4NUBA

Crystal structure of escherichia coli ribosomal oxygenase ycfd
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
372
structure length
361
Chain Sequence
MEYQLTLNWPDFLERHWQKRPVVLKRGFNNFIDPISPDELAGLAMESEVDSRLVSHQDGKWQVSHGPFESYDHLGETNWSLLVQAVNHWHEPTAALMRPFRELPDWRIDDLMISFSVPGGGVGPHLDQYDVFIIQGTGRRRWRVGAALLQVDPFEAIIDEELEPGDILYIPPGFPHEGYALENAMNYSVGFRAPNTRELISGFADYVLQRELGGNYYSDPDVPPRAHPADVLPQEMDKLREMMLELINQPEHFKQWFGEFISQSRHELDIAPPEPPYQPDEIYDALKQGEVLVRLGGLRVLRIGDDVYANGEKIDSPHRPALDALASNIALTAENFGDALEDPSFLAMLAALVNSGYWFFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and Functional Analysis of YcfD, a Novel 2-Oxoglutarate/Fe(2+)-Dependent Oxygenase Involved in Translational Regulation in Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
molecule keywords 50S ribosomal protein L16 arginine hydroxylase
total genus 85
structure length 361
sequence length 372
ec nomenclature ec 1.14.11.47: [50S ribosomal protein L16]-arginine 3-hydroxylase.
pdb deposition date 2013-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08007 Cupin_4 Cupin superfamily protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2510 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4nubA02
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 4nubA01
5F2WA 4QX8A 5A7QA 2XDVA 5FYUA 4XDPA 2W2IA 5FY5A 5FXXA 3RVHA 4CCKA 5LY1A 4LIVA 5FZ0A 4LIUA 3LD8A 4HOOA 5FUNA 3AVRA 4E4HA 3N9QA 5FZLA 5FPLA 4GJZA 5A7WB 2P5BA 2VD7A 5FZOA 5FZMA 4DO0A 5FZ3A 3K3OA 5A3WA 5FYTA 5IW0A 4ASKA 5F3GA 5FP7A 5IWFA 5A1FA 5FJKA 5A7OA 5FZ8A 5FP3A 5IVBA 5FXZA 3N9OA 5A7NA 4CCJA 4DIQA 5FYIA 4C8DA 4IGOA 5F5IA 4EYUA 3DXTA 3K2OA 5FXWA 4XDOA 4QXBA 4QWNA 5FPAA 2Q8CA 5FYZA 2GP3A 5F5CA 4Y4RA 5FZBA 5IVVA 5FZ7A 5CEHA 2WWUA 5FZDA 5FY4A 5FYBA 5IVFA 5FZCA 5FZ9A 3AVSA 5A7PA 2YPDA 2Q8DA 4EZHA 4URAA 5FPUA 5FYMA 5LWBA 5IVYA 4IGQA 4BU2A 3KV6A 4CCNA 5F5AA 5FBJA 5FY7A 3PURA 5E6HA 5FV3A 3KV9A 5FWEA 4D6SA 2XXZA 2YBPA 5F3CA 3PU8A 5FUPA 5KR7A 2YBSA 3PTRB 5FXVA 5FYYA 5A3PA 3PUSA 5FP8A 4BXFA 3AL6A 5FZEA 3KV4A 5FY0A 4D6RA 4UF0B 3PU3A 4LITA 4BISA 3PUAA 2OT7A 5FZAA 4TN7A 3NJYA 4QX7A 2GP5A 4Y33A 4AI9A 4LXLA 5ANQA 5FYVA 2YBKA 4QXHA 2OQ7A 3N9PA 3KV5A 2PXJA 3PUQA 2OQ6A 4V2WA 5FY8A 4EZ4A 4CCOA 3N9LA 5FZKA 5FYHA 4CSWA 4GJYA 3UYJA 5A3NA 4CUGA 3ZLIA 2YU1A 5FYCA 5K4LA 3U78A 5IVCA 3LDBA 4V2VA 5FP4A 5FZHA 2XMLA 4Y3OA 4GD4A 5F3EA 3N9MA 4QXCA 5F32A 3AL5A 3PDQA 5FY1A 5FZFA 5FZIA 5FZOB 5A7WA 5FWJA 5A3TA 5IVEA 2Q8EA 2WWJA 4D6QA 5FPVA 4GAZA 5FZGA 3DXUA 5FY9A 3KVAA 1VRBA 3ZPOA 4AAPA 5A1LA 5IVJA 5LW9A 3OPWA 5A7SA 5F39A 2XUEA 5F3IA 5FZ6A 2OS2A 5FZ4A 3K3NA 3U4SA 5LY2A 5FPBA 4QU1A 5FZ1A 4CCMA 3OPTA 4UF0A 5A80A 5FP9A 5FYSA 5FJHA 2YU2A 4CCLA 5ISLA 4NUBA 4IGPA 5F2SA 4HONA 3KVBA 2OX0A 5F37A 3N9NA
chains in the Genus database with same CATH superfamily
3MZYA 2Y31A 4H3WA 3G6EI 3JQWA 2VU9A 5T5OA 3DCFA 3FXOA 4XF3A 3QPHA 1SANA 2OCEA 5FTTC 4OQ8A 1SAXA 5CJ9A 3IIIA 3C2GA 4PFOA 3CCRI 3M8EA 3A0KA 4M72A 1T39A 3DQVC 2Z79A 4YW1A 2A5ZA 3ZR6A 2QLZA 1MVEA 2BGOA 4DIQA 4E8CA 2V6CA 2HYFA 4XRFA 1NK3P 3MI8A 1Y6IA 5JUVA 2XBO2 2Y38A 1VJ2A 3HL2A 3FHZA 3MIBA 1W8UA 4HMZA 3VDDA 5JR2A 4EGYA 2R5YA 3N7KA 4OI0A 3G1OA 3W6JB 5D8AC 4NRPA 4OIPF 1W9FA 3S3OA 2X1EA 5DDGA 1CQ9A 4JZRA 4YW3A 3SFIA 2YPJA 4KGGA 4XETA 5ANQA 2Y64A 1VQ9I 4U36A 5DEQA 3PUQA 2OC6A 2E19A 4HN1A 4Q4X3 1JZ4A 4Q4W2 3WGHA 4YW5A 2LY9A 3T3YA 5DD4A 1JHJA 5LBCA 3ERED 5FPVA 2EXHA 3ACHA 4XSZF 5F27A 4DY5A 1WWYA 4WM8B 2AENA 1PO21 1V55H 1ON1A 2DMNA 1YI2I 1BJAA 5A80A 2DODA 2RG4A 2R063 4LT5A 4TTGA 5FLIA 1JOPA 4RS5C 1HXDA 1S5LC 2Y75A 4A45A 3FBYA 5FJ8J 4ZYHA 3H50A 2VBXA 2VCMA 4ENMA 3RVHA 3GFLA 2PLYA 3RZGA 4GZ9A 1Q1HA 2BY0A 1F4HA 1HIXA 3O3KA 4S0HB 5B5EC 3A22A 1KJRA 3KP6A 1PMIA 5FKCA 5FZ3A 3FDYA 2A7AA 5IVBA 5FXZA 2DA2A 3QAHA 5DDJ1 2YROA 4G3YC 4UUSB 4AVCA 1AX1A 5FZCA 2P6HA 4Q0PA 3SNMA 2BPA2 2FBKA 1JI6A 1OH3A 4CDUC 2IRFG 4FHTA 1D4M1 2D43A 2IXSA 2XQXA 3WG2A 4IV1B 3HB9A 3RG0A 1QQP2 2C5DA 1E3HA 4I3PA 1W99A 3IT8A 3RGBA 2E7WA 4XKWA 1I9RA 2MA3A 4DEVA 5LD2C 1NOVA 1Q5OA 2HEYF 1PHMA 1J58A 1VQLI 4BPZA 1UQXA 3OYCA 1KYWA 1QH6A 3I55I 3SXYA 3TP0A 1Y1WJ 1APLC 3DBHB 3C3WA 1S72I 2EAKA 3DU5A 3L2CA 2GH8A 4Z92B 1LHUA 3V0AB 1RTVA 4BJ6C 3CESA 4CICA 5FZ1A 5K0UC 5CVIA 3FBMA 1GANA 5L3CA 2VN2A 3CQOA 2ZJCA 1AYM3 2RDSA 5FXXA 3MDPA 1EAH3 2A6EF 2VBZA 4XW3A 2C1FA 3RQIA 3HOZJ 1QNYA 3ZGKA 2C6YA 2I45A 4QKNA 3WT3A 4I0AA 3M07A 3VN4A 1U5ZA 2QF7A 4XABA 4YFZA 5ABJA 4LB6B 5FYIA 4A41A 3DPLC 3HNBM 4DOZA 3WUDA 1TW2A 2LFBA 3GZEA 5BNQA 2DBBA 2VZ3A 4IPAA 5FY7A 1CAXA 1AR62 2J7MA 1WJDA 4MFEA 2ICWG 4KJZA 1LGBA 2XC7A 5FZEA 1IW7F 1G7YA 3CL1A 4D6RA 2KA3A 3TL4X 5DUKA 4XRSA 4XFAA 3HRSA 1LENA 2HWE1 1HB3A 3ABLH 3K2ZA 3ZMSA 1QJY3 4NIIA 2EFNA 2DPUA 1RUH2 4WM7B 3UYJA 5L3EA 1YUDA 1OUSA 5IPAA 3MICA 3VBFC 2FCTA 3B7MA 2ZGPA 3R4KA 5CKNA 2Q8EA 2LTNA 1RVF3 2DMPA 1EAH1 4E27A 4NIGA 1F2NA 2XUMA 5CFCB 3F6OA 2L5QA 3J8F2 1BEV2 5LA0A 1VRH3 2BZTA 1BHGA 2P37A 1ASJ3 2PFWA 1WJAA 3VDBA 5C4WC 5K7PA 4R8HA 2DA6A 2QQJA 4ZPIA 3OIQA 3L2UA 2LNBA 3LD8A 5ILSA 5CB7A 2ZSIB 1BIAA 3HDDA 3N4MA 2VD7A 5KNLA 4XJZA 1OD3A 5LGUA 3PVNA 4IHWA 1ULCA 5DZFA 1JYVA 4WXHA 3EUKL 2M5WA 2HEWF 2DDBA 5HOOA 3Q8CA 2RR13 5IVVA 1HF0A 1ZKGA 1YQ2A 4WZCA 3W58A 3ZSLA 1JKOC 2HXOA 3KETA 1DUXC 5HV0A 1B6AA 5JFRA 4CCNA 3IV5A 2ZGKA 4UVBA 2YBPA 3P5JA 2WZEA 3Q0VA 5FP8A 4KG8A 4JKMA 1TME2 1POV1 3HMYA 4GGGA 5H20A 2NYXA 3I64A 3S3NA 1F5JA 3MEPA 1RVF1 5CVJA 5HS7A 2D97A 2RV8A 1REPC 2CG4A 4UW3A 5FY8A 3VHOA 5J37A 1VRH1 1SDWA 2IA0A 1LEAA 2BOLA 1I6XA 4XZPA 1FOD2 4BCUA 2X1DA 1ZBA1 5KVRA 5IP9J 3CF6E 5G04L 1SFYA 4QWQA 2LTPA 4UOJA 1YX3A 3K4JA 1PYVA 3PFYA 1GLHA 4Z82A 4OUEA 2ZGOA 3LQCA 5TGTA 4LBQA 1TTYA 4ZC3A 1U5YA 1GNYA 3L2RA 4BDVB 1BOAA 3BU7A 3LAJA 3GCXA 4S2GA 1RMU1 1XNKA 1VE0A 3NARA 3WNKA 2VT3A 5D5WB 1RUG1 3L00A 5FPZA 4IE7A 4H7LA 2X9DA 4YM2A 1WW7A 5FP7A 1VPHA 4LLLA 1IN6A 2XAUA 3KEYA 5DTDA 5ERLA 4QX0A 2VMIA 2RS51 1V0AA 4N43A 2JDHA 4LLGF 4NQWA 4UVAA 3K4DA 1JZ3A 3CUQB 2VCBA 3BPSA 3PUIA 1DPRA 3JZVA 1E2XA 1NG6A 3KF3A 1ENHA 3KS7A 3VWBA 4LE4A 1AL23 3SISA 3T2QA 1MZFA 2LY1A 1RESA 1ACIA 3DN7A 2JA8J 3P3NA 1W9SA 2XONA 1WH5A 3SH4A 2RMU2 3GVAA 2W57A 4KGQA 1FOYA 1BQPA 4M6YA 1YS6A 3AG1H 1Y7BA 3TWIA 5A3LA 4QPGC 2I74A 2P6TA 2ZSHB 3FWEA 2BOJA 5H9PA 4E70A 5T5LA 1CR7A 1FSHA 1S2EA 3CTAA 4EJTA 1W6QB 2DT5A 1RUG3 4GAZA 3MF9A 1PVC2 4COZA 5C8CA 5IVJA 1S0CA 5E1RA 1LDKB 4WVWA 2BNMA 4QHZA 1M4WA 2MC3A 3OR2C 2ZACA 3K6GA 3I54A 1GV9A 2BHYA 2WFF2 1FYMA 4OFGA 4B48A 5C7GA 2KPMA 5EYYA 3HN1A 1XMXA 5JZGB 1UMZA 4WBBA 2W1UA 4D7SA 3H7YA 1OLQA 2PQ8A 4AGGA 4JVAA 3F8NA 3GEZA 1ZG5A 2ES3A 3WTVC 1HRV1 2ENRA 5A7OA 4EM0B 1LEDA 2YYOA 3WW3A 1W7PB 1Y9GA 4C90A 3IAPA 2RQPA 4Q4V3 4LMYA 2KDOA 3CCEI 4DXTA 3F8CA 1W6MA 4JRAA 2NVQJ 3DPRC 2HWF3 1D8JA 3WQ7A 3WEZA 4AXOA 5K9YA 1F15A 4DNYA 2ZGRA 1ZZ6A 4QPYA 2Z33A 3J7MA 5K7HA 1SPPA 2KXLA 2J1TA 4BIOA 1XNCA 2IS2A 3HAGA 4MGTA 1W2TA 3HSRA 4RAFA 4P5OA 4F7ZA 5IYDJ 1IOAA 1XE0A 3ZMVA 2F5DA 2Y2ZA 1MR5A 1WD4A 1H9TA 4KNCA 4I30A 1S7OA 1WHUA 5DCMB 1FYUA 1HDPA 3W3CA 4UUVA 3AYDA 4IV3B 3PO2J 3K4LA 3WCSA 5KBFA 3BIEA 4XQWA 2W1OA 4ZU5A 2AACA 1GZTA 1G3SA 1OKRA 3DEUA 3KB5A 3WF4A 4GKYA 1G59A 3OBTA 4NIHA 2CQQA 1BA5A 1OISA 1OCTC 3WNXA 2Y6KA 3HHHA 4BMBA 2YMZA 3WG4A 2X85A 3H3ZA 4XPVA 3JRIA 1X9TA 2HQ5A 4HLXA 3I4MJ 4G6QA 3HN3A 2BUKA 3K70C 3H9AA 1Q8VA 3KP5A 1HDKA 4CUBA 5FXWA 2W92A 2Q8KA 3MIGA 3BR2A 5GLZA 1WMXA 1UIKA 2XAQA 3B93A 2HBTA 3SH3A 4Q27A 2VOKA 2BDRA 2GU9A 2M30A 3EQEA 2HZDA 4LBLA 1ZR4A 5LA2A 3I5UA 5EJ1B 4OMYA 2P1BA 3ZYBA 4EMSA 3RPQA 3L2WA 5FY0A 2O9LA 2J1VA 4OIQF 4OI2A 3VDDB 3CJTB 2R93J 1RUD3 5CVUA 2YR2A 4B7EA 3ZIWA 1XPWA 1T08B 2KRFA 3MFKA 2HDCA 2RS11 3TYJA 1LHVA 4EVIA 5FYHA 2QKMB 1T33A 1BBT3 3B02A 1HDDC 2VPRA 4UUTA 3WG9A 3KP4A 5ED4A 5FP4A 3WW1A 2WNEA 3F21A 2HGCA 4AFDA 4E4ZA 1Q56A 1CZSA 4W6WA 1DU3D 1E3PA 3ITQA 2DFCA 1KS4A 4G8XA 2ZNZA 3OYGA 1OLMA 1D1BA 2VODA 3JTHA 2XVCA 1RUI2 3PM1A 2R49A 3D5OA 5JPNB 2OTJI 3AZZA 4FP2A 2A6VA 1ODMA 1TG7A 4X8PA 5F6FA 3E6BA 2MW8A 5EZGA 2YV8A 4RS8A 1BJQA 5JOXA 4MNUA 4NDLA 5FZ8A 2CO5A 1BR2A 3FZ3A 4B3XA 1UXZA 1X33A 3BN6A 4NHLA 3TOJA 2ZMNA 1NHAA 2WJSA 1IN5A 2QQPA 2BXZA 3M3CA 5FO5A 1H88C 3MUY1 4JQTA 1GNZA 4FAGA 1FP1D 1BBT1 2D6KA 2HI3A 1A35A 4V1PA 2BWAA 4XQFA 4CUCA 3MEXA 1DP0A 2WNUA 4UF0B 1T6GC 3G6JB 2PHWA 4NIDA 2QQMA 1JKPC 2O03A 3BB6A 5C44J 1TQIA 4XFCA 2EIMH 3HT1A 2EFWA 1SD7A 3Q3SA 3ULQB 4BM8A 3HWJA 2TEPA 4ESBA 2W84A 5DAWA 3UKVA 3KQRA 2ADEA 3B5LB 4K7JA 2WR9A 2CV6A 1ZVFA 1W8ZA 4HT1T 3HRUA 3QOEA 2C26A 2W08A 3NV2A 3ZQCA 4COVA 5A3MA 1PIV2 4IGPA 3UNGC 1P8JA 4HFSA 3ZMOA 2W85A 3K70D 1UZYA 4MTEA 3ZFFB 2Y48A 3RZOJ 3GTKJ 1RUI1 4FQ4A 3D5RC 4Y5Z0 4YM3A 3I2HA 4QPGA 4E7SA 5A1FA 1IZ1A 2VPVA 1SVMA 4RGRA 3UV9A 4CU8A 1PK6B 4I02A 3ABTA 4KBBA 3W2AA 4JTNA 2AREA 3DPUA 4KIFA 5FPAA 1W4MA 1MMGA 3VD9A 5M3MJ 4A0ZA 5SV5A 1YRNB 4NNJA 2VTFA 2QSFX 1KU3A 1AF9A 4N90A 1KRIA 3VBUC 3RJPA 4WZFA 4AVTA 3A03A 4HDVA 2J22A 5IJRA 3GTOJ 2EICA 3E5QA 2VW2A 2RJKA 4LHNA 5CNAA 1N1VA 2YS9A 4D5CA 3R0RA 1T8IA 4TN7A 4YGEA 3GDBA 2LKPA 3BODA 2VL8A 4LG3A 3IDCB 2XIGA 2JB8A 5DZGA 4RB3C 3BT9A 2JICA 3NNFA 4HG2A 4LULA 2DTWA 4FOWA 3FXKA 3A0BC 2PAMA 2YU1A 4RA2A 3BOPA 2BY1A 3HPHA 1EH7A 1X19A 1LRHA 2PLV1 2VAUA 2VQAA 1QZEA 1MACA 3ACLA 1S2KA 3ETQA 2CWSA 3I53A 4HAMA 3IKVA 1UELB 1AZDA 2IFRA 2GA2A 1CF7B 1T95A 3R0JA 2I07B 3H5AA 1MS5A 5C3SA 5FY5A 3O1MA 1RITA 1O6UA 4GB33 1R093 1UYXA 3N35A 2WLQA 4RGXA 1ZA7A 3CMYA 1IDZA 5FYTA 1R6RA 3M8JA 5J1UA 1MZEA 2EZHA 5F1JA 1RVF2 1X58A 5CVRA 1GXQA 1I39A 4K2EA 5DUWA 1VBE2 5E79C 1OA2A 4INDA 1MJBA 2B5HA 4LK0F 4D8MA 1FMD3 2J5OA 1OBNA 1OA4A 4FVVA 2A70A 2PN5A 1GYKA 2JG8A 4ZZDA 2G9FA 5AC93 3HD8B 1UFMA 3UR3C 3ZQFA 3PU8A 1FTZA 3ATGA 3LQQA 4MIMA 2WA0A 4PZJA 2BFUL 1UL9A 3GTJJ 2A6YA 1EH8A 1STZA 1IZ3A 2GALA 2E6VA 5L9RA 3JB4C 3J7HA 4Q48A 1XCBA 1ETYA 1DGWY 2CAUA 5A3NA 5FPXA 1ETKA 4LGWA 4LORA 2EPFA 2EALA 2VZUA 1YIOA 1XG1A 1VBA2 2HEOA 1TNSA 1VBE1 1MD0A 4UFIA 1K5MA 1R091 1GQPA 3AZVA 4B4QA 2D40A 5T55A 2GNBA 4QQHA 2ID4A 3OPTA 1QPIA 5EZHA 2Y9ZA 2E63A 1S4CA 1XE7A 2NOJB 1ZRFA 5BNOB 3ON7A 1YI7A 2HDDA 2P7VB 3ZFFA 4N43B 4AI8A 3AX4A 3BQYA 2P5VA 1CX1A 1FNZA 3AP6A 2ATFA 2CRGA 4M0HA 1O3RA 1CVNA 4O9GA 3MZ8A 2NN8A 3V4GA 3C7FA 4HYEA 3KPHA 3PNAA 4N0BA 3BROA 1UOGA 2F4OB 3GZUC 2ZJRF 5FY4A 3VZLA 2WY8Q 2DT7B 2VBWA 4XJAA 2RQQA 1Z77A 2ZHNA 1S0JA 1QJZA 2VQCA 4BDYA 5LBQA 3SMHA 3ABMH 3UKTA 4HSRA 1BMV1 3RMYA 1GP6A 1P92A 2BERA 2F4MB 2WAOA 5J96B 3MAJA 4I3GA 3AG3H 2WNUC 3ZM8A 4BE0A 2EIDA 3OUHA 1LOAA 4Q8LA 1SAUA 3ELKA 3S0MA 3WP5A 1S8NA 4PLNA 1UY4A 3KZ4C 4LXLA 1SLIA 2X10A 2V1DA 3BR0A 3GX4X 2HWVA 1AX2A 1NA1B 4LA2A 4FPJA 1NE4A 3C8XA 3TEXA 3PIGA 5KAFC 2UURA 2UXXA 4L11A 1EYBA 3GZ6A 2WYFA 2LW8A 2VMEA 5JOYA 2V26A 3HIFA 2L9NA 3M7AA 4FFFA 1QJX3 1FBSA 4JQFA 4E4SA 3H9JA 3VBUA 1MNMC 4ISRA 1H2MA 3T1LA 1DQ2A 3IAS2 3DBRB 3AZWA 5I8SA 3FL7A 2X6WA 3UJOA 1S1AA 3POGA 1OLTA 1ZG1A 2BQPA 3VBRB 1H8TA 4NPLA 2D3SA 1YW7A 1GLNA 2F17A 3CCMI 1REFA 3C7GA 2E7XA 4RFRB 3USSA 2E33A 1BI3A 1K6OA 1PP8F 3VL8A 3R0AA 4EE2A 2KLOA 2ZX2A 3J7ZI 4RGAA 1H0BA 4QHBA 4EJVA 2Q0OA 3I3MA 1S0BA 4BE1A 4WVMA 1MBKA 3AXDA 3HOBA 5B66C 1UF2C 4P1WA 3DYOA 4E4DX 3MLKA 5B4XA 2AXTC 4BH9A 2QKLB 1U0AA 5D8LB 4OHZA 5I0RA 1U12A 4HF0A 1MZBA 2RS12 2D5FA 2WADA 2W48A 2D93A 3R60A 1FP2A 1W2OA 1YHFA 1YW8A 4H4KC 4B4PA 3WTXC 1QJX1 2IGMA 3NAUA 2JECA 1YC61 2BU9A 1U5IA 2MEV2 1RUD2 1COV1 2RDQA 3I7DA 2V6EA 4ITCA 4P5HA 3DEMA 2XB0X 1XNBA 1TL8A 3VD3A 4P9IA 3OGVA 1K6YA 1AXYA 2CUZA 3CCLI 5LEJA 1HBXG 4HKOA 4NBQA 4RAYA 2YFZA 4ZONA 4R79A 2PI0A 4B3AA 2KJCA 1WMFA 4YELA 4D0PA 2CGOA 2JWPA 3WLUA 2GZWA 4AYBA 1F4KA 2K02A 1U8BA 5CQEA 2WSVA 2LS6A 2VBYA 4KH9A 1B72A 3N9OA 2EV6A 5D4RA 2OTLI 1BZWA 1EUUA 1FOD3 3DXTA 1OHFA 3MF6A 5LK5A 3PO3J 1NA1A 2Z4FA 5IVFA 4F55A 5CYVA 3FUQA 3PNTA 2O8OA 5JIAA 5BPXA 2GC1A 3ZFGB 2K3FA 4MHGA 4NAMA 2ILMA 3P1IA 2X09A 2L02A 1TBXA 3J9SA 2CGPA 3E6MA 2FCVA 3GJAA 3RSJA 1ZGWA 4PDWB 2PXJA 3ZMTA 4LO4B 1VMFA 4RHV3 2VNVA 2BP6A 1VZ0A 1RMU2 2DYSH 2AR6A 1XD7A 2NVUB 1LOBA 2UXNA 4COYA 4AVZA 4IEOA 5IK7A 5GLTA 2HTSA 2LD5A 1ULOA 5IFPA 5JPMB 2AGSA 4LHSA 2HFHA 1Y39A 2WV1A 1K5MC 1UX6A 4NHYA 1UHWA 3R4SA 3JBG2 1AR91 3PQKA 4NROA 3DPRB 5KCMA 3A0HC 1PZ7A 2JT1A 1HN0A 3DFGA 1XYPA 3QCWA 3WDWA 2VUCA 4RN5A 3EDPA 4JX5A 3L9JT 3ECQA 1PMHX 4GJZA 1WI3A 1C1FA 1ZG3A 3T5XA 3J80Z 3O6BB 2Q2EA 3LAPA 2FHRA 2IT0A 5DG1A 2RS31 4R4XA 2QZ8A 2UWAA 4LKSA 5L3FA 1RUC1 1GNHA 1UJ8A 4LO6B 5JXGA 2XOMA 4FPCA 1FV3A 4Q0VA 3FXMA 1OQYA 3LDKA 4Q4Y1 5DM6F 4B1RA 1ULEA 4BMEA 5BV6A 4BQQA 1PVC1 1OCCH 4J25A 5LEKA 2OT7A 3BG5A 2FDHA 3AFKA 3JR9A 3QH6A 3P9CA 3IUOA 2DTZA 2CV2A 2VNOA 4KYWA 4HXCA 4EZ4A 2WNVA 2ZC2A 3VV1A 4BQWA 3DGTA 5EEGA 2TBVA 3M7GA 1AR71 2W1WA 2WO7A 2ZX1A 3RCOA 4XOPA 4L92A 2E1NA 2V5YA 1JYCA 4IHXA 3VBSC 1UY0A 1YNAA 3TQNA 1QXRA 3VYUB 1DBNA 5JHUA 2XH6A 3OYIA 1HN1A 1B35A 3MFCA 3ZYHA 1P7IA 3ZSEA 5F37A 4XMIA 1CJPA 4XLEA 3GZAA 3KGZA 2NNYA 1G4DA 4NPMA 4AG4A 4L99A 2M0CA 3MW2A 3G3ZA 2DDAA 1A6IA 4Q4Y3 2KIUA 4RHV2 1ZA4A 1BC8C 3LNQA 2Q8CA 5F5CA 1A78A 1VQOI 2XWBB 1Y43B 3NNGA 4K8RB 2ME6A 2PJRA 2EZKA 1CAUB 4HANA 4XTMA 3IDEA 4PJMA 2JIGA 4JOMA 1SDDB 4AK3A 2LRDA 1CX4A 4Y1XA 2FBHA 1H9PA 2ZHMA 2DXIA 3TP3A 4AEDC 4NN0A 4OOIA 1QHDA 1FEXA 1RRJA 1RYYA 2BVVA 1TNTA 4PF5A 5C3EJ 4NWVA 2XB6C 5FFXA 3TEYA 1WQ2A 3NRUA 5D5VB 3W6VA 1Y8QB 4BNCA 1C8M3 1DQ6A 4P9WA 4IQ4A 1WI9A 2WA4A 4XR6A 1V6NA 3BR3A 1UYYA 4UFMA 5HDNA 2E35A 4UB8C 3C2BA 2XL7A 5KXCA 2R32A 1MS8A 3MKZA 4UFHA 3X29B 3ORJA 3SEPA 2ZZQA 3DECA 3CCJI 1PMJX 5ISLA 1XBFA 1DFQA 1XMAA 1ND2C 3ZMNA 3OEBA 3ZR5A 4CDWB 2XJPA 3TEZA 4YFWA 1RPWA 4RFT0 4GKXA 3FK6A 4FOQA 1RUH3 3WNPA 5IT3A 3HT2A 3G4SI 1XB9A 3O2PE 1H1IA 3J7AO 2PMZA 3AP9A 1KU9A 4WK8F 2V79A 4E2SA 1ONAA 4XMAA 2KIFA 4Y4YA 4K8FA 1NZCA 4J01A 2CMPA 4BHCA 1JH5A 4UW6A 4JGZC 1W9WA 2VKHA 4TV7A 3WF0A 4EQVA 1DQ4A 4B44A 2TNFA 3TEDA 4A3LJ 1RJ8A 1H30A 3F0CA 4BGDA 1BI0A 1HKQA 3BIWE 1S0FA 4U2AA 3KV9A 2K86A 4LKFA 2WUHA 3PTRB 1KDKA 2RHPA 2FOWA 3ABKH 4PFPA 4FCYA 1RL3A 3KV4A 4K9SA 3BZ6A 4JKLA 3MHZA 3HBKA 2EA7A 4YW2A 3AYAA 3NJYA 3OGSA 3GNEA 5LCWL 4NVPA 3SITA 4DINB 2MFZA 1CAWB 2ID3A 3H3VK 5DMYA 3HEFA 5DG2A 4TSVA 1AYM2 1UMQA 3M4OJ 4E7KA 3VZJA 2XMLA 3POJA 4CXXA 2CL2A 3KYCB 3HOUJ 5EZWA 4HN0A 2VQGA 3MV01 4Y13A 3CCYA 1KQ0A 2Q5TA 1MBGA 3GYHX 2BW8A 2BJSA 4XIOA 5ICCA 4CTEA 4FCAA 4YZ2A 4LLOA 5CA6A 1FJLA 2HOSA 3AC0A 5CIRA 4BAYA 2LR8A 4P02B 5D6EA 2L9RA 1OQDA 4YVWC 4XBNA 1RUJ2 4A3ZA 2D45A 1ZRDA 5I8TA 4XLFA 4NIAA 1G3TA 2WTEA 1OLME 1U5TB 2DA1A 2ZOEB 2I2SA 2HKOA 5B1AH 2CDPA 1Z9CA 1RJ7A 4A2UA 5GZGA 1X50A 4KL1A 1K78A 2W24A 4GULA 1TT5B 1W5CC 5D2AA 1GOGA 3ZDSA 5EF6A 2LMDA 3B3QE 2HKXA 5HLTA 4IV1C 2IEKA 2Y69H 1BEV1 5D1IA 5HV4A 1X3UA 4BE2A 3FHNA 2OQ7A 1ZTRA 2W9XA 1YQ5A 3O14A 1V3FA 1N1SA 4LK6A 1PIV1 1VB4A 1GV5A 2H1KA 4ZZ5A 4GIQA 1R1A1 4A4AA 3OOUA 5D21A 1H8TB 4GXLA 1VRBA 2Y30A 2QNKA 2DDUA 4QU1A 3RZLA 2F4IA 3OYJA 4QPIC 5FJHA 3VZMA 1MBHA 4YW7A 4A0XA 3WNNA 1LHNA 4FPGA 1LB2A 2ZHKA 1NXD1 1Q43A 4GXOA 1MSFC 3KYDB 1YO5C 5AC92 2IGKA 2XUBA 1HW5A 2JE9A 2RE9A 5FLVA 3L2QA 1YFYA 2H1LA 4DO0A 4DXSA 1QU3A 3AKPA 1TZOA 1LJ7A 4Q0QA 4ES8A 3POSA 4EYUA 5CKMA 5ICEA 3A7QA 4SBVA 3BUCA 4O3MA 4YZ1A 5LGNA 5CEHA 1WUVA 3OY8B 4M00A 1A3KA 3T1BA 4XJWA 2L3DA 2OZ6A 4XXAA 1JU3A 1L3JA 1OPMA 1DF0A 3H5NA 3THTA 3GZTB 1U78A 3CNAA 2V4JC 4C1XA 3V0AA 3ZFEA 4XF1A 1LR5A 3T2TA 4LNVA 5D8AA 3NQHA 2WB1N 3PIPF 4DRRA 2Y6GA 2FDFA 2ZHLA 1ZAOA 2CAVA 3SQOA 2KIMA 1WW6A 3K4MA 1HB2A 3IRQA 1H4HA 3AJYA 4IL6C 5HNHA 3VOEA 4PK4A 4N8MA 2ADDA 2W47A 4GH4B 3IAM2 3PVBB 2JE7A 5EJ3A 1FYLA 4GWNA 4DXRA 2YPRA 4GALA 4RGGA 4JTOA 3OWTA 1A34A 2R043 3BG7A 2EH3A 1JYIA 1OT5A 2V73A 2ARCA 2V1UA 1BN5A 5IP7J 1UZWA 4UF0A 1ZZ8A 4K3UA 2A5WA 1JUSA 5D4SA 2YSRA 2D44A 2FZ1A 5DDJ3 3S3MA 5JR7B 1H0MA 3ZN5A 5K8SA 2CY6A 1FYKA 3L1PA 1G8XA 3AVRA 3ZYGA 5DS9A 1X82A 3K4KA 2R7ZJ 2VECA 3PUHA 1ZBE3 1F1ZA 1RUF2 1TMF2 3AXEA 3SCFA 1ASJ1 3VBFA 3NAPC 1CIWA 2ZKLA 1VMHA 4LBMA 2O0OA 2VJXA 3EB7A 1YYNA 3VBFB 5ABJB 2RGVA 3A01A 3AYCA 2X51A 2Q8DA 3WXPA 4W50A 2R7OA 3S6PA 1X3ZB 1JHFA 2O8QA 4Q4X2 2DW4A 2C9KA 5FUPA 1ZLKA 2A71A 4C2MJ 4F8AA 3S17J 3WSOA 3VDAA 2RR11 3T0AA 3RZJA 2KM2A 4P9FA 1V6IA 3GYDA 4XLCA 2DTYA 1SZBA 1SLAA 2VC1A 2B9UA 3HYIA 5JZGC 1FZPB 1MH3A 1V6MA 4B4RA 1D0XA 2LOOA 1P7JA 2A3XA 3ZXJA 3HGGA 3NL1A 4AAPA 1VLNA 3WGIA 4DS0A 3QLQA 3VBRC 2RDNA 1RC6A 1ZK8A 5FP9A 4CCLA 1GOHA 5GTIC 3T30A 1ZBA3 2RJ2A 3AJZA 1DQ0A 2PMWB 1SMVA 3WNOA 4C0HA 4YWAA 2K40A 1ODNA 3DKWA 2RR12 4S2HA 3ZFEB 1OXCA 4I7HA 4BOWA 2VC0A 1R23A 1NX9A 1ZYBA 1I3QJ 3OYMA 1MSEC 3AP5A 3CU7A 5E8AA 5J1YA 3CIHA 1N1YA 1MQTA 2W46A 1DQUA 1KQRA 4M3CF 3I56I 3H8RA 1ASJ2 1HW1A 1MBEA 4P55A 3W5NA 5AFEA 3VBHA 3TN91 1QJY1 2JPCA 2VNRA 2QQBA 2A73B 3MO4A 1XMKA 4P96A 3FMQA 3HJRA 4QSHA 4BXFA 3KHBA 1Z21A 2COBA 1ULYA 4HX8A 2DCZA 3OTFA 3H8OA 2WWYA 4FPKA 2FBEA 1YQ6A 3L7WA 2WFPA 4JCKA 2RV9A 2ZMEB 5CFCC 1CAWA 5D8KB 1FAYA 3JREA 3LFKA 4DQ2A 4GJYA 1Z7LA 3U2RA 5HODA 2WQ4A 3U78A 4JGYC 4LBNA 1CAUA 5DCMA 3GFIA 1JGGA 3C7OA 4MHUA 1FWZA 1DIWA 1XOYA 5FY9A 3KVAA 2VOOA 1YWKA 1MGTA 4LBJA 3GWZA 3S15J 4LK1F 3VKLA 2VXRA 3HRMA 2P6SA 4ATFA 1TQPA 2CUEA 4FQGA 1LDJA 1MMSA 5DQ0A 5FKBA 1TT0A 1G9BA 1YJNI 3VODA 2JN6A 3Q9OA 4LIUA 4TLGA 3TMOA 3WTWC 3EYPA 3MZHA 4XEZA 1RHI2 1IPSA 1SMYF 1OURA 2JA6J 1F43A 3QOPA 4KIBA 3HBLA 3K2OA 3A02A 2OUHA 2YC0A 4DRVA 1LVKA 5LHHA 1U5TA 1QHHD 3B73A 1AKHA 3FLPA 2FMYA 5FYMA 5LWBA 3KV6A 3CKHA 5FD5A 3PURA 2JKXA 1JJ8C 1HRV3 3ZXDA 3TDUC 3P9KA 2K27A 1OVSA 2RDRA 2KJBA 2DOAA 3AFGA 3ZOBA 1R4MB 1SVOA 5DD8A 2F4LA 4N53B 4XQ4A 2D98A 3E1F1 1J59A 3CBNA 2HWF1 1XNDA 2AO9A 1MIJA 4EM1A 3LFUA 4OZXA 1UU6A 1B9MA 1QGPA 1Q8QA 5IVEA 3PNYA 1J83A 2NS7A 4Z07A 1LE8B 2FSWA 2MH2A 2VMFA 4I0BA 1OQ1A 1UHSA 4HLTA 4IERA 4PDKA 5FYSA 3DKYA 5IFTA 4A3IJ 2L9LA 3JRFA 1DQ5A 1X2MA 4UVCA 1LKXA 2RS53 2X05A 5FR3A 1IS3A 4XVHA 2PAEA 4E4HA 3PTYA 2L4MA 1RUE2 3MBWA 3ELNA 2F5FA 3THPA 2W94A 4GYIA 5GADJ 4E7ZA 5IWFA 2JVHA 4UBHA 4YGCA 2EV0A 4RM3A 5EG0B 3BJ6A 3BP8A 2UWBA 5FYZA 1H4GA 2VOPA 4H7MA 4GH4A 3HNYM 5AFBA 3TEWA 5A7PA 3HR9A 4MGYE 2XVGA 2HWC3 3F95A 2W1SA 3VGIA 3H92A 2XLGA 5L19A 2VY0A 4WVMB 1V6JA 3MFAA 3PIJA 3F23A 2ZCWA 1I1EA 2UV1A 4IV1A 1D2SA 5A3UA 5FZAA 3ZVXA 4OI4A 4KT5C 3QH7A 2JDKA 2PFBA 2R6QA 3ZPLA 1X2NA 3AMMA 5IP6A 5FZKA 1N25A 2DBIA 4XUOA 5FLXK 4XJ9A 4PI0A 1XSXA 4O6JA 2M87A 1N78A 3LL7A 5E3NA 1SFUA 5F32A 2M34A 2EAAA 4DZJA 4IHSA 4BJ0A 3VHNA 1WKYA 4HLYA 1A8DA 3S16J 5JCTA 2XJQA 2VASA 4M3CA 2RS13 4COUA 1GUUA 1W8FA 2R7RA 1MEC2 1UU4A 1V6LA 4CZZA 1JXSA 4XXPA 1TC3C 1BK1A 5GAEJ 1KGSA 4TXWA 5JVGF 2Z69A 1N3QA 4EV0A 1UZZA 5JSPA 1SMTA 2LALA 5H6QA 2VTXA 2W00A 5C3RA 1BMV2 5C6CA 4XCAA 1PK6A 1EKEA 5A7WB 3IPVA 1KDMA 1F9NA 4YYOA 2BHZA 4H14A 2HXIA 1AWCA 1VQNI 1CZTA 3CLPA 5DAQA 1QJU3 4K1ZA 4N7IA 5C4XJ 4XJ8A 5J4VA 1MQTC 4UB6C 2WA3A 2J1RA 1IV8A 3LSHA 4RQPC 3RRDA 1YCIA 4QB6A 1XE8A 5BS6A 3HOWJ 2GXAA 2P2KA 2XXZA 5JXIA 2CNAA 3D6EA 2JSPA 3Q8EA 3VL9A 2DAOA 2XASA 2Q8OA 1CJDA 1ENXA 4OAYA 2VUJA 3CMAI 1ZBE2 2PBIA 3WF1A 5JAXA 2CUFA 5CFCA 2VMHA 4PDWA 3CD6I 4HNVA 1AYN2 1GZWA 1POQA 5HXMA 5ABJC 4HQEA 1XNAA 1YE9A 2DA3A 3CDZB 1U3EM 2CWEA 4YW6A 4C0BA 2VJ4A 3OIPA 2I5UA 4LJZF 2UU8A 3U4SA 3MLJA 3K2AA 4FQZA 4ZS3A 2KZVA 2W5FA 4Q4ZF 3J7YJ 2GMPA 1FMVA 2VMCA 4XK4A 1AOYA 1J3RA 2RN7A 3S7EA 4LPLA 1DP3A 1H2KA 3JD72 2W39A 3LFMA 4XRMA 4MEXF 2D6NA 1GDTA 2PA7A 4AM3A 3VBUB 2ZGUA 4R4ZA 4IE5A 1WZXA 2UUZA 4MQVA 1LQ1A 1FATA 2ADUA 5IT9K 1UXXX 3OS1A 2ZXIA 1C4RA 4Y15A 4KFCA 4PJYA 4Q4V2 2RKHA 1RUD1 3FHQA 3DU6A 4KN7X 5ILUA 1O5UA 2DVAA 5F6LB 4HDUA 4UT5A 2HWE2 1PGW1 2JQ7A 4C3HJ 2XKPA 2QQVA 1X4OA 1WCSA 2DUPA 1SCSA 3M1EA 2RM23 1IF1A 5A6YA 5GLUA 1BW6A 4IZZA 3VYSB 3O1SA 1J09A 1R71A 3MD2A 4M9ZA 4KQ7A 2CH0A 1SLLA 2J42A 4UBGA 2IAIA 2R4GA 3LCPA 4A3EJ 3U1XA 1K42A 3PFIA 2QBXA 4L8QA 1OKOA 2Q1MA 1JZ8A 1PVXA 1X1DA 3D8CA 1W7PD 5HCHA 3IZOA 3H3UA 4LEJA 2AQEA 5FKKA 1OOPB 5BNPC 1JXNA 4N53C 2ZJQF 3B6AA 1WJBA 1JKQC 1I6HJ 1QF3A 4HONA 3EETA 4M9XA 2ARXA 3JCIA 3BOWA 3GJBA 1R1VA 3WD5A 3NAPB 5DCFA 5CFDB 2AUYA 1EJ9A 1W28A 4M01A 1NCQA 3RNSA 1VFCA 2D6PA 3H1MA 2R7QA 4A3FJ 3LPFA 3JXSA 2B63J 2VUMJ 1E5HA 3LOBA 1H1AA 1NG0A 2K9SA 5C4JJ 2IGNA 3JW4A 1ZZCA 4QQPA 4QDSA 4HRIA 2MH9A 2VBBA 3HOYJ 1W0PA 5L7OB 4BEHA 2HQRA 5K5QA 5TSWA 3E5XA 5F6KA 3WHTA 4O5VA 4J19A 3OG2A 4C2UA 5BNNB 1H8VA 1LFBA 4YVSA 2BBYA 2DURA 5H9RA 4CDXC 4PIZA 2D7FA 4KUMA 2PHLA 2CQXA 5BPDA 3ACGA 4GWIA 2PELA 3FJSA 3ZN4A 3V7RA 4AI9A 1R082 2BXYA 2P5KA 1C3HA 1WCKA 4DMIA 3ILFA 2IW5A 4ZYAA 5A6ZA 5FQ0B 5K4LA 3BCBA 1FIAA 1P6RA 2VOWA 2HTJA 5FZIA 2L9VA 1B59A 4ANJA 3TKYA 2H8WA 2G9ZA 3HSFA 4W1UA 3UNPA 3JTGA 2VPLA 3TNQA 1QKQA 2DA7A 3CMGA 5FOJB 2YDEA 5A33B 3GF2A 3BZKA 5DABA 2OBPA 4Y1YA 1Y3TA 1POV0 5J98B 1Z7S2 3D5LA 1IXSB 5LASA 3IN9A 3SZPA 3LEIA 1LOGA 4M9SA 2W25A 1JYTA 3FXLA 1SBFA 2OYZA 1RI7A 1OPCA 4R1HA 2WNOA 3HG9A 1YEWA 3UGGA 1J7KA 1PJRA 4A7YA 3KIOA 4I2OA 1AR61 4TLFA 2A6TA 1U5TC 1IUYA 1QZZA 4IGQA 3S2DJ 5I0DA 1P4XA 5FB2A 1K5MB 5KR7A 3PUBA 4JRLA 5CFDC 3FHAA 4RS5B 2ID6A 1SFXA 1S6LA 2KT0A 4CDQA 5JLWA 4B47A 2PLV3 4H2AA 1YJ9I 3ZSKA 4RQPB 2VLAA 5J3LA 5JHFA 3CF5F 3WCRA 5KHJA 3MIFA 2ME0A 2BY2A 5BNNA 2OPWA 3I9V2 3CC7I 3T09A 5HBAA 1YI9A 4FPLA 3K4ZA 2BOIA 2E1MB 3OR1C 1NYWA 5GZFA 4C9YA 2HWD2 2E32A 2JENA 1XCVA 2VUAA 4TYSA 2HPMA 1PNGA 2QQUA 3O1TA 4UFKA 4B7KA 1BYHA 1OJLA 2AEYA 3R61A 3LSRA 2R072 2VCCA 3ZP5A 3AKZA 3BTCA 4JHZA 3ZSMA 1UPSA 1DP7P 2HWB1 2B0LA 1W0TA 2GNTA 1VBC3 3OY9A 3GCWA 3POFA 4FFGA 1ZELA 3A2KA 3RKYA 1MZ5A 5J3UA 4MOAA 3BR5A 1LESA 1ULFA 1V4RA 3MW3A 3SLIA 2OAZA 3WG1A 1NE6A 3H0DA 4YZ3A 4Y4RA 1AL0G 2QKDA 4Z2WA 3OBAA 4M3FA 1RXGA 3POYA 2M8GX 4HV6A 4IX7A 4EZHA 4LBQD 1TZLA 2DU1A 2VZVA 4KISA 4YPJA 2QQLA 4KWLA 4U0WA 1F35A 1JBCA 3LSTA 3W2WA 2L01A 4HBNA 5BNOA 1VP6A 5B2GB 1UO9A 4RR3A 1YHQI 4CE8A 1S7EA 1Z67A 4IXLA 3AKQA 3DTEA 3ZYRA 4BXSV 4C2TA 5KAIC 4ISQA 2ECBA 2Y8KA 3ESWB 2OD5A 4NB5A 3X2QH 5JVVA 3J26N 3QU6A 1IQAA 5TJJA 3NJXA 5FZGA 3RYPA 4IEUA 3BOQA 4G9SB 4N43C 2V09A 3ZPOA 5GPAA 1VBC1 5C70A 1HJGA 5J36A 3AL0C 4HVRA 5BOXA 3I4PA 3KFWX 1YTYA 4DXZA 4YZ5A 3LOCA 3KVBA 4L0ZB 3K4CA 5EYRA 2GN3A 1N47A 5FOBB 3KEOA 1XX5A 4XICA 1QQP3 4CO8A 2FQ3A 3AL0B 1IS6A 2B39A 4Q4Y2 4L9BA 3NV3A 4L9TA 1U9NA 2Y6LA 1ZBA2 1LGNA 2YXSA 4O7XA 4QU2A 3JUUA 4O65A 4M6XA 3GHNA 4LKEA 1TE1B 2QCSB 2WWUA 3VSLA 1S0EA 4AUXA 5CVVA 2ESHA 5BQTA 1T56A 5DAVA 3OS2A 1XYOA 2XJRA 4P5YA 4AF9A 4XUPA 2B45X 1B35B 2VB6A 5K7FA 2QBYB 3AL6A 1YXWA 4YG2F 2VVEA 1WRJA 2G19A 1IG3A 2A6HF 1NCRA 1UIJA 4PIYA 3RYRA 4HX7A 4WVZA 4S05A 3S1NJ 4AVSA 1O5LA 4IHTA 2MSYA 5EEHA 2JDPA 3WDTA 1VBA3 2R0HA 4GMP3 4EJWA 3I2KA 3HSEA 5FZ6A 2R1DA 1TLHB 4RB2C 2PQSA 3DYPA 4RHV1 4HZFA 5CZKA 3WTSC 2VOVA 5J7MA 4BJTA 3JD71 3JRCA 5KXEA 3A01B 4L5IA 1VIWB 1RUC2 4AEMA 4DQAA 2OUJA 5A7QA 1LEBA 1ENQA 5BPIA 1FLIA 2WO2A 5FGMA 4FAHA 2W7NA 3GW2A 2VE8A 3CCQI 3I4NJ 5BUVA 3GTQJ 2D5VA 4LA3A 3A1YA 2QDNA 2ECCA 2MD0A 2CW8A 4CP1A 4XNFA 2WNVC 4RD7A 4A5NA 1X8EA 2MD5A 2BBVA 3SQNA 2R7TA 3QODA 3TW7A 3MIEA 2PEXA 4BQ2A 2HYJA 3WG7H 1MNEA 4KU8A 2DA5A 3HQRA 2HH9A 4Q47A 3SDBA 5CFDA 3E7LA 1WKMA 3WODF 5B1BH 2QVSB 1KYZA 1AL22 1OLRA 2RS33 3SHRA 4L9NA 2DK8A 1FMWA 4QQOA 3UKNA 5DAPA 1V9U1 4AWDA 2OPKA 2STTA 3NJZA 2R30A 2W0XA 2VT2A 4FPFA 1B4AA 4JDOA 5E88A 2LSOA 1ZGAA 2DT6A 5F3EA 1NK2P 1XYNA 4MO7A 4P08A 3THDA 4EJUA 4D7MA 5EGOB 1ACCA 5GZDA 3WGGA 5JDBA 1XDSA 3ETPA 1QU0A 2F5CA 3H0GJ 4HK9A 4II3A 3G71I 3NJVA 2DCYA 1ZGJA 4FTEA 1DZRA 5I8YA 5FCCA 1FOD1 4OYUA 3DWLE 4EJRA 3LQRA 1URXA 1X1AA 4KBZA 1YFUA 1UY2A 3ZFGA 4XFFA 4QPWA 3PUFA 4XL9A 2M9HA 2O6GE 4UAPA 1GWKA 3IPVB 2QZ3A 2OCCH 3UGFA 2WLPA 2WBMA 5CKTA 3E1SA 3NEUA 4A0YA 1PGW2 1YQAA 2X6OA 4AZZA 1EF4A 3VBOB 1Z3YA 1IUFA 2W87A 4SLIA 2XAHA 4BLIA 5JSRA 4HK8A 2JD9A 3ZCOA 2L0KA 4B3NA 4CGZA 4V19K 5CQGA 3VBSA 4BS9A 2IS1A 1UHMA 4M3CB 2GMMA 1LODA 1Q8OA 2JVGA 1GZ9A 4HF2A 3ZQ7A 3KSCA 1PX4A 5K5RA 4NHKA 2L9SA 2UWMA 1LNWA 3ACIA 5LB6A 3K1PA 2FQ4A 2A1XA 3PMEA 4BISA 1OCRH 4M3EA 4K1YA 3GHMA 4XAAA 3D5SC 5BY5A 3QU3A 3B69A 2NRAC 1XPXA 4IRGA 2VZQA 1YFHA 4BXXJ 2J1UA 2P34A 4FT8A 3V8KA 2FXAA 1W6OA 4YARA 2Z2SB 5IY5H 4WM7C 1QGLA 2FMLA 3ZXFA 5LW9A 3MUZ1 2JD4A 1C1LA 1ZYRF 4L97A 2A07F 2DCJA 4CDUA 1VBB2 1ODDA 4HPQA 3I2OA 5H2FC 1GKBA 1NT0A 1WLWA 5F0FA 1P4WA 1C8M1 4PSXA 3ONQA 2CSGA 2RM22 1ST8A 2XBO1 3AM2A 3KLSA 4LFUA 3HGYA 5EG0A 5EQUA 3JAMK 4OQ9A 1X8MA 2RVCA 5KHIA 4CXWA 3JRAA 2K0GA 4CDWC 5I0UA 1LNSA 1DGRM 3MVPA 2B46X 1R5ID 1K45A 2QVOA 4L0YB 4W6XA 1K83J 3PIOF 4CZSA 2DYRH 2ELJA 4Q0SA 4R9AA 2VKEA 1UZVA 3QD6A 1PVC3 5FO9B 5FQ0A 3TNPB 5CBLA 1BLZA 5J47A 2YPDA 1J0RA 1YRZA 3D0JA 1R1A2 5E6HA 4CP9B 3JSOA 1D5VA 3QP5A 4JBAA 3F3XA 3A4UA 3BCWA 2JA7J 3CDHA 1IPJA 1IGOA 2ZMEA 2CU5A 4QKFA 4BQXA 1AR73 2EA2A 3SEQA 4EEFG 5LBFA 1KGYA 1WGXA 4AWXB 3N7LA 5JI7A 2DFFA 5G05L 1RZ4A 4Y20A 3M8LA 3FISA 3AMHA 4BEHB 3ABZA 3CCSI 5M3FJ 4OLLA 4FXGB 4L2NA 1ZRCA 3FF5A 2HOEA 1V6OA 4AIDA 2XBO3 2Y60A 3S2HJ 2LUWA 4IV3A 5A3TA 4D1QA 4CU6A 3BQZA 5T5JA 2ZNYA 3RSNA 3GF6A 5CG9A 3OEAA 1N75A 5L73A 1HCRA 1E17A 1AKHB 1QJEA 4JP0A 3RKXA 5DDJ2 4ESJA 1VBD3 5FFZA 1WGPA 1OUXA 2DVBA 3OUIA 5L36A 3N9NA 1MDMB 4MSVA 1MBFA 3ZFFC 2HYKA 2W2IA 5IAXA 2QGUA 4M3CE 5LK7B 1PO12 2VXZA 2X6XA 3KD4A 5FKLA 4N9IA 3M8FA 2EXIA 2DJNA 4QXBA 2HQNA 3WHCA 2E5NA 2X5IB 1OA3A 2IGOA 5JMCA 4FPOB 2RNJA 4XCBA 5FK8A 4C3IJ 2HOTA 3S1QJ 3S1RJ 3O0XA 1EUTA 1WZ2A 1A5JA 5E16A 3IB3A 5L3GA 5ICFA 2PX9A 2XGXA 3A0NA 1FV2A 3MGUA 1UN1A 2ISZA 2R071 1UAIA 3VZKA 2V72A 2K7LA 3ME2A 1CAXB 4BQAA 4BXUA 2BVLA 1B72B 3NQOA 4AR2A 4PJJA 3GBFA 3N9MA 3WDVA 3W5MA 1Z91A 1MEC3 3F2ZA 3NVCA 1VQ4I 1LHWA 2Y0IA 4JC1A 4MGZE 4D0QA 4UV8A 1W6NA 3KWVA 2PHDA 1M1EB 4MADA 4A6OA 5GP9A 3WF3A 1W2AX 3SEZA 3BPXA 4IEZA 3VPRA 4FO9A 1VAKA 3CUQC 4LOTA 1QOSA 2Z42A 1ND2A 4II2A 4CA0A 2VUDA 1DPUA 1F8VA 1YG2A 4JGZB 2IWGB 1PO23 2V9PA 2EXJA 3ZXAC 3DEWA 1W04A 1NG7A 1PZ8A 4S2DA 1LHOA 3TBIA 3AKTA 5FYBA 2XGDA 1J3PA 4AFAA 3JSPA 2R073 3LEMA 2ET1A 2QBYA 2ZEZA 2AYHA 1UZCA 4GA9A 3P3PA 2Y9YA 4LG0B 3BTYA 2L54A 1IV6A 3I3BA 1E5SA 4O61A 2LLKA 5KXBA 1YIFA 2ARBA 2PG4A 4KU7A 1X7NA 3JBG1 1XN7A 4AI1A 2VVFA 4LOCA 4YFKF 4BQ1A 4V2WA 1D4M3 1NCQC 3N9LA 5BNGA 2RVAA 3K46A 1PGL2 1P4AA 1UWWA 2NAZA 3SKVA 1FC3A 3BY6A 1IG0A 4AVBA 2ZO4A 4RAZA 4YVWB 4BK4A 3K10A 3VFZA 4LD5A 1HW2A 4CCCA 5EYXA 1V70A 5GKAC 3VEPA 4F3QA 5FREA 2HPIA 2JTVA 3J80K 4CYDA 2NMOA 5A6QA 5K7ZA 4WXCA 3NNLA 5F8PA 2JEMA 2VQTA 2MBFA 2DQRA 5FMDA 2MPFA 3P9IA 1EV13 4G7ZF 2K46A 2VQ0A 4MV2A 2XVLA 2NPIA 2R7EB 1S0DA 3OL4A 1PP7U 3FMSA 5LGTA 1V6KA 1BEV3 4ASMB 2VXDA 3I3LA 1JN2P 4NMIA 4G6DA 1O7LA 4Q5OA 2O5RA 2E71A 4NJ4A 4GB32 1E0EA 2PMHA 3U1DA 1YLLA 2M4KA 3M3YJ 3LEGA 2E31A 2M45A 3AFHA 3JU9A 2OKXA 4IEQA 2X0LA 1KZHA 4A3CJ 1DZQA 2BTVC 3VSKA 3ZYFA 5JSOA 5FKMA 3TO6A 5K0UB 2L2OA 2XL9A 1YJLA 3E0JB 4Q29A 4IO9F 4R9DA 2EBIA 2LDUA 1QHGA 4XDQA 4RLQA 4EWEA 2JDNA 4E7IA 3OIOA 4G7OF 2HWC2 3H42B 4Y1UA 3WP6A 2D2WA 2VJ5A 3CJNA 2B4KA 2HWE3 1UOJA 2V5DA 2FX0A 2DWRA 1JHNA 3VBHC 1MH4A 4M6VA 1TQ5A 4WVVA 4CCMA 1JOBA 1XGSA 3MMYB 1EV11 1ZRIA 5L3BA 1RB8G 1RINA 1P9QC 2LRPA 4A7ZA 1OQEA 3LMMA 2OQRA 1IQDC 1X4PA 4OI1A 1JUMA 4BLJA 1BM9A 4JHTA 3MKLA 2GQQA 4DJAA 1KQ8A 1EAH2 1REDA 5C9AB 4YG6A 4L9JA 2X6YA 3PLQA 3J81Z 3HTSB 3LDRA 4DUWA 4CHUA 3BPVA 1X3WB 4CP2A 2Y0OA 2XF7A 3OYHA 4PI2A 2M7BA 1LEMA 1UMHA 4GWJA 3RWKX 3WTTC 2VNGA 4B09A 2MGQA 1USTA 2EFPA 1J1TA 3ECOA 1QIQA 4XFHA 1DG6A 3B00A 1K61A 3INAA 2WS92 1C5HA 4N53A 3REOA 1YITI 2BZDA 1G3WA 4PBOA 2RAEA 3KCCA 1NZIA 2IS4A 1UKGA 3BVCA 2E5ZA 4XOTA 4FTHA 4FXKB 5ACA2 5K1YA 5A2QK 2ZX4A 4QX3A 2ZBJA 1X36A 4Y17A 1PNFA 3UJQA 2WAQA 1CGPA 1IS5A 1CWPA 4O9EA 4GD4A 5J6XA 1AYM1 2L7MP 3GZ5A 3URFA 1XRUA 3C7JA 1RETA 1N1TA 3CDLA 2CW0F 1W05A 1J2XA 4QB1A 4H0EA 4ZDOA 2D6OX 3CZUA 2WY7Q 5BNPA 4YGBA 4CDXB 2SBAA 4UI9L 4BQ5A 1BJZA 5DYMA 2YGLA 1JTYA 4ARXA 4PSWA 4BDZA 5FIXA 2FZ2A 1H6YA 1Y9MA 2WO3A 3L2VA 5GZEA 2Z3YA 1IRXA 4U7DA 4QHOA 3ZYIB 1SLTA 2QA4I 5J1XA 3BR1A 1Z7UA 4CDWA 4IHVA 1SQ4A 5KHHA 4FASD 2QQWA 1BI2A 2W1QA 4CH7A 5DZEA 3IHUA 2A75A 3ZSJA 1Y1VJ 2Z1DA 3WTYC 1D0GA 1AA7A 1E3OC 2B8MA 3SDGA 1EY2A 3BLYA 1OFSA 3RWNA 3IDAA 2NXNB 4YW4A 2VZSA 1HKTA 3I97A 2XJUA 4DB5A 2DCEA 4PGGA 3L9FA 2YBSA 1W03A 2B9SA 2JDUA 4D94A 1IDYA 1R49A 1ULPA 3O1PA 2OV7A 4F91B 3USUB 3G1LA 4FPEA 1BW5A 4QX7A 2XPWA 4ZTJA 1ETXA 2XJSA 1JOJA 4CP9A 2LBFA 2WAEA 4GCVA 2VKDA 1F9KA 5FZFA 3AL5A 3U37A 1ZLJA 2DF7A 1IS4A 1YJWI 1LAJA 1C8NA 1LDDA 2BRTA 1VQ6I 3M2MA 1MS4A 2XUEA 5HPOA 3S5QA 2JG9C 3BC8A 1IRGA 4OMCA 3OCPA 1UW8A 1RUF3 1B9NA 1SFNA 2YU2A 5JLXA 2Y0SN 1KS5A 1L7LA 3LEKA 1SPPB 4ARYA 2UWCA 4AEKA 2D3PA 4P9XA 3GLXA 1T0FC 5GAHJ 2NVYJ 1HKSA 1GU3A 1GT0C 2RS32 3Q5FA 1K78B 1IXCA 4IL7A 4C8DA 1W7PA 2GOMA 3FKIJ 2GIVA 2QYOA 4DYQA 4XIKA 4BBRJ 4A3GJ 1XB4A 2V7FA 2EF6A 4IQJA 4DBQA 3RZMA 2RREA 1AYN1 3SC7X 3PHMA 2X29A 1COV2 2CQNA 4IEJA 1B1BA 2GC0A 5FROA 1ENSA 3K4AA 2VCAA 2QSGX 5J48A 4IEXA 1HOMA 2GBYA 5L7OC 3T2OA 3U75A 3DL3A 5DPNA 5FRAA 4OUSA 4QM8A 1OVPA 2ETEA 2GDFA 4L5JA 1JHHA 4AIHA 1BKZA 1FSEA 3CLQA 4RAGA 4B1MA 1M06G 3BJOA 1UY3A 1I5PA 3OSGA 2V9VA 1TWAJ 1FBQA 5HCBA 4RDUA 4BE3A 1RMU3 5F0CA 4JDNA 3VBOC 4HW0A 2M7AA 4ZXKA 2QZ2A 3AB0A 1JZ6A 1K4SA 3SXWA 3NWSA 1I1GA 4JX0A 1Z1DA 4QGNA 2OF7A 3OPWA 3DEEA 2P81A 3K3NA 4XMYA 2LK2A 4XUNA 3Q0UA 4AIKA 4BKXA 4IOAF 1GFF2 3FM3A 5KWRA 4OUMA 5F2SA 3OYWA 4CPBD 5FDBA 1VI0A 2VW0A 1LVAA 3V7CA 4WWCA 3OOPA 1DGRN 1WD3A 2XAJA 2AEZA 2GSYA 3KZZA 1TWHJ 1FX5A 2R5ZA 2YG0A 3GFMA 1SEUA 5CKQA 4Z8BA 3S5AA 1K79A 4MFDA 1VBC2 4IEYA 5EEAA 3HRTA 3ZYJB 1WJFA 1O7FA 3KLOA 5FZ9A 1NH3A 2G0EA 2WKKA 4ZZLA 3I59B 1SFPA 1VBD2 4IW3A 1QJU1 4LO8A 4W6YA 5CISA 4RA0A 3BG3A 5ICGA 5KK1A 4F3JA 4GWMA 4DW6A 1JS9A 3K75B 3HC7A 2WL1A 3C3VA 1WBLA 3O1VA 1PX3A 2JA2A 3DLLF 1Q1VA 1EA3A 2G4IA 3OY8A 4AHXA 2VE1A 3IH4A 4ABZA 4RM2A 4CEYC 2EZIA 5LA9A 4KDPA 5A7WA 3I2JA 1DYPA 2P4WA 1REEA 1SBEA 2NVXJ 1A04A 2IPQX 1IO2A 2HOAA 3ZN0A 5ACA3 2JUCA 2RMU1 4HA8A 2OS2A 2OIIA 2LYCA 2O0YA 1HRV2 4MHRA 3BG6A 4S2FA 1HA8A 4QPIB 3RI8A 4V2FA 5C4WA 2LREA 5F2WA 5KHGA 5J09A 3M3EA 2K9ZA 4M0NA 4Q4V1 5CAZA 1TQMA 3G7DA 2LF8A 1OC1A 3DXJF 3OJBA 4KWJA 3OYAA 4HOOA 2YX4A 1OCPA 2EWNA 4QLCU 3WU2C 4PCRA 4XUQA 4XN0A 4LE3A 2HWC1 2P5BA 1ETVA 1BBT2 1YOVB 1SEFA 1PGL1 2VI6A 1WW4A 2ZXHA 2OU2A 4AAXA 1IJWC 3TRSB 3E6CC 2IBDA 2DQLA 4LUKA 4XTPA 2WWSA 1GQHA 1OFNA 1QMJA 2KIQA 1FPQA 1QNTA 2DU0A 4LUMA 1RUG2 1W5SA 5LHIA 1Y4WA 4BY1J 4XC9A 3MWMA 2FJ1A 1W6PA 1H8AC 4PUSA 2C4XA 4EN7B 2P17A 1HRI3 2E36A 5B3SH 3UETA 4G12A 1H9WA 1GICA 4BHBA 1EH6A 2BNNA 3DP7A 3ACFA 1DU6A 3KX2A 2ZGLA 4ZY9A 5J8FA 3ZYPA 4CSWA 1J1LA 1JZ2A 3TBDA 3NKTA 5FRNA 4A5MA 2WZR1 1APNA 3EYYA 3S14J 4COWA 4WM7A 2JK3A 5JLVA 2XJTA 1JJ6C 1NXMA 2A5YB 4AOCA 2KKOA 1VB2A 1WVRA 4DFSA 2F48A 1ND2B 5GM0A 4AYBN 1AR72 4WCGA 2H0BA 5IATA 4NO4A 5JWPA 3GTPJ 2LM3A 2O7OA 3BTZA 2QJVA 2HDWA 3O1OA 1O8PA 1SLBA 2F5EA 4XKCA 2ZPXA 5JVTA 1AHSA 4A6DA 4IKFA 5CYYA 5FZ7A 1NKGA 3P7NA 5GLWA 4MH0E 1W8NA 2QQ8A 1LECA 4QB2A 2BY3A 2A6XA 2VE9A 1UYPA 4IUGA 4TZDA 3U0ZA 2NVTJ 4AFCA 1T6BX 1IRZA 3NV1A 2OUMA 2FBIA 1RC9A 3CMEI 4F93B 4XLAA 3ZFGC 1VALA 4XAEA 2QUOA 2D6LX 1FXZA 4XHBA 1Z05A 2O1QA 3LSDA 2F2EA 1GBGA 2FQPA 4GRIA 5JOZA 2IC1A 4NC6A 4HKWA 2WAFA 2NM1A 1OYIA 1SD5A 2D1VA 1YFWA 4ASNA 2AQFA 1CF7A 5KHDA 1JZ5A 4LHKA 1S3JA 1FY7A 2G7HA 1IKPA 5DXDA 2EIBA 3WVJA 1V5GA 5AIPA 2TCTA 1O3SA 1D0ZA 5APAA 2XAFA 2XDVA 4HKLA 5EXOA 1V5FA 1JI8A 4CXYA 2EXKA 1Z6RA 1BK0A 1TVGA 2ZABA 4DUXA 3CC2I 4KNYA 3ILRA 1HXS3 1LOFC 2LBFB 4BQYA 3ISPA 1ERDA 2CFXA 1UU5A 2VM9A 3R05A 3GCMA 3TN92 2UYBA 4BUPA 5HCFA 5TRDA 2ACJA 2KZGA 5M5XJ 1U9OA 2JRTA 2RM21 1PO22 3OYFA 2JG9B 3KE2A 3ECHA 3GGLA 5FXVA 2MLGA 2MG4A 4ZZ8A 4URTA 1E5IA 4AFBA 2JKBA 3O0WA 1HC8A 1I3HA 1ZH5A 4RB1A 5J40A 3COAC 1O57A 2WN3A 4KG0A 1H9GA 3O7OA 5L9BA 1AJOA 1W3XA 5KHKA 4JKKA 1L7RA 4BK5A 3OL3A 1RUI3 5KC6A 2FDKA 3GZNB 3HUGA 4JX4A 1WMEA 3CJIB 2YC2A 2J1SA 1NQDA 2HWB2 2XF5A 2VZOA 3WP3A 3OB8A 2AZ5A 4AW7A 1FI2A 3OF1A 5A3OA 3WDUA 2DUOA 3OGJA 2QENA 1QH7A 5GTHC 1KQ9A 2BW3B 1L7QA 2MEV1 3BCAA 3NNMA 2Q1ZB 2JE8A 4KICA 3NWTA 4XORA 1BL0A 2CSOA 2DFBA 1VNDA 4CCJA 3CC4I 2R042 3O0VA 2WNUB 2E51A 1NA1C 2DMQA 1QO0D 5DN2A 4LJHA 1A8MA 3G2BA 2E2JJ 2FDJA 4MGIE 2JX9A 1RUJ1 3PL0A 1LTEA 2B9VA 2JDAA 3AP7A 3VDDC 3T2PA 1UB9A 2Q30A 1KEXA 3HQXA 4XLPF 3PUSA 2O8KA 3D0SA 4FPHA 3M70A 3AMNA 1I3AA 2VW1A 1I5ZA 1GR3A 1FX7A 2KQRA 3FXUA 5C5TA 1Z3XA 1Q8SA 2XRNA 1E57A 4QX2A 2OPTA 1H2NA 2BE5F 5GAGJ 2CJJA 4Y22A 3CJXA 4F92B 2NZ9A 3OYEA 5D5UB 2D5HA 3OYKA 4V2VA 1RUNA 3CJQB 4E7HA 5LA1A 5GLVA 5FFOC 4CUAA 2YU9J 2DMTA 1C28A 4YIRX 1S9HA 2DU9A 3N7JA 5FO7B 1RGSA 1S55A 3U1KA 2MC4A 1FMD2 1DGWA 4ASLA 3WHBA 1QOTA 4YIFA 2ZFUA 4Q2FA 2VQHA 3RS6A 1U5XA 1EPWA 5CLSA 1K12A 1RUJ3 1MVQA 4AEJA 1CQTA 3LSPA 3DBLB 2X5IA 5FJKA 4J1WA 3QYFA 4BA6A 4CCEA 2TUNA 1QJY2 4H55A 4IEVA 1OFCX 3LAGA 4RGSA 3BWGA 3O8HA 5FBJA 1OPOA 4WV8A 3ZR8X 1LUJB 3SFZA 1VBE3 2I8DA 3ZQGA 3JCUC 3POWA 4B1LA 2GH2A 2M2EA 4XONA 5F0HA 3I49A 3WR0A 2KRHA 4IOCF 3RDIA 1GXPA 3T8RA 1JMUB 4JGYA 2PMUA 3SKJE 4QXCA 5FY1A 1A6QA 2VG9A 4AQTA 4XQDA 3CZ6A 2A6ZA 2EIGA 4CU7A 3DV8A 3QPSA 1UNBA 4DY3A 4XBQA 2E53A 4A3XA 3QQAA 3ZQQA 2R7DA 4FE4A 4LK7A 2IXKA 3EHKA 3WU0A 4A3JJ 3OOXA 3MIHA 4AI3A 1JT6A 4CDQB 1ND3B 2QSHX 2DA4A 2DFEA 2FF4A 4CU9A 3N7MA 4WM8A 1J84A 2H0VA 5FD6A 2ZZJA 4CVUA 3CUOA 2JSCA 3KP3A 1SLCA 1NCQB 4X1EA 2J1AA 1AXKA 4W8JA 4I98B 1SFKA 4UYBA 4A42A 2NS8A 5C71A 5DV5A 3CQZJ 2K2SA 2CV1A 3HVDA 1YLFA 4HSTA 3M1CA 2VC9A 5GPCA 3JRDA 2EINH 2FA5A 4MLOA 1D5YA 1HQCA 2G7UA 3MV11 1WLTA 3HOTA 4QIWN 4G9YA 2WABA 2O8XA 3ABUA 3H8XA 1MJ9A 1VQKI 4LG0A 1W6MB 2EK5A 2XGCA 1LOEA 2VZTA 5C33A 3ZMDA 3WU1B 3NKGA 3V65A 2FDIA 4BWOA 4QX5A 9ANTA 3CJIA 4KN4X 5HDKA 5T50A 4D5FA 1BI1A 2WSUA 5JZGA 1CZVA 4HBLA 4GMP0 3WDYA 1HQNA 5FMBA 2WNVB 1ZM1A 2XRLA 1G8WA 5E18F 4JGZA 4EROA 2WFF1 4MGKE 2LF7A 5IK4A 3C7HA 4HSJA 3KZYA 3TAYA 2YUEA 2NYYA 3VBRA 2P0WA 1RKTA 4FETA 2XPVA 4IRHA 2R7WA 4AL9A 3I8TA 2XSDC 2ZMLA 3E5UA 5HS8A 3K69A 3VBSB 1UOBA 3AK0A 2O3FA 1VRH2 3A21A 2KFDA 4AQ6A 1LPQA 2K85A 4WXDA 3VZNA 4JGYB 1NY71 1NAEA 3WNMA 1IRFA 5FUIA 1WLCA 4QPQA 3J4UH 1SVLA 1F4AA 1ON2A 4IE4A 4FTBA 3MW4A 4KITB 1XU2A 3Q8AA 1LU1A 2OXBA 3KT1A 4D7YA 2CV0A 2NS0A 1UD1A 4OIOF 2IVJA 2PLV2 1BVP1 4AFMA 4P9YA 3ROUA 4XBLA 1JKRC 1DLCA 1W5TA 2WFF3 5FYVA 3CDIA 3RTRA 4ONUA 1D1CA 2QE3A 5EJZB 2D3RA 1A6CA 1PZ9A 3MN2A 2WC2A 4AYUA 4XE9A 2ESNA 1RR8C 3JD73 4C1WA 4JV4A 5LHGA 2WS91 4Y26A 1ND3C 4AHZA 4OMZA 2ETHA 1NQJA 3DXUA 4MXVA 1ZR2A 1RHI1 2C0ZA 4EJOA 4CDGA 1N77A 4L18B 4RMNA 2G9GA 5EFUA 3JRHA 3U07A 3FBNB 1O3QA 3ASOH 5EJCA 4LBQB 1TP4A 1O91A 1PM7A 4RGKA 1BXHA 3D4KA 1J9IA 5GALA 5EHDA 3MIDA 2LROA 4BIFA 4UNOA 4D3WA 3R6SA 2QQAA 2XKOA 3BTJA 3W20A 4ORFA 2FNAA 4R52A 4GYGA 1ORKA 3K4NA 3Q0WA 1SCRA 1X1CA 1HXS2 2W3JA 3QWLA 4P9UA 1T2KA 1R1UA 1VMJA 4BHPA 4IV3C 4YFNF 2IXHA 5E1XA 3I3QA 2OA4A 1WJ5A 4K21A 1G3YA 4NRMA 2P3YA 1Y9QA 1W8TA 3HOSA 2JA5J 2Y26A 1G9DA 1KD7A 3V8LA 2WT1A 4DOUA 4CEWC 2WS93 3LGRA 4JQRA 5JXHA 4QKBA 4B4CA 5HVQC 2VMGA 4Q4W1 1D8KA 3OBRA 5D6FA 1RHI3 3LB9A 2IXJA 3LWFA 3NWKA 5ILVA 3TOAA 2WQ8A 2ZJPF 3U10A 4CCOA 3OS0A 2CTVA 1HKDA 1MBJA 4MVTA 3VD7A 2YX7A 4UFLA 2DPDA 2ORXA 1TW3A 4N7UA 2PHTA 4J00A 1XSDA 5E89A 1X1BA 1YS7A 4Y1ZA 1K5JA 2Y6HA 2NLRA 3H35A 1VR3A 1TME3 1DDLA 4AI2A 3J7LA 1VQ8I 4YRDA 3RZHA 2ZXQA 4XOGA 3M4FA 4ZJZA 3KCYA 5ANNA 2XV4S 1R9TJ 2ZEXA 4DEQA 3HUGB 2QTWB 4Y24A 1WFXA 1JGSA 5FZOA 4I6ZA 1IKQA 5DUXA 3MKYB 4RBOA 1LFUP 3ALQA 2D1HA 4YEJA 5JMOA 4MUVA 2OA2A 3J81K 2RNGA 3KP7A 2P5LC 4X6QB 5LRSA 1G2HA 3M9AA 3AAFA 1UZ0A 1YO8A 4NHXA 2YY1A 3QPTA 2Y33A 3H1WA 2X8KA 3FFQA 5FLXZ 1Z7S1 4ESFA 1OMIA 4AVAA 2IUWA 2Z9OA 3V64A 1TNFA 3MKWB 3I71A 1JT0A 2ZEYA 4B29A 4MYEA 4FOYA 2VIXA 2XHKA 3PNVA 3HPGA 1XNTA 5FLJA 2LKXA 5JIUA 1SD6A 1TME1 1QVUA 2CQ7A 2CQKA 3GO5A 3V0BB 2JJ7A 4HPKA 1E5RA 4D6QA 3GM8A 4ET7A 3S1MJ 3FIWA 1QQIA 4YM0A 4BZ4A 5LLQA 3T8TA 3ZO0B 2VJJA 5B4NA 2EIJH 4OZOA 4EGZA 5LBBA 2AHQA 3ZN1A 3FLTA 2NNNA 1XJAA 3LSKA 4ENJA 3R4UA 4X6AJ 4PCQA 4DBRA 4AHYA 2K4JA 1NLRA 2L7ZA 2A6WA 1VAVA 4YIIA 1GOFA 2EIKH 4E7LA 1FPN2 1US2A 1GSLA 4JYKA 3PSIA 2BVBA 4BACA 1DDNA 3F22A 5FP3A 1Z7S3 1QNWA 4KI5M 2P3IA 2PTMA 2GN7A 4ZDPA 1WH7A 1QZYA 3F8BA 2VTXJ 5E20A 3THCA 1AJKA 3BGAA 5FBZA 5C8CC 3WG3A 2LP0A 3MPPG 4YSFA 3RPUA 5FWEA 3A4CA 2HZTA 3VKFC 5A6XA 1U0JA 2HNHA 2R0FA 4PJLA 2H8RA 5IOYA 1KITA 4HPKB 4M3BA 4Y33A 4QXHA 1SFEA 4KIGA 2GMEA 3H9GA 5HLIA 1K7AA 1PUFB 1XSQA 2WYSA 2AH2A 3PQJA 5KC5A 3H7JA 2LG4A 2A61A 3DUIA 1TNRA 1SACA 1W0NA 1HQLA 2ZGSA 3FUOA 3ST7A 4E6KG 1UX7A 3GBWA 4K20A 4DGWB 3ILNA 3A23A 1GP4A 2QM3A 3ZKYA 4XKBA 1KA8A 2ORZA 1BC7C 4DUVA 1PIV3 4L5EA 4HVQA 1Y0UA 2GAUA 2YGMA 3K4BA 5C9AA 3ZQLA 2UY8A 2NQYA 5A3PA 1DGRA 2XAGA 1F31A 4A44A 3LSEA 4PT6A 5LY1A 5IT9Z 5FZ0A 2CFOA 1SG3A 4NHJA 3WX5A 2IA1A 4XKVA 1UCXA 1UYZA 3U11A 3HM5A 1WA4A 4I99C 2XWJB 4QQ2A 2VQLA 4AE2A 3OSDA 2C24A 2XB5A 2N7GA 4XRSG 2UYAA 2KP6A 3TO7A 3M3QA 3IL2A 1KJLA 1B8IB 3JB8A 1XXNA 3CHXA 1T6SA 3RKQA 1G9CA 3DPTA 3WNLA 5K0UA 1G86A 3VLBB 5EV7A 4KMQA 1WBFA 1B35C 2PMZN 4AQ2A 5EPAA 4W97A 2FCUA 1BVVA 3O1RA 2COMA 5E3OA 5AVPA 3T08A 1IXRC 5JR3A 2R062 5CPRB 4FP3A 3ERMA 2WQZC 2OW4A 4ETSA 2R92J 1XSVA 3UKGA 1D7PM 2LY2A 2QCOA 5FZHA 2ERFA 4P9GA 4U0YA 3JQXA 2DK5A 1S2BA 2BV4A 2ISYA 3GFJA 1TWCJ 3BKZA 1CAVB 1WPKA 3ES4A 4FSJA 2IXIA 2TRTA 3U14A 1LOCA 3KT4A 4R9BA 3VKMA 3W21A 1ZN2A 4M3GA 2CGNA 2IFWA 4I0WB 2K4BA 1LFPA 3FLRA 1MJAA 3IWFA 3PL8A 2HJIA 5GZCA 4XDPA 3KF5A 4DYCA 3C7EA 3LIGA 2DV9A 1I1SA 4RSUA 2VOTA 5T3NA 4Q8KA 5DM7F 1PM4A 2VL4A 4PF1A 3RZZA 4BQ4A 5IW0A 2QEXI 4QTRA 1JW6A 4IEWA 4BB3A 4YRVA 5IUQA 3ZXEA 4IGOA 2A3WA 3Q9VA 4KMFA 4QPGB 4P00B 3IKTA 2VBDA 3JBG3 4D7TA 5AIQA 3SZGA 1N3PA 5E8IA 3C1DA 2FMDA 4BQNA 5EWSA 4URAA 3K1NA 4XACA 1OYYA 4AVVA 3WTZA 4PHZA 3ASIA 1G6NA 4Z1VA 1XTAA 4A3KJ 1W3VA 4BQ3A 3P6BA 1V9U2 5J1RA 1R1A3 3BTXA 3VB2A 3K48A 5BNOC 4ZH4F 4Q1PA 3EUHA 4P14A 3KLNA 2FDGA 5IYYA 3IMMA 2XROA 1FBUA 3UESA 2UY9A 2XJVA 4LO5B 4PBPA 4IHYA 2R061 3QBQA 1K4TA 2G1MA 4U87A 2D6MA 2EV5A 4OINF 3CO6C 5F9TA 3IMNA 2ZBKA 1XSRA 2ZGMA 2FEZA 5FKNA 3TW6A 2XG3A 4EWAA 3TDZC 2BYVE 4GDFA 3R4DB 3T1MA 3GMEA 5E3MA 1MW7A 3CO2A 3IM0A 5CADA 3SCHA 4D9JA 3EPZA 5L3DA 4KT6A 3ZMZA 4WM8C 1RUOA 1CPNA 1H8TC 1WMDA 1O4YA 2WN2A 1C5IA 2IJLA 2B7EA 4DYRA 3DTKA 2VOXA 1R1ZA 3M3IA 4M3DA 2HYXA 3IDBB 1IC8A 3ENRA 1FIPA 2XR4A 4NPRA 3E97A 3LA7A 2DYCA 1GWMA 1OKQA 2GP3A 3WP4A 1UAAA 2HQAA 3QRFF 1R22A 2IP2A 3GALA 2UZKA 5FMOS 2KL4A 1JZ7A 3OSFA 2EIEA 1D2QA 5F5QA 2WT2A 2JPBA 4IETA 2ZXWH 3RQ0A 2LH9A 1KXGA 4EN6B 4IJAA 3C2HA 1B09A 2R041 4U0VA 4A69C 1D0HA 4CDQC 2VR4A 4JX6A 4J1XA 2WT0A 4IESA 4FTSA 1AX0A 1PGSA 3TN93 3ZRGA 4LLNA 4ZYEA 5E1WA 2YUSA 1LCLA 4B43A 2VONA 2X5IC 3AG4H 3G73A 3CO7C 2ZKZA 4A3MJ 3LDBA 4X6RB 3ES1A 2BW3A 3S32A 4OMDA 3U9GA 3OYBA 2A3YA 2DCTA 3PVEA 2QQIA 4AQSA 1C8M2 3SEEA 1RR7A 3V42A 4LB5A 3CEWA 2KD7A 1ZBE1 4AGRA 1XDUA 4YG0A 3FMGA 1FOXA 2HBUA 2EFQA 3GUDA 1SD4A 3D3AA 2OX0A 3I4IA 3LA3A 1FOWA 3VD4A 2FOKA 3KT7A 4QX8A 3GBGA 2HLEA 1U8RA 1BCXA 2GNMA 2X1CA 2RDPA 3V56A 3AKSA 3HZJA 1ENRA 4E2QA 4E9KA 2M4GA 2O14A 5F1RA 3ML6A 4YLZA 4ZKTB 1LJ9A 3BTLA 2ARAA 5TISC 1XGOA 2V4AA 1BIBA 4LMFA 1WLDA 1QOOA 1ZZ9A 1JUHA 2XLAA 4QAWA 2DFIA 1GP5A 4XM3A 2VZPA 5HLHA 1HJFA 1ZHFA 2Z5WA 3FKJA 2IVIB 3HXLA 4NOTA 3HBZA 2Z16A 4BQOA 1O3TA 3ZXLA 4C30A 2B42B 4D6SA 3QPLA 3KCXA 3OUJA 5FYYA 4GQ7A 3Q8FA 3FZVA 5F04A 3FM5A 4CP0A 4AEDA 4I09A 3VDCA 3PUAA 5BYNA 3KHCA 2GP5A 3VYTB 3BJAA 1PUFA 1CN1A 1XS9A 2KRCA 1PUEE 5J4YA 4S04A 4GFBA 2JRMA 5IVCA 1CAVA 1YFXA 1WA6X 4RR3B 2PJPA 2KDZA 3D1NI 3RJ2X 2GIZA 5A7SA 3C2UA 4HETA 3PSFA 3T4VA 5FPBA 3DPRA 5I93A 2YZ4A 2HWF2 1DHKB 1Y0NA 1A36A 1UY1A 1Y56A 3EXUA 5EGOA 1OH4A 2FNPA 2JDMA 4CCKA 3BZCA 1XC6A 3N05A 3W6KB 4OIRF 3KQ4B 3FX3A 1GMMA 3VKOA 5AONA 2GC3A 4IF4A 5SV8A 3LSJA 1ZZBA 4E8DA 4LQRA 3EMRA 1W8OA 2PAKA 3WOGA 1QXJA 1POV3 2IZWA 1EV7A 2ZXJA 2JDZA 4EWDA 2R5ZB 1IN4A 2MABA 2OJED 2FE3A 1DGLA 3OYWB 3ZFEC 3BDDA 3F72A 2E7TA 4JAAA 4A3DJ 2GA1A 4N9HA 1CD3G 4Y1VA 4UY8I 3OBZA 4XUTA 3HKZA 4PGHA 2VZRA 4CPBA 2PQQA 2IVMA 2VMDA 2Y34A 1PO11 4RYDA 4XZUG 2KMUA 1QRYA 4CRQA 2HVSA 1RUF1 1QA6A 4MTDA 3ZLIA 2B7YA 4NAOA 1GWLA 2EA4A 4IDZA 4UWDA 1QJX2 4BU2A 4LKDA 3GTGJ 2EZLA 4R9CA 5D5XB 2E60A 4RLFA 2C9AA 2DVGA 3N3HA 2DI3A 4HQMA 3HHGA 4Q5SF 3W59A 3NV4A 1DU0A 3OD0A 1WCMJ 1HB4A 5IK8A 2CW7A 5JI9A 4V2GA 5DUIA 2EFOA 2R7VA 2P7CB 2IXLA 3H0OA 5M5YJ 1RUE3 5BXXA 5ACA1 3N9QA 1AYN3 2P6CA 5HCAA 3CLOA 3H36A 1Y8RB 5H6RA 1I27A 3PJQA 3MLLA 2F6CA 1AL21 3K9TA 2H6CA 4K40A 5A7NA 3NSTA 3WQ0A 2ZKNA 5LFAA 4XDOA 2ET7A 1YQ8A 5FZBA 2VKVA 1GQGA 4MEYF 1W36D 1V5EA 5I0SA 2AC1A 3D82A 5FPUA 1NTCA 1PO13 4QKDA 3L2HA 4YVSC 1ZREA 4PJNA 4UW5A 5A33A 2IA2A 2YB7A 1AR83 3WV6A 5D8AB 3LPGA 1W9TA 2FRHA 1G9AA 1MDMA 3FHIB 4HG6B 3N36A 4ZU4A 1OR7C 3BTAA 1OCZH 4JDMA 2Y0SA 4IE6A 2CUJA 4RL7A 3OMYA 2JIJA 2JZYA 4PDWC 3O12A 2WZR2 5A32A 1CIYA 4AC0A 3OYLA 1QJFA 4CUGA 2ELHA 1T98A 2E7AA 1KFXL 3AZYA 1HRI1 2VJIA 3DKXA 1RUE1 1RIRA 1R36A 5F39A 2MYSA 1ETOA 4QT6A 3PJRA 1R5HA 4ZYDA 2C6SA 2XHNA 4HNUA 4PQ9A 3S2WA 4Y7NJ 2EJRA 2BWCA 4EQQA 4ITVA 4M74A 3KEQA 4QPIA 4NUBA 2XSJC 4XURA 3GLLA 1QBJA 4WX9A 1AR92 3TB0A 5L7OA 4LLFA 3FBIB 2L7KA 1BBYA 4I01A 2GC2A 3HPNA 2CS3A 4DZGA 4HV5A 3VBHB 5FZLA 5FPLA 3LSIA 4DZPA 3TOBA 5FZMA 3HQUA 1LULA 3S57A 1YYVA 3VUOA 1H1MA 3H9QA 4IVNA 3VHPA 2PJRB 1MKMA 3HKZN 3GTMJ 1AR81 2GXBA 1HRI2 4D69A 4B8EA 4QGMA 5FMOL 4GO1A 3AVSA 2ZAHA 1JUPA 2STWA 1JE8A 1YQCA 2V4VA 4IE0A 2XPJA 4KWKA 5A2QZ 3J8F3 2QQ9A 1VF9A 1S0IA 2WRAA 3AMPA 1QPMA 4UV9A 2VO5A 2X48A 2HVQA 4XLHA 2DMUA 1Q8PA 1IAWA 5FK7A 5JOWA 4AIJA 3I0TA 2RMU3 2NMNA 1B8IA 5HS9A 1UKRA 1HQWA 3BPZA 5BNNC 3CJIC 3NMBA 2JWTA 4EATA 5FYCA 1R092 3N97A 4E7JA 1OYWA 2CDOA 4J6GA 1W6OB 1USSA 3JAMZ 2K9LA 4A6SA 3HOXJ 1EV12 3WW4A 1S7AA 4G6TB 1ULGA 3RQ4A 1IHMA 3LA2A 1D4VB 4MZUA 4HSLA 1JYNA 4LBOA 1YX5A 3NRVA 2FD8A 2HVRA 3BR6A 5FYUA 5FRMA 2ZGTA 4FFIA 4Y5SA 3LZZA 4AU7A 2QDRA 3U4XA 1RIOH 3UGHA 2R16A 3W9AA 4FOVA 1W6NB 5HDGA 1Z78A 5C3QA 4ASKA 5K5OA 1EPZA 3V7SA 3J8F1 3VKNA 5IAVA 5FKOA 4U88A 3POBA 2WZ8A 1F5TA 1S0GA 4QWNA 1L0OC 4JK1X 1H89C 4XF0A 4LBKA 2YU3A 3LSMA 3APBA 2KISA 6PAXA