4QX2A 4UFHA 1FOD2 2IZWA 1WMDA 2ERFA 3OTFA 1X8EA 1EV13 2G9GA 4Q4Y2 4DY3A 1PHMA 1G86A 2CGNA 3CNAA 2WO1A 2HWC1 3LWCA 2GMPA 3NQHA 4OHYA 4XQ4A 1DQ0A 2VJXA 3ENRA 4D3WA 3POSA 1RMU2 4W6WA 1WA6X 3NKTA 3LAGA 1AYM1 2Q5TA 1GZ9A 2GH2A 3H3LA 1SLCA 1H2NA 4OVEA 5FMBA 1FT9A 5JI7A 1H2KA 4NVPA 4UYBA 3LEIA 5I93A 2FDIA 1UN1A 2JDUA 1YFWA 2W1WA 3ZYFA 4RHV2 2W92A 4C90A 1H1AA 2PN5A 3NNJA 3ZPYA 3J9SA 5CEHA 1MQTA 2HWD2 1QH7A 3JD73 5ISLA 3K77A 1Q5OA 2PLV3 1YFXA 1VBA1 3VHNA 1VRH2 3MGUA 1ST8A 2RMU2 4ZONA 2WNUA 4AI3A 3POGA 1HKDA 2GNMA 3KB5A 4A3XA 1FV3A 1OVSA 2JDKA 4QWNA 3NKGA 1Z0HA 4OMDA 2OZ6A 5DZFA 1V6MA 3LOBA 1CESA 4TZDA 1DQ2A 5FZCA 4GQ7A 2ZAAA 2HWC2 1ZRIA 4N43C 5JUVA 2YU1A 3AZVA 2GNDA 5DAQA 1S0IA 1W6PB 2EXIA 3K75B 4PCRA 2CL2A 2VUDA 4Q27A 3RWKX 3SISA 2HWF1 1AYM2 3T09A 3LGRA 4M00A 2XQXA 4QHZA 5CG9A 2GU9A 4EWAA 4DXZA 2VNRA 3MUY1 4ZU7A 3VD9A 1Q8QA 1UPSA 4XUOA 4CEWC 2IXCA 4CDQB 5CG8A 4UT5A 2ZGUA 5FZOB 3RZZA 4OQ8A 5T55A 1R1A1 2XONA 3SC7X 2NM1A 3LDKA 1JHJA 5F5AA 3GZAA 2KXLA 5FOJB 2WWUA 2GC1A 3P5BA 4MXWB 4ZXKA 2RS13 2HEVF 1NY71 4IXLA 5H9SA 1D4M1 4XC9A 5JXIA 2PMWB 3MUZ1 1SLAA 3Q8BA 5IFPA 3G6JB 1VBA2 4XJ9A 1A3KA 4AFAA 1RUOA 1J3RA 2BYVE 4FFIA 4YZ2A 4CDUA 3TYJA 1CAVA 4FQZA 2KR2A 4IEQA 5FZ1A 2Q0AA 3RMXA 4QX0A 4B4PA 1AYN1 2C0ZA 2EIDA 1AJKA 2GC0A 3WINE 1B35C 3WG1A 2AENA 2WA3A 1S2KA 5FCCA 5LA2A 3AKTA 5LATA 4AFCA 1GZTA 1OLQA 2P3JA 4QGNA 2HWF2 2BNOA 1UCXA 1ULPA 2QQPA 1PNFA 4UFIA 1FMD3 2N7GA 4HVQA 3E6DA 1WUVA 1VIWB 3ZIWA 2DCZA 1N3PA 2AREA 1CN1A 3ZPOA 3EXUA 3PUQA 1R1A2 1I5PA 2YPJA 3DKWA 4W8JA 4FPJA 1YQ8A 3FL7A 1G9FA 4PF1A 2D3RA 4JKMA 4AZZA 4BH9A 1POV0 2ZEYA 4DUXA 1NY72 2D5FA 1D4M2 3RYRA 2BJSA 4GH4B 5J96B 1D0GA 3THCA 3IPVA 4HG6B 5FPUA 4WM7C 1OH4A 3H42B 1UKGA 1TVGA 1NYWA 1OOPC 5LASA 5FZKA 1WLDA 3BGAA 1U5XA 2MEV1 1ENQA 1DLCA 4OZXA 1AYN2 1RUG1 3USUA 3HEIA 3AYAA 3ZYBA 4XJAA 2DVBA 3GBGA 4URTA 3CJXA 2XJRA 1BBT1 2E9QA 5A7PA 3OBAA 4U2AA 1RUJ3 4COVA 3THTA 2XUMA 1US3A 1K12A 2WQZC 5FUNA 5JSRA 2CV6A 3OBRA 3WQ0A 2TEPA 1N1VA 4LE3A 1C8M1 4XAEA 1DYPA 1JI6A 1DHKB 4XEZA 3BB6A 4H7MA 1SBFA 3JUUA 4R4XA 1GICA 1UX6A 2Y6GA 4M4PA 4DY5A 2XLGA 3NAPB 1TEIA 5KR7A 4Q4V1 1V9U3 5IYYA 1RUNA 1W8OA 4O9EA 3LA2A 3RZJA 4B1MA 4QB1A 4I30A 3LIGA 1LKNA 4N43A 3NV1A 3LKJA 4XTMA 2MEV2 4J6GA 4R9AA 1EYBA 1RUG2 2HWB3 3V0BA 4LKSA 3U4XA 1O7FA 4QPWA 3RJ2X 5L7OB 3N3HA 3BU0A 4RGKA 1HXS2 1BBT2 4CEWA 4K21A 3W59A 4MOAA 1PK6B 1BEV3 4FXKB 4S2DA 1MVQA 5A32B 1HJFA 4CXYA 5HI0A 3QH6A 4FXGB 2RDSA 2VVFA 2VZPA 2PHFA 3K3NA 1C8M2 1LOGA 3HPNA 4R9CA 1CX4A 1MS8A 1KJRA 4XUNA 4AVTA 4Y5SA 3N7LA 1OSGA 1C28A 1VBB3 2W52A 4B1LA 2HJIA 2ZX4A 4IEYA 2RDQA 4G3YC 2WNVB 3MYXA 3BOPA 4Z92B 1O3QA 4Q4V2 2ADEA 2E53A 4MGYE 1MZ6A 4KQ7A 5EZWA 2VUJA 3VLBB 1ZX5A 2R063 3OD4A 2MPFA 3M3QA 4YFWA 2RJLA 1YFYA 4BCUA 1RUH1 1DG6A 1JZ6A 3S5AA 4QT6A 1C1LA 1ZRDA 4NWWA 3PNAA 4QKNA 2CU5A 1ASJ3 4ZZ5A 1OF4A 3M70A 1AX1A 1JMUB 2G9FA 3O14A 2R49A 4AEDB 2VVEA 4LIUA 3WD5A 4EROA 1GWMA 1V00A 4D6QA 4H7LA 2B9VA 1C4RA 5DN2A 4IETA 1AR63 1W0OA 1CX1A 1W8FA 5FZLA 4AGRA 3TEYA 1CGPA 5EPAA 3J8F1 2JG9A 1KS4A 2Y26A 2J7MA 3SH5A 4OI2A 1JU3A 4XZPA 2BFUS 1HQLA 2WAOA 3D0JA 3LDRA 3QD6A 4WM7A 4Y4RA 3VKMA 3WF3A 5GM0A 4QB6A 1NUKA 1I6XA 3JZVA 2VZUA 1NCRA 1XJAA 4LXLA 4OI1A 3GALA 1A6CA 5FJHA 5E89A 3ZXFA 1DQ6A 2QQWA 4LHKA 4O9GA 4YG0A 5F3EA 2AH2A 2J1EA 4LJHA 1RVF1 4NHXA 3LPGA 2NPIA 2VNOA 2EXKA 2R073 4JAAA 4Y26A 1PZ9A 2FZ1A 3WUCA 3ZFFB 1WWYA 4Q0UA 2R32A 2VZTA 3IWZA 2BWCA 1GKBA 2Y60A 3B9IA 4P08A 3F2ZA 4MZUA 5J3UA 2WAAA 1W9SA 3H1MA 3MLKA 4NPRA 3VHOA 1X9TA 1WW5A 2QE3A 3OJBA 3NJYA 1T6BX 4BE3A 4E9KA 4W6YA 4EN0A 5J37A 2J1UA 2ZACA 1UY2A 5F3GA 3HN1A 3T2TA 4UFKA 2W46A 4K20A 2RDRA 2PAMA 4RYDA 4IV1A 4CU9A 4CUAA 4OHWA 3A7QA 1VBD3 3AXDA 3M3OA 4A6SA 4LO4B 2CWMA 4HPKB 2ILMA 3GBFA 3J8F2 5A6YA 3I3MA 2A75A 3KWVA 2YBSA 4EV0A 2BBVA 1W3VA 1PO22 4XFAA 1PX4A 5FIXA 4Q5OA 1WBLA 1RUF3 4ZPIA 5C8CB 1H30A 2VMGA 4INDA 2HKXA 1X9PA 3OPWA 2V73A 2FDKA 1WW7A 1FNYA 1JTZX 1ZZ8A 5A7NA 3ABZA 4MGZE 2JG8B 4CVUA 2OPWA 1VR3A 1W3XA 1RVF2 2IVIB 2ZABA 4AAXA 2WYSA 5ABJA 5F5CA 1BLZA 1DCSA 1DGLA 1XNKA 3ACFA 4NOTA 5M0TA 4XACA 2ARXA 2ZGSA 4XJWA 2ZHLA 4CDXB 2WN3A 3KZ4C 3WVJA 2VQ0A 1ZREA 3JU9A 3B00A 1DQ4A 2VMHA 1JN2P 2WNVC 1TMF2 5AVPA 3U0ZA 2WN2A 4Q2FA 4O61A 2OVUA 5JSOA 5HCFA 2ZAHA 5CNAA 5JIUA 2R0HA 4CPBA 1WCDJ 4B4QA 1JU4A 5HXVA 2P3KA 3DYPA 3WLUA 4YW7A 2VW1A 2DVAA 4JGZA 4K3UA 5FYBA 4GKXA 1LU1A 1OT5A 2WZR1 1TE1B 3SH3A 3U37A 1KDKA 3GCWA 4JQTA 3LOIA 4AEDC 2VO5A 5FP7A 3AFKA 4DEQA 5I8TA 1H4GA 1EAH1 1LENA 4QM9A 1WKYA 3ZYRA 2JKBA 4RS5B 2O8OA 4FPHA 1UNBA 4N90A 2FDGA 3ZSEA 5C3PA 3O1UA 2DCKA 2VD7A 1HRI1 3ROUA 2R1BA 1CJPA 5FFOC 1S0GA 5DAWA 2B8MA 3TNQA 2VZRA 4BU2A 1CAXA 3OBZA 4ORFA 3VDDA 4I01A 2RS31 4CZSA 5BNQA 2B45X 3FHIB 3OCPA 3HIFA 4H55A 4A7YA 3MICA 4R9DA 4HN0A 1Y4WA 1VJ2A 4DNYA 4FPLA 1VB2A 1H8TC 2J22A 2WT1A 5FZ0A 5LRRA 4D69A 3ZFFC 2ZGRA 3JB4C 3JCIA 4LBJA 1JZ7A 1RUD1 2EA7A 2VTXJ 5IVEA 1BMV1 5A6QA 3IIAA 4QXKA 1W6MA 2CDOA 4NR1A 4OUSA 2WZR2 4XCBA 4E4DX 4YM1A 1AX0A 1D2SA 3B93A 3GHMA 3VBRC 4KMQA 2XJQA 1URXA 1Y43B 2ZGLA 1W6NB 4DIQA 5I0SA 1ND2B 2WFF3 4LOSA 1UD1A 2ID4A 4BOWA 2ZMLA 4IE0A 5C33A 3R4SA 5BXXA 3UETA 2FHRA 1PM4A 1W8UA 3WCRA 1OPMA 5A3WA 4PJYA 4RD7A 2WO3A 1HRI2 1A8MA 3KHBA 4P9IA 1TME1 3N7JA 4Q4W3 4WV8A 2RR13 1HN0A 1W8TA 2VR4A 5C8CC 2VQTA 1WD3A 1TNRA 4D7YA 1OKOA 2RS32 1GYKA 2EAKA 1UL9A 2PYTA 1CONA 1V6KA 1JOJA 2ADDA 4GMP0 3NV4A 4SBVA 4KG0A 5K4LA 1HQNA 3K46A 3GJAA 1O8SA 5IUQA 3VBSB 2LW8A 4P9XA 3WQ1A 1KEXA 3KCXA 4QPGB 3I2OA 2AACA 4A42A 3N9LA 1UWWA 2QDRA 4J1XA 3WY6A 3V56A 3SKVA 1BMV2 5FPZA 5IK5A 4CDXC 2WSUA 4YFZA 3GJBA 3CZUA 2HWE1 3DECA 5FLIA 4WVMB 4CYDA 3KV5A 1JYVA 1JYCA 3HOBA 4EN7B 3PTRB 1UW8A 3EMRA 5LA0A 4YVWB 1ZNPA 5FZIA 2FQPA 1H8VA 3AZWA 2JENA 5IVYA 5IFTA 2ZHNA 3KV4A 3VBUC 5K7PA 5L36A 1NQDA 3ZXJA 1ENRA 5KHKA 1WCQA 1IGOA 1ZZ9A 3C7FA 4CUBA 1BJQA 1UU6A 4YWAA 2V5YA 2WL1A 3I59B 1TME2 4HLTA 1O4YA 1FATA 3E1F1 4JCKA 5JMCA 4TLGA 4XXPA 1KQRA 3MF6A 3NRUA 1UXXX 2NYYA 3ZN4A 4UF0B 4ZS3A 2P2KA 4QDRA 3DGTA 2P3IA 4RS5C 3VZNA 1QQP1 1AR83 1WCKA 3NL1A 4HKLA 4AHWA 5FMCA 3LEGA 1O3RA 1YXWA 3RGBA 4BZ4A 2W1QA 3EHKA 2WYFA 2HH9A 4Y1UA 4BLIA 1IS5A 4LLOA 3ST7A 2FCUA 3UJOA 1AXKA 3AVSA 3PU8A 1OA4A 1PVC3 1EPZA 5FTTC 1IG0A 3FFQA 2HWE2 1PMHX 2P6CA 4IV3B 5A3TA 1LEDA 2EVXA 2Z2SB 2QQKA 1UYXA 1PO12 3AP9A 5FRAA 1JZ5A 3MZHA 1L7RA 1V0AA 4P5HA 4NMIA 2Q8OA 1NCQC 2IXHA 2VMCA 4Y22A 3WHUA 3I2FA 2HYXA 2D98A 2WSVA 1DYOA 3B5LB 3FC0A 3I97A 4Z8BA 1Y9QA 4GULA 5C4WB 4TSVA 2CYFA 4XF9A 4XFBA 5F5IA 5T5JA 3PL0A 4BYYA 2VZSA 2UWBA 3MIGA 2DVGA 3H3ZA 3DL3A 1DU3D 4ASKA 1ND2C 4OYUA 1H8TA 1BXHA 3PUHA 1EP0A 4D0QA 3NV3A 4IEPA 5DAVA 2XJTA 1QQP2 4FPFA 5FXXA 1EV11 2E26A 3R6SA 3SXWA 3WCSA 2H0VA 3HQUA 4PDWC 3ZFEB 4NHLA 2QQJA 1Q8PA 5APAA 5HCAA 3VBRA 1J3PA 2K46A 3AL6A 5FAXA 1H1MA 1Y9GA 3FUQA 4QPIB 3WQ7A 1AR93 4HXCA 4QHOA 4KWJA 4CP9B 1QMJA 5FZ7A 5FQ0A 5IATA 3N9QA 4LBQA 4UWDA 2ZMNA 2VZOA 4MADA 4HMZA 3VBSC 5CFCC 1COV3 4M3CB 1UYPA 3OYWB 4FOWA 5FKBA 5EIYB 3H7YA 2AUYA 1UZZA 5IW0A 2W5FA 2YPDA 2YBPA 4HANA 5DQ0A 5JZGC 3VZMA 2DCJA 3KHCA 4QX3A 1NAEA 3Q8CA 4EN9B 2OUHA 1P8JA 3JD71 4QX1A 4XMIA 5JPMB 2PLV1 5EP9A 2QUOA 1DBNA 1VRBA 3TB0A 5EYYA 5TSWA 1SLIA 4PLNA 3U75A 3WG2A 5JXHA 3O1TA 2XJSA 3AMPA 4XIKA 5A7SA 4COUA 1EV12 3J7HA 5T5OA 1MS4A 1KD7A 5J48A 5BNPB 5AFEA 3TEWA 4GALA 2J1SA 2ZGTA 1OC1A 3NJVA 3O0VA 5FXWA 1WD4A 1PGL1 4LR4A 1QJFA 2BEOA 2BQPA 3OGJA 4GB33 2VBDA 2BVVA 5DXDA 3VBUA 5FXVA 1SG3A 4XYXA 4A3ZA 1LHWA 5C3QA 3D5OA 4FP3A 3MFAA 4RR3B 5CFDC 3W20A 2ATFA 3BCWA 3V0AA 1VBE3 4UW3A 4ZKTB 1W2AX 1X8MA 5DAPA 2RS11 3I54A 3P3PA 3WQBA 1QJEA 3O1MA 3RRDA 3DKQA 3JD72 5DABA 4YM0A 2YUEA 2VULA 3KCCA 4IV3C 3D8CA 3HAGA 1YLLA 2SBAA 5FDBA 4MV2A 3BUCA 3ZOIA 5FO9B 1AUYA 4OULA 4HN1A 1R091 2NN8A 2C6SA 3ZFGC 3GXUA 4PIZA 4E8DA 1D0HA 4AOCA 1RHI3 2OS2A 4G4FA 1NLRA 5C9AC 1BZWA 1ZBE3 1H6YA 2AGSA 2W1SA 4GA9A 1GWLA 3OUIA 2OIIA 5FYTA 3GZEA 5JLVA 2CGPA 5JIAA 3WDUA 1N47A 1WLTA 1RUI1 2PHRA 2X29A 4D94A 4PT6A 1NCQA 3NNLA 3VDAA 4FTEA 2GC2A 2QQMA 4Q29A 1NXD1 4YG6A 3HWJA 3VN4A 2OYZA 1ZZ6A 3AL5A 2ZX0A 2R7EB 1FMD1 2A3WA 1YWKA 4P9YA 2V4VA 1UU5A 3KGLA 3C2UA 4X8PA 5D8AC 2I2SA 3ZFEC 4RSUA 1CVNA 1R64A 3HN3A 5A6XA 3ALQA 4DS0A 2PHDA 2ZEZA 4L0PA 4JGYB 4Q4X3 5F8PA 3CJIC 4RL7A 2QCSB 2B46X 2RS12 5FY8A 2VXRA 5T52A 3RYKA 5B2GB 1CAUA 2PA7A 3VL9A 3VBHC 3ILFA 4ES8A 4EWEA 4BISA 1JODA 4YW1A 3IDBB 4Q0SA 1XYNA 4PDWA 4ZY9A 1ND3A 1R092 4S2FA 5FMDA 3ACHA 3IBMA 4PIYA 5I0UA 1Y9MA 2OX0A 3CIHA 1W9WA 1O91A 4FOQA 5FLHA 1XPWA 3USSA 5CBLA 1PNGA 5C7GA 5LEKA 1HIXA 1RUI2 4LLFA 3UT0A 2HBUA 5CFCA 3O1RA 4BQYA 4CCMA 5LK5A 4X6RB 2BOIA 4XF1A 2PHUA 4MYEA 2FMYA 5E1RA 1LOFC 2P34A 3FHQA 5F39A 5JZGA 1MS0A 2JEMA 4PI0A 2JICA 3FFZA 3LD8A 1QOTA 1GP4A 2A3YA 2OXBA 4GXLA 1YUDA 5A3NA 5BNPC 1W03A 5FMOL 4HBNA 4HL0A 3WDYA 4XOGA 3B69A 1US2A 2PHXA 2WKKA 1LHNA 3ZN5A 3BIWE 3CZJA 1GOGA 1V9U1 1W8ZA 2I07B 2JIGA 2WT0A 3S7IA 4AE2A 4BPZA 1JZ2A 4TN7A 3OGGA 2WRAA 1AF9A 2JECA 3MF9A 3MEPA 4AYUA 2VTXA 4RR3C 2RDNA 3IM0A 4OUMA 2DYCA 4XAAA 1LHUA 4HKOA 3WDVA 4EJRA 1UXZA 5SV8A 4ISQA 1LAJA 1N1YA 1JOBA 2WO2A 3MIFA 5IVJA 1NT0A 3GYDA 1NA1C 1S4CA 3SLIA 1GZWA 4DQAA 5EJ1B 4COWA 4JTOA 5BNOA 1JYIA 1BEV1 3VKFC 3BKZA 1RUE3 2BW8A 2ES3A 1VAMA 5FREA 1H9WA 1XNTA 2V09A 5CFDA 3E97A 3AP6A 1GP5A 2C9KA 1VBC3
chains in the Genus database with same CATH topology
1W0PA 3AP7A 1CD3G 1OHFA 3KT4A 3JBG3 5BNNC 1S2BA 1VBB1 4I0BA 1ZZ7A 3ZFGA 3WW3A 5FPXA 3M7AA 5C9AA 4LBLA 1V9U2 4E4ZA 1YJLA 1MACA 1U5YA 2JG9B 2R061 4L97A 3VZLA 2RS52 3AJYA 4ES9A 1LJ7A 1SFNA 5GLUA 3BOWA 1RL3A 1IS4A 4LA2A 5D1IA 2DF7A 1QOSA 4ASMB 3AXEA 1ASJ1 1QU0A 3JQXA 2GNBA 5D8AA 2A6YA 2ZGKA 1K5MB 1BEV2 4MGKE 2WLPA 3R4DB 1MZEA 1X36A 3QH7A 4DFSA 1QXPA 1Y3TA 5JOWA 1UPIA 3CJIA 4HVOA 3Q9OA 3QLQA 4Q0QA 3H50A 1BYHA 1CQ9A 3WDWA 4I0AA 2HYKA 1UMZA 3VBHA 1U5ZA 3VBFB 1VBB2 3LA7A 1HQWA 5CVRA 1DQ5A 5F9TA 4PF5A 4JC1A 4IV1B 3CO2A 1V70A 3BODA 4M0NA 2R071 1X33A 2R062 2NZ9A 2LTNA 5DUVA 3RYPA 4XFGA 4IEZA 3WT3A 1OPOA 1QXRA 3N7KA 1C5HA 3KSCA 3AYDA 1LOFA 2XBO3 4CEYA 4BLJA 4XF4A 1QJX1 4C1XA 5E8AA 1VBD1 5FLJA 1O4TA 1XNBA 1C8NA 5C6CA 4DMIA 3TWIA 1RUF1 2XKOA 4FAHA 5A33A 5CA6A 3FLRA 2QDNA 4N53A 4FPKA 5J36A 4BIFA 3WZ1A 3L2HA 5H9RA 3SCFA 2VGDA 4JGZB 1YCIA 1CPMA 2R072 2FMDA 1YHFA 2WINB 4GMP3 3I7DA 4HK9A 2ZOEB 3J4UH 5KHJA 4Q1RA 3ZN6A 3VZOA 4YM3A 5CU1A 4HSJA 3FJSA 2ZGOA 4QQHA 4LBMA 1SQ4A 1APNA 2K2SA 1O5UA 4NHKA 4LTAA 5DZGA 2RM23 1QJX2 3H1YA 2WZPP 5BNNA 1VBD2 4LEJA 4UXAA 3VDDB 1FI2A 2D43A 1G9CA 2B42B 4RQPB 4YZ1A 4QGMA 1OQ1A 4AI1A 1RUF2 1FOD3 5GLZA 3O0WA 4Q4Y3 2EIGA 3M3IA 4LT5A 3M2MA 4QX5A 3ZXKA 4CDQC 1MEC3 4JDOA 1QJY3 2A71A 3ZX7A 5LRSA 2BPA2 1SMVA 4QD2A 3SCHA 2Y0IA 1PMIA 4AG4A 1ZYBA 1QDCA 1SEFA 1BVVA 2R043 2YYOA 3JQWA 5JOYA 4RHV3 3ZO0B 5ACA1 4FPCA 3LSDA 3NJZA 1Y7BA 2NQYA 3ZSMA 3AMNA 4K9SA 1L3JA 2Z79A 1ZZBA 1WMFA 5KXCA 1H1IA 3PJQA 5DDJ3 1ULFA 2WFF1 1JH5A 2PTMA 4E4SA 4A7KA 3A4UA 4FPOB 1M4WA 4FVVA 2QJVA 1Q56A 2UWCA 4IEVA 1B35A 1AYM3 4Q4W1 1E57A 2RR11 1F9KA 4KBBA 1RJ7A 3RMYA 3MLJA 1W6OB 4YARA 3PVOA 3E5QA 2GALA 3KMHA 2NLRA 4GH4C 1Z78A 5J09A 4LUKA 2Q1MA 4AQTA 1UIJA 5ACA2 3FE5A 5GZEA 3SCGA 1FAYA 1DGWX 1YI9A 1QY4A 2FZ2A 2AYHA 3VGIA 4MLOA 2XWJB 1UIKA 1KXGA 5CADA 4YW4A 2DU1A 4AI2A 2LM3A 2WFF2 1OOPA 3UJQA 5GZCA 4PIXA 5EJ3A 1IS3A 1XE7A 5KHGA 4F7ZA 1DF0A 4FTSA 4RQPC 1DZRA 4Q4W2 1M06G 2RR12 4OHZA 1EY2A 1RUH2 1ZVFA 2D6PA 3OF1A 2JE7A 1S0DA 3MIHA 3PMEA 3NAPC 4HK8A 1R1A3 4AVVA 1AR81 4PQ9A 4D7SA 3RI9A 4KL1A 5BY5A 3MPPG 1UU4A 1AHSA 1RUC1 4WM8B 4XFFA 3AP4A 1V6LA 2WA4A 4LULA 1QJZA 2Y38A 3ETQA 3POWA 1PVC1 2UYAA 5JOZA 3TAYA 5L7OC 1G6NA 2ZGMA 3O7OA 1AYN3 4CDQA 1PK6C 2D6OX 3D6EA 5KC6A 2XLAA 4H14A 5H9QA 4Q8LA 3KS7A 4MXWA 1VAVA 2D44A 2VG9A 1HRV3 1NE6A 1MZ5A 1RB8G 3X29B 2W0XA 4X6QB 1UF2C 3SMHA 4YRDA 2YC0A 1AR82 3AJZA 4R4ZA 3RJRA 2HEWF 1NXMA 4P9LA 4CRQA 1RUC2 4QHBA 3APBA 2X5IB 3GBWA 1AR91 1IS6A 1PVC2 4K6BA 4Y1XA 3U11A 4AVSA 3N7MA 4Z82A 4K7JA 1F2NA 1AL21 4B8EA 2VH9A 1COV1 1RUG3 4WVZA 3SH4A 1SFYA 4ONUA 3DPRB 5FMOS 5F6LB 2Z69A 1QWRA 1HXS3 1N1TA 4P9JA 4RGGA 4B3NA 4CP2A 5HBAA 3T1LA 5EXOA 3S0MA 1VALA 2D93A 3S6PA 4P9WA 1SCSA 2CAVA 1G9DA 1B09A 1RTVA 2D3PA 3E5UA 5K0UB 2C1FA 4LBKA 2PFWA 2UU8A 3JB8A 5KC5A 1LECA 4C0HA 2JX9A 5FBZA 3G7DA 2JE9A 1RGSA 1IKQA 3ASIA 2ZTNA 4Q4V3 1WGPA 3D4KA 2O1QA 4XXAA 3H0OA 3IT8A 1NG0A 5BPXA 3ILNA 4GB31 1JUHA 4LBOA 2NMOA 4N7IA 3WP4A 4YVSB 1XYPA 4Y20B 3NVCA 1AL22 4S2HA 4LA3A 1COV2 1EAH2 3IDEA 2XWBB 3HT2A 4RGAA 4WM8C 3IMNA 3BTAA 1VBE1 2BGCA 1SDWA 5H9PA 3ZMOA 2YXSA 2YZ4A 4LHNA 4L11A 3POYA 3NAPA 2WS91 1PVXA 3WG4A 4XMAA 4QPYA 2PQQA 4JQRA 1PGW1 3NW4A 2SLIA 1RHI1 1N1SA 3TN93 2LALA 1ZBE1 3K51A 2JG8C 5KBFA 2D5HA 1NOVA 1S0FA 1H0BA 4UW4A 2W68A 4AGGA 2MNGA 2G4IA 1RUD2 1G7YA 3VBOB 4GKYA 1PK6A 2R30A 5A32A 1AJOA 4GB32 3RSJA 4JVAA 2X8KA 4ATEA 1AR73 5HCBA 3W58A 4G9SB 4TWTA 3SHRA 1DGRA 4Q4X1 4PLOA 5IK4A 3GNEA 1DZTA 1VBE2 3ME2A 1PZ8A 2X5IC 2XHKA 4COYA 2WNEA 4N7UA 3AKQA 1N3QA 4XW3A 2WNVA 2WS92 1DIWA 1QNYA 1PGW2 3J8F3 5DUWA 4AWDA 4CDWB 1RHI2 4DINB 1PO23 4FQ4A 4WVWA 1ZBE2 4I0WB 5I91A 1WCSA 1LCLA 1PM7A 2NP0A 1YIPA 2W08A 3QCWA 4X8NA 4I09A 4AEDA 3ATGA 1BQPA 1OFSA 5L19A 1I1EA 4FOYA 4Q0PA 2XH6A 5GJ6A 4FSJA 2VUAA 4E2SA 4LBQD 4FT8A 2XJVA 2ZX3A 2Q1ZB 3B3QE 2VECA 1TMF3 3FMGA 4I3PA 5BNOB 1LOBA 4BQ1A 4FTBA 4HFSA 3PJYA 1VP6A 4LO6B 1QKQA 1YFUA 3ZFFA 1R083 5JR7B 2QVSB 4AFMA 3MW4A 5I0TA 3HBZA 3AZXA 1FYUA 1LOCA 1MQTB 4XF0A 1WBFA 1JXNA 1YIFA 1G9BA 1SCRA 1Z7S3 3H8UA 2WNUB 5EV7A 5C8WA 1QDOA 2D6NA 2WIIB 1ZA4A 4HPKA 3RNSA 2ZCWA 1FPN3 1POV3 2YHJA 4XILA 4QPGC 2B7YA 4L92A 3K48A 3JBG1 4RFT0 1QNWA 2D7FA 3FBYA 1VB4A 3VBOC 5C8CA 4P9GA 3V65A 2YGMA 2GAUA 4Y1ZA 2OZJA 2GMMA 2JG8A 4IQPA 2WQ4A 4KWKA 3UKVA 1QJU3 3TRSB 3AB0A 1ZBA3 4YVWC 4L99A 5GZFA 4AK3A 1BVP1 4CDXA 1SLLA 1CPNA 4D7TA 5KHHA 3PTYA 4BHPA 2QZ3A 2ZHMA 4JTNA 2PAKA 5AC93 5AFBA 2IFWA 3E5XA 3QOPA 4CDUB 2LUWA 1CAVB 4ZU5A 1REFA 1C1FA 4XIOA 2EXHA 2B9UA 2TNFA 2QFEA 4OHXA 2BVBA 2E7QA 2WJSA 3N4MA 2TUNA 3JBG2 2BTVC 3NSTA 1AZDA 5IK8A 1MS9A 2WC2A 3AP5A 4MGIE 1BKZA 2PLV2 4RS5A 4META 5DG2A 2VNGA 3TBDA 1WW6A 2DVDA 4LO8A 2IXKA 2KA3A 4HETA 4PBOA 1DZQA 1FX5A 2ZZQA 4FP2A 4IEWA 4B4RA 5T50A 5C4WC 2UURA 3INAA 2H0BA 5A33B 1OA2A 2XLFA 2E7AA 1A8DA 4AGVA 1KITA 3W9AA 2XBO1 3HD8B 3IPVB 4Z2WA 2YMZA 3WP6A 2GNTA 4TLFA 3AFGA 1JUIA 4XFIA 2D97A 5EWSA 4YW2A 4YGDA 1TME3 3GF6A 5GKAC 3MIBA 4AVBA 4UBGA 2D6KA 3USUB 4CP1A 3M1HA 1J3QA 3ELNA 3O0XA 2VW2A 5T5PA 2A70A 1Q43A 1W6NA 4QPIC 1ND2A 1R1ZA 2WNUC 4ATFA 2DURA 5KXDA 3BALA 4L2NA 1HW5A 5L73A 4YLZA 4YYOA 3WW4A 2DV9A 4GMP1 4H3WA 2A6XA 1S0CA 3UV9A 2DCYA 1PO13 1SACA 3WW2A 1XE8A 4AFBA 3QBQA 4A2UA 2XBO2 1LB2A 3HMYA 3VBSA 4I3GA 1RUJ1 4MXVA 1PIV3 2RM21 2ZHKA 4N43B 4QPGA 2BWAA 1FMD2 4AVAA 1Q8SA 3PVBB 3ZDSA 2Z42A 3V0BB 5KXBA 4WVMA 4IEXA 1ZZCA 1FOD1 2GH8A 4LE4A 1KS5A 1ONAA 4K8FA 4Q4Y1 1GNZA 4CEWB 1W39A 1OLRA 3HT1A 3A0KA 4YGCA 4YVWA 4BMBA 4MUVA 4WBBA 4C91A 1MEC1 1QJY1 3ZYIB 1U0AA 3FLTA 3I59A 3HQXA 3AM2A 3AZYA 1D2QA 3N36A 2HWB1 2H6BA 4N9HA 2R041 4R52A 4QM8A 3ZXLA 2GDFA 2TBVA 2ZGQA 4RHV1 3VHRA 1B35B 1RUJ2 1WLWA 2OPKA 1I3HA 2RM22 1XU1A 4OFGA 3B01A 4P14A 1KFXL 1C57A 5GLVA 4IV3A 2Q30A 1Q8VA 1F31A 2ZS6B 5DDJ1 3GZTB 1XNCA 3R0RA 2ZA9A 3EO6A 3OPZA 4NWVA 4EN6B 4QQ2A 5C4WA 1ULEA 3L2YA 4JV4A 3MIEA 1MEC2 1QJY2 1QF3A 3HR9A 4JGYC 1UZYA 4BA6A 4WM7B 2HWB2 1O4ZA 1QOOA 2XGXA 2CAUA 1OOPB 1X7NA 1NCRB 1LU2A 2R042 2UY9A 1C3HA 3RI8A 4AVCA 3ZFEA 2O0OA 1XNDA 2DWRA 4KU8A 2DU0A 1AR61 1LRHA 2GMEA 2YGLA 1O3SA 4B29A 1BCXA 3CU7A 4QPIA 4KH9A 4AHXA 2JD4A 3SNMA 1UAIA 1RC6A 3AZZA 4A7ZA 1ULGA 5JPNB 3DV8A 2QZ2A 5DDJ2 3J26N 5JDBA 4M3CA 3WW1A 4LBNA 3OYWA 4XTPA 1ULCA 4E27A 4OI0A 1GLHA 1RITA 1KJLA 1OD5A 4ZU4A 4QQLA 2Q4SA 2B5HA 3UKTA 1ENSA 4FAGA 4QGLA 1ASJ2 2R1DA 3AYEA 2IWGB 3FUOA 3VKLA 1UKRA 3PMSA 2CY6A 2A3XA 2XJUA 4MX3A 5ABJB 3RWNA 3VV1A 2GSYA 1AR62 3MPBA 4HVRA 5BNPA 1DGWA 1R093 1JW6A 4WZCA 1CR7A 4XBLA 5CIRA 1LR5A 3S30A 3AKPA 3V64A 2VVDA 4XQDA 4V1PA 4M01A 2OA2A 2JJ6A 4RR3A 4M0HA 5FOBB 4E2GA 2A6ZA 1RUI3 5CB7A 3LB9A 3OY8A 4AHZA 1U12A 3ZXGA 1HRV1 1I9RA 1NA1A 1DDLA 4XBNA 5EYXA 1SLBA 3WX5A 4Y4YA 1RINA 4KNCA 4EN8B 2D6LX 2E7TA 4I2OA 2JG9C 4FPEA 4DZGA 3IN9A 1H9PA 1CAWA 2ZJCA 1CAXB 4YG3A 3FLPA 3FZ3A 1NCRC 1I5ZA 1GANA 3AMMA 1K5MC 4UW6A 3ZYPA 3E6CC 3ILRA 4DRRA 1W6QA 4JGYA 3MLLA 1HXS1 3VUOA 1RMU3 1W6MB 1HRV2 2IXIA 5DUUA 4K40A 2XL7A 2GZWA 3VBFC 4K1YA 4KGGA 5T3NA 2E6VA 1AXYA 2PELA 5AVAA 4IV1C 2ENRA 2UYBA 3B94A 2ZMKA 1LTEA 4EWDA 3ZVXA 4XJZA 1FXZA 2HWD3 1DQ1A 3WHTA 1LGCA 1F5JA 1VRH3 2K0GA 1TNFA 2RMU3 5GALA 4NHMA 2RS53 1ENXA 2XB6C 4XPVA 2WT2A 2PHWA 1NLSA 5BV6A 2XPJA 5ABJC 2ZZJA 2O8QA 3ACLA 2HWC3 4JDMA 3WOGA 5GLTA 2VMIA 1WLCA 2UWAA 4N9IA 1YYNA 3OBTA 4BIOA 5IK7A 3PHMA 4C0BA 3GHNA 1Q8OA 3TN91 3ZSKA 2VOWA 1MS1A 4CP0A 3H9AA 4Q26A 3RQ0A 3GZUC 4L9BA 2CGOA 1D4VB 4JGZC 2XVKA 4LHLA 4Q8KA 1OMIA 4KGQA 1VBA3 4OI4A 4Y1YA 1GSLA 1J1TA 2ZKNA 4AQSA 1AR71 2GC3A 4CTEA 2RHPA 4HZFA 2W39A 2XJPA 4AQ6A 1HDKA 3BU7A 3SITA 1VLNA 3CF6E 4IESA 4YZ3A 3ES1A 4MH0E 1LGNA 3VDDC 3PVNA 2HWF3 1YI7A 4YW3A 3MDPA 4MVTA 1NZCA 2YDEA 3TN92 3ZXAC 1PO21 2E63A 4Y22B 2ZGPA 3KCYA 3M3EA 1OI6A 3RS6A 2ZGNA 5LK7B 1D4M3 4KU7A 1H4HA 4FPYA 1W6PA 1K5MA 1RJ8A 1DYKA 1DGRN 1H8TB 4AI0A 2DFBA 4XFHA 1AR72 1GNHA 3I2DA 4AW7A 2DFCA 3VKNA 1YRZA 2F6BA 3VHPA 4R8HA 3IDCB 1JHNA 4JRAA 3VBRB 1A78A 1IZ3A 1TMF1 5GZDA 1IPJA 3VBFA 4DOUA 3QACA 1GZCA 2MHFA 4XQWA 4BWOA 3S7EA 5F1RA 4F83A 2A7AA 1QJX3 5FQ0B 1IPKA 2AZ5A 4BMEA 3ES4A 5K8SA 4OLLA 2RE9A 4LBQB 3EJKA 1XXNA 1FNZA 1R081 3AKRA 1SLTA 3FBMA 4QQPA 4S2GA 4YZ4A 3ZMNA 4QU2A 4COZA 4W65A 3NV2A 3LCPA 2B39A 5J98B 1GQHA 1LEMA 1Z7S1 3LZZA 4AEKA 2UY8A 2H6CA 5BYNA 2BNNA 5A3MA 1LESA 4HKWA 4XETA 2DVFA 4PLMA 3AKSA 2MEV3 1AL0G 1FPN1 1POV1 4Y1VA 3FX3A 1F5FA 2D6MA 2BNMA 2A6WA 5EFUA 1BBT3 4XJ8A 3KT7A 3URFA 1X50A 4GH4A 1O5LA 1QJU1 3VBUB 3ZSJA 2ZPXA 2VU9A 2XL9A 2YY1A 1ZBA1 1C8M3 5I8YA 1R082 4B7KA 3AMQA 2ZBJA 1HV1A 5I8SA 3V0AB 1BK1A 1OQDA 2IC1A 3N35A 5AC91 1XQNA 4I02A 3R4UA 2AR6A 1Z7S2 1YNAA 1G9AA 3ZXEA 1AR92 1IQAA 5DG1A 4C1WA 1CJDA 1OQEA 1XU2A 3KGZA 1AX2A 4HSLA 4JDNA 5JSPA 1FPN2 5F5QA 1LOEA 4KWLA 4RQPA 3KT1A 1RIRA 1S55A 2VY0A 4UBHA 4XE9A 3OD0A 1ZRCA 3WDXA 3DN7A 1V6JA 2XVGA 1HLCA 1NCQB 4Y24A 5ACA3 2WWSA 1J1LA 3KQRA 2QKDA 1GQGA 1QJU2 1V6OA 3D0SA 2X53S 1ZBA2 3AK0A 3TOJA 2PHTA 2R6QA 5JVVA 3MI8A 5CAZA 2XG3A 5L7OA 4NN0A 1IKPA 1CAUB 1YJKA 1MS3A 1REDA 2CTVA 5AC92 2C9AA 4YW5A 1ZRRA 2VW0A 4PDWB 3PVEA 2IXLA 1ND3B 2E51A 4MSVA 1LGBA 3EQEA 1RUH3 1JBCA 4AI8A 4AXOA 1MZFA 4GWNA 5SV5A 5FO8B 2I45A 1HV0A 5CFCB 1QHDA 2GN3A 2DTWA 4UW5A 1OKQA 2C5DA 2DCTA 3B7MA 4AHYA 4M3CF 5JZGB 4FOVA 2VPVA 3O12A 2A73B 4AF9A 1F8VA 2ET7A 3VKOA 3WDTA 3WG3A 4AQ2A 4Z07A 5BUVA 1J59A 3DPRC 4PBPA 1PO11 1ALYA 1W6OA 4GIQA 2VOXA 3C3VA 2EXJA 5JWPA 3ZXDA 4AEJA 3I4IA 2R0FA 4F3JA 1NQJA 3ZSLA 1RVF3 2HEYF 1PIV1 2EAAA 4DB5A 2A6VA 1S1AA 5K9YA 4IEUA 1CIWA 4XJUA 4TYSA 5K0UC 1ULDA 4YZ5A 2EF6A 2ZX1A 4Q4X2 3VL8A 1GZWB 1PGSA 5GLWA 3U07A 4XBQA 1H2MA 1KDMA 5KXEA 3RDIA 4F8AA 1RUC3 5DZEA 5CFDB 1REEA 4QMAA 4YVSC 2I74A 2PHLA 3ZYJB 1WMEA 2IXJA 2D3SA 1KFUL 1XRUA 1G8WA 3ZIXA 3KM5A 4Y5Z0 1N3OA 3ZFGB 2P17A 5C9AB 1W2UA 1FV2A 3RG0A 3VZKA 1GV9A 1RUE1 4WM8A 1PIV2 3M4FA 3A0NA 1DFQA 3LA3A 4AFDA 1C5IA 1U5IA 3DF0A 1J58A 1PZ7A 1VBC1 4FPGA 3WNXA 4AEMA 1AVBA 3M3CA 5JAXA 2ZX2A 2DUPA 3CEWA 5D8AB 3WV6A 4R9BA 1AXZA 1ND3C 4BM8A 1DLLA 2JDZA 3CJIB 2EALA 5J7MA 1NE4A 5F6KA 5LEJA 1LODA 4M3CE 2WZR3 2Z5WA 4XHBA 2VOKA 3VBHB 4IL7A 1EPWA 5T54A 3UK9A 3LSEA 2YROA 4XF3A 4LUMA 1AL23 5JI9A 1EAH3 1HX6A 5E16A 1X82A 1S0EA 1RUE2 4RA0A 3WR0A 4CDWC 4DRVA 4YGEA 1HRI3 4LNVA 1OFNA 2DUOA 1V6IA 2X5IA