3O1RA

Iron-catalyzed oxidation intermediates captured in a dna repair dioxygenase
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
202
structure length
202
Chain Sequence
b'EPLAAGAVILRRFAFNAAEQLIRDINDVASQSPFRQMVTPGGYTMSVAMTNCGHLGWTTHRQGYLYSPIDPQTNKPWPAMPQSFHNLCQRAATAAGYPDFQPDACLINRYAPGAKLCLHQDKDEPDLRAPIVSVSLGLPAIFQFGGLKRNDPLKRLLLEHGDVVVWGGESRLFYHGIQPLKAGFHPLTIDCRYNLTFRQAGK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alpha-ketoglutarate-dependent dioxygenase AlkB
publication title Iron-catalysed oxidation intermediates captured in a DNA repair dioxygenase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 47
structure length 202
sequence length 202
ec nomenclature ec 1.14.11.33: DNA oxidative demethylase.
pdb deposition date 2010-07-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.590 Mainly Beta Sandwich Jelly Rolls Alpha-ketoglutarate-dependent dioxygenase AlkB-like 3o1rA00
4NIGA 3RZGA 4NIHA 3O1VA 2FD8A 3RZKA 4IE7A 4IE0A 3O1SA 3O1RA 3S5AA 4NRMA 2FDHA 4QHOA 4IDZA 3BTZA 3I3QA 4QKDA 3O1PA 3BUCA 4MG2A 3O1MA 3RZMA 4NIIA 4ZS2A 3I3MA 3KHCA 3RZHA 4QKBA 2IUWA 4NPMA 4IE6A 3BI3A 4ZHNA 3T4VA 4QKNA 3O1OA 3BKZA 4NRQA 3H8OA 4NPLA 3O1TA 3KHBA 4O61A 5F8PA 2FDFA 2FDJA 4O7XA 3BIEA 3I49A 2FDIA 3LFMA 4QKFA 3H8RA 4MGTA 4NJ4A 3BU0A 2FDGA 4JHTA 3RZJA 4NIDA 4NRPA 4CXYA 3BTYA 3T3YA 4IE5A 4RFRB 3I2OA 3T4HB 4CXXA 3H8XA 4OCTA 3O1UA 4IE4A 4NROA 3BTXA 2FDKA 3RZLA 4CXWA 4ZS3A 5DABA 3S57A
chains in the Genus database with same CATH superfamily
2WZR2 4AAPA 1QJU2 4XFCA 4KI5M 1IKQA 4Q4W3 1O4ZA 2EALA 1H4GA 2VBPA 2DDUA 2WSVA 3R4UA 5FTTC 1R083 1LEDA 2ZJCA 3RZKA 1UXXX 1W2NA 3DUIA 3GXUA 1K45A 2Y6JA 4HANA 1GLHA 1NY71 4XFGA 5FMBA 3AVRA 4LT5A 4YVWA 5J3UA 2WQ8A 4JRLA 4DIQA 4Q8KA 2ADEA 2QQJA 3SCFA 1WLTA 2JIGA 1VPHA 2D44A 2KD7A 4QHOA 4YYOA 4BJ0A 3BTZA 1UZ0A 1N1YA 3PHMA 2RMU2 1VRH2 4M3CE 3GBGA 4A6OA 5C7GA 3IIIA 1OH3A 3SKVA 4AFAA 3O1PA 1R091 1F5JA 3B01A 3DXUA 5EYXA 2QQPA 2BYVE 3Q8FA 2W92A 2O8QA 1OI6A 2W3JA 3M70A 1AR92 1OXCA 1V6LA 5IAXA 2E26A 4PLNA 1N3QA 1PK6C 4AVCA 2VMGA 4XURA 3C3VA 1QKQA 4TZDA 5JOYA 2VNOA 5KXDA 3H7YA 4XUNA 1UAIA 2JECA 3J7HA 2ZHMA 1W0NA 4RL7A 2BRTA 3ZYIB 3J8F3 2I45A 2W87A 2VZSA 4CDUA 3R4SA 4AFMA 1VE0A 2JX9A 4JVAA 5EWSA 1NCQA 4E8DA 5LEKA 2W2IA 4CDQA 4QX1A 2W1WA 2XOMA 4TYSA 5FWEA 3MLKA 5KXEA 5M0TA 1AR83 2BTVC 5F2WA 1BQPA 1AYN3 1KFUL 1D2QA 2RS32 2VMFA 2BZDA 3B94A 1DLLA 4AEDA 3N9QA 1EPWA 3AYDA 3VKOA 1XNAA 3BODA 1R1A3 2QQKA 4QQPA 5LY2A 2W39A 1QJFA 4ZZ8A 3HOBA 3PNAA 4IGPA 1LHOA 4H7MA 2VG9A 1S0JA 3P6BA 4GZ9A 3TNPB 5F9TA 1U0AA 1X33A 1SPPB 1ZZ9A 4MGSA 4P5HA 1DQ2A 4D6SA 5HCHA 4GMP0 5I0UA 1ZRFA 5ABJC 2B9UA 5DDJ3 2PHRA 5A3LA 3JBG3 3Q8AA 4RSUA 4DXTA 3LAGA 3LFMA 5EP9A 4AQ6A 1URXA 2IZWA 5JXIA 3HD8B 3GCXA 4RR3A 3WP3A 4UW6A 1LOEA 1DLCA 2R073 3EO6A 5KHIA 3TOJA 2WNUA 2WS92 1HXS3 2ZGRA 4XFAA 1VBC2 1DGWX 4RFRB 1PVC3 1XE8A 1DQ6A 2Y6KA 4X8NA 3CNAA 3RWKX 2E33A 3K4DA 4E27A 1VB2A 1EV11 1PGW1 2E7TA 4P9XA 1POV0 3FBYA 4OHVA 1ULFA 1VIWB 1G86A 1L7LA 2O0OA 2XXZA 2WZ8A 1RUD1 3I3BA 4ORFA 3H9AA 5HBAA 2V5YA 2XJPA 2Y6GA 5FZ8A 2MEV2 4XUTA 1Y9GA 1WA4A 5FZFA 3AP9A 5BNPC 1GOHA 2UU8A 1DGRN 2HWF3 2V4VA 3SH4A 3Q8BA 4QPGA 1TME2 1JN2P 1YCIA 3IDBB 1JODA 4IUGA 5CG8A 3K46A 1UQXA 2DBIA 1S4CA 2JDAA 2VW1A 4CCDA 4FQZA 1WLDA 3LA2A 2BVBA 5FY9A 1CX4A 4CEYB 3A4UA 4Y22A 2ZABA 5DAVA 3DN7A 3IMNA 4XYXA 3ZXAC 1FMD1 5CISA 3AM2A 4LIUA 1REDA 4KBBA 1YFYA 3IT8A 4DOUA 1C28A 1VR3A 2FD8A 5FZ9A 2NMNA 5C33A 1ASJ2 5FPAA 1J3PA 2ZZJA 3E5UA 3MI8A 2HWB2 4CP9B 1X9PA 4I3GA 4H55A 5F6KA 1DGRA 1YWKA 3Q9OA 1RUI1 2JXAA 4GKXA 1H0BA 4FQ4A 4IW3A 4LKDA 4FTBA 1WLWA 5GLZA 4LITA 1WCDJ 3A21A 5I8SA 4D6QA 1AYM2 1D4M1 1SCRA 4DPNA 5FZGA 1NE4A 1N1VA 5BPXA 4ZU5A 4BLIA 2C6SA 1PO13 3GZUC 3HT1A 4Q1RA 4XF4A 2X29A 1STMA 1RVF1 4NOTA 4Q0VA 4OUEA 3A0KA 2KM2A 4PDWA 1QWRA 1OD5A 4AW7A 1MS8A 4JRAA 2F4PA 3ACFA 4TSVA 2HWD3 2ZX1A 5JSOA 3HNYM 3JU9A 3CJIA 4FPCA 5CNAA 3VBRC 4GB33 4QM9A 2QKDA 4C8DA 2VZ1A 3J9SA 4K8FA 1TEIA 5H9PA 2DUOA 4Q8LA 3NRUA 4RGGA 5A7WA 1YI9A 2TBVA 2VMCA 2XBO2 3R05A 5T55A 3ZN5A 5FQ0A 5F7UA 1PNFA 3AKRA 1DHKB 2GMMA 5I0SA 3AYCA 5JPNB 1F5FA 4BQ3A 3FHQA 3DPRB 2VMIA 4N43A 2SLIA 4CDWA 2HWC3 1MACA 4GJZA 3RI9A 3MEPA 4W8JA 4Q4W2 1JZ2A 4BB3A 2A3WA 3NAPB 4YGDA 1PX3A 1YIFA 4LBQB 5C8CB 2VY0A 4B3NA 4CVUA 4A6SA 1QJY1 3E5QA 1VBB2 3K3NA 1REFA 4K40A 5KBFA 4W6XA 3D3AA 3TWIA 4LKEA 4JGYC 1OOPB 5H9QA 4XTMA 1FV3A 2P1BA 3UYJA 4CUGA 3WQBA 4ZY9A 4LBQD 5DPNA 2ZMLA 1R64A 3BVCA 1U12A 1DFQA 2XVGA 3MFCA 1FPN1 4I3PA 4QKFA 5FZLA 4BYYA 4TLGA 5I93A 4CP0A 4MGTA 2WZEA 3JUUA 4OMDA 1YHFA 4KWKA 3AP4A 2ZX4A 4MXWA 2OPKA 5FY1A 3OUHA 5LWBA 4P5YA 2AEZA 2KR2A 3JXSA 1REEA 3E1F1 1Z78A 4WZFA 1GR3A 3I59B 3WINE 2N7GA 2AGSA 1K3IA 3OUIA 3POYA 1ND3A 1ZZ8A 4BISA 2NYYA 5FZ4A 5FCCA 4CSWA 4QGLA 3FMGA 4LR4A 1TMF1 3WT3A 5FY5A 4TN7A 4LLFA 4BK4A 2X09A 2VVFA 1HJGA 3VBHA 3ATGA 2JG8A 2UWBA 2DBNA 4HKOA 4JTOA 2VOTA 2XUMA 1FAYA 5LBBA 2VNRA 3LOIA 5DUWA 2VUDA 3SISA 4AVSA 4BCUA 4FPJA 2PQSA 1SCSA 1E57A 3PLQA 4Y26A 3FLPA 1R1A2 3U75A 3NW4A 5DAQA 2ZEYA 5IVJA 3FJSA 3U37A 3ZLIA 5DDJ2 1W8HA 1V9U2 3FN9A 4AHWA 1BXHA 1R093 4LHKA 5E88A 5T5OA 2YXSA 4C1XA 1CWPA 5LK7B 4Q29A 4N53A 2YHJA 2VOKA 3K77A 2ZMKA 2EIEA 1FNYA 3H3UA 5CKNA 3H42B 4IV3B 3AL5A 1S0DA 4C91A 1M06G 2R072 2AR6A 3WLUA 1ZBE3 5CBLA 3QBQA 5A7OA 2FBEA 1NX9A 3VD7A 1ND2A 2ZGTA 3LEKA 1HXS2 1UYXA 1RUG2 3UKTA 4IESA 4A3ZA 2EXJA 4UT5A 1XE7A 5LASA 4GH4B 1JYWA 4AVBA 1ZYBA 4PBPA 1LU1A 2ARBA 2ZX2A 4ZKTB 5K0UA 3WW3A 3OBAA 3IIAA 3I3EA 4AI9A 3AJYA 4LPLA 1IG3A 1Y43B 2Z2SB 4B7KA 2HWF2 3WDTA 4QPIC 1LOFC 1O4TA 5CU1A 1RUE1 1RUF1 2RS13 2TUNA 2Q8CA 5BNOB 3JB8A 2EXIA 3KD4A 1W06A 3RDIA 3OYWB 5L7OB 4LHSA 1HDKA 3OG2A 4RS5C 2GZWA 4FPOB 1UOFA 4WBBA 3ENRA 3RZZA 3AFKA 1LAJA 5FWJA 1A34A 2WA3A 1YEWA 4YW5A 3ZSKA 2GP3A 2WWUA 4J1WA 2FCTA 3OD0A 4UYBA 5H9RA 2EAKA 4BQWA 1MEC3 4YW6A 3ACLA 1PHMA 1C8NA 4EJRA 1PGSA 1XNCA 2JENA 3VL8A 3B02A 4X6QB 4OZOA 4XFFA 5FDBA 3BIEA 5FZ1A 2BVVA 2C5DA 4QB6A 2R1DA 4EZHA 1EAH1 3UGHA 2FDIA 2VMEA 4QHZA 1QXRA 1YI7A 1WUVA 4AFDA 2B4KA 2XL7A 2RS51 3FFZA 2R042 3MDPA 4IV1B 4OMCA 4XJ9A 4CDXB 1RGSA 1O3TA 1LHUA 3QH6A 4YZ2A 1RIRA 4DRRA 4NHKA 1QQP1 1UN1A 5K7PA 3NJZA 1UY2A 3O14A 3MW2A 1BHGA 3TEYA 3RZJA 1PO12 1G9DA 3LDBA 5A3WA 3WCSA 2WNVB 2GC2A 1RUD3 4A4AA 1GMMA 2CHHA 1GNYA 4YVSB 1I1EA 2JKBA 3MV11 1GICA 1JZ6A 5KHHA 2ZPXA 3ZFGA 5FYVA 3AK0A 1UKGA 4GB32 3VB9A 2VZUA 5FPLA 4Q26A 1MS5A 4BOWA 5IVYA 1FT9A 2QUOA 4Y1ZA 4FFGA 1RUC1 3BIWE 4HFSA 4LO4B 5CKQA 1W6QB 2E7QA 3RZLA 4HVRA 4CXWA 1MZ6A 4XE9A 3RYKA 3VDDB 3NNLA 5DMYA 1MS0A 2XMLA 4DXZA 5BNNA 2YV8A 5LZ6A 1QJX1 2FZ2A 4MOAA 2OS2A 2VCCA 4EN0A 3EQEA 3QD6A 4XMAA 2VCMA 3WNLA 1IHMA 1RB8G 3ZMNA 5FP9A 3G7DA 4RA0A 1PVXA 1WW6A 3T0AA 1RUI3 4O65A 4XHBA 3VBOB 2DTYA 4LTAA 3ZFFC 5JMOA 1XU2A 5FXXA 1W6NA 2VMHA 1OQDA 2VR4A 1UZYA 3WZ1A 2H0BA 3ZXJA 2ZGNA 4NRMA 2WABA 4AAXA 4XDQA 1OA3A 1CAWB 4QQHA 1ZZCA 1RVF3 3B93A 3W21A 1YO8A 4BWOA 4COZA 4XZPA 4LHLA 1K5MB 1GZWB 3WDXA 4YARA 4BXFA 3ORJA 3D6EA 3HNBM 1OPOA 4LO7A 1Q8PA 2Q30A 3PVOA 5C71A 1D0GA 5AC92 5LATA 1KS5A 5I8TA 3THTA 2BGCA 3HPNA 4NO4A 4HN1A 1PK6A 2BWAA 3FLTA 4QKBA 3JD73 5F2SA 1LCLA 2F4LA 3WSOA 1LB2A 3DYPA 2WR9A 1JYCA 5JCTA 1BMV1 4QAWA 2BWCA 1OD3A 2FCUA 1AX0A 1KS4A 3UV9A 2DVDA 3ST7A 4U36A 3ZR5A 5IWFA 1LEMA 3ZN6A 2VC9A 3O0WA 1X7NA 1QJY3 1C3HA 4P14A 5AVPA 3WF0A 1NY72 3VBUB 2VULA 4NHYA 5F39A 1RHI3 4DEQA 5HXVA 1S2BA 3KHBA 2XR4A 5GZFA 4D0QA 1FPN3 1ONAA 2R0FA 3SITA 3M3OA 5FY4A 3RGBA 1Q56A 1UIJA 2IC1A 5FK7A 2ZGOA 2LW8A 1QU0A 5K4LA 5C8CA 5FR3A 5ABJA 2EIGA 5EIYB 4G3YC 4QU2A 4XOGA 3X29B 4Q4X1 2RDQA 1UMZA 3MIHA 5FPUA 3DF0A 1ZRRA 3N7JA 2RM23 3I2IA 5FIXA 4ZU4A 5LBEA 4AWDA 4BH9A 2RR11 3I2KA 5GLVA 2OX0A 2WBKA 3FZ3A 3KT4A 1W6PB 5D8AB 1NT0A 3D82A 1QIQA 2VOWA 3VBFB 2WZR3 2XJVA 2IFRA 2CDOA 3ZPOA 3GJBA 2DFCA 4PHZA 2Y0OA 3T2PA 2BOIA 2KA3A 3VUOA 4UAPA 4AVTA 2VZTA 2DCJA 2WT1A 3VBSB 4OI4A 1NCRA 4K1YA 1ZZ6A 4FT8A 3CQOA 1A8DA 2B39A 1GWMA 3PUQA 5BNPA 1V6NA 1KJLA 4URTA 1UU4A 3LDRA 1C8M1 4PJYA 4S2DA 3M3QA 3NNFA 5FMCA 1ULEA 1B09A 1O91A 1VRH3 2RMU3 1WW7A 2GSYA 1S0CA 5FXZA 4EE2A 5C9AA 1Z7S1 1KXGA 1IS4A 5FV3A 4R4ZA 1CPNA 3M4FA 2VNGA 4AZZA 1AR71 2JIJA 1WLCA 1YYNA 1EUTA 1AR93 5G04L 4G4FA 1MQTB 2R16A 4YM3A 2JDUA 3EXUA 4UFIA 2BFUS 1UCXA 2XUEA 3EBRA 5FUPA 5FJHA 4PQQA 5FAXA 2DVAA 1SFYA 4C0BA 1RUG1 1NA1A 5HI0A 2P4EA 2AENA 4LBJA 2A6WA 4XDOA 5B2GB 1RUH1 5EJ1B 5FP7A 5FZAA 1FV2A 1XE0A 1LGNA 1EV12 1PGW2 2OW4A 4XF9A 4R4XA 1IOAA 4WVZA 5EYYA 4CP2A 5FXVA 5LCWL 4GAZA 3KGLA 4I2OA 1TVGA 1OVSA 2DFBA 5FYYA 1RUD2 4CU6A 3PMEA 4JKLA 2BQPA 4J25A 1H1MA 3E6DA 3WW2A 3NNMA 4ES8A 1FOD1 1ACCA 2VTXA 4WV8A 2ZEXA 2PHTA 4BXSV 4CCEA 2WYSA 5J48A 2YYOA 1CESA 2AH2A 3QOPA 4ZPIA 3ZMOA 1UXZA 2D7FA 2WSUA 3D5OA 3MW3A 3VBRA 2DVGA 3K4AA 1JTZX 2X53S 4XBQA 3HR9A 1I6XA 2GNBA 4GULA 1FMD2 2J42A 5L9RA 1OUSA 3QCWA 4F7ZA 5CKMA 5A1FA 5F1RA 4UFKA 1GP4A 1HB3A 3AP7A 1YLLA 1UPSA 5J36A 4GMP1 5JR2A 5I8YA 2VD7A 3O1TA 2ZGPA 4FOQA 1RUI2 1N1SA 3CMGA 4KMQA 4YFWA 5TSWA 4Y1YA 5FZIA 1JOPA 3K51A 3ZYPA 1I9RA 4A41A 1QQP3 1D4M2 1YQ5A 2BJSA 2ZCWA 4XCBA 4CZSA 3IZOA 3L9JT 4JGYA 2B46X 2VZVA 4DZGA 1RVF2 3PTRB 3N7LA 4K8RB 3WNKA 3AMHA 3ZXKA 4ISQA 1UMHA 2MEV3 5F3EA 4IGOA 2PHDA 4MH0E 2XJQA 3M3CA 5IATA 2WFF2 4LORA 4JHTA 4NIDA 1POV1 2PHLA 3ZSMA 1SBEA 3A23A 5FZOA 4I0BA 2YG0A 3LPFA 1AHSA 5FPVA 5JPMB 2D3RA 4CDUB 2BPA2 1X36A 4A7ZA 3CZJA 3KCCA 1OSGA 1NCQB 4R9CA 1RUJ1 4FVVA 4CDQB 4FPKA 3WD5A 2D6OX 3N9MA 5C8CC 2XDVA 4AVVA 1ASJ3 5IUQA 5D2AA 1RTVA 4NPRA 4XJAA 4AEDB 4EROA 1OOPC 3WNXA 3VV1A 3WR0A 5ANNA 5GLTA 2IXJA 3VKNA 1QJY2 2I74A 1J1LA 1US3A 3OUJA 1GSLA 4UXAA 4TTGA 5IVCA 2R30A 2E53A 1G8WA 5DG1A 4LK7A 4EN6B 1F4HA 4NN0A 4FFFA 3ME2A 1JHNA 5A3NA 4NIGA 2YU1A 1XQNA 4LBLA 4MGIE 3JQXA 2CSGA 1FPN2 4NIHA 5A3UA 4UFHA 5JIAA 5KHKA 3RFRA 3N4MA 4ISRA 3WOGA 4S2HA 1RXFA 4IEUA 4RR3B 2Q8OA 3HNMA 3O1RA 1AVBA 3AZYA 4PF5A 4Y20B 3B9CA 4ZU7A 1B35A 4FP3A 3NJXA 3VZMA 1W39A 3H8UA 2P3IA 4E8CA 1X8EA 1QH6A 2YBSA 3USSA 1BCXA 3LA3A 2QFEA 4JAAA 1OKOA 1AJKA 5J1XA 5A3MA 1GKBA 1MZFA 4GQ7A 2W68A 4XAEA 3TBDA 1QDCA 1TMF2 2P5BA 1YIPA 3AFGA 4W6WA 1C1LA 3I97A 4Y24A 4BQ2A 1VB4A 4ZS2A 4MX3A 2YBPA 4KL1A 4L92A 4P9JA 4E4ZA 3PJQA 1WWYA 3I3MA 2BUKA 4B4QA 1GZ9A 1WMEA 2E63A 3G6JB 4Y33A 2CGNA 3K75B 1VBA1 1VRBA 5FZ6A 4D3WA 1DZTA 5IFTA 2BOJA 1VBB3 3LPGA 4WM7C 4AEMA 4COWA 4N9HA 4DS0A 2CGOA 3OBRA 4CYDA 3SCGA 1Q5OA 3W5MA 2QQNA 3IAQA 5LA1A 4P9WA 1XNDA 4HBNA 2BBAA 4Y22B 1H30A 3E5XA 4XILA 5C70A 4CUCA 2E51A 3O1OA 4QPIA 1WA6X 4GWMA 2C26A 1AL22 1LOFA 2QNKA 4H14A 1J83A 2ES3A 4B29A 3MZHA 2HBTA 4IV3C 1OH4A 3GYDA 3P3PA 4PF1A 2JDHA 4RS5A 3S7EA 1MZ5A 3H8OA 2EA7A 4HSLA 4FO9A 4UI9L 1GZCA 2Z79A 3PURA 5KXCA 4Q4V1 5D21A 1W9FA 1BK1A 4BMEA 4Q4X3 3NV1A 1A3KA 3WP4A 5GLWA 5JXHA 1XJAA 4K7JA 3J4UH 4Z8BA 5FPXA 1UW8A 2RR13 2VQ0A 1CIWA 3N3HA 3EB7A 5FYIA 2GALA 2Y38A 5LRRA 4A45A 1HB2A 3LSDA 4YM1A 3WUDA 2WZPP 3LIGA 4AGVA 2B5HA 4HSJA 4M0NA 3RI8A 2R061 3OEBA 4JGZA 4PDWB 3WW4A 2FDGA 2NN8A 4AYUA 1SLBA 2WO3A 3ECQA 2YPDA 4XUPA 3CJIB 3ASIA 3KV9A 2JDPA 2HH9A 1JW6A 1W90A 2D97A 3IDAA 3MLJA 1PO21 5LW9A 3I2OA 1RUE2 1RUF2 2H6CA 2HJIA 3PU8A 1N47A 3N36A 5A7WB 1PIV1 5T52A 5FQ0B 2BDRA 2BFUL 3S30A 1D0HA 1X8MA 2QE3A 4CEWA 1V9U3 3OGRA 4YRDA 3LD8A 1Z7S3 1H8TC 1Y9QA 3BYWA 1CVNA 3AXDA 4YZ1A 2GNTA 1HQWA 4C1WA 4C90A 1AR73 5I0RA 3PU3A 3NKGA 1SBDA 4L9BA 2BGPA 2ZHLA 4IV1C 4F8AA 2XJUA 5C3RA 1W8TA 1U5IA 3A22A 2A73B 2OVUA 4LJHA 1EAH2 3DYOA 3F95A 3HN1A 4OFGA 4QPWA 2VJXA 2WUHA 1HQNA 4XUQA 4R9BA 3THDA 4YGCA 1RUG3 5J98B 1UPIA 3ZPYA 2RS52 2WNVC 3QH7A 4UFLA 4YW1A 2QQMA 5FZBA 1LECA 4JTNA 3TEXA 3TYJA 2X5IC 1U5XA 1QQP2 4YVSC 1VLNA 1ZM1A 1ZA7A 3WUCA 3ZFFA 4DXSA 1GV9A 4N9IA 1CPMA 1Z0HA 3CKHA 1OLQA 4MXWB 3N7KA 3IPVA 5F32A 2FDHA 1EPZA 3WEZA 4HETA 5FOBB 4HPKA 3HQRA 3MUY1 3AKSA 1FOD3 3IWZA 2XWBB 5EHDA 1TNRA 1IGOA 5CFDA 2OIIA 2H0VA 5DXDA 2AREA 1W9TA 3UESA 2RE9A 1ND3B 3ACIA 3VDDC 5J37A 1OLME 3H7JA 2C1FA 5A7SA 4OLLA 1TE1B 5FO8B 3B7MA 1RUC2 1H9PA 1HLCA 2CDPA 2YDEA 2IXHA 3KF5A 3SKJE 4Q0QA 4BIOA 2JG8B 2W47A 4K21A 3TNQA 1UKRA 4QB2A 3H50A 3V0AA 5L73A 1QJX2 2XLFA 3MYXA 2WL1A 3DKQA 3NNJA 4NE9A 1LJ7A 4Q1PA 2VECA 1MZEA 5IW0A 1W03A 1LENA 3MFAA 3RG0A 4UOJA 3LF7A 5DN2A 4AR2A 1IG0A 3OBTA 2R043 2Q8EA 3DGTA 3ZN4A 4B4PA 3SMHA 4LOTA 4RGAA 3W5NA 5JSPA 1YC61 1K5MC 2Q4SA 3WQ0A 1OMIA 1UOGA 2DV9A 3AYAA 4N53B 3ABZA 3AMNA 2AYHA 3GJAA 4G9SB 5HXMA 3UGGA 5IJRA 1MVQA 4UBHA 4EV0A 1N3PA 5KWRA 2UYBA 2WFF1 4GJYA 3HIFA 3MF9A 3LSEA 3VGIA 4BQ4A 1CAVA 5A32A 3H3LA 2XVKA 3H1WA 4YG6A 4P9GA 4KU7A 1ND2B 4HT1T 4Y4YA 5DAPA 4FAGA 1XNKA 1DQ1A 2XKPA 4WM8B 4Z2AA 5F5QA 1YQ6A 1MVEA 2WO1A 2R1BA 5BNQA 3AMPA 4LULA 1AR61 3T09A 3ZKUA 4Z1VA 2JG9A 4COVA 5K0UB 4IE5A 1BMV2 3RSJA 3LOBA 2J1AA 1LOGA 2Z69A 2ETEA 3GNEA 3H3ZA 2XJTA 1X9TA 3I4IA 1C4RA 5C5TA 2ZGSA 4DUVA 1DGWA 2ZACA 1HRI1 4JHZA 3OSDA 1RUOA 2ZTNA 5CB7A 3PMSA 1WMFA 4IE4A 1JS9A 2CU5A 4JCKA 2GNMA 4QT6A 5EFUA 2FDKA 3B69A 2ILMA 2VQUA 2XQXA 4NVPA 5IHRA 3LDKA 4V2VA 1QOOA 3FUOA 4TXWA 1G9BA 4RHV1 1BBT1 1UU5A 5FZEA 1V6JA 1HW5A 3HN3A 2OYZA 1W6MA 5A3PA 5A7QA 2DURA 4AK3A 2V5DA 4DINB 3D0SA 5D8AC 5IT6A 2W0XA 3O1VA 2DYCA 2ZZQA 4Q4X2 5AC93 1UL9A 5LK5A 3VBFC 2XG3A 5C8WA 4XBLA 3K4ZA 4CUAA 4HK9A 1SFNA 4XZUG 2RR12 4CCOA 2FZ1A 4CCCA 4L99A 2D6PA 1ZZ7A 2ADDA 4OYUA 4S2FA 4LA2A 4QM8A 2WN3A 3ZXGA 1XNTA 5ANQA 3CZUA 2A6VA 2BEOA 3MBWA 1NXD1 3VKMA 3C8XA 1S2KA 1G6NA 1VBA3 2QQWA 4AFBA 1ENRA 5DZEA 3ZFGB 1WCKA 2J1SA 4PIXA 1LHNA 2J1TA 1G9CA 1J58A 1O3QA 2RDNA 2WQ4A 2A7AA 3POWA 2YFZA 1AL21 1C8M2 1HIXA 4FXKB 3TB0A 4XFHA 4PIYA 3WP6A 1P8JA 4D7TA 1MQTC 3ZYRA 4H7LA 5BNNB 1IKPA 4IEZA 1V6MA 1Z7S2 1KEXA 2HWE1 3OPTA 2OUJA 4FXGB 1GBGA 4BQ1A 4O9EA 3ZFEA 5JIUA 4NMIA 1AR72 4ZONA 1A6CA 4RQPC 3WDWA 3ZSJA 1LOAA 1UD1A 1QHDA 1COV1 3FL7A 2VO5A 1W99A 3RRDA 5I0DA 3VN4A 3SEEA 2D6MA 3VZKA 1W6NB 3ZYHA 3HBKA 4UW3A 2Z4FA 5HCBA 2P2KA 5F3CA 4AF9A 1OA4A 1RUH2 3USUA 4R9DA 3K2OA 3UGFA 3AX4A 4QX5A 5FZHA 1UYPA 1XB9A 2R0HA 1Y7BA 3KV6A 1NE6A 2LTNA 4O7XA 3AP6A 1GNZA 1NQJA 2JKXA 1UX6A 1UY0A 2Y26A 4KQ7A 4EWAA 3U0ZA 3CJXA 3T1LA 3Q8EA 4PT6A 2RG4A 1W2OA 2ZBJA 3V0BA 1SLLA 3POJA 4FPLA 4LK6A 4BQYA 4UFMA 3P5BA 1UY4A 1UOJA 3FLRA 1FOD2 1W6OA 2AEYA 5GZEA 2NM1A 5BY5A 1CONA 4XETA 2IXCA 3T2QA 1FI2A 2EXHA 3INAA 1W0OA 1PK6B 5LA9A 4WVVA 2ERFA 5JWPA 3ETQA 2PHUA 3BTYA 1JU4A 1T6BX 2EAAA 2VOVA 1GWLA 3OPZA 4QX8A 3VZLA 4YFZA 2WT0A 3KSCA 1WMXA 1ODMA 4CCJA 3ES1A 3VKFC 3ZYBA 4EQVA 2VL4A 4YW3A 1PMHX 2BGOA 4FFIA 1LTEA 3LEIA 1O59A 2C24A 2K2SA 3FHIB 4W4ZA 1TZOA 2VTXJ 1ZNPA 1MR5A 1VBE1 1W3VA 2XJSA 1V0AA 3THPA 4UW5A 4CCNA 4XQWA 4NROA 1ZX5A 3JZVA 4FP2A 4XCAA 1JBCA 4CCLA 4I02A 5FLIA 1DDLA 5FZKA 4DNYA 3HVDA 5SV5A 3T0BA 5B4XA 2GU9A 2XQRA 4M3CA 4WVMB 1EV13 2ZXQA 2A1XA 4LBKA 4M4PA 4BE3A 3AKTA 4CRQA 5EZWA 1W9YA 5C4WA 1QOSA 4K20A 1DZQA 5JZGC 4A3XA 3OJBA 5ABJB 3C7OA 1WGPA 3MIDA 4YM2A 3WX5A 5BV6A 2A6YA 4HN0A 4IETA 1CZVA 4MGKE 3IN9A 1C5IA 5ACA1 3JCIA 4Q2FA 5GALA 1L3JA 4CDUC 4LA3A 2EIDA 1D7PM 5JVVA 2GDFA 4ET7A 3MUZ1 1NCQC 4Q4Y1 3T2OA 3ZM8A 4CDQC 5E6HA 1GZTA 1OT5A 4M01A 4HOOA 4QU1A 4UW4A 4XTPA 2ZX0A 4YLZA 2BBVA 3BGAA 4XIKA 1HRV1 2LALA 2QDNA 3WG1A 4QHBA 1FMD3 3U14A 4AEDC 1RUJ2 5GZDA 2WRAA 2YMZA 2YFUA 4YNIA 4YG3A 1F35A 3KLSA 4K3UA 4I30A 1KQRA 4L2NA 4XDPA 3W59A 5FPZA 2JEMA 4RFT0 2UY9A 4ASKA 4JKKA 1NCRB 4XJZA 4FI9A 2DU1A 4OI0A 2B42B 5SV8A 3WY6A 5BNPB 1VBD1 1C5HA 2FQPA 2HLEA 3U10A 2NMOA 4KGGA 1XBFA 3OGGA 2VW0A 4MYEA 1D4M3 3IB3A 4WM7A 4YW7A 4IE6A 3GZEA 2W1QA 1XSQA 2F17A 4QQLA 5C9AB 3VD4A 3UKVA 4ZHNA 2YY1A 1G9FA 3SHRA 1PM7A 2I2SA 1ULGA 4PLMA 3WCRA 3AXEA 1OUXA 2W9XA 4WZCA 4FBFA 1HB1A 2WIIB 4F83A 3AZZA 2Q1FA 4FPYA 4URAA 4DRVA 2WFF3 1XNBA 3AP5A 2K46A 1ODNA 4QXHA 2ID4A 3RJRA 1AXZA 1NA1B 1H2LA 3OGVA 4XC9A 2JDYA 3LCPA 1C1FA 4XVHA 3ZYJB 5L9BA 4YWAA 4IEYA 4XPVA 4AI2A 5C5UA 2XHNA 5F5AA 5JI9A 1RMU2 2JE7A 4AI1A 4AHYA 2GN3A 3NJVA 1K12A 3HAGA 2Y8KA 3IAPA 4OI2A 2XGXA 1IS3A 3GHNA 3NJYA 1C57A 3ROUA 4D69A 1FX5A 3AVSA 4HG6B 5I91A 2A75A 1S0FA 5T54A 2DVBA 3PIJA 3NL1A 3U4SA 4NJ4A 1VBA2 1DBNA 4YM0A 3W58A 3NV4A 2ZGKA 3LE0A 2VQTA 3MICA 5EJ3A 1GP5A 4JDMA 1HRI3 1X50A 2IXLA 3O0XA 3OB8A 4XF0A 2BNOA 4YGEA 5C3OA 4E2SA 5FZ3A 3FWEA 3ZOIA 3C7EA 5JDBA 4QX0A 1J84A 3APBA 3WP5A 1PZ7A 3ES4A 4Z2WA 5F6LB 3VBRB 4YW4A 3T0DA 5JOXA 2A70A 2B8MA 5E1RA 4KG0A 2DCTA 4CCKA 2XPJA 3V65A 4HKLA 4IEXA 4OHWA 2P17A 4J1XA 4OHXA 1I3HA 4ARXA 1BBT3 3ACHA 4A7KA 3OGJA 5JSRA 3GZAA 5GM0A 3O1UA 1R081 3J7MA 3UNPA 1W04A 5FKCA 1H8TA 3KCYA 4Q4V2 5FMOS 4ZS3A 2GNDA 5FOJB 2VZQA 2RJLA 5A70A 5FUIA 3U4XA 1F31A 1VMFA 3B3QE 4AQTA 1UZVA 4XAAA 5CFCB 5ISLA 1TMF3 4JGYB 3WDVA 2Y34A 4R8HA 1W8NA 4DB5A 4L11A 1UY3A 2Z5WA 5A7PA 3WNNA 1S55A 2O14A 1UMIA 1AUYA 2BW8A 2R062 4IE7A 4IE0A 4OZXA 4AL9A 4N7IA 2X5IA 3ZKYA 3S5AA 3NKTA 2C4XA 1QF3A 2WJSA 2VTFA 4IDZA 5A6QA 5KC5A 2OQ7A 1HN0A 3WHTA 4Q0UA 4IL7A 3ZXLA 5J7MA 1PO22 2W1UA 3GZTB 3J8F1 1IS5A 3OGSA 1PIV2 1AL23 4XJ8A 3VD5A 3U1XA 4MHRA 4TWTA 4N8MA 3IM0A 1JMUB 4NIIA 5F5CA 1MPXA 5FZ0A 3WF2A 1AR81 2J1RA 1AYN1 4QWNA 2C9KA 3VDBA 3TN92 3J26N 3GBFA 3UT0A 4MV2A 1OVPA 2WDBA 3N9LA 4Q5OA 2YB7A 3LGRA 5I0TA 2WLQA 5A33A 3WF3A 2VXJA 5JUVA 3WHUA 1I5PA 1UYZA 4QX7A 2VNVA 5F37A 1DQ0A 2Y0IA 3AZXA 1O3RA 3ALQA 4FOVA 4OHYA 1W9WA 3RPQA 3ZSEA 3JBG1 3ITQA 4BZ4A 3S6PA 3BALA 2YROA 4ARYA 3LWCA 5A3TA 4LE3A 4ONUA 2QQOA 5L36A 1O7FA 2WC2A 1ND3C 3B00A 3ZDVA 3OY8B 2XLAA 4CEYC 1LGBA 1B35B 5F3IA 3OEAA 1LESA 4FOYA 4XABA 1RUE3 1RUF3 3KT7A 1XYPA 5DAWA 2WLPA 4COYA 1SDWA 4Q0SA 3T1MA 1IPKA 1CAUA 1LGCA 1PVC1 4Y5Z0 1DP0A 2DCKA 1CAXA 4NAOA 5A7NA 2HEWF 3FHAA 5JLVA 4E4SA 3CDZB 4PI2A 4BMBA 2QCSB 1YXWA 2YUEA 2TNFA 4HONA 1KITA 3I7DA 3C7FA 1D4VB 1IQDC 3O0VA 1UIKA 4GALA 3BU0A 2R7EB 3VHRA 1APNA 3CLPA 4AI8A 4NRPA 1KJRA 1UO9A 2Y60A 3P1IA 3I2GA 2JDMA 1VBE3 1EAH3 3SCHA 3DEMA 2BV4A 4YVWB 2JE8A 3WQ1A 5AVAA 5G05L 5FY7A 2LRPA 3I2DA 2WINB 2RS53 2VXRA 4AQ2A 2G9ZA 5HPOA 2J1UA 2G1MA 3U07A 1PGL1 4OUSA 1VJ2A 3WDUA 3RQ0A 2JB4A 2DCZA 1BEV1 1GQHA 2OKXA 1W8WA 4RS5B 5LA0A 4ZZ5A 2BNMA 3VDAA 1BKZA 1ENXA 2X8KA 5ACA3 4WM8C 5H9SA 1GP6A 4JKMA 2XONA 1JZ3A 4Q4Y3 3ZXFA 2JD4A 2ZGUA 2XB6C 5ERLA 4UF0A 2RJ2A 3DPRC 3WXPA 1YUDA 3BPSA 5IK7A 4DMIA 4M4RA 5K0UC 5KC6A 1HRV3 1RUC3 1US2A 2AZ5A 5C3QA 3NAPC 3VBFA 1RITA 2XL9A 3POFA 4BIFA 1G9AA 4JGZB 3T30A 1OKQA 4NWVA 1AR62 1QJX3 2ZAAA 3TEZA 2I07B 2YBKA 2P3KA 3PL0A 2X05A 2K9ZA 4GIQA 5J09A 2HWD1 4HVOA 4LE4A 1VP6A 2B9VA 3P3NA 1W28A 2CWMA 1O5LA 2ATFA 3KWVA 3MO4A 3NV3A 1JOBA 4IQPA 4XW3A 4A42A 1LULA 3GF6A 3O1MA 3ILFA 1HRI2 4B7EA 5EPAA 1IPSA 4DQAA 2VU9A 4Z07A 1V00A 5GKAC 2GMEA 4CEWB 3KV4A 1V70A 1DQ4A 1VMJA 2W46A 4JZRA 3KHCA 4Y4RA 3QLQA 5DZGA 1F4AA 4GD4A 4KG8A 2ZOEB 3GHMA 4QD2A 2HWC1 4GWIA 1O8PA 4XQDA 3RYRA 3W20A 4RHV2 1BBT2 1ULDA 2WWJA 1OBNA 1UY1A 2VH9A 4NPMA 3BOPA 3OD4A 4QPYA 2IVJA 3BTAA 4YSFA 5FYMA 5DQ0A 1H4HA 3NQHA 2WNUB 2VZPA 2WNOA 3AMMA 3HMYA 4RQPA 4CA9A 3IKWA 4I0WB 4HK8A 5B4NA 3FBMA 1RMU1 2DUPA 4MGQA 3ZFFB 3VKLA 3EMRA 1DYOA 5FPBA 1AF9A 1WW5A 1ZVFA 3PUSA 3ZFGC 3IPVB 4D8MA 5LY1A 1YRZA 3LFIA 4O61A 4V2WA 3MW4A 5IYYA 4HPKB 1VAVA 4LEJA 4OVEA 3MIFA 4QPGB 1RXGA 5CFDB 1Q43A 1Y3TA 2D3SA 5FZ7A 2IVIB 2MHFA 3VDCA 1QXPA 1FXZA 1HQLA 1EUUA 2JJ6A 3Q8CA 4A2UA 5BNNC 3VD3A 2C9AA 2MNGA 3DKWA 3O5SA 4MUVA 4Y1XA 4MO3M 5FMOL 3WNOA 2ORZA 1UU6A 3LQCA 4XF1A 1OF4A 1U5YA 1OHFA 3LKJA 3WNPA 3V0AB 3H1MA 1H9WA 1Q8SA 2VPVA 2A6XA 4CU9A 2HWE2 1E5IA 3S7IA 1JUHA 5DG2A 3JQWA 1S0IA 2PAKA 4HKWA 2J1EA 2P3JA 1DG6A 2QZ2A 2YPJA 3I3DA 5EQUA 3M1HA 3T4HB 1XRUA 1COV2 2ZKNA 3HBZA 2DU0A 2VE1A 4GH4C 2YC4A 4Y1UA 2NP0A 1H6YA 1YFUA 4X8PA 3VZJA 4KWLA 5FKBA 3NVCA 4TLFA 4J6GA 2D5HA 5K8SA 3OCPA 5KHGA 2W94A 4LXLA 2WNEA 3UK9A 3ZO0B 3RYPA 2P3YA 3POIA 2E6VA 4PCRA 5FFOC 5DABA 4GWJA 1WW4A 4KWUA 2ET7A 2NQYA 5BNOC 1XU1A 2K0GA 4NHXA 1W8UA 5L7OC 3ON7A 1CJDA 2XWJB 4Y5TA 1CAVB 5A32B 4LBOA 4AGRA 2BERA 3EHKA 3ZDSA 4I01A 3RMXA 3ZSLA 1ZBE1 5JZGA 4FPEA 1DU3D 1TQ5A 2OZ6A 4EN7B 4XBNA 3O1SA 3GBWA 1C8M3 2YU2A 5AFBA 4XHXA 3K48A 3GCWA 3CL1A 2E31A 2EVXA 3CO2A 2DCYA 4L97A 1BVVA 3QACA 4LKSA 5IVFA 4MLOA 3WVJA 5FMDA 3IMMA 3PTYA 4FPHA 1T2XA 3AC0A 4N43B 4CDWB 1ZRCA 2JG9B 1MS1A 3TN91 4PI0A 4GKYA 5J96B 3I2FA 4AOCA 5IFPA 1NQDA 1YFXA 1OA2A 1ENSA 4CDXC 2BU9A 4R52A 4YPJA 1LRHA 1VBE2 3HQXA 3NWKA 2D3PA 2DTWA 1EYBA 1W8ZA 2RS11 3WG4A 1WD4A 3A0NA 2VMDA 4IXLA 4DFSA 1O3SA 1NYWA 1VALA 2YC2A 2GC3A 2YGLA 3RZHA 1W8OA 1RUH3 2UYAA 1NKGA 2H6BA 2P37A 4KH9A 3SEPA 5A1LA 2J1VA 1XYNA 1MEC1 3PUHA 3NSTA 2E7AA 1AJOA 4MADA 1MS4A 4Z92B 1X82A 2BNNA 3M2MA 1JZ5A 1W6MB 4QKNA 1ST8A 2IFWA 1HB4A 5ACA2 2XJRA 4Y20A 4AEKA 2D98A 3MHZA 3M7AA 4XJUA 4Q4Y2 2Y33A 1IQAA 4MVTA 1F8VA 3SNMA 3SH3A 3WF4A 2WN2A 2WO2A 4P00B 1HRV2 4AXOA 3VBHB 5JAXA 3N35A 2IXIA 1NCRC 2DVFA 2PLV1 4MGZE 2YC0A 4P9YA 2ZGLA 5FZDA 4LKFA 2EICA 2R6QA 2CAUA 2P6CA 3AZWA 3PVNA 4WVWA 3VBOC 4D6RA 1N3OA 4GMP3 5FYUA 4FPFA 5KXBA 3KM5A 3BPZA 1LHWA 1WKYA 1JU3A 4XFIA 2J7MA 1W9SA 5C9AC 3OBZA 5LBFA 2XH6A 1VBD2 2PTMA 1XOYA 2VM9A 3KCXA 2Y64A 4FOWA 2VVDA 4R9AA 4XACA 1JYTA 3T3YA 4LO8A 2CNAA 2WO7A 1H8VA 2ARXA 2ARCA 4UBGA 1BEV3 2G9GA 2QBXA 4IEPA 3ZFEB 2P34A 1GWKA 3VHOA 4DUWA 1NA1C 1WD3A 3CEWA 4MXVA 4V1PA 2D43A 1ZA4A 3ZYGA 3KF3A 3RMYA 3URFA 1POV3 2Q5TA 3KS7A 3M3IA 4IEVA 4PBOA 1J3QA 1CZTA 1HV1A 5FBJA 2WAAA 3JB4C 4AHXA 5DUVA 4RYDA 3U11A 2TEPA 5LB6A 1HV0A 3USUB 3PIGA 4N90A 1RUJ3 2WFPA 1RJ7A 1RUNA 3AJZA 1NUKA 1V6KA 5C6CA 2XVLA 3A7QA 3ACGA 4GWNA 2P6HA 2YZ4A 5JMCA 3LIHA 2Q8DA 2FHRA 3RZGA 3D0JA 3VBUC 1LOCA 3V0BB 1V6OA 4FPGA 1BZWA 3VL9A 2DF7A 5LEJA 3KGZA 1W6OB 2VZ3A 1NG0A 1F15A 5EV7A 1AX2A 1GFF2 2JICA 1DQ5A 2UWCA 1M4WA 1UF2C 2X10A 4AGGA 1Q8VA 4W65A 2XKOA 2C0ZA 2ORXA 1SPPA 4AEJA 1QDOA 3JD71 4K9SA 5IVBA 4HMZA 3UJQA 4FTSA 2HYXA 4IEWA 1UX7A 1SZBA 2GH2A 4AI0A 1PMIA 3RZMA 1UWWA 1H1AA 4QQ2A 4E2QA 1SEFA 4XXPA 1XPWA 1YJKA 4UWDA 4F3JA 5FO7B 4IEQA 3I54A 3AKQA 3F2ZA 3O7OA 1R082 1SQ4A 2VUCA 5C3PA 5CFCC 1Q8OA 5T50A 3T2TA 1ZBA1 2B7YA 3VZNA 4I09A 2RJKA 2ZHNA 5FUNA 1RHI1 4EWEA 5CADA 1UZZA 1UYYA 2ZGQA 3H0OA 2LS6A 2IUWA 2OQ6A 4QB1A 4CPBD 5IK8A 4M3CB 4MZUA 3E6BA 1OLRA 1RMU3 4L0PA 5E8AA 1GOGA 1GOFA 3T4VA 3VBSC 2MPFA 4AVAA 1JXNA 5JR7B 5C4WB 1J1TA 5A6YA 4BM8A 5KHJA 1ENQA 1W2TA 3VHPA 5CYYA 4ZXEA 1EP0A 2SBAA 5DAXA 4SBVA 3SLIA 1E5RA 4LQRA 2OUHA 3L2HA 4BK5A 4KNCA 2BP6A 5FP4A 1YJLA 2UWAA 2RM21 3N7MA 5T5PA 1S2EA 2F6BA 5E89A 2OA2A 1GUIA 1NZCA 1SDDB 3CF6E 4CEYA 4PLOA 3CU7A 2Y6LA 3J8F2 1QJZA 1DCSA 3HQUA 1O5UA 1SMVA 1WBLA 2EIBA 2WZR1 4QQOA 5GJ6A 5A80A 4CU7A 2W91A 1QJU1 1WMDA 3AB0A 4ATFA 5IAVA 1UNBA 2L9LA 5T5LA 4DXRA 1AR82 1DYPA 1AYN2 2GN7A 2VCBA 4ASMB 1MS3A 1PZ9A 4Q4V3 4NHMA 4CP9A 1Q3EA 3C2UA 3EJKA 3M8LA 1JH5A 3PJYA 1CX1A 2VCAA 3T08A 1NLQA 3CBNA 2PELA 1ZRDA 1KGYA 3KVAA 4WM7B 4AHZA 1J59A 1Y4WA 1L7RA 1VRH1 2RMU1 3ELNA 4Y5SA 4BLJA 2PYTA 1QMJA 1GANA 3JBG2 3HJRA 1B35C 1VAKA 3WW1A 5A6XA 1UZWA 2R063 3KVBA 2EXKA 4BPZA 2E32A 1AR91 3KT1A 2E9QA 2ZHKA 4E4DX 5A1AA 3DYMA 2EF6A 3MIGA 1OQ1A 2J22A 5FP3A 3SQOA 4IEOA 5CAZA 5JOZA 1JYIA 1HJFA 1OQEA 2ZGMA 1PO23 2PAMA 1SBFA 2LUWA 1RC6A 2PHWA 1PIV3 1PM4A 4WM8A 5FYCA 5CEHA 1GU3A 1PVC2 1T6GC 2CYFA 5KR7A 5F5IA 4K6BA 4MSVA 5EXOA 1OFNA 1BVP1 1F2NA 2ZKLA 3DPRA 3TN93 1TNFA 2RS31 4YVWC 2RHPA 3PUIA 2GC1A 3SXWA 1BLZA 3NAPA 4CPBA 1QY4A 3DL3A 4HL0A 1CD3G 1RL3A 2WAOA 4LBQA 3ZN6B 2QJVA 4BHPA 4X6RB 4CUBA 4PIZA 2QQVA 2NZ9A 3KB5A 5LRSA 1NLRA 1UOBA 5CZKA 5HV0A 3NMBA 3GM8A 5HCFA 3CHXA 1OOPA 4CCMA 4FCAA 2JE9A 1TG7A 2UURA 3ILNA 5AFEA 1JYXA 3KV5A 3UKNA 1RYYA 1PGL2 2CV6A 3ETPA 2OXBA 4IERA 1O8SA 3WG3A 1BEV2 3MPPG 2D93A 5FK8A 4FAHA 3NV2A 1F9KA 1OF3A 1W3XA 1H8TB 2VW2A 1CQ9A 2JB8A 4B1LA 2DUQA 2Q1ZB 3AMQA 3I59A 4UFJA 3N9NA 2WS91 4O9GA 5BUVA 1LHVA 4OI1A 1I5ZA 1VBC1 5FJKA 3BI3A 4RD7A 3HWJA 1JI6A 2Q1MA 1IPJA 4JGZC 3V56A 3BB6A 3WF1A 4XUOA 4L8QA 1S0BA 3FX3A 1RINA 1ZZBA 1WBFA 3KZ4C 4E9KA 1R1ZA 2PLV3 2R32A 4SLIA 3AZVA 5FLJA 4COUA 3BKZA 5JXGA 4NRQA 2MEV1 1A8MA 3AYEA 2QQIA 2X5IB 4NPLA 4Q27A 5FO9B 3TEWA 4QX3A 1O6UA 1TME1 3FFQA 3MF6A 5A6ZA 2HWD2 2AC1A 4HZFA 3AKPA 5F8PA 3POBA 4CEWC 1XSRA 3PUAA 2FDFA 4QGMA 2VOXA 3E6CC 4LLOA 4EN8B 2JDZA 5T3NA 3RVHA 3LA7A 1OFSA 4JDNA 4EN9B 3N9PA 4YW2A 3RS6A 2CWSA 5FREA 4RR3C 4OULA 2IXKA 3H1YA 2FCVA 3HT2A 5BXXA 5FYBA 4LBMA 1PMJX 2GP5A 1ASJ1 1PX4A 1IZ3A 2VZRA 3I8TA 5FY0A 5LBCA 4CU8A 5IVEA 1PZ8A 4BQ5A 2WNUC 2HWC2 4I0AA 2HWB1 3AL6A 4QGNA 4INDA 2VBBA 4IV3A 5A33B 4KGQA 2O8OA 4EWDA 1WCSA 4KBZA 5CIRA 3E97A 2RDRA 2RVAA 3WG2A 1JZ8A 1AYM1 1J3RA 1ULPA 2QQUA 2ARAA 2VQAA 1DIWA 5FLHA 5FBZA 1NOVA 4CXXA 1SACA 3DXTA 3VLBB 4GH4A 3K3OA 3DV8A 3MV01 4JDOA 3D4KA 1AR63 4QPGC 2HKXA 1JUIA 1DGLA 5CFDC 5LA2A 1LNSA 5L9VA 4QXBA 1A78A 4YGBA 3RJ2X 3VHNA 3B5LB 2QDRA 1OPMA 4H2AA 4AI3A 3TRSB 5GZCA 1KD7A 3S57A 1H2NA 4QMAA 3GGLA 3ZX7A 1MS9A 4A7YA 4E2GA 1W2AX 2NPIA 2B45X 4B8EA 4LUMA 1SLTA 3KQRA 5BNOA 4XJWA 1YNAA 3GDBA 3R4DB 4DEVA 1CAUB 2XBO1 2A71A 3OYWA 1FYUA 1CAXB 1CZSA 1OLMA 2CTVA 3IDEA 4KU8A 1LOBA 5L7OA 4C0HA 3LZZA 4CP1A 4BQXA 3EYPA 2NLRA 4M00A 4RGKA 4D7YA 1GQGA 1PNGA 5APAA 4B4RA 1SHWB 4Q4W1 1CIYA 4RHV3 1BYHA 1SFPA 1JHJA 1QOTA 1W05A 3I2HA 2D6LX 5T5JA 4NR1A 5DUXA 1VBB1 1FATA 4QKDA 3BN6A 3BUCA 1N1TA 1ZBA3 4MG2A 4DO0A 2GC0A 1OURA 2V09A 3ZVXA 1GYKA 1H2MA 4QX2A 5A3OA 2ZX3A 4IV1A 2AUYA 1JZ4A 4PDWC 4CDXA 5F3GA 3DCQA 2A3XA 1HX6A 4HLTA 4WVMA 1BK0A 4JX0A 3CJIC 4N7UA 1ULCA 2JD9A 4XMIA 1R092 2D6KA 5CVRA 5DUUA 2WNVA 3W9AA 4LO5B 3ZIXA 4JV4A 4ZXKA 2Q0AA 4YVSA 4XFBA 3MPBA 2GH8A 1FNZA 1DYKA 2G9FA 1K5JA 1XXNA 4FTEA 1QXJA 1S1AA 5FZOB 1AXKA 2ZA9A 1YFWA 3FC0A 4ITCA 1ZBE2 4UF0B 4NIAA 1Y9MA 4IGQA 4EZ4A 2PA7A 4N43C 4CDWC 2JG9C 3IDCB 1JYNA 2WYFA 4D7SA 2WWSA 2RV9A 1W6QA 2FMYA 4LUKA 1D2SA 3LB9A 3NNGA 1QJU3 3VDDA 5L19A 4QDSA 3SC7X 2HWE3 3N9OA 3ZYFA 1KDMA 2CGPA 3BU7A 2D40A 3KMHA 2YGMA 4U2AA 4EYUA 5IK4A 4FSJA 2W52A 4M3CF 2W1SA 5D1IA 5FP8A 3I49A 4CE8A 3CIHA 3KQ4B 1G7YA 1R1A1 1COV3 4LHNA 4LOSA 5IK5A 2UY8A 2PN5A 4NHLA 2RS12 3VBOA 4HXCA 1W2UA 5FZMA 3POSA 4A44A 1VMHA 4OHZA 2WQZC 4BDVB 5CG9A 1VAMA 3RNSA 3I2JA 2Y6HA 1WCQA 5DDJ1 1AL0G 1V9U1 5DZFA 1XC6A 2PXJA 3MLLA 1CAWA 5FZCA 1H2KA 2CAVA 1MEC2 3VZOA 1H1IA 1YQCA 2PHFA 3GALA 3FUQA 2HYKA 2ZS6B 1K5MA 5FRAA 1GZWA 4AFCA 4Y3OA 3OTFA 4H3WA 2R071 4LO6B 5CA6A 1JYVA 5FXWA 3UJOA 5IVVA 2D5FA 1HXS1 3FE5A 2O1QA 3OOXA 4OCTA 4RQPB 4XXAA 3VBHC 5JI7A 2A5ZA 2JG8C 1SLIA 3BTXA 4W6YA 1HN1A 1OC1A 4NUBA 3OF1A 5K9YA 2PAEA 1QEXA 2PLV2 2Z42A 4MGYE 2OPWA 3WQ7A 2RS33 1IS6A 2GAUA 4W50A 2VUAA 5FYSA 2QQLA 1S0EA 4P08A 5JOWA 4KWJA 2HWF1 4P9IA 4QDQA 3ZXEA 1WZXA 4Q0PA 4ASLA 4FFHA 1DF0A 4GXLA 5FY8A 4BA6A 1ZREA 2QZ3A 3UL2A 3C7HA 5EJZB 3VBUA 1AX1A 1QNWA 5FYZA 3UETA 1NAEA 1JZ7A 2WT2A 4N53C 4AE2A 4QPIB 3ZFEC 1LR5A 4ATEA 1YQ8A 1BJQA 1NZIA 4OUMA 2XLGA 4DY5A 2G19A 1NLSA 3ZIWA 3POEA 4GA9A 5E16A 2G4IA 4P02B 1QNYA 3I3QA 4LMFA 2FMDA 2D6NA 3HEIA 4JC1A 4Y1VA 3R6SA 3RWNA 3THCA 1ND2C 4JQTA 5HCAA 3M3EA 1QGLA 4PQ9A 4YZ5A 1WCUA 1SG3A 1KFXL 3PVBB 2QTWB 3D8CA 3SH5A 2WS93 5HV4A 3R0RA 1LU2A 2W5FA 2R041 1VBC3 4XEZA 4ES9A 5C3SA 3J7LA 1GNHA 4AQSA 3PDQA 2HEYF 2A6ZA 5CFCA 1ALYA 4M0HA 2VZOA 1DZRA 5D8AA 1Q8QA 1W6PA 1PO11 2OT7A 1SLAA 2W95A 2WA4A 4OQ8A 1JOJA 2JDNA 2VVEA 3WDYA 3O12A 1XYOA 3OPWA 5FYHA 1U5ZA 3MGUA 5JXJA 3ZXDA 4BU2A 4E4HA 1YQ2A 3BOWA 1TME3 2AACA 2JWPA 2V4AA 3VBSA 1AZDA 2LM3A 4GB31 1W0PA 4YG0A 1LKNA 5JZGB 2Y6FA 3VD9A 3WNMA 1W8FA 1CN1A 1VBD3 3POGA 2GMPA 4B1MA 4CTEA 2HBUA 1RJ8A 2V72A 4XIOA 1CR7A 2ENRA 3JD72 4LNVA 4P9LA 4AG4A 1H6XA 4Z82A 2FDJA 2VAUA 3B9IA 4YZ4A 3C7GA 1E5SA 2IWGB 2KXLA 4YZ3A 3U78A 4LIVA 4XQ4A 1LODA 3MIBA 1K42A 5FYTA 2HWB3 1EY2A 2OZJA 2PQQA 3LEGA 2A3YA 3MIEA 1MQTA 4NWWA 3H8RA 1V6IA 4DUXA 1KRIA 1SLCA 1CJPA 1E5HA 4QXCA 2HEVF 4LBNA 2PHXA 2PMWB 2ZEWA 2VUJA 2CY6A 1ZBA2 4QDRA 1ZRIA 5GZGA 3IBMA 2DWRA 2ZEZA 4HVQA 5C4WC 1RHI2 1AYM3 1CGPA 2WKKA 4RN5A 3S0MA 3LEMA 3ZR6A 4CXYA 1ULOA 3ILRA 1O4YA 2XHKA 1NXMA 4S2GA 4JQRA 1S0GA 3L2YA 4QXKA 2CL2A 2ZAHA 3DECA 4DY3A 4D94A 1GQPA 1QH7A 2PFWA 2RDSA 2ZMNA 3OY8A 3H8XA 4OQ9A 2JDKA 2VBDA 1QJEA 4META 2QVSB 4MHUA 5AC91 2VGDA 3BCWA 3S5QA 1AXYA 1L7QA 5BYNA 2R49A 1POQA 2V73A 2RM22 1HKDA 2XBO3 3PVEA 4NAMA 3J7NA 4K1ZA 5GLUA 3WV6A 2ET1A 3V64A 3NO8A 3TAYA 2LROA 1KDKA 4XF3A 2W08A
chains in the Genus database with same CATH topology
4NIGA 3RZGA 4NIHA 3O1VA 2FD8A 3RZKA 4IE7A 4IE0A 3O1SA 3O1RA 3S5AA 4NRMA 2FDHA 4QHOA 4IDZA 3BTZA 3I3QA 4QKDA 3O1PA 3BUCA 4MG2A 3O1MA 3RZMA 4NIIA 4ZS2A 3I3MA 3KHCA 3RZHA 4QKBA 2IUWA 4NPMA 4IE6A 3BI3A 4ZHNA 3T4VA 4QKNA 3O1OA 3BKZA 4NRQA 3H8OA 4NPLA 3O1TA 3KHBA 4O61A 5F8PA 2FDFA 2FDJA 4O7XA 3BIEA 3I49A 2FDIA 3LFMA 4QKFA 3H8RA 4MGTA 4NJ4A 3BU0A 2FDGA 4JHTA 3RZJA 4NIDA 4NRPA 4CXYA 3BTYA 3T3YA 4IE5A 4RFRB 3I2OA 3T4HB 4CXXA 3H8XA 4OCTA 3O1UA 4IE4A 4NROA 3BTXA 2FDKA 3RZLA 4CXWA 4ZS3A 5DABA 3S57A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NIG A;  3RZG A;  4NIH A;  3O1V A;  2FD8 A;  3RZK A;  4IE7 A;  4IE0 A;  3O1S A;  3O1R A;  3S5A A;  4NRM A;  2FDH A;  4QHO A;  4IDZ A;  3BTZ A;  3I3Q A;  4QKD A;  3O1P A;  3BUC A;  4MG2 A;  3O1M A;  3RZM A;  4NII A;  4ZS2 A;  3I3M A;  3KHC A;  3RZH A;  4QKB A;  2IUW A;  4NPM A;  4IE6 A;  3BI3 A;  4ZHN A;  3T4V A;  4QKN A;  3O1O A;  3BKZ A;  4NRQ A;  3H8O A;  4NPL A;  3O1T A;  3KHB A;  4O61 A;  5F8P A;  2FDF A;  2FDJ A;  4O7X A;  3BIE A;  3I49 A;  2FDI A;  3LFM A;  4QKF A;  3H8R A;  4MGT A;  4NJ4 A;  3BU0 A;  2FDG A;  4JHT A;  3RZJ A;  4NID A;  4NRP A;  4CXY A;  3BTY A;  3T3Y A;  4IE5 A;  4RFR B;  3I2O A;  3T4H B;  4CXX A;  3H8X A;  4OCT A;  3O1U A;  4IE4 A;  4NRO A;  3BTX A;  2FDK A;  3RZL A;  4CXW A;  4ZS3 A;  5DAB A;  3S57 A; 
#chains in the Genus database with same CATH topology
 2WZR 2;  4AAP A;  1QJU 2;  4XFC A;  4KI5 M;  1IKQ A;  4Q4W 3;  1O4Z A;  2EAL A;  1H4G A;  2VBP A;  2DDU A;  2WSV A;  3R4U A;  5FTT C;  1R08 3;  1LED A;  2ZJC A;  3RZK A;  1UXX X;  1W2N A;  3DUI A;  3GXU A;  1K45 A;  2Y6J A;  4HAN A;  1GLH A;  1NY7 1;  4XFG A;  5FMB A;  3AVR A;  4LT5 A;  4YVW A;  5J3U A;  2WQ8 A;  4JRL A;  4DIQ A;  4Q8K A;  2ADE A;  2QQJ A;  3SCF A;  1WLT A;  2JIG A;  1VPH A;  2D44 A;  2KD7 A;  4QHO A;  4YYO A;  4BJ0 A;  3BTZ A;  1UZ0 A;  1N1Y A;  3PHM A;  2RMU 2;  1VRH 2;  4M3C E;  3GBG A;  4A6O A;  5C7G A;  3III A;  1OH3 A;  3SKV A;  4AFA A;  3O1P A;  1R09 1;  1F5J A;  3B01 A;  3DXU A;  5EYX A;  2QQP A;  2BYV E;  3Q8F A;  2W92 A;  2O8Q A;  1OI6 A;  2W3J A;  3M70 A;  1AR9 2;  1OXC A;  1V6L A;  5IAX A;  2E26 A;  4PLN A;  1N3Q A;  1PK6 C;  4AVC A;  2VMG A;  4XUR A;  3C3V A;  1QKQ A;  4TZD A;  5JOY A;  2VNO A;  5KXD A;  3H7Y A;  4XUN A;  1UAI A;  2JEC A;  3J7H A;  2ZHM A;  1W0N A;  4RL7 A;  2BRT A;  3ZYI B;  3J8F 3;  2I45 A;  2W87 A;  2VZS A;  4CDU A;  3R4S A;  4AFM A;  1VE0 A;  2JX9 A;  4JVA A;  5EWS A;  1NCQ A;  4E8D A;  5LEK A;  2W2I A;  4CDQ A;  4QX1 A;  2W1W A;  2XOM A;  4TYS A;  5FWE A;  3MLK A;  5KXE A;  5M0T A;  1AR8 3;  2BTV C;  5F2W A;  1BQP A;  1AYN 3;  1KFU L;  1D2Q A;  2RS3 2;  2VMF A;  2BZD A;  3B94 A;  1DLL A;  4AED A;  3N9Q A;  1EPW A;  3AYD A;  3VKO A;  1XNA A;  3BOD A;  1R1A 3;  2QQK A;  4QQP A;  5LY2 A;  2W39 A;  1QJF A;  4ZZ8 A;  3HOB A;  3PNA A;  4IGP A;  1LHO A;  4H7M A;  2VG9 A;  1S0J A;  3P6B A;  4GZ9 A;  3TNP B;  5F9T A;  1U0A A;  1X33 A;  1SPP B;  1ZZ9 A;  4MGS A;  4P5H A;  1DQ2 A;  4D6S A;  5HCH A;  4GMP 0;  5I0U A;  1ZRF A;  5ABJ C;  2B9U A;  5DDJ 3;  2PHR A;  5A3L A;  3JBG 3;  3Q8A A;  4RSU A;  4DXT A;  3LAG A;  3LFM A;  5EP9 A;  4AQ6 A;  1URX A;  2IZW A;  5JXI A;  3HD8 B;  3GCX A;  4RR3 A;  3WP3 A;  4UW6 A;  1LOE A;  1DLC A;  2R07 3;  3EO6 A;  5KHI A;  3TOJ A;  2WNU A;  2WS9 2;  1HXS 3;  2ZGR A;  4XFA A;  1VBC 2;  1DGW X;  4RFR B;  1PVC 3;  1XE8 A;  1DQ6 A;  2Y6K A;  4X8N A;  3CNA A;  3RWK X;  2E33 A;  3K4D A;  4E27 A;  1VB2 A;  1EV1 1;  1PGW 1;  2E7T A;  4P9X A;  1POV 0;  3FBY A;  4OHV A;  1ULF A;  1VIW B;  1G86 A;  1L7L A;  2O0O A;  2XXZ A;  2WZ8 A;  1RUD 1;  3I3B A;  4ORF A;  3H9A A;  5HBA A;  2V5Y A;  2XJP A;  2Y6G A;  5FZ8 A;  2MEV 2;  4XUT A;  1Y9G A;  1WA4 A;  5FZF A;  3AP9 A;  5BNP C;  1GOH A;  2UU8 A;  1DGR N;  2HWF 3;  2V4V A;  3SH4 A;  3Q8B A;  4QPG A;  1TME 2;  1JN2 P;  1YCI A;  3IDB B;  1JOD A;  4IUG A;  5CG8 A;  3K46 A;  1UQX A;  2DBI A;  1S4C A;  2JDA A;  2VW1 A;  4CCD A;  4FQZ A;  1WLD A;  3LA2 A;  2BVB A;  5FY9 A;  1CX4 A;  4CEY B;  3A4U A;  4Y22 A;  2ZAB A;  5DAV A;  3DN7 A;  3IMN A;  4XYX A;  3ZXA C;  1FMD 1;  5CIS A;  3AM2 A;  4LIU A;  1RED A;  4KBB A;  1YFY A;  3IT8 A;  4DOU A;  1C28 A;  1VR3 A;  2FD8 A;  5FZ9 A;  2NMN A;  5C33 A;  1ASJ 2;  5FPA A;  1J3P A;  2ZZJ A;  3E5U A;  3MI8 A;  2HWB 2;  4CP9 B;  1X9P A;  4I3G A;  4H55 A;  5F6K A;  1DGR A;  1YWK A;  3Q9O A;  1RUI 1;  2JXA A;  4GKX A;  1H0B A;  4FQ4 A;  4IW3 A;  4LKD A;  4FTB A;  1WLW A;  5GLZ A;  4LIT A;  1WCD J;  3A21 A;  5I8S A;  4D6Q A;  1AYM 2;  1D4M 1;  1SCR A;  4DPN A;  5FZG A;  1NE4 A;  1N1V A;  5BPX A;  4ZU5 A;  4BLI A;  2C6S A;  1PO1 3;  3GZU C;  3HT1 A;  4Q1R A;  4XF4 A;  2X29 A;  1STM A;  1RVF 1;  4NOT A;  4Q0V A;  4OUE A;  3A0K A;  2KM2 A;  4PDW A;  1QWR A;  1OD5 A;  4AW7 A;  1MS8 A;  4JRA A;  2F4P A;  3ACF A;  4TSV A;  2HWD 3;  2ZX1 A;  5JSO A;  3HNY M;  3JU9 A;  3CJI A;  4FPC A;  5CNA A;  3VBR C;  4GB3 3;  4QM9 A;  2QKD A;  4C8D A;  2VZ1 A;  3J9S A;  4K8F A;  1TEI A;  5H9P A;  2DUO A;  4Q8L A;  3NRU A;  4RGG A;  5A7W A;  1YI9 A;  2TBV A;  2VMC A;  2XBO 2;  3R05 A;  5T55 A;  3ZN5 A;  5FQ0 A;  5F7U A;  1PNF A;  3AKR A;  1DHK B;  2GMM A;  5I0S A;  3AYC A;  5JPN B;  1F5F A;  4BQ3 A;  3FHQ A;  3DPR B;  2VMI A;  4N43 A;  2SLI A;  4CDW A;  2HWC 3;  1MAC A;  4GJZ A;  3RI9 A;  3MEP A;  4W8J A;  4Q4W 2;  1JZ2 A;  4BB3 A;  2A3W A;  3NAP B;  4YGD A;  1PX3 A;  1YIF A;  4LBQ B;  5C8C B;  2VY0 A;  4B3N A;  4CVU A;  4A6S A;  1QJY 1;  3E5Q A;  1VBB 2;  3K3N A;  1REF A;  4K40 A;  5KBF A;  4W6X A;  3D3A A;  3TWI A;  4LKE A;  4JGY C;  1OOP B;  5H9Q A;  4XTM A;  1FV3 A;  2P1B A;  3UYJ A;  4CUG A;  3WQB A;  4ZY9 A;  4LBQ D;  5DPN A;  2ZML A;  1R64 A;  3BVC A;  1U12 A;  1DFQ A;  2XVG A;  3MFC A;  1FPN 1;  4I3P A;  4QKF A;  5FZL A;  4BYY A;  4TLG A;  5I93 A;  4CP0 A;  4MGT A;  2WZE A;  3JUU A;  4OMD A;  1YHF A;  4KWK A;  3AP4 A;  2ZX4 A;  4MXW A;  2OPK A;  5FY1 A;  3OUH A;  5LWB A;  4P5Y A;  2AEZ A;  2KR2 A;  3JXS A;  1REE A;  3E1F 1;  1Z78 A;  4WZF A;  1GR3 A;  3I59 B;  3WIN E;  2N7G A;  2AGS A;  1K3I A;  3OUI A;  3POY A;  1ND3 A;  1ZZ8 A;  4BIS A;  2NYY A;  5FZ4 A;  5FCC A;  4CSW A;  4QGL A;  3FMG A;  4LR4 A;  1TMF 1;  3WT3 A;  5FY5 A;  4TN7 A;  4LLF A;  4BK4 A;  2X09 A;  2VVF A;  1HJG A;  3VBH A;  3ATG A;  2JG8 A;  2UWB A;  2DBN A;  4HKO A;  4JTO A;  2VOT A;  2XUM A;  1FAY A;  5LBB A;  2VNR A;  3LOI A;  5DUW A;  2VUD A;  3SIS A;  4AVS A;  4BCU A;  4FPJ A;  2PQS A;  1SCS A;  1E57 A;  3PLQ A;  4Y26 A;  3FLP A;  1R1A 2;  3U75 A;  3NW4 A;  5DAQ A;  2ZEY A;  5IVJ A;  3FJS A;  3U37 A;  3ZLI A;  5DDJ 2;  1W8H A;  1V9U 2;  3FN9 A;  4AHW A;  1BXH A;  1R09 3;  4LHK A;  5E88 A;  5T5O A;  2YXS A;  4C1X A;  1CWP A;  5LK7 B;  4Q29 A;  4N53 A;  2YHJ A;  2VOK A;  3K77 A;  2ZMK A;  2EIE A;  1FNY A;  3H3U A;  5CKN A;  3H42 B;  4IV3 B;  3AL5 A;  1S0D A;  4C91 A;  1M06 G;  2R07 2;  2AR6 A;  3WLU A;  1ZBE 3;  5CBL A;  3QBQ A;  5A7O A;  2FBE A;  1NX9 A;  3VD7 A;  1ND2 A;  2ZGT A;  3LEK A;  1HXS 2;  1UYX A;  1RUG 2;  3UKT A;  4IES A;  4A3Z A;  2EXJ A;  4UT5 A;  1XE7 A;  5LAS A;  4GH4 B;  1JYW A;  4AVB A;  1ZYB A;  4PBP A;  1LU1 A;  2ARB A;  2ZX2 A;  4ZKT B;  5K0U A;  3WW3 A;  3OBA A;  3IIA A;  3I3E A;  4AI9 A;  3AJY A;  4LPL A;  1IG3 A;  1Y43 B;  2Z2S B;  4B7K A;  2HWF 2;  3WDT A;  4QPI C;  1LOF C;  1O4T A;  5CU1 A;  1RUE 1;  1RUF 1;  2RS1 3;  2TUN A;  2Q8C A;  5BNO B;  3JB8 A;  2EXI A;  3KD4 A;  1W06 A;  3RDI A;  3OYW B;  5L7O B;  4LHS A;  1HDK A;  3OG2 A;  4RS5 C;  2GZW A;  4FPO B;  1UOF A;  4WBB A;  3ENR A;  3RZZ A;  3AFK A;  1LAJ A;  5FWJ A;  1A34 A;  2WA3 A;  1YEW A;  4YW5 A;  3ZSK A;  2GP3 A;  2WWU A;  4J1W A;  2FCT A;  3OD0 A;  4UYB A;  5H9R A;  2EAK A;  4BQW A;  1MEC 3;  4YW6 A;  3ACL A;  1PHM A;  1C8N A;  4EJR A;  1PGS A;  1XNC A;  2JEN A;  3VL8 A;  3B02 A;  4X6Q B;  4OZO A;  4XFF A;  5FDB A;  3BIE A;  5FZ1 A;  2BVV A;  2C5D A;  4QB6 A;  2R1D A;  4EZH A;  1EAH 1;  3UGH A;  2FDI A;  2VME A;  4QHZ A;  1QXR A;  1YI7 A;  1WUV A;  4AFD A;  2B4K A;  2XL7 A;  2RS5 1;  3FFZ A;  2R04 2;  3MDP A;  4IV1 B;  4OMC A;  4XJ9 A;  4CDX B;  1RGS A;  1O3T A;  1LHU A;  3QH6 A;  4YZ2 A;  1RIR A;  4DRR A;  4NHK A;  1QQP 1;  1UN1 A;  5K7P A;  3NJZ A;  1UY2 A;  3O14 A;  3MW2 A;  1BHG A;  3TEY A;  3RZJ A;  1PO1 2;  1G9D A;  3LDB A;  5A3W A;  3WCS A;  2WNV B;  2GC2 A;  1RUD 3;  4A4A A;  1GMM A;  2CHH A;  1GNY A;  4YVS B;  1I1E A;  2JKB A;  3MV1 1;  1GIC A;  1JZ6 A;  5KHH A;  2ZPX A;  3ZFG A;  5FYV A;  3AK0 A;  1UKG A;  4GB3 2;  3VB9 A;  2VZU A;  5FPL A;  4Q26 A;  1MS5 A;  4BOW A;  5IVY A;  1FT9 A;  2QUO A;  4Y1Z A;  4FFG A;  1RUC 1;  3BIW E;  4HFS A;  4LO4 B;  5CKQ A;  1W6Q B;  2E7Q A;  3RZL A;  4HVR A;  4CXW A;  1MZ6 A;  4XE9 A;  3RYK A;  3VDD B;  3NNL A;  5DMY A;  1MS0 A;  2XML A;  4DXZ A;  5BNN A;  2YV8 A;  5LZ6 A;  1QJX 1;  2FZ2 A;  4MOA A;  2OS2 A;  2VCC A;  4EN0 A;  3EQE A;  3QD6 A;  4XMA A;  2VCM A;  3WNL A;  1IHM A;  1RB8 G;  3ZMN A;  5FP9 A;  3G7D A;  4RA0 A;  1PVX A;  1WW6 A;  3T0A A;  1RUI 3;  4O65 A;  4XHB A;  3VBO B;  2DTY A;  4LTA A;  3ZFF C;  5JMO A;  1XU2 A;  5FXX A;  1W6N A;  2VMH A;  1OQD A;  2VR4 A;  1UZY A;  3WZ1 A;  2H0B A;  3ZXJ A;  2ZGN A;  4NRM A;  2WAB A;  4AAX A;  4XDQ A;  1OA3 A;  1CAW B;  4QQH A;  1ZZC A;  1RVF 3;  3B93 A;  3W21 A;  1YO8 A;  4BWO A;  4COZ A;  4XZP A;  4LHL A;  1K5M B;  1GZW B;  3WDX A;  4YAR A;  4BXF A;  3ORJ A;  3D6E A;  3HNB M;  1OPO A;  4LO7 A;  1Q8P A;  2Q30 A;  3PVO A;  5C71 A;  1D0G A;  5AC9 2;  5LAT A;  1KS5 A;  5I8T A;  3THT A;  2BGC A;  3HPN A;  4NO4 A;  4HN1 A;  1PK6 A;  2BWA A;  3FLT A;  4QKB A;  3JD7 3;  5F2S A;  1LCL A;  2F4L A;  3WSO A;  1LB2 A;  3DYP A;  2WR9 A;  1JYC A;  5JCT A;  1BMV 1;  4QAW A;  2BWC A;  1OD3 A;  2FCU A;  1AX0 A;  1KS4 A;  3UV9 A;  2DVD A;  3ST7 A;  4U36 A;  3ZR5 A;  5IWF A;  1LEM A;  3ZN6 A;  2VC9 A;  3O0W A;  1X7N A;  1QJY 3;  1C3H A;  4P14 A;  5AVP A;  3WF0 A;  1NY7 2;  3VBU B;  2VUL A;  4NHY A;  5F39 A;  1RHI 3;  4DEQ A;  5HXV A;  1S2B A;  3KHB A;  2XR4 A;  5GZF A;  4D0Q A;  1FPN 3;  1ONA A;  2R0F A;  3SIT A;  3M3O A;  5FY4 A;  3RGB A;  1Q56 A;  1UIJ A;  2IC1 A;  5FK7 A;  2ZGO A;  2LW8 A;  1QU0 A;  5K4L A;  5C8C A;  5FR3 A;  5ABJ A;  2EIG A;  5EIY B;  4G3Y C;  4QU2 A;  4XOG A;  3X29 B;  4Q4X 1;  2RDQ A;  1UMZ A;  3MIH A;  5FPU A;  3DF0 A;  1ZRR A;  3N7J A;  2RM2 3;  3I2I A;  5FIX A;  4ZU4 A;  5LBE A;  4AWD A;  4BH9 A;  2RR1 1;  3I2K A;  5GLV A;  2OX0 A;  2WBK A;  3FZ3 A;  3KT4 A;  1W6P B;  5D8A B;  1NT0 A;  3D82 A;  1QIQ A;  2VOW A;  3VBF B;  2WZR 3;  2XJV A;  2IFR A;  2CDO A;  3ZPO A;  3GJB A;  2DFC A;  4PHZ A;  2Y0O A;  3T2P A;  2BOI A;  2KA3 A;  3VUO A;  4UAP A;  4AVT A;  2VZT A;  2DCJ A;  2WT1 A;  3VBS B;  4OI4 A;  1NCR A;  4K1Y A;  1ZZ6 A;  4FT8 A;  3CQO A;  1A8D A;  2B39 A;  1GWM A;  3PUQ A;  5BNP A;  1V6N A;  1KJL A;  4URT A;  1UU4 A;  3LDR A;  1C8M 1;  4PJY A;  4S2D A;  3M3Q A;  3NNF A;  5FMC A;  1ULE A;  1B09 A;  1O91 A;  1VRH 3;  2RMU 3;  1WW7 A;  2GSY A;  1S0C A;  5FXZ A;  4EE2 A;  5C9A A;  1Z7S 1;  1KXG A;  1IS4 A;  5FV3 A;  4R4Z A;  1CPN A;  3M4F A;  2VNG A;  4AZZ A;  1AR7 1;  2JIJ A;  1WLC A;  1YYN A;  1EUT A;  1AR9 3;  5G04 L;  4G4F A;  1MQT B;  2R16 A;  4YM3 A;  2JDU A;  3EXU A;  4UFI A;  2BFU S;  1UCX A;  2XUE A;  3EBR A;  5FUP A;  5FJH A;  4PQQ A;  5FAX A;  2DVA A;  1SFY A;  4C0B A;  1RUG 1;  1NA1 A;  5HI0 A;  2P4E A;  2AEN A;  4LBJ A;  2A6W A;  4XDO A;  5B2G B;  1RUH 1;  5EJ1 B;  5FP7 A;  5FZA A;  1FV2 A;  1XE0 A;  1LGN A;  1EV1 2;  1PGW 2;  2OW4 A;  4XF9 A;  4R4X A;  1IOA A;  4WVZ A;  5EYY A;  4CP2 A;  5FXV A;  5LCW L;  4GAZ A;  3KGL A;  4I2O A;  1TVG A;  1OVS A;  2DFB A;  5FYY A;  1RUD 2;  4CU6 A;  3PME A;  4JKL A;  2BQP A;  4J25 A;  1H1M A;  3E6D A;  3WW2 A;  3NNM A;  4ES8 A;  1FOD 1;  1ACC A;  2VTX A;  4WV8 A;  2ZEX A;  2PHT A;  4BXS V;  4CCE A;  2WYS A;  5J48 A;  2YYO A;  1CES A;  2AH2 A;  3QOP A;  4ZPI A;  3ZMO A;  1UXZ A;  2D7F A;  2WSU A;  3D5O A;  3MW3 A;  3VBR A;  2DVG A;  3K4A A;  1JTZ X;  2X53 S;  4XBQ A;  3HR9 A;  1I6X A;  2GNB A;  4GUL A;  1FMD 2;  2J42 A;  5L9R A;  1OUS A;  3QCW A;  4F7Z A;  5CKM A;  5A1F A;  5F1R A;  4UFK A;  1GP4 A;  1HB3 A;  3AP7 A;  1YLL A;  1UPS A;  5J36 A;  4GMP 1;  5JR2 A;  5I8Y A;  2VD7 A;  3O1T A;  2ZGP A;  4FOQ A;  1RUI 2;  1N1S A;  3CMG A;  4KMQ A;  4YFW A;  5TSW A;  4Y1Y A;  5FZI A;  1JOP A;  3K51 A;  3ZYP A;  1I9R A;  4A41 A;  1QQP 3;  1D4M 2;  1YQ5 A;  2BJS A;  2ZCW A;  4XCB A;  4CZS A;  3IZO A;  3L9J T;  4JGY A;  2B46 X;  2VZV A;  4DZG A;  1RVF 2;  3PTR B;  3N7L A;  4K8R B;  3WNK A;  3AMH A;  3ZXK A;  4ISQ A;  1UMH A;  2MEV 3;  5F3E A;  4IGO A;  2PHD A;  4MH0 E;  2XJQ A;  3M3C A;  5IAT A;  2WFF 2;  4LOR A;  4JHT A;  4NID A;  1POV 1;  2PHL A;  3ZSM A;  1SBE A;  3A23 A;  5FZO A;  4I0B A;  2YG0 A;  3LPF A;  1AHS A;  5FPV A;  5JPM B;  2D3R A;  4CDU B;  2BPA 2;  1X36 A;  4A7Z A;  3CZJ A;  3KCC A;  1OSG A;  1NCQ B;  4R9C A;  1RUJ 1;  4FVV A;  4CDQ B;  4FPK A;  3WD5 A;  2D6O X;  3N9M A;  5C8C C;  2XDV A;  4AVV A;  1ASJ 3;  5IUQ A;  5D2A A;  1RTV A;  4NPR A;  4XJA A;  4AED B;  4ERO A;  1OOP C;  3WNX A;  3VV1 A;  3WR0 A;  5ANN A;  5GLT A;  2IXJ A;  3VKN A;  1QJY 2;  2I74 A;  1J1L A;  1US3 A;  3OUJ A;  1GSL A;  4UXA A;  4TTG A;  5IVC A;  2R30 A;  2E53 A;  1G8W A;  5DG1 A;  4LK7 A;  4EN6 B;  1F4H A;  4NN0 A;  4FFF A;  3ME2 A;  1JHN A;  5A3N A;  4NIG A;  2YU1 A;  1XQN A;  4LBL A;  4MGI E;  3JQX A;  2CSG A;  1FPN 2;  4NIH A;  5A3U A;  4UFH A;  5JIA A;  5KHK A;  3RFR A;  3N4M A;  4ISR A;  3WOG A;  4S2H A;  1RXF A;  4IEU A;  4RR3 B;  2Q8O A;  3HNM A;  3O1R A;  1AVB A;  3AZY A;  4PF5 A;  4Y20 B;  3B9C A;  4ZU7 A;  1B35 A;  4FP3 A;  3NJX A;  3VZM A;  1W39 A;  3H8U A;  2P3I A;  4E8C A;  1X8E A;  1QH6 A;  2YBS A;  3USS A;  1BCX A;  3LA3 A;  2QFE A;  4JAA A;  1OKO A;  1AJK A;  5J1X A;  5A3M A;  1GKB A;  1MZF A;  4GQ7 A;  2W68 A;  4XAE A;  3TBD A;  1QDC A;  1TMF 2;  2P5B A;  1YIP A;  3AFG A;  4W6W A;  1C1L A;  3I97 A;  4Y24 A;  4BQ2 A;  1VB4 A;  4ZS2 A;  4MX3 A;  2YBP A;  4KL1 A;  4L92 A;  4P9J A;  4E4Z A;  3PJQ A;  1WWY A;  3I3M A;  2BUK A;  4B4Q A;  1GZ9 A;  1WME A;  2E63 A;  3G6J B;  4Y33 A;  2CGN A;  3K75 B;  1VBA 1;  1VRB A;  5FZ6 A;  4D3W A;  1DZT A;  5IFT A;  2BOJ A;  1VBB 3;  3LPG A;  4WM7 C;  4AEM A;  4COW A;  4N9H A;  4DS0 A;  2CGO A;  3OBR A;  4CYD A;  3SCG A;  1Q5O A;  3W5M A;  2QQN A;  3IAQ A;  5LA1 A;  4P9W A;  1XND A;  4HBN A;  2BBA A;  4Y22 B;  1H30 A;  3E5X A;  4XIL A;  5C70 A;  4CUC A;  2E51 A;  3O1O A;  4QPI A;  1WA6 X;  4GWM A;  2C26 A;  1AL2 2;  1LOF A;  2QNK A;  4H14 A;  1J83 A;  2ES3 A;  4B29 A;  3MZH A;  2HBT A;  4IV3 C;  1OH4 A;  3GYD A;  3P3P A;  4PF1 A;  2JDH A;  4RS5 A;  3S7E A;  1MZ5 A;  3H8O A;  2EA7 A;  4HSL A;  4FO9 A;  4UI9 L;  1GZC A;  2Z79 A;  3PUR A;  5KXC A;  4Q4V 1;  5D21 A;  1W9F A;  1BK1 A;  4BME A;  4Q4X 3;  3NV1 A;  1A3K A;  3WP4 A;  5GLW A;  5JXH A;  1XJA A;  4K7J A;  3J4U H;  4Z8B A;  5FPX A;  1UW8 A;  2RR1 3;  2VQ0 A;  1CIW A;  3N3H A;  3EB7 A;  5FYI A;  2GAL A;  2Y38 A;  5LRR A;  4A45 A;  1HB2 A;  3LSD A;  4YM1 A;  3WUD A;  2WZP P;  3LIG A;  4AGV A;  2B5H A;  4HSJ A;  4M0N A;  3RI8 A;  2R06 1;  3OEB A;  4JGZ A;  4PDW B;  3WW4 A;  2FDG A;  2NN8 A;  4AYU A;  1SLB A;  2WO3 A;  3ECQ A;  2YPD A;  4XUP A;  3CJI B;  3ASI A;  3KV9 A;  2JDP A;  2HH9 A;  1JW6 A;  1W90 A;  2D97 A;  3IDA A;  3MLJ A;  1PO2 1;  5LW9 A;  3I2O A;  1RUE 2;  1RUF 2;  2H6C A;  2HJI A;  3PU8 A;  1N47 A;  3N36 A;  5A7W B;  1PIV 1;  5T52 A;  5FQ0 B;  2BDR A;  2BFU L;  3S30 A;  1D0H A;  1X8M A;  2QE3 A;  4CEW A;  1V9U 3;  3OGR A;  4YRD A;  3LD8 A;  1Z7S 3;  1H8T C;  1Y9Q A;  3BYW A;  1CVN A;  3AXD A;  4YZ1 A;  2GNT A;  1HQW A;  4C1W A;  4C90 A;  1AR7 3;  5I0R A;  3PU3 A;  3NKG A;  1SBD A;  4L9B A;  2BGP A;  2ZHL A;  4IV1 C;  4F8A A;  2XJU A;  5C3R A;  1W8T A;  1U5I A;  3A22 A;  2A73 B;  2OVU A;  4LJH A;  1EAH 2;  3DYO A;  3F95 A;  3HN1 A;  4OFG A;  4QPW A;  2VJX A;  2WUH A;  1HQN A;  4XUQ A;  4R9B A;  3THD A;  4YGC A;  1RUG 3;  5J98 B;  1UPI A;  3ZPY A;  2RS5 2;  2WNV C;  3QH7 A;  4UFL A;  4YW1 A;  2QQM A;  5FZB A;  1LEC A;  4JTN A;  3TEX A;  3TYJ A;  2X5I C;  1U5X A;  1QQP 2;  4YVS C;  1VLN A;  1ZM1 A;  1ZA7 A;  3WUC A;  3ZFF A;  4DXS A;  1GV9 A;  4N9I A;  1CPM A;  1Z0H A;  3CKH A;  1OLQ A;  4MXW B;  3N7K A;  3IPV A;  5F32 A;  2FDH A;  1EPZ A;  3WEZ A;  4HET A;  5FOB B;  4HPK A;  3HQR A;  3MUY 1;  3AKS A;  1FOD 3;  3IWZ A;  2XWB B;  5EHD A;  1TNR A;  1IGO A;  5CFD A;  2OII A;  2H0V A;  5DXD A;  2ARE A;  1W9T A;  3UES A;  2RE9 A;  1ND3 B;  3ACI A;  3VDD C;  5J37 A;  1OLM E;  3H7J A;  2C1F A;  5A7S A;  4OLL A;  1TE1 B;  5FO8 B;  3B7M A;  1RUC 2;  1H9P A;  1HLC A;  2CDP A;  2YDE A;  2IXH A;  3KF5 A;  3SKJ E;  4Q0Q A;  4BIO A;  2JG8 B;  2W47 A;  4K21 A;  3TNQ A;  1UKR A;  4QB2 A;  3H50 A;  3V0A A;  5L73 A;  1QJX 2;  2XLF A;  3MYX A;  2WL1 A;  3DKQ A;  3NNJ A;  4NE9 A;  1LJ7 A;  4Q1P A;  2VEC A;  1MZE A;  5IW0 A;  1W03 A;  1LEN A;  3MFA A;  3RG0 A;  4UOJ A;  3LF7 A;  5DN2 A;  4AR2 A;  1IG0 A;  3OBT A;  2R04 3;  2Q8E A;  3DGT A;  3ZN4 A;  4B4P A;  3SMH A;  4LOT A;  4RGA A;  3W5N A;  5JSP A;  1YC6 1;  1K5M C;  2Q4S A;  3WQ0 A;  1OMI A;  1UOG A;  2DV9 A;  3AYA A;  4N53 B;  3ABZ A;  3AMN A;  2AYH A;  3GJA A;  4G9S B;  5HXM A;  3UGG A;  5IJR A;  1MVQ A;  4UBH A;  4EV0 A;  1N3P A;  5KWR A;  2UYB A;  2WFF 1;  4GJY A;  3HIF A;  3MF9 A;  3LSE A;  3VGI A;  4BQ4 A;  1CAV A;  5A32 A;  3H3L A;  2XVK A;  3H1W A;  4YG6 A;  4P9G A;  4KU7 A;  1ND2 B;  4HT1 T;  4Y4Y A;  5DAP A;  4FAG A;  1XNK A;  1DQ1 A;  2XKP A;  4WM8 B;  4Z2A A;  5F5Q A;  1YQ6 A;  1MVE A;  2WO1 A;  2R1B A;  5BNQ A;  3AMP A;  4LUL A;  1AR6 1;  3T09 A;  3ZKU A;  4Z1V A;  2JG9 A;  4COV A;  5K0U B;  4IE5 A;  1BMV 2;  3RSJ A;  3LOB A;  2J1A A;  1LOG A;  2Z69 A;  2ETE A;  3GNE A;  3H3Z A;  2XJT A;  1X9T A;  3I4I A;  1C4R A;  5C5T A;  2ZGS A;  4DUV A;  1DGW A;  2ZAC A;  1HRI 1;  4JHZ A;  3OSD A;  1RUO A;  2ZTN A;  5CB7 A;  3PMS A;  1WMF A;  4IE4 A;  1JS9 A;  2CU5 A;  4JCK A;  2GNM A;  4QT6 A;  5EFU A;  2FDK A;  3B69 A;  2ILM A;  2VQU A;  2XQX A;  4NVP A;  5IHR A;  3LDK A;  4V2V A;  1QOO A;  3FUO A;  4TXW A;  1G9B A;  4RHV 1;  1BBT 1;  1UU5 A;  5FZE A;  1V6J A;  1HW5 A;  3HN3 A;  2OYZ A;  1W6M A;  5A3P A;  5A7Q A;  2DUR A;  4AK3 A;  2V5D A;  4DIN B;  3D0S A;  5D8A C;  5IT6 A;  2W0X A;  3O1V A;  2DYC A;  2ZZQ A;  4Q4X 2;  5AC9 3;  1UL9 A;  5LK5 A;  3VBF C;  2XG3 A;  5C8W A;  4XBL A;  3K4Z A;  4CUA A;  4HK9 A;  1SFN A;  4XZU G;  2RR1 2;  4CCO A;  2FZ1 A;  4CCC A;  4L99 A;  2D6P A;  1ZZ7 A;  2ADD A;  4OYU A;  4S2F A;  4LA2 A;  4QM8 A;  2WN3 A;  3ZXG A;  1XNT A;  5ANQ A;  3CZU A;  2A6V A;  2BEO A;  3MBW A;  1NXD 1;  3VKM A;  3C8X A;  1S2K A;  1G6N A;  1VBA 3;  2QQW A;  4AFB A;  1ENR A;  5DZE A;  3ZFG B;  1WCK A;  2J1S A;  4PIX A;  1LHN A;  2J1T A;  1G9C A;  1J58 A;  1O3Q A;  2RDN A;  2WQ4 A;  2A7A A;  3POW A;  2YFZ A;  1AL2 1;  1C8M 2;  1HIX A;  4FXK B;  3TB0 A;  4XFH A;  4PIY A;  3WP6 A;  1P8J A;  4D7T A;  1MQT C;  3ZYR A;  4H7L A;  5BNN B;  1IKP A;  4IEZ A;  1V6M A;  1Z7S 2;  1KEX A;  2HWE 1;  3OPT A;  2OUJ A;  4FXG B;  1GBG A;  4BQ1 A;  4O9E A;  3ZFE A;  5JIU A;  4NMI A;  1AR7 2;  4ZON A;  1A6C A;  4RQP C;  3WDW A;  3ZSJ A;  1LOA A;  1UD1 A;  1QHD A;  1COV 1;  3FL7 A;  2VO5 A;  1W99 A;  3RRD A;  5I0D A;  3VN4 A;  3SEE A;  2D6M A;  3VZK A;  1W6N B;  3ZYH A;  3HBK A;  4UW3 A;  2Z4F A;  5HCB A;  2P2K A;  5F3C A;  4AF9 A;  1OA4 A;  1RUH 2;  3USU A;  4R9D A;  3K2O A;  3UGF A;  3AX4 A;  4QX5 A;  5FZH A;  1UYP A;  1XB9 A;  2R0H A;  1Y7B A;  3KV6 A;  1NE6 A;  2LTN A;  4O7X A;  3AP6 A;  1GNZ A;  1NQJ A;  2JKX A;  1UX6 A;  1UY0 A;  2Y26 A;  4KQ7 A;  4EWA A;  3U0Z A;  3CJX A;  3T1L A;  3Q8E A;  4PT6 A;  2RG4 A;  1W2O A;  2ZBJ A;  3V0B A;  1SLL A;  3POJ A;  4FPL A;  4LK6 A;  4BQY A;  4UFM A;  3P5B A;  1UY4 A;  1UOJ A;  3FLR A;  1FOD 2;  1W6O A;  2AEY A;  5GZE A;  2NM1 A;  5BY5 A;  1CON A;  4XET A;  2IXC A;  3T2Q A;  1FI2 A;  2EXH A;  3INA A;  1W0O A;  1PK6 B;  5LA9 A;  4WVV A;  2ERF A;  5JWP A;  3ETQ A;  2PHU A;  3BTY A;  1JU4 A;  1T6B X;  2EAA A;  2VOV A;  1GWL A;  3OPZ A;  4QX8 A;  3VZL A;  4YFZ A;  2WT0 A;  3KSC A;  1WMX A;  1ODM A;  4CCJ A;  3ES1 A;  3VKF C;  3ZYB A;  4EQV A;  2VL4 A;  4YW3 A;  1PMH X;  2BGO A;  4FFI A;  1LTE A;  3LEI A;  1O59 A;  2C24 A;  2K2S A;  3FHI B;  4W4Z A;  1TZO A;  2VTX J;  1ZNP A;  1MR5 A;  1VBE 1;  1W3V A;  2XJS A;  1V0A A;  3THP A;  4UW5 A;  4CCN A;  4XQW A;  4NRO A;  1ZX5 A;  3JZV A;  4FP2 A;  4XCA A;  1JBC A;  4CCL A;  4I02 A;  5FLI A;  1DDL A;  5FZK A;  4DNY A;  3HVD A;  5SV5 A;  3T0B A;  5B4X A;  2GU9 A;  2XQR A;  4M3C A;  4WVM B;  1EV1 3;  2ZXQ A;  2A1X A;  4LBK A;  4M4P A;  4BE3 A;  3AKT A;  4CRQ A;  5EZW A;  1W9Y A;  5C4W A;  1QOS A;  4K20 A;  1DZQ A;  5JZG C;  4A3X A;  3OJB A;  5ABJ B;  3C7O A;  1WGP A;  3MID A;  4YM2 A;  3WX5 A;  5BV6 A;  2A6Y A;  4HN0 A;  4IET A;  1CZV A;  4MGK E;  3IN9 A;  1C5I A;  5ACA 1;  3JCI A;  4Q2F A;  5GAL A;  1L3J A;  4CDU C;  4LA3 A;  2EID A;  1D7P M;  5JVV A;  2GDF A;  4ET7 A;  3MUZ 1;  1NCQ C;  4Q4Y 1;  3T2O A;  3ZM8 A;  4CDQ C;  5E6H A;  1GZT A;  1OT5 A;  4M01 A;  4HOO A;  4QU1 A;  4UW4 A;  4XTP A;  2ZX0 A;  4YLZ A;  2BBV A;  3BGA A;  4XIK A;  1HRV 1;  2LAL A;  2QDN A;  3WG1 A;  4QHB A;  1FMD 3;  3U14 A;  4AED C;  1RUJ 2;  5GZD A;  2WRA A;  2YMZ A;  2YFU A;  4YNI A;  4YG3 A;  1F35 A;  3KLS A;  4K3U A;  4I30 A;  1KQR A;  4L2N A;  4XDP A;  3W59 A;  5FPZ A;  2JEM A;  4RFT 0;  2UY9 A;  4ASK A;  4JKK A;  1NCR B;  4XJZ A;  4FI9 A;  2DU1 A;  4OI0 A;  2B42 B;  5SV8 A;  3WY6 A;  5BNP B;  1VBD 1;  1C5H A;  2FQP A;  2HLE A;  3U10 A;  2NMO A;  4KGG A;  1XBF A;  3OGG A;  2VW0 A;  4MYE A;  1D4M 3;  3IB3 A;  4WM7 A;  4YW7 A;  4IE6 A;  3GZE A;  2W1Q A;  1XSQ A;  2F17 A;  4QQL A;  5C9A B;  3VD4 A;  3UKV A;  4ZHN A;  2YY1 A;  1G9F A;  3SHR A;  1PM7 A;  2I2S A;  1ULG A;  4PLM A;  3WCR A;  3AXE A;  1OUX A;  2W9X A;  4WZC A;  4FBF A;  1HB1 A;  2WII B;  4F83 A;  3AZZ A;  2Q1F A;  4FPY A;  4URA A;  4DRV A;  2WFF 3;  1XNB A;  3AP5 A;  2K46 A;  1ODN A;  4QXH A;  2ID4 A;  3RJR A;  1AXZ A;  1NA1 B;  1H2L A;  3OGV A;  4XC9 A;  2JDY A;  3LCP A;  1C1F A;  4XVH A;  3ZYJ B;  5L9B A;  4YWA A;  4IEY A;  4XPV A;  4AI2 A;  5C5U A;  2XHN A;  5F5A A;  5JI9 A;  1RMU 2;  2JE7 A;  4AI1 A;  4AHY A;  2GN3 A;  3NJV A;  1K12 A;  3HAG A;  2Y8K A;  3IAP A;  4OI2 A;  2XGX A;  1IS3 A;  3GHN A;  3NJY A;  1C57 A;  3ROU A;  4D69 A;  1FX5 A;  3AVS A;  4HG6 B;  5I91 A;  2A75 A;  1S0F A;  5T54 A;  2DVB A;  3PIJ A;  3NL1 A;  3U4S A;  4NJ4 A;  1VBA 2;  1DBN A;  4YM0 A;  3W58 A;  3NV4 A;  2ZGK A;  3LE0 A;  2VQT A;  3MIC A;  5EJ3 A;  1GP5 A;  4JDM A;  1HRI 3;  1X50 A;  2IXL A;  3O0X A;  3OB8 A;  4XF0 A;  2BNO A;  4YGE A;  5C3O A;  4E2S A;  5FZ3 A;  3FWE A;  3ZOI A;  3C7E A;  5JDB A;  4QX0 A;  1J84 A;  3APB A;  3WP5 A;  1PZ7 A;  3ES4 A;  4Z2W A;  5F6L B;  3VBR B;  4YW4 A;  3T0D A;  5JOX A;  2A70 A;  2B8M A;  5E1R A;  4KG0 A;  2DCT A;  4CCK A;  2XPJ A;  3V65 A;  4HKL A;  4IEX A;  4OHW A;  2P17 A;  4J1X A;  4OHX A;  1I3H A;  4ARX A;  1BBT 3;  3ACH A;  4A7K A;  3OGJ A;  5JSR A;  3GZA A;  5GM0 A;  3O1U A;  1R08 1;  3J7M A;  3UNP A;  1W04 A;  5FKC A;  1H8T A;  3KCY A;  4Q4V 2;  5FMO S;  4ZS3 A;  2GND A;  5FOJ B;  2VZQ A;  2RJL A;  5A70 A;  5FUI A;  3U4X A;  1F31 A;  1VMF A;  3B3Q E;  4AQT A;  1UZV A;  4XAA A;  5CFC B;  5ISL A;  1TMF 3;  4JGY B;  3WDV A;  2Y34 A;  4R8H A;  1W8N A;  4DB5 A;  4L11 A;  1UY3 A;  2Z5W A;  5A7P A;  3WNN A;  1S55 A;  2O14 A;  1UMI A;  1AUY A;  2BW8 A;  2R06 2;  4IE7 A;  4IE0 A;  4OZX A;  4AL9 A;  4N7I A;  2X5I A;  3ZKY A;  3S5A A;  3NKT A;  2C4X A;  1QF3 A;  2WJS A;  2VTF A;  4IDZ A;  5A6Q A;  5KC5 A;  2OQ7 A;  1HN0 A;  3WHT A;  4Q0U A;  4IL7 A;  3ZXL A;  5J7M A;  1PO2 2;  2W1U A;  3GZT B;  3J8F 1;  1IS5 A;  3OGS A;  1PIV 2;  1AL2 3;  4XJ8 A;  3VD5 A;  3U1X A;  4MHR A;  4TWT A;  4N8M A;  3IM0 A;  1JMU B;  4NII A;  5F5C A;  1MPX A;  5FZ0 A;  3WF2 A;  1AR8 1;  2J1R A;  1AYN 1;  4QWN A;  2C9K A;  3VDB A;  3TN9 2;  3J26 N;  3GBF A;  3UT0 A;  4MV2 A;  1OVP A;  2WDB A;  3N9L A;  4Q5O A;  2YB7 A;  3LGR A;  5I0T A;  2WLQ A;  5A33 A;  3WF3 A;  2VXJ A;  5JUV A;  3WHU A;  1I5P A;  1UYZ A;  4QX7 A;  2VNV A;  5F37 A;  1DQ0 A;  2Y0I A;  3AZX A;  1O3R A;  3ALQ A;  4FOV A;  4OHY A;  1W9W A;  3RPQ A;  3ZSE A;  3JBG 1;  3ITQ A;  4BZ4 A;  3S6P A;  3BAL A;  2YRO A;  4ARY A;  3LWC A;  5A3T A;  4LE3 A;  4ONU A;  2QQO A;  5L36 A;  1O7F A;  2WC2 A;  1ND3 C;  3B00 A;  3ZDV A;  3OY8 B;  2XLA A;  4CEY C;  1LGB A;  1B35 B;  5F3I A;  3OEA A;  1LES A;  4FOY A;  4XAB A;  1RUE 3;  1RUF 3;  3KT7 A;  1XYP A;  5DAW A;  2WLP A;  4COY A;  1SDW A;  4Q0S A;  3T1M A;  1IPK A;  1CAU A;  1LGC A;  1PVC 1;  4Y5Z 0;  1DP0 A;  2DCK A;  1CAX A;  4NAO A;  5A7N A;  2HEW F;  3FHA A;  5JLV A;  4E4S A;  3CDZ B;  4PI2 A;  4BMB A;  2QCS B;  1YXW A;  2YUE A;  2TNF A;  4HON A;  1KIT A;  3I7D A;  3C7F A;  1D4V B;  1IQD C;  3O0V A;  1UIK A;  4GAL A;  3BU0 A;  2R7E B;  3VHR A;  1APN A;  3CLP A;  4AI8 A;  4NRP A;  1KJR A;  1UO9 A;  2Y60 A;  3P1I A;  3I2G A;  2JDM A;  1VBE 3;  1EAH 3;  3SCH A;  3DEM A;  2BV4 A;  4YVW B;  2JE8 A;  3WQ1 A;  5AVA A;  5G05 L;  5FY7 A;  2LRP A;  3I2D A;  2WIN B;  2RS5 3;  2VXR A;  4AQ2 A;  2G9Z A;  5HPO A;  2J1U A;  2G1M A;  3U07 A;  1PGL 1;  4OUS A;  1VJ2 A;  3WDU A;  3RQ0 A;  2JB4 A;  2DCZ A;  1BEV 1;  1GQH A;  2OKX A;  1W8W A;  4RS5 B;  5LA0 A;  4ZZ5 A;  2BNM A;  3VDA A;  1BKZ A;  1ENX A;  2X8K A;  5ACA 3;  4WM8 C;  5H9S A;  1GP6 A;  4JKM A;  2XON A;  1JZ3 A;  4Q4Y 3;  3ZXF A;  2JD4 A;  2ZGU A;  2XB6 C;  5ERL A;  4UF0 A;  2RJ2 A;  3DPR C;  3WXP A;  1YUD A;  3BPS A;  5IK7 A;  4DMI A;  4M4R A;  5K0U C;  5KC6 A;  1HRV 3;  1RUC 3;  1US2 A;  2AZ5 A;  5C3Q A;  3NAP C;  3VBF A;  1RIT A;  2XL9 A;  3POF A;  4BIF A;  1G9A A;  4JGZ B;  3T30 A;  1OKQ A;  4NWV A;  1AR6 2;  1QJX 3;  2ZAA A;  3TEZ A;  2I07 B;  2YBK A;  2P3K A;  3PL0 A;  2X05 A;  2K9Z A;  4GIQ A;  5J09 A;  2HWD 1;  4HVO A;  4LE4 A;  1VP6 A;  2B9V A;  3P3N A;  1W28 A;  2CWM A;  1O5L A;  2ATF A;  3KWV A;  3MO4 A;  3NV3 A;  1JOB A;  4IQP A;  4XW3 A;  4A42 A;  1LUL A;  3GF6 A;  3O1M A;  3ILF A;  1HRI 2;  4B7E A;  5EPA A;  1IPS A;  4DQA A;  2VU9 A;  4Z07 A;  1V00 A;  5GKA C;  2GME A;  4CEW B;  3KV4 A;  1V70 A;  1DQ4 A;  1VMJ A;  2W46 A;  4JZR A;  3KHC A;  4Y4R A;  3QLQ A;  5DZG A;  1F4A A;  4GD4 A;  4KG8 A;  2ZOE B;  3GHM A;  4QD2 A;  2HWC 1;  4GWI A;  1O8P A;  4XQD A;  3RYR A;  3W20 A;  4RHV 2;  1BBT 2;  1ULD A;  2WWJ A;  1OBN A;  1UY1 A;  2VH9 A;  4NPM A;  3BOP A;  3OD4 A;  4QPY A;  2IVJ A;  3BTA A;  4YSF A;  5FYM A;  5DQ0 A;  1H4H A;  3NQH A;  2WNU B;  2VZP A;  2WNO A;  3AMM A;  3HMY A;  4RQP A;  4CA9 A;  3IKW A;  4I0W B;  4HK8 A;  5B4N A;  3FBM A;  1RMU 1;  2DUP A;  4MGQ A;  3ZFF B;  3VKL A;  3EMR A;  1DYO A;  5FPB A;  1AF9 A;  1WW5 A;  1ZVF A;  3PUS A;  3ZFG C;  3IPV B;  4D8M A;  5LY1 A;  1YRZ A;  3LFI A;  4O61 A;  4V2W A;  3MW4 A;  5IYY A;  4HPK B;  1VAV A;  4LEJ A;  4OVE A;  3MIF A;  4QPG B;  1RXG A;  5CFD B;  1Q43 A;  1Y3T A;  2D3S A;  5FZ7 A;  2IVI B;  2MHF A;  3VDC A;  1QXP A;  1FXZ A;  1HQL A;  1EUU A;  2JJ6 A;  3Q8C A;  4A2U A;  5BNN C;  3VD3 A;  2C9A A;  2MNG A;  3DKW A;  3O5S A;  4MUV A;  4Y1X A;  4MO3 M;  5FMO L;  3WNO A;  2ORZ A;  1UU6 A;  3LQC A;  4XF1 A;  1OF4 A;  1U5Y A;  1OHF A;  3LKJ A;  3WNP A;  3V0A B;  3H1M A;  1H9W A;  1Q8S A;  2VPV A;  2A6X A;  4CU9 A;  2HWE 2;  1E5I A;  3S7I A;  1JUH A;  5DG2 A;  3JQW A;  1S0I A;  2PAK A;  4HKW A;  2J1E A;  2P3J A;  1DG6 A;  2QZ2 A;  2YPJ A;  3I3D A;  5EQU A;  3M1H A;  3T4H B;  1XRU A;  1COV 2;  2ZKN A;  3HBZ A;  2DU0 A;  2VE1 A;  4GH4 C;  2YC4 A;  4Y1U A;  2NP0 A;  1H6Y A;  1YFU A;  4X8P A;  3VZJ A;  4KWL A;  5FKB A;  3NVC A;  4TLF A;  4J6G A;  2D5H A;  5K8S A;  3OCP A;  5KHG A;  2W94 A;  4LXL A;  2WNE A;  3UK9 A;  3ZO0 B;  3RYP A;  2P3Y A;  3POI A;  2E6V A;  4PCR A;  5FFO C;  5DAB A;  4GWJ A;  1WW4 A;  4KWU A;  2ET7 A;  2NQY A;  5BNO C;  1XU1 A;  2K0G A;  4NHX A;  1W8U A;  5L7O C;  3ON7 A;  1CJD A;  2XWJ B;  4Y5T A;  1CAV B;  5A32 B;  4LBO A;  4AGR A;  2BER A;  3EHK A;  3ZDS A;  4I01 A;  3RMX A;  3ZSL A;  1ZBE 1;  5JZG A;  4FPE A;  1DU3 D;  1TQ5 A;  2OZ6 A;  4EN7 B;  4XBN A;  3O1S A;  3GBW A;  1C8M 3;  2YU2 A;  5AFB A;  4XHX A;  3K48 A;  3GCW A;  3CL1 A;  2E31 A;  2EVX A;  3CO2 A;  2DCY A;  4L97 A;  1BVV A;  3QAC A;  4LKS A;  5IVF A;  4MLO A;  3WVJ A;  5FMD A;  3IMM A;  3PTY A;  4FPH A;  1T2X A;  3AC0 A;  4N43 B;  4CDW B;  1ZRC A;  2JG9 B;  1MS1 A;  3TN9 1;  4PI0 A;  4GKY A;  5J96 B;  3I2F A;  4AOC A;  5IFP A;  1NQD A;  1YFX A;  1OA2 A;  1ENS A;  4CDX C;  2BU9 A;  4R52 A;  4YPJ A;  1LRH A;  1VBE 2;  3HQX A;  3NWK A;  2D3P A;  2DTW A;  1EYB A;  1W8Z A;  2RS1 1;  3WG4 A;  1WD4 A;  3A0N A;  2VMD A;  4IXL A;  4DFS A;  1O3S A;  1NYW A;  1VAL A;  2YC2 A;  2GC3 A;  2YGL A;  3RZH A;  1W8O A;  1RUH 3;  2UYA A;  1NKG A;  2H6B A;  2P37 A;  4KH9 A;  3SEP A;  5A1L A;  2J1V A;  1XYN A;  1MEC 1;  3PUH A;  3NST A;  2E7A A;  1AJO A;  4MAD A;  1MS4 A;  4Z92 B;  1X82 A;  2BNN A;  3M2M A;  1JZ5 A;  1W6M B;  4QKN A;  1ST8 A;  2IFW A;  1HB4 A;  5ACA 2;  2XJR A;  4Y20 A;  4AEK A;  2D98 A;  3MHZ A;  3M7A A;  4XJU A;  4Q4Y 2;  2Y33 A;  1IQA A;  4MVT A;  1F8V A;  3SNM A;  3SH3 A;  3WF4 A;  2WN2 A;  2WO2 A;  4P00 B;  1HRV 2;  4AXO A;  3VBH B;  5JAX A;  3N35 A;  2IXI A;  1NCR C;  2DVF A;  2PLV 1;  4MGZ E;  2YC0 A;  4P9Y A;  2ZGL A;  5FZD A;  4LKF A;  2EIC A;  2R6Q A;  2CAU A;  2P6C A;  3AZW A;  3PVN A;  4WVW A;  3VBO C;  4D6R A;  1N3O A;  4GMP 3;  5FYU A;  4FPF A;  5KXB A;  3KM5 A;  3BPZ A;  1LHW A;  1WKY A;  1JU3 A;  4XFI A;  2J7M A;  1W9S A;  5C9A C;  3OBZ A;  5LBF A;  2XH6 A;  1VBD 2;  2PTM A;  1XOY A;  2VM9 A;  3KCX A;  2Y64 A;  4FOW A;  2VVD A;  4R9A A;  4XAC A;  1JYT A;  3T3Y A;  4LO8 A;  2CNA A;  2WO7 A;  1H8V A;  2ARX A;  2ARC A;  4UBG A;  1BEV 3;  2G9G A;  2QBX A;  4IEP A;  3ZFE B;  2P34 A;  1GWK A;  3VHO A;  4DUW A;  1NA1 C;  1WD3 A;  3CEW A;  4MXV A;  4V1P A;  2D43 A;  1ZA4 A;  3ZYG A;  3KF3 A;  3RMY A;  3URF A;  1POV 3;  2Q5T A;  3KS7 A;  3M3I A;  4IEV A;  4PBO A;  1J3Q A;  1CZT A;  1HV1 A;  5FBJ A;  2WAA A;  3JB4 C;  4AHX A;  5DUV A;  4RYD A;  3U11 A;  2TEP A;  5LB6 A;  1HV0 A;  3USU B;  3PIG A;  4N90 A;  1RUJ 3;  2WFP A;  1RJ7 A;  1RUN A;  3AJZ A;  1NUK A;  1V6K A;  5C6C A;  2XVL A;  3A7Q A;  3ACG A;  4GWN A;  2P6H A;  2YZ4 A;  5JMC A;  3LIH A;  2Q8D A;  2FHR A;  3RZG A;  3D0J A;  3VBU C;  1LOC A;  3V0B B;  1V6O A;  4FPG A;  1BZW A;  3VL9 A;  2DF7 A;  5LEJ A;  3KGZ A;  1W6O B;  2VZ3 A;  1NG0 A;  1F15 A;  5EV7 A;  1AX2 A;  1GFF 2;  2JIC A;  1DQ5 A;  2UWC A;  1M4W A;  1UF2 C;  2X10 A;  4AGG A;  1Q8V A;  4W65 A;  2XKO A;  2C0Z A;  2ORX A;  1SPP A;  4AEJ A;  1QDO A;  3JD7 1;  4K9S A;  5IVB A;  4HMZ A;  3UJQ A;  4FTS A;  2HYX A;  4IEW A;  1UX7 A;  1SZB A;  2GH2 A;  4AI0 A;  1PMI A;  3RZM A;  1UWW A;  1H1A A;  4QQ2 A;  4E2Q A;  1SEF A;  4XXP A;  1XPW A;  1YJK A;  4UWD A;  4F3J A;  5FO7 B;  4IEQ A;  3I54 A;  3AKQ A;  3F2Z A;  3O7O A;  1R08 2;  1SQ4 A;  2VUC A;  5C3P A;  5CFC C;  1Q8O A;  5T50 A;  3T2T A;  1ZBA 1;  2B7Y A;  3VZN A;  4I09 A;  2RJK A;  2ZHN A;  5FUN A;  1RHI 1;  4EWE A;  5CAD A;  1UZZ A;  1UYY A;  2ZGQ A;  3H0O A;  2LS6 A;  2IUW A;  2OQ6 A;  4QB1 A;  4CPB D;  5IK8 A;  4M3C B;  4MZU A;  3E6B A;  1OLR A;  1RMU 3;  4L0P A;  5E8A A;  1GOG A;  1GOF A;  3T4V A;  3VBS C;  2MPF A;  4AVA A;  1JXN A;  5JR7 B;  5C4W B;  1J1T A;  5A6Y A;  4BM8 A;  5KHJ A;  1ENQ A;  1W2T A;  3VHP A;  5CYY A;  4ZXE A;  1EP0 A;  2SBA A;  5DAX A;  4SBV A;  3SLI A;  1E5R A;  4LQR A;  2OUH A;  3L2H A;  4BK5 A;  4KNC A;  2BP6 A;  5FP4 A;  1YJL A;  2UWA A;  2RM2 1;  3N7M A;  5T5P A;  1S2E A;  2F6B A;  5E89 A;  2OA2 A;  1GUI A;  1NZC A;  1SDD B;  3CF6 E;  4CEY A;  4PLO A;  3CU7 A;  2Y6L A;  3J8F 2;  1QJZ A;  1DCS A;  3HQU A;  1O5U A;  1SMV A;  1WBL A;  2EIB A;  2WZR 1;  4QQO A;  5GJ6 A;  5A80 A;  4CU7 A;  2W91 A;  1QJU 1;  1WMD A;  3AB0 A;  4ATF A;  5IAV A;  1UNB A;  2L9L A;  5T5L A;  4DXR A;  1AR8 2;  1DYP A;  1AYN 2;  2GN7 A;  2VCB A;  4ASM B;  1MS3 A;  1PZ9 A;  4Q4V 3;  4NHM A;  4CP9 A;  1Q3E A;  3C2U A;  3EJK A;  3M8L A;  1JH5 A;  3PJY A;  1CX1 A;  2VCA A;  3T08 A;  1NLQ A;  3CBN A;  2PEL A;  1ZRD A;  1KGY A;  3KVA A;  4WM7 B;  4AHZ A;  1J59 A;  1Y4W A;  1L7R A;  1VRH 1;  2RMU 1;  3ELN A;  4Y5S A;  4BLJ A;  2PYT A;  1QMJ A;  1GAN A;  3JBG 2;  3HJR A;  1B35 C;  1VAK A;  3WW1 A;  5A6X A;  1UZW A;  2R06 3;  3KVB A;  2EXK A;  4BPZ A;  2E32 A;  1AR9 1;  3KT1 A;  2E9Q A;  2ZHK A;  4E4D X;  5A1A A;  3DYM A;  2EF6 A;  3MIG A;  1OQ1 A;  2J22 A;  5FP3 A;  3SQO A;  4IEO A;  5CAZ A;  5JOZ A;  1JYI A;  1HJF A;  1OQE A;  2ZGM A;  1PO2 3;  2PAM A;  1SBF A;  2LUW A;  1RC6 A;  2PHW A;  1PIV 3;  1PM4 A;  4WM8 A;  5FYC A;  5CEH A;  1GU3 A;  1PVC 2;  1T6G C;  2CYF A;  5KR7 A;  5F5I A;  4K6B A;  4MSV A;  5EXO A;  1OFN A;  1BVP 1;  1F2N A;  2ZKL A;  3DPR A;  3TN9 3;  1TNF A;  2RS3 1;  4YVW C;  2RHP A;  3PUI A;  2GC1 A;  3SXW A;  1BLZ A;  3NAP A;  4CPB A;  1QY4 A;  3DL3 A;  4HL0 A;  1CD3 G;  1RL3 A;  2WAO A;  4LBQ A;  3ZN6 B;  2QJV A;  4BHP A;  4X6R B;  4CUB A;  4PIZ A;  2QQV A;  2NZ9 A;  3KB5 A;  5LRS A;  1NLR A;  1UOB A;  5CZK A;  5HV0 A;  3NMB A;  3GM8 A;  5HCF A;  3CHX A;  1OOP A;  4CCM A;  4FCA A;  2JE9 A;  1TG7 A;  2UUR A;  3ILN A;  5AFE A;  1JYX A;  3KV5 A;  3UKN A;  1RYY A;  1PGL 2;  2CV6 A;  3ETP A;  2OXB A;  4IER A;  1O8S A;  3WG3 A;  1BEV 2;  3MPP G;  2D93 A;  5FK8 A;  4FAH A;  3NV2 A;  1F9K A;  1OF3 A;  1W3X A;  1H8T B;  2VW2 A;  1CQ9 A;  2JB8 A;  4B1L A;  2DUQ A;  2Q1Z B;  3AMQ A;  3I59 A;  4UFJ A;  3N9N A;  2WS9 1;  4O9G A;  5BUV A;  1LHV A;  4OI1 A;  1I5Z A;  1VBC 1;  5FJK A;  3BI3 A;  4RD7 A;  3HWJ A;  1JI6 A;  2Q1M A;  1IPJ A;  4JGZ C;  3V56 A;  3BB6 A;  3WF1 A;  4XUO A;  4L8Q A;  1S0B A;  3FX3 A;  1RIN A;  1ZZB A;  1WBF A;  3KZ4 C;  4E9K A;  1R1Z A;  2PLV 3;  2R32 A;  4SLI A;  3AZV A;  5FLJ A;  4COU A;  3BKZ A;  5JXG A;  4NRQ A;  2MEV 1;  1A8M A;  3AYE A;  2QQI A;  2X5I B;  4NPL A;  4Q27 A;  5FO9 B;  3TEW A;  4QX3 A;  1O6U A;  1TME 1;  3FFQ A;  3MF6 A;  5A6Z A;  2HWD 2;  2AC1 A;  4HZF A;  3AKP A;  5F8P A;  3POB A;  4CEW C;  1XSR A;  3PUA A;  2FDF A;  4QGM A;  2VOX A;  3E6C C;  4LLO A;  4EN8 B;  2JDZ A;  5T3N A;  3RVH A;  3LA7 A;  1OFS A;  4JDN A;  4EN9 B;  3N9P A;  4YW2 A;  3RS6 A;  2CWS A;  5FRE A;  4RR3 C;  4OUL A;  2IXK A;  3H1Y A;  2FCV A;  3HT2 A;  5BXX A;  5FYB A;  4LBM A;  1PMJ X;  2GP5 A;  1ASJ 1;  1PX4 A;  1IZ3 A;  2VZR A;  3I8T A;  5FY0 A;  5LBC A;  4CU8 A;  5IVE A;  1PZ8 A;  4BQ5 A;  2WNU C;  2HWC 2;  4I0A A;  2HWB 1;  3AL6 A;  4QGN A;  4IND A;  2VBB A;  4IV3 A;  5A33 B;  4KGQ A;  2O8O A;  4EWD A;  1WCS A;  4KBZ A;  5CIR A;  3E97 A;  2RDR A;  2RVA A;  3WG2 A;  1JZ8 A;  1AYM 1;  1J3R A;  1ULP A;  2QQU A;  2ARA A;  2VQA A;  1DIW A;  5FLH A;  5FBZ A;  1NOV A;  4CXX A;  1SAC A;  3DXT A;  3VLB B;  4GH4 A;  3K3O A;  3DV8 A;  3MV0 1;  4JDO A;  3D4K A;  1AR6 3;  4QPG C;  2HKX A;  1JUI A;  1DGL A;  5CFD C;  5LA2 A;  1LNS A;  5L9V A;  4QXB A;  1A78 A;  4YGB A;  3RJ2 X;  3VHN A;  3B5L B;  2QDR A;  1OPM A;  4H2A A;  4AI3 A;  3TRS B;  5GZC A;  1KD7 A;  3S57 A;  1H2N A;  4QMA A;  3GGL A;  3ZX7 A;  1MS9 A;  4A7Y A;  4E2G A;  1W2A X;  2NPI A;  2B45 X;  4B8E A;  4LUM A;  1SLT A;  3KQR A;  5BNO A;  4XJW A;  1YNA A;  3GDB A;  3R4D B;  4DEV A;  1CAU B;  2XBO 1;  2A71 A;  3OYW A;  1FYU A;  1CAX B;  1CZS A;  1OLM A;  2CTV A;  3IDE A;  4KU8 A;  1LOB A;  5L7O A;  4C0H A;  3LZZ A;  4CP1 A;  4BQX A;  3EYP A;  2NLR A;  4M00 A;  4RGK A;  4D7Y A;  1GQG A;  1PNG A;  5APA A;  4B4R A;  1SHW B;  4Q4W 1;  1CIY A;  4RHV 3;  1BYH A;  1SFP A;  1JHJ A;  1QOT A;  1W05 A;  3I2H A;  2D6L X;  5T5J A;  4NR1 A;  5DUX A;  1VBB 1;  1FAT A;  4QKD A;  3BN6 A;  3BUC A;  1N1T A;  1ZBA 3;  4MG2 A;  4DO0 A;  2GC0 A;  1OUR A;  2V09 A;  3ZVX A;  1GYK A;  1H2M A;  4QX2 A;  5A3O A;  2ZX3 A;  4IV1 A;  2AUY A;  1JZ4 A;  4PDW C;  4CDX A;  5F3G A;  3DCQ A;  2A3X A;  1HX6 A;  4HLT A;  4WVM A;  1BK0 A;  4JX0 A;  3CJI C;  4N7U A;  1ULC A;  2JD9 A;  4XMI A;  1R09 2;  2D6K A;  5CVR A;  5DUU A;  2WNV A;  3W9A A;  4LO5 B;  3ZIX A;  4JV4 A;  4ZXK A;  2Q0A A;  4YVS A;  4XFB A;  3MPB A;  2GH8 A;  1FNZ A;  1DYK A;  2G9F A;  1K5J A;  1XXN A;  4FTE A;  1QXJ A;  1S1A A;  5FZO B;  1AXK A;  2ZA9 A;  1YFW A;  3FC0 A;  4ITC A;  1ZBE 2;  4UF0 B;  4NIA A;  1Y9M A;  4IGQ A;  4EZ4 A;  2PA7 A;  4N43 C;  4CDW C;  2JG9 C;  3IDC B;  1JYN A;  2WYF A;  4D7S A;  2WWS A;  2RV9 A;  1W6Q A;  2FMY A;  4LUK A;  1D2S A;  3LB9 A;  3NNG A;  1QJU 3;  3VDD A;  5L19 A;  4QDS A;  3SC7 X;  2HWE 3;  3N9O A;  3ZYF A;  1KDM A;  2CGP A;  3BU7 A;  2D40 A;  3KMH A;  2YGM A;  4U2A A;  4EYU A;  5IK4 A;  4FSJ A;  2W52 A;  4M3C F;  2W1S A;  5D1I A;  5FP8 A;  3I49 A;  4CE8 A;  3CIH A;  3KQ4 B;  1G7Y A;  1R1A 1;  1COV 3;  4LHN A;  4LOS A;  5IK5 A;  2UY8 A;  2PN5 A;  4NHL A;  2RS1 2;  3VBO A;  4HXC A;  1W2U A;  5FZM A;  3POS A;  4A44 A;  1VMH A;  4OHZ A;  2WQZ C;  4BDV B;  5CG9 A;  1VAM A;  3RNS A;  3I2J A;  2Y6H A;  1WCQ A;  5DDJ 1;  1AL0 G;  1V9U 1;  5DZF A;  1XC6 A;  2PXJ A;  3MLL A;  1CAW A;  5FZC A;  1H2K A;  2CAV A;  1MEC 2;  3VZO A;  1H1I A;  1YQC A;  2PHF A;  3GAL A;  3FUQ A;  2HYK A;  2ZS6 B;  1K5M A;  5FRA A;  1GZW A;  4AFC A;  4Y3O A;  3OTF A;  4H3W A;  2R07 1;  4LO6 B;  5CA6 A;  1JYV A;  5FXW A;  3UJO A;  5IVV A;  2D5F A;  1HXS 1;  3FE5 A;  2O1Q A;  3OOX A;  4OCT A;  4RQP B;  4XXA A;  3VBH C;  5JI7 A;  2A5Z A;  2JG8 C;  1SLI A;  3BTX A;  4W6Y A;  1HN1 A;  1OC1 A;  4NUB A;  3OF1 A;  5K9Y A;  2PAE A;  1QEX A;  2PLV 2;  2Z42 A;  4MGY E;  2OPW A;  3WQ7 A;  2RS3 3;  1IS6 A;  2GAU A;  4W50 A;  2VUA A;  5FYS A;  2QQL A;  1S0E A;  4P08 A;  5JOW A;  4KWJ A;  2HWF 1;  4P9I A;  4QDQ A;  3ZXE A;  1WZX A;  4Q0P A;  4ASL A;  4FFH A;  1DF0 A;  4GXL A;  5FY8 A;  4BA6 A;  1ZRE A;  2QZ3 A;  3UL2 A;  3C7H A;  5EJZ B;  3VBU A;  1AX1 A;  1QNW A;  5FYZ A;  3UET A;  1NAE A;  1JZ7 A;  2WT2 A;  4N53 C;  4AE2 A;  4QPI B;  3ZFE C;  1LR5 A;  4ATE A;  1YQ8 A;  1BJQ A;  1NZI A;  4OUM A;  2XLG A;  4DY5 A;  2G19 A;  1NLS A;  3ZIW A;  3POE A;  4GA9 A;  5E16 A;  2G4I A;  4P02 B;  1QNY A;  3I3Q A;  4LMF A;  2FMD A;  2D6N A;  3HEI A;  4JC1 A;  4Y1V A;  3R6S A;  3RWN A;  3THC A;  1ND2 C;  4JQT A;  5HCA A;  3M3E A;  1QGL A;  4PQ9 A;  4YZ5 A;  1WCU A;  1SG3 A;  1KFX L;  3PVB B;  2QTW B;  3D8C A;  3SH5 A;  2WS9 3;  5HV4 A;  3R0R A;  1LU2 A;  2W5F A;  2R04 1;  1VBC 3;  4XEZ A;  4ES9 A;  5C3S A;  3J7L A;  1GNH A;  4AQS A;  3PDQ A;  2HEY F;  2A6Z A;  5CFC A;  1ALY A;  4M0H A;  2VZO A;  1DZR A;  5D8A A;  1Q8Q A;  1W6P A;  1PO1 1;  2OT7 A;  1SLA A;  2W95 A;  2WA4 A;  4OQ8 A;  1JOJ A;  2JDN A;  2VVE A;  3WDY A;  3O12 A;  1XYO A;  3OPW A;  5FYH A;  1U5Z A;  3MGU A;  5JXJ A;  3ZXD A;  4BU2 A;  4E4H A;  1YQ2 A;  3BOW A;  1TME 3;  2AAC A;  2JWP A;  2V4A A;  3VBS A;  1AZD A;  2LM3 A;  4GB3 1;  1W0P A;  4YG0 A;  1LKN A;  5JZG B;  2Y6F A;  3VD9 A;  3WNM A;  1W8F A;  1CN1 A;  1VBD 3;  3POG A;  2GMP A;  4B1M A;  4CTE A;  2HBU A;  1RJ8 A;  2V72 A;  4XIO A;  1CR7 A;  2ENR A;  3JD7 2;  4LNV A;  4P9L A;  4AG4 A;  1H6X A;  4Z82 A;  2FDJ A;  2VAU A;  3B9I A;  4YZ4 A;  3C7G A;  1E5S A;  2IWG B;  2KXL A;  4YZ3 A;  3U78 A;  4LIV A;  4XQ4 A;  1LOD A;  3MIB A;  1K42 A;  5FYT A;  2HWB 3;  1EY2 A;  2OZJ A;  2PQQ A;  3LEG A;  2A3Y A;  3MIE A;  1MQT A;  4NWW A;  3H8R A;  1V6I A;  4DUX A;  1KRI A;  1SLC A;  1CJP A;  1E5H A;  4QXC A;  2HEV F;  4LBN A;  2PHX A;  2PMW B;  2ZEW A;  2VUJ A;  2CY6 A;  1ZBA 2;  4QDR A;  1ZRI A;  5GZG A;  3IBM A;  2DWR A;  2ZEZ A;  4HVQ A;  5C4W C;  1RHI 2;  1AYM 3;  1CGP A;  2WKK A;  4RN5 A;  3S0M A;  3LEM A;  3ZR6 A;  4CXY A;  1ULO A;  3ILR A;  1O4Y A;  2XHK A;  1NXM A;  4S2G A;  4JQR A;  1S0G A;  3L2Y A;  4QXK A;  2CL2 A;  2ZAH A;  3DEC A;  4DY3 A;  4D94 A;  1GQP A;  1QH7 A;  2PFW A;  2RDS A;  2ZMN A;  3OY8 A;  3H8X A;  4OQ9 A;  2JDK A;  2VBD A;  1QJE A;  4MET A;  2QVS B;  4MHU A;  5AC9 1;  2VGD A;  3BCW A;  3S5Q A;  1AXY A;  1L7Q A;  5BYN A;  2R49 A;  1POQ A;  2V73 A;  2RM2 2;  1HKD A;  2XBO 3;  3PVE A;  4NAM A;  3J7N A;  4K1Z A;  5GLU A;  3WV6 A;  2ET1 A;  3V64 A;  3NO8 A;  3TAY A;  2LRO A;  1KDK A;  4XF3 A;  2W08 A; 
#chains in the Genus database with same CATH homology
 4NIG A;  3RZG A;  4NIH A;  3O1V A;  2FD8 A;  3RZK A;  4IE7 A;  4IE0 A;  3O1S A;  3O1R A;  3S5A A;  4NRM A;  2FDH A;  4QHO A;  4IDZ A;  3BTZ A;  3I3Q A;  4QKD A;  3O1P A;  3BUC A;  4MG2 A;  3O1M A;  3RZM A;  4NII A;  4ZS2 A;  3I3M A;  3KHC A;  3RZH A;  4QKB A;  2IUW A;  4NPM A;  4IE6 A;  3BI3 A;  4ZHN A;  3T4V A;  4QKN A;  3O1O A;  3BKZ A;  4NRQ A;  3H8O A;  4NPL A;  3O1T A;  3KHB A;  4O61 A;  5F8P A;  2FDF A;  2FDJ A;  4O7X A;  3BIE A;  3I49 A;  2FDI A;  3LFM A;  4QKF A;  3H8R A;  4MGT A;  4NJ4 A;  3BU0 A;  2FDG A;  4JHT A;  3RZJ A;  4NID A;  4NRP A;  4CXY A;  3BTY A;  3T3Y A;  4IE5 A;  4RFR B;  3I2O A;  3T4H B;  4CXX A;  3H8X A;  4OCT A;  3O1U A;  4IE4 A;  4NRO A;  3BTX A;  2FDK A;  3RZL A;  4CXW A;  4ZS3 A;  5DAB A;  3S57 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...