4NUBA

Crystal structure of escherichia coli ribosomal oxygenase ycfd
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
372
structure length
361
Chain Sequence
MEYQLTLNWPDFLERHWQKRPVVLKRGFNNFIDPISPDELAGLAMESEVDSRLVSHQDGKWQVSHGPFESYDHLGETNWSLLVQAVNHWHEPTAALMRPFRELPDWRIDDLMISFSVPGGGVGPHLDQYDVFIIQGTGRRRWRVGAALLQVDPFEAIIDEELEPGDILYIPPGFPHEGYALENAMNYSVGFRAPNTRELISGFADYVLQRELGGNYYSDPDVPPRAHPADVLPQEMDKLREMMLELINQPEHFKQWFGEFISQSRHELDIAPPEPPYQPDEIYDALKQGEVLVRLGGLRVLRIGDDVYANGEKIDSPHRPALDALASNIALTAENFGDALEDPSFLAMLAALVNSGYWFFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and Functional Analysis of YcfD, a Novel 2-Oxoglutarate/Fe(2+)-Dependent Oxygenase Involved in Translational Regulation in Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
molecule keywords 50S ribosomal protein L16 arginine hydroxylase
total genus 85
structure length 361
sequence length 372
ec nomenclature ec 1.14.11.47: [50S ribosomal protein L16]-arginine 3-hydroxylase.
pdb deposition date 2013-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08007 Cupin_4 Cupin superfamily protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2510 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4nubA02
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 4nubA01
3ZLIA 4GAZA 5FJHA 4GJZA 5A3WA 4DIQA 5IVEA 5FPUA 3N9QA 4XDPA 4EZ4A 5IW0A 2P5BA 5FZ3A 2WWUA 5A7WB 4CCJA 2W2IA 5FZMA 3U4SA 5A3TA 5ISLA 3KVBA 5FWJA 5FPBA 2XDVA 2YBSA 3KV5A 2YBPA 3LD8A 3PUSA 5FUPA 4QWNA 4E4HA 5FP8A 3N9LA 2YU1A 4QXHA 5FYTA 5FZAA 2XMLA 5F3IA 5IWFA 3N9PA 5FUNA 5FZ7A 5FZ1A 4XDOA 3N9NA 5FYVA 4TN7A 5FZKA 5A1FA 3ZPOA 5FP7A 5FZHA 5FYIA 2YBKA 5FXWA 5E6HA 5FPVA 5A1LA 5K4LA 5FYUA 2Q8EA 5KR7A 4LIVA 3N9OA 4EZHA 5FYCA 5FYYA 5FZIA 3OPTA 5LY1A 4BU2A 4QXCA 3K3NA 3N9MA 5F5AA 5FZ8A 5IVYA 4AAPA 5IVVA 5FY5A 4C8DA 4Y4RA 4CCKA 4URAA 5A7PA 4UF0A 3AL6A 5FZOA 5CEHA 2Q8DA 3OPWA 4BISA 2WWJA 4HONA 2PXJA 3PU8A 5F5CA 5A80A 2YU2A 5A7QA 5A3PA 4D6SA 5A7NA 3KV6A 4LXLA 4CCNA 3PUAA 3DXTA 2GP5A 5FXZA 4Y33A 4D6QA 5FYZA 3NJYA 2VD7A 5FP4A 3K3OA 2OX0A 4AI9A 5FY0A 5FPLA 4GD4A 5F32A 5FYSA 2Q8CA 4QU1A 5ANQA 1VRBA 5FP9A 5FP3A 4GJYA 5LWBA 4QXBA 4IGOA 2OT7A 2OQ7A 5F3EA 5FBJA 2XUEA 5FZ0A 5FXVA 3UYJA 4UF0B 5F39A 5FZ6A 4NUBA 4DO0A 3PURA 5FY8A 3KV9A 4ASKA 5F37A 5IVFA 5A7OA 3PDQA 5FZOB 5FZ4A 5FZCA 3K2OA 4IGPA 2YPDA 5FY1A 5FYHA 5FZGA 5F2SA 5LY2A 5FYBA 5A3NA 4CCLA 5FZ9A 3KV4A 2OQ6A 5A7WA 3U78A 4LITA 3LDBA 5F2WA 5FYMA 2GP3A 4D6RA 4V2WA 3AL5A 5F3CA 4CUGA 3PTRB 5FZBA 5IVJA 5F5IA 5FZDA 4V2VA 5FY7A 5FJKA 2OS2A 5FZEA 5FWEA 4CCOA 2XXZA 3KVAA 5FV3A 5A7SA 3PU3A 4QX7A 5FPAA 5FY9A 4LIUA 3RVHA 4CCMA 3DXUA 5FZFA 5FXXA 5LW9A 3AVRA 4QX8A 4Y3OA 4HOOA 4BXFA 3PUQA 5IVCA 5FZLA 4IGQA 5FY4A 4CSWA 5IVBA 5F3GA 4EYUA 3AVSA
chains in the Genus database with same CATH superfamily
1IS5A 2GWRA 1YOVB 4UFKA 4WM8C 1VQ4I 4Q4W3 5FMOL 4DZGA 3VBOC 1OISA 4NAOA 3NAPA 4XN3A 3HGGA 1ND2B 4BJ0A 3O8GA 3IBMA 2W39A 2A5ZA 2VQLA 4HRIA 3BTXA 2NRAC 4MQVA 3GTPJ 4WXCA 1A78A 3IKVA 3UKTA 3S5QA 1XPWA 3UGGA 2DVGA 5FYYA 1AHSA 1YRNA 3AP7A 2JEMA 5IVVA 1YYNA 2A6HF 4U88A 2PJRB 1POQA 3WNLA 4M0NA 2LP0A 4Y5SA 2EALA 1BI1A 3CCLI 4C2UA 1OC1A 4LMFA 4MYEA 1S0CA 3WNNA 4CXWA 4P9GA 1W6MB 5IY5H 4OINF 4LBLA 1Y9MA 2P0WA 3T8TA 3WQ0A 1JUIA 5D5XB 2DVAA 3CJRB 4GD4A 5F32A 1RUE1 3RTRA 2BGCA 4JTNA 4GWJA 3CCRI 3WQBA 1KYZA 1O8PA 5F0FA 2FDGA 1OHFA 2Q2EB 5TRDA 1XU2A 1V6KA 2A6ZA 3SEPA 4DJAA 3DPLC 2E7QA 4OYUA 3DL3A 4URTA 1XGOA 2BW3B 1JKRC 1ACIA 1ND3A 1QXJA 1LUJB 3TL4X 3I55I 1EV7A 3IDAA 4YM3A 3K4AA 5J37A 2X51A 4MSVA 4W6WA 4UW3A 2NN8A 2X05A 3P9CA 3MGUA 3CP2A 2VZ3A 2PMZA 4GMP3 4UV9A 1COV3 3LSJA 4DNYA 2WS91 4HFSA 5J6XA 2Y75A 2HTSA 2W1WA 5D1IA 1IJWC 4R52A 1SFYA 5DPNA 3CUOA 4FPJA 1UOFA 1FAYA 2XJRA 4EN7B 3IDCB 4YFXF 4PSWA 1HKQA 1KDKA 1QH6A 1ZLJA 3RQ4A 1D0HA 3ML6A 3N9NA 3OOXA 2D3PA 5FZHA 2OBPA 5KHHA 2BBAA 4IV1A 4Q5SF 2O8QA 2IEKA 5D8LB 5LBBA 1KXGA 5KHJA 1NG7A 3OYJA 2D5FA 3RKXA 2LY1A 5F1JA 2DTYA 4XSXF 4QX3A 3TBIA 3GBWA 1CAVA 2MD0A 1H8VA 4IE5A 5BNNA 2BFUL 2FZ1A 4RS5C 2RS32 2Q2EA 3OUJA 1ZG3A 1W36D 2OUMA 4RGUA 4GYIA 2HWVA 3NMBA 2ID4A 4IVNA 4UF0B 2Q0OA 2IP2A 4MQ9F 4CP9B 3OS1A 3CLOA 2XJTA 2LMDA 5FKMA 1R1ZA 3PSFA 4G7HF 1WSUA 4IEZA 5K5OA 2YXSA 3AKQA 4Y1YA 2JDPA 1YWKA 2BPA2 2AH2A 2VTXJ 2VZRA 4N4NB 2D6PA 2W9XA 2W91A 3I64A 2Z3YA 4V2VA 2F4IA 3WGIA 3WLUA 1HRV2 2NS8A 4QM9A 1BQPA 2UYBA 1DP3A 1B8IA 4HPKB 3F22A 4E2QA 1F2NA 3PMEA 1RHI1 3BZ6A 3BCAA 4DUVA 1AOYA 2HH9A 2XGCA 1E3PA 5B1AH 1MR5A 5CVVA 4B43A 1TEIA 1DGRM 2DFFA 4HZFA 3MKWB 2Y64A 3MV01 2K9QA 1PUFB 2E2JJ 2HXOA 4BHCA 4Q5OA 4RGSA 5GM0A 3VZOA 4O65A 4MLOA 1JBCA 3LGRA 1WBLA 4LA3A 5BNNB 2JPCA 3T4HB 1E2XA 1GV9A 1J84A 3LA7A 2LM3A 5DYMA 2VAUA 4CXYA 3ABTA 3PIOF 3QH7A 1XGNA 2G7HA 4PI2A 4MTDA 2JUGA 5BV6A 4XCBA 2QQIA 3LFUA 4ZS2A 3S7IA 3JRDA 5FFOC 5HCAA 1MZEA 5E18F 4ES9A 3H3VK 1S0FA 5IT9Z 1VALA 4A3DJ 4M6YA 1RUC3 4MIMA 5FGMA 5CZKA 4B3XA 2VODA 5L9BA 4RFT0 1QDOA 3CMEI 1JYCA 4QX1A 4BDVB 3H1WA 2V1DA 1Z91A 2WA3A 3DTKA 1RI7A 2O8OA 1S3JA 1WJDA 2XJSA 2RDSA 1BA5A 4N7IA 1DF0A 5E1ZB 1R4MB 1WKYA 4JGYC 2FEZA 2IS4A 5F6LB 2DO7A 3N9QA 4YW4A 5F5QA 2XOMA 2DUPA 5FBZA 4M3BA 1K5JA 3NL1A 4YEJA 2OVUA 1NH3A 2Y6JA 2M7AA 4Q0VA 4FFIA 3BC8A 1BL0A 4JAAA 2DOFA 4UFLA 3DLLF 4LIVA 3CESA 4HX7A 1VBE1 1CD3G 1ZYBA 2FE3A 5F5AA 4CU6A 1PM7A 5DCMB 3JZVA 4HF1A 5KHDA 3PVBB 4R79A 4CUBA 4NHJA 4EGYA 3OSFA 4ZY9A 4D6SA 3ZFFB 3A02A 1YJNI 2ADDA 2DFEA 1NCRC 4RS5B 2J22A 4IEVA 5FPLA 2K85A 2ZXJA 3M3CA 3HOYJ 4I02A 2QUFA 3Q8EA 5J1YA 3R05A 2TRTA 3VD5A 2FMDA 1PUEE 2XUMA 3NO8A 3VHOA 2JJ6A 3PIJA 4BL0B 2DYSH 1ZZCA 1Q8PA 1I27A 2AHQA 4JX6A 1T95A 3KFWX 5JOZA 4ZYDA 4V2WA 4DW6A 1DPUA 4QD2A 4BGDA 1YITI 1QOSA 2JSPA 2BDRA 4A6EA 2GNDA 1B9MA 4KWJA 2FQ4A 1D1BA 2PBIA 4LBOA 1VQ6I 2XB0X 3T30A 2CMPA 2K2SA 5E1RA 5J1RA 4Z1VA 4AVCA 1QA6A 3ZXSA 3V7RA 1POV3 4XFCA 3C1DA 3WQ1A 3WF1A 3HWJA 4UHTA 1ZR2A 4R9AA 1OOPB 3G71I 1GP6A 2LS6A 3KLSA 2Z79A 1VZ0A 2VULA 5JHFA 4JGYA 1VMFA 2QM3A 1IV8A 1G3SA 3TP0A 2F17A 4E4SA 2DFHA 4ZU4A 1V5GA 3GMEA 4KWUA 1GUUA 1GSLA 3MV11 4LXLA 4LB6B 2E5NA 3VDAA 3NJYA 4IESA 1I39A 4HEA2 2EJRA 2X48A 4LJZF 2GC0A 3CQZJ 3HOVJ 4IV1C 3VL8A 2C5DA 2BXYA 1BHGA 2GNTA 4G4FA 1LHVA 3FHAA 4OCTA 3CO2A 3I2DA 3FL7A 2RVCA 4F55A 4NJ4A 4HL0A 5EXOA 5FPAA 3GXOA 3OUHA 4RL7A 4CA0A 4B7KA 2ZA9A 3K1PA 1FOD1 2ZX4A 4CSWA 3MO4A 2ZMKA 3Q5FA 4BS9A 1UELB 1BI3A 5L7OA 4ZTJA 2VVEA 4XDQA 2YY1A 2VUAA 5FLIA 5FQ0A 1STZA 3GHNA 2RS12 5FZ1A 5JVTA 1O4XA 2YV8A 2QKLB 1BR4A 1RIRA 4M9ZA 5HCBA 1EH7A 4Y4RA 1R1A3 4UF0A 2R7TA 4XMAA 2A69F 3OYWA 2ZJ2A 1YEWA 1W5TA 4PDWB 1J9IA 1RMU1 1RHI2 2YPJA 1IUYA 3GDBA 4AWDA 1O57A 2R6QA 2FBEA 1MZ5A 4NOTA 3JBG2 5FP9A 2OW4A 5IJRA 5B4NA 4LKDA 1RHI3 3AXDA 5L9RA 1RUH3 2XLGA 4ATFA 3O2PE 2VLAA 1IW7F 2ZMEB 1VRH1 2VTFA 4XHBA 2BZDA 2G9FA 4BE1A 3KT7A 4JC1A 1WVRA 3U78A 1W8HA 1REEA 1VBB3 3LDBA 1RVF1 3OGJA 3R61A 2OUJA 3N35A 3HHHA 4HMZA 5E8AA 4YVWB 2A61A 1UMQA 1JYXA 1NXMA 5FK7A 4CEYA 3GW2A 3MWMA 1VBB2 4Y5TA 1T6SA 3LAGA 3D5LA 3RZOJ 1Z7LA 1K78A 3CDIA 1ULOA 3I3BA 3SCFA 1XN7A 5IVEA 3U11A 1FMVA 1RUJ2 1MEC2 2D1VA 2Z1DA 3ZOBA 1FMD1 3I56I 1JHJA 4KG0A 1DQ4A 2BXZA 3AZVA 5B2GB 2VOWA 5T5OA 5BNQA 3C7OA 3ZPOA 1ZBA1 2GM4A 2NOGA 5IT3A 2M87A 2QZ8A 3P3NA 3FN9A 3KCYA 3AL6A 3MCZA 3Q9SA 2R7QA 1VAMA 3VSKA 1LR5A 3E97A 2NP0A 1FSHA 3S1QJ 3T0AA 2R7OA 2Y0OA 4WZFA 1KFXL 4DXRA 1YQAA 4NROA 3ELNA 4FE4A 4JOMA 2M5WA 1CF7A 3SZPA 1BC8C 3AMNA 4FOVA 5HXMA 3A0KA 4OOIA 4HNVA 1K4SA 3TEDA 2CSOA 2PAMA 3DTEA 2A70A 5FZDA 3CTAA 1W8ZA 2DWRA 1XD7A 4HXCA 3BTCA 4Q1RA 2BGOA 5J1UA 1U0AA 2Q8OA 1FOKA 4OMDA 5FKBA 4EJRA 1QF3A 4QB2A 4XFGA 2WFF1 1TWHJ 4XICA 3LD8A 3LAPA 1MBJA 1K4TA 1BOBA 1L0OC 1YIOA 3FZVA 4L2NA 3ZSJA 1UOJA 1SHWB 4XDOA 2O14A 1FIPA 2VUJA 5FXWA 5LBFA 3ZN5A 1FV2A 4OI2A 1OCTC 2PMUA 1V9U1 3H50A 3SC7X 4FXGB 5DABA 1EAH1 3OJBA 5LGUA 4B4QA 2YB7A 3H1YA 1WCDJ 1R081 3JD73 3ZVXA 3B6AA 2ILMA 3SFIA 2O03A 3O1OA 1U5YA 1DDNA 2C9KA 2OC6A 3HBLA 2KKOA 3MFKA 4XRSG 5M5WJ 2BWAA 1MIJA 4CDUC 5A7OA 4XQDA 3KM5A 2VJXA 4Y52J 3AYEA 3MKYB 3VSLA 3CUQC 1UY2A 2BBVA 1I50J 2BY0A 4BDZA 4YFZA 1PGL2 4A7YA 3RI9A 1R083 3CNAA 2CAVA 3MQ0A 4XLHA 1V6LA 3DCQA 3KHCA 4FPYA 5F0CA 1YTYA 4CEYC 5CIRA 5DD4A 1IAWA 5DQ0A 5I93A 1PHMA 3WF2A 1LOGA 4KGGA 3UV9A 4PJYA 1MBHA 1EPWA 1FP1D 4IW3A 4R8HA 3H5AA 4A3LJ 2D6MA 1HOMA 4FPFA 4NPMA 1UYZA 5GLWA 3THCA 3WT3A 4LG0B 5CKNA 1H9GA 1ZTRA 3PQKA 4N43C 3AXEA 1U5ZA 2AYHA 1XC5A 3GYDA 1G8XA 1R091 1E5RA 1RUI1 1NUKA 1X36A 5FYIA 3A22A 1JUHA 2JDMA 3AAFA 1POV1 1W5SA 4OQ8A 2VBZA 5DUIA 4LBQA 3ZMTA 3I3DA 2W94A 4P1WA 5A6YA 3DXTA 1O91A 3FUQA 4M3DA 4XXPA 3KP2A 2KLOA 1VQPI 4AI9A 4LMYA 4GIQA 2M45A 2ZHMA 4HW0A 3HTUA 2X5IC 3I58A 2H0BA 4MXWA 2EAKA 1R1VA 3VBOA 3ZX7A 1CPNA 3AG1H 1OYYA 4RD7A 2ADUA 3NJZA 3FXQA 3WGHA 4XKCA 3EQLF 2FCTA 2VZPA 1XNCA 4KH9A 1GZWA 1B59A 2R1BA 2FUG2 1H30A 2OA4A 4DY5A 3NWKA 1BVP1 2J7MA 2NQYA 2UWCA 2DA2A 3GBFA 4HKOA 4PCQA 2QCSB 4QWQA 3FFQA 4U87A 3RJ2X 3J26N 2OZ6A 4Y24A 4GFBA 2R5ZA 1Z0XA 1OFNA 3ZN1A 1RVF3 1CAXA 1QNWA 1W6NB 4W1UA 4GJZA 1QQP1 2ZBKA 3B01A 3ZXLA 2GALA 2VL8A 3N05A 1K45A 4QXHA 2Q1ZB 3S7EA 2QE3A 3BIEA 1UHWA 4BIOA 1PX4A 2EIGA 5CFDB 4B1MA 3G7DA 5FOJB 2Y0SN 2D98A 2AQFA 4MFDA 1OLQA 2JA2A 3S2HJ 1FLIA 4IEWA 4M3FA 5HLHA 4OHZA 3N4MA 2P5LC 2JECA 3JRAA 4IOCF 4XUPA 4AF9A 1LFUP 2E31A 4XRFA 5GAGJ 1RC6A 1LULA 3W9AA 4GQ7A 4XM3A 2MNGA 4LUMA 3OYNA 1Z7S1 2R7RA 1S2KA 2P2KA 3T2OA 2F5FA 5FZ0A 1L7QA 2L9SA 2BGPA 2F5CA 2YX4A 3RIRA 1O3RA 2IW5A 3SDBA 2YPDA 2R5YB 2WB1A 2A75A 4FVVA 4BQWA 2XPWA 3IDEA 3IM0A 2DODA 2JKBA 1OXCA 3WODF 2CGNA 1XSQA 4HG2A 2JDZA 1W9SA 1W6NA 1VQNI 1R1A1 5CISA 5ABJA 2OAZA 4HOOA 2ARXA 2DMPA 1MZ6A 2ERFA 2HWD3 4L8QA 5LGNA 1RUC1 1GT0C 4X6QB 2W85A 3K46A 3AZXA 2W95A 2EICA 1NQJA 3ZYRA 5FZ7A 5KAFC 2JIJA 2OZJA 4RSUA 4UT5A 3WEZA 1JYTA 3WOGA 4BE2A 5FOBB 3FLPA 2C6SA 4XUTA 3I8TA 3WW3A 2VBBA 1QJU2 4IRIA 2ZX3A 1TP4A 2CQQA 1CGPA 3CJIA 1L3LA 1BW5A 1C8NA 3BKZA 2ZEWA 2WS92 4BISA 4XFFA 1G8WA 1ZELA 2VVDA 1WUVA 1AXZA 3JCIA 4H55A 4RB1A 4CYCB 1LCLA 2IT0A 2EZHA 4HLXA 1YS7A 4P14A 2NVUB 1ZG5A 1VB2A 4CP9A 1JXNA 3ZQ7A 5F39A 1OD3A 2K9ZA 3PJYA 1SBFA 4BWOA 2EFWA 3T1MA 2X6YA 1GUIA 2R7FA 3MUZ1 4BY1J 3OD4A 4OULA 1J83A 3IT8A 1MQTC 1R36A 4HNUA 3SEZA 3WV6A 5A6ZA 3ONQA 1GMMA 4P96A 2FBIA 1NCRB 3OTFA 3HM5A 1SQ4A 3WW2A 3DFGA 1Q5OA 1VQ5I 1JOBA 5CU1A 1DU0A 3A03A 4A3CJ 4QQLA 4IJAA 2WWYA 4B1RA 1JKPC 1ZRIA 5FJHA 4P55A 2HOEA 2Y60A 2Q4SA 3L2VA 4XZPA 1KJLA 1SG3A 4FT8A 5DMYA 3WE2A 1AJKA 5IT9K 1VAKA 3ESWB 2QFEA 2D6OX 1NK2P 3FX3A 2E9QA 1I1GA 4AGGA 4CUCA 2OTLI 2ZABA 3A21A 3A01A 3WGGA 3LQCA 4A3MJ 2K4BA 4BQ5A 1FYKA 2VPRA 3WNPA 2ZGTA 1HKSA 2M0MA 4EJWA 4V19K 2ZFUA 1GNYA 1WBFA 1YI2I 1AR81 5ANQA 1VQMI 4GJYA 2COMA 1GU3A 3IZOA 1K6OA 2JDKA 2WWSA 1HKTA 1VE0A 3MEPA 4WCGA 4FASD 4YIFA 4ZDPA 2EQRA 3VZLA 1EH6A 3VBHB 4A3XA 3J80Z 1UZVA 2LBFA 1LGCA 4LK6A 2YPRA 2WZEA 4D8MA 1A3KA 2X53S 3QP5A 3RRDA 4CDWC 3DTIA 4CCOA 3BROA 2CV0A 1UB9A 1JT6A 2NYYA 1XNTA 4BBRJ 2BV6A 4A3BJ 4FCYA 3WDXA 2J5OA 2RNGA 1AR72 4FBFA 2BQPA 3EYYA 4ZZDA 4A6DA 4LJHA 3U75A 3T08A 4EWAA 4FP3A 2HQRA 1NZIA 2JMWA 4GRIA 4RGAA 3N9LA 4UB6C 3T2PA 2F4OB 4JHTA 1EV13 1LKNA 1BBYA 3QACA 2RV8A 3TGNA 4YVWA 1VNDA 1SDDB 4ZC3A 3OOUA 2WRAA 4D5FA 5K4LA 2BY1A 1X19A 3VBUC 1SPPA 4NRPA 1NYWA 1XDSA 1LOCA 3D0SA 4Q2FA 4MVTA 1QNYA 4WZCA 2JXAA 1FOD3 2XQXA 3E3VA 2QEXI 1HB2A 1UY3A 3KEOA 3OF1A 1GFF2 4BQQA 2JG8B 4LG3A 1XNBA 1ZBE2 5FXVA 3S17J 5CJ9A 3BJ6A 4QIWN 3IAPA 2VOOA 4PK4A 1WJ5A 5SV8A 3BR2A 3HNBM 5C8CB 3HQRA 2QQAA 4NRMA 5FYHA 4XMYA 2CGPA 2E1MB 4QDQA 2A6TA 5M3MJ 2ZZJA 3RPQA 2B9VA 4KWKA 4MGKE 2DCTA 4JQFA 4OZOA 3QCWA 1S0EA 4ISRA 1W7PD 1R4NB 1GLHA 4DBQA 1AYM3 1IDZA 5FPZA 5FQ0B 2P5BA 4QU2A 2L54A 3IL2A 3QODA 4FI9A 3IV5A 4NBQA 4XFBA 1YQ8A 3MIDA 1AR93 1QKQA 4TV7A 4CCCA 1ENSA 4COYA 1USSA 5ERLA 2DF7A 3WCRA 1UYPA 3VGIA 4M6VA 1B35B 3CMMA 2CFOA 5A7NA 1UHMA 2Y48A 2B42B 4E8CA 3HEFA 4MUVA 3U10A 1YS6A 1U5TC 2D1HA 2WAEA 1GZ9A 2ZJPF 2DU1A 4B7EA 2M4GA 1J3PA 3PVNA 4KUMA 4KFCA 2WNVA 5DAWA 4PIZA 3LE0A 3PUFA 2A3YA 3K51A 4E2SA 2C24A 5FZOB 2BE5F 2UXXA 4IGPA 4YW3A 2BOIA 1TVGA 1S55A 2DFCA 2Y6LA 4G12A 3TNPB 4HYEA 1O4TA 2B9SA 3BI3A 2NZ9A 3L9FA 2DU0A 1B72B 3TO9A 3DP7A 3VDBA 1R71A 3KZIC 4E27A 3GVAA 4NPLA 1CJPA 2DVDA 3S57A 1KGSA 5C5TA 1WLTA 3F72A 3T0DA 2E7WA 3K4KA 4EWDA 2FU4A 3HG9A 4J01A 2HWF2 4D5CA 3TP3A 5LB6A 1F9NA 5E17F 4EROA 2M34A 1GQGA 3PL0A 1YJLA 5FZMA 3WDUA 1ETWA 2BOLA 2QCOA 3M3EA 3KV5A 5A32A 3WX5A 2VZ1A 3CEWA 2JTVA 3BZKA 2AGSA 5DUKA 2Y0SA 5DG1A 1GV5A 2J1AA 5LK7B 4C1WA 1EUTA 5A70A 2OU2A 3OL4A 5DXDA 3P6BA 1AR82 5C33A 4LBKA 4F93B 2PXJA 1H4HA 4TLGA 1NE4A 4UBHA 4PDWC 2K3FA 3J7HA 5FXZA 1VRH3 3VDCA 2X1EA 4KMFA 4IXAA 1ETVA 3BG6A 2E34A 2R32A 3H1CA 1O5LA 1U8BA 4RS5A 2EILH 1UCRA 4IEQA 5E3MA 4KI5M 2WZPP 1SBEA 1XSXA 1AKHB 1RUE3 1Y8QB 4NB5A 5L9VA 3ZYBA 1YQ5A 4OU0A 1AL23 3H1MA 1MMSA 1M4WA 2XG3A 2HNHA 2K86A 2TNFA 3CO6C 3K4LA 5E8IA 4GYGA 3COAC 1X2MA 5K0UC 1LU2A 1V0AA 2HWC2 1JU3A 1MD0A 2XL9A 4AYUA 3GBGA 3NRVA 4C0BA 5IAVA 2WO7A 3AG3H 5LRSA 4XDPA 3A7QA 4XF9A 2DTWA 1OCOH 9ANTA 3ABZA 4L0PA 2KPMA 3G1MA 1ITYA 4OIRF 1N1TA 2WABA 5CNAA 3VYTB 3NQHA 4ZYHA 2UWAA 3ACGA 4NWVA 3IP4B 4HAMA 4RQPC 4AVSA 2Q8DA 4J1WA 1NXD1 3GJBA 3RZGA 3SEQA 3WW4A 4B4PA 4ZHNA 1TLHB 2GH8A 3H36A 3B7MA 1R9TJ 3F8BA 3RKYA 5EYXA 2DVBA 2VD7A 2D40A 2EIKH 2J1SA 1VBC3 1PO22 3VOEA 3LSHA 1US2A 3TB0A 3ZFFC 3LFKA 4XAAA 3NV3A 1W90A 1PO11 4FFGA 2ZXIA 3RDIA 1T0FC 3G1LA 4P9FA 1SFXA 5EFUA 1ZK8A 1GZCA 2L9LA 2ZB9A 1KFUL 2VN2A 3RVHA 2H1LA 2R16A 4BEHA 2FBKA 2P6CA 3W59A 3CBNA 1Y8RB 2IXHA 3VUOA 4NHYA 4EYUA 2AREA 3HQXA 1H2MA 2RR12 2V6CA 2RHPA 3KYCB 3FHQA 4QAWA 2VKEA 4J1XA 3LFIA 5M5XJ 4CCJA 3SCGA 2DPDA 1UJ8A 3K4MA 1QJY2 5C3RA 5D5WB 5FP8A 4CCDA 5EJZB 5L36A 3H0OA 3G1OA 1US3A 3I59A 3FXOA 3CDZB 3AKZA 3HAGA 5EJCA 4M71A 5FY5A 3EQEA 2ARAA 4FX0A 5KVRA 5H9RA 3UKNA 2XC7A 3K70C 5A3LA 4HONA 2A73B 1SDWA 4N43B 3J8F3 5HLGA 2JG8C 4AI3A 1IUFA 3J7AY 5C44J 3NKGA 5AC92 1DZQA 1EF4A 3K75B 4E7LA 1UIKA 2MFZA 2PLV2 1XNKA 4C0HA 4EATA 5E79C 4PZJA 4MHUA 1N75A 3A0BC 3OGGA 1GVJA 1YFUA 1IPKA 2KD7A 1MNDA 2K4JA 4CP2A 5EG0B 1W4MA 3WP5A 1R1UA 1G3YA 1O5UA 1QQP2 3G2BA 3KX2A 2ZPXA 4ONUA 5J36A 3W2AA 2KR2A 3AYCA 4E6KG 4LHSA 2ZXHA 2GBYA 4LEJA 1WLCA 5JDBA 4KN7X 4B4CA 1E0EA 1AR73 4D7TA 1HSJA 3K4ZA 1SVOA 1DYKA 2G9GA 4A0XA 1QZYA 3I59B 3AJZA 3NWSA 5FLXK 4BXSV 1BM9A 4H4KC 2HQNA 4EN9B 3B69A 2LKXA 2YFZA 3QU3A 4Q4W2 2VC9A 3T5XA 4LLLA 1T6BX 2ZSHB 1U12A 1X50A 2E33A 4XK4A 3IMNA 2HXIA 1W39A 1EH8A 4EM2A 2K9MA 2VM9A 2MGQA 2MYSA 1MVEA 3PVOA 3PQJA 2D43A 4XBQA 4UVBA 5CKQA 2LALA 4OHXA 3KMHA 4LKEA 4CTEA 4YZ2A 4A12A 4R4XA 1W8UA 1HJFA 5L3EA 2UY9A 1UWWA 5FP4A 1W6QA 3QH6A 1IC8A 3UJOA 3EMRA 1K79A 1OH4A 2EXKA 4NIIA 1AJOA 3C2UA 1ORKA 2Y69H 5BXXA 4NC6A 1PGW2 1MS4A 4Y13A 4DGWB 1POV0 1N1VA 2BJSA 2ZEZA 1J1TA 3ELKA 2FMYA 1QHDA 2YU3A 2ZJQF 1C5HA 4B3AA 4JDOA 4PLMA 1OR7A 1UIJA 2QTWB 1F1ZA 1UU6A 2HEOA 2B9UA 5A3UA 1VBC1 1AR92 1CAXB 5HXVA 1IHMA 1ZNPA 4FOYA 4I09A 2VI6A 2E51A 3VKLA 1C5IA 1L7LA 1J59A 1X9PA 1ST8A 1FWZA 3H42B 3ZFFA 3MHZA 3M3OA 4W8JA 5BNPC 4PGGA 1R22A 1QGPA 1USTA 5C4WA 3LSIA 1DGWA 3FXUA 1IS3A 2V9VA 4C3JJ 4HK8A 4GZ9A 2XROA 1JHNA 4YG6A 4GCVA 2RM22 2HEYF 3WP3A 1AYN3 2H09A 2DCKA 2JDUA 3ZYHA 1KRIA 1UU5A 2DBBA 3BPXA 2JN6A 4PF5A 2W47A 3NAUA 2ZNYA 5FYSA 1LNWA 1WMXA 3DN7A 5JXHA 5AVAA 3ECOA 3CCMI 4X8PA 3WCSA 1IXCA 4XE9A 1QXRA 4K3UA 3LPGA 1XXNA 3VBSC 4KU7A 4BIFA 2LREA 1XTAA 3GZ5A 4BE0A 2OD5A 2VXJA 4GH4A 1ZGWA 3M3YJ 2VCAA 2IA0A 3G6EI 4B48A 2E53A 4OWRB 5FZ9A 1ACCA 5TSWA 2ZAHA 3B00A 1KQ9A 1QGLA 2MEV2 2EA4A 4CZSA 3CJIC 4L9BA 2Z5WA 4LO5B 5GPCA 3BJOA 2WB1N 4LD5A 4IHXA 1HX6A 1PZ9A 4AR2A 5I0SA 4XOTA 1MJAA 3PJRA 2HEWF 1FX5A 3MZ8A 1RUD1 3K48A 1UQXA 1PVC3 2LKPA 3IC7A 4ENNA 4GB32 3CC4I 3OGSA 5D2AA 5FUPA 1T0FA 3HC7A 2LTPA 2LYCA 3L2QA 4CXXA 1XNDA 1PIV3 2ORXA 4BACA 4FPEA 4A0ZA 1DBNA 2CU5A 2JX9A 4JCKA 1K83J 5AFEA 3OPTA 4DXSA 4AVZA 4BB3A 2EFOA 2UZKA 1CAWB 3SZGA 3SNMA 5A3MA 1S2EA 2O0YA 2ACJA 4EM1A 4MV2A 1PM4A 2IRFG 3PO2J 3ZM8A 1ODDA 1NCQA 5FY0A 1V4RA 3ZN6B 2GC1A 5D6EA 3DEWA 1Z9CA 3J8F1 2KRCA 4RFRB 2Y0IA 2CG4A 1ZHFA 3FE5A 3OS0A 3J9SA 3KGZA 3OIPA 1AA7A 1PGL1 3QWLA 3NRUA 2VE9A 2UURA 1RUJ1 2ZKZA 2RS31 3CMGA 4GO1A 1HXS1 2CSGA 1TNFA 5CBLA 3I2OA 3BPSA 1K42A 4CUAA 2W87A 2A3SA 3ZXFA 2VPLA 3VBSA 4CZCA 4IKFA 2TCTA 2WN3A 3K4JA 2JA5J 4DUXA 5F27A 5IP7J 3L2RA 2XVLA 1ND2A 3L09A 4XQ4A 1JT0A 2DAOA 4EGZA 4GAZA 4UNOA 1N78A 1ETYA 1I1EA 1MQTA 4PJJA 2W92A 1W3XA 4OHYA 4RMNA 3JSPA 2D93A 4TN7A 4ZZ5A 4LOTA 3ALQA 1D8KA 3D5OA 1W2OA 1B35C 4ZDLA 2O61A 2W82A 1OOPC 2WY7Q 3ISPA 3BUCA 4DZJA 1XDUA 5J4VA 1BJZA 1QPMA 1WA4A 3ZXKA 4GMP1 5K9YA 3BLYA 3JBG3 2GIZA 1TMF3 4YRVA 5KC6A 4DB5A 5IPAA 4AHWA 2ZEYA 1H1AA 1PGSA 1Y43B 5I0UA 3D82A 1PIV1 1RUI3 3GLLA 3W2WA 4YGEA 2LBFB 5IYDJ 5DDGA 5BNPA 1DDLA 2F5EA 3E5UA 3GCXA 2V73A 3LIGA 5A7SA 3PU3A 1GNZA 3WU2C 2PQQA 1X3ZB 3LWCA 4AVPA 3HOSA 4HA8A 2D5HA 4JKMA 4WVZA 2KIFA 3BWGA 3S3OA 4K1ZA 4QKFA 3LOCA 2DDAA 3POIA 4CRQA 1LDKB 3TNQA 1DQ2A 2NVXJ 3GX4X 4HKWA 2COBA 3HUGB 1R58A 3HKZA 3S3NA 5A3WA 1TQIA 4HX8A 3E5QA 4CEYB 4QPYA 1YI7A 5ISLA 2BBYA 5EJ1B 4IOAF 3BR6A 4AQ6A 3RWNA 5JR7B 2DI3A 3KF5A 1QIQA 1R5GA 4L11A 4CE8A 3W5NA 1FYMA 1PK6B 4URAA 5FLXZ 2XPUA 3RKWA 5BPDA 1HRV3 1K6YA 1ENXA 3DYPA 4E9KA 5F5CA 2F5DA 2KIQA 2HLEA 3SKJE 5DS9A 4D1QA 4N53A 4KISA 3ABUA 1W0NA 3A4CA 1Z0HA 2F2EA 2CRGA 4OIOF 2VOXA 3H8RA 5AVPA 2BRTA 5GLVA 3CC2I 1CVNA 3BU0A 1VQLI 3GTLJ 2IWGB 1ZLKA 1SCSA 4DINB 3UKGA 2LSOA 4JBAA 1REFA 5ICCA 1HRI1 2ZX0A 5IK7A 2YR2A 4R9BA 2KM2A 3ZQHA 3BTYA 1QJFA 4PQ9A 1GLNA 2XPJA 3GFLA 5F2WA 4G7ZF 2GP3A 3ZIWA 2XJVA 2CFXA 2ORZA 3OG2A 4WBBA 4YG2F 4JDNA 1QQP3 3HOWJ 1CZVA 1PUFA 1RL3A 1WHUA 4LFUA 1JMUB 3A4UA 1Y3TA 1BR2A 2W68A 2IXJA 2HWB3 1O3SA 1ALYA 1X1CA 3B94A 1XB4A 2W2IA 4BLIA 5A3TA 1YW8A 2W0XA 1RUC2 4DRVA 5F3IA 5L3CA 5ICEA 4MH0E 1KONA 4GWNA 3GZTB 3VKOA 2YBKA 1BI2A 3KT4A 5J1XA 3ZO0B 1LHUA 1DLCA 1QPIA 2XH6A 3JD72 5FKKA 1ETXA 2R92J 2EK5A 1CAUB 3VFZA 2Z16A 1U8RA 4CU7A 4N9IA 2PJPA 4XFHA 3OWTA 3H3ZA 1X3WB 2K9LA 5CQGA 3WTXC 1MKMA 4LGWA 1YFHA 2JE9A 1CIWA 2JDNA 4F92B 1JZ5A 1PO13 4JX0A 2M8EA 1IG3A 2P17A 5LHGA 3L2WA 3RZMA 1ULPA 4CU9A 1IGNA 3PO3J 4ASLA 1GWMA 5LBCA 3CJTB 2WNUA 3ZGKA 3CJNA 4ENMA 1H8AC 3HRMA 3HJEA 2XJPA 2JUCA 3IRQA 5EIYB 4AIKA 1Q56A 2R041 3RZZA 1S8NA 2KJCA 4IDZA 3KP4A 2ZGNA 5F7UA 2ZS6B 5BYNA 1HKDA 2E32A 4RS8A 3JRBA 2ARCA 4XBFA 2CTVA 3VZMA 4EE2A 5DDJ2 4Z92B 2ZMEA 3KYDB 3MPPG 5DAPA 5GZDA 5J8CA 3VBUA 1RUH1 1XMXA 2GN7A 2OUHA 3ZXGA 1SMTA 1SEUA 1OPMA 4EZ4A 4JK1X 5A7WB 2H27A 4ZDOA 3JB8A 2JZYA 2PYTA 4IUGA 3M8LA 1LECA 1OJLA 1GOHA 5IK4A 1AU7A 1XSVA 1LE8B 1W9FA 4Q8KA 4IEOA 1VQ8I 1AR63 5J96B 1WJAA 3AMMA 3CCUI 3OYHA 4IETA 1SFUA 4AAPA 5CG8A 1FP2A 5CKTA 2QQOA 2J42A 3SXWA 2EIDA 1J3RA 1FYLA 5FD6A 2ENRA 1UW8A 4XRSA 4V2GA 1CF7B 4F7ZA 2CO5A 2VNGA 3WNMA 1F4AA 3KV6A 1KJRA 3AFHA 2VQ0A 4CEWC 2ZMNA 3F23A 2CAUA 3R0RA 1WI9A 4GXLA 4HLTA 1MQTB 4BMEA 1G6NA 2WSUA 4D0QA 2RMU2 4XOGA 5L3BA 3MW2A 1GOFA 2WYSA 1DQ5A 3NV2A 1JYNA 4E70A 1RJ7A 2RNJA 4QMAA 5K0UB 2RM21 2BW8A 4ZONA 4XTMA 1OKRA 2JVGA 1DQ0A 3LB9A 1UYYA 4RAGA 5HLTA 4IE7A 3M70A 5BY5A 2LNBA 1KQRA 2WO2A 1Z6TA 1W6QB 4MXWB 3HTSB 2RGVA 3DECA 1V9U3 3MICA 5A1AA 2MEV3 4C9YA 1B8IB 3MMYB 2FXAA 3M8JA 2EBIA 3I7DA 4ZKTB 1Z77A 3U4XA 2WNUB 4HKLA 1XQNA 3H5NA 5IVCA 1IN8A 3IKTA 2YROA 2Y9ZA 2MPFA 4O9GA 4W6YA 1TT5B 1FNZA 1SLLA 4JV4A 3IN9A 1W04A 2W7NA 4AEKA 4F8AA 1MACA 1V6IA 2VXDA 3J81K 1E5SA 2WKKA 4B1LA 4BY7J 3AZZA 1OKQA 4IV3A 1BMV2 3KYLA 4PLNA 4H0EA 2C6YA 3ZPYA 1OLMA 4OUMA 1I9RA 2KJBA 1AR83 2ETHA 4SBVA 3M1CA 1H1MA 5CYYA 3N7MA 4Q29A 5T55A 1PGW1 2LFBA 3E6BA 4NC7A 2CGOA 2G4IA 3VZJA 4CP1A 5EYYA 3NSTA 3HYIA 3IH4A 3Q8FA 3MF9A 5A7QA 1AL22 3EYIA 5I8SA 3R60A 3VKNA 3NNFA 5E16A 2FQ3A 3POBA 5IATA 5AIPA 2K02A 4BQ4A 2G1MA 5CVJA 2VW0A 2XUEA 5FBJA 3KZ4C 5CVRA 4M00A 2Y30A 2WNEA 4O7XA 4AM3A 3T1LA 2W84A 5CFCA 1V6JA 3MW3A 1A8DA 3VPRA 1GV2A 4ISQA 2XF6A 4P9JA 5LK5A 4IHTA 5LCWL 1OQ1A 2DPUA 2VU9A 2EXHA 2W1SA 1VBD2 4JRAA 2FF4A 3AK0A 4DRRA 1N3PA 4EQVA 2VQUA 4PIYA 3AL5A 3BTZA 3AYAA 5FZBA 1TME2 1ZM1A 1IPJA 3W6KB 4XUNA 2OF7A 3MF6A 3KEQA 1AX1A 3URFA 4CPBD 1RUF1 4MGQA 2D45A 4IQ4A 4KU8A 3CJIB 4JQRA 4P02B 1Y4WA 4NWWA 3JRHA 3JREA 5JPNB 3V65A 5GLUA 3OIQA 2P5VA 3FK7A 3H8XA 3P9IA 4S2DA 4XUQA 2R0HA 3TDUC 5BMZA 2VECA 3OBRA 4QWNA 2YUEA 2R7UA 3OY8A 1AYN1 1VPHA 5C8CA 1HQWA 3I9V2 3OBZA 2HWB1 4QPIC 3TDZC 2HWE2 3REOA 4ZZLA 1LJ9A 4W6XA 5JR3A 2IS2A 1B4AA 2BV4A 3FUOA 2M8GX 2ZACA 1W0TA 5FMDA 4MOAA 2CQXA 3Q8BA 2W46A 4K20A 3F21A 1I3HA 4Q0SA 3FJSA 3TW7A 4ZYEA 2ZHLA 1EJ9A 2NVTJ 1UO9A 3IPVA 5LGTA 1BJAA 1N1YA 3MD2A 2QKMB 4XLPF 2DA7A 2VE8A 1SLBA 4PDKA 4UVCA 4BH9A 4RN5A 1XYNA 3BALA 3BDDA 5CAZA 3CZUA 4HANA 1CIYA 2OQ6A 2EV0A 2VMHA 2XVKA 4QT6A 1XJAA 3GTGJ 3ZFGA 1MMNA 3ZIXA 3THPA 3LOIA 1YLLA 4IEPA 2D3SA 4HSTA 2FDKA 3ON7A 2HPIA 3M1EA 2CV6A 3SDGA 1NY71 1YIJI 3J7NA 5I91A 4IHVA 3ROUA 4A7ZA 3ASNH 2MLGA 5TGTA 2DXIA 3N7JA 1QJY3 2K40A 1IRXA 2IS6A 2VJJA 3IAM2 1RINA 3B9IA 1FY7A 4HOBA 2V5YA 1KA8A 4P9YA 1G9AA 1W7PA 1HXS2 4RBOA 2HDCA 5AC93 3G3ZA 3IWZA 1ASJ1 1C8M1 1JGGA 1ONAA 5FYUA 3H7JA 1V6OA 3N9OA 1Z3YA 2VT3A 2WAFA 2XAQA 3BTLA 2EH3A 5H6QA 4XYXA 3K2AA 2J1TA 4PJLA 1YJKA 5T50A 4YGDA 4C91A 1UZZA 1MSEC 3ZMOA 5B3SH 2PHDA 2XSDC 4WWCA 2LD5A 2XF5A 3MW4A 3VL9A 1X1AA 1YC61 3I2GA 2YSRA 3LFMA 2Y6HA 2OPTA 2OCEA 5F64A 1B09A 2JWPA 3CUQB 3H5RA 3ZFGB 1BYHA 1UXXX 3ASOH 1MVQA 3KV4A 3BP8A 4I01A 2Y38A 1W8OA 4FE7A 2V7FA 4JHZA 2TEPA 4LITA 2WUHA 4YM1A 1LHOA 4XLAA 1N3OA 3TQNA 4JGZB 5FY9A 1IOAA 3DXUA 4Y20B 2EINH 4GB31 5FKCA 1WJCA 4BXFA 3FXJA 1S0BA 1TW2A 3USUB 4D7YA 2XVGA 1QQIA 2P3YA 4BQOA 4R1HA 3A2KA 2P1BA 3IDBB 1V54H 3SZTA 1TT0A 5IAXA 3BG3A 3EUAA 2PN6A 3K4CA 3N9PA 1OR7C 4B29A 1LENA 4ASMB 3PUBA 4HSLA 4Q4X1 4LK0F 1AWCA 2MG4A 2YX7A 1RITA 2XRLA 2CW8A 3OYCA 1G9BA 3ZYIB 2VMGA 1RKTA 1VQ7I 4Y22A 4YARA 3OYKA 2IGOA 3TEYA 4H7LA 5LASA 5GKAC 1KU2A 2BVMA 3WDVA 4LHLA 3X29B 2HWD1 3VB2A 4U7BA 3AC0A 5E3OA 3H9QA 4L9NA 1NHAA 3IMMA 4JGZC 4IQJA 2AACA 4DQ2A 1F15A 3F95A 2K7LA 1RUH2 4IE4A 3MZHA 5JAXA 2JDHA 3GHMA 2I45A 1AUYA 1VAVA 3M7GA 2RC4A 3O8HA 1C4RA 3K2OA 5DDJ1 2VONA 4YM0A 4FTBA 5H20A 3SQNA 3GM8A 3WHBA 5F04A 3T2QA 4CDQB 3RJRA 2VTXA 2WS93 4MXVA 1IN6A 3ULQB 4GXOA 2R042 2VUMJ 4XIOA 2HBUA 1O4ZA 2R073 3H3LA 1OQDA 2O9LA 4RQPA 4L5EA 5JIUA 3K4DA 2WJSA 5KC5A 2DLLA 5HS9A 1IRZA 4Q27A 4AD9A 2XLFA 4RHV1 3FHIB 3ZMNA 2W57A 5CKMA 3FISA 1VR3A 2ZAAA 4C3IJ 1W9WA 1R5HA 3LF7A 1QU3A 1NA1C 2GOXB 2QJVA 3WHUA 2YU1A 1WI3A 3CP8A 5ILUA 3VHRA 3I71A 3O1SA 2CQNA 1YQCA 5ILVA 1MS5A 3EDPA 1H2NA 1Y6IA 1WCKA 1H2KA 2EFPA 4QPGC 5JHUA 3T3YA 1W99A 2OPKA 4RAYA 5FB2A 2GN3A 4BOWA 2RMU3 3RYKA 2RS53 5EV7A 1YIPA 4N0BA 2XAJA 4BA6A 5KXBA 1Y0NA 4G6DA 3VBRA 5LA2A 3VLBB 3LEMA 1O3TA 1XC6A 2WADA 1GVDA 3C7EA 2FOWA 1STMA 1E3OC 4QPIA 3LSRA 5HLIA 2ZXQA 4ESFA 3ZN4A 2G9ZA 4KBBA 2BTVC 3ZR6A 3NWTA 1KEXA 1NK3P 3I4PA 1A04A 4PCRA 1IN7A 4XACA 4LKSA 2ZGRA 5HV4A 3ABLH 3HXLA 2R5ZB 1APNA 2M2EA 1OI6A 1S0DA 5IYYA 3CZ6A 3W6JB 4LTAA 4OQ9A 1A31A 1WCUA 3ZSEA 1U9OA 3D8CA 2NS0A 1DQ6A 1JN2P 3R4UA 4NRQA 3V8KA 5DTDA 1AKHA 3QYEA 3VYSB 4DIQA 3CZJA 1MS9A 2BNNA 1Y39A 3ZR8X 2QQBA 3KCCA 2VVFA 4MGRA 3NEUA 3SXYA 1PVEA 1BKZA 4QGMA 1D1AA 2DK5A 2WNUC 2PEXA 1IF1A 1S7OA 2V1NA 5FREA 5L3FA 2XPVA 1T33A 2JG9B 2HTJA 4PHZA 1V6NA 1MDMA 2R7DA 1BIAA 3IUOA 1LVAA 1UX7A 4Q4W1 2HWD2 3TO6A 4PJMA 5JI6A 4DXTA 4RGGA 5FO8B 5FKNA 3V7CA 1HDKA 3OBAA 3HMYA 4ZZ8A 1TBXA 3CMYA 5FZGA 3S5AA 4QQ2A 2IXKA 3VBRB 2KIMA 3TN92 3WY6A 2DA4A 5IT6A 4QXKA 3PL8A 2DFBA 3M4OJ 4Y1VA 4AU7A 2Q30A 3NAPC 1U3EM 1D4M1 1EA3A 1R64A 1NG0A 2VMDA 1TME3 1IRGA 5FXXA 3FLTA 4Y15A 4Y3OA 4META 4GGGA 4D94A 3V0BB 3GALA 3AFGA 1LEAA 1O8SA 3CIHA 3OMYA 3VD7A 1M1EB 4I0WB 3VYRB 3DF0A 1K78B 3ZCOA 2LY2A 3SITA 4XORA 1HCRA 1RXFA 2HZDA 4XJ8A 2IPQX 1G2HA 1D0YA 3QAHA 1A6QA 5LD2C 2CNAA 2H1KA 1UG2A 5FYVA 1JZ7A 2KZVA 2FCUA 1PYVA 1PMHX 2P4EA 1WGXA 5EDNA 1PNGA 1DUXC 2OQRA 3OGVA 3OOPA 5FZ8A 1UOGA 3P3PA 1X82A 1NX9A 2HYJA 4HVQA 1YJWI 3KB5A 3RMYA 3WQ7A 1DG6A 1PO23 4M72A 3PUAA 2RQPA 2VMEA 2ZHNA 1DCSA 2ICWG 2UXNA 3K3OA 3U1KA 1RUF3 1LEMA 4RYDA 4LA2A 5GZFA 1OMIA 4RA0A 4AIJA 1DU3D 4LOSA 1WW7A 3PURA 1NLRA 3SFZA 2WFPA 2RR11 3DUIA 3SMHA 5BNOC 4WVWA 4HN0A 2M1BA 4FSJA 5ACA1 1OA2A 4HG6B 3USSA 3ZQQA 4KNCA 4Q4X3 1LGBA 2MHFA 2GA2A 2BY3A 2JIGA 4JRLA 4F3QA 4HETA 1OCRH 5DZEA 1MZFA 4N8MA 4XXAA 2RDNA 1S7EA 5I8TA 3PLQA 3RYRA 4AFMA 2HBTA 4E2GA 3J8F2 2B45X 3TOBA 4AE2A 2YC2A 2ESNA 3W21A 3WTYC 3OL3A 2VKDA 2ES3A 3O0XA 2ELKA 2PFWA 5C3OA 4QQHA 3VBUB 3RFRA 5JZGB 5ERIA 2R7XA 5I8YA 3D3AA 3R0JA 2WAQA 4ARYA 2Y6KA 1GNHA 3OSGA 4AW7A 3VV1A 3DXJF 5JI7A 4M4RA 3RI8A 3KD4A 3I2JA 5D4RA 3S6PA 2BVBA 5EZHA 2YUSA 3KIOA 4LB5A 3RS6A 2PMHA 2ZTNA 4M3CF 2QBYA 5A6XA 1UZWA 2KRFA 2JA7J 3OYWB 4UB8C 4FPCA 1HQNA 3WG4A 5J7MA 3JUUA 4XETA 3U07A 5F8PA 5FRAA 3QOPA 2NNYA 2BFUS 5LWBA 2Z42A 1JYIA 1UL9A 3UYJA 2D3RA 1J2XA 3Q9OA 5HBAA 5BPIA 1R093 2B7YA 2QQJA 2BHZA 1NG6A 1Y9GA 2W3JA 3LEIA 2VCBA 4AYBA 3CF6E 2HWB2 2K9NA 4JVAA 1I3AA 3HVDA 3C7FA 1GXQA 2VXRA 4Z07A 5FFZA 4KT6A 4AGRA 1RTVA 4FCAA 2RJLA 1QH7A 4QHBA 2XWJB 1K61A 4CGZA 2ECBA 2I2SA 4V1PA 2ISYA 4N4OB 2FDHA 3LSTA 1PP8F 5IK5A 4GDFA 3PMSA 4BXUA 1TME1 1F5JA 5AFBA 3FBMA 2IUWA 4S04A 3PUSA 2CW0F 1VBD1 3WNOA 2IXLA 1H8TA 1K7AA 1S1AA 3IIAA 4QDSA 2GXGA 2STWA 1SAUA 4Y17A 4XF3A 3ZDVA 4C2MJ 1R23A 3D1NI 4C2TA 3T0YA 2J1RA 1X1PA 3WF3A 5FYCA 2JJ7A 4MNUA 3M8EA 4RR3C 2JB4A 3S15J 5A7PA 1TNTA 1LNSA 3F2ZA 2LK2A 3ETPA 4IHWA 3RNSA 3DV8A 2YC4A 2WIIB 4MGZE 2W00A 5C3PA 2QDNA 2OX0A 4D7SA 1XMKA 2Q8CA 4Z2AA 2IVJA 3ZMSA 2G7UA 1GP5A 3BTJA 3S2WA 5BNOA 4U0VA 3QPHA 2KIUA 1W05A 1BXHA 1VBC2 4FETA 3TYJA 5ICGA 3G4SI 2HPMA 4IHYA 1O3QA 5J09A 5A7WA 3I3MA 2V9KA 1GWLA 2YYOA 3FXKA 5IVJA 1W8WA 1NE6A 3Q8AA 2XF7A 2RM23 4FP2A 3ZFEA 4UFJA 2CV1A 4NIGA 2OPWA 2X6WA 2OKXA 2IVIB 1LOAA 1F4KA 1QJEA 3ZYFA 3H9AA 3RWKX 3WINE 1YX5A 2H0VA 5CYVA 4HLYA 3FXLA 1A5JA 2L9RA 3S3MA 3BODA 3HBZA 1UKRA 2QBXA 5CVUA 2R0FA 1GDTA 1L7RA 5EEAA 3SH3A 3LEKA 2WA0A 4RGKA 1LE8A 4AEDB 4EZHA 3A0NA 4N43A 3I0TA 1WA6X 5DAXA 1QO0D 2D5VA 4FPGA 4AIDA 1PZ8A 5FRMA 5L73A 1KS5A 5EEHA 2AS5F 2V5DA 4LLNA 4FOQA 2ADEA 2RR13 2DT6A 2RKHA 4YYOA 1VQ9I 2LVSA 5FLVA 2CQ7A 1E3HA 4XLEA 2L7ZA 3ST7A 5A2QK 2Y2ZA 3R6SA 2Y33A 1OQYA 3D5RC 2MBFA 1OLRA 2OCCH 3EUHA 1GWKA 2UY8A 2V4JC 1ZZBA 3TRSB 1J0RA 2MA3A 3BJAA 5LY2A 1JZ8A 4GKXA 4C1XA 5FO5A 2Y6FA 5F3CA 1LEBA 4DOUA 1C57A 2GMPA 1ZRCA 1V3FA 2DN0A 2MH9A 5J40A 4BQNA 5KK1A 1HB4A 2WFF3 5HCFA 2R062 1ND2C 1UHSA 1REDA 1LFBA 4PFOA 3UGFA 5A33B 1GYKA 4Q26A 1VMJA 4N53C 4MEYF 2HKOA 4IV1B 1CX1A 2V4AA 4LBNA 2DDUA 4FX4A 2V1UA 4FHTA 4LORA 2A6WA 1LVKA 3CLQA 2KDOA 1PMJX 1A6CA 4BUPA 3LL7A 1IRFA 1YW9A 3KP3A 4LT5A 4IV3B 1YG2A 4KNYA 2EZKA 3AL0C 1AXYA 1S0JA 2GLOA 1TNSA 1JS9A 4QHZA 3O1PA 3POJA 4U2AA 4OMZA 4WM7B 1ND3B 1ZGJA 4ZYGA 1EV12 1VP6A 2XBO1 3FM5A 1NY72 3KF3A 2EB7A 4R9CA 2EWNA 2HOAA 4GALA 3P1IA 1ZZ7A 5FZ6A 4HVOA 1XS9A 3M07A 5FR3A 2P7CB 1CAVB 2M0CA 2DMQA 1AL0G 3E5XA 3S93A 4BBSJ 2L0KA 2DA6A 3PJQA 5TISC 1YXWA 2ID3A 3CF5F 2XIGA 3ZYPA 4PJ0C 2LF7A 3KP7A 1POGA 1RPWA 5G04L 2CJJA 1Q8OA 2HWE3 1TL8A 3ZP5A 2W52A 5BNPB 1ON1A 3DLAA 3WU1B 1BLZA 4Q0UA 4XR6A 2ZX2A 4II2A 5DAVA 4BQYA 4OUSA 3ZOIA 2RN7A 1KS4A 2B5HA 4XC9A 3U4SA 5EQUA 2DU9A 4FQ4A 1JH5A 1HRI3 2IXIA 1R6RA 2C9AA 4ES8A 1MGTA 2B4KA 5LHHA 4IRGA 2P4WA 2B46X 2W48A 3PM1A 1RUD3 1WW5A 3O1UA 4EWEA 1IPSA 4DPNA 4L9TA 2DYRH 1S6LA 3APBA 2Z33A 1UXZA 4C30A 3E6CC 5DN2A 3EHKA 2BOJA 1MZBA 2ZXWH 2WO3A 5JXGA 1IGOA 2VB6A 3MKLA 5LEJA 3OYDA 2UU8A 1A36A 1BBT3 2R7EB 3IAQA 2JRMA 2STTA 4JQTA 1ZR4A 4TXWA 3LNQA 4YZ3A 1NKGA 1YI9A 4M6XA 2DYCA 1TE1B 4AFCA 4QDRA 2VQGA 4J19A 5JOWA 4E7KA 3QRFF 2FA5A 1YW7A 3UL2A 5AC91 1FATA 2HOSA 4KG8A 2O8XA 2CUEA 3BOPA 1F4HA 2ET7A 1XGSA 4PBPA 1ZBA2 4F91B 1F9KA 2W1OA 1VLNA 5K5QA 1RRJA 1LOBA 5C4WB 2PHWA 4P9XA 1XYPA 4XJWA 4XLFA 4CYCA 1D5VA 1A8MA 5JI9A 2EIBA 1LQ1A 1ZKGA 2UUZA 3E0JB 4UUVA 3UK9A 5IW0A 4E4DX 4HPQA 2PLV3 2ZMLA 3DEMA 2VC0A 1YIFA 2D6NA 1NA1B 3GFIA 2Y34A 2GOMA 1IXRC 3ATGA 1Y1WJ 4BZ4A 4A5NA 3PUHA 1RVF2 2WZR1 4KN4X 1QOOA 4NO4A 5HI0A 4KWLA 3RG0A 1BMV1 1YJ9I 3POYA 1PIV2 3QU6A 4OAZA 3OEBA 4NPRA 5JLVA 4AFAA 4R4ZA 4KBZA 4CZZA 1YUDA 3LSDA 3JQXA 1Z1DA 1OA3A 5FRNA 3GCWA 1WJBA 2HVRA 2GP5A 1U6GA 4DZPA 1FEXA 1FV3A 1XPXA 4PGHA 3HQUA 4EEFG 1KGYA 2PLYA 1BCXA 4X1EA 2XWBB 4RR3B 4EVIA 3OEAA 3Q0WA 2OTJI 3HZJA 2VE1A 2YDEA 1J3QA 1SVLA 3SLIA 3JRCA 3KP5A 2IC1A 2EZIA 2A6XA 4UUSA 4CA9A 3NNGA 4XVHA 2IA2A 2WNOA 4E7ZA 2WC2A 3F8FA 1F31A 3DU5A 2R061 5FJKA 4EJVA 2FBHA 1SLCA 2P37A 1S72I 3RGBA 2XBO2 3D6EA 1W36C 3S32A 5FK8A 5LHIA 2BVLA 3I97A 1ODNA 2ME0A 1DGWX 1TC3C 5HDNA 2VZQA 1ULCA 3BYWA 1QVUA 4Z8BA 3W5MA 3V64A 1HN0A 4Y1ZA 5KAIC 2GSYA 3HN1A 4M9SA 4UBGA 2EV5A 5FKLA 2BVVA 2XDVA 4XTPA 3NNJA 5FYTA 2YG0A 3VDXA 4CXFA 2F6CA 3ORJA 5CFCC 1LFPA 2DOAA 3VBFC 4Q4Y2 3RMXA 1SFOJ 2J1EA 4QB1A 3LSMA 4ITVA 2JD4A 5LY1A 3O7OA 1LB2A 4OMCA 3MIFA 4QKDA 4BCUA 2EIEA 3ASIA 1JGSA 4Q1PA 1OH3A 4EN0A 2E1NA 2D6LX 2GAUA 4O3MA 1COV1 4AVVA 4I0AA 1NA1A 2K9SA 5FROA 3WG7H 3POFA 2EA2A 3JRFA 2ZZQA 2Q5TA 2VMFA 2BNOA 3HN3A 4RGXA 1TWCJ 4BQ3A 1KU9A 2R1DA 2VQAA 3RI4A 1TMF2 1Q1VA 1TG7A 4MGIE 4A44A 3M4FA 1OVSA 1DIWA 3ZSMA 4XONA 1DQUA 3PDQA 4LK7A 3O5SA 2MSYA 5C7GA 3MIBA 2LR8A 1JKQC 3ECHA 1WCQA 3EO6A 3QYBA 5HCHA 4LKFA 2LF8A 3JB4C 4DYRA 3JAMK 1SC7A 1UX6A 3GGLA 3RPUD 3HPNA 1GOGA 2VIXA 1ULGA 4UXAA 2VJ5A 4BDYA 2XHNA 4Y20A 2NAZA 1OPCA 5IK8A 2MEV1 4XQFA 4PSXA 2VUCA 3ACLA 1IZ3A 3IB3A 5FZAA 1MBFA 3I49A 2L01A 1WRJA 3EBRA 2ID6A 4P5YA 4BKXA 1BVVA 2RS33 3JD71 3V8LA 5E6HA 2G0EA 3AP9A 2QSGX 1HDDC 4OMYA 3TEXA 3N7LA 4UUTA 1I5PA 2E7TA 3IH2A 2VQTA 2CDPA 2RS52 1Y0UA 2QNKA 4AUXA 1MSFC 1XE8A 3JXSA 1FOXA 3F0CA 2YGMA 4CO8A 3RZKA 3RJPA 1JTZX 4IHSA 4XKVA 2VR4A 3WNKA 4U0WA 1YNAA 1HQCA 3T0BA 1EAH3 5APAA 1DGRN 3P5JA 4K2EA 5D6FA 1HIXA 1G9DA 5FZ4A 1EAH2 1WW4A 4Q4ZF 4LK1F 1B9NA 5DCFA 2LRDA 4TLFA 1XSDA 4N7UA 4YVSB 4XPVA 2O5RA 3O6BB 5C3QA 1ASJ2 3FDYA 5E3LA 3PFIA 2HKXA 4ENKA 4LLOA 4LBQD 1J7KA 5EPAA 3CMAI 2ZCWA 2P81A 4EJOA 4FTSA 1ASJ3 1OUXA 3OR2C 2WZR3 4WVVA 2VW2A 4YW5A 4IX7A 1ZZ6A 4NHLA 3TMOA 5K7FA 4TSVA 4G6TB 4Y7NJ 2OXBA 3KWVA 3VB9A 3AL0B 2E7AA 1FTTA 4BU2A 1K5MC 2QVOA 3KE2A 5E8GA 4CCKA 2RG4A 1WJEA 1K5MB 3VZNA 4QKBA 3ES4A 4HPKA 3LEGA 1JKOC 2AEYA 1B6AA 4M3CA 1I3QJ 2E35A 1DGWY 2P8TA 3NNLA 1VI0A 4HK9A 2IJLA 3OYMA 1ZQ3P 3L00A 5EHDA 2HFHA 3R4KA 3TOAA 2JG9C 4XJ9A 5AONA 1D1CA 5GPAA 2WNVB 4LR4A 1D5YA 1CZTA 1TTYA 3GTKJ 2X1CA 3FKJA 4I3GA 1FZPB 3NJXA 3MEXA 2QSFX 3P5BA 3A0HC 1O7LA 1OPOA 5KHIA 3ZMUA 3GFMA 3GO5A 1HDPA 1T08B 2FSWA 3WDYA 2OS2A 1MS1A 3ZYGA 2NNNA 1N77A 1H88C 2KT0A 4BJTA 3U1DA 1QJX1 1MEC1 3O1TA 3ILRA 4IF4A 1A35A 2AEZA 2WQ8A 4GMP0 4YVSC 4FXKB 5IVBA 1HBXG 3A01B 2R5YA 2E60A 1JHHA 1D8JA 2WA4A 5FD5A 2XKPA 4OAYA 4FPLA 5FPUA 4DBRA 4ORFA 3ZFEC 2VT2A 3LA3A 1CQTA 3OYBA 2K46A 2A6EF 4W97A 1HW2A 1HRV1 1OT5A 4M3CB 3ZXEA 1RIOH 1RUF2 1XYOA 3GCMA 1WLDA 2BP6A 1XNAA 3O0WA 2O0OA 2YS9A 1VQKI 2QQWA 1X4PA 3WU0A 3MI8A 3HT2A 2E7XA 2JSCA 1F5TA 2BU9A 2R043 2KL4A 1G3WA 1J58A 2CUFA 3F8NA 4RAFA 1SEFA 2JDYA 3S30A 2YU2A 2XJQA 3UGHA 3E7LA 1W28A 3VDDB 5FMBA 1LKXA 4BAYA 5JSOA 1W6MA 2H94A 4OI0A 3C2GA 4FFHA 2BNMA 2E1OA 3ZXDA 3EUKL 4RB3C 2DCZA 4D7MA 1QHHD 1WPKA 1W06A 3WF4A 1IXSB 3RZHA 3GTQJ 4F3JA 5ACA2 3ACFA 1XB9A 1AR62 4OI1A 2LKSA 1X58A 3N3HA 2VNRA 2W4SA 2AXLA 1PZ7A 2VOTA 2W1UA 4D6RA 5H9QA 2DVFA 1EYBA 2NVQJ 2BY2A 3RCOA 4LG0A 3JR9A 4BQXA 3AKTA 1GBGA 3PNTA 5LW9A 4LO6B 2XAGA 3L1PA 2D97A 3NNMA 1UG0A 3THTA 3S14J 1UAIA 4NVPA 2PI0A 4FPHA 4I3PA 1JZ4A 3K0LA 5C71A 3K1NA 4F52A 3LSGA 2GU9A 4GB33 2FD8A 4HNTA 3NV1A 5F6KA 2HWF3 5JVVA 3BR1A 3AB0A 4L9VA 3GZEA 5CQEA 4BQ1A 2M4KA 3DQVC 4HSRA 3WE3A 2WBKA 5I0TA 5C5UA 3MAJA 1PVC2 4NMIA 2VJIA 2IFRA 4YW7A 4E7IA 3HSRA 5IOZA 4E8DA 2JWTA 2HOTA 2XONA 5FIXA 2WT0A 4A42A 1WH7A 4TYSA 3LCPA 5D8AC 1D4M2 4K21A 1WCMJ 1CZSA 1JODA 2NS7A 1H89C 5J98B 2QQ9A 2KDZA 4L0YB 4XZUG 4ZXEA 2ZGMA 3CLPA 1LJ7A 3T2TA 1V55H 2VCCA 2BWCA 3BTIA 2MLKA 2JICA 4W50A 3W3CA 2IA1A 5GADJ 3GFJA 4MO3M 4K1YA 1V5FA 2A3XA 1SPPB 2EA7A 2DMNA 4XOPA 1P4WA 3KVAA 1NCQC 5FV3A 1ETQA 4OHWA 3HRSA 3MN2A 4AI2A 4AVAA 1S7AA 2HWC3 2VBWA 2ZKLA 5T54A 4Y22B 4B4RA 4K8RB 1C1FA 2FNAA 1OFSA 5F08A 1M06G 1JI6A 4QKNA 3WG1A 3ZKUA 4YG3A 2O3FA 4FQGA 3O0VA 1UD1A 1E17A 3AZWA 1N25A 2WAOA 3GUDA 1FXZA 3GF2A 3ZFGC 4IEUA 3T8RA 1ZZ8A 2DTRA 2RS13 1KITA 3S2DJ 4IXLA 3HOZJ 3N9MA 1IN4A 5CEHA 1K12A 3AP5A 1R1A2 2L2OA 5FUIA 1QJU3 1QBJA 4TWTA 2WQZC 5EWSA 2PQSA 4CDQA 5HODA 1D2SA 3DPRC 1U9NA 2HGCA 4JZRA 2TDXA 4A6OA 1D7PM 4OHVA 1H9TA 1JI8A 3AZYA 3UJQA 2CS3A 5LBQA 4CDWB 3E6DA 2DT5A 3O1MA 3GTOJ 4NUBA 2VPVA 3JTHA 4XNFA 1F43A 3L7WA 4XEZA 3ACIA 3GXUA 3PIPF 4FPOB 2CWSA 3MVPA 2C4XA 3I4IA 1YO8A 1S5LC 1LPQA 3WTTC 4CCLA 4P9LA 5GLTA 4YLZA 2VGDA 2B0LA 1V6MA 5CG9A 4UAPA 4AYBN 4EJUA 1FBQA 3OYEA 4RB2C 1ULYA 5H6RA 1UMIA 3X2QH 5FLHA 3CQOA 5IP6A 4G94A 1JOJA 3BR3A 1Z78A 2I10A 2YFUA 3WTUC 1ZVFA 1UFMA 1EP0A 2O8KA 4YW6A 2P6HA 3GZUC 4XMIA 3FBIB 3PFYA 1HF0A 2XAFA 1Y9QA 4UW6A 1H6XA 2RMU1 5GTHC 2RJKA 1R1TA 2R7SA 5A3OA 4MFEA 2YC0A 3CDHA 4GKYA 5GLZA 5FZIA 2JT1A 4QX5A 1JUPA 3K3NA 5CB7A 5HS7A 2PHLA 5FMCA 3O3KA 1V9U2 2NMOA 4PUSA 2BEOA 2XGXA 2DCYA 4RHV2 4XF0A 1W2UA 4OIQF 4O9EA 1OYWA 4BQ2A 5JCTA 2EFNA 1RESA 2MW8A 1FT9A 3HGYA 1X8MA 5G05L 2WFF2 2GC2A 1I1SA 5H2FC 3S0MA 4QLCU 2ELJA 1YE9A 1MPXA 3HD8B 2XLAA 1PJRA 4IO9F 1SLTA 3PVEA 2AUYA 4NHXA 2FZ2A 4A41A 5GJ6A 2VUDA 5DD8A 3QYFA 2DUOA 4A4AA 4D3WA 1ZRFA 2QQNA 3VBRC 4RLFA 3PNAA 3AYDA 3PTRB 5C70A 1LTEA 1AVBA 3ZSKA 2X29A 2EIMH 1PVC1 4I30A 3E6MA 1MJ9A 2PLV1 3QPSA 4XRMA 5C4XJ 2CQKA 4ZYAA 3QOEA 3HB9A 4G9SB 3RZJA 1P2FA 2GNBA 1XCBA 4NIDA 5C9AB 1B35A 4WM7C 1SD4A 2DT7B 4ANJA 1X2NA 2DJIA 3OR1C 2XRNA 4EN6B 2ESHA 3WUCA 5JSRA 2B39A 1ENHA 1R092 1A34A 1E5HA 1NTCA 1Q3EA 4NIAA 5ABJC 4M3CE 2L7KA 4NAMA 3EETA 1BIBA 5J3LA 2CYFA 3BVCA 4XFAA 3UESA 3H8OA 3PSIA 4M01A 4YSFA 2RAEA 2FCVA 1S9HA 2L7FP 3S1MJ 1T38A 3H9GA 5BOXA 4AK3A 2PAEA 1Z3XA 3TO7A 4PJNA 1OQEA 2HU9A 3HEIA 4Y4YA 4MADA 4XLCA 5LFAA 1C8M2 1FMD2 4CP0A 1CN1A 2LDUA 3LZZA 2HDWA 4AAXA 1CX4A 5IFTA 3KQ4B 3HL2A 2QGUA 2CY6A 3U9GA 4ASKA 4C90A 3CHXA 3BCWA 2R0QC 3ILNA 1FMD3 3HHGA 2ZKNA 5TJJA 2R7VA 4QPGA 1BBT1 2F4LA 1GKBA 4XJUA 3HDDA 3SCHA 2FDIA 2M30A 3FC0A 1F8VA 3S1NJ 2DFIA 1RUG3 2VC1A 2L5QA 2Z99A 1UY0A 6PAXA 2FOKA 2W24A 1ULFA 4AQ2A 4EQQA 2ZO4A 5BUVA 4XKBA 1IQAA 5B66C 4XJAA 2IGMA 3MYXA 3WTSC 2NLRA 1R082 4LIUA 5ILSA 4E7HA 2QUOA 1H2LA 2F5VA 1HV0A 4UVAA 1QWRA 1P7IA 2D2WA 1MJBA 4ABZA 1XU1A 3DPRA 1S4CA 3WR0A 4CDXC 1X4OA 1BK1A 4I0BA 2P6SA 2XHKA 4JYKA 3DU6A 1ON2A 1HRI2 4WVMA 2XUBA 2IGNA 1FNNA 3CCJI 1BBT2 1DFQA 2I8DA 2SLIA 1HXDA 5CFDC 4G7OF 3B3QE 3ENRA 5JLWA 3R0AA 5DDJ3 1WKMA 1IQDC 3WW1A 1W8NA 4RGRA 2O7OA 5BS6A 1Q1HA 4U7DA 1G3TA 4P9WA 5DM6F 4AEDC 4S2FA 4JTOA 5BPXA 2RS11 2CW7A 3Q8CA 5JR2A 1N1SA 3JSOA 2HWE1 4COWA 2HWC1 1RR8C 4B47A 4LHNA 3HBKA 4LO7A 2OT7A 2JPBA 1AYN2 4QM8A 1KYWA 4Z2YA 2XAUA 3KETA 5DEQA 1ULDA 3HJRA 1H1IA 3SISA 2CYYA 1KQ0A 5C8CC 2AZ5A 1TWAJ 2WBMA 3VN4A 4QX0A 3WD5A 2WINB 1W0OA 3Q3SA 5F6FA 2OIIA 4CDQC 5JOYA 3K77A 2RDRA 3KQRA 4CUGA 4WXHA 3DF8A 5FZEA 2D44A 4V2FA 4IQPA 5HV0A 4LO4B 1SANA 3GLXA 3WVJA 3DPTA 2VOVA 1S2BA 1RB8G 3JQWA 5F3GA 1J75A 3FMRA 1HN1A 1Q8SA 2WV0A 2V26A 5D5UB 1NLQA 3BQYA 1LEDA 1HQLA 4M9XA 3WTZA 3G6JB 2HQAA 4DOZA 1VIWB 2PX9A 2YBPA 4IE0A 4G6QA 3J81Z 4HBNA 4UV8A 5FUNA 2PELA 5FZKA 3ETQA 4OIPF 4COUA 1MW7A 3WG2A 4NHMA 4L92A 4RR3A 4A3KJ 3KGLA 3I2FA 4AGVA 3ABKH 2LOOA 4AOCA 4LO8A 4ARXA 1VBB1 2HJIA 4AI0A 4QB6A 3OSDA 2P6TA 2WWJA 5K1YA 4A3FJ 1CJDA 2ZGQA 1AF9A 4INDA 4QQOA 3KSCA 2XR4A 3DEEA 1DGRA 1W2NA 1DPRA 1QZZA 1ZA4A 2LTNA 4Y33A 3BOWA 1IKPA 3MLKA 5LA9A 4MG2A 1X1DA 4G3YC 2XV4S 5BQTA 1VF9A 3H9JA 1NCQB 1QJU1 3VBHC 2VL4A 2QF7A 1VFCA 3I54A 3ERMA 3HUGA 1LRHA 1IO2A 4JGZA 2IXCA 3ZYJB 3USUA 1G7YA 2VO5A 2FMLA 3EUHC 2WQ4A 3LAJA 3UETA 1OKOA 2VBXA 4ATEA 4CDUB 2QQLA 2Y9YA 4Y1UA 5A32B 4FAHA 3DGTA 3HT1A 1RUNA 1SAXA 5LBEA 2GNMA 3GTMJ 1GQPA 3LQQA 1AL21 4CDXA 4HVRA 4K9SA 3AVSA 3OYGA 2GXAA 1JZ2A 3DKXA 4JX4A 3NVCA 4RB0A 2D6KA 4XCAA 1GZWB 1AZDA 3WSOA 2VG9A 5C8WA 1RC9A 5FPBA 3J4UH 3W58A 4E4HA 5KXDA 5JLXA 5K7PA 2A3WA 4QSHA 2HZTA 3PHMA 2ZX1A 3HOBA 4Y5Z0 4M3EA 1U2WA 2NOJB 4YZ4A 2J5PA 1ZRDA 5KR7A 3BQZA 3BR0A 1BOAA 3LWFA 3RQ0A 1YX3A 2KXLA 3JRIA 4DEVA 1VBE2 2ZGUA 3M3QA 5FZOA 1Z67A 2CH0A 2R072 3TOJA 5HDKA 1YRZA 5DV5A 4EV0A 4YZ1A 2WSVA 4O6JA 2PN5A 1OYIA 3I2HA 4I99C 1REPC 4A45A 1H8TC 2K3PA 3H92A 2ZOEB 1UMHA 1SMYF 3H8UA 1PK6C 3T1BA 5FPXA 1VRBA 3IIIA 2TUNA 2VNVA 1W9YA 3ZMDA 3VODA 1TZOA 1MS8A 1W6PB 2EAAA 5JZGC 1WFXA 2EPFA 2ZGLA 3U0ZA 2YU9J 2IAIA 2HQ5A 4LLGF 3N97A 2DMUA 2HYGD 4A69C 4BMBA 1T56A 1RUD2 5LLQA 2LUWA 2P7VB 4JKKA 3T4VA 4CDXB 4YFWA 4KICA 2R7WA 2QQKA 2UWBA 1DHKB 3GJAA 3S1RJ 2JK3A 1KD7A 3VD3A 4IRHA 2AC1A 3AG4H 4AEDA 1WMFA 1QHGA 5C4WC 1R7JA 3FFZA 1P6RA 3MIEA 4EJTA 4AXOA 4Q4V3 1WMDA 3KHBA 4LULA 1WH5A 1YLFA 1SD5A 1WD3A 3BU7A 2A6YA 1XSRA 3D5SC 4Q4V2 4HDUA 4UYBA 2BERA 2KA3A 3BIWE 3QD6A 1T8IA 3OYFA 4LPLA 1Z7UA 1WQ2A 1V5EA 2E36A 3FK6A 2WY8Q 3OPZA 3E1SA 4YFKF 3M2MA 4MTEA 1MS3A 3K9TA 3P9KA 1UF2C 3LOBA 4RAZA 2E26A 4ZPIA 4BK5A 4S0HB 1ETKA 4OFGA 1W0PA 2NMNA 3R4SA 4GH4C 3SHFA 2VMCA 2C0ZA 4WM8B 4QXBA 2H8RA 1QOTA 4AHYA 1T2XA 2QQ8A 1URXA 4XJZA 5FO7B 4YIIA 5FKOA 1W6OA 2XAHA 2V6EA 3POGA 1FSEA 3FKIJ 3IRRA 3RZDJ 4RM3A 2VASA 3H0DA 1FYUA 1Z7S3 2A1XA 5LA1A 1YFWA 3M7AA 2EV6A 3QPTA 1E57A 5A2QZ 4IV3C 3U37A 2QQPA 4OUEA 3CC7I 2P3JA 3DYMA 1VTNC 3ERED 3J7ZI 1B1BA 4BJ5C 5ABJB 1XBFA 3ABMH 3F8MA 1UMZA 5FJ8J 1MNMC 3VEPA 2XSJC 4LOCA 1Q8QA 5L7OC 1SFNA 4N9HA 1O7FA 5JIAA 3MDPA 2DW4A 4KIFA 4HV5A 1O4YA 5GZCA 2XQRA 1SD7A 1NQDA 1FIAA 2VJ4A 2FRHA 4LBJA 1C1LA 5K8SA 1C3HA 4CDGA 2IZWA 2X09A 1LHNA 3EXUA 5K5RA 3V4GA 3BGAA 3LSEA 2R49A 1ND3C 5A80A 2PHXA 1OCZH 2ZC2A 1PO12 4FAGA 5BNGA 4XF4A 1PK6A 1SFEA 5EF6A 3WF0A 4G9YA 2LROA 3AJYA 1SFKA 4A5MA 1JW6A 1L3JA 2X10A 1LESA 1TZLA 1UCXA 4L97A 4ET7A 1EPZA 3K4NA 3TKYA 1YYVA 3Q0VA 2JVHA 3UT0A 1XG1A 1XMAA 2VZUA 3BG7A 3MZYA 2JENA 3K7AJ 3SQOA 1J5YA 2F4PA 4Q4Y3 2L02A 1Y1VJ 3F3XA 2QQUA 3AMHA 1Q8VA 2QENA 4L9JA 3AKPA 4FTEA 1X3UA 2K0GA 3GEZA 1HV1A 2XXZA 5B5EC 4CCMA 4HQMA 4L18B 3HNMA 2I07B 2QKDA 3NARA 4GH4B 4MX3A 2V1XA 5F9TA 1QJX2 3K2ZA 3ZXAC 5T52A 5J4YA 2XB6C 2HEVF 5DUUA 5IFPA 1P8JA 2BYVE 3C3WA 3LIHA 3INAA 1R49A 2PAKA 5H9SA 4QPGB 1XGMA 3TW6A 4H3WA 4DUWA 2EF6A 4AEMA 3BB6A 2E71A 2E1MC 1OURA 4BLJA 2PHRA 3J7LA 1X9TA 1F5FA 1PVXA 1X1BA 5EP9A 2O1QA 4KGQA 1ZBA3 4QGNA 1PDNC 1H0MA 2VMIA 1IG0A 1QJZA 5ICFA 4MGTA 2X5IB 4YM2A 4DQAA 4R9DA 3VDDA 1TW3A 4QPOA 3EJKA 2ETEA 1JJ6C 3J7MA 5EGOB 1RUJ3 2GQQA 4WF2A 2X4HA 1B72A 1OLME 5HNFA 5LZ6A 2KMUA 2LC2A 2DMTA 4AC0A 1T39A 1EV11 5EZWA 2QWWA 3AM2A 4NC8A 3WDWA 1HC8A 2JG8A 1QDCA 4GA9A 2HVSA 2GDFA 2KZGA 1AR61 2BUKA 5M5YJ 5KWRA 2HYFA 2R7ZJ 3SHRA 4AZZA 4JDMA 4YG0A 4CPBA 2OZUA 4NR1A 3DBRB 2NYXA 3BG5A 5T3NA 3PUIA 3O1RA 1OLTA 3VYUB 2JE8A 5CPRB 1EKEA 4M74A 3C2HA 2R063 5L3GA 4Q8LA 2HR3A 2A68F 1SCRA 4CCEA 2Q0AA 4QX2A 1J09A 5D4SA 1HW1A 4P9UA 1H0BA 1VBA2 4LHKA 1KU7A 5GP9A 3C7GA 4BE3A 5LATA 3KZYA 2ELHA 1VRH2 1RXGA 4NQWA 4UFIA 1WLWA 1P9QC 4WM7A 2Z9OA 1VBA3 1SFPA 4HT1T 4C8DA 5KCMA 5T5JA 1RUOA 4BNCA 2JA8J 3B5LB 3L2HA 5D8AB 5GAHJ 2ZGSA 3VKMA 4JGYB 3FLRA 2WTEA 4A3JJ 1N47A 4AWXB 3LMMA 2FD5A 2WZ8A 2O6GE 2WYFA 5JMOA 2XJUA 4H14A 2IBDA 2DA1A 4XHXA 2V79A 4IGOA 1DGLA 5J3UA 3ZQCA 4HV6A 1EY2A 1W1WE 1VB4A 2YMZA 3D4KA 2MABA 1W7PB 3VZKA 2WAAA 4X0GA 2IVMA 2GC3A 2UYAA 4KIGA 2WO1A 2JDAA 4ZTFA 5FYBA 2PHTA 3BOQA 1RUE2 5FYMA 3F6OA 3DKWA 3M9AA 4YGBA 4FISA 2XL7A 4AFBA 2L9VA 3ZXJA 3KLNA 4QQPA 1Z21A 5FZFA 3TBDA 4DEQA 3HPGA 3AVRA 2Y8KA 4KDPA 4M3GA 2CWMA 4X6AJ 1RR7A 1BC7C 4IGQA 2NVYJ 3I2KA 1DZTA 3RSNA 3CL1A 3WNXA 3KVBA 1X33A 3I4NJ 5C9AA 4J6GA 1MBKA 2AO9A 2CUJA 1KU3A 4FQZA 3OY9A 3DWLE 4I98B 3AX4A 3N7KA 1WD4A 3ZR5A 2LG4A 2DCEA 1ZH5A 2V9PA 4MO7A 1WZXA 4QXCA 3FWEA 5DUVA 3BCBA 5CFDA 1BEV2 1FC3A 2F4MB 3TWIA 1UNBA 4TTGA 4QPWA 2JB8A 4PF1A 2XVCA 5DG2A 3BN6A 1COV2 1PMIA 4G8XA 4AVBA 5LEKA 1W2AX 2ZNZA 1FPQA 1JTYA 3T09A 2LLKA 2HYKA 3I4MJ 5AIQA 4DNCA 3CKHA 3MFAA 4OVEA 4HBLA 1WW6A 1UPSA 1FPN2 3A23A 2ZMEC 3HIFA 1UPIA 3QBQA 2DQLA 4F83A 2V72A 3ZFEB 2PHFA 3PTYA 4P08A 4ZJZA 1P7JA 1I6HJ 2Z5UA 2WN2A 4XLNF 1T6GC 3V0AA 2KFDA 2MH2A 1Z6RA 1VJ2A 2OA2A 4NE9A 1D0XA 4UW5A 4ITCA 4II3A 1UYXA 1HSTA 2OJED 2WR9A 1CAUA 3KT1A 1RNLA 4WXDA 1TWGJ 3ZPLA 3K1MA 2Q8KA 2DCJA 5FZ3A 4RLQA 1ZA7A 4OLLA 3VBOB 3V56A 2QSHX 2EVXA 3BZCA 1NZCA 2FHRA 2HS5A 2A5YB 5HS8A 2RS51 3VBHA 2L4AA 1QZEA 4Q48A 2GA1A 4LNVA 2IS1A 2VBDA 2YHJA 1FOYA 1TWFJ 3CCQI 5KBFA 3PNVA 1MMGA 1YO5C 2XB5A 1UY4A 3UKVA 3ZMZA 3DYOA 3NJVA 4QPIB 1NCRA 3C2BA 3V42A 2VH9A 4DY3A 2X8KA 4IPAA 4WK8F 3KV9A 3ZQGA 2OV7A 3KCXA 2WZR2 1AX0A 2J1UA 4ASNA 2CV2A 2RE9A 5DZGA 1QMJA 2KP6A 2VOPA 5FZCA 2JA6J 1JYWA 3J7AO 1SBDA 5KXCA 3HRUA 1APLC 5C3EJ 1ETOA 4DXZA 1C0WA 3EYPA 3OGRA 1OBNA 1R00A 3THDA 5F5IA 3WG9A 3LKJA 4AL9A 2A71A 3BY6A 5L7OB 3VWBA 5JOXA 1W2TA 2M9HA 2VBYA 2X5IA 3I3EA 3FBYA 3NAPB 4NN0A 3ZQIA 2RJ2A 3BG9A 5C9AC 3H35A 5L19A 3QP6A 5FWJA 3V0BA 4HN1A 1RJ8A 3G73A 3OCPA 3MKZA 5JZGA 5EG0A 1JTXA 4RA2A 2B63J 5JWPA 2GXBA 3WZ1A 2H8WA 2L9NA 1ZBE1 5T5PA 2FX0A 2I74A 4E7JA 5DUXA 1JZ6A 3OUIA 1ZN2A 1D0ZA 2XBO3 2CWEA 3CJQB 5M0TA 5EGOA 2PMWB 5IUQA 2PQ8A 4PLOA 5K0UA 2QZ3A 2W5FA 3V8JA 1RUG2 1FBUA 3FMGA 1BZWA 3CF2A 5D5VB 3B6CA 4DMIA 3BR5A 4CYDA 4RM2A 2E63A 5HPOA 2A7AA 3FZ3A 4FTHA 1D3YA 2CDOA 1DP7P 2QQMA 1ERDA 2VQCA 3B9CA 4XIKA 2PJRA 1OD5A 4LE4A 1QY4A 3H3UA 3I53A 1PNFA 1YFYA 2W25A 1Q43A 2X0LA 5D8AA 4PDWA 1WJFA 1Z05A 3GZAA 4I6ZA 4AFDA 3AMPA 2DBIA 1WCSA 4ESJA 4W4ZA 3FBNB 5KXEA 2X6OA 1ZREA 1XX5A 4A2UA 5J48A 4XW3A 4YW2A 1WGPA 3J7YJ 2K5CA 2J1VA 3DCFA 1GQHA 5GAEJ 4ZU7A 4KL1A 4DS0A 1O6UA 2OYZA 3ZLIA 3HPHA 3JW4A 2YZ4A 2PTMA 4BJ6C 3ZRGA 2N7GA 3DPRB 4XKWA 2ISZA 1RMU2 2RQQA 2TBVA 4P00B 1U0JA 4Q0PA 4I7HA 1WZ2A 4XFIA 2E6VA 4EN8B 4KT5C 1OVPA 4QHOA 2A07F 1H8TB 2MC3A 1AHDP 4PFPA 2AXTC 5A1FA 4A3IJ 5FP7A 1DQ1A 2DDBA 2QA4I 2R3SA 1SVMA 2VXZA 2I5UA 2ZJRF 2E2IJ 2GMMA 3ECQA 4Z82A 4XURA 5FLJA 1JU4A 2Y26A 2VBPA 2A05A 1W0UA