3O1RA

Iron-catalyzed oxidation intermediates captured in a dna repair dioxygenase
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
202
structure length
202
Chain Sequence
EPLAAGAVILRRFAFNAAEQLIRDINDVASQSPFRQMVTPGGYTMSVAMTNCGHLGWTTHRQGYLYSPIDPQTNKPWPAMPQSFHNLCQRAATAAGYPDFQPDACLINRYAPGAKLCLHQDKDEPDLRAPIVSVSLGLPAIFQFGGLKRNDPLKRLLLEHGDVVVWGGESRLFYHGIQPLKAGFHPLTIDCRYNLTFRQAGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Iron-catalysed oxidation intermediates captured in a DNA repair dioxygenase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
molecule keywords Alpha-ketoglutarate-dependent dioxygenase AlkB
total genus 47
structure length 202
sequence length 202
ec nomenclature ec 1.14.11.33: DNA oxidative demethylase.
pdb deposition date 2010-07-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.590 Mainly Beta Sandwich Jelly Rolls Alpha-ketoglutarate-dependent dioxygenase AlkB-like 3o1rA00
4JHTA 3H8XA 3KHBA 2FDJA 2FDGA 4MG2A 4IE7A 3O1UA 2FD8A 4O61A 4NROA 4CXYA 4QKBA 3O1SA 3BKZA 4O7XA 4CXXA 5DABA 5F8PA 3T3YA 3O1VA 4NPLA 4IDZA 4QKNA 3RZGA 4ZS2A 3BU0A 3I3QA 4ZS3A 4NRPA 4QKFA 3RZKA 3I3MA 4CXWA 4IE4A 3LFMA 4RFRB 4NJ4A 3I2OA 3O1PA 2FDFA 3RZMA 4NIGA 2FDIA 3RZLA 3S5AA 4MGTA 2IUWA 4NIHA 3KHCA 2FDKA 3O1RA 3O1OA 3BTYA 4QHOA 3T4HB 4NIIA 4NIDA 4NRMA 3BIEA 3O1MA 4NRQA 3O1TA 4IE6A 3T4VA 3S57A 4NPMA 3RZHA 3RZJA 3I49A 4IE0A 4IE5A 4OCTA 3H8RA 3H8OA 3BTXA 3BTZA 3BUCA 3BI3A 4ZHNA 2FDHA 4QKDA
chains in the Genus database with same CATH superfamily
3TEWA 2J1TA 1LOEA 3DF0A 1JYNA 1MVEA 1WZXA 2ARAA 1RUD2 2BFUL 5LA1A 4A45A 4AHYA 1B09A 1U5IA 2WLPA 4YSFA 2JG8B 1VAKA 1SPPA 2B9VA 3NRUA 3NJYA 5FWJA 2Y8KA 4NIGA 2QJVA 2VOXA 2XJTA 3PU8A 2NM1A 1LODA 2HH9A 1S4CA 3ENRA 4ASLA 1SLCA 1ZZ9A 1V6IA 5JLVA 3RZHA 2BYVE 1WW5A 4MOAA 4RS5B 4XFAA 2VQUA 4LNVA 1J3RA 4JDNA 5M0TA 2OS2A 4URTA 2VW1A 4EN0A 1YFXA 3AL5A 2XL9A 4JHTA 1O3QA 1W6OB 3T08A 4OMCA 1XYOA 3ME2A 1GZWB 3OF1A 1FAYA 2VBDA 2HBTA 1YLLA 3PUAA 4LTAA 1MR5A 3HT2A 4UFMA 1G86A 2RR13 3LEGA 4DXZA 3O1VA 4FAHA 3RMXA 1UPSA 1W8HA 2ZABA 1Y43B 5A3MA 3D4KA 1QGLA 2WQZC 1GOHA 3GZEA 4IUGA 4KGGA 3IDBB 4CEWA 5FY0A 3LDKA 4I30A 3GBWA 2QQNA 2B4KA 4RHV3 1GNHA 4CCNA 2O14A 3BTXA 3MUY1 3K3OA 3R4SA 3K77A 2JG9C 3MPBA 3POFA 4Z1VA 4YW2A 3WP3A 1L7RA 3I2JA 2ZMKA 4J6GA 2IC1A 5BYNA 3INAA 2LUWA 4CDXA 3JB8A 5FO8B 2GU9A 3BGAA 1UY3A 5F9TA 3NWKA 2PHDA 1V6MA 3VBRC 4ASKA 5IFPA 4B7EA 1UZWA 2XG3A 1C8M2 2VH9A 1JI6A 1TMF1 2QKDA 3SH5A 3NV2A 1I5ZA 2ZGOA 2RV9A 3GJAA 2XKPA 3IT8A 3IAPA 3FBMA 1HKDA 2X5IA 4GWIA 3MW2A 4P9YA 2RVAA 3CO2A 4RSUA 1TE1B 3DCQA 3IZOA 4NPMA 5FY8A 3ZKUA 4BK5A 2W1UA 1H8TA 2VXJA 4BU2A 1MQTB 2CGOA 1NKGA 4W6YA 1ZA4A 2LS6A 3WX5A 1VB4A 1N47A 3A21A 3ZFGB 2GNBA 2L9LA 1JZ4A 1XOYA 1O4TA 1W0PA 2PLV1 2UWCA 3M3QA 4UFHA 5DABA 5FUNA 1UX7A 5JDBA 1OQDA 4L97A 3DV8A 4YW6A 3WW4A 2LALA 2CWMA 2HEWF 4FSJA 1QKQA 1G9BA 5IVFA 1CAXB 4ZY9A 2ZHLA 5A3TA 3KWVA 4DINB 1TNRA 2GH2A 3K46A 4UW5A 5BNNA 1YUDA 1R1A3 1PX3A 3WNKA 2RS12 1BVP1 2IXHA 4E2GA 2WWUA 1JN2P 1WCSA 1RYYA 1IQDC 2PLV2 4W4ZA 1UKGA 2VCBA 5C4WB 4AF9A 4Z07A 4D0QA 1NCRA 2W39A 5A7PA 3RPQA 4LQRA 4QU1A 2WS91 1NT0A 1SCSA 2IUWA 4P9JA 5DUVA 5CG8A 4QXKA 5F39A 3IIIA 1UXZA 4GB31 2ZHNA 2R1DA 1R1A2 2JEMA 1H1MA 4A41A 1JU3A 4D6RA 3DXTA 2WZR3 1LOFC 2VZTA 5CYYA 4BXFA 2VBBA 4C8DA 3QCWA 1JZ6A 1SQ4A 1W6PB 1ZBE2 4OHXA 4XF0A 2RDSA 1UY0A 1XNKA 1DU3D 1QQP1 4OZXA 4Y3OA 5ANQA 4AR2A 2KA3A 1ZM1A 3LEIA 4CVUA 3FHAA 4G9SB 2YG0A 3IPVA 1YQCA 3PTYA 5FMDA 2ZKLA 2WNVC 2XWBB 3OUIA 1NXMA 1G8WA 3SHRA 4Z8BA 1EUUA 2YBKA 3RDIA 2W92A 2WS92 3I2IA 3ZOIA 4MXWB 2Y60A 1MZEA 2EVXA 5EWSA 3WDWA 4NVPA 1Q8SA 2J1SA 4EQVA 4BH9A 1IS5A 3J4UH 2HEYF 3NAPB 1Q5OA 4Q4W1 5FZCA 2HYXA 4S2HA 5FXVA 4Q4W3 1N1TA 3POSA 1OUSA 3ZN6A 1U0AA 3OTFA 4HFSA 2Q8EA 2JKBA 3I49A 4DY5A 1GANA 4M4RA 4AGRA 5A7WA 5J48A 4GALA 1OQ1A 1HJGA 3DPRB 1J58A 1PIV3 1QJX1 2AGSA 2XR4A 1O3SA 2D6PA 2WNUC 1PM4A 2XH6A 2YROA 4JDMA 1X9PA 4QQLA 5BPXA 3SISA 1HRV2 4B1MA 2DURA 3THTA 4ONUA 4YW5A 4BLIA 1H0BA 1DYPA 4YZ4A 4O7XA 1NQDA 5K7PA 1Z7S3 2RM22 3OBZA 4Z2AA 4LK7A 5TSWA 2D40A 1K5MA 4Z92B 3AK0A 4YW4A 4Q4W2 2MPFA 3V0BB 5L36A 4E9KA 3FLPA 2RDNA 4PIXA 4H7LA 1KGYA 2P6HA 1H1IA 1KEXA 3WF4A 3FLRA 1OUXA 5F2WA 5C5TA 3JQWA 1ENRA 4YVSC 5GZEA 3W5MA 4QX5A 2G9FA 4IV3A 3AX4A 5AC93 5L9VA 1SCRA 5C3SA 2WZR1 2QDRA 3VBFA 3WDYA 2WRAA 5DQ0A 1PZ9A 3T0DA 3WQ7A 2HEVF 3M4FA 3H0OA 4K3UA 4HZFA 5IVYA 5FZAA 4PDWB 1FOD3 2HWE1 2RM21 1UNBA 1CZVA 5DG1A 2LTNA 3WF3A 5J37A 4BQ1A 5FZBA 1GV9A 5LK5A 4YZ5A 5ACA2 5IVVA 5H9SA 2ET1A 1UYPA 1QWRA 2R042 2A3XA 3VKLA 5FYVA 1K5MC 4WVZA 3USUB 2LRPA 2JDUA 2VECA 4DUVA 2UWBA 1YFUA 4DEQA 2A75A 3AJYA 2VG9A 4GKYA 3H8XA 2OPKA 4CA9A 1MEC3 5DMYA 2ZTNA 1WMEA 1EV12 1JZ5A 5CKNA 1FNYA 3N35A 2XBO3 3ASIA 3I2GA 2OW4A 1FT9A 3NV3A 1K3IA 3HNBM 4UBHA 5FZ7A 3WD5A 3A7QA 3AYDA 3OEBA 5KHIA 2A6ZA 1XU2A 2R0HA 4I3PA 1BJQA 5IT6A 4CCJA 1HXS3 1DIWA 3UKNA 3IKWA 4ISRA 1AYN1 1YRZA 4LUKA 4S2FA 3VZKA 3AMHA 1YNAA 2BBAA 2OUJA 2XUEA 2ZEWA 3VLBB 4BE3A 1J1TA 2G9GA 2VNRA 1QOOA 4AFAA 3BVCA 1B35B 2WL1A 3OG2A 3BU7A 4R52A 1NQJA 4MVTA 4KMQA 5F3EA 5F5CA 4DPNA 1HQNA 1QOSA 1V00A 5JVVA 1W0NA 1XU1A 3RSJA 1UY2A 1CIWA 4FOVA 5JZGC 1Q8VA 1W03A 2NMOA 2WWJA 4XVHA 3PUHA 4EN8B 3WG4A 5IK4A 4NIDA 4C0HA 4MSVA 4ZZ8A 3L9JT 3ZFEC 4QD2A 3GCWA 3AM2A 3ZFEB 4FPEA 3H8UA 4JVAA 4N53C 1CD3G 3QLQA 2K0GA 4V2VA 1EPZA 2W08A 5DAWA 5FYZA 3U4XA 2GMEA 2WSUA 3KCXA 4FPGA 1ONAA 1HV1A 3M2MA 5EPAA 5FYTA 2PHFA 3APBA 5E16A 5I8TA 4Y1UA 2W46A 5C5UA 2A3WA 2P3IA 1Y9MA 5KBFA 1S0BA 3AP9A 1REDA 4CDUC 5L7OA 2BEOA 2JDYA 2WFF3 2WYSA 4Q0QA 1JBCA 1K12A 1W28A 1AXKA 4HKWA 4XURA 3I3MA 4IE4A 1PVC1 4CEWB 4YZ2A 4CCMA 2IVIB 1AR73 1SLTA 3I8TA 4JHZA 1W8TA 2TBVA 3VZJA 5DN2A 1A6CA 4AEJA 4D7TA 1OXCA 1ULDA 2J22A 3CMGA 4FOYA 5FBJA 1FNZA 1O6UA 1OPOA 3IDAA 4R8HA 5I0SA 2HWF2 4QPYA 2CYFA 2QQKA 2NYYA 1C5HA 2W94A 4LO6B 4LIVA 3I3DA 4LMFA 4UXAA 1TME2 5FYCA 4ZHNA 4FQZA 4J1WA 2VQ0A 1D4M3 1PGSA 3KHBA 5FZDA 4IE7A 5DG2A 3SEPA 4GH4A 4MH0E 3S6PA 4DQAA 1I3HA 3WCRA 5EV7A 5A32A 4DRRA 4XZPA 2UU8A 5AFEA 5HXMA 3EXUA 4E2QA 3PVOA 4QT6A 1TMF2 3T0AA 5BY5A 1VB2A 3R4UA 4BM8A 1D0HA 3RYKA 3OD0A 5LY2A 2I07B 5BV6A 3C3VA 5DZEA 1S0DA 2BNMA 1JUIA 3QH6A 4CE8A 5GLUA 1I1EA 5JSPA 5FOJB 3MIEA 2HWF3 2QQIA 3OUHA 3S0MA 4A7ZA 4NRMA 1HDKA 3I2DA 3MLKA 1LR5A 2D6KA 3CF6E 1YCIA 2FDGA 3B3QE 4BB3A 1JZ3A 2PHRA 2YZ4A 4H3WA 4I3GA 5IWFA 1PHMA 1TEIA 2JDKA 4C91A 1W6NB 1AYM3 2JJ6A 2SLIA 4LE3A 5FZKA 2CSGA 4LHNA 3MBWA 2FCVA 2OT7A 2PAEA 4IEPA 2W1SA 5CFCB 2RHPA 1H2LA 2PHLA 3KQ4B 4FAGA 4YFZA 5CFCC 1LENA 5KHKA 2A6YA 2EXKA 1SHWB 2LM3A 4AI8A 2HBUA 1OF3A 3MI8A 3LFMA 3RJ2X 2K9ZA 3K51A 4HXCA 1JS9A 3JD71 1RUF2 4QM9A 2PN5A 3HQXA 4FPHA 4UW4A 4XF1A 1N1SA 5JI7A 5IK5A 1LHNA 2VNVA 1HJFA 3HNMA 4ITCA 1O3RA 4OHYA 1KS5A 3UGHA 1ND3B 3VZLA 1W8WA 1RMU3 4XIKA 3MLLA 3GZAA 2D3SA 1CAWB 2O8OA 2Q4SA 2X09A 4OI4A 2Y6JA 3NKGA 1H9PA 5F37A 3C7HA 3HPNA 1RUG1 4Q0SA 5FY5A 3B01A 1UZ0A 4KWUA 4PF1A 3W20A 4QPIB 2CGNA 2QE3A 4PLOA 4NHLA 1ZRIA 1A34A 1PMIA 2IXLA 3LSEA 2OZJA 3OJBA 1RUF3 3LE0A 3O0WA 3OEAA 1ZRRA 2H0BA 1CAUA 5I0TA 1C8M3 3WNPA 3RZMA 1NE4A 4GB32 4QXBA 1NOVA 2BGPA 3FE5A 3BTYA 2ZX0A 3IDEA 3VBUA 5J96B 3LAGA 1V0AA 3VBOA 5FXWA 5BNNC 4PI2A 1FMD1 4IETA 1PO22 1UIJA 2NMNA 1FV2A 4CEWC 5LZ6A 5A33A 4JGZA 1RUE3 2CAVA 4L99A 5GLWA 2BGCA 1LJ7A 2RJ2A 4GH4B 2R0FA 4CXXA 4M3CE 1W9SA 3BOWA 3O12A 2YBPA 4QKNA 4EZHA 3NVCA 2AEZA 5C8CA 5HV4A 2Y33A 4AGGA 2DCKA 3CU7A 3M3EA 1ZBA2 2DYCA 4XF9A 3LEKA 1UWWA 4LPLA 1KQRA 2DBIA 1HB1A 2VOWA 5F6LB 3WNMA 2HKXA 4D8MA 4XETA 1W9WA 3FJSA 4OLLA 4QX2A 4X8PA 1ZYBA 2ATFA 1WLCA 2VMDA 5GZDA 4YPJA 5K8SA 3Q8AA 3FHIB 4OCTA 2YMZA 5L9BA 2JD9A 2I74A 3V0AB 2A71A 1VBB2 1VRBA 3NW4A 4ARXA 4OYUA 1ODNA 3NV1A 1C57A 3ATGA 2ID4A 5T3NA 3VBUC 4HT1T 4LJHA 2VBPA 3VBHB 5IW0A 1Y3TA 1QF3A 1MS8A 4F83A 3W58A 1UMIA 3PDQA 3AYEA 2WO3A 2J7MA 1AX1A 3WW1A 5FZHA 1AR82 1SBEA 4IEYA 4R9CA 4LK6A 1WD3A 2A6XA 1HQWA 1KDKA 2CAUA 4Q4Y3 3O1OA 4KG0A 2GC3A 3M1HA 2P4EA 4X6RB 4YM3A 2HWD1 3DN7A 4JGYA 1W0OA 4CCLA 1XRUA 4IE5A 3WW2A 4Q4V2 1W3XA 3TRSB 2WZR2 1KJRA 4P9XA 4BDVB 4WZFA 1CESA 1XNBA 1PO11 2VTXJ 5LA0A 2WNUB 3ZSLA 4JDOA 1WKYA 2QQJA 3K75B 3P6BA 2QBXA 1AJKA 4KNCA 1X9TA 2VXRA 3U1XA 2OQ6A 2ZX2A 1RUE1 4GXLA 5IK7A 1W9YA 1YJLA 2VUJA 4Q4Y2 5FPVA 1UYXA 3QOPA 2WS93 3GJBA 1RXGA 2PAKA 2YGMA 3VBSA 5J36A 1M4WA 2MEV3 4FTBA 3NJVA 5KHJA 2CDOA 3VD7A 5C8CB 1GOGA 1G9FA 1WBLA 4A44A 2FZ1A 2VZUA 3N7LA 1RIRA 5FUIA 4AVSA 4CP0A 4NE9A 2BFUS 1EV11 1NLQA 1ZZ6A 1V6NA 2JB4A 4IL7A 1PO12 1VE0A 5HCFA 1T6BX 5E89A 4XQWA 2ZBJA 1QH7A 2Y6HA 5FRAA 3K4ZA 4KI5M 2VOKA 3NNFA 4Q2FA 5ANNA 1OD5A 4PQQA 3KT4A 1D4VB 2JE7A 2VD7A 4ASMB 4CP9A 2RS51 4QHBA 5GM0A 2PA7A 3DYOA 3H3LA 4M01A 1KD7A 4DB5A 4MGTA 2IXJA 3W59A 3ZYPA 2XMLA 3KD4A 4QHOA 5FYYA 5F32A 3WV6A 4INDA 2E32A 3V56A 1G9DA 5A3LA 3PLQA 2ZPXA 4B1LA 4MYEA 1FPN3 1JOBA 2VE1A 1WW7A 2DDUA 4R9DA 3IBMA 3O5SA 3AMQA 2FDHA 1OLQA 1W6MB 4M0NA 4E8DA 3AZWA 4FP3A 1Q56A 1T2XA 3BODA 2RMU3 2VCAA 1ZNPA 3LKJA 4FPFA 4CCKA 4JAAA 3WNOA 4LHLA 3ZFEA 1GQHA 1ASJ2 4BK4A 3H3ZA 2Z5WA 3VD5A 4IDZA 4N53B 1J3PA 2YUEA 4I02A 3RZKA 1VBC2 2GN3A 2VZOA 3N9LA 3TEYA 2FDFA 3AKQA 1XSQA 2EICA 1JYVA 2R16A 3LIGA 1BK0A 3NNGA 5FBZA 1PNGA 5FJHA 5A7NA 1DGWA 4PHZA 2R073 3J9SA 3E6BA 1ULFA 4DIQA 3WQBA 2W2IA 2ZHMA 4NRQA 4GWNA 4RS5C 4FO9A 4P02B 2OYZA 4FQ4A 4AVTA 3D0JA 3MFAA 5FLJA 1X82A 1VBD2 3B93A 4D7SA 3ZXAC 2JECA 5IATA 1DQ4A 2B8MA 4YZ3A 2DF7A 1QH6A 3IMMA 1EYBA 2ZX3A 3SMHA 3DYPA 1ZRCA 1LU1A 4LUMA 3A22A 2R30A 5F5QA 5T54A 1VBE2 1N3QA 4EWAA 4PCRA 1PVC2 2W3JA 1L3JA 2XBO2 2EXIA 4GJYA 4QM8A 4XQDA 2HWC2 2Y6LA 3WQ0A 1RUH1 5FLIA 4NWWA 4AG4A 2NN8A 1DQ2A 5C4WA 3WF0A 5FY4A 3ZXDA 4XPVA 3TNPB 1HXS2 3BIEA 2BV4A 1JYIA 5SV8A 3O1TA 1H30A 3JU9A 3O0XA 4ZKTB 4MXWA 3P5BA 1W9FA 2XQRA 3LA3A 5FZ3A 1VMHA 1LGBA 4XXPA 1LGNA 2EIBA 4FPJA 3VDCA 3B69A 3K48A 5ABJA 4BZ4A 3PL0A 3VZNA 4MZUA 2EIGA 3VBSB 1ZZ7A 3HQUA 3BKZA 3FLTA 4CP2A 4HPKB 1YI9A 1GICA 5LEKA 2GAUA 4QX7A 4OI0A 2RMU1 3BCWA 4YZ1A 1RUH2 2VGDA 4N43C 4FPYA 4IXLA 2C9AA 5JXJA 3OGGA 4XDOA 3TNQA 2D43A 2FDKA 1ULPA 3HR9A 1JYWA 1HQLA 2Y34A 4OUSA 4C1XA 2WNUA 3IDCB 3V65A 1XYPA 4BA6A 3VDBA 2VL4A 3H9AA 5IVCA 3LDRA 1GQGA 3FFQA 5C3QA 1BEV3 5BXXA 3HAGA 2ZEXA 4HK8A 5JPMB 2C5DA 1OKQA 1ZA7A 3LOIA 2VW2A 2YYOA 1RL3A 2D3PA 2ZA9A 4HONA 4HBNA 4XFBA 4XTPA 4BPZA 1YFYA 4CUGA 4XF4A 1PK6B 4LXLA 1Y7BA 2WO1A 1W2NA 4WM8B 1BXHA 3PUIA 4NWVA 1HB3A 2WINB 1O8SA 3JD72 5FTTC 2Z2SB 2N7GA 4QU2A 4LBQB 4WM7C 4DFSA 3O1PA 4Y20A 1BVVA 4FCAA 3ZXFA 3KVBA 3SQOA 2X8KA 3LDBA 3OGSA 4UF0A 3ZR6A 3POIA 3ZR5A 2Q0AA 3FC0A 5FO9B 5KC5A 1S2EA 1Y4WA 1D0GA 5JR2A 5JZGA 1NUKA 1HB4A 4ZU4A 3SNMA 5KWRA 1W2AX 3BPSA 2D5HA 3IIAA 1YQ2A 4IERA 5FZ4A 4JRAA 5B4NA 1LHWA 2BNNA 2VR4A 1R082 3GXUA 2IXKA 4Y4YA 4UOJA 2VOVA 1IQAA 2WO7A 4BMBA 4D94A 1LOCA 4AAXA 1CQ9A 1ZX5A 2GP3A 1CN1A 2TEPA 3C7EA 3VBFB 4N9IA 3GM8A 1QJZA 2E63A 1HN0A 4JTOA 3VGIA 1IZ3A 5C3PA 4P9WA 2WT1A 2NLRA 1W8FA 3S5QA 1OLMA 2V72A 3P3PA 1RUG3 1RHI2 4QMAA 4COYA 2F6BA 4AFBA 4N90A 2GNTA 1XYNA 3RYRA 3CNAA 1VRH2 1DG6A 1IG3A 3POEA 5FK7A 3G7DA 2Z42A 2EIDA 3C7FA 3KLSA 1PX4A 2YB7A 4LHSA 4AI2A 1JUHA 3GGLA 3JBG1 1ZBA1 3I3EA 4U36A 4XTMA 3BU0A 2GALA 3GDBA 5FPXA 2D6OX 5C3OA 2ZEZA 3SH3A 1AR62 2DVAA 1W6QB 3L2YA 4FFFA 3VL8A 2VO5A 5GLTA 3I7DA 4CEYB 3DUIA 4RA0A 5I91A 3ECQA 4JX0A 5JR7B 2ZGKA 4XJZA 3SLIA 1RHI3 3LGRA 1IS4A 1HRI3 4QGNA 2CDPA 5FXXA 2XWJB 3OYWA 1DYKA 4K40A 2PXJA 2I45A 1LOAA 2XVKA 5IVEA 1K45A 5FOBB 4E4DX 1C1FA 3PHMA 1Y9QA 5A6YA 3AVSA 3NNLA 4YG6A 3U78A 1OLRA 2GMPA 3KGLA 3KV4A 1EAH3 1UN1A 5BNNB 2OZ6A 1KRIA 5C8CC 5APAA 5F1RA 1HLCA 4PIZA 5J98B 3AC0A 1AR63 2A3YA 3F95A 2UYAA 1COV1 1AR61 2W47A 4E8CA 1COV3 2PMWB 5DZGA 3WNXA 2HWD2 2ADDA 4HK9A 1NA1B 4XAAA 3TWIA 4IEUA 1YQ6A 3ZIWA 2Y26A 5IVBA 3T4VA 2WZEA 4Q4V1 2E26A 4XFCA 4GQ7A 1O5LA 3BTAA 4BQXA 5FR3A 3M3CA 1OVSA 1PO23 3ZXEA 4C0BA 1XC6A 3VHPA 4F3JA 1EP0A 2VZVA 3POBA 4DUWA 4M3CF 1MS9A 3A0KA 4QKBA 5FZOA 1EY2A 1RUOA 2YBSA 4AFCA 4A7YA 4BQ5A 3FUQA 3FWEA 4Q4Y1 5AFBA 4HKLA 5FUPA 1COV2 1NCRC 5LA9A 3UGFA 5JMCA 3E6DA 2XQXA 3A0NA 4OI2A 4PQ9A 1OHFA 4N8MA 4L8QA 1NCQC 4I0BA 4MGSA 2O0OA 4AEDC 1PMHX 1Z78A 1ZBA3 2Y0OA 5A32B 4FXKB 3T0BA 3KS7A 4WVVA 2ENRA 5F7UA 4N53A 5FMOL 4COVA 1BMV2 4AEDA 4DY3A 4NHMA 2KR2A 4IW3A 2GP5A 1CAVB 1QNWA 2E31A 4OUEA 3ZSMA 3BTZA 1W2UA 1DGRN 3EQEA 4GMP3 4XUNA 2EAAA 3LIHA 3GHMA 2R062 3VBOB 4GMP1 1AL23 1DF0A 4UI9L 4X6QB 3THDA 3WLUA 2RR11 4NAOA 3ZPYA 2XVLA 3AZYA 4HANA 4QX8A 3NJZA 2QQMA 3B9CA 2E6VA 4M4PA 1JZ7A 2VC9A 1DLCA 1C8NA 1QMJA 2VCCA 4XABA 1UZYA 5FYIA 2HWB2 2GDFA 5EJZB 1GNZA 2EA7A 4KQ7A 3S5AA 3CHXA 1DZQA 3MICA 4QHZA 1UU6A 4KL1A 3IMNA 4UFJA 3WR0A 1XQNA 4L0PA 3AP5A 3RG0A 1ODMA 2AREA 2MHFA 1AL22 1A8DA 4J25A 4JV4A 3LD8A 3VD4A 1ALYA 1Q8PA 1QXRA 4XILA 4Q4V3 1OMIA 5CB7A 4QAWA 2FMYA 2QQLA 2QCSB 3HIFA 4SBVA 3T2QA 3AZXA 3J26N 3K4AA 5F5IA 4RGKA 3EBRA 4AHZA 4BQ3A 3LOBA 2GH8A 3N36A 4NRPA 4CDUA 5L7OC 2WT0A 3B9IA 2PHWA 3VDDB 2UURA 5F3IA 3AFKA 2XHNA 1W6MA 4XBLA 4IEQA 1XBFA 5KXEA 4TYSA 3AP4A 1REEA 2FMDA 1O59A 1LOBA 5GLZA 5A3WA 2C26A 1DQ6A 4CP1A 3FUOA 4C90A 3CL1A 2BOJA 2AENA 5LASA 1RGSA 4YGCA 1T6GC 2AR6A 5I0UA 4CEYC 1MQTA 1UOJA 1GYKA 4FPLA 3TOJA 4ZZ5A 4RGGA 1RUD1 4LT5A 2F4PA 5T5JA 4AHXA 4A4AA 3N7JA 1F4AA 4FOWA 4CDUB 1JU4A 3WHUA 5KXBA 5ABJB 1O3TA 3HVDA 2QFEA 4NIHA 5A7SA 3RFRA 4MV2A 1O4ZA 2WABA 2DTWA 3HN1A 2J42A 3QBQA 5CFDC 2JE9A 2XLGA 4K7JA 3FHQA 1UYZA 5LW9A 3OGRA 1DGWX 4CDWB 3S57A 2XJUA 3TYJA 1GSLA 2B5HA 1E57A 3OD4A 5FQ0A 5KXDA 4FPCA 4CDXB 5CU1A 4R9BA 1GP4A 1RUI2 1ACCA 4ET7A 2OPWA 3LA7A 4H55A 5FZIA 3M70A 5CKMA 3RS6A 3KF5A 1NZIA 2XJRA 4AFMA 4NPLA 4TLFA 1UD1A 3VHNA 4TWTA 3PU3A 3WF2A 3VKFC 5CG9A 2CWSA 4LEJA 2C0ZA 5CNAA 2ZGMA 2Q8CA 1Q8QA 4YGEA 2XVGA 2XUMA 3E5QA 4BIOA 2ZGNA 1SDDB 2B39A 5K0UA 2R072 1OKOA 2V73A 4KG8A 1XSRA 4D69A 2DFCA 1PIV2 1TZOA 3ORJA 4FI9A 2X5IB 4KGQA 4QPGB 2JE8A 2WQ8A 5FMCA 1WA6X 3HOBA 4IGQA 4IV1A 5LBBA 1BCXA 1YFWA 3TEXA 4BLJA 1WLWA 4DXSA 4C1WA 4LO7A 1OPMA 4KU8A 5FZ9A 4BQYA 2VU9A 2MNGA 1DQ5A 2GN7A 2VZ3A 3AVRA 1RJ7A 3EYPA 2ZOEB 3KV6A 3KT7A 4JKLA 3E5UA 1H2MA 2JDHA 4CDXC 3FZ3A 4G3YC 3BALA 3AKPA 4XYXA 2DTYA 3DECA 1YC61 1OBNA 2Y6KA 2WUHA 3O7OA 2CNAA 5A3PA 4XFFA 5JOWA 3N3HA 3D82A 4KWKA 4XMIA 1E5HA 3DYMA 1OOPA 4IE0A 3UETA 3I2KA 4TTGA 4LKFA 1UZVA 2YHJA 2D6NA 4HVRA 1OURA 2AUYA 4K1ZA 2P3JA 3JXSA 2R49A 2KD7A 2W95A 2YC0A 5J1XA 2ZGQA 3IM0A 2P3KA 4Y1XA 4QPIC 3WG1A 1HV0A 1NAEA 3RI9A 4QB6A 3FL7A 4BQ4A 1OD3A 3ZXJA 4EYUA 2P17A 5DAPA 5FMOS 3LCPA 3T1MA 3KVAA 2JIJA 4RFRB 4S2DA 3FMGA 5LWBA 2DCZA 5A6ZA 1RUJ2 4WM7B 1J59A 2VM9A 1RUH3 3KZ4C 3SCFA 4AEDB 2P6CA 2OVUA 4P5HA 3U10A 2A6VA 1IS3A 4P00B 5EJ3A 3J7LA 4GA9A 1LHVA 1GWKA 2WWSA 5JAXA 2VMGA 1HN1A 3AKSA 1CZTA 4BXSV 1KXGA 1SMVA 2JG9B 3J7NA 4IEZA 1NLRA 4GWMA 3RVHA 2VZSA 4UFLA 1EV13 2AYHA 2WZPP 1BEV2 1QJY1 5JSOA 4AHWA 4Q1PA 3MDPA 4RGAA 4MO3M 1HX6A 1F31A 1NYWA 1OOPC 4FFIA 1OOPB 4QDQA 3T1LA 1QJU1 3PVNA 4AI0A 1WCDJ 4XJUA 2Y6GA 2UY9A 4LLFA 4PBOA 3S7EA 1GLHA 4U2AA 3ILRA 1RUJ3 3U75A 3KCCA 3OPZA 1RUJ1 4PDWA 2PQSA 4YVSB 2RS32 5BNOB 5BNOC 1GUIA 5FPAA 5LATA 3WT3A 3MO4A 5CFDB 4Q26A 3X29B 3ZN4A 5FK8A 3BUCA 2W1QA 3OPWA 4XIOA 4HVOA 4YVWC 3BI3A 4QXCA 1ZRDA 1ZBE1 2IFRA 1BEV1 2DCJA 2PTMA 4LR4A 1V6LA 3WSOA 5C8WA 1ZBE3 1A3KA 2X10A 1S0JA 1MS1A 1U5XA 3ZYGA 2VMFA 5FZFA 4KH9A 4Y22B 1VP6A 1ULOA 2LW8A 2RJKA 3ILNA 5FP8A 3OCPA 4LBOA 4RQPB 3R05A 3UESA 1DZRA 1GZCA 2RS33 4LBMA 2R7EB 2C9KA 3C2UA 1AX2A 3OY8B 4HSLA 4Y26A 4BWOA 3RZLA 1XE0A 3AMMA 1W6NA 2XKOA 1JZ2A 3CJIA 5F6KA 4OI1A 4WZCA 2K2SA 1DGLA 2ORZA 1WA4A 3FFZA 1RVF2 2B9UA 1OA2A 4ES9A 1IKQA 3N7MA 1RXFA 4ISQA 2ZMLA 3HEIA 2XOMA 4AVVA 4NHXA 5DUXA 1XPWA 3RI8A 2OA2A 2OIIA 1S0CA 2XJVA 1KDMA 2WN2A 1GWLA 5FPLA 3UT0A 1AR92 1HRV1 4W6XA 5JOXA 1LTEA 5C3RA 2BZDA 4H2AA 1U12A 1BYHA 1HRV3 4SLIA 5EQUA 1VRH3 5T52A 1EPWA 1XNCA 4L11A 1QJY3 2HYKA 3LPGA 3SKJE 3ETQA 1GP6A 1LCLA 4DXTA 5K4LA 4BQ2A 1CJPA 1QXPA 1RTVA 1RVF3 5IJRA 1S0GA 4MGZE 2AEYA 3NMBA 4WM8A 1BMV1 4GD4A 5FP3A 1CAXA 2PAMA 1FV3A 4WM8C 4RD7A 2ERFA 3ZXKA 3KV5A 4QX1A 4N9HA 2IXIA 3E97A 4Y1YA 5HI0A 3OPTA 2IVJA 2VULA 1UIKA 3BYWA 1QXJA 2BWCA 5E8AA 2R1BA 5GALA 4NN0A 1JYCA 1MS5A 1RUC3 4N43A 3MEPA 2ZACA 4XEZA 5D21A 3NV4A 1MEC1 5FYSA 1EAH2 3ROUA 1UF2C 1X36A 2RG4A 2F4LA 1LOGA 3T2TA 1NCRB 1OT5A 1UOBA 5EXOA 5CAZA 3ZFGC 1SLBA 4V2WA 1OLME 1I5PA 3QACA 3SXWA 3CZUA 3ZYBA 1J1LA 1O5UA 2G19A 1V9U2 2E7QA 3OGJA 2VZQA 1YYNA 3PUQA 4XCAA 4RN5A 2LROA 4LBJA 4AEKA 1NY71 1X7NA 2EAKA 4O9EA 2NZ9A 5FP7A 4QQOA 3UGGA 2ZGUA 2BOIA 3JB4C 4M00A 4UYBA 4YWAA 4CCEA 1CZSA 2BP6A 3NNJA 5CEHA 4YNIA 5FKCA 5JOYA 2D44A 1POV3 4DOUA 4CU6A 1MEC2 1POV1 4JKMA 1KFUL 1M06G 4Q4X2 1EAH1 2E7AA 1W9TA 2Y64A 5HCHA 4LBNA 1U5YA 3PJQA 4NAMA 3GZUC 1FX5A 3R0RA 4M0HA 4DS0A 2H6CA 3NJXA 3RWNA 2QZ2A 3GF6A 3VHOA 5JIAA 1UQXA 4EN7B 3O0VA 2WAOA 2V09A 2VUDA 3ALQA 5I8YA 5F3GA 2XLAA 4JTNA 4P14A 2Q8DA 2R32A 1RINA 1YQ8A 3GNEA 1APNA 1H8TB 4K6BA 1FATA 1ND2C 5FYMA 1YXWA 2V5YA 4DO0A 3CIHA 4ES8A 4MG2A 4XC9A 5EJ1B 3VDDA 5H9QA 3ZM8A 2ZAAA 1IKPA 4IQPA 2YFUA 4YGDA 1VMFA 3T3YA 5HBAA 4WM7A 4QDRA 3RGBA 1SG3A 5DUWA 3T2PA 1S0EA 1V6OA 3ZN5A 1K5JA 1US3A 4AI3A 3IN9A 1MS0A 3GBFA 5B4XA 1AR71 1PNFA 1S2KA 3H1YA 5E88A 3P1IA 3WVJA 3ZSEA 2FHRA 3U4SA 3C7GA 4NIIA 2ZKNA 2W52A 1S2BA 4GMP0 3VL9A 1DP0A 1SLAA 1XNAA 2BNOA 3D6EA 5FZOB 4NMIA 4JQRA 3TB0A 1RUI1 3H50A 4P9LA 1W6QA 3ZMNA 4CEYA 3RRDA 1SBDA 4A2UA 1PZ8A 2CU5A 5FY1A 3ZXLA 1W8UA 2FD8A 2CTVA 5C4WC 5CADA 1ZZBA 3HNYM 3N9OA 4LBLA 4YYOA 4BISA 3VUOA 4CSWA 3VN4A 3E6CC 5I93A 3M3IA 1C8M1 4CP9B 1GZ9A 1WLTA 1CGPA 5FP9A 1ULCA 2H6BA 3NAPA 4D3WA 3SCGA 2BRTA 3E1F1 4MADA 4XW3A 2JX9A 5AVAA 1R091 1S0IA 2AACA 2A5ZA 4K1YA 2BUKA 2J1EA 5CKQA 5G04L 3UYJA 1ZREA 1LEMA 4FT8A 2DFBA 5DAVA 2HWF1 3TAYA 3U07A 1MVQA 2ZEYA 5LRRA 3I54A 1UOGA 3I97A 4Z82A 1YQ5A 1TME1 3FN9A 3ZFFB 3N9QA 3AXEA 3WG2A 3ZFFC 2E9QA 1TME3 4AVBA 5LY1A 2ZS6B 1STMA 4GKXA 3T2OA 3VBUB 3LSDA 5EFUA 1D4M2 1GQPA 4O61A 1S55A 3VBHA 1UX6A 3OYWB 4QGMA 5LBEA 2D6LX 4F7ZA 1WUVA 1PGL1 4CCOA 1NE6A 1AR83 1ENSA 2NQYA 3WEZA 1ND2B 1B35A 2VVFA 4QKFA 1FI2A 1A78A 1NZCA 3VV1A 4HVQA 5FPZA 5IAXA 5JMOA 4B3NA 2ARBA 1ZZCA 1WW4A 4MXVA 1J84A 2OXBA 1R092 4YW3A 4JKKA 4AQ2A 1GR3A 2E7TA 2HJIA 3AZZA 2FBEA 3HWJA 3J7MA 3HJRA 5A7WB 3WQ1A 3WDVA 1YHFA 2BTVC 3OBTA 5HXVA 3CZJA 4JZRA 5GZFA 4KBZA 3RMYA 2W9XA 4XBQA 4TN7A 5A1FA 3PVBB 1NA1A 2IZWA 4QQ2A 5EHDA 2J1RA 3DPRC 5HCAA 5LCWL 2B42B 5FCCA 2Z69A 1KS4A 2C4XA 2PLV3 4LO8A 1YIFA 4YG0A 4LBQA 3H7JA 1AYM2 1R1ZA 4QB2A 1MZ6A 3DEMA 3LFIA 1G6NA 1PGL2 1RUD3 1QIQA 4NPRA 1KJLA 2D5FA 1UL9A 1IPJA 4E4HA 2O1QA 1RUF1 3WOGA 1YEWA 4YFWA 4B7KA 3WG3A 1LKNA 1R1A1 4OHWA 1W2OA 1CWPA 4LULA 5C7GA 4AYUA 5JXHA 4I2OA 3OSDA 3Q8BA 4QQPA 1CAUB 2QTWB 1JYTA 1RMU2 1PO13 3LEMA 4N43B 2BU9A 4CDQC 3WXPA 5C9AB 3WF1A 1VBB1 4CYDA 5BNPB 1UAIA 4DEVA 4EROA 1UY4A 2I2SA 4I01A 1GWMA 5DUUA 4K21A 1IGOA 3AB0A 4LBQD 2BJSA 4PBPA 2YU2A 3ZN6B 5FZMA 4URAA 4L9BA 3Q8EA 1I6XA 3VB9A 4Y33A 2XHKA 2E51A 1W3VA 2WN3A 2J1UA 2JG9A 4CUAA 5K9YA 2KXLA 1RUNA 4LA2A 1AR81 4ZPIA 1DDLA 1MACA 3ETPA 1D2SA 4OVEA 2D3RA 1CJDA 3MIBA 3THCA 1JMUB 4IEWA 3K3NA 2G4IA 3EO6A 3R6SA 2CGPA 1CVNA 2WLQA 2B7YA 2QUOA 2RS11 1FMD2 1QQP3 3ZSJA 3LZZA 5E1RA 5FFOC 4XFGA 1ASJ3 4EZ4A 1WCKA 1TQ5A 3VKOA 1Z7S2 3ZDVA 5J3UA 1VJ2A 5E6HA 4Q0UA 5FZ8A 3MHZA 2Q30A 4LKDA 4ZS3A 3RWKX 3MV11 2AZ5A 4NOTA 2XLFA 3CJIB 4P9GA 5D8AC 3I2OA 3B94A 2VQTA 2VTFA 4XHXA 5T55A 3NSTA 2ZGRA 3ACFA 1NG0A 4IV3C 1JH5A 3DPRA 5JSRA 3JCIA 2XXZA 1VALA 4MGIE 1VAMA 1DHKB 2Y6FA 3UNPA 2VMIA 5EYXA 1QNYA 1WGPA 1QQP2 4YVWA 2QDNA 1AXYA 3ES4A 3G6JB 1VIWB 2YC4A 3HQRA 4GIQA 4UF0B 4YM0A 3I4IA 4XUTA 3M7AA 1QJX3 2ARCA 2JDZA 1WMDA 2NPIA 1GBGA 2C1FA 3ZYFA 1IOAA 3UKTA 2W68A 2PFWA 1Z7S1 3KCYA 4R4ZA 1FOD2 1JXNA 2DVBA 4MLOA 4RS5A 5A7OA 1SFPA 1LEDA 2HWE2 5T5OA 2HWC3 4ZU5A 5CFDA 4IESA 4QPGA 3DGTA 2VZRA 1JHNA 3V64A 3H3UA 4W50A 5T5PA 4AZZA 4RFT0 2RS52 2VNGA 3OBAA 3PNAA 3ACGA 2ZGSA 4MHRA 1PMJX 3BN6A 4RL7A 3GALA 3LF7A 3BIWE 3E5XA 2MEV1 1QJX2 1XNTA 4BQWA 5F5AA 2XJSA 3R4DB 3RNSA 3AJZA 4YW1A 1UU4A 1TG7A 3MF9A 1JOPA 2X29A 3OY8A 4EN6B 2RS13 1FOD1 1C28A 1NCQA 2D6MA 2HWE3 3EMRA 3W21A 3M8LA 4XAEA 3WP4A 3P3NA 3MZHA 1US2A 1WD4A 3CLPA 4QWNA 5CBLA 5DAXA 4XJAA 3ST7A 1ASJ1 4IGPA 1W06A 5ERLA 1H9WA 4MGKE 2JXAA 3W9AA 1ULEA 2RS53 4O9GA 3ACHA 4OULA 5FWEA 5ABJC 5A1LA 5LK7B 4B4QA 4PJYA 2QQPA 4M3CA 1W8ZA 2FZ2A 5LEJA 4DXRA 1AYN2 4QB1A 4PI0A 1G7YA 5A3NA 1N1VA 2MEV2 1OH3A 4COUA 5C70A 4A3XA 3T09A 1L7LA 4PDWC 4E27A 4CTEA 2VNOA 3PTRB 1UMZA 1VBD1 1NXD1 1V6JA 4MGYE 1W2TA 1NCQB 1UXXX 1WMXA 2QQWA 2W1WA 3AMNA 3I59A 4N7IA 3NKTA 4Q4X1 4QPWA 1G9AA 1LB2A 1JHJA 5FZ1A 1DZTA 2C24A 3SCHA 4AFDA 1SZBA 4COWA 2F17A 1VBE1 4A3ZA 3AKRA 1L7QA 4MHUA 4P5YA 5DDJ2 2DU0A 2ZX4A 3AP6A 4NIAA 2D98A 5BNPC 3VDDC 3ZYIB 2HWC1 2VQAA 4RYDA 1AYN3 1H1AA 5L9RA 2OQ7A 3MW4A 3O1RA 1E5RA 3U11A 2E33A 1QEXA 2VY0A 1OVPA 4TXWA 2VW0A 3IWZA 4O65A 3AXDA 3AFGA 5A6XA 1XNDA 1C1LA 4LO4B 3S30A 4ARYA 1LRHA 4YARA 3BPZA 3J8F3 1E5IA 3CJIC 5D8AB 4XOGA 5FZLA 3WDXA 3C7OA 4WVMA 1CR7A 2JB8A 2YFZA 4TSVA 3WW3A 1OC1A 2WFF2 4Y5SA 1RUC2 5AC91 2QVSB 2RDRA 1K5MB 1UW8A 3H1WA 4B8EA 1YIPA 1AR72 2ILMA 4B4RA 3CKHA 1IS6A 4YVWB 3ELNA 3ITQA 4QX3A 5FY9A 1J83A 2RM23 1VBC3 4XFHA 2BWAA 3AL6A 4LOSA 5FYBA 1OI6A 4GH4C 2W91A 2HLEA 1OQEA 5A80A 2XPJA 1VBA2 1DQ0A 5FDBA 2ES3A 3USSA 4AEMA 1MZFA 2XB6C 5DXDA 5C9AA 2D97A 1DGRA 4W65A 5FAXA 1PZ7A 5FZ0A 3OBRA 4CCDA 3O1SA 5C9AC 5CISA 4ZXEA 5L7OB 2W5FA 1DCSA 1QOTA 3DXUA 1F5JA 1JTZX 5CIRA 4XDQA 3MIHA 2GSYA 2WFF1 3NNMA 1RUC1 3H7YA 5AC92 5L19A 5FYHA 4OUMA 4J1XA 5DZFA 1D7PM 5FIXA 5FLHA 1IPKA 1F9KA 3MIFA 4OFGA 4Q4X3 3AYAA 4JGZB 1CAVA 1CPMA 3POWA 3T30A 1J3QA 1UY1A 2XONA 1NLSA 1TVGA 3D0SA 3VBHC 4HMZA 1HRI2 4OHVA 1N3OA 2IFWA 5ACA3 1C5IA 4GWJA 2QZ3A 1HXS1 1OH4A 3LA2A 1QU0A 3VD3A 4GZ9A 1H8VA 2EF6A 4F8AA 4A6OA 1D4M1 2X5IC 3B7MA 4EJRA 2PELA 2UYBA 3ACIA 3PVEA 3PMSA 1H2KA 1XE8A 3VKNA 3ZXGA 1G9CA 2RJLA 4UT5A 4Q27A 3ES1A 4BHPA 4L2NA 3VDAA 1C3HA 2PHTA 3MFCA 3PURA 3IB3A 2ZHKA 2BVBA 2A73B 5C33A 2GC0A 1F15A 1XXNA 4BOWA 1RB8G 1JODA 1HRI1 3FX3A 2QQVA 2RE9A 2WBKA 1ND3C 1Z0HA 4Y20B 5JXGA 4YGBA 1BK1A 2AH2A 2CV6A 2WNVB 4B29A 1SFYA 1UZZA 2P2KA 3A23A 5GKAC 3L2HA 1AYM1 2DCTA 3ZKYA 3HD8B 4AAPA 1LU2A 5IVJA 2VJXA 1UMHA 3B02A 4DRVA 4YW7A 2JDNA 2P37A 1DBNA 1PK6A 4GAZA 5FJKA 3I2HA 2AC1A 2QNKA 2OUHA 1ST8A 3A4UA 5HCBA 2BVVA 1BBT1 4LA3A 3KM5A 4WVWA 3WP5A 4AQSA 5CFCA 3USUA 4AK3A 2KM2A 3D3AA 5H9RA 3EJKA 1I9RA 1UCXA 5G05L 2WA4A 2CL2A 1PVXA 1RMU1 5KC6A 5LBFA 2JDMA 2WC2A 4XCBA 4XFIA 4XJ9A 5A1AA 1PO21 3WDTA 3NL1A 5J7MA 1KFXL 2VPVA 4XUPA 1DYOA 2VUCA 1CIYA 1YWKA 2J1AA 3KV9A 4W8JA 2FDJA 2W87A 2EALA 3MLJA 1H4HA 4KWJA 4CXYA 4K8FA 2DV9A 1AHSA 1H6YA 5FPBA 3GHNA 1R083 4NHKA 1VPHA 1UKRA 3N7KA 1WLDA 5FXZA 3H1MA 3VBRA 4E4SA 4NJ4A 3ZYJB 4HETA 2CY6A 4IV1B 4CU7A 4AQ6A 1OFSA 4XE9A 1DQ1A 4XUQA 4E4ZA 3PJYA 1R093 1VBB3 4FFGA 2WNEA 4AI9A 1GU3A 1RUG2 3Q8FA 4H7MA 2Q5TA 4FFHA 2K46A 3POGA 1YJKA 4LKEA 2Q1FA 1BQPA 3TN93 3WNLA 2DVDA 2DU1A 5EYYA 3HN3A 3WNNA 1R64A 2WA3A 4YM2A 3I59B 5JZGB 4CPBA 1TMF3 2YDEA 1P8JA 2BW8A 1QDCA 5I0RA 5KHGA 4XF3A 1Q8OA 2WZ8A 1POV0 4R9AA 3KHCA 2JKXA 1SEFA 5FV3A 3EB7A 4OQ8A 3KT1A 1GZWA 3RZZA 3VKMA 3C8XA 3TBDA 5JXIA 1D2QA 3VBRB 4QGLA 4COZA 2SBAA 4PF5A 2Q1MA 2VOTA 4META 4EN9B 2FQPA 3OGVA 4LIUA 1PGW1 3O1UA 3OOXA 1MS4A 2QQOA 4NROA 3ZX7A 5IHRA 3N4MA 2YPDA 2O8QA 5FZGA 4KWLA 3LWCA 2Z4FA 3CDZB 2ZZJA 1Q3EA 4KU7A 4LITA 2PYTA 4HG6B 3CJXA 3ZPOA 3DKWA 3GBGA 3MPPG 1AXZA 2JG8A 4K9SA 1DLLA 3OB8A 4XJ8A 5CVRA 3VBFC 2HWB1 2DVGA 2HWD3 1IG0A 4EE2A 3WP6A 3IAQA 5FYUA 1GNYA 3H8RA 4OZOA 1O91A 2DCYA 1RUI3 1JZ8A 2CHHA 4Q5OA 4QQHA 1UU5A 1PGW2 1FMD3 2B46X 3PIJA 1OA4A 1MPXA 2WSVA 3ON7A 1FYUA 2JDPA 4LBKA 4FTSA 1BLZA 2VTXA 2WO2A 2YGLA 1W6OA 1HB2A 4UAPA 5GJ6A 5IUQA 3HBZA 4A42A 1REFA 3UK9A 3PIGA 4WV8A 3SH4A 4CCCA 4QDSA 4AI1A 2WNVA 2YC2A 1DFQA 2D7FA 4KBBA 5F2SA 2BDRA 1W99A 2WT2A 4I0WB 2NP0A 4RHV1 4GB33 4MGQA 1ENXA 4Q1RA 4YLZA 4A6SA 2GNDA 5F3CA 4I09A 4YVSA 5GZCA 2YY1A 2JG8C 1S1AA 4BCUA 1W8NA 1OF4A 1ZRFA 4E2SA 1WBFA 2C6SA 4UW6A 2PHXA 1UOFA 1RJ8A 4UWDA 4XJWA 4OQ9A 1SBFA 2EXHA 5FMBA 2RR12 2IWGB 1W05A 1XE7A 1Q43A 3ZFGA 1AX0A 4V1PA 4YM1A 1RUE2 2A1XA 1RC6A 5A7QA 1W39A 4UBGA 2DBNA 5DDJ1 3VZOA 5A6QA 1UO9A 1F2NA 1Y9GA 3ZYHA 4QXHA 2YU1A 2P1BA 4BMEA 4AWDA 2VAUA 4IV3B 3HT1A 4IV1C 5HV0A 4JGYB 4RHV2 5FREA 2XJQA 2A70A 4TZDA 1GKBA 2XJPA 3D5OA 4HSJA 1MZ5A 4LLOA 4AGVA 1WCQA 1LESA 1VBD3 4K8RB 3ILFA 3W5NA 3B00A 2ZXQA 4XACA 1XJAA 2ZX1A 4G4FA 3JUUA 5IYYA 2BQPA 5JCTA 1YO8A 1VBE3 1GMMA 5IAVA 1PK6C 1IPSA 1B35C 5JWPA 1W04A 3MF6A 3HBKA 1OFNA 4HLTA 2GC1A 2ZMNA 1BKZA 3U0ZA 3S7IA 4CDQB 3FBYA 1KITA 4Q0PA 4WBBA 4DZGA 5BNPA 1MS3A 1WCUA 2Y0IA 1VBA1 4Q8KA 5BNQA 4AXOA 2ARXA 4QPIA 1X8MA 1YI7A 2ORXA 2VMCA 1LHUA 4FOQA 5FZEA 4CDQA 3KGZA 3MIGA 1E5SA 1LNSA 4QX0A 1HIXA 4HPKA 1VAVA 5LA2A 4AE2A 4B4PA 4MUVA 4Q29A 5CZKA 3J7HA 3ACLA 4R4XA 4W6WA 2H0VA 4JCKA 3WDUA 4AQTA 4EWEA 2YXSA 5D2AA 4CUCA 2JWPA 1URXA 3VBSC 1AUYA 2W0XA 1UYYA 2X05A 3POJA 4DNYA 1VBC1 3IPVB 2WDBA 4L92A 4FP2A 1O8PA 3JQXA 1LGCA 4XMAA 2BERA 3KQRA 1N1YA 5LRSA 1MQTC 2DWRA 5K0UB 2VMEA 5DDJ3 2GZWA 2V5DA 4AOCA 5FY7A 2P3YA 5K0UC 1QDOA 1PM7A 4OMDA 5KR7A 4NUBA 2XL7A 3GZTB 3MIDA 3O1MA 1CPNA 2ZGPA 2RDQA 1JOJA 1LHOA 2UY8A 1QJFA 1O4YA 1VMJA 1WWYA 2WFPA 3OUJA 4LORA 3WUCA 1X50A 1FPN1 3LQCA 1NA1C 2ETEA 2R6QA 3J8F2 3JZVA 3K2OA 4BJ0A 4GULA 3WUDA 2ET7A 4GJZA 4LOTA 3KMHA 2XBO1 5GZGA 2GC2A 4CU8A 3QD6A 3Q8CA 4N7UA 5IK8A 4ZS2A 5A3OA 3TEZA 3SKVA 2X53S 5FQ0B 1C4RA 4AVAA 4CXWA 2FCTA 2Q8OA 2ZJCA 1VR3A 4D6SA 2WYFA 1SACA 2WQ4A 2JICA 4FXGB 3ZFFA 5A70A 5HPOA 4WVMB 5SV5A 1LULA 1WW6A 5A33B 1JW6A 2EXJA 2PHUA 4ZONA 5FO7B 3BB6A 4IE6A 2G1MA 4K20A 4NO4A 2R071 1VBA3 3UKVA 3WY6A 5CA6A 4HOOA 5LBCA 4LO5B 2DUOA 3MW3A 1PIV1 2QQUA 3D8CA 1FPN2 3ZLIA 4QPGC 2EIEA 3J8F1 3B5LB 2GMMA 1QJY2 1BBT2 3QH7A 4IEXA 2XGXA 1GP5A 2RMU2 2V4VA 1V70A 2OX0A 3WCSA 1QJU2 4HN1A 3Q9OA 4FPKA 3V0AA 2D93A 2P5BA 1X8EA 1O7FA 3CEWA 5A3UA 4HN0A 3ZDSA 3EHKA 4XZUG 4JGYC 4PLNA 5FPUA 4RQPA 3WINE 2UWAA 2ZGLA 1LOFA 4RQPC 3WZ1A 5FZ6A 1ZZ8A 2Z79A 4CDWA 5BUVA 4EWDA 1BBT3 1VRH1 4DMIA 2VVDA 4JQTA 4OHZA 4P08A 4NR1A 2YPJA 1QJU3 3AKTA 3U37A 3JBG2 4S2GA 4UFIA 4ZXKA 3ZYRA 3ZIXA 3RZGA 3VHRA 3KSCA 1LAJA 1PVC3 1SFNA 4JGZC 5C6CA 3NAPC 1TNFA 3HMYA 2VUAA 1V9U3 5DPNA 1VLNA 3RJRA 3NQHA 2DUQA 5JIUA 3VZMA 2WJSA 5J09A 2FCUA 1HW5A 2ZGTA 3RZJA 1GFF2 4FPOB 4JRLA 4AVCA 2ZAHA 3GCXA 3WHTA 4X8NA 2WAAA 4UW3A 2JD4A 3CQOA 3POYA 1V6KA 4YG3A 2JENA 3DKQA 4D7YA 1R081 3THPA 1K42A 1OSGA 3ZVXA 4XHBA 3JBG3 1CX1A 1AVBA 2VMHA 2WR9A 4PLMA 2VZPA 1SLLA 4Y24A 5H9PA 4CDWC 3SITA 1CAWA 3K4DA 4FTEA 4IEVA 4ORFA 4FBFA 3ZSKA 2RS31 2Y38A 1IHMA 3N9MA 4Y5TA 4AL9A 2R043 3AYCA 3I2FA 4M3CB 4Q0VA 1OA3A 5FKBA 1RHI1 3O14A 2A7AA 1POQA 3VD9A 1AL0G 2J1VA 1W90A 3AZVA 1H8TC 1F5FA 2VZ1A 3GYDA 3MGUA 1H4GA 4XXAA 3PMEA 3AP7A 4TLGA 3UJOA 5BNOA 4LE4A 5D1IA 1UPIA 4Z2WA 3PUSA 4HL0A 3N9NA 1F35A 3LB9A 4IGOA 3MUZ1 3U14A 1SPPB 2A6WA 2Q1ZB 5B2GB 4Y4RA 1NX9A 5FP4A 4MX3A 3ABZA 1WMFA 1CX4A 4XQ4A 1ND2A 3JD73 2FDIA 4BIFA 5I0DA 5JUVA 3T4HB 2V4AA 1GOFA 3BOPA 4ZU7A 4HKOA 2TNFA 4CU9A 1JYXA 1RVF1 1BZWA 2E53A 2BPA2 4LHKA 1V9U1 2VVEA 3AMPA 3I3BA 1N3PA 2R063 4CPBD 3CBNA 4RR3C 3KB5A 3N9PA 3SC7X 2R061 3VBOC 1W8OA 4XBNA 1ZVFA 5EIYB 4A7KA 3RYPA 3LPFA 2BBVA 4RR3A 2WIIB 1BHGA 4Q8LA 4Y5Z0 1AR91 1QJEA 4UFKA 5GLVA 1SLIA 4ATEA 3V0BA 2XDVA 3TN92 1AR93 1AF9A 2HWB3 2VCMA 1FXZA 3I3QA 4FVVA 2ADEA 3URFA 2P34A 1A8MA 2JDAA 1GZTA 3RQ0A 3ZO0B 5L73A 1CONA 1H2NA 1SDWA 5JOZA 2GNMA 4I0AA 1S0FA 2PQQA 5ACA1 5EP9A 1LECA 3ZMOA 5ISLA 4PT6A 4AW7A 5EZWA 3H8OA 2WNOA 1AL21 1U5ZA 2BGOA 1AZDA 2R041 2DVFA 4P9IA 5DAQA 5I8SA 5T5LA 4CUBA 4EV0A 1F8VA 4XDPA 3F2ZA 5C71A 5JPNB 3NO8A 3M3OA 1QY4A 4ATFA 2JIGA 1ULGA 2B45X 3TN91 1X33A 4H14A 1F4HA 5F8PA 2ZCWA 1ND3A 2IXCA 1H6XA 2YV8A 3SEEA 3MV01 4Y22A 5T50A 3KF3A 2OKXA 1RITA 3UJQA 4NHYA 2WKKA 4RR3B 1QHDA 5KXCA 4CZSA 2TUNA 3DL3A 5D8AA 1AJOA 4LKSA 3MYXA 4IEOA 4PIYA 5IFTA 5JI9A 2G9ZA 2ZZQA 4XUOA 5AVPA 4DUXA 4CRQA 1ENQA 4Y1VA 4JC1A 3H42B 5KHHA 3UL2A 4D6QA 1EUTA 2DUPA 4YRDA 1W6PA 3UV9A 5LB6A 4BYYA 1NY72 4Y1ZA 1XB9A 4QKDA
chains in the Genus database with same CATH topology
4JHTA 3H8XA 3KHBA 2FDJA 2FDGA 4MG2A 4IE7A 3O1UA 2FD8A 4O61A 4NROA 4CXYA 4QKBA 3O1SA 3BKZA 4O7XA 4CXXA 5DABA 5F8PA 3T3YA 3O1VA 4NPLA 4IDZA 4QKNA 3RZGA 4ZS2A 3BU0A 3I3QA 4ZS3A 4NRPA 4QKFA 3RZKA 3I3MA 4CXWA 4IE4A 3LFMA 4RFRB 4NJ4A 3I2OA 3O1PA 2FDFA 3RZMA 4NIGA 2FDIA 3RZLA 3S5AA 4MGTA 2IUWA 4NIHA 3KHCA 2FDKA 3O1RA 3O1OA 3BTYA 4QHOA 3T4HB 4NIIA 4NIDA 4NRMA 3BIEA 3O1MA 4NRQA 3O1TA 4IE6A 3T4VA 3S57A 4NPMA 3RZHA 3RZJA 3I49A 4IE0A 4IE5A 4OCTA 3H8RA 3H8OA 3BTXA 3BTZA 3BUCA 3BI3A 4ZHNA 2FDHA 4QKDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JHT A;  3H8X A;  3KHB A;  2FDJ A;  2FDG A;  4MG2 A;  4IE7 A;  3O1U A;  2FD8 A;  4O61 A;  4NRO A;  4CXY A;  4QKB A;  3O1S A;  3BKZ A;  4O7X A;  4CXX A;  5DAB A;  5F8P A;  3T3Y A;  3O1V A;  4NPL A;  4IDZ A;  4QKN A;  3RZG A;  4ZS2 A;  3BU0 A;  3I3Q A;  4ZS3 A;  4NRP A;  4QKF A;  3RZK A;  3I3M A;  4CXW A;  4IE4 A;  3LFM A;  4RFR B;  4NJ4 A;  3I2O A;  3O1P A;  2FDF A;  3RZM A;  4NIG A;  2FDI A;  3RZL A;  3S5A A;  4MGT A;  2IUW A;  4NIH A;  3KHC A;  2FDK A;  3O1R A;  3O1O A;  3BTY A;  4QHO A;  3T4H B;  4NII A;  4NID A;  4NRM A;  3BIE A;  3O1M A;  4NRQ A;  3O1T A;  4IE6 A;  3T4V A;  3S57 A;  4NPM A;  3RZH A;  3RZJ A;  3I49 A;  4IE0 A;  4IE5 A;  4OCT A;  3H8R A;  3H8O A;  3BTX A;  3BTZ A;  3BUC A;  3BI3 A;  4ZHN A;  2FDH A;  4QKD A; 
#chains in the Genus database with same CATH topology
 3TEW A;  2J1T A;  1LOE A;  3DF0 A;  1JYN A;  1MVE A;  1WZX A;  2ARA A;  1RUD 2;  2BFU L;  5LA1 A;  4A45 A;  4AHY A;  1B09 A;  1U5I A;  2WLP A;  4YSF A;  2JG8 B;  1VAK A;  1SPP A;  2B9V A;  3NRU A;  3NJY A;  5FWJ A;  2Y8K A;  4NIG A;  2QJV A;  2VOX A;  2XJT A;  3PU8 A;  2NM1 A;  1LOD A;  2HH9 A;  1S4C A;  3ENR A;  4ASL A;  1SLC A;  1ZZ9 A;  1V6I A;  5JLV A;  3RZH A;  2BYV E;  1WW5 A;  4MOA A;  4RS5 B;  4XFA A;  2VQU A;  4LNV A;  1J3R A;  4JDN A;  5M0T A;  2OS2 A;  4URT A;  2VW1 A;  4EN0 A;  1YFX A;  3AL5 A;  2XL9 A;  4JHT A;  1O3Q A;  1W6O B;  3T08 A;  4OMC A;  1XYO A;  3ME2 A;  1GZW B;  3OF1 A;  1FAY A;  2VBD A;  2HBT A;  1YLL A;  3PUA A;  4LTA A;  1MR5 A;  3HT2 A;  4UFM A;  1G86 A;  2RR1 3;  3LEG A;  4DXZ A;  3O1V A;  4FAH A;  3RMX A;  1UPS A;  1W8H A;  2ZAB A;  1Y43 B;  5A3M A;  3D4K A;  1QGL A;  2WQZ C;  1GOH A;  3GZE A;  4IUG A;  4KGG A;  3IDB B;  4CEW A;  5FY0 A;  3LDK A;  4I30 A;  3GBW A;  2QQN A;  2B4K A;  4RHV 3;  1GNH A;  4CCN A;  2O14 A;  3BTX A;  3MUY 1;  3K3O A;  3R4S A;  3K77 A;  2JG9 C;  3MPB A;  3POF A;  4Z1V A;  4YW2 A;  3WP3 A;  1L7R A;  3I2J A;  2ZMK A;  4J6G A;  2IC1 A;  5BYN A;  3INA A;  2LUW A;  4CDX A;  3JB8 A;  5FO8 B;  2GU9 A;  3BGA A;  1UY3 A;  5F9T A;  3NWK A;  2PHD A;  1V6M A;  3VBR C;  4ASK A;  5IFP A;  4B7E A;  1UZW A;  2XG3 A;  1C8M 2;  2VH9 A;  1JI6 A;  1TMF 1;  2QKD A;  3SH5 A;  3NV2 A;  1I5Z A;  2ZGO A;  2RV9 A;  3GJA A;  2XKP A;  3IT8 A;  3IAP A;  3FBM A;  1HKD A;  2X5I A;  4GWI A;  3MW2 A;  4P9Y A;  2RVA A;  3CO2 A;  4RSU A;  1TE1 B;  3DCQ A;  3IZO A;  4NPM A;  5FY8 A;  3ZKU A;  4BK5 A;  2W1U A;  1H8T A;  2VXJ A;  4BU2 A;  1MQT B;  2CGO A;  1NKG A;  4W6Y A;  1ZA4 A;  2LS6 A;  3WX5 A;  1VB4 A;  1N47 A;  3A21 A;  3ZFG B;  2GNB A;  2L9L A;  1JZ4 A;  1XOY A;  1O4T A;  1W0P A;  2PLV 1;  2UWC A;  3M3Q A;  4UFH A;  5DAB A;  5FUN A;  1UX7 A;  5JDB A;  1OQD A;  4L97 A;  3DV8 A;  4YW6 A;  3WW4 A;  2LAL A;  2CWM A;  2HEW F;  4FSJ A;  1QKQ A;  1G9B A;  5IVF A;  1CAX B;  4ZY9 A;  2ZHL A;  5A3T A;  3KWV A;  4DIN B;  1TNR A;  2GH2 A;  3K46 A;  4UW5 A;  5BNN A;  1YUD A;  1R1A 3;  1PX3 A;  3WNK A;  2RS1 2;  1BVP 1;  2IXH A;  4E2G A;  2WWU A;  1JN2 P;  1WCS A;  1RYY A;  1IQD C;  2PLV 2;  4W4Z A;  1UKG A;  2VCB A;  5C4W B;  4AF9 A;  4Z07 A;  4D0Q A;  1NCR A;  2W39 A;  5A7P A;  3RPQ A;  4LQR A;  4QU1 A;  2WS9 1;  1NT0 A;  1SCS A;  2IUW A;  4P9J A;  5DUV A;  5CG8 A;  4QXK A;  5F39 A;  3III A;  1UXZ A;  4GB3 1;  2ZHN A;  2R1D A;  1R1A 2;  2JEM A;  1H1M A;  4A41 A;  1JU3 A;  4D6R A;  3DXT A;  2WZR 3;  1LOF C;  2VZT A;  5CYY A;  4BXF A;  2VBB A;  4C8D A;  3QCW A;  1JZ6 A;  1SQ4 A;  1W6P B;  1ZBE 2;  4OHX A;  4XF0 A;  2RDS A;  1UY0 A;  1XNK A;  1DU3 D;  1QQP 1;  4OZX A;  4Y3O A;  5ANQ A;  4AR2 A;  2KA3 A;  1ZM1 A;  3LEI A;  4CVU A;  3FHA A;  4G9S B;  2YG0 A;  3IPV A;  1YQC A;  3PTY A;  5FMD A;  2ZKL A;  2WNV C;  2XWB B;  3OUI A;  1NXM A;  1G8W A;  3SHR A;  4Z8B A;  1EUU A;  2YBK A;  3RDI A;  2W92 A;  2WS9 2;  3I2I A;  3ZOI A;  4MXW B;  2Y60 A;  1MZE A;  2EVX A;  5EWS A;  3WDW A;  4NVP A;  1Q8S A;  2J1S A;  4EQV A;  4BH9 A;  1IS5 A;  3J4U H;  2HEY F;  3NAP B;  1Q5O A;  4Q4W 1;  5FZC A;  2HYX A;  4S2H A;  5FXV A;  4Q4W 3;  1N1T A;  3POS A;  1OUS A;  3ZN6 A;  1U0A A;  3OTF A;  4HFS A;  2Q8E A;  2JKB A;  3I49 A;  4DY5 A;  1GAN A;  4M4R A;  4AGR A;  5A7W A;  5J48 A;  4GAL A;  1OQ1 A;  1HJG A;  3DPR B;  1J58 A;  1PIV 3;  1QJX 1;  2AGS A;  2XR4 A;  1O3S A;  2D6P A;  2WNU C;  1PM4 A;  2XH6 A;  2YRO A;  4JDM A;  1X9P A;  4QQL A;  5BPX A;  3SIS A;  1HRV 2;  4B1M A;  2DUR A;  3THT A;  4ONU A;  4YW5 A;  4BLI A;  1H0B A;  1DYP A;  4YZ4 A;  4O7X A;  1NQD A;  5K7P A;  1Z7S 3;  2RM2 2;  3OBZ A;  4Z2A A;  4LK7 A;  5TSW A;  2D40 A;  1K5M A;  4Z92 B;  3AK0 A;  4YW4 A;  4Q4W 2;  2MPF A;  3V0B B;  5L36 A;  4E9K A;  3FLP A;  2RDN A;  4PIX A;  4H7L A;  1KGY A;  2P6H A;  1H1I A;  1KEX A;  3WF4 A;  3FLR A;  1OUX A;  5F2W A;  5C5T A;  3JQW A;  1ENR A;  4YVS C;  5GZE A;  3W5M A;  4QX5 A;  2G9F A;  4IV3 A;  3AX4 A;  5AC9 3;  5L9V A;  1SCR A;  5C3S A;  2WZR 1;  2QDR A;  3VBF A;  3WDY A;  2WRA A;  5DQ0 A;  1PZ9 A;  3T0D A;  3WQ7 A;  2HEV F;  3M4F A;  3H0O A;  4K3U A;  4HZF A;  5IVY A;  5FZA A;  4PDW B;  1FOD 3;  2HWE 1;  2RM2 1;  1UNB A;  1CZV A;  5DG1 A;  2LTN A;  3WF3 A;  5J37 A;  4BQ1 A;  5FZB A;  1GV9 A;  5LK5 A;  4YZ5 A;  5ACA 2;  5IVV A;  5H9S A;  2ET1 A;  1UYP A;  1QWR A;  2R04 2;  2A3X A;  3VKL A;  5FYV A;  1K5M C;  4WVZ A;  3USU B;  2LRP A;  2JDU A;  2VEC A;  4DUV A;  2UWB A;  1YFU A;  4DEQ A;  2A75 A;  3AJY A;  2VG9 A;  4GKY A;  3H8X A;  2OPK A;  4CA9 A;  1MEC 3;  5DMY A;  2ZTN A;  1WME A;  1EV1 2;  1JZ5 A;  5CKN A;  1FNY A;  3N35 A;  2XBO 3;  3ASI A;  3I2G A;  2OW4 A;  1FT9 A;  3NV3 A;  1K3I A;  3HNB M;  4UBH A;  5FZ7 A;  3WD5 A;  3A7Q A;  3AYD A;  3OEB A;  5KHI A;  2A6Z A;  1XU2 A;  2R0H A;  4I3P A;  1BJQ A;  5IT6 A;  4CCJ A;  1HXS 3;  1DIW A;  3UKN A;  3IKW A;  4ISR A;  1AYN 1;  1YRZ A;  4LUK A;  4S2F A;  3VZK A;  3AMH A;  1YNA A;  2BBA A;  2OUJ A;  2XUE A;  2ZEW A;  3VLB B;  4BE3 A;  1J1T A;  2G9G A;  2VNR A;  1QOO A;  4AFA A;  3BVC A;  1B35 B;  2WL1 A;  3OG2 A;  3BU7 A;  4R52 A;  1NQJ A;  4MVT A;  4KMQ A;  5F3E A;  5F5C A;  4DPN A;  1HQN A;  1QOS A;  1V00 A;  5JVV A;  1W0N A;  1XU1 A;  3RSJ A;  1UY2 A;  1CIW A;  4FOV A;  5JZG C;  1Q8V A;  1W03 A;  2NMO A;  2WWJ A;  4XVH A;  3PUH A;  4EN8 B;  3WG4 A;  5IK4 A;  4NID A;  4C0H A;  4MSV A;  4ZZ8 A;  3L9J T;  3ZFE C;  4QD2 A;  3GCW A;  3AM2 A;  3ZFE B;  4FPE A;  3H8U A;  4JVA A;  4N53 C;  1CD3 G;  3QLQ A;  2K0G A;  4V2V A;  1EPZ A;  2W08 A;  5DAW A;  5FYZ A;  3U4X A;  2GME A;  2WSU A;  3KCX A;  4FPG A;  1ONA A;  1HV1 A;  3M2M A;  5EPA A;  5FYT A;  2PHF A;  3APB A;  5E16 A;  5I8T A;  4Y1U A;  2W46 A;  5C5U A;  2A3W A;  2P3I A;  1Y9M A;  5KBF A;  1S0B A;  3AP9 A;  1RED A;  4CDU C;  5L7O A;  2BEO A;  2JDY A;  2WFF 3;  2WYS A;  4Q0Q A;  1JBC A;  1K12 A;  1W28 A;  1AXK A;  4HKW A;  4XUR A;  3I3M A;  4IE4 A;  1PVC 1;  4CEW B;  4YZ2 A;  4CCM A;  2IVI B;  1AR7 3;  1SLT A;  3I8T A;  4JHZ A;  1W8T A;  2TBV A;  3VZJ A;  5DN2 A;  1A6C A;  4AEJ A;  4D7T A;  1OXC A;  1ULD A;  2J22 A;  3CMG A;  4FOY A;  5FBJ A;  1FNZ A;  1O6U A;  1OPO A;  3IDA A;  4R8H A;  5I0S A;  2HWF 2;  4QPY A;  2CYF A;  2QQK A;  2NYY A;  1C5H A;  2W94 A;  4LO6 B;  4LIV A;  3I3D A;  4LMF A;  4UXA A;  1TME 2;  5FYC A;  4ZHN A;  4FQZ A;  4J1W A;  2VQ0 A;  1D4M 3;  1PGS A;  3KHB A;  5FZD A;  4IE7 A;  5DG2 A;  3SEP A;  4GH4 A;  4MH0 E;  3S6P A;  4DQA A;  1I3H A;  3WCR A;  5EV7 A;  5A32 A;  4DRR A;  4XZP A;  2UU8 A;  5AFE A;  5HXM A;  3EXU A;  4E2Q A;  3PVO A;  4QT6 A;  1TMF 2;  3T0A A;  5BY5 A;  1VB2 A;  3R4U A;  4BM8 A;  1D0H A;  3RYK A;  3OD0 A;  5LY2 A;  2I07 B;  5BV6 A;  3C3V A;  5DZE A;  1S0D A;  2BNM A;  1JUI A;  3QH6 A;  4CE8 A;  5GLU A;  1I1E A;  5JSP A;  5FOJ B;  3MIE A;  2HWF 3;  2QQI A;  3OUH A;  3S0M A;  4A7Z A;  4NRM A;  1HDK A;  3I2D A;  3MLK A;  1LR5 A;  2D6K A;  3CF6 E;  1YCI A;  2FDG A;  3B3Q E;  4BB3 A;  1JZ3 A;  2PHR A;  2YZ4 A;  4H3W A;  4I3G A;  5IWF A;  1PHM A;  1TEI A;  2JDK A;  4C91 A;  1W6N B;  1AYM 3;  2JJ6 A;  2SLI A;  4LE3 A;  5FZK A;  2CSG A;  4LHN A;  3MBW A;  2FCV A;  2OT7 A;  2PAE A;  4IEP A;  2W1S A;  5CFC B;  2RHP A;  1H2L A;  2PHL A;  3KQ4 B;  4FAG A;  4YFZ A;  5CFC C;  1LEN A;  5KHK A;  2A6Y A;  2EXK A;  1SHW B;  2LM3 A;  4AI8 A;  2HBU A;  1OF3 A;  3MI8 A;  3LFM A;  3RJ2 X;  2K9Z A;  3K51 A;  4HXC A;  1JS9 A;  3JD7 1;  1RUF 2;  4QM9 A;  2PN5 A;  3HQX A;  4FPH A;  4UW4 A;  4XF1 A;  1N1S A;  5JI7 A;  5IK5 A;  1LHN A;  2VNV A;  1HJF A;  3HNM A;  4ITC A;  1O3R A;  4OHY A;  1KS5 A;  3UGH A;  1ND3 B;  3VZL A;  1W8W A;  1RMU 3;  4XIK A;  3MLL A;  3GZA A;  2D3S A;  1CAW B;  2O8O A;  2Q4S A;  2X09 A;  4OI4 A;  2Y6J A;  3NKG A;  1H9P A;  5F37 A;  3C7H A;  3HPN A;  1RUG 1;  4Q0S A;  5FY5 A;  3B01 A;  1UZ0 A;  4KWU A;  4PF1 A;  3W20 A;  4QPI B;  2CGN A;  2QE3 A;  4PLO A;  4NHL A;  1ZRI A;  1A34 A;  1PMI A;  2IXL A;  3LSE A;  2OZJ A;  3OJB A;  1RUF 3;  3LE0 A;  3O0W A;  3OEA A;  1ZRR A;  2H0B A;  1CAU A;  5I0T A;  1C8M 3;  3WNP A;  3RZM A;  1NE4 A;  4GB3 2;  4QXB A;  1NOV A;  2BGP A;  3FE5 A;  3BTY A;  2ZX0 A;  3IDE A;  3VBU A;  5J96 B;  3LAG A;  1V0A A;  3VBO A;  5FXW A;  5BNN C;  4PI2 A;  1FMD 1;  4IET A;  1PO2 2;  1UIJ A;  2NMN A;  1FV2 A;  4CEW C;  5LZ6 A;  5A33 A;  4JGZ A;  1RUE 3;  2CAV A;  4L99 A;  5GLW A;  2BGC A;  1LJ7 A;  2RJ2 A;  4GH4 B;  2R0F A;  4CXX A;  4M3C E;  1W9S A;  3BOW A;  3O12 A;  2YBP A;  4QKN A;  4EZH A;  3NVC A;  2AEZ A;  5C8C A;  5HV4 A;  2Y33 A;  4AGG A;  2DCK A;  3CU7 A;  3M3E A;  1ZBA 2;  2DYC A;  4XF9 A;  3LEK A;  1UWW A;  4LPL A;  1KQR A;  2DBI A;  1HB1 A;  2VOW A;  5F6L B;  3WNM A;  2HKX A;  4D8M A;  4XET A;  1W9W A;  3FJS A;  4OLL A;  4QX2 A;  4X8P A;  1ZYB A;  2ATF A;  1WLC A;  2VMD A;  5GZD A;  4YPJ A;  5K8S A;  3Q8A A;  3FHI B;  4OCT A;  2YMZ A;  5L9B A;  2JD9 A;  2I74 A;  3V0A B;  2A71 A;  1VBB 2;  1VRB A;  3NW4 A;  4ARX A;  4OYU A;  1ODN A;  3NV1 A;  1C57 A;  3ATG A;  2ID4 A;  5T3N A;  3VBU C;  4HT1 T;  4LJH A;  2VBP A;  3VBH B;  5IW0 A;  1Y3T A;  1QF3 A;  1MS8 A;  4F83 A;  3W58 A;  1UMI A;  3PDQ A;  3AYE A;  2WO3 A;  2J7M A;  1AX1 A;  3WW1 A;  5FZH A;  1AR8 2;  1SBE A;  4IEY A;  4R9C A;  4LK6 A;  1WD3 A;  2A6X A;  1HQW A;  1KDK A;  2CAU A;  4Q4Y 3;  3O1O A;  4KG0 A;  2GC3 A;  3M1H A;  2P4E A;  4X6R B;  4YM3 A;  2HWD 1;  3DN7 A;  4JGY A;  1W0O A;  4CCL A;  1XRU A;  4IE5 A;  3WW2 A;  4Q4V 2;  1W3X A;  3TRS B;  2WZR 2;  1KJR A;  4P9X A;  4BDV B;  4WZF A;  1CES A;  1XNB A;  1PO1 1;  2VTX J;  5LA0 A;  2WNU B;  3ZSL A;  4JDO A;  1WKY A;  2QQJ A;  3K75 B;  3P6B A;  2QBX A;  1AJK A;  4KNC A;  1X9T A;  2VXR A;  3U1X A;  2OQ6 A;  2ZX2 A;  1RUE 1;  4GXL A;  5IK7 A;  1W9Y A;  1YJL A;  2VUJ A;  4Q4Y 2;  5FPV A;  1UYX A;  3QOP A;  2WS9 3;  3GJB A;  1RXG A;  2PAK A;  2YGM A;  3VBS A;  5J36 A;  1M4W A;  2MEV 3;  4FTB A;  3NJV A;  5KHJ A;  2CDO A;  3VD7 A;  5C8C B;  1GOG A;  1G9F A;  1WBL A;  4A44 A;  2FZ1 A;  2VZU A;  3N7L A;  1RIR A;  5FUI A;  4AVS A;  4CP0 A;  4NE9 A;  2BFU S;  1EV1 1;  1NLQ A;  1ZZ6 A;  1V6N A;  2JB4 A;  4IL7 A;  1PO1 2;  1VE0 A;  5HCF A;  1T6B X;  5E89 A;  4XQW A;  2ZBJ A;  1QH7 A;  2Y6H A;  5FRA A;  3K4Z A;  4KI5 M;  2VOK A;  3NNF A;  4Q2F A;  5ANN A;  1OD5 A;  4PQQ A;  3KT4 A;  1D4V B;  2JE7 A;  2VD7 A;  4ASM B;  4CP9 A;  2RS5 1;  4QHB A;  5GM0 A;  2PA7 A;  3DYO A;  3H3L A;  4M01 A;  1KD7 A;  4DB5 A;  4MGT A;  2IXJ A;  3W59 A;  3ZYP A;  2XML A;  3KD4 A;  4QHO A;  5FYY A;  5F32 A;  3WV6 A;  4IND A;  2E32 A;  3V56 A;  1G9D A;  5A3L A;  3PLQ A;  2ZPX A;  4B1L A;  4MYE A;  1FPN 3;  1JOB A;  2VE1 A;  1WW7 A;  2DDU A;  4R9D A;  3IBM A;  3O5S A;  3AMQ A;  2FDH A;  1OLQ A;  1W6M B;  4M0N A;  4E8D A;  3AZW A;  4FP3 A;  1Q56 A;  1T2X A;  3BOD A;  2RMU 3;  2VCA A;  1ZNP A;  3LKJ A;  4FPF A;  4CCK A;  4JAA A;  3WNO A;  4LHL A;  3ZFE A;  1GQH A;  1ASJ 2;  4BK4 A;  3H3Z A;  2Z5W A;  3VD5 A;  4IDZ A;  4N53 B;  1J3P A;  2YUE A;  4I02 A;  3RZK A;  1VBC 2;  2GN3 A;  2VZO A;  3N9L A;  3TEY A;  2FDF A;  3AKQ A;  1XSQ A;  2EIC A;  1JYV A;  2R16 A;  3LIG A;  1BK0 A;  3NNG A;  5FBZ A;  1PNG A;  5FJH A;  5A7N A;  1DGW A;  4PHZ A;  2R07 3;  3J9S A;  3E6B A;  1ULF A;  4DIQ A;  3WQB A;  2W2I A;  2ZHM A;  4NRQ A;  4GWN A;  4RS5 C;  4FO9 A;  4P02 B;  2OYZ A;  4FQ4 A;  4AVT A;  3D0J A;  3MFA A;  5FLJ A;  1X82 A;  1VBD 2;  3B93 A;  4D7S A;  3ZXA C;  2JEC A;  5IAT A;  1DQ4 A;  2B8M A;  4YZ3 A;  2DF7 A;  1QH6 A;  3IMM A;  1EYB A;  2ZX3 A;  3SMH A;  3DYP A;  1ZRC A;  1LU1 A;  4LUM A;  3A22 A;  2R30 A;  5F5Q A;  5T54 A;  1VBE 2;  1N3Q A;  4EWA A;  4PCR A;  1PVC 2;  2W3J A;  1L3J A;  2XBO 2;  2EXI A;  4GJY A;  4QM8 A;  4XQD A;  2HWC 2;  2Y6L A;  3WQ0 A;  1RUH 1;  5FLI A;  4NWW A;  4AG4 A;  2NN8 A;  1DQ2 A;  5C4W A;  3WF0 A;  5FY4 A;  3ZXD A;  4XPV A;  3TNP B;  1HXS 2;  3BIE A;  2BV4 A;  1JYI A;  5SV8 A;  3O1T A;  1H30 A;  3JU9 A;  3O0X A;  4ZKT B;  4MXW A;  3P5B A;  1W9F A;  2XQR A;  3LA3 A;  5FZ3 A;  1VMH A;  1LGB A;  4XXP A;  1LGN A;  2EIB A;  4FPJ A;  3VDC A;  3B69 A;  3K48 A;  5ABJ A;  4BZ4 A;  3PL0 A;  3VZN A;  4MZU A;  2EIG A;  3VBS B;  1ZZ7 A;  3HQU A;  3BKZ A;  3FLT A;  4CP2 A;  4HPK B;  1YI9 A;  1GIC A;  5LEK A;  2GAU A;  4QX7 A;  4OI0 A;  2RMU 1;  3BCW A;  4YZ1 A;  1RUH 2;  2VGD A;  4N43 C;  4FPY A;  4IXL A;  2C9A A;  5JXJ A;  3OGG A;  4XDO A;  3TNQ A;  2D43 A;  2FDK A;  1ULP A;  3HR9 A;  1JYW A;  1HQL A;  2Y34 A;  4OUS A;  4C1X A;  2WNU A;  3IDC B;  3V65 A;  1XYP A;  4BA6 A;  3VDB A;  2VL4 A;  3H9A A;  5IVC A;  3LDR A;  1GQG A;  3FFQ A;  5C3Q A;  1BEV 3;  5BXX A;  3HAG A;  2ZEX A;  4HK8 A;  5JPM B;  2C5D A;  1OKQ A;  1ZA7 A;  3LOI A;  2VW2 A;  2YYO A;  1RL3 A;  2D3P A;  2ZA9 A;  4HON A;  4HBN A;  4XFB A;  4XTP A;  4BPZ A;  1YFY A;  4CUG A;  4XF4 A;  1PK6 B;  4LXL A;  1Y7B A;  2WO1 A;  1W2N A;  4WM8 B;  1BXH A;  3PUI A;  4NWV A;  1HB3 A;  2WIN B;  1O8S A;  3JD7 2;  5FTT C;  2Z2S B;  2N7G A;  4QU2 A;  4LBQ B;  4WM7 C;  4DFS A;  3O1P A;  4Y20 A;  1BVV A;  4FCA A;  3ZXF A;  3KVB A;  3SQO A;  2X8K A;  3LDB A;  3OGS A;  4UF0 A;  3ZR6 A;  3POI A;  3ZR5 A;  2Q0A A;  3FC0 A;  5FO9 B;  5KC5 A;  1S2E A;  1Y4W A;  1D0G A;  5JR2 A;  5JZG A;  1NUK A;  1HB4 A;  4ZU4 A;  3SNM A;  5KWR A;  1W2A X;  3BPS A;  2D5H A;  3IIA A;  1YQ2 A;  4IER A;  5FZ4 A;  4JRA A;  5B4N A;  1LHW A;  2BNN A;  2VR4 A;  1R08 2;  3GXU A;  2IXK A;  4Y4Y A;  4UOJ A;  2VOV A;  1IQA A;  2WO7 A;  4BMB A;  4D94 A;  1LOC A;  4AAX A;  1CQ9 A;  1ZX5 A;  2GP3 A;  1CN1 A;  2TEP A;  3C7E A;  3VBF B;  4N9I A;  3GM8 A;  1QJZ A;  2E63 A;  1HN0 A;  4JTO A;  3VGI A;  1IZ3 A;  5C3P A;  4P9W A;  2WT1 A;  2NLR A;  1W8F A;  3S5Q A;  1OLM A;  2V72 A;  3P3P A;  1RUG 3;  1RHI 2;  4QMA A;  4COY A;  2F6B A;  4AFB A;  4N90 A;  2GNT A;  1XYN A;  3RYR A;  3CNA A;  1VRH 2;  1DG6 A;  1IG3 A;  3POE A;  5FK7 A;  3G7D A;  2Z42 A;  2EID A;  3C7F A;  3KLS A;  1PX4 A;  2YB7 A;  4LHS A;  4AI2 A;  1JUH A;  3GGL A;  3JBG 1;  1ZBA 1;  3I3E A;  4U36 A;  4XTM A;  3BU0 A;  2GAL A;  3GDB A;  5FPX A;  2D6O X;  5C3O A;  2ZEZ A;  3SH3 A;  1AR6 2;  2DVA A;  1W6Q B;  3L2Y A;  4FFF A;  3VL8 A;  2VO5 A;  5GLT A;  3I7D A;  4CEY B;  3DUI A;  4RA0 A;  5I91 A;  3ECQ A;  4JX0 A;  5JR7 B;  2ZGK A;  4XJZ A;  3SLI A;  1RHI 3;  3LGR A;  1IS4 A;  1HRI 3;  4QGN A;  2CDP A;  5FXX A;  2XWJ B;  3OYW A;  1DYK A;  4K40 A;  2PXJ A;  2I45 A;  1LOA A;  2XVK A;  5IVE A;  1K45 A;  5FOB B;  4E4D X;  1C1F A;  3PHM A;  1Y9Q A;  5A6Y A;  3AVS A;  3NNL A;  4YG6 A;  3U78 A;  1OLR A;  2GMP A;  3KGL A;  3KV4 A;  1EAH 3;  1UN1 A;  5BNN B;  2OZ6 A;  1KRI A;  5C8C C;  5APA A;  5F1R A;  1HLC A;  4PIZ A;  5J98 B;  3AC0 A;  1AR6 3;  2A3Y A;  3F95 A;  2UYA A;  1COV 1;  1AR6 1;  2W47 A;  4E8C A;  1COV 3;  2PMW B;  5DZG A;  3WNX A;  2HWD 2;  2ADD A;  4HK9 A;  1NA1 B;  4XAA A;  3TWI A;  4IEU A;  1YQ6 A;  3ZIW A;  2Y26 A;  5IVB A;  3T4V A;  2WZE A;  4Q4V 1;  2E26 A;  4XFC A;  4GQ7 A;  1O5L A;  3BTA A;  4BQX A;  5FR3 A;  3M3C A;  1OVS A;  1PO2 3;  3ZXE A;  4C0B A;  1XC6 A;  3VHP A;  4F3J A;  1EP0 A;  2VZV A;  3POB A;  4DUW A;  4M3C F;  1MS9 A;  3A0K A;  4QKB A;  5FZO A;  1EY2 A;  1RUO A;  2YBS A;  4AFC A;  4A7Y A;  4BQ5 A;  3FUQ A;  3FWE A;  4Q4Y 1;  5AFB A;  4HKL A;  5FUP A;  1COV 2;  1NCR C;  5LA9 A;  3UGF A;  5JMC A;  3E6D A;  2XQX A;  3A0N A;  4OI2 A;  4PQ9 A;  1OHF A;  4N8M A;  4L8Q A;  1NCQ C;  4I0B A;  4MGS A;  2O0O A;  4AED C;  1PMH X;  1Z78 A;  1ZBA 3;  2Y0O A;  5A32 B;  4FXK B;  3T0B A;  3KS7 A;  4WVV A;  2ENR A;  5F7U A;  4N53 A;  5FMO L;  4COV A;  1BMV 2;  4AED A;  4DY3 A;  4NHM A;  2KR2 A;  4IW3 A;  2GP5 A;  1CAV B;  1QNW A;  2E31 A;  4OUE A;  3ZSM A;  3BTZ A;  1W2U A;  1DGR N;  3EQE A;  4GMP 3;  4XUN A;  2EAA A;  3LIH A;  3GHM A;  2R06 2;  3VBO B;  4GMP 1;  1AL2 3;  1DF0 A;  4UI9 L;  4X6Q B;  3THD A;  3WLU A;  2RR1 1;  4NAO A;  3ZPY A;  2XVL A;  3AZY A;  4HAN A;  4QX8 A;  3NJZ A;  2QQM A;  3B9C A;  2E6V A;  4M4P A;  1JZ7 A;  2VC9 A;  1DLC A;  1C8N A;  1QMJ A;  2VCC A;  4XAB A;  1UZY A;  5FYI A;  2HWB 2;  2GDF A;  5EJZ B;  1GNZ A;  2EA7 A;  4KQ7 A;  3S5A A;  3CHX A;  1DZQ A;  3MIC A;  4QHZ A;  1UU6 A;  4KL1 A;  3IMN A;  4UFJ A;  3WR0 A;  1XQN A;  4L0P A;  3AP5 A;  3RG0 A;  1ODM A;  2ARE A;  2MHF A;  1AL2 2;  1A8D A;  4J25 A;  4JV4 A;  3LD8 A;  3VD4 A;  1ALY A;  1Q8P A;  1QXR A;  4XIL A;  4Q4V 3;  1OMI A;  5CB7 A;  4QAW A;  2FMY A;  2QQL A;  2QCS B;  3HIF A;  4SBV A;  3T2Q A;  3AZX A;  3J26 N;  3K4A A;  5F5I A;  4RGK A;  3EBR A;  4AHZ A;  4BQ3 A;  3LOB A;  2GH8 A;  3N36 A;  4NRP A;  4CDU A;  5L7O C;  2WT0 A;  3B9I A;  2PHW A;  3VDD B;  2UUR A;  5F3I A;  3AFK A;  2XHN A;  1W6M A;  4XBL A;  4IEQ A;  1XBF A;  5KXE A;  4TYS A;  3AP4 A;  1REE A;  2FMD A;  1O59 A;  1LOB A;  5GLZ A;  5A3W A;  2C26 A;  1DQ6 A;  4CP1 A;  3FUO A;  4C90 A;  3CL1 A;  2BOJ A;  2AEN A;  5LAS A;  1RGS A;  4YGC A;  1T6G C;  2AR6 A;  5I0U A;  4CEY C;  1MQT A;  1UOJ A;  1GYK A;  4FPL A;  3TOJ A;  4ZZ5 A;  4RGG A;  1RUD 1;  4LT5 A;  2F4P A;  5T5J A;  4AHX A;  4A4A A;  3N7J A;  1F4A A;  4FOW A;  4CDU B;  1JU4 A;  3WHU A;  5KXB A;  5ABJ B;  1O3T A;  3HVD A;  2QFE A;  4NIH A;  5A7S A;  3RFR A;  4MV2 A;  1O4Z A;  2WAB A;  2DTW A;  3HN1 A;  2J42 A;  3QBQ A;  5CFD C;  2JE9 A;  2XLG A;  4K7J A;  3FHQ A;  1UYZ A;  5LW9 A;  3OGR A;  1DGW X;  4CDW B;  3S57 A;  2XJU A;  3TYJ A;  1GSL A;  2B5H A;  1E57 A;  3OD4 A;  5FQ0 A;  5KXD A;  4FPC A;  4CDX B;  5CU1 A;  4R9B A;  1GP4 A;  1RUI 2;  1ACC A;  4ET7 A;  2OPW A;  3LA7 A;  4H55 A;  5FZI A;  3M70 A;  5CKM A;  3RS6 A;  3KF5 A;  1NZI A;  2XJR A;  4AFM A;  4NPL A;  4TLF A;  1UD1 A;  3VHN A;  4TWT A;  3PU3 A;  3WF2 A;  3VKF C;  5CG9 A;  2CWS A;  4LEJ A;  2C0Z A;  5CNA A;  2ZGM A;  2Q8C A;  1Q8Q A;  4YGE A;  2XVG A;  2XUM A;  3E5Q A;  4BIO A;  2ZGN A;  1SDD B;  2B39 A;  5K0U A;  2R07 2;  1OKO A;  2V73 A;  4KG8 A;  1XSR A;  4D69 A;  2DFC A;  1PIV 2;  1TZO A;  3ORJ A;  4FI9 A;  2X5I B;  4KGQ A;  4QPG B;  2JE8 A;  2WQ8 A;  5FMC A;  1WA6 X;  3HOB A;  4IGQ A;  4IV1 A;  5LBB A;  1BCX A;  1YFW A;  3TEX A;  4BLJ A;  1WLW A;  4DXS A;  4C1W A;  4LO7 A;  1OPM A;  4KU8 A;  5FZ9 A;  4BQY A;  2VU9 A;  2MNG A;  1DQ5 A;  2GN7 A;  2VZ3 A;  3AVR A;  1RJ7 A;  3EYP A;  2ZOE B;  3KV6 A;  3KT7 A;  4JKL A;  3E5U A;  1H2M A;  2JDH A;  4CDX C;  3FZ3 A;  4G3Y C;  3BAL A;  3AKP A;  4XYX A;  2DTY A;  3DEC A;  1YC6 1;  1OBN A;  2Y6K A;  2WUH A;  3O7O A;  2CNA A;  5A3P A;  4XFF A;  5JOW A;  3N3H A;  3D82 A;  4KWK A;  4XMI A;  1E5H A;  3DYM A;  1OOP A;  4IE0 A;  3UET A;  3I2K A;  4TTG A;  4LKF A;  1UZV A;  2YHJ A;  2D6N A;  4HVR A;  1OUR A;  2AUY A;  4K1Z A;  2P3J A;  3JXS A;  2R49 A;  2KD7 A;  2W95 A;  2YC0 A;  5J1X A;  2ZGQ A;  3IM0 A;  2P3K A;  4Y1X A;  4QPI C;  3WG1 A;  1HV0 A;  1NAE A;  3RI9 A;  4QB6 A;  3FL7 A;  4BQ4 A;  1OD3 A;  3ZXJ A;  4EYU A;  2P17 A;  5DAP A;  5FMO S;  3LCP A;  3T1M A;  3KVA A;  2JIJ A;  4RFR B;  4S2D A;  3FMG A;  5LWB A;  2DCZ A;  5A6Z A;  1RUJ 2;  4WM7 B;  1J59 A;  2VM9 A;  1RUH 3;  3KZ4 C;  3SCF A;  4AED B;  2P6C A;  2OVU A;  4P5H A;  3U10 A;  2A6V A;  1IS3 A;  4P00 B;  5EJ3 A;  3J7L A;  4GA9 A;  1LHV A;  1GWK A;  2WWS A;  5JAX A;  2VMG A;  1HN1 A;  3AKS A;  1CZT A;  4BXS V;  1KXG A;  1SMV A;  2JG9 B;  3J7N A;  4IEZ A;  1NLR A;  4GWM A;  3RVH A;  2VZS A;  4UFL A;  1EV1 3;  2AYH A;  2WZP P;  1BEV 2;  1QJY 1;  5JSO A;  4AHW A;  4Q1P A;  3MDP A;  4RGA A;  4MO3 M;  1HX6 A;  1F31 A;  1NYW A;  1OOP C;  4FFI A;  1OOP B;  4QDQ A;  3T1L A;  1QJU 1;  3PVN A;  4AI0 A;  1WCD J;  4XJU A;  2Y6G A;  2UY9 A;  4LLF A;  4PBO A;  3S7E A;  1GLH A;  4U2A A;  3ILR A;  1RUJ 3;  3U75 A;  3KCC A;  3OPZ A;  1RUJ 1;  4PDW A;  2PQS A;  4YVS B;  2RS3 2;  5BNO B;  5BNO C;  1GUI A;  5FPA A;  5LAT A;  3WT3 A;  3MO4 A;  5CFD B;  4Q26 A;  3X29 B;  3ZN4 A;  5FK8 A;  3BUC A;  2W1Q A;  3OPW A;  4XIO A;  4HVO A;  4YVW C;  3BI3 A;  4QXC A;  1ZRD A;  1ZBE 1;  2IFR A;  1BEV 1;  2DCJ A;  2PTM A;  4LR4 A;  1V6L A;  3WSO A;  5C8W A;  1ZBE 3;  1A3K A;  2X10 A;  1S0J A;  1MS1 A;  1U5X A;  3ZYG A;  2VMF A;  5FZF A;  4KH9 A;  4Y22 B;  1VP6 A;  1ULO A;  2LW8 A;  2RJK A;  3ILN A;  5FP8 A;  3OCP A;  4LBO A;  4RQP B;  3R05 A;  3UES A;  1DZR A;  1GZC A;  2RS3 3;  4LBM A;  2R7E B;  2C9K A;  3C2U A;  1AX2 A;  3OY8 B;  4HSL A;  4Y26 A;  4BWO A;  3RZL A;  1XE0 A;  3AMM A;  1W6N A;  2XKO A;  1JZ2 A;  3CJI A;  5F6K A;  4OI1 A;  4WZC A;  2K2S A;  1DGL A;  2ORZ A;  1WA4 A;  3FFZ A;  1RVF 2;  2B9U A;  1OA2 A;  4ES9 A;  1IKQ A;  3N7M A;  1RXF A;  4ISQ A;  2ZML A;  3HEI A;  2XOM A;  4AVV A;  4NHX A;  5DUX A;  1XPW A;  3RI8 A;  2OA2 A;  2OII A;  1S0C A;  2XJV A;  1KDM A;  2WN2 A;  1GWL A;  5FPL A;  3UT0 A;  1AR9 2;  1HRV 1;  4W6X A;  5JOX A;  1LTE A;  5C3R A;  2BZD A;  4H2A A;  1U12 A;  1BYH A;  1HRV 3;  4SLI A;  5EQU A;  1VRH 3;  5T52 A;  1EPW A;  1XNC A;  4L11 A;  1QJY 3;  2HYK A;  3LPG A;  3SKJ E;  3ETQ A;  1GP6 A;  1LCL A;  4DXT A;  5K4L A;  4BQ2 A;  1CJP A;  1QXP A;  1RTV A;  1RVF 3;  5IJR A;  1S0G A;  4MGZ E;  2AEY A;  3NMB A;  4WM8 A;  1BMV 1;  4GD4 A;  5FP3 A;  1CAX A;  2PAM A;  1FV3 A;  4WM8 C;  4RD7 A;  2ERF A;  3ZXK A;  3KV5 A;  4QX1 A;  4N9H A;  2IXI A;  3E97 A;  4Y1Y A;  5HI0 A;  3OPT A;  2IVJ A;  2VUL A;  1UIK A;  3BYW A;  1QXJ A;  2BWC A;  5E8A A;  2R1B A;  5GAL A;  4NN0 A;  1JYC A;  1MS5 A;  1RUC 3;  4N43 A;  3MEP A;  2ZAC A;  4XEZ A;  5D21 A;  3NV4 A;  1MEC 1;  5FYS A;  1EAH 2;  3ROU A;  1UF2 C;  1X36 A;  2RG4 A;  2F4L A;  1LOG A;  3T2T A;  1NCR B;  1OT5 A;  1UOB A;  5EXO A;  5CAZ A;  3ZFG C;  1SLB A;  4V2W A;  1OLM E;  1I5P A;  3QAC A;  3SXW A;  3CZU A;  3ZYB A;  1J1L A;  1O5U A;  2G19 A;  1V9U 2;  2E7Q A;  3OGJ A;  2VZQ A;  1YYN A;  3PUQ A;  4XCA A;  4RN5 A;  2LRO A;  4LBJ A;  4AEK A;  1NY7 1;  1X7N A;  2EAK A;  4O9E A;  2NZ9 A;  5FP7 A;  4QQO A;  3UGG A;  2ZGU A;  2BOI A;  3JB4 C;  4M00 A;  4UYB A;  4YWA A;  4CCE A;  1CZS A;  2BP6 A;  3NNJ A;  5CEH A;  4YNI A;  5FKC A;  5JOY A;  2D44 A;  1POV 3;  4DOU A;  4CU6 A;  1MEC 2;  1POV 1;  4JKM A;  1KFU L;  1M06 G;  4Q4X 2;  1EAH 1;  2E7A A;  1W9T A;  2Y64 A;  5HCH A;  4LBN A;  1U5Y A;  3PJQ A;  4NAM A;  3GZU C;  1FX5 A;  3R0R A;  4M0H A;  4DS0 A;  2H6C A;  3NJX A;  3RWN A;  2QZ2 A;  3GF6 A;  3VHO A;  5JIA A;  1UQX A;  4EN7 B;  3O0V A;  2WAO A;  2V09 A;  2VUD A;  3ALQ A;  5I8Y A;  5F3G A;  2XLA A;  4JTN A;  4P14 A;  2Q8D A;  2R32 A;  1RIN A;  1YQ8 A;  3GNE A;  1APN A;  1H8T B;  4K6B A;  1FAT A;  1ND2 C;  5FYM A;  1YXW A;  2V5Y A;  4DO0 A;  3CIH A;  4ES8 A;  4MG2 A;  4XC9 A;  5EJ1 B;  3VDD A;  5H9Q A;  3ZM8 A;  2ZAA A;  1IKP A;  4IQP A;  2YFU A;  4YGD A;  1VMF A;  3T3Y A;  5HBA A;  4WM7 A;  4QDR A;  3RGB A;  1SG3 A;  5DUW A;  3T2P A;  1S0E A;  1V6O A;  3ZN5 A;  1K5J A;  1US3 A;  4AI3 A;  3IN9 A;  1MS0 A;  3GBF A;  5B4X A;  1AR7 1;  1PNF A;  1S2K A;  3H1Y A;  5E88 A;  3P1I A;  3WVJ A;  3ZSE A;  2FHR A;  3U4S A;  3C7G A;  4NII A;  2ZKN A;  2W52 A;  1S2B A;  4GMP 0;  3VL9 A;  1DP0 A;  1SLA A;  1XNA A;  2BNO A;  3D6E A;  5FZO B;  4NMI A;  4JQR A;  3TB0 A;  1RUI 1;  3H50 A;  4P9L A;  1W6Q A;  3ZMN A;  4CEY A;  3RRD A;  1SBD A;  4A2U A;  1PZ8 A;  2CU5 A;  5FY1 A;  3ZXL A;  1W8U A;  2FD8 A;  2CTV A;  5C4W C;  5CAD A;  1ZZB A;  3HNY M;  3N9O A;  4LBL A;  4YYO A;  4BIS A;  3VUO A;  4CSW A;  3VN4 A;  3E6C C;  5I93 A;  3M3I A;  1C8M 1;  4CP9 B;  1GZ9 A;  1WLT A;  1CGP A;  5FP9 A;  1ULC A;  2H6B A;  3NAP A;  4D3W A;  3SCG A;  2BRT A;  3E1F 1;  4MAD A;  4XW3 A;  2JX9 A;  5AVA A;  1R09 1;  1S0I A;  2AAC A;  2A5Z A;  4K1Y A;  2BUK A;  2J1E A;  5CKQ A;  5G04 L;  3UYJ A;  1ZRE A;  1LEM A;  4FT8 A;  2DFB A;  5DAV A;  2HWF 1;  3TAY A;  3U07 A;  1MVQ A;  2ZEY A;  5LRR A;  3I54 A;  1UOG A;  3I97 A;  4Z82 A;  1YQ5 A;  1TME 1;  3FN9 A;  3ZFF B;  3N9Q A;  3AXE A;  3WG2 A;  3ZFF C;  2E9Q A;  1TME 3;  4AVB A;  5LY1 A;  2ZS6 B;  1STM A;  4GKX A;  3T2O A;  3VBU B;  3LSD A;  5EFU A;  1D4M 2;  1GQP A;  4O61 A;  1S55 A;  3VBH A;  1UX6 A;  3OYW B;  4QGM A;  5LBE A;  2D6L X;  4F7Z A;  1WUV A;  1PGL 1;  4CCO A;  1NE6 A;  1AR8 3;  1ENS A;  2NQY A;  3WEZ A;  1ND2 B;  1B35 A;  2VVF A;  4QKF A;  1FI2 A;  1A78 A;  1NZC A;  3VV1 A;  4HVQ A;  5FPZ A;  5IAX A;  5JMO A;  4B3N A;  2ARB A;  1ZZC A;  1WW4 A;  4MXV A;  1J84 A;  2OXB A;  1R09 2;  4YW3 A;  4JKK A;  4AQ2 A;  1GR3 A;  2E7T A;  2HJI A;  3AZZ A;  2FBE A;  3HWJ A;  3J7M A;  3HJR A;  5A7W B;  3WQ1 A;  3WDV A;  1YHF A;  2BTV C;  3OBT A;  5HXV A;  3CZJ A;  4JZR A;  5GZF A;  4KBZ A;  3RMY A;  2W9X A;  4XBQ A;  4TN7 A;  5A1F A;  3PVB B;  1NA1 A;  2IZW A;  4QQ2 A;  5EHD A;  2J1R A;  3DPR C;  5HCA A;  5LCW L;  2B42 B;  5FCC A;  2Z69 A;  1KS4 A;  2C4X A;  2PLV 3;  4LO8 A;  1YIF A;  4YG0 A;  4LBQ A;  3H7J A;  1AYM 2;  1R1Z A;  4QB2 A;  1MZ6 A;  3DEM A;  3LFI A;  1G6N A;  1PGL 2;  1RUD 3;  1QIQ A;  4NPR A;  1KJL A;  2D5F A;  1UL9 A;  1IPJ A;  4E4H A;  2O1Q A;  1RUF 1;  3WOG A;  1YEW A;  4YFW A;  4B7K A;  3WG3 A;  1LKN A;  1R1A 1;  4OHW A;  1W2O A;  1CWP A;  4LUL A;  5C7G A;  4AYU A;  5JXH A;  4I2O A;  3OSD A;  3Q8B A;  4QQP A;  1CAU B;  2QTW B;  1JYT A;  1RMU 2;  1PO1 3;  3LEM A;  4N43 B;  2BU9 A;  4CDQ C;  3WXP A;  5C9A B;  3WF1 A;  1VBB 1;  4CYD A;  5BNP B;  1UAI A;  4DEV A;  4ERO A;  1UY4 A;  2I2S A;  4I01 A;  1GWM A;  5DUU A;  4K21 A;  1IGO A;  3AB0 A;  4LBQ D;  2BJS A;  4PBP A;  2YU2 A;  3ZN6 B;  5FZM A;  4URA A;  4L9B A;  3Q8E A;  1I6X A;  3VB9 A;  4Y33 A;  2XHK A;  2E51 A;  1W3V A;  2WN3 A;  2J1U A;  2JG9 A;  4CUA A;  5K9Y A;  2KXL A;  1RUN A;  4LA2 A;  1AR8 1;  4ZPI A;  1DDL A;  1MAC A;  3ETP A;  1D2S A;  4OVE A;  2D3R A;  1CJD A;  3MIB A;  3THC A;  1JMU B;  4IEW A;  3K3N A;  2G4I A;  3EO6 A;  3R6S A;  2CGP A;  1CVN A;  2WLQ A;  2B7Y A;  2QUO A;  2RS1 1;  1FMD 2;  1QQP 3;  3ZSJ A;  3LZZ A;  5E1R A;  5FFO C;  4XFG A;  1ASJ 3;  4EZ4 A;  1WCK A;  1TQ5 A;  3VKO A;  1Z7S 2;  3ZDV A;  5J3U A;  1VJ2 A;  5E6H A;  4Q0U A;  5FZ8 A;  3MHZ A;  2Q30 A;  4LKD A;  4ZS3 A;  3RWK X;  3MV1 1;  2AZ5 A;  4NOT A;  2XLF A;  3CJI B;  4P9G A;  5D8A C;  3I2O A;  3B94 A;  2VQT A;  2VTF A;  4XHX A;  5T55 A;  3NST A;  2ZGR A;  3ACF A;  1NG0 A;  4IV3 C;  1JH5 A;  3DPR A;  5JSR A;  3JCI A;  2XXZ A;  1VAL A;  4MGI E;  1VAM A;  1DHK B;  2Y6F A;  3UNP A;  2VMI A;  5EYX A;  1QNY A;  1WGP A;  1QQP 2;  4YVW A;  2QDN A;  1AXY A;  3ES4 A;  3G6J B;  1VIW B;  2YC4 A;  3HQR A;  4GIQ A;  4UF0 B;  4YM0 A;  3I4I A;  4XUT A;  3M7A A;  1QJX 3;  2ARC A;  2JDZ A;  1WMD A;  2NPI A;  1GBG A;  2C1F A;  3ZYF A;  1IOA A;  3UKT A;  2W68 A;  2PFW A;  1Z7S 1;  3KCY A;  4R4Z A;  1FOD 2;  1JXN A;  2DVB A;  4MLO A;  4RS5 A;  5A7O A;  1SFP A;  1LED A;  2HWE 2;  5T5O A;  2HWC 3;  4ZU5 A;  5CFD A;  4IES A;  4QPG A;  3DGT A;  2VZR A;  1JHN A;  3V64 A;  3H3U A;  4W50 A;  5T5P A;  4AZZ A;  4RFT 0;  2RS5 2;  2VNG A;  3OBA A;  3PNA A;  3ACG A;  2ZGS A;  4MHR A;  1PMJ X;  3BN6 A;  4RL7 A;  3GAL A;  3LF7 A;  3BIW E;  3E5X A;  2MEV 1;  1QJX 2;  1XNT A;  4BQW A;  5F5A A;  2XJS A;  3R4D B;  3RNS A;  3AJZ A;  4YW1 A;  1UU4 A;  1TG7 A;  3MF9 A;  1JOP A;  2X29 A;  3OY8 A;  4EN6 B;  2RS1 3;  1FOD 1;  1C28 A;  1NCQ A;  2D6M A;  2HWE 3;  3EMR A;  3W21 A;  3M8L A;  4XAE A;  3WP4 A;  3P3N A;  3MZH A;  1US2 A;  1WD4 A;  3CLP A;  4QWN A;  5CBL A;  5DAX A;  4XJA A;  3ST7 A;  1ASJ 1;  4IGP A;  1W06 A;  5ERL A;  1H9W A;  4MGK E;  2JXA A;  3W9A A;  1ULE A;  2RS5 3;  4O9G A;  3ACH A;  4OUL A;  5FWE A;  5ABJ C;  5A1L A;  5LK7 B;  4B4Q A;  4PJY A;  2QQP A;  4M3C A;  1W8Z A;  2FZ2 A;  5LEJ A;  4DXR A;  1AYN 2;  4QB1 A;  4PI0 A;  1G7Y A;  5A3N A;  1N1V A;  2MEV 2;  1OH3 A;  4COU A;  5C70 A;  4A3X A;  3T09 A;  1L7L A;  4PDW C;  4E27 A;  4CTE A;  2VNO A;  3PTR B;  1UMZ A;  1VBD 1;  1NXD 1;  1V6J A;  4MGY E;  1W2T A;  1NCQ B;  1UXX X;  1WMX A;  2QQW A;  2W1W A;  3AMN A;  3I59 A;  4N7I A;  3NKT A;  4Q4X 1;  4QPW A;  1G9A A;  1LB2 A;  1JHJ A;  5FZ1 A;  1DZT A;  2C24 A;  3SCH A;  4AFD A;  1SZB A;  4COW A;  2F17 A;  1VBE 1;  4A3Z A;  3AKR A;  1L7Q A;  4MHU A;  4P5Y A;  5DDJ 2;  2DU0 A;  2ZX4 A;  3AP6 A;  4NIA A;  2D98 A;  5BNP C;  3VDD C;  3ZYI B;  2HWC 1;  2VQA A;  4RYD A;  1AYN 3;  1H1A A;  5L9R A;  2OQ7 A;  3MW4 A;  3O1R A;  1E5R A;  3U11 A;  2E33 A;  1QEX A;  2VY0 A;  1OVP A;  4TXW A;  2VW0 A;  3IWZ A;  4O65 A;  3AXD A;  3AFG A;  5A6X A;  1XND A;  1C1L A;  4LO4 B;  3S30 A;  4ARY A;  1LRH A;  4YAR A;  3BPZ A;  3J8F 3;  1E5I A;  3CJI C;  5D8A B;  4XOG A;  5FZL A;  3WDX A;  3C7O A;  4WVM A;  1CR7 A;  2JB8 A;  2YFZ A;  4TSV A;  3WW3 A;  1OC1 A;  2WFF 2;  4Y5S A;  1RUC 2;  5AC9 1;  2QVS B;  2RDR A;  1K5M B;  1UW8 A;  3H1W A;  4B8E A;  1YIP A;  1AR7 2;  2ILM A;  4B4R A;  3CKH A;  1IS6 A;  4YVW B;  3ELN A;  3ITQ A;  4QX3 A;  5FY9 A;  1J83 A;  2RM2 3;  1VBC 3;  4XFH A;  2BWA A;  3AL6 A;  4LOS A;  5FYB A;  1OI6 A;  4GH4 C;  2W91 A;  2HLE A;  1OQE A;  5A80 A;  2XPJ A;  1VBA 2;  1DQ0 A;  5FDB A;  2ES3 A;  3USS A;  4AEM A;  1MZF A;  2XB6 C;  5DXD A;  5C9A A;  2D97 A;  1DGR A;  4W65 A;  5FAX A;  1PZ7 A;  5FZ0 A;  3OBR A;  4CCD A;  3O1S A;  5C9A C;  5CIS A;  4ZXE A;  5L7O B;  2W5F A;  1DCS A;  1QOT A;  3DXU A;  1F5J A;  1JTZ X;  5CIR A;  4XDQ A;  3MIH A;  2GSY A;  2WFF 1;  3NNM A;  1RUC 1;  3H7Y A;  5AC9 2;  5L19 A;  5FYH A;  4OUM A;  4J1X A;  5DZF A;  1D7P M;  5FIX A;  5FLH A;  1IPK A;  1F9K A;  3MIF A;  4OFG A;  4Q4X 3;  3AYA A;  4JGZ B;  1CAV A;  1CPM A;  3POW A;  3T30 A;  1J3Q A;  1UY1 A;  2XON A;  1NLS A;  1TVG A;  3D0S A;  3VBH C;  4HMZ A;  1HRI 2;  4OHV A;  1N3O A;  2IFW A;  5ACA 3;  1C5I A;  4GWJ A;  2QZ3 A;  1HXS 1;  1OH4 A;  3LA2 A;  1QU0 A;  3VD3 A;  4GZ9 A;  1H8V A;  2EF6 A;  4F8A A;  4A6O A;  1D4M 1;  2X5I C;  3B7M A;  4EJR A;  2PEL A;  2UYB A;  3ACI A;  3PVE A;  3PMS A;  1H2K A;  1XE8 A;  3VKN A;  3ZXG A;  1G9C A;  2RJL A;  4UT5 A;  4Q27 A;  3ES1 A;  4BHP A;  4L2N A;  3VDA A;  1C3H A;  2PHT A;  3MFC A;  3PUR A;  3IB3 A;  2ZHK A;  2BVB A;  2A73 B;  5C33 A;  2GC0 A;  1F15 A;  1XXN A;  4BOW A;  1RB8 G;  1JOD A;  1HRI 1;  3FX3 A;  2QQV A;  2RE9 A;  2WBK A;  1ND3 C;  1Z0H A;  4Y20 B;  5JXG A;  4YGB A;  1BK1 A;  2AH2 A;  2CV6 A;  2WNV B;  4B29 A;  1SFY A;  1UZZ A;  2P2K A;  3A23 A;  5GKA C;  3L2H A;  1AYM 1;  2DCT A;  3ZKY A;  3HD8 B;  4AAP A;  1LU2 A;  5IVJ A;  2VJX A;  1UMH A;  3B02 A;  4DRV A;  4YW7 A;  2JDN A;  2P37 A;  1DBN A;  1PK6 A;  4GAZ A;  5FJK A;  3I2H A;  2AC1 A;  2QNK A;  2OUH A;  1ST8 A;  3A4U A;  5HCB A;  2BVV A;  1BBT 1;  4LA3 A;  3KM5 A;  4WVW A;  3WP5 A;  4AQS A;  5CFC A;  3USU A;  4AK3 A;  2KM2 A;  3D3A A;  5H9R A;  3EJK A;  1I9R A;  1UCX A;  5G05 L;  2WA4 A;  2CL2 A;  1PVX A;  1RMU 1;  5KC6 A;  5LBF A;  2JDM A;  2WC2 A;  4XCB A;  4XFI A;  4XJ9 A;  5A1A A;  1PO2 1;  3WDT A;  3NL1 A;  5J7M A;  1KFX L;  2VPV A;  4XUP A;  1DYO A;  2VUC A;  1CIY A;  1YWK A;  2J1A A;  3KV9 A;  4W8J A;  2FDJ A;  2W87 A;  2EAL A;  3MLJ A;  1H4H A;  4KWJ A;  4CXY A;  4K8F A;  2DV9 A;  1AHS A;  1H6Y A;  5FPB A;  3GHN A;  1R08 3;  4NHK A;  1VPH A;  1UKR A;  3N7K A;  1WLD A;  5FXZ A;  3H1M A;  3VBR A;  4E4S A;  4NJ4 A;  3ZYJ B;  4HET A;  2CY6 A;  4IV1 B;  4CU7 A;  4AQ6 A;  1OFS A;  4XE9 A;  1DQ1 A;  4XUQ A;  4E4Z A;  3PJY A;  1R09 3;  1VBB 3;  4FFG A;  2WNE A;  4AI9 A;  1GU3 A;  1RUG 2;  3Q8F A;  4H7M A;  2Q5T A;  4FFH A;  2K46 A;  3POG A;  1YJK A;  4LKE A;  2Q1F A;  1BQP A;  3TN9 3;  3WNL A;  2DVD A;  2DU1 A;  5EYY A;  3HN3 A;  3WNN A;  1R64 A;  2WA3 A;  4YM2 A;  3I59 B;  5JZG B;  4CPB A;  1TMF 3;  2YDE A;  1P8J A;  2BW8 A;  1QDC A;  5I0R A;  5KHG A;  4XF3 A;  1Q8O A;  2WZ8 A;  1POV 0;  4R9A A;  3KHC A;  2JKX A;  1SEF A;  5FV3 A;  3EB7 A;  4OQ8 A;  3KT1 A;  1GZW A;  3RZZ A;  3VKM A;  3C8X A;  3TBD A;  5JXI A;  1D2Q A;  3VBR B;  4QGL A;  4COZ A;  2SBA A;  4PF5 A;  2Q1M A;  2VOT A;  4MET A;  4EN9 B;  2FQP A;  3OGV A;  4LIU A;  1PGW 1;  3O1U A;  3OOX A;  1MS4 A;  2QQO A;  4NRO A;  3ZX7 A;  5IHR A;  3N4M A;  2YPD A;  2O8Q A;  5FZG A;  4KWL A;  3LWC A;  2Z4F A;  3CDZ B;  2ZZJ A;  1Q3E A;  4KU7 A;  4LIT A;  2PYT A;  4HG6 B;  3CJX A;  3ZPO A;  3DKW A;  3GBG A;  3MPP G;  1AXZ A;  2JG8 A;  4K9S A;  1DLL A;  3OB8 A;  4XJ8 A;  5CVR A;  3VBF C;  2HWB 1;  2DVG A;  2HWD 3;  1IG0 A;  4EE2 A;  3WP6 A;  3IAQ A;  5FYU A;  1GNY A;  3H8R A;  4OZO A;  1O91 A;  2DCY A;  1RUI 3;  1JZ8 A;  2CHH A;  4Q5O A;  4QQH A;  1UU5 A;  1PGW 2;  1FMD 3;  2B46 X;  3PIJ A;  1OA4 A;  1MPX A;  2WSV A;  3ON7 A;  1FYU A;  2JDP A;  4LBK A;  4FTS A;  1BLZ A;  2VTX A;  2WO2 A;  2YGL A;  1W6O A;  1HB2 A;  4UAP A;  5GJ6 A;  5IUQ A;  3HBZ A;  4A42 A;  1REF A;  3UK9 A;  3PIG A;  4WV8 A;  3SH4 A;  4CCC A;  4QDS A;  4AI1 A;  2WNV A;  2YC2 A;  1DFQ A;  2D7F A;  4KBB A;  5F2S A;  2BDR A;  1W99 A;  2WT2 A;  4I0W B;  2NP0 A;  4RHV 1;  4GB3 3;  4MGQ A;  1ENX A;  4Q1R A;  4YLZ A;  4A6S A;  2GND A;  5F3C A;  4I09 A;  4YVS A;  5GZC A;  2YY1 A;  2JG8 C;  1S1A A;  4BCU A;  1W8N A;  1OF4 A;  1ZRF A;  4E2S A;  1WBF A;  2C6S A;  4UW6 A;  2PHX A;  1UOF A;  1RJ8 A;  4UWD A;  4XJW A;  4OQ9 A;  1SBF A;  2EXH A;  5FMB A;  2RR1 2;  2IWG B;  1W05 A;  1XE7 A;  1Q43 A;  3ZFG A;  1AX0 A;  4V1P A;  4YM1 A;  1RUE 2;  2A1X A;  1RC6 A;  5A7Q A;  1W39 A;  4UBG A;  2DBN A;  5DDJ 1;  3VZO A;  5A6Q A;  1UO9 A;  1F2N A;  1Y9G A;  3ZYH A;  4QXH A;  2YU1 A;  2P1B A;  4BME A;  4AWD A;  2VAU A;  4IV3 B;  3HT1 A;  4IV1 C;  5HV0 A;  4JGY B;  4RHV 2;  5FRE A;  2XJQ A;  2A70 A;  4TZD A;  1GKB A;  2XJP A;  3D5O A;  4HSJ A;  1MZ5 A;  4LLO A;  4AGV A;  1WCQ A;  1LES A;  1VBD 3;  4K8R B;  3ILF A;  3W5N A;  3B00 A;  2ZXQ A;  4XAC A;  1XJA A;  2ZX1 A;  4G4F A;  3JUU A;  5IYY A;  2BQP A;  5JCT A;  1YO8 A;  1VBE 3;  1GMM A;  5IAV A;  1PK6 C;  1IPS A;  1B35 C;  5JWP A;  1W04 A;  3MF6 A;  3HBK A;  1OFN A;  4HLT A;  2GC1 A;  2ZMN A;  1BKZ A;  3U0Z A;  3S7I A;  4CDQ B;  3FBY A;  1KIT A;  4Q0P A;  4WBB A;  4DZG A;  5BNP A;  1MS3 A;  1WCU A;  2Y0I A;  1VBA 1;  4Q8K A;  5BNQ A;  4AXO A;  2ARX A;  4QPI A;  1X8M A;  1YI7 A;  2ORX A;  2VMC A;  1LHU A;  4FOQ A;  5FZE A;  4CDQ A;  3KGZ A;  3MIG A;  1E5S A;  1LNS A;  4QX0 A;  1HIX A;  4HPK A;  1VAV A;  5LA2 A;  4AE2 A;  4B4P A;  4MUV A;  4Q29 A;  5CZK A;  3J7H A;  3ACL A;  4R4X A;  4W6W A;  2H0V A;  4JCK A;  3WDU A;  4AQT A;  4EWE A;  2YXS A;  5D2A A;  4CUC A;  2JWP A;  1URX A;  3VBS C;  1AUY A;  2W0X A;  1UYY A;  2X05 A;  3POJ A;  4DNY A;  1VBC 1;  3IPV B;  2WDB A;  4L92 A;  4FP2 A;  1O8P A;  3JQX A;  1LGC A;  4XMA A;  2BER A;  3KQR A;  1N1Y A;  5LRS A;  1MQT C;  2DWR A;  5K0U B;  2VME A;  5DDJ 3;  2GZW A;  2V5D A;  4AOC A;  5FY7 A;  2P3Y A;  5K0U C;  1QDO A;  1PM7 A;  4OMD A;  5KR7 A;  4NUB A;  2XL7 A;  3GZT B;  3MID A;  3O1M A;  1CPN A;  2ZGP A;  2RDQ A;  1JOJ A;  1LHO A;  2UY8 A;  1QJF A;  1O4Y A;  1VMJ A;  1WWY A;  2WFP A;  3OUJ A;  4LOR A;  3WUC A;  1X50 A;  1FPN 1;  3LQC A;  1NA1 C;  2ETE A;  2R6Q A;  3J8F 2;  3JZV A;  3K2O A;  4BJ0 A;  4GUL A;  3WUD A;  2ET7 A;  4GJZ A;  4LOT A;  3KMH A;  2XBO 1;  5GZG A;  2GC2 A;  4CU8 A;  3QD6 A;  3Q8C A;  4N7U A;  5IK8 A;  4ZS2 A;  5A3O A;  3TEZ A;  3SKV A;  2X53 S;  5FQ0 B;  1C4R A;  4AVA A;  4CXW A;  2FCT A;  2Q8O A;  2ZJC A;  1VR3 A;  4D6S A;  2WYF A;  1SAC A;  2WQ4 A;  2JIC A;  4FXG B;  3ZFF A;  5A70 A;  5HPO A;  4WVM B;  5SV5 A;  1LUL A;  1WW6 A;  5A33 B;  1JW6 A;  2EXJ A;  2PHU A;  4ZON A;  5FO7 B;  3BB6 A;  4IE6 A;  2G1M A;  4K20 A;  4NO4 A;  2R07 1;  1VBA 3;  3UKV A;  3WY6 A;  5CA6 A;  4HOO A;  5LBC A;  4LO5 B;  2DUO A;  3MW3 A;  1PIV 1;  2QQU A;  3D8C A;  1FPN 2;  3ZLI A;  4QPG C;  2EIE A;  3J8F 1;  3B5L B;  2GMM A;  1QJY 2;  1BBT 2;  3QH7 A;  4IEX A;  2XGX A;  1GP5 A;  2RMU 2;  2V4V A;  1V70 A;  2OX0 A;  3WCS A;  1QJU 2;  4HN1 A;  3Q9O A;  4FPK A;  3V0A A;  2D93 A;  2P5B A;  1X8E A;  1O7F A;  3CEW A;  5A3U A;  4HN0 A;  3ZDS A;  3EHK A;  4XZU G;  4JGY C;  4PLN A;  5FPU A;  4RQP A;  3WIN E;  2UWA A;  2ZGL A;  1LOF A;  4RQP C;  3WZ1 A;  5FZ6 A;  1ZZ8 A;  2Z79 A;  4CDW A;  5BUV A;  4EWD A;  1BBT 3;  1VRH 1;  4DMI A;  2VVD A;  4JQT A;  4OHZ A;  4P08 A;  4NR1 A;  2YPJ A;  1QJU 3;  3AKT A;  3U37 A;  3JBG 2;  4S2G A;  4UFI A;  4ZXK A;  3ZYR A;  3ZIX A;  3RZG A;  3VHR A;  3KSC A;  1LAJ A;  1PVC 3;  1SFN A;  4JGZ C;  5C6C A;  3NAP C;  1TNF A;  3HMY A;  2VUA A;  1V9U 3;  5DPN A;  1VLN A;  3RJR A;  3NQH A;  2DUQ A;  5JIU A;  3VZM A;  2WJS A;  5J09 A;  2FCU A;  1HW5 A;  2ZGT A;  3RZJ A;  1GFF 2;  4FPO B;  4JRL A;  4AVC A;  2ZAH A;  3GCX A;  3WHT A;  4X8N A;  2WAA A;  4UW3 A;  2JD4 A;  3CQO A;  3POY A;  1V6K A;  4YG3 A;  2JEN A;  3DKQ A;  4D7Y A;  1R08 1;  3THP A;  1K42 A;  1OSG A;  3ZVX A;  4XHB A;  3JBG 3;  1CX1 A;  1AVB A;  2VMH A;  2WR9 A;  4PLM A;  2VZP A;  1SLL A;  4Y24 A;  5H9P A;  4CDW C;  3SIT A;  1CAW A;  3K4D A;  4FTE A;  4IEV A;  4ORF A;  4FBF A;  3ZSK A;  2RS3 1;  2Y38 A;  1IHM A;  3N9M A;  4Y5T A;  4AL9 A;  2R04 3;  3AYC A;  3I2F A;  4M3C B;  4Q0V A;  1OA3 A;  5FKB A;  1RHI 1;  3O14 A;  2A7A A;  1POQ A;  3VD9 A;  1AL0 G;  2J1V A;  1W90 A;  3AZV A;  1H8T C;  1F5F A;  2VZ1 A;  3GYD A;  3MGU A;  1H4G A;  4XXA A;  3PME A;  3AP7 A;  4TLG A;  3UJO A;  5BNO A;  4LE4 A;  5D1I A;  1UPI A;  4Z2W A;  3PUS A;  4HL0 A;  3N9N A;  1F35 A;  3LB9 A;  4IGO A;  3MUZ 1;  3U14 A;  1SPP B;  2A6W A;  2Q1Z B;  5B2G B;  4Y4R A;  1NX9 A;  5FP4 A;  4MX3 A;  3ABZ A;  1WMF A;  1CX4 A;  4XQ4 A;  1ND2 A;  3JD7 3;  2FDI A;  4BIF A;  5I0D A;  5JUV A;  3T4H B;  2V4A A;  1GOF A;  3BOP A;  4ZU7 A;  4HKO A;  2TNF A;  4CU9 A;  1JYX A;  1RVF 1;  1BZW A;  2E53 A;  2BPA 2;  4LHK A;  1V9U 1;  2VVE A;  3AMP A;  3I3B A;  1N3P A;  2R06 3;  4CPB D;  3CBN A;  4RR3 C;  3KB5 A;  3N9P A;  3SC7 X;  2R06 1;  3VBO C;  1W8O A;  4XBN A;  1ZVF A;  5EIY B;  4A7K A;  3RYP A;  3LPF A;  2BBV A;  4RR3 A;  2WII B;  1BHG A;  4Q8L A;  4Y5Z 0;  1AR9 1;  1QJE A;  4UFK A;  5GLV A;  1SLI A;  4ATE A;  3V0B A;  2XDV A;  3TN9 2;  1AR9 3;  1AF9 A;  2HWB 3;  2VCM A;  1FXZ A;  3I3Q A;  4FVV A;  2ADE A;  3URF A;  2P34 A;  1A8M A;  2JDA A;  1GZT A;  3RQ0 A;  3ZO0 B;  5L73 A;  1CON A;  1H2N A;  1SDW A;  5JOZ A;  2GNM A;  4I0A A;  1S0F A;  2PQQ A;  5ACA 1;  5EP9 A;  1LEC A;  3ZMO A;  5ISL A;  4PT6 A;  4AW7 A;  5EZW A;  3H8O A;  2WNO A;  1AL2 1;  1U5Z A;  2BGO A;  1AZD A;  2R04 1;  2DVF A;  4P9I A;  5DAQ A;  5I8S A;  5T5L A;  4CUB A;  4EV0 A;  1F8V A;  4XDP A;  3F2Z A;  5C71 A;  5JPN B;  3NO8 A;  3M3O A;  1QY4 A;  4ATF A;  2JIG A;  1ULG A;  2B45 X;  3TN9 1;  1X33 A;  4H14 A;  1F4H A;  5F8P A;  2ZCW A;  1ND3 A;  2IXC A;  1H6X A;  2YV8 A;  3SEE A;  3MV0 1;  4Y22 A;  5T50 A;  3KF3 A;  2OKX A;  1RIT A;  3UJQ A;  4NHY A;  2WKK A;  4RR3 B;  1QHD A;  5KXC A;  4CZS A;  2TUN A;  3DL3 A;  5D8A A;  1AJO A;  4LKS A;  3MYX A;  4IEO A;  4PIY A;  5IFT A;  5JI9 A;  2G9Z A;  2ZZQ A;  4XUO A;  5AVP A;  4DUX A;  4CRQ A;  1ENQ A;  4Y1V A;  4JC1 A;  3H42 B;  5KHH A;  3UL2 A;  4D6Q A;  1EUT A;  2DUP A;  4YRD A;  1W6P A;  3UV9 A;  5LB6 A;  4BYY A;  1NY7 2;  4Y1Z A;  1XB9 A;  4QKD A; 
#chains in the Genus database with same CATH homology
 4JHT A;  3H8X A;  3KHB A;  2FDJ A;  2FDG A;  4MG2 A;  4IE7 A;  3O1U A;  2FD8 A;  4O61 A;  4NRO A;  4CXY A;  4QKB A;  3O1S A;  3BKZ A;  4O7X A;  4CXX A;  5DAB A;  5F8P A;  3T3Y A;  3O1V A;  4NPL A;  4IDZ A;  4QKN A;  3RZG A;  4ZS2 A;  3BU0 A;  3I3Q A;  4ZS3 A;  4NRP A;  4QKF A;  3RZK A;  3I3M A;  4CXW A;  4IE4 A;  3LFM A;  4RFR B;  4NJ4 A;  3I2O A;  3O1P A;  2FDF A;  3RZM A;  4NIG A;  2FDI A;  3RZL A;  3S5A A;  4MGT A;  2IUW A;  4NIH A;  3KHC A;  2FDK A;  3O1R A;  3O1O A;  3BTY A;  4QHO A;  3T4H B;  4NII A;  4NID A;  4NRM A;  3BIE A;  3O1M A;  4NRQ A;  3O1T A;  4IE6 A;  3T4V A;  3S57 A;  4NPM A;  3RZH A;  3RZJ A;  3I49 A;  4IE0 A;  4IE5 A;  4OCT A;  3H8R A;  3H8O A;  3BTX A;  3BTZ A;  3BUC A;  3BI3 A;  4ZHN A;  2FDH A;  4QKD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...