3O1RA

Iron-catalyzed oxidation intermediates captured in a dna repair dioxygenase
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
202
structure length
202
Chain Sequence
EPLAAGAVILRRFAFNAAEQLIRDINDVASQSPFRQMVTPGGYTMSVAMTNCGHLGWTTHRQGYLYSPIDPQTNKPWPAMPQSFHNLCQRAATAAGYPDFQPDACLINRYAPGAKLCLHQDKDEPDLRAPIVSVSLGLPAIFQFGGLKRNDPLKRLLLEHGDVVVWGGESRLFYHGIQPLKAGFHPLTIDCRYNLTFRQAGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Iron-catalysed oxidation intermediates captured in a DNA repair dioxygenase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
molecule keywords Alpha-ketoglutarate-dependent dioxygenase AlkB
total genus 47
structure length 202
sequence length 202
ec nomenclature ec 1.14.11.33: DNA oxidative demethylase.
pdb deposition date 2010-07-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.590 Mainly Beta Sandwich Jelly Rolls Alpha-ketoglutarate-dependent dioxygenase AlkB-like 3o1rA00
4IE4A 4IE7A 3T4HB 3BIEA 3I3QA 4NIHA 4QHOA 4ZS3A 3O1OA 2FD8A 4MGTA 4NRQA 3T3YA 3I2OA 3RZKA 4NROA 4QKDA 3O1PA 2FDJA 4OCTA 2FDGA 4ZS2A 3O1TA 3BI3A 2FDHA 4IE6A 3H8RA 4IE0A 2FDFA 4QKBA 3BTXA 3KHCA 4O61A 3H8XA 4CXWA 4CXYA 3O1MA 3RZJA 4NRMA 3I49A 3O1UA 4RFRB 4QKFA 3BKZA 3RZHA 3RZLA 2FDIA 4CXXA 3BUCA 3LFMA 3H8OA 3RZGA 3S5AA 3O1RA 4NPLA 4NPMA 4NRPA 3O1VA 3BTYA 4NIIA 3S57A 4ZHNA 4QKNA 2IUWA 3KHBA 2FDKA 4NIGA 4NJ4A 4O7XA 4IE5A 4JHTA 3RZMA 4MG2A 5F8PA 3T4VA 4IDZA 5DABA 3BTZA 3I3MA 3BU0A 3O1SA 4NIDA
chains in the Genus database with same CATH superfamily
1B35C 3GZEA 3D0SA 3MIGA 2DTYA 3IWZA 4GXLA 1BVP1 1ZBE3 2UURA 3PVNA 4AGRA 2VNGA 3U4SA 3IIAA 4HPKA 2DU1A 4XABA 1BCXA 1ENQA 1HKDA 2QZ3A 4NN0A 1TME3 5E8AA 3ES4A 3LA2A 5FZHA 2VQUA 1NLRA 3URFA 2RR13 4Q4W3 1YIPA 4P00B 3KV5A 4RR3B 4MV2A 4OQ9A 1HXS3 2I74A 3FBYA 2VGDA 1XQNA 1LNSA 1TMF2 3RYRA 2JE7A 2VQ0A 1V9U1 2O8OA 4GB31 5CFCB 3H7JA 2WWJA 3OPZA 4WVMB 1LU1A 1UQXA 4A42A 3RFRA 3KB5A 2BU9A 5ABJA 1JUIA 1TNRA 4YRDA 4YNIA 4JGZC 3ZSKA 3KCXA 3C7GA 3UGFA 1VAMA 2WINB 2Y6LA 4Q1PA 3GCXA 3CQOA 4HLTA 2OQ6A 5FJHA 3SH3A 4CDXB 2QDNA 4YZ5A 1S2KA 1W28A 2YBSA 4XMIA 3RJRA 2P6CA 2BBAA 5D21A 3ZPYA 1YYNA 5DAXA 5L7OA 4TN7A 3RYKA 5IAVA 3AKTA 5A6QA 2JG9A 1UKGA 3DPRB 4LIVA 2RJLA 1VIWB 5IVEA 3SEPA 1IPKA 5ANNA 5FLJA 4K1ZA 2Y0OA 4Y1YA 2D98A 3J8F1 3BYWA 5LY2A 4B4RA 3RRDA 2ZJCA 1DGLA 3VBUC 4GWMA 3DYOA 2ZXQA 4IEXA 2X05A 1PGL2 2RS11 4MHRA 1GNHA 4XILA 5ANQA 1PO11 2DVFA 2E33A 4C1WA 2FDGA 1K42A 1YJKA 3GBGA 1O8SA 5DZGA 4WM7C 5FIXA 4META 3IDAA 4Q26A 3M4FA 1FV3A 3ELNA 1BKZA 2HWB3 2VMEA 2XLFA 2Z79A 5CB7A 1LAJA 4AHZA 3DECA 4Q5OA 1NA1A 4MUVA 5BNOA 3LOIA 1UY4A 1LCLA 1COV2 5FWEA 3KV4A 5BNNA 3D3AA 1TQ5A 4XAAA 4EJRA 5HBAA 4MYEA 4FPYA 1HQLA 2YV8A 4JZRA 2D3SA 2VZOA 1NQDA 4YVWA 2XR4A 4TZDA 1UW8A 4IEPA 3EXUA 5HV4A 1AR63 1DQ5A 1DQ0A 1PX3A 1UKRA 1H2LA 1UZ0A 2ZX0A 3B9IA 4XUTA 1AUYA 5K0UB 3JQXA 3OUJA 5IVJA 1E5SA 5FPAA 4Q0VA 2B9VA 2CNAA 3OY8A 5A32B 3BU7A 5BNPC 2B42B 1SACA 5EQUA 5AFEA 3MPPG 4CXYA 3GNEA 2G9ZA 3N4MA 2OX0A 2XHNA 3KQ4B 3R05A 3E6CC 4J1XA 2ZGNA 4I0BA 5JLVA 3KT7A 2QE3A 3AZWA 5FXWA 3TOJA 2WLPA 5ERLA 1NCQA 1UMHA 5K7PA 1DZTA 4CDQC 1VRH2 2A3XA 1UOFA 2PN5A 4XQ4A 4W6XA 1R64A 2VBDA 4XF3A 3LOBA 5F2SA 1UAIA 1VBC2 2E32A 2RMU1 3DN7A 4OHXA 1FV2A 3RNSA 3LA3A 1MACA 1W05A 4SLIA 4LA3A 5DN2A 3UETA 4Q0UA 3VD9A 4M0HA 4CUAA 5C8CC 2IC1A 1YUDA 1RTVA 3K4DA 3FLRA 4CUGA 3AKQA 5FYHA 1PVXA 3JBG2 3OPWA 1J1TA 1HRV3 5FP7A 5FY0A 2JDZA 4Y1VA 4LHLA 4AQTA 2YGMA 4AFCA 1ND2C 1WUVA 1MZ6A 1W6OB 2SBAA 2VCMA 4P9LA 4WV8A 4LTAA 3KZ4C 3U78A 1A3KA 2VOWA 2X53S 3MICA 3M3IA 1W6NB 4MOAA 3UGGA 4LOTA 5KXEA 5IVFA 1VBE3 2BBVA 2HWD2 5F3EA 2PAEA 4YPJA 4OUMA 3ZIWA 4DS0A 3LDKA 3PUQA 3RG0A 4QX2A 5FYUA 2D5FA 3DGTA 4QX1A 2RDQA 1REFA 2QQMA 3LE0A 1U12A 4GWIA 3POEA 3A23A 3K51A 2XB6C 3WT3A 2AYHA 2DFBA 1WCDJ 1OSGA 2GNBA 3AL5A 4QGMA 4AL9A 1BLZA 3ASIA 4FPKA 1GWMA 2JD4A 3J9SA 4K20A 1APNA 3OCPA 1JMUB 3QOPA 1KITA 2D40A 2E53A 5AC91 1BXHA 4MLOA 5FY9A 2B45X 1S4CA 3AXDA 2D6OX 2PHLA 4UI9L 3ZFGB 3IB3A 5E1RA 1RUC2 4HVQA 4W4ZA 1VRBA 2W39A 1BBT3 2ATFA 2DBNA 1EAH3 3J7LA 2XL7A 1PGW2 2GAUA 3VL8A 3P1IA 2C4XA 2XKOA 1DQ6A 4NO4A 4QHOA 3LPGA 4ARYA 3RZKA 2HWE1 4I2OA 1O5LA 4NWWA 3K3NA 4GKXA 2WFF2 1JTZX 3QACA 1CX4A 1UYPA 2VJXA 5AVAA 5FZCA 1F9KA 2ZGLA 2EAKA 4K8FA 1UXZA 4DPNA 1JZ5A 1XC6A 1S2EA 1GOGA 4PBOA 5LBFA 1V6MA 4XZUG 4MGQA 4YVSA 3TN91 5C6CA 1POV1 2CDPA 5FOBB 1SQ4A 2DFCA 1PX4A 2P1BA 3ZFEB 1QNYA 4TTGA 4WM8C 1GICA 1OHFA 1MS0A 1I9RA 2HWF3 4KWJA 1AR62 5LA9A 2PHXA 1COV3 3Q8AA 4KBZA 1O3SA 1JYTA 4JGZA 3AJYA 3USUA 2BWCA 1LOBA 4LK6A 3IDBB 1H0BA 2VY0A 3MW4A 1C4RA 4YFWA 3ITQA 3VBOC 2B46X 2ZKLA 3ACIA 1UD1A 3GALA 3KVBA 4QPGB 5I8YA 4FT8A 5F9TA 4RS5A 4JTOA 3HT1A 5JMOA 4BJ0A 3GHNA 2XXZA 3GM8A 3OSDA 1EAH2 3J7HA 4HANA 3LDBA 1VBC3 2WNUA 3H42B 2XQRA 2AACA 2H6CA 4H2AA 4RFT0 5CZKA 5FUNA 1EPZA 3FHIB 4IEUA 4UAPA 3VGIA 5BY5A 1TEIA 1ZZ7A 2GH8A 5I91A 1JOJA 2QVSB 1W06A 3PTYA 1WCSA 1HJFA 3RMYA 4ASLA 4DQAA 1UY3A 2Y6HA 4X6QB 1QXPA 1HQNA 3KWVA 4Q0SA 4EN7B 4PJYA 5IYYA 4BXFA 3WQ0A 4XF4A 2DU0A 1LGNA 2RJ2A 4MXVA 5C4WC 3DKQA 4LBNA 4Q0QA 3GZTB 3MFAA 1O7FA 3NJXA 3ZYJB 5A1AA 3K48A 2BVVA 5KHHA 1JHNA 3BOWA 2WT1A 4S2HA 5L9RA 5JZGB 1NA1C 2HWD3 4AHWA 3O1UA 3AC0A 1AL22 3OY8B 1WMDA 2W52A 4UYBA 1R093 1Z7S3 4DNYA 5A3WA 3GBWA 1L3JA 1VBA1 4FFGA 1K5MC 3AP4A 2WSVA 2VOXA 4QX8A 2W5FA 1ZREA 2O0OA 1C5HA 1VBA2 4XACA 3ZXAC 3WNNA 3ZFFB 2JENA 2Y38A 2XHKA 3A7QA 4HVRA 5JIAA 3EQEA 4A3XA 4A6SA 2FBEA 4Y33A 1R091 1TNFA 1Z7S1 2I45A 4BCUA 4LOSA 1KFUL 3WNKA 2ET7A 5C70A 1QU0A 5BNPA 4I0AA 4A7YA 2XPJA 1MQTC 3ZYRA 3K75B 2FHRA 4YLZA 5JI9A 1N3OA 3H1WA 1JYWA 1EPWA 4LBQA 3FJSA 2FDIA 1EP0A 2D6LX 3AMPA 5EPAA 4LA2A 4W65A 4CDQA 5A3LA 3BTYA 3MV11 1BZWA 2EIGA 2K2SA 3LGRA 4NHKA 3PVBB 3PMSA 3Q8EA 1V00A 4RR3A 5CVRA 4YG3A 1SPPB 1Y4WA 3LIHA 3PJYA 1W6NA 2IXLA 2VUCA 1UMIA 1ZZ9A 1LODA 1GWLA 1ULEA 2PHRA 3NNMA 4LIUA 5CYYA 1RHI2 4QPWA 2D6PA 2FDFA 2OUJA 2PHFA 3VZKA 2PFWA 2C9KA 4H55A 2Y6KA 4YWAA 4B4QA 2W92A 2WUHA 1WA6X 4FFFA 4NHXA 4R4XA 1O4ZA 5D8AC 5AVPA 2HEYF 3VZOA 5DZFA 4BWOA 4QX3A 3KHBA 3SCHA 4TLFA 5L7OB 4JHTA 5LEKA 5G05L 2XQXA 4G9SB 1UYXA 1RUE2 5FY1A 1O8PA 1AR61 1JYXA 1QJY2 4IE7A 2JIJA 2WRAA 4DMIA 1MVQA 4XBQA 2RMU2 5APAA 3FN9A 5FYBA 2WFF1 2VUAA 1Q8PA 1A34A 2C9AA 4FPEA 4YARA 4QHZA 1NX9A 2VPVA 4ZY9A 1RUC3 5CEHA 3KHCA 2XGXA 3VKNA 5LA2A 3GXUA 4XCAA 1OOPC 4EN9B 1I1EA 1OBNA 3APBA 3J4UH 4XFFA 5A7QA 4NAMA 1W8WA 2IZWA 1RGSA 2D6NA 4AW7A 1AXYA 1JOBA 4LK7A 2VMCA 3ROUA 1E5HA 4BOWA 3ACGA 2PXJA 1GZWB 2W46A 2OT7A 1PO13 1NLQA 3Q9OA 4JTNA 1B35B 5CU1A 2WJSA 3HMYA 3VBFB 4B7KA 5FZDA 4R9DA 3ZXFA 5CISA 1MS3A 1G7YA 2JWPA 4L99A 4O9EA 1YIFA 4JGYB 3BOPA 4MXWB 1U0AA 5DUWA 2A1XA 3VDDB 2VULA 3PUIA 3VBHC 1CQ9A 4ASKA 1IPJA 2BW8A 3ZN6B 4G3YC 3THTA 1CAXB 1JW6A 3OF1A 2YFUA 4YGCA 4QPIB 4CEYC 3AMQA 4YVSC 3NNLA 2VOVA 3WZ1A 4FXKB 2D6KA 4XDPA 2P3KA 1VJ2A 4HBNA 2VMGA 4JC1A 4OZOA 4BLJA 4NVPA 3H8OA 2VZVA 1A78A 2W9XA 4XF9A 4XURA 3USSA 4DXTA 2IFWA 2ZGMA 1F5JA 4YGBA 1RJ8A 1ND3A 3UYJA 5BNQA 3W9AA 5IVCA 1CZSA 5F3CA 2NLRA 1PMIA 2YU1A 5GLVA 2VW0A 1JYVA 2ZEYA 2Q8OA 5CIRA 3AYCA 3M8LA 4RS5C 4LUKA 2QQIA 4NHYA 1G9DA 2Z4FA 2GMMA 5CKQA 4XJAA 4OI1A 5A80A 1UIJA 3L2HA 2WNUC 4CP9A 1G9CA 1IQDC 5JR2A 2XBO3 1QH6A 2R042 4DB5A 4QKFA 4YW5A 2ZMNA 2UU8A 2IWGB 3NV3A 5C9AB 1YFYA 3IPVA 1UX7A 1RUG3 2OS2A 3LFIA 1AR71 3LEGA 3Q8FA 4CEWA 4LULA 4OULA 1RUF2 4X6RB 5FBJA 4D6SA 1SLIA 4D94A 5FPUA 2QQOA 1DP0A 5I0RA 2R0HA 5A7WB 4LORA 1ULOA 1OPMA 1QJY3 3VHPA 4DEQA 5FXVA 2LTNA 1H9PA 1PIV1 1S0CA 3POSA 5J98B 1ASJ3 2VU9A 1Y9GA 2B8MA 2WFPA 4Z2AA 2JICA 2A3WA 2ILMA 2XVGA 2W0XA 2J1TA 5FYZA 2OKXA 2VVDA 3AK0A 4QKBA 1XSQA 2QTWB 2OIIA 3JB4C 3K46A 2YGLA 1W0PA 3MBWA 4OHYA 5AC93 3HN3A 2VUJA 3N3HA 2ARCA 1YQ5A 1J3RA 1K5MA 3ME2A 5FCCA 3KMHA 4LBQB 5KHKA 3NV4A 1G9AA 1S2BA 1ULDA 1EV12 4AXOA 2VZ1A 3PUHA 4N43B 1Q56A 1DLCA 1IGOA 2XVLA 2QJVA 2IVJA 1ODNA 1W8ZA 1SPPA 3BIWE 4AHXA 4AOCA 4B29A 4RQPC 1XNKA 2OYZA 5JSOA 2GDFA 4OHZA 3W5MA 1L7QA 5KC5A 1JU3A 4AF9A 2KD7A 3ETQA 3VKLA 2JG9C 2XJRA 1WGPA 3WUDA 1JZ3A 5FMDA 1Q43A 2VBPA 2ZGKA 4HKLA 3RI9A 2P3IA 2ZS6B 4L9BA 1O3QA 3BUCA 1MS9A 1DG6A 1V0AA 3S7EA 4RGGA 4NIIA 3W58A 1PM7A 4TXWA 4KWUA 2RDRA 3SKJE 4M4PA 1H6YA 1AVBA 2IXCA 2WLQA 2VMHA 1LOGA 3BPSA 3G6JB 5A1FA 3UNPA 4V2VA 1SLCA 4XIOA 5FYTA 1ONAA 1CAUA 4LITA 2GC3A 3MDPA 3P5BA 1NZCA 2GNDA 4LBMA 3KM5A 3U4XA 3V0BA 3N9MA 4FP3A 4XEZA 2R49A 3IZOA 2XJTA 3F95A 4AFDA 3NAPA 2NMOA 3EO6A 2YBKA 4YZ2A 4PIYA 4GMP3 4URTA 1TE1B 5FP3A 1F15A 5IK8A 3AFGA 5BNOC 5FLIA 4XYXA 4F8AA 5IVVA 2RMU3 4LHNA 4MGKE 1ZZ8A 3O0XA 3I7DA 4LO4B 4FPGA 4LQRA 4QPYA 4C90A 4QXKA 4YZ3A 2V72A 5F5IA 5GALA 1VBD2 3OGGA 1FMD2 5ACA2 3I3MA 2NYYA 2VMFA 2WIIB 4O9GA 2JIGA 1UWWA 4LBLA 3LIGA 3R4UA 4FAHA 1H8TB 2AEZA 2J7MA 1M06G 2RM23 3KF5A 2ZAHA 3VBFA 1QJU2 2FZ1A 3LSDA 3WNXA 4HT1T 3N35A 1IKQA 1PGSA 1OLME 3WY6A 2OPKA 3I2IA 3C2UA 4I09A 4IGQA 4XAEA 4AVCA 3RPQA 2CWMA 3CJIC 1MS5A 4FVVA 1ZBE2 2W1QA 4NHLA 2WZEA 1Y43B 3O14A 4GB32 1X33A 3KCYA 2PAKA 1WA4A 1CPMA 3A0NA 3WW4A 4GJZA 2P34A 4JKLA 1RUNA 2PQSA 1ST8A 2D3PA 4ATEA 2J1RA 4CYDA 5EXOA 5JSPA 4E8CA 2YROA 1C8NA 2GMPA 3HBZA 2V5YA 3M2MA 2DVGA 3MUY1 5FFOC 5JXIA 2CGPA 4BXSV 4XF0A 4FAGA 3I54A 4MGSA 3CLPA 2ZTNA 4N43A 1PIV2 4FP2A 3SC7X 2W87A 3FC0A 4AGVA 2FDHA 1C1LA 3SISA 2RDSA 2E9QA 4YW3A 1CIYA 1UIKA 1OVPA 1ZA7A 5JAXA 2DVDA 3H50A 2D97A 4ASMB 3OYWB 1AR72 4B8EA 1AF9A 1C5IA 3VD7A 4WVMA 3V56A 1W2AX 4YZ4A 1ND3C 2YG0A 2LALA 2X5IC 4AG4A 1NKGA 3LA7A 4QX5A 2MEV1 5FZAA 1PGL1 3FL7A 2DCZA 3O7OA 4NOTA 4OLLA 5H9QA 4CEWB 2RG4A 2X29A 1PO21 4N53A 1MS8A 4P9WA 1UY2A 1VR3A 5F5QA 1NCRA 5B2GB 3PDQA 5L9VA 5CKNA 3MLKA 1W2UA 1WLWA 2Q0AA 3H8RA 4GA9A 3GHMA 3I3BA 4FQZA 5EWSA 1J83A 1U5YA 1W6QA 5FZ7A 2ZAAA 5F5CA 5LY1A 2MHFA 3ILRA 4KG8A 3AJZA 2ZGOA 4AQ2A 5IK4A 1COV1 1C8M2 4QXBA 4LBJA 3DYMA 2B9UA 4ZU7A 2G19A 2QQVA 3M1HA 1CAVA 1CZTA 3FX3A 5C3QA 5CADA 1UNBA 2RR11 4Q4W1 2W3JA 3D4KA 1IHMA 4LLFA 1HW5A 1FATA 1NQJA 3T0AA 5FZ8A 2BJSA 1R1A1 2Q4SA 1FPN2 5FZOA 3WNLA 1UCXA 2ZGUA 4CUCA 1X8EA 4IUGA 1REDA 4YM0A 3ZLIA 4JRLA 4FBFA 3JU9A 1OA3A 3WF0A 3HJRA 4YW6A 1RUJ3 2HWE3 4CDUB 2KM2A 2LROA 3A22A 4CU9A 5C3SA 3OEBA 4FFIA 2WZPP 5K8SA 1FAYA 2VQAA 3WW2A 2OVUA 1HV0A 2QUOA 1CD3G 4DEVA 2D6MA 3ZXKA 2G9FA 1LOFA 3A0KA 1ZBA1 4B3NA 2X10A 3E6BA 4LE3A 5DMYA 1DQ2A 1RXGA 2PHWA 4Y1UA 4OMDA 2HBUA 4Y1XA 2DUOA 5H9RA 1V6LA 2DCTA 2ZX2A 3HWJA 4IXLA 4RQPA 1X82A 3DUIA 5T5OA 3W5NA 4Y5TA 3T3YA 2JDKA 2WNOA 1CAUB 2YFZA 4QKDA 4SBVA 4AFBA 5T55A 1W6PA 2V5DA 3BCWA 5DUVA 4BQ3A 1OMIA 5L9BA 3EBRA 4E2SA 3JBG3 4FOVA 3V0BB 1VP6A 3U11A 3A4UA 3B93A 5EIYB 1W0NA 2ZOEB 1P8JA 1HX6A 1D2QA 5DDJ3 5FPBA 2A6XA 3SHRA 3RSJA 1ODMA 3N7MA 4LHKA 3B00A 2VE1A 1QGLA 1UX6A 3CF6E 3POBA 3WP6A 3ZXJA 3B5LB 4MG2A 1AR91 4IDZA 1V6IA 1RIRA 3U37A 3ACHA 4HZFA 1RUOA 1XYPA 4LNVA 1FYUA 2XH6A 3E97A 1GR3A 3KVAA 3ZM8A 4XHXA 4G4FA 5A32A 3O1OA 2FD8A 4U36A 4XHBA 5JVVA 5C8CB 3J7MA 5J09A 4MH0E 3CBNA 2ZHMA 1H2NA 1CPNA 2SLIA 5FZEA 1N3PA 2LW8A 3AKSA 1QQP2 1ENXA 2VD7A 4AAPA 3N9PA 1W2OA 2YC0A 3KT1A 4MADA 4IEYA 4JV4A 4QDRA 4E4DX 3FE5A 3NKGA 5L7OC 1QJU3 2Z2SB 1XPWA 5FV3A 1OT5A 1JU4A 5D2AA 4QQLA 3D0JA 1Y3TA 3INAA 4JKKA 2NMNA 5HCAA 4L2NA 1J1LA 1AXZA 3M3OA 1H1AA 2VC9A 3POGA 5A1LA 4H3WA 3I2DA 4XDOA 2W94A 1GZWA 4FFHA 2A3YA 2VNOA 5JPMB 2WKKA 3VBUA 1ULCA 5A3PA 1QXRA 3OOXA 1PNGA 4EWAA 3MUZ1 1RUJ2 5FYVA 4XMAA 4KG0A 1B09A 4M3CB 3POJA 2RV9A 1NLSA 3FWEA 4EN6B 5FZMA 3VBRB 1ZRFA 1AL21 2VUDA 1K3IA 1CVNA 4C8DA 1VRH3 1WLDA 3AYDA 5F7UA 3SITA 3NO8A 2HWB1 4OMCA 1FMD1 1KJLA 4KMQA 4BU2A 1MEC2 2AENA 2Q5TA 1IS5A 3UKVA 4QAWA 2VZUA 4Z8BA 3WCRA 2C26A 1GKBA 2YMZA 1SCSA 3LZZA 3JZVA 3VZNA 2WS91 4EWEA 1LHOA 2OPWA 4QGNA 3ON7A 5G04L 1W8FA 1R092 1Z7S2 4YVSB 2GH2A 4CEYB 1SBEA 1NCRB 3CKHA 5LCWL 2NN8A 4ZPIA 3RI8A 2AH2A 1V6KA 3OGVA 3ZFEC 1OQ1A 4Y22B 3VKFC 5DG2A 1W90A 1CZVA 1LHVA 2BDRA 2X5IA 4P08A 2FQPA 4GMP0 1XBFA 2WC2A 1QMJA 1Z0HA 1KS5A 1RUG1 2ADEA 4L0PA 4P9GA 4XPVA 5F8PA 2HH9A 4BQ5A 4CCDA 1LB2A 3RS6A 1VB2A 2E31A 3ZDVA 3POWA 5IHRA 1FOD1 3RMXA 4ZXEA 4CP1A 4RD7A 1OOPA 5FJKA 1YO8A 1AYN2 2JEMA 4PT6A 1TME2 5DDJ1 1VMJA 4GWNA 5FDBA 3N7JA 1UO9A 2D43A 3MIBA 5C8CA 1D0GA 3JXSA 1G86A 5FK8A 1QJFA 1QQP1 3NAPB 3OUHA 1IS6A 1GFF2 4V1PA 5LZ6A 1F4AA 2CTVA 4OUSA 5H9SA 5FZ1A 1O3TA 2JDPA 1OH3A 4CCLA 1DGWX 5AFBA 4YYOA 2EA7A 1W8NA 2IXIA 1XE7A 4MVTA 3B9CA 1POV3 4HPKB 4QQPA 2R062 5A70A 3VBHA 1OLRA 4GULA 4DUVA 4Z1VA 1HDKA 1PZ8A 4YW7A 3M70A 1N47A 4NRQA 3VKMA 1OURA 2RS33 4GWJA 4YVWC 2UYAA 4XJ8A 2UWAA 2JX9A 3DCQA 2VTFA 1WWYA 1ZA4A 5JZGA 3V0AA 4OUEA 4MZUA 5CNAA 3AZZA 1O4TA 1NY72 3BALA 1NA1B 2YY1A 4DY5A 2NZ9A 2D44A 1QIQA 5FBZA 3VBSA 2GN7A 3WG1A 5LEJA 4CCOA 2QQUA 3CMGA 1SLLA 4QU2A 4NJ4A 1GMMA 2BGCA 3NSTA 4MHUA 2QQPA 2ZX4A 4DZGA 2QQWA 1HIXA 3ZO0B 1XNBA 2KA3A 5FAXA 2EIBA 1FI2A 4AWDA 1LECA 1ULPA 2EIDA 4PCRA 4CE8A 5JOXA 4OI0A 2I07B 2V4VA 3PIGA 2BFUL 4Q4X2 3AMMA 4XBLA 3VLBB 1RHI3 1AR93 4Q4X1 3JCIA 3SLIA 2QBXA 2W08A 4JDMA 1QQP3 5ACA3 1VLNA 1AR82 2HEVF 3MW2A 3BTXA 2EXHA 4FPFA 2Q30A 2XL9A 2WR9A 4DXZA 1TVGA 2ENRA 1R081 2PA7A 2HWF2 5DAPA 2ARXA 4XTMA 4BHPA 1GQHA 2BGOA 4HSJA 1Y9MA 5DG1A 1YQ8A 2FMDA 4YGEA 1IZ3A 4RHV3 5HCHA 3CHXA 1LHUA 1S0BA 2QFEA 2WABA 3M3QA 1YLLA 2PTMA 4FPOB 3WSOA 1GWKA 2D3RA 3VDBA 5FZGA 2GZWA 5F32A 4E2GA 2R32A 4GH4B 3NJVA 1YRZA 3OD4A 4I3PA 2R7EB 4QDSA 3VBUB 3AKPA 1DGWA 4N53B 3RDIA 3HQUA 4AI3A 3H8XA 4H7MA 1WW4A 3BTAA 4YM1A 1O6UA 5EFUA 4EQVA 1JH5A 2XKPA 1LGCA 1LHWA 4NPMA 3WVJA 4PIZA 5F39A 4AI2A 4HKOA 1V9U2 1S0JA 4N7UA 2DTWA 4ES8A 1VBB1 2JXAA 3BTZA 4QD2A 3VN4A 2NP0A 2RS51 1GSLA 1DFQA 3I3QA 4WBBA 1DZQA 2C24A 2P3YA 2G1MA 3VHOA 4CDWC 5D1IA 5FO9B 5CG9A 1LEDA 2C1FA 2VZQA 1BMV2 3UL2A 4FTSA 3JUUA 1XB9A 4R9BA 4K3UA 4P9YA 1JZ6A 2R073 1G6NA 1HRV2 2F4LA 2MEV3 2WN2A 2XWJB 4A6OA 4OHVA 4NRMA 1C3HA 3CJIB 5C5TA 1C28A 1PK6A 2OA2A 4BM8A 1AZDA 3HT2A 3BB6A 3ZXEA 3ZKYA 1IQAA 2RM21 5FTTC 2VQTA 5A7NA 3OYWA 2OW4A 1D4M3 1BYHA 5LB6A 5LA1A 2JKBA 1GOHA 1KDKA 2BWAA 1VAKA 1CONA 5EYXA 2RS53 3FLPA 1KDMA 4XXAA 3IMNA 1PO12 5F5AA 4LT5A 3IN9A 1TG7A 4FPCA 4NROA 3ETPA 2BNOA 1NZIA 1W6OA 4CU7A 1QOSA 3KD4A 5KWRA 2VVFA 1AR83 5M0TA 5I0TA 2JDYA 2PHDA 4Q27A 1XXNA 1OA4A 2WO2A 2HWC1 1QDCA 4LKSA 3O1RA 3KT4A 1ND3B 2GC0A 4XTPA 5EZWA 4BQWA 2UYBA 4DFSA 3T0DA 3ATGA 3THCA 1DYPA 5GZEA 3HD8B 3T4VA 4A2UA 4BQXA 1F31A 4M00A 5FOJB 1GV9A 3W21A 4CCKA 2R6QA 1VALA 3AXEA 2J1AA 1S0GA 3H9AA 3WEZA 1ENSA 3NRUA 4EYUA 5LRRA 2ZZQA 4IV3C 3NKTA 4UFLA 5FYIA 5J3UA 2K9ZA 2WFF3 3CEWA 4GALA 1NT0A 1VAVA 1GZCA 2CAUA 3ZR5A 5JXHA 5ISLA 4Y5SA 4AVTA 2K46A 1CJDA 1NE6A 1JUHA 5FO7B 5FZOB 2YDEA 1UZVA 4U2AA 3IPVB 3KLSA 3I2GA 3RZZA 4F3JA 4IETA 3CL1A 3FMGA 2BOJA 1YQCA 1W6MA 2Y6FA 3I2KA 3K2OA 4KWKA 3SH4A 1U5IA 4NPLA 4AEDB 4P14A 2B7YA 2WZR2 2E26A 4EZHA 2HWF1 1RVF3 5D8AA 5FPVA 1JHJA 1SHWB 2EICA 2VZRA 2WO3A 5IK7A 2H0VA 3P3NA 3JD71 3SCGA 1Z78A 4K21A 1S0IA 2JB8A 3ORJA 4ORFA 2GNMA 1ZRRA 5IK5A 3R4SA 4XETA 4QQOA 4B7EA 3GJAA 4XQDA 1RUH1 4QB2A 5HXMA 1ZRDA 1W9YA 2QQKA 4Q4Y1 1POQA 2LRPA 3ZYHA 3KGLA 5DXDA 3L2YA 4CDUC 1EV13 4IE0A 1SZBA 3VHRA 4IERA 2YZ4A 3HIFA 5K9YA 1PMJX 2PYTA 4HXCA 3ZMOA 1WLTA 1W03A 2ZEWA 1BQPA 1UPSA 1QJX1 1HRV1 1ZRIA 3FFQA 1REEA 5AC92 1NXMA 1C8M3 4A7ZA 1ASJ1 5FZKA 4A4AA 1XNTA 1N1VA 4RL7A 1PK6B 3FFZA 4CDXA 1MEC3 3K4AA 2DDUA 3OBAA 4IV1C 4RR3C 3ZN5A 4A44A 3PIJA 4EV0A 2VO5A 5FZBA 3O12A 5HCBA 1SFYA 5JXGA 5T50A 1A8MA 3O1PA 2JDAA 3N9NA 5CFCC 1LENA 4QT6A 2JG9B 2R16A 1DYKA 3DPRA 3NJZA 4ZU4A 2TBVA 3UT0A 3ZOIA 1JYIA 1FT9A 3DXTA 3VKOA 4CXWA 4L8QA 4GH4A 4XFIA 4DO0A 5L19A 4ZXKA 1V70A 4DXSA 1ZZ6A 2IFRA 3HNBM 2DYCA 1IS4A 2VTXJ 5FREA 4NWVA 4R9AA 4YFZA 4DUWA 5HXVA 2XJPA 3IDEA 1RINA 2HJIA 4QM8A 5FKCA 3ZR6A 1WCUA 4XUNA 5F6LB 5CG8A 1AHSA 4NIHA 3WX5A 4CUBA 4UBHA 5DAVA 3SKVA 1BK1A 2VCBA 1VMHA 2XJSA 3I2HA 5DUXA 3BI3A 4K7JA 1OF3A 4LBQD 4UWDA 2A70A 4HL0A 4YG6A 4QDQA 4BK4A 1POV0 3AYAA 3V64A 4DIQA 4AZZA 3FUQA 2J22A 5BNOB 4LO5B 3NNFA 1AR81 3PVOA 5C33A 1F35A 2RM22 3T1LA 4D8MA 5J48A 4INDA 2BGPA 3CO2A 5IVBA 2DURA 4PLNA 5K0UC 4RA0A 3N7LA 2Y33A 2A6VA 3NV1A 3C3VA 3WQBA 2XBO1 4H14A 4AFAA 3VBRA 3LEMA 4FPHA 5DPNA 5BNPB 2RHPA 2GNTA 1UY0A 1XNAA 3PVEA 1QY4A 2VG9A 1H2KA 2AC1A 1JODA 1OQDA 3K77A 2BERA 4M3CE 4D0QA 1VPHA 5FXZA 3PUAA 5FO8B 3O1TA 3WG4A 3MGUA 4KGQA 5FYSA 2UY9A 4CDQB 2BQPA 1CN1A 2JG8A 1SEFA 3AP6A 2O8QA 3AZXA 1NCQB 4Y1ZA 3AZVA 4YM2A 3TN92 1ZX5A 5GZDA 3IM0A 1PVC3 2IXHA 1L7RA 1RVF1 1OUSA 3T30A 4Z82A 4XC9A 2XUMA 5KC6A 1RVF2 5DABA 2Y34A 3RVHA 1JZ4A 2WNVB 4JQTA 3WF4A 3MFCA 5L36A 4W6YA 1BBT2 3T4HB 4LBOA 1D7PM 3WG3A 1WBLA 2CSGA 3T2TA 4F7ZA 4COWA 3UK9A 5LRSA 1XYOA 2MNGA 3RYPA 1VBE2 3IAPA 5FPZA 1I5ZA 3ZSLA 2ZMLA 1MR5A 1DQ4A 5JWPA 2B5HA 4KBBA 4PDWB 2XWBB 3QH6A 1SCRA 3C7OA 1S0EA 1QKQA 5BV6A 4JCKA 2V09A 3LAGA 1AXKA 3HVDA 4NRPA 1AJKA 5BXXA 4UFMA 5FXXA 3WP3A 4DY3A 3G7DA 5FYMA 1FPN3 1NOVA 3OB8A 5FUPA 4LEJA 2VCAA 4L97A 4UOJA 4CEWC 4FOQA 3QBQA 2WO1A 4HONA 1DLLA 5KHGA 2F6BA 4HKWA 4XFHA 5FLHA 1BMV1 3WDXA 2D93A 4QX7A 1KD7A 1RMU3 1UU4A 2ARBA 5A6ZA 1KRIA 3IKWA 4I30A 1XNCA 3ZFGC 4LUMA 1JOPA 1U5XA 1XRUA 3DYPA 1W9SA 3BODA 1UOGA 1GP4A 3WINE 1JN2P 3MF9A 3NAPC 1OD3A 4QQHA 4KI5M 5DDJ2 2CL2A 4BISA 1ASJ2 4XDQA 2Y60A 4YW2A 4BQYA 3MPBA 1V9U3 4N9HA 1IG3A 5E6HA 3VBSB 2ZEXA 4XJUA 5IUQA 1YFXA 5LW9A 3NW4A 2F17A 4NR1A 3ALQA 3CDZB 4Y4YA 2PQQA 2XBO2 3AFKA 4UW3A 2VMDA 1LKNA 3VDAA 5FUIA 4Q4V1 2A7AA 2HYXA 5GLZA 4COVA 2FDJA 3MYXA 2KR2A 4WM8B 3WD5A 3P3PA 5A3TA 2P2KA 3M7AA 4IE6A 5JMCA 3QCWA 4LO7A 3ZFEA 3HNYM 2AEYA 5FRAA 2R041 1W9TA 1FXZA 5CFDB 3T2PA 3HEIA 1VE0A 3WQ7A 1CR7A 4ZKTB 4GZ9A 4RFRB 2QKDA 3DF0A 2A5ZA 3EJKA 3PJQA 4GAZA 4KH9A 4XFBA 4Y20A 1AR92 3AM2A 3OTFA 3WNOA 3TAYA 1W2NA 2A75A 3VBOB 4QPIC 3PTRB 4CDXC 4CCJA 3ZKUA 3CJIA 2WQ4A 2EXKA 1OLQA 1WCQA 1RUD3 2RS12 2VR4A 1Q8OA 2YPJA 3FZ3A 4PBPA 4UFHA 5T52A 2E51A 3ZXLA 4CZSA 4D3WA 3A21A 5JSRA 3WF1A 2HWB2 4AQ6A 5CFCA 5EP9A 1FNZA 3DPRC 4S2FA 1H30A 3J7NA 4XJ9A 1Q8VA 3OEAA 3RQ0A 1RUH2 1RYYA 4ITCA 3EMRA 2W68A 4XW3A 4JRAA 1GUIA 3ENRA 4JVAA 5F1RA 4XXPA 4IEQA 1SMVA 1GU3A 5FPLA 3O5SA 4RS5B 3SMHA 4XUPA 4PQQA 4GKYA 4QPGC 2CU5A 2EXJA 1KS4A 1RUE1 3MW3A 1WBFA 1UOJA 2JD9A 3TWIA 1RJ7A 4AE2A 2H0BA 5C4WB 2CWSA 4FI9A 2GALA 2XLGA 1H6XA 4WM7B 2CGOA 2ZZJA 4Y4RA 3AMNA 5HV0A 1LTEA 5JZGC 1AYM2 3T2QA 4BDVB 3FLTA 3NQHA 1FOD2 1AYM1 2VW2A 1VBA3 1AL0G 3H7YA 1OI6A 3ILNA 4QXHA 2Y64A 3TN93 3OPTA 2BYVE 1QNWA 1DU3D 3QLQA 2VL4A 1YC61 4AR2A 1QJX2 3OUIA 2XMLA 2RJKA 4HN1A 2ID4A 2WWUA 4X8NA 3ZFFC 1I6XA 4PIXA 2JG8B 1HB3A 3TEYA 4IW3A 3WHTA 4HK8A 3IT8A 3ZPOA 1NXD1 4L11A 4QQ2A 3WNPA 5LWBA 1SG3A 2ZGQA 5F3GA 2JDUA 1EUTA 1JI6A 4KL1A 4IEWA 4UT5A 3AL6A 1WD3A 2WA3A 4XJZA 4R4ZA 1RUD2 1W8HA 2P3JA 1DHKB 1X36A 1G9FA 1GZTA 2RS13 4PLMA 4AK3A 4CDWB 2WNVA 5FY5A 4CRQA 2AR6A 2JDMA 4W8JA 5C5UA 5T5JA 3LD8A 3WDWA 4M3CA 5I8TA 1W3XA 5JOWA 4N90A 3ZSMA 2DCKA 5LBCA 3K3OA 3LCPA 4LO8A 2D7FA 1LEMA 1F8VA 4K6BA 4HVOA 5E16A 3AVSA 2PHUA 3GJBA 3I8TA 3Q8CA 3VD4A 5FR3A 1UU5A 2CGNA 4XFAA 3VZJA 3BVCA 1H1MA 3VD5A 3WDYA 1JZ7A 5KXBA 4IGOA 1D0HA 3DKWA 3MO4A 1MQTB 5F2WA 1J58A 4GJYA 4TLGA 5I0SA 4OFGA 1X8MA 2LM3A 1WD4A 2Q1ZB 4Y20B 1WW5A 1V6OA 5T5LA 4NIAA 5FY8A 1CWPA 2VXRA 2VNVA 4MSVA 1D2SA 5LBEA 4D7SA 1XE8A 1VB4A 1GZ9A 3GBFA 2OZJA 2VOTA 2IVIB 2ZA9A 3U10A 1PNFA 3WW1A 2EIEA 2YBPA 4ATFA 2DCYA 3N9LA 4A45A 5C3PA 3EYPA 3RZGA 2YYOA 3UKTA 4BK5A 2AREA 1R082 2WDBA 2EXIA 2GU9A 3DV8A 2Y8KA 4ES9A 3M3CA 1OFNA 5IVYA 4XFGA 1JS9A 5A7SA 5D8AB 3WP4A 5EV7A 2Q1FA 3HBKA 4IV3B 4C1XA 5JDBA 2LUWA 3S30A 3WR0A 1GLHA 3THDA 4CCEA 1X50A 1GP6A 2DUQA 1YXWA 2JE9A 1W6QB 1K5JA 1N3QA 3ACFA 1ALYA 3AP5A 3B01A 4UXAA 3SQOA 3OJBA 3F2ZA 3H3ZA 4BLIA 4O61A 4COUA 4HSLA 2R063 3NNJA 2JJ6A 2J42A 1H8TC 1UY1A 1V6JA 1UL9A 2ZMKA 3FHAA 3JBG1 5EJZB 4AEDC 4OQ8A 2YC4A 4WVWA 4YM3A 2W1SA 4MGYE 3ES1A 1J59A 4J1WA 1CAVB 3ZYFA 3U0ZA 3Q8BA 4LE4A 1DYOA 3T09A 1RUI1 4CP2A 5ABJC 5F6KA 3CZUA 4XUQA 4MXWA 3N9OA 1HN1A 3CIHA 1YFWA 3K4ZA 1W99A 1T6BX 3TYJA 3U07A 1OD5A 4FXGB 2Z5WA 4BQ2A 5JOZA 5C71A 3V0AB 4IQPA 1US3A 4OVEA 4RHV1 4Z2WA 3C7FA 5IAXA 2DV9A 5T54A 5FZFA 3KF3A 1H4GA 3ZIXA 1HRI2 3ACLA 3AZYA 1Q5OA 3MF6A 2VM9A 1HRI1 3MIHA 3OD0A 3VV1A 2OQ7A 3QD6A 3POFA 4PI2A 4JGYC 3ZVXA 2QDRA 3VDDC 4EN8B 5JCTA 3VL9A 2PMWB 4QPIA 3PMEA 3NV2A 4Q8LA 2PELA 3ZSEA 4E4HA 1OLMA 2VOKA 4LHSA 3C7HA 5GLTA 4XVHA 3AKRA 3T0BA 5EJ1B 3ZMNA 2IXKA 1RB8G 3U75A 1BHGA 1H9WA 5C7GA 3BIEA 1FPN1 1HN0A 4Q4Y3 4WM7A 1EUUA 3JB8A 4Y26A 1RUD1 2W47A 3P6BA 4W50A 3RWNA 1HJGA 1ULFA 1SLTA 3UGHA 4UW6A 5FY4A 5GLUA 2ZHNA 1FNYA 3OBZA 3TB0A 1HB4A 4COZA 5DZEA 2XG3A 4IEOA 1YQ2A 3ZN4A 5A33B 2J1VA 3AP7A 3IAQA 3WDTA 3FHQA 4UF0B 4KGGA 5EJ3A 5BNNC 2E7TA 1W8UA 2A71A 3O1VA 2UWCA 4BIOA 3THPA 3WF2A 1PO23 2HWC2 2ZX1A 2CV6A 3CZJA 1WKYA 3WXPA 4C0HA 1RUF3 1CJPA 2WNUB 4LLOA 5IATA 4PQ9A 4E2QA 1PGW1 2P37A 2FZ2A 5C9AA 1G8WA 4Q4V2 2ADDA 1GP5A 3AB0A 4UFJA 2RVAA 4CDUA 1PVC2 3M3EA 1ZM1A 2OUHA 3SH5A 2EALA 4DOUA 2PHTA 1PVC1 5JIUA 3BPZA 4KNCA 1OFSA 4CPBD 4PLOA 1K5MB 5F3IA 1W2TA 2HYKA 4Q4V3 4D69A 1D4M2 2NQYA 2YXSA 3VZMA 3ZYIB 3PURA 2CAVA 3VZLA 3WF3A 3S6PA 3OG2A 4QB6A 2BRTA 2CY6A 1A6CA 5B4XA 3NL1A 3WOGA 5B4NA 2DBIA 1HB1A 1HLCA 1K45A 2VXJA 3SXWA 4CA9A 4QGLA 1PZ9A 4OZXA 3EHKA 3ZYBA 5GLWA 2VZTA 2RS32 1AJOA 2JECA 4E4ZA 2JE8A 3JD72 2O14A 1E57A 1F5FA 2W1UA 4XBNA 5FQ0B 4EN0A 2LS6A 3GYDA 3HAGA 1T6GC 3E6DA 3J8F3 2Y0IA 1XSRA 2XONA 3POYA 2AGSA 2R1BA 2VH9A 4LMFA 4EWDA 1K12A 4YGDA 1ND2A 2ZPXA 4CCNA 2QQLA 4JKMA 2WYFA 2ZACA 3LKJA 5JPNB 2DCJA 4WM8A 2GP5A 5C3OA 5FP4A 4AVAA 1XE0A 5A3MA 2WT0A 2XUEA 3OBRA 4TSVA 3WDVA 2UWBA 1OVSA 3KSCA 3ZX7A 3AP9A 5GM0A 4HK9A 2XJQA 2EVXA 4K1YA 3NWKA 1S55A 1YHFA 2GMEA 1AX2A 2ZGTA 5FZ3A 4MGTA 1R1ZA 3BN6A 2WZ8A 4BPZA 4QWNA 2BVBA 1R083 2WAAA 3WP5A 3WHUA 2QQJA 4PDWC 4MGZE 4BB3A 4Y22A 4XJWA 1GNZA 5KXCA 3H1YA 3LWCA 3RGBA 5GKAC 5FKBA 5GZCA 2BPA2 2NPIA 2WZR1 4RN5A 1IS3A 1URXA 3MI8A 4DINB 2XOMA 3VHNA 2CDOA 1MS4A 4CPBA 3B69A 3NNGA 5IW0A 1HV1A 2GSYA 3GDBA 1VBD3 4AFMA 1NYWA 1YCIA 2BNNA 4UF0A 2JB4A 2W1WA 2RDNA 4KU7A 2A6ZA 1R1A2 2BP6A 2ZEZA 3I4IA 4PI0A 4Q4Y2 4YW4A 3I2OA 1KGYA 4AI0A 5C4WA 3E5QA 4E8DA 4FOYA 2FMYA 3FUOA 3KQRA 1JYNA 4HOOA 2HEWF 2IXJA 1QJU1 1YI7A 4UFKA 3LDRA 5GZFA 1H8TA 1SLAA 5CBLA 3KV9A 1W6MB 3ZDSA 4AEDA 2BTVC 4URAA 2Z42A 3HQRA 2PLV2 3O0WA 2DVBA 2BV4A 4AEMA 4ARXA 5BPXA 3TRSB 5JXJA 1MZFA 1L7LA 1QF3A 1TMF1 1YQ6A 1ZYBA 3LQCA 2FCVA 3VBSC 1CAWA 5EHDA 3ZYPA 2K0GA 3HR9A 4ZHNA 3S57A 3UJQA 1LHNA 3LSEA 4XQWA 5DQ0A 3RZMA 4FTEA 1HRI3 5LK5A 4ZU5A 3TEWA 2BEOA 3I3DA 3VBOA 1WZXA 1YJLA 4D7YA 5LA0A 1W8TA 2NM1A 2YU2A 2F4PA 1RHI1 5FMOL 1C1FA 5I0DA 1WLCA 1Q8QA 3GZUC 1B35A 3U14A 5CFDC 3WV6A 2VCCA 2BOIA 3T2OA 1H8VA 4JGYA 4CP0A 4JQRA 4N8MA 2A6WA 1JXNA 1W9FA 3IBMA 4MGIE 4E4SA 4UW4A 4AVVA 2G9GA 2D5HA 3IMMA 3T1MA 3ZN6A 3RZLA 4CXXA 2ORXA 1CAXA 5SV8A 1YNAA 3NVCA 4R9CA 1TMF3 1RUF1 4AYUA 1MPXA 3PLQA 1BEV1 1N1YA 1PK6C 1QJY1 1QXJA 3H8UA 3BU0A 5FK7A 1QJZA 4M3CF 3ABZA 5FYCA 1Y7BA 4N9IA 3CNAA 4S2GA 5E88A 4DRRA 1S0FA 1R1A3 5BUVA 1NAEA 5FMOS 1PO22 2HWC3 4QHBA 3LPFA 4P9JA 2VZ3A 5A7PA 3W20A 5A6YA 3O1MA 3SEEA 5DAQA 3HOBA 4I02A 1AX1A 4HETA 2P6HA 1EV11 4HFSA 4JDOA 2E7AA 2WZR3 4QKNA 4CP9B 1BEV3 2KXLA 2ZGSA 4K8RB 4D7TA 4BMEA 5IJRA 1C8M1 4LKEA 5BYNA 3U1XA 2CYFA 4P9XA 3O1SA 1OKOA 2RS31 5GZGA 1QJX3 1DQ1A 4DRVA 5KHJA 1S0DA 3B3QE 4DUXA 2BZDA 2VW1A 4XZPA 3PHMA 3E5UA 2G4IA 1LESA 5A7WA 4CDWA 5F37A 1RUH3 3HPNA 2HLEA 4COYA 2YB7A 2P4EA 5FQ0A 1BJQA 2R071 2WAOA 5FZLA 5LK7B 2EAAA 5LASA 1TME1 5CKMA 4OI4A 4D6RA 1KXGA 2DF7A 4YZ1A 2PLV1 2XVKA 1J3PA 1O91A 1RUG2 1UMZA 4FQ4A 3TNQA 1JYCA 1ENRA 1ZBE1 4RQPB 1GNYA 3KCCA 2YPDA 3WNMA 3PU3A 2QCSB 2XDVA 3H3UA 4M0NA 1ZVFA 4WZFA 4ZZ8A 2V73A 1DIWA 4H7LA 4RGAA 4BQ1A 5A6XA 1MZEA 1V6NA 3HQXA 4JGZB 4R52A 3TEZA 4Z92B 3AX4A 2Q8DA 4BQ4A 2W95A 4I3GA 1LR5A 4CU8A 2HWE2 5KXDA 3W59A 1FMD3 1LJ7A 3MLLA 4AAXA 4NPRA 4QPGA 4NMIA 1IG0A 4XIKA 1D4M1 4K9SA 1OH4A 2HKXA 3RJ2X 3LFMA 4NAOA 3S5AA 4TYSA 1Q8SA 1VBD1 1XJAA 4UW5A 4JHZA 3NJYA 4M4RA 4CU6A 1UPIA 1UU6A 2B4KA 1BEV2 1KJRA 1LRHA 2VBBA 1DGRA 3MIEA 4JAAA 1YWKA 4RSUA 2BUKA 3I59A 4LKFA 1X9PA 4XUOA 2MEV2 3V65A 4IE4A 1JBCA 1DBNA 1NG0A 3O0VA 4GD4A 1DZRA 2X8KA 2A6YA 4BH9A 2J1SA 3I2FA 4GB33 5IT6A 5IFTA 3GZAA 2ORZA 4IV3A 3B02A 3OGSA 2GC2A 2I2SA 2WSUA 3D5OA 3D82A 2PLV3 2VMIA 1CX1A 3ILFA 4EE2A 3I49A 4CCMA 4P5HA 5JOYA 2QNKA 2TUNA 4K40A 1DF0A 4P02B 1N1SA 4NHMA 4Q4X3 1W8OA 2Q8EA 4LJHA 1PM4A 3AVRA 1RUC1 1AX0A 1PMHX 3H0OA 3MIFA 4GH4C 4YW1A 4NIGA 1OC1A 2MPFA 1HXS1 1WMXA 2TEPA 2ZKNA 3D6EA 4XCBA 1CAWB 5IWFA 5T5PA 4GIQA 1Q3EA 4BE3A 3N7KA 4FPLA 2C0ZA 2XJVA 4Q0PA 2BNMA 2BFUS 5A3UA 3KS7A 3PU8A 2Y26A 3I2JA 1QOOA 1ZZCA 2R1DA 4CSWA 4OCTA 1M4WA 3MV01 4Y5Z0 3NMBA 5JI7A 1IKPA 3QH7A 1QWRA 1J84A 4KU8A 3C8XA 1OXCA 3S7IA 1RUJ1 4XF1A 3BKZA 3RZHA 3B7MA 4KQ7A 3T08A 5DAWA 1ULGA 2VECA 4BA6A 5ABJB 3D8CA 4JX0A 3C7EA 3MHZA 1X7NA 3IDCB 1ZBA2 4R8HA 1MVEA 3OGRA 2VVEA 3R4DB 4XFCA 1JZ8A 5JUVA 1OA2A 4ZZ5A 1WMEA 2ZCWA 1GANA 1RL3A 5ACA1 1DDLA 3MEPA 4BYYA 1ZNPA 3VDCA 2TNFA 4UBGA 3VBRC 4IV1A 5CFDA 5FZIA 2PAMA 1SBDA 1H4HA 3TBDA 4IL7A 5HI0A 2X5IB 4QX0A 5IFPA 3ZSJA 2OZ6A 5T3NA 1WW6A 1O3RA 3PUSA 3X29B 3E1F1 3BGAA 1ND2B 1T2XA 2WBKA 4ISRA 3I97A 4Q29A 5A33A 4B1LA 4B4PA 4AI1A 4E27A 4ET7A 1G9BA 5TSWA 1RUE3 1HB2A 2ARAA 2HWD1 1FOD3 3TEXA 3ZXGA 3ZYGA 4GQ7A 5J37A 4QU1A 1YFUA 2WQ8A 1PZ7A 2DVAA 4QM9A 1OKQA 4UFIA 1RXFA 1AYN1 1PIV3 5H9PA 1GYKA 3I59B 1LOEA 4W6WA 4CVUA 3WDUA 2FCTA 1E5IA 4IEVA 1ZBA3 2WNEA 4QB1A 2QQNA 2E7QA 1KQRA 5BNNB 1UXXX 1MS1A 2R0FA 4HMZA 4JDNA 1W39A 1ACCA 1AR73 1W0OA 4C91A 2ZGPA 3S5QA 2AZ5A 2DUPA 4YVWB 2EF6A 3EB7A 4D6QA 2FDKA 3KGZA 2Q8CA 2FCUA 1RC6A 2YUEA 1OQEA 4N7IA 4OYUA 3LEIA 5K0UA 1QHDA 3GF6A 3WG2A 4PF1A 4WVVA 5FMCA 4A7KA 4L92A 3VBFC 1NE4A 2W2IA 3SNMA 1PHMA 2OXBA 4S2DA 3WCSA 4BZ4A 1BVVA 5KHIA 1J3QA 4Z07A 3VBHB 4AI9A 1LU2A 5FWJA 1LOCA 1UZYA 3VDDA 2N7GA 5HPOA 1HQWA 4RGKA 1KEXA 1UF2C 4EROA 1GOFA 2ET1A 2JG8C 4FO9A 1NY71 3JD73 3ZFGA 4XE9A 3LEKA 1RITA 3LF7A 3J8F2 1N1TA 2P5BA 1RUI3 2JDHA 3FBMA 3UV9A 1IPSA 1QEXA 1VBB3 2RR12 4Q4W2 3S0MA 1A8DA 4MX3A 1TZOA 1UZZA 4WZCA 4ZS3A 5FPXA 1CIWA 1QH7A 4A3ZA 2W91A 1JZ2A 2ZBJA 3POIA 2WQZC 4RHV2 5FZ4A 1KFXL 1D4VB 1EAH1 1XOYA 2WYSA 1O5UA 2CHHA 4FOWA 4F83A 4M01A 4IV1B 3UJOA 2WWSA 5J36A 3RZJA 1W6PB 3JQWA 2R072 5KR7A 4BIFA 1MQTA 2ES3A 1AL23 1H2MA 2R30A 5CA6A 4NUBA 1UOBA 3H1MA 1NUKA 4YG0A 5C9AC 3L9JT 1HXS2 3R6SA 3OGJA 1O59A 1W9WA 3PL0A 2VTXA 4AHYA 2ZHLA 5J96B 1STMA 5I93A 1WCKA 4N53C 2ZGRA 3DEMA 4DXRA 4X8PA 4J25A 3WLUA 1AYM3 3VB9A 2ZABA 1BBT1 2HBTA 1XU2A 4RYDA 2A73B 4Y3OA 3MLJA 4YSFA 4AEJA 1GBGA 2WS93 4HN0A 3VUOA 2C5DA 4XOGA 5C8WA 3H3LA 4AEKA 4I01A 2Y6JA 1VMFA 4Y24A 3AMHA 3HNMA 3TNPB 3ECQA 4B1MA 2O1QA 1O4YA 1YI9A 2WT2A 5LATA 1VRH1 1RMU2 4CTEA 5L73A 3J26N 4IESA 1WMFA 5KBFA 1ZRCA 3MZHA 4Q2FA 4IEZA 1U5ZA 1MEC1 3AYEA 1UYYA 3ZXDA 1F2NA 5FZ0A 2XLAA 4N43C 4GMP1 1I3HA 4ZONA 3N9QA 2AUYA 4EZ4A 1QOTA 2RS52 2RE9A 3CU7A 5E89A 1UYZA 2UY8A 4LBKA 1CGPA 1VBE1 3HN1A 5I8SA 2Y6GA 2L9LA 1W04A 3B94A 4PHZA 1GQGA 5CAZA 1OPOA 1DCSA 2WA4A 1E5RA 3DXUA 4PF5A 4LXLA 3VD3A 1UZWA 2JDNA 2JKXA 2ZX3A 2WN3A 4J6GA 5FP8A 4WVZA 2Q1MA 4C0BA 4ISQA 1LOFC 1XNDA 4IGPA 1SFPA 5FY7A 5I0UA 5JR7B 3USUB 4V2WA 3KV6A 4AGGA 4MO3M 1H1IA 2DWRA 2E6VA 4AI8A 3WUCA 3R0RA 2Z69A 3ZFFA 5GJ6A 1AYN3 1LOAA 4CCCA 1NCQC 1WW7A 1IOAA 5FMBA 2R043 1Y9QA 2VNRA 3DL3A 1NCRC 4TWTA 2YC2A 3SCFA 1I5PA 1SDDB 3WQ1A 3WW3A 4BMBA 2ZHKA 4ONUA 5K4LA 3I3EA 4PDWA 5EYYA 1EY2A 1F4HA 2ERFA 5HCFA 4P9IA 4P5YA 4OI2A 2C6SA 2P17A 4ZS2A 3PNAA 5J7MA 2V4AA 1SLBA 1SDWA 2X09A 4LKDA 4QXCA 5FP9A 1OF4A 1QDOA 1SBFA 2WNVC 1LULA 3ST7A 5A3NA 2VZSA 3N36A 4KWLA 3GGLA 5C3RA 2ETEA 5FZ9A 2QZ2A 4LO6B 1BK0A 3MIDA 2YHJA 4CEYA 2XJUA 4AVBA 2WL1A 1ZZBA 4AVSA 3OBTA 3LB9A 4FPJA 1LGBA 2IUWA 5FZ6A 4IE5A 2R061 1UN1A 1XU1A 1X9TA 2VAUA 4A41A 4FSJA 1SFNA 1EYBA 2B39A 4LR4A 5SV5A 2J1UA 1C57A 2GC1A 5A3OA 1OUXA 4FTBA 4Q8KA 1YEWA 2WO7A 4LPLA 3IIIA 2E63A 2WS92 4FCAA 4HG6B 4OHWA 2GP3A 1QJEA 3GCWA 4AQSA 2GN3A 5FYYA 5J1XA 1FX5A 1OOPB 1MZ5A 1US2A 4I0WB 2VZPA 1RUI2 3E5XA 5DUUA 5LBBA 4NE9A 3RWKX 3UKNA 2J1EA 4O7XA 1VBC1 4QMAA 1W3VA 1GQPA 4O65A 1RMU1 5A7OA 1CESA 3CJXA 1DGRN 4Q1RA 1S1AA 4NIDA 1VBB2 2H6BA 1XYNA 4E9KA 3UESA
chains in the Genus database with same CATH topology
4IE4A 4IE7A 3T4HB 3BIEA 3I3QA 4NIHA 4QHOA 4ZS3A 3O1OA 2FD8A 4MGTA 4NRQA 3T3YA 3I2OA 3RZKA 4NROA 4QKDA 3O1PA 2FDJA 4OCTA 2FDGA 4ZS2A 3O1TA 3BI3A 2FDHA 4IE6A 3H8RA 4IE0A 2FDFA 4QKBA 3BTXA 3KHCA 4O61A 3H8XA 4CXWA 4CXYA 3O1MA 3RZJA 4NRMA 3I49A 3O1UA 4RFRB 4QKFA 3BKZA 3RZHA 3RZLA 2FDIA 4CXXA 3BUCA 3LFMA 3H8OA 3RZGA 3S5AA 3O1RA 4NPLA 4NPMA 4NRPA 3O1VA 3BTYA 4NIIA 3S57A 4ZHNA 4QKNA 2IUWA 3KHBA 2FDKA 4NIGA 4NJ4A 4O7XA 4IE5A 4JHTA 3RZMA 4MG2A 5F8PA 3T4VA 4IDZA 5DABA 3BTZA 3I3MA 3BU0A 3O1SA 4NIDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IE4 A;  4IE7 A;  3T4H B;  3BIE A;  3I3Q A;  4NIH A;  4QHO A;  4ZS3 A;  3O1O A;  2FD8 A;  4MGT A;  4NRQ A;  3T3Y A;  3I2O A;  3RZK A;  4NRO A;  4QKD A;  3O1P A;  2FDJ A;  4OCT A;  2FDG A;  4ZS2 A;  3O1T A;  3BI3 A;  2FDH A;  4IE6 A;  3H8R A;  4IE0 A;  2FDF A;  4QKB A;  3BTX A;  3KHC A;  4O61 A;  3H8X A;  4CXW A;  4CXY A;  3O1M A;  3RZJ A;  4NRM A;  3I49 A;  3O1U A;  4RFR B;  4QKF A;  3BKZ A;  3RZH A;  3RZL A;  2FDI A;  4CXX A;  3BUC A;  3LFM A;  3H8O A;  3RZG A;  3S5A A;  3O1R A;  4NPL A;  4NPM A;  4NRP A;  3O1V A;  3BTY A;  4NII A;  3S57 A;  4ZHN A;  4QKN A;  2IUW A;  3KHB A;  2FDK A;  4NIG A;  4NJ4 A;  4O7X A;  4IE5 A;  4JHT A;  3RZM A;  4MG2 A;  5F8P A;  3T4V A;  4IDZ A;  5DAB A;  3BTZ A;  3I3M A;  3BU0 A;  3O1S A;  4NID A; 
#chains in the Genus database with same CATH topology
 1B35 C;  3GZE A;  3D0S A;  3MIG A;  2DTY A;  3IWZ A;  4GXL A;  1BVP 1;  1ZBE 3;  2UUR A;  3PVN A;  4AGR A;  2VNG A;  3U4S A;  3IIA A;  4HPK A;  2DU1 A;  4XAB A;  1BCX A;  1ENQ A;  1HKD A;  2QZ3 A;  4NN0 A;  1TME 3;  5E8A A;  3ES4 A;  3LA2 A;  5FZH A;  2VQU A;  1NLR A;  3URF A;  2RR1 3;  4Q4W 3;  1YIP A;  4P00 B;  3KV5 A;  4RR3 B;  4MV2 A;  4OQ9 A;  1HXS 3;  2I74 A;  3FBY A;  2VGD A;  1XQN A;  1LNS A;  1TMF 2;  3RYR A;  2JE7 A;  2VQ0 A;  1V9U 1;  2O8O A;  4GB3 1;  5CFC B;  3H7J A;  2WWJ A;  3OPZ A;  4WVM B;  1LU1 A;  1UQX A;  4A42 A;  3RFR A;  3KB5 A;  2BU9 A;  5ABJ A;  1JUI A;  1TNR A;  4YRD A;  4YNI A;  4JGZ C;  3ZSK A;  3KCX A;  3C7G A;  3UGF A;  1VAM A;  2WIN B;  2Y6L A;  4Q1P A;  3GCX A;  3CQO A;  4HLT A;  2OQ6 A;  5FJH A;  3SH3 A;  4CDX B;  2QDN A;  4YZ5 A;  1S2K A;  1W28 A;  2YBS A;  4XMI A;  3RJR A;  2P6C A;  2BBA A;  5D21 A;  3ZPY A;  1YYN A;  5DAX A;  5L7O A;  4TN7 A;  3RYK A;  5IAV A;  3AKT A;  5A6Q A;  2JG9 A;  1UKG A;  3DPR B;  4LIV A;  2RJL A;  1VIW B;  5IVE A;  3SEP A;  1IPK A;  5ANN A;  5FLJ A;  4K1Z A;  2Y0O A;  4Y1Y A;  2D98 A;  3J8F 1;  3BYW A;  5LY2 A;  4B4R A;  3RRD A;  2ZJC A;  1DGL A;  3VBU C;  4GWM A;  3DYO A;  2ZXQ A;  4IEX A;  2X05 A;  1PGL 2;  2RS1 1;  4MHR A;  1GNH A;  4XIL A;  5ANQ A;  1PO1 1;  2DVF A;  2E33 A;  4C1W A;  2FDG A;  1K42 A;  1YJK A;  3GBG A;  1O8S A;  5DZG A;  4WM7 C;  5FIX A;  4MET A;  3IDA A;  4Q26 A;  3M4F A;  1FV3 A;  3ELN A;  1BKZ A;  2HWB 3;  2VME A;  2XLF A;  2Z79 A;  5CB7 A;  1LAJ A;  4AHZ A;  3DEC A;  4Q5O A;  1NA1 A;  4MUV A;  5BNO A;  3LOI A;  1UY4 A;  1LCL A;  1COV 2;  5FWE A;  3KV4 A;  5BNN A;  3D3A A;  1TQ5 A;  4XAA A;  4EJR A;  5HBA A;  4MYE A;  4FPY A;  1HQL A;  2YV8 A;  4JZR A;  2D3S A;  2VZO A;  1NQD A;  4YVW A;  2XR4 A;  4TZD A;  1UW8 A;  4IEP A;  3EXU A;  5HV4 A;  1AR6 3;  1DQ5 A;  1DQ0 A;  1PX3 A;  1UKR A;  1H2L A;  1UZ0 A;  2ZX0 A;  3B9I A;  4XUT A;  1AUY A;  5K0U B;  3JQX A;  3OUJ A;  5IVJ A;  1E5S A;  5FPA A;  4Q0V A;  2B9V A;  2CNA A;  3OY8 A;  5A32 B;  3BU7 A;  5BNP C;  2B42 B;  1SAC A;  5EQU A;  5AFE A;  3MPP G;  4CXY A;  3GNE A;  2G9Z A;  3N4M A;  2OX0 A;  2XHN A;  3KQ4 B;  3R05 A;  3E6C C;  4J1X A;  2ZGN A;  4I0B A;  5JLV A;  3KT7 A;  2QE3 A;  3AZW A;  5FXW A;  3TOJ A;  2WLP A;  5ERL A;  1NCQ A;  1UMH A;  5K7P A;  1DZT A;  4CDQ C;  1VRH 2;  2A3X A;  1UOF A;  2PN5 A;  4XQ4 A;  4W6X A;  1R64 A;  2VBD A;  4XF3 A;  3LOB A;  5F2S A;  1UAI A;  1VBC 2;  2E32 A;  2RMU 1;  3DN7 A;  4OHX A;  1FV2 A;  3RNS A;  3LA3 A;  1MAC A;  1W05 A;  4SLI A;  4LA3 A;  5DN2 A;  3UET A;  4Q0U A;  3VD9 A;  4M0H A;  4CUA A;  5C8C C;  2IC1 A;  1YUD A;  1RTV A;  3K4D A;  3FLR A;  4CUG A;  3AKQ A;  5FYH A;  1PVX A;  3JBG 2;  3OPW A;  1J1T A;  1HRV 3;  5FP7 A;  5FY0 A;  2JDZ A;  4Y1V A;  4LHL A;  4AQT A;  2YGM A;  4AFC A;  1ND2 C;  1WUV A;  1MZ6 A;  1W6O B;  2SBA A;  2VCM A;  4P9L A;  4WV8 A;  4LTA A;  3KZ4 C;  3U78 A;  1A3K A;  2VOW A;  2X53 S;  3MIC A;  3M3I A;  1W6N B;  4MOA A;  3UGG A;  4LOT A;  5KXE A;  5IVF A;  1VBE 3;  2BBV A;  2HWD 2;  5F3E A;  2PAE A;  4YPJ A;  4OUM A;  3ZIW A;  4DS0 A;  3LDK A;  3PUQ A;  3RG0 A;  4QX2 A;  5FYU A;  2D5F A;  3DGT A;  4QX1 A;  2RDQ A;  1REF A;  2QQM A;  3LE0 A;  1U12 A;  4GWI A;  3POE A;  3A23 A;  3K51 A;  2XB6 C;  3WT3 A;  2AYH A;  2DFB A;  1WCD J;  1OSG A;  2GNB A;  3AL5 A;  4QGM A;  4AL9 A;  1BLZ A;  3ASI A;  4FPK A;  1GWM A;  2JD4 A;  3J9S A;  4K20 A;  1APN A;  3OCP A;  1JMU B;  3QOP A;  1KIT A;  2D40 A;  2E53 A;  5AC9 1;  1BXH A;  4MLO A;  5FY9 A;  2B45 X;  1S4C A;  3AXD A;  2D6O X;  2PHL A;  4UI9 L;  3ZFG B;  3IB3 A;  5E1R A;  1RUC 2;  4HVQ A;  4W4Z A;  1VRB A;  2W39 A;  1BBT 3;  2ATF A;  2DBN A;  1EAH 3;  3J7L A;  2XL7 A;  1PGW 2;  2GAU A;  3VL8 A;  3P1I A;  2C4X A;  2XKO A;  1DQ6 A;  4NO4 A;  4QHO A;  3LPG A;  4ARY A;  3RZK A;  2HWE 1;  4I2O A;  1O5L A;  4NWW A;  3K3N A;  4GKX A;  2WFF 2;  1JTZ X;  3QAC A;  1CX4 A;  1UYP A;  2VJX A;  5AVA A;  5FZC A;  1F9K A;  2ZGL A;  2EAK A;  4K8F A;  1UXZ A;  4DPN A;  1JZ5 A;  1XC6 A;  1S2E A;  1GOG A;  4PBO A;  5LBF A;  1V6M A;  4XZU G;  4MGQ A;  4YVS A;  3TN9 1;  5C6C A;  1POV 1;  2CDP A;  5FOB B;  1SQ4 A;  2DFC A;  1PX4 A;  2P1B A;  3ZFE B;  1QNY A;  4TTG A;  4WM8 C;  1GIC A;  1OHF A;  1MS0 A;  1I9R A;  2HWF 3;  4KWJ A;  1AR6 2;  5LA9 A;  2PHX A;  1COV 3;  3Q8A A;  4KBZ A;  1O3S A;  1JYT A;  4JGZ A;  3AJY A;  3USU A;  2BWC A;  1LOB A;  4LK6 A;  3IDB B;  1H0B A;  2VY0 A;  3MW4 A;  1C4R A;  4YFW A;  3ITQ A;  3VBO C;  2B46 X;  2ZKL A;  3ACI A;  1UD1 A;  3GAL A;  3KVB A;  4QPG B;  5I8Y A;  4FT8 A;  5F9T A;  4RS5 A;  4JTO A;  3HT1 A;  5JMO A;  4BJ0 A;  3GHN A;  2XXZ A;  3GM8 A;  3OSD A;  1EAH 2;  3J7H A;  4HAN A;  3LDB A;  1VBC 3;  2WNU A;  3H42 B;  2XQR A;  2AAC A;  2H6C A;  4H2A A;  4RFT 0;  5CZK A;  5FUN A;  1EPZ A;  3FHI B;  4IEU A;  4UAP A;  3VGI A;  5BY5 A;  1TEI A;  1ZZ7 A;  2GH8 A;  5I91 A;  1JOJ A;  2QVS B;  1W06 A;  3PTY A;  1WCS A;  1HJF A;  3RMY A;  4ASL A;  4DQA A;  1UY3 A;  2Y6H A;  4X6Q B;  1QXP A;  1HQN A;  3KWV A;  4Q0S A;  4EN7 B;  4PJY A;  5IYY A;  4BXF A;  3WQ0 A;  4XF4 A;  2DU0 A;  1LGN A;  2RJ2 A;  4MXV A;  5C4W C;  3DKQ A;  4LBN A;  4Q0Q A;  3GZT B;  3MFA A;  1O7F A;  3NJX A;  3ZYJ B;  5A1A A;  3K48 A;  2BVV A;  5KHH A;  1JHN A;  3BOW A;  2WT1 A;  4S2H A;  5L9R A;  5JZG B;  1NA1 C;  2HWD 3;  4AHW A;  3O1U A;  3AC0 A;  1AL2 2;  3OY8 B;  1WMD A;  2W52 A;  4UYB A;  1R09 3;  1Z7S 3;  4DNY A;  5A3W A;  3GBW A;  1L3J A;  1VBA 1;  4FFG A;  1K5M C;  3AP4 A;  2WSV A;  2VOX A;  4QX8 A;  2W5F A;  1ZRE A;  2O0O A;  1C5H A;  1VBA 2;  4XAC A;  3ZXA C;  3WNN A;  3ZFF B;  2JEN A;  2Y38 A;  2XHK A;  3A7Q A;  4HVR A;  5JIA A;  3EQE A;  4A3X A;  4A6S A;  2FBE A;  4Y33 A;  1R09 1;  1TNF A;  1Z7S 1;  2I45 A;  4BCU A;  4LOS A;  1KFU L;  3WNK A;  2ET7 A;  5C70 A;  1QU0 A;  5BNP A;  4I0A A;  4A7Y A;  2XPJ A;  1MQT C;  3ZYR A;  3K75 B;  2FHR A;  4YLZ A;  5JI9 A;  1N3O A;  3H1W A;  1JYW A;  1EPW A;  4LBQ A;  3FJS A;  2FDI A;  1EP0 A;  2D6L X;  3AMP A;  5EPA A;  4LA2 A;  4W65 A;  4CDQ A;  5A3L A;  3BTY A;  3MV1 1;  1BZW A;  2EIG A;  2K2S A;  3LGR A;  4NHK A;  3PVB B;  3PMS A;  3Q8E A;  1V00 A;  4RR3 A;  5CVR A;  4YG3 A;  1SPP B;  1Y4W A;  3LIH A;  3PJY A;  1W6N A;  2IXL A;  2VUC A;  1UMI A;  1ZZ9 A;  1LOD A;  1GWL A;  1ULE A;  2PHR A;  3NNM A;  4LIU A;  5CYY A;  1RHI 2;  4QPW A;  2D6P A;  2FDF A;  2OUJ A;  2PHF A;  3VZK A;  2PFW A;  2C9K A;  4H55 A;  2Y6K A;  4YWA A;  4B4Q A;  2W92 A;  2WUH A;  1WA6 X;  4FFF A;  4NHX A;  4R4X A;  1O4Z A;  5D8A C;  5AVP A;  2HEY F;  3VZO A;  5DZF A;  4BWO A;  4QX3 A;  3KHB A;  3SCH A;  4TLF A;  5L7O B;  4JHT A;  5LEK A;  5G05 L;  2XQX A;  4G9S B;  1UYX A;  1RUE 2;  5FY1 A;  1O8P A;  1AR6 1;  1JYX A;  1QJY 2;  4IE7 A;  2JIJ A;  2WRA A;  4DMI A;  1MVQ A;  4XBQ A;  2RMU 2;  5APA A;  3FN9 A;  5FYB A;  2WFF 1;  2VUA A;  1Q8P A;  1A34 A;  2C9A A;  4FPE A;  4YAR A;  4QHZ A;  1NX9 A;  2VPV A;  4ZY9 A;  1RUC 3;  5CEH A;  3KHC A;  2XGX A;  3VKN A;  5LA2 A;  3GXU A;  4XCA A;  1OOP C;  4EN9 B;  1I1E A;  1OBN A;  3APB A;  3J4U H;  4XFF A;  5A7Q A;  4NAM A;  1W8W A;  2IZW A;  1RGS A;  2D6N A;  4AW7 A;  1AXY A;  1JOB A;  4LK7 A;  2VMC A;  3ROU A;  1E5H A;  4BOW A;  3ACG A;  2PXJ A;  1GZW B;  2W46 A;  2OT7 A;  1PO1 3;  1NLQ A;  3Q9O A;  4JTN A;  1B35 B;  5CU1 A;  2WJS A;  3HMY A;  3VBF B;  4B7K A;  5FZD A;  4R9D A;  3ZXF A;  5CIS A;  1MS3 A;  1G7Y A;  2JWP A;  4L99 A;  4O9E A;  1YIF A;  4JGY B;  3BOP A;  4MXW B;  1U0A A;  5DUW A;  2A1X A;  3VDD B;  2VUL A;  3PUI A;  3VBH C;  1CQ9 A;  4ASK A;  1IPJ A;  2BW8 A;  3ZN6 B;  4G3Y C;  3THT A;  1CAX B;  1JW6 A;  3OF1 A;  2YFU A;  4YGC A;  4QPI B;  4CEY C;  3AMQ A;  4YVS C;  3NNL A;  2VOV A;  3WZ1 A;  4FXK B;  2D6K A;  4XDP A;  2P3K A;  1VJ2 A;  4HBN A;  2VMG A;  4JC1 A;  4OZO A;  4BLJ A;  4NVP A;  3H8O A;  2VZV A;  1A78 A;  2W9X A;  4XF9 A;  4XUR A;  3USS A;  4DXT A;  2IFW A;  2ZGM A;  1F5J A;  4YGB A;  1RJ8 A;  1ND3 A;  3UYJ A;  5BNQ A;  3W9A A;  5IVC A;  1CZS A;  5F3C A;  2NLR A;  1PMI A;  2YU1 A;  5GLV A;  2VW0 A;  1JYV A;  2ZEY A;  2Q8O A;  5CIR A;  3AYC A;  3M8L A;  4RS5 C;  4LUK A;  2QQI A;  4NHY A;  1G9D A;  2Z4F A;  2GMM A;  5CKQ A;  4XJA A;  4OI1 A;  5A80 A;  1UIJ A;  3L2H A;  2WNU C;  4CP9 A;  1G9C A;  1IQD C;  5JR2 A;  2XBO 3;  1QH6 A;  2R04 2;  4DB5 A;  4QKF A;  4YW5 A;  2ZMN A;  2UU8 A;  2IWG B;  3NV3 A;  5C9A B;  1YFY A;  3IPV A;  1UX7 A;  1RUG 3;  2OS2 A;  3LFI A;  1AR7 1;  3LEG A;  3Q8F A;  4CEW A;  4LUL A;  4OUL A;  1RUF 2;  4X6R B;  5FBJ A;  4D6S A;  1SLI A;  4D94 A;  5FPU A;  2QQO A;  1DP0 A;  5I0R A;  2R0H A;  5A7W B;  4LOR A;  1ULO A;  1OPM A;  1QJY 3;  3VHP A;  4DEQ A;  5FXV A;  2LTN A;  1H9P A;  1PIV 1;  1S0C A;  3POS A;  5J98 B;  1ASJ 3;  2VU9 A;  1Y9G A;  2B8M A;  2WFP A;  4Z2A A;  2JIC A;  2A3W A;  2ILM A;  2XVG A;  2W0X A;  2J1T A;  5FYZ A;  2OKX A;  2VVD A;  3AK0 A;  4QKB A;  1XSQ A;  2QTW B;  2OII A;  3JB4 C;  3K46 A;  2YGL A;  1W0P A;  3MBW A;  4OHY A;  5AC9 3;  3HN3 A;  2VUJ A;  3N3H A;  2ARC A;  1YQ5 A;  1J3R A;  1K5M A;  3ME2 A;  5FCC A;  3KMH A;  4LBQ B;  5KHK A;  3NV4 A;  1G9A A;  1S2B A;  1ULD A;  1EV1 2;  4AXO A;  2VZ1 A;  3PUH A;  4N43 B;  1Q56 A;  1DLC A;  1IGO A;  2XVL A;  2QJV A;  2IVJ A;  1ODN A;  1W8Z A;  1SPP A;  3BIW E;  4AHX A;  4AOC A;  4B29 A;  4RQP C;  1XNK A;  2OYZ A;  5JSO A;  2GDF A;  4OHZ A;  3W5M A;  1L7Q A;  5KC5 A;  1JU3 A;  4AF9 A;  2KD7 A;  3ETQ A;  3VKL A;  2JG9 C;  2XJR A;  1WGP A;  3WUD A;  1JZ3 A;  5FMD A;  1Q43 A;  2VBP A;  2ZGK A;  4HKL A;  3RI9 A;  2P3I A;  2ZS6 B;  4L9B A;  1O3Q A;  3BUC A;  1MS9 A;  1DG6 A;  1V0A A;  3S7E A;  4RGG A;  4NII A;  3W58 A;  1PM7 A;  4TXW A;  4KWU A;  2RDR A;  3SKJ E;  4M4P A;  1H6Y A;  1AVB A;  2IXC A;  2WLQ A;  2VMH A;  1LOG A;  3BPS A;  3G6J B;  5A1F A;  3UNP A;  4V2V A;  1SLC A;  4XIO A;  5FYT A;  1ONA A;  1CAU A;  4LIT A;  2GC3 A;  3MDP A;  3P5B A;  1NZC A;  2GND A;  4LBM A;  3KM5 A;  3U4X A;  3V0B A;  3N9M A;  4FP3 A;  4XEZ A;  2R49 A;  3IZO A;  2XJT A;  3F95 A;  4AFD A;  3NAP A;  2NMO A;  3EO6 A;  2YBK A;  4YZ2 A;  4PIY A;  4GMP 3;  4URT A;  1TE1 B;  5FP3 A;  1F15 A;  5IK8 A;  3AFG A;  5BNO C;  5FLI A;  4XYX A;  4F8A A;  5IVV A;  2RMU 3;  4LHN A;  4MGK E;  1ZZ8 A;  3O0X A;  3I7D A;  4LO4 B;  4FPG A;  4LQR A;  4QPY A;  4C90 A;  4QXK A;  4YZ3 A;  2V72 A;  5F5I A;  5GAL A;  1VBD 2;  3OGG A;  1FMD 2;  5ACA 2;  3I3M A;  2NYY A;  2VMF A;  2WII B;  4O9G A;  2JIG A;  1UWW A;  4LBL A;  3LIG A;  3R4U A;  4FAH A;  1H8T B;  2AEZ A;  2J7M A;  1M06 G;  2RM2 3;  3KF5 A;  2ZAH A;  3VBF A;  1QJU 2;  2FZ1 A;  3LSD A;  3WNX A;  4HT1 T;  3N35 A;  1IKQ A;  1PGS A;  1OLM E;  3WY6 A;  2OPK A;  3I2I A;  3C2U A;  4I09 A;  4IGQ A;  4XAE A;  4AVC A;  3RPQ A;  2CWM A;  3CJI C;  1MS5 A;  4FVV A;  1ZBE 2;  2W1Q A;  4NHL A;  2WZE A;  1Y43 B;  3O14 A;  4GB3 2;  1X33 A;  3KCY A;  2PAK A;  1WA4 A;  1CPM A;  3A0N A;  3WW4 A;  4GJZ A;  2P34 A;  4JKL A;  1RUN A;  2PQS A;  1ST8 A;  2D3P A;  4ATE A;  2J1R A;  4CYD A;  5EXO A;  5JSP A;  4E8C A;  2YRO A;  1C8N A;  2GMP A;  3HBZ A;  2V5Y A;  3M2M A;  2DVG A;  3MUY 1;  5FFO C;  5JXI A;  2CGP A;  4BXS V;  4XF0 A;  4FAG A;  3I54 A;  4MGS A;  3CLP A;  2ZTN A;  4N43 A;  1PIV 2;  4FP2 A;  3SC7 X;  2W87 A;  3FC0 A;  4AGV A;  2FDH A;  1C1L A;  3SIS A;  2RDS A;  2E9Q A;  4YW3 A;  1CIY A;  1UIK A;  1OVP A;  1ZA7 A;  5JAX A;  2DVD A;  3H50 A;  2D97 A;  4ASM B;  3OYW B;  1AR7 2;  4B8E A;  1AF9 A;  1C5I A;  3VD7 A;  4WVM A;  3V56 A;  1W2A X;  4YZ4 A;  1ND3 C;  2YG0 A;  2LAL A;  2X5I C;  4AG4 A;  1NKG A;  3LA7 A;  4QX5 A;  2MEV 1;  5FZA A;  1PGL 1;  3FL7 A;  2DCZ A;  3O7O A;  4NOT A;  4OLL A;  5H9Q A;  4CEW B;  2RG4 A;  2X29 A;  1PO2 1;  4N53 A;  1MS8 A;  4P9W A;  1UY2 A;  1VR3 A;  5F5Q A;  1NCR A;  5B2G B;  3PDQ A;  5L9V A;  5CKN A;  3MLK A;  1W2U A;  1WLW A;  2Q0A A;  3H8R A;  4GA9 A;  3GHM A;  3I3B A;  4FQZ A;  5EWS A;  1J83 A;  1U5Y A;  1W6Q A;  5FZ7 A;  2ZAA A;  5F5C A;  5LY1 A;  2MHF A;  3ILR A;  4KG8 A;  3AJZ A;  2ZGO A;  4AQ2 A;  5IK4 A;  1COV 1;  1C8M 2;  4QXB A;  4LBJ A;  3DYM A;  2B9U A;  4ZU7 A;  2G19 A;  2QQV A;  3M1H A;  1CAV A;  1CZT A;  3FX3 A;  5C3Q A;  5CAD A;  1UNB A;  2RR1 1;  4Q4W 1;  2W3J A;  3D4K A;  1IHM A;  4LLF A;  1HW5 A;  1FAT A;  1NQJ A;  3T0A A;  5FZ8 A;  2BJS A;  1R1A 1;  2Q4S A;  1FPN 2;  5FZO A;  3WNL A;  1UCX A;  2ZGU A;  4CUC A;  1X8E A;  4IUG A;  1RED A;  4YM0 A;  3ZLI A;  4JRL A;  4FBF A;  3JU9 A;  1OA3 A;  3WF0 A;  3HJR A;  4YW6 A;  1RUJ 3;  2HWE 3;  4CDU B;  2KM2 A;  2LRO A;  3A22 A;  4CU9 A;  5C3S A;  3OEB A;  4FFI A;  2WZP P;  5K8S A;  1FAY A;  2VQA A;  3WW2 A;  2OVU A;  1HV0 A;  2QUO A;  1CD3 G;  4DEV A;  2D6M A;  3ZXK A;  2G9F A;  1LOF A;  3A0K A;  1ZBA 1;  4B3N A;  2X10 A;  3E6B A;  4LE3 A;  5DMY A;  1DQ2 A;  1RXG A;  2PHW A;  4Y1U A;  4OMD A;  2HBU A;  4Y1X A;  2DUO A;  5H9R A;  1V6L A;  2DCT A;  2ZX2 A;  3HWJ A;  4IXL A;  4RQP A;  1X82 A;  3DUI A;  5T5O A;  3W5N A;  4Y5T A;  3T3Y A;  2JDK A;  2WNO A;  1CAU B;  2YFZ A;  4QKD A;  4SBV A;  4AFB A;  5T55 A;  1W6P A;  2V5D A;  3BCW A;  5DUV A;  4BQ3 A;  1OMI A;  5L9B A;  3EBR A;  4E2S A;  3JBG 3;  4FOV A;  3V0B B;  1VP6 A;  3U11 A;  3A4U A;  3B93 A;  5EIY B;  1W0N A;  2ZOE B;  1P8J A;  1HX6 A;  1D2Q A;  5DDJ 3;  5FPB A;  2A6X A;  3SHR A;  3RSJ A;  1ODM A;  3N7M A;  4LHK A;  3B00 A;  2VE1 A;  1QGL A;  1UX6 A;  3CF6 E;  3POB A;  3WP6 A;  3ZXJ A;  3B5L B;  4MG2 A;  1AR9 1;  4IDZ A;  1V6I A;  1RIR A;  3U37 A;  3ACH A;  4HZF A;  1RUO A;  1XYP A;  4LNV A;  1FYU A;  2XH6 A;  3E97 A;  1GR3 A;  3KVA A;  3ZM8 A;  4XHX A;  4G4F A;  5A32 A;  3O1O A;  2FD8 A;  4U36 A;  4XHB A;  5JVV A;  5C8C B;  3J7M A;  5J09 A;  4MH0 E;  3CBN A;  2ZHM A;  1H2N A;  1CPN A;  2SLI A;  5FZE A;  1N3P A;  2LW8 A;  3AKS A;  1QQP 2;  1ENX A;  2VD7 A;  4AAP A;  3N9P A;  1W2O A;  2YC0 A;  3KT1 A;  4MAD A;  4IEY A;  4JV4 A;  4QDR A;  4E4D X;  3FE5 A;  3NKG A;  5L7O C;  1QJU 3;  2Z2S B;  1XPW A;  5FV3 A;  1OT5 A;  1JU4 A;  5D2A A;  4QQL A;  3D0J A;  1Y3T A;  3INA A;  4JKK A;  2NMN A;  5HCA A;  4L2N A;  1J1L A;  1AXZ A;  3M3O A;  1H1A A;  2VC9 A;  3POG A;  5A1L A;  4H3W A;  3I2D A;  4XDO A;  2W94 A;  1GZW A;  4FFH A;  2A3Y A;  2VNO A;  5JPM B;  2WKK A;  3VBU A;  1ULC A;  5A3P A;  1QXR A;  3OOX A;  1PNG A;  4EWA A;  3MUZ 1;  1RUJ 2;  5FYV A;  4XMA A;  4KG0 A;  1B09 A;  4M3C B;  3POJ A;  2RV9 A;  1NLS A;  3FWE A;  4EN6 B;  5FZM A;  3VBR B;  1ZRF A;  1AL2 1;  2VUD A;  1K3I A;  1CVN A;  4C8D A;  1VRH 3;  1WLD A;  3AYD A;  5F7U A;  3SIT A;  3NO8 A;  2HWB 1;  4OMC A;  1FMD 1;  1KJL A;  4KMQ A;  4BU2 A;  1MEC 2;  2AEN A;  2Q5T A;  1IS5 A;  3UKV A;  4QAW A;  2VZU A;  4Z8B A;  3WCR A;  2C26 A;  1GKB A;  2YMZ A;  1SCS A;  3LZZ A;  3JZV A;  3VZN A;  2WS9 1;  4EWE A;  1LHO A;  2OPW A;  4QGN A;  3ON7 A;  5G04 L;  1W8F A;  1R09 2;  1Z7S 2;  4YVS B;  2GH2 A;  4CEY B;  1SBE A;  1NCR B;  3CKH A;  5LCW L;  2NN8 A;  4ZPI A;  3RI8 A;  2AH2 A;  1V6K A;  3OGV A;  3ZFE C;  1OQ1 A;  4Y22 B;  3VKF C;  5DG2 A;  1W90 A;  1CZV A;  1LHV A;  2BDR A;  2X5I A;  4P08 A;  2FQP A;  4GMP 0;  1XBF A;  2WC2 A;  1QMJ A;  1Z0H A;  1KS5 A;  1RUG 1;  2ADE A;  4L0P A;  4P9G A;  4XPV A;  5F8P A;  2HH9 A;  4BQ5 A;  4CCD A;  1LB2 A;  3RS6 A;  1VB2 A;  2E31 A;  3ZDV A;  3POW A;  5IHR A;  1FOD 1;  3RMX A;  4ZXE A;  4CP1 A;  4RD7 A;  1OOP A;  5FJK A;  1YO8 A;  1AYN 2;  2JEM A;  4PT6 A;  1TME 2;  5DDJ 1;  1VMJ A;  4GWN A;  5FDB A;  3N7J A;  1UO9 A;  2D43 A;  3MIB A;  5C8C A;  1D0G A;  3JXS A;  1G86 A;  5FK8 A;  1QJF A;  1QQP 1;  3NAP B;  3OUH A;  1IS6 A;  1GFF 2;  4V1P A;  5LZ6 A;  1F4A A;  2CTV A;  4OUS A;  5H9S A;  5FZ1 A;  1O3T A;  2JDP A;  1OH3 A;  4CCL A;  1DGW X;  5AFB A;  4YYO A;  2EA7 A;  1W8N A;  2IXI A;  1XE7 A;  4MVT A;  3B9C A;  1POV 3;  4HPK B;  4QQP A;  2R06 2;  5A70 A;  3VBH A;  1OLR A;  4GUL A;  4DUV A;  4Z1V A;  1HDK A;  1PZ8 A;  4YW7 A;  3M70 A;  1N47 A;  4NRQ A;  3VKM A;  1OUR A;  2RS3 3;  4GWJ A;  4YVW C;  2UYA A;  4XJ8 A;  2UWA A;  2JX9 A;  3DCQ A;  2VTF A;  1WWY A;  1ZA4 A;  5JZG A;  3V0A A;  4OUE A;  4MZU A;  5CNA A;  3AZZ A;  1O4T A;  1NY7 2;  3BAL A;  1NA1 B;  2YY1 A;  4DY5 A;  2NZ9 A;  2D44 A;  1QIQ A;  5FBZ A;  3VBS A;  2GN7 A;  3WG1 A;  5LEJ A;  4CCO A;  2QQU A;  3CMG A;  1SLL A;  4QU2 A;  4NJ4 A;  1GMM A;  2BGC A;  3NST A;  4MHU A;  2QQP A;  2ZX4 A;  4DZG A;  2QQW A;  1HIX A;  3ZO0 B;  1XNB A;  2KA3 A;  5FAX A;  2EIB A;  1FI2 A;  4AWD A;  1LEC A;  1ULP A;  2EID A;  4PCR A;  4CE8 A;  5JOX A;  4OI0 A;  2I07 B;  2V4V A;  3PIG A;  2BFU L;  4Q4X 2;  3AMM A;  4XBL A;  3VLB B;  1RHI 3;  1AR9 3;  4Q4X 1;  3JCI A;  3SLI A;  2QBX A;  2W08 A;  4JDM A;  1QQP 3;  5ACA 3;  1VLN A;  1AR8 2;  2HEV F;  3MW2 A;  3BTX A;  2EXH A;  4FPF A;  2Q30 A;  2XL9 A;  2WR9 A;  4DXZ A;  1TVG A;  2ENR A;  1R08 1;  2PA7 A;  2HWF 2;  5DAP A;  2ARX A;  4XTM A;  4BHP A;  1GQH A;  2BGO A;  4HSJ A;  1Y9M A;  5DG1 A;  1YQ8 A;  2FMD A;  4YGE A;  1IZ3 A;  4RHV 3;  5HCH A;  3CHX A;  1LHU A;  1S0B A;  2QFE A;  2WAB A;  3M3Q A;  1YLL A;  2PTM A;  4FPO B;  3WSO A;  1GWK A;  2D3R A;  3VDB A;  5FZG A;  2GZW A;  5F32 A;  4E2G A;  2R32 A;  4GH4 B;  3NJV A;  1YRZ A;  3OD4 A;  4I3P A;  2R7E B;  4QDS A;  3VBU B;  3AKP A;  1DGW A;  4N53 B;  3RDI A;  3HQU A;  4AI3 A;  3H8X A;  4H7M A;  1WW4 A;  3BTA A;  4YM1 A;  1O6U A;  5EFU A;  4EQV A;  1JH5 A;  2XKP A;  1LGC A;  1LHW A;  4NPM A;  3WVJ A;  4PIZ A;  5F39 A;  4AI2 A;  4HKO A;  1V9U 2;  1S0J A;  4N7U A;  2DTW A;  4ES8 A;  1VBB 1;  2JXA A;  3BTZ A;  4QD2 A;  3VN4 A;  2NP0 A;  2RS5 1;  1GSL A;  1DFQ A;  3I3Q A;  4WBB A;  1DZQ A;  2C24 A;  2P3Y A;  2G1M A;  3VHO A;  4CDW C;  5D1I A;  5FO9 B;  5CG9 A;  1LED A;  2C1F A;  2VZQ A;  1BMV 2;  3UL2 A;  4FTS A;  3JUU A;  1XB9 A;  4R9B A;  4K3U A;  4P9Y A;  1JZ6 A;  2R07 3;  1G6N A;  1HRV 2;  2F4L A;  2MEV 3;  2WN2 A;  2XWJ B;  4A6O A;  4OHV A;  4NRM A;  1C3H A;  3CJI B;  5C5T A;  1C28 A;  1PK6 A;  2OA2 A;  4BM8 A;  1AZD A;  3HT2 A;  3BB6 A;  3ZXE A;  3ZKY A;  1IQA A;  2RM2 1;  5FTT C;  2VQT A;  5A7N A;  3OYW A;  2OW4 A;  1D4M 3;  1BYH A;  5LB6 A;  5LA1 A;  2JKB A;  1GOH A;  1KDK A;  2BWA A;  1VAK A;  1CON A;  5EYX A;  2RS5 3;  3FLP A;  1KDM A;  4XXA A;  3IMN A;  1PO1 2;  5F5A A;  4LT5 A;  3IN9 A;  1TG7 A;  4FPC A;  4NRO A;  3ETP A;  2BNO A;  1NZI A;  1W6O A;  4CU7 A;  1QOS A;  3KD4 A;  5KWR A;  2VVF A;  1AR8 3;  5M0T A;  5I0T A;  2JDY A;  2PHD A;  4Q27 A;  1XXN A;  1OA4 A;  2WO2 A;  2HWC 1;  1QDC A;  4LKS A;  3O1R A;  3KT4 A;  1ND3 B;  2GC0 A;  4XTP A;  5EZW A;  4BQW A;  2UYB A;  4DFS A;  3T0D A;  3ATG A;  3THC A;  1DYP A;  5GZE A;  3HD8 B;  3T4V A;  4A2U A;  4BQX A;  1F31 A;  4M00 A;  5FOJ B;  1GV9 A;  3W21 A;  4CCK A;  2R6Q A;  1VAL A;  3AXE A;  2J1A A;  1S0G A;  3H9A A;  3WEZ A;  1ENS A;  3NRU A;  4EYU A;  5LRR A;  2ZZQ A;  4IV3 C;  3NKT A;  4UFL A;  5FYI A;  5J3U A;  2K9Z A;  2WFF 3;  3CEW A;  4GAL A;  1NT0 A;  1VAV A;  1GZC A;  2CAU A;  3ZR5 A;  5JXH A;  5ISL A;  4Y5S A;  4AVT A;  2K46 A;  1CJD A;  1NE6 A;  1JUH A;  5FO7 B;  5FZO B;  2YDE A;  1UZV A;  4U2A A;  3IPV B;  3KLS A;  3I2G A;  3RZZ A;  4F3J A;  4IET A;  3CL1 A;  3FMG A;  2BOJ A;  1YQC A;  1W6M A;  2Y6F A;  3I2K A;  3K2O A;  4KWK A;  3SH4 A;  1U5I A;  4NPL A;  4AED B;  4P14 A;  2B7Y A;  2WZR 2;  2E26 A;  4EZH A;  2HWF 1;  1RVF 3;  5D8A A;  5FPV A;  1JHJ A;  1SHW B;  2EIC A;  2VZR A;  2WO3 A;  5IK7 A;  2H0V A;  3P3N A;  3JD7 1;  3SCG A;  1Z78 A;  4K21 A;  1S0I A;  2JB8 A;  3ORJ A;  4ORF A;  2GNM A;  1ZRR A;  5IK5 A;  3R4S A;  4XET A;  4QQO A;  4B7E A;  3GJA A;  4XQD A;  1RUH 1;  4QB2 A;  5HXM A;  1ZRD A;  1W9Y A;  2QQK A;  4Q4Y 1;  1POQ A;  2LRP A;  3ZYH A;  3KGL A;  5DXD A;  3L2Y A;  4CDU C;  1EV1 3;  4IE0 A;  1SZB A;  3VHR A;  4IER A;  2YZ4 A;  3HIF A;  5K9Y A;  1PMJ X;  2PYT A;  4HXC A;  3ZMO A;  1WLT A;  1W03 A;  2ZEW A;  1BQP A;  1UPS A;  1QJX 1;  1HRV 1;  1ZRI A;  3FFQ A;  1REE A;  5AC9 2;  1NXM A;  1C8M 3;  4A7Z A;  1ASJ 1;  5FZK A;  4A4A A;  1XNT A;  1N1V A;  4RL7 A;  1PK6 B;  3FFZ A;  4CDX A;  1MEC 3;  3K4A A;  2DDU A;  3OBA A;  4IV1 C;  4RR3 C;  3ZN5 A;  4A44 A;  3PIJ A;  4EV0 A;  2VO5 A;  5FZB A;  3O12 A;  5HCB A;  1SFY A;  5JXG A;  5T50 A;  1A8M A;  3O1P A;  2JDA A;  3N9N A;  5CFC C;  1LEN A;  4QT6 A;  2JG9 B;  2R16 A;  1DYK A;  3DPR A;  3NJZ A;  4ZU4 A;  2TBV A;  3UT0 A;  3ZOI A;  1JYI A;  1FT9 A;  3DXT A;  3VKO A;  4CXW A;  4L8Q A;  4GH4 A;  4XFI A;  4DO0 A;  5L19 A;  4ZXK A;  1V70 A;  4DXS A;  1ZZ6 A;  2IFR A;  3HNB M;  2DYC A;  1IS4 A;  2VTX J;  5FRE A;  4NWV A;  4R9A A;  4YFZ A;  4DUW A;  5HXV A;  2XJP A;  3IDE A;  1RIN A;  2HJI A;  4QM8 A;  5FKC A;  3ZR6 A;  1WCU A;  4XUN A;  5F6L B;  5CG8 A;  1AHS A;  4NIH A;  3WX5 A;  4CUB A;  4UBH A;  5DAV A;  3SKV A;  1BK1 A;  2VCB A;  1VMH A;  2XJS A;  3I2H A;  5DUX A;  3BI3 A;  4K7J A;  1OF3 A;  4LBQ D;  4UWD A;  2A70 A;  4HL0 A;  4YG6 A;  4QDQ A;  4BK4 A;  1POV 0;  3AYA A;  3V64 A;  4DIQ A;  4AZZ A;  3FUQ A;  2J22 A;  5BNO B;  4LO5 B;  3NNF A;  1AR8 1;  3PVO A;  5C33 A;  1F35 A;  2RM2 2;  3T1L A;  4D8M A;  5J48 A;  4IND A;  2BGP A;  3CO2 A;  5IVB A;  2DUR A;  4PLN A;  5K0U C;  4RA0 A;  3N7L A;  2Y33 A;  2A6V A;  3NV1 A;  3C3V A;  3WQB A;  2XBO 1;  4H14 A;  4AFA A;  3VBR A;  3LEM A;  4FPH A;  5DPN A;  5BNP B;  2RHP A;  2GNT A;  1UY0 A;  1XNA A;  3PVE A;  1QY4 A;  2VG9 A;  1H2K A;  2AC1 A;  1JOD A;  1OQD A;  3K77 A;  2BER A;  4M3C E;  4D0Q A;  1VPH A;  5FXZ A;  3PUA A;  5FO8 B;  3O1T A;  3WG4 A;  3MGU A;  4KGQ A;  5FYS A;  2UY9 A;  4CDQ B;  2BQP A;  1CN1 A;  2JG8 A;  1SEF A;  3AP6 A;  2O8Q A;  3AZX A;  1NCQ B;  4Y1Z A;  3AZV A;  4YM2 A;  3TN9 2;  1ZX5 A;  5GZD A;  3IM0 A;  1PVC 3;  2IXH A;  1L7R A;  1RVF 1;  1OUS A;  3T30 A;  4Z82 A;  4XC9 A;  2XUM A;  5KC6 A;  1RVF 2;  5DAB A;  2Y34 A;  3RVH A;  1JZ4 A;  2WNV B;  4JQT A;  3WF4 A;  3MFC A;  5L36 A;  4W6Y A;  1BBT 2;  3T4H B;  4LBO A;  1D7P M;  3WG3 A;  1WBL A;  2CSG A;  3T2T A;  4F7Z A;  4COW A;  3UK9 A;  5LRS A;  1XYO A;  2MNG A;  3RYP A;  1VBE 2;  3IAP A;  5FPZ A;  1I5Z A;  3ZSL A;  2ZML A;  1MR5 A;  1DQ4 A;  5JWP A;  2B5H A;  4KBB A;  4PDW B;  2XWB B;  3QH6 A;  1SCR A;  3C7O A;  1S0E A;  1QKQ A;  5BV6 A;  4JCK A;  2V09 A;  3LAG A;  1AXK A;  3HVD A;  4NRP A;  1AJK A;  5BXX A;  4UFM A;  5FXX A;  3WP3 A;  4DY3 A;  3G7D A;  5FYM A;  1FPN 3;  1NOV A;  3OB8 A;  5FUP A;  4LEJ A;  2VCA A;  4L97 A;  4UOJ A;  4CEW C;  4FOQ A;  3QBQ A;  2WO1 A;  4HON A;  1DLL A;  5KHG A;  2F6B A;  4HKW A;  4XFH A;  5FLH A;  1BMV 1;  3WDX A;  2D93 A;  4QX7 A;  1KD7 A;  1RMU 3;  1UU4 A;  2ARB A;  5A6Z A;  1KRI A;  3IKW A;  4I30 A;  1XNC A;  3ZFG C;  4LUM A;  1JOP A;  1U5X A;  1XRU A;  3DYP A;  1W9S A;  3BOD A;  1UOG A;  1GP4 A;  3WIN E;  1JN2 P;  3MF9 A;  3NAP C;  1OD3 A;  4QQH A;  4KI5 M;  5DDJ 2;  2CL2 A;  4BIS A;  1ASJ 2;  4XDQ A;  2Y60 A;  4YW2 A;  4BQY A;  3MPB A;  1V9U 3;  4N9H A;  1IG3 A;  5E6H A;  3VBS B;  2ZEX A;  4XJU A;  5IUQ A;  1YFX A;  5LW9 A;  3NW4 A;  2F17 A;  4NR1 A;  3ALQ A;  3CDZ B;  4Y4Y A;  2PQQ A;  2XBO 2;  3AFK A;  4UW3 A;  2VMD A;  1LKN A;  3VDA A;  5FUI A;  4Q4V 1;  2A7A A;  2HYX A;  5GLZ A;  4COV A;  2FDJ A;  3MYX A;  2KR2 A;  4WM8 B;  3WD5 A;  3P3P A;  5A3T A;  2P2K A;  3M7A A;  4IE6 A;  5JMC A;  3QCW A;  4LO7 A;  3ZFE A;  3HNY M;  2AEY A;  5FRA A;  2R04 1;  1W9T A;  1FXZ A;  5CFD B;  3T2P A;  3HEI A;  1VE0 A;  3WQ7 A;  1CR7 A;  4ZKT B;  4GZ9 A;  4RFR B;  2QKD A;  3DF0 A;  2A5Z A;  3EJK A;  3PJQ A;  4GAZ A;  4KH9 A;  4XFB A;  4Y20 A;  1AR9 2;  3AM2 A;  3OTF A;  3WNO A;  3TAY A;  1W2N A;  2A75 A;  3VBO B;  4QPI C;  3PTR B;  4CDX C;  4CCJ A;  3ZKU A;  3CJI A;  2WQ4 A;  2EXK A;  1OLQ A;  1WCQ A;  1RUD 3;  2RS1 2;  2VR4 A;  1Q8O A;  2YPJ A;  3FZ3 A;  4PBP A;  4UFH A;  5T52 A;  2E51 A;  3ZXL A;  4CZS A;  4D3W A;  3A21 A;  5JSR A;  3WF1 A;  2HWB 2;  4AQ6 A;  5CFC A;  5EP9 A;  1FNZ A;  3DPR C;  4S2F A;  1H30 A;  3J7N A;  4XJ9 A;  1Q8V A;  3OEA A;  3RQ0 A;  1RUH 2;  1RYY A;  4ITC A;  3EMR A;  2W68 A;  4XW3 A;  4JRA A;  1GUI A;  3ENR A;  4JVA A;  5F1R A;  4XXP A;  4IEQ A;  1SMV A;  1GU3 A;  5FPL A;  3O5S A;  4RS5 B;  3SMH A;  4XUP A;  4PQQ A;  4GKY A;  4QPG C;  2CU5 A;  2EXJ A;  1KS4 A;  1RUE 1;  3MW3 A;  1WBF A;  1UOJ A;  2JD9 A;  3TWI A;  1RJ7 A;  4AE2 A;  2H0B A;  5C4W B;  2CWS A;  4FI9 A;  2GAL A;  2XLG A;  1H6X A;  4WM7 B;  2CGO A;  2ZZJ A;  4Y4R A;  3AMN A;  5HV0 A;  1LTE A;  5JZG C;  1AYM 2;  3T2Q A;  4BDV B;  3FLT A;  3NQH A;  1FOD 2;  1AYM 1;  2VW2 A;  1VBA 3;  1AL0 G;  3H7Y A;  1OI6 A;  3ILN A;  4QXH A;  2Y64 A;  3TN9 3;  3OPT A;  2BYV E;  1QNW A;  1DU3 D;  3QLQ A;  2VL4 A;  1YC6 1;  4AR2 A;  1QJX 2;  3OUI A;  2XML A;  2RJK A;  4HN1 A;  2ID4 A;  2WWU A;  4X8N A;  3ZFF C;  1I6X A;  4PIX A;  2JG8 B;  1HB3 A;  3TEY A;  4IW3 A;  3WHT A;  4HK8 A;  3IT8 A;  3ZPO A;  1NXD 1;  4L11 A;  4QQ2 A;  3WNP A;  5LWB A;  1SG3 A;  2ZGQ A;  5F3G A;  2JDU A;  1EUT A;  1JI6 A;  4KL1 A;  4IEW A;  4UT5 A;  3AL6 A;  1WD3 A;  2WA3 A;  4XJZ A;  4R4Z A;  1RUD 2;  1W8H A;  2P3J A;  1DHK B;  1X36 A;  1G9F A;  1GZT A;  2RS1 3;  4PLM A;  4AK3 A;  4CDW B;  2WNV A;  5FY5 A;  4CRQ A;  2AR6 A;  2JDM A;  4W8J A;  5C5U A;  5T5J A;  3LD8 A;  3WDW A;  4M3C A;  5I8T A;  1W3X A;  5JOW A;  4N90 A;  3ZSM A;  2DCK A;  5LBC A;  3K3O A;  3LCP A;  4LO8 A;  2D7F A;  1LEM A;  1F8V A;  4K6B A;  4HVO A;  5E16 A;  3AVS A;  2PHU A;  3GJB A;  3I8T A;  3Q8C A;  3VD4 A;  5FR3 A;  1UU5 A;  2CGN A;  4XFA A;  3VZJ A;  3BVC A;  1H1M A;  3VD5 A;  3WDY A;  1JZ7 A;  5KXB A;  4IGO A;  1D0H A;  3DKW A;  3MO4 A;  1MQT B;  5F2W A;  1J58 A;  4GJY A;  4TLG A;  5I0S A;  4OFG A;  1X8M A;  2LM3 A;  1WD4 A;  2Q1Z B;  4Y20 B;  1WW5 A;  1V6O A;  5T5L A;  4NIA A;  5FY8 A;  1CWP A;  2VXR A;  2VNV A;  4MSV A;  1D2S A;  5LBE A;  4D7S A;  1XE8 A;  1VB4 A;  1GZ9 A;  3GBF A;  2OZJ A;  2VOT A;  2IVI B;  2ZA9 A;  3U10 A;  1PNF A;  3WW1 A;  2EIE A;  2YBP A;  4ATF A;  2DCY A;  3N9L A;  4A45 A;  5C3P A;  3EYP A;  3RZG A;  2YYO A;  3UKT A;  4BK5 A;  2ARE A;  1R08 2;  2WDB A;  2EXI A;  2GU9 A;  3DV8 A;  2Y8K A;  4ES9 A;  3M3C A;  1OFN A;  5IVY A;  4XFG A;  1JS9 A;  5A7S A;  5D8A B;  3WP4 A;  5EV7 A;  2Q1F A;  3HBK A;  4IV3 B;  4C1X A;  5JDB A;  2LUW A;  3S30 A;  3WR0 A;  1GLH A;  3THD A;  4CCE A;  1X50 A;  1GP6 A;  2DUQ A;  1YXW A;  2JE9 A;  1W6Q B;  1K5J A;  1N3Q A;  3ACF A;  1ALY A;  3AP5 A;  3B01 A;  4UXA A;  3SQO A;  3OJB A;  3F2Z A;  3H3Z A;  4BLI A;  4O61 A;  4COU A;  4HSL A;  2R06 3;  3NNJ A;  2JJ6 A;  2J42 A;  1H8T C;  1UY1 A;  1V6J A;  1UL9 A;  2ZMK A;  3FHA A;  3JBG 1;  5EJZ B;  4AED C;  4OQ8 A;  2YC4 A;  4WVW A;  4YM3 A;  2W1S A;  4MGY E;  3ES1 A;  1J59 A;  4J1W A;  1CAV B;  3ZYF A;  3U0Z A;  3Q8B A;  4LE4 A;  1DYO A;  3T09 A;  1RUI 1;  4CP2 A;  5ABJ C;  5F6K A;  3CZU A;  4XUQ A;  4MXW A;  3N9O A;  1HN1 A;  3CIH A;  1YFW A;  3K4Z A;  1W99 A;  1T6B X;  3TYJ A;  3U07 A;  1OD5 A;  4FXG B;  2Z5W A;  4BQ2 A;  5JOZ A;  5C71 A;  3V0A B;  4IQP A;  1US3 A;  4OVE A;  4RHV 1;  4Z2W A;  3C7F A;  5IAX A;  2DV9 A;  5T54 A;  5FZF A;  3KF3 A;  1H4G A;  3ZIX A;  1HRI 2;  3ACL A;  3AZY A;  1Q5O A;  3MF6 A;  2VM9 A;  1HRI 1;  3MIH A;  3OD0 A;  3VV1 A;  2OQ7 A;  3QD6 A;  3POF A;  4PI2 A;  4JGY C;  3ZVX A;  2QDR A;  3VDD C;  4EN8 B;  5JCT A;  3VL9 A;  2PMW B;  4QPI A;  3PME A;  3NV2 A;  4Q8L A;  2PEL A;  3ZSE A;  4E4H A;  1OLM A;  2VOK A;  4LHS A;  3C7H A;  5GLT A;  4XVH A;  3AKR A;  3T0B A;  5EJ1 B;  3ZMN A;  2IXK A;  1RB8 G;  3U75 A;  1BHG A;  1H9W A;  5C7G A;  3BIE A;  1FPN 1;  1HN0 A;  4Q4Y 3;  4WM7 A;  1EUU A;  3JB8 A;  4Y26 A;  1RUD 1;  2W47 A;  3P6B A;  4W50 A;  3RWN A;  1HJG A;  1ULF A;  1SLT A;  3UGH A;  4UW6 A;  5FY4 A;  5GLU A;  2ZHN A;  1FNY A;  3OBZ A;  3TB0 A;  1HB4 A;  4COZ A;  5DZE A;  2XG3 A;  4IEO A;  1YQ2 A;  3ZN4 A;  5A33 B;  2J1V A;  3AP7 A;  3IAQ A;  3WDT A;  3FHQ A;  4UF0 B;  4KGG A;  5EJ3 A;  5BNN C;  2E7T A;  1W8U A;  2A71 A;  3O1V A;  2UWC A;  4BIO A;  3THP A;  3WF2 A;  1PO2 3;  2HWC 2;  2ZX1 A;  2CV6 A;  3CZJ A;  1WKY A;  3WXP A;  4C0H A;  1RUF 3;  1CJP A;  2WNU B;  4LLO A;  5IAT A;  4PQ9 A;  4E2Q A;  1PGW 1;  2P37 A;  2FZ2 A;  5C9A A;  1G8W A;  4Q4V 2;  2ADD A;  1GP5 A;  3AB0 A;  4UFJ A;  2RVA A;  4CDU A;  1PVC 2;  3M3E A;  1ZM1 A;  2OUH A;  3SH5 A;  2EAL A;  4DOU A;  2PHT A;  1PVC 1;  5JIU A;  3BPZ A;  4KNC A;  1OFS A;  4CPB D;  4PLO A;  1K5M B;  5F3I A;  1W2T A;  2HYK A;  4Q4V 3;  4D69 A;  1D4M 2;  2NQY A;  2YXS A;  3VZM A;  3ZYI B;  3PUR A;  2CAV A;  3VZL A;  3WF3 A;  3S6P A;  3OG2 A;  4QB6 A;  2BRT A;  2CY6 A;  1A6C A;  5B4X A;  3NL1 A;  3WOG A;  5B4N A;  2DBI A;  1HB1 A;  1HLC A;  1K45 A;  2VXJ A;  3SXW A;  4CA9 A;  4QGL A;  1PZ9 A;  4OZX A;  3EHK A;  3ZYB A;  5GLW A;  2VZT A;  2RS3 2;  1AJO A;  2JEC A;  4E4Z A;  2JE8 A;  3JD7 2;  2O14 A;  1E57 A;  1F5F A;  2W1U A;  4XBN A;  5FQ0 B;  4EN0 A;  2LS6 A;  3GYD A;  3HAG A;  1T6G C;  3E6D A;  3J8F 3;  2Y0I A;  1XSR A;  2XON A;  3POY A;  2AGS A;  2R1B A;  2VH9 A;  4LMF A;  4EWD A;  1K12 A;  4YGD A;  1ND2 A;  2ZPX A;  4CCN A;  2QQL A;  4JKM A;  2WYF A;  2ZAC A;  3LKJ A;  5JPN B;  2DCJ A;  4WM8 A;  2GP5 A;  5C3O A;  5FP4 A;  4AVA A;  1XE0 A;  5A3M A;  2WT0 A;  2XUE A;  3OBR A;  4TSV A;  3WDV A;  2UWB A;  1OVS A;  3KSC A;  3ZX7 A;  3AP9 A;  5GM0 A;  4HK9 A;  2XJQ A;  2EVX A;  4K1Y A;  3NWK A;  1S55 A;  1YHF A;  2GME A;  1AX2 A;  2ZGT A;  5FZ3 A;  4MGT A;  1R1Z A;  3BN6 A;  2WZ8 A;  4BPZ A;  4QWN A;  2BVB A;  1R08 3;  2WAA A;  3WP5 A;  3WHU A;  2QQJ A;  4PDW C;  4MGZ E;  4BB3 A;  4Y22 A;  4XJW A;  1GNZ A;  5KXC A;  3H1Y A;  3LWC A;  3RGB A;  5GKA C;  5FKB A;  5GZC A;  2BPA 2;  2NPI A;  2WZR 1;  4RN5 A;  1IS3 A;  1URX A;  3MI8 A;  4DIN B;  2XOM A;  3VHN A;  2CDO A;  1MS4 A;  4CPB A;  3B69 A;  3NNG A;  5IW0 A;  1HV1 A;  2GSY A;  3GDB A;  1VBD 3;  4AFM A;  1NYW A;  1YCI A;  2BNN A;  4UF0 A;  2JB4 A;  2W1W A;  2RDN A;  4KU7 A;  2A6Z A;  1R1A 2;  2BP6 A;  2ZEZ A;  3I4I A;  4PI0 A;  4Q4Y 2;  4YW4 A;  3I2O A;  1KGY A;  4AI0 A;  5C4W A;  3E5Q A;  4E8D A;  4FOY A;  2FMY A;  3FUO A;  3KQR A;  1JYN A;  4HOO A;  2HEW F;  2IXJ A;  1QJU 1;  1YI7 A;  4UFK A;  3LDR A;  5GZF A;  1H8T A;  1SLA A;  5CBL A;  3KV9 A;  1W6M B;  3ZDS A;  4AED A;  2BTV C;  4URA A;  2Z42 A;  3HQR A;  2PLV 2;  3O0W A;  2DVB A;  2BV4 A;  4AEM A;  4ARX A;  5BPX A;  3TRS B;  5JXJ A;  1MZF A;  1L7L A;  1QF3 A;  1TMF 1;  1YQ6 A;  1ZYB A;  3LQC A;  2FCV A;  3VBS C;  1CAW A;  5EHD A;  3ZYP A;  2K0G A;  3HR9 A;  4ZHN A;  3S57 A;  3UJQ A;  1LHN A;  3LSE A;  4XQW A;  5DQ0 A;  3RZM A;  4FTE A;  1HRI 3;  5LK5 A;  4ZU5 A;  3TEW A;  2BEO A;  3I3D A;  3VBO A;  1WZX A;  1YJL A;  4D7Y A;  5LA0 A;  1W8T A;  2NM1 A;  2YU2 A;  2F4P A;  1RHI 1;  5FMO L;  1C1F A;  5I0D A;  1WLC A;  1Q8Q A;  3GZU C;  1B35 A;  3U14 A;  5CFD C;  3WV6 A;  2VCC A;  2BOI A;  3T2O A;  1H8V A;  4JGY A;  4CP0 A;  4JQR A;  4N8M A;  2A6W A;  1JXN A;  1W9F A;  3IBM A;  4MGI E;  4E4S A;  4UW4 A;  4AVV A;  2G9G A;  2D5H A;  3IMM A;  3T1M A;  3ZN6 A;  3RZL A;  4CXX A;  2ORX A;  1CAX A;  5SV8 A;  1YNA A;  3NVC A;  4R9C A;  1TMF 3;  1RUF 1;  4AYU A;  1MPX A;  3PLQ A;  1BEV 1;  1N1Y A;  1PK6 C;  1QJY 1;  1QXJ A;  3H8U A;  3BU0 A;  5FK7 A;  1QJZ A;  4M3C F;  3ABZ A;  5FYC A;  1Y7B A;  4N9I A;  3CNA A;  4S2G A;  5E88 A;  4DRR A;  1S0F A;  1R1A 3;  5BUV A;  1NAE A;  5FMO S;  1PO2 2;  2HWC 3;  4QHB A;  3LPF A;  4P9J A;  2VZ3 A;  5A7P A;  3W20 A;  5A6Y A;  3O1M A;  3SEE A;  5DAQ A;  3HOB A;  4I02 A;  1AX1 A;  4HET A;  2P6H A;  1EV1 1;  4HFS A;  4JDO A;  2E7A A;  2WZR 3;  4QKN A;  4CP9 B;  1BEV 3;  2KXL A;  2ZGS A;  4K8R B;  4D7T A;  4BME A;  5IJR A;  1C8M 1;  4LKE A;  5BYN A;  3U1X A;  2CYF A;  4P9X A;  3O1S A;  1OKO A;  2RS3 1;  5GZG A;  1QJX 3;  1DQ1 A;  4DRV A;  5KHJ A;  1S0D A;  3B3Q E;  4DUX A;  2BZD A;  2VW1 A;  4XZP A;  3PHM A;  3E5U A;  2G4I A;  1LES A;  5A7W A;  4CDW A;  5F37 A;  1RUH 3;  3HPN A;  2HLE A;  4COY A;  2YB7 A;  2P4E A;  5FQ0 A;  1BJQ A;  2R07 1;  2WAO A;  5FZL A;  5LK7 B;  2EAA A;  5LAS A;  1TME 1;  5CKM A;  4OI4 A;  4D6R A;  1KXG A;  2DF7 A;  4YZ1 A;  2PLV 1;  2XVK A;  1J3P A;  1O91 A;  1RUG 2;  1UMZ A;  4FQ4 A;  3TNQ A;  1JYC A;  1ENR A;  1ZBE 1;  4RQP B;  1GNY A;  3KCC A;  2YPD A;  3WNM A;  3PU3 A;  2QCS B;  2XDV A;  3H3U A;  4M0N A;  1ZVF A;  4WZF A;  4ZZ8 A;  2V73 A;  1DIW A;  4H7L A;  4RGA A;  4BQ1 A;  5A6X A;  1MZE A;  1V6N A;  3HQX A;  4JGZ B;  4R52 A;  3TEZ A;  4Z92 B;  3AX4 A;  2Q8D A;  4BQ4 A;  2W95 A;  4I3G A;  1LR5 A;  4CU8 A;  2HWE 2;  5KXD A;  3W59 A;  1FMD 3;  1LJ7 A;  3MLL A;  4AAX A;  4NPR A;  4QPG A;  4NMI A;  1IG0 A;  4XIK A;  1D4M 1;  4K9S A;  1OH4 A;  2HKX A;  3RJ2 X;  3LFM A;  4NAO A;  3S5A A;  4TYS A;  1Q8S A;  1VBD 1;  1XJA A;  4UW5 A;  4JHZ A;  3NJY A;  4M4R A;  4CU6 A;  1UPI A;  1UU6 A;  2B4K A;  1BEV 2;  1KJR A;  1LRH A;  2VBB A;  1DGR A;  3MIE A;  4JAA A;  1YWK A;  4RSU A;  2BUK A;  3I59 A;  4LKF A;  1X9P A;  4XUO A;  2MEV 2;  3V65 A;  4IE4 A;  1JBC A;  1DBN A;  1NG0 A;  3O0V A;  4GD4 A;  1DZR A;  2X8K A;  2A6Y A;  4BH9 A;  2J1S A;  3I2F A;  4GB3 3;  5IT6 A;  5IFT A;  3GZA A;  2ORZ A;  4IV3 A;  3B02 A;  3OGS A;  2GC2 A;  2I2S A;  2WSU A;  3D5O A;  3D82 A;  2PLV 3;  2VMI A;  1CX1 A;  3ILF A;  4EE2 A;  3I49 A;  4CCM A;  4P5H A;  5JOY A;  2QNK A;  2TUN A;  4K40 A;  1DF0 A;  4P02 B;  1N1S A;  4NHM A;  4Q4X 3;  1W8O A;  2Q8E A;  4LJH A;  1PM4 A;  3AVR A;  1RUC 1;  1AX0 A;  1PMH X;  3H0O A;  3MIF A;  4GH4 C;  4YW1 A;  4NIG A;  1OC1 A;  2MPF A;  1HXS 1;  1WMX A;  2TEP A;  2ZKN A;  3D6E A;  4XCB A;  1CAW B;  5IWF A;  5T5P A;  4GIQ A;  1Q3E A;  4BE3 A;  3N7K A;  4FPL A;  2C0Z A;  2XJV A;  4Q0P A;  2BNM A;  2BFU S;  5A3U A;  3KS7 A;  3PU8 A;  2Y26 A;  3I2J A;  1QOO A;  1ZZC A;  2R1D A;  4CSW A;  4OCT A;  1M4W A;  3MV0 1;  4Y5Z 0;  3NMB A;  5JI7 A;  1IKP A;  3QH7 A;  1QWR A;  1J84 A;  4KU8 A;  3C8X A;  1OXC A;  3S7I A;  1RUJ 1;  4XF1 A;  3BKZ A;  3RZH A;  3B7M A;  4KQ7 A;  3T08 A;  5DAW A;  1ULG A;  2VEC A;  4BA6 A;  5ABJ B;  3D8C A;  4JX0 A;  3C7E A;  3MHZ A;  1X7N A;  3IDC B;  1ZBA 2;  4R8H A;  1MVE A;  3OGR A;  2VVE A;  3R4D B;  4XFC A;  1JZ8 A;  5JUV A;  1OA2 A;  4ZZ5 A;  1WME A;  2ZCW A;  1GAN A;  1RL3 A;  5ACA 1;  1DDL A;  3MEP A;  4BYY A;  1ZNP A;  3VDC A;  2TNF A;  4UBG A;  3VBR C;  4IV1 A;  5CFD A;  5FZI A;  2PAM A;  1SBD A;  1H4H A;  3TBD A;  4IL7 A;  5HI0 A;  2X5I B;  4QX0 A;  5IFP A;  3ZSJ A;  2OZ6 A;  5T3N A;  1WW6 A;  1O3R A;  3PUS A;  3X29 B;  3E1F 1;  3BGA A;  1ND2 B;  1T2X A;  2WBK A;  4ISR A;  3I97 A;  4Q29 A;  5A33 A;  4B1L A;  4B4P A;  4AI1 A;  4E27 A;  4ET7 A;  1G9B A;  5TSW A;  1RUE 3;  1HB2 A;  2ARA A;  2HWD 1;  1FOD 3;  3TEX A;  3ZXG A;  3ZYG A;  4GQ7 A;  5J37 A;  4QU1 A;  1YFU A;  2WQ8 A;  1PZ7 A;  2DVA A;  4QM9 A;  1OKQ A;  4UFI A;  1RXF A;  1AYN 1;  1PIV 3;  5H9P A;  1GYK A;  3I59 B;  1LOE A;  4W6W A;  4CVU A;  3WDU A;  2FCT A;  1E5I A;  4IEV A;  1ZBA 3;  2WNE A;  4QB1 A;  2QQN A;  2E7Q A;  1KQR A;  5BNN B;  1UXX X;  1MS1 A;  2R0F A;  4HMZ A;  4JDN A;  1W39 A;  1ACC A;  1AR7 3;  1W0O A;  4C91 A;  2ZGP A;  3S5Q A;  2AZ5 A;  2DUP A;  4YVW B;  2EF6 A;  3EB7 A;  4D6Q A;  2FDK A;  3KGZ A;  2Q8C A;  2FCU A;  1RC6 A;  2YUE A;  1OQE A;  4N7I A;  4OYU A;  3LEI A;  5K0U A;  1QHD A;  3GF6 A;  3WG2 A;  4PF1 A;  4WVV A;  5FMC A;  4A7K A;  4L92 A;  3VBF C;  1NE4 A;  2W2I A;  3SNM A;  1PHM A;  2OXB A;  4S2D A;  3WCS A;  4BZ4 A;  1BVV A;  5KHI A;  1J3Q A;  4Z07 A;  3VBH B;  4AI9 A;  1LU2 A;  5FWJ A;  1LOC A;  1UZY A;  3VDD A;  2N7G A;  5HPO A;  1HQW A;  4RGK A;  1KEX A;  1UF2 C;  4ERO A;  1GOF A;  2ET1 A;  2JG8 C;  4FO9 A;  1NY7 1;  3JD7 3;  3ZFG A;  4XE9 A;  3LEK A;  1RIT A;  3LF7 A;  3J8F 2;  1N1T A;  2P5B A;  1RUI 3;  2JDH A;  3FBM A;  3UV9 A;  1IPS A;  1QEX A;  1VBB 3;  2RR1 2;  4Q4W 2;  3S0M A;  1A8D A;  4MX3 A;  1TZO A;  1UZZ A;  4WZC A;  4ZS3 A;  5FPX A;  1CIW A;  1QH7 A;  4A3Z A;  2W91 A;  1JZ2 A;  2ZBJ A;  3POI A;  2WQZ C;  4RHV 2;  5FZ4 A;  1KFX L;  1D4V B;  1EAH 1;  1XOY A;  2WYS A;  1O5U A;  2CHH A;  4FOW A;  4F83 A;  4M01 A;  4IV1 B;  3UJO A;  2WWS A;  5J36 A;  3RZJ A;  1W6P B;  3JQW A;  2R07 2;  5KR7 A;  4BIF A;  1MQT A;  2ES3 A;  1AL2 3;  1H2M A;  2R30 A;  5CA6 A;  4NUB A;  1UOB A;  3H1M A;  1NUK A;  4YG0 A;  5C9A C;  3L9J T;  1HXS 2;  3R6S A;  3OGJ A;  1O59 A;  1W9W A;  3PL0 A;  2VTX A;  4AHY A;  2ZHL A;  5J96 B;  1STM A;  5I93 A;  1WCK A;  4N53 C;  2ZGR A;  3DEM A;  4DXR A;  4X8P A;  4J25 A;  3WLU A;  1AYM 3;  3VB9 A;  2ZAB A;  1BBT 1;  2HBT A;  1XU2 A;  4RYD A;  2A73 B;  4Y3O A;  3MLJ A;  4YSF A;  4AEJ A;  1GBG A;  2WS9 3;  4HN0 A;  3VUO A;  2C5D A;  4XOG A;  5C8W A;  3H3L A;  4AEK A;  4I01 A;  2Y6J A;  1VMF A;  4Y24 A;  3AMH A;  3HNM A;  3TNP B;  3ECQ A;  4B1M A;  2O1Q A;  1O4Y A;  1YI9 A;  2WT2 A;  5LAT A;  1VRH 1;  1RMU 2;  4CTE A;  5L73 A;  3J26 N;  4IES A;  1WMF A;  5KBF A;  1ZRC A;  3MZH A;  4Q2F A;  4IEZ A;  1U5Z A;  1MEC 1;  3AYE A;  1UYY A;  3ZXD A;  1F2N A;  5FZ0 A;  2XLA A;  4N43 C;  4GMP 1;  1I3H A;  4ZON A;  3N9Q A;  2AUY A;  4EZ4 A;  1QOT A;  2RS5 2;  2RE9 A;  3CU7 A;  5E89 A;  1UYZ A;  2UY8 A;  4LBK A;  1CGP A;  1VBE 1;  3HN1 A;  5I8S A;  2Y6G A;  2L9L A;  1W04 A;  3B94 A;  4PHZ A;  1GQG A;  5CAZ A;  1OPO A;  1DCS A;  2WA4 A;  1E5R A;  3DXU A;  4PF5 A;  4LXL A;  3VD3 A;  1UZW A;  2JDN A;  2JKX A;  2ZX3 A;  2WN3 A;  4J6G A;  5FP8 A;  4WVZ A;  2Q1M A;  4C0B A;  4ISQ A;  1LOF C;  1XND A;  4IGP A;  1SFP A;  5FY7 A;  5I0U A;  5JR7 B;  3USU B;  4V2W A;  3KV6 A;  4AGG A;  4MO3 M;  1H1I A;  2DWR A;  2E6V A;  4AI8 A;  3WUC A;  3R0R A;  2Z69 A;  3ZFF A;  5GJ6 A;  1AYN 3;  1LOA A;  4CCC A;  1NCQ C;  1WW7 A;  1IOA A;  5FMB A;  2R04 3;  1Y9Q A;  2VNR A;  3DL3 A;  1NCR C;  4TWT A;  2YC2 A;  3SCF A;  1I5P A;  1SDD B;  3WQ1 A;  3WW3 A;  4BMB A;  2ZHK A;  4ONU A;  5K4L A;  3I3E A;  4PDW A;  5EYY A;  1EY2 A;  1F4H A;  2ERF A;  5HCF A;  4P9I A;  4P5Y A;  4OI2 A;  2C6S A;  2P17 A;  4ZS2 A;  3PNA A;  5J7M A;  2V4A A;  1SLB A;  1SDW A;  2X09 A;  4LKD A;  4QXC A;  5FP9 A;  1OF4 A;  1QDO A;  1SBF A;  2WNV C;  1LUL A;  3ST7 A;  5A3N A;  2VZS A;  3N36 A;  4KWL A;  3GGL A;  5C3R A;  2ETE A;  5FZ9 A;  2QZ2 A;  4LO6 B;  1BK0 A;  3MID A;  2YHJ A;  4CEY A;  2XJU A;  4AVB A;  2WL1 A;  1ZZB A;  4AVS A;  3OBT A;  3LB9 A;  4FPJ A;  1LGB A;  2IUW A;  5FZ6 A;  4IE5 A;  2R06 1;  1UN1 A;  1XU1 A;  1X9T A;  2VAU A;  4A41 A;  4FSJ A;  1SFN A;  1EYB A;  2B39 A;  4LR4 A;  5SV5 A;  2J1U A;  1C57 A;  2GC1 A;  5A3O A;  1OUX A;  4FTB A;  4Q8K A;  1YEW A;  2WO7 A;  4LPL A;  3III A;  2E63 A;  2WS9 2;  4FCA A;  4HG6 B;  4OHW A;  2GP3 A;  1QJE A;  3GCW A;  4AQS A;  2GN3 A;  5FYY A;  5J1X A;  1FX5 A;  1OOP B;  1MZ5 A;  1US2 A;  4I0W B;  2VZP A;  1RUI 2;  3E5X A;  5DUU A;  5LBB A;  4NE9 A;  3RWK X;  3UKN A;  2J1E A;  4O7X A;  1VBC 1;  4QMA A;  1W3V A;  1GQP A;  4O65 A;  1RMU 1;  5A7O A;  1CES A;  3CJX A;  1DGR N;  4Q1R A;  1S1A A;  4NID A;  1VBB 2;  2H6B A;  1XYN A;  4E9K A;  3UES A; 
#chains in the Genus database with same CATH homology
 4IE4 A;  4IE7 A;  3T4H B;  3BIE A;  3I3Q A;  4NIH A;  4QHO A;  4ZS3 A;  3O1O A;  2FD8 A;  4MGT A;  4NRQ A;  3T3Y A;  3I2O A;  3RZK A;  4NRO A;  4QKD A;  3O1P A;  2FDJ A;  4OCT A;  2FDG A;  4ZS2 A;  3O1T A;  3BI3 A;  2FDH A;  4IE6 A;  3H8R A;  4IE0 A;  2FDF A;  4QKB A;  3BTX A;  3KHC A;  4O61 A;  3H8X A;  4CXW A;  4CXY A;  3O1M A;  3RZJ A;  4NRM A;  3I49 A;  3O1U A;  4RFR B;  4QKF A;  3BKZ A;  3RZH A;  3RZL A;  2FDI A;  4CXX A;  3BUC A;  3LFM A;  3H8O A;  3RZG A;  3S5A A;  3O1R A;  4NPL A;  4NPM A;  4NRP A;  3O1V A;  3BTY A;  4NII A;  3S57 A;  4ZHN A;  4QKN A;  2IUW A;  3KHB A;  2FDK A;  4NIG A;  4NJ4 A;  4O7X A;  4IE5 A;  4JHT A;  3RZM A;  4MG2 A;  5F8P A;  3T4V A;  4IDZ A;  5DAB A;  3BTZ A;  3I3M A;  3BU0 A;  3O1S A;  4NID A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...