4NUBA

Crystal structure of escherichia coli ribosomal oxygenase ycfd
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
372
structure length
361
Chain Sequence
MEYQLTLNWPDFLERHWQKRPVVLKRGFNNFIDPISPDELAGLAMESEVDSRLVSHQDGKWQVSHGPFESYDHLGETNWSLLVQAVNHWHEPTAALMRPFRELPDWRIDDLMISFSVPGGGVGPHLDQYDVFIIQGTGRRRWRVGAALLQVDPFEAIIDEELEPGDILYIPPGFPHEGYALENAMNYSVGFRAPNTRELISGFADYVLQRELGGNYYSDPDVPPRAHPADVLPQEMDKLREMMLELINQPEHFKQWFGEFISQSRHELDIAPPEPPYQPDEIYDALKQGEVLVRLGGLRVLRIGDDVYANGEKIDSPHRPALDALASNIALTAENFGDALEDPSFLAMLAALVNSGYWFFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords 50S ribosomal protein L16 arginine hydroxylase
publication title Structure and Functional Analysis of YcfD, a Novel 2-Oxoglutarate/Fe(2+)-Dependent Oxygenase Involved in Translational Regulation in Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
total genus 85
structure length 361
sequence length 372
ec nomenclature ec 1.14.11.47: [50S ribosomal protein L16]-arginine 3-hydroxylase.
pdb deposition date 2013-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08007 Cupin_4 Cupin superfamily protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2510 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4nubA02
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 4nubA01
3K2OA 5FZ3A 3K3OA 4CCMA 2OT7A 5FZ6A 5FPBA 5ANQA 3N9OA 5FY0A 4GJZA 4DIQA 2OQ7A 4QXCA 5FJHA 2YBPA 5IVJA 5E6HA 5FZBA 3PTRB 5FZ7A 5A3PA 3LDBA 5FZAA 5K4LA 3KV4A 5FP7A 2YU2A 4LXLA 2P5BA 4CCOA 4DO0A 3PURA 5IVFA 2WWJA 4AAPA 5FY5A 4EZ4A 4CSWA 4D6SA 5LWBA 5FY9A 5A7SA 5FBJA 4TN7A 5FYBA 5FWJA 5FYVA 5FZKA 5FYZA 4BU2A 5FZLA 2W2IA 3AL6A 3ZPOA 4C8DA 5FZGA 2XDVA 5FUPA 2GP5A 5FZMA 5FPUA 5FZ4A 4EYUA 2XXZA 4V2VA 5F3EA 4BXFA 2OX0A 5FZCA 5IVCA 4IGQA 3PUSA 5FJKA 5FYMA 2YBKA 3PU8A 5F5IA 3AVSA 5FZEA 5FZOB 5A1FA 3N9PA 4CCLA 4XDPA 5A3WA 5FZ9A 5FZIA 5FP8A 3N9MA 5FY8A 5A7NA 4E4HA 4LIUA 2XMLA 5F3CA 5FXXA 4V2WA 4D6RA 5FYIA 4ASKA 3U78A 4HOOA 5FPLA 4Y33A 5CEHA 5F3IA 4Y4RA 2XUEA 5FYUA 5F2WA 5FY7A 4CUGA 5FXWA 2Q8CA 2Q8EA 5FZOA 5FYYA 3KVBA 3AL5A 4GAZA 5F5AA 4CCJA 3K3NA 4GD4A 5IVEA 5F39A 4AI9A 3PUQA 2OS2A 3DXTA 3PDQA 5F32A 4D6QA 5LY2A 2Q8DA 3OPWA 4IGPA 5FV3A 4QWNA 5FY1A 5FZFA 5IVBA 5F3GA 5FUNA 5A7PA 5FP4A 4QX7A 4LITA 4HONA 5FYTA 3KVAA 5FPAA 5IVYA 5A7WB 5A3TA 4QXBA 5FP3A 5FZ0A 3LD8A 5FZDA 2YPDA 5FY4A 3RVHA 5FYCA 3U4SA 4QU1A 4LIVA 2YU1A 5A80A 4QX8A 5F5CA 5IVVA 4UF0A 5IW0A 5KR7A 5FZ1A 3PU3A 3OPTA 5FXZA 5ISLA 3KV9A 3NJYA 5F37A 5F2SA 5FXVA 4URAA 2PXJA 4QXHA 4UF0B 5IWFA 5LY1A 4GJYA 4NUBA 5A7QA 3N9LA 3AVRA 5A7WA 3KV5A 5FZ8A 5FWEA 3UYJA 1VRBA 4CCKA 5A7OA 2YBSA 5FYSA 3KV6A 4CCNA 3ZLIA 5FYHA 5FZHA 5A3NA 2WWUA 2OQ6A 3PUAA 3N9QA 4EZHA 5LW9A 3N9NA 5FP9A 5A1LA 4XDOA 4BISA 2GP3A 3DXUA 4IGOA 2VD7A 4Y3OA 5FPVA
chains in the Genus database with same CATH superfamily
2BVLA 2KDOA 2PTMA 4UUSB 5FLVA 4U0WA 3LAGA 2VAUA 4YVSB 3HQUA 2XRNA 1R083 1UPIA 3O1OA 2CWSA 1TNRA 3FIWA 1UXZA 2VQLA 3WNNA 2DN0A 2WA0A 4CU6A 4L18B 3JD73 4L92A 2L7ZA 3I5UA 1RINA 5CLSA 4FX4A 2JG9B 2Y0MA 3CLOA 5F3CA 4EE2A 1N1VA 2P34A 5CVIA 1HDKA 2OUJA 2CV1A 3ZSLA 4XR6A 4A2UA 1CIYA 5ED4A 3WG7H 4LKDA 4XIKA 2E5ZA 3G6EI 3B94A 3J7AY 4P9JA 1R1ZA 3H8UA 2WAFA 2VMHA 1NXMA 4N7UA 4Y1VA 1I5PA 2JG9A 3W2VA 4B3NA 5C8CA 3ILNA 1Z77A 4CUAA 2K9QA 4XQWA 1F1ZA 4HA8A 4XE9A 1AR63 1W5CC 3EUHC 1W3VA 5FPAA 2OZUA 1FTZA 2WL1A 3DTIA 3ZMSA 4DZGA 1US3A 4XJ8A 3BTJA 5FZ1A 4QDRA 5FJ8J 2DPUA 3S1MJ 1NG7A 3P3PA 1ZBE2 3T8TA 1GP5A 4ARXA 1UHWA 2XV4S 2FMLA 4Y13A 3EYYA 3AFKA 1AHSA 3CTAA 1LJ7A 1LEBA 3COAC 4R9DA 4J1XA 4EQVA 2QQBA 1YYNA 4WXHA 2VO5A 1LEMA 4DY3A 4DNCA 5HOOA 3CIHA 2UWBA 4CCMA 2FDFA 4XEZA 2AZ5A 4Q4X1 4B4QA 1X1CA 4HETA 2R0FA 4GMP1 5JI6A 2OIIA 2M0MA 4BJ6C 3WF3A 3MEXA 3AYEA 3G3ZA 4ZZDA 5DEQA 1F9NA 1NKGA 2O8XA 1YLLA 2YBKA 3DU6A 3S5AA 1KS5A 4JX0A 3CNAA 1JN2P 1PIV2 1XSRA 1FPN3 1Z21A 4DFSA 1TME2 4OIRF 3SZTA 2B42B 4DS0A 2DVFA 2BBVA 2NS0A 1X1PA 1IDZA 1OQEA 2O14A 3HMYA 1W1WE 3AP5A 2VMDA 1R49A 1ND2A 1VBC2 3AL5A 2OU2A 3TO9A 2PMZN 1H1AA 4A3EJ 3CLQA 2RV8A 4RAGA 5CIRA 1OPOA 3RZKA 1C1FA 4PIZA 2QQIA 3V42A 2ZSIB 5DM7F 4JAAA 4QX7A 3HNMA 4CP9B 2RN7A 1UOFA 4CCDA 3G1LA 3E5XA 1VAVA 3NJYA 2QWWA 4AFCA 3TNPB 4XBFA 3ZIXA 1X3ZB 2MABA 3RCOA 3VDAA 5FMOL 3DPRA 4BA6A 3MLKA 5K9YA 4AYUA 2LTNA 4H2AA 3CEWA 3FWEA 4CHUA 4XLHA 2XAJA 1SHWB 3WT3A 4CXFA 5CKMA 1Q1VA 3OD4A 2KRCA 4LK1F 3E0JB 1POQA 2ZZJA 1VMHA 3SDBA 1QZYA 3X29B 2IA1A 1QQIA 3OYCA 4IHVA 2H09A 4BHCA 1W0UA 1MR5A 3FFQA 1LULA 3N9PA 3GXOA 3ZKYA 1IDYA 3KM5A 3LOBA 2VZPA 2WNOA 1O4ZA 1W8WA 4Y33A 2VOPA 2J42A 2HYKA 3TDUC 3U4XA 4Q0QA 4I02A 5K5RA 2MLGA 1U78A 1S0FA 2J1VA 3KCCA 4D0QA 4NHYA 1H30A 3BROA 4M9SA 5KAFC 4LBQD 1ZM1A 5LBEA 2XAGA 1HKTA 2HEOA 2YXSA 4URTA 1IN8A 4AHYA 2HS5A 2X0LA 2WS92 3GJBA 3W6KB 3VBHC 3JW4A 2BRTA 3BQYA 2DT6A 4YRVA 2EFOA 2YX4A 2NP0A 1UZVA 2GC3A 3N7KA 5J7MA 3J8F2 4P9FA 5HS8A 1LQ1A 4P14A 4AVTA 1EH8A 2NNNA 1WD3A 2ARCA 5KBFA 1ND2C 2R7EB 3LA7A 3MF9A 3Q9SA 4HV6A 2VW0A 1UMHA 2BWCA 2YFZA 3V0AB 1QZEA 5C71A 1K5MC 3DEEA 3ABTA 3G6JB 2XUBA 1H4GA 4FCAA 4DBQA 1STMA 2VQGA 3ZO0B 4D69A 5A7SA 3NQOA 4E7JA 3V0AA 1QXJA 4C3IJ 4AU7A 3OWTA 2MSYA 3EXUA 3HOWJ 3ZFFB 3DPRC 4XF4A 3RPUA 3WP6A 4BMBA 4CCCA 4BBRJ 1COV2 3KZYA 1K12A 3F8CA 3FBIB 2VXZA 3JTHA 5ERLA 3POIA 1WFXA 1TG7A 1QMJA 3ZFFA 1WH7A 2A68F 4DXZA 4I76A 2QTWB 2WO2A 4M3GA 1BYHA 3HQRA 3ILRA 3WE2A 1GDTA 4OAYA 1MNDA 3I2FA 1Z6RA 1OCRH 4XW3A 2MLKA 5DQ0A 5F0FA 2VZOA 1G9CA 2ME0A 3M4OJ 1ULEA 4WF2A 2ARAA 3GZEA 3TGNA 2XIGA 1HB2A 1JKPC 2V79A 4HBLA 1DZQA 1NTCA 1HJGA 2R1BA 1FPQA 3BIWE 5ANNA 1ZRCA 5D5UB 3N9LA 3F95A 3HPGA 1W6OB 3I3LA 1IPSA 1WJFA 4FOYA 2E1OA 4OI2A 3CMEI 5JSPA 2YSRA 3N4MA 4OZXA 3Q3SA 3NAUA 1AR71 1JHHA 5J4YA 1W6OA 4DIQA 1CPMA 1JBCA 4CDQA 1DU3D 4XJAA 2CDPA 4YIIA 3K4NA 3WQ7A 3NSTA 3SZPA 1S0EA 3ZXDA 2K3FA 1J9IA 1D2QA 1ZZCA 2R073 4FOWA 4DNYA 1ASJ1 1ULOA 1XTAA 1NCRB 3OY8B 4D7SA 1XDSA 5JZGB 5DMYA 4S05A 2HXIA 3BTXA 4C91A 1ZYBA 4FPKA 4EJUA 3JRHA 1AU7A 1VBA3 2R7ZJ 2VLAA 1NCRA 3OY8A 3K2ZA 3C7HA 5JZGA 4PF5A 1OKQA 2G9FA 5KXDA 1UHMA 2VBWA 2FXAA 3CQZJ 4EATA 1DGWX 4K21A 2JDKA 4AIHA 2W39A 3K46A 2HEVF 3E7LA 5ILVA 4XJWA 5FP4A 2JA8J 1C8NA 4B4RA 1FOXA 1TLHB 2ZGPA 5FY4A 3DPLC 3U4SA 3WTUC 1MS4A 5DZFA 5F5CA 1X33A 2WTEA 5J3LA 2VPLA 2MEV1 1HXS3 2DW4A 1HF0A 4DYCA 5D5WB 4KJZA 3CMMA 1SD4A 4CEYA 1K4SA 1ZYRF 3SC7X 3L2VA 4OWRB 1BBT3 1JI8A 5J48A 1CQTA 2FNPA 2OXBA 4YW4A 4PSWA 2XG3A 4LKFA 4LQRA 4A0ZA 2HWB1 2SBAA 2MPFA 1BIAA 3DF0A 2OD5A 2VKHA 2P1BA 3JSOA 1RUI3 1OBNA 3THDA 2PI0A 1JMUB 2Y0IA 3UGGA 4AOCA 2R7FA 1OPCA 4XBLA 4MGIE 5FMBA 4PJJA 1HDDC 2HU9A 2JA5J 3DPUA 4BH9A 2GNTA 1WJBA 4JK1X 4XDPA 4EWEA 1VNDA 1DP3A 2VONA 2CW0F 3LWCA 5JOXA 1EA3A 4IEUA 4RGRA 1BR1A 5HDGA 2YY1A 1PVC2 1E5HA 2VPRA 5E79C 4JYKA 1WZ2A 4ZY9A 4XORA 4JGZC 2MBFA 3KYLA 4NPMA 3W5NA 2UWCA 2RKHA 3F6OA 3K1MA 4ZDOA 2E1MC 1APNA 2HQAA 5KK1A 4ITCA 4QU2A 4F8AA 3GYDA 2R043 4LG3A 2NVQJ 3DF8A 5HS7A 2V1NA 2CQ7A 2Z5UA 5GLTA 4ZHNA 2IA0A 1UPSA 4TXWA 5IW0A 2O8KA 4MO3M 3CCSI 1I3QJ 2P5LC 4HK8A 4F3QA 4HSLA 4EM0B 2R5YB 4IEQA 2CGPA 4B4CA 2J1EA 1OMIA 2IGOA 2BERA 2D7FA 3G4SI 1G9AA 4XF3A 5CQGA 4PSXA 4HG2A 3OEBA 4NOTA 4BCUA 3SEPA 2O8OA 4AQ2A 2R5YA 2CV6A 1H6YA 1Z7LA 5JI9A 2WNUB 1R1TA 4ENKA 1BC8C 4NIDA 3CJXA 1Y6IA 1XSDA 3GTOJ 2J7MA 4A5NA 1PK6B 2ZEWA 1IHMA 2X9DA 1LGNA 4XAEA 2WNUA 4JKMA 1PNFA 4FPOB 4BU2A 2HYGD 3T5XA 2GALA 2CQNA 5C4WC 4CEYC 5ACA3 1UELB 3SQNA 2D3PA 2VUJA 4XPVA 5EZGA 1PK6A 3R4UA 2EZKA 2Y0SN 2MD5A 5I91A 1ODNA 1WBFA 3KT1A 3CJRB 4GFBA 2EAKA 1R7JA 2PA7A 2Z5WA 2O7OA 4V2GA 3BJOA 3SCGA 1TWAJ 2W1UA 3GTPJ 2FZ1A 2I8DA 4CDWC 2HWD2 1I27A 4I98B 2X48A 2Z42A 2NQYA 1X1DA 2YG0A 3CMGA 1QDCA 4OCTA 3VYRB 4KIFA 4JKLA 2YU1A 2ZNZA 3FC0A 3O1PA 3RI9A 2E7QA 1H9GA 1YWKA 4HDUA 2F5VA 4BHBA 4J6GA 1HW1A 1VBE1 2ID6A 2RS51 4HOBA 1GQHA 3O0VA 1K3IA 1YNAA 5J36A 3KV6A 4XIOA 1E17A 5LW9A 1JKRC 1ODDA 3ZFGB 2ZGUA 5IT9K 3J7MA 2K9ZA 3OYWB 1VE0A 5GZDA 1VQOI 5C7GA 3OR1C 1JE8A 5CKNA 3CCEI 2V7FA 2R062 2QQOA 5IVJA 3MGUA 3SLIA 3ZFGA 3S0MA 2DPDA 1HRV1 3HAGA 5DD4A 3K4ZA 2A6VA 1BI3A 2ADEA 4DO0A 1WMEA 1Z91A 3MDPA 1YYVA 1AKHA 3NEUA 3POJA 1LECA 5J3UA 1IQAA 3KP7A 2A5YB 1U3EM 3SHRA 1OI6A 3HUGB 5CFDB 3J7NA 1HV0A 2LYCA 2O6GE 3KS7A 2KIMA 1Z7UA 2PHRA 3SFIA 1UMIA 3V65A 1ZBA1 2A7AA 2B8MA 3ATGA 3PIPF 2TCTA 4BGDA 2V6EA 4CZCA 2H1KA 3HUGA 4P5HA 3OYEA 5CFDA 5IATA 4RGUA 3KCXA 4ZZ5A 1Q8OA 2WA3A 1IGNA 1DFQA 4QWNA 3QPLA 1YI7A 4LITA 2Z9OA 4J01A 3QLQA 4ONUA 4Y22B 4XILA 1CWPA 3BWGA 3ZSJA 4AYBN 5F37A 5JLVA 1WHUA 4LGWA 1MVQA 5D8AA 4ZJZA 4BAYA 1MQTB 5LY1A 2HI3A 1JT0A 5FLXK 2OKXA 4B47A 5JOYA 4HX8A 1GHCA 2W25A 3ABLH 4CCKA 1QIQA 2ECCA 3JRGA 3QODA 4ET7A 2ZMNA 1B72B 4Z2YA 1B8IA 2NMOA 2E7TA 2WAAA 2O03A 4W6YA 1O5UA 1QJY1 1F4KA 4RGAA 4Y3OA 2PMUA 1TL8A 3BPSA 3P9IA 1AX0A 3NQHA 2OZ6A 4UI9L 3K6GA 1B72A 4COZA 5DUXA 2E1NA 1H8TB 4Q48A 3JD71 5TGTA 3H9JA 2ZGKA 4FP3A 3RZOJ 1JYTA 2WA4A 4AQTA 3SEEA 2FOWA 2E6VA 1QQP3 4GWJA 1H8TA 1RHI1 4TZDA 1T6SA 1SCSA 3WF4A 4AM3A 1OPMA 2GC1A 5L3BA 2V1XA 4OVEA 2DFBA 1CAWB 4QPQA 1R5HA 2NN8A 1AR61 4O9EA 4YWAA 1AR72 3I4NJ 2XPUA 3O8HA 1YJKA 5T5LA 4Q4V1 3G7DA 1VQ4I 3QH6A 3FHAA 1ZZ9A 4YFKF 5B5EC 1RMU3 1YIJI 1FV2A 1QRYA 2W82A 1CAWA 2D6LX 2FX0A 2C9AA 3FHQA 1GR3A 2HKXA 4MSVA 1ASJ2 2ZX1A 3OGRA 5JOZA 4UF0A 3WR0A 1Q3EA 2VG9A 2VI6A 4Q29A 3FXJA 3JBG3 5GLZA 3IB3A 1RUD1 1UNBA 4CU8A 4NWVA 1XE0A 2BGCA 3DEUA 4PLMA 4O6JA 4XZPA 2FD8A 3TEYA 1B35C 2VGDA 3KPHA 3SHFA 3WW2A 2WKKA 4GZ9A 2B63J 3QU6A 3F22A 5G05L 2QQNA 3IHUA 2V9KA 1CAVB 4XFAA 3Q8AA 5FLMJ 3EUKL 1W06A 2QA4I 4G9SB 5ICGA 4JX5A 5D21A 4XFFA 1YOVB 5KAIC 4QPGC 1UJ8A 4ZTJA 2GU9A 1CJPA 4NQWA 4Q26A 4KIGA 2Z3YA 3DKWA 5KCMA 4IHWA 1CAVA 4XFGA 4DMIA 3V8KA 3VZJA 4YFXF 4AFDA 1OD3A 2YU9J 1CX1A 3K75B 2P3KA 4OI1A 3AMNA 2JUGA 3WG9A 3HOVJ 5EZHA 1JTZX 4AHWA 4E2QA 4L0ZB 3IKVA 3N7MA 4FFGA 3SEZA 2HWC1 2HWB2 1U5TB 3I0TA 3LPGA 4NNJA 3THCA 1GZCA 4QPOA 2A73B 3PDQA 1LDKB 1MJ9A 5IJRA 2QQJA 5DS9A 3HQXA 1J59A 3KHBA 3T0BA 5LBCA 1U5TA 1VBB3 5A7WB 2JJ6A 2JMWA 2E7AA 3OUHA 4HF0A 5EYRA 2IC1A 3PLQA 1MACA 4HVOA 5FXZA 4GULA 3RWKX 3KF5A 3G73A 2WNVC 4OUEA 2HXOA 1KDKA 3HRTA 1T8IA 4UFKA 3WF0A 2BXYA 5A7WA 1W2TA 4CEWB 3LQCA 5FYHA 1WJAA 5HBAA 2HTJA 5GPCA 1TW2A 5DUKA 3GBFA 1D1AA 3HC7A 3H0OA 4IV3B 2QZ2A 1BVP1 4GXLA 4FX0A 4Q27A 3H9AA 4HANA 1I39A 2ZABA 3CO7C 1S7AA 2IGNA 2LD5A 5I0UA 2BOJA 1AOYA 1KDMA 5KHKA 5I8YA 3VBRC 1S2BA 5APAA 4O7XA 3PURA 4LR4A 2EK5A 3ON7A 3J9SA 3WHCA 3MHZA 1NT0A 3OS2A 4LLNA 4DOUA 5K0UB 1VF9A 2PN6A 2DFEA 4ES8A 1GOHA 1WWXA 1KU7A 2BTVC 4RHV3 4BBSJ 3DYMA 2WYFA 1UL9A 2FMYA 2V72A 2WUHA 2PQQA 4GB33 5K0UA 1DPRA 1N3QA 1W36D 2XJRA 1ON2A 3VODA 1SACA 4D7MA 2VR4A 1R4MB 4BXUA 3LFIA 2XHKA 3BZCA 2VVEA 1RVF1 2CW8A 4HVRA 1HW2A 1XU1A 2ENRA 3CC4I 3A03A 2JSPA 3GFJA 3PVOA 5L9VA 2CWMA 2PHLA 1FP1D 3WHUA 3KYDB 1ERDA 3PQKA 5DN2A 5L19A 3BU0A 4BQ1A 1LDDA 4LJHA 1AL0G 3W3CA 1WUVA 2NZ9A 2VD7A 4LLGF 1V5FA 4Y4YA 3D82A 1WH5A 2DF7A 4G7ZF 5HV0A 1F8VA 1PO11 3UGHA 2H0VA 4IQJA 4XMAA 5D4SA 3BY6A 3MCZA 3GTMJ 3NL1A 4N43C 1JKOC 2K9MA 3K4CA 1SVMA 2EBIA 1D3YA 2P7VB 2HYJA 1GP4A 2VUCA 4WBBA 2XF5A 2GMPA 5FUIA 2RS52 3BB6A 1JOJA 1TNTA 1FIPA 4Q0VA 3HZJA 3BG5A 3JCIA 2QEXI 1SD7A 1QGPA 1Z6TA 2QQWA 4BY1J 1WKMA 1ETYA 1MS9A 3MF6A 4MHGA 3M4FA 4AFAA 1YXWA 3TNQA 1Y7BA 5IHRA 5FIXA 4JRAA 3H5NA 3N7LA 4LHNA 1AYM1 3CU7A 3PJYA 3ORJA 4FFHA 3CL1A 2A1XA 4W6WA 5T5JA 3GCXA 3NV4A 4KWKA 2C0ZA 3GCMA 3KEYA 1O3QA 5J96B 2OQ6A 2CQKA 4A3DJ 1OUSA 1RR7A 1G3SA 3EBRA 3P7NA 2UV1A 1LTEA 1FV3A 3DLLF 2WWSA 3OJBA 1KXGA 3WG3A 3VYTB 5IVFA 3I2HA 1AUYA 2N7GA 1VRH1 3TN91 4Y15A 5J1RA 1LRHA 5BNNC 2ERFA 1FEXA 3DFGA 3VBOA 3RS6A 4BQYA 2BPA2 2DUOA 4MLOA 5C44J 5T5OA 3D5RC 4GH4C 5BNPB 4IHTA 2Y60A 2OV7A 2ZGTA 2VPVA 3FK6A 3ZPLA 3MW2A 4C3HJ 3BU7A 5E1XA 4TLGA 2DT5A 1UO9A 5BNPA 1YW7A 3X2QH 4LHSA 4JX6A 2P3YA 1OYYA 1P92A 4DEVA 4FTBA 3LWFA 2KJBA 1VQLI 2XF7A 5JHFA 4Y7NJ 3JD72 5FZ0A 5E20A 3GZNB 4AVVA 3POBA 2A3YA 4XABA 1X36A 4AR2A 4W97A 1XCVA 5CG9A 4WVVA 3AL0C 5LA2A 2BOLA 4NHKA 1EYBA 1WLTA 1FNZA 2EB7A 2DUPA 3C2BA 2LM3A 1IW7F 4WM8B 1PMJX 1ULGA 4B43A 1PM4A 1AR93 2ZB9A 1RKTA 1NE4A 1X2NA 3WD5A 1AR62 2HBUA 2BFUL 2R3SA 4JZRA 5HCBA 2VKDA 3GVAA 4FE7A 2ECBA 1CPNA 5JPNB 4WM8A 1FOD1 4UBGA 1SFUA 2CSGA 2Y8KA 5K8SA 2RS33 2WZR3 3GUDA 4BE0A 4QKBA 4Y1UA 2WC2A 3CJQB 1VP6A 2QQ8A 2Y69H 1F5FA 4IEVA 1P8JA 2R5ZB 5BNOC 2VJ4A 4BQ4A 4JBAA 3ZXLA 3DWLE 5E3NA 2R0HA 2RM21 1FX7A 1XGSA 3I56I 3OYGA 2Q0AA 1UOJA 3NRUA 2Y75A 3ASOH 4HNTA 2BHYA 4BJ5C 4NHXA 3UKTA 4HN0A 4EN7B 2R5ZA 5F3IA 2K9NA 4CUCA 3ZYIB 2R0QC 3SISA 3AYDA 3ACIA 5JSRA 3VD9A 2DA7A 2YU3A 4XICA 2NVXJ 2ISYA 3GLLA 2XPJA 4RM3A 3UKGA 3QU3A 3ITQA 2KISA 5LATA 3ZMTA 1D7PM 5DZEA 2PXJA 1PGW1 5F27A 3GTGJ 2OAZA 3T0AA 3FHIB 5FFZA 2XBO3 2WV0A 3VKOA 3C2HA 5A6QA 1T98A 3DL3A 2F5DA 3VFZA 4E4DX 1Y3TA 4FXGB 4B44A 2HWC2 1HIXA 5DDJ1 3W21A 1UX6A 4LBQB 4CP2A 2QKMB 3ULQB 2RREA 2CDOA 2W1QA 5J1XA 3CCQI 3RZMA 5E6HA 4XOGA 5DAXA 2X4HA 3SQOA 1GBGA 2DCTA 2X6OA 4IVNA 2XKPA 4LBQA 2W3JA 3GMEA 3C7EA 1DDLA 1ULFA 1UU6A 2NVTJ 1LGCA 4D7TA 2OX0A 5EGOA 3ZXAC 5KHIA 1GV5A 1OSGA 4Z2AA 4BJ0A 2P6SA 4V2WA 4LBJA 4XIDA 3JR9A 1TP4A 1GVDA 2ADUA 3AX4A 2BW3A 2LVSA 4B8EA 3GTQJ 4JGZB 3RKYA 5GAEJ 1T95A 2MH9A 4CCJA 4H14A 4KGGA 5H9PA 1DGRN 4NAMA 4HV5A 3DPTA 1Z78A 2IPQX 1W9YA 2V9PA 4IJAA 1R1A1 2RVAA 2DVBA 1G6NA 4IQ4A 5IY5H 1XNDA 2JDNA 4HKOA 3M8JA 4B7KA 2ZJCA 4IHXA 3THPA 4FHTA 4QKDA 1I6XA 2FE3A 1KITA 3ZVXA 1W2OA 3TO7A 3GCWA 4JC1A 4P08A 4P9LA 4WVWA 1CQ9A 3EO6A 1BLZA 2UU8A 2VCAA 1RUJ3 4Y20A 4EMSA 2FOKA 5KHJA 4HZFA 1V3FA 4O9GA 3U37A 4KFCA 2VODA 3RZDJ 1L7RA 4QB2A 2AGSA 3MVPA 2E63A 2VCBA 1X9TA 5FR3A 1HSTA 4BB3A 4A44A 3NWKA 2R7XA 5C4WB 1NA1A 1UIKA 3POYA 1US2A 5T3NA 2AR6A 4PHZA 1HCRA 3BG3A 4G6TB 5FZMA 1BW6A 5DCMB 3RZLA 5ICEA 2NYYA 2UUZA 4G8XA 4IE0A 1XYOA 3HBKA 5LB6A 4AGRA 3RRDA 4XK4A 2XJSA 2QQKA 3ZN0A 2HR3A 3TOJA 3JRBA 3WDTA 3K4DA 2YV8A 2ZNYA 4Y5Z0 1TWHJ 4CUGA 3T2PA 2D6OX 1I3HA 5FOBB 1OUXA 2CUZA 2E19A 4M3DA 1FSHA 2QQVA 1PO12 4IPAA 1AJKA 3HPNA 2JA6J 3LSEA 1KONA 3MW4A 1DZRA 1WLCA 1D5YA 1WCDJ 2VBYA 1K6OA 2GOXB 1K78A 1GP6A 5FBZA 4QXBA 3GLXA 1VAKA 5BYNA 4A3IJ 3K2AA 1NCQA 2YGLA 2KZVA 2ET1A 3T0DA 4EROA 1Y39A 1YC61 2WINB 3BTLA 2ME6A 3U11A 5LK5A 5SV8A 3QPHA 5IK4A 4KYWA 2HGCA 3CF5F 2OTJI 3PQJA 2YBSA 5C3OA 3FM5A 4HX7A 4MVTA 4LKEA 1IXCA 3T09A 5CVVA 2QQUA 4XLFA 1AX1A 3ELNA 1G9DA 5A32A 5FK7A 4L5JA 4FPHA 1WVRA 2FBHA 4YGEA 2A05A 3FKIJ 1A36A 4P00B 3HG9A 4XBNA 3IIIA 1W9WA 1DZTA 4MGTA 4A6SA 4YW7A 3FMGA 3FMRA 5L7OC 4R9CA 2EV6A 3F0CA 1UWWA 3TAYA 3E6MA 1AYM2 1I1GA 3AG3H 5HNFA 4GXOA 2XB5A 2L7KA 2D5FA 3OSFA 4K8RB 3K4BA 3OR2C 1IV6A 1LB2A 1ETVA 4CDUC 1OVPA 2OUHA 5GZFA 1CAXA 1W6PA 1WLDA 3AK0A 5CADA 2VTXJ 1O4XA 4N53B 5EYXA 5AVPA 4I99C 4AG4A 1JHNA 5T5PA 3T0YA 2W85A 3U9GA 1OR7A 1QH6A 2HLEA 1GVJA 2UXNA 2ZFUA 2R072 2OTLI 2K40A 1H9WA 3L2UA 4N53A 5FLHA 4Q0PA 4JP0A 3WGHA 1JYNA 4EGZA 1ZRRA 1JZ4A 3HSFA 3P5JA 1RXGA 1Z7S1 1MZEA 1MS5A 4PIYA 4CXYA 4JOMA 1O4TA 4PDKA 1VBA2 2PHUA 3ZN5A 5LRSA 5GPAA 1PUFB 1JOBA 2XJTA 3POSA 2VL8A 5A2QZ 2BXZA 3DKQA 2XVGA 2I45A 2VY0A 3USUB 5JMOA 2JUCA 4FPJA 2A71A 5A3MA 2B7EA 1W0NA 1USTA 3WTVC 1VBD3 2HVSA 1OVSA 4AEJA 4NROA 3USUA 1P9QC 2DMUA 1MJBA 4HN1A 4N4OB 1EUTA 2C5DA 3WW1A 1Q1HA 5LHHA 3AXEA 1HXS2 2VMCA 3CKHA 2VZ1A 4DZJA 5L3DA 4LMYA 9ANTA 4E7HA 2HQ5A 2VBZA 2EAAA 1VB2A 1IN5A 1QNTA 3QPSA 1BEV3 1BBT2 2BBYA 2XDVA 2HWE1 2IS2A 4AI8A 1Z3YA 2VT2A 1FI2A 2ZXIA 4KG8A 1ZZ6A 2XL7A 4ENNA 1LKNA 4XLCA 4H7LA 4NWWA 3O0XA 3CCUI 4IESA 4RB1A 1NLQA 2QQMA 4CE8A 4Y4RA 1O7FA 4OUMA 2Q8CA 1H2KA 2KKOA 2VCMA 3ZFEC 1Z3XA 2Q2EB 3ZXEA 2AH2A 1FOD2 4PJ0C 2VU9A 1MZBA 1CF7B 4U0YA 3E1SA 3CZJA 3GBGA 2ZXWH 5FYCA 3K77A 2H8RA 3AMQA 3WDWA 1JYVA 5K5OA 5EG0B 3P3NA 1W2UA 4BHPA 2XSJC 1A6IA 4XSZF 4HK9A 2EVXA 3KQRA 1BOBA 1RC9A 1QU0A 4M0NA 1IF1A 1W9FA 3POEA 1H0MA 3RMXA 3VBSB 5E17F 3HOSA 2JICA 5EG0A 1OR7C 2H6CA 1QJU3 1ORKA 3I3MA 3BR1A 2R042 4AVPA 1HDPA 3CDZB 2F17A 4BMEA 3VBSA 2A61A 2EIBA 4FPLA 5TSWA 3BI3A 5C3EJ 2R32A 4QPGB 5DABA 5A3PA 3HHGA 1SEUA 2DVDA 5L3FA 1UYZA 1BR4A 5HDNA 2VZUA 4NN0A 4QKFA 1IXRC 1PO21 5JHUA 2W94A 4D1QA 1W8OA 5M3FJ 4WXDA 1LOFA 1F43A 5G04L 4IGQA 5LBBA 1DGRA 4PDWC 4Y1ZA 2ORXA 2GC2A 1B6AA 5IK7A 4ESFA 3LAJA 2BZDA 4I0AA 2NPIA 5F1RA 1LOBA 2H1LA 2CO5A 3IH4A 3GTKJ 2HYXA 4HOOA 4UHTA 1HB3A 1LOGA 2QGUA 5GADJ 5DDJ2 1Y8QB 2F4MB 3BG9A 1NUKA 4LUMA 1B9MA 1VR3A 4I01A 3LB9A 3ZMNA 1SMVA 2IXHA 3SYTA 1SLTA 4GQ7A 4QPWA 5C5TA 4BM8A 5ACA2 2QENA 1C8M3 1X58A 4EJTA 1G4DA 1JYWA 4CXXA 1QJX3 4QU1A 1OLMA 1ETWA 4IERA 1UB9A 1T33A 1J83A 4YVWA 4YW6A 2EINH 2L9NA 4S2HA 2GN7A 3N35A 1HV1A 4EN8B 2WWYA 1MZ6A 3T08A 3P1IA 4BQAA 5E18F 3WG2A 2PYTA 4AEDB 3LSPA 4RS5B 3MIBA 3RZZA 4ITVA 4XUQA 2GNDA 3OGGA 2L0KA 2E2HJ 1AYN1 1GMMA 1X4PA 3CMAI 4E9KA 4UFHA 2UURA 4I7HA 1FT9A 1UOBA 4AEDA 4RS5A 1UYXA 3LKJA 3O14A 2EZLA 1L3JA 4GKXA 4HLXA 1H89C 3GW2A 3TEWA 2ZCWA 2ZMEC 1HB4A 5A3WA 1NZCA 2WAEA 2BGPA 3V0BA 3MV11 4A41A 1VMFA 3AZXA 3BDDA 3VGIA 4I6ZA 1RYYA 2ZC2A 3VKMA 3AZWA 5CKQA 3OGVA 4RGKA 2W68A 4HLYA 1WKYA 3HGYA 3SJMA 3W2WA 2PQSA 3OIPA 3MIFA 4OFGA 3KZZA 5BNGA 4H4KC 3DUIA 1RKWA 4N0BA 1M1EB 4A42A 2ZSHB 3OOPA 3OGSA 4L5IA 4XQDA 5I8SA 5BY5A 2CSOA 1APLC 4BQ3A 1AXYA 2LALA 1XSQA 4XCBA 1UY4A 3KV5A 4MOAA 1CAUA 4ZH4F 2Q5TA 3JAMK 5B66C 4X6QB 1MW7A 2OZJA 2X1DA 4Y1XA 3TEZA 5C70A 3UESA 3LFMA 1V9U3 1LE8A 2EZIA 5J1YA 1EKEA 3A0HC 1V4RA 5D4RA 4XZUG 3GFIA 2ZX0A 1UHSA 2E71A 4UW6A 3A1YA 1DYOA 3FBMA 4YVWC 5CISA 3AG2H 1JT6A 2VM9A 5I93A 4IRHA 3T4VA 2EPFA 3CDIA 3HL2A 5BPDA 2C4XA 2QQLA 1FTTA 3W59A 4MFEA 5C6CA 5FKNA 4B48A 1SCRA 3O1MA 1QHDA 4QIWN 1GLHA 5F2WA 3L2QA 4L9NA 3NV3A 4WVZA 2ZKZA 2NYXA 1H0BA 3C7JA 5FTTC 3CF2A 3Q0UA 3TO6A 4FASD 1W8HA 1LKXA 5E1ZB 1OH3A 3HSRA 2UWAA 1W0OA 4KN4X 4IW3A 3MAJA 1KRIA 1EAH1 1R093 4AGGA 2VCCA 3VZLA 3S17J 4YGCA 1KQ0A 2ZS6B 2UZKA 4UNOA 4OHYA 2AUYA 2QNKA 2L02A 4FFIA 5FWEA 3IMNA 4ORFA 1D8KA 1JGGA 4HAMA 4DXRA 1TWGJ 3C3VA 1LHVA 2BGOA 4JHZA 2BZTA 2TNFA 4BISA 1ZELA 3HXLA 3O1TA 4KIBA 1SDWA 1POV3 2RS31 3T2TA 2WZR1 3HR9A 2ZGSA 3UJQA 4ZU7A 3VB2A 1ETKA 1D0ZA 1GZWB 4NHMA 4BKXA 2E32A 3JBG2 2P5BA 4O5VA 4ZDPA 1QVTA 4S04A 2PBIA 2WBKA 2W87A 1PVEA 3H1CA 3IAS2 4MX3A 2EIMH 4GH4B 3GM8A 4NJ4A 3FX3A 2RNJA 1AR83 3MIHA 1MJAA 3VV1A 2G9WA 5J1UA 3PFYA 5A6YA 4ZPIA 4XUPA 2RJKA 4AQSA 4AI2A 1OFCX 2GQQA 4DUXA 4AHXA 5LHIA 2DA4A 3OSGA 3LZZA 4NO4A 1S0JA 1KQRA 5D6FA 2OPWA 3OPZA 4L0PA 5E89A 2MGQA 3CJNA 1XRUA 1BA5A 2WADA 3ZMUA 1MS0A 4G12A 3W5MA 2JX9A 2L4MA 2DA5A 2W52A 3LPFA 3GFMA 5ILUA 2IZWA 2FJ1A 2XAUA 2BV4A 2HWE2 1OH4A 2ZTNA 3CDLA 4U88A 1Z1DA 1RJ7A 3LGRA 2YPRA 4F3JA 2K4JA 5CNAA 4A7ZA 4ENJA 2QUFA 1R1VA 1Q8VA 2ZKLA 3IZOA 2JVHA 2F5CA 4BNCA 3NJXA 5F08A 2P6HA 1YO8A 3VN4A 3U10A 1ON1A 4HVQA 2RS11 2YBPA 4CZZA 1ZRIA 1SDDB 4HFSA 4NIAA 2QZ3A 2KZGA 3KT7A 5CB7A 1M06G 1HKSA 3F6VA 3DTEA 3GFLA 3HSEA 2DDAA 4XXPA 1EUUA 2ZZQA 3VZMA 2J1RA 1Q8SA 2WR9A 3K70D 1UN1A 4CYCB 1MS8A 1C5HA 1HA8A 2NS8A 2D43A 1P4XA 2B9SA 3LDKA 3OY9A 3GZ6A 2VIXA 3ME2A 1FMD3 2X1EA 3JCUC 4LPLA 3GALA 2LTPA 4XLAA 3TEDA 1BI2A 5IYDJ 2GZWA 3VKLA 3POWA 1MMNA 2RAEA 2C26A 4C1WA 1NE6A 3V7RA 5M3MJ 4QQLA 1S0DA 1JJ8C 3UGFA 1XSXA 1Y43B 1K61A 5B4XA 2BDRA 4N4NB 3MICA 3M8LA 3URFA 3VDDA 3KP5A 4CGZA 4QPIB 2W24A 5JR2A 4XCAA 4Z07A 2F48A 1W7PD 4MXWB 2KLOA 4IKFA 4C2TA 1JOPA 3AZVA 3LSTA 2CW7A 1FOWA 1GT0C 4OIQF 1SMYF 3L00A 4YW5A 3K2OA 3VB9A 3MFAA 2XAFA 1JZ2A 2VNRA 2KRFA 1W05A 3IRRA 3HOZJ 1DGRM 5FKBA 4DEQA 3TL4X 5FD5A 1OFNA 2GMEA 4QHBA 5JFRA 5JR3A 2B9VA 2GN3A 1J3PA 4D7YA 2AEYA 1ZG1A 1HRI3 2DCZA 4IO9F 4GYIA 2G19A 3AZYA 3E6BA 2DU0A 2L01A 1OCZH 4FPGA 2W46A 2DCKA 1GNYA 4I0BA 2HYFA 5A7NA 1TBXA 3WTWC 2L4AA 5ABJB 4JTOA 1LCLA 4XRSA 3DCFA 3HKZN 2X53S 1K4TA 1SFEA 3KE2A 1OF4A 2BY3A 1WW6A 3KVBA 4WM7B 1OLME 4BK5A 4QX5A 2VNGA 3WDUA 1I9RA 1IQDC 5L3EA 2FBIA 1PIV1 2BYVE 3AP9A 4LLLA 2YUEA 2WIIB 2YPDA 4XHBA 3DQVC 3GJAA 3S7EA 1IXSB 1VBC1 4Q0SA 2P81A 5AIPA 4BDYA 2DYCA 2QKLB 2X05A 3NJZA 3VSKA 4DY5A 1PYVA 3FBYA 2JDPA 2IXSA 3GXUA 1XNAA 4A7YA 5IT6A 5CPRB 5CJ9A 1SLAA 4PLNA 1VLNA 2JKXA 3F8FA 2OA2A 4YG6A 3J80K 2GC0A 3NNMA 2LY9A 2IGMA 3GZ5A 5KVRA 4MGQA 3RNSA 1ENQA 5FMOS 1Q43A 5F6KA 2DOEA 1SFKA 1U6GA 4Q4Y3 2IXCA 1B09A 4JQFA 3OYDA 3POGA 4IQPA 3MZHA 2VE1A 3OOUA 4II3A 5DUVA 3ZCOA 3Q8EA 4PZJA 1W90A 5FZIA 2V5YA 2OC6A 1WI9A 2LKXA 2JD4A 2ZHMA 1SC7A 3ASIA 4UVCA 2IXJA 3HJEA 5K7ZA 5B2GB 2DLLA 3LSHA 1GV2A 3LIHA 3NV2A 3O0WA 3VHNA 2ETHA 2A5WA 3ZQIA 3ZXSA 1W8TA 2R7DA 4AIJA 2ZFWA 1QY4A 3H7YA 2Q8DA 3K1PA 5BNQA 1A5JA 4YM1A 1XYPA 2VBPA 4XC9A 3JRIA 4P9WA 4UFIA 4E8DA 1L0OC 5EJ1B 3G1MA 2V26A 3M8FA 1G86A 4QX8A 4YFZA 1UD1A 2AC1A 3BR2A 1DUXC 2FEZA 1ND3B 3HOXJ 2UYBA 3I2DA 5FMDA 1VQ6I 4KGQA 5B1AH 2PJRB 5IK8A 2RHPA 1ND3A 2R7QA 2KMUA 1UZZA 1A04A 1CZTA 1PMIA 5A33B 3JXSA 3CUQA 3H1WA 2KA3A 5FPBA 4LK7A 1F2NA 3S7IA 4P1WA 2ZEZA 3WUCA 4Q1PA 2PLV1 4CP0A 3J4UH 1EAH2 4EWAA 2STTA 4CDUB 5H6QA 4XVHA 2YYOA 3H9QA 4M3CF 1LFUP 1AR92 3VKNA 1EPWA 3OBZA 2Y38A 2A3SA 4E6KG 2LFBA 4H3WA 4M71A 4IOAF 2RMU3 1R5GA 4HEA2 1ZAOA 4B3XA 4MHRA 2HDWA 2RS32 2WZR2 1F9KA 4NVPA 1X4OA 4QQPA 2DK8A 4BQWA 3RFRA 3A22A 1BJZA 3S5QA 4IGPA 4QDSA 5FV3A 4Z8BA 4FPCA 2OUMA 2B46X 1COV1 4XLNF 1IZ1A 2DFFA 2QE3A 3PIJA 1ZBE3 1R22A 2TUNA 3OYKA 5F2SA 2R92J 1N1YA 2DA1A 5F6FA 4LNVA 1IUFA 1WW7A 1FNYA 2FA5A 2L9LA 2Y34A 4LBMA 4HYEA 4IDZA 4B1LA 4IV1C 5J98B 2F5EA 3WQ0A 2COMA 3ZXJA 4XKBA 2DTYA 4XF1A 2WYSA 1I3AA 4HXCA 1YS6A 3OIOA 4A3JJ 3I2OA 4YZ2A 2M9HA 4KT6A 1YUDA 2Y6LA 2IVMA 1UF2C 1Y56A 4YW1A 2MC3A 3VYSB 4BEHB 3N05A 3DEWA 3ZXFA 2JK3A 2XBO2 2VUAA 4EJWA 5FPUA 4FXKB 1ALYA 1DG6A 1XE8A 1YW9A 5FJKA 3ACFA 4HMZA 3WP5A 1TME3 4L8QA 4META 1SFXA 4BEHA 2VJIA 3IAM2 4JVAA 4MXVA 3ZFEB 4A3ZA 5IT9Z 3OOXA 1TZOA 2XUEA 1CR7A 3ACLA 5FY7A 2K5CA 4U0VA 5IP9J 2WDBA 4AQ6A 5K1YA 2HNHA 4R8HA 2VC1A 5FQ0B 1QJX1 4W50A 2AQEA 2FNAA 1NY71 5CVUA 4QGMA 3FUQA 3WTXC 3AZZA 4YNIA 4U36A 2HKOA 2W1OA 4FFFA 2LREA 5FQ0A 3MBWA 3M3OA 3FXKA 3KHCA 4EGYA 1FJLA 4RA0A 3ZSKA 4JDOA 4H55A 2VH9A 5JSOA 4HSJA 5A7QA 4XOPA 4NRQA 1LODA 3H36A 1UY3A 4XFHA 5CFCC 1OCPA 3A01B 4UUSA 2ZACA 4QB6A 4KU7A 2XAQA 4YVSA 1QPIA 1JUMA 2W7NA 2LUWA 4UUTA 3IKWA 3HOBA 3HKZA 1C57A 1ZARA 1J3RA 1D1CA 4MEYF 5JIAA 1FMVA 1ULYA 2JG8C 3BTAA 2CYYA 2GP5A 1XDUA 4C0BA 3ZSEA 3BOWA 1RUJ2 5FLXZ 5TJJA 3CC7I 3ES1A 2DMPA 3OYJA 1T6GC 2EALA 1YE9A 2X5IC 1ZA7A 3H92A 2VBDA 3A7QA 1RRJA 2W08A 3LSIA 3VBUC 4NR1A 1Y9GA 3WE3A 4HF1A 4HL0A 1KGYA 5M5XJ 1KJRA 4QX3A 2WS93 3BOQA 2GSYA 3ZOIA 3IBMA 3OMYA 3J8F3 4BS9A 1PVC1 4DUWA 2NAZA 1YRZA 3H50A 3PUIA 3AKTA 4TYSA 3ZYJB 3KP2A 2D3SA 1QXPA 3IN9A 2WFF1 5A7OA 3FHZA 4X8NA 1GZ9A 2RDRA 4J19A 5JVVA 5BV6A 5DAQA 1RUOA 4KH9A 1HW5A 3FXOA 4UXNA 3H42B 1MZFA 4UFLA 3FMQA 2P6TA 4WVMB 1U8BA 4WK8F 3FN9A 3LDBA 5TISC 4FP2A 4QQHA 3BR3A 4ZDLA 2KJCA 3M07A 1M4WA 3CP2A 1PGSA 1JUSA 4AE2A 1HC8A 5IAXA 2Z33A 2LF7A 1K79A 1MNEA 2P8TA 2ZMEB 2W4SA 4WVMA 5HXVA 1GNZA 2B7YA 5IFTA 2MYSA 1RL3A 3T1LA 3DTKA 4AK3A 1MSFC 3ETQA 5HLHA 2XPWA 2G7UA 1XYNA 2M87A 2FDHA 4LE4A 3QBQA 4MH0E 4QKNA 1YI2I 2YB7A 4BQ5A 4S2FA 1OFSA 1YIFA 3CDHA 4CP9A 1LJ9A 4Q5SF 2XJUA 3ZYFA 3PIOF 3U75A 1B59A 1S0IA 1J0RA 2JSCA 3J7ZI 2JG9C 5C8CC 4BIOA 4GWMA 4YIFA 4G3YC 3BT9A 1YJ9I 3K4JA 4HKLA 1U12A 3J7HA 1IRZA 2HWD1 4F83A 3UYJA 3WQ1A 2V5DA 3QOPA 2EZHA 5JDBA 4W1UA 3MLJA 2JRMA 4A3XA 3PJRA 1D4VB 1RUC1 2EV0A 2B9UA 4OHVA 4HPQA 4CDXB 5B1BH 3KZ4C 2VKEA 1X1BA 5LGUA 1IS3A 3JQXA 1EPZA 2YUSA 2BVVA 4HBNA 1LOCA 2A6XA 3FLPA 5FREA 3VZNA 2E7XA 5IUQA 4DRRA 2Y30A 4JGYB 3KYCB 1XBFA 4CDXA 2VZRA 5HLIA 4LA2A 2CNAA 4TV7A 1YQCA 2DO7A 4OMZA 2VQTA 3ECQA 4QAWA 2D44A 3K4MA 2R061 1L7QA 3C7GA 3AFGA 1VBD2 2EXHA 3TEXA 2KFDA 3SH4A 4JGYA 4AF9A 1WW4A 4COWA 1WCQA 4HQMA 4QGLA 4AEMA 1D4M1 1W3XA 1RUG1 1OYWA 4C1XA 4BXXJ 4PJLA 1O3SA 2DWRA 3DXTA 2PX9A 4A4AA 3BJAA 1BEV2 4MFDA 2X8KA 3OYMA 2E26A 2LROA 4Y26A 2PLV2 1YQAA 1TMF1 3BR5A 3HTUA 3BGAA 1F36A 3LD8A 1LEDA 3U21A 2A6YA 5A80A 2GMMA 1A31A 1XD7A 1QWRA 1X82A 3D5LA 5KC6A 3DCQA 4IRIA 3VBFB 1B1BA 3WUDA 1GXQA 2JWPA 4ASNA 3AC0A 4RFRB 2FCTA 4PLOA 4PQQA 2WT1A 3OYIA 4F92B 3RJRA 3WX5A 3GF6A 3ZMOA 4AVZA 2RQQA 3CJTB 5IOYA 2HTSA 1AZDA 1GNHA 3VBFA 4M4PA 3N9OA 2Z69A 1UXXX 4F55A 4ATEA 1GICA 1DP0A 4AVSA 1D0YA 4OUSA 4BDVB 4KU8A 4L0YB 4FCYA 2P0WA 5FRNA 4AAPA 5AIQA 3KEQA 1IKPA 1VZ0A 2Y6KA 2QVSB 5IFPA 1X3WB 4HT1T 1KU3A 5C4XJ 5FLJA 1O8PA 1FMD1 2E35A 1D5VA 1QJU2 5H20A 4FPYA 3PL8A 3PNVA 2HWVA 5FP8A 4LMFA 3WNXA 4G6DA 3IWFA 2DJNA 4BY7J 4RAZA 1OQ1A 4ISRA 2EWNA 1WZXA 4Q4W1 4M01A 4LO5B 4Q4X3 1XMAA 3I2IA 4W4ZA 5D6EA 2G4IA 4GMP3 3L2YA 3WCSA 2F2EA 1U9OA 3RTRA 3TMOA 1JTYA 1FAYA 3CCMI 2EF6A 4Q47A 4CDGA 5J6XA 3HB9A 2F4LA 1TQ5A 5JCTA 4MZUA 3F9KA 3H3LA 2GXBA 4DQ2A 3DBRB 4XKWA 4YGBA 3MN2A 3LSKA 2OQGA 2J1SA 2X10A 1JU3A 2QKDA 2HPIA 3GEZA 3BPVA 2TEPA 1DQ5A 1HKDA 1ETXA 2VE9A 2RC4A 3VHRA 2QLZA 4XRMA 1C8M2 3BALA 2Z16A 4P9YA 5FZ3A 4CZSA 2CU7A 2PHWA 1QJX2 5KNLA 4XURA 3ABUA 1NY72 1YFWA 2ESNA 3R6SA 3OD0A 4D3WA 4QD2A 4ZYEA 1QEXA 2JIGA 2XONA 2QQPA 1AL21 4COYA 2DOAA 5DUIA 4U7DA 4KG0A 4CA0A 3MI8A 4EYUA 1G7YA 2YROA 2OPTA 2M8EA 5A1FA 1PGL2 3ZSMA 5J47A 1YQ5A 3ZRGA 3LSDA 4K20A 2NS7A 3W6VA 1RPWA 1JZ3A 4A6OA 3BLYA 1ZLKA 4R9AA 4RQPB 4QSHA 2UXXA 1TW3A 4FVVA 3BTZA 1GQGA 4RR3B 3AYCA 3PUQA 5LEJA 1KD7A 2XQXA 2IS4A 3IMMA 1XMKA 4QX0A 3FISA 1IAWA 1BQPA 3WY6A 1IRXA 3PFIA 2MD0A 2RR11 5FD6A 5IYYA 3ZFFC 1MBFA 4RQPA 2NNYA 1E3OC 3T2QA 4XDQA 1T38A 4RR3A 4NIHA 2VNOA 4AC0A 3MIGA 4CVUA 2DTWA 3ZM8A 2DOFA 5M5YJ 1BIBA 3K10A 1OOPB 2Z2SB 1U2WA 3LEMA 1UKGA 1SLIA 1Y9MA 1Y8RB 1WCUA 4KMUX 1RR8C 4M9XA 1QJZA 2ISZA 3F8NA 1YEWA 1OOPA 4M3EA 3ZYHA 5FO8B 2PMZA 1BJQA 2P6CA 1MIJA 2LG4A 2Y6JA 1K45A 2Y6GA 4XTPA 1GANA 3P6BA 3Q9VA 2DK5A 3CJIB 1IGOA 4Q4Y1 4CXWA 1E3PA 4X8PA 1DQ4A 2R7VA 3VYUB 4S2DA 4O65A 2M7AA 1OXCA 1O6UA 3S2DJ 3T1BA 4F91B 4TWTA 1UZYA 4CDQC 2FQ4A 3CJIA 4FI9A 4V2VA 3IV5A 5F3EA 1ZGAA 4LHLA 2JVGA 3UNPA 4RS8A 5FZ9A 1KYZA 2WFF2 4KWLA 4GWIA 1KA8A 5FYIA 2KDZA 1V9U2 1LUJB 2EH3A 2VMGA 3C7FA 3RIRA 5E1WA 4Z2WA 3ZMZA 4YZ3A 1U5ZA 2M8GX 3S2HJ 3M9AA 3CCJI 1XC6A 2H8WA 2L2OA 3M1EA 2FQPA 3RKXA 4NPLA 4FOQA 4KMFA 2VQ0A 2DXIA 4AW7A 4KITB 2V4JC 2QVOA 1NCRC 4ETSA 2E1CA 5JZGC 4FOVA 1WPKA 3J81K 1Q56A 3FK7A 1SPPB 5T54A 3MO4A 2JD9A 4NRPA 1W9SA 2WAQN 4MG2A 1T39A 2DMTA 5T50A 5CG8A 3KP4A 2PHTA 3EPZA 3ZQQA 1RGSA 1EH6A 3BTYA 1B9NA 3FXLA 1SPPA 1ZQ3P 1XU2A 2WNEA 3POFA 3D6EA 3MKLA 2O61A 3LEIA 1POGA 1S3JA 4HQEA 3ILFA 1S0GA 3G1OA 1YHFA 5A6ZA 1R092 4KN7X 2AACA 3M70A 2A6TA 1MBKA 4KUMA 5JVGF 4ZYGA 4WWCA 3GDBA 5FUPA 3ZYGA 2KD7A 3NRVA 2BHZA 1MH3A 1RI7A 1MBEA 2D40A 4AWDA 5C9AB 1N1SA 4OHWA 2XMLA 3I8TA 5DUUA 5DV5A 5FLIA 1AR73 1R64A 3C7OA 1RUC2 1F15A 5EWSA 2LW8A 1VI0A 4D5CA 3DGTA 5T52A 1NQJA 2M1BA 1F5TA 2Y6HA 3AFHA 1REFA 3H8OA 5FY1A 1ASJ3 2ILMA 2ZJPF 4MGYE 1WQ2A 3MIEA 2WLQA 2MH2A 4Q1RA 2D6NA 2Y48A 3BC8A 4QXKA 4KNCA 3AP4A 1SBEA 1QA6A 1A34A 4LOTA 4PCRA 2P3IA 3EMRA 2W95A 4OQ8A 3M3QA 2IWGB 2WSUA 2C9KA 2GH8A 2AS5F 4GDFA 3HJRA 2IXIA 3O12A 3U14A 4ZYDA 3OYWA 1D4M2 1RUG2 1D0HA 3USSA 3WXPA 4BYYA 4AIKA 5DAVA 1UZ0A 1TQIA 3KLOA 2RJLA 3RYKA 5HNHA 2GM4A 4JKKA 2OVUA 1BM9A 4ZKTB 2KP6A 3ZYRA 3CMYA 3PO3J 1OLQA 1TMF2 4XQ4A 4QQ2A 2VOOA 2MEV3 3ZIWA 5C3QA 1GUUA 4D6SA 1FSEA 1BHGA 4L9BA 3I59B 4FQGA 4BQXA 3BG7A 3AMHA 3DECA 2FDIA 2EXIA 1R58A 4J25A 1W7PB 3NAPB 1VQMI 2BJSA 2CUFA 1E3HA 5AC93 2WNUC 5FXXA 5GJ6A 1DYPA 2GA2A 4XFBA 5A3LA 4P5OA 3CCVI 4DOZA 1W7PA 2BY0A 1DF0A 3NAPA 3QRFF 1PK6C 1IS5A 3VHPA 1JJ6C 5TRDA 4UW4A 4Y22A 1MSEC 5B4NA 3OB8A 1OISA 2BEOA 3DEMA 5IVYA 3DN7A 2CRGA 5D5VB 3ACGA 1RNLA 1W99A 1MQTA 4PF1A 2F4PA 2VKVA 3NWTA 1FMD2 1R081 3SNMA 3I3BA 3TBIA 4A3GJ 1VIWB 4JTNA 4Z6YA 4IV1B 4G6QA 4QQOA 3SKJE 4Q4W2 3N9NA 3HTSB 2FDJA 3FF5A 4IGOA 1BI1A 4MNUA 2SLIA 1ETQA 3HIFA 4ASLA 2MC4A 1OA2A 3I2KA 2VW2A 2VC0A 3OL4A 4LB6B 4ZS2A 1TWFJ 2STWA 1V00A 3WU1B 1MBHA 3B3QE 1DBNA 2W57A 2ZOEB 2QYOA 1FWZA 2A75A 3W58A 4XN3A 2MFZA 1KFXL 3MW3A 3JRFA 1MDMB 4LLFA 3ZFGC 4KNYA 4JDNA 2XVKA 1V5GA 2QJVA 2E7WA 3LF7A 2DCEA 1X1AA 4RLQA 1MDMA 4QTRA 2QSHX 2EJRA 5KHHA 2RDPA 4ZYHA 3F8BA 4LO7A 4EN0A 2VOXA 1ZLJA 2R7SA 3IH3A 2O8QA 3C3WA 1AL22 3UV9A 2ATFA 5IK5A 2DCJA 4IE7A 4H0EA 5CFDC 3B93A 1XG1A 2JZYA 3PUBA 5GZGA 2W84A 2K2SA 4M3CB 4Z82A 3B6CA 4E2SA 2MHFA 1Y1WJ 1GV9A 3KEOA 2D2WA 3FXRA 3W6JB 5CFCB 1EV13 5D2AA 1YJNI 2ZJ2A 1WMDA 3H5AA 2IT0A 2W1SA 5D8AC 2GP3A 3M3IA 4EWDA 4PBOA 3KZIC 1O57A 1XCBA 1FPN1 3HOYJ 4DXTA 1EV7A 1NXD1 4XONA 3ES4A 1ZKGA 5C5UA 3K48A 3EDPA 1XQNA 2B5HA 2RR12 2IP2A 2VMIA 1H8AC 4BE1A 1FP2A 1PZ8A 1VBE3 1P4WA 1GYKA 1LR5A 2GAUA 3QYFA 4OHXA 4L11A 5EJCA 5JLWA 1FXZA 5JIUA 3FLRA 4G4FA 2D5VA 4B29A 3KSCA 4XLEA 4AXOA 3VBUB 5H9RA 3ZMVA 2Q4SA 5CEHA 1UG0A 3WTZA 2VVDA 2WB1N 2WAQA 4A69C 4K3UA 3EUHA 1H8TC 3ESWB 5LGNA 1HRV3 4LORA 1CZVA 2PFBA 1WCMJ 4Q4Y2 1WA4A 2HWF3 1N1TA 2PAKA 3OPWA 5EZWA 1C1LA 5EIYB 2R7RA 2FBEA 2LOOA 3PMEA 4I09A 4HNVA 1DGWY 3BN6A 3EQEA 2FBKA 3OYBA 1RIRA 4XMYA 3A4CA 4CEWA 4URAA 2Y0SA 2P7CB 1X3UA 2M30A 2BUKA 2KIFA 1ZBA3 4CCEA 2K02A 4IEOA 3GX4X 3PHMA 3S32A 5JUVA 3ZLIA 2VQCA 3R0JA 3AKQA 2WWUA 4IV3A 5H6RA 1XB4A 4MGKE 5D1IA 4DBRA 3Q5FA 3B7MA 4NC8A 4WCGA 5BUVA 2CS3A 1FBQA 1UIJA 5JOWA 3IP4B 5LASA 3HOTA 2NLRA 4P9IA 3ALQA 1VTNC 5HS9A 2QCSB 1NQDA 5LCWL 4E4ZA 1XC5A 1Y4WA 4CSWA 2WRAA 4M0HA 2P17A 5FYBA 5FYVA 2L7MP 5FZGA 5A3OA 2DVGA 3E6DA 1XPWA 2O3FA 2RV9A 1W8UA 3HNYM 1QJY3 4P5YA 4SLIA 1U8RA 4XHXA 2BP6A 3EQLF 2X85A 1MS1A 4MADA 2LRDA 3O1UA 1WA6X 5DDGA 5FO7B 3LSJA 4YZ4A 5FUNA 5C8CB 5BQTA 4IE5A 1FYKA 3QCWA 2K4BA 1RHI3 2VUMJ 1GXPA 2FMDA 4ON0A 2RMU2 4IRGA 1K83J 1U5TC 4AIDA 2A6ZA 5K7HA 2Z99A 5FZ8A 3IPVB 1ONVA 1NG0A 1SFYA 3PMSA 1XE7A 1SBDA 3RQIA 4PFOA 4Y52J 3PM1A 1J84A 5M0TA 4Q4V3 4MQVA 1FOYA 2I5UA 3IPVA 3CCYA 1P2FA 3S3NA 1T56A 3CCRI 4EVIA 3KCYA 1E57A 3GF2A 1L3LA 4OMCA 1SBFA 3FJSA 5CU1A 3AMMA 2WWJA 2LSOA 1D2SA 1RUD3 4CEWC 4AYBA 2OPKA 3ST7A 1CX4A 1FYLA 3RYPA 3L2WA 2LDUA 1EF4A 1GWMA 2XXZA 2ZPXA 2DBBA 2CV2A 2D1HA 1QJEA 4IV3C 3ASNH 1T08B 3VBHB 5BS6A 2YGMA 4B1MA 4OLLA 2V9VA 1Z67A 1URXA 1JUHA 4KICA 2BOIA 5L9BA 4BQ2A 4NBQA 1VFCA 3TOBA 4HX4A 5FYYA 5F5AA 2GXAA 3E1F1 4UW3A 3VBHA 4M3BA 3MUY1 2LC2A 1OLTA 1ND2B 1P7JA 3M3YJ 3ZQCA 3OG2A 3AXDA 5K0UC 4KA4A 5GM0A 5JR7B 1RUH3 4HLTA 1K5MB 2C6SA 1O7LA 2GIVA 3RSJA 1T6BX 1K6YA 4RAFA 2R071 1T2KA 5ICCA 3QYBA 2DU1A 1IPJA 5L9RA 1XNTA 4C2MJ 1BJAA 2HWC3 1W4MA 1K5MA 2L7FP 3PUAA 5IYCJ 1G9BA 3WW3A 2CHHA 3ZQGA 3DPRB 2VUDA 1S0CA 4TLFA 1VBA1 1XGOA 6PAXA 1VAMA 2VT3A 3BJ6A 5AVAA 1TZLA 2GNMA 2VW1A 2COBA 3MUZ1 1TVGA 5HCAA 2Y31A 3OS0A 3H8XA 1W0TA 1I1EA 2BNMA 3R0RA 3P5BA 4NB5A 1R082 5CA6A 2V4VA 1GOFA 3ABMH 1ZGJA 2AXTC 3IDEA 2OA4A 3VEPA 1RESA 1QOSA 1E5IA 3N9MA 3WU2C 5HCHA 1HXS1 3JAMZ 2NMNA 2Y2ZA 3CUOA 4Y5TA 4XBQA 2KL4A 2ID3A 1PVXA 4LFUA 3MZYA 5FYUA 3NKTA 1BBT1 5GLVA 1ULDA 2O1QA 4LLOA 1REEA 1DPUA 3K3NA 3UKVA 1F35A 2JDHA 3S2WA 1W6NB 4AAXA 5LY2A 1J58A 3FXUA 4XAAA 3NKGA 5J4VA 3LEGA 2DVAA 3B02A 1S2EA 5GZEA 5L3GA 4UXAA 1RUI1 4EJRA 1ZN2A 4KWUA 4HKWA 1W6NA 1Z0XA 1Z05A 4M73A 4J00A 4GJYA 1RIOH 4NC7A 5F5QA 2D3RA 2Y9YA 1JZ7A 2E5NA 2WO3A 4X6AJ 2MA3A 2BE5F 2WQ4A 4Q4ZF 4EJVA 2WZPP 3WTSC 4ESBA 3QP5A 2R6QA 4QPYA 2IBDA 5E3LA 5DZGA 3ABZA 3DKXA 5LGTA 3DV8A 3OBTA 3PNAA 3RWNA 3L2RA 1RVF3 1USSA 3VDXA 1KFUL 1LHOA 1QZZA 2YFUA 1CIWA 1DQ1A 1TQMA 2WB1A 2Z1DA 4TN7A 2K7LA 5J8CA 2JT1A 4CU9A 3ZPOA 2R041 2Y9ZA 2DFIA 2BY1A 2PFWA 1S0BA 3JU9A 3L2HA 1BKZA 3RGBA 4ARYA 5E88A 2AQFA 2XGCA 5H2FC 5DTDA 2JDMA 1RUE3 1N78A 1W6QB 2ESHA 1ENSA 3VBOC 1UG2A 3R0AA 1PO13 1TE1B 4PQ9A 2D97A 3NNGA 1LGBA 1FPN2 1QO0D 5FRAA 3T1MA 3OYAA 2NM1A 1ST8A 4L9JA 4X1EA 4B4PA 1ZG3A 1IN4A 1W6QA 4A45A 1S55A 1YFYA 3UKNA 4KDPA 2ARXA 2M0CA 4MIMA 3WDYA 5A3TA 1HQLA 5BNPC 4M3CE 4RGSA 1BVVA 5IVVA 5JXHA 3JREA 3HM5A 4IEJA 2L3DA 1QU3A 4QXHA 3FL7A 3CQOA 3H5RA 3HD8B 3LSRA 1SVLA 4NE9A 3GNEA 4MGRA 5ACA1 2CH0A 3L09A 3TKYA 4CCNA 4RSUA 2CTVA 4XKCA 4UW5A 2ZGMA 2D93A 3H3UA 4KISA 3J26N 3IKTA 3FKJA 3GZUC 1I1SA 5A1AA 1TQPA 4K7JA 3KFWX 3MQ0A 3SZGA 5GKAC 3U1KA 2WO7A 1AYM3 3OYHA 5CKTA 4A12A 1R4NB 4CDQB 2BQPA 4GYGA 2L5QA 3VZKA 1GFF2 3VHOA 5E8AA 5DM6F 2E1MB 1ZGWA 4N7IA 4WM8C 1SFPA 5F5IA 3NO8A 3D0SA 5T55A 3I4PA 3WHBA 1SLLA 2WT0A 5BOXA 1RTVA 4ZONA 4EN9B 2HJIA 4JGZA 3ENRA 4AI3A 4GCVA 5LA1A 5IYBJ 3M7AA 3OS1A 5DAWA 4KBBA 1V6IA 1FLIA 4HSTA 2ELHA 5GP9A 4COUA 2IXLA 3KMHA 4BE2A 1JYIA 3I3QA 2HPMA 1P4AA 1R9TJ 4XNFA 3TP3A 1VRH3 2WQ8A 3TN93 3GGLA 3FUOA 1QNWA 1W39A 2IXKA 3N7JA 1ZHFA 3LCPA 3K69A 4B8XA 5F1JA 3HN1A 1ZG5A 3TB0A 1DHKB 1YW8A 4FISA 2G7HA 2G1MA 4A3KJ 5ISLA 4QLCU 1IRFA 1ZZBA 4LKSA 3A23A 1DDNA 1WJ5A 2ZJRF 3V64A 5GTHC 4GKYA 1LVAA 2W48A 3CO6C 1SD5A 1K5JA 3QYEA 3C2UA 3IDBB 1IPKA 4U7BA 4CEYB 3CZ6A 1GWKA 5EEAA 1ZK8A 3K7AJ 1FYMA 4XKVA 1UAAA 1YFXA 2ARBA 4LBNA 3TYJA 4K40A 1IKQA 4GJZA 5EYYA 4F52A 3H3ZA 3V8LA 4HW0A 1BOAA 5C4WA 3WP3A 5I0RA 1BC7C 3Q8BA 4QX2A 5IOZA 3HVDA 3QWLA 3KF3A 4NDLA 2GOMA 3NNFA 5DCMA 2QCOA 1IJWC 1BXHA 4LT5A 2ZGLA 3SKVA 1YTYA 1H4HA 1XN7A 5AC91 5HXMA 4CDWB 3LFKA 1TEIA 2CUEA 2VBXA 1IRGA 4XUOA 1BR2A 4YIRX 1T0FA 3M8EA 3VLBB 3PUFA 3ZQHA 2YDEA 1O3TA 1U5IA 3LE0A 1XOYA 4CDWA 1W6MB 1H6XA 2A69F 1E0EA 3M7GA 2J5OA 3MLLA 4GWNA 4KI5M 2G9GA 3I64A 4E70A 1FOD3 2EFWA 1LVKA 1BBYA 2BNNA 2GA1A 3VZOA 1VALA 2UY8A 2XB0X 4E7KA 1W6MA 1UY0A 3OSDA 4Y24A 4KL1A 1A78A 4M72A 4BACA 2IRFG 1GKBA 1UU4A 1OHFA 2OCEA 1I6HJ 1Y0NA 4IL6C 4BIFA 1UFMA 2RM23 2FF4A 3VKFC 3MEPA 3KV9A 1HXDA 2E2IJ 2W1WA 3O6BB 3N3HA 1GLNA 5FFXA 4Q4X2 4L97A 3EYIA 2XGDA 3B01A 3IIAA 1J75A 3BCBA 4ANJA 3VDCA 2J1TA 3VL9A 4YG0A 5JMCA 1V5EA 1QQP1 3WP4A 5AONA 4RAYA 2HOAA 5JXIA 1YFUA 3HEFA 4R52A 5CVJA 1S29A 4FT8A 5F7UA 1SVOA 3A02A 5FZBA 3WNMA 4BE3A 3U1XA 3ROUA 3NNJA 3E6CC 1XPXA 1UCXA 1ZR4A 2LKPA 1ZRDA 4YYOA 2EICA 2VZVA 4LO6B 1KGSA 1WJCA 2ZAAA 3MPBA 4R4ZA 3AL6A 3HN3A 1RMU1 5SV5A 2LLKA 1LU2A 1LNWA 2J1AA 2YMZA 2CUJA 4QT6A 4PI2A 4LOCA 3ZPYA 1QBJA 5FZOB 4BWOA 1NA1C 1R6RA 4AD9A 4LIUA 1FX5A 5DDJ3 3JRDA 3JBG1 2E60A 4BXSV 4DJAA 1QXRA 1W8NA 3KIOA 2NRAC 3MKZA 4OYUA 2PEXA 5FZOA 3J80Z 3IAPA 1BMV1 1DQUA 3DYPA 2AREA 2K46A 2R49A 3I54A 4J1WA 3WVJA 3KETA 2RGVA 5LEKA 3EB7A 2PMHA 3GWZA 1OKOA 5B3SH 4G7OF 1PUFA 5FB2A 4YELA 1T0FC 2VXJA 3PSIA 2HEWF 1EV11 3WNKA 3JRAA 1X50A 3KX2A 4AWXB 3O5SA 3VD7A 5FKOA 3WF2A 3OIQA 5FPXA 4M74A 4XM3A 5J8FA 3ZQLA 3ZXGA 1VQ8I 1X8EA 4WZFA 5JWPA 2X09A 1NCQC 1MZ5A 2F6BA 1A8MA 2DUQA 3EYPA 1J3QA 4WV8A 1OURA 3DP7A 1R1A3 5FY0A 4EQQA 1BCXA 3OYNA 2EQRA 2KT0A 1MKMA 1YITI 3GBWA 4ES9A 2JWTA 1RUI2 5J37A 4OAZA 3K4AA 4QWQA 5BMZA 4NHLA 3WF1A 1VBB1 3LOIA 5FZCA 1AKHB 1EH7A 4OMDA 1IO2A 3O1VA 4Q8KA 4CYDA 1JTXA 5FY8A 3RZHA 1OLRA 3G71I 1REPC 2DYRH 1UY1A 1WGXA 2YHJA 4ASKA 1LHUA 4B3AA 1GOGA 2HWF1 2Q2EA 2VN2A 1STZA 5FKKA 4EM1A 4LD5A 1GUIA 4GD4A 4AI9A 3IH2A 4DYRA 1CF7A 3AKSA 4CUBA 1VMJA 2CGNA 1IZ3A 4XQFA 1B35B 4LE3A 2CG4A 1DQ2A 1J1LA 2RJ2A 2X1CA 3FLTA 5DAPA 1OD5A 2XH6A 3C8XA 1MNMC 1NOVA 4S2GA 2DBIA 1B35A 2ZA9A 5IT3A 4N53C 4QX1A 5FAXA 4XF9A 3E5UA 3WOGA 1ZREA 2EFQA 5D8AB 2XVCA 4GRIA 1H88C 3M2MA 1ZX5A 1JZ5A 3OV8A 1MMDA 4RHV1 2LMDA 1B8IB 4PBPA 4QPGA 3CD6I 3W2AA 1U9NA 2OT7A 3BCWA 3NNLA 1JUPA 2XWJB 3M3CA 4GB31 3DLAA 5FZAA 2JA7J 2W91A 1NYWA 3HBZA 3S16J 2V73A 2PAEA 3QQAA 1HQNA 5DXDA 4WX9A 2VL4A 5FZ4A 1I5ZA 2W47A 2IUWA 3KLNA 3WU0A 2W5FA 3U07A 4ZXEA 5LK7B 3O7OA 3V7CA 3S1NJ 1WI3A 1X7NA 1PP8F 1QOOA 2WNVB 2QDNA 1A3KA 1J7KA 4OMYA 1VQPI 4K6BA 4XF0A 1ONAA 2EV5A 1KJLA 1FOKA 4DZPA 1XNKA 3PJQA 1MMAA 1C5IA 2WNVA 3ECHA 4L5EA 5F3GA 5A7PA 4IL7A 4EJOA 2B4KA 3SEQA 1EY2A 1V6MA 3S3OA 3JQWA 3WZ1A 2L9VA 4OZOA 2H6BA 1R00A 2TDXA 1L7LA 4Q2FA 2FD5A 3GTJJ 1NK3P 2VTFA 1TTYA 3VBRB 4UF0B 3ERED 2YX7A 4BQOA 2FRHA 4RYDA 2LRPA 1POV0 1YIPA 3MKYB 4UOJA 4MUVA 2GWRA 2ZHLA 2GNBA 3LSMA 3VBRA 3JTGA 2VNVA 4RB3C 1QVUA 5M5WJ 3ZOBA 5KXBA 1G9FA 3VL8A 1Z7S3 3O1RA 2LP0A 2P2KA 2F6CA 4IHYA 4FPEA 2MG4A 2PG4A 1YQ6A 3BKZA 2ZEYA 1HBXG 5LLQA 3WGIA 5HDKA 4YG2F 1J09A 4A6EA 3VBSC 1X2MA 3UETA 1WRJA 4C30A 2AENA 3HHHA 2W0XA 3QP6A 5IVCA 3HRUA 4NQWB 4BK4A 5ILSA 2H94A 3F21A 4OULA 4ZU4A 5LZ6A 2P4EA 1XX5A 1LOFC 4IZZA 3FBNB 3A0BC 3ZDVA 4ATFA 1O91A 3NARA 1VQ9I 3IDAA 2MEV2 1IN7A 4MYEA 1RUH1 1SG3A 5F32A 2CQXA 3GHNA 3ZQFA 3AYAA 1N77A 3ZDSA 3PNYA 2HWE3 4FPFA 1B4AA 3WTTC 1OYIA 2DQLA 2X6WA 4IEXA 5AC92 4AGVA 1QOTA 3PVBB 3UT0A 4E7ZA 4UUVA 2WAOA 4AUXA 4FO9A 4YM2A 3BVCA 2JE9A 4N43B 2ID4A 2ZHKA 4NUBA 4YZ1A 1AVBA 4UFJA 1OF3A 1J5YA 1H2NA 1VRBA 2R30A 5EJ3A 1V6OA 2Y6FA 5GLWA 2CMPA 2IFRA 2D98A 2OCCH 4N43A 3RKQA 4CRQA 2ZGNA 3BTCA 3KV4A 4V19K 3B69A 3I71A 2RNGA 3BR0A 1UYYA 1MEC3 5DG1A 5FZLA 2IGKA 1LENA 2VVFA 1KQ9A 1V55H 1ULCA 2JEMA 3PNTA 3CF6E 3AP7A 5C33A 4FTHA 4LOSA 2FDKA 1H2MA 1QQP2 4AEDC 2IAIA 4JCKA 4RS5C 1MMGA 2VJ5A 3LDRA 4YW3A 1RZ4A 5EJZB 3BR6A 2DDBA 3INAA 4P96A 3RPQA 5I0SA 3L7WA 2E33A 3WQBA 4PJNA 4KMQA 4A0YA 1N25A 1AR91 1HOMA 1PO23 5GTIC 2QBXA 3QH7A 1IC8A 2UWMA 1Y1VJ 2E53A 2HBTA 1FBSA 2JPBA 4ENMA 2OW4A 1U5XA 1RMU2 3AKRA 1ZTRA 1K7AA 4FTSA 4DYQA 1KU2A 2EA2A 4E7IA 4PI0A 1H9PA 4ESJA 5BNNB 1W9TA 3LAPA 2XUMA 2O0OA 5A1LA 3CZUA 3J7LA 4YM3A 1MBGA 5C3RA 1BMV2 1GZWA 4DRVA 4M6YA 3K3OA 1V6JA 1FBUA 5BNNA 4BJTA 1GWLA 3S14J 1UZWA 3PTRB 1WWYA 4V1PA 4BZ4A 1X8MA 4AVBA 1DU6A 5FY5A 4GH4A 1LU1A 1RUF3 1EV12 1RUE1 5CAZA 2JB4A 2VZQA 4NC6A 1XB9A 4BLIA 2FZ2A 1WCKA 4JHTA 3HBLA 2XWBB 5LA0A 4IEYA 2KQRA 2M34A 2CJJA 2ZJQF 1FZPB 2R7TA 3S8PA 1X19A 1Q8PA 3AL0B 2ZKNA 1AX2A 2XLGA 3IL2A 2ZEXA 4OIOF 2Q8EA 4GGGA 2XBO1 3RI8A 1SAXA 2ZGRA 3AMPA 4Q5OA 5F39A 1VBE2 1WW5A 4ZYAA 2P3JA 5HLTA 4NAOA 1AYN3 1UYPA 5FKLA 3I55I 3VSLA 3IT8A 1V54H 5CVRA 5LFAA 3D5SC 2AYHA 5A3UA 4M4RA 4XFCA 4W6XA 3SCHA 4C2UA 2WJSA 1IS6A 1VBB2 1ENXA 2LNBA 1NLSA 3BOPA 2YC4A 3GHMA 1C0WA 4IEWA 2V1DA 3SXYA 2FSWA 2ORZA 3PIGA 5F9TA 1F5JA 1HRV2 4MQ9F 5BNOB 1V70A 2VULA 3FZVA 2WBMA 3S15J 2HWF2 1OJLA 1LOAA 3DXUA 1JW6A 1MPXA 4PGHA 1QPMA 4UBHA 4K8FA 2R93J 1S6LA 2V4AA 2JPCA 5BPIA 1YRNB 5ANQA 2VQUA 5FMCA 2RDNA 1ENRA 5BNOA 4R4XA 5K7FA 5K4LA 2KIQA 4LA3A 4DW6A 2WSVA 5CYVA 2K0GA 4OHZA 4CYCA 1ZBA2 4GALA 3RDIA 4IOCF 5FYZA 1YRNA 5KXEA 3FDYA 4CTEA 2HQRA 4MGZE 4NHJA 1GU3A 2JXAA 2PHDA 2Y64A 3B6AA 2K9SA 3VBOB 4I3PA 3KQ4B 1NZIA 1ZH5A 4E4HA 1DIWA 4NMIA 5KHDA 1ODMA 2VXRA 4UY8I 3HRSA 1N47A 2BV6A 1PDNC 3RQ4A 2PHXA 1CD3G 2ACJA 4RHV2 3ZN1A 4P9UA 1UY2A 1OA3A 1S1AA 4A7KA 3O8GA 4EEFG 1C28A 3WLUA 3BQZA 1RUJ1 4GB32 1K42A 3OUIA 1SFNA 3H0GJ 2ZGQA 1PUEE 4RD7A 3GO5A 1IOAA 1PX4A 2KRHA 3WODF 2A6HF 4QPIA 2VBBA 4D5FA 1QJY2 4QGNA 2BBAA 4MXWA 4AFMA 2WV1A 4IE4A 2ZAHA 2F5FA 4XJZA 1QHHD 2KIUA 3ZQ7A 1AJOA 3T30A 5E3MA 2HOEA 1BW5A 1O8SA 2C24A 1LHNA 2XJQA 4QHZA 2QF7A 1RHI2 3B73A 3TRSB 4UT5A 1EAH3 1HN1A 5EHDA 2P4WA 1FC3A 4CCOA 2O9LA 4A93J 2A6WA 4LHKA 3A0NA 5FWJA 1JHFA 2TBVA 2A70A 4LUKA 1TC3C 1KU9A 2D6MA 2RQPA 3K51A 1G8WA 1Y0UA 3EHKA 4JQRA 4PK4A 1W36C 4E2GA 3FE5A 5FYMA 5ABJA 4GIQA 2JRTA 4BUPA 2RDQA 5E8IA 4Q4V2 3IWZA 4XYXA 5JAXA 2NOGA 3THTA 3KP3A 4Z1VA 1G8XA 4WM7A 5I8TA 1UKRA 4E7LA 1MS3A 1HLCA 5EXOA 1UOGA 1SANA 2VB6A 1C3HA 2X6YA 1RUD2 3KWVA 2PMWB 2OYZA 2F4IA 3DKYA 5FK8A 3AKPA 4COVA 1H1IA 4LO8A 4QB1A 2WN3A 5FP3A 4M6XA 2DURA 4LIVA 4FTEA 4DXSA 4A6DA 1V6KA 4LK0F 1WMFA 3MKWB 5EV7A 5EEHA 1ZA4A 2BVBA 3ZR8X 4IHSA 3WHTA 1ZRFA 5IWFA 5FKMA 2VQHA 4FQZA 4RB0A 2QSGX 3VDDC 1R71A 3UNGC 1HLVA 4FAGA 2QM3A 1YJWI 3ZYPA 3RZGA 1P7IA 1YX5A 3BPXA 3F3XA 1RUH2 2OF7A 2RDSA 3E3VA 3HT1A 2WY8Q 4RDUA 3Q9OA 4LBOA 4YZ5A 4QPIC 2P5VA 2ZXJA 3H8RA 2LKSA 2DA6A 4UV9A 1PNGA 1YIOA 1S5LC 3BPZA 5H9QA 2EXJA 2L9SA 3RJPA 2BWAA 2D1VA 3LA3A 3M1HA 4PGGA 2XJPA 4QMAA 1R5ID 3FFZA 3PUSA 1HB1A 4BQNA 3JZVA 3R4KA 4D0PA 4V2FA 5J09A 3UL2A 1O4YA 5EGOB 5E1RA 1SAUA 1SZBA 2VC9A 4OOIA 4YARA 5DPNA 1XS9A 3EJKA 3PUHA 2RS13 2HZDA 2XLFA 4RGXA 3ABKH 4D94A 2JTVA 4DGWB 3AKZA 4YPJA 1GZTA 1UMZA 2BW3B 2DA2A 1CJDA 1SFOJ 4HRIA 1VBD1 3PVEA 1X9PA 1YLFA 1QNYA 3BP8A 2XVLA 2IS1A 4XOTA 4D7NA 2EFNA 2GH2A 1Z9CA 2JQ7A 2D6PA 3ZN6B 1LEAA 1YFHA 1JODA 4TSVA 5ABJC 4PUSA 1UMQA 4UYBA 5L7OB 3S1QJ 1CZSA 2C6YA 1YO5C 3LOCA 1BEV1 2IW5A 2PJRA 2VOTA 4WM7C 4K1YA 3FM3A 3ZN6A 3KGZA 1YQ8A 5A33A 1DP7P 2V1UA 5L7OA 1ACIA 2IA2A 5FPVA 2VZ3A 2KXLA 1MGTA 4DPNA 2HH9A 4XFIA 4Y20B 1XNCA 3H7JA 4FSJA 1KS4A 5ICFA 4K9SA 3J81Z 4CDUA 2M45A 3WV6A 4AHZA 5FY9A 4U2AA 4CPBD 1AA7A 1I50J 1LNSA 2EIEA 3T2OA 5HLGA 1NA1B 3IAQA 5FOJB 5KXCA 1ITYA 1NK2P 3PU8A 4W65A 4YRDA 4DB5A 3QAHA 1WBLA 2YC2A 3LNQA 2WZ8A 4RMNA 4ABZA 4CA9A 4EV0A 1CONA 1RVF2 2EIKH 1MVEA 1E5RA 3FZ3A 3UJOA 4GAZA 5JPMB 2VECA 1S7OA 2QZ8A 2DDUA 2AO9A 2OS2A 4S0HB 1QJU1 3E5QA 1DLCA 2J1UA 1N3OA 5EEGA 2E51A 2VQAA 3R61A 3D4KA 3VDBA 4BDZA 4NPRA 5GAHJ 1KEXA 1RUE2 1DGWA 4DQAA 1TWCJ 1K78B 1AXZA 1OKRA 2QQ9A 3SDGA 3SFZA 1NCQB 4C3JJ 3CC2I 3D1NI 1FY7A 4E27A 4R1HA 1FMWA 1MMSA 5FZHA 1R1UA 1DQ0A 5LD2C 1WMXA 3S93A 3V56A 3FHNA 1PIV3 5C3PA 5A32B 3SCFA 2VZTA 4O61A 5IAVA 2C1FA 3TOAA 1ND3C 1WD4A 4XRFA 1W28A 1VBC3 3IC7A 3NV1A 2CWEA 2D5HA 3CUQC 1HKQA 1MH4A 2CGOA 1C8M1 1FYUA 2IJLA 4G94A 1UZCA 5FKCA 1U0JA 3AJYA 3ZFEA 4RL7A 3MIDA 3BIEA 2BNOA 3ISPA 3GZAA 3OYFA 1D0GA 1CAXB 2WFPA 2VZSA 1W6PB 2P37A 1F4HA 4AI0A 4AVCA 4MGSA 3A0KA 3SH5A 3WNLA 2Q8KA 1UCRA 1PGL1 2Q8OA 3Q0WA 1RB8G 3CO2A 4HSRA 5FRMA 4HONA 2LY2A 4AVAA 1R23A 4E8CA 5FZDA 1U5YA 4SBVA 4FETA 4UWDA 2XSDC 1QJFA 3ZYBA 4ASMB 1AWCA 5IP7J 3A01A 4UB8C 1O59A 1W0PA 3WCRA 2ZXHA 5HPOA 1VRH2 3D5OA 3TN92 3ZKUA 4CH7A 4MTDA 1XSVA 1WCSA 4PDWB 3P9KA 4YEJA 3LQQA 1C4RA 1XMXA 2DU9A 2KM2A 4G9YA 1IG3A 3SITA 5K7PA 4AI1A 3S3MA 4IEZA 4PDWA 1BI0A 4CICA 3MZ8A 3QD6A 3RG0A 4RA2A 3I3DA 4OI4A 1PMHX 4YGDA 5ERIA 5FGMA 3GTLJ 1RITA 3KGLA 4L2NA 4CCLA 3M1CA 3O2PE 2I74A 1JYXA 3FXMA 2JDAA 3V4GA 2MNGA 3Q8CA 1JI6A 1UAIA 1CGPA 2DMNA 2K3PA 5C4JJ 4BOWA 2ICWG 2WLPA 2ZMKA 2BY2A 4M3FA 1DLLA 5A70A 1BK1A 1UW8A 5CBLA 4OU0A 2FHRA 4A5MA 1OCTC 2PLV3 3ZX7A 4XLPF 3OL3A 1SD6A 2K9LA 5DYMA 1JXSA 3KVAA 3OF1A 4UV8A 5JXJA 1A35A 1V9U1 2GLOA 2RG4A 2A5ZA 2J22A 4N9IA 2XF6A 3WEZA 1XJAA 2VOWA 3M3EA 5FDBA 2QQAA 4G7HF 1NAEA 3TBDA 1LFBA 3OUJA 3JB4C 1LHWA 2LY1A 4XSXF 3WDXA 3DBLB 3H3VK 3NJVA 4P02B 2YZ4A 1TT0A 4NRMA 4OINF 3WSOA 2R7OA 2NVUB 4JQTA 1COV3 5FZ6A 1MEC1 2PELA 2RM22 3WGGA 3HGGA 2CFOA 2PJPA 3K4KA 2YU2A 5FO9B 1BZWA 3S1RJ 4YLZA 2ZMEA 1BN5A 2XKOA 2GBYA 3DYOA 1E2XA 4IXLA 3I58A 2VASA 4YVSC 3ZXKA 1U0AA 3VD4A 1IG0A