4NUBA

Crystal structure of escherichia coli ribosomal oxygenase ycfd
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
372
structure length
361
Chain Sequence
MEYQLTLNWPDFLERHWQKRPVVLKRGFNNFIDPISPDELAGLAMESEVDSRLVSHQDGKWQVSHGPFESYDHLGETNWSLLVQAVNHWHEPTAALMRPFRELPDWRIDDLMISFSVPGGGVGPHLDQYDVFIIQGTGRRRWRVGAALLQVDPFEAIIDEELEPGDILYIPPGFPHEGYALENAMNYSVGFRAPNTRELISGFADYVLQRELGGNYYSDPDVPPRAHPADVLPQEMDKLREMMLELINQPEHFKQWFGEFISQSRHELDIAPPEPPYQPDEIYDALKQGEVLVRLGGLRVLRIGDDVYANGEKIDSPHRPALDALASNIALTAENFGDALEDPSFLAMLAALVNSGYWFFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and Functional Analysis of YcfD, a Novel 2-Oxoglutarate/Fe(2+)-Dependent Oxygenase Involved in Translational Regulation in Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
molecule keywords 50S ribosomal protein L16 arginine hydroxylase
total genus 85
structure length 361
sequence length 372
ec nomenclature ec 1.14.11.47: [50S ribosomal protein L16]-arginine 3-hydroxylase.
pdb deposition date 2013-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08007 Cupin_4 Cupin superfamily protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2510 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4nubA02
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 4nubA01
3ZLIA 4LIUA 5F5IA 5F3CA 5F3EA 5IVYA 4ASKA 5F39A 5F2SA 3AL6A 5FJHA 5FY5A 5FY4A 5LY1A 5FZLA 5FBJA 3PUAA 3U78A 4AAPA 5FJKA 4CCJA 5FXVA 2OS2A 3KVAA 5FZ1A 3KV9A 3AL5A 5FPAA 5FUNA 5FYHA 4CCNA 2Q8CA 5F3IA 2XDVA 5FZOA 3N9OA 5FP7A 5FZDA 4IGPA 5FZ6A 3N9LA 3PUQA 2YU2A 4QXHA 5IVVA 5FZGA 3DXUA 5FYCA 5FZEA 4CUGA 4Y3OA 3PU3A 5IW0A 5FPVA 4GAZA 5FWEA 4EZ4A 4EZHA 5IVBA 5FZ9A 5FZAA 5FY9A 2OT7A 2VD7A 4XDOA 5LWBA 3LD8A 5F2WA 4CCMA 2XXZA 3K3NA 5A1LA 5A80A 4IGQA 4CCLA 2W2IA 5FZ8A 3UYJA 5KR7A 3NJYA 5FZKA 3KVBA 5FY7A 3PDQA 5FP8A 3N9MA 4D6QA 4LIVA 5FZ0A 3KV5A 5A7QA 4UF0B 2WWJA 2Q8DA 5FY0A 5A7OA 5A3PA 4QU1A 5IVCA 5A7SA 4BXFA 5F37A 5FV3A 3KV6A 3OPWA 5A7WB 5LY2A 4URAA 4D6RA 5FYVA 3PTRB 5FZBA 4C8DA 5IVJA 2GP5A 5F32A 3KV4A 5FP4A 2YBPA 5FP9A 2PXJA 3U4SA 4GD4A 5FYYA 5FXWA 3K3OA 5F3GA 5IVFA 5FPLA 5FYIA 4DO0A 4BU2A 4QXBA 5FY8A 5FYTA 2YU1A 5IWFA 5FZHA 4TN7A 4LITA 4GJYA 5A3WA 4QWNA 2YPDA 2OX0A 4QXCA 5FWJA 4QX8A 5FZ4A 5FZOB 5K4LA 3K2OA 3DXTA 5FYBA 2WWUA 5CEHA 5FYZA 2XMLA 3PUSA 4XDPA 4BISA 3ZPOA 1VRBA 2OQ7A 5FPBA 4DIQA 5FXXA 5A7WA 4QX7A 5FYUA 5FYSA 4D6SA 3LDBA 4V2WA 5F5CA 4E4HA 2OQ6A 5FZ3A 3AVSA 5F5AA 5A7PA 2P5BA 3AVRA 3PU8A 5A3NA 4Y4RA 4CCKA 5LW9A 2GP3A 5FXZA 4UF0A 4IGOA 4AI9A 4HOOA 5FP3A 5A7NA 5A1FA 3OPTA 5ISLA 4CCOA 5FPUA 2XUEA 4Y33A 3N9QA 2YBSA 5A3TA 5FZFA 5FZIA 4EYUA 5FZMA 4GJZA 2Q8EA 3RVHA 2YBKA 4HONA 5ANQA 4LXLA 4CSWA 5FYMA 5FUPA 4NUBA 4V2VA 5E6HA 5FY1A 3N9NA 3PURA 3N9PA 5IVEA 5FZCA 5FZ7A
chains in the Genus database with same CATH superfamily
4M3EA 4MGQA 1UW8A 1V3FA 1YHFA 4FQGA 4AXOA 5IHRA 3HOSA 1XJAA 3CF5F 1U5IA 2Y6HA 2KHMA 3BLYA 3SFZA 5L9RA 4IHYA 2BYVE 5KHGA 1ZGJA 2VLAA 3I58A 3U75A 2VPRA 4IXAA 3GZEA 4D94A 3MKYB 1PVEA 1V5FA 3KE2A 3S2DJ 1NK2P 4CCLA 3PL8A 4YG2F 1FJLA 1PO23 4LOSA 2AQEA 4A93J 4M4PA 2EIEA 4U7DA 4A12A 5IOZA 1MNDA 1O8PA 1I6XA 1XE8A 1W5CC 1CIYA 2CSOA 2DFBA 5DZEA 3KZYA 3ZDVA 2M5WA 4YWAA 1OLTA 3J7MA 1H0BA 3WE3A 1WW6A 1J58A 4BQ3A 4BMEA 4M6XA 1UYZA 4Q2FA 3ZYJB 5JR7B 3GYHX 1LOCA 1EKEA 2HEVF 2F4OB 3IH4A 5IK7A 1VF9A 4DY3A 1BMV2 1SFXA 3LSTA 4ZZ8A 1U9OA 3WG4A 1AXZA 5IOYA 4G7HF 1F35A 2HWD2 3HSFA 2CUJA 4G9SB 2VXRA 3TDUC 2FDJA 3LDRA 1C5IA 2JQ7A 1FOXA 3FXQA 1BHGA 3KZ4C 1GBGA 4YARA 1O8SA 3HD8B 3ME2A 4HDUA 3T2TA 3SKJE 3UYJA 5J37A 4Z2WA 1SFPA 5G04L 1RIRA 1OH3A 3ML6A 5FPZA 2QBYB 3PVNA 1CZSA 2XVLA 1O91A 5EZWA 2MEV3 1B4AA 2XB6C 4GB33 2ELHA 2VOKA 2OTJI 2YGLA 5HOOA 5JLWA 5FZHA 1QGLA 2O1QA 3LQRA 1OLMA 2YPDA 4XHXA 1UMQA 1XGNA 2V6EA 1A8DA 2Y6LA 3VBFA 1FOD2 3M1HA 2CW8A 3LB9A 1G6NA 2QQBA 2QZ8A 1OH4A 4CZCA 5BYNA 1S5LC 4XRMA 4E7KA 3MIDA 5DPNA 5L7OA 3K70C 4QU2A 3Q3SA 4FPJA 2DUPA 3D4KA 1LEAA 3VL9A 1HXDA 5KAFC 2H1KA 4CXWA 1MR5A 3VBHB 2I5UA 5FO5A 3W2VA 3VD9A 2CU7A 5CVUA 3V8LA 3MHZA 1YG2A 4XUTA 3NMBA 1TWGJ 4LGWA 3IDCB 4BJTA 1MMNA 1RMU3 1XSXA 3N4MA 4CDGA 4XZUG 3K4DA 4U0YA 3BCWA 1S0EA 2LH9A 4JDNA 2K3PA 3UR3C 1TMF1 4AQSA 2EILH 3GBFA 4AGGA 3PDQA 3LA2A 1ND3B 5IK8A 5FY0A 2HDCA 4DEVA 2H6BA 3CC7I 3O1UA 5JHUA 4Y7NJ 2LREA 2QUFA 2WO2A 1CQTA 3AB0A 3KV4A 3T4VA 2ET7A 1BOBA 1Z7LA 3ZN5A 5GTIC 2JG8C 4E6KG 1POGA 3T0YA 1WBLA 1NY71 4C9YA 5DEQA 4FOVA 4MQVA 3B6CA 2WWUA 3WOGA 4YG0A 2JUCA 4A3CJ 4ITVA 3ZYFA 2JMWA 3NNGA 2OIIA 3G1OA 5CKQA 2HOEA 1WW5A 4L2NA 3RI8A 2HWD1 5FOBB 3WNPA 2VMCA 5KHHA 3JAMK 2HZTA 1S2BA 4AHWA 4CSWA 3WODF 1HKQA 2L7ZA 3MI8A 4YELA 1ZTRA 5FZCA 3ZLIA 4LUMA 3G3ZA 2E5ZA 1UJ8A 2D6PA 4LR4A 4E7LA 1CR7A 3BU0A 3LA3A 3CUOA 1JN2P 3K4AA 2JIGA 2VULA 1DFQA 3H1YA 2HNHA 1K6YA 1QNYA 1RETA 3HB9A 4DYCA 1ACCA 3UNPA 3TL4X 4I3PA 3SDGA 4H0EA 3VD3A 1D1CA 2ENRA 2C6YA 3R0JA 1WCUA 1Q8QA 4HSTA 4B47A 5CFDA 3WP4A 1RMU2 1YS6A 2ME6A 1OPCA 5FP8A 1GV5A 4D6QA 3BQYA 3PTYA 3RQ4A 3FXJA 4KMUX 3ZQFA 5I93A 4BJ5C 2CHHA 3I55I 4I0WB 2VVEA 1NCRA 5JVGF 4HYEA 2IVMA 1SQ4A 4HF1A 3GTQJ 4XBQA 3KP5A 2I2SA 5FZBA 5JOWA 4A6OA 1S7AA 2VCMA 1Q5OA 3T0BA 4DO0A 2XVCA 1YQCA 1YQ6A 2ZACA 5GAHJ 1ENRA 3RIRA 3LZZA 4AEMA 1AL0G 4GWIA 3OIQA 1DYPA 3FISA 4BJ0A 4YW2A 5EYXA 1KU9A 5FXZA 3BROA 1IHMA 1OT5A 2R043 3GLXA 1YI2I 4HOOA 4WWCA 1EJ9A 1C8M3 1GANA 4AE2A 4I76A 5F9TA 3B7MA 4LA3A 3BP8A 3S93A 2BNMA 3JR9A 1DG6A 2CSGA 1YJWI 1FV2A 1O5LA 2GIZA 2O7OA 4Q4Y3 3K2ZA 1IN6A 1RB8G 4PCQA 4AVVA 2PQ8A 3ZYPA 2ZHKA 4EROA 1OA3A 5C9AA 3HWJA 4P9IA 3JSPA 4A5NA 4WVMB 3CESA 1AX2A 3ZQGA 3OEAA 3ZMTA 2NNYA 3V7SA 2PAEA 3GTMJ 5LBCA 4YG6A 3H0GJ 1Y39A 1COV2 2OT7A 2G0EA 1ZZBA 2PJRA 2VBBA 3LOCA 2MABA 2MPFA 3KGZA 3MLLA 3E5UA 3KVBA 3HKZA 2P37A 1OCOH 1L0OC 3WY6A 4LORA 4UB8C 5ACA1 4UV8A 1LDDA 5FYYA 4XUQA 1GZWB 1CPMA 3UKGA 5D8AA 1GUUA 1OMIA 3M3QA 3CCYA 5FK7A 1Z05A 2KRHA 4QPGA 2WY7Q 4XDPA 2VBDA 4BUPA 4GH4B 3C7GA 4WM7C 1XC5A 4LQRA 1JZ3A 3AMNA 1UN1A 2NN8A 4E2SA 4WX9A 5JXHA 5CVIA 3VEPA 2WS92 4B4QA 4NN0A 1KZHA 2R7DA 3BJOA 2RR13 5FLMJ 2E1NA 2AO9A 2VMHA 1IDYA 2CUEA 4FAHA 1BL0A 2WNUB 5IVEA 5K0UA 3OR1C 3TN91 5JXGA 1BKZA 1P9QC 3U4XA 5KHKA 2KL4A 2W95A 1QRYA 1BW5A 5A70A 3K75B 1AR92 2ETEA 1XNKA 4UT5A 2Q1MA 2VUMJ 2IXIA 3JD73 4DS0A 1BJZA 1OQ1A 4RS8A 2ERFA 2LY2A 4CU7A 3BTAA 3TAYA 2WADA 1ENHA 1T6SA 1OLME 4U2AA 4XFCA 3B6AA 3LSPA 3BTYA 1S0BA 1FX5A 2R0FA 2EH3A 1H9WA 4YNIA 3O7OA 4ZYGA 5J1UA 1DZRA 2F5CA 3GTKJ 2Q2EB 4URAA 4RGGA 4XUOA 2GP5A 2IJLA 3DUIA 4Z92B 2FX0A 1SC7A 3T4HB 3BR5A 2ZA9A 1MBKA 2DYCA 3MEXA 4I0BA 2QUOA 1Y0UA 1ZA7A 3NJXA 3PVEA 1EH7A 3WQ1A 3CUQB 4J6GA 4KUMA 3ZPOA 2R7TA 2W48A 3WNOA 4CP9A 5JLVA 2JD4A 5FMBA 1XU1A 3VBUC 1GUIA 1K5MB 5D6EA 1C28A 2H27A 5JHFA 1J7KA 3H9GA 1LHNA 4HKWA 3WG3A 1KFUL 4FPGA 5FZFA 4CGZA 5K1YA 1ZELA 4HNUA 4GJZA 5FZMA 5GZDA 2K4BA 2CV1A 1VBA2 3IIIA 1RR7A 3O1OA 2G7HA 1OFSA 3S5QA 4LK6A 4XR6A 3KB5A 4D7YA 2CQXA 2OPKA 5IP7J 5C3EJ 4HF2A 2ISYA 5GLUA 2NVTJ 2ZMEC 3L2CA 3OSGA 1MBEA 3KYLA 5L36A 2JJ7A 3LQCA 4Y5SA 2JPBA 1UYYA 1REDA 4ARYA 1MD0A 5FPXA 3J8F1 2JDMA 3WE2A 3ISPA 3CMMA 1LJ7A 2IXCA 4GMP1 2FF4A 4GB31 1WFXA 1RUE2 3S16J 4QKBA 1WQ2A 3WG1A 4BLIA 1FOKA 1AYN3 4HW0A 2Q8OA 2V5YA 3U9GA 3GFIA 1LOBA 3HRUA 4DBRA 1O3TA 1IW7F 3VKOA 3KCXA 4QD2A 1SEUA 1R7JA 1CZVA 1I3QJ 4E2GA 2K9SA 3RYKA 3A21A 5A1AA 5FD6A 1N47A 2MLGA 1WA4A 3M4OJ 5L3GA 1S8NA 3HM5A 2IS4A 2C9AA 3QPHA 3UV9A 1H1MA 1NH3A 4IOCF 4NB5A 1PNFA 1OVPA 1OD5A 4ANJA 2BVMA 1NE4A 3EUAA 5ICGA 3GCWA 3GXOA 3GCMA 2ZZJA 2JG8A 1NHAA 2J1TA 5J4YA 2ZS6B 5E20A 3W9AA 2TEPA 1W8UA 3J81K 1PVC1 1HRV2 5DUIA 4GYGA 5AC93 4R9CA 1I3AA 3QD6A 3O1SA 2RHPA 1JE8A 1YS7A 5FY4A 1F8VA 3PJRA 5IYDJ 1HXS1 2UURA 2DBNA 2GC0A 1W3XA 3AMMA 3FUQA 4CYCA 3DWLE 2WZEA 4QMAA 4GYIA 1RUJ2 4XE9A 5J8CA 3VN4A 4OYUA 1UPIA 1DPUA 5FLVA 4CTEA 4ZJZA 2ZMEB 1MH3A 1RUG1 3T5XA 1DP7P 5GKAC 1PO13 3OS2A 2YFUA 5HODA 1ERDA 1O3SA 3HYIA 4UFLA 3RZKA 3PJQA 1X4OA 5C3SA 5FAXA 4AFCA 4U87A 2A6WA 2WZPP 2X1CA 4Q0QA 3RS6A 1HRV1 2VAUA 3C8XA 5J6XA 3OJBA 1F5TA 3RJPA 4XKVA 4BMBA 1N1TA 4GXOA 3TEXA 1V9U1 1SFOJ 4C3IJ 1UY4A 3M8LA 3OF1A 5CKTA 2C24A 3PVOA 5K7HA 2EIDA 4DUVA 5FPUA 1PVXA 3IWZA 3JBG2 5JIAA 3MV01 2BNOA 2B42B 1LFPA 1UG0A 1U5TB 4M6YA 4KH9A 3MV11 2K85A 3TBDA 4ESFA 1V6JA 1YHQI 4PZJA 3Q8EA 1Z9CA 3L7WA 1X8MA 2RS51 3AL6A 3ORJA 2XAHA 4D5CA 3ZIXA 4IEPA 4B3NA 4YFKF 1HW1A 4RYDA 3TO9A 2GMPA 3ATGA 3QYBA 1Z0HA 2UY8A 3PNVA 1UG2A 1DUXC 2V4JC 2P1BA 4P9GA 4Q4V2 4Y1XA 3KIOA 3VD7A 1A31A 3THTA 2D6LX 2JICA 1BR1A 2WNUC 1FSEA 2XRNA 1AR82 4ASMB 5IATA 1D0YA 3BG6A 4CU8A 1PO12 2F6CA 1IJWC 2WWYA 3DPRB 2BXYA 2CGNA 4HKOA 2BU9A 3O1VA 2UZKA 5HCBA 2WT2A 3L2HA 1D8JA 4RB1A 1LENA 1N3PA 1W05A 2WZ8A 4OAZA 5FUIA 4Y4RA 2MEV1 4LTAA 1ZLJA 3N7JA 1HLVA 2EALA 3VDDB 3SH5A 5EJZB 1LB2A 3F8NA 4UFMA 5FKLA 5ERIA 5F0HA 4XTMA 4XRSA 4C1XA 4JTNA 5JDBA 3BCAA 4II3A 1H8AC 1EUUA 1SLLA 3EBRA 4CUCA 3DEMA 3FF5A 4YLZA 2P17A 2FOKA 4UY8I 2VTFA 3JTHA 3BODA 1D4M1 3LF7A 2R5YB 1UL9A 1LDKB 2QEXI 3ST7A 2VOTA 2WAQN 1JZ5A 4UI9L 1TTYA 5SV5A 1JZ6A 3BYWA 2HVQA 4OQ9A 2PA7A 1G3TA 1BI0A 3AZXA 4RBOA 4KJZA 2BWAA 4N4OB 2XF6A 1WKMA 3NWKA 2A5ZA 4AQTA 3OS1A 1UOGA 2PTMA 1YEWA 1PGW1 4XFHA 2W52A 1ULEA 2V7FA 5FV3A 3ZXFA 1J9IA 1ULFA 5I8TA 2XQXA 2F5FA 3F23A 3A4UA 4QHZA 4KU8A 1POV1 5B4XA 5HBAA 2CGOA 2DTYA 3DYOA 3TN92 2V1XA 2TNFA 3BZ6A 1T33A 4P5YA 2OAZA 1WCSA 4PIZA 2QZ3A 3HN1A 4GA9A 4A0XA 4IF4A 5LLQA 2WSUA 1BCXA 3KT1A 1SFEA 2VPLA 3G6EI 1UCXA 1KQ8A 2JA7J 3SH3A 4SBVA 3WHCA 1YFYA 1GZCA 3WTTC 5K0UB 3OYGA 4XYXA 4UYBA 3W2WA 2FBKA 5D8LB 3ZYGA 4IRIA 5CA6A 1U8RA 2BY2A 5E18F 3EXUA 3F22A 1LULA 4YFNF 5CZKA 4ASKA 2IXSA 1IN8A 4OZOA 2F5EA 1PGSA 3WF2A 4HG2A 2CV0A 4YSFA 5IVVA 2HBTA 4CUGA 2XAUA 3QBQA 2K46A 3JRCA 5FZ9A 4QWQA 1GOFA 3POSA 1BBT3 3ZMDA 1SDDB 3SCFA 4DNCA 2EAAA 3A03A 1H8TA 3PUHA 4M3CE 3U10A 1W1WE 1T6BX 1OD3A 2IVJA 2ZOEB 2M0CA 1RUF3 3I8TA 5CYYA 1SAXA 2H8RA 4O9EA 1DQ2A 5LBBA 2YG0A 3C3VA 3HAGA 4BBRJ 2VQ0A 4Y5TA 3OYWB 3WTZA 3ABKH 4XIOA 3OYHA 1O5UA 5D2AA 1H2MA 2JE7A 1JZ8A 1W0OA 1ZH5A 4COUA 3I2GA 3DU6A 1XNDA 2H0VA 4JRAA 3KP7A 1D2QA 2R5ZA 3M2MA 4QKDA 1UHWA 2RQPA 3RVHA 3K69A 3UESA 2E1MB 4LXLA 2MA3A 3HSEA 1KEXA 1MEC3 3MVPA 1HJFA 3N9NA 4C30A 2ZGPA 3H36A 4M73A 3EQEA 4D0QA 1YJKA 5D6FA 4BQXA 2ZGKA 3KETA 2KJBA 5EYRA 3M8FA 3WUDA 3PIJA 3I3QA 2K9LA 1UOFA 4D5FA 3OBTA 4IDZA 1BVVA 2P6TA 4M3BA 1TC3C 2DO7A 4TLFA 5TISC 5IW0A 5CPRB 5F27A 3F9KA 1Z0XA 5C9AC 4OMDA 5F8PA 1AKHA 1W7PB 1JW6A 1HB1A 4LLLA 1MQTC 4PIYA 4FPCA 3RGBA 2M3AA 2QVOA 3BVCA 1FSHA 3J7LA 3COAC 1DP0A 1MNEA 3HHGA 3HGGA 3P5BA 4IEYA 3QU6A 4L9JA 1BR4A 2E5NA 2X85A 4M74A 1UU4A 3FMGA 2P6CA 2EA7A 3LEGA 4CUAA 1EY2A 3K51A 4FASD 1HKSA 2P5VA 5GPAA 1H9PA 2GN7A 5A6ZA 3ZXKA 1W0UA 2XKPA 2CWEA 4HKLA 3CCQI 3WTYC 4PF5A 3N7LA 5DDJ3 4YVWC 2VW1A 4AEDC 1UIJA 1VQLI 1OPOA 5JR3A 1R1A3 2RJKA 2KA3A 3N9QA 5DUWA 1W6OA 2VC9A 2Y26A 2DA2A 1QU3A 3EYPA 3SISA 1D8KA 3WQ0A 1CD3G 1NG0A 4B1RA 2OXBA 1S0IA 1RITA 4RAGA 1LKXA 5BNOA 2LLKA 3WX5A 1O3QA 3LNQA 1M06G 2CV2A 3WP5A 4HX7A 3CO6C 1S7EA 2HEOA 4WV8A 4FAGA 5HCHA 5J98B 2O6GE 4Q0UA 2DURA 5TRDA 1PO21 5B5EC 2EZLA 2QJVA 4QX1A 2RNJA 4MXWA 4CCDA 2ZABA 4EZHA 4A0YA 2IFRA 3I4MJ 3CC4I 2J1AA 5FCCA 1QJY1 3RWKX 2VNGA 4XJ8A 5A6QA 1V4RA 3S17J 4QHOA 1DGWX 3MZHA 5AIQA 3CF6E 5KC5A 2XB5A 1A5JA 3FE5A 1I5ZA 3EYIA 2JG9A 5H9QA 4AGVA 4Q4Y2 1WSUA 4XKWA 1S3JA 1OFCX 1VNDA 3JBG3 4G6TB 3PNAA 4UUVA 2PQSA 2DW4A 4XF1A 3VBOB 1K5JA 1VALA 3VL8A 4YW1A 3H35A 2H8WA 3A23A 5JUVA 2RS33 3OYIA 1KU7A 3N36A 4HLTA 2NQYA 4YVSA 3KWVA 2VJ4A 4QPIB 3X29B 2HYGD 1NAEA 3PURA 1DGRN 2OA2A 4XOPA 1T2XA 4CXFA 1MZBA 2QSFX 3PSIA 4N8MA 4N9IA 4YGEA 3BOWA 4LBMA 3JRGA 1RUC1 4XFIA 3ZMVA 4UW4A 3U14A 1AR61 2KIMA 2JVGA 3N35A 1O4ZA 2WO7A 3QWLA 5JVTA 4B1LA 2PG4A 5HDNA 4G4FA 1AR93 2L4MA 2XGXA 3GZ5A 2ICWG 2ZJPF 1TW2A 5HVQC 1HLCA 3IAQA 3PMSA 5ICFA 4MEXF 1YCIA 5FY7A 4I2OA 1Y9QA 5CIRA 4BA6A 1QHGA 5DMYA 3ZXEA 5IVCA 1WLCA 1KJRA 3S0MA 2HGCA 5E1WA 5A2QZ 4QQHA 3QODA 2BFUL 3PHMA 3VBHC 1MKMA 2Q2EA 4BU2A 1LOFA 5AFBA 4CDQA 4KMFA 2OZJA 4ZYEA 1LVKA 2E36A 3WG7H 4C3JJ 3VSLA 2XONA 3AZZA 5JIUA 1G9DA 2EXHA 4CO8A 1RYYA 1SACA 1FMVA 3WU2C 2GP3A 5A7NA 5FJ8J 3C2UA 2DTRA 1DQ5A 4K20A 5AFEA 1TME3 2FMLA 1QOSA 1YIPA 2PEXA 1XSVA 2WV1A 3BC8A 3GALA 3I49A 5HLTA 1ND2C 2VT2A 3OYJA 4S0HB 2Z16A 4DJAA 4Q27A 4L8QA 3ABMH 1IAWA 5FKBA 2M7BA 2WAEA 2ZJQF 3AK0A 2R5YA 2IPQX 1W7PA 4JP0A 1B8IB 3AL5A 1GQGA 1FIAA 2HR3A 3BDDA 4H4KC 1X1DA 3PLQA 1US2A 1HN1A 4IGPA 1NZCA 2FU4A 2VZPA 4WM8A 5CJ9A 3AAFA 5FZEA 4DQAA 3C3WA 4NRPA 3S1MJ 4XMAA 3VHPA 3RI4A 1GVDA 4FP3A 3KCYA 3F0CA 1HRI3 1YW8A 1R49A 2ARCA 2QKMB 4MSVA 2Z1DA 2VR4A 4BOWA 3L9FA 1FMD2 1KDKA 1MBGA 4CXXA 4BE3A 3BUCA 3ZR8X 1TNSA 4W50A 1HQCA 5GM0A 1RUE3 4I09A 3EUKL 1MS8A 2QLZA 4K40A 3K77A 2TDXA 5HDKA 2FDIA 1ZREA 4OI1A 3AG2H 3AP4A 3DKQA 4NHMA 3GX4X 3WDTA 5GJ6A 2R49A 2PFWA 1C0WA 4RDUA 4X8PA 2VUJA 2D3SA 1LU1A 2HJIA 4HF0A 3RMXA 3ZFFB 5HDGA 1N77A 1HXS2 4D1QA 4BLJA 4DY5A 1UELB 2M9HA 2BWCA 2QENA 2E1CA 2Z33A 4OUMA 2L7KA 3QH7A 1G9FA 1DHKB 4LKFA 1OLRA 3B9IA 2L02A 2DJNA 3M1EA 1ZRFA 4MX3A 1LVAA 5SV8A 5AIPA 1T0FA 1AR71 3OOUA 5DD8A 2RDPA 4YEJA 3GXUA 3VBOA 1GDTA 3MN2A 5A3MA 5HNHA 4K3UA 2OPTA 3M7AA 2ZGOA 1FPN3 1YQ2A 2WFF3 2UWCA 3NVCA 3O3KA 2R7FA 5C8CA 2CWMA 4Q4ZF 3MUZ1 5JSOA 1RUD2 1FTZA 4Y1ZA 4ZY9A 4IV3C 4IV1A 3BJ6A 1NG6A 4Y15A 3RPUA 4K2EA 2WBKA 2IRFG 2QBXA 4MV2A 5FKOA 3OIPA 3V7CA 2LUWA 1NOVA 4AD9A 4JYKA 3J7AO 4EVIA 3DGTA 1H2NA 3JRHA 3LSEA 4HRIA 1DQ0A 4RGRA 4D6RA 5FQ0B 1JT0A 2XHNA 1Q56A 1D5VA 2FHRA 4DNYA 1Y3TA 2FBEA 1YW7A 1UAIA 3HRSA 4AQ6A 4MGYE 3FDYA 5IAXA 3HOVJ 2RVCA 4UAPA 1DQ6A 1OI6A 5FZOB 2VNRA 3RQ0A 2KM2A 1UY3A 1NT0A 1W36D 1EV12 4Z6YA 5DDJ1 4U88A 4DYRA 4JQRA 1TQ5A 4LBKA 4EJTA 3IMMA 1I39A 3QOEA 1V00A 2YUSA 3WLUA 1GFF2 2VUDA 1HQNA 2O0OA 3BIWE 2A6VA 2C1FA 4CYCB 4PGGA 1YOVB 4XIDA 4GULA 3AYCA 1BYHA 2ZX4A 3PUAA 5E8GA 1ZZ7A 1XDSA 1QJEA 4COZA 3GVAA 1AUYA 2VBPA 3IH3A 4W6WA 3F8BA 4ESBA 3NL1A 3O6BB 1JYIA 2RS12 4MHGA 3GBGA 4PQ9A 2VMFA 2RM23 1PIV2 3DFGA 4PSWA 2YB7A 3HQUA 1WUVA 3PVBB 3MIBA 2XPJA 3AKPA 1ENSA 3IZOA 2BZTA 4DW6A 4PJMA 1O4YA 2VODA 2CW0F 2HWC1 1HB4A 2LR8A 4BQQA 3CJTB 2X8KA 3IDEA 3TO6A 3PJYA 1XYNA 1FX7A 4GQ7A 4KDPA 1MEC1 2EXKA 3FLTA 3ESWB 4TN7A 5E8IA 3R05A 1H9GA 4LOCA 4O7XA 4EWEA 2KJCA 3P6BA 1J3QA 3DXJF 2NMNA 4BKXA 1HSTA 3EJKA 5LHGA 4RFRB 1PUFB 1NCQA 2VNVA 3FUOA 2GSYA 3RZHA 4OHZA 4I01A 4CA0A 4UUTA 2L9VA 4ZYHA 5GADJ 3LE0A 4LD5A 4V2VA 2R063 2GIVA 4EN0A 3NJVA 1R36A 1RKTA 4YW5A 5FB2A 4GXLA 4PLMA 2WB1N 2YHJA 4CDUB 1L3JA 4HX8A 4MGTA 4DOUA 4HV5A 4CDUA 3L2UA 2GC1A 4NIIA 1X36A 2P6HA 1RUI1 3MCZA 2P8TA 4CEYA 1QPIA 2K4JA 5FYCA 4CYDA 2ADEA 3K4BA 3CEWA 2FDGA 2X6YA 3ZFGA 5J48A 5DAVA 1TWHJ 1G2HA 5ABJB 4UFJA 1FBSA 3K4MA 1ASJ1 2ORZA 1ZZCA 2QKLB 3OYEA 1NCQB 4BACA 3JB4C 1BR2A 2X5IC 2MH2A 1LHOA 3OR2C 2M8EA 1X2NA 2B0LA 1TWCJ 5I0DA 4A6EA 1UOBA 1FBUA 1QDCA 5DAWA 5J40A 4S2GA 1ST8A 1QH7A 1G9BA 3ZRGA 5EG0B 2ZXHA 4UFHA 2LKXA 2JE9A 1AL22 3CDZB 1QNTA 3I4PA 1HJGA 4DIQA 3RFRA 5K9YA 2XGDA 1EPZA 2W39A 5IP9J 3THCA 1X3UA 5FROA 4M9ZA 2CDPA 3VBHA 1XTAA 3KPHA 4ZYAA 2B4KA 2VNOA 1KS4A 5C4WC 4OULA 3IIAA 3FK7A 3KYCB 3N9PA 2JKXA 2EWNA 1OLQA 2PMWB 1FYUA 1JT6A 2BVBA 3CCJI 2GALA 3ZFGC 1ITYA 2C6SA 5KHJA 3RKWA 1TWAJ 2A6XA 2ZMLA 4JBAA 3MEPA 4RB3C 3AKQA 4X8NA 3WQBA 3H5NA 4CICA 1UPSA 4PJLA 3N9LA 2OD5A 2DDBA 4RM3A 3VV1A 3TW6A 2ZGLA 1V5GA 1DPRA 2BW3A 2XLAA 2DMQA 3ZSKA 4RLFA 3FHZA 2DK8A 1KS5A 3GTLJ 3KEYA 3NAPA 1Y7BA 4Q4V1 4LIVA 1BQPA 5C7GA 1QVTA 2R042 2RV9A 1YW9A 2HQ5A 5KCMA 5GTHC 4CA9A 3HOZJ 1ZVFA 2KR2A 3OBZA 3WTWC 1FTTA 1L7LA 3QP6A 2WN2A 1GZ9A 4JX0A 4W65A 1XGSA 1H1AA 1KYWA 4XJUA 4P9WA 1N3OA 3ZQQA 4HG6B 2KDZA 4Q29A 4BDYA 3CJIB 4JVAA 1LEMA 5B1AH 3WDYA 4P02B 3HPNA 1W2AX 2KQRA 1V6OA 3ERED 4M3CB 1HRI1 1J75A 1HW2A 4UVBA 2NVYJ 1V9U2 3OTFA 2IZWA 4NOTA 1W2TA 2WJSA 3ACHA 2VXJA 3GGLA 4EYUA 3JXSA 4OAYA 5DDGA 2OUJA 3HN3A 2E2HJ 2MH9A 1X1BA 2B39A 1RHI3 1OF3A 5T3NA 5LK5A 2ZBKA 2RR12 4LBNA 4HK9A 3RJ2X 1OPMA 1WZXA 3JQWA 3K70D 2WLQA 4X6AJ 3WNMA 1HQWA 2HYKA 5AONA 1ND2B 1T8IA 3JUUA 4N7IA 3POEA 5FZ6A 3H92A 2KXLA 4RB0A 4XF9A 3HSRA 1H1IA 4XFBA 2GC2A 3DTKA 2AHQA 4CCCA 4I98B 3JU9A 3A4CA 1NY72 3RZMA 4R9DA 2ZHNA 4COWA 1ZKGA 1OA2A 2HWC2 4XILA 2R073 5L9VA 3WGGA 1B9NA 5CVJA 3A22A 2BY0A 3W20A 3VZKA 3WTVC 4L5IA 2GU9A 4RGKA 3CJNA 5C8WA 3GFLA 5ILSA 3TDZC 5LBFA 3ZSEA 4CH7A 2JDUA 5FFOC 1BI2A 3G4SI 2ZSHB 5JZGA 2BV6A 5L19A 1WWYA 4XETA 4KNYA 3H8UA 1XB4A 2D44A 2NYYA 4CHUA 3K4KA 3CHXA 3S3NA 4AVAA 2Z3YA 3BG9A 1ZZ9A 2EZHA 1J1TA 2DAOA 5FRAA 2A3SA 1SD7A 1LKNA 1R083 3RPUD 3GYDA 2W87A 2AEZA 4IE4A 1A3KA 1S6LA 1LNSA 3K1PA 1MQTB 4BJ6C 4BQYA 1SD6A 4ITCA 1WD3A 2NS8A 1QZYA 3L9JT 4LIUA 1S55A 2X10A 1XCVA 2R7OA 2ESNA 3HOTA 3S3MA 1MDMA 3WGIA 3NAPB 1OCRH 3PSFA 2XDVA 5EQUA 1NLSA 1ULGA 4DZPA 3I97A 4NDLA 2UYBA 4Y22B 5IFTA 1US3A 3VYRB 2P0WA 3UGFA 3GZUC 1MJBA 3J80Z 5JSRA 2JDPA 2M30A 5K7ZA 1RC6A 3KHBA 3FXKA 3GZTB 1MS4A 1OCZH 4JTOA 5H9PA 5EIYB 1FPN1 1B1BA 5E1ZB 1KA8A 1VBC1 1W0NA 1HIXA 1UF2C 4RFT0 4XF0A 1LDJA 2NNNA 3H9JA 4GGGA 4AVZA 2BUKA 1R00A 4ZYDA 2YBPA 2FMYA 2RVAA 2EIKH 3KLOA 5HS8A 1OYYA 3SEQA 1JHJA 1D0ZA 5FWJA 2JUGA 3K1NA 3V0AB 4G12A 3IV5A 4NWVA 4D6SA 3MZ8A 3GZNB 2OPWA 2W84A 3CDHA 1OQEA 2VMIA 2DFFA 3IH2A 3OY8A 2I07B 4IL7A 3REOA 3Q8CA 2COMA 4BDVB 4H7LA 3E1F1 4X6RB 1Y1WJ 1RC9A 2LY9A 3U1DA 1SZBA 4ISQA 1OHFA 4B29A 1LJ9A 2OYZA 4A7KA 3V64A 3SZTA 1HBXG 1U5XA 3C7OA 1TQMA 1DU6A 4OFGA 2F48A 4FT8A 4FCAA 5D5WB 4NHKA 2VTXJ 3H50A 2VT3A 4RR3C 4A3MJ 5LA9A 4FVVA 5BOXA 4C0HA 1XBFA 2RREA 1BEV2 2CWSA 2M2EA 2VZTA 4QDSA 2JENA 3AMPA 5IVBA 4EWAA 3W3CA 2CY6A 4KQ7A 1PM7A 1MSEC 1HCRA 2Y38A 2JECA 3EETA 4B8XA 1IC8A 3VBUB 3MIFA 1W6PB 1OJLA 4LULA 5C4JJ 4ZDOA 4A2UA 1X9PA 3E6DA 2FD8A 4KA4A 2PXJA 3W58A 5L3CA 1C4RA 1TZOA 2ZEZA 2WO3A 4AHYA 4Z2YA 4A3ZA 1IN5A 3V8KA 2UXNA 2CG4A 4DGWB 3T1MA 1Z77A 1YFXA 1ETXA 3FFQA 5CU1A 4ET7A 4IW3A 1V0AA 1HA8A 3WW4A 4Q5OA 4BQ1A 3RZGA 4IXLA 1UU5A 1W8HA 1XDUA 5LD2C 2XUEA 2Y6FA 4NAOA 3MD2A 3B5LB 3LIGA 1PGW2 3M8EA 2PMHA 1ZNPA 5KXEA 1JKRC 2ZC2A 3NW4A 2XHKA 1ZRIA 4XLPF 3MMYB 4K7JA 3VKNA 2FUG2 5CYVA 5GLWA 4WVVA 4J00A 1W6QB 4MGZE 1K79A 5CFCB 2A7AA 1LQ1A 4XN3A 2DVBA 4PQQA 2R7XA 5A33A 1WMDA 2RG4A 4AYBA 1IRFA 5EZGA 3AXDA 1TQPA 1HKDA 4LO5B 5E17F 1HQLA 3KZZA 2J42A 3V0AA 6PAXA 3MPPG 4NHYA 1OFNA 4M3CF 4L92A 3FM3A 1BIAA 3RYRA 1R58A 1R093 1QU0A 3RJRA 3BTLA 2PHUA 2JJ6A 1Z21A 4OIPF 3Q8FA 2LBFA 5JR2A 2VE8A 4B44A 1VAKA 3CF2A 4IKFA 4HVRA 4HLXA 2OCCH 2Z69A 1Z91A 4OHWA 3S32A 3DKXA 3IKTA 3KSCA 1IQAA 2GWRA 1W9SA 1ZZ6A 2O14A 1ZX5A 3OUIA 3GO5A 1TNFA 3JZVA 1YX3A 1N75A 3OYBA 3QH6A 2PAKA 3BQZA 4PLOA 2DOEA 5FZ3A 2XROA 2JPCA 1AR62 3WF0A 2ESHA 1VBC2 3R4DB 3LEIA 3GWZA 3C7FA 2JDZA 1JYWA 2RAEA 3HGYA 1W5SA 1R1VA 1WW7A 1B72A 2EA2A 2ZGQA 3CL1A 2OU2A 2WY8Q 3IAM2 1ND3A 1JTZX 2RV8A 2VXZA 5IPAA 3ASOH 1ETYA 2EICA 4JDMA 2HPIA 1Q8SA 2QQOA 4BQWA 3FMSA 4XPVA 5FZOA 1VBD2 1UZZA 1QNWA 2LF8A 2RMU1 5L3EA 3BR2A 1RGSA 2A6TA 4XQFA 2L54A 3FJSA 3OV8A 1WW4A 2XUMA 3NWTA 3AKRA 4MTDA 4OI2A 3BI3A 4NHLA 2NMOA 5LA2A 1ZR4A 3R4SA 4AC0A 4OQ8A 4QX5A 1CPNA 1YO5C 4XUPA 2ZEXA 4BXFA 2DOFA 4XAEA 2V26A 4IQJA 2VQGA 3HT1A 2K5CA 2AXTC 1DYKA 4G8XA 4XW3A 1RUG3 1XG1A 3H3VK 4RQPA 5LA1A 4MUVA 4FX0A 1ONAA 4Q0PA 4M0NA 2G19A 1Z3YA 3ZCOA 2JB8A 3JTGA 5C70A 2LTNA 4QX7A 2UY9A 3ECQA 2SBAA 3SHRA 5DCFA 4QTRA 3OGRA 3U0ZA 1MDMB 3N7KA 2EBIA 3ZFFC 3BG7A 3BR0A 3KYDB 1XU2A 5T50A 3BGAA 4PJJA 2WZR1 2WN3A 3T2PA 1WCMJ 4XACA 2PMZN 1YFUA 1B8IA 1W4MA 2OA4A 2RDQA 4UNOA 1QOTA 4RMNA 1K6OA 3WG2A 1QWRA 5H9RA 2QCSB 3FKIJ 4K8FA 2CDOA 2XBO3 4KI5M 3WV6A 2EXJA 5APAA 1F9NA 2IC1A 2DUOA 5A3OA 3VB9A 1K45A 5E89A 2KP6A 2YX7A 4N53C 4S2HA 4Q1RA 4HVQA 3PUQA 2ATFA 2KKOA 1QZZA 1PM4A 1E3PA 2D6OX 4O9GA 4IUGA 4BB3A 3GBWA 1WA6X 1E5HA 2K7LA 3WU1B 2LM3A 3J7HA 4JDOA 5LWBA 3O1RA 2HVSA 2Q1FA 3HDDA 2AUYA 1SFKA 3OYAA 3SQNA 2VZSA 1I50J 1APLC 4ETSA 4UBGA 4GZ9A 3E5XA 1MW7A 2JK3A 2W85A 5D4RA 1Z67A 1LFBA 2P6SA 3ZQIA 1S1AA 5FP9A 2VQCA 5L73A 1V5EA 4TSVA 2HQNA 1BJAA 3RKXA 5FPLA 4IE5A 2KT0A 2VQAA 1FYLA 4LITA 3CZ6A 5DG2A 4XFGA 2AREA 4A42A 4CRQA 1YI7A 3GJBA 3OWTA 1GU3A 1X2MA 4KICA 1VQMI 3K6GA 4LLGF 2IWGB 2LRDA 4DYQA 3URFA 5LASA 3HHHA 1E3OC 3Q9OA 1DCSA 5K7FA 4YW7A 2NVQJ 1FBQA 3GHNA 4YGDA 3EUHA 4KYWA 3USSA 4N53B 2RM22 4Y4YA 2VKDA 4AEDA 2VQUA 1HV0A 3C2GA 4RAFA 4QDRA 4BS9A 3NO8A 1FOD1 1SMVA 1COV3 5C4WA 3VKFC 2F4PA 4JX5A 4D7MA 4KG0A 4BY7J 3V4GA 3ACIA 1YC61 2YSRA 4S2DA 1ACIA 2MLKA 2WL1A 4P5OA 4E2QA 3L2RA 2PN6A 4I0AA 1QQP1 2FBIA 3A02A 4N7UA 3SHFA 3Q8BA 4WZFA 2CTVA 3DYMA 3NJZA 5IT9Z 3KQ4B 1TT5B 4IE0A 4AF9A 3KT7A 4R4XA 4KWKA 3W6KB 5DS9A 4YGBA 4E7JA 2VKVA 2YU1A 1OCTC 4P9XA 1K61A 5JWPA 1F9KA 4JQTA 2A70A 4Z82A 2L01A 5FYBA 2E7QA 3CP8A 4K9SA 4QIWN 1U12A 1TNTA 3FBNB 5LGTA 4UB6C 5JLXA 2VZ3A 2CFOA 3K4JA 3E6BA 1QJU2 4FPLA 1VR3A 4NIDA 4XC9A 2CQKA 1JYVA 1RVF3 5ABJC 1Y56A 3MKLA 2ID6A 1G3YA 1W9WA 3UNGC 2Q4SA 1QPMA 3WNXA 4CEWC 5F5IA 1W8WA 4QAWA 4HBLA 5BPDA 2W82A 1QJX1 4M3DA 3HZJA 5IK5A 4ZXEA 3SEEA 4S2FA 2Y34A 2FZ1A 1FPN2 5B66C 1SLIA 4CU9A 3CJQB 2BNNA 4MXWB 2H09A 1IUYA 2HWB1 3S2WA 4YVWB 3WR0A 3I3LA 4HSJA 1P2FA 4DOZA 4PHZA 5CVRA 5LEKA 5FZ8A 4FOQA 1LHUA 4RGSA 4W6XA 4PGHA 4J01A 2D43A 3OPZA 4B4RA 1W8OA 1IRZA 3NNLA 3UETA 1NZIA 2VBWA 4V2GA 3ECHA 3G7DA 4NAMA 5B1BH 1UY1A 4EMSA 1W6MB 4EE2A 1ZGAA 5F3GA 2XB0X 4IERA 2A61A 3ZQHA 4GJYA 2VJIA 3HC7A 4O5VA 3BPVA 4Q47A 1AVBA 2YFZA 2ETHA 4E8CA 1P7IA 1NQDA 2VOXA 4XMIA 2E2IJ 1AYN1 5FXXA 3D0SA 3SYTA 1N1VA 3SLIA 5M5XJ 2HXIA 3JRDA 2E1OA 1SPPB 5L9BA 1BEV3 5ACA2 4L9BA 3FHIB 1FXZA 2AC1A 4HL0A 2JZYA 2DA4A 2JA5J 3FX3A 3FXUA 2V9KA 4EJUA 2ZMEA 1DGLA 4B48A 4MEYF 1IS6A 3OGSA 1XPXA 4EJWA 2VMDA 5K5RA 4LE4A 2ZXWH 3F8MA 3OD0A 1I1EA 1KD7A 2IT0A 1UAAA 3FZ3A 1WMXA 2B9VA 2VG9A 1HDPA 3OL3A 3VHOA 5DCMB 3IP4B 2YPRA 2R7SA 3POGA 2YYOA 4OI0A 2VU9A 2HPMA 2A1XA 3MO4A 3P3NA 1VRH2 4M72A 1RHI2 2VJ5A 1XMAA 1AYN2 2GH2A 2ZAAA 4D7NA 2FZ2A 4AG4A 2R30A 2ZZQA 2XWBB 5FKCA 4LLNA 1CAWA 1U9NA 2AEYA 2V1DA 5GLZA 5KHIA 4PBPA 2Y8KA 4HPQA 1QQP3 2O8OA 4BQ4A 1GWKA 1CZTA 2PI0A 2X0LA 5DUKA 1FMD1 2DU9A 1R1ZA 1ZBA1 1VZ0A 2W9XA 5FY8A 1WCKA 1PGL1 3LFKA 2YS9A 1F2NA 2O61A 1QJU3 3DXTA 3ES1A 1D1AA 2OUHA 1JYXA 4A7YA 1SAUA 1PJRA 2QDNA 3FXRA 2G9GA 5DCMA 4N4NB 2BJSA 4WXCA 3OYLA 5IAVA 1Q3EA 1ZRDA 4NPRA 2R92J 2JT1A 3KF3A 2DCZA 2RS52 5F5QA 1YQAA 1HRV3 2QDRA 4K8RB 2DMUA 3ZM8A 3D1NI 5A33B 4QKFA 4J19A 1MMGA 3CNAA 4XJZA 2W94A 4CU6A 2GMEA 5CFDC 5CFCA 3D5SC 1IF1A 3WF1A 1DGWA 4MNUA 2QKDA 5A3UA 4A3XA 2E19A 5EGOA 5E1RA 5JVVA 1IKPA 2D3PA 2JA8J 1QJY2 5IY5H 3WUCA 2GZWA 4CDWB 2XOMA 5FOJB 2XF5A 4P08A 2P5KA 1JHFA 2L4AA 2MSYA 5H2FC 5I8YA 1H8TB 3ABZA 4MGIE 3KD4A 2CQQA 1WKYA 3S1NJ 2WLPA 3RPQA 1UY2A 1DZTA 3BTIA 1VBB2 3I2KA 2WAAA 2DVDA 2NVUB 3PTRB 5FYVA 3ZFEB 2ZGTA 5IVJA 3NWSA 4IPAA 1OOPA 3IPVA 3K3OA 1W90A 2QQ8A 2K02A 3WHUA 4CE8A 3J7AY 3LMMA 3EHKA 4XF3A 4ZC3A 2OW4A 3I2IA 5FREA 5A32B 2BOIA 2OQ7A 5FPBA 3DEUA 5A7WA 1EAH1 4IV3A 2I45A 4LK1F 2F4IA 3FBYA 4LBQA 1VBD3 5F5AA 2J1EA 4HFSA 5FMOS 3R61A 2JTVA 3UKVA 1GSLA 1AR83 3WGHA 3S57A 3MICA 5DDJ2 3LFMA 4R4ZA 4ISRA 1QHDA 4XLNF 2GLOA 1MMAA 1GXPA 5T55A 3KLNA 1MH4A 1GMMA 2XL9A 1R5HA 4LKEA 4F93B 3PMEA 1IV6A 3P5JA 5HNFA 3VZOA 1XE7A 5KVRA 5FZ1A 2HYFA 2YV8A 3WDWA 2CJJA 3K0LA 5F04A 1Q8PA 1VE0A 3PM1A 1X1AA 4J1WA 2DK5A 2V79A 3TEDA 3M3IA 2GXAA 2WNUA 4UXNA 4JK1X 3POFA 1J0RA 2QQVA 3PFIA 4P9UA 5C4WB 4META 4U0WA 2FA5A 1GWMA 4CPBD 2DT7B 2IA0A 4AWDA 1JKOC 3OPWA 5A7WB 1OA4A 3IT8A 3AL0C 3H8XA 1HX6A 1XPWA 4GKYA 4QPGB 2WNVA 2KD7A 4HAMA 3GM8A 4B09A 3MPBA 3HOYJ 3G1LA 3L2WA 1DGWY 2ARXA 5HXVA 1R1A2 4G6QA 2XLGA 3ZXLA 1JGSA 1UWWA 4DRRA 1SBFA 3L2QA 2OZ6A 4F55A 5LBQA 1CF7A 1BVP1 3GNEA 3JREA 4MVTA 1UZVA 4HV6A 3ABTA 1GLHA 1ETQA 3VYTB 5FY1A 2VVDA 3NV1A 1SD4A 2Q30A 3B00A 1YE9A 3P1IA 4MGKE 2JDNA 5BMZA 3NQHA 3HMYA 3POBA 3ZN1A 1GHCA 4U36A 3VD4A 3K46A 4G3YC 4WF2A 1LGCA 3UGHA 1YXWA 3M3YJ 3VBSB 1IG3A 4BQOA 4A3IJ 5FGMA 3ON7A 3IUOA 4ZHNA 4NC8A 3MW3A 5HV0A 3I56I 4XM3A 5HCAA 5F1RA 3NKGA 2QM3A 2M34A 2ZEYA 1G8XA 3ZKYA 3PIPF 3W5NA 4L0ZB 1CX1A 4MO3M 2ZGRA 5FZKA 3BIEA 2E2JJ 4UF0B 2K9MA 2YZ4A 5JZGC 4B3XA 2ZGMA 1ENQA 2ZKZA 1D0GA 4CZSA 2VBZA 3LWCA 2YY1A 2QNKA 2VUAA 1IGOA 2XSDC 1F5JA 1F43A 3BB6A 1J83A 1QY4A 3I2DA 2HWVA 1K7AA 3FWEA 3DP7A 2BBYA 2D2WA 2XJSA 2J5OA 2PMUA 3FXOA 4F83A 2M45A 5J09A 4U0VA 4LUKA 2DVFA 4QX3A 5JOXA 3CC2I 4DBQA 1VLNA 2NS7A 2XJRA 3W5MA 5JFRA 3DTEA 2Z5UA 1GYKA 1MVEA 2JDYA 4HETA 2GBYA 1UO9A 3S1RJ 2YBKA 1Q1HA 4YVSB 1WRJA 5H9SA 2EINH 5EP9A 4JKKA 1TT0A 5LHIA 2R7VA 1W99A 1D2SA 2XBO1 5FLHA 3VFZA 2R7WA 1J84A 1SCRA 4KNCA 2P3YA 1T98A 1YLLA 2A6EF 4DMIA 5CISA 1VB4A 4L5JA 1CESA 3SC7X 5ICCA 4Y3OA 2VMGA 1QEXA 1J2XA 4CEWA 2Y64A 4MGRA 4FCYA 4CCMA 1TEIA 1XOYA 1MEC2 3D5OA 1JUMA 3JRAA 3BALA 2JXAA 3CLOA 4XSZF 3B73A 5M3FJ 1HV1A 4OLLA 4UFIA 2DDUA 4XLAA 3QCWA 1Z6TA 2PHTA 4AWXB 2R7EB 2XC7A 3H9AA 3BOQA 5FYTA 2AGSA 3ZOBA 5J1RA 2HLEA 1KONA 5FFXA 1NK3P 4E7SA 4R8HA 2P2KA 4KWLA 4E7HA 1RXFA 1VQKI 2XMLA 3PUSA 1F15A 3IRQA 3ZMOA 3C2BA 1JYTA 1TME2 2K0GA 4V2WA 3TOAA 2MEV2 3LSKA 4WK8F 3H1CA 1NXD1 1CJDA 1PX4A 5FP3A 2ECCA 2E33A 4YM3A 4GRIA 4N9HA 4YZ2A 3CCLI 1UMIA 1Z78A 4XQ4A 1W3VA 4GDFA 5LFAA 9ANTA 2QGUA 1RL3A 4E7ZA 5IT3A 4M3FA 1GQHA 3POYA 2TRTA 4JX4A 3A2KA 5FBJA 3V65A 1QA6A 4XJWA 1JHHA 2RN7A 4XLFA 2XPWA 3POIA 1FIPA 1OBNA 1JHNA 5LA0A 3K2AA 2YU2A 3AM2A 1IXSB 1IO2A 1Y9MA 2X9DA 4Y20B 3T2OA 4EGYA 3ZYHA 4CEYB 4MG2A 2O8QA 3C7JA 3UL2A 1VP6A 3ITQA 2AYHA 2L5QA 5LB6A 2WC2A 4C2UA 5A1LA 5K5OA 2IA2A 2HWF3 4FPHA 3VBOC 5L7OB 4G94A 1ZBA3 4M4RA 4LA2A 4OMZA 5A7OA 5M3MJ 2DTZA 1LE8B 4Z07A 1POV0 3MIHA 1AKHB 4KT6A 3FN9A 3ECOA 1ULYA 2CQNA 1LODA 5C33A 3I3DA 4DZGA 2KFDA 1W6MA 2Z4FA 4A0ZA 4EATA 5FO9B 2DCTA 4ZU4A 5D5XB 2IGMA 1WLWA 3ZYIB 3A7QA 5DTDA 1BIBA 3CO2A 1K5MA 4V1PA 4BQNA 5GLVA 2X6OA 4LFUA 2QBYA 2ID3A 1W8FA 1YIJI 2WT1A 4D9JA 4B7EA 5EHDA 3EMRA 3H7JA 5K0UC 1LGBA 3ZIWA 5T5OA 3NEUA 4YW6A 3HOUJ 4CCOA 1I9RA 2BOLA 3SMHA 2DMPA 3ZVXA 2G9WA 4OIQF 3UGGA 3C7HA 4NJ4A 4AZZA 4PDWB 1HOMA 4OI4A 3QPTA 1JBCA 1P4WA 4PCRA 5BS6A 1DBNA 2WKKA 2Z99A 1O57A 1W7PD 2DWRA 5D8AC 1ZAOA 1GOGA 4UV9A 1YJNI 2OUMA 1QGPA 2VIXA 4Q4W1 3ZSJA 2FQ4A 5EEGA 3OYFA 4HPKA 1W03A 4FPKA 2GMMA 3THDA 2CL2A 2BXZA 5FPVA 4TXWA 3HR9A 2E32A 1ZK8A 2WT0A 1QXRA 4D0PA 2EFOA 2GN3A 2LY1A 3N9MA 3E7LA 1SLTA 3V0BB 2RQQA 3DKYA 4YW3A 4A44A 2KISA 4LHLA 4V2FA 1PMJX 4C8DA 2DA1A 5E1XA 2YU9J 4UW5A 2J1VA 3CUQA 1XRUA 3J4UH 3D6EA 2JIJA 3BJAA 2VZUA 5IVFA 3U21A 1X19A 3WINE 3V8JA 3LAPA 3KP6A 4M6VA 3HQXA 2WAFA 4IETA 1XYPA 2DCEA 1J3PA 2JRMA 4OUEA 5FYUA 2OQ6A 2HDDA 4AFMA 1Y8QB 2X4HA 1OC1A 2UXXA 2W47A 4ATEA 3WDVA 1FMWA 5ED4A 3R4KA 3JCIA 1X9TA 4XURA 1MJAA 4BE0A 1XSRA 3TEZA 2ID4A 5HCFA 3ZFEA 4RAZA 1VB2A 2OC6A 3I0TA 4WCGA 3PUIA 5FBZA 5HS9A 2LG4A 1QXPA 1TBXA 2H0BA 1GP4A 3H8RA 4ES9A 4LK7A 2R1BA 3D5LA 3VBRB 3B69A 2EFWA 2YXSA 1RVF2 3ZDSA 4OHYA 4ZS3A 3WT3A 4N53A 1V6NA 2VCBA 2IAIA 4MH0E 2GOMA 1XMXA 4CDWA 4AOCA 3LOBA 1P92A 5GAGJ 2IXLA 5FFZA 4HXCA 3D8CA 4IE6A 3BTJA 3AP6A 3J8F2 3IHUA 3ENRA 4P9JA 1R082 2E51A 2YDEA 1UXXX 3VDDC 2ZPXA 4HMZA 4JRLA 4LHSA 5IP6A 3CBNA 5BNQA 2YC0A 4GWNA 5GLTA 3PUFA 4XL9A 3JB8A 3R0AA 1U0JA 2OTLI 4YM2A 1VQPI 3THPA 2DCJA 3DBHB 1MNMC 4YZ5A 4EJVA 4FXGB 4PDWC 3SZGA 2LW8A 2PYTA 1RUG2 1CJPA 1JOBA 3IKVA 2JWTA 2ZSIB 2WIIB 4E9KA 2OCEA 2IGKA 4PFPA 1QDOA 1FWZA 2WDBA 5A3NA 2DYRH 2YR2A 4LEJA 3RZLA 2DQLA 1Z7UA 1U5YA 3AMQA 1F31A 3HUGA 2XG3A 5HLHA 1OKOA 2YUEA 3HBZA 3V56A 1SVLA 3KEOA 2R3SA 1RR8C 5FYMA 5JMOA 3F6VA 5J36A 2DMTA 1R081 2A69F 1PVC2 3APBA 4HN0A 5FMDA 4GKXA 1VQ5I 2P81A 4QKNA 5E3LA 2DYSH 3FC0A 1ZRCA 4UOJA 3GTPJ 4FTSA 4O65A 3ZO0B 1PDNC 2EIGA 3T1LA 3KV9A 2W5FA 3SH4A 2DFIA 3M9AA 2IS1A 3N9OA 4ZS2A 5FZDA 1PP7U 3I7DA 3HXLA 3T08A 1K78A 4AYUA 3U2RA 2GNMA 2HS5A 2WQ4A 4RN5A 3LSRA 1SD5A 1YQ8A 3BPXA 5A80A 3AMHA 3SEZA 3CCRI 1MSFC 1JUHA 2D5FA 3ACFA 3HEFA 1PNGA 5A7SA 2E7XA 5LY2A 1JMUB 1X58A 4LKDA 1CAUB 2MG4A 2V9VA 1RUE1 5FIXA 3S8PA 1A78A 4G6DA 1NLQA 4XK4A 4KGGA 3ALQA 4D7TA 2HXOA 2WQ8A 4M3CA 1KU3A 4WVZA 2DLLA 5ICEA 2K9QA 4A6SA 3GZ6A 1W8NA 2IBDA 2BVLA 5L7OC 4XXAA 2MD5A 4RB2C 2FCVA 1LEBA 3RWNA 4P96A 4P9FA 4HOBA 4QQ2A 1LOAA 5LCWL 1MBHA 5FKNA 3M8JA 4L9VA 5KNLA 1MGTA 1RPWA 1JTXA 3TOJA 3VOEA 4QQOA 3CJIA 4IVNA 3J7ZI 2VVFA 2YGMA 1EV13 4YG3A 1W8TA 3P7NA 3FZVA 4FETA 2W57A 2TUNA 1TME1 4QM9A 5C5UA 4AVPA 2QF7A 2L9NA 4RSUA 2VKEA 1YUDA 2XXZA 2Y6GA 5CQEA 4NHJA 5FRMA 5I8SA 4EEFG 2L9SA 4CDXB 2NP0A 3J7YJ 1GVJA 4NR1A 2A3YA 2CUZA 2NRAC 1ZBE1 2M7AA 2XJVA 5J96B 5C4XJ 4BCUA 4IX7A 2BW3B 3X2QH 4V19K 4PLNA 1CIWA 4I6ZA 3E1SA 2A05A 3OOXA 4IHWA 4XDQA 1WPKA 2AQFA 4EGZA 1YYVA 2HEWF 3F95A 4UWDA 5DAXA 1RVF1 1WGPA 5K4LA 5M5WJ 1W6PA 3IN9A 4NBQA 4BZ4A 5F5CA 3RCOA 5EF6A 2B46X 4BE1A 4WM7A 1VQ4I 5E88A 1AR91 3CP2A 1PHMA 4NE9A 3GLLA 1DLCA 4XJ9A 2GH8A 1W39A 2YBSA 5GZEA 1HB3A 5FZIA 2VN2A 1D0XA 1RRJA 1VBC3 3PO2J 4HONA 5ANQA 5KXDA 3I53A 2D6NA 3PNTA 3E5QA 1CN1A 1TLHB 1Q1VA 1JYCA 5F3EA 3SNMA 4P9YA 3JRIA 3DEEA 4UFKA 1WCQA 1GNHA 1W9FA 3SXWA 4B1MA 4TWTA 4R9BA 1PO22 4CDWC 3M3OA 2RC4A 1BBT1 2V1NA 3BG3A 3A0HC 1DDNA 1U6GA 3H8OA 2X48A 2CYYA 3GTJJ 2B63J 4HLYA 1TQIA 1UFMA 2IGNA 1GT0C 3NARA 2VH9A 4XVHA 2JA2A 4EJOA 2LOOA 2LSOA 2NOGA 2XGCA 4COVA 4CVUA 2XL7A 2Y2ZA 4LO7A 1C5HA 4CCEA 4LMFA 3J26N 1F1ZA 1LU2A 5CKNA 1R091 2OF7A 4IEXA 5ABJA 4TV7A 2Y75A 4BXUA 4E4SA 1AR72 3DV8A 2DCYA 3WW3A 2DDAA 2WFF1 4LO8A 2Y9ZA 3R4UA 2JRTA 5F6KA 4GH4C 1YFHA 4LE3A 2JDAA 2RS11 5BUVA 1UZWA 4AR2A 3BWGA 4CZZA 5CEHA 2A6ZA 4MFEA 4UVAA 1OYWA 1D0HA 2VY0A 4Y1YA 2PLV1 2PJPA 2G9ZA 2QYOA 3K4LA 1TL8A 1W9YA 5ISLA 3FK6A 1FV3A 5KAIC 1QHHD 1R1UA 3E97A 4CUBA 2J1RA 1FAYA 4NQWA 5BNNB 2HWF2 1XYOA 2IUWA 5ERLA 4H3WA 5JXIA 1POV3 1PUFA 2FEZA 1CX4A 2Y48A 1CAXA 3OIOA 3BOPA 3A0NA 1L3LA 3SXYA 4L11A 4ZZDA 2ELKA 2K9ZA 1W2NA 3OCPA 3GTOJ 3FLPA 1VRH3 1SCSA 4S04A 2VZOA 4LLFA 1S9HA 4Q4X2 4XSXF 2VJJA 1U5ZA 3F8FA 2D45A 1PP8F 4QPOA 3AKTA 1SLBA 1YIFA 4OHXA 1WJ5A 4GH4A 4OUSA 4AHXA 4GB32 2RM21 1JU4A 3LQQA 3RKQA 5EJCA 2VMEA 3NQOA 3KFWX 2XAQA 2XPUA 2NOJB 1JUPA 4GFBA 2R7ZJ 2A3WA 5CQGA 3ZSMA 1QJX3 2V09A 3I2HA 1GP6A 4XKBA 3WTSC 1C1LA 1YYNA 1AZDA 2ADUA 4G7ZF 1Y8RB 1LRHA 4DZJA 5J8FA 5DZFA 3GFJA 2O5RA 1D7PM 2W1SA 2DVGA 2WZR3 1VQ9I 1S0CA 3TKYA 4EN6B 4E7IA 4NWWA 3HVDA 1WI9A 2JWPA 4A3FJ 1VBA1 1XE0A 4XBLA 5LW9A 3MZYA 2DMNA 2VQTA 4E4DX 4EM2A 4EV0A 2FNPA 3B94A 5CVVA 2HVRA 4C2MJ 4WXDA 3BU7A 4AVSA 2VL4A 1AU7A 2VZ1A 1U5TC 5I0TA 3DCFA 3ZPYA 3H5AA 2EIMH 2LNBA 5FD5A 1O7FA 3W21A 4IV3B 4AAPA 3HT2A 3GF6A 1IKQA 2IGOA 2HQAA 1UD1A 4B7KA 1GV9A 4ZPIA 2ZX3A 4AHZA 4LT5A 1CGPA 4FBFA 5J47A 1AXKA 3A0BC 1ALYA 2OZUA 2Y9YA 2W08A 2OV7A 3Q9VA 3RQIA 5IYBJ 2VL8A 2ZX1A 3MWMA 4FPEA 3WCSA 1KJLA 3BZCA 4N0BA 3O0VA 4YVSC 3L1PA 2LKPA 5A3PA 1VI0A 1K4TA 2ECBA 4QB2A 2V4AA 1IUFA 2DA5A 4QPWA 1I1SA 2Q5TA 1H30A 3FL7A 5K7PA 1FNYA 4LHNA 3MGUA 1I6HJ 1WD4A 4FISA 2Y0IA 4ON0A 3AC0A 5M5YJ 3CJIC 4QX8A 3ZFFA 2PAMA 1LUJB 4YYOA 2PHFA 1J3RA 1G3SA 3LSIA 4K6BA 1F4HA 1VAMA 1EH6A 2LTPA 4JAAA 1Q8OA 3OPTA 2XJUA 3AFHA 1HDKA 3JRBA 2PHLA 4Y33A 2KIQA 5D5VB 3GW2A 2EV0A 2EIJH 5E79C 2D93A 5BPIA 3QU3A 3C7EA 3MYXA 2F5DA 4B4PA 3V7RA 2LBFB 2XH6A 4LPLA 4EN9B 1P6RA 4PDKA 4JOMA 4IL6C 4Q4X3 3RYPA 3J9SA 5IUQA 1JU3A 2R4GA 4OIOF 3HKZN 4W6YA 2PELA 2OJED 3TW7A 4GWJA 3I4IA 4NIGA 1H2LA 2JSCA 1DZQA 4QX2A 3K1MA 4WM8B 1VPHA 5HLGA 2VZRA 4L5EA 2NPIA 1IG7A 2AH2A 2QE3A 1IZ1A 3WEZA 4MFDA 1ZBA2 1GKBA 1NCRB 2STWA 2DFEA 1KDMA 2P3JA 1PUEE 2LF7A 3TP3A 1UQXA 4JZRA 1AWCA 5H20A 1AJOA 2EA4A 2R071 2PHXA 4D7SA 5FXWA 5AC91 2BRTA 2M87A 2PX9A 1A35A 3VBFC 2BOJA 1OKRA 4M71A 2LK2A 2FOWA 4F8AA 2ZGNA 2ET1A 2EIBA 3WVJA 5CADA 1ETVA 2QSHX 5C44J 1W2OA 3Q8AA 2R7QA 1YJLA 4FOYA 5AC92 4D69A 4CCKA 2AR6A 4CDQB 5JOZA 3P9CA 5T5LA 5A1FA 1FP1D 3TNQA 1C1FA 1VBB1 3E6CC 1DYOA 4AI0A 2P4WA 3N3HA 2CUFA 4XJAA 3CMAI 2JD9A 4F91B 5JOYA 4N90A 2F6BA 1ZZ8A 5BQTA 4QX0A 1TMF2 2H1LA 2DCKA 3ONQA 2HWE2 2A6YA 4NPLA 4DXRA 1XX5A 2QQJA 1OOPC 5EFUA 5HLIA 4WM8C 3CU7A 3KQRA 3HNBM 4LB5A 3TWIA 4ENJA 2ZTNA 3GDBA 2O8KA 4KN7X 1AYM1 1SMYF 1D1BA 1RKWA 5BV6A 2KMUA 1RUF2 2O3FA 4O6JA 5E3NA 2LKSA 3VBFB 4A7ZA 4C91A 5FLIA 2IFWA 1IPKA 5LEJA 1IOAA 2XBO2 4AIJA 1STMA 3I3BA 3QRFF 2UWBA 1A6QA 3WNLA 2NZ9A 3CCSI 1S72I 3AZYA 2L9RA 4GCVA 2X5IA 1XGOA 3ZN6A 4OHVA 5GP9A 1H8TC 3OSDA 3U1XA 2BEOA 4CDXA 5GPCA 4QGMA 1ULPA 2P34A 1GR3A 3H0DA 1L7RA 5HV4A 3BR6A 1W0TA 2HWB2 3KZIC 1Y4WA 2Q1ZB 1YRNA 2PLV3 4BQ5A 2ZGUA 2FQ3A 4UBHA 4AI9A 1XMKA 4PFOA 1K12A 4YGCA 4CDUC 4KN4X 1WJCA 1FNZA 2RS31 4EQQA 1E5RA 1G86A 1O3RA 2NYXA 3EB7A 4QQPA 3ACGA 3R60A 4D8MA 1JOJA 1ZLKA 2SLIA 5BNOB 3MF9A 3ZR6A 1MMDA 4DINB 1IXRC 3Q0WA 4WBBA 2FXAA 1QJU1 3F72A 5LY1A 5FZLA 4QT6A 1ND3C 1ZARA 3VHRA 4FTHA 3S5AA 5DD4A 4M0HA 4HZFA 4CEWB 2WABA 3MKZA 5KK1A 4Y13A 2HBUA 1IGNA 2XIGA 1ON1A 4Y24A 2QQAA 3VKLA 4Q26A 4ZTJA 2B8MA 4XN0A 2Y0OA 4FSJA 1LAJA 1MZ6A 2CO5A 2ZHMA 1RINA 1W36C 1YO8A 2WFF2 1BMV1 3SEPA 1O4XA 4RS5A 1FZPB 4KFCA 1MBFA 3VWBA 5TGTA 2A3XA 3M3EA 2JN6A 3U11A 4B43A 4FFIA 1S0JA 1ZM1A 2RS53 3M70A 3RI9A 2PMZA 4M01A 3RMYA 4YM0A 5DAQA 4LBLA 2XWJB 2VQLA 5GZGA 2PHDA 1SHWB 4TTGA 1Z7S1 1FC3A 5D4SA 3K4CA 4LLOA 4M9XA 3H0OA 1R1TA 4NIAA 4A3DJ 3K4ZA 4SLIA 3WW2A 1QJY3 2DT5A 3CCMI 2JEMA 3L00A 3OMYA 4WZCA 3ZR5A 1S4CA 1ULCA 3DEWA 3DTIA 1WZ2A 5E16A 1X3ZB 3POJA 5T5JA 1VBA3 1HDDC 3MFKA 3R6SA 4Y17A 2LRPA 2VECA 4OMCA 2IP2A 1RJ7A 4OMYA 1X7NA 3WCRA 5FJKA 3I71A 2CS3A 3NV2A 3EDPA 1NXMA 5FUNA 1ZR2A 1HN0A 5FP7A 4XRFA 1BOAA 3BR3A 1E5SA 1XNTA 4MXVA 1ULDA 2BHYA 1X33A 1JZ4A 4A41A 2HZDA 1SANA 1HB2A 1UMZA 3BKZA 1VBB3 1IPSA 1Q8VA 3CIHA 1USTA 3BZKA 5DM7F 2BERA 3FMQA 2EJRA 2IS6A 5FR3A 4ENKA 4KBZA 1R5GA 2B7YA 2L0KA 2IA1A 5C3RA 2MGQA 1DQ1A 1QBJA 2VZVA 1OR7A 1RHI1 4I99C 1U78A 3FXLA 1PZ8A 2E7WA 4FQZA 5LBEA 3RZJA 3HUGB 1S29A 3AG4H 3WU0A 2VW0A 4ASNA 5A3WA 3AXEA 1AJKA 2BZDA 5M0TA 3CCEI 4MO7A 4RQPC 1H2KA 3HJRA 2RE9A 1POQA 2J1UA 4H55A 4CPBA 4CP9B 1KU2A 1APNA 4H14A 2FRHA 3ASNH 3IC7A 3TMOA 4YRDA 5DUVA 1FEXA 3MUY1 2Y31A 5C8CB 2MC4A 4JHZA 4L0YB 1XB9A 4L97A 4NUBA 1DU3D 5EEAA 1FYMA 4GWMA 2KIFA 3DL3A 1XNBA 2NS0A 2FCTA 2R7UA 4NPMA 2EAKA 2Q0AA 3TO7A 1CWPA 1J09A 1BW6A 5FRNA 3AP5A 2NXNB 3HJEA 4KITB 2UV1A 1X82A 3K10A 1S0DA 1CQ9A 3HG9A 2GM4A 3T8RA 1ZGWA 4MQ9F 4F52A 5DN2A 1WJEA 2WWJA 2ZBJA 3TNPB 2Z79A 1D5YA 2D6MA 2E34A 4EM0B 4QPGC 4NROA 2J5PA 3M3CA 5BNPA 4IV1C 3TRSB 2UWMA 1OQYA 1ZQ3P 2WTEA 1O7LA 2HTJA 4C2TA 4JHTA 2W4SA 4XNFA 2WWSA 4K21A 3OL4A 5FZ4A 2F4MB 3IL2A 2WNVB 3QPLA 2BBAA 3JBG1 5FYZA 2I8DA 4FFHA 1FOD3 4FFFA 2PN5A 1IDZA 1MS0A 4II2A 4IRHA 2VCAA 4LNVA 5DUXA 5FK8A 2FD5A 3GFMA 4FPYA 2ME0A 4COYA 1Y6IA 2GXGA 4RGUA 3QLQA 2WNOA 4AI3A 5FO8B 1UX6A 1OOPB 3IPVB 2Q0OA 5EWSA 4YW4A 1A8MA 2MFZA 1DF0A 3QOPA 4BY1J 1B35C 1H89C 2L3DA 1YX5A 3G71I 4U7BA 4DFSA 4IEQA 4CCJA 4AI2A 1LTEA 3ZOIA 1ZG1A 3RRDA 1SBEA 3I59B 2X29A 1QJZA 2A68F 3BPZA 3VDDA 3S1QJ 1TMF3 1E5IA 2WR9A 1TG7A 1RZ4A 5KXBA 2AS5F 4C3HJ 1FI2A 2ARBA 5GZFA 5FZAA 2VCCA 5G05L 1BC7C 3NAPC 3S2HJ 3P9KA 4PIXA 4ZDPA 1PO11 2DA6A 1W6NB 1OUXA 1QQP2 4KIGA 5CNAA 2H94A 2Y6JA 1WCDJ 3FHNA 3LWFA 1IN4A 5A32A 1KGSA 2KZVA 1ZA4A 3ZFEC 1CAVA 5DYMA 5H6QA 2EFNA 4BK5A 3ZX7A 4HPKB 1GZWA 2VZQA 4JGZC 2RR11 1W0PA 4DXSA 3ZN4A 3MIGA 4P55A 3AG1H 3CO7C 2Y69H 1YITI 1CAXB 2P5BA 4XBFA 2AENA 3T0AA 2IW5A 1W28A 1UOJA 1WJDA 4PDWA 3I5UA 5B2GB 3NV3A 3E0JB 3RZZA 2CW7A 3PO3J 3MQ0A 4IO9F 1E57A 5FDBA 3N05A 2RDNA 2AZ5A 2FDKA 4ESJA 5EGOB 4AU7A 3DU5A 3NSTA 3MLJA 1V6MA 2CGPA 2M4GA 1H4HA 1ORKA 2GNTA 4BDZA 5GZCA 1V6KA 3WDXA 2RMU2 4ZZ5A 4Y20A 4EN7B 5C5TA 2ZKLA 2EF6A 1ZG5A 1PYVA 1C8M1 1REFA 4EN8B 1ZG3A 2BE5F 3SFIA 2UYAA 4CP1A 4BXXJ 4QLCU 4Q4X1 3DF8A 1NG7A 4QDQA 3VBUA 5F08A 1NKGA 2FBHA 1LOGA 2R1DA 3GCXA 4W1UA 3JW4A 3ZYBA 4Y5Z0 3EQLF 3LKJA 5JMCA 1UNBA 3WF3A 1RUH3 2HKXA 3FKJA 3Q0UA 4YZ3A 5JXJA 1FPQA 2DA3A 4BK4A 3H3ZA 2D5HA 4DUWA 4I02A 4UHTA 5DXDA 3LEKA 3OUHA 2HWE3 3KGLA 1RUJ1 3BTCA 1OYIA 4BPZA 4D3WA 2QQPA 5JPNB 1VQNI 5FLXK 3IRRA 3N7MA 1AR63 3TOBA 3A01A 2WZR2 2GA2A 4HBNA 3ILNA 3R0RA 4IHSA 4JGZB 5IFPA 3CKHA 1V6LA 1R5ID 4AW7A 1YIOA 4A3GJ 1SG3A 1YFWA 2COBA 3SITA 5FQ0A 1TNRA 2EK5A 3S30A 3JAMZ 2RGVA 1UY0A 1HW5A 2LMDA 3LSGA 3MW4A 2XGEA 1T0FC 2ISZA 4ENMA 4HA8A 2BDRA 2ZNZA 4Q0VA 2K9NA 3J80K 5DQ0A 2VPVA 4XABA 2Q8CA 5EZHA 2PLYA 4KISA 4AIKA 5D1IA 3ZXGA 4UVCA 4JX6A 1WVRA 4GAZA 2Y33A 1BZWA 3T2QA 2LC2A 5KHDA 3K3NA 5LGUA 4RLQA 5EJ1B 2ORXA 2E26A 1T56A 4ZXKA 2CMPA 1JUIA 2DV9A 2K86A 3G73A 2BP6A 3SQOA 3CLPA 1X8EA 5F37A 2E31A 5C3PA 3O1PA 3FFZA 2MHFA 1QO0D 5FTTC 3CMEI 2LP0A 2FCUA 2VBXA 1GXQA 4KT5C 4PUSA 4K1YA 3O5SA 2YC4A 2EXIA 4IZZA 4IHXA 1M1EB 5LRRA 3BR1A 5IK4A 1FOYA 2WS91 4IE7A 2HDWA 2XPVA 4A5MA 2D1HA 3TP0A 3BT9A 2K40A 3NV4A 3IB3A 3CDIA 2E7TA 1H4GA 2XKOA 1E2XA 1AL23 1X3WB 3FLRA 1FOWA 3IAPA 4KWUA 2FDHA 1ND2A 4XXPA 1JH5A 3VBSA 1I1GA 4Q0SA 4HSRA 4W4ZA 3OGVA 5IJRA 2VBYA 4XHBA 4AYBN 1U0AA 1QXJA 1QJFA 5D8KB 1PK6C 2R0QC 5E8AA 4LG0A 3ILRA 1ZBE2 2R0HA 2A71A 2X1EA 2CNAA 3ETPA 2OVUA 4Y1UA 2DUQA 3I2OA 1VRH1 3S14J 2JB4A 3L09A 3JSOA 5FZGA 5JZGB 2DFHA 3D3AA 4RHV1 3INAA 5K5QA 4A45A 2W00A 2NLRA 4E8DA 3DLLF 4FPFA 4BQAA 1QMJA 3TQNA 3Q5FA 1R22A 1S0FA 1PIV1 1Y9GA 3UJOA 5FZ0A 3DPLC 2GAUA 3KCCA 4LOTA 1N25A 1A6IA 4P14A 2XUBA 2WS93 3O0XA 2PFBA 1REPC 4ZKTB 2EFPA 3EUHC 2F5VA 3CCVI 1UMHA 4MYEA 4AGRA 4TZDA 3VBSC 4XIKA 1JZ2A 5KBFA 1ETKA 1W9TA 1K78B 2HOTA 2VOVA 2WYSA 3UJQA 4QXCA 4XLCA 2ZXIA 1MIJA 2J22A 2ES3A 1SFNA 2ZJCA 4UF0A 2RDRA 2OQRA 3HRMA 2O9LA 3GJAA 4AFBA 2CAUA 4GO1A 2AXLA 3OGJA 3AZVA 4EWDA 1EV11 2OBPA 1IRGA 2HOAA 4XQWA 2CRGA 4Y1VA 4YZ1A 2XAFA 1LNWA 1KQRA 1BI3A 1RUC3 3I9V2 3LA7A 1UKGA 2R93J 4E4ZA 4O3MA 4LBQD 2A73B 1MS1A 4YPJA 5FXVA 5EDNA 2ZXJA 3O1TA 2JDKA 1U2WA 5HI0A 2D97A 3AL0B 3WHBA 4L9TA 2DPDA 4INDA 3ZXDA 3LAGA 3K9TA 2JDHA 2EV6A 2DVAA 2VD7A 3MIEA 4RA2A 1C57A 4LBQB 2G9FA 4R1HA 4UW3A 1RUF1 1ASJ3 4HNTA 4KG8A 1AYM2 2KLOA 1O6UA 4QU1A 3H5RA 4QGNA 2L9LA 4HANA 2HWE1 1VMFA 3HTSB 1YRZA 3ROUA 4XCAA 3NNFA 2D40A 3OBAA 3WSOA 1RUH1 3FIWA 3DPRC 1LGNA 3UKNA 2IEKA 4UUSA 2N8GA 3ELNA 2CYFA 1UIKA 2FNAA 1G3WA 4CDQC 3GEZA 3RTRA 5KC6A 5EJ3A 4N43B 1M4WA 4GIQA 1ONVA 1OCCH 2MYSA 1QF3A 4R52A 2QQMA 3JD71 4XFAA 1LR5A 3C2HA 3CQZJ 1RNLA 4IEUA 1MS9A 4M3GA 1GQPA 1YRNB 1XQNA 3G1MA 2DU0A 3B93A 4RD7A 3TEWA 1B09A 4HQEA 3I3EA 5B4NA 3TN93 4YFZA 3IDAA 2E1MC 1BC8C 2R061 3HEIA 4E70A 2R072 4MGSA 3BN6A 1KRIA 5EG0A 3KF5A 1WJBA 1F4KA 4IEZA 2VI6A 1R1A1 5BXXA 3I2FA 1RUNA 4IEVA 1U5TA 4LBOA 2XJPA 3PNYA 2WYFA 4AI8A 4OINF 2QQ9A 1URXA 3KLSA 4I7HA 4HEA2 4LO6B 5GAEJ 4CXYA 5J4VA 1RUJ3 5JI6A 4NIHA 3DPRA 1N78A 3MF6A 1C8M2 1R23A 2CQ7A 1SDWA 2V9PA 1X1PA 3VB2A 5F6FA 1EA3A 2DI3A 1UZCA 1BBYA 4ZU5A 2PHRA 1RMU1 5EV7A 2D6KA 4ABZA 4XCBA 3H7YA 3DYPA 1MZFA 5T54A 5A2QK 1G9AA 2BQPA 3P9IA 4TLGA 3VGIA 2IXHA 1JGGA 5JCTA 1PX3A 3O8GA 3H1MA 1UCRA 4Z2AA 4E4HA 2QFEA 3D5RC 3WD5A 1WH5A 4Q4Y1 5JPMB 3E3VA 3AP9A 1VFCA 1S0GA 5C8CC 1VBD1 1VAVA 1XXNA 1W5TA 1D4M3 2BY3A 4Z8BA 4OIRF 4P5HA 4FTEA 2FMDA 3TEYA 3ZN0A 1W6OB 4QB6A 3BCBA 2VO5A 1NYWA 1JJ6C 1UB9A 3WW1A 1DGRM 1J59A 2DA7A 4RR3B 2JG9C 2HFHA 1CAWB 1OUSA 3HPGA 2NM1A 2UUZA 5F0FA 3MBWA 3OYDA 4ZDLA 2RMU3 1T95A 2ZMNA 3FBMA 1G7YA 2W1UA 3JQXA 1STZA 4KIBA 3U1KA 2F17A 5BY5A 1RESA 2FJ1A 3ACLA 1XCBA 2ILMA 1DQUA 1SPPA 2RNGA 1JXSA 4B8EA 1IN7A 2VUCA 4JGZA 4AL9A 3JD72 1YQ5A 5A7QA 1IRXA 5ILUA 4KU7A 2BV4A 2LROA 3ZXAC 1LECA 3I3MA 5CFDB 5TSWA 3HOBA 4ES8A 1XSQA 4NQWB 5BNNA 2QZ2A 5L3DA 1QIQA 3L2VA 2YC2A 1KGYA 1GNYA 2CFXA 3ZYRA 3KP4A 3OB8A 2F2EA 1U3EM 3MKWB 1AL21 1VBE1 4H7MA 4Y26A 2Z2SB 4BIOA 2A5WA 5FYSA 5JI7A 3OYWA 1PZ9A 1MZEA 1GZTA 3OY9A 4YRVA 3SCGA 5J7MA 1OISA 3WDUA 1FLIA 3J7NA 3K48A 4XONA 3T09A 4MIMA 3WTXC 3PL0A 2VOPA 1LHWA 3IM0A 2DT6A 1FT9A 1HRI2 2VB6A 5TJJA 4Q4W3 1A34A 4DB5A 5FZ7A 1OR7C 5J3LA 5CG9A 1FMD3 4DXZA 1W6NA 1X1CA 1YI9A 3A1YA 4MTEA 2A6HF 1MS3A 3DN7A 2X53S 3OSFA 3GZAA 4XUNA 3Q9SA 4RR3A 4N43A 4F3QA 3PQJA 3LAJA 4A3BJ 2ZXQA 2P7CB 2J1SA 4BH9A 2MNGA 1O4TA 3O14A 3AJZA 1Z7S3 2B7EA 1KXGA 2YPJA 4XFFA 3VHNA 3D0JA 1VQOI 3TB0A 4YZ4A 4R79A 2TCTA 1O59A 4AVTA 2Y0SN 3O2PE 1QH6A 3HNMA 2CV6A 1R4MB 1IS4A 3NKTA 1QJX2 1SVMA 1JI8A 5FP4A 1OVSA 3G6JB 4W8JA 4GD4A 3VODA 4IV1B 4G7OF 2LS6A 5FYIA 4BE2A 4BXSV 5IWFA 2BGOA 3AZWA 1TVGA 4LG3A 1USSA 5F0CA 4FE7A 2GNDA 3OYCA 2WBMA 2VOOA 1Y1VJ 3W6VA 3VZJA 4B4CA 1BEV1 3A0KA 2HWF1 4PK4A 3ZKUA 2V73A 1GV2A 2XV4S 1NE6A 3IKWA 3WF4A 1K3IA 2V5DA 3RG0A 3SDBA 4QPQA 4BNCA 2XVGA 3BY6A 4A3EJ 2OKXA 3DBLB 1QVUA 3MFCA 1J5YA 1PVC3 1EAH3 2R32A 5IYCJ 2CH0A 4JCKA 4RHV2 4UUSB 5FJHA 1GP5A 2C26A 3HTUA 3KVAA 1OSGA 4YIFA 2QWWA 1P4XA 2XJQA 1XGMA 1K5MC 2DU1A 2X1DA 3ASIA 5J1XA 3ZMUA 3U37A 1RTVA 2VC1A 3DXUA 5ANNA 3CJRB 4GMP0 1T38A 1S7OA 1JJ8C 3HBKA 4BHPA 2HWB3 4MADA 4XORA 5KR7A 3VDAA 3WP3A 1EYBA 4X1EA 4JV4A 2Z42A 1BBT2 3KV5A 3S7EA 5C3OA 2ACJA 4XKCA 2G7UA 3OY8B 2RS32 2WINB 1SFUA 2WNEA 2QQWA 2TBVA 3KV6A 1N1YA 3T1BA 3N97A 2HH9A 4HVOA 4ZU7A 5D8AB 2DOAA 1MQTA 4Q8LA 4XQDA 1AYM3 3RZOJ 1H6YA 4QWNA 3QPSA 1IV8A 3VKMA 2OX0A 1SMTA 3S15J 1UU6A 3AKSA 3DBRB 1PGL2 1BLZA 4RAYA 2VM9A 1PK6A 3VDCA 4B3AA 2XR4A 2WSVA 3ZQLA 4FP2A 3K4NA 3EYYA 4QM8A 1NTCA 1SLCA 4RM2A 1JUSA 3MFAA 4PT6A 4M9SA 2RS13 2ZCWA 4BL0B 1CAUA 3CCUI 2WA3A 5BNGA 3DQVC 4LG0B 5T5PA 1NUKA 1I27A 1ODNA 2B9SA 5L3BA 1LHVA 4ORFA 4X6QB 1VQ6I 4J25A 1XSDA 1F4AA 4GALA 3U78A 2IXJA 2W92A 4QPIA 3JCUC 2BGCA 1AF9A 1JODA 2GC3A 2I74A 5A3LA 5D21A 3AYDA 2M1BA 4O61A 4PJ0C 1JTYA 1VBE2 1QZEA 4FX4A 4Q8KA 2VE9A 3GF2A 4XDOA 3VSKA 2C5DA 3F6OA 2V72A 2AACA 1E3HA 2ZJRF 1V70A 3CJXA 5AVAA 1QOOA 1XN7A 4W97A 4FFGA 2B5HA 2G4IA 4YIRX 5A6YA 1GNZA 2W91A 2LFBA 2WB1A 1LCLA 3MW2A 4XBNA 2L7FP 1Q43A 2D3RA 3RKYA 3LGRA 2DQRA 1FYKA 2X6WA 3GHMA 3S3OA 4A6DA 4KMQA 4ZH4F 2VTXA 4CDXC 3AFKA 1NCRC 3FXMA 3NAUA 3RNSA 4OWRB 2ZMKA 5CB7A 1BK0A 1R6RA 1WLDA 1K42A 2Z9OA 2CAVA 2E71A 3MAJA 5DUUA 4NHXA 3WNNA 1Y0NA 1CONA 2ARAA 4FXKB 3ULQB 4HNVA 2DPUA 2ZGSA 5BPXA 1Z6RA 5FPAA 4FHTA 1UHSA 1ODDA 4HQMA 1WMFA 2DF7A 1F5FA 4QXHA 3RSJA 4OU0A 4C90A 4J1XA 2NAZA 2HQRA 2JG9B 2E6VA 1XNCA 1NX9A 1IZ3A 2W2IA 1HSJA 1EV7A 2Q8DA 1SLAA 2VQHA 2OQGA 1HXS3 2CU5A 5HS7A 1B72B 3WQ7A 4P1WA 1GICA 1AA7A 5BNNC 4FO9A 3TGNA 5F32A 3AJYA 4OCTA 3VUOA 4EJRA 5FLXZ 1R71A 4RQPB