3O1RA

Iron-catalyzed oxidation intermediates captured in a dna repair dioxygenase
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
202
structure length
202
Chain Sequence
EPLAAGAVILRRFAFNAAEQLIRDINDVASQSPFRQMVTPGGYTMSVAMTNCGHLGWTTHRQGYLYSPIDPQTNKPWPAMPQSFHNLCQRAATAAGYPDFQPDACLINRYAPGAKLCLHQDKDEPDLRAPIVSVSLGLPAIFQFGGLKRNDPLKRLLLEHGDVVVWGGESRLFYHGIQPLKAGFHPLTIDCRYNLTFRQAGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Alpha-ketoglutarate-dependent dioxygenase AlkB
publication title Iron-catalysed oxidation intermediates captured in a DNA repair dioxygenase.
pubmed doi rcsb
source organism Escherichia coli
total genus 47
structure length 202
sequence length 202
ec nomenclature ec 1.14.11.33: DNA oxidative demethylase.
pdb deposition date 2010-07-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.590 Mainly Beta Sandwich Jelly Rolls Alpha-ketoglutarate-dependent dioxygenase AlkB-like 3o1rA00
4QKDA 4NIHA 3RZJA 4QHOA 4JHTA 3RZMA 4O61A 4IE5A 4NIIA 3RZKA 4ZHNA 3KHBA 4IE7A 3RZLA 3BTXA 4IE6A 4IDZA 3I49A 3S5AA 4QKBA 3O1MA 4NIDA 4ZS2A 3BU0A 4NROA 3BKZA 3I2OA 3BI3A 4RFRB 4CXYA 2FDFA 3O1OA 3H8OA 5F8PA 5DABA 3O1RA 3O1TA 4IE0A 4ZS3A 4NPMA 4O7XA 2FDKA 4QKNA 2IUWA 3RZHA 4CXWA 3O1VA 3H8RA 4QKFA 4IE4A 3T4HB 3H8XA 4NJ4A 3BTZA 3T3YA 2FDIA 2FDJA 4NPLA 3LFMA 2FDGA 4NRQA 2FDHA 3O1SA 3I3MA 3I3QA 3O1UA 2FD8A 3BIEA 4CXXA 3O1PA 4NIGA 3KHCA 3T4VA 3BTYA 4MG2A 4NRPA 4NRMA 4MGTA 4OCTA 3RZGA 3S57A 3BUCA
chains in the Genus database with same CATH superfamily
2JG9B 1QKQA 2Z79A 3MYXA 2JDMA 2CGNA 5FTTC 3CZUA 4FFHA 2A70A 4LBJA 1OUXA 3E5XA 2BBVA 3GDBA 4D7SA 5FO7B 2V4AA 5FYTA 2C9KA 3T30A 2R063 4YGDA 1JYTA 1W05A 4HT1T 2MEV2 3B9CA 4XF4A 3MEPA 4EN0A 1NQJA 2QDNA 2VMEA 4FXGB 1H4HA 3HQRA 1GICA 1LHNA 1QJX2 3FX3A 1Q56A 5D1IA 5F9TA 1CGPA 4Q27A 1LEMA 1XJAA 1W8FA 1ZRIA 2YU2A 4Z1VA 2RS51 4FPLA 2OZ6A 1YIFA 4CEWA 5HI0A 1U0AA 2VMGA 3ZN5A 4MADA 3NV4A 2ZPXA 2HWB2 3KQRA 4I3GA 4YW5A 2VMDA 5J7MA 4AQTA 4Q4Y3 4XC9A 2AR6A 3ZSKA 4BQ1A 5A33B 3MIGA 4Y22A 1WCQA 2E31A 3WG3A 3ZXAC 4LTAA 1JUIA 4Y20B 1XYPA 4WZCA 2ARAA 4L8QA 1BK1A 4Q0QA 5B2GB 5CFCB 1I3HA 1W2OA 2XB6C 2WZR1 3TBDA 5FY8A 4H7LA 4MGZE 1EAH1 1H2LA 3VUOA 1Y9QA 2R073 1ASJ1 4N43C 4WM7B 2BWCA 2TNFA 1O3TA 2RE9A 2WL1A 2WNOA 4DUVA 2W87A 5DABA 5JR7B 4RS5C 3T08A 2BWAA 2ENRA 2HBTA 3ECQA 3MV11 4W8JA 4AI0A 3M1HA 1HB4A 3MGUA 1ZA7A 3KB5A 1KJRA 1RUC3 2IUWA 3KD4A 1BHGA 1FV3A 4LORA 2W1QA 2HH9A 5FPZA 4OULA 3WLUA 1PVXA 4Y24A 3SEPA 4Q1RA 4QHBA 4MXWB 3T2TA 2JG8A 2Z42A 1AXZA 5L7OA 4COYA 2UURA 2MNGA 4LOTA 1N1YA 3VBUC 4QX3A 2YG0A 3H8RA 2YBPA 5CFDB 1QXPA 4YM0A 1PMHX 1XYNA 2MPFA 1HN0A 3C7FA 3JQWA 4QU1A 5C3PA 3H8XA 4C8DA 3MLKA 2RG4A 3HR9A 2VNGA 4FAHA 4CDWA 1LB2A 4CZSA 3OYWA 4OHYA 4YG6A 2A6XA 5FAXA 4ZKTB 1G7YA 5ACA3 4B4QA 2DDUA 4J1WA 3M3EA 3WEZA 3AZVA 3ZXGA 3J7MA 4OMDA 3UL2A 3AKQA 4BIOA 1FT9A 3A4UA 4K1ZA 4XQWA 5JZGB 4MGKE 3O1SA 5J36A 4LBKA 4LBQD 2H6BA 4BA6A 2XJPA 4CXXA 4UOJA 2VU9A 4WVMB 1MZEA 3RRDA 2G1MA 3WP6A 1KD7A 4A45A 3NV2A 4PT6A 1XE0A 4Y1XA 4NWVA 3SCGA 3P1IA 2Y64A 3WNPA 4Q8LA 3VBSA 5FZOA 3T4VA 2WNUA 1CIYA 1RHI2 2LROA 4K3UA 4AE2A 2XDVA 1AVBA 1UN1A 4P00B 2RM22 3N9LA 5BNQA 5A32B 1UCXA 3ZSMA 5LBEA 5A70A 5ABJB 3GHNA 3J9SA 2AC1A 5F39A 1J3RA 3FZ3A 2RDNA 1A3KA 1GMMA 1WMEA 2XG3A 3N9OA 5FZ4A 4IV1C 1GP4A 1RMU2 3H1MA 3PDQA 4JHTA 3R6SA 3RMYA 4EWAA 1W8HA 4UFLA 3RJ2X 1BYHA 4XFFA 4URAA 2Q1MA 1RUJ2 1DQ6A 2JD4A 1E5SA 3ALQA 4AHXA 1FPN3 4O65A 5FZKA 2Y60A 4J1XA 2A5ZA 2ZHLA 3I59B 2D6MA 1RGSA 1NG0A 5FYVA 4CP2A 1MS1A 3FWEA 3N9NA 3ZFGA 3LZZA 4KU7A 1W6PB 4E2QA 2BGPA 4DY5A 4L9BA 2KM2A 1C8M1 1SFYA 3KCYA 1NLQA 5LA9A 1O4ZA 2JICA 3AC0A 3VD7A 5HCHA 1ZRCA 1B35C 1IOAA 1KITA 2J1UA 5H9RA 1DZTA 3MIEA 5FZ8A 1W2TA 2XQRA 3N9PA 3RVHA 3NAPA 3ZYRA 4LLOA 5LEKA 1GKBA 1LU2A 4L2NA 4OUSA 3FFZA 1MZFA 5FIXA 3K4DA 4EWEA 1JYWA 3T0AA 3S7EA 5FDBA 3W5MA 2BV4A 3IAQA 3O0WA 3K4ZA 2PLV3 1V9U2 3D5OA 2Y33A 5F8PA 4AVSA 4XOGA 3ZXJA 4CCOA 1ULDA 2BGCA 2WQZC 4I2OA 4XJAA 1QH6A 1R64A 5DXDA 4K6BA 2EXJA 1RJ7A 1AL23 2VOKA 2BFUS 2OT7A 1AR73 5E6HA 4OHZA 1DIWA 1ODNA 1XNBA 1S55A 2PFWA 4XCBA 3WV6A 2HYXA 4XF1A 3QACA 2JDUA 1XU1A 3J4UH 4ITCA 4OHWA 2ZGQA 5KHIA 2B45X 4OLLA 1O8SA 4LKSA 4TLFA 5DUUA 4DMIA 4CXWA 2ZGSA 4EN8B 1ZRDA 3VGIA 3LWCA 5D2AA 5F2WA 2ORXA 3DXUA 4YZ2A 2YV8A 4JGYC 2PAEA 5DUWA 5KXDA 5HPOA 1YCIA 2MEV3 4LKDA 3J8F1 1UZZA 4XILA 4KBZA 1QJX3 1W6MB 2ES3A 2A3XA 1W8OA 2ZX2A 3I2FA 1YFXA 4N7IA 4V2WA 1JZ4A 2YGMA 1JH5A 1WLDA 4HVRA 1UZYA 1Q8OA 2HWB3 3DXTA 3S5QA 4OQ9A 4XABA 3KLSA 1S0GA 2RS11 4INDA 1Y3TA 5BNPA 1ST8A 3B02A 2Q8OA 2XR4A 5A1FA 1CVNA 4PI0A 3RNSA 3ZR5A 1JYVA 2D3PA 3JBG1 1V6MA 4N43B 2DYCA 1BEV2 2XL7A 4Y5SA 4CA9A 1RUD1 1VBE1 1VR3A 3KHCA 1V6LA 1PMJX 5EV7A 4B29A 4RS5B 2K0GA 1A78A 1RUE2 2ZX4A 3CNAA 1AR61 1F5FA 4Y1UA 2C5DA 3QH6A 1NE6A 4Q0VA 1IG0A 1ZM1A 4OVEA 3ZXDA 4HK9A 3ZN6B 2DCYA 2ZMNA 2DFBA 4QPYA 3N35A 4NWWA 3SLIA 2B46X 2VZTA 3J7HA 3WF2A 4IGPA 4Q8KA 4EN6B 3EYPA 3VBUB 5K0UC 1O6UA 5CG9A 5EXOA 2BNOA 5FZ1A 1NE4A 4E4DX 2XUEA 2I45A 4CRQA 5JIUA 1X33A 1XE7A 5LWBA 2ZGPA 1VBC3 1WA6X 2CAUA 3MFAA 1DLLA 1OD5A 5BNOC 4XUNA 1LOEA 4GJYA 3OGJA 4PBPA 1RUH2 1YWKA 4A7ZA 2Y6LA 4FT8A 2JKXA 3VDBA 5C8CC 3GZEA 1RB8G 1NX9A 3LPGA 4L97A 4NMIA 1WLWA 5FO9B 5AVAA 1HJFA 1PO22 1K5MA 3T1MA 3SQOA 2VNRA 3AB0A 3AKRA 3PIJA 4GWJA 5FZLA 1AJOA 1AJKA 2VZSA 2OX0A 1X36A 3B3QE 4B1MA 2LALA 4LA2A 1W6OA 1DLCA 1D4M1 3LEMA 4QKBA 5GLTA 5HV4A 1YFYA 2VOVA 4GQ7A 3H9AA 3SCFA 2E9QA 3GJBA 3WNKA 3QD6A 4Z2WA 5CA6A 1WW6A 1PVC2 1C4RA 2VZ3A 2R041 2WZEA 5BPXA 4QPGA 4H3WA 1AX2A 1DGWX 3H7JA 1LR5A 2J1SA 4QX7A 5DG2A 2HEYF 5F6LB 3H8OA 3S0MA 3VZLA 4BK5A 4AFDA 1X9TA 1GLHA 1CAVA 2VL4A 4OI1A 3WINE 1SCSA 4NHMA 4CDXC 3O1RA 3M7AA 2JEMA 3POWA 1UY1A 1REFA 4FPFA 3CLPA 4XAEA 4H14A 4IV1B 4YZ4A 2HWF1 1REEA 1RHI3 1QQP1 1RUI1 2XBO3 3ETQA 2GAUA 4N9IA 1W0PA 2RM23 1WA4A 4OI4A 4C91A 5JSPA 2VMFA 2DFCA 2LRPA 1Q8VA 2MHFA 3N7KA 3BTAA 2EIBA 1PZ7A 4HXCA 4AFAA 1S1AA 4UFJA 2YUEA 1RMU3 5HV0A 2VW1A 3W9AA 2W5FA 1MR5A 4Q4W2 4IEPA 1QOSA 5DUVA 2RV9A 2R16A 3WF3A 3AKTA 4XZPA 4KWLA 1RUJ3 1ZRFA 1WZXA 1B35B 5ANQA 4M01A 4AXOA 4X6QB 4E4ZA 4M4PA 1VALA 3NNMA 1DGLA 4CDQC 2BUKA 4QX5A 1VBA2 3M8LA 4XHBA 5FKBA 2E63A 1DQ2A 3V64A 2BVVA 2HEWF 3MUZ1 5F32A 3FMGA 3VHNA 1TZOA 1IPJA 5FQ0B 1ND3C 5HCAA 4EN7B 1ENSA 3CQOA 4GMP0 1VBD2 1UKRA 5DDJ1 5GLUA 1U12A 4CEYA 1NT0A 3LA2A 3HT2A 5CEHA 4JKKA 3KQ4B 2AREA 2P6CA 3VBHC 4K21A 4DZGA 1PZ8A 5KXBA 1PGSA 4AEMA 3H50A 2YGLA 2R1DA 1W8WA 3K51A 2GN7A 2WZ8A 5DAXA 1R092 1YIPA 4XXPA 2VMIA 2PHTA 2HBUA 1V9U3 1Y9GA 1G9BA 1V00A 2AUYA 1EYBA 1O8PA 4HN1A 5EYYA 4Y4RA 2SLIA 1LOFC 5FUNA 5A3NA 2HWD2 2KD7A 3H7YA 3ZFFC 3WNLA 4JGYB 4Q4X2 2WYSA 1KQRA 1HJGA 4LHKA 3AMNA 5FFOC 3WDYA 2X05A 2JD9A 5FXWA 4BDVB 2QKDA 4HG6B 2OPKA 4BU2A 3NW4A 2WC2A 2ZGTA 1H1IA 4XIKA 3WQ0A 3R0RA 3WW1A 3A22A 4CU9A 1GWKA 4MGYE 2UWBA 3JU9A 2PHLA 2C9AA 3I2JA 3KHBA 2VTXJ 3WF0A 2ATFA 3FE5A 4GWIA 3A21A 3VKLA 1KGYA 2J1RA 2WO1A 2VMHA 3VL9A 4QWNA 4ZU5A 3M70A 3V0AB 3LDBA 1CZVA 4BQXA 4KH9A 4BLIA 3KGZA 4AGRA 2Z69A 5IVCA 4JGZA 1QHDA 4BMBA 5JPNB 5C8WA 4R52A 4QQHA 2ZHMA 2ZXQA 3LSDA 3WHTA 2PHUA 5FYZA 3B5LB 1IS3A 1YQCA 3VDCA 4B4RA 5C4WC 4MHUA 4EN9B 4ZY9A 1BEV3 1QOTA 2X5IA 5FPLA 2GH8A 4EWDA 2RDSA 2RS52 4P9JA 1SPPB 2FDKA 1RUE3 4N53A 5FMDA 1FOD1 2IXLA 3GJAA 3MPBA 3OY8A 2NM1A 4QX1A 3CL1A 4CCCA 1A8MA 5T52A 5IK5A 3I2HA 3O1VA 2Y6FA 5BNOB 3KSCA 4PF1A 4R4XA 1DYOA 4S2GA 1K42A 2WS93 4QQLA 2DVFA 2O8OA 2WWSA 4LKEA 3V0AA 4P5YA 1DQ4A 3RDIA 3ON7A 3URFA 1W04A 3AXEA 1US2A 4B7KA 4GWNA 2ZA9A 5C8CB 4UFMA 5FBZA 5JWPA 2HEVF 1OT5A 2WZR2 2XL9A 4BJ0A 3ZFEC 1JN2P 1EAH2 1D7PM 2FDJA 2QDRA 3LF7A 3I3DA 5AFBA 1ASJ2 2FDHA 1RUH3 4RHV1 2YFZA 3VD4A 2RJ2A 2WT2A 3Q8FA 2ZEYA 3IN9A 2FD8A 2P3YA 2ZJCA 4KGGA 4YVWA 3VKNA 4P08A 3ZIXA 3BIEA 4QM8A 5JAXA 3O1PA 1PO23 2JDKA 4LBLA 4HPKB 4DB5A 4Y4YA 1X8MA 3ACGA 3FHQA 1AUYA 2QQMA 4GWMA 2OA2A 3V65A 4QXHA 4AEDA 1AR81 2XJUA 4XIOA 3CJXA 1HV1A 2RJKA 4QGNA 4Z82A 2GALA 1OVPA 4CDXB 5JPMB 4BQ5A 4QQOA 3VKMA 3J26N 4W6WA 4IEVA 2Q8EA 3UV9A 1PVC3 4NHKA 2VTFA 2WS91 4QDRA 3U4SA 4MGTA 3D0SA 2BZDA 5FBJA 4N8MA 5J1XA 4AI3A 2DURA 4UF0A 1JZ3A 1JOJA 4QMAA 1A6CA 1Y4WA 2VAUA 2WQ4A 2FMYA 1JTZX 3UGHA 5DMYA 3QLQA 5SV8A 5FZ6A 5FYHA 1OOPC 5IK4A 1XYOA 3D82A 3IDCB 1CPMA 1Q5OA 3IT8A 5GZGA 1RTVA 1MVEA 3AZZA 1R1ZA 1N1SA 2DVAA 2GC2A 3G7DA 5LZ6A 2EXHA 2Y26A 4M0NA 3POFA 1X9PA 1QGLA 1Z7S1 1LESA 3A7QA 3G6JB 2E51A 3JUUA 4HLTA 1RYYA 4IE5A 4ONUA 4XUPA 3OUIA 4AGGA 4DUXA 5A7OA 1Y43B 4XMAA 4JDMA 5L9BA 2JJ6A 5CFCC 2IZWA 1UPIA 1YI9A 3GCWA 5A3OA 1NY71 5DZFA 4JAAA 1YJKA 4YW6A 4CDQB 4A4AA 4XJ9A 1O3SA 2VZRA 1IQDC 3W5NA 3IWZA 4GMP1 4RL7A 4Q4W3 2VMCA 5DPNA 1LGCA 3WCRA 4JKLA 3ASIA 1UNBA 1RUF1 5IJRA 5F3CA 5IK8A 1EV11 1SLLA 4FTSA 1QXRA 5ERLA 5DN2A 1O5UA 3VDDC 1OC1A 3S7IA 1S4CA 4FPGA 1MQTA 3SITA 1VBA3 4E8CA 1W9FA 3VBHB 3OGSA 1F9KA 1OPOA 4LOSA 2VH9A 3PVOA 4NE9A 1GU3A 2RS31 5CG8A 5ISLA 4QGLA 3MI8A 4DFSA 4JVAA 3NJZA 3LPFA 4F3JA 5CFDC 1VBD3 1ZA4A 4UFKA 2VBDA 3WCSA 1JXNA 4MH0E 1PK6C 2XJRA 1X8EA 1WMDA 4XFHA 2YZ4A 1SLCA 4YGCA 2C26A 3VBFC 3MF9A 2QE3A 2QTWB 3X29B 1DZRA 1R093 3J7NA 2V5DA 3ZFFB 1BKZA 1YI7A 2XQXA 1UWWA 1C8M2 1OQDA 1SLBA 1YRZA 2Y0IA 2YHJA 1M4WA 3JQXA 4I09A 5JZGC 1RVF1 5D8AC 2I07B 4FOYA 3KWVA 5FZ9A 4PDWA 4DXRA 5JDBA 1ZRRA 4YPJA 2ZOEB 5A7WA 1WW7A 3Q8BA 4TZDA 3OOXA 3CKHA 1RC6A 5A7PA 4J6GA 5LA2A 4BOWA 4CDUA 1GFF2 3ZVXA 4Q4X3 3ZKYA 1ZBE1 4CU7A 1VRBA 1YO8A 1VMFA 4NPLA 1KFXL 2CGPA 4LPLA 2Z5WA 2VECA 1F35A 4RD7A 2W08A 2ORZA 4RGKA 4NUBA 1C8NA 4HL0A 2YPJA 3MF6A 2DBNA 4KWUA 3W20A 5L36A 3IDAA 3AVSA 1N3PA 3K3OA 1SBDA 3KT4A 4D7TA 1W6NB 3USSA 1C5IA 3E6BA 3PUQA 1UU6A 2ZGUA 4XCAA 2VM9A 1NLSA 3CJIC 3IMMA 3I3BA 4NIAA 3CHXA 1AR91 5DUXA 4YW4A 1ENRA 3THPA 2NMOA 5C4WB 2ZZQA 3DPRA 4IW3A 1IKQA 1W8UA 3PURA 5FZAA 2X29A 2C6SA 2ADEA 4RYDA 3I54A 4Q4V1 1LOGA 1OD3A 5GZFA 1UMHA 4OQ8A 1CAXB 3FUQA 1W06A 4BYYA 1OHFA 3NNFA 3SNMA 1AYN1 2Y6JA 1HLCA 3HMYA 1TG7A 3J8F2 5EYXA 3ZDSA 2RDQA 1ONAA 3GHMA 1H9WA 5C9AC 1UD1A 1DHKB 3MLJA 4W6XA 5BXXA 2FQPA 2YC4A 1ZBA1 1WBFA 2EAAA 2RS53 3PVEA 4AVVA 4CU8A 3M2MA 1H30A 5EHDA 3ATGA 4LEJA 5F5AA 2D6LX 3TOJA 5JXHA 1DYKA 2CWMA 5CZKA 2RS12 2BNNA 2WWUA 3ZFEB 1ZZ9A 2JG9A 2Q8CA 1D2SA 1NCRC 2FCUA 1AL22 4ORFA 4S2HA 4U36A 4HVQA 4YZ1A 3JBG2 3E6CC 3VBRB 3UYJA 3PTYA 2WABA 3OD0A 5IATA 1RUD2 1CAUB 1VBE2 3VZNA 4FFGA 5CADA 2D6NA 2VQAA 3JXSA 1AR62 4XPVA 4BQYA 5A3UA 2WZR3 3P3NA 1DG6A 2K2SA 2VGDA 1EAH3 3OGRA 5IVBA 3WP5A 1G9DA 4P02B 1VB2A 2K46A 4BISA 1CX1A 5F1RA 3UT0A 1UYPA 2WWJA 1ASJ3 1XNDA 5FUIA 4DNYA 5AFEA 2GC3A 5A3TA 4TTGA 4ZS2A 4IEZA 2HYKA 4OZOA 3VKOA 1WW4A 4AHYA 2PTMA 1SFPA 4FFIA 1F15A 4XJ8A 5T54A 2NYYA 4JRAA 1JW6A 1QEXA 2HJIA 3HBKA 5K9YA 5A33A 3EBRA 4QDSA 3O1OA 2GDFA 1UYYA 2QZ2A 2VZ1A 2VCCA 3WDUA 1JODA 1EY2A 5A1LA 4Y20A 3AL6A 4BLJA 3AJYA 3USUB 1QJFA 2WZPP 4Q2FA 3T2PA 2O14A 3WUCA 3P6BA 4XFAA 3T2OA 1GOHA 1OOPB 2W3JA 3HN3A 1SBFA 2W91A 3LDKA 4QKNA 4XFGA 5LA1A 3DEMA 4LJHA 4E4HA 4WM7A 1W2AX 2PMWB 2WLQA 2WINB 3ZXLA 2VQTA 4GZ9A 1R1A1 3ILNA 5C7GA 3MIFA 4P9XA 5EZWA 5IVFA 4XQDA 4BHPA 3J7LA 3MZHA 4HANA 5DAWA 2N7GA 5LK5A 3I2DA 4QHZA 1AX1A 4HETA 1D4M2 3GM8A 4NJ4A 5KHKA 3T3YA 1O4YA 2WFF1 5E16A 4FQZA 4MXWA 3THCA 1ZZ8A 2R042 4I0BA 4ZXKA 4Y26A 1GV9A 5FMOL 3IPVB 3TWIA 3H3UA 1UIJA 4A6OA 4E9KA 3AMHA 4A3XA 2PQSA 3VDDB 5BUVA 1J59A 4CCLA 3UJOA 2DCJA 1R081 2B5HA 4LK7A 4RFT0 5FP9A 1VBC2 1W0NA 1G6NA 2ZKNA 4WVWA 4LE4A 3UETA 1H6XA 4RR3C 1VP6A 1COV1 3B94A 4DO0A 3AP7A 2HWF2 1QQP2 3D8CA 4EYUA 2QNKA 4Y22B 4GA9A 4WZFA 1PK6B 4K7JA 5FK8A 4FCAA 3F2ZA 2Z2SB 5JOWA 3I2IA 1K45A 2GC0A 3VBFB 2XJTA 1OURA 4NAOA 1UZWA 2WNEA 5G04L 1CN1A 1BVVA 4C0BA 1ND2C 2YYOA 1FXZA 2WQ8A 1F31A 1IS5A 3S57A 4EROA 4DUWA 1XE8A 4HKWA 4CUAA 3NMBA 2XH6A 5JI7A 1BXHA 3BUCA 5D8AB 2KA3A 4JC1A 3HNMA 1RUG1 4UW3A 3RG0A 2LS6A 5JMCA 2VXJA 4A2UA 4EZHA 4MHRA 1QDCA 1SEFA 3U4XA 4AVCA 3LA3A 4IEOA 5A6YA 4AGVA 5A32A 3DF0A 5LATA 3K2OA 1TMF1 1PO11 1C8M3 2DF7A 2IXKA 2WN3A 5FZEA 5FXVA 4AF9A 4AWDA 4D6SA 5ABJA 1MEC1 3DN7A 2GSYA 5DDJ2 2ZMKA 2V73A 1RJ8A 5L7OB 2R0FA 2XBO2 1GQPA 3ITQA 3EXUA 1LHWA 1QOOA 1DQ0A 4IE7A 5LRSA 1N3QA 1JS9A 4JRLA 2JDAA 1VMHA 3ZOIA 4ZZ5A 2WLPA 3JB4C 3PVBB 4GB31 4Q29A 3BGAA 3AM2A 1HRI1 3I59A 3O5SA 4CDWB 3D0JA 3GZTB 3CJIB 1CJDA 2BDRA 1VRH1 1W6PA 1W8NA 1XNKA 4LKFA 1HV0A 1UX7A 1GNYA 4E2GA 3O1MA 5C3SA 1H6YA 4AYUA 3VL8A 2I2SA 1GR3A 4A41A 4AQSA 2P3KA 3Q9OA 1PGW1 4DRRA 4H55A 2J1VA 3HD8B 3UGFA 4JV4A 3VBOC 3IZOA 2VTXA 5GKAC 1NXD1 3BVCA 3OEBA 4FPEA 3I2GA 4GXLA 2P3JA 4NO4A 3O1TA 4E2SA 1OA2A 4LK6A 5C9AB 4Z2AA 3AZYA 3RGBA 2ID4A 3C2UA 5FYUA 4YM3A 2RMU1 1LHOA 3BYWA 2F17A 4QXBA 4ISRA 2WNUB 4GALA 1OPMA 1XU2A 4QPGC 5AC91 3EB7A 1WWYA 5I8YA 1OF4A 1S0JA 4KU8A 4BXSV 5GZCA 2J1TA 3J8F3 3POIA 4JX0A 1ODMA 1NCRB 2K9ZA 4QKFA 3MUY1 3R4UA 3RSJA 1CR7A 1EP0A 3ZYBA 3POSA 3HIFA 1ENQA 1QIQA 1BK0A 4YG0A 4XF9A 4XACA 2ET7A 4XE9A 2BPA2 4XQ4A 3AKPA 3I2KA 5GZEA 1QH7A 3S30A 3OBAA 5LY1A 3UJQA 1XNTA 3WNXA 2RS13 5E1RA 1C5HA 1IS6A 3LFMA 5C5UA 1X7NA 5GLVA 1OFSA 1UZVA 1UY2A 3JBG3 4ZXEA 3N36A 3ZFGB 3O1UA 1NA1C 2E53A 4IEUA 1RUD3 1CZSA 1VBE3 3QBQA 4GIQA 2R0HA 4FXKB 1UU5A 4GH4C 4AI8A 1AR63 4NIGA 1FOD2 3ZN4A 1UQXA 3DL3A 3ZYHA 1WLTA 2VOWA 3D3AA 5FYCA 2XWJB 5FY7A 2ETEA 3ZDVA 5I0UA 1Q3EA 4YARA 2BERA 2D7FA 3RPQA 2RR11 5C6CA 3C7HA 1PNGA 1QXJA 2VW2A 5LK7B 1VBB1 1FAYA 1LNSA 1OLQA 2R30A 3POBA 3RZGA 3APBA 2HWC1 3ZPYA 4N43A 2WAAA 3ORJA 3RJRA 4QKDA 4RS5A 5E88A 3POJA 3ACLA 3FFQA 3RZJA 3RYRA 5EJ3A 1NZCA 4XTPA 2ZKLA 3DCQA 5K8SA 3WUDA 4RHV2 4QGMA 3GALA 4QPIC 2GNTA 4JQRA 3ZN6A 5FP7A 5CAZA 5C70A 4AFMA 2G9GA 3GZAA 3PTRB 4E4SA 4FPYA 2H6CA 4UW5A 2VUCA 5HCFA 4DQAA 3N3HA 4XURA 2ILMA 3VBUA 5FPUA 1WCUA 1HRV1 3LGRA 1QJZA 1N1TA 3ACHA 3DYOA 2Y34A 3KCCA 5JCTA 1AR82 3M3OA 1D4M3 2GC1A 4LBNA 4M3CF 5BYNA 2VUJA 4RR3B 2VVFA 2QQUA 2R043 3TYJA 2WS92 3SH3A 2BJSA 1W8TA 1YYNA 3AZWA 3NVCA 2GP3A 2VR4A 1JYCA 1WCKA 1H1MA 3GBFA 1FMD3 1YFUA 1S0FA 2GH2A 1IHMA 3UESA 2WSUA 2WKKA 2FDFA 3PUSA 3CEWA 4FVVA 4XUQA 3AZXA 2D3RA 3JB8A 3TEZA 1ND2B 5FPVA 2O8QA 4D3WA 5BNPB 2HWF3 3EJKA 5F5QA 1QQP3 1RUI3 2IFWA 2PQQA 1UPSA 2CYFA 4OHXA 1Z7S2 2W1SA 3EHKA 3VV1A 3IB3A 2IWGB 1L7LA 3LKJA 3RS6A 2AEYA 4E27A 4ZS3A 1HX6A 4O7XA 2KR2A 1JYXA 2VC9A 1NY72 1WD4A 4YZ5A 3NQHA 5H9PA 1GOGA 1NCQC 3E6DA 1MS3A 1UMIA 1O3QA 3OCPA 3HQUA 2XKPA 1ZREA 1W2NA 1XNAA 3ZYJB 2GU9A 4CCEA 2FZ1A 4PIZA 5DZEA 3WDWA 3AL5A 3H1YA 3H0OA 1KS4A 3WSOA 4LBQB 1XPWA 3DV8A 1W6QA 1RUF2 1LCLA 1PX3A 2A71A 1H0BA 4IV1A 5A6XA 3HOBA 2JDYA 3U78A 3SISA 4QU2A 2W92A 3LD8A 2WNVC 2ARBA 3B01A 1FMD1 2ET1A 4LLFA 2RS32 1XB9A 2ZGMA 5DAPA 1U5XA 4META 1GZWB 1SLIA 4HONA 1CZTA 4K20A 2B4KA 1J84A 5FZDA 3BPZA 3KZ4C 5DDJ3 4EZ4A 4I3PA 3RWNA 3MBWA 3N9QA 2D93A 2VVDA 4FOVA 5T5JA 3CBNA 3VHOA 5CKMA 4RGAA 2E33A 3H3LA 1O59A 2WBKA 3KVAA 1B35A 4NN0A 1WW5A 4YG3A 1M06G 2YROA 1D2QA 4W50A 2JKBA 5FKCA 3VBOB 1WCDJ 3ZYPA 2PYTA 2E7QA 3OB8A 1RVF2 5LASA 1W6OB 3O0XA 1I9RA 3R4SA 4K8RB 5C3RA 2XUMA 5I0SA 3RZZA 2W95A 1U5ZA 4HSJA 4AW7A 3NJVA 1W99A 2J1EA 4YW3A 1DGRN 4S2FA 4ARYA 3AYEA 4QPGB 5CB7A 2BOIA 4XXAA 3WG1A 2BBAA 3BPSA 3NV3A 4CPBA 2L9LA 1ZBE2 1O7FA 1OA4A 5DAQA 5HXMA 2W9XA 4OFGA 4L99A 2Q4SA 2NLRA 4HVOA 3LE0A 2ZACA 4FQ4A 5FK7A 3R4DB 4M3CA 2HWE1 3NWKA 4PHZA 3RZMA 4XW3A 1OH3A 2W1WA 2X53S 2OUJA 1RXFA 1UXXX 4R8HA 3P5BA 5B4XA 4UW6A 2QFEA 4AI1A 3GZUC 3MLLA 1KEXA 2A6YA 2C4XA 4QX0A 1UU4A 3A0KA 3ZMOA 1S0DA 3VHRA 3WX5A 2VUAA 4XUOA 2DTWA 1UX6A 1S0EA 2P17A 2XKOA 3WW2A 1AR92 2ZCWA 3WNMA 1POV0 4JGYA 5FLHA 1NA1B 3E5QA 3RZLA 1CESA 3BTXA 4IDZA 2ZGLA 1NAEA 3FN9A 2VQ0A 4Q4V2 4QM9A 4GH4B 2PAKA 1JOPA 1H8TC 3I49A 2GN3A 5F3GA 3TNQA 1AYN2 2UWCA 1W3VA 2OVUA 2W46A 1E5RA 5BNNC 3T0DA 3SC7X 3HEIA 4WM8C 4ATEA 3I2OA 3BIWE 3MW4A 4P9GA 4XJUA 1BZWA 1AXKA 2Q1FA 1ZBA2 5FZCA 1UYXA 3AYAA 2P3IA 4BM8A 2CDOA 2AEZA 4RQPC 3KT7A 1FOD3 2ZGRA 5LA0A 4QB6A 3PU8A 3HJRA 4YVSC 3WR0A 1D4VB 1LECA 4IV3C 1ULFA 2JDNA 4TSVA 3RYKA 3IKWA 2W1UA 3U0ZA 1MQTC 1HQNA 3C7EA 1WUVA 2EIDA 5FPBA 4PIYA 5LB6A 4L0PA 3V0BA 2QQJA 4LXLA 4IEXA 4QPIB 4XJZA 3ZR6A 4CSWA 2VQUA 3I8TA 4JQTA 1ENXA 2EAKA 2YMZA 3POEA 4IUGA 4BB3A 4FPOB 2QZ3A 1L7QA 2WT1A 5K0UA 1SPPA 2GZWA 4XTMA 5FMCA 3M3QA 3NV1A 2XXZA 3PMSA 3VD9A 1J1TA 4IERA 5F6KA 3AJZA 5KR7A 1QJY1 4RHV3 5FPAA 2VZVA 2VXRA 3AP5A 4FPJA 2O1QA 1H2MA 1I5ZA 5JOZA 3QH7A 4UXAA 5BNOA 1PMIA 1L7RA 2CU5A 4IESA 4Y1VA 5TSWA 5I0DA 4BE3A 4Y1ZA 2AGSA 3P3PA 4KG0A 3ZPOA 2FBEA 3AFKA 3ABZA 5C8CA 2JDZA 1JBCA 1AR83 1H2NA 1W0OA 3I97A 2XPJA 3MIBA 1CD3G 2QJVA 4V2VA 1XNCA 1DCSA 4GJZA 2W39A 2JDPA 2D6OX 4CUBA 4ARXA 4O9EA 4DXZA 4OI2A 5F7UA 2G9FA 5IVVA 1R1A2 2ZTNA 4AI9A 3OJBA 1GQHA 5C3QA 2VOXA 1TVGA 5JIAA 5GZDA 1GQGA 2YBKA 2TBVA 1QJU1 5CNAA 4JGZB 1NCQB 4QX2A 2F4LA 4OMCA 5JOYA 5KHJA 3VBRC 2YDEA 2XVKA 2WFF2 4LO5B 5JXIA 5F5CA 3KMHA 3D4KA 1Z7S3 2Q30A 3W21A 3DKQA 4CDXA 1DGWA 5T5PA 3HNYM 1YFWA 3WDXA 2E6VA 4GKXA 2ZEWA 1MS5A 4P9LA 4MZUA 1R082 4M0HA 1GZTA 3NRUA 2WNVB 1KDMA 3AP6A 3WT3A 4RA0A 4GMP3 2YC0A 3K3NA 1LOBA 3AX4A 5K4LA 1COV2 1BMV1 5FYBA 1X82A 4L11A 4QAWA 3ZYIB 3R05A 5FCCA 5FJKA 2WRAA 1W28A 1RUF3 2P37A 5H9QA 1EV13 4YZ3A 2E7AA 2LM3A 3OPWA 1Q8SA 2XVLA 4R9CA 3GBWA 4COVA 4B7EA 2RS33 5LBBA 5A7NA 3AVRA 1GZCA 1Q43A 4K8FA 3VD5A 4GKYA 4CDQA 2NN8A 3NKTA 1XBFA 2Q5TA 3BN6A 3WDTA 5I0TA 1RUG2 3VLBB 4LNVA 5FZIA 2TUNA 1VMJA 2ZZJA 4HSLA 1GUIA 1ND3A 4M3CE 2X8KA 5FR3A 1UY4A 1TME1 3JD71 4CP9B 2WIIB 4PIXA 5CIRA 1VAVA 4CEWB 5BV6A 5FV3A 1J3QA 1PO12 4R9DA 2JB4A 3VBHA 3KF3A 4LO6B 4MLOA 2VCAA 1RVF3 1VPHA 1MEC2 3WG4A 1A34A 3LEKA 3N7JA 1HIXA 1PM4A 2BVBA 4C1WA 3GXUA 4D7YA 5J3UA 4QB2A 1ACCA 2VJXA 3ACIA 1UKGA 4ASKA 2B39A 4FI9A 2IC1A 5FZHA 3PUHA 3DUIA 5LEJA 5HXVA 4CEWC 5E89A 3TEYA 1CAWB 1ZBE3 3N7LA 1POV1 4W4ZA 1FNYA 4GB32 4IEYA 2ZGNA 3TEWA 1HRI2 1GP6A 1LOFA 3VD3A 4LUMA 2D44A 2H0BA 4KWKA 1OXCA 2QBXA 3UKVA 4UBHA 2JWPA 3ZFFA 4HN0A 1HB2A 4HZFA 2YC2A 1LODA 4KWJA 1P8JA 1VE0A 4XBNA 1CX4A 1PGW2 2GNMA 3VZMA 1H8TB 2R7EB 4DXSA 3RI9A 2QQVA 3ROUA 3LA7A 3LFIA 4Q5OA 3RYPA 4C0HA 1AR93 5BNNB 3L2YA 4I02A 3W59A 4WM8B 2XJSA 1AZDA 1NQDA 2OIIA 1H4GA 3OUHA 4UYBA 3VZOA 1OLRA 5LBFA 2RMU2 2EA7A 1NLRA 2E26A 2EICA 4KG8A 4Q4V3 4ZU7A 4RQPB 3CDZB 5AC92 3DGTA 4QDQA 2BYVE 2GMEA 4CCKA 2CDPA 5I91A 1UOBA 2DVDA 1AYN3 2A6VA 4YVSB 4Z8BA 4IV3B 3WQ1A 5IAVA 4BQ3A 1MQTB 4COUA 5KHHA 5JLVA 5KXEA 2VVEA 1W6NA 5DG1A 5FZ3A 3WF1A 3PU3A 1ZBA3 3FLTA 1BVP1 5CYYA 3WY6A 2JG8C 1GBGA 4M4RA 5L7OC 3HPNA 1GNHA 1YQ8A 2E32A 5FY4A 5SV5A 5IAXA 1JYNA 1C57A 3OPZA 5FZGA 5C4WA 1JZ5A 1BJQA 2J1AA 1RUOA 1HB3A 1ULEA 3PHMA 3GGLA 1WKYA 1MVQA 1ULPA 3L9JT 2B8MA 2D3SA 2VNVA 4YRDA 3WNOA 3WQBA 4NPRA 2JB8A 5JVVA 1B09A 1CAXA 4CDWC 4COZA 4QXKA 2PELA 1MACA 3K46A 1FNZA 4FPCA 1GWLA 4YYOA 2D98A 3ZM8A 3THTA 2XJQA 2VD7A 4X8PA 1W9TA 5GJ6A 5J37A 1HXS1 4ZHNA 1TEIA 3MDPA 2DCKA 4IETA 2V09A 5KBFA 1V0AA 2Q1ZB 4EE2A 1KRIA 4AHZA 1YHFA 4HK8A 2RR12 3ZFEA 4YGBA 1H9PA 1T2XA 1VB4A 1VBB2 2C1FA 3POYA 5T5LA 2HWC2 5FRAA 1V70A 1LTEA 1AYM1 2R49A 2W94A 3VBSC 1CAUA 5EJ1B 2PXJA 3KM5A 2WNUC 2DV9A 3KT1A 3OBRA 2JE7A 1UW8A 3U1XA 4EQVA 3BU0A 2VW0A 5IUQA 1G86A 1K5JA 4JKMA 5JXJA 3OGVA 4FTEA 5FLJA 1QMJA 2D6KA 4FAGA 4QQPA 2WT0A 4XETA 4FO9A 2G9ZA 3M4FA 2EALA 1LOAA 3H8UA 4IE0A 1YQ5A 1XSRA 3ILRA 1R1A3 1UOGA 3IBMA 2CTVA 1HRV2 2ZAAA 3B9IA 3KV6A 5APAA 3NNLA 3RMXA 3ZXKA 1FX5A 2QQKA 3RZHA 4A7KA 4D6RA 4LITA 2TEPA 4LUKA 3ES1A 2BOJA 3T2QA 4X8NA 1EUUA 2OXBA 4Y33A 3ZFGC 2WFF3 1GP5A 1HQWA 3HBZA 1XRUA 4CE8A 4NHXA 1BBT1 1OOPA 1POQA 2QQWA 4I30A 2EXIA 4QQ2A 4ZPIA 3THDA 1PIV1 3MHZA 2QQNA 1PHMA 1N1VA 5FYYA 4Y5Z0 1R083 4FTBA 4AAXA 1JHNA 4QXCA 3NAPC 2BNMA 1E57A 5CFCA 4A42A 5GALA 4KBBA 1COV3 1CONA 3IAPA 3WNNA 4ZZ8A 1I1EA 3MW3A 1MS0A 2DWRA 5F3EA 5FJHA 1OVSA 1DP0A 1ULOA 4G4FA 1BQPA 3KS7A 3ZYGA 1DZQA 1YXWA 3Q8CA 2DCZA 1JZ2A 2WO3A 5EP9A 3DKWA 1MZ5A 4WBBA 5FOBB 1N3OA 3K4AA 4Q26A 3O0VA 3TN91 3CZJA 1OQEA 1DF0A 3IPVA 5FP4A 3LOBA 5FYSA 1SACA 2GMPA 3NNGA 1SBEA 1YLLA 5AVPA 1LAJA 4AQ6A 1RIRA 1YC61 4XYXA 5I93A 1HB1A 2NQYA 2D40A 1JUHA 4IL7A 4URTA 3VDDA 1JHJA 2WA4A 1KJLA 1UAIA 1QDOA 1K12A 1RUG3 1IGOA 3EQEA 3OPTA 3UNPA 2Q0AA 3OF1A 1OSGA 3WD5A 1LKNA 5ANNA 5CFDA 1FMD2 1GWMA 3KVBA 2IVIB 4TYSA 1PK6A 3PL0A 3B93A 1TMF3 1PO13 3POGA 4P9YA 1IS4A 1NYWA 3IIAA 1SDWA 2ZEXA 4FOWA 4D6QA 4ET7A 5JOXA 3VBFA 1MEC3 5GM0A 2E7TA 1NOVA 2UWAA 1HW5A 5LY2A 4AFBA 3QCWA 1UMZA 3RI8A 4PQ9A 1RUI2 4MGIE 2C0ZA 1LENA 1G9FA 3PMEA 5FY5A 1UOFA 1WD3A 5JZGA 2CL2A 4LA3A 5IFTA 2R061 5D8AA 3U37A 4A7YA 1SLTA 3H1WA 3JCIA 4IEWA 4GB33 4BZ4A 1YUDA 1Z0HA 1HRI3 3LAGA 4MV2A 5FMOS 4HKLA 2ERFA 1XC6A 1HN1A 4WVMA 1ZVFA 1VRH3 3IDEA 5BNPC 4CCMA 2W0XA 4AR2A 4FOQA 2DUPA 1BCXA 3C8XA 1ZZCA 3O7OA 1EUTA 2Y8KA 5F3IA 4FPHA 1JZ6A 2VG9A 3BOWA 2FCTA 1T6BX 3NNJA 3S5AA 2WAOA 2V4VA 4I0AA 3GCXA 2D43A 5CKNA 4J25A 4Q4Y1 2XLFA 4XJWA 4K40A 3BI3A 4IGQA 2YBSA 2QVSB 5C33A 4NHLA 2HWE2 2CY6A 2JIGA 2WR9A 2OZJA 3LIHA 4MVTA 4HKOA 3WP4A 2RMU3 1PX4A 4Q0PA 2JG8B 3CJIA 3WW4A 2D97A 2XOMA 3UK9A 2F4PA 4CYDA 5AC93 3C7GA 4TWTA 1KXGA 1MS9A 2ZGKA 3D6EA 1J83A 2R071 4UFHA 4RN5A 3ZX7A 4AHWA 1O91A 3M3IA 3E97A 2A75A 4CVUA 3OYWB 5FOJB 4I01A 1L3JA 5C5TA 4F8AA 2PHFA 1EPWA 1RUC1 5FWJA 3GF6A 5A7SA 5C9AA 3DYPA 3NO8A 3Q8AA 4BIFA 4D69A 3IM0A 1YQ6A 5FYIA 2P34A 1QWRA 4ASLA 1K5MC 3BTZA 4XAAA 3WVJA 2VBPA 1N47A 4UT5A 2XVGA 1GYKA 4FBFA 2W47A 3MICA 5FO8B 2PHRA 5H9SA 5IYYA 3AP9A 1W9WA 4PBOA 4NRQA 4LIVA 1NCRA 3I3MA 1JI6A 1PGL1 1NXMA 4PJYA 5J48A 1OH4A 4WVVA 3VBSB 5FZOB 2ZMLA 4L92A 5ACA1 4BQ2A 1F5JA 1SCRA 4MGQA 5CBLA 4OI0A 2DUQA 1HQLA 4UWDA 1XQNA 3VZKA 4NVPA 2UY9A 4QT6A 3K48A 2RR13 3AP4A 2V72A 1S2KA 4DRVA 1VBB3 2W68A 5L19A 2NPIA 5KC6A 2HWC3 4V1PA 1TNRA 1V6IA 1UZ0A 5J98B 5CISA 1W2UA 3PVNA 2Y0OA 2JENA 2YXSA 4LHLA 3SH4A 5FXZA 1QJY2 2BFUL 3FBYA 4A44A 1IZ3A 2HLEA 3NJXA 2AYHA 3MIHA 4YFWA 5F5IA 3Q8EA 2ZHKA 3WHUA 4NHYA 5FMBA 1TQ5A 4R9BA 4CPBD 1SHWB 2VZPA 4XHXA 4CCDA 4JDOA 1O4TA 2P6HA 4OUEA 3OBTA 1HRV3 2XHNA 4O61A 1W6MA 2GMMA 4YSFA 2VZQA 2KXLA 1LHUA 2DVBA 2A1XA 2UYBA 1ULGA 5FUPA 1RUNA 1GANA 5A80A 1WMXA 2CSGA 5T5OA 3LB9A 3NAPB 5DAVA 4A3ZA 1OUSA 2FHRA 3WXPA 1SQ4A 5FZBA 1DQ5A 2AZ5A 4ZU4A 1FPN1 4B8EA 5C3OA 1JOBA 2RVAA 1WLCA 4PLOA 5GLZA 3BALA 4CEYC 1XOYA 4XDPA 3LIGA 5KC5A 1QJU2 4P5HA 1H8VA 5FP3A 2X09A 2PHXA 5JMOA 4MSVA 1DYPA 4BWOA 3FHIB 2DVGA 1ALYA 1GNZA 1U5IA 4P14A 3IDBB 2JXAA 4RR3A 2XHKA 1C28A 1LOCA 5EFUA 1RL3A 3CIHA 3HQXA 5IW0A 5I8TA 4AOCA 1K3IA 2VO5A 1RXGA 4H2AA 4NPMA 1I5PA 4Y3OA 3GNEA 4UW4A 1SDDB 4G3YC 1BMV2 4F83A 2PLV1 1W39A 4E8DA 1V6JA 3SKVA 1ND2A 2CAVA 1D0GA 3SCHA 5K7PA 1E5IA 2EXKA 5I8SA 1AL21 2WO7A 4XFIA 1YQ2A 4N90A 1AR71 2J7MA 3LCPA 4LIUA 1J3PA 3VN4A 2BP6A 2CV6A 4SLIA 3ZSLA 3T4HB 2OQ7A 2ZGOA 3S6PA 2XMLA 2RDRA 1ZNPA 4R4ZA 3MO4A 2OW4A 3AYDA 3TB0A 4LQRA 3HT1A 4F7ZA 2EVXA 1IKPA 4WVZA 4LBQA 1OFNA 4Z92B 4HFSA 2MEV1 1TME2 1ZZBA 3JD72 1HKDA 5CKQA 2ZBJA 4AK3A 4MXVA 1H2KA 2XLGA 4JGZC 3FC0A 1QJX1 1FYUA 3AFGA 1J58A 1MS4A 4LMFA 5FY1A 3H3ZA 5T55A 3SH5A 2C24A 4P9IA 3U10A 2ZAHA 1F8VA 5DQ0A 4AVAA 1V6OA 1UO9A 1GZWA 5A6QA 3SEEA 4UI9L 2DCTA 2HWB1 5A3MA 2X5IC 1EV12 4B3NA 3NJYA 1KS5A 4N53C 4JTOA 4PI2A 4XDQA 2Y6KA 4MG2A 4NRPA 3TEXA 1IG3A 2V5YA 1OLMA 2XWBB 3WW3A 4YFZA 3FHAA 4OUMA 3A0NA 3NL1A 1KFUL 2HWE3 1SFNA 4IEQA 2GNDA 5FZFA 4NR1A 4Q0UA 4MO3M 3VBOA 4ZONA 2FMDA 2G4IA 2SBAA 3LSEA 1FATA 4LO8A 5FREA 2XJVA 4NIHA 4RGGA 1VIWB 3CU7A 2A7AA 5A3LA 3V56A 2VY0A 2R6QA 3E5UA 1Z78A 1GZ9A 2OQ6A 3NSTA 4TXWA 4MX3A 1CJPA 1VAKA 5T50A 1K5MB 3L2HA 3PUIA 3ZIWA 2CHHA 2IXHA 3PLQA 2Q8DA 4Y5TA 3BOPA 5E8AA 1QJEA 2LW8A 2YU1A 3C3VA 3PJQA 4BK4A 5JR2A 2P2KA 2JECA 3KV5A 2BQPA 3EMRA 1VBC1 5KXCA 4JDNA 3RZKA 4LO7A 2EIEA 5A3WA 1ZX5A 5FQ0A 3CMGA 4YVWC 1W6QB 2AACA 3IIIA 2NP0A 1BLZA 4IE6A 2NMNA 4CU6A 1E5HA 4LULA 4YM2A 5FWEA 4COWA 4IQPA 3WOGA 2XGXA 3E1F1 4AEDC 1CAVB 4N9HA 4OYUA 5F2SA 1EPZA 1SZBA 4HOOA 1LGBA 1UXZA 2WFPA 4QX8A 3WZ1A 3B7MA 4XEZA 5IT6A 1NA1A 1TNFA 3PJYA 4UFIA 4DEQA 2QCSB 1Y9MA 3PUAA 2IFRA 4CXYA 4MYEA 5G05L 3ENRA 2LUWA 4TLGA 4DY3A 5F37A 2B9VA 3ILFA 4GH4A 4PQQA 5L9RA 3ZKUA 4JTNA 4D94A 4M00A 3WG2A 4Q1PA 2GNBA 2D5FA 4PLNA 3GYDA 1AX0A 4H7MA 4JCKA 5KHGA 4ASMB 2JDHA 4YW1A 4LHSA 4YLZA 5KWRA 1W90A 4UAPA 3FJSA 5LBCA 1F4AA 5L73A 3U07A 1OMIA 1XSQA 3AMMA 3VB9A 1CQ9A 4CUCA 1QNYA 3I4IA 1HXS2 4IGOA 4AG4A 1W3XA 1S0BA 4YW7A 1LGNA 1QJY3 1ZZ7A 5LRRA 5GLWA 4YM1A 1RHI1 3AYCA 2XBO1 4AZZA 3N7MA 2VBBA 3T0BA 4EV0A 2RM21 2A3WA 4UBGA 4TN7A 4XFCA 4YWAA 1UYZA 1AYM2 2J42A 4M3CB 5BY5A 3KV4A 4QPIA 2FDIA 4XF3A 2WN2A 3HAGA 4GULA 4KI5M 1US3A 4G9SB 4P9WA 3OD4A 2A3YA 4X6RB 1RMU1 4CEYB 2VOTA 1LRHA 4KMQA 4FPKA 3I3QA 1APNA 3OGGA 1V6KA 4XZUG 2BTVC 4W6YA 1OKQA 2WDBA 4PLMA 1RUJ1 5CVRA 3U75A 3ZMNA 1OA3A 4AQ2A 2QQPA 3OEAA 4I0WB 3ZO0B 4LBOA 4FSJA 2BEOA 3MIDA 2H0VA 2JE8A 3MFCA 1DDLA 3IMNA 4XBLA 3JZVA 1UY0A 1YNAA 5LW9A 1OI6A 3TNPB 1QJU3 3TRSB 4BCUA 2J22A 5JSOA 3W58A 2P5BA 3MV01 5FZ0A 4LHNA 2XLAA 2YFUA 3ACFA 2QQIA 3ELNA 4Q0SA 2BW8A 4XMIA 3VHPA 4BH9A 5IHRA 3K75B 2PN5A 3FBMA 1BBT2 4NRMA 4YGEA 3ZXEA 3AMPA 1V6NA 1PIV2 5JI9A 2CGOA 2LTNA 4ES9A 3PNAA 4PDWC 4GAZA 4JZRA 3O12A 2R1BA 1C1FA 1W03A 2ZS6B 4QHOA 4LT5A 2ARXA 3H42B 3SKJE 2PHDA 4QB1A 5I0RA 1SG3A 4CDUC 4S2DA 2O0OA 1V9U1 1UL9A 3O14A 1NCQA 1UF2C 4FP3A 4DIQA 2CNAA 2JIJA 4NIIA 3V0BB 3RWKX 3TN92 1UIKA 2RHPA 4XDOA 4XUTA 4Y1YA 5FY0A 3UKTA 4FFFA 1AF9A 5CU1A 3ST7A 5L9VA 2WSVA 3BODA 4DPNA 3EO6A 5K0UB 4MGSA 5DZGA 4Z07A 1JZ8A 4HPKA 4CP0A 3F95A 2WNVA 4AEJA 3N4MA 2JX9A 2R32A 2X10A 2EF6A 4U2AA 2ZABA 2DBIA 2QQOA 3UGGA 1KDKA 1OLME 3DPRC 2X5IB 1D0HA 1TME3 3JD73 2BU9A 4OZXA 4ATFA 4NIDA 3VKFC 2Y6GA 4NROA 2PA7A 2DU0A 4N53B 4RFRB 1VAMA 1FV2A 3ZLIA 5A6ZA 4AEKA 5EWSA 5FYMA 3OY8B 1HDKA 5FY9A 3KGLA 3WDVA 1IPKA 1VJ2A 5A3PA 3HNBM 2ZEZA 2DU1A 2DUOA 4AFCA 1W8ZA 2R062 1DQ1A 1Y7BA 3KCXA 4BXFA 1Q8QA 2W2IA 4EJRA 1JU3A 2A6ZA 1POV3 2VULA 5B4NA 1A8DA 2D6PA 3LDRA 2VNOA 4KNCA 1BEV1 3U11A 3AK0A 4XBQA 1IQAA 3MW2A 4CP9A 1S0CA 1WMFA 2JG9C 1JU4A 3VZJA 1RUE1 3RFRA 4B1LA 1ZYBA 3B00A 4IE4A 5FZMA 5FZ7A 3ME2A 4PF5A 3OUJA 3ZYFA 5IVYA 4BMEA 3T1LA 3AKSA 5LCWL 3BU7A 2VCBA 1AXYA 4Q4Y2 1XXNA 1NKGA 1SMVA 4HBNA 1U5YA 4YVWB 1CPNA 4AAPA 2WYFA 1QU0A 1STMA 3OBZA 1TMF2 5M0TA 1CAWA 1JMUB 2P1BA 3DYMA 4AVTA 2ZX3A 4BPZA 4AEDB 1DBNA 3KF5A 3SMHA 4D0QA 3WQ7A 2Y6HA 3T09A 2WUHA 5A7QA 2BGOA 3HVDA 5EQUA 2WO2A 3LEGA 4D8MA 1J1LA 1LJ7A 3ZSJA 5A1AA 2AH2A 4BQ4A 2BRTA 2YY1A 3I3EA 4KQ7A 2R072 4XF0A 1G8WA 5IWFA 2GP5A 4KL1A 1RUH1 1WGPA 3K77A 3OSDA 1PM7A 4N7UA 2B7YA 2D5HA 4UF0B 1YEWA 4DEVA 1H8TA 3WF4A 4QD2A 1Q8PA 3AMQA 5HBAA 1IPSA 1VRH2 5BNNA 1PO21 3KV9A 3OTFA 1RUC2 2CWSA 2ZX0A 3N9MA 3A23A 4WM8A 5FXXA 1OQ1A 1DGRA 2UU8A 4IXLA 4YW2A 4WM7C 1LEDA 3ES4A 3INAA 4K1YA 1FI2A 4OHVA 5JXGA 4AL9A 2F6BA 3AXDA 4RQPA 5JSRA 4C90A 5C71A 1ND3B 1OF3A 1PVC1 2UY8A 4YVSA 5EPAA 4DINB 4IV3A 1G9AA 5T3NA 4JHZA 4HMZA 2VUDA 1PGL2 3LOIA 3UKNA 4YNIA 1GOFA 2YB7A 5ACA2 1HXS3 3GBGA 1PNFA 1NZIA 3NKGA 2VZOA 4LR4A 1G9CA 2AENA 1RITA 1QF3A 2VCMA 1W9SA 1I6XA 1MPXA 2VPVA 4AI2A 4CP1A 2I74A 1C3HA 2Z4FA 3C7OA 3SHRA 4KGQA 3CF6E 4PCRA 1NUKA 1QNWA 1AYM3 2FCVA 2VZUA 4R9AA 4A6SA 5J96B 2ARCA 2A6WA 2ZHNA 5IVEA 2NZ9A 4WV8A 1O3RA 1ZZ6A 1JYIA 1LU1A 2PAMA 2QUOA 1WCSA 5D21A 2OS2A 1PZ9A 4MOAA 4Q4W1 4RSUA 3BKZA 2W52A 3DECA 4LE3A 4DS0A 1WBLA 5IVJA 3SXWA 2HWD3 4MUVA 1YJLA 2PHWA 1LULA 4W65A 1OBNA 1OKOA 1VBA1 4LO4B 5IK7A 1H1AA 1SLAA 1ULCA 2UYAA 4SBVA 1T6GC 4LBMA 4QPWA 5HCBA 1DFQA 4DOUA 2YPDA 5J09A 4PDWB 2IXJA 4ES8A 2WJSA 2P4EA 1CWPA 4NOTA 3BB6A 2IXIA 2OYZA 5A7WB 5FLIA 3HWJA 3ZSEA 3FLPA 1VBD1 1LHVA 1AL0G 4CDUB 1JZ7A 4AVBA 1F4HA 2JE9A 4BQWA 5EIYB 1BBT3 1O5LA 1FPN2 4XFBA 3QOPA 1C1LA 4ISQA 3HN1A 4C1XA 5FP8A 5ABJC 1PIV3 2OKXA 4B4PA 3VBRA 1DU3D 1W9YA 3M3CA 4CUGA 4CTEA 1MZ6A 1S2EA 1R091 2OUHA 2ADDA 2VE1A 1S2BA 2OPWA 1VLNA 2DTYA 1TE1B 2IXCA 1REDA 4XVHA 1URXA 5EJZB 2FZ2A 2FDGA 3RQ0A 2HWD1 3TN93 5IFPA 3DPRB 4FP2A 4Q4X1 3FL7A 3TAYA 1UY3A 2EIGA 3OG2A 3FLRA 1MS8A 1GSLA 2PLV2 2WA3A 4GD4A 3USUA 2ZX1A 2A73B 2QQLA 2RJLA 2Y38A 3B69A 3LEIA 3ZXFA 3VDAA 1F2NA 3I7DA 3LQCA 4CCJA 5FPXA 1QY4A 4CCNA 4DXTA 1CIWA 1RINA 1AR72 4O9GA 3BTYA 4NAMA 2B9UA 4K9SA 1AHSA 3U14A 2XONA 1X50A 2B42B 3ETPA 1UOJA 4OCTA 3PIGA 3CO2A 1S0IA 3BCWA 2IVJA 5JUVA 2G19A 3WP3A 2HKXA 3MPPG 3FUOA
chains in the Genus database with same CATH topology
4QKDA 4NIHA 3RZJA 4QHOA 4JHTA 3RZMA 4O61A 4IE5A 4NIIA 3RZKA 4ZHNA 3KHBA 4IE7A 3RZLA 3BTXA 4IE6A 4IDZA 3I49A 3S5AA 4QKBA 3O1MA 4NIDA 4ZS2A 3BU0A 4NROA 3BKZA 3I2OA 3BI3A 4RFRB 4CXYA 2FDFA 3O1OA 3H8OA 5F8PA 5DABA 3O1RA 3O1TA 4IE0A 4ZS3A 4NPMA 4O7XA 2FDKA 4QKNA 2IUWA 3RZHA 4CXWA 3O1VA 3H8RA 4QKFA 4IE4A 3T4HB 3H8XA 4NJ4A 3BTZA 3T3YA 2FDIA 2FDJA 4NPLA 3LFMA 2FDGA 4NRQA 2FDHA 3O1SA 3I3MA 3I3QA 3O1UA 2FD8A 3BIEA 4CXXA 3O1PA 4NIGA 3KHCA 3T4VA 3BTYA 4MG2A 4NRPA 4NRMA 4MGTA 4OCTA 3RZGA 3S57A 3BUCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QKD A;  4NIH A;  3RZJ A;  4QHO A;  4JHT A;  3RZM A;  4O61 A;  4IE5 A;  4NII A;  3RZK A;  4ZHN A;  3KHB A;  4IE7 A;  3RZL A;  3BTX A;  4IE6 A;  4IDZ A;  3I49 A;  3S5A A;  4QKB A;  3O1M A;  4NID A;  4ZS2 A;  3BU0 A;  4NRO A;  3BKZ A;  3I2O A;  3BI3 A;  4RFR B;  4CXY A;  2FDF A;  3O1O A;  3H8O A;  5F8P A;  5DAB A;  3O1R A;  3O1T A;  4IE0 A;  4ZS3 A;  4NPM A;  4O7X A;  2FDK A;  4QKN A;  2IUW A;  3RZH A;  4CXW A;  3O1V A;  3H8R A;  4QKF A;  4IE4 A;  3T4H B;  3H8X A;  4NJ4 A;  3BTZ A;  3T3Y A;  2FDI A;  2FDJ A;  4NPL A;  3LFM A;  2FDG A;  4NRQ A;  2FDH A;  3O1S A;  3I3M A;  3I3Q A;  3O1U A;  2FD8 A;  3BIE A;  4CXX A;  3O1P A;  4NIG A;  3KHC A;  3T4V A;  3BTY A;  4MG2 A;  4NRP A;  4NRM A;  4MGT A;  4OCT A;  3RZG A;  3S57 A;  3BUC A; 
#chains in the Genus database with same CATH topology
 2JG9 B;  1QKQ A;  2Z79 A;  3MYX A;  2JDM A;  2CGN A;  5FTT C;  3CZU A;  4FFH A;  2A70 A;  4LBJ A;  1OUX A;  3E5X A;  2BBV A;  3GDB A;  4D7S A;  5FO7 B;  2V4A A;  5FYT A;  2C9K A;  3T30 A;  2R06 3;  4YGD A;  1JYT A;  1W05 A;  4HT1 T;  2MEV 2;  3B9C A;  4XF4 A;  3MEP A;  4EN0 A;  1NQJ A;  2QDN A;  2VME A;  4FXG B;  1H4H A;  3HQR A;  1GIC A;  1LHN A;  1QJX 2;  3FX3 A;  1Q56 A;  5D1I A;  5F9T A;  1CGP A;  4Q27 A;  1LEM A;  1XJA A;  1W8F A;  1ZRI A;  2YU2 A;  4Z1V A;  2RS5 1;  4FPL A;  2OZ6 A;  1YIF A;  4CEW A;  5HI0 A;  1U0A A;  2VMG A;  3ZN5 A;  4MAD A;  3NV4 A;  2ZPX A;  2HWB 2;  3KQR A;  4I3G A;  4YW5 A;  2VMD A;  5J7M A;  4AQT A;  4Q4Y 3;  4XC9 A;  2AR6 A;  3ZSK A;  4BQ1 A;  5A33 B;  3MIG A;  4Y22 A;  1WCQ A;  2E31 A;  3WG3 A;  3ZXA C;  4LTA A;  1JUI A;  4Y20 B;  1XYP A;  4WZC A;  2ARA A;  4L8Q A;  1BK1 A;  4Q0Q A;  5B2G B;  5CFC B;  1I3H A;  1W2O A;  2XB6 C;  2WZR 1;  3TBD A;  5FY8 A;  4H7L A;  4MGZ E;  1EAH 1;  1H2L A;  3VUO A;  1Y9Q A;  2R07 3;  1ASJ 1;  4N43 C;  4WM7 B;  2BWC A;  2TNF A;  1O3T A;  2RE9 A;  2WL1 A;  2WNO A;  4DUV A;  2W87 A;  5DAB A;  5JR7 B;  4RS5 C;  3T08 A;  2BWA A;  2ENR A;  2HBT A;  3ECQ A;  3MV1 1;  4W8J A;  4AI0 A;  3M1H A;  1HB4 A;  3MGU A;  1ZA7 A;  3KB5 A;  1KJR A;  1RUC 3;  2IUW A;  3KD4 A;  1BHG A;  1FV3 A;  4LOR A;  2W1Q A;  2HH9 A;  5FPZ A;  4OUL A;  3WLU A;  1PVX A;  4Y24 A;  3SEP A;  4Q1R A;  4QHB A;  4MXW B;  3T2T A;  2JG8 A;  2Z42 A;  1AXZ A;  5L7O A;  4COY A;  2UUR A;  2MNG A;  4LOT A;  1N1Y A;  3VBU C;  4QX3 A;  2YG0 A;  3H8R A;  2YBP A;  5CFD B;  1QXP A;  4YM0 A;  1PMH X;  1XYN A;  2MPF A;  1HN0 A;  3C7F A;  3JQW A;  4QU1 A;  5C3P A;  3H8X A;  4C8D A;  3MLK A;  2RG4 A;  3HR9 A;  2VNG A;  4FAH A;  4CDW A;  1LB2 A;  4CZS A;  3OYW A;  4OHY A;  4YG6 A;  2A6X A;  5FAX A;  4ZKT B;  1G7Y A;  5ACA 3;  4B4Q A;  2DDU A;  4J1W A;  3M3E A;  3WEZ A;  3AZV A;  3ZXG A;  3J7M A;  4OMD A;  3UL2 A;  3AKQ A;  4BIO A;  1FT9 A;  3A4U A;  4K1Z A;  4XQW A;  5JZG B;  4MGK E;  3O1S A;  5J36 A;  4LBK A;  4LBQ D;  2H6B A;  4BA6 A;  2XJP A;  4CXX A;  4UOJ A;  2VU9 A;  4WVM B;  1MZE A;  3RRD A;  2G1M A;  3WP6 A;  1KD7 A;  4A45 A;  3NV2 A;  4PT6 A;  1XE0 A;  4Y1X A;  4NWV A;  3SCG A;  3P1I A;  2Y64 A;  3WNP A;  4Q8L A;  3VBS A;  5FZO A;  3T4V A;  2WNU A;  1CIY A;  1RHI 2;  2LRO A;  4K3U A;  4AE2 A;  2XDV A;  1AVB A;  1UN1 A;  4P00 B;  2RM2 2;  3N9L A;  5BNQ A;  5A32 B;  1UCX A;  3ZSM A;  5LBE A;  5A70 A;  5ABJ B;  3GHN A;  3J9S A;  2AC1 A;  5F39 A;  1J3R A;  3FZ3 A;  2RDN A;  1A3K A;  1GMM A;  1WME A;  2XG3 A;  3N9O A;  5FZ4 A;  4IV1 C;  1GP4 A;  1RMU 2;  3H1M A;  3PDQ A;  4JHT A;  3R6S A;  3RMY A;  4EWA A;  1W8H A;  4UFL A;  3RJ2 X;  1BYH A;  4XFF A;  4URA A;  2Q1M A;  1RUJ 2;  1DQ6 A;  2JD4 A;  1E5S A;  3ALQ A;  4AHX A;  1FPN 3;  4O65 A;  5FZK A;  2Y60 A;  4J1X A;  2A5Z A;  2ZHL A;  3I59 B;  2D6M A;  1RGS A;  1NG0 A;  5FYV A;  4CP2 A;  1MS1 A;  3FWE A;  3N9N A;  3ZFG A;  3LZZ A;  4KU7 A;  1W6P B;  4E2Q A;  2BGP A;  4DY5 A;  4L9B A;  2KM2 A;  1C8M 1;  1SFY A;  3KCY A;  1NLQ A;  5LA9 A;  1O4Z A;  2JIC A;  3AC0 A;  3VD7 A;  5HCH A;  1ZRC A;  1B35 C;  1IOA A;  1KIT A;  2J1U A;  5H9R A;  1DZT A;  3MIE A;  5FZ8 A;  1W2T A;  2XQR A;  3N9P A;  3RVH A;  3NAP A;  3ZYR A;  4LLO A;  5LEK A;  1GKB A;  1LU2 A;  4L2N A;  4OUS A;  3FFZ A;  1MZF A;  5FIX A;  3K4D A;  4EWE A;  1JYW A;  3T0A A;  3S7E A;  5FDB A;  3W5M A;  2BV4 A;  3IAQ A;  3O0W A;  3K4Z A;  2PLV 3;  1V9U 2;  3D5O A;  2Y33 A;  5F8P A;  4AVS A;  4XOG A;  3ZXJ A;  4CCO A;  1ULD A;  2BGC A;  2WQZ C;  4I2O A;  4XJA A;  1QH6 A;  1R64 A;  5DXD A;  4K6B A;  2EXJ A;  1RJ7 A;  1AL2 3;  2VOK A;  2BFU S;  2OT7 A;  1AR7 3;  5E6H A;  4OHZ A;  1DIW A;  1ODN A;  1XNB A;  1S55 A;  2PFW A;  4XCB A;  3WV6 A;  2HYX A;  4XF1 A;  3QAC A;  2JDU A;  1XU1 A;  3J4U H;  4ITC A;  4OHW A;  2ZGQ A;  5KHI A;  2B45 X;  4OLL A;  1O8S A;  4LKS A;  4TLF A;  5DUU A;  4DMI A;  4CXW A;  2ZGS A;  4EN8 B;  1ZRD A;  3VGI A;  3LWC A;  5D2A A;  5F2W A;  2ORX A;  3DXU A;  4YZ2 A;  2YV8 A;  4JGY C;  2PAE A;  5DUW A;  5KXD A;  5HPO A;  1YCI A;  2MEV 3;  4LKD A;  3J8F 1;  1UZZ A;  4XIL A;  4KBZ A;  1QJX 3;  1W6M B;  2ES3 A;  2A3X A;  1W8O A;  2ZX2 A;  3I2F A;  1YFX A;  4N7I A;  4V2W A;  1JZ4 A;  2YGM A;  1JH5 A;  1WLD A;  4HVR A;  1UZY A;  1Q8O A;  2HWB 3;  3DXT A;  3S5Q A;  4OQ9 A;  4XAB A;  3KLS A;  1S0G A;  2RS1 1;  4IND A;  1Y3T A;  5BNP A;  1ST8 A;  3B02 A;  2Q8O A;  2XR4 A;  5A1F A;  1CVN A;  4PI0 A;  3RNS A;  3ZR5 A;  1JYV A;  2D3P A;  3JBG 1;  1V6M A;  4N43 B;  2DYC A;  1BEV 2;  2XL7 A;  4Y5S A;  4CA9 A;  1RUD 1;  1VBE 1;  1VR3 A;  3KHC A;  1V6L A;  1PMJ X;  5EV7 A;  4B29 A;  4RS5 B;  2K0G A;  1A78 A;  1RUE 2;  2ZX4 A;  3CNA A;  1AR6 1;  1F5F A;  4Y1U A;  2C5D A;  3QH6 A;  1NE6 A;  4Q0V A;  1IG0 A;  1ZM1 A;  4OVE A;  3ZXD A;  4HK9 A;  3ZN6 B;  2DCY A;  2ZMN A;  2DFB A;  4QPY A;  3N35 A;  4NWW A;  3SLI A;  2B46 X;  2VZT A;  3J7H A;  3WF2 A;  4IGP A;  4Q8K A;  4EN6 B;  3EYP A;  3VBU B;  5K0U C;  1O6U A;  5CG9 A;  5EXO A;  2BNO A;  5FZ1 A;  1NE4 A;  4E4D X;  2XUE A;  2I45 A;  4CRQ A;  5JIU A;  1X33 A;  1XE7 A;  5LWB A;  2ZGP A;  1VBC 3;  1WA6 X;  2CAU A;  3MFA A;  1DLL A;  1OD5 A;  5BNO C;  4XUN A;  1LOE A;  4GJY A;  3OGJ A;  4PBP A;  1RUH 2;  1YWK A;  4A7Z A;  2Y6L A;  4FT8 A;  2JKX A;  3VDB A;  5C8C C;  3GZE A;  1RB8 G;  1NX9 A;  3LPG A;  4L97 A;  4NMI A;  1WLW A;  5FO9 B;  5AVA A;  1HJF A;  1PO2 2;  1K5M A;  3T1M A;  3SQO A;  2VNR A;  3AB0 A;  3AKR A;  3PIJ A;  4GWJ A;  5FZL A;  1AJO A;  1AJK A;  2VZS A;  2OX0 A;  1X36 A;  3B3Q E;  4B1M A;  2LAL A;  4LA2 A;  1W6O A;  1DLC A;  1D4M 1;  3LEM A;  4QKB A;  5GLT A;  5HV4 A;  1YFY A;  2VOV A;  4GQ7 A;  3H9A A;  3SCF A;  2E9Q A;  3GJB A;  3WNK A;  3QD6 A;  4Z2W A;  5CA6 A;  1WW6 A;  1PVC 2;  1C4R A;  2VZ3 A;  2R04 1;  2WZE A;  5BPX A;  4QPG A;  4H3W A;  1AX2 A;  1DGW X;  3H7J A;  1LR5 A;  2J1S A;  4QX7 A;  5DG2 A;  2HEY F;  5F6L B;  3H8O A;  3S0M A;  3VZL A;  4BK5 A;  4AFD A;  1X9T A;  1GLH A;  1CAV A;  2VL4 A;  4OI1 A;  3WIN E;  1SCS A;  4NHM A;  4CDX C;  3O1R A;  3M7A A;  2JEM A;  3POW A;  1UY1 A;  1REF A;  4FPF A;  3CLP A;  4XAE A;  4H14 A;  4IV1 B;  4YZ4 A;  2HWF 1;  1REE A;  1RHI 3;  1QQP 1;  1RUI 1;  2XBO 3;  3ETQ A;  2GAU A;  4N9I A;  1W0P A;  2RM2 3;  1WA4 A;  4OI4 A;  4C91 A;  5JSP A;  2VMF A;  2DFC A;  2LRP A;  1Q8V A;  2MHF A;  3N7K A;  3BTA A;  2EIB A;  1PZ7 A;  4HXC A;  4AFA A;  1S1A A;  4UFJ A;  2YUE A;  1RMU 3;  5HV0 A;  2VW1 A;  3W9A A;  2W5F A;  1MR5 A;  4Q4W 2;  4IEP A;  1QOS A;  5DUV A;  2RV9 A;  2R16 A;  3WF3 A;  3AKT A;  4XZP A;  4KWL A;  1RUJ 3;  1ZRF A;  1WZX A;  1B35 B;  5ANQ A;  4M01 A;  4AXO A;  4X6Q B;  4E4Z A;  4M4P A;  1VAL A;  3NNM A;  1DGL A;  4CDQ C;  2BUK A;  4QX5 A;  1VBA 2;  3M8L A;  4XHB A;  5FKB A;  2E63 A;  1DQ2 A;  3V64 A;  2BVV A;  2HEW F;  3MUZ 1;  5F32 A;  3FMG A;  3VHN A;  1TZO A;  1IPJ A;  5FQ0 B;  1ND3 C;  5HCA A;  4EN7 B;  1ENS A;  3CQO A;  4GMP 0;  1VBD 2;  1UKR A;  5DDJ 1;  5GLU A;  1U12 A;  4CEY A;  1NT0 A;  3LA2 A;  3HT2 A;  5CEH A;  4JKK A;  3KQ4 B;  2ARE A;  2P6C A;  3VBH C;  4K21 A;  4DZG A;  1PZ8 A;  5KXB A;  1PGS A;  4AEM A;  3H50 A;  2YGL A;  2R1D A;  1W8W A;  3K51 A;  2GN7 A;  2WZ8 A;  5DAX A;  1R09 2;  1YIP A;  4XXP A;  2VMI A;  2PHT A;  2HBU A;  1V9U 3;  1Y9G A;  1G9B A;  1V00 A;  2AUY A;  1EYB A;  1O8P A;  4HN1 A;  5EYY A;  4Y4R A;  2SLI A;  1LOF C;  5FUN A;  5A3N A;  2HWD 2;  2KD7 A;  3H7Y A;  3ZFF C;  3WNL A;  4JGY B;  4Q4X 2;  2WYS A;  1KQR A;  1HJG A;  4LHK A;  3AMN A;  5FFO C;  3WDY A;  2X05 A;  2JD9 A;  5FXW A;  4BDV B;  2QKD A;  4HG6 B;  2OPK A;  4BU2 A;  3NW4 A;  2WC2 A;  2ZGT A;  1H1I A;  4XIK A;  3WQ0 A;  3R0R A;  3WW1 A;  3A22 A;  4CU9 A;  1GWK A;  4MGY E;  2UWB A;  3JU9 A;  2PHL A;  2C9A A;  3I2J A;  3KHB A;  2VTX J;  3WF0 A;  2ATF A;  3FE5 A;  4GWI A;  3A21 A;  3VKL A;  1KGY A;  2J1R A;  2WO1 A;  2VMH A;  3VL9 A;  4QWN A;  4ZU5 A;  3M70 A;  3V0A B;  3LDB A;  1CZV A;  4BQX A;  4KH9 A;  4BLI A;  3KGZ A;  4AGR A;  2Z69 A;  5IVC A;  4JGZ A;  1QHD A;  4BMB A;  5JPN B;  5C8W A;  4R52 A;  4QQH A;  2ZHM A;  2ZXQ A;  3LSD A;  3WHT A;  2PHU A;  5FYZ A;  3B5L B;  1IS3 A;  1YQC A;  3VDC A;  4B4R A;  5C4W C;  4MHU A;  4EN9 B;  4ZY9 A;  1BEV 3;  1QOT A;  2X5I A;  5FPL A;  2GH8 A;  4EWD A;  2RDS A;  2RS5 2;  4P9J A;  1SPP B;  2FDK A;  1RUE 3;  4N53 A;  5FMD A;  1FOD 1;  2IXL A;  3GJA A;  3MPB A;  3OY8 A;  2NM1 A;  4QX1 A;  3CL1 A;  4CCC A;  1A8M A;  5T52 A;  5IK5 A;  3I2H A;  3O1V A;  2Y6F A;  5BNO B;  3KSC A;  4PF1 A;  4R4X A;  1DYO A;  4S2G A;  1K42 A;  2WS9 3;  4QQL A;  2DVF A;  2O8O A;  2WWS A;  4LKE A;  3V0A A;  4P5Y A;  1DQ4 A;  3RDI A;  3ON7 A;  3URF A;  1W04 A;  3AXE A;  1US2 A;  4B7K A;  4GWN A;  2ZA9 A;  5C8C B;  4UFM A;  5FBZ A;  5JWP A;  2HEV F;  1OT5 A;  2WZR 2;  2XL9 A;  4BJ0 A;  3ZFE C;  1JN2 P;  1EAH 2;  1D7P M;  2FDJ A;  2QDR A;  3LF7 A;  3I3D A;  5AFB A;  1ASJ 2;  2FDH A;  1RUH 3;  4RHV 1;  2YFZ A;  3VD4 A;  2RJ2 A;  2WT2 A;  3Q8F A;  2ZEY A;  3IN9 A;  2FD8 A;  2P3Y A;  2ZJC A;  4KGG A;  4YVW A;  3VKN A;  4P08 A;  3ZIX A;  3BIE A;  4QM8 A;  5JAX A;  3O1P A;  1PO2 3;  2JDK A;  4LBL A;  4HPK B;  4DB5 A;  4Y4Y A;  1X8M A;  3ACG A;  3FHQ A;  1AUY A;  2QQM A;  4GWM A;  2OA2 A;  3V65 A;  4QXH A;  4AED A;  1AR8 1;  2XJU A;  4XIO A;  3CJX A;  1HV1 A;  2RJK A;  4QGN A;  4Z82 A;  2GAL A;  1OVP A;  4CDX B;  5JPM B;  4BQ5 A;  4QQO A;  3VKM A;  3J26 N;  4W6W A;  4IEV A;  2Q8E A;  3UV9 A;  1PVC 3;  4NHK A;  2VTF A;  2WS9 1;  4QDR A;  3U4S A;  4MGT A;  3D0S A;  2BZD A;  5FBJ A;  4N8M A;  5J1X A;  4AI3 A;  2DUR A;  4UF0 A;  1JZ3 A;  1JOJ A;  4QMA A;  1A6C A;  1Y4W A;  2VAU A;  2WQ4 A;  2FMY A;  1JTZ X;  3UGH A;  5DMY A;  3QLQ A;  5SV8 A;  5FZ6 A;  5FYH A;  1OOP C;  5IK4 A;  1XYO A;  3D82 A;  3IDC B;  1CPM A;  1Q5O A;  3IT8 A;  5GZG A;  1RTV A;  1MVE A;  3AZZ A;  1R1Z A;  1N1S A;  2DVA A;  2GC2 A;  3G7D A;  5LZ6 A;  2EXH A;  2Y26 A;  4M0N A;  3POF A;  1X9P A;  1QGL A;  1Z7S 1;  1LES A;  3A7Q A;  3G6J B;  2E51 A;  3JUU A;  4HLT A;  1RYY A;  4IE5 A;  4ONU A;  4XUP A;  3OUI A;  4AGG A;  4DUX A;  5A7O A;  1Y43 B;  4XMA A;  4JDM A;  5L9B A;  2JJ6 A;  5CFC C;  2IZW A;  1UPI A;  1YI9 A;  3GCW A;  5A3O A;  1NY7 1;  5DZF A;  4JAA A;  1YJK A;  4YW6 A;  4CDQ B;  4A4A A;  4XJ9 A;  1O3S A;  2VZR A;  1IQD C;  3W5N A;  3IWZ A;  4GMP 1;  4RL7 A;  4Q4W 3;  2VMC A;  5DPN A;  1LGC A;  3WCR A;  4JKL A;  3ASI A;  1UNB A;  1RUF 1;  5IJR A;  5F3C A;  5IK8 A;  1EV1 1;  1SLL A;  4FTS A;  1QXR A;  5ERL A;  5DN2 A;  1O5U A;  3VDD C;  1OC1 A;  3S7I A;  1S4C A;  4FPG A;  1MQT A;  3SIT A;  1VBA 3;  4E8C A;  1W9F A;  3VBH B;  3OGS A;  1F9K A;  1OPO A;  4LOS A;  2VH9 A;  3PVO A;  4NE9 A;  1GU3 A;  2RS3 1;  5CG8 A;  5ISL A;  4QGL A;  3MI8 A;  4DFS A;  4JVA A;  3NJZ A;  3LPF A;  4F3J A;  5CFD C;  1VBD 3;  1ZA4 A;  4UFK A;  2VBD A;  3WCS A;  1JXN A;  4MH0 E;  1PK6 C;  2XJR A;  1X8E A;  1WMD A;  4XFH A;  2YZ4 A;  1SLC A;  4YGC A;  2C26 A;  3VBF C;  3MF9 A;  2QE3 A;  2QTW B;  3X29 B;  1DZR A;  1R09 3;  3J7N A;  2V5D A;  3ZFF B;  1BKZ A;  1YI7 A;  2XQX A;  1UWW A;  1C8M 2;  1OQD A;  1SLB A;  1YRZ A;  2Y0I A;  2YHJ A;  1M4W A;  3JQX A;  4I09 A;  5JZG C;  1RVF 1;  5D8A C;  2I07 B;  4FOY A;  3KWV A;  5FZ9 A;  4PDW A;  4DXR A;  5JDB A;  1ZRR A;  4YPJ A;  2ZOE B;  5A7W A;  1WW7 A;  3Q8B A;  4TZD A;  3OOX A;  3CKH A;  1RC6 A;  5A7P A;  4J6G A;  5LA2 A;  4BOW A;  4CDU A;  1GFF 2;  3ZVX A;  4Q4X 3;  3ZKY A;  1ZBE 1;  4CU7 A;  1VRB A;  1YO8 A;  1VMF A;  4NPL A;  1KFX L;  2CGP A;  4LPL A;  2Z5W A;  2VEC A;  1F35 A;  4RD7 A;  2W08 A;  2ORZ A;  4RGK A;  4NUB A;  1C8N A;  4HL0 A;  2YPJ A;  3MF6 A;  2DBN A;  4KWU A;  3W20 A;  5L36 A;  3IDA A;  3AVS A;  1N3P A;  3K3O A;  1SBD A;  3KT4 A;  4D7T A;  1W6N B;  3USS A;  1C5I A;  3E6B A;  3PUQ A;  1UU6 A;  2ZGU A;  4XCA A;  2VM9 A;  1NLS A;  3CJI C;  3IMM A;  3I3B A;  4NIA A;  3CHX A;  1AR9 1;  5DUX A;  4YW4 A;  1ENR A;  3THP A;  2NMO A;  5C4W B;  2ZZQ A;  3DPR A;  4IW3 A;  1IKQ A;  1W8U A;  3PUR A;  5FZA A;  2X29 A;  2C6S A;  2ADE A;  4RYD A;  3I54 A;  4Q4V 1;  1LOG A;  1OD3 A;  5GZF A;  1UMH A;  4OQ8 A;  1CAX B;  3FUQ A;  1W06 A;  4BYY A;  1OHF A;  3NNF A;  3SNM A;  1AYN 1;  2Y6J A;  1HLC A;  3HMY A;  1TG7 A;  3J8F 2;  5EYX A;  3ZDS A;  2RDQ A;  1ONA A;  3GHM A;  1H9W A;  5C9A C;  1UD1 A;  1DHK B;  3MLJ A;  4W6X A;  5BXX A;  2FQP A;  2YC4 A;  1ZBA 1;  1WBF A;  2EAA A;  2RS5 3;  3PVE A;  4AVV A;  4CU8 A;  3M2M A;  1H30 A;  5EHD A;  3ATG A;  4LEJ A;  5F5A A;  2D6L X;  3TOJ A;  5JXH A;  1DYK A;  2CWM A;  5CZK A;  2RS1 2;  2BNN A;  2WWU A;  3ZFE B;  1ZZ9 A;  2JG9 A;  2Q8C A;  1D2S A;  1NCR C;  2FCU A;  1AL2 2;  4ORF A;  4S2H A;  4U36 A;  4HVQ A;  4YZ1 A;  3JBG 2;  3E6C C;  3VBR B;  3UYJ A;  3PTY A;  2WAB A;  3OD0 A;  5IAT A;  1RUD 2;  1CAU B;  1VBE 2;  3VZN A;  4FFG A;  5CAD A;  2D6N A;  2VQA A;  3JXS A;  1AR6 2;  4XPV A;  4BQY A;  5A3U A;  2WZR 3;  3P3N A;  1DG6 A;  2K2S A;  2VGD A;  1EAH 3;  3OGR A;  5IVB A;  3WP5 A;  1G9D A;  4P02 B;  1VB2 A;  2K46 A;  4BIS A;  1CX1 A;  5F1R A;  3UT0 A;  1UYP A;  2WWJ A;  1ASJ 3;  1XND A;  5FUI A;  4DNY A;  5AFE A;  2GC3 A;  5A3T A;  4TTG A;  4ZS2 A;  4IEZ A;  2HYK A;  4OZO A;  3VKO A;  1WW4 A;  4AHY A;  2PTM A;  1SFP A;  4FFI A;  1F15 A;  4XJ8 A;  5T54 A;  2NYY A;  4JRA A;  1JW6 A;  1QEX A;  2HJI A;  3HBK A;  5K9Y A;  5A33 A;  3EBR A;  4QDS A;  3O1O A;  2GDF A;  1UYY A;  2QZ2 A;  2VZ1 A;  2VCC A;  3WDU A;  1JOD A;  1EY2 A;  5A1L A;  4Y20 A;  3AL6 A;  4BLJ A;  3AJY A;  3USU B;  1QJF A;  2WZP P;  4Q2F A;  3T2P A;  2O14 A;  3WUC A;  3P6B A;  4XFA A;  3T2O A;  1GOH A;  1OOP B;  2W3J A;  3HN3 A;  1SBF A;  2W91 A;  3LDK A;  4QKN A;  4XFG A;  5LA1 A;  3DEM A;  4LJH A;  4E4H A;  4WM7 A;  1W2A X;  2PMW B;  2WLQ A;  2WIN B;  3ZXL A;  2VQT A;  4GZ9 A;  1R1A 1;  3ILN A;  5C7G A;  3MIF A;  4P9X A;  5EZW A;  5IVF A;  4XQD A;  4BHP A;  3J7L A;  3MZH A;  4HAN A;  5DAW A;  2N7G A;  5LK5 A;  3I2D A;  4QHZ A;  1AX1 A;  4HET A;  1D4M 2;  3GM8 A;  4NJ4 A;  5KHK A;  3T3Y A;  1O4Y A;  2WFF 1;  5E16 A;  4FQZ A;  4MXW A;  3THC A;  1ZZ8 A;  2R04 2;  4I0B A;  4ZXK A;  4Y26 A;  1GV9 A;  5FMO L;  3IPV B;  3TWI A;  3H3U A;  1UIJ A;  4A6O A;  4E9K A;  3AMH A;  4A3X A;  2PQS A;  3VDD B;  5BUV A;  1J59 A;  4CCL A;  3UJO A;  2DCJ A;  1R08 1;  2B5H A;  4LK7 A;  4RFT 0;  5FP9 A;  1VBC 2;  1W0N A;  1G6N A;  2ZKN A;  4WVW A;  4LE4 A;  3UET A;  1H6X A;  4RR3 C;  1VP6 A;  1COV 1;  3B94 A;  4DO0 A;  3AP7 A;  2HWF 2;  1QQP 2;  3D8C A;  4EYU A;  2QNK A;  4Y22 B;  4GA9 A;  4WZF A;  1PK6 B;  4K7J A;  5FK8 A;  4FCA A;  3F2Z A;  2Z2S B;  5JOW A;  3I2I A;  1K45 A;  2GC0 A;  3VBF B;  2XJT A;  1OUR A;  4NAO A;  1UZW A;  2WNE A;  5G04 L;  1CN1 A;  1BVV A;  4C0B A;  1ND2 C;  2YYO A;  1FXZ A;  2WQ8 A;  1F31 A;  1IS5 A;  3S57 A;  4ERO A;  4DUW A;  1XE8 A;  4HKW A;  4CUA A;  3NMB A;  2XH6 A;  5JI7 A;  1BXH A;  3BUC A;  5D8A B;  2KA3 A;  4JC1 A;  3HNM A;  1RUG 1;  4UW3 A;  3RG0 A;  2LS6 A;  5JMC A;  2VXJ A;  4A2U A;  4EZH A;  4MHR A;  1QDC A;  1SEF A;  3U4X A;  4AVC A;  3LA3 A;  4IEO A;  5A6Y A;  4AGV A;  5A32 A;  3DF0 A;  5LAT A;  3K2O A;  1TMF 1;  1PO1 1;  1C8M 3;  2DF7 A;  2IXK A;  2WN3 A;  5FZE A;  5FXV A;  4AF9 A;  4AWD A;  4D6S A;  5ABJ A;  1MEC 1;  3DN7 A;  2GSY A;  5DDJ 2;  2ZMK A;  2V73 A;  1RJ8 A;  5L7O B;  2R0F A;  2XBO 2;  1GQP A;  3ITQ A;  3EXU A;  1LHW A;  1QOO A;  1DQ0 A;  4IE7 A;  5LRS A;  1N3Q A;  1JS9 A;  4JRL A;  2JDA A;  1VMH A;  3ZOI A;  4ZZ5 A;  2WLP A;  3JB4 C;  3PVB B;  4GB3 1;  4Q29 A;  3BGA A;  3AM2 A;  1HRI 1;  3I59 A;  3O5S A;  4CDW B;  3D0J A;  3GZT B;  3CJI B;  1CJD A;  2BDR A;  1VRH 1;  1W6P A;  1W8N A;  1XNK A;  4LKF A;  1HV0 A;  1UX7 A;  1GNY A;  4E2G A;  3O1M A;  5C3S A;  1H6Y A;  4AYU A;  3VL8 A;  2I2S A;  1GR3 A;  4A41 A;  4AQS A;  2P3K A;  3Q9O A;  1PGW 1;  4DRR A;  4H55 A;  2J1V A;  3HD8 B;  3UGF A;  4JV4 A;  3VBO C;  3IZO A;  2VTX A;  5GKA C;  1NXD 1;  3BVC A;  3OEB A;  4FPE A;  3I2G A;  4GXL A;  2P3J A;  4NO4 A;  3O1T A;  4E2S A;  1OA2 A;  4LK6 A;  5C9A B;  4Z2A A;  3AZY A;  3RGB A;  2ID4 A;  3C2U A;  5FYU A;  4YM3 A;  2RMU 1;  1LHO A;  3BYW A;  2F17 A;  4QXB A;  4ISR A;  2WNU B;  4GAL A;  1OPM A;  1XU2 A;  4QPG C;  5AC9 1;  3EB7 A;  1WWY A;  5I8Y A;  1OF4 A;  1S0J A;  4KU8 A;  4BXS V;  5GZC A;  2J1T A;  3J8F 3;  3POI A;  4JX0 A;  1ODM A;  1NCR B;  2K9Z A;  4QKF A;  3MUY 1;  3R4U A;  3RSJ A;  1CR7 A;  1EP0 A;  3ZYB A;  3POS A;  3HIF A;  1ENQ A;  1QIQ A;  1BK0 A;  4YG0 A;  4XF9 A;  4XAC A;  2ET7 A;  4XE9 A;  2BPA 2;  4XQ4 A;  3AKP A;  3I2K A;  5GZE A;  1QH7 A;  3S30 A;  3OBA A;  5LY1 A;  3UJQ A;  1XNT A;  3WNX A;  2RS1 3;  5E1R A;  1C5H A;  1IS6 A;  3LFM A;  5C5U A;  1X7N A;  5GLV A;  1OFS A;  1UZV A;  1UY2 A;  3JBG 3;  4ZXE A;  3N36 A;  3ZFG B;  3O1U A;  1NA1 C;  2E53 A;  4IEU A;  1RUD 3;  1CZS A;  1VBE 3;  3QBQ A;  4GIQ A;  2R0H A;  4FXK B;  1UU5 A;  4GH4 C;  4AI8 A;  1AR6 3;  4NIG A;  1FOD 2;  3ZN4 A;  1UQX A;  3DL3 A;  3ZYH A;  1WLT A;  2VOW A;  3D3A A;  5FYC A;  2XWJ B;  5FY7 A;  2ETE A;  3ZDV A;  5I0U A;  1Q3E A;  4YAR A;  2BER A;  2D7F A;  3RPQ A;  2RR1 1;  5C6C A;  3C7H A;  1PNG A;  1QXJ A;  2VW2 A;  5LK7 B;  1VBB 1;  1FAY A;  1LNS A;  1OLQ A;  2R30 A;  3POB A;  3RZG A;  3APB A;  2HWC 1;  3ZPY A;  4N43 A;  2WAA A;  3ORJ A;  3RJR A;  4QKD A;  4RS5 A;  5E88 A;  3POJ A;  3ACL A;  3FFQ A;  3RZJ A;  3RYR A;  5EJ3 A;  1NZC A;  4XTP A;  2ZKL A;  3DCQ A;  5K8S A;  3WUD A;  4RHV 2;  4QGM A;  3GAL A;  4QPI C;  2GNT A;  4JQR A;  3ZN6 A;  5FP7 A;  5CAZ A;  5C70 A;  4AFM A;  2G9G A;  3GZA A;  3PTR B;  4E4S A;  4FPY A;  2H6C A;  4UW5 A;  2VUC A;  5HCF A;  4DQA A;  3N3H A;  4XUR A;  2ILM A;  3VBU A;  5FPU A;  1WCU A;  1HRV 1;  3LGR A;  1QJZ A;  1N1T A;  3ACH A;  3DYO A;  2Y34 A;  3KCC A;  5JCT A;  1AR8 2;  3M3O A;  1D4M 3;  2GC1 A;  4LBN A;  4M3C F;  5BYN A;  2VUJ A;  4RR3 B;  2VVF A;  2QQU A;  2R04 3;  3TYJ A;  2WS9 2;  3SH3 A;  2BJS A;  1W8T A;  1YYN A;  3AZW A;  3NVC A;  2GP3 A;  2VR4 A;  1JYC A;  1WCK A;  1H1M A;  3GBF A;  1FMD 3;  1YFU A;  1S0F A;  2GH2 A;  1IHM A;  3UES A;  2WSU A;  2WKK A;  2FDF A;  3PUS A;  3CEW A;  4FVV A;  4XUQ A;  3AZX A;  2D3R A;  3JB8 A;  3TEZ A;  1ND2 B;  5FPV A;  2O8Q A;  4D3W A;  5BNP B;  2HWF 3;  3EJK A;  5F5Q A;  1QQP 3;  1RUI 3;  2IFW A;  2PQQ A;  1UPS A;  2CYF A;  4OHX A;  1Z7S 2;  2W1S A;  3EHK A;  3VV1 A;  3IB3 A;  2IWG B;  1L7L A;  3LKJ A;  3RS6 A;  2AEY A;  4E27 A;  4ZS3 A;  1HX6 A;  4O7X A;  2KR2 A;  1JYX A;  2VC9 A;  1NY7 2;  1WD4 A;  4YZ5 A;  3NQH A;  5H9P A;  1GOG A;  1NCQ C;  3E6D A;  1MS3 A;  1UMI A;  1O3Q A;  3OCP A;  3HQU A;  2XKP A;  1ZRE A;  1W2N A;  1XNA A;  3ZYJ B;  2GU9 A;  4CCE A;  2FZ1 A;  4PIZ A;  5DZE A;  3WDW A;  3AL5 A;  3H1Y A;  3H0O A;  1KS4 A;  3WSO A;  4LBQ B;  1XPW A;  3DV8 A;  1W6Q A;  1RUF 2;  1LCL A;  1PX3 A;  2A71 A;  1H0B A;  4IV1 A;  5A6X A;  3HOB A;  2JDY A;  3U78 A;  3SIS A;  4QU2 A;  2W92 A;  3LD8 A;  2WNV C;  2ARB A;  3B01 A;  1FMD 1;  2ET1 A;  4LLF A;  2RS3 2;  1XB9 A;  2ZGM A;  5DAP A;  1U5X A;  4MET A;  1GZW B;  1SLI A;  4HON A;  1CZT A;  4K20 A;  2B4K A;  1J84 A;  5FZD A;  3BPZ A;  3KZ4 C;  5DDJ 3;  4EZ4 A;  4I3P A;  3RWN A;  3MBW A;  3N9Q A;  2D93 A;  2VVD A;  4FOV A;  5T5J A;  3CBN A;  3VHO A;  5CKM A;  4RGA A;  2E33 A;  3H3L A;  1O59 A;  2WBK A;  3KVA A;  1B35 A;  4NN0 A;  1WW5 A;  4YG3 A;  1M06 G;  2YRO A;  1D2Q A;  4W50 A;  2JKB A;  5FKC A;  3VBO B;  1WCD J;  3ZYP A;  2PYT A;  2E7Q A;  3OB8 A;  1RVF 2;  5LAS A;  1W6O B;  3O0X A;  1I9R A;  3R4S A;  4K8R B;  5C3R A;  2XUM A;  5I0S A;  3RZZ A;  2W95 A;  1U5Z A;  4HSJ A;  4AW7 A;  3NJV A;  1W99 A;  2J1E A;  4YW3 A;  1DGR N;  4S2F A;  4ARY A;  3AYE A;  4QPG B;  5CB7 A;  2BOI A;  4XXA A;  3WG1 A;  2BBA A;  3BPS A;  3NV3 A;  4CPB A;  2L9L A;  1ZBE 2;  1O7F A;  1OA4 A;  5DAQ A;  5HXM A;  2W9X A;  4OFG A;  4L99 A;  2Q4S A;  2NLR A;  4HVO A;  3LE0 A;  2ZAC A;  4FQ4 A;  5FK7 A;  3R4D B;  4M3C A;  2HWE 1;  3NWK A;  4PHZ A;  3RZM A;  4XW3 A;  1OH3 A;  2W1W A;  2X53 S;  2OUJ A;  1RXF A;  1UXX X;  4R8H A;  3P5B A;  5B4X A;  4UW6 A;  2QFE A;  4AI1 A;  3GZU C;  3MLL A;  1KEX A;  2A6Y A;  2C4X A;  4QX0 A;  1UU4 A;  3A0K A;  3ZMO A;  1S0D A;  3VHR A;  3WX5 A;  2VUA A;  4XUO A;  2DTW A;  1UX6 A;  1S0E A;  2P17 A;  2XKO A;  3WW2 A;  1AR9 2;  2ZCW A;  3WNM A;  1POV 0;  4JGY A;  5FLH A;  1NA1 B;  3E5Q A;  3RZL A;  1CES A;  3BTX A;  4IDZ A;  2ZGL A;  1NAE A;  3FN9 A;  2VQ0 A;  4Q4V 2;  4QM9 A;  4GH4 B;  2PAK A;  1JOP A;  1H8T C;  3I49 A;  2GN3 A;  5F3G A;  3TNQ A;  1AYN 2;  2UWC A;  1W3V A;  2OVU A;  2W46 A;  1E5R A;  5BNN C;  3T0D A;  3SC7 X;  3HEI A;  4WM8 C;  4ATE A;  3I2O A;  3BIW E;  3MW4 A;  4P9G A;  4XJU A;  1BZW A;  1AXK A;  2Q1F A;  1ZBA 2;  5FZC A;  1UYX A;  3AYA A;  2P3I A;  4BM8 A;  2CDO A;  2AEZ A;  4RQP C;  3KT7 A;  1FOD 3;  2ZGR A;  5LA0 A;  4QB6 A;  3PU8 A;  3HJR A;  4YVS C;  3WR0 A;  1D4V B;  1LEC A;  4IV3 C;  1ULF A;  2JDN A;  4TSV A;  3RYK A;  3IKW A;  2W1U A;  3U0Z A;  1MQT C;  1HQN A;  3C7E A;  1WUV A;  2EID A;  5FPB A;  4PIY A;  5LB6 A;  4L0P A;  3V0B A;  2QQJ A;  4LXL A;  4IEX A;  4QPI B;  4XJZ A;  3ZR6 A;  4CSW A;  2VQU A;  3I8T A;  4JQT A;  1ENX A;  2EAK A;  2YMZ A;  3POE A;  4IUG A;  4BB3 A;  4FPO B;  2QZ3 A;  1L7Q A;  2WT1 A;  5K0U A;  1SPP A;  2GZW A;  4XTM A;  5FMC A;  3M3Q A;  3NV1 A;  2XXZ A;  3PMS A;  3VD9 A;  1J1T A;  4IER A;  5F6K A;  3AJZ A;  5KR7 A;  1QJY 1;  4RHV 3;  5FPA A;  2VZV A;  2VXR A;  3AP5 A;  4FPJ A;  2O1Q A;  1H2M A;  1I5Z A;  5JOZ A;  3QH7 A;  4UXA A;  5BNO A;  1PMI A;  1L7R A;  2CU5 A;  4IES A;  4Y1V A;  5TSW A;  5I0D A;  4BE3 A;  4Y1Z A;  2AGS A;  3P3P A;  4KG0 A;  3ZPO A;  2FBE A;  3AFK A;  3ABZ A;  5C8C A;  2JDZ A;  1JBC A;  1AR8 3;  1H2N A;  1W0O A;  3I97 A;  2XPJ A;  3MIB A;  1CD3 G;  2QJV A;  4V2V A;  1XNC A;  1DCS A;  4GJZ A;  2W39 A;  2JDP A;  2D6O X;  4CUB A;  4ARX A;  4O9E A;  4DXZ A;  4OI2 A;  5F7U A;  2G9F A;  5IVV A;  1R1A 2;  2ZTN A;  4AI9 A;  3OJB A;  1GQH A;  5C3Q A;  2VOX A;  1TVG A;  5JIA A;  5GZD A;  1GQG A;  2YBK A;  2TBV A;  1QJU 1;  5CNA A;  4JGZ B;  1NCQ B;  4QX2 A;  2F4L A;  4OMC A;  5JOY A;  5KHJ A;  3VBR C;  2YDE A;  2XVK A;  2WFF 2;  4LO5 B;  5JXI A;  5F5C A;  3KMH A;  3D4K A;  1Z7S 3;  2Q30 A;  3W21 A;  3DKQ A;  4CDX A;  1DGW A;  5T5P A;  3HNY M;  1YFW A;  3WDX A;  2E6V A;  4GKX A;  2ZEW A;  1MS5 A;  4P9L A;  4MZU A;  1R08 2;  4M0H A;  1GZT A;  3NRU A;  2WNV B;  1KDM A;  3AP6 A;  3WT3 A;  4RA0 A;  4GMP 3;  2YC0 A;  3K3N A;  1LOB A;  3AX4 A;  5K4L A;  1COV 2;  1BMV 1;  5FYB A;  1X82 A;  4L11 A;  4QAW A;  3ZYI B;  3R05 A;  5FCC A;  5FJK A;  2WRA A;  1W28 A;  1RUF 3;  2P37 A;  5H9Q A;  1EV1 3;  4YZ3 A;  2E7A A;  2LM3 A;  3OPW A;  1Q8S A;  2XVL A;  4R9C A;  3GBW A;  4COV A;  4B7E A;  2RS3 3;  5LBB A;  5A7N A;  3AVR A;  1GZC A;  1Q43 A;  4K8F A;  3VD5 A;  4GKY A;  4CDQ A;  2NN8 A;  3NKT A;  1XBF A;  2Q5T A;  3BN6 A;  3WDT A;  5I0T A;  1RUG 2;  3VLB B;  4LNV A;  5FZI A;  2TUN A;  1VMJ A;  2ZZJ A;  4HSL A;  1GUI A;  1ND3 A;  4M3C E;  2X8K A;  5FR3 A;  1UY4 A;  1TME 1;  3JD7 1;  4CP9 B;  2WII B;  4PIX A;  5CIR A;  1VAV A;  4CEW B;  5BV6 A;  5FV3 A;  1J3Q A;  1PO1 2;  4R9D A;  2JB4 A;  3VBH A;  3KF3 A;  4LO6 B;  4MLO A;  2VCA A;  1RVF 3;  1VPH A;  1MEC 2;  3WG4 A;  1A34 A;  3LEK A;  3N7J A;  1HIX A;  1PM4 A;  2BVB A;  4C1W A;  3GXU A;  4D7Y A;  5J3U A;  4QB2 A;  1ACC A;  2VJX A;  3ACI A;  1UKG A;  4ASK A;  2B39 A;  4FI9 A;  2IC1 A;  5FZH A;  3PUH A;  3DUI A;  5LEJ A;  5HXV A;  4CEW C;  5E89 A;  3TEY A;  1CAW B;  1ZBE 3;  3N7L A;  1POV 1;  4W4Z A;  1FNY A;  4GB3 2;  4IEY A;  2ZGN A;  3TEW A;  1HRI 2;  1GP6 A;  1LOF A;  3VD3 A;  4LUM A;  2D44 A;  2H0B A;  4KWK A;  1OXC A;  2QBX A;  3UKV A;  4UBH A;  2JWP A;  3ZFF A;  4HN0 A;  1HB2 A;  4HZF A;  2YC2 A;  1LOD A;  4KWJ A;  1P8J A;  1VE0 A;  4XBN A;  1CX4 A;  1PGW 2;  2GNM A;  3VZM A;  1H8T B;  2R7E B;  4DXS A;  3RI9 A;  2QQV A;  3ROU A;  3LA7 A;  3LFI A;  4Q5O A;  3RYP A;  4C0H A;  1AR9 3;  5BNN B;  3L2Y A;  4I02 A;  3W59 A;  4WM8 B;  2XJS A;  1AZD A;  1NQD A;  2OII A;  1H4G A;  3OUH A;  4UYB A;  3VZO A;  1OLR A;  5LBF A;  2RMU 2;  2EA7 A;  1NLR A;  2E26 A;  2EIC A;  4KG8 A;  4Q4V 3;  4ZU7 A;  4RQP B;  3CDZ B;  5AC9 2;  3DGT A;  4QDQ A;  2BYV E;  2GME A;  4CCK A;  2CDP A;  5I91 A;  1UOB A;  2DVD A;  1AYN 3;  2A6V A;  4YVS B;  4Z8B A;  4IV3 B;  3WQ1 A;  5IAV A;  4BQ3 A;  1MQT B;  4COU A;  5KHH A;  5JLV A;  5KXE A;  2VVE A;  1W6N A;  5DG1 A;  5FZ3 A;  3WF1 A;  3PU3 A;  1ZBA 3;  3FLT A;  1BVP 1;  5CYY A;  3WY6 A;  2JG8 C;  1GBG A;  4M4R A;  5L7O C;  3HPN A;  1GNH A;  1YQ8 A;  2E32 A;  5FY4 A;  5SV5 A;  5IAX A;  1JYN A;  1C57 A;  3OPZ A;  5FZG A;  5C4W A;  1JZ5 A;  1BJQ A;  2J1A A;  1RUO A;  1HB3 A;  1ULE A;  3PHM A;  3GGL A;  1WKY A;  1MVQ A;  1ULP A;  3L9J T;  2B8M A;  2D3S A;  2VNV A;  4YRD A;  3WNO A;  3WQB A;  4NPR A;  2JB8 A;  5JVV A;  1B09 A;  1CAX A;  4CDW C;  4COZ A;  4QXK A;  2PEL A;  1MAC A;  3K46 A;  1FNZ A;  4FPC A;  1GWL A;  4YYO A;  2D98 A;  3ZM8 A;  3THT A;  2XJQ A;  2VD7 A;  4X8P A;  1W9T A;  5GJ6 A;  5J37 A;  1HXS 1;  4ZHN A;  1TEI A;  3MDP A;  2DCK A;  4IET A;  2V09 A;  5KBF A;  1V0A A;  2Q1Z B;  4EE2 A;  1KRI A;  4AHZ A;  1YHF A;  4HK8 A;  2RR1 2;  3ZFE A;  4YGB A;  1H9P A;  1T2X A;  1VB4 A;  1VBB 2;  2C1F A;  3POY A;  5T5L A;  2HWC 2;  5FRA A;  1V70 A;  1LTE A;  1AYM 1;  2R49 A;  2W94 A;  3VBS C;  1CAU A;  5EJ1 B;  2PXJ A;  3KM5 A;  2WNU C;  2DV9 A;  3KT1 A;  3OBR A;  2JE7 A;  1UW8 A;  3U1X A;  4EQV A;  3BU0 A;  2VW0 A;  5IUQ A;  1G86 A;  1K5J A;  4JKM A;  5JXJ A;  3OGV A;  4FTE A;  5FLJ A;  1QMJ A;  2D6K A;  4FAG A;  4QQP A;  2WT0 A;  4XET A;  4FO9 A;  2G9Z A;  3M4F A;  2EAL A;  1LOA A;  3H8U A;  4IE0 A;  1YQ5 A;  1XSR A;  3ILR A;  1R1A 3;  1UOG A;  3IBM A;  2CTV A;  1HRV 2;  2ZAA A;  3B9I A;  3KV6 A;  5APA A;  3NNL A;  3RMX A;  3ZXK A;  1FX5 A;  2QQK A;  3RZH A;  4A7K A;  4D6R A;  4LIT A;  2TEP A;  4LUK A;  3ES1 A;  2BOJ A;  3T2Q A;  4X8N A;  1EUU A;  2OXB A;  4Y33 A;  3ZFG C;  2WFF 3;  1GP5 A;  1HQW A;  3HBZ A;  1XRU A;  4CE8 A;  4NHX A;  1BBT 1;  1OOP A;  1POQ A;  2QQW A;  4I30 A;  2EXI A;  4QQ2 A;  4ZPI A;  3THD A;  1PIV 1;  3MHZ A;  2QQN A;  1PHM A;  1N1V A;  5FYY A;  4Y5Z 0;  1R08 3;  4FTB A;  4AAX A;  1JHN A;  4QXC A;  3NAP C;  2BNM A;  1E57 A;  5CFC A;  4A42 A;  5GAL A;  4KBB A;  1COV 3;  1CON A;  3IAP A;  3WNN A;  4ZZ8 A;  1I1E A;  3MW3 A;  1MS0 A;  2DWR A;  5F3E A;  5FJH A;  1OVS A;  1DP0 A;  1ULO A;  4G4F A;  1BQP A;  3KS7 A;  3ZYG A;  1DZQ A;  1YXW A;  3Q8C A;  2DCZ A;  1JZ2 A;  2WO3 A;  5EP9 A;  3DKW A;  1MZ5 A;  4WBB A;  5FOB B;  1N3O A;  3K4A A;  4Q26 A;  3O0V A;  3TN9 1;  3CZJ A;  1OQE A;  1DF0 A;  3IPV A;  5FP4 A;  3LOB A;  5FYS A;  1SAC A;  2GMP A;  3NNG A;  1SBE A;  1YLL A;  5AVP A;  1LAJ A;  4AQ6 A;  1RIR A;  1YC6 1;  4XYX A;  5I93 A;  1HB1 A;  2NQY A;  2D40 A;  1JUH A;  4IL7 A;  4URT A;  3VDD A;  1JHJ A;  2WA4 A;  1KJL A;  1UAI A;  1QDO A;  1K12 A;  1RUG 3;  1IGO A;  3EQE A;  3OPT A;  3UNP A;  2Q0A A;  3OF1 A;  1OSG A;  3WD5 A;  1LKN A;  5ANN A;  5CFD A;  1FMD 2;  1GWM A;  3KVB A;  2IVI B;  4TYS A;  1PK6 A;  3PL0 A;  3B93 A;  1TMF 3;  1PO1 3;  3POG A;  4P9Y A;  1IS4 A;  1NYW A;  3IIA A;  1SDW A;  2ZEX A;  4FOW A;  4D6Q A;  4ET7 A;  5JOX A;  3VBF A;  1MEC 3;  5GM0 A;  2E7T A;  1NOV A;  2UWA A;  1HW5 A;  5LY2 A;  4AFB A;  3QCW A;  1UMZ A;  3RI8 A;  4PQ9 A;  1RUI 2;  4MGI E;  2C0Z A;  1LEN A;  1G9F A;  3PME A;  5FY5 A;  1UOF A;  1WD3 A;  5JZG A;  2CL2 A;  4LA3 A;  5IFT A;  2R06 1;  5D8A A;  3U37 A;  4A7Y A;  1SLT A;  3H1W A;  3JCI A;  4IEW A;  4GB3 3;  4BZ4 A;  1YUD A;  1Z0H A;  1HRI 3;  3LAG A;  4MV2 A;  5FMO S;  4HKL A;  2ERF A;  1XC6 A;  1HN1 A;  4WVM A;  1ZVF A;  1VRH 3;  3IDE A;  5BNP C;  4CCM A;  2W0X A;  4AR2 A;  4FOQ A;  2DUP A;  1BCX A;  3C8X A;  1ZZC A;  3O7O A;  1EUT A;  2Y8K A;  5F3I A;  4FPH A;  1JZ6 A;  2VG9 A;  3BOW A;  2FCT A;  1T6B X;  3NNJ A;  3S5A A;  2WAO A;  2V4V A;  4I0A A;  3GCX A;  2D43 A;  5CKN A;  4J25 A;  4Q4Y 1;  2XLF A;  4XJW A;  4K40 A;  3BI3 A;  4IGQ A;  2YBS A;  2QVS B;  5C33 A;  4NHL A;  2HWE 2;  2CY6 A;  2JIG A;  2WR9 A;  2OZJ A;  3LIH A;  4MVT A;  4HKO A;  3WP4 A;  2RMU 3;  1PX4 A;  4Q0P A;  2JG8 B;  3CJI A;  3WW4 A;  2D97 A;  2XOM A;  3UK9 A;  2F4P A;  4CYD A;  5AC9 3;  3C7G A;  4TWT A;  1KXG A;  1MS9 A;  2ZGK A;  3D6E A;  1J83 A;  2R07 1;  4UFH A;  4RN5 A;  3ZX7 A;  4AHW A;  1O91 A;  3M3I A;  3E97 A;  2A75 A;  4CVU A;  3OYW B;  5FOJ B;  4I01 A;  1L3J A;  5C5T A;  4F8A A;  2PHF A;  1EPW A;  1RUC 1;  5FWJ A;  3GF6 A;  5A7S A;  5C9A A;  3DYP A;  3NO8 A;  3Q8A A;  4BIF A;  4D69 A;  3IM0 A;  1YQ6 A;  5FYI A;  2P34 A;  1QWR A;  4ASL A;  1K5M C;  3BTZ A;  4XAA A;  3WVJ A;  2VBP A;  1N47 A;  4UT5 A;  2XVG A;  1GYK A;  4FBF A;  2W47 A;  3MIC A;  5FO8 B;  2PHR A;  5H9S A;  5IYY A;  3AP9 A;  1W9W A;  4PBO A;  4NRQ A;  4LIV A;  1NCR A;  3I3M A;  1JI6 A;  1PGL 1;  1NXM A;  4PJY A;  5J48 A;  1OH4 A;  4WVV A;  3VBS B;  5FZO B;  2ZML A;  4L92 A;  5ACA 1;  4BQ2 A;  1F5J A;  1SCR A;  4MGQ A;  5CBL A;  4OI0 A;  2DUQ A;  1HQL A;  4UWD A;  1XQN A;  3VZK A;  4NVP A;  2UY9 A;  4QT6 A;  3K48 A;  2RR1 3;  3AP4 A;  2V72 A;  1S2K A;  4DRV A;  1VBB 3;  2W68 A;  5L19 A;  2NPI A;  5KC6 A;  2HWC 3;  4V1P A;  1TNR A;  1V6I A;  1UZ0 A;  5J98 B;  5CIS A;  1W2U A;  3PVN A;  2Y0O A;  2JEN A;  2YXS A;  4LHL A;  3SH4 A;  5FXZ A;  1QJY 2;  2BFU L;  3FBY A;  4A44 A;  1IZ3 A;  2HLE A;  3NJX A;  2AYH A;  3MIH A;  4YFW A;  5F5I A;  3Q8E A;  2ZHK A;  3WHU A;  4NHY A;  5FMB A;  1TQ5 A;  4R9B A;  4CPB D;  1SHW B;  2VZP A;  4XHX A;  4CCD A;  4JDO A;  1O4T A;  2P6H A;  4OUE A;  3OBT A;  1HRV 3;  2XHN A;  4O61 A;  1W6M A;  2GMM A;  4YSF A;  2VZQ A;  2KXL A;  1LHU A;  2DVB A;  2A1X A;  2UYB A;  1ULG A;  5FUP A;  1RUN A;  1GAN A;  5A80 A;  1WMX A;  2CSG A;  5T5O A;  3LB9 A;  3NAP B;  5DAV A;  4A3Z A;  1OUS A;  2FHR A;  3WXP A;  1SQ4 A;  5FZB A;  1DQ5 A;  2AZ5 A;  4ZU4 A;  1FPN 1;  4B8E A;  5C3O A;  1JOB A;  2RVA A;  1WLC A;  4PLO A;  5GLZ A;  3BAL A;  4CEY C;  1XOY A;  4XDP A;  3LIG A;  5KC5 A;  1QJU 2;  4P5H A;  1H8V A;  5FP3 A;  2X09 A;  2PHX A;  5JMO A;  4MSV A;  1DYP A;  4BWO A;  3FHI B;  2DVG A;  1ALY A;  1GNZ A;  1U5I A;  4P14 A;  3IDB B;  2JXA A;  4RR3 A;  2XHK A;  1C28 A;  1LOC A;  5EFU A;  1RL3 A;  3CIH A;  3HQX A;  5IW0 A;  5I8T A;  4AOC A;  1K3I A;  2VO5 A;  1RXG A;  4H2A A;  4NPM A;  1I5P A;  4Y3O A;  3GNE A;  4UW4 A;  1SDD B;  4G3Y C;  1BMV 2;  4F83 A;  2PLV 1;  1W39 A;  4E8D A;  1V6J A;  3SKV A;  1ND2 A;  2CAV A;  1D0G A;  3SCH A;  5K7P A;  1E5I A;  2EXK A;  5I8S A;  1AL2 1;  2WO7 A;  4XFI A;  1YQ2 A;  4N90 A;  1AR7 1;  2J7M A;  3LCP A;  4LIU A;  1J3P A;  3VN4 A;  2BP6 A;  2CV6 A;  4SLI A;  3ZSL A;  3T4H B;  2OQ7 A;  2ZGO A;  3S6P A;  2XML A;  2RDR A;  1ZNP A;  4R4Z A;  3MO4 A;  2OW4 A;  3AYD A;  3TB0 A;  4LQR A;  3HT1 A;  4F7Z A;  2EVX A;  1IKP A;  4WVZ A;  4LBQ A;  1OFN A;  4Z92 B;  4HFS A;  2MEV 1;  1TME 2;  1ZZB A;  3JD7 2;  1HKD A;  5CKQ A;  2ZBJ A;  4AK3 A;  4MXV A;  1H2K A;  2XLG A;  4JGZ C;  3FC0 A;  1QJX 1;  1FYU A;  3AFG A;  1J58 A;  1MS4 A;  4LMF A;  5FY1 A;  3H3Z A;  5T55 A;  3SH5 A;  2C24 A;  4P9I A;  3U10 A;  2ZAH A;  1F8V A;  5DQ0 A;  4AVA A;  1V6O A;  1UO9 A;  1GZW A;  5A6Q A;  3SEE A;  4UI9 L;  2DCT A;  2HWB 1;  5A3M A;  2X5I C;  1EV1 2;  4B3N A;  3NJY A;  1KS5 A;  4N53 C;  4JTO A;  4PI2 A;  4XDQ A;  2Y6K A;  4MG2 A;  4NRP A;  3TEX A;  1IG3 A;  2V5Y A;  1OLM A;  2XWB B;  3WW3 A;  4YFZ A;  3FHA A;  4OUM A;  3A0N A;  3NL1 A;  1KFU L;  2HWE 3;  1SFN A;  4IEQ A;  2GND A;  5FZF A;  4NR1 A;  4Q0U A;  4MO3 M;  3VBO A;  4ZON A;  2FMD A;  2G4I A;  2SBA A;  3LSE A;  1FAT A;  4LO8 A;  5FRE A;  2XJV A;  4NIH A;  4RGG A;  1VIW B;  3CU7 A;  2A7A A;  5A3L A;  3V56 A;  2VY0 A;  2R6Q A;  3E5U A;  1Z78 A;  1GZ9 A;  2OQ6 A;  3NST A;  4TXW A;  4MX3 A;  1CJP A;  1VAK A;  5T50 A;  1K5M B;  3L2H A;  3PUI A;  3ZIW A;  2CHH A;  2IXH A;  3PLQ A;  2Q8D A;  4Y5T A;  3BOP A;  5E8A A;  1QJE A;  2LW8 A;  2YU1 A;  3C3V A;  3PJQ A;  4BK4 A;  5JR2 A;  2P2K A;  2JEC A;  3KV5 A;  2BQP A;  3EMR A;  1VBC 1;  5KXC A;  4JDN A;  3RZK A;  4LO7 A;  2EIE A;  5A3W A;  1ZX5 A;  5FQ0 A;  3CMG A;  4YVW C;  1W6Q B;  2AAC A;  3III A;  2NP0 A;  1BLZ A;  4IE6 A;  2NMN A;  4CU6 A;  1E5H A;  4LUL A;  4YM2 A;  5FWE A;  4COW A;  4IQP A;  3WOG A;  2XGX A;  3E1F 1;  4AED C;  1CAV B;  4N9H A;  4OYU A;  5F2S A;  1EPZ A;  1SZB A;  4HOO A;  1LGB A;  1UXZ A;  2WFP A;  4QX8 A;  3WZ1 A;  3B7M A;  4XEZ A;  5IT6 A;  1NA1 A;  1TNF A;  3PJY A;  4UFI A;  4DEQ A;  2QCS B;  1Y9M A;  3PUA A;  2IFR A;  4CXY A;  4MYE A;  5G05 L;  3ENR A;  2LUW A;  4TLG A;  4DY3 A;  5F37 A;  2B9V A;  3ILF A;  4GH4 A;  4PQQ A;  5L9R A;  3ZKU A;  4JTN A;  4D94 A;  4M00 A;  3WG2 A;  4Q1P A;  2GNB A;  2D5F A;  4PLN A;  3GYD A;  1AX0 A;  4H7M A;  4JCK A;  5KHG A;  4ASM B;  2JDH A;  4YW1 A;  4LHS A;  4YLZ A;  5KWR A;  1W90 A;  4UAP A;  3FJS A;  5LBC A;  1F4A A;  5L73 A;  3U07 A;  1OMI A;  1XSQ A;  3AMM A;  3VB9 A;  1CQ9 A;  4CUC A;  1QNY A;  3I4I A;  1HXS 2;  4IGO A;  4AG4 A;  1W3X A;  1S0B A;  4YW7 A;  1LGN A;  1QJY 3;  1ZZ7 A;  5LRR A;  5GLW A;  4YM1 A;  1RHI 1;  3AYC A;  2XBO 1;  4AZZ A;  3N7M A;  2VBB A;  3T0B A;  4EV0 A;  2RM2 1;  2A3W A;  4UBG A;  4TN7 A;  4XFC A;  4YWA A;  1UYZ A;  1AYM 2;  2J42 A;  4M3C B;  5BY5 A;  3KV4 A;  4QPI A;  2FDI A;  4XF3 A;  2WN2 A;  3HAG A;  4GUL A;  4KI5 M;  1US3 A;  4G9S B;  4P9W A;  3OD4 A;  2A3Y A;  4X6R B;  1RMU 1;  4CEY B;  2VOT A;  1LRH A;  4KMQ A;  4FPK A;  3I3Q A;  1APN A;  3OGG A;  1V6K A;  4XZU G;  2BTV C;  4W6Y A;  1OKQ A;  2WDB A;  4PLM A;  1RUJ 1;  5CVR A;  3U75 A;  3ZMN A;  1OA3 A;  4AQ2 A;  2QQP A;  3OEA A;  4I0W B;  3ZO0 B;  4LBO A;  4FSJ A;  2BEO A;  3MID A;  2H0V A;  2JE8 A;  3MFC A;  1DDL A;  3IMN A;  4XBL A;  3JZV A;  1UY0 A;  1YNA A;  5LW9 A;  1OI6 A;  3TNP B;  1QJU 3;  3TRS B;  4BCU A;  2J22 A;  5JSO A;  3W58 A;  2P5B A;  3MV0 1;  5FZ0 A;  4LHN A;  2XLA A;  2YFU A;  3ACF A;  2QQI A;  3ELN A;  4Q0S A;  2BW8 A;  4XMI A;  3VHP A;  4BH9 A;  5IHR A;  3K75 B;  2PN5 A;  3FBM A;  1BBT 2;  4NRM A;  4YGE A;  3ZXE A;  3AMP A;  1V6N A;  1PIV 2;  5JI9 A;  2CGO A;  2LTN A;  4ES9 A;  3PNA A;  4PDW C;  4GAZ A;  4JZR A;  3O12 A;  2R1B A;  1C1F A;  1W03 A;  2ZS6 B;  4QHO A;  4LT5 A;  2ARX A;  3H42 B;  3SKJ E;  2PHD A;  4QB1 A;  5I0R A;  1SG3 A;  4CDU C;  4S2D A;  2O0O A;  1V9U 1;  1UL9 A;  3O14 A;  1NCQ A;  1UF2 C;  4FP3 A;  4DIQ A;  2CNA A;  2JIJ A;  4NII A;  3V0B B;  3RWK X;  3TN9 2;  1UIK A;  2RHP A;  4XDO A;  4XUT A;  4Y1Y A;  5FY0 A;  3UKT A;  4FFF A;  1AF9 A;  5CU1 A;  3ST7 A;  5L9V A;  2WSV A;  3BOD A;  4DPN A;  3EO6 A;  5K0U B;  4MGS A;  5DZG A;  4Z07 A;  1JZ8 A;  4HPK A;  4CP0 A;  3F95 A;  2WNV A;  4AEJ A;  3N4M A;  2JX9 A;  2R32 A;  2X10 A;  2EF6 A;  4U2A A;  2ZAB A;  2DBI A;  2QQO A;  3UGG A;  1KDK A;  1OLM E;  3DPR C;  2X5I B;  1D0H A;  1TME 3;  3JD7 3;  2BU9 A;  4OZX A;  4ATF A;  4NID A;  3VKF C;  2Y6G A;  4NRO A;  2PA7 A;  2DU0 A;  4N53 B;  4RFR B;  1VAM A;  1FV2 A;  3ZLI A;  5A6Z A;  4AEK A;  5EWS A;  5FYM A;  3OY8 B;  1HDK A;  5FY9 A;  3KGL A;  3WDV A;  1IPK A;  1VJ2 A;  5A3P A;  3HNB M;  2ZEZ A;  2DU1 A;  2DUO A;  4AFC A;  1W8Z A;  2R06 2;  1DQ1 A;  1Y7B A;  3KCX A;  4BXF A;  1Q8Q A;  2W2I A;  4EJR A;  1JU3 A;  2A6Z A;  1POV 3;  2VUL A;  5B4N A;  1A8D A;  2D6P A;  3LDR A;  2VNO A;  4KNC A;  1BEV 1;  3U11 A;  3AK0 A;  4XBQ A;  1IQA A;  3MW2 A;  4CP9 A;  1S0C A;  1WMF A;  2JG9 C;  1JU4 A;  3VZJ A;  1RUE 1;  3RFR A;  4B1L A;  1ZYB A;  3B00 A;  4IE4 A;  5FZM A;  5FZ7 A;  3ME2 A;  4PF5 A;  3OUJ A;  3ZYF A;  5IVY A;  4BME A;  3T1L A;  3AKS A;  5LCW L;  3BU7 A;  2VCB A;  1AXY A;  4Q4Y 2;  1XXN A;  1NKG A;  1SMV A;  4HBN A;  1U5Y A;  4YVW B;  1CPN A;  4AAP A;  2WYF A;  1QU0 A;  1STM A;  3OBZ A;  1TMF 2;  5M0T A;  1CAW A;  1JMU B;  2P1B A;  3DYM A;  4AVT A;  2ZX3 A;  4BPZ A;  4AED B;  1DBN A;  3KF5 A;  3SMH A;  4D0Q A;  3WQ7 A;  2Y6H A;  3T09 A;  2WUH A;  5A7Q A;  2BGO A;  3HVD A;  5EQU A;  2WO2 A;  3LEG A;  4D8M A;  1J1L A;  1LJ7 A;  3ZSJ A;  5A1A A;  2AH2 A;  4BQ4 A;  2BRT A;  2YY1 A;  3I3E A;  4KQ7 A;  2R07 2;  4XF0 A;  1G8W A;  5IWF A;  2GP5 A;  4KL1 A;  1RUH 1;  1WGP A;  3K77 A;  3OSD A;  1PM7 A;  4N7U A;  2B7Y A;  2D5H A;  4UF0 B;  1YEW A;  4DEV A;  1H8T A;  3WF4 A;  4QD2 A;  1Q8P A;  3AMQ A;  5HBA A;  1IPS A;  1VRH 2;  5BNN A;  1PO2 1;  3KV9 A;  3OTF A;  1RUC 2;  2CWS A;  2ZX0 A;  3N9M A;  3A23 A;  4WM8 A;  5FXX A;  1OQ1 A;  1DGR A;  2UU8 A;  4IXL A;  4YW2 A;  4WM7 C;  1LED A;  3ES4 A;  3INA A;  4K1Y A;  1FI2 A;  4OHV A;  5JXG A;  4AL9 A;  2F6B A;  3AXD A;  4RQP A;  5JSR A;  4C90 A;  5C71 A;  1ND3 B;  1OF3 A;  1PVC 1;  2UY8 A;  4YVS A;  5EPA A;  4DIN B;  4IV3 A;  1G9A A;  5T3N A;  4JHZ A;  4HMZ A;  2VUD A;  1PGL 2;  3LOI A;  3UKN A;  4YNI A;  1GOF A;  2YB7 A;  5ACA 2;  1HXS 3;  3GBG A;  1PNF A;  1NZI A;  3NKG A;  2VZO A;  4LR4 A;  1G9C A;  2AEN A;  1RIT A;  1QF3 A;  2VCM A;  1W9S A;  1I6X A;  1MPX A;  2VPV A;  4AI2 A;  4CP1 A;  2I74 A;  1C3H A;  2Z4F A;  3C7O A;  3SHR A;  4KGQ A;  3CF6 E;  4PCR A;  1NUK A;  1QNW A;  1AYM 3;  2FCV A;  2VZU A;  4R9A A;  4A6S A;  5J96 B;  2ARC A;  2A6W A;  2ZHN A;  5IVE A;  2NZ9 A;  4WV8 A;  1O3R A;  1ZZ6 A;  1JYI A;  1LU1 A;  2PAM A;  2QUO A;  1WCS A;  5D21 A;  2OS2 A;  1PZ9 A;  4MOA A;  4Q4W 1;  4RSU A;  3BKZ A;  2W52 A;  3DEC A;  4LE3 A;  4DS0 A;  1WBL A;  5IVJ A;  3SXW A;  2HWD 3;  4MUV A;  1YJL A;  2PHW A;  1LUL A;  4W65 A;  1OBN A;  1OKO A;  1VBA 1;  4LO4 B;  5IK7 A;  1H1A A;  1SLA A;  1ULC A;  2UYA A;  4SBV A;  1T6G C;  4LBM A;  4QPW A;  5HCB A;  1DFQ A;  4DOU A;  2YPD A;  5J09 A;  4PDW B;  2IXJ A;  4ES8 A;  2WJS A;  2P4E A;  1CWP A;  4NOT A;  3BB6 A;  2IXI A;  2OYZ A;  5A7W B;  5FLI A;  3HWJ A;  3ZSE A;  3FLP A;  1VBD 1;  1LHV A;  1AL0 G;  4CDU B;  1JZ7 A;  4AVB A;  1F4H A;  2JE9 A;  4BQW A;  5EIY B;  1BBT 3;  1O5L A;  1FPN 2;  4XFB A;  3QOP A;  1C1L A;  4ISQ A;  3HN1 A;  4C1X A;  5FP8 A;  5ABJ C;  1PIV 3;  2OKX A;  4B4P A;  3VBR A;  1DU3 D;  1W9Y A;  3M3C A;  4CUG A;  4CTE A;  1MZ6 A;  1S2E A;  1R09 1;  2OUH A;  2ADD A;  2VE1 A;  1S2B A;  2OPW A;  1VLN A;  2DTY A;  1TE1 B;  2IXC A;  1RED A;  4XVH A;  1URX A;  5EJZ B;  2FZ2 A;  2FDG A;  3RQ0 A;  2HWD 1;  3TN9 3;  5IFP A;  3DPR B;  4FP2 A;  4Q4X 1;  3FL7 A;  3TAY A;  1UY3 A;  2EIG A;  3OG2 A;  3FLR A;  1MS8 A;  1GSL A;  2PLV 2;  2WA3 A;  4GD4 A;  3USU A;  2ZX1 A;  2A73 B;  2QQL A;  2RJL A;  2Y38 A;  3B69 A;  3LEI A;  3ZXF A;  3VDA A;  1F2N A;  3I7D A;  3LQC A;  4CCJ A;  5FPX A;  1QY4 A;  4CCN A;  4DXT A;  1CIW A;  1RIN A;  1AR7 2;  4O9G A;  3BTY A;  4NAM A;  2B9U A;  4K9S A;  1AHS A;  3U14 A;  2XON A;  1X50 A;  2B42 B;  3ETP A;  1UOJ A;  4OCT A;  3PIG A;  3CO2 A;  1S0I A;  3BCW A;  2IVJ A;  5JUV A;  2G19 A;  3WP3 A;  2HKX A;  3MPP G;  3FUO A; 
#chains in the Genus database with same CATH homology
 4QKD A;  4NIH A;  3RZJ A;  4QHO A;  4JHT A;  3RZM A;  4O61 A;  4IE5 A;  4NII A;  3RZK A;  4ZHN A;  3KHB A;  4IE7 A;  3RZL A;  3BTX A;  4IE6 A;  4IDZ A;  3I49 A;  3S5A A;  4QKB A;  3O1M A;  4NID A;  4ZS2 A;  3BU0 A;  4NRO A;  3BKZ A;  3I2O A;  3BI3 A;  4RFR B;  4CXY A;  2FDF A;  3O1O A;  3H8O A;  5F8P A;  5DAB A;  3O1R A;  3O1T A;  4IE0 A;  4ZS3 A;  4NPM A;  4O7X A;  2FDK A;  4QKN A;  2IUW A;  3RZH A;  4CXW A;  3O1V A;  3H8R A;  4QKF A;  4IE4 A;  3T4H B;  3H8X A;  4NJ4 A;  3BTZ A;  3T3Y A;  2FDI A;  2FDJ A;  4NPL A;  3LFM A;  2FDG A;  4NRQ A;  2FDH A;  3O1S A;  3I3M A;  3I3Q A;  3O1U A;  2FD8 A;  3BIE A;  4CXX A;  3O1P A;  4NIG A;  3KHC A;  3T4V A;  3BTY A;  4MG2 A;  4NRP A;  4NRM A;  4MGT A;  4OCT A;  3RZG A;  3S57 A;  3BUC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...