2XLAA

Structure and metal-loading of a soluble periplasm cupro-protein: cu- cuca-closed
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
233
structure length
233
Chain Sequence
HTFDDIPMPKLADPLLIYTPANEIFDIASCSAKDIGFAIAHAQIPPGGGPMPHIHYFINEWFWTPEGGIELFHSTKQYPNMDELPVVGGAGRGDLYSIQSEPKQLIYSPNHYMHGFVNPTDKTLPIVFVWMRNEVAPDFPYHDGGMREYFQAVGPRITDLNNLPELTNAQRAAFASEAPKYGINQSSYFMEYVNTISDKLPAQIAKLKNDKDLERMVEVIEAFNRGDKSVTCS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SLL1785 PROTEIN
publication title Structure and Metal Loading of a Soluble Periplasm Cuproprotein.
pubmed doi rcsb
source organism Synechocystis sp. pcc 6803
molecule tags Metal binding protein
total genus 63
structure length 233
sequence length 233
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-07-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2xlaA00
3BPZA 2OZ6A 5BY5A 4QX5A 2IXJA 3C3VA 4LUMA 5EZWA 3H1MA 3SCGA 1ZRFA 2I45A 5FLHA 1U12A 4MV2A 5E1RA 5KBFA 4IEPA 4D7TA 4XF4A 4IESA 1O5LA 2BNOA 2FQPA 4HN0A 2GC3A 5JAXA 4HBNA 4MGKE 3G7DA 3BB6A 4KU8A 4Q0SA 5CU1A 3TNQA 3U0ZA 4IEZA 4IEUA 3H1YA 1NXMA 4AVBA 4R8HA 1CAWB 4HSJA 2PHDA 3RYKA 3FX3A 4X6QB 5FPZA 2DCTA 4LA3A 2QDRA 3O14A 4IEYA 4FAGA 2UY8A 5JSPA 2KXLA 1NE6A 1H1IA 1CAWA 2EAAA 2O8QA 1Y3TA 1SFNA 3SMHA 5EFUA 1EY2A 2Q30A 2C0ZA 3MYXA 5LEKA 4LEJA 2ET7A 3HIFA 4QMAA 4E2GA 3LZZA 2GZWA 4HSLA 3CF6E 2Q0AA 1RUNA 4XFIA 4IEVA 3H7YA 3HQXA 3WW3A 4O9EA 4YARA 5AVPA 3E6BA 3LAGA 5BV6A 4I0AA 1LRHA 4J1XA 3RNSA 1UIKA 4HVOA 4F8AA 4JVAA 4QGMA 1VJ2A 3NL1A 2IXHA 4XFAA 2ATFA 5KHGA 5I0RA 4AQ2A 1FI2A 3I59B 3E5XA 2VQAA 4MX3A 4UBHA 4AQ6A 4EWAA 3OF1A 5I91A 2QCSB 2ET1A 1EP0A 1O5UA 4KWKA 4OFGA 3UKTA 1FT9A 4UXAA 4GULA 3I59A 4QGLA 4HZFA 3LOIA 3H8UA 3ES4A 2XL7A 4H7LA 1EYBA 4L11A 1GQHA 2D5FA 5I0UA 4AVAA 3NW4A 3PVBB 4MGZE 2VECA 4QM8A 3MPBA 5LEJA 4LLOA 4XF1A 2GC0A 3BCWA 4E2SA 4XF3A 3DV8A 5E16A 4Q0VA 5J3UA 3VHRA 1UPIA 4UBGA 3E6CC 4MZUA 5I8TA 3H3ZA 2IXIA 1HW5A 3MDPA 5D1IA 2XL9A 4Q0PA 4FAHA 4P9GA 2XGXA 1OMIA 4HVQA 2BEOA 3CO2A 5F1RA 4AXOA 5J48A 1L3JA 2GU9A 3KMHA 1WA4A 4MGYE 5J7MA 2N7GA 3U11A 1OFNA 1DGWA 1CAXA 3SCHA 1TQ5A 4B29A 1O3QA 1I5ZA 3U10A 3WW1A 1PMIA 3RYPA 1DZTA 3S7EA 3DKWA 5JR7B 4WVZA 4Q0QA 2CGPA 1J3RA 3RPQA 5BXXA 2EVXA 5KHKA 4KWJA 4Q29A 4QM9A 1J59A 2HKXA 1ZZ9A 5FQ0B 2GC1A 1I6XA 2CV6A 2UYAA 1QXRA 2BGCA 4E2QA 2Z2SB 2B8MA 1LR5A 3H7JA 4QGNA 3CLPA 2E9QA 4X6RB 5FQ0A 4XFCA 1NYWA 4Q0UA 5CADA 1NZCA 5LRSA 2IXKA 2F4PA 1XRUA 4N9IA 1QXJA 1Q5OA 4HVRA 3N4MA 5KHIA 4J1WA 3HT1A 1ZREA 1ZNPA 4OLLA 1RL3A 4JTNA 4AVCA 1O3TA 3ES1A 1YUDA 1DGRA 3I7DA 2MPFA 2XLAA 3IDBB 1XE8A 3JZVA 4EWEA 1LKNA 2GAUA 2WFPA 3NSTA 1GQGA 4F7ZA 3I54A 3WW2A 3ROUA 3PNAA 1UCXA 3IDCB 5C6CA 5JSRA 4I3PA 4BH9A 3IWZA 3OGJA 4I01A 4LA2A 3OTFA 3D0SA 1SQ4A 1G6NA 1Q43A 3LA2A 4JTOA 5FLJA 4Z07A 4PIZA 4HLTA 4I0BA 1J3PA 2PA7A 4IEOA 4BYYA 3KGLA 2XLGA 4XFFA 2UY9A 1X7NA 4LTAA 1J1LA 2VPVA 2EA7A 4YSFA 4JV4A 1IPKA 5K8SA 4HN1A 5FLIA 4PJYA 4Z82A 4MGIE 4RD7A 4EWDA 4XFGA 4IEWA 1X8EA 2O1QA 3CJXA 3FWEA 2PQQA 3ST7A 4WBBA 4YNIA 1O7FA 2BNNA 5CVRA 3DL3A 4EV0A 3IBMA 1ZZCA 4I09A 4I02A 2Q4SA 1ZZBA 1Y9QA 1YHFA 3NVCA 4MUVA 4CYDA 4ZU7A 3IIAA 2OYZA 4BIFA 3H3UA 1ZRCA 2GH2A 3MZHA 2PAMA 4XFHA 3M3IA 3LA7A 4LUKA 4ZU5A 3L2HA 4I2OA 1YFXA 3RYRA 3ZDSA 1CAXB 3KGZA 4ORFA 2BYVE 5KHHA 3ACLA 1PM7A 3LA3A 1OI6A 2Z69A 2Y0OA 3FFQA 4YYOA 1YLLA 3GYDA 2OZJA 3SXWA 1RGSA 1QWRA 3BALA 4FT8A 4YRDA 3KSCA 1IPJA 2IXLA 1X8MA 3S7IA 2B5HA 1ZZ7A 1ZRRA 5I93A 2H6CA 4HMZA 4XEZA 1YWKA 3QOPA 3OD0A 2OPKA 4A2UA 2QVSB 3NKTA 3E97A 4BHPA 2K9ZA 1WGPA 3FHIB 3UKVA 4R52A 2Q1ZB 1YFUA 2MHFA 4ZU4A 1ZZ6A 5JSOA 4ONUA 1CAUA 4KWLA 1V70A 3WW4A 1CGPA 1UD1A 4K8FA 1FXZA 2CAUA 2IC1A 2K0GA 3RZZA 3DN7A 4KU7A 3USSA 3H9AA 4NVPA 4D7SA 1X82A 4TLFA 3OCPA 1LB2A 1DZRA 3EQEA 3RDIA 1UW8A 4O9GA 5FDBA 1VR3A 1JUHA 1OD5A 4IEXA 3H50A 3HT2A 5BPXA 1ZX5A 1ZRDA 4IEQA 1J3QA 2H0VA 2CAVA 5KHJA 2ZKLA 2QJVA 2P17A 3E6DA 3EHKA 1O3RA 3ETQA 2FMYA 1YFWA 1YFYA 3D0JA 5BUVA 1EPZA 3EJKA 1VP6A 2XHKA 3B02A 3QACA 4IERA 1QY4A 3D82A 4XETA 1CAVB 2QNKA 1XE7A 3UKNA 3H1WA 1O3SA 1H1MA 1NE4A 1ZZ8A 2XKPA 1RC6A 2V09A 3EBRA 3SHRA 3PLQA 3GBFA 4IETA 4LULA 5I0SA 3TNPB 3E5UA 2HJIA 3FE5A 4DINB 2XLFA 4META 3NJZA 1CAVA 2WC2A 3SCFA 4WZCA 2PAKA 4MH0E 4PIXA 4FBFA 2PYTA 1RTVA 2MNGA 3CEWA 2H6BA 2XKOA 4KL1A 2ETEA 2IXCA 2ZCWA 3BU7A 1O4TA 5I0TA 5I8YA 4N9HA 5HI0A 1SEFA 2D5HA 2D40A 3EO6A 2PHLA 4XF9A 3CL1A 1RUOA 2D93A 5FCCA 3R6SA 4QXKA 4L2NA 1UIJA 1WLTA 1CX4A 4EROA 1Q3EA 5C8WA 3FZ3A 5T3NA 4XF0A 5LRRA 1ZVFA 5JCTA 2BNMA 2B9UA 2PAEA 4PIYA 3ELNA 2OA2A 2UYBA 3M70A 3FJSA 3LWCA 5FPXA 5I8SA 1J58A 1CAUB 3KCCA 2PFWA 2PTMA 3S0MA 4XFBA 3E5QA 2GC2A
chains in the Genus database with same CATH superfamily
4G9SB 4QX5A 3ZFFB 2E7QA 2VUJA 4FFHA 3H1MA 4CDWC 1UMIA 1W8UA 2DU0A 4XCBA 4MV2A 2RR12 4OHYA 4D0QA 4BQ2A 5KBFA 2VZPA 2VMDA 4D7TA 4CP1A 2ZGQA 4UF0B 3R4UA 1QQP2 4QQ2A 1PVC3 2VVDA 1PIV2 2B4KA 3OBTA 5A7PA 5JAXA 3VZOA 3WHTA 3WP4A 1OH3A 3WG2A 3BOWA 3MV11 5L36A 1PHMA 4QPIC 2RDSA 4FPCA 2Y0IA 5CU1A 1QOTA 3Q8BA 4UF0A 1VBD1 2LALA 1SLAA 2QE3A 5FYVA 5JUVA 1BHGA 4E4DX 2DDUA 1W6MB 5C8CC 3FX3A 5FKCA 5DUVA 1A8MA 3AKPA 3NAPC 4IEYA 2DBNA 4IV1C 5DUUA 1SLLA 2QZ3A 1EV12 5CNAA 4OI4A 3VLBB 2C5DA 4IV3B 4RA0A 2EAAA 1JYCA 1LCLA 1W6MA 1V00A 1CJPA 1Y3TA 4FPHA 1SFNA 2YFZA 4AEMA 5IVEA 3TEZA 5BNOC 1AXKA 1EY2A 2L9LA 2R30A 1N3OA 2WZEA 4NHMA 2Y64A 2BDRA 4PLOA 4RR3C 3MYXA 2F4LA 2KM2A 1RMU1 3KCYA 3WDTA 2WA3A 1HB4A 3K75B 5T5PA 5A6YA 5DUWA 5LEKA 4MG2A 3HIFA 4QMAA 3ZYJB 4HPKA 4YZ3A 5FMCA 4LE3A 2UU8A 2GZWA 2EXIA 2WFF1 3A0KA 4FOWA 4BE3A 3BPSA 3J7MA 3LFMA 3KD4A 4OHWA 4XFIA 3H7YA 4EN6B 3HQXA 1UWWA 1IZ3A 5EHDA 2GN7A 2YV8A 1VBD2 4XTPA 4FPOB 1UY1A 2VCAA 1C5IA 3T2TA 3RNSA 3U78A 1WLDA 4BQ1A 2RMU1 4S2FA 2VMCA 1UIKA 4UFMA 4AW7A 2TUNA 2HYKA 1QHDA 4F8AA 5FO9B 2I74A 3PVNA 2FD8A 2Q8DA 1WCUA 5A1LA 3VKFC 4DRRA 2IXHA 4B4RA 5KHGA 4KGQA 4AGGA 4CU7A 4CDUC 1A3KA 3OGGA 4F83A 4XE9A 1FI2A 2P3KA 1ZA4A 2W46A 5HBAA 4CUAA 1JYNA 2BFUL 2VQAA 4GWMA 1UPSA 4YW3A 4NPRA 2VC9A 3VBRC 4NHYA 4KWKA 3AYDA 3POFA 2QQVA 1W2TA 4TN7A 3I3BA 3WG1A 1YRZA 1RMU2 4UXAA 3AMHA 2DCKA 3R4DB 2WO7A 3OPWA 1BCXA 4GWJA 1IGOA 3BN6A 2YMZA 4GWNA 4OCTA 4B1LA 3HBKA 3GCXA 2OIIA 4UFHA 5A6ZA 5FY4A 1TMF2 1W2AX 1VBB3 1W2UA 2D43A 2VBBA 2XL7A 4H7LA 3R4SA 1HV0A 1GQHA 3PU8A 4Y1YA 4Z8BA 1UY4A 4BQ4A 4CP2A 4QPYA 5IWFA 2ZGNA 3NV2A 3O7OA 5C3PA 3AKRA 3VD5A 1GZCA 2GC0A 1Q8VA 4PBPA 1C57A 2OX0A 2RMU2 2VCBA 5GLVA 3WUCA 3DV8A 1HXS3 2GN3A 4Q0VA 5J3UA 3PUIA 1D4VB 4K3UA 4OUSA 2ZKNA 5EWSA 1WBLA 5IAVA 3H3LA 5JIAA 2CWMA 5EJ3A 3SKVA 2C1FA 5I8TA 1OD3A 1GU3A 1Z0HA 1JYWA 3FHQA 3MDPA 2ARXA 2W39A 2QBXA 2PLV2 4YM1A 4FAHA 2VULA 1ULCA 4YGCA 4DXSA 4P9GA 1ND3B 2YB7A 1W03A 4BLIA 1UOJA 2BEOA 5J48A 4YG6A 5D2AA 2JB8A 4AFDA 1W8HA 2E32A 3VDBA 4KG8A 1XNBA 2W08A 1AR71 3AL6A 3IB3A 3KMHA 4NRQA 3B9IA 4QKBA 4GQ7A 3ZPYA 2CWSA 1ND3A 2BRTA 2NPIA 1NXD1 1VLNA 2OVUA 5CFCC 4YVSC 1DP0A 1A78A 1YQ8A 3KWVA 3U10A 3VD9A 3N7MA 1PMIA 5ISLA 3A23A 4CCOA 3AZXA 5F5IA 1H0BA 2R1DA 3CBNA 4Q0QA 4BZ4A 4UW5A 4XDQA 1TME1 3ENRA 3AFGA 1O59A 4P02B 5SV8A 2WNOA 5GLZA 4Q29A 4XZUG 4LO5B 4FCAA 2PMWB 1JZ4A 2HWF1 4FOYA 4DY5A 4N7UA 2BPA2 4DXZA 4FXKB 2JG8A 2FCUA 2PXJA 3GBGA 4Y1ZA 4LXLA 5CBLA 3TEXA 1W8ZA 2WUHA 2ZABA 2XBO1 2D6OX 4UFIA 1VIWB 1PMJX 2BGCA 3AM2A 4Y22B 3W20A 3Q8CA 4CCEA 1O91A 5JOYA 4JC1A 5HV4A 2IVIB 5GLUA 1P8JA 1NCRC 3I2DA 1DIWA 2HLEA 3O1MA 1QIQA 4QDSA 3H7JA 3URFA 3PDQA 4OZOA 4JCKA 2VTXA 1V9U1 1AR72 1FATA 2E9QA 4RS5C 1SBDA 2W68A 2G9FA 4OI1A 4XJ8A 1H2MA 5KWRA 3BIEA 1W9YA 3M3CA 1RUD3 4Y22A 4RQPC 4G3YC 2F4PA 1XRUA 4D7YA 5F3CA 1PZ7A 1H6XA 3OY8A 2BWCA 3I3DA 1UYXA 2WZPP 3M4FA 3SKJE 2AUYA 1DYKA 5AC92 3DEMA 4HT1T 1YC61 1UU6A 2VMGA 4FFIA 5IVBA 5KHIA 2BVVA 4YM3A 3TAYA 4UW6A 1E57A 3CHXA 1ZREA 1RL3A 5A7SA 2Q8CA 4JTNA 1O3TA 1DF0A 1W8TA 3JCIA 4QPWA 2LROA 3VKOA 3WVJA 1HB2A 3ZIWA 1XYOA 5LBEA 4AVTA 2GAUA 2HWF2 2JX9A 1XNTA 1GQGA 3NSTA 4N53C 3WW2A 4BMEA 1OA2A 3C7OA 4ATFA 5BNNB 3ROUA 3PNAA 1UCXA 2XOMA 4MHRA 1OOPB 1CZTA 4OQ8A 4QHBA 4BPZA 4L92A 3WP5A 5JZGC 2ZTNA 2PELA 2A1XA 2W92A 1SMVA 3I3QA 3OTFA 3U4XA 3LIGA 3PTRB 1V9U2 4JTOA 2IVJA 1OVSA 2VMFA 4K6BA 4IEOA 4BYYA 4INDA 5LCWL 3M3OA 1ND2B 2XLGA 1X7NA 4LBLA 2EIBA 2VJXA 3WSOA 3VL9A 4MOAA 4YZ1A 3RQ0A 1YNAA 4QB1A 4NO4A 1YEWA 5JLVA 4LOSA 3BTAA 2WWJA 3N9OA 1D7PM 2C26A 3FFZA 3PU3A 3RZJA 3GZTB 3PTYA 4CDQB 2WO3A 1NG0A 4EWDA 5T52A 3RWNA 2ZZJA 2WLQA 2O1QA 4FFFA 3ACFA 2PQQA 2VUDA 2Y33A 3FWEA 4A41A 5H9RA 3J26N 4DIQA 4WM7B 1WBFA 3POBA 1C3HA 5F5AA 1XE0A 1MVEA 2PHUA 2RDRA 3DL3A 2V72A 1ZZCA 5DAQA 3K3NA 4CP0A 5I0DA 2B7YA 4CDQA 1HIXA 3VBHB 1CZVA 4EN7B 1JXNA 1Y9QA 3AP7A 3M3EA 3J8F2 3NV4A 3NVCA 4MUVA 2D6NA 4CYDA 4ZU7A 1AYN3 3BKZA 2W1SA 3NJXA 3TWIA 1GWMA 3KT1A 1KDMA 4RFRB 4WM7A 3AZVA 4XQWA 1G9CA 3LA7A 2VW1A 4TYSA 5EXOA 5L7OB 3VBHA 4FOQA 3T0BA 2Q8EA 5FFOC 5A32B 4AEDC 5KXEA 1YIPA 3AZYA 3C7EA 2DV9A 4XCAA 5CG8A 3LA3A 2AEZA 2Z69A 1VE0A 1KITA 3FFQA 4LHKA 4SLIA 4QXBA 2ZZQA 4ZZ8A 2D3SA 1U5XA 5IHRA 1Q8OA 2OZJA 4JQTA 5L7OA 4RGGA 1NCQA 4S2DA 1XBFA 2XMLA 5A32A 4YRDA 3VN4A 1POV0 2IXLA 4QU1A 4LBOA 4M4RA 5GZFA 3S7IA 4E8DA 3RZHA 3RZLA 2GALA 1RUH3 5F7UA 4QAWA 4JHTA 4XEZA 2DCYA 1ENQA 1G9FA 2JXAA 1J84A 2WKKA 3OD0A 1F5FA 3JXSA 5J1XA 2QVSB 4CXXA 4E8CA 3EMRA 2X09A 4BHPA 2I07B 1WGPA 3KV6A 3VGIA 2O8OA 1YFUA 1YQ5A 4QKNA 2YGLA 3AFKA 1WCSA 2VMIA 3NQHA 1Q56A 3T2QA 5DG2A 1NA1B 4DEVA 1QOOA 4WM8C 1FXZA 1WMDA 2CAUA 2OT7A 3N7JA 2B46X 4LNVA 4AFBA 5F2WA 2R061 3I2KA 5J36A 4QPIA 1FV3A 1IQDC 5JDBA 1OURA 1OHFA 3DN7A 4KU7A 4QU2A 1V6OA 4ZONA 3HR9A 3RMYA 4S2GA 4NVPA 3I2GA 1C8M1 1AF9A 2J1AA 4Y26A 3VBUC 2XVLA 1X82A 2W91A 5JWPA 2WAOA 4CEYC 1DQ0A 1DZRA 1MR5A 2RG4A 5C8CA 1LB2A 1KQRA 3T3YA 2ZEZA 5DAPA 5DDJ3 1ASJ3 1W6NB 1AX0A 3ORJA 3NAPA 1UW8A 1GZWA 1PGL2 3H50A 5BPXA 4X8PA 1ZX5A 5SV5A 1W6QB 2BOJA 4IEQA 2R071 1J3QA 1OF3A 1N1VA 1VBC3 2Y6HA 4R9AA 3FBMA 3DUIA 5CKQA 5T5LA 5KHJA 5IVCA 1JI6A 2VNRA 2GDFA 1OUXA 2CTVA 1WW6A 3MPPG 1C5HA 1W6NA 1O3RA 3VBSB 3ETQA 5FP9A 4N90A 1W9WA 3DPRB 4RR3A 5FBZA 4Q4Y3 3WNXA 2V73A 3U14A 2E63A 3ACIA 5FUPA 1YFYA 3MIHA 3KZ4C 4NIIA 1HV1A 5F32A 5G05L 3D0JA 2A5ZA 3WF1A 5BUVA 3TEWA 1MS0A 4C8DA 4M0HA 3HVDA 3ZXFA 3IPVB 1WCQA 3VHNA 1QJU1 2FZ1A 2VQUA 4W6WA 1C8M2 4PQ9A 1XOYA 3ZMOA 1JYVA 1CAVB 4D8MA 2QNKA 1XE7A 2PHFA 5IVYA 4OMCA 4CEWB 1H1MA 2RR13 3B3QE 2XKPA 1RC6A 3CQOA 3EBRA 4ZXEA 3SHRA 4ZKTB 1H6YA 5K7PA 1UN1A 3GBFA 5EIYB 3IPVA 1ZBA1 5I0SA 4RGKA 3FE5A 4DINB 1S0IA 3R0RA 3MLKA 4LHLA 5LATA 3H8RA 1CAVA 1KFUL 2JD4A 3BODA 5FIXA 3ZN4A 2R072 2H0BA 3INAA 3OEBA 4FO9A 3AC0A 4WZCA 1CN1A 1JS9A 4CEWA 1ULFA 2F6BA 3BTZA 5FPAA 2KR2A 1N1TA 2PYTA 1RUJ3 4FTEA 2JDMA 4MLOA 1RTVA 2MNGA 3POJA 2H6BA 2VOKA 2OUJA 1QNYA 4PDWB 2VUAA 2ETEA 2ZCWA 4JQRA 2YGMA 1E5RA 1W3VA 3GGLA 4JZRA 5I8YA 4P9IA 1BVVA 2D5HA 3EO6A 3MBWA 5KXBA 3SEPA 1H2NA 3THTA 1EV13 3CL1A 3P3PA 4CTEA 1QJU2 3RG0A 4RSUA 4NWWA 1NUKA 2D93A 1FNYA 1MEC3 2VNOA 3DXTA 3R6SA 5A3NA 1ENRA 1UIJA 1HB1A 3NJVA 1LOFC 3LCPA 5KR7A 1RUF3 3IDAA 4I30A 1APNA 1MQTC 4EN8B 2DVAA 2OPWA 4JGZB 4NAMA 3SQOA 5FZDA 5T3NA 3ZIXA 1ZBA2 4XF0A 1DGLA 1ZVFA 4WVMB 4P9JA 4W6XA 4HK9A 1GLHA 4XYXA 4PIYA 3ELNA 2WZ8A 4YM2A 4YW7A 3RVHA 4LO7A 2PHRA 1AR81 2BERA 3C7GA 5FPXA 4GJZA 5FZ6A 2WQ4A 1EV11 1AZDA 1VBD3 1LU2A 2OQ7A 4L99A 1CAUB 5BNPC 2FDFA 1JHJA 5LBCA 2XHNA 3KCCA 4AZZA 1HRV1 1OLQA 2W5FA 4QHOA 2J1EA 1SCSA 5FV3A 3PIJA 2YY1A 2IXJA 3C3VA 4A44A 4Q8LA 1JYIA 5FYSA 1DFQA 2Z5WA 3AP9A 3CJIB 3M7AA 3O0VA 3SCGA 5EYXA 4XJZA 5J37A 2BVBA 1ZRFA 2AACA 1WMFA 2RS31 4P9YA 1SBEA 5E1RA 4AGVA 4YVSA 3CDZB 3WHUA 3AJYA 3N36A 1MZ5A 3QD6A 1LHVA 4QT6A 4J6GA 2VZ3A 5DPNA 1UXZA 1RMU3 2P3YA 3IM0A 3P5BA 1YJLA 1MS4A 3U0ZA 3VZMA 3O1VA 3KCXA 3X29B 2DURA 1EAH1 2XQRA 4AVBA 3F95A 1Y4WA 3K4ZA 1TMF3 5ABJC 2ARBA 3ETPA 3BTXA 1AR82 2IWGB 3VDDB 2BU9A 1UNBA 4X6QB 4LE4A 3AMPA 4DXRA 5A7OA 2DU1A 3N35A 2QDRA 1SG3A 2NMOA 1IKQA 1UKGA 2BUKA 3OBZA 4CZSA 1HRV2 3RJ2X 1REDA 4FAGA 1NCRA 3RFRA 4BJ0A 1HN0A 1W6OA 5JMCA 2HEYF 3LE0A 4RS5A 1IKPA 4GJYA 3W9AA 4C91A 5LK7B 1PK6C 4L0PA 3NNLA 4LJHA 1HQWA 3SMHA 5EFUA 3LDKA 2IUWA 2RS32 4RQPA 1JW6A 5DAXA 5A3PA 4DUWA 3T4VA 5F9TA 1PO22 4SBVA 4DRVA 1IG0A 4Y3OA 2ET7A 1V6MA 2PLV3 5KXDA 4HSLA 5FZFA 2MEV1 5FYHA 1UYZA 3KLSA 3LDRA 2W1QA 2Z4FA 4Q4V1 3GZUC 3M8LA 4QPGC 2FDKA 5D8AC 3WW3A 5IT6A 4O9EA 5AVPA 1EAH2 1Z7S1 1OQ1A 4GH4C 3LEIA 4I0AA 5FOBB 2YHJA 1S0CA 3OEAA 2RS11 2A75A 4URAA 3VBFB 4AAPA 2QQOA 4ARYA 4HVOA 1BMV1 4JVAA 3WDXA 5JZGA 2JIJA 2ATFA 3DECA 1YO8A 3AK0A 4QDRA 1RVF1 3ZDVA 3I59B 1I3HA 5CEHA 2RS52 4GB33 5FZ9A 4NHXA 4D3WA 1R082 4MX3A 2HWC1 4AFCA 4AQ6A 2EXKA 4EWAA 5I91A 4LT5A 4CCDA 1COV3 3HNBM 3T2PA 2DVGA 5CKMA 4B1MA 3MUY1 2WIIB 1O5UA 1V0AA 3BIWE 4GKXA 3O5SA 3UKTA 4QB6A 4COWA 2NZ9A 3I59A 1A34A 1S0BA 5K0UB 4QGLA 4XQDA 1CX1A 4FPJA 3DYOA 1V6LA 4HZFA 3ZN6B 3LOIA 1WWYA 2MEV2 2VAUA 3H8UA 1H4HA 2ADDA 2XUEA 3ES4A 4K20A 4L11A 1KFXL 5L19A 2GNDA 4AVAA 2VZVA 1AR73 2GP3A 5LA0A 3NW4A 1Z7S2 4MGZE 3VDAA 4CP9A 3ZSJA 1PX3A 4LLOA 4XF1A 3BCWA 1NQDA 1GP5A 5FZIA 3ZN6A 4RHV1 1LHOA 3WNNA 4XVHA 5FZOA 1BMV2 4Q4X2 1BJQA 4ES9A 5AC93 3O1UA 1LECA 4W50A 1BXHA 2W87A 1UPIA 2RJKA 4JKMA 1SHWB 1RVF2 4MZUA 2D6PA 5K4LA 1WUVA 2A73B 4AI1A 4MGTA 3MF9A 2VZQA 4RYDA 4XDPA 3RI8A 3UETA 3H42B 1XYPA 1W9SA 1RHI1 2HWC2 2IXIA 3KT4A 5CAZA 2LM3A 5FXWA 2WYSA 3IN9A 1SPPA 2XL9A 2P37A 3LSEA 2RDNA 5A80A 5CFDB 4YZ4A 2XGXA 1ONAA 3GZAA 2WR9A 2HWF3 4NUBA 1QH7A 4P5YA 3CO2A 3T30A 1UZWA 4DQAA 5F1RA 1L3JA 2GU9A 4Q4W1 1U5ZA 3WXPA 4LBNA 3FBYA 3KVAA 3WOGA 5FP8A 4N43B 2EXHA 1T6GC 5E89A 4QQPA 1Q8PA 2EALA 5CFDA 3CZUA 1CAXA 1EPWA 4YLZA 2A70A 1VB4A 2CDOA 3Q8FA 1O3QA 5T50A 1V9U3 3BI3A 1I5ZA 5JXHA 2ARCA 4XURA 3VV1A 4FPLA 2UWAA 4Y5Z0 2ZEWA 2YC4A 2QQMA 3ZXGA 2R0HA 5FY9A 3PJQA 4N43A 4JGYB 3S7EA 2VOWA 5E88A 2ZHLA 4RHV2 2E7TA 2CHHA 1LHNA 2VMHA 1Q8SA 5IFTA 1G8WA 3RPQA 5BXXA 4YW5A 2ADEA 4AI8A 2DVFA 1TNFA 5C3RA 1K3IA 1DLCA 2VL4A 4QM9A 5FZGA 1G86A 5FWJA 5KC5A 1JZ6A 1AX2A 2HKXA 1RHI2 3I3EA 4JGYA 2YFUA 4D6QA 2R6QA 3K48A 5JOZA 4LHNA 4PI0A 1HX6A 2CV6A 4Y20A 4R4XA 4OQ9A 2VZRA 2WSVA 2XJPA 4FSJA 3MIFA 4YVWC 2VCMA 4E2QA 2B8MA 5FY1A 1LTEA 1QDOA 1F4HA 4MO3M 2HWD1 3CLPA 4OI2A 3T0AA 4HPKB 1RUG3 2E6VA 1LNSA 4XFCA 4IXLA 1NYWA 1ZM1A 4OHVA 3W58A 3J8F3 3WQ7A 5LRSA 1H9WA 3VBUA 4DMIA 4Q27A 4XMAA 3V64A 1OPOA 2YBKA 1R1ZA 1QXJA 4QD2A 3D6EA 4HVRA 1TVGA 2HEWF 3K51A 5AVAA 5IVJA 1A6CA 3S5AA 2VD7A 5FJKA 3KV9A 2BV4A 2ZGRA 5DAWA 1FPN3 4HKOA 3AXDA 2RM23 1RUI3 4AVCA 5LWBA 4CVUA 1PZ8A 1DGRA 2QQUA 3H0OA 3N3HA 5JI7A 2XJSA 3S57A 3HN1A 1E5SA 3JZVA 4EWEA 5C7GA 1LKNA 2ILMA 2VTXJ 5DMYA 4GKYA 3LEMA 3I54A 1H2KA 2Y6LA 5FP3A 3IDCB 5C6CA 1D2QA 2QTWB 5JSRA 2E51A 2AREA 4ZS2A 5FRAA 3KQ4B 3OGJA 4ZS3A 2XDVA 2YDEA 4I01A 3VKNA 3IAQA 4FPEA 4YM0A 3D0SA 2WWUA 2HWD2 4Q1PA 1G6NA 5C71A 3O1PA 3LA2A 2JICA 5FLJA 4Z07A 4GMP0 4YZ2A 2A6WA 4QX3A 3NV1A 1PNGA 4I0BA 1X33A 3LF7A 1O4YA 1U5YA 3VKMA 4NPMA 3H8OA 5A33A 1B35C 3I2FA 4LTAA 1AYM1 1LJ7A 1ST8A 1LULA 4Q8KA 4AAXA 5IAXA 2EA7A 1QJX1 3JUUA 4MVTA 1R1A1 4YSFA 2YBSA 2WS93 4YFWA 5AFEA 2X5IC 3ILFA 2FHRA 5K8SA 2WFF2 4HN1A 1D0HA 3IKWA 4PF1A 4JDNA 5J09A 1VBE1 1DBNA 4Z82A 2YYOA 4MGIE 1LGBA 1XPWA 1ZBE3 4TWTA 1H8TB 3KHCA 2E33A 1VMHA 2VW2A 1OC1A 3ZN5A 2TEPA 3ASIA 5FPLA 5C5TA 1ULOA 3PVEA 3IIIA 3RMXA 4CDXB 3IBMA 2A6ZA 3T08A 5LY2A 2VZOA 3RZKA 1W05A 4I09A 5LB6A 5T55A 5ACA1 3B94A 1ZZBA 1H8TA 1QJY1 2NP0A 2Q5TA 4MYEA 1LEMA 3UGFA 3THCA 2WNUC 1ZRCA 2R1BA 3VKLA 1UU5A 4UOJA 5C5UA 2YC2A 4U36A 4LKFA 4QHZA 4CDXA 4ZU5A 3MV01 3TN91 2R0FA 1UU4A 4P9LA 2NM1A 1AYM2 1GICA 1LOFA 4P14A 4BWOA 1MQTA 1PM7A 3W59A 3R05A 4NWVA 1R1A2 5FJHA 4KWUA 1YLLA 1IQAA 2W95A 1KEXA 1VMJA 2F17A 5BNPB 2BFUS 4MSVA 5FMDA 3SXWA 1LHWA 1RGSA 1QWRA 1VBE2 4FT8A 2UWCA 4K40A 5FZ4A 2W0XA 5JPNB 1C4RA 3V0AB 1IPJA 1X8MA 4CA9A 1MPXA 1UY3A 1GV9A 2CY6A 3BOPA 1W9FA 4JRLA 1HRI1 1PGW1 5A6QA 3QOPA 5T5JA 2VQTA 3CMGA 4PHZA 4BB3A 5BNPA 3KQRA 4W65A 2JG8B 1QKQA 4E4ZA 3LEGA 5FYUA 4CSWA 3V0AA 4GZ9A 3CU7A 3WX5A 5ACA2 4NOTA 4R4ZA 2QQIA 1QJY2 3ZSMA 3AP5A 3FHIB 4B4QA 3UKVA 4R52A 2Q1ZB 3BGAA 5DG1A 3WNLA 1K5MB 1W06A 1ZZ6A 1VBA1 1O4ZA 5JSOA 3ITQA 4ONUA 1S4CA 1S0EA 1RUC1 3TN92 1V70A 1XSQA 1OBNA 4W8JA 1O8PA 1WA6X 3KHBA 2A3YA 1Q8QA 2ZX4A 4FPGA 4K8FA 3HAGA 5H9QA 3B93A 4AWDA 2IC1A 2YBPA 2W3JA 3OY8B 4AR2A 3N9QA 1K5MA 3ZSKA 4CCNA 3VUOA 2HWB1 3K3OA 4P5HA 2J1TA 2NMNA 4M3CE 5C33A 1H1AA 2X53S 3H9AA 4O61A 1WKYA 3VHOA 4D7SA 3JB8A 4PBOA 3ABZA 5BNQA 2RE9A 3EXUA 3FN9A 4YG3A 5TSWA 2VM9A 2WN2A 5FY8A 4BK4A 4COZA 1HRI2 1JZ7A 1URXA 1ZA7A 1PO13 5JXJA 3RDIA 1IS4A 2ARAA 1N3PA 2WNVB 3ZYIB 1TME2 5FZBA 3MIGA 5FDBA 1VR3A 5F5CA 5A7WB 2SBAA 3I49A 1UQXA 4AHZA 1ZRDA 2V5YA 3J9SA 4B4PA 4JRAA 2CAVA 2ZGTA 1PVC1 2P17A 1JH5A 2JKBA 2P2KA 2RV9A 3PIGA 3D3AA 4BXSV 3E6DA 3EHKA 1RUC2 1U0AA 3LKJA 2WNVA 4LBJA 4BXFA 1DG6A 1GANA 2FMYA 4LO4B 2XBO2 3PJYA 1FMD3 2XJTA 1SFPA 4YW1A 2BBAA 4XILA 5A7WA 3WQBA 2JD9A 3POGA 3ZFGC 1CD3G 5FK7A 2VZ1A 1UKRA 4CCKA 4A3ZA 3ZSEA 2HWB2 1EPZA 3UGHA 2YU1A 3MFCA 3B02A 3K2OA 3ZYGA 4QPGA 3QACA 1AR93 5LY1A 3RGBA 4OUEA 3VBOC 2QKDA 1DYPA 4LO8A 1GOHA 5H9PA 3POWA 4A7KA 1PNFA 3WF0A 3AXEA 4DEQA 4EN0A 2RJ2A 3H1WA 2CGNA 2ZEXA 5HXVA 1NE4A 3LPGA 1O3SA 3UYJA 1GUIA 1FV2A 2WZR3 4YWAA 4LBMA 1EUUA 2VTFA 2JDKA 2XJUA 5FAXA 2WA4A 3AYCA 3E5UA 4Y4YA 4OYUA 2WSUA 1OXCA 1CESA 2XLFA 4IGPA 4KMQA 2J42A 3WNPA 1OF4A 3SCFA 5F3GA 4PIXA 2CU5A 2ZBJA 4XQ4A 1PVC2 5FUNA 3T2OA 4ZHNA 1LOBA 3GCWA 4AHYA 2G19A 2X29A 1KJRA 4Y5TA 5C9AC 1AR83 2FDIA 4QX1A 5I0TA 1VAKA 2FZ2A 4HKLA 1OLME 3SH5A 1CONA 3LEKA 1W8OA 3Q8AA 1I1EA 2JDPA 1SEFA 1I9RA 1WLCA 4BM8A 1HRV3 5C4WB 4UYBA 1YI7A 3VHPA 4HOOA 5JR2A 1UZ0A 3APBA 1XNAA 1NCQB 3M1HA 1RUOA 3T4HB 4CPBA 1QMJA 1YQ6A 1GP4A 4XDOA 4QXKA 3T0DA 4EROA 5HCHA 4V1PA 2RS33 4XBLA 2JG9C 3THDA 2VCCA 5C8WA 3FZ3A 4MXWA 4LLFA 1JODA 1PO23 1QF3A 2E7AA 2V5DA 2ID4A 5C4WA 1VRBA 3ZFEB 5ANNA 4QX0A 2B9UA 5IK5A 3WQ1A 3ZXEA 1OA3A 2D3RA 3FUQA 1UF2C 1V6JA 4CCLA 3JBG1 4KQ7A 2OA2A 5FYIA 3VZKA 2QQLA 4B3NA 3LWCA 1UMHA 4RFT0 3WP3A 4XAEA 3WNKA 4XJ9A 4WVVA 1BEV3 5CIRA 4NIDA 5I8SA 3ZFEA 1J58A 4CDWB 1OVPA 2VQ0A 3GBWA 2ZHMA 4AI2A 1OSGA 3RZGA 4W4ZA 3P6BA 4YW2A 3PUHA 4XFBA 3ZLIA 3E5QA 1G9DA 1DU3D 1L7RA 2OZ6A 2C4XA 2ZX2A 1MS1A 1CJDA 3FMGA 4Y1VA 4LUMA 3OYWB 4NE9A 2A6YA 5EZWA 4A42A 3GZEA 3IMMA 3SITA 4QPIB 2I45A 4R9BA 4JKKA 3HPNA 4U2AA 4Y1XA 5FLHA 5FZMA 5GLTA 4CDWA 2RS53 1NKGA 2HWE3 3GXUA 4XF4A 4GMP1 5E6HA 5F6LB 1R083 2OUHA 1O5LA 1HXS1 2A3XA 3ZYHA 3DGTA 3ZFFC 2GC3A 3TEYA 1TE1B 2EIEA 5FZHA 3OYWA 1QJZA 5LK5A 2V4AA 5C8CB 2ZHNA 4KU8A 1LOCA 4LBKA 4Q0SA 3AX4A 1ODNA 1IS5A 2VUCA 3NAPB 4IEZA 4JHZA 1MACA 2OQ6A 4ASLA 1D4M1 1W0OA 1XU2A 4IV1B 1GZWB 1QEXA 3ACHA 5F8PA 3UL2A 2BTVC 4CRQA 2EICA 2MEV3 3JBG2 4Y24A 3NJYA 4R8HA 4HSJA 2PHDA 2FMDA 5FPZA 2DCTA 5BNOB 4LA3A 3ATGA 3O14A 5FZAA 3OGRA 4YVWA 4FPYA 4IV1A 4RR3B 3KV4A 2UY8A 1POV3 2C9AA 5JSPA 2GMMA 1AVBA 2GNBA 2WAAA 4LIUA 3DYMA 5HCAA 3QCWA 1W90A 4C1XA 4Q5OA 2HBUA 4Q4X3 3WD5A 5A3LA 1LEDA 1W04A 5BNOA 4HKWA 4I0WB 3AZWA 4XJWA 1CQ9A 3USUA 1JU4A 2Q30A 3LQCA 3PUAA 4LK6A 4H7MA 1HXS2 1R091 5FZKA 3W21A 3AMQA 3A22A 1RJ8A 4IV3C 4LEJA 2C9KA 1S0FA 4FQ4A 2QQWA 3AYAA 2R062 1BK1A 2Z79A 4GA9A 4E2GA 3LPFA 1GZ9A 2XJRA 3WT3A 1DQ6A 4NHKA 1RUNA 3S5QA 4BQXA 4BQ3A 2BJSA 1D4M2 1VAVA 1LENA 1S0DA 4M00A 2QQPA 1VMFA 1BK0A 1CR7A 4M0NA 4CDUB 3ZOIA 5EJ1B 3AVRA 1LU1A 1XNKA 4DO0A 3B9CA 2HEVF 4QB2A 1K45A 2ZX3A 5D21A 1RXFA 2LS6A 3VBRB 1QQP3 3QLQA 3WDUA 1VJ2A 4XFAA 1PIV3 1QDCA 3FC0A 5FZEA 4A4AA 4AQ2A 5I0RA 2ZGMA 4CDUA 1RXGA 1JZ8A 2AC1A 3ZXDA 4TZDA 3MUZ1 1KDKA 4B7KA 5L73A 3E5XA 4FTSA 2WL1A 4UBHA 3PHMA 2VBPA 2X8KA 4E4HA 1US2A 4XUQA 3FHAA 3VBRA 4AF9A 4YW4A 3MIBA 4BOWA 1B35A 1W8FA 4OFGA 4KNCA 3WY6A 1FT9A 1RHI3 1R092 1N1SA 3OD4A 4GULA 4QX8A 1ULGA 2PN5A 3OJBA 3AL5A 3SEEA 1GFF2 3SNMA 4NMIA 2X5IA 1FOD1 4DB5A 1PMHX 1MS8A 2W94A 3D5OA 4GAZA 4NRMA 5CG9A 1S0JA 2A71A 4BQWA 1JZ2A 1VRH1 5I0UA 1GP6A 2VG9A 3WR0A 4DPNA 1NAEA 2VECA 4D69A 3ILRA 4LR4A 4X8NA 5FBJA 1ZRIA 5L9RA 3WNOA 4E2SA 1YCIA 3EYPA 3O0XA 2QQKA 4XF3A 5E16A 2Y6JA 4HL0A 3HOBA 4BK5A 3T09A 3PUSA 2CDPA 1OLRA 1XB9A 1GOFA 4UBGA 4YW6A 3E6CC 5EP9A 4R9DA 4AEKA 1T6BX 3NNFA 3H3ZA 1STMA 4WV8A 5L9VA 2XPJA 5D1IA 2P1BA 2DUOA 4Q0PA 4LKEA 3HN3A 3DKQA 4IE7A 2Q1FA 3U07A 1S1AA 1OMIA 4HVQA 2VNGA 5DAVA 4KI5M 5CFCB 1UX7A 1UY2A 4YVSB 4GALA 3NV3A 4IL7A 4XBQA 2ZMLA 2ZMKA 1FOD2 1WA4A 2NN8A 4MGYE 1AR61 2CSGA 2VVEA 1DGWA 2GSYA 1ND3C 3SCHA 3ZXJA 4B29A 3K4DA 1VRH2 1WW4A 2HWD3 1Y9MA 1E5HA 3C7FA 4B7EA 2FDJA 2BBVA 1ALYA 5LA2A 4WVWA 5CFCA 1DCSA 1V6NA 2R041 2Y6GA 1F35A 3W5NA 4RL7A 3C7HA 2DYCA 2GH8A 3DKWA 3PUQA 2AR6A 5JR7B 5J96B 4WVZA 1AYN1 2HYXA 2ZGOA 4EQVA 2VNVA 1QXPA 2EVXA 3N7LA 5IK4A 5KHKA 1VALA 2BZDA 3NRUA 1NCRB 2D6KA 2WFF3 4D94A 1W6OB 4RS5B 4DUVA 1ZZ9A 4ET7A 1I6XA 2UYAA 5B4XA 3HNMA 1QXRA 2AYHA 2O14A 4MHUA 1S2KA 4ISRA 3V56A 4RQPB 3M2MA 2IFWA 4IE5A 2JIGA 2NLRA 5F3EA 1XYNA 3J7NA 1NQJA 1W3XA 2RMU3 1REEA 2JDAA 4QGNA 1GZTA 3UJOA 4X6RB 2P5BA 1AR62 2AZ5A 2LRPA 1NLRA 2DCZA 4XTMA 5ANQA 4CCMA 1NZCA 5CADA 1LGCA 2QQNA 1IPSA 4DXTA 4N9IA 2ZGPA 2RDQA 4NAOA 3MGUA 5FZLA 4EZ4A 2R042 1WD3A 2DTWA 3N4MA 2WYFA 3N9MA 4KG0A 4AI0A 2JDNA 1FNZA 4N53B 5FO7B 2J1UA 1WMEA 3HT1A 5E8AA 1RINA 3O12A 1ZNPA 4OLLA 1AL21 4XUPA 5FMOS 5IFPA 1ULDA 2Q8OA 3ES1A 4XJUA 5JZGB 4UFKA 3Q8EA 1AJOA 3M3QA 4XZPA 3JQXA 2AH2A 1BLZA 1POQA 4FPKA 2W52A 2R16A 3KVBA 5FP7A 4N53A 3ZXAC 5CA6A 1JUIA 3C8XA 1PM4A 4P00B 3OUJA 1UYPA 1Z78A 4IE6A 4UI9L 2A3WA 4JDMA 4I3PA 4K21A 4KBZA 4XHBA 4XIOA 4BH9A 5HXMA 1IG3A 1LOGA 1TG7A 3HEIA 3ZFGA 4G4FA 5FY7A 5CB7A 2J1RA 4I3GA 4K8RB 1V6KA 2A6VA 5BNNC 3O1TA 1W6PB 5A3MA 5ACA3 4PIZA 1OOPC 1J3PA 2P3JA 2WQZC 5G04L 3VL8A 3ZKYA 3LDBA 4D6SA 1W8WA 1UAIA 5DDJ1 1B09A 1ASJ1 4V2VA 4XHXA 2B42B 4CP9B 3UNPA 3TN93 4A3XA 4XXPA 1W6PA 1DQ1A 3TOJA 1VBC1 1IPKA 1WCDJ 3HWJA 1AL22 3QH7A 4JV4A 5FLIA 4ASMB 2QUOA 1BYHA 1ND2C 2DUPA 3MICA 5FZOB 4Q4V2 2JECA 3O1OA 4RD7A 3ZMNA 4XFGA 4YG0A 4IEWA 4PF5A 2GP5A 3CJXA 4Q4Y1 1SBFA 4WBBA 4YNIA 3ZM8A 2ZMNA 2PHTA 3DYPA 4RN5A 5HCBA 3BU0A 4NIGA 5CVRA 2RS12 5LA9A 2Y6FA 3VB9A 5FP4A 4Z2WA 4EV0A 2VOXA 1SPPB 1TEIA 4CDQC 2D44A 1GNYA 2VOTA 3OGSA 1UOBA 4PCRA 1HRI3 3WCSA 4AEDB 4UT5A 4QKDA 2VR4A 4XC9A 1YHFA 2CNAA 2P6CA 2WINB 1HJGA 1DGRN 3H3UA 4WM7C 5EQUA 1TME3 2GH2A 2PAMA 4XFHA 3M3IA 4LUKA 3L2HA 4I2OA 1YFXA 3RYRA 3VBHC 3ZDSA 1CAXB 5DDJ2 4COYA 1ASJ2 3KGZA 3VZLA 5FY0A 2KA3A 3GF6A 1F9KA 1RUE1 4AEDA 5JPMB 4XACA 5KHHA 3ACLA 1D2SA 2JG9A 1OKQA 1OI6A 3UESA 3RRDA 3WDYA 1AUYA 2Y0OA 3SH3A 4FOVA 2XBO3 3AKSA 4BQ5A 1VBC2 3GYDA 4Z2AA 1RB8G 4EYUA 1RIRA 5L7OC 4Q26A 2Y34A 3BALA 1RUJ1 3HQRA 1GSLA 1LOAA 4J25A 3KSCA 2HWB3 5FZ1A 2HBTA 5GZGA 1SLBA 4QDQA 4TSVA 2B5HA 1DQ4A 4Q4Y2 4AHXA 1KS5A 1AHSA 1ZZ7A 3A21A 1ZRRA 3KF3A 5I93A 3RZMA 4HMZA 1OPMA 4XPVA 1YWKA 2SLIA 3ON7A 5JVVA 4P9XA 5F3IA 3FLRA 1OKOA 4Y20B 3AP4A 3CNAA 2EAKA 3NKTA 2RJLA 4COUA 5DZEA 2YROA 4BIOA 5EPAA 2ZAHA 1O6UA 3GM8A 4WM8B 2K9ZA 1PGL1 1WMXA 4H14A 3IDEA 1W0PA 1MEC1 2MHFA 4QXCA 4ZU4A 3NNGA 3CIHA 5JI9A 3F2ZA 1RUF1 1JZ5A 5IK7A 4KWLA 4IQPA 4QWNA 4LITA 4EE2A 1CGPA 2ZHKA 5IJRA 4S2HA 1UD1A 2D6MA 3ZR5A 3OPZA 4WM8A 1RUE2 4LPLA 3P3NA 3VBUB 4AI3A 2ZJCA 4H55A 3ZFFA 2K0GA 1BBT1 4Q4W2 5FYTA 1CWPA 3N7KA 1W28A 4CEYB 3A4UA 4A7ZA 1H8VA 1QOSA 3L9JT 4FP3A 4L9BA 1NA1C 3WLUA 5FZ7A 3USSA 2CL2A 1RUJ2 4AVVA 4NIHA 5C3OA 1MVQA 3ALQA 4UAPA 1L7LA 1S2EA 2VZSA 3OCPA 4TLFA 4CEYA 5IYYA 5DABA 1H4GA 1SZBA 4PQQA 4IGOA 3MIDA 3ZXKA 1F5JA 4FVVA 4O9GA 1UO9A 3FLPA 3WNMA 1JUHA 4IEXA 3HT2A 1UYYA 1GNHA 2FDHA 4COVA 1RJ7A 4ZPIA 2PHXA 2H0VA 1MEC2 3WF2A 1HN1A 3VZJA 4FPFA 1C8NA 2ZKLA 3ECQA 1CIWA 4OULA 4UFJA 4HETA 4MGSA 1RUF2 4ITCA 3ZYRA 3HBZA 3KM5A 2FBEA 2XG3A 1CVNA 3KF5A 2ES3A 4C0BA 2Y38A 4LBQB 5A33B 2A7AA 2E26A 2VBDA 2ZACA 2G1MA 4H3WA 4IV3A 3MFAA 2XXZA 1A8DA 1BBT2 4QQOA 1FX5A 5FUIA 4JDOA 3D4KA 3D8CA 4OMDA 3EJKA 5APAA 1TMF1 3ACGA 4K7JA 4M3CB 2ZAAA 4W6YA 3VBSC 1VP6A 2XHKA 5A70A 5K9YA 4AEJA 3DPRC 1R64A 3MO4A 2KD7A 4OHXA 2BOIA 1BQPA 4LBQA 4XETA 3Q9OA 3POYA 5A3TA 5JIUA 4QX2A 1US3A 2DF7A 1W99A 2D98A 2WRAA 3UKNA 3I2HA 2YU2A 4AYUA 1IS3A 2V09A 3WF4A 5KXCA 1YQCA 3PLQA 2J7MA 4QKFA 5GKAC 1HQLA 4M3CA 4XOGA 4NR1A 1ACCA 1D0GA 1VB2A 3SC7X 4META 3NJZA 4K1YA 5EJZB 3RSJA 4TTGA 3WDWA 2EF6A 4O65A 2ZXQA 2PAKA 4MH0E 4CEWC 3AJZA 1AX1A 2JE9A 4AGRA 1WZXA 2PLV1 1W8NA 1KD7A 3B01A 4A6OA 3PMEA 3JBG3 3IMNA 1YIFA 3BVCA 1LGNA 3JD71 4KL1A 2ZPXA 5FREA 3BU7A 4OZXA 3RI9A 1MQTB 2D40A 1OA4A 4KH9A 3KS7A 1Y9GA 4HONA 2BP6A 2ERFA 1HQNA 4PDWC 2JDHA 1LODA 4L2NA 1CX4A 3P1IA 1DQ5A 1Q3EA 4YZ5A 1QJX2 1VPHA 2W1UA 4GMP3 4GB31 1HDKA 2C24A 4MGQA 5FY5A 3I8TA 1BVP1 1H9PA 3MHZA 5LASA 4KGGA 4XMIA 5LRRA 2R063 1COV1 4CE8A 1W2OA 3OUIA 5HCFA 4OHZA 4YPJA 4FP2A 5LBFA 1SACA 3M70A 1F31A 1JU3A 1GMMA 3FJSA 4BDVB 4JGZC 2G9ZA 4DNYA 4IUGA 4YGDA 1YI9A 4ISQA 1D4M3 1DQ2A 4Y5SA 4DFSA 1C8M3 3AVSA 3NNMA 4IE4A 4M01A 5C3SA 4LQRA 3JD72 3GALA 4BLJA 3S0MA 1JMUB 4ZXKA 5EYYA 2GC2A 3BPZA 4BISA 5BY5A 4CU6A 4ZZ5A 2K46A 4XIKA 5IK8A 3EB7A 1U12A 1OQDA 1EUTA 4IEPA 4WZFA 4ES8A 2R073 4IESA 5M0TA 2FQPA 2BNOA 4YFZA 1MZFA 5AC91 4HN0A 1OLMA 1KGYA 5ABJB 2JDUA 3VDCA 4AE2A 3CJIC 1DGWX 4GB32 4HBNA 4MGKE 5IW0A 1E5IA 1QH6A 3G7DA 4LO6B 1R093 3BB6A 2P34A 3NWKA 2QFEA 1NT0A 2I2SA 5FZCA 2X05A 3TNQA 1FAYA 1GYKA 4CUCA 3TRSB 1COV2 2JKXA 4IEUA 3H1YA 3WDVA 1SDDB 5ERLA 1NXMA 1JOPA 2LTNA 5ABJA 1CAWB 1IHMA 3LB9A 2VE1A 3RYKA 1PK6B 3U4SA 1PGW2 4CPBD 1QJU3 4PT6A 1MZ6A 2TNFA 5F39A 5FYZA 3MLLA 1DZQA 5C3QA 1PGSA 3E1F1 2KXLA 4GXLA 2ORXA 3HQUA 3O1SA 1NE6A 1H1IA 1CAWA 4UW3A 3VDDC 1ZBA3 2O8QA 3PURA 1PK6A 1VBA2 4AQSA 2JDZA 3WINE 1NLSA 2XVGA 4JKLA 4PLMA 1M4WA 4QPGB 3ZXLA 3KT7A 4TXWA 5D8AB 2C0ZA 3ZX7A 2XONA 2B45X 1W0NA 3N9PA 4GH4B 5GLWA 1X9TA 3LZZA 3I4IA 2G9GA 4AI9A 2PHWA 3CF6E 2YUEA 2Q0AA 4GD4A 2BGPA 4C0HA 3LOBA 3KB5A 3WG3A 4IEVA 5FO8B 3TB0A 5GZCA 3NNJA 1QU0A 1WLWA 5D8AA 1XJAA 5T5OA 1FOD3 4YARA 5FK8A 2LW8A 2VOVA 1F2NA 3E6BA 3LAGA 4E9KA 4GH4A 2DCJA 5BV6A 1LRHA 4J1XA 4YGEA 4F3JA 2WLPA 2W2IA 1VRH3 4QX7A 1JYXA 4P08A 2YZ4A 2DBIA 1F4AA 4FXGB 4Z92B 1RUG1 1QJFA 4QGMA 3WUDA 3NL1A 1X36A 5HV0A 3ZYPA 3J8F1 2BWAA 3DF0A 1AJKA 2WT0A 3POEA 3J4UH 5FPVA 1I5PA 5BNNA 3ZYBA 3NKGA 3VBFC 3L2YA 2GMPA 3OF1A 1OOPA 3MIEA 2QCSB 2ET1A 1CPMA 4A7YA 5A3UA 5LZ6A 4BA6A 1W39A 1YXWA 3GJAA 1EP0A 2VVFA 2EXJA 2Y60A 5AFBA 4FTBA 1FPN1 1PVXA 1SLCA 2RM21 1RUI1 5A7QA 1W9TA 5CISA 1LESA 4EZHA 3CKHA 2WT2A 1G9AA 4HG6B 2UURA 3MW2A 2VXRA 3POSA 4MXWB 1ND2A 1C28A 1MZEA 1EYBA 2A6XA 3FL7A 2FCVA 2D5FA 2ZOEB 3ZPOA 2XUMA 3PVBB 4QM8A 3MPBA 4XBNA 5K0UC 1AR63 5LEJA 1S2BA 1XSRA 3AYEA 4Y4RA 1NX9A 1WD4A 4BCUA 1GOGA 3ZSLA 4CU9A 1RUG2 2R043 1W2NA 4IW3A 4E4SA 4HANA 3VHRA 4D6RA 3UJQA 2WO1A 1LAJA 4HXCA 1T2XA 1MS3A 2P6HA 2JENA 2ZX1A 1C1LA 1HW5A 1UZZA 5CYYA 4Y1UA 3DXUA 2BW8A 1SCRA 2WN3A 2PQSA 2WS91 1EAH3 1UL9A 1M06G 2WT1A 4GWIA 3ZVXA 2Y26A 1FPN2 1C1FA 4QQLA 1S0GA 1AXYA 1RUI2 2RM22 4AXOA 1OQEA 1VBB1 5IATA 3HD8B 2BGOA 4ZY9A 1ZBE1 2VMEA 3GHMA 2QZ2A 1JBCA 1QNWA 1XU1A 3WZ1A 4K1ZA 5J7MA 2N7GA 5CFDC 3U11A 5JMOA 1OFNA 4XJAA 4AQTA 4O7XA 1K5JA 1TQ5A 2XJQA 4OI0A 5J98B 1FYUA 1S55A 1UY0A 1OUSA 2YPJA 3BTYA 1SLTA 5FKBA 3WCRA 4CCJA 1SFYA 2P4EA 4JAAA 4YGBA 3RYPA 3WW1A 3AP6A 5B2GB 1DZTA 2JB4A 2WNEA 4N43C 4PLNA 4AFMA 3S30A 4AL9A 2WABA 2TBVA 3NMBA 3VZNA 2D6LX 3UV9A 1J83A 2ORZA 1JOBA 5JOWA 1J3RA 2ZGUA 4YVWB 5FPBA 4EN9B 2CGPA 4NN0A 1Y43B 4L8QA 4KWJA 5FZ8A 2B39A 1J59A 1AL23 2IFRA 2VZTA 4XUOA 4AK3A 3O1RA 2VW0A 3I97A 3WQ0A 1GNZA 1ODMA 3MI8A 4JGYC 4Q4V3 2HH9A 5FYBA 5FQ0B 3UGGA 2GC1A 3ZR6A 2WS92 1Z7S3 2JE7A 1WW5A 4AOCA 5A1AA 3USUB 2RS13 2Z2SB 4AVSA 1CPNA 1KS4A 1VBB2 3AZZA 3BYWA 3KV5A 3SH4A 5HPOA 5JOXA 1LR5A 1ZBE2 3B69A 3A0NA 3O0WA 4UWDA 4E27A 5FQ0A 5EV7A 4JX0A 1NA1A 3PMSA 2C6SA 4Q0UA 3V65A 4IE0A 1RVF3 1F8VA 2IXKA 3OOXA 2D7FA 4HK8A 5DQ0A 2X10A 2EIGA 2RHPA 5FMBA 1Q5OA 2HWC3 4M3CF 3V0BB 3TBDA 2UWBA 1GWKA 5FYYA 5LA1A 4J1WA 1GWLA 3C2UA 4R9CA 2YG0A 2D97A 1YUDA 1YYNA 4A45A 1KJLA 3I2IA 2MPFA 3I7DA 5A3WA 2XLAA 4ASKA 3MEPA 3GNEA 3OUHA 3IDBB 2O0OA 4Z1VA 4UFLA 1XE8A 5A1FA 3MW3A 5A6XA 1XXNA 3V0BA 2WFPA 4XABA 4F7ZA 5LBBA 4MADA 2Q1MA 2E31A 3GDBA 5IVFA 3SISA 5GM0A 2GMEA 1K12A 1O8SA 3IWZA 4BMBA 1B35B 1TNRA 1W6QA 4OUMA 1G9BA 4LA2A 1YJKA 3ZYFA 1BZWA 1JHNA 2VXJA 4OVEA 4AG4A 4RHV3 3UT0A 1RUD1 1SQ4A 2DVDA 4M4PA 1Q43A 2ZGSA 3AKTA 2X5IB 3VBSA 2YPDA 4HLTA 2PA7A 3DPRA 4KBBA 1SDWA 3JQWA 3PVOA 5F37A 5IUQA 1UOFA 3KGLA 1CZSA 1PO11 3LSDA 4XFFA 5DXDA 3VD3A 2UY9A 3PL0A 5FYMA 2ZGKA 1J1LA 2VH9A 3I3MA 5L9BA 5FXXA 3AMNA 4Q1RA 3U75A 2QQJA 1RYYA 2VPVA 1GR3A 3NO8A 2EIDA 3AMMA 3MF6A 3GJBA 4AHWA 4LKDA 3FUOA 1RUE3 2JWPA 4PJYA 3UK9A 4CUGA 1H30A 4Q4W3 2OW4A 3IAPA 1X8EA 1JYTA 3I2JA 3ST7A 1FMD1 1N3QA 2AGSA 3N9NA 4LIVA 5GJ6A 1O7FA 2BNNA 3THPA 5C70A 2WNUB 3ME2A 2XR4A 4LK7A 2NYYA 1NLQA 3RWKX 3J7HA 2CGOA 4CUBA 1JOJA 3RS6A 5FOJB 4A6SA 2QDNA 3B7MA 4I02A 5DZFA 2LUWA 1ULEA 1H8TC 2Q4SA 3HJRA 4NIAA 1AR91 2ZEYA 1RUD2 1UMZA 3IIAA 4HFSA 4N8MA 2OYZA 4BIFA 2RVAA 2WNUA 2ZS6B 4XUNA 1QGLA 2ENRA 4CDXC 4AFAA 3MZHA 4FI9A 5GZDA 2GNTA 2WZR1 4H2AA 5DZGA 1MS9A 4PDWA 1PO12 3RJRA 2VY0A 4NJ4A 3T1LA 2AENA 4CXWA 4IGQA 4ORFA 2BYVE 5H9SA 2AEYA 3H8XA 4YYOA 2ZGLA 4Y33A 2XJVA 5CKNA 3MLJA 1IOAA 2J1SA 2YXSA 2W47A 1BBT3 3N9LA 3IZOA 2DUQA 1NY71 1FMD2 4ARXA 4JGZA 2XWBB 2H6CA 1Y7BA 2OPKA 4WVMA 1ZYBA 1YQ2A 4A2UA 1SLIA 2XWJB 3E97A 4C90A 1RITA 1ENXA 4XAAA 5GZEA 1U5IA 3B5LB 1HJFA 5FMOL 1AR92 4C1WA 5F6KA 3U37A 3TYJA 3QH6A 3I2OA 4TLGA 3OPTA 4DZGA 5FTTC 2E53A 1CAUA 5CZKA 2JG8C 2XVKA 1DHKB 1XNDA 2WZR2 3WW4A 3SLIA 3HMYA 1PO21 3QBQA 2WQ8A 4L97A 1AXZA 4K9SA 1DLLA 4N7IA 5T54A 1UX6A 1OT5A 2WWSA 3JB4C 3LIHA 1K5MC 1REFA 2VZUA 2Z42A 3CJIA 3OBRA 2FCTA 2Y8KA 4PI2A 4BU2A 3RZZA 4DY3A 1RUH1 1N1YA 2W1WA 3IT8A 1OFSA 4LMFA 5FYCA 2V4VA 3ILNA 1MS5A 1BEV1 4URTA 2ZA9A 2DTYA 3OG2A 2VO5A 1NY72 5FZ3A 3WG4A 3LD8A 2J22A 2NQYA 3GHNA 3JU9A 4XXAA 1IS6A 3EQEA 4LKSA 2OS2A 3VD7A 3OB8A 1HKDA 3POIA 2K2SA 1AYN2 3CZJA 3OBAA 4UW4A 1AYM3 5A7NA 1UZVA 3ZO0B 1JTZX 4DUXA 4LORA 1OD5A 4BQYA 4NPLA 1QJX3 1R1A3 1XQNA 2DWRA 2HWE1 2RS51 3K77A 3ZFGB 4ATEA 1R081 3VDDA 3LFIA 5FPUA 2QJVA 1QJEA 4FFGA 4RGAA 1VBE3 1LOEA 1PZ9A 2IZWA 4EJRA 1GQPA 2WNVC 4CU8A 4IDZA 1DDLA 5KC6A 2WBKA 5B4NA 2VU9A 3G6JB 1YFWA 1F15A 3VBOB 3K46A 2D3PA 2VGDA 1JN2P 4GIQA 1KXGA 4XUTA 3FLTA 2XH6A 5FR3A 2WJSA 3JD73 2DFBA 3T1MA 2R49A 1RUH2 4QQHA 1QJY3 1CIYA 2OXBA 1BEV2 4IERA 1AL0G 1QY4A 2ZX0A 3D82A 3VBOA 3DCQA 4FQZA 3AKQA 4P9WA 5F5QA 1NOVA 5FXZA 3U1XA 3S6PA 2JDYA 2JE8A 3BUCA 1POV1 3OSDA 4V2WA 1ZZ8A 4DS0A 4CCCA 4LHSA 3AB0A 2OKXA 1LHUA 4IETA 5JXGA 4LULA 4Q4X1 3TNPB 1XC6A 2HJIA 4QXHA 5C9AB 1KRIA 3WV6A 1ENSA 1XNCA 2HWE2 4NRPA 2WC2A 4XW3A 1HLCA 3VBFA 1X9PA 1L7QA 4FBFA 2XB6C 2P3IA 2JEMA 3MW4A 1WW7A 3CEWA 2WO2A 4B8EA 2W9XA 3VD4A 2XKOA 5DN2A 5A3OA 4DOUA 5C9AA 1WCKA 3J7LA 2IXCA 2DFCA 1O4TA 4MXVA 5IVVA 2CYFA 2YC0A 3WF3A 4N9HA 1H2LA 4Q2FA 5HI0A 5JXIA 2JG9B 5FWEA 2PHLA 5DUXA 4XF9A 3B00A 3HNYM 2RR11 1ULPA 2JJ6A 5FCCA 4NHLA 1PX4A 5K0UA 1QQP1 1VBA3 1HB3A 1WLTA 3WP6A 1UXXX 1PIV1 3A7QA 1DYOA 1UZYA 4CXYA 1RUC3 2WDBA 1GKBA 1X50A 3WEZA 5BYNA 1N47A 1VAMA 1TZOA 5F2SA 5C4WC 5FXVA 1NZIA 4LOTA 3OGVA 1NCQC 2G4IA 1G7YA 2BNMA 2Y6KA 5JCTA 4NROA 3K4AA 2PAEA 2FDGA 5LW9A 2UYBA 1BKZA 2R7EB 3LGRA 1J1TA 1GBGA 2XQXA 4LBQD 2BQPA 3ZFEC 1JZ3A 1V6IA 2DVBA 2J1VA 3W5MA 1UOGA 5FZ0A 1K42A 2GNMA 2PFWA 2PTMA 3ZKUA 1OH4A 2B9VA 2R32A 5GALA
chains in the Genus database with same CATH topology
4G9SB 4QX5A 3ZFFB 2E7QA 2VUJA 3H1MA 4CDWC 2DU0A 4MV2A 2RR12 4OHYA 5KBFA 4D7TA 4CP1A 2ZGQA 3R4UA 1QQP2 4QQ2A 1PVC3 2VVDA 1PIV2 3OBTA 5JAXA 3VZOA 3WHTA 3WP4A 3WG2A 3BOWA 5L36A 1PHMA 4QPIC 4FPCA 2Y0IA 5CU1A 1QOTA 1VBD1 2LALA 1SLAA 2QE3A 4E4DX 1W6MB 5C8CC 3FX3A 5DUVA 1A8MA 3AKPA 3NAPC 4IEYA 4IV1C 5DUUA 1SLLA 2QZ3A 1EV12 5CNAA 4OI4A 3VLBB 2C5DA 4IV3B 4RA0A 2EAAA 1JYCA 1LCLA 1W6MA 1V00A 1CJPA 1Y3TA 4FPHA 1SFNA 4AEMA 5BNOC 1AXKA 1EY2A 2R30A 1N3OA 4NHMA 4RR3C 4PLOA 3MYXA 2KM2A 1RMU1 3KCYA 3WDTA 2WA3A 5T5PA 5LEKA 5DUWA 3HIFA 4QMAA 3ZYJB 4HPKA 4YZ3A 4LE3A 2UU8A 2GZWA 2EXIA 2WFF1 3A0KA 4FOWA 4BE3A 4OHWA 3KD4A 4XFIA 3H7YA 4EN6B 3HQXA 1IZ3A 2GN7A 2YV8A 1VBD2 4XTPA 4FPOB 1C5IA 3T2TA 3RNSA 1WLDA 4BQ1A 2RMU1 4S2FA 1UIKA 4AW7A 2TUNA 2HYKA 1QHDA 4F8AA 5FO9B 2I74A 3PVNA 3VKFC 4DRRA 2IXHA 4B4RA 5KHGA 4KGQA 4AGGA 4CDUC 1A3KA 3OGGA 4F83A 4XE9A 1FI2A 2P3KA 1ZA4A 5HBAA 2BFUL 2VQAA 4GWMA 1UPSA 4YW3A 4NPRA 3VBRC 4KWKA 3AYDA 3WG1A 1YRZA 1RMU2 4UXAA 3AMHA 2DCKA 3R4DB 1BCXA 1IGOA 2YMZA 4GWNA 2OIIA 1TMF2 2D43A 1VBB3 1W2UA 2XL7A 4H7LA 3R4SA 1HV0A 1GQHA 4Y1YA 4Z8BA 4CP2A 4QPYA 2ZGNA 3NV2A 3O7OA 3AKRA 1GZCA 2GC0A 1Q8VA 4PBPA 1C57A 2RMU2 5GLVA 3WUCA 3DV8A 1HXS3 2GN3A 4Q0VA 5J3UA 1D4VB 4K3UA 4OUSA 2ZKNA 5EWSA 1WBLA 5JIAA 2CWMA 5EJ3A 2C1FA 5I8TA 1Z0HA 3MDPA 2ARXA 2W39A 4YM1A 2PLV2 4FAHA 2VULA 1ULCA 4YGCA 4P9GA 1ND3B 4BLIA 2BEOA 5J48A 4YG6A 4AFDA 4KG8A 1XNBA 2W08A 1AR71 3KMHA 3B9IA 4GQ7A 3ZPYA 2CWSA 1ND3A 2NPIA 1NXD1 1VLNA 2OVUA 5CFCC 4YVSC 1A78A 3U10A 3N7MA 1PMIA 3AZXA 1H0BA 2R1DA 4Q0QA 4BZ4A 4UW5A 4XDQA 1TME1 3ENRA 3AFGA 5SV8A 5GLZA 4Q29A 4LO5B 4FCAA 2HWF1 4FOYA 4DY5A 4N7UA 2BPA2 4DXZA 4FXKB 2JG8A 4Y1ZA 5CBLA 3GBGA 2ZABA 2XBO1 2D6OX 4Y22B 1VIWB 3AM2A 2BGCA 5JOYA 1O91A 4JC1A 5GLUA 1NCRC 3I2DA 1DIWA 3URFA 3H7JA 4YZ5A 4RS5C 4JCKA 4OI1A 1V9U1 1AR72 1FATA 2E9QA 1SBDA 2W68A 2G9FA 4XJ8A 1H2MA 5KWRA 3M3CA 1RUD3 4Y22A 4RQPC 4G3YC 2F4PA 1XRUA 4D7YA 1PZ7A 3OY8A 2BWCA 2WZPP 3M4FA 2AUYA 1DYKA 5AC92 4HT1T 5KHIA 1UU6A 2VMGA 2BVVA 4YM3A 3TAYA 4UW6A 1E57A 1ZREA 1RL3A 4JTNA 1O3TA 1DF0A 3JCIA 3VKOA 3WVJA 3ZIWA 1XYOA 4AVTA 2GAUA 2HWF2 2JX9A 3NSTA 1GQGA 4N53C 3WW2A 4BMEA 1OA2A 4ATFA 5BNNB 3ROUA 3PNAA 1UCXA 1OOPB 4QHBA 4BPZA 4L92A 3WP5A 5JZGC 2ZTNA 2PELA 3U4XA 1SMVA 3OTFA 1V9U2 4JTOA 4K6BA 4IEOA 4BYYA 4INDA 3M3OA 1ND2B 2XLGA 1X7NA 4LBLA 3VL9A 4YZ1A 3RQ0A 1YNAA 4NO4A 5JLVA 3BTAA 3FFZA 3GZTB 3PTYA 4CDQB 1NG0A 4EWDA 5T52A 3RWNA 2ZZJA 2WLQA 2O1QA 3FWEA 2PQQA 5H9RA 3J26N 4WM7B 1WBFA 1C3HA 1MVEA 2PHUA 3DL3A 1ZZCA 4CP0A 2B7YA 4CDQA 1HIXA 3VBHB 4EN7B 1JXNA 1Y9QA 3AP7A 3M3EA 3J8F2 3NV4A 3NVCA 4MUVA 2D6NA 4CYDA 4ZU7A 1AYN3 3TWIA 3KT1A 1KDMA 4WM7A 3AZVA 4XQWA 1G9CA 3LA7A 2VW1A 4TYSA 5EXOA 5L7OB 3VBHA 4FOQA 5FFOC 5A32B 4AEDC 5KXEA 1YIPA 3AZYA 2DV9A 5CG8A 3LA3A 2Z69A 4SLIA 1KITA 3FFQA 4LHKA 2ZZQA 2D3SA 1U5XA 1Q8OA 2OZJA 5L7OA 4RGGA 1NCQA 4S2DA 5A32A 4YRDA 3VN4A 1POV0 2IXLA 5GZFA 4LBOA 3S7IA 2GALA 1RUH3 4XEZA 2DCYA 1ENQA 1G9FA 2JXAA 3OD0A 2WKKA 1F5FA 2QVSB 4BHPA 2I07B 1WGPA 3VGIA 2O8OA 1YFUA 2YGLA 3AFKA 1WCSA 2VMIA 1Q56A 5DG2A 1NA1B 1QOOA 4WM8C 1FXZA 1WMDA 2CAUA 3N7JA 2B46X 4LNVA 4AFBA 2R061 5J36A 4QPIA 1FV3A 5JDBA 1OHFA 3DN7A 4KU7A 4QU2A 1V6OA 3HR9A 3RMYA 4S2GA 4NVPA 1C8M1 1AF9A 3VBUC 4Y26A 2XVLA 1X82A 5JWPA 4CEYC 1DQ0A 1DZRA 1MR5A 5C8CA 1LB2A 1KQRA 5DDJ3 1ASJ3 1W6NB 1AX0A 3NAPA 1UW8A 1GZWA 1PGL2 3H50A 5BPXA 4X8PA 1ZX5A 5SV5A 1W6QB 4IEQA 2R071 1J3QA 1VBC3 1N1VA 4R9AA 3FBMA 3DUIA 5T5LA 5KHJA 2VNRA 2GDFA 2CTVA 1WW6A 3MPPG 1C5HA 1W6NA 1O3RA 3VBSB 3ETQA 4N90A 3DPRB 4RR3A 5FBZA 4Q4Y3 3WNXA 2V73A 2E63A 1YFYA 3MIHA 3KZ4C 1HV1A 3D0JA 2A5ZA 5BUVA 1MS0A 4M0HA 3ZXFA 3IPVB 3VHNA 1QJU1 2FZ1A 4W6WA 1C8M2 4PQ9A 3ZMOA 1CAVB 2QNKA 1XE7A 2PHFA 4CEWB 1H1MA 2RR13 3B3QE 2XKPA 1RC6A 3EBRA 3SHRA 4ZKTB 5K7PA 1UN1A 3GBFA 3IPVA 1ZBA1 5I0SA 3FE5A 4DINB 1S0IA 3R0RA 3MLKA 4LHLA 1CAVA 1KFUL 2JD4A 3BODA 3ZN4A 2R072 2H0BA 3INAA 4FO9A 4WZCA 1CN1A 4CEWA 1ULFA 2F6BA 2PYTA 1N1TA 1RUJ3 4FTEA 4MLOA 1RTVA 2MNGA 2H6BA 2VOKA 2OUJA 1QNYA 4PDWB 2VUAA 2ETEA 2ZCWA 4JQRA 2YGMA 5I8YA 4P9IA 1BVVA 2D5HA 3EO6A 5KXBA 1H2NA 3THTA 1EV13 3CL1A 3P3PA 4CTEA 1QJU2 3RG0A 4RSUA 4NWWA 2D93A 1FNYA 1MEC3 2VNOA 3R6SA 1ENRA 1UIJA 1LOFC 3LCPA 1RUF3 4I30A 1APNA 1MQTC 4EN8B 2DVAA 4JGZB 5T3NA 3ZIXA 1ZBA2 4XF0A 1DGLA 1ZVFA 4WVMB 4P9JA 4W6XA 4HK9A 1GLHA 4XYXA 4PIYA 3ELNA 4YM2A 4LO7A 2PHRA 1AR81 5FPXA 2WQ4A 1AZDA 1VBD3 1LU2A 4L99A 5BNPC 1CAUB 3KCCA 1HRV1 1OLQA 1SCSA 2YY1A 2IXJA 3C3VA 4Q8LA 1JYIA 1DFQA 2Z5WA 3AP9A 3CJIB 3M7AA 3O0VA 3SCGA 5EYXA 4XJZA 5J37A 2BVBA 1ZRFA 1WMFA 2RS31 4P9YA 1SBEA 5E1RA 4AGVA 4YVSA 3WHUA 3AJYA 3N36A 1MZ5A 3QD6A 1LHVA 4QT6A 4J6GA 1RMU3 3IM0A 1YJLA 1MS4A 3U0ZA 3VZMA 3KCXA 3X29B 2DURA 1EAH1 4AVBA 1TMF3 5ABJC 2ARBA 1AR82 2IWGB 3VDDB 4X6QB 4LE4A 3AMPA 2DU1A 3N35A 2QDRA 2NMOA 1IKQA 1UKGA 2BUKA 4CZSA 1HRV2 3RJ2X 1REDA 4FAGA 1NCRA 1W6OA 5JMCA 2HEYF 4RS5A 4C91A 1IKPA 3W9AA 5LK7B 1PK6C 1HQWA 3SMHA 5EFUA 2RS32 4RQPA 1JW6A 5F9TA 1PO22 4SBVA 4DRVA 2ET7A 1V6MA 2PLV3 5KXDA 4HSLA 2MEV1 3KLSA 4Q4V1 3GZUC 3M8LA 4QPGC 5D8AC 3WW3A 4O9EA 5AVPA 1EAH2 1Z7S1 1OQ1A 4GH4C 4I0AA 5FOBB 2YHJA 1S0CA 2RS11 2A75A 3VBFB 4HVOA 1BMV1 4JVAA 3WDXA 5JZGA 2ATFA 1YO8A 3AK0A 1RVF1 3I59B 1I3HA 2RS52 4GB33 4D3WA 1R082 4MX3A 2HWC1 4AFCA 4AQ6A 2EXKA 4EWAA 5I91A 4LT5A 1COV3 2DVGA 2WIIB 1O5UA 3BIWE 4GKXA 3O5SA 3UKTA 4COWA 2NZ9A 3I59A 1S0BA 5K0UB 4QGLA 4XQDA 4FPJA 1V6LA 4HZFA 3ZN6B 3LOIA 2MEV2 3H8UA 1H4HA 3ES4A 4K20A 4L11A 1KFXL 5L19A 2GNDA 4AVAA 1AR73 3NW4A 1Z7S2 4MGZE 3ZSJA 4LLOA 4XF1A 3BCWA 1NQDA 3ZN6A 4RHV1 1LHOA 1BMV2 4Q4X2 1BJQA 4ES9A 5AC93 1LECA 1BXHA 1UPIA 2RJKA 1RVF2 4MZUA 2D6PA 4AI1A 1WUVA 2A73B 3MF9A 3RI8A 1XYPA 2IXIA 1RHI1 2HWC2 3KT4A 5CAZA 2LM3A 3IN9A 2XL9A 2P37A 3LSEA 5CFDB 4YZ4A 2XGXA 1ONAA 3GZAA 2HWF3 1QH7A 3CO2A 4DQAA 5F1RA 1L3JA 2GU9A 4Q4W1 1U5ZA 3WXPA 4LBNA 3FBYA 3WOGA 4N43B 2EXHA 1T6GC 5E89A 4QQPA 1Q8PA 2EALA 5CFDA 1CAXA 1EPWA 4YLZA 2A70A 1VB4A 1O3QA 5T50A 1V9U3 1I5ZA 3VV1A 4FPLA 2UWAA 4Y5Z0 3ZXGA 2R0HA 3PJQA 4N43A 4JGYB 3S7EA 2VOWA 5E88A 2ZHLA 4RHV2 2E7TA 1LHNA 2VMHA 1Q8SA 1G8WA 3RPQA 5BXXA 4YW5A 4AI8A 2DVFA 1TNFA 4QM9A 1G86A 5KC5A 1AX2A 2HKXA 1RHI2 4JGYA 2R6QA 3K48A 5JOZA 4LHNA 4Y20A 1HX6A 2CV6A 4R4XA 2XJPA 2WSVA 4FSJA 3MIFA 4YVWC 4E2QA 2B8MA 1LTEA 1QDOA 2HWD1 3CLPA 4OI2A 4HPKB 1RUG3 2E6VA 4XFCA 4IXLA 1NYWA 1ZM1A 4OHVA 3W58A 3J8F3 3WQ7A 5LRSA 1H9WA 3VBUA 4DMIA 4Q27A 4XMAA 3V64A 1OPOA 1R1ZA 1QXJA 4QD2A 3D6EA 4HVRA 2HEWF 5AVAA 3K51A 1A6CA 2ZGRA 1FPN3 4HKOA 3AXDA 2RM23 1RUI3 4AVCA 1PZ8A 1DGRA 3H0OA 3N3HA 5JI7A 2XJSA 3HN1A 3JZVA 4EWEA 1LKNA 2ILMA 4GKYA 3I54A 1H2KA 3IDCB 5C6CA 1D2QA 5JSRA 2E51A 2AREA 5FRAA 3OGJA 2YDEA 4I01A 3VKNA 4FPEA 4YM0A 3D0SA 2HWD2 4Q1PA 1G6NA 3LA2A 2JICA 5FLJA 4Z07A 4GMP0 4YZ2A 2A6WA 3NV1A 1PNGA 4I0BA 1X33A 1O4YA 1U5YA 3VKMA 5A33A 1B35C 4LTAA 1AYM1 1LJ7A 1LULA 4Q8KA 2EA7A 1QJX1 3JUUA 4MVTA 1R1A1 4YSFA 4YFWA 2WS93 5AFEA 2X5IC 3ILFA 2FHRA 5K8SA 2WFF2 4HN1A 1D0HA 3IKWA 4JDNA 5J09A 1VBE1 1DBNA 4Z82A 2YYOA 4MGIE 1LGBA 1ZBE3 4TWTA 1H8TB 2VW2A 3ZN5A 2TEPA 3ASIA 3PVEA 3RMXA 4CDXB 3IBMA 2A6ZA 4I09A 5T55A 5ACA1 3B94A 1ZZBA 1H8TA 1QJY1 2NP0A 2Q5TA 4MYEA 1LEMA 2WNUC 1ZRCA 2R1BA 3VKLA 1UU5A 4U36A 4CDXA 4ZU5A 3TN91 2R0FA 1UU4A 4P9LA 2NM1A 1AYM2 1GICA 1LOFA 4P14A 4BWOA 1MQTA 1PM7A 3W59A 3R05A 4NWVA 1R1A2 1YLLA 1IQAA 5BNPB 2BFUS 4MSVA 3SXWA 1LHWA 1RGSA 1QWRA 1VBE2 4FT8A 2UWCA 4K40A 5JPNB 2W0XA 3V0AB 1C4RA 1IPJA 1X8MA 1GV9A 2CY6A 3BOPA 4JRLA 1HRI1 1PGW1 3QOPA 5T5JA 5BNPA 3KQRA 4W65A 2JG8B 1QKQA 4E4ZA 3V0AA 3WX5A 3CU7A 5ACA2 4NOTA 4R4ZA 3ZSMA 1QJY2 3AP5A 3FHIB 4B4QA 3UKVA 4R52A 2Q1ZB 5DG1A 1K5MB 1ZZ6A 1VBA1 1O4ZA 5JSOA 4ONUA 1S0EA 1RUC1 3TN92 1V70A 2A3YA 1Q8QA 2ZX4A 4FPGA 4K8FA 3HAGA 5H9QA 3B93A 4AWDA 2IC1A 3OY8B 1K5MA 3ZSKA 3VUOA 2HWB1 4P5HA 2NMNA 4M3CE 5C33A 1H1AA 2X53S 3H9AA 3VHOA 4D7SA 3JB8A 4PBOA 5BNQA 2RE9A 3EXUA 4YG3A 5TSWA 4COZA 1HRI2 1URXA 1PO13 3RDIA 1IS4A 1N3PA 2WNVB 3ZYIB 1TME2 5FDBA 3MIGA 1VR3A 2SBAA 4AHZA 1ZRDA 2V5YA 3J9SA 4B4PA 4JRAA 2CAVA 2ZGTA 1PVC1 2P17A 1JH5A 2P2KA 2JKBA 3E6DA 3EHKA 1RUC2 1U0AA 3LKJA 2WNVA 4LBJA 1DG6A 1GANA 2FMYA 4LO4B 2XBO2 3PJYA 1FMD3 2XJTA 4YW1A 4XILA 3ZFGC 1CD3G 1UKRA 3ZSEA 2HWB2 1EPZA 3MFCA 3B02A 3ZYGA 4QPGA 3QACA 1AR93 3VBOC 2QKDA 1DYPA 4LO8A 5H9PA 3POWA 4A7KA 1PNFA 3AXEA 4EN0A 3H1WA 2CGNA 1O3SA 5HXVA 1NE4A 2WZR3 1FV2A 4LBMA 2XJUA 5FAXA 2WA4A 3AYCA 3E5UA 4Y4YA 2WSUA 2XLFA 1CESA 3SCFA 4PIXA 2ZBJA 4XQ4A 1PVC2 1LOBA 4AHYA 2X29A 1KJRA 5C9AC 1AR83 5I0TA 1VAKA 2FZ2A 4HKLA 3SH5A 1CONA 1I1EA 1SEFA 1I9RA 1WLCA 4BM8A 1HRV3 5C4WB 1YI7A 3VHPA 3APBA 1NCQB 3M1HA 1RUOA 1QMJA 4QXKA 4EROA 4V1PA 2RS33 4XBLA 2JG9C 5C8WA 3FZ3A 4MXWA 4LLFA 1QF3A 1PO23 3ZFEB 2E7AA 5C4WA 2B9UA 5IK5A 3WQ1A 3ZXEA 1OA3A 2D3RA 3FUQA 1UF2C 1V6JA 3JBG1 4KQ7A 2OA2A 3VZKA 4B3NA 3LWCA 4RFT0 3WP3A 4XJ9A 4WVVA 1BEV3 5CIRA 5I8SA 3ZFEA 1J58A 4CDWB 2VQ0A 3GBWA 2ZHMA 4AI2A 1OSGA 4YW2A 4XFBA 3E5QA 1G9DA 1DU3D 2OZ6A 2ZX2A 1MS1A 1CJDA 3FMGA 4Y1VA 4LUMA 3OYWB 5EZWA 2A6YA 3SITA 4QPIB 2I45A 4R9BA 4U2AA 5FLHA 5GLTA 4Y1XA 4CDWA 2RS53 2HWE3 4XF4A 4GMP1 5F6LB 1R083 2OUHA 1O5LA 1HXS1 2A3XA 3DGTA 3ZFFC 2GC3A 1TE1B 3OYWA 1QJZA 5LK5A 5C8CB 2ZHNA 4KU8A 1LOCA 4LBKA 4Q0SA 3AX4A 1IS5A 4ASLA 3NAPB 4IEZA 1MACA 1D4M1 1W0OA 1XU2A 4IV1B 1GZWB 3UL2A 4CRQA 2BTVC 2MEV3 3JBG2 4Y24A 4R8HA 4HSJA 2PHDA 2FMDA 5FPZA 2DCTA 5BNOB 4LA3A 3ATGA 3O14A 4YVWA 4FPYA 4IV1A 4RR3B 2UY8A 1POV3 2C9AA 5JSPA 2GMMA 1AVBA 2GNBA 5HCAA 3QCWA 4C1XA 4Q4X3 3WD5A 5A3LA 1LEDA 5BNOA 4HKWA 4I0WB 3AZWA 4XJWA 1CQ9A 3USUA 2Q30A 4H7MA 1HXS2 1R091 3AMQA 1RJ8A 4IV3C 4LEJA 4FQ4A 1S0FA 3AYAA 2R062 1BK1A 2Z79A 4GA9A 4E2GA 1GZ9A 2XJRA 3WT3A 1DQ6A 4NHKA 1RUNA 1D4M2 1VAVA 1LENA 1S0DA 4M00A 2QQPA 4CDUB 1CR7A 4M0NA 1LU1A 1XNKA 3B9CA 2HEVF 2ZX3A 3VBRB 1QQP3 3QLQA 3WDUA 1VJ2A 4XFAA 1PIV3 1QDCA 3FC0A 5I0RA 4AQ2A 2ZGMA 4CDUA 3ZXDA 4TZDA 1KDKA 4B7KA 5L73A 3E5XA 4FTSA 2WL1A 4UBHA 3PHMA 2X8KA 3VBRA 4AF9A 4YW4A 3MIBA 4BOWA 1B35A 4OFGA 3WY6A 4KNCA 1FT9A 1RHI3 1R092 1N1SA 3OD4A 4GULA 1ULGA 2PN5A 3OJBA 1GFF2 3SNMA 2X5IA 1FOD1 4DB5A 1MS8A 3D5OA 5CG9A 1S0JA 2A71A 1VRH1 5I0UA 2VG9A 3WR0A 4DPNA 2VECA 4D69A 3ILRA 4LR4A 4X8NA 4E2SA 1YCIA 3O0XA 4XF3A 5E16A 4HL0A 1OLRA