2XLAA

Structure and metal-loading of a soluble periplasm cupro-protein: cu- cuca-closed
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
233
structure length
233
Chain Sequence
HTFDDIPMPKLADPLLIYTPANEIFDIASCSAKDIGFAIAHAQIPPGGGPMPHIHYFINEWFWTPEGGIELFHSTKQYPNMDELPVVGGAGRGDLYSIQSEPKQLIYSPNHYMHGFVNPTDKTLPIVFVWMRNEVAPDFPYHDGGMREYFQAVGPRITDLNNLPELTNAQRAAFASEAPKYGINQSSYFMEYVNTISDKLPAQIAKLKNDKDLERMVEVIEAFNRGDKSVTCS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords SLL1785 PROTEIN
publication title Structure and Metal Loading of a Soluble Periplasm Cuproprotein.
pubmed doi rcsb
source organism Synechocystis sp. pcc 6803
total genus 63
structure length 233
sequence length 233
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-07-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2xlaA00
2HKXA 2XLAA 3H7JA 1Q3EA 2XLFA 4LUKA 4XF1A 3WW3A 4L11A 5J3UA 3FZ3A 3FWEA 3KGZA 5FLHA 2ZKLA 1CAWA 4Q0VA 4DINB 3GBFA 1ZZBA 5LRSA 4XF3A 3E5UA 2XKPA 4IEPA 1G6NA 3KSCA 2QCSB 1WLTA 2VECA 1J1LA 4HVOA 4AVCA 5LEKA 4I09A 4XFFA 1YFYA 4GULA 2QVSB 4PIYA 1Y3TA 3H50A 4AQ6A 1H1MA 2UYAA 4IERA 1YUDA 3ES4A 3I54A 3OTFA 1NE4A 4HSLA 4IEUA 1CAUA 5EFUA 1ZVFA 4Q29A 4KU8A 4WBBA 2B5HA 1H1IA 5J7MA 2PYTA 4N9HA 1RTVA 2PQQA 3KGLA 4HSJA 3PVBB 2CAVA 1TQ5A 3ST7A 3E6BA 1WGPA 2GC0A 4KU7A 1SFNA 1YWKA 3FX3A 3IDCB 3BU7A 3NW4A 4HBNA 5I0SA 2QDRA 2WC2A 4QXKA 4QX5A 4X6RB 3R6SA 5T3NA 4LUMA 3TNQA 2MNGA 4XFAA 5CU1A 4XFIA 4ORFA 3TNPB 1CAXB 4Q0PA 3EQEA 4EROA 4UXAA 5FPXA 3FHIB 4LA3A 2VQAA 5I0TA 4FBFA 4K8FA 3E6DA 4I02A 3S0MA 1CGPA 4XFGA 1O3TA 5EZWA 3M70A 4E2GA 4AVBA 4HN0A 1FT9A 2XL9A 4JTOA 4EWEA 3ES1A 3EHKA 5FLJA 3IDBB 4ZU4A 5FDBA 2UY8A 3G7DA 5I93A 3NJZA 1J59A 2B8MA 4XF9A 1Q43A 4QGLA 4UBGA 4CYDA 2GAUA 2IC1A 3RYKA 2H6CA 3EO6A 2Q4SA 5I0UA 3IWZA 2O8QA 4HMZA 3RYPA 1FXZA 2D93A 2BNOA 3ZDSA 5BV6A 2GU9A 3KCCA 1ZRRA 3RZZA 1WA4A 3LA2A 1O4TA 4EWDA 4XFHA 4FAHA 2Y0OA 2B9UA 2FQPA 2GC3A 1UCXA 1QXJA 3SXWA 1XRUA 2GZWA 5KHJA 3CJXA 2Z2SB 3OCPA 1OMIA 1JUHA 3QACA 2N7GA 1QY4A 2QJVA 3WW4A 1DZTA 3H1YA 2IXJA 1ZZ6A 1UPIA 1O3RA 3DV8A 4LULA 4JTNA 3KMHA 2EVXA 1X8EA 3H9AA 4JVAA 3NL1A 4MUVA 5FQ0B 5JSPA 2Q1ZB 2PAEA 1ZZ7A 3NSTA 4IEVA 1EP0A 3UKVA 4N9IA 5FCCA 1ZZCA 3SCFA 3SCHA 5E1RA 4I0AA 3DKWA 1CAVB 4BHPA 4E2SA 4OLLA 3GYDA 5F1RA 2VPVA 3ETQA 1PMIA 2QNKA 2IXLA 3SMHA 1YFUA 1RL3A 1O5LA 1L3JA 3CLPA 3BPZA 3LAGA 4FT8A 1UIJA 1Q5OA 2BGCA 1DGWA 1RUOA 1XE8A 2Z69A 3H3ZA 3U10A 4R52A 3BCWA 4HZFA 2ATFA 2V09A 4MZUA 1NYWA 5CADA 2ET7A 5C8WA 4UBHA 5BXXA 2FMYA 2PFWA 1Y9QA 1V70A 3I59B 2P17A 2C0ZA 1UW8A 2Q0AA 3B02A 2IXCA 4I01A 1I6XA 4WZCA 4KL1A 3ROUA 5KHHA 5KHIA 1O3QA 2ZCWA 4B29A 5BUVA 1DGRA 4I3PA 4OFGA 1ZZ8A 4O9EA 2K0GA 4P9GA 4XF4A 4QMAA 3MYXA 3D0SA 4RD7A 4Q0QA 4O9GA 2BYVE 1LKNA 5D1IA 2CAUA 4HN1A 1CAWB 2CGPA 1X8MA 5CVRA 3PLQA 1ZREA 3LA3A 1LB2A 1LR5A 2GC2A 4YNIA 2H0VA 2HJIA 5FPZA 4MV2A 4H7LA 1QWRA 3L2HA 1RGSA 4HVRA 3UKTA 1CX4A 5AVPA 3OF1A 3PNAA 3MPBA 2PHDA 4YRDA 4F7ZA 4XFCA 1XE7A 4XFBA 3DL3A 2E9QA 2IXIA 3C3VA 3ACLA 3CO2A 3N4MA 2GH2A 2UYBA 1DZRA 1I5ZA 5I0RA 4ZU5A 4YARA 2OZ6A 4IESA 1NZCA 1LRHA 4PIZA 1CAUB 3HT2A 3I7DA 4Z07A 4EWAA 2OZJA 3H3UA 1YLLA 1YFWA 5J48A 3FJSA 1EYBA 4XF0A 2XKOA 3S7EA 2I45A 1CAXA 4Q0SA 4X6QB 3WW1A 4D7TA 2XGXA 4YSFA 2GC1A 1VJ2A 4XEZA 3H8UA 3OD0A 4WVZA 5JR7B 1OD5A 1GQHA 2D40A 3NKTA 3USSA 3WW2A 3HQXA 2CV6A 3LZZA 4AQ2A 2OYZA 2BNNA 3DN7A 4QM9A 4I2OA 3SHRA 1O3SA 4ZU7A 2ET1A 1OFNA 3FFQA 1EPZA 2OA2A 2ETEA 2BEOA 2PA7A 4IEOA 1UIKA 1VP6A 4LEJA 3E5XA 3VHRA 4YYOA 2D5HA 1GQGA 2OPKA 5JSRA 5I8SA 1U12A 4HLTA 3RYRA 5JAXA 3E6CC 4AXOA 3SCGA 5LEJA 2PAKA 3LOIA 5HI0A 2XLGA 1ZNPA 3E97A 5KHGA 1NXMA 1NE6A 3D82A 4KWKA 1SEFA 3H1MA 3QOPA 2F4PA 5BPXA 1YFXA 2K9ZA 2WFPA 4QGMA 3O14A 4J1WA 5C6CA 3S7IA 3RDIA 3IIAA 3LA7A 3LWCA 1IPJA 4IEWA 4MGZE 5FLIA 3H1WA 5I8YA 5I8TA 1O5UA 4BYYA 2UY9A 2PTMA 3CF6E 3E5QA 4QM8A 4PIXA 1RUNA 1OI6A 2PAMA 2PHLA 4I0BA 3HT1A 4AVAA 2O1QA 1X82A 1QXRA 2DCTA 3ELNA 2IXHA 5FQ0A 4F8AA 4BIFA 1VR3A 1J58A 4L2NA 4D7SA 3UKNA 2XL7A 4XETA 3IBMA 2H6BA 2Q30A 3MDPA 1FI2A 3HIFA 4EV0A 3D0JA 4MGYE 4MGIE 4MH0E 4PJYA 4IEZA 1CAVA 4Z82A 3U0ZA 3RPQA 3M3IA 3H7YA 5KHKA 5JSOA 2EAAA 3JZVA 4BH9A 4LTAA 3RNSA 5I91A 4TLFA 3CL1A 2EA7A 1O7FA 2XHKA 3BB6A 3CEWA 4HVQA 1ZRCA 4META 2MPFA 1ZZ9A 1RC6A 4IEYA 4MX3A 3EJKA 1YHFA 4NVPA 4LA2A 5JCTA 4A2UA 1ZRDA 3BALA 4ONUA 2D5FA 3MZHA 1IPKA 1J3PA 5LRRA 1ZRFA 4R8HA 1EY2A 4QGNA 1SQ4A 1X7NA 4J1XA 4KWLA 4FAGA 1J3RA 1PM7A 3FE5A 4IEXA 4IEQA 3I59A 2KXLA 3U11A 4IETA 4JV4A 4Q0UA 1ZX5A 2MHFA 5E16A 1HW5A 4KWJA 1J3QA 2IXKA 1UD1A 5K8SA 5BY5A 3NVCA 4E2QA 2BNMA 4LLOA 3OGJA 4MGKE 5KBFA 3EBRA
chains in the Genus database with same CATH superfamily
2VM9A 1QQP2 2HKXA 2XLAA 2AH2A 2RS11 1AJKA 2XLFA 1CQ9A 3MW2A 4H3WA 3ZXEA 1SLCA 5CEHA 1AYM1 2WT1A 5LY2A 3WUDA 4YWAA 3T2QA 1K42A 4Q4W1 2KD7A 2WT2A 2ZKLA 3FMGA 1T6GC 1CAWA 1TMF2 5JOYA 3A0KA 4MO3M 5FP8A 3GBFA 4DINB 3KD4A 2PXJA 3K4AA 3MLKA 4LOSA 3BPSA 4GWNA 4HK8A 3E5UA 4CCDA 2XG3A 3C2UA 4IEPA 5FP7A 2ARBA 1JU4A 3KSCA 4LJHA 3LIGA 2VECA 3WP3A 1NOVA 2P6CA 4YGEA 5FZCA 4I09A 4I3GA 2X5IB 2ZX1A 4XFFA 4KNCA 4A3XA 4P9JA 1H2LA 2QVSB 5C4WB 4PIYA 3ZPOA 2NM1A 3FUOA 3VZJA 1H1MA 2CGOA 1Z7S2 1YEWA 4RL7A 1JI6A 4FTSA 4HT1T 5GZDA 1VMHA 3ILFA 4N43C 3VBUB 4YZ5A 3OTFA 3QH6A 1H4HA 4TSVA 5K4LA 2YUEA 3I3EA 5JXHA 1RUI2 3AMPA 5A3OA 4OVEA 2LUWA 1IQDC 1IS4A 3AVRA 1V6KA 3ORJA 1ZVFA 4WBBA 4KU8A 5A7WA 3SKVA 2VR4A 1OLMA 2A5ZA 4IDZA 4FPLA 2PYTA 1RVF3 1S0FA 2WO1A 1ENQA 1DZQA 2JDKA 4NHMA 2PQQA 5F9TA 3TN93 4HSJA 1HQLA 3PVBB 2CAVA 3DEMA 1QQP3 3NAPB 3E6BA 1W99A 3N7LA 5FJKA 1U5YA 3AFKA 1FNYA 2CL2A 2DURA 2X53S 4MXVA 1DLCA 2XJTA 3NW4A 5I0SA 3MV11 5SV5A 4ES9A 4QX5A 2W0XA 2E53A 1TMF3 4LUMA 1WD3A 1OLQA 5T3NA 3TNQA 3GZEA 4DPNA 1QOTA 1CJDA 3MUZ1 5BNOC 2MNGA 3EMRA 4LORA 4P00B 1XC6A 4LKEA 1DGLA 4XFIA 4ORFA 1JOJA 4Q0PA 2E51A 4KH9A 1GANA 5J36A 3WF3A 1CESA 5FPXA 3AB0A 4Y22B 1BK0A 3TEYA 3NV2A 2WJSA 5J98B 2ZGUA 1JZ2A 3N9NA 5LBBA 3NJYA 3E6DA 4I02A 4Q1RA 1D4VB 3J7LA 4RS5B 4KMQA 3TEWA 3T2PA 1CGPA 3BODA 3IDAA 2VNVA 4D69A 1H6YA 1O3TA 3K48A 1ZA4A 5FMOL 2NYYA 3OGGA 3RI8A 4GH4B 1ZYBA 2Y34A 3ZFFB 4AVBA 4BCUA 1PX3A 2AGSA 1H0BA 4MLOA 4BZ4A 2HWF2 3I4IA 4EWEA 4QX7A 1M06G 5GZEA 2CYFA 3ES1A 3I2HA 2HEYF 3DECA 5FLJA 4RQPC 4DXSA 3WCSA 3IDBB 4O65A 3UNPA 3OYWA 5A7OA 3DGTA 4YW7A 4OUMA 3W21A 1WD4A 3ZFEA 2EIEA 2HWD1 5C8CC 4C1XA 2QQJA 1K5MA 3KV5A 4AI0A 2D6MA 2J1SA 4OQ9A 3FBMA 1RXGA 4UBGA 2JX9A 3MBWA 1AR82 1HB2A 5F3IA 4AGRA 5DG2A 2ZGQA 2IC1A 2GNDA 1XBFA 2R32A 4YVSC 4AQTA 5DMYA 1XNAA 4LIUA 3WHUA 5L7OC 4EZ4A 1G86A 5DAWA 1LECA 5FWJA 3HBKA 2VOWA 4D6RA 5I0UA 3O0VA 4LBQD 3IWZA 2ZOEB 2O8QA 4HMZA 2GP3A 4AAXA 1RUC2 2CWMA 1U0AA 2VW2A 4HPKA 1YI9A 4JCKA 4DXRA 3O5SA 1RIRA 2GU9A 3Q8BA 1RUF1 4Q8LA 4QQHA 2E31A 2WQZC 1K45A 3VKLA 2W68A 4XFHA 3USUB 2Y6FA 2YV8A 1AL0G 3CZJA 4EWDA 4FAHA 1RB8G 2WLPA 2FQPA 4P5YA 1QDOA 1P8JA 4AF9A 1XRUA 4TWTA 2VMIA 2GZWA 4CCOA 5KHJA 4A7YA 2P2KA 3CJXA 4AEJA 4CDWB 2VZQA 1C8M1 1JUHA 3QACA 4XMIA 4EQVA 2X29A 1XB9A 5A80A 1QJZA 3WDYA 4JGZA 5ANNA 4XJWA 1DZTA 3WW4A 2IXJA 1ZZ6A 1UPIA 3JUUA 5C9AA 2HWF3 1ODMA 4BPZA 5DAQA 3ZSKA 3JD72 4Q4X2 1VBA3 2W46A 4A41A 2J7MA 1VE0A 4OHVA 1HB1A 2CNAA 3VBSA 5JDBA 3H9AA 4JVAA 1IOAA 1LESA 1PIV3 1UZVA 1APNA 4ITCA 1S0EA 5JSPA 5FZ0A 4NIGA 1EAH1 4E4ZA 3BUCA 2OXBA 1AR83 3NSTA 4BQ4A 1WA6X 5FZ4A 1Z0HA 2W2IA 4Q4V1 1GNHA 4QHBA 4W65A 5F5CA 1ND2B 1VALA 5T5LA 1JUIA 3KHCA 4FTEA 4LHKA 3AL6A 3PVOA 3UKVA 2EXIA 3RQ0A 3AZWA 1REEA 3VV1A 5K0UB 2VMEA 5FMBA 4D8MA 1PGW2 3GYDA 2AZ5A 2A70A 4ZS3A 2X10A 2OUHA 1CWPA 2ARCA 1YFUA 1GMMA 2SBAA 2XWBB 3H3LA 3WHTA 4BXFA 4NHYA 4CDQA 2NMNA 4DZGA 5FZOA 3IN9A 3BPZA 3O0XA 1WCQA 3AKQA 5FP9A 2G9ZA 5FYUA 4AVSA 2ZS6B 1XNKA 4HANA 1QHDA 1Q5OA 3HQRA 4JGYB 4Z1VA 4UAPA 2JXAA 3B01A 3MF6A 4XBNA 1XE8A 1FV3A 2YYOA 3FC0A 5FZEA 2P3KA 5FZAA 4G3YC 2VMCA 3U10A 3MLLA 5DAVA 3RMYA 3VB9A 4XHBA 3JD73 1OOPB 1DGWX 3LDKA 2ET7A 3KWVA 1LEDA 4Q4X3 4QX2A 5C8WA 1N47A 5A6YA 2R1BA 4URAA 1NG0A 2D7FA 1V70A 1AX1A 1W6OA 2A6WA 4QPGC 1UW8A 3IB3A 3UJQA 4NN0A 3VGIA 5LY1A 5KXCA 3N7JA 1UO9A 5CFCB 1SLTA 3DYMA 3LCPA 2VD7A 4W6YA 4Y3OA 4CZSA 2AYHA 2Z4FA 4Y5TA 5A3UA 5IYYA 2ZCWA 3GCXA 3WNOA 3S6PA 4BE3A 2QQWA 1H6XA 2WO7A 3WSOA 4YM2A 4P9WA 1VBD2 4PQ9A 5FMDA 4XAEA 1CD3G 3D0SA 5LBEA 1NLSA 5FJHA 2OQ7A 3MPPG 3POYA 1NLRA 4BQ3A 3LSEA 4XC9A 5EV7A 5T55A 1O4YA 4MVTA 2R7EB 2AC1A 4D3WA 3J9SA 2X5IA 4CEWB 3ZFEC 1UF2C 1X8MA 4NAOA 3AYCA 5C4WA 4NHKA 4S2FA 2BP6A 2RDQA 2Y64A 4WVVA 1UX7A 2GC2A 4YM1A 2H0VA 2QQVA 5LASA 5FYYA 3KF5A 3M4FA 3NMBA 2P4EA 4H7LA 3SC7X 1GQPA 1PX4A 1STMA 2DTWA 3TWIA 4IGQA 4HVRA 3WP6A 2OT7A 1UMZA 4R9DA 3MIGA 1NCQB 1KJLA 3ZOIA 3BTXA 3WUCA 2VULA 3DL3A 2E9QA 5IHRA 4L92A 4NHLA 4UFHA 3QH7A 1S1AA 2DV9A 2VUJA 5EYXA 4CCLA 5C5TA 2VZ1A 2UYBA 3CZUA 2VCMA 4O61A 4ZU5A 5I0RA 4YARA 1A8DA 1C8NA 1TNRA 1VBB1 1DQ4A 2OZ6A 1NZCA 4A7KA 3ZFGC 4IUGA 1A6CA 3P6BA 3I7DA 2LM3A 4NUBA 1CPNA 5A7PA 2OQ6A 1RJ8A 5FKBA 4AFCA 3H3UA 2R0HA 1YLLA 2WZR2 3N9LA 4MGQA 4V2VA 4IV3C 1LGNA 2VCCA 4NPRA 4JGZC 4OHWA 5ANQA 1UN1A 3FJSA 3KB5A 1B35B 5JOXA 3L2YA 5C9AC 2XKOA 5C71A 1GP5A 3FBYA 5GLUA 1KXGA 1C8M2 4Y1VA 1AZDA 1HRI1 4M0NA 3RWNA 4Y22A 1BJQA 3IMMA 4QX1A 4OHZA 1UOFA 5IAVA 3THTA 4COUA 2DDUA 1U5IA 1AR61 4TN7A 5E8AA 2ZX4A 3OD0A 3OPWA 4WVZA 4RS5A 4LO4B 5JR7B 2Q8DA 3O1RA 3WDUA 2ZGSA 3O1OA 3FHQA 2DVGA 3K46A 4IE0A 2BERA 5ABJB 2PLV1 2Y8KA 1CIYA 4GH4A 3W9AA 2DCZA 2DVBA 3WW2A 3ZFFA 5A3MA 4U2AA 1XNBA 2OYZA 1WMEA 3DN7A 2JKBA 3CNAA 3ILRA 3VZKA 5GALA 1R1A1 2HBUA 4TTGA 1S2EA 2VW0A 3J7NA 3FFQA 4UI9L 4P5HA 2OA2A 1X33A 5J96B 1OPMA 4N7IA 3VZMA 4B4RA 5IAXA 2R16A 4CDQC 1RUG1 1YYNA 3OUJA 1V6IA 3E5XA 5IJRA 4H7MA 4YYOA 2BUKA 3RZKA 3P5BA 3POFA 2OS2A 5I8SA 2FZ2A 1POV1 1SFPA 3CJIA 3R0RA 4XCBA 5FK8A 4DRVA 3LF7A 4EE2A 3RYRA 5LA0A 2E6VA 3LKJA 2WZR3 3AMHA 5CKMA 3R05A 3SCGA 4RR3A 1L7LA 3QBQA 2WNVB 1S0DA 3B9CA 2B42B 2WABA 1LOCA 5IATA 1NE6A 1C8M3 3D82A 3C7HA 4MSVA 3WX5A 5A6ZA 5AFEA 4RHV1 1JYNA 1BMV1 3AKPA 5DN2A 3VZOA 3USUA 2A71A 2WFPA 1G7YA 3HWJA 2XBO2 5KXEA 5IK7A 1H4GA 1EPWA 2ZGPA 4RSUA 5B4NA 5J1XA 1LODA 4X8PA 4CU7A 1RXFA 3VDDB 3LA7A 4KBBA 5E6HA 3LWCA 3U4SA 2VG9A 1VPHA 3H1WA 1XE0A 1FATA 2VAUA 4BYYA 3V0BB 2I74A 4CDXB 3GCWA 4UW6A 4LE3A 2VZUA 5ERLA 1NKGA 1YO8A 2WYSA 4I0BA 2DWRA 4Q4V3 3HT1A 4XAAA 3VZNA 4COZA 1MZEA 3ACIA 1WMDA 2CWSA 2X5IC 1OA4A 1SLIA 2DVDA 4XQWA 4MADA 1VR3A 2FMDA 2P3IA 4A6SA 1J58A 2VC9A 4L2NA 4R9BA 3N3HA 5FFOC 3KCYA 1RJ7A 2H6BA 4FXKB 4FXGB 1DU3D 3D0JA 2YPDA 1ND2A 4MGYE 5JUVA 3AZXA 4BA6A 3PIJA 5JWPA 5G05L 3U75A 3KS7A 3GJAA 3VBOB 3IT8A 4IEZA 4CCJA 4HKLA 3I3BA 2JD4A 3P1IA 4Z82A 5K0UA 2C9AA 5J37A 4ATFA 2ZEYA 5CB7A 5JSOA 2EAAA 2D6PA 5FK7A 1QU0A 3WXPA 4Y5SA 3VBFC 3BKZA 1HQWA 3AKSA 4OHXA 3HN1A 1C5HA 4META 2MPFA 4KGGA 1W6QB 1RC6A 2JG8C 2R30A 3ALQA 4ZKTB 1HRV2 1CVNA 4JGYA 2HWE1 1W8HA 1YHFA 1GFF2 4AHWA 3LDBA 4AFBA 3INAA 2RMU1 2DUQA 5JCTA 5FY4A 1VBB2 2D5FA 2E7TA 2J42A 2LROA 3MIBA 1IPKA 1W90A 3MZHA 2XJSA 5LRRA 4ARYA 1ZRFA 4Q26A 1IQAA 3PUIA 3Q9OA 1RMU1 1LGCA 1OT5A 1SBEA 2JDYA 3GDBA 1SQ4A 1F31A 3AFGA 2QDNA 4XURA 3BTZA 1OOPA 3PUSA 1PM7A 3W5MA 1W3XA 3OPZA 4P9XA 1LOEA 1D0HA 2ZXQA 5I0DA 3LIHA 1D7PM 1MEC2 2MHFA 4BK4A 3QCWA 3ME2A 2Y6JA 1HW5A 5CFCA 2YPJA 2YU2A 3FUQA 4YM0A 1H2KA 1BBT1 4FOYA 1KFXL 1PO12 5JPNB 5K8SA 5FOJB 4GH4C 1RHI1 3ZFFC 1OPOA 3JU9A 3KV4A 1CIWA 2VOXA 3TRSB 4BK5A 4XTMA 1Q3EA 1SLAA 1JYWA 2VW1A 4L11A 2JE7A 5FO7B 4BLJA 5J3UA 4FTBA 3FZ3A 4XTPA 5FZ3A 3KGZA 4PF1A 5FLHA 5EPAA 5DPNA 2R062 5C3PA 3NO8A 4CEWA 1R1A2 1OF4A 4OMCA 5FREA 2O0OA 1W2OA 2WS91 4BJ0A 2JIGA 2WWJA 5LA9A 1OUSA 1J83A 3A23A 1KDKA 4GMP1 3T0AA 3HPNA 1LU2A 4B8EA 5JIAA 2XB6C 1D4M1 3R4DB 2ZTNA 3CJIC 2QCSB 1RUG2 3T4HB 3KHBA 4C91A 5F39A 4HVOA 3WNMA 2FDJA 5DZGA 1XPWA 5IWFA 4GZ9A 4A3ZA 3OJBA 2JE8A 3WP4A 1VBB3 4RR3C 1A3KA 3OD4A 3PU8A 4OMDA 1YFYA 1W03A 4XUPA 1NCQA 4GULA 5CAZA 4GB32 2R1DA 4CP1A 2BOJA 1AVBA 1TEIA 1Y3TA 1DG6A 1GP4A 3WZ1A 1UAIA 5JMOA 4AQ6A 4QDSA 4IERA 2ID4A 3T08A 4WM7B 1ZBA1 3KT7A 2VXJA 3ES4A 4XZPA 2A6XA 2ORXA 3I54A 1NA1A 4HSLA 4NIHA 1RUJ2 4AEKA 5AC92 4COWA 5ISLA 1LCLA 1H1IA 3OGRA 5C3RA 5J7MA 4AFDA 4DS0A 3U37A 4YLZA 1OVPA 2CTVA 2RS31 2FDFA 3D5OA 2IVJA 4Y1UA 3KGLA 1B35A 2D98A 3WR0A 2RG4A 4PF5A 2B7YA 3NV1A 3GZTB 4KWUA 4JAAA 3ZYIB 3ZYJB 1YWKA 3IDCB 4GWIA 5D21A 4ZS2A 4P9IA 4NIAA 1W8FA 4HBNA 2FDKA 2A7AA 3JQXA 1PMJX 2QDRA 2R063 2UWBA 1V6JA 3JQWA 1F4AA 4LIVA 1R1A3 4QXKA 3WDWA 5IK4A 1K12A 1S0JA 4FPOB 4XFAA 4FOQA 5CU1A 4CDUA 2WNOA 2O14A 3Q8EA 1G9CA 5FYTA 4A7ZA 2W95A 1EUTA 4EROA 4GIQA 4L9BA 4EYUA 1C57A 5JZGA 1JN2P 4UXAA 1ND2C 2ARAA 3ITQA 1RUG3 3RZMA 3M3QA 1US3A 3I3QA 1YQ8A 3BYWA 4K8FA 1PK6B 2SLIA 4FSJA 4CCMA 2VZOA 4D6SA 1Q8SA 5K0UC 3I2KA 4WM8B 4GB33 2ZA9A 3I2OA 5HCAA 2JB4A 4FFGA 3M70A 2P34A 1W0PA 2P3YA 2X8KA 4K40A 4HN0A 5A7SA 1FT9A 4CUCA 5FPUA 1RUJ3 2ZX3A 1OH3A 4K1ZA 5AC93 1HXS1 3HD8B 1DIWA 4JGYC 3GZAA 1OA3A 1PGL1 5FDBA 2YGLA 2UY8A 1LEMA 1PZ7A 1L7RA 2Y38A 5I93A 2XUEA 3RVHA 3SQOA 2FDHA 1MS5A 2WNVA 5A32B 3AKRA 4DXZA 3BTAA 1HDKA 1SG3A 2E7QA 2QQLA 3AC0A 4IV1B 4M3CF 2JD9A 1BCXA 1C5IA 1GBGA 1DYKA 1WCDJ 1VLNA 3EO6A 5FP4A 2YY1A 2Q4SA 1XU1A 1AR71 2XONA 1BK1A 1YIFA 3F95A 1O91A 2YHJA 3K4ZA 2Z79A 4UFKA 4UW5A 4C1WA 3NQHA 1FXZA 2D93A 4CP9B 2BNOA 2WINB 1WLCA 1WCKA 3VDDA 1QDCA 1C4RA 2PQSA 3AP5A 3LQCA 1W8WA 1ZRRA 4PLNA 1VBC1 1W2TA 2Y6KA 3AM2A 3LA2A 1OC1A 2BVVA 3GHMA 1AHSA 1RVF2 2XOMA 5A7QA 4PDWC 5IUQA 4GD4A 2Y0OA 2B9UA 2YBSA 3UK9A 4CDXA 5HCHA 4B4PA 1NZIA 1SFYA 4CVUA 3N9OA 1PNFA 4NWVA 1RHI2 2AEYA 3SXWA 1QXJA 2HH9A 2VZ3A 1MR5A 2WDBA 1EV12 4JKKA 2BV4A 5BYNA 3HNMA 4K3UA 3ZMNA 1ND3B 4A44A 2VVFA 2N7GA 5FYMA 1QY4A 4IW3A 4FCAA 5KC5A 2FDIA 3UV9A 1O3RA 4TLGA 1JMUB 3DV8A 3PHMA 4LULA 4M0HA 3KMHA 1JHJA 4HKOA 1QJU1 2AEZA 2W1SA 4ET7A 4UFIA 5EYYA 2J1VA 1CZTA 4QKFA 3VBOA 4F83A 1QNYA 4MUVA 5FQ0B 2ZX0A 1H9PA 5EHDA 5JI7A 3AJZA 3WG2A 2HWE3 4EN9B 2PAEA 4LXLA 2HYKA 4CRQA 2RMU3 1H2MA 4LK6A 5GZFA 4Z8BA 4AHYA 1YRZA 2PHXA 4FPGA 2QQUA 1JH5A 1NA1C 3M7AA 1O8SA 5FZMA 1EP0A 4Y5Z0 5FZBA 2QQKA 2VQUA 5FCCA 1SHWB 3K51A 2LS6A 4YW2A 3SCFA 4BWOA 5KXBA 5E1RA 5A1FA 3BU0A 4I0AA 4LBNA 3DKWA 4FPEA 4AEDB 3HEIA 4XXPA 4BHPA 1IPSA 4E2SA 4OLLA 2UWCA 3AP6A 1KFUL 2A3YA 4P9LA 4E4DX 1PMIA 1B35C 4XUQA 1RL3A 2W92A 1ZBE2 1I5PA 2Z5WA 2ENRA 5HXMA 3MFAA 1VB4A 4BQ1A 1DQ1A 2WWSA 1RHI3 5EJ3A 2HWC1 4FT8A 2RR12 1V6OA 2JIJA 2W87A 3VHOA 2BDRA 1EV13 2BGCA 4LHSA 2ZGKA 5L36A 1SMVA 2DFCA 4GKYA 4S2HA 1D0GA 2D44A 2Z69A 1OVSA 2W52A 1I3HA 1LHWA 5FZIA 1HV1A 4CDUC 3PU3A 3PL0A 2Y33A 5FO8B 2FCTA 4HZFA 3ZYHA 4CP0A 1Y9GA 5JZGC 4YGBA 4MZUA 5A1LA 5C7GA 2I2SA 1H8TB 4QQPA 3WF2A 3I2JA 3OY8A 4KBZA 4UBHA 4QPYA 2FMYA 2JG9C 5CG9A 2P17A 2VQTA 3MW3A 1AJOA 2C0ZA 2IZWA 3ZSJA 4D7YA 1NT0A 4LBQA 1NY72 2WT0A 4I01A 4IQPA 1OF3A 2E32A 2WO3A 5FY0A 3WDVA 4KG0A 1I6XA 4BQ5A 4RGAA 4KL1A 5BNNB 1ZA7A 5KHIA 1O3QA 4YGCA 4CUGA 5F2SA 4B29A 5BUVA 3T0BA 4I3PA 3WVJA 1QJX1 4N90A 4OFGA 2NLRA 4O9EA 4CXXA 4XF4A 5F5AA 3MYXA 4E8CA 2JDNA 5FWEA 1ZBA3 3M2MA 4O9GA 1FMD1 5FYSA 5IFPA 4GWMA 3DYOA 1VBA2 1Y43B 4Y4YA 5A3LA 2J1UA 2VUCA 1QIQA 2VOKA 4HN1A 2DVAA 4WVMB 2CGPA 1YQ5A 1HXS2 1PO21 2WNVC 5CVRA 5T50A 1R081 1YCIA 1ZBE3 2VOTA 4IE6A 1PIV2 1X50A 1LB2A 4H55A 1LR5A 2PHRA 5JOWA 5EIYB 4YNIA 2RS33 4W8JA 4MV2A 3IMNA 2RR13 1Q8PA 1PVXA 3L2HA 5ACA1 1ENSA 4DY3A 4N7UA 5B4XA 4RYDA 5APAA 2GP5A 3WQ1A 3ENRA 4MOAA 5AVPA 1BVP1 2JDUA 3MPBA 2BZDA 2A6ZA 4XFCA 1XE7A 2VBPA 2ADDA 3MW4A 5FYCA 4CUAA 5K9YA 3ACLA 5JVVA 4BM8A 2V4AA 3VLBB 1E5SA 5EJ1B 3IPVA 4AZZA 1PVC2 4EN6B 2GH2A 3I3MA 4CDXC 3O1PA 3N4MA 5GM0A 4IESA 2A6VA 4EN0A 3HT2A 3KCXA 3HJRA 4Z07A 2ZABA 2AR6A 2OZJA 1UOJA 4XUNA 4YFZA 1F4HA 2ZMNA 3ZXAC 3ZO0B 2YBPA 1LHUA 3PVEA 1YFWA 5J48A 4ASMB 1QH6A 1LOBA 2RS12 3NRUA 2LTNA 3SNMA 2R071 2Q8EA 1RUH1 4D7TA 2XGXA 4YSFA 1ASJ1 1N1SA 1W2NA 2QQOA 1AYM2 3ZM8A 1DQ0A 1Q8OA 4YVWB 3ZKYA 3LOBA 1MVQA 3LE0A 4Q4W2 4Q5OA 3VBOC 5IVJA 2PN5A 5E89A 3H8UA 4HOOA 4K21A 1JYCA 1PK6A 4F3JA 5K7PA 1U5ZA 4XBQA 2E33A 1HXS3 1QJU2 4WM8A 1NCRB 4C0BA 1IZ3A 3BOPA 3KLSA 1RUE1 2GNMA 4N53B 1WCSA 2D40A 1GQHA 3LEMA 1UXZA 1XYNA 2PELA 4AI2A 2TNFA 4XJ9A 2CV6A 2IFRA 3ZYBA 1GWLA 3S57A 4XE9A 1UMHA 3C7FA 1R1ZA 4I30A 4JQTA 3RRDA 3SHRA 4G9SB 4I2OA 3TBDA 4MHRA 4XBLA 1YJLA 2ET1A 1OFNA 2ORZA 2TEPA 1DLLA 4M01A 5FUIA 5LB6A 1PNGA 3GM8A 2ETEA 1W9YA 2BEOA 2XQXA 2ZKNA 2PA7A 1SLLA 2JDAA 3POIA 4JRAA 4IEOA 1LENA 2BBAA 3RWKX 1WMXA 1KGYA 4CTEA 5F3CA 1PVC3 3PTRB 3VHRA 4BMEA 5A32A 1ULPA 1KITA 1BQPA 2EIGA 4LBKA 2RS51 3U78A 5FZ1A 5JSRA 1JZ5A 1U12A 4LBOA 2AENA 4HLTA 5KR7A 4LMFA 4QX0A 5JAXA 1K3IA 5GLZA 3ILNA 3OUHA 1JW6A 5IVFA 5F2WA 1O8PA 3PDQA 4AI3A 2PAKA 1W6NB 1W8UA 2HWC2 1D2SA 1PZ9A 3V64A 4CP9A 5IVCA 3U4XA 2RS13 3U14A 1ZNPA 1OQDA 1XXNA 1NXMA 3MF9A 1CZSA 4KWKA 1SEFA 3TB0A 3H1MA 4Y1ZA 4AR2A 1AYM3 2ADEA 3THCA 4FPKA 3TOJA 3FN9A 4Q4W3 3Q8FA 4K20A 4LO6B 4BB3A 5C6CA 4XILA 1MPXA 2VUAA 2BFUL 3B3QE 3S7IA 3CBNA 3ZXGA 1MVEA 4LK7A 1QJU3 4XUTA 4QU2A 2CU5A 4DY5A 3O1UA 2Y26A 4QHOA 5LK7B 2KR2A 5I8YA 3UYJA 5I8TA 1AXZA 4N8MA 3T2OA 1ENRA 2VGDA 4W4ZA 3ZDVA 2BU9A 2PTMA 3E5QA 4JDMA 4MXWB 4QM8A 1WW7A 3LFMA 2TUNA 5EP9A 1OI6A 4AK3A 4XJZA 1Q8VA 5HBAA 1RUNA 1SBDA 1OBNA 1ULOA 1BYHA 1WCUA 3I2GA 5HV0A 2Q1MA 1QXRA 2D6OX 1JZ8A 2VVEA 2IXHA 4Y1XA 2PHTA 4EN7B 1V0AA 5FQ0A 4BIFA 1QGLA 1AR91 4D7SA 1FPN1 3UKNA 2GMMA 3OB8A 4XETA 5BNPB 1K5MC 1FOD1 3MGUA 2ARXA 2Q30A 1FI2A 1S0CA 2ZACA 2WQ4A 3C8XA 4QPIB 4UWDA 5DZEA 3VBRB 4AGGA 1MS3A 1COV1 1UOBA 2UWAA 4E8DA 1HN1A 4YZ2A 3OBRA 2W9XA 2HWD2 1UKRA 4L97A 3WLUA 3VBUA 2Q8CA 2HWC3 4Y24A 5FXWA 3OBTA 3OBAA 3RPQA 4IGOA 3JZVA 3ZVXA 4LTAA 5I91A 4QHZA 3D4KA 4TLFA 4ZONA 3JXSA 3CEWA 3OSDA 1N1TA 1WLWA 4GJYA 5A33B 1FNZA 4ZPIA 1C1LA 4FFHA 2R041 3CHXA 2D6KA 2VY0A 1HB4A 5JXGA 4FOWA 4IEYA 4MX3A 5GJ6A 2WA3A 5IK5A 3NAPA 4NVPA 4DUXA 3I2DA 4LA2A 1VIWB 1LULA 4A2UA 1W9TA 2R6QA 1RUF2 4AI8A 4QU1A 4R9AA 2Q1FA 3M3CA 2EAKA 4UW4A 3AKTA 3GHNA 4Q1PA 3K4DA 2JENA 3VD7A 3RSJA 1C1FA 1X7NA 2ZGOA 3ZXKA 4KWLA 3DXTA 4LHNA 3GBGA 2HLEA 2XUMA 4FFIA 4AFAA 3FE5A 3ZLIA 1FV2A 1GOFA 1QJX3 1BHGA 2XJPA 4IEQA 3ZR5A 2KXLA 3VBSC 1BKZA 4IETA 4JV4A 4YPJA 4CEYB 1ZX5A 1MZ5A 1YQCA 2WZ8A 3LGRA 1FMD3 4Y33A 3NNLA 5A6QA 1UD1A 1A8MA 3N9QA 4N43B 5LA1A 5BNNA 3MICA 1AF9A 4QX3A 3OGJA 1CN1A 2VMDA 3A4UA 1GZWB 3EBRA 1VMJA 2VNOA 5FBZA 1W04A 5F7UA 1RYYA 3C7OA 4UFLA 2HWD3 4X8NA 2UURA 3WW3A 1BEV1 1EAH2 2FD8A 3A21A 2VTXA 1D2QA 3FWEA 4ASLA 5JR2A 4COVA 3AP7A 4PQQA 5ACA3 1GICA 5LBFA 4Q4V2 4WVMA 1IG0A 3RJRA 2B46X 1UU4A 1ZZBA 2MEV1 4XXAA 2PHFA 5HCBA 3AP4A 2FZ1A 2P1BA 1LGBA 4LBMA 2WN2A 2XKPA 2JICA 1G6NA 4GKXA 4OI1A 1REDA 3V0AB 1J1TA 1WLTA 2WKKA 1J1LA 4LLFA 3B94A 1WLDA 2WA4A 2WLQA 4NMIA 5C5UA 1ENXA 5FYVA 1RUF3 1SZBA 3N7MA 4QB6A 2WFF1 2BTVC 2DTYA 1H30A 2XXZA 4HXCA 3T3YA 3ZYFA 3TAYA 4FI9A 5J09A 2XJUA 3A22A 2WAAA 4IE4A 4LKSA 4Q8KA 1XU2A 4P14A 2DF7A 4KG8A 4UT5A 3SEEA 2OX0A 1NXD1 5DDJ1 4HKWA 2EIDA 3I2IA 1AL21 1NE4A 1QOSA 1TVGA 4LR4A 2H0BA 4KQ7A 1Y9MA 5FUPA 1U5XA 2PHUA 4AL9A 1RUH3 4LHLA 4QDQA 2J22A 1ASJ3 1HN0A 1S0GA 5DZFA 5EFUA 4DRRA 4YM3A 3O1MA 2B5HA 3ON7A 4CCCA 4NIDA 3KF3A 2WNUB 5FYIA 1LNSA 1LHVA 2JJ6A 4XIOA 4CDWA 1TG7A 2D43A 4B3NA 4Q2FA 2JDZA 2GALA 4J6GA 1TQ5A 4RQPB 3ST7A 2GC0A 4E27A 2F4LA 4KU7A 1SFNA 2ZEWA 3PMSA 3WNXA 3GXUA 3O1SA 2NP0A 4YVWA 1EAH3 4YG6A 2VTXJ 4K8RB 4OUSA 3VUOA 4FQ4A 4YW4A 3UT0A 4K7JA 3OG2A 3R6SA 4B7EA 1IKQA 3UGHA 2Z42A 1YQ2A 5T52A 2CHHA 1NCRA 3LFIA 3HQUA 4YVSB 1OA2A 1RUD1 3FLTA 4DNYA 3EQEA 5C4WC 5L19A 1VBE1 4D6QA 4UF0B 2QKDA 5FO9B 4YW6A 2QQMA 3OEAA 1AR92 4UYBA 4PT6A 1S0BA 2K2SA 5FZ6A 5B2GB 2VQAA 1IGOA 4FBFA 3VBUC 4H2AA 1RITA 4B7KA 4A4AA 3EXUA 5F3GA 3POEA 5BNQA 2XVKA 5CA6A 3LPFA 5IVEA 3OOXA 4XFGA 3CDZB 3R4SA 3ZN6B 5F37A 1JZ3A 3R4UA 1VAMA 2ERFA 4HONA 3PMEA 4E2GA 2J1RA 1UZYA 1YQ6A 3FLPA 1VRH1 5FUNA 4PLMA 3W20A 4JTOA 1S55A 2ZJCA 3OBZA 4NPMA 4A45A 1LAJA 4P08A 1TME1 5HV4A 3JBG1 3GF6A 3NAPC 4XQDA 4QKDA 3WQ0A 2ZZJA 2R042 2B9VA 3MO4A 3ACFA 2B8MA 4XF9A 3RI9A 2DU1A 2JWPA 4BIOA 4QGLA 2XPJA 3ZSEA 4CSWA 4QT6A 3RYKA 2H6CA 2YBKA 2ZHKA 1DYPA 1DP0A 3KQ4B 3K2OA 2B45X 3DKQA 3M3EA 1AUYA 3RS6A 3KVAA 5FIXA 2XHNA 1UZ0A 1UY4A 5T5JA 1QJY1 2J1EA 4BLIA 4CA9A 2BPA2 2VVDA 2XJQA 3RYPA 4FP2A 3D3AA 3POJA 4RS5C 5BNNC 2QZ2A 4U36A 3T30A 1FYUA 1HRI2 2W3JA 3QLQA 1WA4A 2W94A 4M00A 5DUUA 2YZ4A 1AR93 2VOVA 4NPLA 2IUWA 4PHZA 1W39A 4XMAA 1AR62 2A75A 1JBCA 2Y6HA 3M1HA 5GKAC 1G9BA 4SLIA 4M3CB 3J8F1 2Z2SB 3G6JB 3OCPA 1COV3 1W28A 1OMIA 2PLV2 1UZWA 4TYSA 1GLHA 4JHZA 1BEV2 1MS4A 3H1YA 1YI7A 3VD3A 4LPLA 5TSWA 1ULEA 5LW9A 4JTNA 2YROA 4QPIA 3VBRA 1W6MB 4BQXA 4Q4Y1 3PTYA 4Y20B 1X36A 3BTYA 2WQ8A 2CSGA 1JYIA 4W50A 3LDRA 3MHZA 1QQP1 2BQPA 2DBIA 2R043 2DUOA 3MIFA 3NL1A 3HNYM 5FPBA 3LEGA 1BLZA 2CDPA 4AHXA 1WZXA 3ZIWA 5IVVA 2ZMLA 3WDXA 2Q1ZB 3THDA 1ZZ7A 3ZIXA 5DABA 5GLVA 2WFF2 2Y6GA 2W08A 1TMF1 1VRBA 3D8CA 4JQRA 4QPGB 1MACA 5A33A 1JYTA 3FHAA 2CGNA 3WF4A 1OLME 3SCHA 5FPAA 4AVVA 1S2BA 1Z78A 2LALA 1X9TA 2RJKA 4DQAA 4OULA 3WQBA 4OI2A 1CR7A 4M3CE 5LATA 1YXWA 5FZLA 4RGKA 1CAVB 5LCWL 4CCKA 3AK0A 1EUUA 3MLJA 3DUIA 2VPVA 3ETQA 4GQ7A 4RHV2 1HRI3 5F1RA 5FZDA 1BMV2 1H2NA 1MS1A 1W9SA 2QNKA 4XDOA 2IXLA 4CDWC 1UYYA 2VUDA 1F8VA 4AEMA 1L3JA 4UW3A 2ES3A 1AR63 4W6XA 3CLPA 3T1LA 3OYWB 2XR4A 3I3DA 3KQRA 4HG6B 3LAGA 5EJZB 4XVHA 1QJEA 4Z92B 4YVWC 1UIJA 2PMWB 1Z7S1 5A3NA 5C3SA 4ISRA 4BISA 3ZFEB 3OGVA 1RUOA 2PLV3 1ST8A 5LZ6A 4FVVA 3IZOA 4CEYA 2DU0A 1GYKA 3AMNA 1W6PB 1RUI1 1BEV3 2BVBA 1DGRN 4R52A 3H8XA 3BCWA 2YC0A 4OYUA 4AW7A 1IS6A 5IFTA 2V09A 5AVAA 4N43A 4V2WA 1W0OA 4Z2WA 2C1FA 4QD2A 5AFBA 2MEV3 3VKMA 2XWJB 1UX6A 5ABJA 2YU1A 3LEIA 5DG1A 4QWNA 5BXXA 2PFWA 2WZEA 5A3WA 3C7EA 2Q0AA 4HPKB 3B02A 4FFFA 2RDSA 2Y6LA 2GMPA 1QXPA 5CFDB 3IIIA 1AXYA 3FLRA 5CKQA 2YFZA 1POV3 1W9FA 1GP6A 5KHHA 2Q5TA 3NNMA 2WFF3 4IGPA 4P02B 3M8LA 1O4ZA 1PM4A 4UFMA 2UU8A 3ZFGB 2K0GA 4P9GA 2QQPA 1R091 4RD7A 4Q0QA 3V0AA 3WDTA 2BYVE 1JHNA 4IV3B 5DDJ3 4JGZB 3VDAA 2CAUA 5KC6A 4RHV3 4AAPA 4NR1A 5FZKA 3JBG2 4DEQA 3ZXJA 4XJ8A 1JYVA 3TEXA 1T2XA 5FZ8A 1ZREA 1QJFA 5HXVA 1REFA 3LA3A 2OW4A 4QQLA 4CP2A 2HJIA 2HWE2 3T0DA 3VHNA 4QQ2A 2VL4A 3LPGA 2RMU2 1C28A 1QWRA 1OOPC 4CPBD 1POV0 4D94A 1E5HA 3ZXLA 2HWF1 1UYXA 1CX4A 2XH6A 1N1VA 3T2TA 1JU3A 1RMU2 1CZVA 3PNAA 3UKTA 1TE1B 4XACA 1WUVA 4WZFA 5SV8A 4GWJA 3P3PA 4DUWA 2G1MA 3DF0A 3C3VA 2WNUA 5CFCC 1FX5A 3CO2A 4IE5A 2WSUA 3BI3A 1Y4WA 4JX0A 4GALA 1VAKA 2QQNA 4QXBA 1I5ZA 2XDVA 4RQPA 2C9KA 1RUD3 1LRHA 1CAUB 3POBA 2YGMA 4BQ2A 3V0BA 3P3NA 1DYOA 1ULGA 3CQOA 4EWAA 1BBT2 5H9QA 3IAPA 3RZHA 3IKWA 2RE9A 1UKGA 2ZX2A 1H8VA 3OEBA 1KS4A 2ZGMA 2XQRA 4CEWC 2ZEZA 1G9FA 1YJKA 5FZGA 1RUC1 4QPIC 3AMMA 4HETA 3VD5A 4DIQA 2QBXA 4CU8A 2GC1A 1JTZX 1VJ2A 3AYEA 5A7NA 1VRH3 4YGDA 1W06A 4KI5M 1PZ8A 3GJBA 1WW4A 4UFJA 4XEZA 5E88A 2EXHA 2WS92 3JBG3 1QEXA 4NIIA 1SACA 3MI8A 3WNLA 1GOHA 2XJVA 3H8OA 1X9PA 3ZN6A 1D4M2 3NKTA 1F35A 1NCQC 1UNBA 4V1PA 3DYPA 4XPVA 1JYXA 3HQXA 1W6OB 3LZZA 1HLCA 3VDBA 3W5NA 1S0IA 2BNNA 2G19A 2Y60A 2YXSA 2TBVA 1UPSA 2DUPA 2B4KA 3WG3A 4BQWA 1QOOA 5DQ0A 1RMU3 3JD71 4Q4X1 4ZU7A 1O3SA 4OUEA 1XSRA 1ZRIA 2OKXA 2RJ2A 1EPZA 3VL9A 4OQ8A 1E57A 1W6QA 3ZPYA 3B5LB 2LRPA 1ZBA2 5FZFA 2BFUS 1HIXA 1QJY3 2R49A 2WL1A 1VP6A 4LEJA 1OQEA 3SISA 1QF3A 1SBFA 4QKNA 2D5HA 4Q27A 1GQGA 3A0NA 5JLVA 2GMEA 2OPKA 2OUJA 5FP3A 3PURA 4NROA 4XW3A 1JZ4A 1BBT3 5FY9A 3K75B 2RS32 4LBLA 3VZLA 4CEYC 3H8RA 1LJ7A 3K77A 5LEJA 2NN8A 5A3TA 2C4XA 5JMCA 1C3HA 4QB1A 1ODNA 3J8F3 3LOIA 1PHMA 2XLGA 3E97A 3N9PA 1PGW1 4GJZA 5FXZA 3QOPA 2F4PA 1YFXA 5L9RA 4DO0A 2K9ZA 5ABJC 1JZ6A 2VMFA 3LD8A 3DPRB 4ARXA 2WBKA 1SDDB 4B1LA 4DEVA 1UL9A 2WS93 2QZ3A 1G9AA 3HN3A 4M3CA 4GMP3 1NUKA 1OSGA 4Q4Y3 3BGAA 2WIIB 3AVSA 4HK9A 5IK8A 2XMLA 3IAQA 2KM2A 4IXLA 3VBFB 1D4M3 4WV8A 2A3WA 4MGZE 3IDEA 4NOTA 5FLIA 3OGSA 3RJ2X 3VKFC 1AYN1 2IVIB 2ZBJA 2ZZQA 2JG8B 3CF6E 1FAYA 4S2GA 3ZN4A 2PAMA 1W6MA 2CY6A 2V5YA 4Y20A 4CU9A 1BZWA 1MS9A 4AVAA 2AREA 2DCTA 3ELNA 1F2NA 1BXHA 4L0PA 1R092 3AXDA 4R9CA 1HKDA 1JS9A 4YG3A 3NKGA 2XL7A 3POWA 4C0HA 4GMP0 5A3PA 3EB7A 1TZOA 1OKOA 3HIFA 4EV0A 1PGL2 5KWRA 1HV0A 2VCBA 1J84A 4QPGA 5H9RA 2JEMA 5JXIA 4MGIE 4AI1A 1WBLA 1OURA 1KDMA 2IFWA 3I8TA 4PJYA 4WM7A 2EIBA 3RFRA 4BQYA 3NV3A 1LOFA 1VBD1 5FPVA 3J7HA 4DB5A 2GN7A 2GN3A 1T6BX 1Z7S3 1CAVA 4Y4RA 2WNUC 1SPPB 3K3NA 1WWYA 5FYBA 3H7YA 4BH9A 2G9GA 3RNSA 3UGGA 2ZGNA 3CL1A 3VDDC 1RINA 1RUI3 1AR72 1O7FA 1MZFA 1Q8QA 1LOGA 3AZZA 3JCIA 1UYZA 4HVQA 4XOGA 1NX9A 4Z2AA 1XQNA 1HB3A 4AQSA 1VAVA 1YC61 4M4PA 3EJKA 3VKNA 4NHXA 3N35A 1ZRDA 4LE4A 5T5PA 2ZAAA 1VBC2 2W1UA 3HNBM 1W6PA 2DFBA 1XNTA 3ZN5A 1EY2A 2D3RA 1TNFA 4YZ4A 3CJIB 2X09A 4QGNA 4LNVA 4TZDA 1S2KA 4XIKA 3APBA 2WZPP 3AP9A 4JHTA 5F5QA 1J3RA 4MG2A 3J7MA 4LO7A 4YG0A 3UJOA 5A1AA 3O0WA 4RR3B 5IT6A 3S5AA 3WP5A 2JDHA 3E1F1 4S2DA 3U11A 4Q0UA 3PIGA 4YZ3A 1R093 3HOBA 5CG8A 4E9KA 1QNWA 1J3QA 1UWWA 2A6YA 2YMZA 4CE8A 5CFDA 3VBHB 5BY5A 2XJRA 4DFSA 4QXHA 2WZR1 2VBBA 1HJGA 1ULCA 3NVCA 4LLOA 2ZGRA 4MGKE 4YRDA 3ZFGA 1UY1A 5FYHA 5F3EA 1W0NA 3H7JA 4LUKA 4XF1A 2I07B 2W1QA 3ZX7A 3LSDA 4M4RA 1GOGA 4MGTA 4IV3A 2E7AA 3SH4A 2J1AA 4J25A 2BRTA 2VJXA 5EXOA 2BGPA 2YDEA 3J26N 4Q0VA 3WG4A 1DBNA 1F5JA 1GWMA 5JPMB 5LRSA 1AR73 2V73A 4FPYA 4G4FA 4XF3A 3L9JT 2VNGA 4ZHNA 1KJRA 4BMBA 4OI4A 2A73B 3UL2A 1JXNA 4YW1A 1WW5A 3VD9A 1YNAA 4IV1A 4YW5A 1OD3A 3I2FA 4INDA 3B69A 4AVCA 3URFA 1VBC3 5LEKA 4HL0A 2D3PA 3T1MA 4BXSV 4LKFA 2J1TA 1N3QA 2JE9A 3I49A 4AI9A 3H50A 4YW3A 3N9MA 2WUHA 1OFSA 2F17A 2UYAA 4LKDA 1OHFA 1YUDA 3JB4C 4XHXA 3WNKA 2E63A 3ZXDA 4IEUA 1RUC3 1CAUA 3PUAA 3CU7A 4RFT0 1UMIA 3WOGA 3SITA 4Q29A 4I0WB 1MQTB 1UU5A 2G4IA 4Y1YA 3VD4A 4C90A 4N9HA 3WD5A 2HEWF 1GZTA 4FP3A 1RTVA 2AUYA 2ILMA 2YB7A 4JRLA 1GZ9A 1ND3A 1W05A 1CPMA 4XQ4A 1WGPA 5CISA 2YG0A 1GWKA 2VMHA 3FX3A 3VDCA 5GLWA 1AYN2 2EXKA 3BU7A 2EALA 1CJPA 5H9SA 2ZPXA 2WC2A 3ATGA 2FDGA 3BOWA 4X6RB 2XBO1 4ATEA 1QJX2 4LQRA 2VZRA 5DUVA 3B9IA 2HWB1 5CZKA 4NRQA 3TNPB 1CAXB 1XJAA 4NE9A 1V00A 2ZAHA 1FMD2 3POSA 5F8PA 3FHIB 4LA3A 4R4XA 5D8AB 3T09A 1OH4A 2RM21 1M4WA 2WYFA 4WM7C 4CXWA 3CKHA 5I0TA 4LITA 3VN4A 1DDLA 1LOFC 1PO22 3FFZA 3CIHA 1R082 1YIPA 4JDNA 3X29B 3ZYPA 3S0MA 3TYJA 4CCEA 3LB9A 5EZWA 4PDWB 4AEDA 1N1YA 5GZCA 5L9BA 5ACA2 3NNGA 2VBDA 3AXEA 5FRAA 1WW6A 1V9U1 2C24A 4QKBA 3A7QA 4EJRA 2R0FA 2XL9A 1A34A 2P5BA 3HAGA 3EHKA 3D6EA 3O12A 4YZ1A 3B93A 3B00A 4URTA 4ZU4A 3U1XA 4B4QA 2YFUA 3G7DA 4H14A 5G04L 2D3SA 3UGFA 3GGLA 3NJZA 3GALA 3PJYA 1J59A 2VO5A 2DBNA 2VU9A 2OVUA 1Q43A 4CYDA 2GAUA 2ZHLA 2XVLA 2VNRA 1MS0A 5FXXA 1IS3A 3BVCA 4RFRB 2QFEA 1DQ2A 2VMGA 3WEZA 1AYN3 1US2A 3DPRA 3SEPA 1H8TA 3AMQA 1XNCA 5FMCA 5LA2A 4DOUA 5FBJA 4NAMA 4XUOA 4B1MA 1OQ1A 5KXDA 2CDOA 1HRV1 1PK6C 5FTTC 5CFDC 2O8OA 2R072 1IHMA 1RUH2 3VBFA 3ZDSA 5BV6A 1NA1B 1ASJ2 1CONA 3KCCA 4WM8C 3RZZA 1KS5A 4LO8A 5F6LB 1SCSA 3HR9A 5A6XA 1O4TA 3OUIA 2BBVA 2JG8A 4IE7A 3ABZA 5JIUA 4XCAA 2GC3A 1LU1A 2V5DA 5CNAA 1PO23 2QE3A 1UCXA 3GBWA 4WVWA 4ASKA 1UZZA 1R083 1RUE2 3WF1A 1V6NA 4IL7A 2P37A 4JKMA 4LOTA 1R64A 3OPTA 5F6KA 1MEC1 3FL7A 4PCRA 1ULFA 2QJVA 4MYEA 1VBD3 3KT1A 5FZ9A 3AJYA 4ZXEA 3ZSLA 3PUHA 5CBLA 1GNYA 1W8TA 1PO11 1LOAA 5FR3A 1UYPA 2EVXA 2KA3A 2HYXA 2Q8OA 4IV1C 3WNNA 5FAXA 4A42A 1X8EA 4Y26A 1F9KA 4PBOA 1V6LA 4FO9A 4CDUB 2VZVA 1UY0A 2ZGTA 3UESA 1NQJA 1SDWA 3N36A 5JZGB 4NWWA 4FPJA 1HQNA 1SPPA 1UY3A 2RS52 3DCQA 3ETPA 4PBPA 4PI0A 4R4ZA 5LK5A 5BNOB 4QPWA 3RZLA 4XJAA 2BGOA 2R061 3O1VA 2JG9B 4IEVA 3SLIA 5T54A 5EQUA 1JOPA 3AZYA 2YC4A 3PVNA 4N9IA 3ASIA 1ZZCA 2RVAA 5DUWA 1GKBA 2GDFA 3M3OA 4AFMA 3MIEA 4NRMA 1VMFA 1VB2A 4AWDA 5HCFA 1XOYA 1JZ7A 3ZXFA 4ZY9A 2R073 5FXVA 3WG1A 3WCRA 2GNTA 2WO2A 3J4UH 1O59A 1AX2A 2DCJA 4CCNA 3WQ7A 1ND3C 3SMHA 1O5LA 4GB31 4OCTA 2RDRA 2RJLA 1PGSA 1UOGA 2IWGB 1OKQA 1RUE3 2JDMA 1I1EA 1DGWA 1WBFA 4JDOA 2JECA 4XDPA 4YFWA 3QD6A 5C3OA 4XJUA 1MZ6A 1RUJ1 3CMGA 3H3ZA 5CYYA 1QH7A 5F32A 5AC91 5C70A 5C8CB 1HX6A 3VHPA 1IS5A 4LBJA 2W1WA 2ATFA 3VBHA 1NQDA 1NYWA 4D0QA 3ECQA 5CADA 5FY1A 4N53A 3EYPA 4DUVA 2HWB2 3WT3A 2ZGLA 2A1XA 5L7OB 1Y9QA 1F5FA 3I59B 3U07A 1NAEA 4O7XA 4L99A 2IXCA 1FPN2 5JI9A 1Q56A 4CU6A 3GNEA 1POQA 2RDNA 1FOD2 2RM22 1H9WA 2RS53 1G9DA 4WZCA 4AEDC 1B09A 3ROUA 4UOJA 4DXTA 3W58A 3ZKUA 3SKJE 1DFQA 5D2AA 1COV2 1DGRA 4OHYA 2BJSA 1ZZ8A 2BW8A 1XYOA 4QMAA 3KZ4C 3ZR6A 5GZGA 4DMIA 1LKNA 1XNDA 2E26A 5D1IA 1V9U2 2W39A 3Q8AA 2WNEA 5FY7A 2VE1A 4QX8A 3ZMOA 3KVBA 1CAWB 3F2ZA 4ZXKA 1E5RA 3PLQA 3AYDA 3HVDA 3PJQA 5LBCA 4GAZA 5CIRA 1Y7BA 1A78A 4AOCA 1W6NA 2BWCA 5FZ7A 2NMOA 1XSQA 4QXCA 3S30A 3NV4A 2OIIA 5FPZA 1W9WA 3WY6A 3WV6A 1W8NA 1RGSA 2P6HA 3DPRC 1H8TC 5FY8A 1UY2A 3ACGA 4P9YA 2D6LX 4KGQA 4GA9A 3AYAA 3OF1A 3NNFA 2PHDA 4F7ZA 1MQTA 2VZSA 3GZUC 4EZHA 4XFBA 3NJVA 2IXIA 1XYPA 2HBTA 1OXCA 2D97A 2DCKA 2XBO3 2X05A 5HPOA 1SCRA 3H42B 1DZRA 3KM5A 2HWB3 1OLRA 4XDQA 4CUBA 4EN8B 5L9VA 3RZGA 2EICA 4PIZA 1F15A 2WWUA 5C33A 2JB8A 4BDVB 4MXWA 1FPN3 5A7WB 2V4VA 1DF0A 2RM23 1FOD3 2EF6A 2BWAA 3C7GA 4XYXA 4NO4A 1EYBA 4XF0A 3N7KA 2EXJA 3B7MA 3S7EA 3O7OA 2W91A 4FPCA 5FPLA 4CXYA 2I45A 3LEKA 1CAXA 4Q0SA 4X6QB 1KEXA 1S4CA 3WW1A 5L73A 1ULDA 5FV3A 1ALYA 5D8AA 2GNBA 2L9LA 5BNPA 2VZTA 1V9U3 1RVF1 5GLTA 1I9RA 2C5DA 2DCYA 2MEV2 2ZMKA 3TN91 1DHKB 2NZ9A 5FY5A 3MIHA 1W3VA 1OD5A 1OUXA 1G8WA 1GZCA 1EV11 1QMJA 1WKYA 2LW8A 4HFSA 1JOBA 3OY8B 3USSA 1GSLA 4PDWA 3WINE 4ZZ5A 4C8DA 1IG3A 5F5IA 1W8OA 1GV9A 4ZZ8A 1H1AA 3ACHA 2JKXA 4AQ2A 5JOZA 2GH8A 3JB8A 1UQXA 4LBQB 4QM9A 2W5FA 4AG4A 3POGA 2JDPA 2W47A 5H9PA 2VXRA 1W2UA 3RZJA 3AX4A 1ONAA 4RGGA 1JODA 1UIKA 4JC1A 5DDJ2 4AHZA 2WRAA 1URXA 1AL22 4FQZA 4QQOA 1HRV3 3UETA 4AE2A 2AACA 3ZYRA 2K46A 1GNZA 1KD7A 1N3PA 1NLQA 3SH5A 1W2AX 1UXXX 3NNJA 3E6CC 3BIWE 4AXOA 3MV01 4AGVA 4SBVA 1MS8A 4BU2A 2WR9A 1QKQA 5DAPA 4QAWA 1K5MB 3WF0A 1AX0A 1O6UA 5HI0A 3VBHC 4ES8A 5KHGA 3TEZA 2F6BA 1NCRC 3MFCA 2VCAA 2C26A 3HMYA 1MEC3 2VTFA 3KT4A 1AXKA 2QQIA 4N53C 5BPXA 1N3OA 5EWSA 1WMFA 4E4SA 4QGMA 1ZBE1 4CPBA 2Y0IA 2NQYA 1GZWA 1PO13 3O14A 4J1WA 1SLBA 2YC2A 3KV6A 4NRPA 2QTWB 4TXWA 1RUD2 2NPIA 2QUOA 2RHPA 2RR11 3IIAA 3IPVB 3RDIA 1ZM1A 1DCSA 1IPJA 1GR3A 1LHOA 1VBE2 2ZEXA 4IEWA 5FMOS 1V6MA 1O5UA 3RMXA 5M0TA 2UY9A 3DXUA 2FCVA 3VL8A 3ZSMA 5FOBB 1IKPA 5DAXA 1K5JA 4E4HA 3RGBA 5C3QA 4PIXA 2WAOA 2C6SA 4FPHA 3W59A 1UU6A 1ACCA 5DXDA 3PUQA 5LWBA 2PHLA 3K3OA 1GUIA 2O1QA 1X82A 3HBZA 3I97A 3MIDA 3T4VA 4BOWA 2ZHNA 4PI2A 3RG0A 4AYUA 1DQ5A 1LHNA 1HJFA 4F8AA 1VRH2 5FKCA 3BN6A 3V65A 5CKNA 3BIEA 4K9SA 1AL23 4PLOA 4L8QA 2GSYA 1NY71 5BNOA 5C9AB 1TME2 3AZVA 3IBMA 4RA0A 3MDPA 4AVTA 2JG9A 3ZYGA 4QB2A 3VBSB 4K6BA 3VKOA 4COYA 4MH0E 2V72A 4MHUA 2ZHMA 1MQTC 3THPA 3S5QA 5FZHA 3U0ZA 2G9FA 3M3IA 4JKLA 1VBA1 5KHKA 1KQRA 4OZOA 1BVVA 2EA7A 2XHKA 3BB6A 4GXLA 2PHWA 1KRIA 1DQ6A 1ZRCA 1QJY2 1ZZ9A 5JXJA 1PIV1 2DYCA 4FPFA 2VZPA 5T5OA 1CX1A 2VQ0A 2HEVF 4LT5A 3MEPA 3AL5A 1LTEA 3BALA 4ONUA 1AR81 3V56A 1L7QA 1VBE3 2P3JA 4OI0A 2XVGA 1J3PA 1W8ZA 4NJ4A 4R8HA 2FHRA 4W6WA 4A6OA 1GU3A 4CDQB 4MGSA 5C8CA 4XABA 5FYZA 3Q8CA 3H0OA 4J1XA 5FZOB 4K1YA 2A3XA 4FAGA 4OZXA 4RN5A 3KV9A 3J8F2 4YVSA 5D8AC 4XZUG 5IW0A 5BNPC 2VH9A 4IEXA 5IVBA 1PVC1 3IM0A 3VBRC 5L7OA 2WN3A 3I59A 3MUY1 2OPWA 5A70A 3O1TA 4UF0A 3SH3A 4JZRA 5E16A 5IVYA 2BOIA 2FBEA 4KWJA 4FOVA 2IXKA 3WNPA 3NJXA 1PMHX 1E5IA 1TME3 2WSVA 2DVFA 4Q4Y2 4QDRA 4ISQA 4LO5B 4E2QA 2FCUA 2RV9A 2BNMA 2D6NA 5DUXA 3TN92 2B39A 5KBFA 3NWKA
chains in the Genus database with same CATH topology
1QQP2 2HKXA 2XLAA 2AH2A 2RS11 1AJKA 2XLFA 1CQ9A 3MW2A 4H3WA 3ZXEA 1SLCA 1AYM1 2WT1A 3WUDA 4Q4W1 2WT2A 3FMGA 2ZKLA 1T6GC 1CAWA 1TMF2 5JOYA 3A0KA 4DINB 3GBFA 3KD4A 3MLKA 4HK8A 4GWNA 3E5UA 2XG3A 3C2UA 4IEPA 2ARBA 3KSCA 2VECA 3WP3A 1NOVA 4YGEA 4I09A 4I3GA 2X5IB 2ZX1A 4XFFA 4KNCA 4A3XA 4P9JA 1H2LA 2QVSB 5C4WB 4PIYA 2NM1A 3FUOA 3VZJA 1H1MA 2CGOA 1Z7S2 4RL7A 4FTSA 4HT1T 5GZDA 4N43C 3ILFA 4YZ5A 3VBUB 3OTFA 3QH6A 1H4HA 4TSVA 2YUEA 1RUI2 3AMPA 4OVEA 2LUWA 1IS4A 1V6KA 1ZVFA 4WBBA 4KU8A 2A5ZA 4FPLA 2PYTA 1RVF3 1S0FA 1ENQA 1DZQA 4NHMA 2PQQA 5F9TA 3TN93 4HSJA 1HQLA 3PVBB 2CAVA 1QQP3 3NAPB 3E6BA 3N7LA 1U5YA 3AFKA 1FNYA 2CL2A 2DURA 2X53S 4MXVA 2XJTA 3NW4A 5I0SA 5SV5A 4ES9A 4QX5A 2W0XA 2E53A 1TMF3 4LUMA 1WD3A 1OLQA 5T3NA 3TNQA 4DPNA 1QOTA 1CJDA 5BNOC 2MNGA 1DGLA 4XFIA 4ORFA 1JOJA 4Q0PA 2E51A 4KH9A 1GANA 5J36A 5FPXA 1CESA 3AB0A 4Y22B 3NV2A 2WJSA 5J98B 2ZGUA 3E6DA 4I02A 4Q1RA 1D4VB 4RS5B 1CGPA 3BODA 4D69A 1O3TA 3K48A 1ZA4A 5FMOL 2NYYA 3OGGA 3RI8A 4GH4B 1ZYBA 3ZFFB 4AVBA 4BCUA 2AGSA 1H0BA 4MLOA 4BZ4A 2HWF2 3I4IA 4EWEA 1M06G 5GZEA 2CYFA 3ES1A 2HEYF 5FLJA 4RQPC 3WCSA 3IDBB 3OYWA 3DGTA 4OUMA 1WD4A 3ZFEA 2HWD1 5C8CC 4C1XA 1K5MA 4AI0A 2D6MA 3FBMA 4UBGA 2JX9A 1AR82 4AGRA 5DG2A 2ZGQA 2IC1A 2GNDA 4YVSC 2R32A 4AQTA 3WHUA 5L7OC 1G86A 1LECA 2VOWA 5I0UA 3O0VA 4LBQD 3IWZA 2ZOEB 2O8QA 4HMZA 1RUC2 2CWMA 1U0AA 2VW2A 4HPKA 1YI9A 4JCKA 3O5SA 1RIRA 2GU9A 1RUF1 4Q8LA 4QQHA 2WQZC 3VKLA 4EWDA 2W68A 4XFHA 3USUB 4FAHA 2YV8A 1AL0G 1RB8G 2WLPA 2FQPA 1QDOA 4AF9A 1XRUA 4TWTA 2VMIA 2GZWA 5KHJA 4A7YA 2P2KA 3CJXA 4AEJA 4CDWB 1C8M1 1JUHA 3QACA 4XMIA 2X29A 1QJZA 3WDYA 4JGZA 3WW4A 4XJWA 1DZTA 2IXJA 1ZZ6A 1UPIA 3JUUA 5C9AA 2HWF3 4BPZA 3ZSKA 3JD72 4Q4X2 1VBA3 4OHVA 3VBSA 2CNAA 5JDBA 3H9AA 4JVAA 1IOAA 1LESA 1PIV3 1APNA 4ITCA 1S0EA 5JSPA 1EAH1 4E4ZA 1AR83 3NSTA 1Z0HA 4Q4V1 4QHBA 1GNHA 4W65A 1ND2B 1VALA 5T5LA 1JUIA 4FTEA 4LHKA 3UKVA 3PVOA 2EXIA 3RQ0A 3AZWA 1REEA 3VV1A 5K0UB 1PGW2 3GYDA 2AZ5A 2A70A 2OUHA 1YFUA 4CDQA 2SBAA 2XWBB 3WHTA 2NMNA 4DZGA 3IN9A 3BPZA 3O0XA 3AKQA 4AVSA 2ZS6B 1XNKA 4HANA 1QHDA 1Q5OA 4JGYB 4Z1VA 2JXAA 3B01A 3MF6A 4XBNA 1XE8A 1FV3A 2YYOA 3FC0A 2P3KA 4G3YC 3U10A 3MLLA 3RMYA 4XHBA 3JD73 1OOPB 1DGWX 4Q4X3 2ET7A 5C8WA 1LEDA 1N47A 2R1BA 1NG0A 2D7FA 1V70A 1AX1A 1W6OA 2A6WA 4QPGC 1UW8A 3UJQA 4NN0A 3VGIA 5KXCA 3N7JA 5CFCB 1SLTA 3LCPA 4W6YA 4CZSA 2AYHA 2ZCWA 3S6PA 4BE3A 4YM2A 4P9WA 1VBD2 4PQ9A 1CD3G 3D0SA 1NLSA 3MPPG 3POYA 1NLRA 3LSEA 5EV7A 5T55A 1O4YA 4MVTA 4D3WA 3J9SA 2X5IA 4CEWB 3ZFEC 1UF2C 1X8MA 3AYCA 5C4WA 4NHKA 4S2FA 4WVVA 2GC2A 4YM1A 2H0VA 3M4FA 4H7LA 2DTWA 3TWIA 4HVRA 3WP6A 1UMZA 4R9DA 3MIGA 1NCQB 1KJLA 3WUCA 2VULA 3DL3A 2E9QA 4L92A 4NHLA 3QH7A 1S1AA 2DV9A 2VUJA 5EYXA 2UYBA 5I0RA 4ZU5A 4YARA 1A8DA 1C8NA 1TNRA 1VBB1 1DQ4A 2OZ6A 1NZCA 4A7KA 3ZFGC 1A6CA 3I7DA 2LM3A 1CPNA 1RJ8A 4AFCA 3H3UA 2R0HA 1YLLA 2WZR2 4IV3C 1LGNA 4NPRA 4JGZC 4OHWA 1UN1A 3FJSA 3KB5A 1B35B 5JOXA 3L2YA 5C9AC 2XKOA 3FBYA 5GLUA 1KXGA 1C8M2 4Y1VA 1AZDA 1HRI1 4M0NA 3RWNA 4Y22A 1BJQA 3THTA 4OHZA 4COUA 1U5IA 1AR61 5E8AA 2ZX4A 3OD0A 4WVZA 4RS5A 4LO4B 5JR7B 3WDUA 2ZGSA 2DVGA 5ABJB 2PLV1 3W9AA 4GH4A 3WW2A 2DCZA 2DVBA 3ZFFA 5A3MA 4U2AA 1XNBA 2OYZA 1WMEA 3DN7A 2JKBA 3CNAA 3ILRA 3VZKA 5GALA 1R1A1 2VW0A 3FFQA 4P5HA 2OA2A 1X33A 5J96B 1OPMA 4N7IA 3VZMA 4B4RA 2R16A 4CDQC 1RUG1 1YYNA 1V6IA 3E5XA 4H7MA 4YYOA 2BUKA 5I8SA 2FZ2A 1POV1 3R0RA 3CJIA 4DRVA 3RYRA 2E6VA 3LKJA 2WZR3 3AMHA 3R05A 3SCGA 4RR3A 3QBQA 2WNVB 1S0DA 3B9CA 2B42B 1LOCA 1NE6A 1C8M3 3D82A 4MSVA 3WX5A 5AFEA 4RHV1 1BMV1 3AKPA 3VZOA 3USUA 2A71A 2WFPA 1G7YA 3HWJA 2XBO2 5KXEA 5IK7A 1H4GA 1EPWA 2ZGPA 4RSUA 1LODA 4X8PA 3VDDB 3LA7A 4KBBA 3LWCA 2VG9A 3H1WA 1FATA 4BYYA 3V0BB 2I74A 4CDXB 4UW6A 4LE3A 1YO8A 4I0BA 2DWRA 4Q4V3 3HT1A 3VZNA 4COZA 1MZEA 1WMDA 2CWSA 2X5IC 1OA4A 1SLIA 2DVDA 4XQWA 1VR3A 2FMDA 2P3IA 1J58A 4L2NA 4R9BA 3N3HA 5FFOC 3KCYA 1RJ7A 2H6BA 4FXKB 4FXGB 1DU3D 3D0JA 1ND2A 4MGYE 3AZXA 4BA6A 5JWPA 3KS7A 3VBOB 3IT8A 4IEZA 4HKLA 2JD4A 4Z82A 5K0UA 2C9AA 5J37A 4ATFA 5CB7A 5JSOA 2EAAA 2D6PA 1QU0A 3WXPA 3VBFC 1HQWA 3AKSA 4OHXA 3HN1A 1C5HA 4META 2MPFA 4KGGA 1W6QB 1RC6A 2JG8C 2R30A 3ALQA 4ZKTB 1HRV2 1CVNA 4JGYA 2HWE1 1YHFA 1GFF2 4AHWA 5JCTA 4AFBA 3INAA 2RMU1 2DUQA 1VBB2 2D5FA 2E7TA 3MIBA 3MZHA 1IPKA 2XJSA 5LRRA 1ZRFA 4Q26A 1IQAA 3Q9OA 1RMU1 1LGCA 1SBEA 1SQ4A 1F31A 3AFGA 2QDNA 1OOPA 1PM7A 3OPZA 4P9XA 1LOEA 1D0HA 1MEC2 2MHFA 3QCWA 3ME2A 1HW5A 5CFCA 2YPJA 3FUQA 4YM0A 1H2KA 1BBT1 4FOYA 1KFXL 1PO12 5JPNB 5K8SA 5FOJB 4GH4C 1RHI1 3ZFFC 1OPOA 3JU9A 2VOXA 1CIWA 3TRSB 4XTMA 1Q3EA 1SLAA 2VW1A 4L11A 2JE7A 5FO7B 4BLJA 5J3UA 4FTBA 3FZ3A 4XTPA 3KGZA 5FLHA 2R062 3NO8A 4CEWA 1R1A2 5FREA 2O0OA 2WS91 4GMP1 1KDKA 1LU2A 4B8EA 5JIAA 2XB6C 1D4M1 3R4DB 2ZTNA 3CJIC 2QCSB 1RUG2 4C91A 4HVOA 5DZGA 3OJBA 3WP4A 1VBB3 4RR3C 1A3KA 3OD4A 1YFYA 5CAZA 1NCQA 4GULA 4GB32 2R1DA 4CP1A 1AVBA 1TEIA 1Y3TA 1DG6A 3WZ1A 1UAIA 4AQ6A 4IERA 4WM7B 1ZBA1 3KT7A 4XZPA 3ES4A 2A6XA 3I54A 1NA1A 4HSLA 1RUJ2 4AEKA 5AC92 4COWA 1LCLA 1H1IA 5J7MA 4AFDA 4DS0A 4YLZA 2CTVA 2RS31 3D5OA 4Y1UA 3KGLA 1B35A 2D98A 3WR0A 4PF5A 2B7YA 3NV1A 3GZTB 4JAAA 3ZYIB 3ZYJB 1YWKA 3IDCB 4P9IA 4HBNA 2A7AA 3JQXA 2QDRA 2R063 2UWBA 1V6JA 3JQWA 4QXKA 3WDWA 1R1A3 5IK4A 1S0JA 4FPOB 4XFAA 4FOQA 5CU1A 4CDUA 1G9CA 4A7ZA 4EROA 4GIQA 4L9BA 5JZGA 1C57A 1JN2P 4UXAA 1ND2C 1RUG3 3M3QA 4K8FA 1PK6B 2SLIA 4FSJA 1Q8SA 5K0UC 4WM8B 4GB33 2ZA9A 5HCAA 3M70A 2P34A 1W0PA 2X8KA 4K40A 4HN0A 1FT9A 1RUJ3 2ZX3A 4K1ZA 5AC93 1HXS1 3HD8B 1DIWA 4JGYC 3GZAA 1OA3A 1PGL1 5FDBA 2YGLA 2UY8A 1LEMA 1PZ7A 2Y38A 5I93A 1MS5A 2WNVA 5A32B 3AKRA 4DXZA 3BTAA 1HDKA 2E7QA 4IV1B 4M3CF 1BCXA 1C5IA 1GBGA 1DYKA 1WCDJ 1VLNA 3EO6A 2YY1A 2Q4SA 1XU1A 1AR71 1BK1A 1YIFA 1O91A 2YHJA 2Z79A 4UW5A 4C1WA 1FXZA 2D93A 2BNOA 2WINB 1WLCA 1WCKA 3VDDA 1QDCA 1C4RA 3AP5A 1ZRRA 4PLNA 1VBC1 3AM2A 3LA2A 2BVVA 3GHMA 1AHSA 1RVF2 4PDWC 5IUQA 2Y0OA 2B9UA 3UK9A 4CDXA 4B4PA 1SFYA 1PNFA 4NWVA 1RHI2 3SXWA 1QXJA 1MR5A 1EV12 5BYNA 4K3UA 3ZMNA 1ND3B 2VVFA 2N7GA 1QY4A 4FCAA 5KC5A 3UV9A 1O3RA 3DV8A 3PHMA 4LULA 4M0HA 3KMHA 4HKOA 1QJU1 5EYYA 3VBOA 4F83A 1QNYA 4MUVA 5FQ0B 2ZX0A 1H9PA 3WG2A 5JI7A 3AJZA 2HWE3 4EN9B 2PAEA 2HYKA 4CRQA 2RMU3 1H2MA 5GZFA 4Z8BA 4AHYA 1YRZA 2PHXA 4FPGA 1JH5A 1NA1C 3M7AA 1EP0A 4Y5Z0 5FCCA 4YW2A 3K51A 3SCFA 4BWOA 5KXBA 5E1RA 4I0AA 4LBNA 3DKWA 4FPEA 4AEDB 4XXPA 4BHPA 4E2SA 4OLLA 2UWCA 3AP6A 1KFUL 2A3YA 4P9LA 4E4DX 1PMIA 1B35C 1RL3A 1ZBE2 2Z5WA 2ENRA 3MFAA 1VB4A 4BQ1A 1DQ1A 2WWSA 1RHI3 5EJ3A 2HWC1 4FT8A 2RR12 1V6OA 3VHOA 1EV13 2BGCA 2ZGKA 5L36A 1SMVA 2DFCA 4GKYA 4S2HA 1D0GA 2D44A 2Z69A 2W52A 1I3HA 1LHWA 1HV1A 4CDUC 5FO8B 4HZFA 4CP0A 5JZGC 4YGBA 4MZUA 2I2SA 1H8TB 4QQPA 3OY8A 4UBHA 4QPYA 2JG9C 2FMYA 5CG9A 2P17A 3MW3A 1AJOA 2C0ZA 2IZWA 3ZSJA 4D7YA 4LBQA 1NY72 2WT0A 4I01A 4IQPA 3WDVA 4KG0A 1I6XA 4RGAA 4KL1A 5BNNB 5KHIA 1O3QA 4YGCA 4B29A 5BUVA 4I3PA 3WVJA 1QJX1 4N90A 4OFGA 2NLRA 4O9EA 4XF4A 3MYXA 1ZBA3 3M2MA 4O9GA 1FMD1 4GWMA 1VBA2 1Y43B 4Y4YA 5A3LA 2VOKA 4HN1A 2DVAA 4WVMB 2CGPA 1HXS2 1PO21 2WNVC 5CVRA 5T50A 1R081 1YCIA 1ZBE3 1PIV2 1X50A 1LB2A 4H55A 1LR5A 2PHRA 5JOWA 4YNIA 2RS33 4MV2A 3IMNA 2RR13 1Q8PA 1PVXA 3L2HA 5ACA1 1ENSA 4DY3A 4N7UA 3WQ1A 3ENRA 5AVPA 1BVP1 3MPBA 2A6ZA 4XFCA 1XE7A 3MW4A 5K9YA 3ACLA 5JVVA 4BM8A 3VLBB 3IPVA 1PVC2 4EN6B 2GH2A 3N4MA 4CDXC 5GM0A 4IESA 2A6VA 4EN0A 3HT2A 3KCXA 4Z07A 2ZABA 2AR6A 2OZJA 4YFZA 2ZMNA 3ZXAC 3ZO0B 1LHUA 3PVEA 1YFWA 5J48A 4ASMB 1QH6A 1LOBA 2RS12 2LTNA 3SNMA 2R071 1RUH1 4D7TA 2XGXA 4YSFA 1ASJ1 1N1SA 1AYM2 1DQ0A 1Q8OA 4YVWB 3LOBA 1MVQA 4Q4W2 3VBOC 2PN5A 5E89A 3H8UA 4K21A 1JYCA 1PK6A 4F3JA 5K7PA 1U5ZA 4XBQA 1HXS3 1QJU2 4WM8A 1NCRB 4C0BA 1IZ3A 3BOPA 3KLSA 1RUE1 2GNMA 4N53B 1WCSA 1GQHA 2D40A 1XYNA 2PELA 4AI2A 2TNFA 4XJ9A 2CV6A 2IFRA 4XE9A 1R1ZA 4I30A 3RRDA 3SHRA 4I2OA 4G9SB 3TBDA 4XBLA 1YJLA 2ET1A 1OFNA 2TEPA 4M01A 1DLLA 1PNGA 2ETEA 2BEOA 2ZKNA 2PA7A 1SLLA 4JRAA 4IEOA 1LENA 4CTEA 1PVC3 3VHRA 5A32A 1KITA 1BQPA 2EIGA 4LBKA 2RS51 5JSRA 1U12A 4LBOA 2AENA 4HLTA 5JAXA 5GLZA 3ILNA 1JW6A 4AI3A 2PAKA 1W6NB 2HWC2 1D2SA 1PZ9A 3V64A 3U4XA 2RS13 1ZNPA 1OQDA 1XXNA 1NXMA 3MF9A 4KWKA 3TB0A 1SEFA 3H1MA 4Y1ZA 1AYM3 4FPKA 3TOJA 4Q4W3 4K20A 4LO6B 5C6CA 4XILA 3B3QE 2VUAA 2BFUL 3S7IA 3ZXGA 1MVEA 1QJU3 4QU2A 4DY5A 2Y26A 5LK7B 5I8YA 5I8TA 1AXZA 1ENRA 2VGDA 2PTMA 3E5QA 4JDMA 4MXWB 4QM8A 1WW7A 5HBAA 2TUNA 1RUNA 1OI6A 4AK3A 4XJZA 1Q8VA 1SBDA 1BYHA 2Q1MA 1QXRA 2D6OX 2VVEA 2IXHA 4Y1XA 2PHTA 4EN7B 5FQ0A 4BIFA 1QGLA 1AR91 4D7SA 1FPN1 3UKNA 2GMMA 4XETA 5BNPB 1K5MC 1FOD1 3MGUA 2ARXA 2Q30A 1FI2A 1S0CA 2ZACA 2WQ4A 4QPIB 3VBRB 5DZEA 4AGGA 1MS3A 1COV1 4YZ2A 2UWAA 3OBRA 4L97A 2HWD2 1UKRA 3WLUA 3VBUA 2HWC3 4Y24A 3OBTA 3RPQA 3JZVA 3ZVXA 4LTAA 5I91A 3D4KA 4TLFA 3CEWA 1N1TA 1WLWA 5A33B 1FNZA 1C1LA 2R041 2D6KA 2VY0A 4FOWA 4IEYA 4MX3A 5GJ6A 2WA3A 5IK5A 3NAPA 4NVPA 3I2DA 4LA2A 1VIWB 1LULA 4A2UA 2R6QA 1RUF2 4AI8A 4R9AA 3M3CA 2EAKA 4UW4A 3AKTA 3GHNA 4Q1PA 2JENA 3RSJA 1C1FA 1X7NA 2ZGOA 3ZXKA 4KWLA 4LHNA 3GBGA 2XUMA 4AFAA 3FE5A 1FV2A 1QJX3 2XJPA 4IEQA 2KXLA 3VBSC 1BKZA 4IETA 4JV4A 4CEYB 1ZX5A 1MZ5A 3LGRA 1FMD3 1UD1A 1A8MA 4N43B 5BNNA 3MICA 1AF9A 3OGJA 1CN1A 3A4UA 1GZWB 3EBRA 2VNOA 5FBZA 2HWD3 4X8NA 2UURA 3WW3A 1BEV1 1EAH2 3FWEA 1D2QA 4ASLA 4COVA 3AP7A 5ACA3 1GICA 4Q4V2 4WVMA 3RJRA 2B46X 1UU4A 1ZZBA 2MEV1 4XXAA 2PHFA 5HCBA 3AP4A 2FZ1A 4LBMA 1LGBA 2XKPA 2JICA 1G6NA 4GKXA 4OI1A 1REDA 3V0AB 1J1TA 1WLTA 2WKKA 1J1LA 4LLFA 3B94A 1WLDA 2WA4A 2WLQA 1ENXA 1RUF3 3N7MA 2WFF1 2BTVC 2DTYA 1H30A 3TAYA 5J09A 2XJUA 4Q8KA 1XU2A 4P14A 2DF7A 4KG8A 1NXD1 5DDJ1 4HKWA 1AL21 1NE4A 1QOSA 4LR4A 2H0BA 4KQ7A 1U5XA 2PHUA 1RUH3 4LHLA 1ASJ3 5DZFA 1S0GA 5EFUA 4DRRA 4YM3A 2B5HA 2WNUB 1LHVA 2JJ6A 4XIOA 4CDWA 2D43A 4B3NA 4Q2FA 2JDZA 2GALA 4J6GA 1TQ5A 4RQPB 3ST7A 2GC0A 4E27A 4KU7A 1SFNA 3PMSA 3WNXA 2NP0A 4YVWA 1EAH3 4YG6A 4OUSA 3VUOA 4FQ4A 4YW4A 4K7JA 4B7EA 3R6SA 1IKQA 2Z42A 5T52A 1NCRA 4YVSB 1OA2A 1RUD1 3FLTA 4DNYA 3EQEA 5C4WC 5L19A 1VBE1 5FO9B 2QKDA 1AR92 1S0BA 2K2SA 5B2GB 2VQAA 1IGOA 4FBFA 3VBUC 5BNQA 1RITA 4B7KA 3EXUA 5CA6A 2XVKA 4XFGA 3R4SA 3ZN6B 3R4UA 1VAMA 2ERFA 3PMEA 4E2GA 1UZYA 3FLPA 1VRH1 4PLMA 4JTOA 1S55A 2ZJCA 1TME1 3JBG1 3GF6A 3NAPC 4XQDA 3WQ0A 2ZZJA 2R042 2B8MA