1EAH3

Pv2l complexed with antiviral agent sch48973
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
235
structure length
235
Chain Sequence
GLPVLNTPGSNQYLTADNYQSPCAIPEFDVTPPIDIPGEVRNMMELAEIDTMIPLNLTNQRKNTMDMYRVELNDAAHSDTPILCLSLSPASDPRLAHTMLGEILNYYTHWAGSLKFTFLFCGSMMATGKLLVSYAPPGAEAPKSRKEAMLGTHVIWDIGLQSSCTMVVPWISNTTYRQTINDSFTEGGYISMFYQTRVVVPLSTPRKMDILGFVSACNDFSVRLLRDTTHISQEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords POLIOVIRUS TYPE 2 COAT PROTEINS VP1 TO VP4
publication title Structure of poliovirus type 2 Lansing complexed with antiviral agent SCH48973: comparison of the structural and biological properties of three poliovirus serotypes.
pubmed doi rcsb
source organism Human poliovirus 2
molecule tags Virus
total genus 37
structure length 235
sequence length 235
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1997-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1eah300
4QPIB 4N43C 5BNNC 1VBE2 5CFDB 2PLV1 1AR72 1PO12 1ASJ2 1RUE3 1MEC1 2WS92 1RUI3 1K5MB 4YVWA 1ND3C 2XBO1 3J8F2 5ACA1 1HX6A 2HWB1 1RVF2 4RHV3 4SBVA 1EAH1 1QJZA 4FTBA 3CJIA 1DDLA 4Q4V2 1C8M3 4Q4X1 5CFCA 1EV13 1PIV1 1R083 2RM22 4IV3A 5ABJA 1PO23 4GMP0 1TME3 1V9U2 1FOD2 4QPGA 4RR3C 1FMD1 3VBFB 1AYN2 2HWC3 5BNOB 2HWE3 3JD73 1NA1B 4CEYA 4JGZA 2GH8A 5C4WC 1MEC2 1RUE1 4CDXA 3VBOA 1RUI1 4CDWA 3DPRA 4WM8C 5GKAC 2XBO2 2R072 4WM7B 3S6PA 5ACA2 4AEDA 5LK7B 1B35B 3VBHB 2BBVA 2X5IB 2MEV3 1VBC3 5C9AA 3VBUC 3ZFFC 4Q4X2 4RQPA 2VQ0A 1H8TC 1PIV2 1C8M1 5L7OC 5AC92 2HWD2 1R081 1NCRC 1RUJ3 5DDJ3 4QPIA 1PO21 5JZGC 1TME1 1Z7S3 1PGW1 1D4M3 4YVWB 1FMD2 1X36A 2RS53 1BEV3 1COV3 2HWC1 1X33A 2WWSA 2HWE1 3JD71 1RUG2 3CJIB 1PVC3 1QQP2 1RUI2 4GH4C 5D8AA 3TN93 5CFCB 1RUH2 4IV3B 3IDEA 1BBT2 1IHMA 5BNPA 1VRH3 1ZBA1 1VBC1 4QPGB 1HRI2 3VDDC 1C8M2 3NAPC 1AL23 1R082 1POV0 5DDJ1 4JGZB 1PGW2 2R063 1Z7S1 4CDXB 3VBSA 3VBOB 1D4M1 4CDWB 1VBB1 3DPRB 1W39A 2RS51 1BEV1 2HWC2 4Z92B 4AEDB 3VBRA 5A32A 4WM7A 4IV1A 1PVC1 4RQPB 3TN91 3ZFEC 1C8NA 1NCQB 2RR12 4GB32 4Q4W2 1NA1C 1AL0G 2QQPA 1ZBA2 2RS13 4N43A 1VRH1 5BNNA 1VB2A 4NWVA 5J96B 2WZR3 1B35C 1AL21 5DDJ2 3VBHC 2Y26A 1OOPB 1ND3A 2RS33 1Z7S2 1VBB2 5D8AB 1HRV2 4GMP1 2R043 2RS52 1BEV2 2WFF1 3ZXAC 1AR83 4PDWB 2IZWA 1RB8G 1ND2A 5BNPB 1AR92 1RHI3 2FZ1A 2BUKA 1F2NA 4CEWA 1PVC2 1GFF2 4RS5A 3TN92 1MQTB 3JB4C 5FMOS 2BFUS 1QJX3 1TMF3 3CJIC 2PLV2 2RS11 1RUD3 3VBSB 2WZR1 2FZ2A 5K0UA 5C8CB 1AL22 4BCUA 5ABJC 1VBA3 3JBG3 4WM8A 5A32B 3VBRB 2RS31 4IV1B 2HWF3 4YVSC 2HWB2 3HAGA 1POV3 4QPGC 1EAH2 4RHV1 2ZZQA 2WFF2 2R041 4FTSA 5J98B 3VBUA 3ZFFA 1AR81 1NCQA 4CEYC 4JGZC 1EV11 1H8TA 1VAKA 3M8LA 4N53A 1RHI1 4N43B 2RMU3 3VBOC 5BNNB 1NCRA 4CDWC 3DPRC 4JGYC 1R093 1QJX1 1TMF1 2WLPA 1ND3B 1VBE3 1M06G 5C9AC 3ZFGA 1OOPA 1RUD1 1PO13 5FMOL 1RUE2 3JB8A 2BFUL 1NY71 2WS93 2BPA2 4GH4A 1CJDA 5A33A 4QPIC 1VBA1 4RFT0 1ND2B 5CFDC 2RS32 4PDWA 3J8F3 4CEWB 4RHV2 1POV1 2TBVA 4RS5B 1K5MC 2ZTNA 2MEV1 1E57A 1MQTA 1AR82 4RR3B 1EV12 3NAPA 1RHI2 1RUJ1 1PO22 2RMU1 4CDUA 1TME2 5K0UB 1V9U3 1R091 5C8CA 4WM8B 1AYN3 1COV1 1QJY3 1VBE1 4Y5Z0 2HWE2 1AYM3 3JD72 1RUD2 1PO11 1BMV1 1NY72 4CDQA 2GSYA 2WS91 3VBFC 4Y4YA 1VBA2 3VBUB 3ZFFB 5BNOC 1RUC3 1H8TB 5L7OB 3ZFEA 4N53B 2R073 1RMU3 1NCRB 2MEV2 1FPN3 1VBC2 5JZGB 1NOVA 3LOBA 3VBRC 4WM7C 5AC93 2HWD3 1RUJ2 1HXS3 3ZFGB 2XPJA 1QJU3 2X5IC 2R061 1AR63 1PGL1 1D4M2 1R092 1FMD3 4GH4B 5A33B 1COV2 1NG0A 1AYN1 1QJY1 1AYM1 1RUG3 1BMV2 1CD3G 1QQP3 4NWWA 4YVWC 1RUH3 3VDDB 3NAPB 1RUC1 1VBD3 1OHFA 2R071 4RR3A 1BBT3 1RMU1 4CDUB 1VRH2 5CFCC 1FPN1 1HRI3 1ND2C 4IV3C 5C4WA 4CEWC 5AC91 2HWD1 4Q4Y3 1HXS1 4RS5C 4FSJA 1QJU1 1A6CA 2R062 1RUF3 1ZBE3 4CDQB 1PGL2 4YVSA 1AR61 3ZFEB 1QJY2 1AYM2 5L7OA 5K0UC 1RUG1 4CDXC 1QQP1 2RR13 5JZGA 4GB33 1RUH1 1RUC2 4Q4W3 4JGYA 5FOJB 4AEDC 1R1A3 1VBD1 1RMU2 1BBT1 1ZBA3 2RS12 1FPN2 4RQPC 2WZR2 1NCQC 1AR73 1ASJ3 1HRI1 4LLFA 4N53C 1HXS2 4Q4Y1 3JBG1 1QJU2 5CFDA 2HWF1 1RUF1 1RVF3 1ZBE1 1AR62 1VBB3 1AUYA 1HRV3 1SMVA 2R042 4Q4V3 1K5MA 3ZFGC 4FTEA 1OOPC 3VDDA 2RM23 1AR93 5D8AC 1OPOA 5C4WB 2RR11 1QJX2 4GB31 4PDWC 1FOD3 4Q4W1 1TMF2 1VBD2 5BNPC 5ABJB 1R1A1 2PLV3 1MQTC 4YVSB 1AR71 1MEC3 1ASJ1 4Q4Y2 1WCDJ 3JBG2 4CDUC 3VBFA 2XBO3 4CEYB 5BNOA 5ACA3 2HWF2 3J8F1 3VBSC 1RUF2 1NA1A 1ZBE2 2HWB3 1EAH3 1F8VA 1RVF1 5C8CC 3FBMA 4GMP3 2WFF3 1HRV1 4JGYB 4Q4V1 1HQNA 4Q4X3 1PIV3 4IV1C 1VB4A 2RM21 4CDQC 4EJRA 1AR91 2DF7A 1B35A 2RMU2 3VBHA 5C9AB 2ZAHA 2X5IA 1V9U1 1FOD1 1R1A2
chains in the Genus database with same CATH superfamily
3CIHA 4J1XA 1VP6A 1KJLA 3AKPA 3IDCB 1JZ4A 4AVAA 1VBE2 5FREA 5LA2A 4J25A 5J1XA 4HK8A 2F4PA 4HONA 1IS4A 4CXXA 3KD4A 1AR72 2FDIA 2BOIA 4AVSA 1F5JA 2WS92 5FY7A 4KG0A 4XDOA 1WKYA 4P9LA 5DABA 2WNOA 4Y1YA 1CVNA 1ND3C 1AHSA 1QMJA 1QXRA 3KQRA 1FI2A 3D0JA 4XDPA 2FD8A 1R1ZA 4NO4A 1Q8QA 1RVF2 4FFHA 1SLLA 1SZBA 4YPJA 4YM0A 4QQHA 4Q4V2 2QKDA 4HKWA 3GBFA 1JTZX 2JD4A 2Y6KA 2VR4A 4Q0VA 4QPYA 5A7WA 3VUOA 1H0BA 5JSOA 1R083 2RM22 4FP3A 4IV3A 3WHTA 2A6ZA 2BERA 4XHXA 3S30A 4JZRA 1S0CA 5ABJA 1OFSA 2NM1A 3WUCA 3TEYA 1QEXA 2V4AA 3FUQA 1K12A 2ZKNA 1DZRA 4GMP0 2YFUA 4B1MA 4OUEA 1TE1B 4YG6A 5J3UA 3UGGA 1W2AX 2F4LA 5IFTA 1XC6A 2EVXA 1AYN2 3LA2A 3AX4A 3ORJA 2Y38A 1CAVA 1W6NA 3PMSA 3RVHA 2BZDA 5FZDA 4CUGA 4H7LA 4TTGA 1TVGA 3LE0A 5C70A 2Q1ZB 1JS9A 3HVDA 1UOGA 2YGMA 4UF0A 4LLOA 2PHRA 3QCWA 1RUI1 3EXUA 4CDWA 4YZ3A 1GV9A 3ZSEA 4M3CB 5C33A 1UYYA 2NQYA 2QQLA 5FZLA 3S6PA 5ACA2 1V00A 3N9MA 1PVXA 4AEDA 1OD5A 3VBHB 2ZGQA 4W65A 5FTTC 2OZ6A 5HCFA 3IN9A 2X5IB 3H3ZA 2VAUA 3PJQA 4LBNA 1OQ1A 3HQUA 4QDSA 1G9CA 3I3BA 4GJZA 4Q4X2 5HCBA 2BNMA 2XDVA 1H8TC 1GZTA 1MZ5A 1PIV2 3LWCA 2QTWB 3OUIA 5ANNA 3SITA 3RZMA 3ZYFA 5IJRA 1BK0A 2DYCA 1QOOA 2VH9A 2V73A 3H1WA 4GAZA 2VVDA 5KC6A 2HEWF 4Q1RA 2FCVA 4META 5AVPA 2LRPA 3GJAA 3RG0A 2O8OA 3BIEA 5JLVA 4R52A 4IEZA 2PA7A 1DCSA 2QNKA 3WP4A 4XQWA 1D4M3 2XJPA 1AXKA 3H9AA 4MH0E 5FPZA 4AQSA 2VQTA 2ZJCA 1NLQA 1IQDC 1X36A 3OGGA 3ZPYA 4ORFA 3CU7A 3AP4A 4D7SA 4Z2WA 4KMQA 2WIIB 2HLEA 3K77A 2OYZA 3HBKA 2D5HA 2JE8A 1UYXA 2WDBA 1WA4A 4QM8A 2XLFA 5FYCA 1QDOA 4OQ9A 3R6SA 3KSCA 2Q8EA 2YDEA 1W8ZA 5BNQA 5I0RA 5J36A 3O1SA 2ZABA 3TN93 4AVVA 1S0DA 3C7FA 5CFCB 1S2KA 1W6OA 3SLIA 1V70A 1JU3A 4YM2A 1O6UA 3NJXA 2VTFA 4MXWA 4JHTA 5FUIA 1UKGA 3IDEA 3WHUA 2VOTA 3UESA 4D6QA 3AYCA 3L9JT 2LM3A 1REEA 1NE6A 1S0GA 3POYA 2JDAA 4AHZA 3G6JB 1ZBA1 4DEVA 1X82A 2ZAAA 4XUPA 1OSGA 1HRI2 3NAPC 1W8OA 4O9GA 5KR7A 4LEJA 4UW5A 5K7PA 2OS2A 3N7KA 4LO5B 1AL23 3CEWA 5CKNA 1ZRFA 4RN5A 2BTVC 5IVYA 3WW2A 4A2UA 4A6SA 3HNYM 2VTXA 4QB2A 1GKBA 1QHDA 1PGW2 2R063 2XUMA 4N8MA 2VCMA 2YBSA 3VBOB 4AQTA 1ZZ7A 3DPRB 4XACA 4RGKA 1J3QA 4PBOA 5LRSA 1DP0A 3TNQA 2XHNA 2GDFA 2OT7A 2VMDA 3WD5A 3WDVA 2ID4A 3ZN5A 2WNVB 3UJOA 1N1SA 5KHHA 4CU9A 1WMFA 3V56A 1NQDA 1SBFA 2AC1A 2JIJA 2QQNA 1PVC1 3WG3A 4BQ5A 4LORA 3E5XA 5C5UA 1C8NA 4PQQA 1REFA 2ZPXA 5FP9A 4Q0SA 3ZVXA 1UMIA 2NP0A 5SV8A 4S2FA 3MDPA 3IAPA 4N43A 1GP5A 3J4UH 2FDFA 4NR1A 3HPNA 2Q8OA 1GNYA 3VD5A 2QVSB 5JOWA 4UFIA 5CZKA 4FAGA 2DVAA 2QBXA 4YM1A 4IE0A 3VBHC 4AR2A 2Y26A 5DAWA 4XJZA 4CVUA 4K21A 1OOPB 2RS33 4RSUA 4Y20A 5EHDA 2VOXA 5FZBA 4B8EA 5IVFA 1UX7A 4YFZA 1W2UA 1MS4A 3W20A 4XUNA 5D8AB 3E6DA 2GALA 2ZGUA 3P5BA 3PU3A 4GMP1 2WFF1 3LGRA 3ZPOA 1OUSA 3N7MA 4N9IA 1VJ2A 1UMZA 3BUCA 1QF3A 4PLNA 1RB8G 1ND2A 2OX0A 4HVOA 3INAA 4XJ9A 3LSDA 4A7KA 5LBBA 4C91A 4QDQA 1SBDA 1MQTB 1LENA 5GZEA 3JB4C 5FMOS 5E16A 1UZZA 2Q4SA 2ZS6B 5G05L 5ERLA 3AKTA 4K8FA 3K48A 4AI1A 2VNRA 2WYFA 4UT5A 2WAOA 3N7JA 2OW4A 4AYUA 1SEFA 5G04L 2RS11 5FZGA 3AFKA 3MW3A 5FZ7A 4OHZA 4GZ9A 5K0UA 1KGYA 3ILRA 4NHMA 4ET7A 3AZXA 3GZEA 2W2IA 3H3LA 4B29A 5C71A 4QXBA 5BXXA 3VBRB 3WUDA 3WW1A 4IV1B 4YVSC 1UO9A 4QKDA 4BJ0A 1B09A 4C1WA 3WXPA 4CA9A 5A80A 2B9UA 3WR0A 4CCEA 2JB4A 5I91A 2VQUA 3MBWA 5FXZA 3EO6A 1AR81 4KWUA 4CCLA 3BODA 4CEYC 5BY5A 1YO8A 3BOWA 4CPBA 5BNNB 3VBOC 1DF0A 1PGSA 2VOKA 3DPRC 1MS9A 3FHAA 3RPQA 1JHJA 2YBPA 3CBNA 5IK4A 1QJX1 2JJ6A 4QB1A 3GXUA 4CCMA 2W5FA 1EPWA 2WYSA 5FZ8A 1QJFA 2D6KA 2PXJA 2DTWA 4ZXKA 5C9AC 3MYXA 2XVKA 4XF3A 5T5PA 4C0BA 3RYKA 3VKNA 1OOPA 2GP3A 1RUD1 1PO13 5CKQA 5T50A 3FHIB 4OHXA 4YZ2A 3D4KA 4IE4A 5FYZA 3VKOA 2BPA2 1BXHA 2P3IA 4GH4A 1LGCA 3RSJA 5A33A 4BYYA 4LXLA 4QPIC 1CGPA 1YNAA 5JIAA 1GNHA 1PX3A 4QGNA 2X05A 4RFRB 2FDGA 5CB7A 4RHV2 4QX1A 3I7DA 4RS5B 4QM9A 4JVAA 5EYYA 1NKGA 1ENQA 2ZTNA 1VRBA 2XG3A 3QLQA 5FZ4A 1E57A 4LBMA 4EV0A 1DQ1A 1MQTA 1IG3A 4YARA 5GLUA 3OEAA 2ADDA 4AW7A 1RHI2 2OQ6A 3B94A 2VM9A 5IW0A 1ZX5A 1XNAA 1HV1A 1LB2A 3ZR5A 2P2KA 3OYWA 4ISQA 4JAAA 2R0HA 2XLGA 2DCKA 4L11A 1V9U3 5FY8A 1IG0A 2VZVA 2O1QA 4UBHA 2Y6JA 5GJ6A 5JSRA 2CWMA 3NJZA 3MHZA 3U07A 4P9GA 4K6BA 4WM8B 3VKLA 1NLSA 2QQKA 4LBLA 1W9TA 2B8MA 1VBE1 1AYM3 2JX9A 3JD72 3SC7X 3UL2A 4BWOA 5JMCA 4BB3A 3NWKA 4LKDA 4LO7A 5C5TA 4FVVA 5JUVA 4OHVA 1DQ2A 4K7JA 1H1IA 1LHOA 1PMIA 2WS91 4F8AA 5K9YA 1W6MB 2R1BA 3LKJA 3R4UA 4NE9A 5FZFA 3VBUB 3ZFFB 4BQ4A 5BNOC 4ATEA 4N53B 1YHFA 3ZSKA 1JZ7A 5D2AA 3T2QA 2WT0A 3O0XA 3OF1A 4IETA 1NCRB 1RYYA 4BXFA 1PMJX 3JU9A 3WCSA 5JZGB 1VBC2 1KQRA 2KR2A 2J42A 4AHYA 1NOVA 1ZA4A 5IHRA 3LOBA 3WX5A 1UZVA 3VBRC 4WM7C 5B4XA 5A1LA 2HWD3 1D7PM 4Y1UA 3MF6A 3WNMA 1JZ8A 3DGTA 1VAMA 1E5RA 1V6JA 3I8TA 1AX2A 3EB7A 2XPJA 5FKBA 2XKOA 4DUXA 3M70A 2R061 2JIGA 3OSDA 1CZTA 3QD6A 1R092 1W8UA 3THDA 1LGNA 4X6QB 2QZ2A 1G6NA 1PZ8A 1AYN1 1ZRCA 4E2SA 3ST7A 1D0GA 3T0BA 2BW8A 4FCAA 3U78A 2YB7A 4NWWA 1CN1A 1VR3A 4FPYA 4XUQA 2WO3A 1GP4A 1XE8A 1RUH3 1WD4A 4LQRA 4YGEA 3VDDB 2FDJA 1UY2A 4H3WA 4DXZA 4HSJA 1BBT3 4GULA 1V6OA 1UYZA 4LBKA 2EAAA 2TEPA 2VVEA 1LOBA 1BVP1 1FPN1 1OH3A 1WUVA 3F95A 3K46A 3WF4A 5BPXA 4AI3A 1A8MA 5C4WA 1UY0A 3U37A 4CPBD 4HPKA 4QQLA 2G9GA 1DFQA 1DQ4A 2D6NA 2ZX2A 3Q8BA 4RS5C 2ZX3A 5FK8A 2Y6HA 3IZOA 1QJU1 4LOSA 2WWUA 2YBKA 4N7IA 1SLAA 1ENXA 1JN2P 4L99A 5F2WA 4CDQB 1OKQA 2BBAA 3WY6A 4DRRA 1AR61 3VZNA 3VV1A 2B4KA 1UF2C 3OCPA 3ZMNA 1W9YA 4DFSA 3ZFEB 2WT1A 5J37A 5FZCA 1QJY2 4EZ4A 2E51A 4L0PA 3NNGA 4W4ZA 4NPLA 1ODNA 3SH4A 4CDXC 5I8YA 2VUDA 3A22A 5DG1A 3LQCA 3OUHA 1WD3A 3E5UA 2RR13 4Y5TA 3ECQA 1QWRA 1UPIA 1WLCA 4GB33 4JGYA 4Q4W3 4UW3A 4XIOA 4XUOA 3OG2A 3IIAA 3WLUA 3WNPA 3I2OA 5FZ1A 2HJIA 4LO8A 1RMU2 1LOFA 2AEZA 2VVFA 4FFGA 2WNEA 4XIKA 2VMIA 2EXIA 4RQPC 2YUEA 3THPA 2Q8DA 1APNA 1XYNA 5DUWA 1ASJ3 1HRI1 3VD3A 4N53C 1BVVA 5C3QA 4XYXA 4ZKTB 3AFGA 4Q4Y1 4K3UA 4O61A 4OQ8A 2ZGLA 1AF9A 5FZHA 2XONA 5CFDA 3O1RA 3LEGA 1RUF1 3DXUA 2AACA 4XFHA 1AUYA 4HMZA 4MGZE 4QX8A 3K3OA 2VOWA 3N9LA 3MPPG 2R042 2ZGPA 3B01A 4AWDA 2C9AA 5CIRA 1K5MA 2IXHA 2WFPA 3V0BA 2ENRA 4AF9A 2D6PA 4PQ9A 1YQ5A 4RGAA 4EZHA 3NQHA 3VDDA 5DZEA 2CY6A 1XJAA 3AMPA 3PTRB 1QXJA 3T4HB 2D93A 1SACA 2JG9C 3I3MA 3BKZA 2EXJA 1SHWB 3R4DB 4LA3A 1ZZBA 4LHNA 1YWKA 5LEJA 3TOJA 2J1SA 3VL8A 1FOD3 1GNZA 1MACA 2CGNA 1R1A1 1VMJA 4R9BA 5JDBA 4XF1A 5JXGA 3ZM8A 3AYDA 5FLHA 4A42A 2VXRA 4FQZA 3AYAA 3ZR6A 3AP6A 3ME2A 2EIEA 3AVRA 1IS3A 2K9ZA 2YROA 4MGYE 1WBLA 4XUTA 1Q5OA 2Q8CA 4AQ6A 1CONA 1S0FA 3MIFA 5FUPA 2D6MA 3MIGA 4O7XA 4UFKA 2JDYA 1DGLA 3I59A 3RS6A 1S0BA 2HWF2 3VBSC 1NA1A 1HJGA 1UYPA 1ZBE2 3CO2A 3K51A 4MHUA 5FXXA 4ES8A 1F8VA 5C8CC 2QQIA 3W59A 3FBMA 4MGQA 3C3VA 5LBFA 1FNYA 5JXHA 3D6EA 3KM5A 2JG8B 1V6IA 4NIAA 2O14A 2VBPA 3OTFA 4PI2A 2H0VA 4FFFA 1BCXA 1CQ9A 2V4VA 4WBBA 4LITA 4CCKA 4CDQC 4U36A 2UYBA 2WQ8A 1N1TA 3OD0A 4XW3A 3ZO0B 5FO7B 2NZ9A 3KF5A 4JQTA 2ZAHA 1N3OA 2W87A 1WW7A 5DUVA 3RYRA 2A6WA 1V9U1 5DUXA 2JICA 3FZ3A 3OPZA 1UCXA 5DZFA 2XL9A 3LPGA 3E97A 5L73A 1VPHA 3H42B 4ARYA 3RZJA 1RUOA 3DL3A 2DBIA 1F4HA 4XFIA 3WDTA 3KT4A 3ZSJA 1J3PA 1W0OA 3ZYIB 5KHKA 3BGAA 3TB0A 4AEJA 1UW8A 1VALA 1MEC1 1DGWX 3NNJA 1RUI3 3KCCA 1V0AA 4YVWA 1Y9MA 4DB5A 2D44A 1O5LA 5C8WA 1RXGA 1ENSA 2XBO1 3J8F2 4Q29A 3J7NA 3OGRA 5FUNA 2YPDA 4YZ5A 4A44A 3H3UA 4AG4A 4AGGA 1F35A 1ACCA 5FZIA 4MV2A 3ZKUA 1YI7A 1KD7A 3OY8A 1HB3A 3X29B 1EV13 1X8EA 2OVUA 3KVBA 4YG3A 2GNMA 4HFSA 2XOMA 1LU2A 3V0AA 3AM2A 1SBEA 2TNFA 4UBGA 4XVHA 4EN0A 1JYCA 3O14A 2C0ZA 2HEVF 2XJUA 1JZ3A 2FQPA 4FPOB 4XBLA 1CAUB 1MS5A 2JXAA 2FBEA 1W0NA 2VJXA 3AL6A 3VBFB 1YIPA 3POBA 1ZA7A 3OPTA 1SLCA 1LULA 4EWDA 4V1PA 5C6CA 2VCBA 1P8JA 4DXRA 2GH8A 3ASIA 2NPIA 1K42A 5FZOB 3NJYA 2R49A 5FYHA 2C26A 5F5IA 2Z69A 1HIXA 3Q8FA 4OMCA 3CLPA 2PHXA 2DTYA 2WJSA 2Q1FA 3WEZA 3HT2A 4S2DA 1O3QA 3W21A 3N9NA 4XFBA 3GCWA 2VU9A 1WLDA 2VNOA 2BBVA 1OLRA 1XNKA 4EN8B 5JI9A 4OHYA 4XBQA 1H8VA 2PELA 1Y3TA 4FOYA 2XVLA 5FQ0A 1C8M1 4A3XA 1OUXA 1S2EA 4XTMA 1CPNA 3OBTA 4P9XA 5AC92 3L2HA 4IEYA 4CZSA 4C90A 4Y33A 2ZACA 1MZ6A 4LHSA 4LKEA 4YW4A 2WINB 5FCCA 2JG8C 4B1LA 3Q8EA 4NHXA 1FMD2 1L3JA 2IVIB 3GJBA 2IUWA 3LD8A 2W68A 1COV3 4Q26A 1GSLA 2YC0A 5A7NA 4A45A 4GKYA 4Q8KA 2HWC1 3RZLA 3J26N 4L92A 4NIGA 2GC3A 1KDMA 3AXEA 2C4XA 2DCZA 3JD71 4XJWA 1UY4A 1W05A 3PUQA 1H4HA 2ZGNA 1PVC3 4AE2A 5FY0A 2DCTA 1QDCA 1G9AA 1GOFA 1UU4A 1SCRA 4DNYA 5A7WB 3DN7A 3V65A 4IV3B 2VGDA 2ET1A 2RJKA 3LCPA 2SBAA 1IPKA 1IHMA 3VHPA 1GYKA 3B7MA 5GZFA 1GU3A 2WZEA 3A7QA 1RINA 3W58A 1VBC1 2RDRA 1GOGA 5LY2A 1A34A 2AGSA 1PX4A 1NLRA 2IXLA 3NV1A 3SQOA 5JOYA 1R082 3FLPA 1CAVB 1POV0 1UX6A 1YJKA 1BKZA 5DDJ1 3ZXEA 1AJOA 5KXCA 2ZGRA 3AKQA 2BU9A 2P5BA 1Z7S1 3APBA 1UXXX 1IZ3A 4OHWA 4CDWB 3DYMA 3OD4A 3VZKA 4DINB 2RS51 1BEV1 2Y0IA 1W8HA 2H0BA 4XOGA 2BV4A 4AEDB 3C7GA 1GWKA 2CTVA 2JDHA 3MIDA 2PFWA 5A32A 4I0AA 4BQWA 3OBZA 5F7UA 4IUGA 1T6BX 1Y7BA 3IM0A 1PNGA 4K1YA 4YW7A 1NCQB 5F3EA 1SCSA 4GWIA 4YGDA 2DUPA 1UU6A 2DFBA 3OBRA 4AZZA 2WN3A 3LFMA 4Q27A 3SNMA 3KMHA 2Y64A 2QQPA 2DBNA 2RS13 4NWVA 5J96B 3S7EA 1WCQA 3K2OA 3ACHA 3GZUC 4D6SA 1YYNA 3K4AA 4LTAA 2HBTA 3RZZA 3RMXA 5T3NA 5C7GA 2ORZA 1AJKA 1DGRA 3Q9OA 1ND3A 4TXWA 4P14A 4FI9A 5F2SA 3T0AA 3DKQA 3WQ0A 2D3SA 4QU2A 5L9BA 5EYXA 1VBB2 4HN0A 1WW5A 2W1SA 2XJRA 1W6OB 4I30A 3J7LA 3NRUA 2WKKA 1O8PA 3FC0A 4S2HA 4FP2A 3TEXA 1AR83 4MSVA 4Y1XA 3CZUA 5DXDA 4MXWB 1AX1A 5FPUA 3PUSA 2XJSA 5BNPB 5DQ0A 1Q43A 3JUUA 4CEWA 2VUCA 2IWGB 1RC6A 1TQ5A 1PK6A 5FP7A 5B4NA 3ES1A 4Q0QA 3TN92 3T08A 1S1AA 1XOYA 4GQ7A 1O3TA 1CX4A 3AKRA 2B9VA 3LDRA 1QJX3 1G86A 3IMMA 3T3YA 3I97A 4GD4A 4OI0A 1UXZA 5CG9A 2QCSB 5EQUA 3L2YA 3USUB 4XAEA 2R30A 4XPVA 2PLV2 3WNKA 1RUD3 3WINE 1JOPA 1FV3A 4AI0A 2BRTA 3C7HA 2BYVE 1OT5A 5CADA 2GAUA 3S0MA 2WQZC 1AL22 1N3QA 2VE1A 4LNVA 5ABJC 2I45A 1NE4A 1N1VA 2DCYA 3SKJE 2VMEA 2WSVA 2QFEA 3ZYGA 2WNUA 2HWB2 3HAGA 1KEXA 1EAH2 5FY9A 2QE3A 3T2PA 1NX9A 3QOPA 5T5LA 3ITQA 3KS7A 4GJYA 1OH4A 2R041 1Y9GA 1UNBA 1NCQA 1U5XA 2MNGA 1YFUA 3RNSA 1EV11 1H8TA 1KITA 1Q3EA 4N43B 4BE3A 4CDWC 2A73B 3FL7A 4AHXA 2CYFA 4M0NA 4NHLA 1DQ0A 5FYYA 1BZWA 3B69A 2OKXA 3KWVA 4UW4A 2W0XA 4NVPA 4MYEA 4QXCA 1VBE3 2VMGA 2VUJA 2A3WA 4Y20B 3ZFGA 3B9IA 2JE7A 5E88A 1OA4A 1RUE2 2WN2A 2BFUL 3I2FA 5FPXA 4CCDA 1QNWA 2WS93 2GP5A 3IAQA 1JZ2A 2VW2A 4DOUA 4G4FA 1RTVA 1CJDA 1VBA1 1Y9QA 2JDMA 2ZXQA 3T2TA 4DS0A 4E8CA 5I8TA 1ND2B 2GNTA 2RS32 1UZWA 1W9FA 1POV1 2TBVA 2ZZJA 3O1VA 3NKTA 3POJA 4QX7A 5CYYA 4H7MA 1JW6A 4RR3B 2IC1A 2NLRA 1XU2A 2W91A 3NAPA 2V09A 4WVMB 3RGBA 4MGKE 3M3QA 1W3VA 2LALA 4IGPA 4I02A 4LBJA 1PO22 3USUA 3WP5A 4CDUA 5A3WA 1TME2 5C3RA 3B02A 1MR5A 3LOIA 1LNSA 3ACLA 5K0UB 3IT8A 3PHMA 2VNGA 4B7KA 3J9SA 4XF9A 2C24A 4DMIA 4WVVA 1AYN3 2GZWA 1COV1 1DU3D 2XVGA 5E6HA 1RJ7A 1AXZA 1SLBA 4FPHA 4NRQA 2HWE2 4EN7B 1N3PA 1HJFA 3GHMA 3HJRA 3IDBB 4FO9A 4MOAA 4BLIA 2UWCA 1VMHA 4GWNA 1WA6X 3NV3A 4IEVA 4JDNA 4D7YA 4RL7A 1NY72 4D8MA 5C3OA 2QQUA 3MI8A 3JCIA 4J1WA 3KV4A 4X8PA 4XEZA 2LTNA 2UURA 5KXEA 3NMBA 5L7OB 1JYVA 1C57A 5HXVA 4ATFA 1LJ7A 4MG2A 3QH7A 3I2HA 1QU0A 3KCXA 4FBFA 2MEV2 1FPN3 5T5JA 1J1LA 4LE3A 4FAHA 1U5YA 1V6KA 2Q1MA 3NW4A 4JRAA 4XE9A 4IGOA 4FQ4A 2R6QA 4LIVA 3EYPA 4N7UA 3I2IA 4QKBA 4ONUA 2JD9A 1RUJ2 2F17A 3IBMA 1Y4WA 1ODMA 4NPMA 4XC9A 5FMDA 5GLWA 1QJU3 1XRUA 2X5IC 4XMAA 3PIJA 5FJHA 3WDYA 4DXTA 2RV9A 4EROA 1AR63 1ZRRA 1S2BA 4KWKA 5HV0A 4GH4B 5FK7A 5A33B 4OZXA 4LKSA 4XJAA 1STMA 4PJYA 4LBQA 5FRAA 1ZRIA 3DYOA 1BMV2 2YFZA 1CD3G 3O1PA 2YPJA 5JIUA 2DFCA 3PDQA 2Y0OA 2ZEXA 4QXKA 1SFPA 3MPBA 5KHJA 1RUC1 2DVDA 4CP0A 3GZAA 4GWJA 4PLOA 1K3IA 5F1RA 5EXOA 2J22A 1OHFA 2ARAA 2W3JA 1HQLA 1CAWA 4M0HA 4RGGA 4RR3A 1QH6A 4QHBA 3OYWB 4CU6A 3VD9A 3O1OA 1VRH2 1OKOA 3HEIA 2E63A 3P3NA 5L9RA 2FMDA 5CFCC 5JOZA 1HRI3 2G4IA 3RZKA 1UN1A 1DBNA 1FV2A 1ND2C 3RMYA 2X29A 2VNVA 3AZZA 5AC91 2BWAA 4Q4Y3 5DAQA 4RYDA 4WVZA 2UY9A 3D82A 3ZXDA 1HXS1 1KS5A 2Y60A 2YMZA 5IAVA 3ACGA 3GZTB 1HQWA 3M3OA 3DCQA 1RUF3 1PGL2 4YVSA 4I0BA 4NHYA 2ZGOA 5CNAA 4OZOA 1IPJA 1OBNA 2WR9A 5JR2A 1CJPA 4FT8A 2VTXJ 4IEWA 1AYM2 4HZFA 1XSRA 4PIYA 4Y22B 4CCJA 5L7OA 1OVPA 5K0UC 2W39A 4R9AA 4LIUA 2PAKA 1RJ8A 2RE9A 2ADEA 2HBUA 1XNTA 1UOJA 3PL0A 4YFWA 2WNVC 2PHUA 3T1LA 1R1A3 1VBD1 2VECA 4I01A 4OUMA 4PF5A 3VHOA 3H1MA 4J6GA 4IESA 3ZSMA 2J1EA 4JX0A 3WG1A 1YFXA 2WZR2 2GN3A 5EIYB 5DN2A 1A3KA 1GR3A 4XFCA 3P3PA 3RI8A 5HXMA 2PHFA 1GQHA 2WZPP 5F6LB 1W0PA 1E5HA 4E4HA 3O12A 5JVVA 1MVQA 2VULA 4YW1A 4DZGA 3LDBA 4LO6B 3AZYA 3GCXA 4BPZA 5E8AA 4Y24A 2AUYA 4YW5A 3AYEA 3N9QA 1XBFA 2JDKA 4H55A 1UPSA 5A3LA 5FZ6A 2WRAA 2DVBA 3OJBA 1OOPC 3DECA 1JUIA 2HH9A 4Y4RA 4DXSA 3G7DA 1ALYA 1SLTA 1YUDA 3PLQA 5D8AC 1VAVA 3C8XA 2AZ5A 3N7LA 5C4WB 1GOHA 3C7EA 4HPKB 4ZS3A 5FPAA 3V64A 1TMF2 2ZGMA 1ULGA 2FDKA 5HBAA 2RHPA 4DIQA 2WO1A 2XQXA 3ZIXA 2J1AA 4XZPA 2AEYA 1MQTC 3P6BA 2K2SA 4COWA 4IE7A 5FPBA 1AR71 1MEC3 1OLQA 1U5IA 4HN1A 4JQRA 4UYBA 4YZ4A 5FY5A 5LASA 1DHKB 4L8QA 4A7ZA 4D6RA 4EYUA 5A1FA 1JYWA 1JYTA 3JBG2 2YYOA 3A0KA 2ZGKA 4C0HA 3N4MA 2XBO3 5BNOA 3TEWA 4QAWA 1W8WA 2E33A 2AYHA 5LATA 4Y22A 4QGMA 3HBZA 4COYA 2ILMA 4W8JA 1RVF1 5IK5A 4NRPA 1XNBA 3OUJA 3I2KA 3LIGA 3OGVA 4JGYB 4HL0A 1HQNA 4Q4V1 2I07B 1ZZ9A 4PI0A 4LBQD 3AMNA 5A6ZA 2D98A 1ULFA 3I49A 2IXCA 4IV1C 3ZN4A 2B45X 3DV8A 2RM21 1ULOA 5BV6A 1B35A 2RMU2 3GM8A 1LGBA 4YGBA 1C4RA 1LOCA 3D5OA 3NV4A 4ZHNA 2P4EA 5FZ3A 2HYXA 4ZZ8A 3FMGA 4D94A 4UFLA 4HKOA 5BNNC 1AX0A 3BN6A 1WW4A 2ETEA 4IL7A 4ISRA 5CFDB 3T0DA 2PLV1 5FP4A 4P9YA 2ZX1A 5LZ6A 1ASJ2 2ZGTA 3E5QA 3S5QA 4KGQA 1OI6A 1K5MB 5T54A 1Q8OA 3V0BB 2LROA 1DZTA 2XWJB 2OIIA 5DG2A 5FWJA 1KFXL 4YGCA 3KQ4B 2Z79A 1LTEA 3VGIA 3RDIA 3ILNA 1JI6A 4HETA 1UY3A 1W6QA 1HX6A 1XU1A 1W8FA 4OYUA 5A7OA 5ACA1 4F3JA 2HWB1 4RHV3 4OVEA 4SBVA 4XJ8A 1EAH1 1QJZA 2P3YA 3PUIA 3CJIA 2JDZA 2PYTA 4FTBA 4XXAA 4QHOA 2IFRA 2E7QA 1JHNA 1C8M3 4Q4X1 4QMAA 1ENRA 2XMLA 1JH5A 3A0NA 1PIV1 1OF4A 1X7NA 5L9VA 4X6RB 3FJSA 2PMWB 3ON7A 2VW1A 1POQA 4XJUA 2Q5TA 2Y6GA 2D3RA 5FP3A 5F5QA 3BCWA 3D8CA 5FYVA 2CSGA 3H8XA 2Z2SB 5JXJA 1FOD2 4QPGA 1W9WA 4Q0UA 2ATFA 1SDDB 3T30A 2Y33A 5F5AA 1JMUB 4NMIA 2HWC3 3UKTA 2PHTA 3I59B 1V6LA 1D2QA 3JD73 4GA9A 1EUUA 1NA1B 3POFA 4JGZA 4TWTA 5C4WC 3WDWA 3I3QA 4YYOA 3ZSLA 1RUE1 2XKPA 1O4TA 4P08A 2WA3A 4CDXA 1O5UA 1W9SA 2D97A 2W47A 2C6SA 4WM8C 2LUWA 1UZ0A 1Z0HA 2CDOA 3BU7A 2GMEA 3R05A 5EV7A 1JYXA 2SLIA 5GKAC 1ZZ8A 3PUAA 2R072 1O59A 2E6VA 5BUVA 5LK7B 5FO8B 3MLLA 3VDCA 3M3EA 4QDRA 3OBAA 1Q8SA 4B4RA 2VZ1A 3WP3A 1VBC3 5IVCA 3U11A 1O8SA 1BHGA 1KFUL 1NUKA 3VBUC 4RQPA 3M7AA 3ZFFC 3VHRA 3I2GA 4DPNA 4CTEA 1JYNA 2DV9A 2ZMNA 2MHFA 1JZ6A 4E4ZA 3ZLIA 4Y5SA 1NCRC 2E31A 5DDJ3 4YM3A 4B4QA 1PO21 2L9LA 5JZGC 1KRIA 1TME1 1UWWA 1Z7S3 1PGW1 1ZM1A 1EP0A 2JENA 4XCBA 1GWLA 4YVWB 4EE2A 4BMEA 2RS53 1BEV3 3MV01 4TLFA 4QX5A 1XNDA 3WCRA 1X33A 2HWE1 5FMBA 2XQRA 1RUG2 3B9CA 2WT2A 5KHGA 1LAJA 4BDVB 1C5IA 1QQP2 2BGOA 1RUI2 5FKCA 4COUA 2JG9A 2NYYA 2ZHLA 3JQWA 2BVBA 3GALA 3OY8B 4Q0PA 2KA3A 1L7RA 4NPRA 1LHVA 2ZHMA 2X8KA 4JHZA 4P9IA 3TRSB 2XLAA 4UFHA 3BB6A 4XXPA 1QOSA 5F3GA 3V0AB 3W9AA 5ANQA 2AENA 2JDUA 2XXZA 5B2GB 5K4LA 1QNYA 2X53S 2DWRA 3VDDC 2EIGA 4KU7A 2Y34A 4PIZA 5FLJA 4JKLA 5AFBA 2ES3A 3CKHA 1UIJA 3O0VA 1REDA 4FPGA 1OPMA 4ZU4A 5F32A 4BZ4A 4CU8A 2EAKA 4G9SB 3VBSA 3PURA 4K40A 4JDMA 2VZOA 1WCSA 4JKMA 3ILFA 3ZYPA 2QQMA 4Z92B 4GWMA 3DUIA 4MADA 3OB8A 4CCCA 2BP6A 1GWMA 2NN8A 3N35A 4WVMA 4IERA 4XQDA 3PJYA 2FCTA 4RA0A 1G9DA 1HB4A 2XGXA 3NJVA 5FQ0B 3TAYA 3ZFEC 1G9BA 4AGRA 4M4RA 2RDQA 2D6OX 4PLMA 3WF0A 2N7GA 5KC5A 1NA1C 1AL0G 4JRLA 5FYTA 5FYSA 4V2WA 4AFMA 1ZBA2 1VRH1 2D43A 3E6BA 1SPPA 2WWJA 4E27A 4URAA 5A6YA 2ARCA 3BTZA 1RIRA 4AFCA 3EJKA 4X8NA 3ZYHA 1O3RA 1MS3A 2ZMKA 4ITCA 3VKFC 5IATA 2P6CA 2XUEA 4PBPA 5D1IA 3H0OA 1YFYA 4D0QA 2A6XA 1YIFA 1WW6A 4N90A 1H1AA 1LCLA 4KWLA 4Q2FA 3SISA 4AHWA 4DRVA 3PTYA 5HV4A 1LESA 1HRV2 2D7FA 2R043 4P02B 1M4WA 1YLLA 4YWAA 2BQPA 4PDWB 2G19A 3SEEA 5F3IA 4MX3A 3VHNA 3ZKYA 4YSFA 3AP5A 1AR92 2FZ1A 2AR6A 4AI2A 3J7HA 1H2KA 1PVC2 1HKDA 3MUY1 2BWCA 5JR7B 5CAZA 4GXLA 2D3PA 4BHPA 5GM0A 5CKMA 2FCUA 4BQ1A 2PQSA 3PVNA 3LFIA 2VOVA 1DQ5A 3GGLA 5GLVA 4XAAA 5GZGA 2DVFA 5AFEA 2GU9A 4TN7A 2LW8A 2VBBA 4ZPIA 4A6OA 4JDOA 1LOEA 2VMFA 4LOTA 5EZWA 1DYOA 2WZR1 1CAXA 1BYHA 2FZ2A 1XE0A 2GNBA 2VQAA 4AK3A 4V2VA 5DUUA 4BCUA 1VBA3 3BIWE 3OGJA 4QT6A 3HN1A 1K45A 2QZ3A 4JTNA 5JI7A 5A32B 3PVEA 1RGSA 2HWF3 3WW3A 4HVRA 3K75B 1POV3 4M3CE 3PU8A 4RHV1 4BIFA 4KNCA 2WA4A 2WFF2 5LA9A 3JQXA 2IXKA 3UKVA 2CWSA 2A70A 3N36A 4FTSA 4Z1VA 5J98B 1XE7A 3AP9A 3KVAA 3WNOA 5JPNB 3H7YA 4KWJA 3D0SA 4AFDA 1RHI1 2J1VA 4AFBA 3R4SA 3HQXA 1RL3A 3SCHA 1T6GC 3RQ0A 2OZJA 2QQWA 3THTA 5F6KA 2W94A 2GC0A 2WAAA 1TMF1 2YHJA 2E53A 1OA2A 1LHWA 3IPVA 1ND3B 2EALA 1ST8A 1M06G 1IKQA 4JV4A 1W6PA 4MXVA 3BTXA 3OGSA 4XFFA 1GZWA 5EPAA 1ULPA 3E1F1 3WF1A 3M4FA 5FMOL 3JB8A 1ZZCA 4QQPA 1DQ6A 2AH2A 2RVAA 2K46A 3AZVA 5FAXA 5FYMA 3IKWA 1JOJA 4XTPA 3Q8CA 4RFT0 5FP8A 4IE5A 4LT5A 4PDWA 3J8F3 2ZA9A 4CEWB 4DUWA 2ZEWA 4W50A 4I3PA 1PK6B 2DU0A 5E1RA 3HIFA 1NAEA 3R0RA 5FXWA 5LEKA 1E5IA 5FDBA 1AR82 1LEMA 1S0EA 2ZKLA 3VDBA 1IS6A 1URXA 2IXJA 1IQAA 5EP9A 4ZONA 4P9JA 2VUAA 4TSVA 1SG3A 5I0UA 3DXTA 2RMU1 2QQOA 3U75A 2JKBA 3RJ2X 5A1AA 4PIXA 5FFOC 4TLGA 5CBLA 4BISA 1I5ZA 1R091 1UAIA 3S57A 1QKQA 3HT1A 3HWJA 4FXGB 4URTA 5A3OA 5AVAA 4NAMA 4HG6B 1CIYA 2DUOA 2B42B 4AEMA 1DYKA 1XSQA 1NXMA 2WNUB 1RUD2 2WUHA 4R4XA 4Z8BA 2D40A 3HOBA 5A3UA 1W99A 3MLKA 4R8HA 1ULCA 2GSYA 2EXKA 5C3PA 3VBFC 2VXJA 3BTAA 1W8NA 1RUC3 2P34A 1H8TB 4BMBA 2Z5WA 4CCOA 2UY8A 3RJRA 2XJQA 5JSPA 4DQAA 3VZJA 1RUNA 3FN9A 5GLZA 5IWFA 3ZN6A 2YV8A 3QACA 3RWKX 1OLME 4QX0A 1L7LA 2QUOA 2MPFA 4YG0A 4F7ZA 5C3SA 2BGPA 4CP1A 5AC93 3ZXJA 3AMHA 1LEDA 1HXS3 2C1FA 4OULA 3ZFGB 4NUBA 2EXHA 2XJVA 1QH7A 2R16A 5FBJA 2ZHKA 1IS5A 5FV3A 5I0DA 1D4M2 2A7AA 4IGQA 1O3SA 5JAXA 1FMD3 5GZDA 4KH9A 1NZIA 1W8TA 1XXNA 4CSWA 4KG8A 1ZVFA 3AZWA 3BYWA 1GQPA 1PM7A 3S5AA 2GC2A 2G9ZA 1GICA 1QJY1 1X8MA 4KU8A 3AL5A 4ZU5A 3U4XA 4YZ1A 5A3MA 1EUTA 3CDZB 3I2DA 2B7YA 1PNFA 4M3CF 2ORXA 1CX1A 1S4CA 3MIBA 5IFPA 3NAPB 3HNBM 5H9PA 4XMIA 3VN4A 3RZHA 3MFCA 1VBD3 2R071 4C1XA 4MO3M 3SCGA 5A6QA 1MZEA 1RMU1 2C5DA 4P9WA 4AI9A 4CDUB 3E6CC 4B4PA 5FOBB 1OQEA 5FJKA 3WF3A 1IKPA 5IYYA 2UWAA 2BGCA 3U10A 5F3CA 4IEPA 5LW9A 3KV9A 4IV3C 3ZXKA 5FMCA 5A70A 4CEWC 3AB0A 3WOGA 1XYOA 2PTMA 2Y8KA 1PK6C 3O0WA 4NJ4A 4RD7A 5FPVA 3T4VA 1QY4A 2CGPA 4FSJA 2JDPA 1DIWA 1NT0A 4QGLA 3C2UA 5JZGA 4FPEA 4BXSV 1A6CA 2R062 4Q5OA 4IXLA 4MGSA 1OD3A 5A3TA 4KBZA 3O1MA 2WSUA 1G9FA 4M4PA 4CYDA 2CU5A 5FZ0A 4MUVA 1G7YA 3I3EA 1RUG1 4MHRA 2X10A 3KHCA 1RXFA 5GZCA 1QQP1 2W1WA 5IT6A 3GHNA 2WQ4A 3WG2A 3GDBA 4BU2A 2YZ4A 3KF3A 2EIBA 3DEMA 1ZYBA 4AEDC 4E2GA 1PM4A 1Q8VA 1T2XA 1HV0A 2WNUC 3RFRA 4LJHA 5J48A 2DUQA 4BK4A 2I2SA 3NV2A 1GZCA 3FFQA 1FPN2 1QJEA 5H9QA 3PUHA 1NCQC 1AR73 1YEWA 3GBWA 3CHXA 4IEQA 1GZ9A 3IDAA 3MEPA 5F8PA 4CP9B 1AVBA 1WLWA 2JB8A 4HVQA 1MS8A 2W46A 4LBQB 4HSLA 3DKWA 5KBFA 4QX3A 1VE0A 1QJU2 1UD1A 1X9PA 4W6WA 1UKRA 2HWF1 1HN1A 1SFNA 2YGLA 3KB5A 1RVF3 1ZBE1 2J1TA 1VBB3 2VCCA 3KV5A 1AR62 1KJRA 4PT6A 1UOFA 5FY1A 4AFAA 1SQ4A 4Q4V3 4ZU7A 3VL9A 3MLJA 2ZCWA 3ZFGC 1W28A 4XF4A 4A4AA 2GN7A 4Z2AA 3ZXLA 1CAWB 2UYAA 4MGIE 2RM23 1ZNPA 2A5ZA 1UL9A 2IVJA 5L36A 2ZBJA 3W5MA 4FXKB 4LBOA 4YNIA 1ULDA 3NNLA 3MW4A 3H8UA 4ASLA 4COZA 4XABA 1XQNA 3I3DA 3URFA 5FYBA 3BI3A 3LA3A 3KV6A 5LA0A 5BNPC 3RI9A 2VL4A 3WW4A 3MICA 3N9OA 5TSWA 2G9FA 4EN9B 5KXBA 2R32A 4AOCA 4W6XA 2PLV3 4I09A 5A7QA 4YVSB 2W52A 5H9RA 3DYPA 3HNMA 5H9SA 5A7PA 4L2NA 2YY1A 2PHDA 1UIKA 1OA3A 4Q4Y2 1WCDJ 4NIHA 4CDUC 3PVBB 2JECA 3ETQA 4CEYB 2E9QA 2ZX0A 3FHQA 5ACA3 5KWRA 1KDKA 1H4GA 4FOWA 2WBKA 3J8F1 1RUF2 2HWB3 2VW0A 2ERFA 1EAH3 3KT7A 5I93A 1WWYA 2E7TA 4K20A 1SLIA 1YJLA 3WQ7A 1HRV1 2DVGA 4Q4X3 3WG4A 5IVEA 1PIV3 2IFWA 3U14A 5IVVA 1FXZA 3KZ4C 4M3CA 1VB4A 3T1MA 2GNDA 4EJRA 1AR91 5IAXA 2DF7A 4O65A 3S7IA 2E26A 3VBHA 1HB2A 1SFYA 5C9AB 1LODA 2X09A 4QD2A 4Q1PA 4AVCA 2X5IA 2A75A 4HANA 3ELNA 4CE8A 4SLIA 4XFGA 2BDRA 2ZGSA 2QQJA 1R1A2 5APAA 4ZS2A 4CP9A 1QXPA 4QPIB 4N43C 1CR7A 5FBZA 3ETPA 4AXOA 2OQ7A 2R0FA 3FBYA 4NAOA 5FZ9A 1PO12 1RUE3 5IUQA 5FZMA 4D7TA 3O1UA 2CNAA 1L7QA 4UXAA 5DAXA 5LCWL 4LK6A 1VLNA 1PMHX 4IDZA 4DY5A 3WNXA 4AQ2A 3LB9A 1OXCA 2WL1A 4KL1A 4BK5A 1HN0A 3EBRA 1OFNA 1H6YA 2RG4A 3A23A 3JXSA 2BJSA 3NNMA 2QQVA 2BEOA 1J3RA 3LDKA 1DDLA 2FHRA 5A3PA 1A8DA 2VMCA 1C3HA 4YW3A 5CFCA 3GNEA 3SMHA 2P1BA 3RWNA 1K5JA 2W1QA 4ASMB 5JXIA 3FUOA 3LPFA 4U2AA 1PO23 4FFIA 1TME3 5LWBA 4NIDA 1UU5A 3SH5A 1Q56A 1V9U2 1N47A 5FO9B 2BNNA 1GANA 4RR3C 1FMD1 3IB3A 4FPJA 3AC0A 4IEXA 3UGHA 4N9HA 1S0IA 5BNOB 4GIQA 4FPKA 2HWE3 1MS1A 4UFJA 1CPMA 1HB1A 1TEIA 1H30A 1HW5A 1BK1A 3Q8AA 5DPNA 4CEYA 4DUVA 1MEC2 3HD8B 3LAGA 2Y6FA 3EMRA 4Z07A 4A41A 5BYNA 1C5HA 4YW2A 1GUIA 3VBOA 2JEMA 2KXLA 2VZQA 3DPRA 3W5NA 4I3GA 5SV5A 1XYPA 2XBO2 4DY3A 4WM7B 4ASKA 2GC1A 1B35B 2WNVA 3POSA 2VZSA 4LO4B 4E4SA 2CDPA 1H9PA 2MEV3 2JDNA 2XR4A 4I0WB 4XZUG 2WLQA 1O4YA 3P1IA 3NVCA 3H7JA 5BNPA 5C9AA 2VQ0A 1PHMA 5L7OC 3IMNA 4OUSA 2YC2A 4QWNA 1WLTA 3DF0A 2HWD2 2D5FA 2VY0A 4R9DA 1R081 1RUJ3 4Y26A 1US3A 4BIOA 1YQCA 1OLMA 4FOQA 4HOOA 3EQEA 1IGOA 4QPIA 4YW6A 2UWBA 3PIGA 1J84A 4S2GA 3TBDA 3VKMA 1W04A 1JOBA 2ARXA 1JYIA 2VZPA 3ZYBA 3RYPA 1FT9A 3CZJA 4ZXEA 3AP7A 4QB6A 2OPKA 2WO7A 3FX3A 1W06A 4QX2A 1W6QB 2WWSA 3VLBB 1DLLA 5J09A 3CJIB 2I74A 4HBNA 1E5SA 3ZYJB 3SXWA 4GH4C 5LY1A 3I4IA 5D8AA 3KCYA 2NMOA 4MGTA 1RUH2 4I2OA 2W1UA 1IPSA 3A4UA 3M3CA 3MGUA 3ZX7A 5LRRA 1H6XA 1HDKA 1BBT2 3THCA 5IK8A 2H6CA 4LHLA 1VRH3 1FYUA 4CU7A 4QPGB 2VC9A 1C8M2 4QHZA 3J7MA 5FZAA 2K0GA 5JWPA 5CU1A 1ULEA 3POIA 2P17A 2VBDA 2VZUA 4JGZB 2EF6A 2VZRA 2CL2A 4XFAA 5I0TA 4CDXB 4R9CA 4OI1A 2C9KA 1D4M1 1VBB1 2UU8A 5EFUA 2D6LX 4IEOA 2WZ8A 4QXHA 1S0JA 1W39A 4LUKA 2JWPA 3BVCA 4OCTA 2HWC2 5E89A 1UMHA 2A3XA 3OEBA 3AMMA 4QPWA 3CF6E 3ABZA 4NN0A 1QOTA 1YQ6A 4WM7A 2FMYA 4IV1A 4UOJA 2H6BA 3VBRA 3PMEA 5D21A 3T09A 3B93A 3N3HA 1XNCA 4RQPB 4LA2A 2DU1A 1WGPA 3TN91 1A78A 1W2NA 5M0TA 2RR12 2QDNA 4GB32 4Q4W2 2YC4A 2O0OA 4YRDA 4EQVA 2CV6A 3MO4A 4K8RB 3WV6A 2Z4FA 5HCHA 1J83A 4HT1T 4FPFA 4FOVA 4KBBA 5F37A 5BNNA 3UT0A 1VB2A 2YXSA 2FDHA 3I54A 1OQDA 2WZR3 5CEHA 4GALA 3JZVA 1YCIA 4LKFA 4NRMA 2WABA 2GMMA 5T55A 1B35C 1AL21 2WO2A 1W90A 4XF0A 3CMGA 4Y1ZA 4LHKA 2XH6A 4WZFA 5DDJ2 4WV8A 3ES4A 4ZZ5A 1JBCA 1VIWB 4CXWA 1Z7S2 4JCKA 2BNOA 2AREA 1AZDA 1D4VB 1IOAA 1WMXA 2JG9B 4G3YC 3QH6A 3UETA 1UZYA 5DZGA 4E4DX 4XCAA 2RS52 1BEV2 2DURA 3KLSA 5FLIA 3ZXAC 1F9KA 3CQOA 3LEIA 1LRHA 5CA6A 5J7MA 1JZ5A 2IZWA 2W95A 1GMMA 2VO5A 2JE9A 1RHI3 2OPWA 3AMQA 2BUKA 3MFAA 1F2NA 1R64A 3AJZA 5LBCA 1GFF2 3HN3A 1NZCA 1YC61 1WMDA 2OA2A 3MUZ1 4RS5A 3VD7A 4XBNA 4QQOA 1C1FA 4BQYA 2BFUS 3PNAA 5IVJA 1TMF3 4LMFA 4FPLA 5F5CA 4INDA 1UQXA 2HYKA 2YU2A 4BH9A 1YQ2A 3CJIC 3VZOA 4QKFA 4F83A 4QU1A 5DAVA 4OMDA 5FXVA 4ES9A 2EA7A 4KQ7A 4UW6A 3LIHA 3NSTA 1US2A 5FYIA 3VBSB 2JKXA 4BA6A 4O9EA 1NXD1 2RDNA 1QIQA 5C8CB 4JC1A 3U4SA 3FLRA 2ET7A 5HCAA 3JBG3 4WZCA 3K4ZA 4WM8A 1ZZ6A 2PN5A 4OI4A 5A7SA 3WT3A 1DGWA 2RS31 2YG0A 3O1TA 4QPGC 4TZDA 5T52A 3M1HA 3TYJA 4BM8A 3H8RA 2W92A 1F5FA 4AAPA 4AGVA 2ZZQA 5JMOA 1U0AA 4H2AA 3M2MA 3ZMOA 2WC2A 1XPWA 2J1UA 1W6MA 3WNNA 3VBUA 3ZFFA 3LA7A 4CP2A 3BPZA 4JGZC 3OOXA 2W08A 1VAKA 3M8LA 4N53A 1V6NA 2V5DA 2O8QA 3TNPB 3ALQA 1C1LA 1C28A 1YFWA 2NMNA 2BVVA 2RMU3 1NCRA 1SPPB 3FLTA 3LEKA 3WDUA 4UAPA 4MLOA 3MZHA 4JGYC 2VD7A 1MPXA 2XWBB 4E8DA 4BQXA 2XJTA 5A6XA 3TEZA 1R093 3ZYRA 3U0ZA 3ACIA 2WLPA 5DAPA 1LOFC 3BU0A 3MF9A 2VCAA 3PVOA 4LUMA 3O7OA 5FR3A 2Z42A 2ZX4A 3UKNA 4C8DA 3VDAA 4AAXA 4LK7A 5KHIA 2A1XA 2A3YA 1F15A 4GKXA 4NIIA 3ZOIA 1NY71 4AEKA 4CRQA 2ZOEB 5FYUA 1JXNA 2BOJA 4H14A 4XILA 3WVJA 2RJLA 1WCUA 5CFDC 4QQ2A 2QJVA 1EYBA 5FIXA 1Q8PA 5IK7A 2VMHA 2VG9A 3ACFA 5I8SA 2XB6C 5JOXA 3BOPA 2F6BA 3NO8A 2J1RA 1K5MC 3LZZA 1J58A 1WCKA 3WNLA 2MEV1 1LKNA 4CUCA 1OC1A 1MS0A 1EV12 4BLJA 4UFMA 4IEUA 1D2SA 4JTOA 1W03A 3H1YA 1RUJ1 1YXWA 3A21A 3LEMA 4IE6A 1GBGA 5L19A 1X50A 5KXDA 1CAXB 1H2MA 1H2LA 1GP6A 1ZREA 2PHLA 3WDXA 5F9TA 3IIIA 5LB6A 4EWAA 3ZXGA 5C8CA 2QDRA 3POEA 4DO0A 3NL1A 1QJY3 4MVTA 5FY4A 4Y5Z0 1BJQA 1ONAA 4YLZA 4E2QA 3UGFA 2G1MA 5A3NA 1PO11 3WZ1A 1BMV1 2DDUA 2KD7A 4CDQA 5FWEA 1FAYA 3U1XA 3AK0A 1DZQA 2A6VA 3MW2A 1NYWA 1VBA2 1D0HA 4NROA 4Y4YA 5LA1A 1Y43B 5GLTA 3ZFEA 2R073 1HLCA 3MIHA 1RMU3 2E32A 1WZXA 3BALA 1H9WA 3POWA 3M3IA 3QBQA 4ARXA 1F4AA 4AVTA 1GQGA 2PQQA 4W6YA 3CJXA 1TNRA 1LHNA 3ZIWA 5CISA 2HEYF 3BTYA 3AKSA 2LS6A 3IPVB 5T5OA 1TNFA 4HXCA 4BQ3A 2E7AA 1W6PB 3NNFA 3B3QE 2KM2A 4PF1A 1GZWB 3USSA 1EY2A 3SH3A 3GYDA 4CUBA 4B3NA 3GF6A 1PGL1 2CAUA 1DGRN 2P37A 2EIDA 2EICA 1YQ8A 2PAEA 1GLHA 1COV2 4COVA 1NG0A 1O7FA 1VMFA 1X9TA 4LR4A 4Q8LA 1CIWA 2XL7A 3CL1A 4LPLA 1AYM1 1RUG3 1CZVA 3HR9A 1H1MA 1PZ7A 4QKNA 1CZSA 1QQP3 4YVWC 5FZEA 5EJ3A 1OURA 1CWPA 2ZHNA 3OPWA 2Y6LA 4K1ZA 5JCTA 3K4DA 1WBFA 3WSOA 1DLCA 4XURA 4IQPA 4PHZA 3VZLA 1CESA 2RJ2A 2V5YA 3F2ZA 3IWZA 4BQ2A 3FWEA 1BQPA 2OXBA 1JUHA 2PHWA 2P6HA 1UOBA 4AL9A 3H8OA 2OUJA 2B5HA 3BPSA 4XQ4A 4CCNA 3MV11 1I6XA 4D3WA 3ZDSA 1AXYA 3AJYA 1I9RA 2HWD1 5F39A 2R1DA 3CNAA 4KGGA 4A3ZA 3TWIA 2B46X 3B5LB 4A7YA 2RDSA 4BOWA 3UJQA 1FX5A 1ZBE3 1J59A 1SDWA 2A6YA 3FE5A 4B7EA 1DG6A 4IW3A 2CHHA 4HLTA 1OF3A 1O91A 3ZXFA 1J1TA 3LSEA 4R4ZA 3VD4A 1H2NA 3ZN6B 5FZKA 3FFZA 1U12A 1BLZA 2GMPA 4XETA 3KGZA 5CVRA 3H50A 5EWSA 5HI0A 3B00A 1NQJA 1RUH1 1RUC2 1XB9A 3HQRA 5FOJB 1U5ZA 2JG8A 4CUAA 4L9BA 1W2TA 4ZY9A 3WQBA 1BBT1 1JU4A 3WQ1A 3UNPA 3AVSA 1ZBA3 4CXYA 2RS12 2J7MA 3T2OA 1YRZA 5ISLA 2ZEYA 1UY1A 1I1EA 3ZDVA 4M00A 2XHKA 1Z78A 4JKKA 4LLFA 1W3XA 2W9XA 3UV9A 4E9KA 4HKLA 4HK9A 5LBEA 1MZFA 1S55A 1HXS2 1PZ9A 3JBG1 3VB9A 2Q30A 2YU1A 1LHUA 1EPZA 3KHBA 3EHKA 3RRDA 3VZMA 5K8SA 5LK5A 5FPLA 1I5PA 1MVEA 1V6MA 3SCFA 2ARBA 3ATGA 1HRV3 1KS4A 1SMVA 3SKVA 1N1YA 4XHBA 1FNZA 2P3KA 1DYPA 2OUHA 2R7EB 3SEPA 4EWEA 4FTEA 1WMEA 2DCJA 4P00B 3UYJA 3N9PA 1LR5A 5HPOA 3WP6A 1OVSA 2VPVA 1AR93 4OLLA 3UK9A 4P5HA 4K9SA 3I2JA 4EN6B 1W2OA 4LE4A 4Y1VA 1OPOA 3K3NA 2RR11 1QJX2 1RITA 2Q0AA 1I3HA 4GB31 4PDWC 4Q4W1 3D3AA 4TYSA 1VBD2 3O5SA 5ABJB 2GH2A 4Z82A 3POGA 3KGLA 1LOAA 2TUNA 4KI5M 4LULA 3HMYA 1JODA 1ASJ1 4OI2A 1LOGA 1O4ZA 3KT1A 4OFGA 5EJZB 4D69A 2B39A 5JPMB 1CAUA 1W6NB 5DMYA 3VBFA 4DEQA 1FATA 4MZUA 4UWDA 3WF2A 3GBGA 3RZGA 4NOTA 3SHRA 3MIEA 1QGLA 4UF0B 2ZMLA 4Y3OA 3ENRA 1LU1A 5I0SA 4AVBA 1F31A 4GMP3 5FZOA 4FPCA 2WFF3 3ROUA 2A71A 4NHKA 4P5YA 4PCRA 1LECA 2CAVA 1G8WA 3NKGA 2PAMA 3LF7A 4UI9L 4AI8A 1YI9A 3C7OA 2CGOA 5IVBA 2VZTA 3AXDA 4M01A 1KXGA 5GALA 4L97A 2IXIA 2VZ3A 4XDQA 5CG8A 1TZOA 1OMIA 1ZRDA 4WVWA 2HKXA 5EJ1B 2P3JA 1FOD1 1TG7A 2V72A 2ZEZA
chains in the Genus database with same CATH topology
4J1XA 1VP6A 1KJLA 3AKPA 3IDCB 4AVAA 1VBE2 5FREA 4HK8A 2F4PA 1IS4A 3KD4A 1AR72 4AVSA 1F5JA 2WS92 4KG0A 4P9LA 4Y1YA 1CVNA 1ND3C 1AHSA 1QMJA 1QXRA 3KQRA 1FI2A 3D0JA 1R1ZA 4NO4A 1Q8QA 1RVF2 1SLLA 4YM0A 4QQHA 4Q4V2 2QKDA 4HKWA 3GBFA 1JTZX 2JD4A 4Q0VA 4QPYA 3VUOA 1H0BA 5JSOA 1R083 2RM22 4FP3A 4IV3A 3WHTA 2A6ZA 4XHXA 3S30A 1S0CA 5ABJA 1OFSA 2NM1A 3WUCA 3FUQA 4GMP0 2ZKNA 1DZRA 1TE1B 4YG6A 5J3UA 2EVXA 1AYN2 3LA2A 3AX4A 2Y38A 1CAVA 1W6NA 3PMSA 4H7LA 2Q1ZB 2YGMA 4LLOA 2PHRA 3QCWA 1RUI1 3EXUA 4CDWA 4YZ3A 1GV9A 3ZSEA 4M3CB 5C33A 2NQYA 5ACA2 3S6PA 1V00A 4AEDA 1PVXA 1OD5A 3VBHB 2ZGQA 4W65A 5FTTC 2OZ6A 5HCFA 3IN9A 2X5IB 3H3ZA 3PJQA 4LBNA 1OQ1A 1G9CA 4Q4X2 5HCBA 2BNMA 1H8TC 1PIV2 1MZ5A 3LWCA 3SITA 2DYCA 3H1WA 1QOOA 2VH9A 2V73A 5KC6A 2VVDA 2HEWF 4Q1RA 4META 5AVPA 3RG0A 2O8OA 5JLVA 4R52A 4IEZA 2PA7A 2QNKA 3WP4A 4XQWA 1D4M3 2XJPA 1AXKA 3H9AA 4MH0E 5FPZA 4AQSA 2ZJCA 3OGGA 1X36A 4Z2WA 3ZPYA 4ORFA 3CU7A 3AP4A 4D7SA 2WIIB 2OYZA 2D5HA 1WA4A 4QM8A 2XLFA 3R6SA 1QDOA 3KSCA 2YDEA 5BNQA 5I0RA 5J36A 2ZABA 3TN93 4AVVA 1S0DA 5CFCB 1S2KA 1W6OA 3SLIA 1V70A 4YM2A 4MXWA 1UKGA 3IDEA 3WHUA 5BNPA 3AYCA 3L9JT 2LM3A 1REEA 1NE6A 1S0GA 3POYA 4AHZA 3G6JB 1ZBA1 1X82A 2ZAAA 1OSGA 1HRI2 3NAPC 4O9GA 4LEJA 4UW5A 5K7PA 3N7KA 4LO5B 1AL23 3CEWA 1ZRFA 2BTVC 3WW2A 4A2UA 1GKBA 1QHDA 1PGW2 2R063 2XUMA 3VBOB 4AQTA 1ZZ7A 3DPRB 1J3QA 4PBOA 5LRSA 3WD5A 3TNQA 3ZN5A 2GDFA 3WDVA 2WNVB 3UJOA 1N1SA 5KHHA 1WMFA 3V56A 1NQDA 1SBFA 1PVC1 3WG3A 3E5XA 1C8NA 1REFA 2ZPXA 4Q0SA 2NP0A 5SV8A 4S2FA 3MDPA 4N43A 3J4UH 4NR1A 2Q8OA 2QVSB 5JOWA 4FAGA 2DVAA 4YM1A 3VBHC 2Y26A 4XJZA 4K21A 1OOPB 2RS33 4RSUA 4Y20A 2VOXA 4B8EA 4YFZA 1W2UA 1MS4A 5D8AB 3E6DA 2GALA 2ZGUA 4GMP1 2WFF1 3LGRA 3N7MA 4N9IA 1VJ2A 1UMZA 1QF3A 4PLNA 1RB8G 1ND2A 4HVOA 3INAA 4XJ9A 3LSDA 4A7KA 4C91A 1SBDA 1MQTB 1LENA 5GZEA 3JB4C 5FMOS 5E16A 1UZZA 2Q4SA 2ZS6B 3AKTA 4K8FA 3K48A 4AI1A 2VNRA 3N7JA 2OW4A 4AYUA 1SEFA 2RS11 3AFKA 3MW3A 4OHZA 5K0UA 4NHMA 3ILRA 3AZXA 4B29A 5BXXA 3VBRB 3WUDA 3WW1A 4IV1B 4YVSC 1B09A 4C1WA 3WXPA 3WR0A 2B9UA 5I91A 3EO6A 1AR81 4CEYC 3BODA 5BY5A 1YO8A 3BOWA 5BNNB 3VBOC 1DF0A 1PGSA 2VOKA 3DPRC 1MS9A 3RPQA 5IK4A 1QJX1 2JJ6A 1EPWA 2D6KA 4ZXKA 2DTWA 5C9AC 3MYXA 2XVKA 4XF3A 5T5PA 4C0BA 3RYKA 3VKNA 1OOPA 1RUD1 1PO13 5T50A 3FHIB 4OHXA 4YZ2A 3D4KA 3VKOA 2BPA2 1BXHA 2P3IA 4GH4A 1LGCA 3RSJA 5A33A 4BYYA 4QPIC 1CGPA 1YNAA 5JIAA 1GNHA 4QGNA 5CB7A 4RHV2 3I7DA 4RS5B 4QM9A 4JVAA 5EYYA 1ENQA 2ZTNA 3QLQA 2XG3A 1E57A 4LBMA 4EV0A 1DQ1A 1MQTA 4YARA 5GLUA 4AW7A 1RHI2 3B94A 1ZX5A 1HV1A 1LB2A 2P2KA 3OYWA 4ISQA 4JAAA 2R0HA 2XLGA 2DCKA 4L11A 1V9U3 2O1QA 4UBHA 5GJ6A 5JSRA 2CWMA 3NJZA 3U07A 4P9GA 4K6BA 4WM8B 3VKLA 1NLSA 4LBLA 2B8MA 1VBE1 1AYM3 2JX9A 3JD72 3UL2A 4BWOA 5JMCA 3NWKA 4LO7A 4FVVA 4OHVA 1DQ2A 4K7JA 1H1IA 1LHOA 1PMIA 2WS91 4F8AA 5K9YA 1W6MB 2R1BA 3LKJA 3R4UA 3VBUB 3ZFFB 5BNOC 4ATEA 4N53B 1YHFA 3ZSKA 2WT0A 3O0XA 3OF1A 4IETA 1NCRB 3JU9A 3WCSA 5JZGB 1VBC2 1KQRA 4AHYA 1NOVA 1ZA4A 3LOBA 3WX5A 3VBRC 4WM7C 2HWD3 4Y1UA 3MF6A 3DGTA 1VAMA 1V6JA 3I8TA 1AX2A 2XPJA 2XKOA 3M70A 2R061 3QD6A 1R092 1LGNA 4X6QB 2QZ2A 1G6NA 1PZ8A 1AYN1 1ZRCA 4E2SA 3ST7A 1D0GA 2BW8A 4FCAA 4NWWA 1CN1A 1VR3A 4FPYA 1XE8A 1RUH3 1WD4A 4YGEA 3VDDB 4H3WA 4DXZA 4HSJA 1BBT3 4GULA 1V6OA 4LBKA 2EAAA 2TEPA 2VVEA 1LOBA 1BVP1 1FPN1 1WUVA 5BPXA 1A8MA 5C4WA 4HPKA 4QQLA 2G9GA 1DFQA 1DQ4A 2D6NA 2ZX2A 4RS5C 2ZX3A 1QJU1 4N7IA 1SLAA 1ENXA 1JN2P 4L99A 4CDQB 1OKQA 3WY6A 4DRRA 1AR61 3VZNA 3VV1A 1UF2C 3OCPA 3ZMNA 4DFSA 3ZFEB 2WT1A 5J37A 1QJY2 2E51A 3SH4A 4CDXC 5I8YA 5DG1A 1WD3A 3E5UA 2RR13 5JZGA 3ECQA 1QWRA 1UPIA 1WLCA 4GB33 4JGYA 4Q4W3 4UW3A 4XIOA 3WLUA 3ZVXA 3IIAA 2HJIA 4LO8A 1RMU2 1LOFA 2VVFA 2WNEA 4XIKA 2VMIA 2EXIA 4RQPC 2YUEA 3THPA 1APNA 1XYNA 5DUWA 1ASJ3 1HRI1 4N53C 1BVVA 4XYXA 4ZKTB 3AFGA 4Q4Y1 4K3UA 2ZGLA 1AF9A 5CFDA 1RUF1 4XFHA 1AUYA 4HMZA 4MGZE 2VOWA 3MPPG 2R042 2ZGPA 3B01A 4AWDA 2C9AA 5CIRA 1K5MA 2WFPA 2IXHA 3V0BA 2ENRA 4AF9A 2D6PA 4PQ9A 4RGAA 3VDDA 5DZEA 2CY6A 3AMPA 1QXJA 2D93A 1SACA 2JG9C 2EXJA 3R4DB 4LA3A 1ZZBA 4LHNA 1YWKA 5LEJA 3TOJA 3VL8A 1FOD3 1GNZA 1MACA 2CGNA 1R1A1 4R9BA 5JDBA 4XF1A 3AYDA 5FLHA 2VXRA 4FQZA 3AYAA 3AP6A 3ME2A 4MGYE 4AQ6A 2YROA 1IS3A 2K9ZA 4CRQA 1WBLA 1Q5OA 1CONA 1S0FA 3MIFA 2D6MA 3MIGA 1DGLA 3I59A 3RS6A 1S0BA 2HWF2 3VBSC 1NA1A 1ZBE2 3CO2A 3K51A 4ES8A 1F8VA 5C8CC 3W59A 3FBMA 3C3VA 1FNYA 3D6EA 3KM5A 2JG8B 1V6IA 3OTFA 4WBBA 2H0VA 1BCXA 1CQ9A 4CDQC 4U36A 2UYBA 3OD0A 1N1TA 3ZO0B 4XW3A 5FO7B 2NZ9A 2ZAHA 1N3OA 1WW7A 5DUVA 3RYRA 2A6WA 1V9U1 5DUXA 2JICA 3FZ3A 3OPZA 1UCXA 5DZFA 2XL9A 5L73A 3E97A 1RUOA 3DL3A 4XFIA 3WDTA 3KT4A 3ZSJA 1J3PA 1W0OA 3ZYIB 5KHKA 3TB0A 4AEJA 1UW8A 1VALA 1MEC1 1DGWX 1RUI3 3KCCA 4YVWA 4DB5A 2D44A 1O5LA 5C8WA 1ENSA 2XBO1 3J8F2 4Q29A 4YZ5A 3H3UA 4AG4A 4AGGA 4MV2A 1YI7A 1KD7A 3OY8A 3X29B 1EV13 1X8EA 2OVUA 4YG3A 2GNMA 4HFSA 1LU2A 3V0AA 3AM2A 1SBEA 2TNFA 4UBGA 4EN0A 1JYCA 3O14A 2C0ZA 2HEVF 2XJUA 2FQPA 4FPOB 4XBLA 1CAUB 1MS5A 2JXAA 2FBEA 3VBFB 1YIPA 4EWDA 1SLCA 1LULA 4V1PA 5C6CA 2GH8A 3ASIA 2NPIA 2R49A 2Z69A 1HIXA 3CLPA 2PHXA 2DTYA 2WJSA 3HT2A 4S2DA 1O3QA 4XFBA 2BBVA 2VU9A 1WLDA 2VNOA 1OLRA 1XNKA 4EN8B 5JI9A 4OHYA 4XBQA 1H8VA 2PELA 1Y3TA 4FOYA 2XVLA 5FQ0A 1C8M1 4A3XA 4XTMA 1CPNA 3OBTA 4P9XA 5AC92 3L2HA 4IEYA 4CZSA 4C90A 2ZACA 1MZ6A 4YW4A 2WINB 5FCCA 2JG8C 1FMD2 1L3JA 2W68A 1COV3 4Q26A 1GSLA 2YC0A 4Q8KA 4GKYA 2HWC1 3J26N 4L92A 2GC3A 1KDMA 3AXEA 3JD71 2DCZA 4XJWA 1H4HA 2ZGNA 1PVC3 4AE2A 2DCTA 1QDCA 1G9AA 1UU4A 1SCRA 4DNYA 3DN7A 3V65A 4IV3B 2VGDA 2ET1A 2RJKA 3LCPA 2SBAA 1IPKA 1IHMA 3VHPA 1GYKA 3B7MA 5GZFA 1RINA 3W58A 1VBC1 2AGSA 1NLRA 2IXLA 3NV1A 5JOYA 1R082 3FLPA 1CAVB 1POV0 1UX6A 1YJKA 1BKZA 5DDJ1 3ZXEA 1AJOA 5KXCA 2ZGRA 3AKQA 1Z7S1 3APBA 1IZ3A 4OHWA 4CDWB 3OD4A 3VZKA 4DINB 2RS51 1BEV1 2Y0IA 2H0BA 4XOGA 4AEDB 2CTVA 3MIDA 2PFWA 5A32A 4I0AA 1Y7BA 3IM0A 1PNGA 4K1YA 1NCQB 1SCSA 4YGDA 2DUPA 1UU6A 2DFBA 3OBRA 4Q27A 3SNMA 3KMHA 2QQPA 2RS13 4NWVA 5J96B 3S7EA 3GZUC 1YYNA 4LTAA 3RZZA 3RMXA 5T3NA 1AJKA 1DGRA 3Q9OA 1ND3A 4P14A 3WQ0A 2D3SA 4QU2A 5EYXA 1VBB2 4HN0A 1WW5A 2XJRA 1W6OB 4I30A 2WKKA 3FC0A 4S2HA 4FP2A 1AR83 4MSVA 4Y1XA 5DXDA 4MXWB 1AX1A 2XJSA 5BNPB 1Q43A 3JUUA 4CEWA 2IWGB 1RC6A 1TQ5A 1PK6A 3ES1A 4Q0QA 3TN92 1S1AA 4GQ7A 1O3TA 1CX4A 3AKRA 1QJX3 1G86A 4OI0A 5CG9A 2QCSB 3USUB 3L2YA 2R30A 4XPVA 2PLV2 1RUD3 3WINE 4AI0A 1FV3A 2BYVE 5CADA 3S0MA 2GAUA 2WQZC 1AL22 1N3QA 4LNVA 5ABJC 2I45A 1NE4A 1N1VA 2DCYA 2WSVA 2QFEA 3ZYGA 2WNUA 2HWB2 3HAGA 1EAH2 2QE3A 3QOPA 5T5LA 3KS7A 2R041 1NCQA 1U5XA 2MNGA 1YFUA 3RNSA 1EV11 1H8TA 1KITA 1Q3EA 4N43B 4BE3A 4CDWC 2A73B 4AHXA 2CYFA 4M0NA 4NHLA 1DQ0A 1BZWA 3B69A 4UW4A 2W0XA 4NVPA 4MYEA 1VBE3 2VMGA 2VUJA 2A3WA 4Y20B 3ZFGA 3B9IA 2JE7A 5E88A 1OA4A 1RUE2 5FPXA 2BFUL 1QNWA 2WS93 2VW2A 4DOUA 4G4FA 1RTVA 1CJDA 1VBA1 1Y9QA 3T2TA 4DS0A 5I8TA 1ND2B 2GNTA 2RS32 1POV1 2TBVA 2ZZJA 3NKTA 4H7MA 1JW6A 4RR3B 2IC1A 2NLRA 1XU2A 3NAPA 4WVMB 2V09A 4MGKE 3M3QA 2LALA 4LBJA 4I02A 1PO22 3USUA 3WP5A 4CDUA 1TME2 3B02A 1MR5A 3LOIA 3ACLA 5K0UB 3IT8A 3PHMA 2VNGA 4B7KA 3J9SA 4XF9A 4DMIA 4WVVA 1AYN3 2GZWA 1COV1 1DU3D 2XVGA 1RJ7A 1AXZA 1SLBA 4FPHA 2HWE2 4EN7B 1N3PA 3GHMA 3IDBB 4FO9A 2UWCA 4GWNA 4JDNA 3NV3A 4IEVA 4D7YA 4RL7A 1NY72 3MI8A 3JCIA 4J1WA 4XEZA 4X8PA 2LTNA 2UURA 5KXEA 5L7OB 1C57A 5HXVA 4ATFA 1LJ7A 3QH7A 1QU0A 3KCXA 4FBFA 2MEV2 1FPN3 5T5JA 1J1LA 4LE3A 4FAHA 1U5YA 1V6KA 2Q1MA 3NW4A 4JRAA 4XE9A 4FQ4A 2R6QA 4N7UA 4ONUA 1RUJ2 3IBMA 5GLWA 1QJU3 1XRUA 2X5IC 4XMAA 3WDYA 4EROA 1AR63 1ZRRA 1S2BA 4KWKA 4GH4B 5A33B 4OZXA 4XJAA 4PJYA 4LBQA 5FRAA 1BMV2 1CD3G 2YPJA 5JIUA 2DFCA 2Y0OA 4QXKA 3MPBA 5KHJA 1RUC1 2DVDA 4CP0A 3GZAA 4PLOA 5F1RA 5EXOA 1OHFA 4RR3A 4M0HA 1HQLA 1CAWA 4RGGA 4WVMA 1QH6A 4QHBA 3OYWB 1VRH2 2E63A 3P3NA 5CFCC 2FMDA 5JOZA 1HRI3 2G4IA 1UN1A 1DBNA 1FV2A 1ND2C 3RMYA 2X29A 3AZZA 5AC91 2BWAA 4Q4Y3 4WVZA 2UY9A 3D82A 3ZXDA 1HXS1 1KS5A 2YMZA 3GZTB 1HQWA 3M3OA 1RUF3 1PGL2 4YVSA 4I0BA 5CNAA 2ZGOA 1IPJA 1CJPA 4FT8A 4IEWA 1AYM2 4HZFA 4PIYA 4Y22B 5L7OA 5K0UC 2W39A 4R9AA 2PAKA 1RJ8A 2RE9A 4YFWA 2WNVC 2PHUA 3T1LA 1R1A3 1VBD1 2VECA 4I01A 4OUMA 4PF5A 3VHOA 3H1MA 4J6GA 4IESA 3ZSMA 3WG1A 1YFXA 2WZR2 2GN3A 1A3KA 1GR3A 4XFCA 3P3PA 3RI8A 2PHFA 1GQHA 2WZPP 5F6LB 1W0PA 3O12A 5JVVA 1MVQA 2VULA 4YW1A 4DZGA 4LO6B 4BPZA 3AZYA 5E8AA 4Y24A 2AUYA 4YW5A 3AYEA 4H55A 1UPSA 5A3LA 2DVBA 3OJBA 1OOPC 1JUIA 3G7DA 1ALYA 1SLTA 1YUDA 3PLQA 5D8AC 1VAVA 2AZ5A 3N7LA 5C4WB 4HPKB 3V64A 1TMF2 2ZGMA 1ULGA 5HBAA 2RHPA 3ZIXA 4XZPA 4COWA 1MQTC 2K2SA 1AR71 1MEC3 1OLQA 1U5IA 4HN1A 4JQRA 4YZ4A 4A7ZA 1DHKB 4L8QA 3JBG2 2YYOA 3A0KA 2ZGKA 4C0HA 3N4MA 2XBO3 5BNOA 2AYHA 4Y22A 4QGMA 3HBZA 4COYA 2ILMA 1RVF1 5IK5A 1XNBA 4JGYB 4HL0A 1HQNA 4Q4V1 2I07B 1ZZ9A 4LBQD 3AMNA 2D98A 1ULFA 2IXCA 4IV1C 3ZN4A 2B45X 3DV8A 2RM21 5BV6A 1B35A 2RMU2 1LGBA 4YGBA 1C4RA 1LOCA 3D5OA 3NV4A 3FMGA 4D94A 4HKOA 5BNNC 1AX0A 1WW4A 2ETEA 4IL7A 4ISRA 5CFDB 2PLV1 4P9YA 2ZX1A 1ASJ2 2ZGTA 3E5QA 4KGQA 1OI6A 1K5MB 5T54A 1Q8OA 3V0BB 1DZTA 2XWJB 2OIIA 5DG2A 1KFXL 4YGCA 2Z79A 1LTEA 3VGIA 3RDIA 3ILNA 4HETA 1W6QA 5ACA1 1HX6A 1XU1A 4F3JA 2HWB1 4RHV3 4OVEA 4SBVA 4XJ8A 1EAH1 1QJZA 4FTBA 3CJIA 2JDZA 2PYTA 4XXAA 2IFRA 2E7QA 1JHNA 1C8M3 4Q4X1 4QMAA 1ENRA 1JH5A 3A0NA 1PIV1 1X7NA 4X6RB 3FJSA 2VW1A 4XJUA 2Q5TA 2D3RA 5F5QA 3BCWA 3D8CA 2Z2SB 1FOD2 4QPGA 4Q0UA 2ATFA 2HWC3 3UKTA 2PHTA 3I59B 1V6LA 1D2QA 3JD73 4GA9A 1NA1B 4JGZA 4TWTA 5C4WC 3WDWA 4YYOA 3ZSLA 1RUE1 2XKPA 1O4TA 4CDXA 2WA3A 1O5UA 2D97A 4WM8C 2LUWA 3R05A 1Z0HA 3BU7A 2GMEA 5EV7A 2SLIA 5GKAC 1ZZ8A 2R072 2E6VA 5BUVA 5LK7B 5FO8B 3MLLA 3M3EA 1Q8SA 4B4RA 3WP3A 1VBC3 3U11A 3VBUC 3ZFFC 1KFUL 4RQPA 3M7AA 3VHRA 4DPNA 4CTEA 2DV9A 2ZMNA 2MHFA 4E4ZA 1NCRC 5DDJ3 4YM3A 4B4QA 1PO21 5JZGC 1KRIA 1TME1 1Z7S3 1PGW1 1ZM1A 1EP0A 2JENA 4YVWB 4BMEA 2RS53 1BEV3 4TLFA 4QX5A 1XNDA 3WCRA 1X33A 2HWE1 1RUG2 3B9CA 2WT2A 5KHGA 1C5IA 1QQP2 1RUI2 4COUA 2JG9A 2NYYA 2ZHLA 3JQWA 2BVBA 3GALA 3OY8B 4Q0PA 2KA3A 4NPRA 1LHVA 2ZHMA 2X8KA 4P9IA 3TRSB 2XLAA 3BB6A 4XXPA 1QOSA 3V0AB 3W9AA 2AENA 5B2GB 1QNYA 2X53S 2DWRA 3VDDC 2EIGA 4KU7A 4PIZA 5FLJA 5AFBA 2ES3A 1UIJA 3O0VA 1REDA 4FPGA 1OPMA 4ZU4A 4BZ4A 2EAKA 4G9SB 3VBSA 4K40A 4JDMA 3ZYPA 1WCSA 3ILFA 4Z92B 4GWMA 3DUIA 2NN8A 3N35A 4XQDA 4IERA 3PJYA 4RA0A 1G9DA 2XGXA 5FQ0B 3TAYA 3ZFEC 1G9BA 4AGRA 2D6OX 4PLMA 5KC5A 2N7GA 1NA1C 1AL0G 4JRLA 4AFMA 1ZBA2 1VRH1 2D43A 3E6BA 4E27A 1RIRA 4AFCA 3EJKA 4X8NA 1O3RA 1MS3A 2ZMKA 4ITCA 3VKFC 4PBPA 5D1IA 3H0OA 1YFYA 2A6XA