4NUBA

Crystal structure of escherichia coli ribosomal oxygenase ycfd
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
372
structure length
361
Chain Sequence
MEYQLTLNWPDFLERHWQKRPVVLKRGFNNFIDPISPDELAGLAMESEVDSRLVSHQDGKWQVSHGPFESYDHLGETNWSLLVQAVNHWHEPTAALMRPFRELPDWRIDDLMISFSVPGGGVGPHLDQYDVFIIQGTGRRRWRVGAALLQVDPFEAIIDEELEPGDILYIPPGFPHEGYALENAMNYSVGFRAPNTRELISGFADYVLQRELGGNYYSDPDVPPRAHPADVLPQEMDKLREMMLELINQPEHFKQWFGEFISQSRHELDIAPPEPPYQPDEIYDALKQGEVLVRLGGLRVLRIGDDVYANGEKIDSPHRPALDALASNIALTAENFGDALEDPSFLAMLAALVNSGYWFFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L16 arginine hydroxylase
publication title Structure and Functional Analysis of YcfD, a Novel 2-Oxoglutarate/Fe(2+)-Dependent Oxygenase Involved in Translational Regulation in Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 85
structure length 361
sequence length 372
ec nomenclature ec 1.14.11.47: [50S ribosomal protein L16]-arginine 3-hydroxylase.
pdb deposition date 2013-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08007 Cupin_4 Cupin superfamily protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2510 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4nubA02
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 4nubA01
5FY7A 5FXXA 5FYIA 2XMLA 4V2WA 4GAZA 4QU1A 5ANQA 4EZ4A 4LXLA 2YBKA 4Y4RA 5FYVA 5A7WB 3KV5A 5FYCA 5A3NA 4LIUA 2VD7A 5A7NA 5F5AA 5F5IA 5FZEA 3NJYA 4IGOA 3U78A 5FYYA 5FXVA 2YBSA 5FPLA 2PXJA 2YPDA 5FYBA 5FZAA 4D6QA 5LY1A 5ISLA 4CSWA 5LY2A 3PU3A 4BXFA 5FZ4A 4BU2A 2WWUA 5F3IA 5FYMA 4NUBA 5LWBA 5F5CA 4LIVA 5IVBA 5FZMA 5FP3A 5FZ0A 3KV4A 2XUEA 5FY5A 2YU2A 5FPAA 2OX0A 5FYTA 5FZCA 2OQ6A 4TN7A 4HOOA 4E4HA 5FP4A 3PURA 3RVHA 3N9LA 5FZKA 5FJKA 2OS2A 5A7WA 4HONA 4QXBA 3AL5A 5FY4A 4CCMA 4IGQA 5K4LA 5FZGA 4XDPA 5FZ8A 3ZLIA 2XXZA 4D6SA 4BISA 5FXWA 4V2VA 5FV3A 2YBPA 4QX7A 5A80A 3DXTA 5FWJA 5FUPA 3PUSA 4QXHA 5FZ7A 5FPBA 5IWFA 2GP5A 5IVVA 4XDOA 5IVYA 4CCOA 5FZHA 4C8DA 3OPWA 5FYHA 4GD4A 5F32A 5IW0A 5F3EA 5A1LA 5FPUA 5A7OA 5IVFA 5IVJA 5F39A 3N9OA 5FPVA 5FZIA 5A3TA 5A7PA 4QXCA 5A3WA 3LD8A 5LW9A 4ASKA 3KVAA 5FUNA 4DIQA 4UF0A 3KV9A 5IVCA 5A3PA 4UF0B 4URAA 4CCKA 3PUQA 2XDVA 3N9QA 5IVEA 5FBJA 5FZ3A 5FZLA 5FZ1A 1VRBA 3UYJA 4Y3OA 5FY8A 4AI9A 3AVSA 2OQ7A 5F3GA 4LITA 4IGPA 5FZBA 4CCLA 4GJZA 5FYZA 4DO0A 5FZ6A 5A1FA 3PU8A 2OT7A 3N9MA 4GJYA 5KR7A 3U4SA 2Q8DA 2GP3A 2WWJA 4QX8A 5FZ9A 5F2SA 3K2OA 5CEHA 2YU1A 5FP8A 3OPTA 5E6HA 2Q8CA 5FZFA 2W2IA 5A7QA 5FJHA 5FZOA 5FZDA 2Q8EA 5FZOB 3DXUA 3N9PA 3PTRB 3K3OA 5FY9A 4Y33A 3PUAA 5FWEA 3K3NA 4CCJA 5F2WA 5FYSA 5FXZA 5FP9A 5FY0A 4D6RA 4CCNA 5F3CA 3AL6A 3KVBA 5FP7A 4QWNA 3ZPOA 3LDBA 3AVRA 3KV6A 4AAPA 4EZHA 3PDQA 5F37A 4CUGA 3N9NA 2P5BA 5A7SA 5FYUA 5FY1A 4EYUA
chains in the Genus database with same CATH superfamily
4TLFA 3NJXA 1MMSA 5JOYA 4A0XA 4Y5SA 1XBFA 2X8KA 2EWNA 4DBQA 4MUVA 5A33B 2E7AA 1VBD1 4BU2A 3NWSA 3PTYA 3ECOA 1ZZ9A 1MDMA 1UYPA 5C4WA 3IRRA 2HWD3 3SFZA 1UWWA 3ZVXA 2Q2EA 3H1CA 4PIYA 1CAWB 1KQ8A 4P5HA 3KP6A 3FX3A 3I3EA 1C4RA 1ZBA1 3BT9A 2B39A 4XUQA 3HSEA 2HWB2 6PAXA 4WM8A 2OUHA 2FX0A 5K0UC 1ZA4A 4CCOA 4V19K 4N7UA 1WA4A 1CVNA 1YJWI 2AR6A 5EGOB 5SV5A 2Q0OA 3TOJA 1AR62 2CU7A 5M3FJ 2VNRA 2LK2A 1XSRA 4Q4X2 4C90A 3WTVC 5L3FA 1Y9QA 4AIHA 3S8PA 4UBGA 4IEPA 4Q4W2 5LK5A 3VBFB 4FE4A 4CYDA 2JA8J 4MGKE 3DEEA 3R60A 3FBIB 1HXS2 3VBUA 2M7AA 3A02A 1G4DA 5FJHA 4PLMA 2FOWA 5FIXA 5C3PA 4EM0B 5BS6A 4YW6A 3VKNA 3NKTA 3E0JB 5F08A 2CY6A 4BJ5C 4GQ7A 4P02B 5J8FA 3UGFA 4MX3A 2LALA 1DFQA 3U10A 1F1ZA 4EZHA 2VW0A 3CD6I 4FOWA 2MLGA 5A3OA 2HVQA 2VOKA 5IFTA 2GQQA 4U0WA 3MPPG 5IK4A 3RGBA 5BNNB 3KGZA 2A6XA 2F4MB 2J1SA 2HQ5A 1GV5A 5FKNA 3BB6A 1WQ2A 3P9KA 5FJKA 2KKOA 3LSPA 3HOUJ 2NLRA 2WSUA 3ZPLA 2R1DA 3CCQI 4L9TA 1SVLA 3HDDA 4P96A 2DVBA 1KITA 3U07A 3P3PA 4IEXA 3AG1H 1R082 4B29A 5C7GA 4NHJA 2KHMA 1ZBE1 3ZXAC 5IVCA 3T1LA 1YRNB 4AFMA 2VZQA 2J1RA 1GR3A 1D0GA 2AEYA 4BJ6C 2DT7B 5DMYA 4LOCA 5AONA 1MS5A 1ZZCA 3IDBB 2Y0SA 3GBFA 3LSTA 3E5UA 3A2KA 1E3PA 2CMPA 5A7QA 4RYDA 2KLOA 2Y6HA 4ZXKA 1ULCA 1UMHA 4LOSA 1DU6A 2ZGKA 1G86A 2X1EA 4DNCA 1UZ0A 2D6KA 5KWRA 2CGOA 5IAXA 4DOUA 2RR13 3TWIA 1AYN3 2WS91 2PG4A 2E51A 4C0BA 3HC7A 1EPWA 1DQ0A 2TEPA 3VZKA 2R5ZB 1BR1A 1WMEA 1MVQA 4XTMA 4DQ2A 1IC8A 1E17A 1T33A 1KJRA 4KYWA 5KHJA 1SFEA 4LBOA 1K78B 3KCYA 4B4CA 1K7AA 1QH7A 4NIHA 3O1UA 5FLHA 4OWRB 1VQ4I 1WWXA 3DN7A 4CU6A 5HOOA 2XHKA 3NJVA 2RDNA 3PIGA 4ZZLA 5DPNA 1TVGA 3RRDA 3U4XA 2OA2A 1NZCA 3D5LA 3IH2A 1YTYA 4DUVA 5CYVA 3ZM8A 1BVVA 3O5SA 1E57A 2AGSA 4D1QA 5JSRA 4RS5A 2P6TA 2HDCA 1CZVA 3CZJA 4CE8A 4ZZ8A 4KIFA 4N43A 2GXBA 4Q1PA 1CF7B 1PGL2 3V7CA 2RS13 3ZRGA 1CX4A 2Z42A 3HOTA 3K4JA 5ICFA 4KICA 2ISZA 4IXLA 5FLMJ 2Q8KA 2VMEA 5FZBA 1ULPA 4CZSA 4JHTA 4E7JA 4H55A 4DXTA 1JYCA 4K40A 5J48A 4HMZA 1VBB1 4P9UA 1HXDA 1FIPA 4E7LA 1BKZA 4CXFA 3VN4A 3SZPA 1HCRA 1W7PB 3K3NA 4MHGA 1Q8SA 5JOWA 3N7MA 2AEZA 4KMQA 3H5NA 1BIBA 3H8XA 3Q0WA 4KBBA 4MZUA 4N4OB 4ZTFA 1YQ5A 1V55H 2NYYA 4Y4YA 4Y20A 3DPTA 2VKDA 1R5HA 4A45A 1U9NA 3V42A 3C7FA 3VV1A 2RHPA 2X51A 1W36C 2ZXHA 2IWGB 1BEV1 3OYIA 3NJZA 2R7RA 1ZBA2 3WP6A 2W1OA 5DAQA 1JYWA 3M7AA 2BZDA 2JG9B 3IDEA 1V6OA 2ADUA 2WA4A 2OQ6A 1V6JA 1U5XA 3L1PA 4LO6B 1GNZA 2OD5A 1W6PA 5IOYA 1BI2A 2QZ2A 1E2XA 1GLHA 2JG8A 2HI3A 1OVSA 2GNDA 5C9AA 2B7YA 4IHXA 5C33A 2JA5J 2KMUA 1SFNA 1NK2P 3CCJI 2V26A 2TRTA 3RCOA 1I5ZA 1S5LC 4YGDA 1VAKA 2L4MA 4YSFA 1HKSA 4AQ6A 1F4AA 4WVVA 2FHRA 1MBGA 1XYOA 2GC1A 2DYRH 2HS5A 2W7NA 3UJOA 1N3QA 4M3FA 4QPIC 4EROA 3NW4A 1D8JA 2DTWA 3NAUA 3PUHA 5JHFA 2ET1A 3M3YJ 5CFCA 1XE8A 4S0HB 3DYOA 2VBYA 4KFCA 4QWNA 4ENNA 4KG0A 5FLJA 5H9PA 5LBQA 1W0PA 4AYUA 3LAGA 1VIWB 2M9HA 4GH4B 3ONQA 3T1MA 2DCKA 1N1SA 2RJKA 1R64A 3H3ZA 1SBDA 4KITB 4QKFA 5BPIA 5GZDA 2R32A 4HLYA 1SHWB 5F04A 1VLNA 1RUD3 3J8F3 3WDUA 1JGGA 3IAPA 2OKXA 2JECA 3SH4A 1U5TC 2XRLA 3ZN6A 4BQNA 4E7ZA 2YHJA 4O9EA 2OX0A 1R58A 3WDWA 2ZA9A 5J8CA 4FHTA 1OPCA 2LRPA 2SBAA 3O3KA 1XPWA 5F6FA 3K77A 1RUH3 1ZBE2 5K0UA 4OIPF 4OHWA 4YPJA 1TZLA 1HV1A 4S2DA 3I2DA 2J1AA 2C6SA 1W5TA 3C18A 3AP5A 4XIDA 1T0FC 5LB6A 5A70A 2ILMA 3B7MA 1VP6A 5FZ3A 1FYMA 1O4YA 2XH6A 1YFHA 2ATFA 4NR1A 3H5RA 3MGUA 1RR7A 2XGEA 2FF4A 3BR1A 4IQJA 3JRGA 4QX8A 4W50A 4KIBA 1L7RA 1QRYA 1DZRA 1IOAA 1W9TA 3MUZ1 2DV9A 1SAXA 1BXHA 5HXMA 2DK8A 4P08A 3WW4A 1Y7BA 2QQ8A 3K0LA 2R16A 3VFZA 1Z1DA 2R7DA 2FD5A 3OIPA 5ACA3 1JJ6C 5AIPA 2EZHA 2ZBJA 4M01A 3CP8A 4H14A 3T30A 2OCEA 1GQGA 1DG6A 5F6KA 3E7LA 4A2UA 1BOBA 4D8MA 3PHMA 5JLWA 5C3OA 2LTPA 4FISA 4XMYA 3BOPA 5M3MJ 5I0SA 2ZNYA 3LFIA 2V1UA 5D4SA 1A6CA 1UU6A 4CCDA 4CA0A 3PUIA 1IUFA 1XD7A 2BXYA 3OSFA 2W46A 1YI2I 4NHLA 4IOCF 3PIPF 1SBEA 4A4AA 2BV4A 2PBIA 2PHDA 2BVMA 1XB4A 4IRGA 2WN2A 3OYHA 2Y0MA 2QQKA 4P5YA 1GFF2 5HCHA 1S0IA 4FFFA 3WNKA 5JXGA 1OOPA 2HEWF 1Z7UA 2L5QA 3CO7C 1X9TA 3OPWA 2M8EA 3TRSB 1U5TB 5FKKA 1JGSA 1A5JA 1PJRA 2MABA 3DTIA 5D8AB 2WKKA 1O4TA 1G9DA 3DKQA 3Q0VA 1VBB2 2NZ9A 5ICCA 4OINF 1LGNA 2XJUA 1EAH3 4DRRA 4A3DJ 1RVF2 1FOD2 1T8IA 2Y64A 2CS3A 2ZXJA 5CEHA 1NLRA 1RKWA 2ZOEB 2H1KA 2X1DA 3PJQA 1U0JA 2Y9ZA 2DJNA 3C3VA 4YIIA 1ZR2A 1QXPA 2FRHA 4LUMA 1JTYA 5A6ZA 1AVBA 5EQUA 3I59A 4I09A 5FYUA 5J4YA 2BY2A 3S1MJ 2RM22 4MGIE 1SVMA 3C7JA 5E17F 4COVA 1VQ8I 4IHTA 4UUVA 4XJ9A 1ODDA 4RR3A 2EINH 2LYCA 1LOEA 1MZ6A 2FUG2 1G9AA 5AIQA 2PYTA 3N97A 3VDDA 4NPLA 4TN7A 4YFZA 4L18B 4UXNA 5K5QA 5L7OB 1PVEA 4JGYA 1ZX5A 3K1PA 5FKOA 1SLAA 1MZEA 5ABJA 2E1MC 3Q9VA 3JBG3 4XC9A 1RUF3 2J1TA 4BL0B 4XAAA 1HRV1 1ASJ3 5E79C 5HLGA 4H2AA 4U7DA 3ERMA 2OXBA 4TWTA 2FDIA 2RDRA 2JD9A 2NAZA 3ZQIA 4M9XA 3VZOA 3H8OA 2HDWA 1S2EA 1H6YA 3PL0A 4CVUA 3DUIA 4XOPA 1O4ZA 1Y4WA 2ZJ2A 4PI2A 3HSFA 3OS0A 5BMZA 2M7BA 4OU0A 2MH9A 1VNDA 4WVMA 1H88C 5KXBA 4LJHA 2ARBA 3G6JB 3POGA 4FPKA 4PJNA 2OZ6A 1OR7C 3S1NJ 5T55A 5EWSA 5FMOL 1NA1A 4AFDA 1K5JA 3A21A 2X10A 5A32A 5EJZB 4RD7A 1OFSA 3BU0A 1UYXA 2CW0F 2M2EA 2JDAA 2CQ7A 1UY1A 2I10A 2VMIA 4XJWA 4LD5A 5IUQA 2ZEWA 1CAUB 3DEUA 4CEYB 1TWHJ 1TNTA 4HN0A 2PMWB 2RS11 3UESA 3GTJJ 1QZYA 2AHQA 5CAZA 4WXCA 4JTOA 4QB2A 2OW4A 4KMFA 5LGUA 4LE3A 3WW1A 2BOLA 2JDYA 2L7MP 1GXPA 1W8FA 2O8QA 2E35A 3M3CA 1W8OA 1U5YA 4CCMA 2QM3A 2F5EA 4YM2A 2IT0A 2HU9A 2JJ6A 3D3AA 4DB5A 2HKOA 5FZ7A 3ZXSA 1GZWA 1H8TC 1GWLA 2QWWA 3CCLI 1RYYA 3WG7H 4HBNA 2M0CA 4M71A 3RSJA 5F39A 3WT3A 4JOMA 2P4EA 1NY71 2XKPA 1URXA 4BQ3A 1OHFA 2OCCH 3GWZA 2HWD2 4YZ5A 4J19A 3WTUC 4CCLA 1OSGA 3ABMH 5A1FA 2XUBA 2VBZA 1JE8A 1MH3A 2RDPA 3OYWA 4MTDA 4QKBA 2Q1MA 4A3ZA 1VMFA 4NB5A 4E9KA 4LG3A 4A5MA 5BOXA 1S1AA 3RZKA 2QKMB 4XSZF 2A71A 3KETA 5F3CA 3FM3A 3LKJA 3AVRA 1FOWA 1ZG5A 2QGUA 2VPLA 3LSKA 2VM9A 4X8NA 4F83A 4GB33 3ZQHA 1GOHA 2L7ZA 4D69A 3ZFGB 1GV2A 3TOBA 2CV6A 3BR5A 2P3IA 4XUOA 1QO0D 4G94A 4RB1A 5F8PA 1CPNA 4QGMA 3MCZA 2JX9A 5DCMA 2VU9A 5G05L 4Y1VA 2ZGQA 1H8VA 1XC6A 3EUKL 1WCQA 2F2EA 5IT6A 2XVLA 1JTXA 4UVAA 1EUTA 3CHXA 1MJBA 1JKQC 3KMHA 1SCRA 4I6ZA 4CP2A 1K83J 1IPJA 2A6ZA 5CZKA 3T0BA 3LPFA 1K61A 4ZPIA 4XFHA 3WW3A 2RKHA 1AXZA 3L09A 4ZH4F 1D4M1 4XIOA 5L3EA 1DDNA 2PLYA 1RUD1 3J8F1 2HPIA 3A0BC 3ZDVA 1OD5A 4YYOA 4WCGA 2AQEA 4EGYA 4FI9A 1NQJA 1ZA7A 1ZRIA 4HF1A 2A3YA 3AMMA 5F2WA 3EYPA 3RI9A 1RUH1 1WCMJ 2EICA 4JKMA 3VBOC 2FDKA 2TDXA 1CWPA 3NO8A 2DOEA 2VBWA 4ETSA 3TEDA 2R7SA 3HGYA 1WJEA 2JA6J 1QNYA 1QJEA 2FBEA 1R4MB 1HB2A 3ZSEA 5ILUA 4YZ3A 2OTJI 1PZ8A 1VJ2A 2BUKA 4LHKA 1Q1VA 4XJ8A 2WAQN 1C8NA 3VYRB 1UOFA 4CUAA 1TG7A 5IT9K 4OVEA 3KLOA 5HDGA 3FBNB 4LB6B 1QF3A 2Y75A 4N9HA 4BQWA 4M73A 3ZOIA 4KJZA 5DUWA 3VBHB 2RR12 4G7ZF 1AYN2 4HANA 3S2HJ 5EV7A 1HSJA 2HWC3 4WM7A 5IWFA 1XJAA 4BJ0A 3M9AA 3BVCA 5CKNA 3QP5A 5ACA1 1N78A 1V6LA 2VQGA 3L9FA 1R00A 2A5WA 3CIHA 3CDLA 1KGYA 3NMBA 1S3JA 4AI2A 3OS1A 5HCBA 2EIGA 5GTIC 2HOAA 3GUDA 1FI2A 1E5IA 2R7ZJ 1GT0C 2GALA 4RGRA 1B8IB 1ND2A 2RVAA 2C4XA 4IERA 1LKXA 3WQ1A 4BQ4A 1W6OA 2P5KA 3RPUA 1FTZA 2HH9A 2FMLA 2IUWA 1RJ8A 2RS12 5C3RA 4KL1A 5L73A 4Z6YA 3RNSA 3PSIA 3O1SA 1L3JA 3KP3A 1OQDA 1F15A 3IAQA 4K8RB 3PMSA 3AG4H 1W3XA 2YBSA 4IEUA 1B35C 3VDCA 1AOYA 5DZGA 4NE9A 3CKHA 3RG0A 1FMVA 1CPMA 1G8XA 3J7AO 5LWBA 1ULGA 1EAH1 1TT0A 4M6XA 2COBA 3HRTA 4NC8A 2XJQA 4AVPA 5JIUA 1I9RA 3BG9A 3USUB 2XBO1 2IGNA 3AL0B 2VE1A 5T54A 1NY72 3DKWA 1LKNA 2VJXA 3I54A 2AYHA 4XDOA 5IVYA 1RHI2 4UAPA 4X8PA 4GD4A 1W0OA 4JYKA 1N25A 4XONA 2MEV1 4XF3A 3HHGA 2XQRA 1R1ZA 2WQZC 4COUA 1A34A 4E7IA 1KYWA 2F5FA 2CQNA 2BGOA 5FGMA 3TO7A 1G3SA 2VODA 3Q0UA 4QB1A 2GMPA 4XF1A 3O12A 3JD73 1LOFC 1YO8A 2GC3A 4FFIA 2IS2A 1ND3C 3KEYA 1QOOA 1DIWA 2Y33A 5AFEA 2WLQA 3H92A 4M00A 3USSA 3DKXA 1OR7A 1TWFJ 3CO6C 4AGRA 3HPNA 1AWCA 4LK1F 4AL9A 3AYEA 2CW8A 5KNLA 4HV6A 1RUF1 2W92A 3JBG1 3NQOA 1ASJ1 2CFXA 3QYFA 3J7MA 5BNPC 1X2NA 1LJ7A 2GXAA 3H50A 3T0DA 2WA3A 1WA6X 3ASOH 2YPDA 3W3CA 1IZ3A 2W9XA 4K21A 4AW7A 3DEMA 4B8EA 3THDA 3NNJA 1TW3A 1ENXA 2VOXA 5J96B 1JUMA 1GOGA 2K27A 3SQNA 1AX2A 1IQDC 4N4NB 3OYDA 4EJVA 4F3QA 4BQXA 3L00A 2PHFA 4BBSJ 1WJ5A 1YLLA 1OMIA 4KG8A 4HX7A 5FWJA 3NAPC 5GP9A 1RC6A 4H4KC 2WNUB 5DG1A 4YZ2A 3PNVA 5C3SA 5EP9A 1Z91A 3TN93 2VKEA 4D3WA 1J75A 3WHCA 1QQIA 2HYXA 3GFLA 1XCBA 4P9LA 2IS4A 2P8TA 2VZOA 1HW2A 1ZRCA 3J8F2 3K6GA 1Y0NA 4CCKA 3WU1B 1FYKA 4FOQA 3S1RJ 5F3GA 3DLLF 4ZY9A 2C24A 2JK3A 3B9IA 3PU8A 3QWLA 2EFNA 1W2TA 2O8KA 4IRHA 1GXQA 3ZN4A 1FOYA 3DGTA 2VLAA 4XTPA 3L2VA 4S2HA 4XN3A 3FIWA 4PCRA 4BYYA 4P9WA 2UZKA 1YQCA 3VBSC 4F8AA 2XF5A 2MGQA 4QQOA 2HYKA 3DCQA 5E8GA 3H5AA 4XHXA 3PO3J 3SCFA 4G7HF 5CFDC 1CQTA 1SVOA 2RC4A 2BPA2 3FHQA 4AHYA 5HI0A 4M0NA 1SDWA 1XNDA 1UFMA 1GP4A 4QHBA 2LS6A 3EMRA 1CX1A 4XQDA 2LF8A 3F21A 2VZ1A 4XJZA 5EG0B 1P4WA 4JX5A 5IP6A 4CDXC 4MGRA 1EA3A 1I39A 4MGZE 2ZSIB 4L5EA 5ACA2 5JMCA 4QXBA 1LHVA 2MH2A 4FX4A 3JXSA 5GLZA 3OUHA 1N1VA 4B1RA 4IVNA 4NAMA 5F1JA 4B47A 3QP6A 2BW8A 4FFGA 3MYXA 1YWKA 4BMBA 2DUPA 3OY9A 4Q27A 4HNVA 2N8GA 1JUIA 2KDOA 2UYBA 5J98B 3PUQA 3W21A 4GB31 3MQ0A 2AACA 3N9MA 1PZ7A 5CVUA 3FHNA 5I8YA 3QU3A 4AVBA 2JVGA 1SCSA 1DPUA 2YGMA 1AYM3 5CADA 4HK9A 3IPVA 4CP9A 4A0ZA 2DO7A 3RFRA 3ABLH 5LGTA 3K3OA 4NQWA 2XGCA 4XYXA 3AZZA 1D4VB 5FJ8J 4CP1A 1HN1A 3THPA 4RGGA 2WR9A 3VBOA 1A36A 1XGMA 1REPC 1W0TA 2X09A 5C4XJ 4MVTA 2LH9A 3GTOJ 3RKWA 3G1OA 3OY8B 2VUJA 2KM2A 4MEXF 3P5BA 4XDQA 1JZ5A 2VUAA 2GBYA 1H9GA 4E8CA 4BGDA 4MGTA 2YU2A 2PFWA 1REDA 4XLFA 3IDCB 4CPBA 1PVC1 5FUIA 1VI0A 2IZWA 2PHTA 4IHSA 3S7EA 2V9KA 3C2GA 5DUKA 2HQAA 4UFJA 3WD5A 4QPGC 2BWCA 1Y39A 3NEUA 3HMYA 2NS7A 3SDGA 4CA9A 3KD4A 2QQ9A 3GTPJ 2WO2A 5HNFA 1JOBA 3HQRA 1HDKA 1PMJX 1QU3A 4IDZA 1FX7A 5JUVA 1D2QA 1O7FA 2Y38A 4YRDA 3PO2J 1FLIA 3C3WA 2D3PA 5ILSA 1ZH5A 4Y5Z0 3E5QA 4XFGA 1RKTA 4AVVA 3I3MA 4GYGA 2GNMA 1RUJ3 3JBG2 1RUF2 3KZZA 2A3XA 4Y1UA 3TBIA 1ASJ2 4AQ2A 2YYOA 4AIJA 3A1YA 3BWGA 4EE2A 3LDBA 2HWC1 1KU7A 3OSDA 1W36D 2Z33A 1LU2A 4E6KG 5FY1A 1XQNA 1OA3A 2P4WA 4PI0A 2AO9A 3U21A 2E9QA 1B35A 1DYKA 1IS5A 2XAGA 2HVSA 2QBXA 4XMAA 5IVBA 2PTMA 4BH9A 2VECA 3VWBA 4YG0A 5APAA 1XNKA 3BG3A 1SEFA 5KHIA 5IFPA 2W94A 5DXDA 3RPQA 1YCIA 1MSFC 2YC2A 4XFIA 3FL7A 2UXNA 4XN0A 4XRSA 3BJOA 1PVXA 2LUWA 4C0HA 1VBC3 4KT5C 1VRH2 1Y0UA 2V9PA 2WWSA 1ZVFA 2IA2A 5KC5A 1WJBA 1OLME 4URAA 1S7AA 3RKYA 3VZNA 1WVRA 4OMYA 3K51A 2J7MA 3BPXA 3E97A 2JPCA 3QCWA 1P7IA 3HEFA 1I1GA 3F6OA 2JZYA 3CJTB 1IUYA 1QJU3 4IETA 3J7AY 2FXAA 2D5VA 2LY1A 1YW8A 5FZDA 2WY7Q 4OI0A 1D0ZA 1J5YA 5HV4A 5L3DA 5LGNA 1D2SA 3IB3A 3F8MA 1IRFA 3J80K 1OQ1A 2D3RA 3T8TA 2Z4FA 5A2QZ 1MZBA 2J1EA 2RG4A 3ULQB 3MLLA 3PUBA 2FOKA 3SDBA 2ZAHA 2AS5F 2IW5A 2DA3A 5BNPA 4QLCU 1JODA 2IS1A 1EP0A 3POJA 2CH0A 1Q8VA 1NHAA 5T5OA 1POV3 2R7EB 3TO6A 4RA2A 3I2HA 4CUBA 1VQMI 1U8BA 1W0UA 4IHYA 3MDPA 3HHHA 5IK8A 2FNAA 3K1NA 4CEWC 1HIXA 5BPXA 5FMOS 4XKWA 1I1SA 3W2AA 1S4CA 3ZO0B 1BZWA 1ON2A 2W5FA 4BWOA 3NAPA 1UU5A 3BY6A 5DM6F 3W59A 1WJCA 4FXKB 1JUSA 2IXKA 4GB32 3P9IA 3UKVA 1W39A 3CESA 3A22A 1K4TA 2VBPA 5A7PA 4XICA 4AWXB 1FBSA 2ICWG 2R0QC 3OB8A 3I2JA 4RA0A 3ME2A 2DQLA 1Y8RB 3GNEA 5C3QA 1GLNA 5HS7A 5EHDA 2GA1A 4AHZA 4BXXJ 3ILFA 3K2OA 1W06A 2HFHA 1PK6C 1YLFA 1JOPA 2P34A 2VAUA 3ZMUA 1F8VA 3ETQA 1ALYA 3P6BA 2OPWA 3QYEA 5FXZA 1PGW2 2VZTA 4IEYA 3VBSA 4SBVA 3UJQA 3NV4A 1G59A 4XKVA 5CFDA 2RQPA 2XMLA 1ZLKA 2VNGA 1VAVA 2ZSHB 3TN91 3WDTA 4A3CJ 2WNOA 5CVIA 3VKFC 3C7HA 5FK7A 1QGPA 3RQIA 1LGBA 1S55A 3K1MA 2DVFA 1W7PA 2PXJA 1EYBA 4JQFA 3WE3A 1A6IA 2C26A 3O1RA 2JSCA 2E1CA 1WKMA 2WWYA 4CDXA 2B9VA 3BTJA 3SITA 1OYYA 3MPBA 1EH8A 3KCXA 2X53S 2FNPA 3RZDJ 4ON0A 5IT3A 2XR4A 3E1F1 5I0UA 4KWJA 3OYLA 2WAFA 2XAFA 2ELKA 2L2OA 2EA4A 2WADA 4YVSC 4JX6A 5JCTA 1MS8A 5F32A 4UY8I 2R49A 5GLWA 1UCRA 4XLHA 1GQPA 1NCQB 3BG6A 1OA2A 2PI0A 4YVWC 4I7HA 2P37A 3HAGA 4AYBN 4L5JA 4H3WA 3I2FA 5J3UA 2O0YA 3LWCA 2JN6A 4OUMA 4LITA 2DODA 2Z3YA 2LF7A 1C3HA 3VUOA 2LFBA 1X2MA 2PLV3 1J58A 2DTRA 2GOMA 1ZG1A 4LT5A 3OWTA 4CU7A 5KAFC 3S7IA 1TT5B 3POBA 3OD4A 3FJSA 2HWC2 2PHXA 2VQAA 2PA7A 3R6SA 1XRUA 4Y33A 4RAGA 4FASD 4QKNA 2BVLA 1TC3C 4DINB 1JYVA 1JW6A 1TLHB 2R073 2OQGA 3T5XA 2L02A 2NMOA 1YQ6A 1RUE3 5ANQA 3O0XA 3WCSA 3MIBA 1XSXA 4LKFA 4BEHB 4R4ZA 2E33A 5FZEA 4S04A 3KHCA 1XGOA 3RSNA 4XF0A 2I07B 5A1AA 5ISLA 1X58A 1FBQA 4QPQA 1XSQA 3LL7A 4LMFA 2XF6A 4GH4A 3BR6A 2E7WA 1K45A 2UXXA 3H9QA 3U1DA 3ETPA 3T2TA 3MW4A 4BXSV 2XHNA 2P0WA 2XVKA 2FEZA 3BI3A 2Q30A 2ADDA 2QQWA 4P9IA 2QTWB 4ZDLA 4R9CA 3K9TA 5A3TA 1OURA 5A3WA 4OQ9A 2F48A 3KT7A 3CLQA 1DGRA 1MQTC 3BR3A 2RN7A 4LK7A 3OSGA 1JYXA 4YM3A 4FP3A 3UNGC 3DPRB 1S7OA 3A7QA 3OV8A 5DV5A 4XXAA 1HRI3 3WW2A 1P4AA 1FBUA 2XAJA 1QGLA 2VPVA 2CV1A 1X19A 4OI4A 3SEPA 4RGUA 2P6HA 1PUEE 2E7QA 5CISA 1YIOA 1ZRFA 4P1WA 3FK6A 3FKIJ 3ZMZA 3ABKH 1RITA 2VW2A 5EZHA 4KN7X 2R063 1VQ9I 3OOUA 4G4FA 1XGNA 2D2WA 4B09A 3KZYA 4H7MA 3BODA 2FCUA 5CJ9A 5HNHA 4ATFA 2FQ3A 3JD72 2HGCA 1FNYA 5LY2A 3REOA 2NOJB 2WWUA 5DUVA 2D40A 2X4HA 4QHZA 2K7LA 3J81Z 1LU1A 1AR81 4S2FA 2ARAA 3RYPA 1RUJ1 3BP8A 3ZFFB 2PJRA 1LECA 4ZXEA 2ZJCA 2YG0A 1YITI 4JDNA 1QDCA 3V8KA 4MQVA 2A70A 1AKHA 3JB8A 1G3TA 5FPVA 4CH7A 3QQAA 2WV0A 2PJPA 3MZ8A 2HPMA 4IJAA 1OXCA 3KFWX 1X4OA 1R1A1 3C2UA 4Y3OA 3CUQB 1NLSA 4CUCA 3SXYA 4KI5M 1LHWA 2EXIA 2A07F 3CQZJ 5LBCA 2G9GA 1S7EA 5KXDA 4XJAA 2G1MA 4RL7A 3UR3C 4G7OF 5LEJA 3V0AB 4I0BA 2W95A 4EJRA 4G8XA 3FLPA 2P7CB 3N9PA 4UUSB 3LPGA 1QXRA 3R4SA 3TN92 4Q5SF 1UYZA 3VD9A 1BW6A 1ZTRA 2A6WA 1S72I 1H2LA 1YHFA 1HKDA 4IF4A 2H6BA 3PUFA 1VBC1 3LOCA 4OOIA 4XSXF 1ZG3A 3KM5A 2M5WA 1LFPA 2EXKA 4ARXA 4B7EA 1C8M3 1IKQA 1I50J 3F0CA 4D6QA 3MKWB 1N1TA 4NC7A 4E2QA 2X6XA 2R6QA 5KXCA 3CBNA 3VZMA 1PM4A 2VZ3A 3WG3A 1QBJA 1UIJA 5J36A 1KDMA 5T5JA 2ZEYA 1QJU1 2F4OB 4CDQB 2I8DA 1XU1A 1IPKA 1IRZA 1ODMA 1W5SA 2VZRA 5FUPA 5FPBA 1NYWA 5EEGA 4B8XA 5IW0A 2GM4A 2DYCA 3IH4A 1NQDA 2X6YA 2MC3A 2UYAA 3WODF 5L7OA 3D6EA 2DVAA 1KEXA 3HR9A 1W8ZA 1CZSA 3VHPA 3HOZJ 1UY0A 5D5WB 4QAWA 2QQIA 4PLNA 5FKCA 4I99C 5FZ6A 2GWRA 2G7UA 2YROA 3PNAA 3RMYA 2HWB3 4L9BA 3BG5A 3S16J 3C1DA 3I2KA 4C3IJ 3BPSA 2IGOA 4OAYA 4II3A 1MZFA 1USSA 2XPUA 1CONA 3VHOA 3WQ7A 4RBOA 4A44A 1HW1A 3BTLA 1HJFA 3KSCA 1P6RA 4LA3A 4BHPA 1B72B 5FFZA 3ZYHA 2BY3A 1Y1VJ 2AZ5A 1TNFA 3BKZA 1W04A 3B9CA 2FDJA 3D5OA 1COV3 2LTNA 1YQAA 2BE5F 2KJCA 1HJGA 4G9YA 2YUEA 1QQP3 2ZMEC 2MLKA 1PDNC 5LY1A 4CSWA 2XB0X 1AYM2 3I7DA 3UV9A 4PDWB 2DA7A 2WA0A 5L3GA 1UHSA 4RAYA 2VPRA 4HBLA 3WCRA 4C1XA 4NRPA 4EN8B 3LDRA 3R0RA 5FY4A 1CAUA 1YJLA 3K4MA 2H0BA 3POEA 4AI0A 3ASIA 2R1BA 3BCWA 4YVSA 3CMAI 4Q29A 3O2PE 3SH5A 1F2NA 2XAHA 5IT9Z 3ZQLA 3WNMA 2DK5A 2ZC2A 4DEVA 4BY1J 5I0DA 5L9VA 1NCRC 1NKGA 4ORFA 3VD5A 4AI9A 1I6XA 5FZLA 2E1NA 4DUXA 1LE8A 4O5VA 2E26A 5K7HA 2IVIB 2W1SA 2KXLA 2V9VA 3WY6A 3MW2A 4HN1A 2PMZA 3OPTA 4XRFA 4EV0A 3CJIB 1X8EA 1ULEA 1ZNPA 3ZMTA 4D7MA 4KU7A 1POGA 3N35A 3I5UA 3HBKA 4JTNA 4A3FJ 3AP4A 4ES9A 3QPHA 4FP2A 4Q5OA 3FWEA 2DVDA 1WI3A 5EPAA 4ZYDA 2BW3B 3HT2A 2DU1A 1RUI3 3BQYA 1SC7A 4FPHA 1NE4A 2WN3A 3POYA 5C4JJ 3GFMA 5EYYA 4XEZA 5EJCA 1RUJ2 2ET7A 2BGPA 1FPN2 2PLV1 4CXXA 3MEPA 4NPMA 5DDGA 3LA3A 3BROA 1LEAA 1UOJA 4LBKA 1X1BA 2CYYA 3CLOA 4AVCA 4LBQD 4P9JA 1IPSA 2ZMEB 3ZCOA 4RQPB 1SPPB 4QXHA 4X6QB 4ISRA 1XB9A 3NNFA 1A04A 1F43A 5KHGA 5FB2A 3BN6A 3DYMA 2XV4S 3SLIA 2R071 1DU3D 2JICA 4AHXA 2GC2A 1SZBA 5FZIA 2DURA 2CWEA 3CDHA 3OR2C 1IGOA 3BTAA 1RUE1 1QJX3 2W68A 1Q3EA 1MQTA 3VBRB 4CRQA 3HOWJ 4AEDC 1F4HA 4PJYA 1VR3A 4BDZA 4QDRA 5D8LB 3D82A 3WF1A 1H2NA 2QDNA 2DA5A 4DZGA 2L4AA 2OTLI 1NE6A 5KCMA 2W85A 1VBC2 4IEQA 2DQRA 3DPUA 3RQ0A 2R7VA 1MW7A 2CV0A 4MH0E 2WY8Q 3LF7A 2DJIA 3FISA 5DG2A 1GZCA 1JBCA 2R041 3SCHA 1Y9GA 5E16A 1RC9A 4I98B 1VQOI 4KIGA 3W5MA 1K79A 2DAOA 3IN9A 3Q5FA 4UFHA 2UY9A 4GXLA 3JRHA 2B7EA 2D6MA 1X1CA 4Q47A 3GX4X 3GHNA 2EH3A 1G3YA 5HLIA 3RI8A 4HX8A 1U8RA 2QVSB 3I4PA 1HRI1 1FXZA 4IV3C 3UKGA 5LRRA 4OUEA 1BC7C 1O91A 1BIAA 2KRFA 2VMFA 3BOQA 3MI8A 3OIQA 2ZS6B 4FQZA 2R061 2NS0A 3QPLA 2WINB 4DYQA 4XOTA 3IMNA 2VTFA 3VBHA 4UW4A 3LAPA 1BI0A 1KS5A 3CDIA 2ZX0A 2WSVA 4E4ZA 2LBFA 1LAJA 1O59A 5JZGC 5LA0A 1J3RA 5CYYA 2QKLB 4XXPA 2Y9YA 5FP8A 4OHZA 2R5YB 4D5FA 4DJAA 3GZ6A 1VQ6I 2PQQA 2PHLA 3V0BB 4KT6A 2Y6KA 4KGQA 2Z5WA 1TME3 3OGSA 2PMUA 3LEKA 1RPWA 2GLOA 3JAMZ 4A7ZA 1MNEA 1POV0 5J7MA 1HLCA 2KQRA 2VVDA 2Q1ZB 4OI2A 5FY7A 2G4IA 1LJ9A 1DUXC 4BA6A 1B8IA 3INAA 1W8HA 2BHYA 1R1UA 4Y1ZA 5E1ZB 4UNOA 1BN5A 4WM8C 3ZQFA 3GLLA 4Y7NJ 2QA4I 3AZYA 1SACA 2J5OA 3K4DA 3RTRA 3PVNA 4Y1YA 1R5ID 2CV2A 2Y0SN 5K4LA 2ES3A 2L0KA 3QRFF 4IV1B 2QSGX 4NRQA 2D98A 4Q4Y3 3POSA 3HOYJ 3GYDA 1EV7A 1I3QJ 3IZOA 3GYHX 4K7JA 1KJLA 5C44J 4HVRA 3ZMNA 1TZOA 3VBUC 3AMPA 3A23A 2RDSA 3USUA 2HXIA 1QY4A 3TEWA 1VBA3 4JDOA 4IHWA 4MYEA 5GKAC 4LR4A 3UYJA 2N7GA 5E20A 4AI1A 1KQ0A 4IV3B 3X2QH 4A6DA 1C8M1 3WINE 1PMIA 2CGNA 5F2SA 2QSHX 2W08A 2K5CA 4YG2F 5A3LA 2MD5A 4NVPA 2KPMA 1LVAA 2JT1A 2C0ZA 1VF9A 4DYCA 3NQHA 2TNFA 1ITYA 3MZHA 4INDA 1UZCA 2ZTNA 1S0CA 4YZ4A 1WCKA 5JI7A 4D9JA 1US3A 4E8DA 2JDNA 3FZVA 5C3EJ 1VFCA 3E6BA 1W28A 2R30A 2PQ8A 1CD3G 1VTNC 1UL9A 4I3GA 1JYNA 5HCAA 1YIJI 3IKTA 1HB3A 4XVHA 4AVZA 1WPKA 5C4WB 1FV2A 3JR9A 4U88A 2VG9A 4EQVA 2HWB1 1UAIA 3MKZA 4M9SA 3TL4X 1Q43A 1HC8A 4XZPA 3EYIA 1JU4A 2PAEA 1PYVA 1J3PA 1TEIA 1IS4A 2VMCA 4WM8B 1AR61 1RUE2 5D4RA 4C8DA 5BNQA 4Q4X1 2ISYA 2B0LA 4Q26A 4BIFA 4GWNA 1BM9A 1LHNA 1D1BA 4UYBA 4A6SA 5FUNA 1NCRA 4HLXA 1COV1 3HN1A 3MMYB 1VRBA 2MA3A 2VE9A 1QQP1 2WNUA 4IQPA 4C3HJ 2V5YA 1GZTA 1CQ9A 2Q8DA 2ECBA 1K5MC 2KP6A 3CZUA 5FZFA 3AJYA 3IIAA 5K1YA 2ZGTA 3VD7A 3WNLA 4LEJA 2WAQA 1XXNA 5EJ3A 3VKMA 4O9GA 4YARA 4Y22A 3OYEA 3TBDA 2ZPXA 3EETA 3EO6A 2UWAA 1MNDA 1ETVA 1DP7P 1RVF3 2IXHA 2GXGA 2W3JA 3B94A 3JUUA 2XRNA 1POQA 4HKLA 1O3QA 3AFGA 2LR8A 4UVCA 4UFKA 1HRI2 2UU8A 3ISPA 3Q9OA 3I56I 4XW3A 4G6TB 2VC0A 2VZSA 1CR7A 5FYTA 4FBFA 2M87A 4BS9A 5ICEA 3I64A 3K2AA 5FQ0B 2R062 3PFYA 1T08B 3K70C 1UIKA 2RM23 4M3CB 2ERFA 2LY9A 1HKTA 1R081 3N7LA 3KZIC 4FX0A 4ABZA 4AZZA 4NHKA 3WUDA 5JXJA 4AQTA 2JUGA 2XGXA 2V79A 2ZGSA 4EN0A 1H1IA 1IJWC 4M3CF 2DFFA 2GU9A 1RUI1 1ZN2A 1WJAA 1FAYA 5FYZA 5CQEA 3WTYC 3POFA 1ZARA 1R23A 4LA2A 3WDVA 2VCMA 1D1AA 1W05A 3OF1A 1ACCA 5C8CC 4ZKTB 4PFOA 2Y0OA 2JWPA 2D3SA 4F92B 3FF5A 2BVVA 1IG7A 1U2WA 3GCWA 4I0WB 5F7UA 1KONA 1YI9A 2IXCA 3VYUB 1LOCA 3HGGA 3ACHA 1UOGA 2ZGNA 3VSKA 3S14J 4AAXA 3AKTA 2OUJA 1TMF3 2E36A 2JDHA 4NDLA 2E60A 3AG2H 4AE2A 4XILA 3MIDA 4LULA 1DDLA 4BHBA 4B43A 2A7AA 2IGMA 2EIEA 5FYBA 1QJX1 1B59A 3IBMA 4KWUA 2Y31A 3I9V2 3MIGA 3MIFA 3ZN5A 1N47A 1RXGA 3GTLJ 3JTHA 2Y0IA 4NMIA 1GV9A 3VB2A 2DU0A 3WE2A 4N53B 2ENRA 1CJPA 3S5QA 1YC61 3H1WA 5HODA 3IP4B 3KF3A 4RS5B 2CJJA 1JI8A 4AK3A 5F3EA 3OCPA 1GVDA 1U0AA 5I0RA 1C8M2 1YS7A 1OLRA 4N43B 1HQCA 1C1FA 3I4IA 5A6QA 3LFKA 5FD6A 3GGLA 3HNMA 2DA6A 4MQ9F 2YFUA 5JZGA 2HYJA 3NWTA 4J00A 3I3DA 3IAM2 3Q8EA 2AQFA 2ARCA 2XQXA 2MW8A 4QWQA 4WZCA 3CF5F 1Y56A 3K7AJ 5IK7A 1IV6A 3UGGA 2JUCA 1FNZA 5FZOA 3J4UH 2HLEA 1MMNA 4CDWB 1SBFA 4HVOA 3M1CA 2KIUA 1OPOA 2HBUA 4Q4V3 5DUXA 4I2OA 3EUAA 2YPRA 2XPJA 1BMV1 4GALA 4LJZF 4N0BA 1DGWX 3J9SA 3HRMA 2R4GA 3OG2A 3C2BA 5FXXA 4HPKA 4Y1XA 1SFXA 2P81A 2PN5A 3SEZA 1ENRA 4Y4RA 2IVMA 4A42A 5FYCA 4Y20B 5A6YA 3NJYA 2XSDC 3LZZA 4DUWA 1IG3A 1OLTA 2CSGA 2V6EA 4Z2WA 1MBEA 4JGZC 1G3WA 5FPAA 3LSJA 2DFCA 3ZQCA 3ESWB 1XSVA 2Z99A 5K7FA 3OJBA 4IGQA 2EA7A 3QPSA 3M2MA 2GH8A 2XB5A 1GWMA 3P3NA 2QFEA 1COV2 5IPAA 5BQTA 4MSVA 2Y26A 2KL4A 1QHHD 2L3DA 3OS2A 5FBZA 2JG8B 1QQP2 5C9AB 4RLFA 5IYBJ 4QQLA 4DIQA 1OCTC 3THCA 1NLQA 5K9YA 4EJUA 3OOXA 1CAVA 1HQWA 4U0VA 2ZXQA 2RS33 1VE0A 2JRMA 1I3AA 1J9IA 2X85A 3ZOBA 2J1UA 3QD6A 4BAYA 4E7SA 2JEMA 1B1BA 2UWCA 1V6MA 3SEEA 1ZK8A 5GPCA 3BU7A 3C7EA 3DXUA 2Y48A 1OKQA 4J01A 3V8LA 5EJ1B 2VH9A 5C8WA 3O1PA 2YGLA 5CFCB 3AL6A 1UB9A 4BDVB 3O8HA 1YHQI 4Q4Y1 4J1WA 4XZUG 1ZZ6A 4AVAA 5HV0A 4LO4B 3ZQQA 2NPIA 5A3NA 4ZJZA 1IO2A 3WTZA 2FCTA 1W9YA 3MHZA 3EDPA 4QX5A 4AD9A 5I93A 1OOPC 3MV01 1HLVA 4EGZA 4BM8A 3WGIA 5T3NA 4G3YC 1Q8QA 5FZMA 2JENA 2RNJA 1RUOA 5TSWA 5J1RA 2Y8KA 3OR1C 2V09A 4DQAA 5HLTA 2GNTA 3WHTA 3S0MA 3OYMA 4ARYA 1DYOA 2LG4A 2RE9A 4XKCA 4XRMA 3WOGA 2DA4A 4BDYA 2WNVC 3PUSA 2QUOA 3ZIWA 2ZABA 5T5LA 5K0UB 1X3UA 4M72A 1WMFA 1TNRA 1RUI2 1YE9A 2EV6A 1E3OC 2AENA 2VQUA 4MO3M 4UF0A 1Z78A 3PVBB 1UY4A 4E2SA 3V7RA 2RV8A 2R92J 3GZTB 2EVXA 1XYNA 4L2NA 5KHHA 2DBIA 2HKXA 4IQ4A 1BW5A 1K5MA 5CIRA 1O5UA 3DU5A 3FMQA 3B69A 1OKRA 1RJ7A 1JZ8A 3GBGA 4D7TA 3VLBB 5DCFA 2RGVA 4Q0SA 1N3OA 1X7NA 4RR3C 2OV7A 4QTRA 1NAEA 4YEJA 1IAWA 3PDQA 5DAWA 1HDDC 4YELA 1QJX2 3VDDC 4A3GJ 2PAKA 4Q8KA 2ZGPA 1T38A 2IXJA 4MNUA 2K0GA 1ERDA 4JGYC 4Q1RA 2VOOA 3MLKA 3JRBA 4O61A 3ZDSA 2EAKA 5ABJC 4NROA 4D94A 4B3NA 3IIIA 2H94A 2QQBA 1BR2A 2P3YA 5LATA 3H0GJ 3CZ6A 2EIBA 2VXJA 2F4PA 3FXQA 3AL5A 2OPTA 1DLCA 4BZ4A 2WJSA 3ZLIA 4D6SA 4DPNA 4QX7A 2BERA 1EV13 2FSWA 1OOPB 1MZ5A 1TWAJ 3TGNA 3R61A 1V5GA 4QXCA 2NVUB 1RVF1 2HWF3 3ZFEC 1FOD1 4YW1A 2LRDA 1PX4A 1NA1C 1MEC3 3V4GA 3GMEA 3Q8FA 2WO1A 2OBPA 1QJY2 2VC1A 3CU7A 2VTXA 4GJYA 1X36A 3OEBA 1DLLA 4GGGA 1BJQA 3DFGA 1BMV2 3FMRA 5C8CA 3DQVC 3KP5A 1RHI3 5CVRA 1QVUA 5GZCA 4XF9A 4CCJA 2XL9A 4K20A 4PHZA 5M5YJ 2D6LX 1UY3A 2VKHA 2RM21 3BZ6A 1F5FA 3CC2I 4RN5A 2DCEA 3I59B 2G9FA 3WP5A 3BCBA 2YBKA 4GKYA 3NL1A 1MBHA 1LR5A 4XBNA 1UCXA 3OGVA 5F5IA 1DQ6A 5BNOA 2QE3A 4AEJA 3VYTB 2BWAA 4M3DA 1LFUP 4F55A 4RR3B 4BOWA 2W84A 2AREA 3PNTA 1YEWA 3ZYJB 1NT0A 5FZ0A 4ZDPA 4V2GA 1Z9CA 2DBNA 3T09A 1OBNA 3KLSA 1TME2 3TEXA 2B9UA 2L9RA 1ULOA 4BEHA 2YV8A 1C5HA 4QDSA 2X0LA 3NNMA 3WG2A 5FR3A 4MFDA 4RB0A 2VKVA 4LB5A 2R93J 4XCBA 4C2UA 1OCZH 1D7PM 1AR92 5A2QK 3U14A 1Z6RA 1ZGWA 2K9SA 1YRZA 2EV5A 1W6MA 5LHHA 2QQJA 4PIZA 1IHMA 4R8HA 5GAGJ 1ETQA 2FBKA 1E5SA 4I76A 1I3HA 5B3SH 2LW8A 2ZACA 2IJLA 4B44A 1TMF1 5BNGA 4K8FA 1T6BX 1VPHA 4YZ1A 2WFF3 5DN2A 3QOEA 3MIHA 2KIQA 5FLIA 4KISA 4F7ZA 1O5LA 1IN7A 4LQRA 3H1MA 4PIXA 4RGAA 3LAJA 1QOSA 3E6DA 4Q4Y2 2ZJQF 3ZYRA 4HG6B 2P7VB 3BTCA 3PQJA 3SC7X 1NA1B 3FUQA 2GMMA 3DPRA 5A32B 5C5UA 1R092 1WLWA 3FKJA 1VBA2 3I71A 1DF0A 3BC8A 3I97A 4AVTA 4B4QA 4WVZA 2DCJA 2NNYA 3EUHA 3VD3A 5FPXA 4R1HA 1W03A 4JQTA 2OF7A 1M1EB 5J47A 4Q2FA 2WZR3 3E5XA 4CDUC 3GF2A 3QACA 1W5CC 2VNVA 4JGZA 4ESJA 5IY5H 3AYDA 4XQ4A 5LK7B 1XC5A 3G73A 5FOJB 5KAIC 5AC93 4KA4A 1DPRA 2DI3A 4PFPA 1Z6TA 5A80A 2D1HA 5FO8B 4Q4V1 5FMBA 1G7YA 1GZWB 3BOWA 5H9QA 1WH7A 4PQQA 5IATA 4Q4ZF 2EIMH 4HV5A 5D6EA 1JMUB 2YMZA 2O03A 3OGJA 1RINA 3WNPA 2JDMA 4Z92B 1RGSA 2HWD1 3VL9A 2ORXA 1NUKA 2P3JA 2DFIA 5DM7F 4NIDA 3ST7A 2Y60A 1RXFA 1LCLA 3MAJA 4HDUA 3QBQA 4XUPA 3LOBA 3U4SA 1UMIA 2L7KA 3CJQB 3OBRA 1EH6A 2WTEA 4QPIB 2VO5A 2XASA 5LHGA 3ON7A 3TP3A 2KDZA 1MS3A 1JN2P 4LLGF 4XQWA 1S8NA 4ITVA 3ZN0A 1WW4A 3ABUA 2BOIA 2ZCWA 1D0YA 2H6CA 3BTIA 3FXOA 1YJNI 5JXIA 4AAPA 2CQKA 4AU7A 2VCBA 4XR6A 5HS9A 2JE7A 2XAQA 4EZ4A 4OI1A 3POWA 1K3IA 3V0AA 1LVKA 3WV6A 2VQ0A 3KP7A 4QX1A 3DBHB 4PLOA 3ZKUA 4WM7C 4DFSA 1ZLJA 4GMP0 5ILVA 5FYMA 4NUBA 4CZCA 5IYDJ 5JPMB 5K5OA 5DCMB 2RS31 5LBEA 3EYYA 4LKEA 1ACIA 5AVAA 1W2UA 3OD0A 2PFBA 2EXJA 4HKWA 2NS8A 3O1TA 1C1LA 2CRGA 1J2XA 4QDQA 4D7YA 4I01A 1XE0A 2WNVA 5D21A 3O7OA 5DQ0A 2GP5A 2IRFG 3WF0A 1KYZA 3H42B 1PX3A 4DGWB 2VMGA 5FKBA 2ZFWA 5E88A 5L36A 1ND2C 2DA1A 1R1TA 1I1EA 3FFQA 1AR73 4CDQA 2F6BA 1WZXA 4BBRJ 1SG3A 4LKSA 2WL1A 4YGEA 2RMU3 1OD3A 2BRTA 4GJZA 1L7QA 3IRQA 2JKBA 1XDSA 2EAAA 5GLTA 2JE9A 4FPLA 1MACA 3KYCB 2YU9J 2GIVA 3H7JA 3H7YA 3ZMSA 4UI9L 1OCPA 5FYSA 1J3QA 2C6YA 3O1VA 2W82A 2IAIA 1RUG3 5HS8A 3G7DA 3AYCA 1AL23 3OGGA 2EIDA 1W9FA 3AP9A 1W90A 1O4XA 4RFRB 4AGGA 1CJDA 1GUUA 2JDPA 2DMPA 1SD5A 5FMDA 2YX4A 2D6NA 2DF7A 2RR11 2XUEA 4DXSA 1AYN1 5FTTC 4CU8A 2O61A 4D0QA 3ACIA 4J25A 4Y26A 3OL4A 3KT1A 4JP0A 5TJJA 3DTKA 3OL3A 4XDPA 1ETKA 1ONVA 3HRUA 3CMMA 1XG1A 4FCYA 2ZXWH 1TMF2 1LUJB 3GO5A 2RJ2A 2VT2A 4AI3A 2WZEA 5DAPA 2CDOA 2ID3A 2LC2A 2A5ZA 4EWAA 1X3ZB 4C9YA 3ZFEA 2FQPA 2WO7A 2HTJA 3TDUC 3WX5A 3RIRA 2P6CA 1DQ4A 4YGBA 2EIJH 3WP4A 4ENMA 4JHZA 4NPRA 3H9GA 1U6GA 1J59A 2O8XA 4QPWA 4XBQA 1R7JA 3J81K 1N3PA 2F5VA 2Q8EA 2VQLA 4HYEA 1CZTA 1VRH3 1BK0A 2H8RA 4LHSA 3RZZA 2G9WA 2F6CA 3FZ3A 4BNCA 2QQOA 1W6OB 5LBBA 4JC1A 3G1MA 1LOGA 1WW5A 2VBXA 3PSFA 1JHFA 3ZXEA 2HZTA 4B1LA 1LODA 3CJIA 5FYVA 3JZVA 1CIYA 4KWKA 1JKOC 3FXUA 1Z0HA 2HWF1 3AM2A 3KE2A 3S17J 4DEQA 3IWZA 1LFBA 2VW1A 3RI4A 4CYCB 5H2FC 4LPLA 3T4VA 2IA1A 1QWRA 2K9LA 1HKQA 5K7PA 1MEC1 2BXZA 2AC1A 3I49A 4PSXA 1J83A 4Q4V2 4DW6A 2RJLA 2HZDA 1BL0A 2BW3A 4ZS3A 5M5XJ 3IC7A 1SLTA 3JRAA 1IV8A 5JHUA 3WDXA 1RHI1 5A6XA 3HUGA 1TWCJ 2YR2A 2E1MB 4Y52J 2HYGD 3HQXA 4C1WA 2A6YA 4PJJA 2WAOA 2ID6A 5IVJA 5J1YA 4PGGA 1MH4A 2VXDA 2ME0A 3VZLA 1ENHA 2R7XA 3A4CA 5L19A 3M7GA 3W20A 2D43A 4RQPA 4FPFA 1SPPA 2E2JJ 1PHMA 4QB6A 1GDTA 3P9CA 1S2KA 2BP6A 4BLIA 1X1DA 2DCZA 4BE1A 3HNYM 4CCEA 1UG0A 2HWE2 4A0YA 3ZMOA 5FY9A 3ZXDA 3ZYGA 2VXRA 3VBRA 4QT6A 3JTGA 3WR0A 1FMD3 3F8FA 3CC4I 4W65A 3A01A 2XJTA 2C5DA 3W2WA 1QVTA 3BALA 3SYTA 3WXPA 3B00A 3WGGA 3FXKA 4GXOA 3S2WA 1RIOH 5IYCJ 5H6QA 3P7NA 2RS32 2R0FA 4R9BA 1OH4A 5FXVA 3LCPA 2WV1A 1JJ8C 1JZ6A 3SFIA 1S0FA 1KXGA 1QPMA 2DYSH 2Q8OA 5K7ZA 3WNOA 2EFOA 1HW5A 2VOPA 1OC1A 2WFF1 2WB1A 4FPYA 2E19A 4CDUA 3D5RC 1NG7A 1N1YA 1UX7A 2CAVA 3AKQA 4XM3A 3LEGA 5FZCA 4F52A 4NN0A 4MG2A 1GQHA 4RM3A 2M0MA 3SKJE 2WC2A 5CKQA 1G2HA 1ULDA 3CLPA 4C2MJ 3IL2A 5FK8A 3GCXA 4H0EA 5FV3A 4G12A 1IF1A 4ITCA 3U37A 1H8TB 3TO9A 2F17A 2PHWA 2IVJA 1LDKB 2PQSA 5B2GB 4HK8A 4HNTA 2RNGA 5FO5A 3RQ4A 1GMMA 2M4KA 1RESA 4META 3PVOA 5CB7A 2XL7A 2LD5A 3FXRA 5FBJA 1UPIA 1RUNA 5DS9A 3TOAA 3S93A 1VQ5I 3K2ZA 2VQTA 1YW7A 2QYOA 4IZZA 4FXGB 1IXSB 2WZR1 4B3AA 3PMEA 2WAAA 2W39A 4OFGA 4M4RA 1JYTA 1D0XA 2WQ4A 2CW7A 4IKFA 3H3LA 1B4AA 2W52A 3CTAA 5JOXA 2HQRA 4RDUA 2WLPA 2LKSA 2EFWA 1BA5A 1NXD1 5DZFA 4QX2A 4FTHA 3M8JA 5TISC 2OAZA 4ASMB 2R5YA 3THTA 3ZSJA 5LA9A 1BVP1 1SD6A 2BTVC 4XFBA 2X5IA 4YIRX 4GA9A 3W2VA 4BXFA 3DEWA 4XORA 1XMKA 4EJTA 3J7NA 1APLC 3R0JA 1LPQA 2ZMKA 1W8UA 2QNKA 5CVVA 3GXUA 4P5OA 4YFNF 4CZZA 3GDBA 3ZYPA 1ONAA 4CCCA 3I2OA 4HONA 1H6XA 3OYJA 4OMCA 4NO4A 4LUKA 1E5RA 2JIGA 3WTSC 1JH5A 1HF0A 1TWGJ 3WP3A 2ESHA 1NTCA 2CYFA 2X1CA 5FPUA 3FXLA 1OJLA 4MGSA 5B4NA 5J37A 4RAZA 1F4KA 2Z16A 3HSRA 1PUFB 3N9QA 4IV1A 4X6AJ 3FXMA 2C1FA 4PSWA 3UKTA 4RMNA 3OBTA 2OT7A 2IGKA 2ELJA 3EHKA 4LFUA 4B4PA 2J42A 2DMUA 4HT1T 3GFIA 1UYYA 4XRSG 1EV12 4CP9B 2A5YB 2WUHA 2ORZA 3B5LB 3W6JB 3NWKA 4FPEA 4NQWB 3CC7I 4BCUA 3CEWA 1DP3A 2VNOA 1CAXB 4UHTA 2HWF2 1CIWA 4TTGA 1FSHA 4HXCA 3VBOB 3VB9A 4JRLA 1JZ2A 3NNLA 1MEC2 4NWVA 4E7KA 4X1EA 4IGOA 4E7HA 3I0TA 3LSGA 4XFAA 3OEAA 1QNTA 2D44A 3O8GA 5JSOA 1MS0A 2IC1A 2D6PA 4XIKA 5CG9A 5CKTA 1FPQA 2WDBA 1F31A 1R49A 2HYFA 1KA8A 1UQXA 2YUSA 5J1XA 4KQ7A 4DZJA 1D5YA 4QQHA 3A4UA 2G9ZA 1RUG1 2L01A 4JV4A 3OYAA 5JAXA 4ASNA 4ZHNA 1AL21 1IQAA 4P9XA 5F6LB 5C71A 1WI9A 3ZR5A 4U36A 3GEZA 1KU9A 1FOXA 3DCFA 2JD4A 3MV11 3LB9A 1GSLA 3QODA 4IO9F 4MV2A 4E2GA 1XN7A 5HDNA 4YM1A 3KV6A 1AL0G 3FDYA 1ZGAA 1WLDA 4OULA 1OUXA 5A7SA 4PQ9A 3VPRA 2ZHNA 4V2WA 1W9WA 4QU1A 5JOZA 2WFF2 1O3TA 5A7WB 2TCTA 3L2UA 4KGGA 4YW3A 4B7KA 3NARA 1B35B 1IKPA 1XPXA 4K3UA 2GZWA 4JVAA 4R9DA 4IPAA 2UY8A 3J7HA 5I0TA 1ZYBA 3AFHA 2XROA 2RV9A 1O7LA 3HKZA 3L2QA 5EYRA 2ZGOA 2RS52 1VRH1 1X8MA 2Y30A 2XVCA 4XE9A 2DTYA 2IXLA 4FOYA 2XUMA 1GU3A 3JAMK 3G71I 1YUDA 4A3XA 1FEXA 3VSLA 1MS4A 4IESA 3I2IA 4LBQB 3EPZA 4JQRA 3HXLA 3RJPA 1J1TA 3ZMVA 2Y6GA 3CCSI 5DAVA 3RWKX 2VC9A 4JBAA 1VMJA 2WZR2 5E8IA 3GXOA 3U75A 5F27A 1DGWA 5FQ0A 4GDFA 2OQ7A 4XMIA 4BB3A 4M3CA 4BQ2A 4U7BA 4C30A 3UGHA 1PP8F 1VQNI 2A3WA 1OFCX 1XU2A 5AC92 1QHGA 2JJ7A 4GFBA 1LENA 1OLQA 1ND3B 3BZKA 1BBT2 5T52A 4EEFG 2W24A 5AFBA 3H8UA 5ANNA 2FDGA 2OUMA 3AKSA 2QQPA 1STZA 3T3YA 3KT4A 3GZNB 2R7QA 2JQ7A 1A8DA 1RB8G 2BBAA 4A7YA 2ELHA 1LB2A 4A41A 2DMTA 1S0EA 4AIKA 5BNPB 2EZIA 4OYUA 1HRV3 3VDXA 3O0WA 1DGRN 3SHRA 4MFEA 2EALA 3ABZA 5GTHC 4M3CE 2JG9C 4XLCA 4BMEA 2O0OA 2VB6A 4DRVA 3KCCA 4HOOA 3PURA 2HQNA 3TYJA 3UNPA 2V4AA 5DEQA 4PGHA 3NAPB 1DBNA 3M3IA 2DVGA 5GADJ 3ITQA 1IRGA 1ZHFA 1OISA 1FMD1 3OIOA 4O6JA 4R79A 4OQ8A 1I6HJ 1HQLA 3BTZA 4LKDA 2HOEA 4N53A 3KYDB 5K8SA 2QQVA 2E32A 3VEPA 4EWDA 2SLIA 4IGPA 3ZXGA 4AIDA 4X6RB 1QPIA 5CQGA 4D7NA 1L0OC 5EYXA 1H2KA 5BUVA 2WT1A 3HTUA 1WGXA 3ZSMA 3WTWC 3VD4A 4YG3A 1LEBA 1PGW1 2NVXJ 5E1XA 1S0BA 4JK1X 2D45A 1IRXA 2CG4A 4BQ5A 5EEAA 2GA2A 3RKXA 1UHMA 1BOAA 2JRTA 3ECQA 1DZQA 3VBSB 1WRJA 3AP6A 2QZ8A 3MFAA 4RB2C 4YFXF 1AR72 3PIOF 1UU4A 2JWTA 5CFDB 5B1AH 2NP0A 4GH4C 2FDHA 1TL8A 3LQQA 1MS1A 2RMU2 2B45X 2V1DA 3PNYA 1WD3A 4CDWA 4O65A 1EJ9A 2XVGA 4AVSA 5A33A 3AYAA 3SHFA 3IV5A 4CDXB 3WGHA 4DNYA 1VBD2 4AC0A 4CGZA 1CAWA 2RREA 3KEQA 5ERIA 2YB7A 3JQWA 5BYNA 3BR2A 4Y15A 1RUG2 1UX6A 4IX7A 3OBAA 4AFBA 2VULA 4HOBA 1YQ2A 1W6QB 2OA4A 1AL22 4A6EA 1AZDA 5EGOA 1IN4A 3L2RA 4LORA 1AX0A 5ERLA 5LASA 2I2SA 1FPN3 4I30A 1TP4A 2WYSA 3C7GA 4IE0A 5I8SA 3G1LA 4XF4A 1HDPA 3VBFA 1G9CA 4H7LA 1OYIA 1LEDA 1FC3A 2J22A 4HSRA 2Y34A 3K69A 2JPBA 2B5HA 1ZQ3P 3V7SA 3JQXA 3LIGA 3PTRB 2NVTJ 2OC6A 4WZFA 1MBKA 2PHRA 3L2HA 3GW2A 3D0JA 1C28A 4YM0A 3SEQA 2UUZA 4CCNA 2BY0A 5J4VA 2WZPP 3GZ5A 3NRVA 1W8WA 4XQFA 1W3VA 4EATA 1REEA 1LDJA 3TKYA 4Z1VA 4ZZDA 2FU4A 3H3UA 1GYKA 3HOVJ 2I45A 1ZZ7A 1MJAA 1Z7S3 5G04L 5BNNA 3RZHA 3MBWA 2PAMA 2A6VA 3ROUA 5CU1A 2XWBB 3HZJA 2R7OA 4XUNA 1Z05A 2V4JC 2QCOA 5LLQA 3AZVA 4HFSA 4YW2A 3HL2A 1WWYA 4QD2A 4AQSA 5FZGA 2LVSA 2HEOA 1W8NA 5DYMA 3CP2A 1T98A 5H6RA 4QPGB 1D4M3 5EFUA 2GOXB 3S1QJ 1I5PA 5JLXA 2JA7J 1L7LA 3LD8A 5D8AC 5K5RA 2ZB9A 3KVAA 4UFMA 3WLUA 1YRNA 1F5TA 5FMCA 3LWFA 1GZ9A 1O3SA 1GICA 4HL0A 4UFIA 4M74A 4Q0PA 5FKLA 4AGVA 2DOAA 1KS4A 5E89A 2YU1A 1JZ4A 4NJ4A 1H89C 3IKVA 1TNSA 3SISA 3L2WA 2QQMA 1Y3TA 1W6NB 3HVDA 5FWEA 4MO7A 4CXYA 2R0HA 5FP7A 2L9VA 3QYBA 2E5NA 1VB4A 3HEIA 3N9NA 3JU9A 5HDKA 2P5BA 2R5ZA 3JD71 1ZRDA 4JCKA 2UURA 3OYCA 2WS92 4XETA 1EY2A 5FRNA 1D3YA 1MVEA 2IPQX 5HVQC 3V8JA 1K78A 4B48A 1I27A 2KIFA 1DGRM 2WZ8A 1SMVA 4FOVA 5C5TA 2YZ4A 2ZGLA 4O7XA 4LIVA 1RETA 5FLVA 3T2OA 2ECCA 3ILNA 2JTVA 4UT5A 3FMGA 4YGCA 5KK1A 4R4XA 3S15J 2RAEA 4AR2A 2D6OX 4A3LJ 2BGCA 4RHV3 2O1QA 5L7OC 1DZTA 2FCVA 1FMD2 2PEXA 1U5IA 5M0TA 3LDKA 3RMXA 2PMZN 2CTVA 3AAFA 2PJRB 3Q8CA 1KQ9A 5C70A 4BPZA 1UOBA 1LHOA 3ZYIB 2UWBA 2XJPA 3U0ZA 1A8MA 3I8TA 1WHUA 2GAUA 5IVFA 1FNNA 5F5QA 3WNNA 1AKHB 3N9OA 3HG9A 3LNQA 1CF7A 2EBIA 3HM5A 1IDZA 5KHDA 2ESNA 3C8XA 1IS3A 2ZKNA 4HVQA 3K4CA 4M9ZA 4LK0F 4ZU4A 2XLGA 1S29A 2R7UA 3M8LA 2VI6A 1SQ4A 4X0GA 3BJAA 3MVPA 2RQQA 4NAOA 3H1YA 1YG2A 1KRIA 2PX9A 5DUUA 4GWMA 2KZGA 4ZYAA 3OOPA 3VOEA 3F23A 4PJ0C 3CNAA 5J6XA 5FYIA 1AU7A 2XBO3 1QU0A 3VYSB 2VUDA 1BYHA 4CEYC 3G2BA 3WF3A 1FMWA 4FQGA 4Z07A 4MADA 4ZYHA 1NH3A 3KGLA 1UY2A 2E7TA 4LLOA 4OHVA 4S05A 3K46A 1BCXA 5CNAA 4CEWB 2JG9A 4KN4X 2MEV3 4J6GA 3ERED 5FY5A 3SMHA 1BEV2 3S2DJ 2XB6C 1D8KA 3N7KA 4TLGA 2R7WA 4BISA 2NVYJ 3IH3A 2QBYB 4NRMA 2DDAA 3LSMA 5I8TA 1SLIA 1TQIA 3JSPA 2FZ2A 2Z5UA 1F9NA 4OHXA 1UZZA 1T6GC 3MLJA 4URTA 2FBIA 2VN2A 3IMMA 5LW9A 2HR3A 3RPUD 1UJ8A 1YOVB 1TQMA 2VBBA 4IHVA 5FO7B 2XDVA 3ZKYA 5D5XB 1LGCA 5BV6A 3OYBA 2VJ4A 1JZ7A 3I3LA 3OBZA 4PZJA 2YDEA 4E70A 1PK6B 4L99A 2XONA 1FT9A 2WO3A 1P8JA 3IHUA 4RM2A 4WF2A 2CQQA 1K6OA 2QKDA 2QQLA 4CUGA 4RGSA 1Q8PA 2Z69A 1WH5A 5LA2A 2IP2A 1S0GA 1W2NA 4NHMA 1AYM1 3ZXJA 3ZFGC 2ZKLA 2BFUL 3CL1A 3W9AA 1XMAA 2Z9OA 1UNBA 4ZZ5A 2O5RA 2ID4A 3VKOA 5KHKA 3NSTA 4TSVA 1WZ2A 1LHUA 4XLEA 5FROA 3D8CA 5F5CA 3WUCA 2W48A 2E6VA 4KNCA 2KISA 4XL9A 2H0VA 3LOIA 3DF0A 1VZ0A 3LGRA 1PM7A 4E4HA 3RVHA 3WG9A 1ETWA 3GTGJ 3WG4A 1MBFA 4N9IA 4YVSB 1MNMC 2K2SA 4XBFA 3JRFA 3MD2A 4G6DA 4HA8A 2BOJA 2E2IJ 1PO13 3DECA 1DU0A 1Z67A 4LLFA 4YVWB 1XNAA 3DP7A 9ANTA 3EJKA 5EF6A 1FWZA 1BI1A 1LE8B 4Z2YA 1E3HA 3T1BA 1ZR4A 2VZUA 1WW6A 4IL7A 1X50A 2OYZA 2IXSA 3B01A 2FQ4A 1SEUA 1JYIA 4NIIA 3PM1A 1QIQA 5A3MA 1J09A 1UXZA 3VGIA 2CUJA 1KGSA 4IEVA 1W1WE 4WVWA 4L0ZB 4LBJA 4LBMA 4PCQA 3VHRA 3ZXLA 3MO4A 4QPIA 1W99A 3U11A 2K9QA 5EZGA 1RUC3 3ASNH 1A31A 1W0NA 5JR2A 3W6KB 1FPN1 3WHUA 4NNJA 2ZJPF 3FHIB 2YY1A 4GKXA 2DDBA 1QKQA 1SFPA 4ZYGA 4HEA2 1V5FA 2DDUA 1UZYA 4IOAF 1H9PA 4M6YA 3B3QE 2VJ5A 2VE8A 5GJ6A 1CESA 2MNGA 1EPZA 5FZKA 3CJRB 1BC8C 3VBHC 1JT6A 5C6CA 2QLZA 4DY3A 3IUOA 1OF3A 4JX4A 3M07A 5IOZA 2E5ZA 1FYUA 1U5TA 1OQYA 4UW6A 3QOPA 3I58A 4NWWA 2XLFA 5D8AA 1PMHX 2HVRA 4P9FA 4WBBA 1O8PA 2Y6FA 1MQTB 2MC4A 1CN1A 1LOBA 3Q8BA 5FFXA 3O14A 3LEIA 1Z7S1 3WQ0A 3MZYA 2STWA 3H35A 3TNQA 4DS0A 1UHWA 1OYWA 3LE0A 5D5VB 3M70A 3ES4A 3TP0A 2DFHA 3AC0A 3ZYFA 1X33A 1T0FA 4FPOB 1WLTA 3ECHA 2K9ZA 1HB1A 2WT2A 3JCUC 2B42B 4OZXA 1JI6A 1JKPC 2LDUA 3FMSA 1PVC3 1ZM1A 3WDYA 2ARXA 1E5HA 4JKLA 2JXAA 5F9TA 3W6VA 2VIXA 4EM2A 1WKYA 1FIAA 3KV5A 1YJKA 1OQEA 1Y8QB 4L9JA 4J1XA 4P9GA 5I91A 1RIRA 1YO5C 1YFWA 4JRAA 5CG8A 4L9NA 1YFXA 2DTZA 3FBMA 3K4ZA 2VY0A 3LMMA 3H8RA 5DDJ3 2KT0A 5GLUA 4KNYA 1MMDA 4FPGA 4WX9A 4OUSA 3AL0C 1AXKA 1YIPA 3V65A 2DPDA 1POV1 5EIYB 3DXJF 2P2KA 5ED4A 1PP7U 1PIV3 1RRJA 1GOFA 1W4MA 1V9U3 5FO9B 1PNGA 3UKNA 2M34A 2NYXA 2BV6A 2XJSA 3SZTA 4KWLA 2DU9A 4LLLA 2EPFA 1HRV2 1IGNA 4M3EA 3S6PA 1ZGJA 3EB7A 5FY8A 3GTMJ 3IT8A 1HA8A 3E6CC 1EF4A 3DF8A 2LBFB 4XLNF 5J09A 2EF6A 1MMGA 4OIQF 1UF2C 4UW3A 4P14A 2YX7A 4YIFA 5JIAA 2O7OA 1MS9A 3WTXC 3AZXA 2EFQA 5JR7B 1V3FA 3A0HC 2YC0A 2DUQA 4BLJA 3PUAA 4BUPA 4RHV1 3GZAA 2P3KA 2ZX4A 4CPBD 2L7FP 1BK1A 1OKOA 5FRAA 4ZU7A 3KZ4C 3DKYA 1SLLA 3AJZA 1JOJA 2DCYA 3LSHA 1F9KA 2LNBA 2JSPA 2W00A 4EJWA 2FE3A 5JVGF 4CEYA 4AEMA 2HJIA 4Y17A 3BQZA 5FYYA 4QQPA 2KIMA 3FUOA 3RYKA 3N4MA 1N75A 5JVTA 4XHBA 2E34A 3NV2A 3BLYA 2M30A 3ABTA 2YXSA 2RVCA 3H9AA 4PJLA 5D1IA 3K4NA 1JKRC 2CAUA 4DXZA 4OLLA 4A3KJ 2HOTA 1YQ8A 4E27A 4IRIA 2H27A 4Y24A 2ZGUA 1XTAA 4GRIA 2QF7A 1GWKA 4ZS2A 1ZAOA 1V6KA 2WNUC 3S3NA 4CYCA 3ACGA 2KRHA 2A6EF 1TTYA 4CP0A 5GZFA 3GZUC 2BU9A 4XFCA 3BR0A 4G9SB 4DXRA 4IE5A 1RMU3 3TQNA 3QAHA 2F5DA 3KHBA 2ZHLA 3F72A 4HDVA 1KZHA 2DA2A 2K3PA 1IN5A 3RZLA 3EQEA 4PK4A 4FTBA 1TQ5A 2DXIA 2FZ1A 3T2QA 1IXCA 2X6WA 1T39A 2F4LA 3IM0A 1H2MA 4GWIA 5LA1A 4N8MA 2LMDA 1DQ2A 5HBAA 1VAMA 3CMGA 4TYSA 4FPCA 2VL4A 1H4GA 4C2TA 3KS7A 4MHUA 2OIIA 1DQUA 5GAEJ 3I53A 3IAS2 3M8EA 2B8MA 2VZVA 3CJNA 3R4KA 1U12A 1ZYRF 1QDOA 3WF2A 4W1UA 2G7HA 3ZFGA 1OUSA 1LNSA 4C91A 1MBJA 4AF9A 3RZJA 4AFAA 1AF9A 1APNA 4FFHA 3WTTC 4Q0UA 2MFZA 2CWSA 3AX4A 4ES8A 4IE4A 4PBOA 2OS2A 3K48A 2VOWA 3WU0A 3VZJA 1B09A 3ACLA 2FMYA 3TAYA 3E3VA 3HBLA 3WZ1A 1IDYA 4KMUX 4YNIA 3CCYA 1Z7S2 4IEOA 4YWAA 2LOOA 4V2FA 1G8WA 2DMQA 1NCRB 1B9NA 4NBQA 3LIHA 1K42A 2MD0A 1YFYA 1H8TA 2LREA 2K86A 1P2FA 4A69C 2HWVA 2EQRA 2WYFA 2WWJA 4FPJA 4FETA 1R4NB 3CMYA 2ADEA 1N77A 5E6HA 1V0AA 2C9KA 1D4M2 4AXOA 2VCAA 4PF5A 1RUD2 3I3QA 2OVUA 2VVFA 4ZDOA 3AXEA 2CUFA 2G0EA 4XABA 2XKOA 2W4SA 3K10A 3KLNA 4Y22B 2GDFA 1UW8A 1G6NA 5GLVA 1SLBA 3JRDA 1T56A 1IN6A 5AVPA 1QJY3 4XFFA 3I55I 3BPVA 1PO11 1RUH2 2Q4SA 4L5IA 2V6CA 4P55A 5F64A 1BJAA 1QA6A 1HB4A 3TW6A 3FLRA 4QM8A 3F8NA 5FZ4A 5F3IA 2Z2SB 1H30A 3AFKA 5HLHA 2ZHKA 4CU9A 4YW7A 3M4OJ 1GP5A 2K02A 1EUUA 3GALA 1XNTA 3F2ZA 2A75A 3CMEI 4AI8A 2X05A 3MN2A 3GJBA 1UN1A 2DLLA 1B9MA 3FFZA 5FREA 3EXUA 4NIAA 4AG4A 3W58A 2ZGRA 2GN7A 2V1NA 2BJSA 3RDIA 5F1RA 1YYVA 2FDFA 3KYLA 1UO9A 3I2GA 3CF2A 5DUIA 3HPGA 5FFOC 2GC0A 2CSOA 1VBE3 2NQYA 1VQPI 4C3JJ 4Y13A 4P00B 3AZWA 2P5VA 1GVJA 3ZGKA 2Y2ZA 4OIRF 2QVOA 5LD2C 1DYPA 1RUC1 3AKRA 3OYKA 4AEDB 5L9BA 2CUEA 3B93A 1STMA 3DV8A 4MOAA 2DCTA 4RHV2 3HTSB 4ISQA 1W7PD 4PF1A 3H36A 1WUVA 2VASA 2B9SA 3SNMA 1AR93 3ZMDA 1UAAA 4FSJA 3AMHA 1OCCH 1PUFA 5JI6A 4A3MJ 4WXHA 2DMNA 2VQHA 3K4KA 3VL8A 1JT0A 4D6RA 1KFXL 1XCVA 2ZJRF 1QXJA 3B6AA 2D7FA 4QPYA 4TV7A 2Z79A 3KEOA 1YI7A 4RLQA 3AKZA 4BKXA 4XBLA 3KB5A 5JI9A 1MD0A 1UXXX 3H3VK 1Q1HA 4WXDA 4MXWB 3PJYA 4ZTJA 1CAXA 1V4RA 3L9JT 2O8OA 4F91B 3G6EI 4M3BA 4RB3C 1PZ9A 3GVAA 1QZEA 1R093 4FVVA 3DBLB 1EAH2 1JU3A 2VMDA 3GM8A 3MIEA 3ZR6A 1QH6A 1X1AA 3UT0A 2XBO2 2XPWA 2ZEZA 2BYVE 4NOTA 2J1VA 4DZPA 3LSDA 1Z0XA 1Y1WJ 3HPHA 3TW7A 2ZFUA 1ULYA 3KIOA 3ATGA 4XCAA 4B1MA 2TBVA 3R0AA 1DGWY 5EEHA 2O6GE 3R4UA 3GLXA 3CQOA 2MEV2 4LG0B 3CF6E 3LSRA 5JZGB 1ORKA 3BG7A 3OUJA 2WT0A 3SKVA 2FBHA 2WFPA 2VTXJ 3SQOA 1Y9MA 2MHFA 4ANJA 5DDJ1 3TMOA 2D5FA 3MFCA 5FZOB 5FAXA 3HNBM 1FSEA 1HOMA 1AHSA 2VVEA 4FAGA 5M5WJ 3RS6A 1WJDA 1SFOJ 1MDMB 4N7IA 3PQKA 4U87A 3SXWA 4UFLA 1XNCA 1ETXA 4Q0QA 1PIV1 3PJRA 3JREA 1BQPA 1V9U1 1IN8A 1AR83 4NIGA 4OMDA 4M0HA 4QHOA 4FCAA 3HBZA 2Q2EB 3KWVA 4HPKB 4GMP3 1H4HA 5GALA 2V73A 4A6OA 3LEMA 4XURA 3PL8A 3TEYA 1RR8C 1LNWA 5FPLA 2DFBA 3MWMA 1H8AC 1NZIA 2I5UA 1FZPB 3CCUI 5FOBB 3GHMA 3WF4A 4HKOA 1OLMA 4IXAA 1R1A3 2XLAA 1MR5A 1UKGA 1FJLA 3BGAA 5A7WA 3GTQJ 3KX2A 2ZO4A 1TQPA 4A3JJ 2EA2A 2JDKA 3LQRA 1MGTA 2NOGA 5TGTA 1Y6IA 4KU8A 3RYRA 3QLQA 2LKXA 3VBUB 4BJTA 2R3SA 2XGDA 5IAVA 1ETOA 4AFCA 3RZGA 2HDDA 2VT3A 1QHDA 2PELA 3SH3A 5L9RA 1Z7LA 1CAVB 4F3JA 2B46X 1A6QA 4ZC3A 4K1ZA 3S32A 2YU3A 1JXNA 4EMSA 2BVBA 2ZXIA 1NOVA 3EBRA 3JRIA 5FZ9A 3W5NA 1ST8A 2JMWA 2XJVA 3ACFA 4LBQA 2M45A 4IUGA 4M3GA 2W2IA 1Q5OA 1T2XA 3H0DA 1V00A 1MKMA 3PFIA 4W6WA 4I0AA 1TE1B 1LTEA 2YFZA 3D0SA 1PO12 3CCRI 5FP9A 5JDBA 3ZXFA 3E1SA 4GO1A 1GANA 1LQ1A 3B6CA 1LOFA 4FE7A 3L2YA 3P1IA 4YW5A 1M4WA 1ND3A 1R1VA 2XSJC 4LIUA 1LDDA 3GBWA 5EDNA 1WBLA 4V1PA 5FD5A 2A6HF 1RMU1 1WCSA 3WHBA 2UWMA 1AHDP 3V64A 5EG0A 4EJOA 1ETYA 2W1QA 2I74A 5IJRA 2W47A 2F5CA 1O8SA 3BPZA 1UELB 4B4RA 5FZ8A 4OMZA 2LLKA 1FV3A 2DWRA 4L11A 2WIIB 1S0JA 3BZCA 2BFUS 3CUOA 1RUC2 4AM3A 4UOJA 2Y69H 4CTEA 2ZX3A 5DZEA 4XK4A 3F22A 3JSOA 1ENQA 3D5SC 2X9DA 1NCQC 3DL3A 4U2AA 4ASKA 5FLXK 4XLAA 3AK0A 1V6NA 3SJMA 4UF0B 5LBFA 2M4GA 1HV0A 3LFMA 4YW4A 2CL2A 1WW7A 3AKPA 3CDZB 3T2PA 2FD8A 4GYIA 5EXOA 5A3UA 3D4KA 1DP0A 3FHAA 3O1OA 4I02A 2AUYA 3ES1A 2GP3A 3WSOA 4EN6B 1K5MB 3RZMA 1S2BA 1T2KA 2EZKA 3IKWA 2D93A 2W91A 4E4SA 3A0NA 3ZXKA 5BNOC 2YS9A 3I4NJ 5FKMA 3KVBA 5H20A 4EVIA 2VOTA 3F3XA 4NC6A 3M3EA 3NVCA 5D8KB 3ZYBA 3NV1A 2A69F 2CFOA 2QJVA 3OY8A 2EFPA 4RS8A 3U1KA 3LFUA 2ZKZA 5KBFA 3URFA 1K4SA 3ELNA 1VQ7I 3KV4A 5JFRA 4IEJA 3U2RA 1S0DA 1A35A 3KQ4B 1OH3A 1LEMA 2RDQA 1EKEA 5CPRB 1PVC2 3J7YJ 1ZREA 1JUHA 3S5AA 3CCVI 2XC7A 2GH2A 1J0RA 2Q1FA 2MBFA 1GNYA 3KV9A 1QJY1 3WG1A 5FZ1A 3T4HB 4QM9A 2CDPA 5IYYA 4A3EJ 5DDJ2 3DPRC 1W6QA 3NV3A 4W6XA 3ORJA 2IFRA 2VQCA 2H8WA 2A05A 4OZOA 5LCWL 5C8CB 3PVEA 3ELKA 2W57A 1FX5A 1PIV2 1REFA 1V9U2 3EUHC 2M3AA 4F93B 1UMZA 2QQUA 2G19A 3OYGA 2JIJA 4RSUA 3T0YA 2HEVF 2R7TA 5D6FA 3HIFA 1ZZ8A 3MICA 1YS6A 5IP9J 1DHKB 1X82A 4ESBA 3OMYA 1U5ZA 1VBE1 4LNVA 2JA2A 2Q0AA 3WU2C 5KXEA 1W6PB 2A73B 3N3HA 5BNOB 2HWE3 3OGRA 3K4AA 2ZZJA 4TXWA 1PO23 2QZ3A 1Q8OA 1TME1 5FP3A 4DBRA 2VZPA 1OI6A 2KA3A 4EWEA 2WBMA 2JDZA 5FP4A 2KFDA 1XGSA 3BDDA 3E6MA 3C7OA 2EIKH 2Y6LA 3M4FA 1AR91 2DBBA 3ZFFC 1JZ3A 1NK3P 5LZ6A 3N7JA 4BQAA 2XOMA 2ZNZA 5IVVA 2K4BA 3M1HA 4M4PA 5FYHA 4GCVA 1ZRRA 2MYSA 2KD7A 4QX3A 1WFXA 5EZWA 1W6MB 1XOYA 3DYPA 1OCOH 2YPJA 5BPDA 2AXTC 3MFKA 4ET7A 4UW5A 4YRVA 4MLOA 1H1AA 3CUQC 4HAMA 1JHNA 5LEKA 4QPGA 4JKKA 1BJZA 4AWDA 4DO0A 3BUCA 1R36A 4A3IJ 1G9BA 5KR7A 1QMJA 3ZSKA 1S6LA 2R043 1AA7A 2K9MA 3KP4A 4ZYEA 5B1BH 3FE5A 1R091 4K1YA 2E63A 3F95A 1VQKI 1VBA1 2OQRA 3O1MA 1IG0A 3R05A 1D5VA 1TW2A 4BQ1A 3ZN6B 2CO5A 4PDKA 4Q8LA 2M8GX 3U9GA 1DQ5A 2P17A 3HT1A 1RMU2 5E8AA 1KU3A 1UG2A 3T08A 2VONA 4W4ZA 3F8CA 3J7LA 4FT8A 1W6NA 1LESA 1L3LA