4NUBA

Crystal structure of escherichia coli ribosomal oxygenase ycfd
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
372
structure length
361
Chain Sequence
b'MEYQLTLNWPDFLERHWQKRPVVLKRGFNNFIDPISPDELAGLAMESEVDSRLVSHQDGKWQVSHGPFESYDHLGETNWSLLVQAVNHWHEPTAALMRPFRELPDWRIDDLMISFSVPGGGVGPHLDQYDVFIIQGTGRRRWRVGAALLQVDPFEAIIDEELEPGDILYIPPGFPHEGYALENAMNYSVGFRAPNTRELISGFADYVLQRELGGNYYSDPDVPPRAHPADVLPQEMDKLREMMLELINQPEHFKQWFGEFISQSRHELDIAPPEPPYQPDEIYDALKQGEVLVRLGGLRVLRIGDDVYANGEKIDSPHRPALDALASNIALTAENFGDALEDPSFLAMLAALVNSGYWFFE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L16 arginine hydroxylase
publication title Structure and Functional Analysis of YcfD, a Novel 2-Oxoglutarate/Fe(2+)-Dependent Oxygenase Involved in Translational Regulation in Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 85
structure length 361
sequence length 372
ec nomenclature ec 1.14.11.47: [50S ribosomal protein L16]-arginine 3-hydroxylase.
pdb deposition date 2013-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08007 Cupin_4 Cupin superfamily protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2510 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4nubA02
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 4nubA01
5IVBA 2Q8DA 4GJYA 5FXZA 4V2WA 5FYCA 5FYIA 5FYZA 1VRBA 3K2OA 4D6SA 5A3NA 5FUNA 5F3EA 5FXWA 5FY4A 5FY8A 3ZLIA 5F39A 4IGPA 5FYVA 5IVFA 5F3GA 3LD8A 5F5IA 5A7NA 4UF0A 5FZIA 5FJHA 4AI9A 5KR7A 3DXUA 3N9OA 5FUPA 4CCMA 4D6QA 2PXJA 5FZHA 5FZ0A 2W2IA 5IVEA 3AL5A 5A7OA 3K3OA 5FZLA 5LY2A 4CSWA 4DO0A 5FYMA 5FZMA 3KVAA 5FY1A 3PDQA 5FZ6A 5IVCA 5LWBA 4EZ4A 4ASKA 2YU2A 5F37A 4QXHA 5FZKA 5FYSA 4DIQA 5FY7A 5CEHA 5A7QA 5FY9A 3LDBA 5FP9A 3PURA 4C8DA 5F2WA 3DXTA 4LIUA 2XMLA 5FV3A 3OPTA 3N9MA 5FXVA 5F3IA 4BISA 4NUBA 3KV5A 3N9PA 5FZDA 5ANQA 3UYJA 5A3TA 4IGOA 4QWNA 5A7WB 3KV4A 4LIVA 2Q8CA 5FZ8A 2OT7A 3KV9A 2GP5A 5F32A 5FXXA 5IVJA 4GJZA 2WWJA 3KV6A 3OPWA 4LITA 5A3WA 5FZOB 5FZCA 5FZGA 5F5AA 5F5CA 5FP7A 3KVBA 5FZBA 5IVVA 4QX7A 4Y3OA 3PTRB 5A1LA 5A7WA 3ZPOA 4EYUA 4EZHA 5FY5A 3U78A 4GD4A 5FWEA 5FWJA 4XDOA 5IVYA 5FZ4A 5FZOA 5LY1A 4HOOA 5FYBA 4E4HA 2WWUA 4XDPA 5FZ7A 4D6RA 3RVHA 5FPVA 3AVRA 2YPDA 5FYUA 5LW9A 5A7SA 2XXZA 3PUAA 5E6HA 2YBPA 4IGQA 2OS2A 5FYYA 2VD7A 2XDVA 5FPLA 5IWFA 4BXFA 4BU2A 4HONA 5FZ9A 5F2SA 4QXBA 2Q8EA 2OQ7A 5A80A 4UF0B 5FPUA 4CCLA 4CCNA 3PU3A 2GP3A 4Y33A 4AAPA 4CUGA 3AVSA 3N9NA 5A7PA 2YBSA 5FZFA 4CCOA 5IW0A 5FZ3A 5F3CA 5K4LA 4GAZA 3PU8A 2OX0A 3N9QA 5FZEA 3AL6A 4V2VA 5FY0A 5ISLA 5A1FA 4TN7A 5FJKA 2OQ6A 4CCKA 2XUEA 3NJYA 3N9LA 4QXCA 5FYTA 3U4SA 4QX8A 4URAA 5FP3A 4QU1A 5A3PA 4Y4RA 3PUSA 5FZ1A 4CCJA 3PUQA 2YBKA 5FBJA 5FP8A 5FZAA 4LXLA 2YU1A 5FYHA 5FPAA 5FPBA 3K3NA 5FP4A 2P5BA
chains in the Genus database with same CATH superfamily
1K4SA 1H6XA 2K3PA 4RN5A 4XL9A 3K4LA 3C2HA 3IH3A 5D8LB 4P08A 5J1YA 1BBYA 5KXDA 3IZOA 4BQAA 1ZGAA 3ORJA 2PXJA 5D2AA 3ULQB 2H1KA 3S2HJ 4PIYA 4UXAA 5LBEA 1QDCA 2JDUA 1IJWC 3ZRGA 5J09A 1JOJA 2ZHLA 4RAZA 4P5OA 2QBYB 2OTJI 3WVJA 2IGMA 2RM21 3OGRA 1VRH2 5E3LA 2L5QA 2V1XA 4GKXA 3VBSA 1UAIA 4Z1VA 5FRMA 2Z99A 1V0AA 5EJCA 1D4M1 2AQFA 2KDZA 1JE8A 2Y6FA 3NW4A 2JDAA 2ARAA 4RL7A 4YW4A 4DXSA 3OOUA 4PJ0C 3I3BA 4QX7A 3PTRB 4WVMB 1UG2A 1U3EM 2IXCA 4Q4Y3 4CXXA 3ON7A 2JMWA 4I0AA 4NPRA 4KFCA 3KEQA 1T33A 3B69A 3P6BA 3CZJA 3CCLI 1U78A 1BBT2 5EGOB 4IX7A 2KQRA 3IKVA 1SFEA 2OS2A 2BDRA 5IYDJ 4QXBA 3TEDA 1ZAOA 4U0WA 3H42B 4KUMA 4OI0A 1PDNC 3THPA 3S14J 1GYKA 3VHOA 2IW5A 5GLWA 5J36A 5E20A 2X53S 1WFXA 2DFEA 3GF2A 2WN3A 3FLRA 2FOWA 2DURA 5FZAA 1PHMA 2QM3A 2OZUA 2ZX1A 2G1MA 1IUYA 1IC8A 2WNOA 5ERLA 3LNQA 4QD2A 1D0ZA 2GXGA 1STZA 2P2KA 2CAVA 3WQBA 2E7XA 1ASJ3 4D94A 1WQ2A 1QJY3 2PHDA 3EUHA 2TDXA 5FY1A 1YQAA 3ASOH 1HDDC 4PIZA 1MS5A 4ITVA 1QJX1 1D4M2 1UNBA 1CAUB 2W08A 1JZ2A 1CN1A 2WT1A 2A6XA 1G2HA 3N9MA 4UW6A 5IK8A 4FQGA 4HVQA 2W68A 4XN0A 5TRDA 2F17A 3P3NA 1GKBA 2OF7A 1J5YA 4AVZA 3IWFA 3DKWA 1LKNA 2YDEA 2WWUA 3PUBA 1X4PA 3C3WA 3W6KB 3CZ6A 2DU0A 2XDVA 3F6OA 1TVGA 1H8TC 5FTTC 3PQJA 3VDBA 3HWJA 2J1RA 3VBOA 2CU7A 4K3UA 2K4JA 5FZEA 1P4AA 2HOSA 1LNWA 4AGGA 2OQ6A 4AEDC 3F23A 4QWQA 3CCRI 2KIUA 1W6OB 3C7FA 1L3JA 4Y4RA 4GB33 1DLCA 3CQZJ 3VD3A 2UUZA 4IRHA 2BRTA 3KGLA 1XU1A 5FP4A 5KK1A 3VKFC 2JG9C 5L19A 1XGNA 2FQPA 3U9GA 4Y5SA 2MA3A 2R073 3JUUA 4CZSA 4IGPA 1OOPA 4WCGA 2H09A 4N8MA 4CGZA 1MEC1 3S7IA 5DG1A 1IPJA 3DWLE 4GH4C 1UY0A 3WDXA 5KNLA 3N36A 3OY9A 3AL5A 2GDFA 5C4XJ 3ALQA 3ZXJA 3OSFA 4CEYB 2ZOEB 2ZXQA 1LFBA 2W94A 4AVCA 4G12A 2FOKA 3BTLA 4NJ4A 1MBEA 4YVWC 2HJIA 1NK3P 3TWIA 3ME2A 3OPWA 4MHRA 2FE3A 2STWA 1OC1A 2OKXA 2JDHA 3VD7A 2DUQA 3KT7A 2ADEA 4A7KA 3K2ZA 1XMXA 1FNYA 3ZQFA 1OQYA 5FK8A 3JRAA 3BDDA 3GVAA 1R58A 4Y1UA 3BPVA 3HN1A 3EQLF 2WQ4A 2FDKA 1JYCA 1AYN3 4LBLA 3LOIA 3T2TA 4CZZA 1CAWB 5ILSA 3F21A 2K02A 4YFNF 2PHUA 4Q1RA 5FKLA 3VL9A 4ITCA 3OG2A 1K6OA 2MBFA 2DCKA 2EQRA 4YIIA 4CCKA 2E7QA 2WSVA 1UFMA 3USUA 5E89A 3VZLA 5FBJA 2PX9A 3U4XA 2HDWA 2VN2A 4PFOA 5FOJB 2E36A 3ZXSA 1X50A 4WZFA 1QRYA 3RPUD 4C2MJ 1OPMA 3WG4A 3M07A 1LECA 4M3CE 3ZMUA 4JOMA 4HPKB 1DU6A 2VMFA 3ACIA 5LLQA 1MJBA 4HT1T 4JGYC 5C3OA 2WY7Q 3S2WA 4DIQA 4A0XA 1LVKA 2RS33 2EF6A 4AE2A 3LDBA 1ULPA 2CQXA 2VVFA 5K0UA 2KMUA 1P9QC 3BG7A 1MMSA 1W8FA 1WUVA 1AKHB 4YGEA 5E8IA 1AZDA 3FXKA 5DS9A 5LEKA 1R1UA 4LHLA 4UV9A 2JTVA 2FUG2 1QU0A 4YWAA 5J4VA 3Q0WA 5F6KA 5F1JA 4CPBD 4KG0A 3J9SA 2QQBA 5KHIA 4MOAA 2O1QA 1XCBA 3MVPA 2HNHA 2IFWA 3VGIA 3CMYA 2HWE3 1LOBA 1U9NA 1F5JA 3ZFGB 2C1FA 2JECA 2IRFG 2F5CA 1X1BA 3T1BA 4PDKA 4ASNA 1I3QJ 4RFRB 3NJYA 2RE9A 4BACA 4CDXA 4YG2F 1EJ9A 2CNAA 2FZ2A 2EH3A 1ZHFA 1WLDA 4YZ1A 3RI9A 3CP2A 4RAGA 3VYRB 4C0HA 3J7HA 4HBNA 2EZLA 4EJRA 4CXWA 1B72B 1A6QA 2NVTJ 1ZBE3 4IV1B 2NXNB 4DS0A 5TJJA 3S17J 4QB1A 1G3TA 5C4WC 4FASD 5E18F 3N7JA 2RS52 3PDQA 5FZ6A 4QQLA 4S2GA 3I2OA 4XLCA 1AR93 2YU2A 5FZKA 3ZR5A 3T0DA 4B4QA 3E7LA 1YWKA 1Y7BA 3PJRA 3DGTA 1TC3C 3H3VK 1TME2 3U37A 2W7NA 4LLGF 4AWXB 1N75A 2KZVA 3ZXEA 1HQLA 1ORKA 1SLTA 3AJYA 2V6EA 4QHOA 4WM7A 1FOWA 3ZR8X 1W0TA 4XSXF 3WE3A 4A69C 5FKCA 4DW6A 4B4RA 2VBYA 4EN0A 3I9V2 4NOTA 1H9WA 1XDSA 4LQRA 3HQRA 3DPRB 1ZLKA 1YW7A 2GH2A 1CIYA 4OAYA 1KITA 3WF4A 4UXNA 1XQNA 3VBSC 4XM3A 1HBXG 4N7IA 4GWNA 1V54H 4QKFA 4XJUA 4NRMA 2HYFA 5GADJ 4W50A 2R0HA 2WIIB 3JU9A 3O0VA 3CCQI 2JJ6A 1QZZA 5HNHA 2PMZA 2YFUA 2XHKA 1VQ4I 4K8RB 4V2WA 1EAH1 1T95A 1IQDC 2CSGA 2IA1A 3GGLA 3W5NA 4IL6C 1YE9A 4XKVA 3JAMK 4AQ6A 1Y6IA 2GNMA 4XIKA 5FPZA 3WX5A 1HV1A 3M70A 3O3KA 2D44A 3TOJA 4CDWA 1UHWA 1W8TA 4F52A 1Y0UA 2XJRA 4EWAA 3ZVXA 1VB2A 1MH3A 1V6OA 5E1XA 3H35A 1QJFA 4IE6A 2Y69H 4IEYA 4QPIB 1XYOA 5LEJA 1SPPA 2BBYA 1PIV2 4XMYA 5JHUA 4XQFA 3OV8A 1OLMA 2EWNA 2WWJA 3IL2A 4EV0A 3FFQA 3T3YA 5FQ0A 3N7LA 1PJRA 3OGSA 3LEMA 2LR8A 1VQ7I 2I2SA 2FMDA 2PELA 1QF3A 4B3NA 3MPPG 3FUQA 3FXOA 3AMMA 2YB7A 2DTWA 2O8KA 1KGSA 1SMYF 1BVVA 3EUHC 1AUYA 2JDKA 3FC0A 5EQUA 5JCTA 1BEV2 3JQWA 3M3QA 2IA0A 1VAVA 2NS0A 4AFCA 3KP4A 5FFOC 2EAKA 4ZJZA 5DQ0A 4QQPA 2YSRA 2KJBA 3H5RA 1RUC3 3KEOA 3T1MA 1ZREA 2A69F 1Y8RB 3HHHA 4RB3C 4DZJA 1XD7A 4E8DA 4OU0A 1EAH2 5FUIA 4CP0A 2VL8A 2VASA 4BEHB 2DDUA 2IWGB 1PYVA 3S15J 1RB8G 3ES4A 2EIDA 3U10A 3IIIA 5FXWA 2CSOA 5T5PA 2LLKA 4HVRA 2VU9A 3RQ0A 4A41A 1DBNA 3ZYRA 3W2AA 3VBOC 1NY72 4ONUA 2QLZA 1F15A 3KVAA 2HOAA 2PAKA 2PHTA 4FP2A 4IDZA 2DQLA 2FNAA 4NE9A 3HEFA 4XKWA 3OUJA 1CWPA 3J80K 4AU7A 3ACLA 3T09A 2X1DA 5FPXA 3I3DA 3B6CA 4ZU4A 1OOPC 1AYM1 1F2NA 1TG7A 1AWCA 2BVLA 4YZ2A 2ZGNA 3CDIA 2A6HF 1HQNA 4AVSA 3CO7C 2L9NA 3OYEA 1S55A 2HVSA 3R6SA 5BPIA 2O03A 3REOA 1R1ZA 3G4SI 2L7ZA 1HSJA 4BDYA 4N0BA 4C3HJ 3HC7A 1BR1A 3C7JA 1LOAA 4AIKA 2JSPA 5C9AB 5LA1A 1OUSA 1OVPA 3H8XA 5ED4A 2FMYA 2ATFA 1WJFA 3RPQA 3Q8AA 1RUD1 1V6LA 1S7EA 3GYDA 2HLEA 3BTIA 3TOAA 3RZOJ 4FHTA 4M00A 3K4CA 3BC8A 3TEWA 3URFA 4CYCA 1COV1 1YJWI 4CRQA 1ULYA 1UHSA 2R7DA 4BLJA 3U2RA 2DVDA 3DXUA 3RMXA 5E3NA 4EE2A 2W2IA 3M3IA 3VDAA 3PSIA 1ENRA 1U2WA 3AFKA 4U2AA 2VUCA 2MYSA 1ENHA 1IN7A 3VZNA 2VB6A 4W8JA 1IN4A 1FIPA 3O8HA 5EG0B 2ZJPF 4QHBA 1FNNA 3OOPA 3MKYB 1AYM2 1RR8C 1SLIA 1TWGJ 5F5CA 1FIAA 2L9SA 3QYBA 1US3A 4XONA 5CQEA 5A7WA 4GO1A 2P5KA 2OTLI 4J1WA 4YIRX 1GMMA 1H30A 2RV9A 2XV4S 5GAGJ 3HKZA 1O91A 3HPHA 1AHSA 3POSA 4XEZA 3PFYA 1KONA 2DFFA 1C5HA 3D1NI 4LT5A 4XAEA 4CCLA 4RSUA 4Y7NJ 1N1VA 5K0UC 1ND3A 1VMFA 2ECCA 2Y30A 3MWMA 3CLQA 2VPVA 4Q4W2 5LBBA 4O3MA 4JKLA 4IEPA 2PQSA 1DQ1A 5C3RA 1XNAA 4Q4Y1 4XQ4A 1KU2A 1LEDA 2ZSIB 3A22A 1AX2A 5FKOA 1VFCA 2EA7A 5LY2A 2FBEA 3NJVA 2A3XA 5FYZA 4L9TA 5LA0A 2ME0A 1HSTA 3GUDA 2BW3A 1Q43A 2E51A 1PMJX 4YG0A 2E2IJ 4LKSA 2VNRA 3HB9A 3KYLA 2DJNA 2K0GA 4W97A 2OW4A 4I76A 4QPGB 3DKXA 3SFZA 2ZZJA 4L92A 3AZXA 5FBZA 2GC2A 5CKQA 3IAS2 4UUSB 3ECOA 3IMNA 1Q8VA 4RB2C 2X48A 4YG6A 2PJPA 1LEBA 1EUUA 1SBFA 4L9JA 3TKYA 1VMJA 3KSCA 2IEKA 3DEMA 4IEWA 1XJAA 2Q1MA 5FV3A 1GICA 1LHNA 1W8ZA 4CDXC 4UW3A 1ERDA 1ZZ8A 2Z2SB 2QTWB 2HBUA 1JT6A 5DEQA 4M6XA 5KAIC 3DLLF 4MHUA 3CJTB 1SQ4A 5KXBA 3OB8A 3EQEA 1ASJ1 1SCRA 2L3DA 2WNVA 2VC0A 2XB0X 1JGGA 1QJY1 1LRHA 3SQOA 2XAQA 1AF9A 3HJRA 5C33A 3OY8A 1P4WA 4PBPA 2DMUA 5B3SH 3TEYA 1UF2C 2QSFX 3KT4A 1JHJA 3AKQA 1DLLA 3BU7A 3MZ8A 5A32A 3FBYA 3MLKA 4YELA 4YEJA 4XLNF 1XYNA 1NXMA 4AQSA 1KYZA 3OYIA 4BHPA 3BVCA 3O1PA 3FMQA 4OIOF 2NLRA 3C7GA 1S0DA 2ZX0A 3IV5A 2OVUA 1VTNC 5IYYA 5FP8A 4WM7C 3GZNB 3JZVA 3IHUA 5EDNA 3C7OA 4GJYA 2WFF3 1WKYA 4B09A 2ILMA 1T2XA 3GALA 5FY4A 2ZXJA 1C57A 1LDJA 1S7AA 2ZEYA 5IP7J 2BXZA 3CDZB 1H8TB 1POV0 2CQ7A 5JIUA 4G7ZF 3CMMA 3S5AA 4E2SA 3OF1A 4GB31 4L5IA 4BYYA 2EZIA 3OL4A 1ALYA 2LDUA 3J7ZI 1ASJ2 5I0SA 1GQPA 5F3IA 3DN7A 3UYJA 2R071 1DQ0A 2VXZA 1FC3A 2HQAA 1QEXA 2JG9B 2W47A 1RHI2 1JS9A 1RUE3 2GC1A 3HUGB 2YYOA 1X9PA 5C8WA 5IVVA 2OIIA 3BKZA 4F91B 2RMU3 3GXUA 3Q9SA 4WWCA 3T4HB 5DV5A 3QRFF 5FY5A 3RKWA 4M3BA 5L3GA 4ISRA 3F8MA 5SV8A 5IFTA 4BIFA 5FMCA 2BXYA 2E2HJ 3E5XA 5JZGA 4CDWC 4RAFA 1GHCA 1Z7S2 3QCWA 4XTPA 1XNDA 1JXNA 1J75A 1R092 4CUGA 4J19A 2NQYA 1WSUA 1S0BA 5LHIA 3NV3A 4B43A 4YW5A 4IVNA 2NNYA 2NAZA 1DF0A 1DFQA 4KJZA 4YVWB 1PZ9A 1Q8OA 1XSQA 4K40A 3BQZA 4M3DA 3RQIA 1Y9QA 2R043 1OHFA 2VAUA 2PHRA 4WXHA 5GAEJ 4QB2A 2IVMA 5FPAA 1TT5B 1JW6A 1AYN1 3JRDA 3FXUA 1GNHA 2R1BA 4G4FA 1ZA4A 4HSTA 3BTCA 3H1MA 2HWB2 1HW1A 2IS6A 1STMA 4GWMA 4X1EA 1OKQA 4RR3B 2DOAA 4NR1A 4NHXA 3BZKA 3K0LA 2HEYF 2L9LA 5DM6F 4QXHA 4NIIA 3WE2A 1ZH5A 2QZ2A 5LBQA 1FMVA 2ZO4A 3ZMSA 4Y4YA 5FXVA 4SBVA 1RESA 5DABA 1JT0A 1B9MA 2DMTA 2CQNA 3I7DA 4EN9B 5FP7A 1FLIA 2AR6A 5FLXK 5ACA3 1KJLA 2PMWB 5IYBJ 1R1TA 4XDOA 1LJ9A 2NS8A 1NLQA 1VBB1 1ETYA 5C4JJ 2YPDA 4D0PA 2RS31 3POBA 3WNPA 5LASA 1HOMA 4AWDA 2YU3A 5CZKA 3Q8EA 4NWWA 5DUVA 4OVEA 3LWFA 2NVXJ 1G9FA 1OD5A 1IXCA 4CU8A 1ONVA 4UUVA 1KYWA 2QSHX 2KIMA 5IT6A 1OFSA 1VBE2 4BQ1A 4Z2AA 2YZ4A 2MABA 1W2NA 3N7MA 3J7MA 2QKDA 1AYN2 2DFBA 2WC2A 4MGKE 4LMYA 5CFCB 1SAUA 5A3MA 1SVOA 1B8IB 1CPNA 5GALA 1WA6X 3HTSB 4MGYE 4R9DA 2K9QA 5F5IA 4UF0A 1UW8A 5J1UA 1XGMA 4Q2FA 3Q5FA 4HLTA 3HSFA 1YFUA 4OHYA 1VJ2A 3V7CA 2OPKA 2QQPA 3RYRA 3FXLA 4P1WA 3BPZA 3H1WA 1Q8QA 3ONQA 2ACJA 2VY0A 5E8GA 4FPKA 4XHBA 3LSHA 2JB8A 4LBJA 4GKYA 1U5XA 4DINB 3GXOA 3IBMA 1RUI3 1H4HA 1F4HA 5A3WA 1BC8C 3BYWA 1ZBE1 4C2TA 1VBB2 4JKKA 2ES3A 3ISPA 2CGNA 3ZM8A 2RS32 2RHPA 3ZQQA 3CCUI 1AR91 3KZYA 1H6YA 1YFYA 3OYFA 2R5ZB 3OUHA 3RZZA 5C4WB 4K2EA 3BZCA 5FYYA 3K4KA 1ZG5A 3ZMVA 3P1IA 4MQVA 2QWWA 1ENQA 2XL9A 5FOBB 1TNSA 1HB1A 1CIWA 5IK5A 4JQRA 3RYPA 1W0OA 4YGDA 4XOPA 2R1DA 2ZCWA 2VE9A 2KA3A 4LPLA 1HN0A 5JWPA 3RMYA 2ZBKA 3CD6I 2ZC2A 4U88A 2BZTA 1H9TA 2PYTA 2LKXA 2CUZA 3H0DA 2MEV2 1UX7A 2Y6LA 3MEPA 2XJTA 2GC0A 2ZKNA 3MI8A 1OCRH 3NNLA 4V2FA 1H2LA 3AP7A 3WNNA 1ND3C 3W59A 3GBWA 3KP7A 3SQNA 2ZJQF 4Y1YA 2RR13 1FSHA 4MVTA 5HI0A 3SDGA 3FXRA 3J80Z 3I59A 3BR2A 1ZBE2 2W48A 3RTRA 1TP4A 4NWVA 1Q1VA 3G7DA 5A33B 4C9YA 1XE0A 3ZYIB 2VMIA 3ETPA 2R30A 4OQ8A 1S0IA 1QJU3 2CAUA 4ASMB 2BPA2 1KU7A 3DYOA 2BOJA 1AX0A 5A6ZA 2O9LA 3AP6A 5GLVA 3ZOIA 1ZG3A 4QX0A 3C2BA 4KMUX 4FTEA 1W2UA 5EF6A 4XF3A 3M7AA 2XVGA 4ZZ5A 2D6PA 4BJTA 2OX0A 4R9AA 3ZFFA 4CYDA 4K6BA 4JX0A 3POIA 2X6OA 2OZJA 2WNVC 3E3VA 3KIOA 3I53A 3MZHA 1QVUA 1DPRA 1W2AX 5IPAA 4W4ZA 2WA3A 3C8XA 2XGCA 3K1MA 2FMLA 3GJBA 2ZGTA 2Y2ZA 4HBLA 2D6MA 1U9OA 3R0RA 4YFZA 2WAQA 1YW9A 2V9VA 1HW5A 3H36A 1OSGA 3JRHA 2WNUA 1IDZA 4CCMA 2QQAA 4H14A 5A7OA 4B8XA 4E7SA 5LGTA 1X3UA 1X2NA 1EY2A 4EJOA 3EO6A 4RGGA 4WM8A 4LK7A 4UFKA 4Q27A 3HNBM 5TISC 2XF6A 2HEVF 4XUQA 3QU6A 2LM3A 2Y38A 4QMAA 4YG3A 2ME6A 2DFCA 4QDRA 2PI0A 2VBBA 3FHIB 1D1CA 4A3MJ 1SHWB 2KR2A 2OD5A 1FTTA 3SHFA 4MH0E 4AL9A 4MGTA 1O4XA 3BLYA 1FPN3 4XIOA 2GNTA 5HLHA 1Z0HA 4OWRB 4OMCA 3ILFA 4UFMA 1XNCA 1JMUB 3HL2A 5LRRA 4HNTA 1LOGA 5E16A 2ZX4A 1D0HA 2PMZN 1K45A 3RSNA 4H7MA 3BR3A 4A3BJ 2XB6C 5L3DA 3PUIA 1ST8A 4C3JJ 4GWIA 2MC3A 2UY8A 2P6TA 2DAOA 4XC9A 4UVAA 3F72A 1S2KA 2JD4A 3R0AA 1OOPB 1FYMA 1WWYA 3WW2A 2FU4A 3K3NA 3WSOA 4BJ6C 3KP6A 1LHWA 1BI1A 4DEQA 1XDUA 4Q0PA 5EIYB 3NAPB 4CDUB 2PHFA 1HV0A 4EJVA 3CDHA 1JJ6C 5JZGC 5HS8A 4YRDA 4K8FA 4OCTA 3ABZA 1Z1DA 2RN7A 2BVBA 5BNQA 2ZGLA 4FPEA 3RYKA 1N3QA 1OKOA 2VJJA 2JRMA 4B1LA 3OYWA 2COBA 3LSTA 1FX5A 1DZQA 1ZRDA 1OJLA 2EK5A 4PUSA 4CCCA 2JT1A 3WHUA 1MNDA 4MGRA 5E79C 3OGJA 3I58A 1JBCA 2BFUS 4XUOA 2J1TA 4BQOA 4IHVA 4QGNA 2ECBA 3LE0A 2EICA 2DW4A 1LULA 2KIQA 3BG6A 2QQVA 1I1SA 1DQ4A 1UCXA 5ABJB 3C7HA 1MW7A 1NH3A 1NT0A 3DKYA 3AVRA 2CGOA 4NPMA 1MBFA 3WG3A 3N97A 3SEEA 5JPNB 4OIPF 1G86A 5FPUA 4DGWB 1IW7F 1WH5A 3NV1A 4M71A 4OULA 2Z9OA 3EUKL 2M1BA 3P5JA 4JDMA 2WJSA 3WTUC 4BGDA 2E2JJ 4DEVA 2Q8KA 2YFZA 2IGNA 1HB2A 5K7ZA 1UKGA 1UMZA 4FPOB 3TBIA 2V5DA 1AL0G 1VBD2 4XFHA 5BYNA 3N05A 1BOAA 3I71A 1SFOJ 1D4VB 4CUCA 2PQQA 1CAVB 2DT5A 3MBWA 1YEWA 3JXSA 1J09A 3FXQA 4A3FJ 1R5HA 4HA8A 2E1MB 4A3JJ 4XFAA 4MZUA 3N9OA 1DG6A 2R16A 2NMOA 1BVP1 4H2AA 4EN7B 5K0UB 3DU6A 2EB7A 3DPUA 5GLUA 3K10A 1PP8F 4EEFG 4QLCU 3MN2A 1X7NA 2VMEA 1WKMA 2JKXA 3NL1A 4YW7A 3RKXA 3LAGA 5F2WA 4ESFA 2X1EA 1JKQC 5BXXA 3FBMA 4JHZA 1RUF3 2CV6A 4AG4A 2XVLA 4QGMA 1I1GA 1IXSB 4Q5OA 3SISA 2X10A 2JA7J 4FX4A 2CO5A 3TB0A 2D5FA 3JRGA 1KS4A 1Z9CA 1ZVFA 2WZ8A 5H9QA 5J1XA 4FSJA 3GBFA 3INAA 2VONA 1DGRA 1RXGA 5CU1A 3FMRA 1G9BA 1OI6A 3GNEA 3LEKA 2XJPA 2CUEA 3PL0A 4DRRA 4XUNA 1FNZA 1NQJA 3H9AA 1T6GC 3AP5A 4ZYAA 3RZKA 2O3FA 1BJQA 3LPFA 1XE7A 4RQPA 1H9GA 3KEYA 2EXIA 4MGQA 3S93A 5I0DA 4URTA 2EFNA 3EHKA 2LTNA 1UU4A 4PQ9A 2PEXA 4XK4A 2R7UA 4NHLA 4NIAA 3UNGC 3WG7H 4UW4A 5DAQA 1YX5A 4HSJA 1ND2B 3JD73 2W0XA 3CJRB 5SV5A 1PO22 3MV01 4R79A 1QU3A 3ZKYA 1REDA 2WFF1 2R92J 1FI2A 4RYDA 4QWNA 2ZJCA 4WX9A 5GLTA 1B35B 5FLXZ 2PHLA 5LFAA 5FLJA 2HQNA 3P9CA 4C1WA 4KDPA 4GMP0 5HS9A 2R063 3QWLA 3COAC 2K9SA 4XDPA 4IRGA 1NCRA 2OBPA 3MFCA 1IXRC 3R4UA 5J96B 3ZFEA 3DP7A 1W0NA 3A03A 5CPRB 3HAGA 4S0HB 3OYBA 5CKTA 4YFWA 1QY4A 5CFDB 1ON1A 1RUE1 3I4NJ 2A68F 1S0GA 2RMU1 4P5YA 2IVIB 2HWC3 4YVSB 2P17A 4HQMA 2JVGA 5BNOC 4CCEA 3J7LA 1PVC3 2ZGMA 4BE2A 2VOPA 3JCIA 5HVQC 1TQPA 4FX0A 4O61A 2DU1A 1QDOA 4E4DX 4OMZA 4ANJA 1ETVA 2ESNA 2KIFA 4CDWB 4G7OF 2A6YA 3A23A 1RZ4A 1DCSA 4BBRJ 1SD7A 4V1PA 1SPPB 5DG2A 3RIRA 3FK6A 2BVVA 4X6QB 3ZFFC 3KCXA 4BMEA 3HTUA 1Y3TA 2GN3A 2R5YB 3GZ6A 2VZTA 3AMHA 1UQXA 3MF6A 2X6XA 1D2SA 2YPRA 3HOYJ 1MVQA 2I45A 3OPZA 4ZZLA 4F8AA 2P7VB 1D8JA 4UFIA 1GP4A 4CDQA 4EVIA 4M9XA 2V26A 2VQCA 2AACA 4ZYEA 1FSEA 4ENKA 2M4KA 2WNUC 4PBOA 3V56A 4IRIA 3SCFA 3D5LA 3CKHA 4CVUA 3BI3A 2XKOA 1PO13 1W8HA 2WRAA 5AC93 4WM8C 3U07A 1PP7U 1YI7A 2BBAA 2W1QA 3CQOA 3HOBA 1NK2P 3S0MA 3UJOA 2VKEA 1BCXA 5ACA1 1RMU3 3L9FA 2DVBA 2Z33A 1QHDA 2ZHKA 3BWGA 1HDPA 4FI9A 4A4AA 1WJDA 4CHUA 4QDQA 3WTSC 1ZR4A 3BG9A 3JRIA 1O7LA 3F22A 2M3AA 1LOEA 4O5VA 4K20A 4LFUA 4XCAA 4IEOA 1AR72 1V55H 4J1XA 1QKQA 2VBZA 4LTAA 3F8CA 1W9SA 2HWD3 2VMDA 4L2NA 1R1A3 5C70A 2BERA 1VB4A 5CIRA 5FMOL 2ETHA 1LU1A 2XG3A 5B66C 2M34A 1VQLI 2XAGA 2A6WA 4CP9A 2V9KA 1KXGA 1AR61 1W06A 1MNEA 5L3BA 3HOWJ 1CJPA 1H2KA 4BXUA 1DU3D 1ETKA 1NA1A 3K75B 4QM8A 2VOOA 5HCFA 1WMXA 3WU2C 2CGPA 3OR2C 4X0GA 3PHMA 3ZO0B 4HZFA 2CL2A 3U14A 3HPNA 5ACA2 3KGZA 4D69A 4BLIA 1D8KA 1RUI1 5LB6A 4COWA 1W90A 1JU3A 5FROA 3P3PA 3ELNA 3NWTA 1PVEA 2KDOA 2YX4A 2KISA 3CMEI 4A93J 2UV1A 1HJFA 1MS8A 3H8OA 2LS6A 2AQEA 2KP6A 4HXCA 3KZ4C 3WG1A 1C8M3 2AEYA 5JOWA 1Y43B 3NVCA 2VZPA 3CNAA 3BOQA 3BCBA 4PJJA 1TWCJ 3RJPA 2QUOA 1CR7A 4Y1XA 2OZ6A 3C18A 3UESA 1RUH2 2XJUA 4XLEA 1IG3A 1IUFA 3RSJA 2L4MA 4N43A 2W1WA 4BE3A 1IN8A 1X8MA 2NYYA 4MXWB 2IBDA 3ZPYA 4ZZ8A 3WNXA 1AR62 2BZDA 3DCQA 4AFDA 5GM0A 2RVCA 5C5UA 3EYYA 5A7WB 3H5AA 2AO9A 2DI3A 2O5RA 4Z82A 2R7SA 4PCQA 3ILRA 5H9PA 1NQDA 5JSPA 1T38A 4OI2A 2V4VA 1XPWA 2W3JA 1YQ2A 4FVVA 1DYOA 3UKTA 5IYCJ 1JYXA 2O8QA 1DIWA 2A5WA 2EBIA 2NVUB 4XIDA 2OQRA 1RUI2 1QBJA 5JAXA 1MMAA 4XBFA 4WXDA 3O5SA 3AVSA 1H1IA 4LHNA 3AG1H 1S3JA 3K4ZA 3CUQB 2K9ZA 3NARA 1J1TA 1W4MA 2B9VA 1IRZA 2E7TA 1QJU1 1X8EA 3CF6E 2YXSA 1FTZA 1VQNI 3WY6A 2G9FA 2BV4A 3ZMZA 4HAMA 2VJ4A 5GP9A 3LDKA 1YYNA 3QODA 1HX6A 3I3MA 2PJRB 3ZMNA 2E60A 3A0BC 3MO4A 4NQWA 1EV13 4OMDA 4WV8A 1IS4A 4CA9A 1K5JA 4XFBA 3I2HA 5DUWA 5C44J 1MBJA 4P9JA 2RJKA 5FZ0A 2VXDA 2Q1ZB 1F1ZA 2XPUA 1F5FA 3OD0A 1OCCH 4XPVA 5B2GB 2DT7B 2L7KA 2NM1A 3I2IA 4LA3A 4WVVA 2VZOA 1CZVA 2XBO2 3K69A 1ULEA 2VOTA 4X8PA 2WNVB 4Y1ZA 4IESA 2XGXA 4ETSA 3SCHA 1YIPA 3O6BB 4L0PA 4RHV3 2ARXA 4RQPC 3AKZA 2EIMH 3B6AA 4P00B 5B5EC 2GOXB 1KQ8A 2VOVA 3LSRA 5IVYA 2FDGA 2Y9ZA 4KISA 4DUWA 1KFXL 2X0LA 5HS7A 2KPMA 5F2SA 5KVRA 4RBOA 5FMDA 3KFWX 4OI4A 2XQXA 5KXCA 1TMF2 2VO5A 3GTJJ 5BY5A 4O9EA 1BKZA 1T2KA 1FV2A 3CCMI 2CYYA 4XZUG 3GDBA 5DUUA 5D6EA 3HDDA 5A3PA 3R4KA 2DCZA 3GTQJ 1K83J 4IKFA 2ZPXA 1FPN1 5FYHA 1QQIA 4JGZB 4QKBA 4OUMA 5BNPA 4MYEA 2YMZA 2ID3A 4Q4ZF 3I56I 3IDBB 3VHPA 2XGEA 5FYVA 1UZCA 4YZ5A 1NCRC 4UI9L 1IHMA 3ZFEC 2LREA 3M3YJ 4DFSA 1QQP3 3L1PA 3CMAI 1D5YA 1ACIA 3WZ1A 3CJIA 1Z3XA 5FYMA 1WLCA 2P7CB 2DF7A 3K70C 4UBGA 3M1EA 1C3HA 3HOZJ 3MIDA 5IUQA 4LLFA 2B7EA 3MKWB 1AR83 2YUSA 4K1YA 1UL9A 3K4NA 1SG3A 4DRVA 1X2MA 1EP0A 3MF9A 4XICA 1XX5A 1X3ZB 3VDXA 4XLHA 2XR4A 4CE8A 2J1SA 3ECQA 4E4HA 1YI9A 3VBRB 1BK0A 2FEZA 3BOWA 1HB3A 3VHRA 2VOXA 6PAXA 4IQJA 1ZN2A 5CNAA 3PU3A 5FGMA 1PNGA 1AHDP 2XAUA 4MXVA 2WAEA 1ACCA 1LAJA 2LVSA 3BR1A 3KP2A 2DXIA 1NCQA 2E1NA 2R49A 4CDQC 4M9ZA 2Y8KA 5CAZA 2AHQA 2BP6A 1IG7A 5CKNA 3QYFA 3DU5A 1GP5A 4IEXA 2BY3A 4IL7A 4YNIA 4EM0B 2VE1A 5DMYA 3CDLA 3FMSA 4BCUA 1FOD2 3VDDB 1QJZA 3FFZA 2K7LA 1VI0A 3MPBA 4Y52J 5KXEA 1DUXC 5L7OB 2JPCA 3HIFA 3PVEA 1VQ8I 2JDPA 1XSVA 2VW0A 2WZR2 3NSTA 1V9U2 1XSDA 4IEQA 1UYPA 1MMDA 2QQJA 5ILUA 1GWLA 1BK1A 4FPJA 3TEXA 3TN93 1UZZA 3H9JA 1PK6B 2HBTA 3UR3C 4D3WA 5CA6A 4TTGA 4LE3A 2ARBA 2Y0IA 4XABA 4GD4A 3M7GA 3AJZA 5I0RA 4LO5B 5FYBA 4I0WB 4DBQA 1KD7A 2KZGA 5D8KB 3OEBA 3I97A 5CVVA 5H9SA 3D6EA 1ZM1A 4MG2A 4LORA 3K77A 3QOPA 3AYDA 2AZ5A 3VFZA 5JMCA 2VTFA 1RUF1 1RR7A 4XF9A 1MVEA 2R7RA 2JXAA 1OF3A 4TLFA 4Y24A 2KRHA 1CF7A 2OCCH 4BQNA 4FOVA 2WS92 2UWBA 2ZEWA 3M4FA 1FPQA 5LRSA 3KD4A 3P9IA 1W8NA 4QPQA 4Q26A 2DBIA 5EEAA 1LDDA 4AVPA 3OYKA 2CDOA 5FYIA 3K9TA 3KLSA 1GFF2 3V0AA 3AMNA 1QPMA 2GXAA 3C2UA 5IVFA 2EIJH 1POQA 5FUPA 3AXEA 5IVEA 4KT6A 4HX8A 4YFKF 4ZDOA 5AFEA 1SD4A 1DP3A 2EFWA 4XURA 5DCFA 5FYSA 5B4XA 4LHSA 3LIGA 3AYCA 1OLQA 2MW8A 2DA2A 4I2OA 1X82A 1TQ5A 2NVQJ 3BODA 2E5ZA 1HRV2 3A2KA 5J6XA 4DOZA 1YJNI 5AVPA 3WP5A 2UWMA 3DFGA 2PLYA 1CESA 2FSWA 2UWAA 1F5TA 2DPDA 1WMEA 1R6RA 3SYTA 3K4JA 1APLC 3GZEA 5JHFA 2L54A 5FWJA 4RB0A 4IEUA 2O61A 3JD71 2FHRA 2CQQA 1XU2A 3PO2J 2XRNA 4N43C 2XXZA 1S4CA 3KP5A 4BXFA 2JA5J 2B8MA 4NC7A 2A3WA 4YYOA 2KFDA 2VIXA 2V4JC 3RDIA 5G05L 2O6GE 3MLLA 3AYEA 3PU8A 1HKDA 2GA2A 5ISLA 4XJWA 2DCTA 3WNLA 5K5RA 4N90A 1JYNA 1YCIA 5D4RA 1ZNPA 3HHGA 3EMRA 3GHNA 2R061 3G1OA 3WHBA 4A7ZA 3I2KA 2H8RA 4IV3A 5KBFA 2JD9A 4XOTA 3RG0A 2W92A 2JWTA 2VXRA 1AJOA 2XJSA 4BXXJ 5F6FA 2JSCA 1XGSA 4BHCA 4OI1A 4AEDA 3MW4A 2DLLA 3HGGA 4V2GA 2RREA 2PLV3 3I59B 4OHZA 2DU9A 2HWF3 1FOXA 1PVC1 4FE7A 3A21A 1PMHX 3A01A 2QQ9A 1TWAJ 3LOBA 1FOKA 3ZR6A 2E6VA 2FD5A 5M3FJ 2B46X 4RGAA 2OT7A 2L7FP 1Z7LA 1UN1A 3JD72 4JDOA 1NE6A 5A1LA 2Q0OA 3HRTA 2DDBA 2KRFA 1DGRN 3OIPA 4H7LA 1DHKB 2Q30A 4ORFA 3L2HA 1REPC 5L3EA 1ETXA 4ET7A 4Y20A 1E5HA 2MD5A 4JVAA 4HONA 5IOZA 1MIJA 3CCYA 3SEPA 4GULA 1WJCA 2ZEZA 3LSKA 2F4IA 4RGXA 4PLMA 4Y17A 1GQHA 3BG3A 3IDAA 3B7MA 2CYFA 2R062 3NV2A 3RZMA 3VHNA 1K4TA 2YX7A 2D2WA 5FKMA 2V1NA 3KQRA 2E7AA 3RZHA 5BPDA 1ZBA3 2WN2A 2NOJB 2BY1A 3POJA 4AEJA 5AC91 2VUMJ 2Y0SA 1G6NA 2RDQA 2WNEA 3L2RA 2X05A 2AUYA 2Q1FA 3N35A 1R00A 1ZLJA 3SFIA 2VNVA 1R22A 4IW3A 1RMU1 3GTKJ 4XJ9A 2W52A 2M4GA 4PF5A 1WLTA 4PZJA 3NWKA 3WV6A 1EA3A 2VXJA 4ESJA 4LBQA 4MO7A 2EAAA 1D2QA 4NUBA 4E8CA 1H0BA 1Y1WJ 2E19A 4Q4X2 2IXSA 1Q56A 5BNPC 4PJMA 5LZ6A 1B4AA 3TNPB 1RUJ2 4DUXA 1U8RA 2A07F 4HPQA 3S30A 4KL1A 2HWD1 3J8F3 4HV6A 5JVTA 4HMZA 4PIXA 3ZYFA 3Q0UA 2WABA 5FPVA 3CJIC 4CZCA 3O14A 4AIHA 4B44A 2DCJA 2XIGA 2VQUA 5A80A 2UU8A 3OYJA 3SDBA 1MSEC 5FZFA 5M3MJ 1UPIA 5I0TA 4MEXF 2P3KA 2LP0A 4I30A 4TWTA 2BEOA 5JOZA 3FM3A 4P96A 1GOFA 3I0TA 4QXCA 2E31A 2DA5A 2VQTA 1RUG3 4HF2A 5AC92 5JLVA 3AL0C 2R3SA 4BZ4A 3AMQA 3CL1A 3VWBA 1MDMB 3BGAA 1YQ6A 1AXZA 5EGOA 1DP7P 1W8UA 4DMIA 3T08A 3OYWB 4LHKA 3FJSA 3ZIXA 2G7HA 2PN6A 3PNYA 2D45A 2Q8OA 4H3WA 4E70A 1X1CA 3MFKA 2W5FA 4B4CA 1NCQC 1VAKA 1GVDA 3HRSA 4PQQA 3BU0A 4YRVA 5FO7B 3I49A 4NHKA 5F0FA 4SLIA 1XNBA 1C8M1 4MGZE 3L00A 3WNKA 5DDGA 2FD8A 4B1RA 2HWD2 4DYCA 4IE0A 4KQ7A 1XXNA 2R0FA 2MD0A 3O1SA 1QH7A 2VULA 4MUVA 3VL8A 3FLTA 4S2HA 4BHBA 1IKQA 4LOSA 2IFRA 3OL3A 4QPOA 4PFPA 2EIGA 5EXOA 2Z69A 1YNAA 3WDUA 1RITA 4CXFA 1CAUA 3F8NA 2VVEA 3ABMH 3VB9A 5D4SA 3LQCA 1SEFA 4FPLA 4IZZA 1FMD3 4Q0VA 1YLLA 2FQ3A 5A1FA 4EGYA 1J9IA 3BJAA 5EEGA 4O65A 2VG9A 3U4SA 2ZMKA 1XE8A 2FDIA 2ZGUA 3BR6A 1P4XA 1QNYA 2JIGA 2WO1A 2JDMA 2W9XA 2X5IB 1BXHA 2DVAA 4OYUA 2AXLA 2QKMB 3GTPJ 4DXZA 1FBUA 1ODNA 3NNGA 3PMEA 3JRBA 2YS9A 2DV9A 4JP0A 2E63A 4HVOA 3WHCA 2IXIA 3F0CA 2COMA 4IHXA 4TLGA 3TBDA 1QMJA 2X8KA 3BIEA 2WB1N 2HEWF 2Y6HA 1HXS1 3E5QA 1UB9A 1QPIA 2QZ8A 4A3GJ 2GIZA 5EYRA 1O4ZA 1RRJA 2RG4A 2JRTA 3PVOA 3KCYA 2IS4A 1JYWA 3IH4A 2CH0A 2CJJA 3OPTA 3PTYA 3LOCA 4BISA 1H0MA 4BK4A 1JTXA 1EV11 3NQHA 2QQOA 5FZGA 5CVUA 3IM0A 2TEPA 2LRDA 1FBQA 5HBAA 1OISA 5CKMA 1SVMA 2CV1A 2LOOA 3M3EA 4LD5A 1SMTA 4D6RA 4ENMA 3NNJA 3H0GJ 1ZKGA 3Q8FA 3PUAA 4CO8A 2FBKA 2KM2A 2Q8EA 5FR3A 1UYXA 1Z67A 4M4PA 2JUGA 1J3PA 4M74A 4YZ3A 2W1OA 4YSFA 2PFWA 2KL4A 4RHV1 3GZAA 1OH3A 3I4PA 2J1AA 1RUOA 2B63J 2RM22 1ULCA 1WCUA 2CHHA 4RQPB 3UGFA 3OBTA 3KYCB 4QGLA 4XFFA 2CDPA 2Z5UA 1I27A 4MHGA 1E57A 2DQRA 2ZGQA 5FUNA 1GV2A 2DO7A 1HXS2 4XETA 3IUOA 2RDNA 1S29A 3S1NJ 2XJVA 5HV0A 2XPJA 1CD3G 2ZHMA 1QNTA 2ID6A 4CTEA 4UB6C 3OJBA 5DCMB 1YLFA 1E17A 2VZSA 2R7EB 5C3SA 2FQ4A 4LBNA 1YYVA 3QOEA 3PO3J 2RNJA 3I4MJ 1S9HA 4M0HA 1L3LA 1OYIA 3OSGA 4XTMA 3D0SA 3M9AA 4XJ8A 2EIKH 1ZA7A 2B9SA 3K4MA 4IV3C 5JXJA 2HEOA 2VPRA 3E1F1 2BQPA 5KWRA 2GOMA 5FO5A 3TEZA 1QQP1 1U0AA 1YUDA 3VKLA 1K5MB 1NCRB 4KA4A 4HPKA 5FWEA 3RI8A 2AH2A 4G6DA 3ZDVA 1OD3A 1W7PD 2EFQA 1E3PA 4Y22B 1AVBA 4COZA 1CAXB 2ERFA 1NKGA 2ZXIA 4IOAF 1AR81 2ZBJA 1KJRA 2ZGRA 1XPXA 1AKHA 2JDYA 3LAPA 1QGPA 4JX5A 4JCKA 1RIRA 4NHMA 1VQMI 2DDAA 4OUSA 1QJX2 1OCZH 3D3AA 3ZQ7A 4W1UA 2FF4A 1JKOC 1O5UA 1XN7A 3ZIWA 4MV2A 3SMHA 3VDCA 5FXZA 5K5OA 1BI3A 1VRBA 2PN5A 1ZR2A 1JZ4A 1IGOA 1HF0A 1USTA 1WH7A 2VUAA 5DDJ1 4M9SA 4ESBA 2EXHA 4MTDA 2ZSHB 1ZARA 9ANTA 3RZJA 3ATGA 1V6MA 5DUIA 3ZFGA 2XF5A 3LQQA 4XAAA 3U21A 3ZQHA 2E9QA 5BUVA 1QOTA 5EJ1B 5A7QA 1O59A 1VRH3 4R1HA 1B1BA 2PFBA 3LA2A 2Z4FA 2O0OA 3EJKA 4KWKA 1TL8A 1VR3A 3J81K 1W0UA 4AVBA 2Q4SA 2BOIA 1B72A 4QAWA 1IKPA 3ZPOA 2BHZA 4JZRA 3H3UA 4OOIA 2QQLA 4A3LJ 4FFGA 1S72I 2QQIA 5JOYA 1BBT3 4QU2A 3RJ2X 2H0BA 4FPHA 1ZYBA 2RKHA 4LO7A 4Q29A 3TN91 1MEC2 1IRXA 1M1EB 5JIAA 2G4IA 1AJKA 3ZXLA 2I07B 2W1UA 2CFXA 3AL6A 3BJ6A 4G3YC 2CY6A 1O3QA 2VI6A 2JICA 2HWVA 2WBKA 1Z6RA 1F8VA 1M06G 2FRHA 3PJYA 4XMIA 4FOQA 3OYMA 1NZCA 2Z42A 3IPVB 5DUXA 1G9CA 2H0VA 5DDJ2 2M8EA 1VQ6I 1O3TA 1UZ0A 1NG0A 5IT3A 3DPRA 4E7ZA 3G1MA 3GTMJ 1O6UA 3LF7A 1LGBA 1OYWA 5A7NA 1PUFA 2VTXA 3O1UA 2CW0F 2XKPA 3K3OA 1QXJA 1DQ5A 1R7JA 4P02B 2VZ1A 3ABLH 4JTOA 4ZC3A 1X1DA 1HKSA 5JI9A 3VYSB 4QSHA 5ANQA 4LLNA 1NA1B 1VE0A 4KNYA 1PGL1 2JEMA 1LGCA 1URXA 1K3IA 1GSLA 4OIRF 1EPWA 5M5WJ 2JE8A 2JZYA 4LUKA 3ZN6B 1UCRA 1YRZA 4OMYA 1LTEA 1SANA 4QPIA 1K7AA 1JKPC 3U1XA 3BPXA 1OLRA 5L36A 2P4WA 4NC6A 2FJ1A 3M2MA 4HF0A 4XHXA 3HNMA 2ZX2A 2WZEA 2HTJA 2IPQX 5FP3A 1AXYA 4I0BA 1VNDA 1LE8A 2K3FA 4P55A 4FFHA 1JN2P 1TEIA 3SC7X 4BQWA 1R64A 1A34A 2Q2EB 1R9TJ 1FAYA 4YARA 5C3QA 4KGQA 1V5GA 1LOFA 2HI3A 2W39A 3GJAA 1UU5A 3N7KA 3JSPA 4UFJA 4NIGA 1JYVA 4N53B 4BEHA 4HEA2 4MADA 3DBRB 1LGNA 1G3WA 1LVAA 4D1QA 5HPOA 2OUMA 4L9NA 3S16J 3EB7A 4RAYA 4RS5B 1HB4A 1LENA 1R1VA 5JSRA 3U78A 5LD2C 5FK7A 4AYBN 3I8TA 2PLV1 3OS1A 1BI0A 3A0NA 2HWF1 4AR2A 2ESHA 1WMFA 4PLNA 4A3ZA 3E6BA 2HOTA 1JZ8A 4XJZA 4NN0A 4ASLA 1WWXA 2FNPA 4KBZA 1F36A 1OQDA 4EWEA 4RGKA 4N4NB 1WRJA 1X33A 3N9LA 3AXDA 4QQHA 1IRFA 2GZWA 1UX6A 3E0JB 3KB5A 2YC2A 3FN9A 3UKVA 3MKZA 1R4MB 3JREA 1CVNA 1W0PA 2JDZA 3PIPF 5LATA 3ESWB 3S7EA 5DD8A 2ZKLA 1N1TA 1ZGWA 2EXJA 3PMSA 3BY6A 2H1LA 1CJDA 1MACA 1UYZA 1W6PB 2BGOA 2HQ5A 4S2FA 5C9AA 3OGGA 2DMQA 1JOBA 1VQ5I 4H0EA 5FJ8J 2HFHA 3B94A 5GTIC 3D4KA 4KWUA 4K7JA 1ZBA1 1JZ3A 4JYKA 3O12A 1XSRA 1LFPA 2FCUA 1JTZX 1LEMA 1S2BA 2K85A 4UFHA 3L7WA 3QPLA 4M73A 1UOBA 1MZ6A 5HLGA 1JTYA 3OBRA 2HZDA 5AFBA 2VT3A 3HOXJ 3ELKA 1W39A 2XASA 2GLOA 1WBFA 4BU2A 3SH4A 1T56A 2QUFA 3S57A 2VKHA 1H2MA 2G9GA 3OWTA 3MYXA 5EG0A 3RPUA 3PVBB 4YM0A 4BQ4A 3J8F1 2LK2A 1FOYA 4MSVA 3BT9A 2J5OA 3BCAA 4XXAA 1W7PB 2GBYA 1MH4A 4COVA 3PFIA 2QQ8A 2ZJ2A 3QQAA 1RC9A 1BN5A 2WAAA 5A3NA 2LH9A 3CJIB 2M5WA 3QAHA 2J1VA 2A71A 4A7YA 2GIVA 2E34A 3H9GA 2VZUA 4DO0A 4B4PA 1ZBA2 2A7AA 4BIOA 1C1LA 5HDGA 2RS53 3R4SA 5M0TA 3GW2A 3FZVA 2JG8A 3HM5A 4CPBA 3MIGA 1DQ6A 1TME3 3S1RJ 1TWHJ 3ERMA 3FHZA 1OCOH 1O3SA 3WTVC 1FYLA 5I91A 4QPGA 2MNGA 5A1AA 3WR0A 1SD5A 3CLOA 2WYSA 4UUSA 1EYBA 4KIFA 3OS2A 4IOCF 3ZFGC 3ABKH 4PK4A 2ZGSA 2ET7A 1L7LA 3SKVA 1HRI1 2Y6KA 1X4OA 3AB0A 2WA4A 5DAPA 1ZK8A 1KZHA 2WO7A 3KHCA 2QVOA 2XAFA 2B9UA 4IETA 2E7WA 4V2VA 2VJXA 4HRIA 2EILH 2QE3A 3QP6A 3OS0A 1TT0A 1NXD1 4KH9A 4RB1A 4LKDA 4NAOA 3GEZA 4GIQA 1O4YA 2YC4A 5JLWA 3ENRA 1YTYA 2B5HA 4KI5M 4ISQA 3VUOA 4GYIA 1FMD1 3A02A 3ZSEA 1BJZA 1WZXA 2DBNA 2VNOA 4HK9A 1EF4A 4NAMA 5TSWA 1SBDA 2P5LC 2QF7A 2OXBA 4ASKA 1D3YA 1OQ1A 1IGNA 3K7AJ 3KQ4B 5IT9K 1MBHA 3PJQA 4AD9A 4LKEA 3IT8A 2A75A 5J98B 4AVAA 1PIV3 1IV6A 4CH7A 3RCOA 3HR9A 2EV5A 3DPRC 4UVBA 3LSIA 1RUD2 1OYYA 4KWLA 3W2VA 4RGSA 1HRI2 2P3YA 1JZ7A 3KX2A 3AKTA 5C3PA 1COV2 5LW9A 3MAJA 2YHJA 2LSOA 1JUIA 3G1LA 5HCBA 1BEV3 2UYBA 4HANA 2P37A 2VZQA 2X29A 3GCWA 4LJZF 5DUKA 4CP2A 4AF9A 4A3KJ 3WP4A 3MW2A 5FY0A 3CO6C 2YPJA 1UOJA 4TN7A 2ZX3A 2X51A 3HUGA 1S0FA 1LHVA 4ENJA 3ZMOA 3SCGA 1JUSA 4IUGA 3VZJA 2M8GX 4LK0F 2VNGA 1T8IA 2BTVC 4BE1A 1KQ0A 1ZRFA 4KU8A 3V0AB 1EAH3 3QU3A 4XORA 3GX4X 3IWZA 2CWEA 5JSOA 5FPBA 2M7BA 4RA2A 1W6QB 4U36A 2WUHA 2W95A 2DWRA 4L99A 3K51A 3HMYA 1YS7A 4EQVA 2OPWA 3LD8A 4CICA 4AQTA 3HQXA 2Y0OA 3RZLA 4QPIC 4JAAA 3WTZA 4C1XA 3O0XA 1MJAA 1UHMA 1GWKA 2MGQA 3NAUA 3HXLA 3OYAA 3CF2A 2VW2A 3POGA 4RA0A 3J4UH 1SVLA 3N3HA 2KT0A 2IAIA 3GLLA 2J7MA 3NNMA 3KCCA 3UJQA 5IAXA 3GO5A 4FPGA 3ZQGA 2G19A 4Y15A 5E1RA 2K2SA 3FXJA 5CVIA 3FHQA 1ZQ3P 5FCCA 3O8GA 4NNJA 1L7QA 4Q4Y2 1TLHB 3V0BB 1VQOI 2YU9J 2WO3A 4RR3A 3GZUC 3MQ0A 5T55A 1WMDA 1DGWA 1QNWA 4NVPA 2CQKA 1REEA 2VJ5A 1LOFC 4RS8A 3S3OA 1MS1A 3QH6A 3KZIC 3JR9A 4F7ZA 1PMIA 3WODF 3C7EA 4HSLA 4U7BA 1MR5A 5CBLA 1V5FA 1CONA 4HG6B 5D1IA 3TO6A 2QA4I 1QXRA 3CEWA 3ZQCA 4J01A 2PHXA 1Z7UA 1W36C 4C91A 1LCLA 2QQNA 4CXYA 2VQGA 4IERA 2P3IA 2PG4A 4GCVA 4M3CA 3FISA 3ILNA 3M3OA 3LDRA 2GM4A 3P7NA 2YU1A 1NZIA 4D6SA 1UELB 1RIOH 3WXPA 5L3FA 1Y0NA 1ZRRA 4RFT0 4AEDB 5K7PA 1HDKA 3IAM2 3H1YA 2Q0AA 4KYWA 4UW5A 5T5LA 1RUNA 5FMOS 5IHRA 1FX7A 1QH6A 1QJY2 1IS3A 3ML6A 1OQEA 1BMV1 5CLSA 3JBG3 4IHTA 3T4VA 3BUCA 1I6XA 3IH2A 3A01B 4Z92B 3RKYA 2K9NA 1W8WA 3O1VA 4GH4B 2VKVA 4FFIA 2C4XA 1VBC3 4BH9A 5CFCA 3NRUA 3ZSJA 3T8RA 1B09A 4FQ4A 2GP5A 2LRPA 1BZWA 1X1PA 1E5IA 2OQGA 1PGSA 1PVXA 1ZG1A 3SJMA 4XQWA 2AS5F 4IQPA 2K4BA 3DV8A 3W6JB 1R36A 4JTNA 5AVAA 4AGRA 4H55A 1W9FA 4O9GA 5C8CA 3ZDSA 2L9RA 5FKKA 2OPTA 5C9AC 4Q47A 3MEXA 1VRH1 5EZGA 5EZHA 1UZYA 2ZXHA 2PHWA 4D7NA 2NS7A 5I8YA 2IGOA 3L2YA 4ARXA 3T0BA 3KHBA 2HPIA 1O8PA 2FBIA 2Z16A 5HXVA 1TQIA 5L9VA 4Q4W3 2H6CA 4D8MA 5FFXA 4A0YA 4GB32 1G3YA 1H9PA 4LK1F 4KNCA 4FT8A 5IVBA 1BBT1 3FK7A 1O4TA 1DPUA 1NTCA 2IVJA 2R072 3F3XA 2ELJA 4XZPA 1BMV2 2R93J 2EIBA 4AI9A 4QX2A 5FIXA 2QQWA 3MHZA 2VMHA 1OCTC 2VBPA 2VZVA 2OC6A 1U0JA 3SH3A 3HGYA 4UHTA 5IVCA 4HX4A 1A5JA 5KCMA 3VZMA 1YC61 3AFGA 2XOMA 4J25A 2AC1A 1RC6A 3SXWA 1RKTA 4JGYB 3CZUA 4L9BA 2D3PA 2V9PA 2WV1A 4Y5Z0 3DECA 3LSMA 5FZCA 3VYUB 1MKMA 2V6CA 2XSDC 4XNFA 4LG0A 4AI8A 3TL4X 3OIQA 1A78A 1GQGA 3H5NA 3Q8CA 4BE0A 2NNNA 4D7SA 3VOEA 4EYUA 4DNYA 2NN8A 2N7GA 3BB6A 4DY5A 1P92A 4AM3A 2XGDA 2JG8C 2O14A 2WL1A 3JAMZ 1JHFA 2M9HA 2VJIA 2HWE1 5A33A 1W28A 1TNFA 4L18B 2XUEA 3EBRA 3KYDB 2TUNA 3AZYA 3ECHA 1D5VA 2IGKA 2OA2A 4QPGC 2JN6A 2F6CA 1PGW1 1T6BX 3Q3SA 2VH9A 3QBQA 3O1TA 2B39A 4LB5A 1XRUA 2DK8A 4UWDA 3JTGA 5GTHC 4AFMA 3UV9A 1LDKB 5F5QA 1OA2A 2F4MB 3UK9A 3WGGA 4DBRA 3VBUA 4AI0A 4QX1A 5D5WB 3ZN1A 2WR9A 4CU6A 2HDDA 2P34A 3WDWA 2ELHA 3HOUJ 4X6AJ 1BJAA 5IY5H 3HEIA 1U5IA 3MGUA 1JYIA 1WLWA 4LR4A 4G9YA 1CQ9A 2VW1A 4FPFA 1TE1B 3CMGA 1U5TA 2CUFA 3WUDA 4B1MA 1TZLA 4HOBA 1TNTA 2LG4A 4YM2A 5FRNA 4P9FA 1RHI3 1GU3A 1G8XA 4QX3A 2EINH 2WWYA 2J1UA 1SLBA 3CP8A 4XKBA 2LBFB 1GZWB 4IXLA 3IAPA 4WBBA 1Z05A 2XQRA 2QFEA 2D6LX 2XVKA 4BS9A 3LSJA 3WOGA 3PIOF 2DT6A 1Z7S3 2HWE2 3AKSA 2GP3A 3VBHA 4META 2R6QA 3D0JA 1R093 4A6OA 4ES8A 1GNZA 1GANA 4HK8A 3PLQA 2I10A 3RFRA 1PX4A 3A4CA 5F27A 5DZFA 4AFBA 5FYTA 3C1DA 3DBLB 1PGW2 1IZ3A 4GA9A 3HOVJ 3S3NA 4EN6B 3VBSB 4BK5A 1W36D 4ZY9A 1SLCA 3LFIA 5LCWL 5BMZA 3V8JA 1YW8A 4QXKA 4C2UA 2LY1A 5J37A 3LIHA 3HRUA 3L2VA 2HWB3 1G4DA 4P9IA 4UT5A 2W91A 5BNOA 2CV0A 1X58A 2TRTA 1AR92 1DP0A 4BWOA 1KEXA 3I2JA 1YIJI 3R60A 5FD6A 3IDEA 4FCAA 5GPCA 4XRMA 1IG0A 3HQUA 2VVDA 4BQ5A 2WLQA 2FZ1A 4KN7X 1ITYA 3NAPA 4CDUA 1ETWA 4B3AA 1WHUA 1IDYA 3MW3A 2WQ8A 3VKNA 3SLIA 3W6VA 3PIGA 1X3WB 4BB3A 4AHWA 3MICA 1GOHA 2XPWA 3RVHA 1L7RA 3BR0A 1UMQA 4XRFA 1MQTA 2C9KA 1GOGA 5FZ9A 1GUIA 2WT0A 3MCZA 2BV6A 4GDFA 4DB5A 2GQQA 2R7QA 1RETA 1XB4A 1DU0A 4TXWA 1TW2A 1TNRA 2VPLA 4MFDA 1N3OA 2CS3A 5KHHA 4YFXF 1OCPA 1TTYA 1LOCA 1RUC1 3H9QA 2M7AA 1H4GA 1VBE3 5CVJA 5JR7B 4UYBA 4YW6A 5ABJA 4AHZA 2DMNA 5A2QK 4RR3C 3K1PA 3ZXDA 4P9UA 2OU2A 4IEZA 4EMSA 5FO8B 1GWMA 3WG9A 4CU7A 4A3IJ 1Z0XA 1LKXA 1R083 4XF4A 1UIJA 2ZGOA 3ZMTA 3WTYC 1Q3EA 4BA6A 2B45X 5IT9Z 4I02A 2VMCA 4UUTA 4BPZA 5JXHA 1UY3A 3X2QH 2VQ0A 5FP9A 1POGA 1UPSA 3W9AA 4AVTA 4I98B 5JI6A 2K5CA 2DYCA 3VBOB 3IRQA 2JKBA 2A3SA 4QQOA 5ERIA 2BJSA 2JJ7A 3FBIB 1CAVA 1ZGJA 5DZEA 3AZVA 4EN8B 2VQAA 3MIEA 2GU9A 1FXZA 4XLPF 1QHGA 4IO9F 2YGMA 2JK3A 3NEUA 5FDBA 2ADDA 1VBB3 3AG3H 5FZ4A 1HIXA 3DTEA 2RS51 4AGVA 5JUVA 3L2WA 2AYHA 4AEMA 1W6MA 2WYFA 1E2XA 1OKRA 1K78A 3VLBB 2W57A 2EIEA 3MZYA 2Y31A 1F43A 5FAXA 2HDCA 5E3MA 3PNAA 1E5RA 1RUC2 1TME1 5FZ3A 3IKTA 4AHXA 5CFCC 4ES9A 1H1MA 4XF0A 1X19A 4Z2WA 3OR1C 4RGRA 1XNKA 5ANNA 1N78A 5CADA 1HN1A 3Q9VA 4ZU7A 5KC5A 1K79A 2D6KA 3BIWE 3V4GA 5LA2A 1NHAA 2F48A 4ZXKA 1GV9A 2DVFA 5C8CC 3K1NA 2ZHNA 1YIOA 4ZKTB 4BNCA 3LA3A 2MEV3 4Q4V3 2HYJA 1JZ6A 4JBAA 2NP0A 1VQPI 1XNTA 3KF3A 4Q1PA 2RVAA 2W00A 3ZQLA 4AZZA 2GALA 1LEAA 2C24A 3RI4A 4AI3A 2HKXA 4XCBA 3QP5A 4KIGA 1O5LA 1UMIA 4DYRA 3AYAA 4NRQA 3DL3A 2C0ZA 3T5XA 2XUBA 1AL23 2J5PA 1A8DA 3ROUA 3U1DA 3USUB 1YJ9I 4YW1A 3V7RA 1G8WA 4M0NA 3ZSKA 2F4OB 4BM8A 4IEJA 3M1HA 3TDZC 2C26A 2OAZA 3GFMA 2L02A 1ND2A 5FYUA 3CUOA 4AI1A 4AFAA 5IK4A 4BJ5C 4OFGA 1PIV1 4J00A 4N7UA 4ARYA 1WZ2A 3KZZA 2ZA9A 2CG4A 1JODA 4CDGA 2JA2A 1ULGA 2AXTC 1B35A 2UZKA 2WFPA 4EM1A 2DJIA 4URAA 4NDLA 3JW4A 2IXLA 3HT1A 1C4RA 3BTAA 3S1QJ 4A0ZA 3OSDA 3AP4A 2F5FA 4XBLA 1PUFB 2F4LA 3J26N 1C8NA 3WNOA 1BEV1 1UZWA 2LUWA 2BOLA 2XLAA 4DNCA 4R8HA 4HNVA 3HOTA 4GXLA 5A3UA 1GLHA 3APBA 4WVWA 5IJRA 3F95A 5CB7A 1X9TA 2MH9A 5KHDA 5CFDA 4XR6A 1R71A 4YVSA 4FAHA 1HLCA 3AAFA 5FY9A 2VUDA 1KU9A 2NZ9A 4B8EA 5DTDA 4BY7J 3ST7A 5T5JA 5G04L 4LIVA 3KV9A 4G8XA 2LNBA 2X4HA 1C0WA 2CWMA 2VOKA 3KWVA 4D7TA 1MGTA 2A61A 2D3SA 1Y9MA 3F2ZA 3W3CA 2XPVA 2D98A 2JUCA 4CDXB 3H8UA 2V1UA 1UMHA 4MGSA 3ZYHA 1NY71 4XVHA 1MD0A 3VBUC 2MLKA 1T39A 4MIMA 4XLFA 2R5YA 3VYTB 3CF5F 1QA6A 1JHNA 2MHFA 5F04A 2VBDA 4LMFA 2M30A 2P3JA 4OIQF 2KKOA 1LE8B 3CC2I 3H1CA 2E5NA 1ZELA 4ZU5A 1U5TC 4KMFA 4QQ2A 4MLOA 4PI0A 4QKNA 3WW1A 4KU7A 4I3PA 4GYGA 1CZSA 1Z6TA 4QT6A 1HCRA 4MO3M 3J7NA 2ICWG 5D8AA 5EZWA 3T0AA 3OYLA 3LGRA 5KR7A 4LLOA 4WM7B 4OHXA 3HKZN 1GR3A 3L2QA 3VBHC 2HVQA 1S7OA 2D40A 3T8TA 2CW7A 4EZ4A 2BWAA 3KF5A 2C6SA 2DBBA 4PSWA 1E3OC 1QGLA 1D0YA 1WW4A 2YC0A 1ZYRF 4UNOA 5GZCA 1XS9A 4HF1A 1W1WE 3OTFA 2V72A 5IVJA 4Q0SA 3GMEA 4E2QA 1D1AA 1POV3 4FETA 4HW0A 1RKWA 2WV0A 3JBG1 1ZZ7A 3UETA 1GZTA 2RDSA 3HBKA 3T2OA 3ZCOA 4HQEA 3LFUA 1YFHA 2ZXWH 4DQAA 1VBC1 4MNUA 1PNFA 4IHSA 1A6CA 4N9HA 1S2EA 1R5ID 2LC2A 1U12A 1V4RA 2CUJA 3E97A 2R32A 3H50A 3B9CA 1AA7A 1Z77A 4RM3A 3J7AY 3M8EA 3M3CA 1FT9A 3NAPC 4CDUC 2E71A 2FDJA 2ZAAA 4G94A 5JVGF 1AU7A 2WFF2 3P5BA 2JVHA 1VBD3 1LR5A 3EDPA 1N3PA 3W21A 4AAXA 5FYCA 2R041 4GRIA 1MBKA 4RLQA 4EJTA 4TZDA 3ZLIA 2XSJC 5FQ0B 4PDWA 5C71A 1MQTC 2E32A 1A04A 3IRRA 1KDKA 4U87A 3POWA 3O1OA 2IA2A 2P0WA 4Q4W1 4QM9A 5CQGA 1V00A 4PJLA 4X6RB 1FP2A 4U0VA 3CO2A 2K46A 2VZRA 5L9BA 5J7MA 3TGNA 1J58A 2XMLA 1HA8A 1FYUA 3EPZA 3WLUA 3KV5A 1QVTA 5ABJC 3JBG2 1YI2I 3VD9A 1NE4A 1RUE2 3VSLA 4W65A 5F7UA 2RMU2 2GNDA 5CYVA 4JRAA 2Y6GA 5F5AA 4ZH4F 3BROA 4LO6B 4F3QA 1VP6A 4XQDA 2KHMA 1VBC2 4LOTA 3FM5A 5FZOA 1BL0A 4IQ4A 4ZHNA 1GBGA 3PQKA 3D5SC 2VD7A 1IO2A 1GP6A 4MXWA 2OQ7A 2KRCA 2CV2A 5T5OA 3M4OJ 4LG3A 2XUMA 4CCNA 2Z5WA 1XG1A 2ZJRF 1JUHA 1A31A 4LOCA 2ETEA 4XBQA 2E53A 3SEQA 2OA4A 1UY2A 1JGSA 3E1SA 1VF9A 2E1MC 2R042 3OD4A 4L0ZB 4PF1A 4BQXA 2DFHA 2D5HA 3PUSA 4IE5A 4V19K 5FZ1A 2XWBB 3LKJA 3FKJA 2D97A 2Q8DA 2O0YA 4A6SA 3B02A 5JFRA 1LU2A 1U8BA 3MMYB 2O8XA 2A05A 4L8QA 1B6AA 1DGWY 2W24A 3BTJA 1ZRCA 4HKOA 3CUQA 1LESA 4TSVA 1YHFA 2ZNYA 2JG8B 3H0OA 3LZZA 3A4UA 2VZ3A 5J48A 4EM2A 1GUUA 2QBXA 1PO23 1XMKA 3KLOA 2ORXA 1ODMA 2PJRA 1Y9GA 4UY8I 2NVYJ 3N4MA 3TP0A 2XHNA 2ORZA 3MV11 4NB5A 3R05A 5F08A 3DQVC 4JKMA 4XMAA 5D5XB 1WJBA 4DJAA 3X29B 2W82A 2D1VA 4CYCB 1UOFA 3CCSI 4UFLA 4LK6A 3MUY1 1W3XA 1J7KA 2YBPA 2DCYA 2DUPA 3ACHA 3ZYBA 1MMGA 4E6KG 4AAPA 5A7PA 2YBSA 1CQTA 3WTXC 5F3CA 5BNNA 2DK5A 1KA8A 2L0KA 1KGYA 3ZX7A 2GH8A 3HBZA 4XUTA 3ZYJB 1RHI1 1HQWA 1OH4A 2E26A 4DOUA 2WDBA 5A2QZ 2A3YA 1P7IA 1TZOA 3DYMA 1RI7A 4COYA 4D5CA 3V64A 2F5DA 3W2WA 2KXLA 5A6YA 1IN6A 3U11A 4OHWA 5EFUA 1Z7S1 3MLJA 1WCMJ 1ND2C 3H3ZA 5DM7F 5J40A 1R091 1H2NA 4BAYA 3WTWC 3G3ZA 3LCPA 1Z21A 1I6HJ 2VC9A 4LA2A 5BOXA 3BG5A 3WINE 3TP3A 1O7FA 5LGUA 5F37A 2DA1A 1NUKA 2P6SA 4KICA 1B35C 3ZYPA 4BOWA 2L01A 3K6GA 3ZXAC 3ZN4A 4JGZA 2Y64A 2JE9A 1W6NA 1ND3B 2RR11 2VTXJ 2QCOA 5LGNA 1XOYA 1KS5A 4MGIE 1BYHA 5FZ8A 2E35A 4DYQA 4U0YA 4LITA 1FWZA 4FQZA 3WF0A 1U5ZA 2HWB1 3UGHA 5FZBA 4Y3OA 2L7MP 2WWSA 3FL7A 2LROA 1BQPA 5CFDC 5A7SA 3WGHA 4BMBA 2BW3B 5D6FA 2LKSA 2F5EA 2X6WA 4YVSC 3NJZA 4GZ9A 2D5VA 3S6PA 1ETQA 1XSXA 4PJYA 1BR2A 2Y34A 3TO7A 2IS1A 1D0GA 4ZONA 4Q0QA 2BGCA 1RYYA 3IIAA 5H6QA 1YITI 5JXIA 2EZKA 1BA5A 2XB5A 2EJRA 4CCJA 5APAA 2YBKA 5ICCA 1I5ZA 4Y26A 5T3NA 2P5BA 2VBWA 1XC5A 3THCA 3VBRA 1JI6A 1KQRA 4QTRA 3CU7A 1Z91A 5T54A 2YG0A 5FJHA 4PSXA 1JI8A 3OBZA 4BJ0A 3C2GA 5E1WA 1AR73 3CCVI 5HV4A 3MIHA 5EYXA 3GF6A 3OY8B 3NV4A 4HN1A 3H8RA 1VBE1 2DTYA 2HH9A 1J59A 1WVRA 2K27A 2Z3YA 2RR12 1R5GA 2VGDA 1J0RA 5DYMA 1H88C 3ZYGA 1MS3A 3BP8A 2EA2A 2G0EA 3NRVA 1EUTA 5A32B 2EFPA 4F83A 1VZ0A 3VD4A 1FYKA 5FXXA 3I4IA 5TGTA 2H27A 5D8AC 3VDDA 1R081 4UBHA 1W05A 2P6CA 2GWRA 1QJU2 3T2PA 1YHQI 3THDA 2LFBA 2KLOA 4XDQA 3NMBA 5L7OA 4L97A 1C5IA 3AG2H 3E5UA 2J22A 1DYPA 5JVVA 4GGGA 1UWWA 1XC6A 3BALA 2IT0A 3DTKA 3S5QA 1RL3A 4O6JA 4ZS3A 3W58A 3RZDJ 2RDPA 1PK6A 2UYAA 2Z79A 2ZAHA 2DTRA 3SHRA 4CP1A 5KAFC 3A0KA 5DZGA 5FRAA 4R9CA 3LMMA 4M3CB 3QH7A 4N9IA 1GXQA 1FBSA 2G7UA 3K4AA 3HN3A 3IC7A 3VD5A 1NG7A 1WA4A 3LFKA 3BQYA 3AM2A 1QO0D 3GLXA 1SBEA 1WCDJ 3FWEA 3O0WA 4P9GA 2QENA 4XW3A 4AIJA 1QZYA 2LTPA 3NWSA 2PAMA 4NC8A 4LEJA 5F3GA 1WW6A 3H92A 3AKPA 1UU6A 3WEZA 4GWJA 1WW5A 1RUH3 1QXPA 2HGCA 5JZGB 2ZMEA 3ZSMA 5GZDA 3KM5A 4C90A 2XWJB 1IRGA 2YUEA 4O7XA 1AR63 1R082 2BY0A 3CC4I 2UURA 1SFKA 2HXIA 3SKJE 3WF2A 3HZJA 2Q5TA 2L4AA 4NO4A 4B48A 5C8CB 3MD2A 2MEV1 4Q4V1 3MUZ1 2QQMA 2F6BA 2H94A 5CG8A 1W5CC 1O57A 3PIJA 4PDWC 3DF8A 2P5VA 4LLLA 4BBSJ 3HSRA 1FPN2 1Y56A 2AGSA 2GMEA 1WD4A 2WAQN 4XXPA 3HNYM 2R7FA 1LJ7A 3POEA 2LKPA 4XF1A 4P9LA 1FV3A 1APNA 1US2A 3PVNA 3CHXA 1RTVA 4A2UA 2OCEA 5F0CA 1DQ2A 3WW3A 1U6GA 1AL21 2JA8J 2F5VA 2CU5A 4LE4A 2RV8A 2ELKA 4ZPIA 2PQ8A 4YW3A 2DUOA 4L0YB 1DGLA 1X36A 2VCAA 2W85A 3HVDA 1XCVA 3UKNA 5EWSA 1Y39A 3NO8A 1OLTA 2EA4A 4H4KC 5EPAA 3WUCA 1RJ8A 2BGPA 3A0HC 1D7PM 1PM7A 5HOOA 3M8FA 1BR4A 2ARCA 2GC3A 1OBNA 5LHGA 1BIAA 3WG2A 4D6QA 1YRNA 2VQLA 1X1AA 3ZMDA 4FAGA 3FUOA 4HFSA 3DXJF 5B1BH 3CBNA 4NRPA 5LWBA 4R4XA 4HSRA 4XFGA 4LO8A 2FX0A 4E7LA 1OVSA 2W84A 3KP3A 3S3MA 5F8PA 3U1KA 2XBO3 4HN0A 4Q4V2 5T52A 2X85A 4IGOA 3M8LA 2DMPA 1W9YA 4BQ3A 5F32A 4LG0B 1W99A 2JX9A 2M0CA 5LK7B 3IDCB 5HCHA 1FP1D 2DFIA 4TYSA 4DPNA 1LHUA 4L5EA 5ILVA 1SFXA 2R4GA 3OEAA 5K7FA 5CYYA 3F8BA 5DAXA 4AVVA 1BLZA 3CUQC 4L9VA 3D8CA 2QQUA 4CCDA 1BC7C 3ZP5A 2UY9A 1AL22 2A6EF 4UF0B 1H89C 2RNGA 4ZYGA 1YO8A 1A36A 4CUAA 1TMF3 4ZTFA 1W3VA 2RAEA 4FXKB 3CJQB 3BTYA 3PM1A 3BPSA 1SCSA 2FCTA 4AQ2A 4ABZA 3VBFA 2Y60A 4CU9A 3V65A 5I93A 2I74A 3VBUB 3IN9A 2KD7A 3K2AA 1WCSA 1GT0C 1ULOA 4Q8LA 3ZGKA 4R52A 1KRIA 5IP9J 1TBXA 3VPRA 2K9MA 3DTIA 1YO5C 5BNNC 4TV7A 1K12A 2D6OX 5L9RA 2O7OA 4XKCA 2W4SA 3WGIA 4LKFA 1U5TB 2XVCA 3OBAA 2Y6JA 3VODA 3DXTA 2V7FA 1RUF2 1E3HA 1ZZCA 1WJ5A 3N9PA 2IUWA 4S05A 2XRLA 3WP3A 2BE5F 1UY1A 2MSYA 2I5UA 4AIDA 4OZXA 3L9JT 5CISA 1UYYA 1RPWA 4OUEA 1JXSA 1J83A 4F3JA 2ZABA 1MZEA 1V6IA 5EJ3A 1SC7A 5KHGA 1YJLA 1YX3A 4OZOA 3VBHB 3R0JA 3UGGA 5C5TA 3GWZA 1V5EA 1NLSA 2QQKA 5M5YJ 4L5JA 1V6JA 3ZXFA 3BTXA 3CCJI 3HPGA 4Z8BA 1BOBA 4HKLA 2LF7A 2QNKA 1POV1 4JGZC 5J4YA 3VSKA 4BQ2A 1EPZA 4NHYA 4A6EA 1KDMA 4XRSA 4GMP3 4NBQA 3WCRA 4QU1A 3B73A 4K9SA 4CEWA 2ISYA 2XAJA 2ZTNA 3VN4A 2HWC1 3CIHA 4I99C 4LB6B 2VC1A 2IXKA 1V6KA 2NYXA 1GV5A 5FLIA 3O1RA 5I8TA 4FPYA 4D0QA 1JOPA 5F3EA 2QEXI 3K70D 1XMAA 5BNOB 5ICGA 1S6LA 4NHJA 1O3RA 3NKTA 2WZPP 1FOD3 2VM9A 4FP3A 1FY7A 4NIDA 4A45A 4MEYF 2DOFA 4WK8F 1NAEA 3JCUC 1J1LA 2WZR3 1P6RA 5FLHA 1A6IA 3M8JA 1V9U3 2WSUA 2WINB 4YW2A 1VBD1 2IJLA 1YG2A 5HLIA 3V8KA 3B93A 4KG8A 4L11A 2ZGKA 3GZTB 1MDMA 5FMBA 3IAQA 2ZGPA 2VCCA 2D3RA 3F9KA 3ZFFB 4M72A 3VBRC 3OYHA 4WZCA 5A70A 1VPHA 5BV6A 1MQTB 1QWRA 4JX4A 4E7IA 5F6LB 1DDLA 3FKIJ 1RVF3 1REFA 4DZPA 4UOJA 2GMMA 2HS5A 2O8OA 2R7ZJ 4P9WA 5GAHJ 3B9IA 5EHDA 1EH6A 2B7YA 1PO11 5C6CA 4HNUA 4HDVA 2WNUB 3WU0A 5LBFA 3M1CA 1Y8QB 2DYRH 4II2A 1GVJA 3JB8A 1UJ8A 5J47A 2EV6A 3TAYA 1V6NA 1E0EA 2HWC2 4HL0A 4B29A 1VAMA 3ASNH 2WS93 2Z1DA 4WM8B 4JX6A 5FD5A 2D43A 3F6VA 1PVC2 3EYIA 3VDDC 1AXKA 4GALA 2FCVA 3BN6A 1Y4WA 1FMWA 5H9RA 2DA7A 3U75A 5L7OC 4MTEA 5IP6A 4A3CJ 3TW6A 3FIWA 1BIBA 3USSA 5FY8A 1IV8A 3WTTC 4UB8C 1ON2A 2D1HA 5FZIA 2XONA 3CLPA 1G9AA 1G3SA 3O2PE 5J8FA 1PK6C 3FLPA 1RGSA 2GXBA 1W8OA 4E9KA 1QJEA 1QHHD 5D5VB 1R1A1 2FDFA 1W9WA 4Q8KA 2DTZA 2X5IA 3RWNA 1EKEA 4X8NA 2GNBA 2QBYA 5CG9A 3FXMA 5JLXA 1ZZ6A 1HRV3 4ENNA 4F55A 2VODA 3K46A 3AKRA 2QDNA 4ZYDA 3B5LB 1S8NA 4R9BA 2VMGA 1W6MB 1JYTA 4DUVA 2QKLB 1K78B 2JQ7A 4JRLA 3E6MA 3FBNB 2D7FA 1PO12 1OPCA 4FTSA 1H8VA 4ZDPA 2OV7A 4EJWA 5DN2A 1UD1A 2QDRA 2FBHA 4WVMA 2P81A 1PO21 4RDUA 4YPJA 2JDNA 3LSGA 3HRMA 4IXAA 2VR4A 2ZMEC 3I2FA 2HR3A 3N9NA 5H2FC 2JWPA 1WGXA 3NKGA 3KMHA 3JRFA 4IJAA 2QJVA 3AZWA 4KITB 1RMU2 1YFXA 5FJKA 3UT0A 2VECA 2BUKA 3DUIA 3KT1A 2EPFA 1YXWA 4C30A 2GN7A 3I3LA 2RJLA 2OUJA 1IOAA 4D7MA 4RM2A 1C1FA 2IXHA 1ZZBA 1VBA3 3FHAA 2V09A 2MH2A 1CGPA 3ETQA 3QPTA 2NRAC 4UAPA 1XB9A 5BNGA 1R1A2 2HQRA 4A12A 5FKNA 3S1MJ 1CX4A 2P6HA 2DYSH 3FDYA 4LBMA 5CEHA 3WDTA 4FXGB 2DA4A 4P5HA 3NQOA 3A1YA 4LGWA 4BL0B 1MZBA 3WT3A 1E5SA 1MSFC 5F9TA 5K5QA 2NPIA 1IAWA 5D21A 3ACGA 3KLNA 3T0YA 4GJZA 4E7JA 3DEUA 3T30A 1I50J 2W1SA 2GA1A 1S1AA 1R23A 1ZZ9A 2P8TA 1RINA 2YROA 2J42A 2DN0A 1FEXA 3HD8B 3LSPA 2LALA 5DCMA 2BU9A 4Q5SF 3EETA 4FOWA 4IGQA 5IWFA 3VV1A 3KS7A 4FCYA 4FO9A 3ZOBA 1FATA 3PSFA 2FDHA 1EH7A 3AFHA 1N1YA 2RDRA 3AC0A 2CWSA 2L9VA 5HCAA 2ZKZA 3NNFA 2ZFUA 2XAHA 5A6QA 2XH6A 3LWCA 1XBFA 4XE9A 3ASIA 4QX8A 2NMNA 4CA0A 2AEZA 1K5MA 2HZTA 4HLYA 2VCMA 2I8DA 3ZPLA 1C8M2 1W6OA 2BYVE 5AIQA 4Y22A 1Q8PA 3K2OA 1CAXA 4HETA 5HNFA 1V70A 2BNNA 1KU3A 3POFA 1RNLA 5F1RA 4P9YA 3TQNA 3CESA 2XF7A 5FKBA 3BJOA 2VOWA 2CTVA 4CSWA 4HKWA 3SZPA 4OLLA 3J7AO 3LFMA 2HU9A 4XRSG 1ENSA 2QYOA 1SDWA 3I55I 3RJRA 4AHYA 1GZCA 4NIHA 2ZB9A 1YQ5A 2VT2A 4UVCA 1WI9A 1LHOA 4CEYA 2B4KA 3KV4A 3QPHA 4LUMA 3VBFC 1G59A 4Q4X3 3J7YJ 1UO9A 3OYDA 2BY2A 3DEEA 1AR71 1WW7A 1AOYA 4A3XA 5K7HA 2LMDA 3DLAA 3GCXA 2GAUA 1RUJ3 4M3GA 4XBNA 4EZHA 2ADUA 4QIWN 4Q48A 4LBKA 3TNQA 4PHZA 1GLNA 3G6EI 1IS5A 4E7HA 1HQCA 3LB9A 2MLGA 3WQ1A 4E27A 2FA5A 5JXGA 4WVZA 3TW7A 4FPCA 2ISZA 4P14A 1CAWA 1I1EA 2KJCA 3FZ3A 3R61A 2R7TA 4RLFA 3K48A 5D8AB 3I64A 4I6ZA 2Y26A 1YQ8A 1EH8A 2RGVA 5I0UA 3MIBA 5HXMA 1J3QA 4A3DJ 4IHYA 5FO9B 1VQ9I 2K86A 2VCBA 4QKDA 1MBGA 4F92B 5FB2A 1GZ9A 1EV12 3GFJA 3WCSA 4D7YA 1IPKA 3A7QA 3OGVA 3HBLA 4DXRA 3WDVA 4G9SB 5FZLA 1SLAA 1F4KA 2EALA 5FZMA 3MIFA 2DA3A 3AZZA 4ATFA 3CTAA 3EYPA 3PNVA 3RZGA 3ZFEB 2XC7A 4C8DA 4D5FA 1WJAA 4BQQA 1PM4A 4CEWC 1N77A 3IPVA 3VKOA 4RHV2 4KBBA 3UL2A 2X09A 2WADA 1B9NA 5AIPA 1JHHA 5H6RA 3I2GA 1YQCA 5KHKA 3KVBA 3ABTA