1EAH3

Pv2l complexed with antiviral agent sch48973
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
235
structure length
235
Chain Sequence
GLPVLNTPGSNQYLTADNYQSPCAIPEFDVTPPIDIPGEVRNMMELAEIDTMIPLNLTNQRKNTMDMYRVELNDAAHSDTPILCLSLSPASDPRLAHTMLGEILNYYTHWAGSLKFTFLFCGSMMATGKLLVSYAPPGAEAPKSRKEAMLGTHVIWDIGLQSSCTMVVPWISNTTYRQTINDSFTEGGYISMFYQTRVVVPLSTPRKMDILGFVSACNDFSVRLLRDTTHISQEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords POLIOVIRUS TYPE 2 COAT PROTEINS VP1 TO VP4
publication title Structure of poliovirus type 2 Lansing complexed with antiviral agent SCH48973: comparison of the structural and biological properties of three poliovirus serotypes.
pubmed doi rcsb
source organism Human poliovirus 2
molecule tags Virus
total genus 37
structure length 235
sequence length 235
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1997-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1eah300
2BPA2 1QJX3 1CJDA 5CFDC 5BNNC 1RUG3 4CEYB 1POV1 1VBD2 3TN93 1FPN3 4RQPC 1RHI2 4CEYA 1X36A 1RUJ2 1VBE1 1HXS2 4GB33 4PDWC 1ZBE1 1R082 1AR81 4RHV2 5ACA3 1IHMA 3VBSB 3NAPC 1AL23 1K5MB 4CDUC 3VBSA 1R091 1QJU2 2MEV1 4QPGB 4QPIB 1K5MA 2PLV3 4FTEA 1NCQB 4QPGA 2RR12 4QPIA 2RS51 1FMD2 1C8M1 1VBB3 1NCQA 1V9U3 4Q4V3 3HAGA 1AR61 1RUD2 4RS5C 1EV12 2XBO2 4RFT0 1PGL1 1TMF1 1MEC2 4Q4X3 1VRH3 5CFDB 1FOD2 5BNNB 5DDJ1 5FMOL 1PVC3 1AYM3 1RUF3 4RQPB 2R071 1RUI1 5JZGA 4PDWB 4RQPA 2WLPA 2WZR2 1HX6A 1RUH2 3NAPB 1VBC3 4PDWA 4CDUB 5L7OC 1D4M2 4IV1C 4AEDC 1EAH1 4CDUA 1QJZA 1VB2A 2QQPA 4CEWC 1HRV2 2RS12 3VBUC 3VBFC 4RS5B 3JBG1 1HQNA 4Y5Z0 2HWC1 1R1A3 4JGZC 1PIV2 4RS5A 2WWSA 4Y4YA 1RMU2 2RS31 2HWF1 1ND3C 3M8LA 1PGW2 1ND2A 5AC91 1TME2 3ZFEC 4Q4W2 4GMP0 5GKAC 2R043 5L7OB 4IV1B 4AEDB 5LK7B 2HWE1 1NY72 1W39A 1BMV1 5L7OA 1QJX1 4GH4C 4IV1A 4AEDA 3VDDC 4CEWB 1RUG1 5C4WC 3VBUB 1COV2 4CEWA 1VBD3 1FPN1 3VBFB 1RHI3 3VBUA 1RUJ3 4GB31 1AR72 1HXS3 1RUE2 4RHV3 5ACA1 3VBFA 1BBT2 4JGZA 1QJU3 1BEV2 1X33A 5BNPC 2RMU2 4NWVA 2PLV1 1ND3B 2RR13 1FMD3 4Q4V1 1VBB1 3ZFEB 1ND3A 1Z7S2 1AL0G 2XBO3 1PO12 1QJY1 4BCUA 1RVF2 4GH4B 1MEC3 3VDDB 2WFF2 1NG0A 1FOD3 4Q4Y2 4GH4A 5C4WB 1GFF2 3VDDA 1PVC1 1AYM1 1RUF1 5C4WA 3ZXAC 2WZR3 1AR91 1RUH3 2MEV2 1VBC1 2WS92 2R062 1WCDJ 1D4M3 5BNPB 2TBVA 5JZGC 1H8TC 3DPRC 2HWD2 3J8F3 1NA1C 5BNPA 1AR62 1CD3G 1HRV3 4WM8C 1F8VA 2ZAHA 5DDJ2 3ZFGC 1RMU3 3CJIC 2DF7A 2R072 1RUI2 2RM21 1ASJ1 1HRI2 1TME3 4Q4W3 2R041 5JZGB 1H8TB 3DPRB 1NA1B 1ND2C 1H8TA 3DPRA 1NA1A 4WM8B 3JBG2 1COV3 1VBD1 1RHI1 4GMP1 4WM8A 2IZWA 5A33B 1RUJ1 1AR73 4RHV1 1RUE3 2GSYA 1BBT3 2RS32 2HWF2 4N43C 1VBA1 5A33A 3ZFGB 3CJIB 2HWB1 2BBVA 1ZBA2 3ZFGA 1E57A 1BEV3 3CJIA 3FBMA 5AC92 2RMU3 3VBRC 5FMOS 2RR11 1FMD1 1Z7S3 2BFUL 1QQP2 1QJX2 1NCRC 3JD71 5ABJC 2XBO1 1PO13 5J98B 1RVF3 1MEC1 1ND2B 2WFF3 1POV3 4FTBA 4Q4Y3 1AYN2 1AUYA 1PO22 1OPOA 1RUC1 2WZR1 4N43B 1OHFA 3S6PA 2WS93 2R063 4N43A 3VBRB 3TN91 2HWD3 3J8F1 3VBRA 4NWWA 1R083 4JGZB 1HRV1 1QJY2 1NCRB 1MQTC 1AL21 5ABJB 5DDJ3 3VBOC 1NCRA 5ABJA 1PVC2 4YVWC 1RMU1 2R073 1RUI3 1V9U1 1AR92 4CDWC 1RUD3 1EV13 1PGW1 1HRI3 3IDEA 4Q4W1 4Q4X1 1VRH1 1M06G 1VBE2 1ZBE2 1AR82 4CDXC 1R092 3JBG3 1MQTB 4N53C 5BNOC 1VB4A 1AR71 5A32B 1RUE1 3VBOB 1OOPC 1MQTA 1BBT1 2HWF3 1C8M2 2RS33 2RS52 4YVWB 4WM7C 5A32A 3VBOA 1ZBA3 4YVWA 2RM22 4YVSC 1ASJ2 2RS13 2RMU1 4CDWB 1PGL2 1TMF2 4CDWA 1R1A1 1PIV3 1Z7S1 3ZFFC 4RR3C 1QQP3 1PO11 2X5IC 1RVF1 5D8AC 2WFF1 4EJRA 2FZ2A 4CDXB 4Q4Y1 1AYN3 4CDXA 1EAH2 1PO23 4N53B 1VBA2 5BNOB 2HWB2 1OOPB 4N53A 5BNOA 4WM7B 3VBHC 2WS91 1OOPA 2R061 2ZZQA 4WM7A 4YVSB 2HWC2 3JB4C 2HWD1 4YVSA 1HXS1 3JD72 1R081 1QJY3 1B35C 2GH8A 3ZFFB 4RR3B 3ZFFA 1QJU1 2X5IB 4RR3A 5D8AB 1POV0 5CFDA 2X5IA 5BNNA 1RUC2 5D8AA 5K0UC 2HWE2 1AR93 1BMV2 1RUD1 5C8CC 5CFCC 1C8NA 5J96B 1EV11 1HRI1 4Z92B 1RUG2 3NAPA 3VBHB 4JGYC 3TN92 1FOD1 1FPN2 3J8F2 3VBHA 1VBE3 4GB32 5ACA2 1ZBE3 1AR83 2FZ1A 1AL22 1RUH1 1B35B 1R093 2MEV3 1B35A 2PLV2 1A6CA 1VAKA 1D4M1 2RS53 2BFUS 1C8M3 1VBB2 4Q4V2 1V9U2 3LOBA 2VQ0A 1AR63 1ZBA1 2BUKA 2RM23 5K0UB 4FTSA 1SMVA 1ASJ3 1RB8G 2RS11 5C8CB 1TMF3 5CFCB 5K0UA 4Q4X2 1VRH2 4CDQC 5C8CA 5CFCA 1PIV1 1AYM2 4JGYB 1RUF2 2Y26A 1QQP1 5C9AC 4IV3C 4JGYA 1F2NA 2ZTNA 1VBC2 4GMP3 1AYN1 1TME1 4SBVA 1EAH3 1PO21 1VBA3 2HWB3 1NY71 4CEYC 1NOVA 2HWC3 1COV1 1R1A2 1DDLA 3VBSC 4CDQB 3ZFEA 3JD73 1K5MC 4CDQA 5C9AB 4QPGC 4QPIC 4IV3B 3JB8A 1NCQC 1BEV1 5C9AA 5AC93 4IV3A 4FSJA 4LLFA 2XPJA 1RUC3 2R042 5FOJB 2HWE3
chains in the Genus database with same CATH superfamily
3AVRA 4LK6A 5AVPA 4YZ1A 2JENA 4MHRA 1CJDA 5BNNC 1ODNA 4YZ4A 2CTVA 1RUG3 3FBYA 4LUMA 1POV1 1J84A 1GWKA 3E5QA 4KWJA 1FPN3 5HCBA 3QH6A 4CEYA 1UYYA 1XOYA 4E4ZA 4RHV2 1VP6A 3WVJA 2W47A 4PDWC 1R082 5JIAA 3I2KA 3ZMNA 3RYPA 3ZMOA 1GP4A 4LHSA 3IDBB 4CPBA 2VNOA 2NP0A 3CKHA 1OD5A 4XW3A 2AC1A 1XRUA 3W9AA 2WZEA 1H2LA 4EN8B 2AEYA 4CDXB 1H1IA 1DFQA 1S55A 2YZ4A 4PCRA 1TE1B 2YBPA 5JR2A 1K5MA 4XJ8A 1GBGA 4LBQA 4DB5A 1ULFA 4QPGA 3J7HA 5A6QA 1FMD2 1C8M1 1I9RA 3EO6A 3POJA 4ONUA 1CR7A 4QHOA 4DXSA 4E9KA 3HAGA 3DCQA 4QU1A 1H6XA 1LRHA 3A21A 4L8QA 3ILRA 1F5JA 1OVSA 2X05A 1PGL1 1UY4A 3RRDA 4NHKA 2RVAA 3GCXA 4YG0A 4XFAA 3AZZA 5BNNB 3S5QA 5FMOL 4JKLA 4XMAA 4ASKA 1RUF3 2E51A 1YCIA 4XTPA 1I5ZA 1Y9MA 5JZGA 3J9SA 1YQ8A 1UYXA 2WKKA 4PDWB 4QDRA 4D7YA 1IZ3A 3LSEA 3MIBA 3IDAA 3R4UA 4E8DA 5FZ8A 3OPWA 2XLAA 5LBBA 1O6UA 4AVBA 5L7OC 4PQ9A 1JHNA 3UJQA 3B93A 4UFKA 3C7EA 5FXVA 2WO2A 1AJOA 1QJZA 1YQ5A 2QQLA 1GQPA 3IIAA 3AMHA 3RZMA 3PIGA 1SFYA 2IVIB 2PMWB 4I02A 4KBZA 1W3VA 5FXWA 4CU7A 4CEWC 2J42A 4FAGA 4BQ3A 2XOMA 3VBFC 5C5TA 3MF9A 3JBG1 3O12A 1S0JA 2HWC1 2OZJA 3IMNA 3M4FA 2JJ6A 3TWIA 2I45A 4EWAA 1UKRA 4DRRA 1IPKA 2GALA 2CYFA 5C71A 4LORA 3RYKA 3SITA 4QB2A 4HLTA 4R9BA 2YB7A 3KD4A 3DXUA 1PGW2 1ND2A 1JHJA 3WW4A 4N9HA 4UF0A 4YGEA 1H1AA 5L7OB 1QNWA 3ZXKA 2HWE1 1GMMA 4R8HA 1W39A 1PM4A 1V6IA 1UMZA 5F2SA 2YV8A 4MV2A 2WSVA 2Q8EA 2W39A 1CZTA 4CEWB 4FPKA 3ZX7A 2BBAA 1URXA 2TNFA 1PK6A 4MXVA 1G9DA 2V72A 3PUHA 3AP5A 3E5UA 1YI7A 3VBFB 4XURA 5L73A 5I91A 3VBUA 1QKQA 1RUJ3 1XNTA 2F4LA 3PLQA 5JI7A 2XJPA 4DY3A 2OUJA 1Y43B 2MHFA 2HJIA 3RDIA 1GWMA 1QJU3 3N7MA 4LNVA 2HYXA 5BNPC 2JECA 1XSRA 2A5ZA 2VH9A 2XONA 4NHLA 1XU1A 3GJBA 2C0ZA 4AHWA 2FDHA 4HVOA 3AZVA 3TNPB 1MVQA 3KV6A 4A42A 4Q4V1 4K40A 4L9BA 4OLLA 2K2SA 1H30A 4M01A 2PAEA 2XBO3 1PO12 4BCUA 2DU0A 2RDRA 3UGFA 1V6NA 1C3HA 3N9PA 1WW7A 1MS0A 1UW8A 2WFF2 3HN1A 3KM5A 4PLOA 4RGAA 2WJSA 5FJHA 4XFGA 3CBNA 2A75A 4RGKA 3S7IA 3POSA 3O7OA 2ZEYA 1CQ9A 3ZXAC 4IE4A 5FZ4A 5G05L 1LHNA 4W6WA 4LO6B 2WN2A 1VBC1 1QOOA 4H3WA 4P9IA 3VZLA 2ZA9A 1LOGA 2BV4A 2ZBJA 5BNPB 4AGRA 5JZGC 3MDPA 1HIXA 1HW5A 2HWD2 1H1MA 2IVJA 3AMQA 3POFA 4G4FA 1GQHA 3L2YA 4UW5A 2ZX1A 1D0HA 2DBNA 1AXKA 3OSDA 3HOBA 4ZU4A 3VN4A 1WZXA 3LDRA 2DCYA 3AP6A 1LESA 2W52A 5F5QA 4DPNA 3FE5A 3N35A 4AVTA 2VMDA 3AX4A 2Q4SA 4FFGA 1YJKA 5EFUA 2R072 4K7JA 4BK5A 2Z2SB 5DAVA 5EQUA 4QMAA 1CAUA 4NAMA 2OPWA 3GYDA 4E27A 3BN6A 3WP4A 3NVCA 2GNDA 2BVBA 4E2QA 3G7DA 2A6WA 2VZTA 4NVPA 2XLGA 1XBFA 4NROA 2WNUC 3NO8A 3ZSJA 2R041 5IFTA 1W6PA 1CX1A 4FP2A 3PU3A 4B7EA 5JZGB 4P9GA 2VAUA 2ZHLA 4LEJA 1ND2C 3LDKA 4CXYA 4PBOA 3W5NA 1H8TA 3DPRA 4QU2A 3L2HA 4RD7A 3ZPYA 4MGYE 3NJYA 1UZWA 1GLHA 2O8OA 5L9BA 1SDDB 4RHV1 2Z42A 1RUE3 3SXWA 4ARYA 4N43C 4ISQA 5A33A 1GQGA 1LOBA 5IW0A 4C0BA 2HWB1 2JDNA 4HT1T 1AX0A 5GJ6A 4U36A 1OA2A 2ZGTA 3DGTA 1E57A 4XABA 3ZFGA 3O1UA 3E6CC 3FBMA 4B1LA 1MS3A 3SH3A 4W65A 5HXMA 2JG9C 5FMOS 4MSVA 1PNGA 3POBA 3N3HA 3GALA 2G19A 1LGCA 1FMD1 1DCSA 4GJZA 4IEPA 3ZDVA 1Z7S3 1W05A 2WNUB 2ZGQA 4A7KA 5FY4A 2F17A 3JD71 4AWDA 1W6OB 1JOPA 4XE9A 2SBAA 2EIBA 1ND2B 1XNBA 3OY8B 1W8ZA 3HVDA 1YUDA 2DCKA 3DYMA 4Q4Y3 4UF0B 5I8SA 3CQOA 1T6BX 1DZRA 5FZKA 4A6OA 5I93A 5LW9A 2JDPA 3R6SA 3USUB 4CE8A 1PO22 3C7GA 1W8FA 1SPPB 3ZYIB 2W9XA 4N43B 2FBEA 2LROA 3OYWA 4G9SB 4LIVA 4P9XA 4RA0A 5FMDA 4BJ0A 5KXDA 3V0BB 4YWAA 2WBKA 2WS93 2ZCWA 4NIHA 3M3CA 4XF0A 3CZJA 5FZMA 3ACFA 4AEKA 3WNOA 4HONA 3B9IA 2JG9B 3J8F1 4HKOA 2NZ9A 1JUHA 1XPWA 1NQDA 3NJVA 3VBRA 1DQ4A 2EAKA 4NWWA 4ARXA 1R083 2OUHA 3C7FA 4Z1VA 4O65A 3U78A 5F5AA 4JV4A 2W1WA 4ITCA 1UY3A 4QWNA 1UO9A 4Y1ZA 4CTEA 3EQEA 3LIHA 5DDJ3 1NCRA 5DPNA 5ABJA 2CL2A 4YVWC 4Q8LA 5CG8A 1KGYA 3K4AA 1E5SA 5IVVA 1WMXA 2Q1FA 5KHHA 3WF2A 5A6YA 4BIOA 5A1LA 1S0DA 1D2QA 5B4NA 3CNAA 2FQPA 3G6JB 3KWVA 4WVZA 4C1WA 3ZYFA 1PGW1 4ORFA 4TXWA 4CUAA 1HB1A 1NZCA 3CJXA 2Z79A 3WDUA 5FZCA 4QB1A 1VJ2A 2FDJA 4GQ7A 2LUWA 1LAJA 2OZ6A 2PQQA 3H3ZA 3JCIA 1ZBE2 3WINE 4H7LA 5DG2A 2RV9A 3LQCA 3PVNA 5F37A 1OSGA 3RPQA 3UYJA 1APNA 3IM0A 5FZBA 1UU4A 4P9WA 2Q0AA 4QHBA 3OTFA 4CDXC 2J7MA 2D5HA 5KHJA 2WT2A 3AK0A 2Q5TA 1OUXA 3W21A 5CVRA 3KV5A 1OOPC 2DVDA 2IWGB 2HWF3 2RS52 4FOWA 4YVWB 2VW1A 1GP5A 1LEDA 4WM7C 5EWSA 4MZUA 4W4ZA 1ZBA3 5FY1A 2XUMA 4MGTA 4XIKA 1ASJ2 1WW5A 2NN8A 3RNSA 1OXCA 4FP3A 3B94A 2ZGMA 3R4DB 4CDWA 1C1FA 1NLSA 1LU2A 1CN1A 1JTZX 3H1MA 4RSUA 3VHOA 3OPTA 4YNIA 2G9GA 4XJAA 2QJVA 2P4EA 2JG8A 1PO11 2X5IC 4BA6A 2XJVA 2JE7A 4UFLA 2WFF1 4YM1A 1J3QA 3WDWA 3ZDSA 4Q27A 4EJRA 3K3OA 5HCFA 1S2EA 3SKJE 4WBBA 3WSOA 1KXGA 1DIWA 2J1UA 2PTMA 3WX5A 2PELA 3ACIA 4K1ZA 1N47A 1VBA2 5CEHA 4HSLA 1UMIA 1HB3A 1C1LA 5KBFA 1OOPB 4N53A 4QHZA 4YM2A 5BNOA 1UZVA 4WM7B 4FPJA 1JODA 5JPNB 1JZ5A 1PZ7A 4LBJA 1OLMA 2P3KA 5I0RA 2VBBA 4XZPA 2YROA 4CSWA 3SCHA 3MLJA 4J25A 4A7ZA 2HWD1 1GKBA 3U4SA 2V5YA 2QQKA 1XE8A 2Y0IA 5FMBA 3NV2A 4IE7A 4LHLA 4OI1A 1QJY3 2EA7A 3OG2A 4XFFA 3TYJA 1WBFA 1JZ2A 2FMDA 1GNZA 3PVBB 2OKXA 4KQ7A 2JIGA 2X29A 2X5IB 3ZFFA 1SFPA 4XF3A 3VD5A 3GM8A 4LOSA 2UY8A 4FPFA 3N9OA 5CFDA 2A7AA 5IK4A 4COUA 1RUC2 3H50A 5D8AA 1F35A 2BGPA 3RMYA 1AR93 3CMGA 3MIEA 4X8PA 3V0AB 5JMCA 4D6QA 5EZWA 4O9GA 3A22A 4DUVA 2DWRA 2PHUA 5J96B 1OH3A 2HBTA 1PX4A 1W2AX 4Z92B 3DYOA 1RUG2 3NAPA 4CCEA 4DXRA 2VUAA 4YW5A 3AC0A 2Q1MA 1FPN2 4ES8A 1JZ8A 2VC9A 1ZZCA 5F7UA 4D0QA 5L9VA 1VBE3 4Y3OA 3ZN5A 4Z2WA 4CCDA 1AR83 1E5HA 1LNSA 1W8UA 2WR9A 3MIHA 4JRAA 1UY1A 3HT2A 4YGCA 4LO5B 1W9YA 5BYNA 1I5PA 1RUH1 5A3MA 1R093 5JLVA 3JZVA 4V1PA 1YFYA 2WNVC 2XMLA 5KHIA 5GZCA 1NE6A 3RZJA 2CGOA 3ES4A 4L0PA 4TN7A 2A3WA 2D6NA 4DY5A 3IAPA 2E31A 3MLLA 2AGSA 1J83A 5DAWA 2EXJA 1UZ0A 3K48A 4XUPA 2BJSA 1KJRA 4W6YA 2EICA 3HIFA 3VD7A 3EYPA 1RB8G 1X7NA 2RS11 2J1TA 4CP0A 4EYUA 2VBPA 2QQWA 3N9LA 3T4HB 3I3BA 3POWA 4OHXA 5FLHA 4PJYA 1S2KA 3D3AA 4AVAA 5C8CA 5CFCA 5H9SA 1PIV1 3BGAA 2B8MA 2Y38A 4LUKA 5JSPA 1RUF2 2Y26A 2KD7A 4IEOA 3FFQA 5C9AC 1R64A 1D7PM 1IS5A 1F2NA 3WV6A 4HOOA 3WNPA 2PHDA 3QACA 5LY2A 4AGGA 5GALA 2GN3A 2GNTA 4GMP3 2ARCA 4OI0A 3INAA 3JQWA 2JDUA 4B29A 2B46X 2WNVB 1PO21 3CEWA 4C1XA 4CU8A 1SLIA 3M7AA 3DN7A 4BXSV 3ZSEA 5IAXA 4JVAA 2CY6A 3HQUA 4FOVA 4YW6A 2K9ZA 1NYWA 3MBWA 4D7TA 5T55A 1NOVA 3SKVA 1KS5A 5T5LA 1KQRA 2VOKA 5FXZA 5FP9A 1JW6A 1QY4A 2GC3A 1U5XA 1IKPA 5K4LA 3UV9A 4Y24A 2WLQA 1QXPA 1W90A 3QBQA 3ROUA 4ZU7A 3IPVA 1HLCA 4J6GA 4CDQA 3ILNA 1MS8A 5FZOB 4R9CA 2JIJA 5C9AB 1BXHA 2GMPA 2W5FA 4QPIC 1C4RA 5FBZA 1NCQC 3LEIA 4NHMA 5C3OA 1WCKA 3LE0A 4NIGA 3AP7A 4AVSA 1FNYA 4ZU5A 3N4MA 5FYUA 2AEZA 4LLFA 3TEYA 4ZS3A 3POEA 4XVHA 1WCSA 5I8TA 2W3JA 3NNJA 1VMFA 2Z69A 3BCWA 3E1F1 4I09A 5FO7B 5CFDC 5HBAA 3M2MA 3WQ7A 3R4SA 2E7TA 3T08A 4EWDA 3Q8CA 1O3TA 3KT4A 3AL5A 1JYVA 3B7MA 1RUJ2 4GB33 2VG9A 5A1AA 1UIJA 1HDKA 1ZBE1 3ACHA 5JOXA 5LBFA 1PM7A 4AI9A 1S1AA 1V70A 3NAPC 4KWUA 5T54A 3N7KA 4NAOA 3DXTA 4WVWA 1W2OA 5IT6A 5DN2A 2DCTA 4CDUC 2MEV1 1QJU2 2KM2A 2XVLA 4ISRA 3AYDA 4XUOA 5E88A 4YGDA 3IZOA 4FPHA 4QPIB 1XNDA 3CO2A 4FTEA 1NCQB 5KXCA 2D40A 4X6QB 1AXZA 4YFWA 5DZEA 3WNMA 3ZYBA 2RS51 2W94A 1OH4A 1VBB3 1LR5A 1V9U3 3OOXA 1YQ2A 5FYCA 4E2GA 5CG9A 1JN2P 4Q0UA 1J58A 3I59B 4I0AA 3CDZB 1H2NA 2YU1A 4UWDA 1O3QA 4FAHA 4RS5C 1EV12 2XBO2 3IWZA 4QQOA 3RG0A 1N3OA 3BU7A 1CIWA 4RFT0 4YW7A 3S5AA 2YYOA 1UF2C 1CZVA 2KA3A 2CWSA 2ETEA 2VZPA 4UT5A 4XMIA 4AFCA 4Q4X3 4B1MA 2XWBB 2OPKA 3K51A 3OEAA 4CUGA 5CFDB 4Y20A 5FZDA 2BNOA 3ME2A 5APAA 2AYHA 1AYM3 1X9PA 3EJKA 1CAXA 2VW0A 4Y26A 2PHLA 4YPJA 2Y60A 5J1XA 1RUI1 4COYA 3WUCA 2XVKA 4FOYA 3NAPB 4FI9A 4PDWA 5FYZA 3ZN6B 1UPSA 4FT8A 4CDUB 5DQ0A 2QE3A 2GMMA 5T5OA 5CA6A 2Q30A 4AEDC 4XXPA 1VALA 2ORZA 2ZHKA 4HKLA 5IK5A 2GC1A 5CIRA 1H9PA 1SBFA 1UOBA 2E63A 3AYEA 4LBKA 1IS3A 2JDYA 1O8SA 5FZ0A 5ACA1 3BU0A 3SEPA 3H3LA 1SFNA 5JSOA 3D6EA 1QIQA 5C8WA 5FK8A 2XL9A 4RS5B 1YYNA 1R1A3 2KR2A 3GHNA 1QXJA 3ETQA 3NNFA 4JGZC 4OUMA 2X09A 3OPZA 4RFRB 1WW4A 3VZMA 3MHZA 2BYVE 1EP0A 2RS31 4BHPA 1WA4A 3RZKA 4AAPA 1FATA 1OMIA 2IXKA 2JD4A 3AKSA 1NZIA 1DYKA 4LK7A 1IG3A 1MR5A 1WCUA 2Q8CA 2D6MA 4Y5SA 3U4XA 1LEMA 4PF1A 3RI9A 1GR3A 3LFMA 1ENSA 4WVMB 4IE6A 4AEDB 5A7WB 3N36A 1NY72 3DYPA 4XACA 5L7OA 4BLJA 5A7OA 4GH4C 2BP6A 3VDDC 5K7PA 4OULA 4QGMA 1W8TA 3KT1A 2VO5A 4ASMB 1W9SA 1RUG1 3SH4A 4AQ2A 4KGGA 4CEWA 1Y4WA 3FN9A 1ZRFA 1FPN1 1YFUA 4Q29A 3IB3A 3J7NA 1HXS3 1RUE2 2BGOA 2R0HA 3VBFA 3CU7A 5EYYA 5G04L 3C3VA 2Z4FA 3E97A 1K42A 4MADA 3IIIA 1OLQA 3OBAA 1HN0A 3RFRA 3HEIA 4AHXA 4AEMA 2B39A 4CCOA 4QKFA 4JKMA 4QQPA 2AENA 2RR13 4KNCA 3AXEA 2ZAAA 4PQQA 5L19A 2K46A 3LOIA 5FY8A 1Z7S2 1JU3A 2XKPA 2VOWA 4MVTA 2IXLA 4EE2A 1ZYBA 4A45A 1RL3A 1AXYA 1A78A 1DGRA 4GH4B 4KU8A 2YPDA 3VDDB 1OBNA 2R16A 3TNQA 5LZ6A 1NG0A 1FOD3 1U0AA 4LKSA 4Q4Y2 4FPCA 4I0BA 4QKDA 4YRDA 2XB6C 1AX1A 1RUF1 4OQ8A 4EQVA 4L92A 5DZFA 3BKZA 3EB7A 3WHUA 1NKGA 2BEOA 5F6KA 2WZR3 4YW1A 5FTTC 1W2NA 4NOTA 1HN1A 2YPJA 3IT8A 2WS92 1CVNA 3WDVA 5GLVA 3U1XA 1F15A 1D4M3 3IBMA 3PTYA 5FUPA 4Q2FA 5FR3A 3ELNA 4Q0QA 1W28A 1G9CA 1REEA 2VE1A 5SV8A 3WW3A 1MPXA 4QX5A 4AL9A 5BNPA 1Q56A 1AR62 4A41A 5LCWL 1CD3G 2ZPXA 4WVVA 3S0MA 4WM8C 3PJQA 1W0OA 1L7LA 1W99A 1N1TA 4FPOB 1F8VA 4KBBA 5A7NA 1N1SA 4CCLA 3EBRA 1GZ9A 3AKTA 2LALA 1IS4A 4K9SA 3RS6A 5DDJ2 1O91A 4XJWA 3OCPA 3KS7A 3CJIC 1PMIA 5A7SA 2DF7A 3WP6A 1Z78A 1PGSA 2VCMA 4BQXA 1I1EA 2X8KA 3T3YA 3UK9A 2GC2A 2EAAA 3BPSA 1OA3A 2ZX3A 4N7IA 3LA2A 5K8SA 2RM21 3SHRA 3ORJA 1TME3 2Y33A 3OBZA 5T50A 5LA1A 1UOFA 1WCQA 2D97A 4Y20B 4Q4W3 4NHYA 1OQDA 5BPXA 4HN1A 1CAXB 4YM0A 1J1LA 2UWCA 3U14A 5DG1A 3T0AA 4M3CE 3I4IA 4IGQA 3DEMA 5JR7B 1ONAA 1VMHA 4TLFA 4WM8B 4CP2A 5JAXA 4R9DA 1COV3 1NXMA 3PUAA 4TZDA 3DECA 1KDKA 1UQXA 3MYXA 5I0DA 1CAVB 2OXBA 4BZ4A 5I0TA 3T1MA 1RUJ1 5HI0A 1OT5A 2GSYA 3T0DA 2HWF2 4IETA 5SV5A 1OF3A 1OLRA 5LA0A 1W0NA 3CJIB 4BM8A 2PXJA 4UW3A 5BY5A 1ZBA2 2GU9A 3I3EA 5LBEA 1BEV3 1W3XA 4HK8A 2R1BA 1QOSA 2ZGKA 3NMBA 3VGIA 3BOPA 5AC92 5ANNA 2HEVF 5FPXA 1ZX5A 4QD2A 1Q8OA 1QGLA 2D3RA 1RYYA 1KFXL 5C33A 5J48A 4PLMA 5FWEA 1XQNA 1L7RA 3BIEA 2VZ3A 1QJX2 4QT6A 4GWJA 2W0XA 4LTAA 4M4PA 1SBDA 2I74A 2WNUA 2XBO1 2Y6FA 2RDNA 1B09A 3AMPA 1RJ8A 1RVF3 3HQRA 3ALQA 3LB9A 4UYBA 4HPKB 1W6OA 4OUEA 4FXGB 1POV3 3ES1A 1RGSA 1ZVFA 2Y6KA 3PVEA 5DMYA 5FZGA 1G9FA 4FBFA 1KRIA 1OQ1A 3IDCB 2D7FA 3OBTA 3OY8A 4L99A 2XQRA 3LZZA 3OGGA 4FFFA 4M3CB 1ZZBA 4O61A 1WLCA 1AUYA 2J22A 3ZYGA 4QX8A 3USUA 3O1VA 1UCXA 5DXDA 4EN9B 3RWNA 3MV11 2F4PA 1SPPA 3CHXA 1NT0A 1DQ0A 1H6YA 1XJAA 2QZ2A 2R063 4N43A 4OMDA 5FY9A 1CX4A 5LATA 3V0BA 2JWPA 5I0SA 4META 3WNNA 1ZREA 3GZEA 3WCSA 1SCRA 1WKYA 3AVSA 3KVAA 4S2HA 3TN91 5CAZA 4LKFA 4PIZA 3TBDA 3LEMA 1LGBA 1VMJA 4IGOA 3S57A 3LAGA 2JG9A 1QJY2 3K3NA 2VMIA 4MYEA 4BQ4A 4P02B 4PT6A 5FPBA 3P1IA 4E4DX 3TEWA 3WDTA 4GWMA 3LA7A 4FFIA 2QDRA 5LY1A 1AL21 5JXIA 5T52A 5E16A 4YW3A 3UT0A 4YZ5A 1PVC2 1FNZA 5F3GA 4F8AA 1Q5OA 2UYAA 1UU6A 4QGLA 3MI8A 1UX7A 1AR92 2H6BA 2P5BA 2ZJCA 3CL1A 5FP8A 2CDPA 3OF1A 5FY7A 1EV13 3KZ4C 4PI0A 1HRI3 5J09A 1O3SA 1X82A 5EJZB 5IAVA 1VRH1 2GZWA 3MUY1 5FYMA 3ZKYA 5FZIA 1M06G 3OB8A 4LO8A 3I97A 1VBE2 1AR82 2IC1A 4JZRA 4Y4RA 1WWYA 4UOJA 2JKXA 4YGBA 3K2OA 3NV3A 1R092 3JBG3 1YHFA 3O1PA 3R05A 2E7AA 4QKBA 3D0SA 1V00A 4L2NA 5B4XA 3SCGA 3WT3A 1RUE1 4E4HA 4KL1A 4LITA 1SEFA 4F3JA 3OUIA 4DRVA 2N7GA 1REDA 2CHHA 4YVWA 3AJYA 4NO4A 4QQ2A 4XBQA 4Z07A 4YVSC 3MICA 4ZXEA 2WZPP 2DFBA 2RJKA 4GALA 1VIWB 4AQ6A 4ZHNA 1H4GA 2E33A 2VJXA 3MIDA 5FPUA 5LRSA 1Z7S1 4XBNA 3RVHA 5DABA 2EIDA 4BU2A 4RR3C 1QQP3 1WD4A 4OI4A 1GV9A 4XF9A 3C7HA 2J1SA 3NW4A 3B9CA 2A6YA 4GULA 2VW2A 3UKNA 1GUIA 2A3XA 3J26N 4LPLA 1ST8A 3DKWA 3BODA 4Q4Y1 5F32A 3QLQA 1AYN3 2Q8DA 3IMMA 4CDXA 5LB6A 4URAA 4OHZA 2IXJA 2GP5A 1X8MA 2WUHA 3RWKX 4ZY9A 1G7YA 3WF0A 1OPMA 1AVBA 3HQXA 1D2SA 2ZHNA 3MLKA 2WS91 1OOPA 2XUEA 2ZZQA 3TRSB 4QDSA 1JZ3A 3E6BA 4WM7A 2YG0A 4YVSB 1N3QA 5JXGA 3LGRA 3KV9A 4UFMA 1O8PA 2EXKA 4EN6B 3D82A 3T0BA 2ARXA 2GP3A 1LHOA 1IS6A 1R081 1ZZ7A 2HBUA 4WZFA 1WMDA 1Q8QA 2QQIA 4RR3B 4EWEA 5A3PA 2DUOA 2JXAA 1W06A 3DL3A 3ZXGA 2OIIA 3UESA 3VKMA 4DXTA 2PHRA 3ECQA 4GZ9A 2P34A 5C7GA 2QCSB 2ZHMA 2X5IA 4COZA 3KCCA 3WP5A 2AREA 1SLBA 1W0PA 2IFRA 4MGQA 5F5CA 4QM9A 3VL9A 5K0UC 1UU5A 4QGNA 5FZLA 3NV1A 5IUQA 1RTVA 3HT1A 5FUIA 3PURA 2JEMA 1YQCA 3MW4A 3V0AA 2VQUA 1JZ4A 1JS9A 1WD3A 2ADDA 2ZEZA 1POQA 1ZA7A 2YBKA 4GB32 1QJFA 3HMYA 3FJSA 2XPJA 4LBNA 2FZ1A 5BUVA 3MEPA 3H8RA 5HPOA 4C90A 1SLLA 4GXLA 5JXHA 1LOFA 3J7LA 4C0HA 2VZVA 3WG3A 1A6CA 1VAKA 5D1IA 1T6GC 4P14A 3FX3A 5DUXA 4DNYA 2BQPA 1VBB2 1V9U2 3MV01 5KR7A 1X9TA 1AR63 1ZBA1 2NYYA 1KFUL 5J37A 4AW7A 5K0UB 1SMVA 4FTSA 1XYNA 4QX0A 3JU9A 1TMF3 4UFHA 4FXKB 4NIAA 4LT5A 1ZM1A 4Q4X2 1ULDA 1N3PA 1D0GA 3HNYM 1WMFA 4YZ2A 3AB0A 5A3OA 5FQ0B 1SACA 1AYM2 3H9AA 1GSLA 1MZ5A 4V2WA 5JIUA 3AKQA 3SLIA 1DBNA 1SCSA 4NHXA 5KXEA 3VD9A 2ORXA 3J7MA 2ZTNA 4AR2A 2BGCA 3RMXA 2JDKA 3KT7A 4SLIA 1OA4A 1TZOA 2ENRA 2JB8A 3ZIWA 1VAVA 2VTFA 2DV9A 2SLIA 5KC5A 1NAEA 3HNBM 1W6NB 1BK1A 4XBLA 1EAH3 1W8WA 1LGNA 2HLEA 2HWB3 2R30A 1NX9A 4AI0A 5JWPA 2WNVA 4AQTA 1ALYA 4LA2A 2FDKA 2DYCA 1QNYA 1CAWA 1SDWA 1UAIA 2RJLA 2YY1A 2ET1A 1OFSA 1PMHX 4Z2AA 1R1A2 4CVUA 5FYVA 3VBSC 3THCA 3UJOA 3QCWA 2NLRA 3LDBA 3WUDA 3JD73 3ZFEA 1FT9A 3ZR6A 4DS0A 1TNRA 1W8NA 4GWIA 2R32A 3TEXA 3S30A 1YC61 2GNMA 2Y0OA 2RE9A 5FZOA 5FDBA 1V6KA 5AC93 5C9AA 4AI2A 5A70A 3WOGA 5GZEA 1I6XA 2H0BA 1ZA4A 2PAMA 2P37A 4IW3A 3WEZA 1K12A 1ODMA 1FV3A 3U37A 3ZSLA 2OVUA 5FZFA 1NUKA 2BPA2 3ON7A 1QJX3 5FXXA 4O9EA 4D94A 3EMRA 4XHBA 5C3QA 1OI6A 1ENXA 5FLIA 4CU6A 2W1SA 4MXWA 4RQPC 4BYYA 3ZYPA 3T2PA 1US2A 1VBE1 1E5IA 1HXS2 1W2TA 3P5BA 4CCMA 1AR81 4WV8A 5ACA3 1IHMA 1QH6A 3VBSB 1F4AA 2ZGOA 4XILA 5JOWA 4IEQA 2B4KA 4KH9A 3ACLA 4R52A 3I2DA 1R091 4KG0A 5KHGA 3H42B 3P3PA 4MUVA 4AG4A 5IVJA 2UURA 2G9FA 2PLV3 4ET7A 2GDFA 1OC1A 1WA6X 4FVVA 4JQRA 5A3UA 3CF6E 3LPFA 2RR12 2RDQA 4QPIA 2WL1A 3W20A 1NCQA 2VVEA 3PUSA 4Q5OA 3ILFA 5IK7A 5EJ1B 1LOFC 5FO8B 4QPYA 1RUD2 3SMHA 4MLOA 4WZCA 3QD6A 2ARAA 3I2OA 1CWPA 3I59A 3M3EA 3HN3A 4XYXA 1TQ5A 4AF9A 5M0TA 1FOD2 1SLAA 3FLRA 4ZS2A 1PVC3 1DYPA 3KGZA 5T3NA 4RQPB 1RITA 3U10A 1JMUB 3R0RA 2R071 3BALA 2WZR2 1KD7A 1HX6A 5FKBA 5H9PA 4AI3A 2ZZJA 1JZ7A 2HYKA 1YNAA 2AR6A 2XL7A 4JHTA 4AHZA 4DMIA 1J3PA 5C6CA 1D4M2 4IV1C 3VDBA 3ZN6A 3BYWA 5A7PA 4P5HA 4CDUA 1Y9QA 1VB2A 1ULCA 2QQPA 3UL2A 2Y6LA 1HV0A 3MFCA 3O0WA 1AZDA 3KHCA 1CZSA 2VD7A 4FOQA 2G9ZA 3I2JA 4NUBA 2BOJA 3K77A 2DUPA 5F9TA 2W46A 5F6LB 1S0IA 1UY2A 5E1RA 1DF0A 2J1VA 4RS5A 4S2DA 2WWSA 4JQTA 4Y4YA 1DQ1A 2VZ1A 3HWJA 5L9RA 1HV1A 3KMHA 1YFXA 1GZWB 2CU5A 1IKQA 2WZ8A 3O0XA 3V56A 4K8RB 1H8VA 3GZTB 3M3OA 3O1TA 4I01A 4GKXA 2IXCA 1Q8VA 1MS4A 1ND3C 3AZYA 3M8LA 2R49A 1NE4A 3WQ1A 1TME2 2D98A 1BQPA 3WG1A 3ZFEC 4BB3A 4Q4W2 4GMP0 4F7ZA 1UY0A 5CKNA 4FPGA 4IV1B 2ZKNA 5LK7B 4JTOA 3KHBA 2VTXJ 2VMCA 1Y3TA 4LR4A 1SZBA 2ID4A 4WVMA 4XF4A 3WF1A 1UN1A 4AEDA 5A7WA 1W9FA 3I54A 3TEZA 1VAMA 2WN3A 3I2IA 4IUGA 4LBLA 2D44A 3THDA 2CAUA 4DFSA 3EHKA 4DUWA 5C4WC 1COV2 1V0AA 1VBD3 1RHI3 3ZYHA 4GB31 2GN7A 2W1QA 3VKFC 3WG2A 5A3LA 2VNRA 4Y1XA 1RXGA 3LFIA 4JGZA 1CAWB 1AX2A 1BEV2 5JXJA 5T5PA 4NIIA 1KEXA 3T1LA 4UI9L 2RJ2A 4OQ9A 4FPLA 4QKNA 1ND3B 4LE3A 1S0FA 4MG2A 4ZPIA 4BISA 4HZFA 1VBB1 2PAKA 3ZFEB 5KC6A 4QAWA 1AL0G 2DURA 1PX3A 2VZUA 1CGPA 3WZ1A 1GANA 5FYBA 4UW4A 3AZXA 1RVF2 3WQBA 1MEC3 2XJQA 3LEGA 1YIFA 5JCTA 2ZS6B 4GH4A 1G8WA 5C4WB 4JDMA 4JHZA 3VDDA 3L9JT 1JBCA 1AYM1 5F5IA 2D6PA 2B7YA 1ACCA 3I2FA 2AACA 3NL1A 4NRMA 3VHPA 4XCAA 5CADA 4MH0E 1LODA 5HCHA 1RUH3 1AF9A 1ENQA 3GBGA 1OLME 2R062 4FO9A 2Y8KA 3VKNA 3KCXA 5FO9B 1WCDJ 2JB4A 4MXWB 4IEZA 4AGVA 3O1MA 2VCBA 1CIYA 1JYNA 1Y9GA 3FFZA 1NA1C 4CPBD 4HVRA 4KWKA 2LRPA 1RJ7A 3FLTA 1HRV3 2B9UA 1S0CA 3LF7A 3ZSKA 1BYHA 2VZSA 3OGVA 3PUQA 2VXJA 4TWTA 5CB7A 4HKWA 1WMEA 2ZAHA 4LBQD 1XE7A 1DHKB 3T2TA 4XUQA 1RMU3 5FOBB 5LWBA 1Q8SA 1QU0A 3BTXA 1VLNA 4DINB 2DVFA 4K20A 2XXZA 4MGKE 4W8JA 5FYHA 1G9BA 4OHWA 1K45A 1TG7A 2OW4A 3MW3A 3Q8AA 3MPBA 2V09A 3HBZA 5T5JA 4CCKA 2BNNA 1K3IA 4YFZA 1ASJ1 1HRI2 4PI2A 1H0BA 4HETA 1JUIA 2J1EA 5J3UA 3LD8A 1DLCA 3ENRA 2R1DA 4D69A 3EXUA 5HV4A 2YGLA 1S4CA 3OJBA 4AQSA 3C7OA 4K1YA 2O14A 5GZGA 1AHSA 2XHNA 1NA1B 4HK9A 4DQAA 2B42B 1CESA 5FZ9A 1YIPA 3GZUC 5GZDA 3JBG2 1W8HA 2CV6A 2DCJA 1UPIA 2B5HA 3A0NA 3WP3A 2R0FA 4ZKTB 2ERFA 4WM8A 3W59A 2LTNA 1AR73 4RL7A 4HANA 3TN92 1BBT3 2ADEA 1CAVA 1VBA1 4KI5M 2VTXA 4FPEA 3URFA 4A4AA 2YHJA 1UOGA 2BTVC 2VMFA 4LKDA 4CU9A 3WW1A 5J36A 2P1BA 1FV2A 4XDQA 4UFJA 3CJIA 1OD3A 3RZLA 2WC2A 2RMU3 1LOCA 1PHMA 1W03A 4AAXA 2JICA 3Q8EA 2RR11 3E6DA 3DUIA 1C5IA 1W9TA 1MS5A 3B69A 2FDGA 4YARA 4XIOA 2BFUL 3DV8A 1QQP2 2IXIA 4QDQA 3BVCA 1SBEA 4NE9A 2H0VA 3GXUA 5TSWA 1BKZA 1LJ7A 3N7LA 5LRRA 4HPKA 1AYN2 3MIFA 4BQYA 4ZXKA 3ABZA 4HFSA 2VY0A 4LKEA 5E89A 1RUC1 2RG4A 5LK5A 4M3CA 2XQXA 2WZR1 3KV4A 3C2UA 3U11A 2WWUA 1OF4A 3GJAA 1HKDA 1OUSA 3ZM8A 4BXFA 2DTWA 3HD8B 5J7MA 3I2HA 2D93A 2P6HA 3KLSA 3ZXLA 1QXRA 1ZRRA 2P17A 4QX2A 5FZHA 2PHFA 4UBGA 3D4KA 1BVP1 3NJXA 5F1RA 3SISA 3RZHA 4JGZB 1S2BA 1WW6A 3A4UA 1S0EA 3KCYA 3HNMA 2PHXA 3RGBA 1MQTC 3JUUA 5FZEA 1W2UA 2W87A 1BJQA 4IDZA 5JSRA 3VBOC 2BWCA 5B2GB 4CCCA 1JYCA 4NRQA 1LB2A 1PVXA 3KQRA 3PTRB 4BK4A 3FL7A 1DQ6A 1F5FA 4DUXA 4M0HA 4URTA 2PYTA 2QQNA 3FZ3A 1RUI3 4P5YA 2UY9A 3AYCA 1HJFA 4LLOA 1V6JA 5CISA 1RINA 4XFCA 2GC0A 1RUD3 1ULPA 3GF6A 4LHKA 2BRTA 2DTYA 3RYRA 4NJ4A 4AHYA 2ZX4A 3GGLA 1IPJA 3IDEA 2JDMA 4Q4W1 3MUZ1 3Q8BA 1QJEA 3DKQA 1DLLA 4KU7A 1GNHA 2ZABA 2DU1A 4XUTA 1RUOA 2CNAA 1XU2A 1ZRCA 5EIYB 5LA2A 3N7JA 1IQDC 4HG6B 5GLUA 1L7QA 4IEUA 3UNPA 1QDOA 1MQTB 2WRAA 4Q1PA 4Q26A 3SEEA 5A32B 3VBOB 5A80A 4S2GA 1HB2A 2RS33 1DGWA 4FPYA 1NXD1 1YQ6A 1U5YA 5A3NA 4XOGA 1NLQA 1RIRA 2WQZC 1Q3EA 2VOTA 1DG6A 2OS2A 2IUWA 3FWEA 3FC0A 3PU8A 5H9QA 2WNOA 3MIGA 4EZ4A 2MNGA 2R7EB 1TMF2 1UYPA 1U12A 3M70A 4P9YA 2FDIA 3MW2A 1LCLA 4Y33A 3WNKA 3J4UH 5LEJA 1G9AA 2E32A 3ETPA 1YJLA 4J1XA 2PN5A 4P00B 3VZKA 5FFOC 5BNQA 5IWFA 4K8FA 2Q1ZB 1RVF1 5H9RA 2P2KA 2D6LX 3GCWA 4RYDA 4XAAA 3QOPA 1BK0A 2ZGNA 3GZAA 5FPLA 1JYWA 4CUCA 3LIGA 2Z5WA 1EAH2 4AFAA 4GJYA 1Z0HA 1UXZA 2HWB2 4FFHA 2JDAA 4OFGA 1UOJA 2XJSA 4LO7A 3VBHC 4XQWA 1LHVA 1MVEA 2R061 4D6RA 4XJUA 4MGZE 2Y34A 3K4ZA 2W92A 4YZ3A 5LA9A 3AM2A 1YRZA 1GOHA 4ZZ8A 5JMOA 3JB4C 2A73B 4YVSA 4AXOA 2A71A 1U5ZA 4TSVA 3JD72 2C5DA 2XG3A 2P3YA 1B35C 2GH8A 3HBKA 3CLPA 3AFGA 3VZNA 1IOAA 1QJU1 2PQSA 4RR3A 1WLDA 2ZGUA 4XXAA 3E5XA 4HN0A 1POV0 4LHNA 1VRBA 4Y1VA 3LKJA 2MPFA 3D5OA 4XFHA 1DQ2A 1LECA 5D21A 3UGGA 1ZZ9A 4IXLA 4AVCA 5AFBA 4OCTA 1OVPA 1BMV2 3BB6A 1C8NA 4CZSA 1EV11 1UX6A 5IVCA 2FD8A 1HRI1 3T09A 3VD4A 1BLZA 4K3UA 3O5SA 3VBHB 5IVBA 2ZGSA 4JGYC 4LMFA 4D3WA 4IEWA 4UBHA 5CZKA 3J8F2 4R4ZA 5DAPA 4XCBA 4M00A 5ACA2 3WR0A 3VZOA 4JDNA 3FHAA 3AP9A 4COVA 3VDCA 4O7XA 4GIQA 1EY2A 4EN7B 1B35B 4LOTA 2IXHA 3ZXEA 3NQHA 2Y64A 5FMCA 2PLV2 2PA7A 4CRQA 2V5DA 3FUQA 4A3ZA 2ZMKA 1O5LA 4HSJA 4JRLA 1XC6A 2BFUS 1C8M3 3LOBA 2V73A 2WYSA 3K46A 2OT7A 3VKLA 1GICA 4D6SA 4H14A 5FPVA 1IQAA 2RM23 4PLNA 1O4ZA 1QWRA 1A3KA 2Y6JA 4Y22B 2PFWA 5A7QA 4RGGA 2DFCA 2D6OX 2A70A 2LM3A 5F3EA 5K0UA 3AYAA 4QM8A 1ENRA 5FP7A 2JE8A 4UFIA 1BMV1 3MO4A 4JGYB 4LXLA 4YW2A 5FZ1A 1QQP1 2VMEA 4FQ4A 4IV3C 5FQ0A 3WW2A 2HEWF 5A1FA 3M3QA 3GDBA 2PHWA 2VUJA 4Q1RA 4XZUG 2JE9A 4XF1A 3THTA 4BLIA 1BVVA 1DYOA 3OGRA 5F8PA 1AYN1 3WF3A 4SBVA 1VPHA 2EXIA 2ZEWA 2E26A 1EPWA 1W6NA 4H2AA 1J1TA 4AE2A 1V6OA 2WO3A 1NY71 5JI9A 3RZGA 4CEYC 2WQ4A 3GNEA 1GOFA 4ES9A 5LBCA 3T30A 1H2KA 2YC0A 2HWC3 2XJTA 3H7JA 3I3MA 1O3RA 2WAAA 5EXOA 4HMZA 3ZVXA 1DDLA 1YO8A 1C5HA 2XKOA 2C4XA 2FCUA 3NWKA 4CUBA 1K5MC 2VMHA 2P6CA 4N9IA 3WDXA 4YG3A 2NQYA 4CP9B 2VU9A 2QZ3A 4QPGC 5C3SA 1J3RA 4IV3B 1OQEA 1D4VB 3A23A 3JB8A 3X29B 4BH9A 3RI8A 5FLJA 1DZQA 1DQ5A 2W08A 4S2FA 2P3JA 1PZ9A 3M1HA 3WY6A 2QQVA 2WFPA 4GWNA 2D3SA 4D8MA 1KS4A 1Y7BA 2GAUA 3OGJA 5FOJB 2HEYF 2HWE3 1A8DA 2OQ7A 2FZ2A 4AI8A 4B4QA 1ULOA 1MZEA 4CP1A 2XHKA 1XE0A 2O1QA 3AMMA 3FLPA 5FZ6A 1O59A 5FP4A 5FP3A 3LEKA 3MPPG 1UZZA 3VHRA 4XPVA 3ZN4A 4CEYB 3F95A 5IHRA 1VBD2 2ZACA 4BIFA 3TN93 2VPVA 5CBLA 1RHI2 1X36A 3H3UA 4BWOA 2JX9A 4NPMA 1ZZ8A 3PMEA 3V64A 1DP0A 4M0NA 1AJKA 5A6ZA 4I3PA 2YMZA 1AL23 1LKNA 1K5MB 2ARBA 2ET7A 5FYYA 3VBSA 1JYTA 4LBQB 1W6QA 3AXDA 3RSJA 4XC9A 4QPGB 2A6XA 2FCVA 4JDOA 5EYXA 3WDYA 1YI9A 1S0BA 1H4HA 1GWLA 4NRPA 4Q4V3 4AVVA 2EALA 1JH5A 2QFEA 4EV0A 1RXFA 2ZX0A 4CCNA 1AR61 3ZYJB 5CKQA 3T4VA 5IJRA 1TMF1 1MEC2 1LHUA 4M4RA 2BDRA 1XXNA 2XWJB 3ZXDA 1VRH3 4LBMA 5BXXA 5DDJ1 2G4IA 4Z82A 3V65A 1FAYA 2C26A 1KJLA 3WF4A 2ZX2A 4QX7A 4A44A 2VCCA 1PMJX 2VZOA 2DUQA 4RQPA 2QUOA 2WLPA 1RUH2 2ZGRA 1F4HA 4LULA 2BZDA 3ZOIA 5FYTA 2VBDA 1VBC3 2ILMA 4PHZA 5IVYA 3I2GA 1GP6A 4XAEA 3NJZA 2XJUA 1EAH1 5FCCA 4B3NA 1S0GA 2VL4A 4L97A 3PHMA 1XNKA 2YFZA 2O0OA 4HXCA 1PK6C 2QQMA 3PVOA 3H8UA 1HRV2 2WA4A 2RS12 3VBUC 4YLZA 5KWRA 5JPMB 3UKVA 3B01A 4Y5Z0 1HQNA 4HVQA 4OZOA 1M4WA 3O1SA 3LCPA 2XJRA 1SLTA 4XFBA 1PIV2 5CKMA 4MGIE 2QQOA 3VB9A 1RMU2 4EN0A 4F83A 4XQ4A 2W68A 3SH5A 4G3YC 2WO1A 2HWF1 3VL8A 1V6MA 4DEVA 2Q8OA 4TLGA 3U75A 1GZWA 1F31A 1UZYA 4GKYA 4IEXA 5EHDA 1C57A 4BQ2A 2NM1A 3ZR5A 4CXXA 5AC91 2XDVA 4YG6A 5HCAA 5IK8A 4AOCA 1JYIA 3KF5A 2V4VA 3VHNA 1O4TA 5GKAC 2VECA 1WGPA 3NSTA 2ZGPA 4BQ1A 1DU3D 2R043 3PDQA 4I3GA 5IFPA 3BUCA 4BQWA 5C70A 3AKPA 2K0GA 2YDEA 5CYYA 4XQDA 2OQ6A 4BQ5A 1QJX1 4IV1A 1PK6B 1REFA 2OA2A 1VE0A 2EIGA 5GLTA 5FUNA 1W9WA 2RHPA 4CA9A 4LJHA 3VBUB 5LEKA 5FY5A 4BMEA 1X8EA 2XVGA 4M3CF 5C5UA 1N1VA 1AR72 1FYUA 4P08A 4RHV3 4QPWA 5ANQA 3UETA 3H0OA 1BBT2 3NRUA 4YM3A 3ACGA 4I0WB 1IPSA 4JKKA 4E8CA 4I2OA 3PIJA 3PMSA 1GZTA 1WLWA 1TNFA 3I8TA 5FREA 1X33A 4Y1UA 5DUVA 2RMU2 4NWVA 2PLV1 5C3PA 1O7FA 2WT1A 2ZGLA 4B8EA 3OD4A 4K21A 1FMD3 3AKRA 2WSUA 3WQ0A 1ND3A 2GH2A 4INDA 5FJKA 1CPNA 5DUWA 4JCKA 3WG4A 3KF3A 3VD3A 1MZ6A 4PIXA 2BU9A 4H7MA 1QJY1 4NR1A 5JDBA 1WLTA 3B00A 4AZZA 1BCXA 2C9AA 3H8OA 3AL6A 3A0KA 1GFF2 1UL9A 4Q0VA 1PVC1 4LQRA 4D7SA 4C91A 4ZZ5A 1WBLA 4MHUA 5C4WA 1LTEA 1SLCA 2A1XA 1UIKA 4QX1A 1H9WA 1AR91 5FZAA 2MEV2 3WHTA 1QMJA 2XGXA 3POIA 1ULGA 3AJZA 4AFDA 3IKWA 2BOIA 2TBVA 3A7QA 1H8TC 1WUVA 2DCZA 3DPRC 3J8F3 4Q8KA 4OHYA 2VM9A 2CAVA 4K6BA 1GOGA 1F9KA 1C28A 1XNCA 2ES3A 1W6QB 2VQTA 4IL7A 1QOTA 2ZKLA 5HV0A 5BV6A 5ISLA 5FPZA 2VNVA 1BZWA 2VR4A 2KXLA 4E4SA 2UWBA 3U0ZA 1EYBA 2QQJA 3ZFGC 1LU1A 2XLFA 3BI3A 2JDZA 1PNFA 2CGPA 2WINB 1CAUB 1RUI2 4BE3A 3FUOA 3I3QA 3THPA 1GNYA 4OHVA 2LS6A 3SC7X 2BERA 1TEIA 5I0UA 1JOJA 2B45X 4COWA 2O8QA 1UXXX 4BMBA 1A34A 3AMNA 2VGDA 3NNMA 1W6PB 1L3JA 4AFBA 1G6NA 4A7YA 2VULA 5FPAA 3W5MA 1DGWX 1H8TB 3DPRB 3VZJA 1UKGA 3P3NA 4HBNA 4DEQA 5E8AA 1OFNA 4N90A 5CU1A 3WLUA 1NA1A 1DGRN 4C8DA 4QXBA 1VBD1 2VCAA 3APBA 2PHTA 4XJ9A 1RHI1 3B5LB 4GMP1 3BTZA 2IZWA 5A33B 5IVFA 1W8OA 2E7QA 1ZNPA 3NKTA 5FRAA 3ZFGB 2RS32 3QH7A 2NPIA 5LASA 2W95A 1O4YA 2C6SA 4IQPA 2BBVA 4V2VA 1HQLA 1O5UA 2VVFA 3O1RA 4EZHA 3T2QA 1NLRA 3H1YA 5DAQA 3VBRC 3VLBB 4BDVB 2J1AA 2YXSA 3VDAA 4CCJA 1W04A 2AH2A 2AUYA 1N1YA 2ZMNA 3GHMA 5D2AA 3TOJA 3I7DA 5GM0A 2ZEXA 1W6MA 2VOXA 4X8NA 1SQ4A 4IESA 3SNMA 1NCRC 2JKBA 1H2MA 2RDSA 1T2XA 3ZPOA 1PO13 4IGPA 4MO3M 5ABJC 5J98B 1JI6A 1MEC1 3MF6A 4J1WA 2WFF3 2WABA 2C9KA 1VR3A 3HR9A 4IE0A 3WNXA 5F3IA 4FTBA 1V6LA 4MGSA 5F3CA 2BWAA 4LO4B 2XR4A 2VUDA 3ZKUA 4OMCA 2D5FA 3JXSA 3OYWB 1OPOA 3UGHA 2UYBA 1TVGA 1MS9A 1EPZA 2FHRA 1OHFA 3OEBA 3S6PA 1DZTA 2DBIA 1I3HA 2WA3A 2FDFA 1P8JA 4FCAA 3LSDA 3OD0A 3O14A 4IEVA 2YC4A 4OUSA 4UXAA 3VBRB 3BTYA 2JD9A 4MOAA 2HWD3 2ZMLA 3I49A 4A2UA 2QKDA 4E2SA 4NPRA 1IGOA 1HQWA 5KHKA 1HRV1 1FI2A 1RC6A 4GAZA 4CYDA 2YC2A 3RJRA 1ZRIA 3ZO0B 3PUIA 1NCRB 4CXWA 5IATA 5ABJB 1YFWA 1UWWA 2AZ5A 3Q8FA 5FV3A 5FZ7A 2DVBA 2WWJA 4AFMA 1RMU1 1QH7A 2DVAA 2EVXA 3KSCA 2R073 1V9U1 1RUNA 4KGQA 1LOEA 3ASIA 4CDWC 1XYPA 2DDUA 5EPAA 5JOZA 5I8YA 3WNLA 1JYXA 4NIDA 2QTWB 2D43A 2I2SA 4JTNA 3ST7A 4EROA 5GLWA 4DXZA 2GMEA 2JG8C 2WAOA 3K75B 4LIUA 1YXWA 3ZYRA 1CPMA 2E9QA 3ZSMA 4Q4X1 1FX5A 4ASLA 4LE4A 2R6QA 5L36A 3MFAA 4W6XA 2BVVA 5FWJA 4KWLA 1MACA 3BTAA 4IERA 1XNAA 1ZRDA 1JOBA 3P6BA 1US3A 3D0JA 4NMIA 3OGSA 2A6VA 4N53C 5BNOC 1VB4A 2ZXQA 3KGLA 3LWCA 4Q0PA 2EIEA 1AR71 3BIWE 4AK3A 1MQTA 1BBT1 1C8M2 3OUHA 4NPLA 3T2OA 5A32A 3VBOA 3POGA 4QX3A 4Y1YA 4BPZA 1Q8PA 2RM22 3H8XA 2CGNA 2E53A 3BOWA 4XETA 2RS13 2RMU1 3RJ2X 4CDWB 1PGL2 4P9JA 2VOVA 1QF3A 2QQUA 4AEJA 4AI1A 4BOWA 1FXZA 4GD4A 4H55A 1DGLA 1SG3A 4PBPA 5FBJA 4LBOA 3SQOA 1KDMA 3ZLIA 1R1A1 2JG8B 2VUCA 1PIV3 3OUJA 5AFEA 3FMGA 3FHQA 3ZFFC 3WCRA 3AFKA 4TTGA 3H7YA 5DAXA 2WNEA 4B7KA 4OVEA 3FHIB 1Q43A 4X6RB 3KQ4B 2IFWA 4R4XA 3TB0A 1OURA 5D8AC 4Q0SA 4Z8BA 1OKOA 4QXKA 3N9QA 3DF0A 4XDPA 3D8CA 2HKXA 3USSA 5EV7A 4XFIA 1PO23 2X53S 4N53B 4QQHA 3TAYA 5BNOB 3AP4A 4U2AA 2QNKA 3UKTA 2LW8A 5FY0A 3LA3A 3NV4A 2L9LA 2V4AA 3RQ0A 1XSQA 3PJYA 1CJPA 1LHWA 2C1FA 3M3IA 2VMGA 4R9AA 5FKCA 3CIHA 4FQZA 1GU3A 1LULA 2YGMA 3PNAA 5C3RA 5ERLA 3AZWA 2HWC2 2CWMA 2J1RA 2VXRA 1ZZ6A 4N7UA 1EUTA 2UWAA 3BPZA 4PIYA 2NMOA 5FAXA 1MZFA 5A3TA 4ATEA 1HXS1 4TYSA 5JUVA 2D3PA 2QVSB 3NNLA 4A3XA 3ZFFB 2WO7A 4YSFA 2BNMA 4QXCA 4A6SA 1LOAA 1UYZA 5A6XA 5FYSA 5D8AB 3W58A 3WD5A 2A3YA 5BNNA 1KITA 5IYYA 3POYA 3I3DA 1MS1A 1BHGA 5DUUA 1W6MB 5AVAA 5GLZA 4DO0A 1NQJA 2HWE2 2VZRA 5FZ3A 2BW8A 3C8XA 1GYKA 2HH9A 1HJGA 1RUD1 3GBWA 4P9LA 4XJZA 4AYUA 5C8CC 5CFCC 3CZUA 2D6KA 5JVVA 2VNGA 2YUEA 5CNAA 5EJ3A 4OZXA 2W1UA 3PL0A 5F2WA 1UD1A 3VUOA 2WYFA 1FOD1 1R1ZA 1HB4A 2WIIB 4JAAA 4OYUA 2GNBA 2UU8A 5GZFA 2TEPA 3VBHA 1E5RA 3VV1A 2C24A 2G1MA 1ZBE3 2WT0A 3OBRA 4XUNA 5F39A 3U07A 3WXPA 3HJRA 2W2IA 4XHXA 5E6HA 1AL22 4RN5A 2MEV3 4DZGA 4HL0A 4ZONA 2JDHA 2EF6A 5FK7A 4N8MA 1YWKA 1B35A 3IAQA 1JU4A 1D4M1 1QDCA 2RS53 4Q4V2 3NKGA 3O1OA 1UNBA 1SHWB 4YW4A 2YBSA 2VQ0A 3MGUA 2BUKA 3N9NA 3B02A 4XDOA 2FCTA 5HXVA 1G86A 1YEWA 2VZQA 4QXHA 1ASJ3 5KXBA 4KMQA 5C8CB 3H1WA 5CFCB 1QEXA 2CSGA 4KG8A 5K9YA 1CONA 4Y22A 2OYZA 1OKQA 1VRH2 1YLLA 4QB6A 4CDQC 2I07B 3KB5A 3K4DA 2OX0A 4QQLA 4JGYA 1U5IA 4B4RA 4XEZA 3ATGA 5A3WA 2P3IA 3Q9OA 2X10A 3ZIXA 1A8MA 1XB9A 4NN0A 1GZCA 5DZGA 1VBC2 3JQXA 4JX0A 2ATFA 2QBXA 5JOYA 2Y6GA 2XH6A 3GBFA 4YYOA 1TME1 2B9VA 2CDOA 2NMNA 3ZXJA 1PZ8A 4UAPA 1VBA3 1JXNA 2YFUA 3F2ZA 4DOUA 2WDBA 4OI2A 2YU2A 1LENA 4PF5A 2TUNA 2VVDA 1IG0A 3RZZA 4I30A 2ZOEB 2WQ8A 2F6BA 3O0VA 2DVGA 4IEYA 2W91A 3IN9A 5IVEA 5FIXA 2E6VA 3ZXFA 4Y5TA 1JZ6A 3VKOA 4ATFA 1COV1 4XTMA 1STMA 3LPGA 1J59A 3IPVB 2FMYA 4LA3A 3HPNA 2H6CA 3SCFA 4CDQB 4B4PA 1XYOA 3B3QE 5EP9A 1QHDA 4GA9A 1EUUA 3NNGA 2A6ZA 1K5JA 1BEV1 4CP9A 1ULEA 3ITQA 4IV3A 4UW6A 3MZHA 4FSJA 1UMHA 4L11A 4JC1A 3S7EA 4DIQA 1X50A 2QDNA 5FYIA 1RUC3 2R042 2Y6HA 2VQAA 3N9MA 4MX3A 2EXHA 4W50A 4IE5A 3KVBA
chains in the Genus database with same CATH topology
5AVPA 4YZ1A 2JENA 1CJDA 5BNNC 4YZ4A 2CTVA 1RUG3 3FBYA 4LUMA 1POV1 5HCBA 4KWJA 3E5QA 1FPN3 3QH6A 4CEYA 4E4ZA 4RHV2 1VP6A 3WVJA 4PDWC 5JIAA 1R082 3ZMNA 3RYPA 3ZMOA 2NP0A 3IDBB 2VNOA 4XW3A 1OD5A 1XRUA 3W9AA 4EN8B 1H2LA 1H1IA 1DFQA 1S55A 2YZ4A 4PCRA 1TE1B 1K5MA 4XJ8A 1GBGA 4LBQA 4DB5A 1ULFA 4QPGA 1FMD2 1C8M1 1I9RA 3EO6A 4ONUA 1CR7A 4E9KA 3HAGA 1LRHA 4L8QA 3ILRA 1F5JA 1PGL1 3RRDA 4NHKA 4YG0A 4XFAA 3AZZA 5BNNB 5FMOL 4XMAA 1RUF3 2E51A 1YCIA 4XTPA 1I5ZA 5JZGA 3J9SA 4PDWB 2WKKA 4D7YA 1IZ3A 3LSEA 3MIBA 3R4UA 2XLAA 4AVBA 5L7OC 4PQ9A 1JHNA 3UJQA 3B93A 1AJOA 1QJZA 3IIAA 3AMHA 1SFYA 4I02A 4CEWC 4FAGA 3VBFC 3MF9A 3JBG1 3O12A 1S0JA 2HWC1 2OZJA 3IMNA 3M4FA 2JJ6A 3TWIA 2I45A 4EWAA 1UKRA 4DRRA 1IPKA 2GALA 2CYFA 3RYKA 3SITA 4HLTA 4R9BA 3KD4A 1PGW2 1ND2A 3WW4A 4N9HA 4YGEA 1H1AA 5L7OB 1QNWA 3ZXKA 2HWE1 4R8HA 1W39A 1V6IA 1UMZA 2YV8A 4MV2A 2WSVA 2W39A 4CEWB 4FPKA 3ZX7A 1URXA 2TNFA 1PK6A 4MXVA 1G9DA 3AP5A 3E5UA 1YI7A 3VBFB 5L73A 5I91A 3VBUA 1QKQA 1RUJ3 3PLQA 5JI7A 2XJPA 4DY3A 2OUJA 1Y43B 2MHFA 2HJIA 3RDIA 1QJU3 3N7MA 4LNVA 5BNPC 2JECA 2A5ZA 2VH9A 4NHLA 1XU1A 4AHWA 2C0ZA 4HVOA 3AZVA 3TNPB 1MVQA 4Q4V1 4K40A 4L9BA 4OLLA 2K2SA 1H30A 4M01A 2PAEA 2XBO3 1PO12 4BCUA 2DU0A 1V6NA 1C3HA 1WW7A 1MS0A 1UW8A 2WFF2 3HN1A 3KM5A 4PLOA 4RGAA 2WJSA 4XFGA 2A75A 3S7IA 3POSA 3O7OA 1CQ9A 3ZXAC 1LHNA 4W6WA 4LO6B 1VBC1 1QOOA 4H3WA 4P9IA 3VZLA 2ZA9A 1LOGA 2ZBJA 5BNPB 4AGRA 5JZGC 3MDPA 1HIXA 1HW5A 2HWD2 1H1MA 4G4FA 3AMQA 1GQHA 3L2YA 4UW5A 2ZX1A 1D0HA 1AXKA 4ZU4A 3VN4A 2DCYA 3AP6A 1LESA 2W52A 5F5QA 4DPNA 3FE5A 3N35A 4AVTA 3AX4A 2Q4SA 1YJKA 5EFUA 2R072 4K7JA 2Z2SB 4QMAA 1CAUA 4E27A 3GYDA 3WP4A 3NVCA 2GNDA 2BVBA 4E2QA 3G7DA 2A6WA 4NVPA 2XLGA 2WNUC 3NO8A 3ZSJA 2R041 1W6PA 4FP2A 4B7EA 5JZGB 4P9GA 2ZHLA 4LEJA 1ND2C 4PBOA 1H8TA 3DPRA 4QU2A 3L2HA 4RD7A 3ZPYA 4MGYE 1GLHA 2O8OA 4RHV1 2Z42A 1RUE3 3SXWA 4N43C 4ISQA 5A33A 1GQGA 1LOBA 4C0BA 2HWB1 4HT1T 1AX0A 5GJ6A 4U36A 1OA2A 2ZGTA 3DGTA 1E57A 3ZFGA 3E6CC 3FBMA 1MS3A 3SH3A 4W65A 2JG9C 5FMOS 4MSVA 1PNGA 3N3HA 3GALA 1LGCA 1FMD1 4IEPA 1Z7S3 2WNUB 2ZGQA 4A7KA 3JD71 4AWDA 1W6OB 4XE9A 2SBAA 1ND2B 1XNBA 3OY8B 1YUDA 2DCKA 4Q4Y3 5I8SA 1DZRA 5I93A 3R6SA 3USUB 1PO22 3ZYIB 4N43B 2FBEA 3OYWA 4G9SB 4P9XA 4RA0A 5KXDA 3V0BB 2WS93 2ZCWA 3M3CA 4XF0A 4AEKA 3B9IA 2JG9B 3J8F1 4HKOA 2NZ9A 1JUHA 3VBRA 1NQDA 1DQ4A 2EAKA 4NWWA 1R083 2OUHA 4Z1VA 4JV4A 4ITCA 4Y1ZA 4CTEA 3EQEA 5DDJ3 1NCRA 5ABJA 2CL2A 4YVWC 4Q8LA 5CG8A 5KHHA 4BIOA 1S0DA 1D2QA 3CNAA 2FQPA 3G6JB 4WVZA 4C1WA 1PGW1 4ORFA 1NZCA 3CJXA 2Z79A 3WDUA 1VJ2A 4GQ7A 2LUWA 2OZ6A 2PQQA 3H3ZA 3JCIA 1ZBE2 3WINE 4H7LA 5DG2A 3PVNA 1OSGA 3RPQA 1APNA 3IM0A 4CDXC 1UU4A 4P9WA 2Q0AA 4QHBA 3OTFA 5KHJA 2D5HA 2WT2A 3AK0A 2Q5TA 5CVRA 1OOPC 2DVDA 2IWGB 2HWF3 2RS52 4FOWA 4YVWB 2VW1A 1LEDA 4WM7C 5EWSA 4MZUA 1ZBA3 2XUMA 4XIKA 1ASJ2 1WW5A 2NN8A 3RNSA 4FP3A 3B94A 2ZGMA 3R4DB 4CDWA 1C1FA 1NLSA 1LU2A 1CN1A 1JTZX 3H1MA 4RSUA 3VHOA 4YNIA 2G9GA 4XJAA 2QJVA 2JG8A 1PO11 2X5IC 4BA6A 2XJVA 2JE7A 2WFF1 4YM1A 1J3QA 3WDWA 3ZDSA 4Q27A 4EJRA 5HCFA 4CDXB 4WBBA 1KXGA 1DIWA 2PTMA 3WX5A 2PELA 4K1ZA 1N47A 1VBA2 4HSLA 1C1LA 5KBFA 1OOPB 4N53A 4YM2A 5BNOA 4WM7B 4FPJA 5JPNB 1PZ7A 4LBJA 2P3KA 5I0RA 4XZPA 2YROA 3SCHA 3MLJA 4A7ZA 2HWD1 1GKBA 2V5YA 1XE8A 2Y0IA 3NV2A 4LHLA 4OI1A 1QJY3 2EA7A 4XFFA 3TYJA 1WBFA 2FMDA 1GNZA 3PVBB 4KQ7A 2X29A 3ZFFA 2X5IB 4XF3A 2UY8A 4FPFA 5CFDA 2A7AA 5IK4A 4COUA 1RUC2 3H50A 5D8AA 3RMYA 1AR93 3MIEA 4X8PA 3V0AB 5JMCA 5EZWA 4O9GA 2DWRA 2PHUA 5J96B 4Z92B 1RUG2 3NAPA 2VUAA 4YW5A 2Q1MA 1FPN2 4ES8A 1ZZCA 1VBE3 3ZN5A 4Z2WA 1AR83 3MIHA 4JRAA 3HT2A 4YGCA 4LO5B 5BYNA 5JLVA 1RUH1 5A3MA 1R093 3JZVA 4V1PA 1YFYA 2WNVC 5KHIA 5GZCA 1NE6A 2CGOA 3ES4A 2A3WA 2D6NA 4DY5A 3MLLA 2AGSA 2EXJA 3K48A 1KJRA 4W6YA 3HIFA 1RB8G 1X7NA 2RS11 4CP0A 3POWA 4OHXA 5FLHA 4PJYA 1S2KA 4AVAA 5C8CA 5CFCA 5H9SA 1PIV1 2B8MA 2Y38A 4LUKA 5JSPA 1RUF2 2Y26A 4IEOA 3FFQA 5C9AC 1IS5A 1F2NA 3WV6A 2PHDA 3QACA 4AGGA 5GALA 2GN3A 2GNTA 4GMP3 4OI0A 3INAA 3JQWA 4B29A 2B46X 2WNVB 1PO21 3CEWA 4C1XA 1SLIA 3M7AA 3DN7A 3ZSEA 4JVAA 2CY6A 4FOVA 4D7TA 2K9ZA 1NYWA 5T55A 1NOVA 1KS5A 5T5LA 1KQRA 2VOKA 1JW6A 1QY4A 2GC3A 1U5XA 1IKPA 4Y24A 2WLQA 1QXPA 3QBQA 3ROUA 4ZU7A 3IPVA 1HLCA 4J6GA 4CDQA 3ILNA 1MS8A 4R9CA 5C9AB 1BXHA 2GMPA 4QPIC 5FBZA 1C4RA 1NCQC 4NHMA 1WCKA 3AP7A 4AVSA 1FNYA 4ZU5A 3N4MA 4LLFA 1WCSA 5I8TA 3BCWA 2Z69A 4I09A 5FO7B 5CFDC 5HBAA 3M2MA 3WQ7A 3R4SA 2E7TA 4EWDA 1O3TA 3KT4A 3B7MA 1RUJ2 4GB33 2VG9A 5JOXA 1UIJA 1HDKA 1ZBE1 1PM7A 1S1AA 1V70A 3NAPC 5T54A 5IT6A 3N7KA 4WVWA 4CDUC 2DCTA 2MEV1 1QJU2 2KM2A 2XVLA 4ISRA 3AYDA 5E88A 4YGDA 4FPHA 4QPIB 1XNDA 3CO2A 4FTEA 1NCQB 5KXCA 2D40A 4X6QB 1AXZA 4YFWA 5DZEA 2RS51 1VBB3 1LR5A 1V9U3 4E2GA 5CG9A 1JN2P 4Q0UA 1J58A 3I59B 4I0AA 1H2NA 1O3QA 4FAHA 4RS5C 1EV12 2XBO2 3IWZA 4QQOA 3RG0A 1N3OA 3BU7A 1CIWA 4RFT0 2YYOA 1UF2C 4XMIA 2KA3A 2CWSA 2ETEA 4AFCA 4Q4X3 5CFDB 2XWBB 2OPKA 3K51A 4Y20A 2BNOA 3ME2A 2AYHA 1AYM3 3EJKA 1CAXA 2VW0A 4Y26A 2PHLA 1RUI1 4COYA 3WUCA 2XVKA 4FOYA 3NAPB 3ZN6B 4PDWA 1UPSA 4FT8A 4CDUB 2QE3A 2GMMA 5T5OA 5CA6A 2Q30A 4AEDC 4XXPA 1VALA 2ZHKA 4HKLA 5IK5A 2GC1A 5CIRA 1H9PA 1SBFA 2E63A 4LBKA 3AYEA 1IS3A 5JSOA 1SFNA 3D6EA 5C8WA 2XL9A 4RS5B 1YYNA 1R1A3 3GHNA 4JGZC 1QXJA 3ETQA 4OUMA 3UV9A 3VZMA 3OPZA 1WW4A 2BYVE 1EP0A 2RS31 4BHPA 1WA4A 1FATA 1OMIA 2IXKA 2JD4A 3AKSA 1DYKA 1MR5A 3U4XA 2D6MA 1LEMA 3RI9A 1GR3A 1ENSA 4WVMB 4AEDB 3N36A 1NY72 5L7OA 4BLJA 4GH4C 3VDDC 5K7PA 4OULA 4QGMA 3KT1A 4ASMB 1RUG1 3SH4A 4AQ2A 4KGGA 4CEWA 1ZRFA 1FPN1 1YFUA 4Q29A 1HXS3 1RUE2 2R0HA 3VBFA 3CU7A 5EYYA 3C3VA 3E97A 1OLQA 4AHXA 4AEMA 2B39A 4QQPA 2AENA 2RR13 4KNCA 3AXEA 2ZAAA 5L19A 3LOIA 1Z7S2 2XKPA 2VOWA 4MVTA 2IXLA 1ZYBA 1RL3A 1AXYA 1A78A 1DGRA 4GH4B 4KU8A 3VDDB 2R16A 3TNQA 1NG0A 1FOD3 1U0AA 4Q4Y2 4FPCA 4I0BA 4YRDA 2XB6C 1AX1A 1RUF1 4L92A 5DZFA 3WHUA 5FTTC 2BEOA 5F6KA 2WZR3 4YW1A 4NOTA 2YPJA 3IT8A 2WS92 1CVNA 3WDVA 5GLVA 3IBMA 1D4M3 3PTYA 4Q2FA 3ELNA 4Q0QA 1G9CA 1REEA 5SV8A 3WW3A 5BNPA 4QX5A 1Q56A 1AR62 1CD3G 2ZPXA 4WVVA 3S0MA 4WM8C 3PJQA 1W0OA 4FPOB 1F8VA 1N1TA 4KBBA 1N1SA 3EBRA 1GZ9A 3AKTA 2LALA 1IS4A 4K9SA 3RS6A 5DDJ2 1O91A 4XJWA 3OCPA 3KS7A 3CJIC 1PMIA 3WP6A 2DF7A 1Z78A 1PGSA 1I1EA 2X8KA 3UK9A 2GC2A 2EAAA 1OA3A 2ZX3A 4N7IA 3LA2A 5K8SA 2RM21 3SHRA 1TME3 5T50A 2D97A 4Y20B 4Q4W3 1OQDA 5BPXA 4HN1A 1CAXB 4YM0A 1J1LA 2UWCA 5DG1A 4M3CE 3I4IA 5JR7B 1ONAA 4TLFA 4WM8B 4CP2A 5JAXA 4TZDA 4R9DA 1COV3 1NXMA 1KDKA 3MYXA 1CAVB 4BZ4A 5I0TA 3T1MA 1RUJ1 5HI0A 2GSYA 2HWF2 4IETA 5SV5A 1OLRA 3CJIB 4BM8A 4UW3A 5BY5A 1ZBA2 2GU9A 1BEV3 4HK8A 2R1BA 1QOSA 2ZGKA 3VGIA 5AC92 3BOPA 2HEVF 5FPXA 1ZX5A 4QD2A 1Q8OA 1QGLA 2D3RA 1KFXL 5C33A 5J48A 4PLMA 1XQNA 1QJX2 4QT6A 2W0XA 4LTAA 1SBDA 2I74A 2WNUA 2XBO1 1B09A 3AMPA 1RJ8A 1RVF3 3LB9A 3ALQA 4HPKB 1W6OA 4FXGB 1POV3 3ES1A 1RGSA 1ZVFA 3PVEA 1G9FA 4FBFA 1KRIA 1OQ1A 3IDCB 2D7FA 3OBTA 3OY8A 4L99A 3LZZA 3OGGA 4MH0E 4M3CB 1ZZBA 1WLCA 1AUYA 3ZYGA 3USUA 1UCXA 5DXDA 4EN9B 3RWNA 2F4PA 1DQ0A 2QZ2A 2R063 4N43A 1CX4A 3V0BA 5I0SA 4META 1ZREA 3WCSA 1SCRA 4S2HA 5CAZA 3TN91 4PIZA 3TBDA 1LGBA 3LAGA 2JG9A 1QJY2 3VUOA 2VMIA 4MYEA 4E4DX 3WDTA 4GWMA 3LA7A 2QDRA 1AL21 5T52A 5E16A 4YW3A 4YZ5A 1PVC2 1FNZA 4F8AA 1Q5OA 2UYAA 1UU6A 4QGLA 3MI8A 1AR92 2H6BA 2ZJCA 3CL1A 3OF1A 1EV13 3KZ4C 1HRI3 5J09A 1O3SA 1X82A 1VRH1 2GZWA 1M06G 4LO8A 1VBE2 1AR82 2IC1A 4YGBA 3NV3A 1R092 3JBG3 1YHFA 3R05A 2E7AA 3D0SA 1V00A 4L2NA 3SCGA 3WT3A 1RUE1 4KL1A 1SEFA 4F3JA 4DRVA 2N7GA 1REDA 4YVWA 3AJYA 4NO4A 4QQ2A 4XBQA 4Z07A 4YVSC 3MICA 2WZPP 2DFBA 2RJKA 4GALA 1VIWB 4AQ6A 1H4GA 3MIDA 5LRSA 1Z7S1 4XBNA 4RR3C 1QQP3 1WD4A 4OI4A 1GV9A 4XF9A 3NW4A 3B9CA 2A6YA 4GULA 2VW2A 3UKNA 2A3XA 3J26N 3DKWA 3BODA 4Q4Y1 3QLQA 1AYN3 4CDXA 4OHZA 2IXJA 1X8MA 1G7YA 1OPMA 1AVBA 3HQXA 1D2SA 2ZHNA 3MLKA 2WS91 1OOPA 2ZZQA 3TRSB 3E6BA 4WM7A 4YVSB 1N3QA 3LGRA 2EXKA 4EN6B 3D82A 2ARXA 1LHOA 1IS6A 1R081 1ZZ7A 4WZFA 1WMDA 1Q8QA 4RR3B 4EWEA 2DUOA 2JXAA 3DL3A 3ZXGA 2OIIA 3VKMA 2PHRA 3ECQA 2P34A 2QCSB 2ZHMA 2X5IA 4COZA 3KCCA 3WP5A 2AREA 1SLBA 1W0PA 2IFRA 4QM9A 3VL9A 5K0UC 1UU5A 4QGNA 3NV1A 5IUQA 1RTVA 3HT1A 2JEMA 3MW4A 3V0AA 1WD3A 4GB32 3HMYA 3FJSA 4LBNA 2FZ1A 5BUVA 3MEPA 4C90A 1SLLA 4GXLA 1LOFA 4C0HA 3WG3A 1A6CA 1VAKA 5D1IA 1T6GC 4P14A 3FX3A 5DUXA 4DNYA 2BQPA 1VBB2 1V9U2 1AR63 1ZBA1 2NYYA 1KFUL 5J37A 4AW7A 5K0UB 1SMVA 4FTSA 1XYNA 3JU9A 1TMF3 4FXKB 4LT5A 1ZM1A 4Q4X2 1ULDA 1N3PA 1D0GA 1WMFA 4YZ2A 3AB0A 5FQ0B 1SACA 1AYM2 3H9AA 1GSLA 1MZ5A 5JIUA 3AKQA 3SLIA 1DBNA 1SCSA 5KXEA 2ZTNA 2BGCA 3RMXA 3KT7A 4SLIA 5JOZA 1OA4A 2ENRA 3ZIWA 1VAVA 2DV9A 2SLIA 5KC5A 1W6NB 1BK1A 4XBLA 1EAH3 1LGNA 2HWB3 2R30A 4AI0A 5JWPA 2WNVA 4AQTA 1ALYA 4LA2A 2DYCA 1QNYA 1CAWA 1SDWA 1UAIA 2RJLA 2YY1A 2ET1A 1OFSA 1R1A2 3VBSC 3UJOA 3QCWA 2NLRA 3WUDA 3ZFEA 3JD73 4DS0A 1FT9A 1TNRA 2R32A 3S30A 2GNMA 2Y0OA 2RE9A 5FDBA 1V6KA 5AC93 5C9AA 4AI2A 3WOGA 5GZEA 1I6XA 2H0BA 1ZA4A 2PAMA 2P37A 3ZSLA 1FV3A 2OVUA 2BPA2 1QJX3 4O9EA 4D94A 4XHBA 1OI6A 1ENXA 5FLIA 4MXWA 4RQPC 4BYYA 3ZYPA 1VBE1 5ACA3 1HXS2 1AR81 4WV8A 1IHMA 1QH6A 3VBSB 2ZGOA 4XILA 5JOWA 4IEQA 4KH9A 3ACLA 4R52A 3I2DA 1R091 4KG0A 5KHGA 3P3PA 4AG4A 4MUVA 2UURA 2G9FA 2PLV3 2GDFA 4JQRA 4FVVA 3CF6E 2RR12 4QPIA 2WL1A 1NCQA 2VVEA 3ILFA 5IK7A 1LOFC 5FO8B 4QPYA 1RUD2 3SMHA 4MLOA 4WZCA 3QD6A 3I59A 3M3EA 4XYXA 1TQ5A 4AF9A 1FOD2 1SLAA 3FLRA 1PVC3 1DYPA 3KGZA 5T3NA 4RQPB 1RITA 3U10A 3R0RA 2R071 3BALA 2WZR2 1KD7A 1HX6A 5H9PA 4AI3A 2ZZJA 2HYKA 1YNAA 2AR6A 2XL7A 4AHZA 4DMIA 1J3PA 5C6CA 1D4M2 4IV1C 3ZN6A 4P5HA 4CDUA 1Y9QA 1VB2A 1ULCA 2QQPA 3UL2A 1HV0A 3MFCA 3O0WA 1AZDA 4FOQA 2DUPA 5F9TA 5F6LB 1S0IA 5E1RA 1DF0A 4RS5A 4S2DA 2WWSA 4Y4YA 1DQ1A 3HWJA 1HV1A 3KMHA 1YFXA 1GZWB 3O0XA 1IKQA 3V56A 1H8VA 3GZTB 3M3OA 4I01A 4GKXA 2IXCA 1Q8VA 1MS4A 1ND3C 3AZYA 3M8LA 2R49A 1NE4A 3WQ1A 1TME2 2D98A 1BQPA 3WG1A 3ZFEC 4Q4W2 4GMP0 4F7ZA 4FPGA 4IV1B 2ZKNA 5LK7B 4JTOA 4XF4A 1Y3TA 4LR4A 4WVMA 4AEDA 1UN1A 3I54A 1VAMA 4LBLA 5C4WC 2D44A 2CAUA 4DFSA 3EHKA 1COV2 1VBD3 1RHI3 4GB31 2GN7A 3VKFC 3WG2A 5A3LA 2VNRA 4Y1XA 4JGZA 1CAWB 1AX2A 1BEV2 5T5PA 3T1LA 4FPLA 1ND3B 4LE3A 1S0FA 4HZFA 1VBB1 2PAKA 3ZFEB 5KC6A 1AL0G 2DURA 1CGPA 3WZ1A 1GANA 4UW4A 3AZXA 1RVF2 2XJQA 1MEC3 1YIFA 5JCTA 2ZS6B 4GH4A 1G8WA 5C4WB 4JDMA 3VDDA 3L9JT 1JBCA 1AYM1 2D6PA 2B7YA 3NL1A 3VHPA 5CADA 1LODA 1RUH3 1AF9A 1ENQA 3GBGA 2R062 4FO9A 3VKNA 5FO9B 3KCXA 1WCDJ 4MXWB 4IEZA 4AGVA 3FFZA 1NA1C 4HVRA 4KWKA 1RJ7A 3FLTA 1HRV3 2B9UA 1S0CA 3ZSKA 1BYHA 4TWTA 5CB7A 4HKWA