1EAH3

Pv2l complexed with antiviral agent sch48973
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
235
structure length
235
Chain Sequence
GLPVLNTPGSNQYLTADNYQSPCAIPEFDVTPPIDIPGEVRNMMELAEIDTMIPLNLTNQRKNTMDMYRVELNDAAHSDTPILCLSLSPASDPRLAHTMLGEILNYYTHWAGSLKFTFLFCGSMMATGKLLVSYAPPGAEAPKSRKEAMLGTHVIWDIGLQSSCTMVVPWISNTTYRQTINDSFTEGGYISMFYQTRVVVPLSTPRKMDILGFVSACNDFSVRLLRDTTHISQEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords POLIOVIRUS TYPE 2 COAT PROTEINS VP1 TO VP4
publication title Structure of poliovirus type 2 Lansing complexed with antiviral agent SCH48973: comparison of the structural and biological properties of three poliovirus serotypes.
pubmed doi rcsb
source organism Human poliovirus 2
total genus 37
structure length 235
sequence length 235
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1997-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1eah300
3ZFFB 1VBA3 2RS31 5BNOC 1PGL2 1H8TB 1AUYA 1ASJ2 5FOJB 5BNOA 4YVSC 1B35C 5BNNB 4Q4V3 1RVF2 4RHV1 2HWD2 1B35A 1VBB3 1POV3 1HXS3 1RMU2 1RUG2 2RS52 1BMV2 1AR92 4Q4Y2 1R083 1PVC3 4WM8B 1NA1C 3JB4C 4AEDC 4QPGB 1ND3C 2TBVA 2VQ0A 4AEDA 3VBOC 2BFUL 4YVWC 1AYN2 3VBOA 2XPJA 1RUH3 1MEC1 5AC91 1C8M1 2FZ1A 1BBT2 3DPRC 4N43C 4YVWA 4CDWA 4N43A 1AL21 4Y4YA 3CJIC 2WZR2 4Q4W2 1NY72 1PGW2 1AR93 3ZFGC 5L7OC 1SMVA 5ABJC 1R091 3VBHB 3JD71 3ZFGA 2HWC3 5L7OA 4JGYA 3J8F1 2HWE2 3M8LA 5K0UB 2X5IB 1HRI1 1K5MC 1FOD2 4CDQC 4CEWC 1RUF1 2WFF3 4PDWC 1A6CA 4CEWA 4CDQA 4PDWA 1RUJ2 1GFF2 1BBT3 1VBA1 1COV1 1QJU1 4WM7A 1AR83 5BNPC 4Q4X3 1TME2 1X33A 5BNPA 3TN93 2XBO3 4RS5C 3NAPC 1VRH3 1VBB1 1POV1 1HXS1 5ACA2 4JGZA 2HWE3 2PLV2 1R081 3VBFC 2R072 5BNOB 1FOD3 1CJDA 1D4M2 5CFCA 4N53C 1W39A 4YVSB 1QQP2 5C9AC 1B35B 1AR72 2RMU3 5DDJ3 2GSYA 4N53A 4RR3C 1RUJ3 2DF7A 1PGL1 4GH4C 1EV12 1RUH1 1PO23 1NA1B 3VBUC 4GH4A 4SBVA 2WS92 4AEDB 1ND3B 1AR61 3ZFEA 4FSJA 1NCQC 1V9U3 1BEV2 1BMV1 1AR91 1VBE2 1NCQA 3VBOB 2RM22 2FZ2A 1WCDJ 4YVWB 2HWC1 1PO13 4N43B 3DPRB 2RR12 2WFF1 3CJIB 2MEV3 3ZFGB 5L7OB 1EV13 5ABJB 4CDXC 1EAH2 2HWF3 2WS93 3HAGA 5JZGC 1AR81 4CDXA 1K5MB 4IV1C 3VBSA 1ND2A 4CEWB 4CDQB 5LK7B 4Q4X1 1RHI2 5JZGA 4PDWB 4IV1A 1VBE3 1Z7S3 3JBG3 3TN91 2RM23 2XBO1 1OOPC 1VRH1 2RS12 1OOPA 5C8CA 1TMF1 2BFUS 4CEYC 2R061 5BNPB 2BPA2 5A32A 4FTSA 4GB31 1RUI3 4CEYA 4EJRA 2RMU1 5DDJ1 1ZBE2 4RS5B 3NAPB 4RQPA 1QJX2 1EAH3 1RUJ1 1RUE2 1ASJ3 4CDWC 1FPN2 1FMD2 3VBFB 1RHI3 1PO21 1RVF3 4N53B 5C9AB 2HWD3 3VDDC 1RUD1 1RMU3 1RUG3 2RS53 1V9U1 4RR3B 4Q4Y3 3VDDA 5GKAC 4JGYC 2R042 1HRV1 4GH4B 1AL0G 2HWB2 3LOBA 1PO11 1R1A2 3VBUB 1E57A 1OPOA 1ZBE3 2RS32 5D8AC 1NCQB 2MEV1 1VB2A 1RUE3 5D8AA 1AYN3 4WM7C 1NOVA 1QJY1 1EV11 1RUC2 4RHV2 2HWF1 2WS91 1HQNA 2WZR3 4Q4W3 1F2NA 4JGZC 4Q4V1 3ZFFA 1Z7S1 3JBG1 5A33B 4FTEA 2RM21 3ZXAC 5FMOS 1PIV2 4CDXB 5CFCC 5BNNA 1MQTC 1PVC1 5JZGB 4IV1B 1IHMA 1MQTA 1RUI1 5AC92 5FMOL 4WM8A 1RUC3 1OOPB 2ZTNA 4QPIC 1AL22 5J98B 4QPIA 1DDLA 5A32B 1ASJ1 4CEYB 1TME3 3ZFEC 1RHI1 4BCUA 1R092 1RVF1 3JD72 4NWWA 2HWD1 4RFT0 3J8F2 1RMU1 1RUG1 1C8NA 2RS51 5ACA3 1PIV3 2PLV3 4Q4Y1 1RUF2 2R073 1D4M3 4CDWB 1QQP3 1AR73 4GMP0 3VDDB 1POV0 4Y5Z0 1VBA2 1COV2 1QJU2 3VBRC 1ZBA2 1RUE1 5C4WC 4JGYB 3VBRA 1AYN1 1OHFA 5C4WA 3VBSC 1BBT1 1ND2C 3FBMA 1R093 1VBB2 1HXS2 3J8F3 1BEV3 1R082 2WZR1 2ZZQA 4Q4W1 1NY71 1PGW1 5D8AB 3JB8A 1VBD2 5C8CC 4WM7B 2HWE1 2RR13 1FOD1 1RB8G 1COV3 1QJU3 4FTBA 4CDUC 4RQPC 4LLFA 2Y26A 4IV3C 1ZBA3 4JGZB 1RUH2 5CFDC 4CDUA 4IV3A 1RUC1 4GMP3 5CFDA 1AYM2 1AR62 4YVSA 5CFCB 2ZAHA 1MQTB 1TME1 2HWC2 1VBD3 5ACA1 2RS13 4QPIB 1PIV1 1VBC2 2PLV1 1NA1A 1HX6A 2WWSA 2WFF2 2R071 1ND3A 1D4M1 1NCRC 3ZFEB 1QQP1 1AR71 1NCRA 1QJX3 1AR82 1AYM3 1AR63 3DPRA 4Q4X2 1FPN3 1FMD3 1NG0A 3CJIA 3TN92 2WLPA 2XBO2 2QQPA 1VRH2 1F8VA 3ZFFC 1M06G 5ABJA 1BEV1 1H8TC 1TMF2 1VBC3 1VBE1 3VBRB 2R062 2R043 1H8TA 5C4WB 5BNNC 4GB32 1K5MA 2RMU2 2HWB3 5DDJ2 1R1A3 3VBSB 1ND2B 2RR11 3S6PA 2GH8A 2RS33 1VB4A 4WM8C 1MEC2 1C8M2 1ZBA1 4QPGC 1PO22 5C8CB 4RHV3 1CD3G 1EAH1 1RUD2 4GMP1 4NWVA 4QPGA 1V9U2 1VAKA 4RS5A 3NAPA 1X36A 1HRV2 1TMF3 2R063 4RQPB 4CDUB 4IV3B 5CFDB 3VBFA 1PO12 4GB33 1VBD1 1HRI2 2BUKA 2RS11 4Z92B 5C9AA 2MEV2 4RR3A 3VBHC 1QJY2 1MEC3 5AC93 1ZBE1 1C8M3 5K0UC 3VBHA 2X5IC 2HWF2 1QJX1 5K0UA 1RUD3 1AL23 2X5IA 1AYM1 3VBUA 1FPN1 1FMD1 4Q4V2 1Z7S2 3JBG2 1NCRB 1HRV3 3JD73 2IZWA 5J96B 1HRI3 1PVC2 1VBC1 1RUF3 2R041 1QJZA 1RUI2 2HWB1 2BBVA 1R1A1 3IDEA 1QJY3 5A33A
chains in the Genus database with same CATH superfamily
3O0WA 3ZFFB 2RS31 1ZM1A 5F5IA 4LITA 4XYXA 5FYHA 4EN9B 4A6OA 5FOJB 3FUOA 1B35C 3VD5A 1GMMA 5ERLA 4BA6A 3OD4A 5IVFA 1RVF2 2C1FA 3POWA 4Q1RA 1JYXA 4W6XA 1LAJA 3OTFA 4X8NA 1KITA 1ZZBA 1VBB3 1POV3 1HXS3 1RMU2 1HV0A 2BGOA 4AVBA 1DQ2A 1BMV2 3GBGA 3ME2A 1OA4A 3PUQA 2Y64A 1SPPB 1R083 3W20A 2EA7A 3BTXA 2A6WA 3UJQA 4CCEA 1GP5A 3BIWE 2VECA 3Q8BA 1FAYA 1GQHA 3MYXA 5EQUA 3E6CC 4AFCA 3LA3A 2CGPA 2XB6C 4YGBA 2ZHKA 2TBVA 3WZ1A 4XC9A 4AEDA 1WD3A 4P9GA 2RE9A 5LK5A 4YARA 1BK1A 4QM8A 4MGZE 4NROA 4XUNA 3N9MA 3WDTA 3ELNA 1AYN2 1W28A 2LALA 4HK8A 1G9DA 3FHQA 4Q5OA 1BHGA 1SFYA 3MV11 3DPRC 4KGGA 4N43C 5F6KA 4BK5A 5FRAA 4I0WB 1LKNA 5FAXA 2CY6A 3NNMA 4WVMB 3OGJA 3Q8CA 1N3QA 2FBEA 1YRZA 3MI8A 3CJIC 4Y4YA 3HPNA 2FCVA 4PLOA 3VUOA 1DQ5A 1WBFA 3IDAA 4MVTA 4Q4W2 2RDSA 1UOFA 2D6LX 4LBQD 2DTWA 2YPJA 3WCRA 1C3HA 4JHTA 4UBGA 3WSOA 2NYYA 4D7SA 1UY0A 3ZFGA 3JD71 3DEMA 1PX4A 1LHWA 3J8F1 4JQRA 4AVCA 1IOAA 4QPWA 5K0UB 3D6EA 3IAPA 5FKCA 4Y26A 3O7OA 4I02A 1FOD2 3PURA 4MXWA 4FP2A 3CLPA 2JDAA 2PTMA 5F3EA 4CEWA 1ZZ6A 2YU2A 4ZONA 3LA7A 3VLBB 4D7YA 1F9KA 2JIGA 2QDNA 4N9IA 4YYOA 3RI9A 2VVFA 4GKXA 1GFF2 2OS2A 1QKQA 4UWDA 5TSWA 1BBT3 1KS5A 2Y38A 2Y6KA 2XWJB 4ONUA 4COZA 4AW7A 1COV1 1QJU1 4ZKTB 1UZZA 2ZEWA 5BNPC 3NNFA 2IVIB 3POEA 5JI9A 3GM8A 4BE3A 1TME2 4XURA 1CX4A 3TN93 3KLSA 4EWDA 1C57A 2XBO3 4RS5C 3NAPC 5LASA 1VBB1 1POV1 1HXS1 3IWZA 1NKGA 1ZRFA 4CCDA 5JSRA 2PLV2 4M01A 1S0JA 4DUXA 1R081 4KBBA 4QAWA 2ZX1A 3VBFC 3BVCA 4Q0UA 2GZWA 3WP6A 4I09A 5KC6A 1UZ0A 1JI6A 1A8DA 4NAOA 1DP0A 1QQP2 2AYHA 1B35B 1AR72 1W04A 2V5DA 3P5BA 3ZIXA 4AI2A 3ZXJA 4WVVA 5JAXA 1OLMA 3SEPA 1RUJ3 3LGRA 3RJ2X 1CAUB 5BXXA 4UYBA 4IEVA 1OD3A 1PGSA 3P6BA 5LEKA 1PGL1 2G9ZA 3OYWB 4GH4C 1EV12 2GMMA 5F8PA 4XFGA 1DBNA 1PO23 2EAKA 4HG6B 4Q0VA 2JENA 3VBUC 4K6BA 3T08A 3CDZB 5D2AA 4CU8A 5I0TA 1TQ5A 4K8RB 1A8MA 4LE4A 4MGTA 3SMHA 4NUBA 1VBE2 3LKJA 2P3YA 2RM22 1WCDJ 3LFIA 1LNSA 3HOBA 5FO8B 1NZIA 2WLQA 1DGLA 3OPWA 3RI8A 3VHOA 1WA6X 1K3IA 1ZZ8A 2AR6A 4N43B 3H3ZA 4TLGA 3DPRB 2VC9A 2RR12 4DXSA 4RFRB 1I1EA 2VAUA 1ENRA 4XF3A 4QKDA 2FQPA 2XR4A 2ZACA 3CJIB 4MGIE 1CZTA 1SLAA 3VZNA 1UZYA 2Y6HA 2GDFA 5FZCA 5KHKA 3MF9A 3U4XA 3EQEA 2BW8A 4H7LA 4MO3M 2ZPXA 3KHBA 1N3OA 1GZWB 5FP8A 3MEPA 3I7DA 3NNLA 4HSJA 3U10A 4XF0A 4DXTA 3AKPA 3PUIA 5FY0A 3UNPA 1EPZA 3VBSA 4A7KA 5KXCA 3NJYA 1N1VA 5JZGA 2JDNA 2C26A 1ST8A 4HPKB 4JVAA 5IFPA 2LUWA 3UGHA 3TN91 4AFDA 3V0BB 4ZU4A 2XBO1 1OOPC 5HCHA 4XACA 3BUCA 3WF1A 3FFQA 2MHFA 2RS12 4XMIA 4LO4B 3ZSJA 4CCCA 3A4UA 1TMF1 1N1TA 5LB6A 4DMIA 1HIXA 1W05A 3I59B 4D6QA 5BNPB 2C9KA 3D4KA 2CTVA 4GB31 3BPSA 4CEYA 4XBLA 4EJRA 1LHOA 1LESA 2VH9A 4IXLA 4RS5B 3NAPB 4LQRA 4R9CA 3V0AB 3OCPA 1QJX2 1EAH3 1RUJ1 3I97A 4XJWA 2WNUA 5F6LB 1RUE2 5L73A 4D94A 4TLFA 5IT6A 1Q56A 5F3GA 1ASJ3 4CDWC 4NHXA 2B46X 3VBFB 2B45X 5AVAA 3AKRA 3C7HA 3I3DA 3MIBA 3OGSA 5F32A 1RHI3 3POBA 2H0BA 4D0QA 1PO21 4KG8A 3MBWA 1JHNA 2K2SA 1RUD1 4XJZA 2YBKA 4TWTA 1OQ1A 2BOJA 1KQRA 2BNNA 2ZA9A 5A3WA 1CONA 5BNQA 1ULGA 4JV4A 5J36A 2BNMA 4H55A 1CAWA 4GH4B 1AL0G 5FY9A 2HWB2 3CEWA 5BPXA 3U4SA 1OC1A 3VBUB 1E57A 5JOZA 3U75A 2VXJA 1Q8VA 2W52A 3KB5A 2WDBA 4NR1A 4BHPA 2VUDA 2EALA 4BISA 2ZEXA 4JRLA 4BK4A 4IEWA 4WVWA 3OBZA 3KVAA 3O12A 4AHYA 4Y24A 1NOVA 1QJY1 2QQIA 4NOTA 2QQKA 5DUWA 2X10A 5FUPA 1OA2A 2YFZA 2YB7A 4BZ4A 3WNPA 3VD4A 1LR5A 1GKBA 3AVSA 4UW5A 1HQNA 4YW1A 3KD4A 1JZ7A 4BWOA 1OSGA 2VM9A 2Z4FA 4EWEA 4YFZA 5FDBA 1X8MA 4IUGA 3ZR6A 4TYSA 5A33B 3FL7A 2C24A 2P37A 4FPOB 4XAAA 2W3JA 3ACFA 1PIV2 3RMXA 5M0TA 3PU3A 5FK8A 3ST7A 5BNNA 5CFCC 5E89A 3N9LA 1MQTC 1PVC1 4BLIA 4DXZA 3KM5A 1KFXL 4FFFA 3UESA 5FOBB 3FBYA 2Y6FA 3IKWA 4K7JA 4AI0A 5HXMA 3ZLIA 3QH6A 5IUQA 1C28A 1QDOA 4I01A 4WZFA 4FFIA 1V0AA 3ZYRA 3T1LA 3KT1A 4WM8A 4UF0A 1OOPB 2ZTNA 4KWUA 2GN7A 2E33A 1LGNA 2AENA 2YFUA 1YFYA 1ASJ1 4BQ5A 4YG6A 3RRDA 1RHI1 4CXYA 3BYWA 2YG0A 3C8XA 5GLVA 4F7ZA 2ZKLA 4R9BA 4CP0A 2H6BA 4OUSA 4R52A 4UT5A 5JXHA 5HCFA 3H1YA 4OMCA 3PJQA 3VKNA 1C5HA 4FAGA 1JOJA 2EIDA 3ZMOA 3VKFC 5HI0A 1LU1A 3CBNA 5JMOA 3R4UA 2ET7A 3H8OA 1WZXA 4M3CF 3AP5A 2VBDA 4LKFA 2GMPA 3VHRA 2PYTA 2GP3A 1G86A 1GP4A 3KS7A 4QXHA 4CDWB 2I74A 1SHWB 4IGQA 4G4FA 5IK4A 1E5IA 4GMP0 2DVAA 4X6QB 4CXWA 3AP6A 2PHXA 1NYWA 3W9AA 2G9GA 2A3XA 1DGRN 2GNTA 5A7QA 3RQ0A 4HANA 3VN4A 1OD5A 2OIIA 5DUXA 2RVAA 1LOGA 3UK9A 4JDNA 4DEVA 3KHCA 1OHFA 3AVRA 2IXIA 3LIGA 3U78A 3ZPOA 5C4WA 4YSFA 3ACIA 3FBMA 2EXHA 1GUIA 2Q4SA 2D93A 1RC6A 3LWCA 4N7UA 2PA7A 3TBDA 4RN5A 2VJXA 4KQ7A 1GOFA 2XJQA 4XUOA 3FC0A 3PMSA 3OSDA 1OLME 3UGGA 1JZ5A 4Q0SA 2J1VA 3IIAA 5C3SA 1OF4A 2QQVA 3ILFA 3OGVA 4CYDA 3T0DA 3C3VA 5IVEA 3OGRA 4NJ4A 3S57A 1ONAA 1RB8G 5CAZA 1ZA7A 4RQPC 4LLFA 2Y26A 4CDUC 3THTA 1RUH2 5FZ4A 1UW8A 1H0BA 4YG0A 1ZNPA 3SEEA 5EYYA 5L19A 1IPSA 3I3BA 5CFCB 2WWJA 2ZAHA 2VUAA 1A3KA 2VQAA 1MQTB 4XBQA 2JECA 2IXLA 3MPPG 1IGOA 1WLTA 4XQWA 3SXWA 2Q8OA 4JDMA 2ZJCA 2YC0A 4LK6A 3N7JA 3NSTA 3ZO0B 3A0KA 4OI0A 1A78A 3H7YA 5DZGA 1JYIA 4M0HA 1H2LA 4NHMA 2GALA 4FOYA 3RZHA 2NMOA 2RDQA 4EZ4A 1HX6A 1WCKA 2WWSA 2D5FA 1GWLA 4EWAA 3PL0A 4GWMA 4KG0A 5FLJA 1SZBA 2XLFA 1G9CA 2F17A 2JICA 3KMHA 3RZGA 1CX1A 2ORXA 2WNEA 3MIEA 4S2HA 1NCRA 3VV1A 3AL6A 1AXZA 3OUHA 3I49A 2VCCA 4B1MA 2W1WA 1AR82 3O1MA 2QQOA 3A22A 1CZVA 1CAVB 4Y1UA 5C3RA 1QXJA 5A3LA 1FPN3 1FMD3 1H2MA 2HLEA 5C3OA 2O0OA 1IS3A 1VMHA 1YUDA 3M7AA 3HMYA 2QQPA 1W6QB 4XHBA 3G6JB 3WG3A 1QY4A 1JYNA 1M06G 4X8PA 1ULCA 1H8TC 1VBC3 3NQHA 1QNYA 1U5IA 2R062 3WNXA 4BU2A 1H9PA 4XVHA 3O1UA 2ZMLA 5KXEA 2DBNA 1L7QA 5GZDA 1CPMA 1K5MA 4AYUA 3O1SA 1JODA 5DDJ2 1R1A3 2J1AA 3BKZA 1IS4A 4COUA 2JX9A 2XJVA 1SCSA 1WBLA 2VOKA 1VB4A 1Y4WA 1D2SA 4XCAA 4Y22B 4HN1A 1HQWA 3TB0A 5FQ0A 4JDOA 3LD8A 4UFIA 1JU3A 1FATA 4RHV3 1JN2P 3EHKA 4JQTA 4DNYA 4R9AA 4NWVA 4AGGA 2WJSA 2P3JA 2X53S 3GF6A 3WLUA 1HN0A 2AUYA 3IZOA 2OZJA 1SBFA 4FT8A 5D21A 5CG9A 5FPVA 3N36A 2ZGRA 1Z78A 1VAVA 4LTAA 4NIHA 1SLCA 4Y5SA 3WF0A 1JH5A 4RQPB 4CDUB 3D0JA 1PX3A 2QTWB 2WABA 5CZKA 3SITA 5HXVA 4KWKA 2P5BA 3ATGA 1HRI2 4W6WA 3HNMA 2BUKA 4Z92B 5FPUA 4GKYA 4YGDA 5BUVA 5F5QA 4CUAA 4YFWA 1JYTA 3H9AA 1ENSA 3LE0A 3PVEA 1XBFA 3VDCA 4XBNA 3CIHA 3JQXA 1C8M3 2O14A 4AVAA 1YQ2A 2RJKA 1WKYA 2VZQA 1W6PA 4ISQA 3CMGA 3ILNA 3VBHA 3VKOA 3TWIA 2X5IA 2NN8A 2TEPA 1W6OB 3UYJA 1IPJA 1FPN1 1FMD1 1V00A 4Q4V2 1UY3A 5LEJA 1Y7BA 4QHOA 5I0RA 1UXXX 1YQ8A 3HNBM 5FMCA 1QJFA 3SHRA 2ADEA 1Y43B 2FMDA 2ZEYA 4XJ8A 2W46A 3FFZA 2G4IA 3BOWA 5APAA 5LBBA 5LRRA 2VQTA 1VBC1 1RUF3 1J58A 4INDA 3ZN4A 3QD6A 2V4VA 5A6ZA 3O5SA 4HN0A 3ZXEA 2J42A 2KA3A 1RUI2 1GR3A 4FPFA 3MUZ1 5J1XA 1UCXA 1UY1A 1R1A1 5FYUA 1GZTA 4LBNA 1OUXA 2K9ZA 3K48A 5FZFA 4LO6B 3UL2A 3EO6A 1H8TB 2VNVA 2ZGMA 3LB9A 4NRQA 2Y0IA 3ENRA 3HIFA 4HFSA 4Y1ZA 3SCFA 2YY1A 3VZJA 2QKDA 5BNOA 1PK6A 1AX0A 1BZWA 3MUY1 1S0DA 2HWD2 2WYSA 4RHV1 1RUG2 2D40A 4JKKA 4DRVA 1G6NA 1J84A 4Q4Y2 2RG4A 3ZXGA 2JB4A 1DZRA 3I2HA 1QH6A 4BOWA 2E9QA 4Y33A 3CO2A 3NMBA 3VD3A 3SKJE 3EMRA 1NA1C 3JB4C 4JX0A 4DFSA 4AQSA 5IAVA 4AEDC 4YZ4A 1PHMA 2JDYA 1ND3C 5FY4A 2A3YA 2VZ3A 3WQBA 3MIHA 5BYNA 4TXWA 2BZDA 2XL9A 1MZ5A 3OYWA 1CAXB 1REFA 3KV5A 1LGCA 3WDWA 5A1LA 1QOSA 2BBAA 5FXVA 4ZY9A 1LJ7A 2WKKA 4JAAA 4O61A 1C8M1 1QDCA 2JG9A 3INAA 3LPFA 4K40A 4YVWA 5FZIA 3M3OA 5A3MA 4COWA 4QHBA 4Y20B 5IWFA 3AXDA 2ZX2A 3F2ZA 5L36A 1PGW2 3HBKA 3SKVA 4RGAA 3ZFGC 1UIKA 4P9LA 5IVCA 1XB9A 1PMIA 1BLZA 5FXXA 1O59A 3WW4A 1YJLA 1R091 4F3JA 2RJ2A 3RPQA 3CHXA 2WR9A 3A23A 3E5XA 5L7OA 2A3WA 4JGYA 4LO8A 2HWE2 5IK7A 1UYPA 2BTVC 4QDQA 1UX6A 2FHRA 4AHZA 4CEWC 3IMMA 1WCSA 1RUF1 2XOMA 1K12A 1CIWA 1KXGA 4P00B 1KJLA 1IS6A 2OQ6A 3NRUA 4CDQA 4LKEA 4HVRA 1W03A 3R4DB 2UYBA 1VJ2A 1MS3A 3AZXA 5FLIA 4F83A 2BQPA 3D5OA 4URTA 4HETA 4WM7A 1T2XA 1F31A 1NQJA 3RWNA 3RYKA 3HT2A 2Q5TA 1X33A 3FX3A 3B9CA 4XQ4A 3T2PA 1S0FA 2GAUA 4OULA 4J25A 4YGCA 4B4QA 1I9RA 1YFUA 4QB6A 2O1QA 1VRH3 4Q0QA 4UW4A 4OQ9A 3VL8A 4JGZA 5DAVA 4LOSA 2GNDA 5GZCA 1W6NA 3CNAA 3IM0A 1NXMA 1WMDA 4R4XA 5H9PA 3UKVA 5A3NA 1O4ZA 1QNWA 4UBHA 2R072 1YJKA 4GWIA 1FOD3 1D4M2 4A6SA 3USUA 3WEZA 4XFAA 1S2EA 1RGSA 1NE4A 1W39A 5C9AC 2RMU3 3AZWA 4OUEA 4UFLA 1QH7A 4RGKA 4N53A 4P08A 1W8ZA 4RR3C 1MS5A 5B4XA 3ZX7A 2VZ1A 5GM0A 1OMIA 4XUQA 5AVPA 2DF7A 4IEOA 4OYUA 4NIGA 3ALQA 1IPKA 1K45A 1NA1B 4SBVA 5F39A 2VNOA 2Z79A 4AEDB 4XUTA 2O8OA 1ND3B 1AR61 2FDIA 5FV3A 3T4HB 5F2SA 3AYCA 2LW8A 2IC1A 1OPMA 2JDKA 4AFAA 1BMV1 4CU6A 3ABZA 3LDRA 3PMEA 5I8YA 1NCQA 1AXKA 3VZMA 2BWAA 4XE9A 1G9BA 2FZ2A 3AKTA 5H9RA 3T3YA 5EXOA 1PO13 4YM2A 4PQ9A 3K2OA 4AHXA 3RMYA 1L3JA 1TNFA 1H2KA 3DL3A 5FUIA 1V6MA 2GC1A 3ZN6B 4DUVA 2EXJA 3ZFGB 1W99A 2VL4A 4E4ZA 4H2AA 4XFCA 1OLRA 1EV13 3LOIA 4YZ5A 4IE5A 3R0RA 2B8MA 3KZ4C 2HWF3 2WUHA 4MXWB 5FUNA 5JZGC 4Y3OA 4CDXA 4Z2AA 4CEWB 2CDOA 4MG2A 3I4IA 3CJXA 1Y9QA 3WG4A 1JZ2A 2W94A 2DCKA 1VBE3 1Z7S3 3M3EA 4L92A 1W9FA 2ZGKA 2RM23 1FT9A 2LROA 1DZTA 1VRH1 2QFEA 3PIJA 5A70A 4CCMA 3DKQA 5C3QA 1RITA 1Y9GA 3SH4A 3IT8A 1DQ0A 1ZZCA 3J7HA 3RJRA 1DYOA 5FZKA 3N4MA 4CEYC 4KMQA 5A32A 1HQLA 2DVDA 2YGLA 3WUCA 1HW5A 1QXPA 4NIDA 5EFUA 3S5AA 1OXCA 2RMU1 4BQ1A 1ENQA 5F9TA 3OY8A 1ZBE2 2Y6JA 3IPVA 2JE8A 2WNUC 3ACLA 4XOGA 3ITQA 4BIFA 4W6YA 2VUJA 3WQ7A 4ZZ5A 1HB4A 2HYXA 2ENRA 5KR7A 4JTNA 3RWKX 1V70A 2ZGQA 4COYA 2BWCA 2YDEA 5DZFA 2WSUA 2WT2A 5LW9A 2WC2A 2WQ4A 4KU7A 5C5TA 4HONA 2WNVC 2OUHA 5C9AB 4PI2A 2EXKA 1XE0A 5FZOA 5JPMB 2RS53 2XXZA 4XF4A 2QVSB 3AMMA 1XQNA 4PQQA 4RR3B 4IERA 3VDDA 4YPJA 1OVPA 4FOQA 3PVOA 1GBGA 3MGUA 4XW3A 1W3XA 1X9PA 2R042 4HVOA 4SLIA 3WNKA 1HRV1 4O7XA 1NAEA 2ZMNA 3ON7A 3LOBA 4AGVA 1IKPA 1PO11 5FCCA 3V64A 3M3CA 5SV8A 1GQPA 2RS32 1XSRA 3ZXDA 3AX4A 3PUSA 3A0NA 1LOFA 1RUE3 2JDMA 3MICA 1RUC2 1EV11 4HKWA 5E1RA 1UKRA 2FMYA 2ZGSA 1OFSA 3DXTA 2HWF1 3DYPA 1H2NA 5EJ1B 4YLZA 4FFHA 1W2AX 4MHRA 1ZZ7A 2WZR3 2DVGA 4AQ6A 2DTYA 2TUNA 3H8RA 4XMAA 1Z7S1 3ZFFA 4ZPIA 1WW5A 2RM21 2DBIA 3DN7A 3WHUA 5LWBA 3PHMA 3N7KA 5FMOS 3MPBA 5FP4A 4DY3A 3MW4A 2WZ8A 1IG3A 1TEIA 2B42B 2KD7A 4HK9A 3WF3A 5JZGB 4CP1A 4MZUA 2DU1A 4YM0A 1H4GA 1OH4A 1F5FA 3MLKA 1GNYA 3MDPA 3H8XA 1SPPA 1H1IA 4LLOA 1SQ4A 3IN9A 3LDBA 3FMGA 4FP3A 3HJRA 5JR7B 3U37A 1ZZ9A 5T5LA 5C70A 2WNOA 5J98B 4QPIA 3J7NA 4O9GA 2D3SA 5FZ0A 4XJAA 4CEYB 4JRAA 4J6GA 5JIUA 3ZFEC 2BGCA 2EIEA 2WO1A 4PT6A 3M70A 3JD72 4NWWA 2WO7A 4RFT0 5FY5A 3J8F2 1D0HA 4PLNA 5EYXA 1QIQA 2JKXA 1C8NA 2RS51 2WNUB 2YV8A 4I0AA 1XXNA 4M00A 5ACA3 1PIV3 4AVTA 3MLLA 4NPMA 4LK7A 4Z2WA 3Q9OA 1XSQA 3D82A 3EB7A 3ECQA 1HKDA 2Q8CA 2FCUA 3WDYA 1W06A 1AX1A 2C6SA 5J7MA 2BJSA 3T2TA 3AYDA 4UXAA 4MSVA 2WNVB 2BNOA 1ACCA 3ZR5A 1POV0 4NPRA 4COVA 5JXJA 1F4AA 1COV2 1QJU2 4HMZA 3BI3A 2ZEZA 1OBNA 3BALA 5FZ1A 3LEGA 3VKLA 4EN6B 1RUE1 5C4WC 4G9SB 3F95A 3PTRB 5E8AA 3THPA 4E2QA 1VALA 2I2SA 1UD1A 4E8DA 1W9WA 1BBT1 1ND2C 2F4PA 3GZTB 1QF3A 2P34A 5J48A 2VMDA 2PQSA 2B9VA 1VBB2 1J3PA 1HXS2 2I07B 4R4ZA 3WUDA 3WF4A 3DGTA 4YGEA 1BEV3 1R082 5FZ7A 4XFBA 2WZR1 2ZZQA 4YNIA 1NY71 4H3WA 2J22A 4AVVA 4EN7B 3FHIB 3JB8A 1UPIA 3I54A 2OKXA 1J3RA 4XEZA 1UY4A 1LHNA 1VBD2 5C8CC 4LBMA 5GLZA 3PVBB 2PN5A 3BGAA 5HCBA 4DOUA 3TEWA 4B29A 3ASIA 4QQHA 2ZHLA 1NT0A 5FWEA 2HYKA 5IK8A 1YFWA 4MOAA 4N8MA 2YUEA 2VULA 3AC0A 2FDFA 3E1F1 1CZSA 4XUPA 1WWYA 2AACA 4GMP3 3MFAA 2VVEA 5LBFA 3T2QA 1AYM2 5EWSA 4LBKA 1UPSA 3BTAA 2WA3A 3APBA 4LMFA 1TNRA 3KQRA 4AI9A 5ANNA 5J37A 1UZWA 2R30A 2VMGA 4AZZA 4UFJA 1CAUA 2VR4A 3JZVA 2IXJA 1REDA 1J1TA 4UF0B 4LULA 4PJYA 4QQLA 4BXSV 5ACA1 4URAA 1L7RA 1O5LA 1IZ3A 4IE4A 5LA9A 2VW1A 4EN8B 1PIV1 2AZ5A 4W4ZA 4C1XA 2WO3A 1H8VA 1S2BA 1CESA 3B00A 4LT5A 1C5IA 1UZVA 3J9SA 4JKMA 4DXRA 1CGPA 1NCRC 2ZZJA 3CZJA 3HN1A 3ZFEB 4QGNA 2F6BA 1MS1A 1E5HA 1HJFA 2ZGOA 4W8JA 4D69A 4DS0A 3VD9A 2VBBA 4DINB 5E6HA 1NLSA 1N1YA 1OKQA 1UWWA 5IK5A 5T5PA 3WNMA 2R1DA 1WW6A 1S55A 3JQWA 3AP7A 3DPRA 3ORJA 4Q8LA 4HKLA 4RD7A 3MV01 3BTZA 4LPLA 5GZFA 1OH3A 3LEIA 3I2IA 2D6KA 1OFNA 2QJVA 3MIGA 1ULDA 3TN92 3CJIA 2GMEA 2OXBA 2XBO2 4EN0A 2EIBA 2J1EA 3TEXA 2DCZA 4DIQA 5CEHA 3RYRA 1BEV1 5FZAA 4A41A 4KWJA 1TMF2 1GZWA 3NJXA 3CKHA 1JYCA 1W8HA 3ZSEA 4PIXA 2JG8A 2ORZA 2XH6A 1MS8A 3CQOA 5C4WB 3H1WA 4GB32 5GALA 3U0ZA 4LO5B 1W0OA 3SH3A 4HPKA 1ND2B 3S6PA 1XPWA 3NWKA 2SBAA 3V0BA 4LHLA 4FPKA 4GD4A 4BH9A 4AI8A 1AVBA 2YC2A 3PUAA 1MEC2 4N90A 4LIUA 1PNGA 3PDQA 1J59A 3PJYA 5LCWL 3I2DA 1PO22 3I59A 5C8CB 3T0AA 1EAH1 1KFUL 1RUD2 4GMP1 4CU9A 4QPGA 4HOOA 1R1ZA 1QJEA 4K21A 3AZVA 2OT7A 2P3KA 5FYYA 5I91A 5BY5A 4J1WA 4Q1PA 3NAPA 1H4HA 4RS5A 1FNZA 4ZS3A 1X36A 2WT0A 4LIVA 4C8DA 1KJRA 2IUWA 5LY1A 2R063 1MZEA 1LHVA 4META 1RUOA 2W47A 3TRSB 4YRDA 1JOPA 3VBFA 1JYWA 3QCWA 5EIYB 2OA2A 2XMLA 2VTXA 4FPHA 4I0BA 4GWJA 1SEFA 1DF0A 3LAGA 3VBHC 1GOGA 4EQVA 3E6BA 1UAIA 4IEUA 1QJY2 4IEQA 3FLTA 5CVRA 1ZREA 3I3EA 5AC93 4XETA 3VZOA 2G1MA 2DCJA 2X5IC 4LBLA 5L9VA 5GLTA 4AEJA 1AL23 3POIA 2DFCA 5C6CA 4LBJA 4QU1A 3VBUA 4HLTA 3GALA 1IG0A 3ZKUA 1DQ6A 5FXZA 1O3SA 4P5HA 1W8WA 1NCRB 2W39A 3E97A 3HQUA 1F35A 5A3UA 4FBFA 1HN1A 3WX5A 5FYVA 2P1BA 1HRI3 2VCBA 4E27A 1PVC2 5LY2A 1JW6A 4LEJA 3OBAA 3S30A 2NP0A 5EJZB 3MHZA 2D6NA 1WUVA 3BOPA 4AG4A 1W8OA 5KHIA 5T3NA 1XYOA 1YXWA 1N47A 4S2DA 4EV0A 5A33A 2R49A 4NHYA 4AAPA 3WCSA 3T09A 2WRAA 4WBBA 5FXWA 1VBA3 4QX1A 5BNOC 4QQOA 3N35A 1AUYA 1ASJ2 2W2IA 3UGFA 3DV8A 1W2NA 2ZMKA 1IQAA 4YVSC 4B7EA 2YBSA 2YZ4A 1YQ5A 4Q4V3 1RUNA 2G19A 1LB2A 3ZYFA 3I8TA 1JBCA 3AMQA 3H42B 4NMIA 5GLWA 1WGPA 5KHGA 1AR92 1U5ZA 5FY7A 5HV4A 3FUQA 3OBTA 5KXBA 1V6OA 3IDCB 5FY1A 5A80A 2WIIB 3KCCA 5K8SA 4QGMA 2AH2A 4IEYA 1VE0A 4K9SA 5CIRA 1SFNA 1OA3A 1NXD1 4C0BA 5A6XA 1PZ7A 4FAHA 4RL7A 3H3UA 2PAEA 3ES4A 4E4HA 4QT6A 3GNEA 4XDOA 1GLHA 4QKFA 5CADA 2JG9C 2VVDA 3A7QA 2EIGA 2J1SA 4RA0A 2DCTA 4YVWC 4MV2A 1DGWA 3VBOA 1WCQA 2YXSA 5FJHA 2FZ1A 4UW3A 5FYSA 4CUGA 5AC91 3Q8EA 1S0BA 4CDWA 4ITCA 5FO7B 3QH7A 1SFPA 2D97A 3K4DA 3N3HA 1XJAA 1JYVA 1AL21 3P3NA 2VCMA 3NV1A 3ZN5A 4LBOA 3E5UA 1XRUA 1VAMA 5L7OC 4M3CA 2OPKA 4LA2A 3QOPA 4IQPA 4UOJA 1W8UA 1Y9MA 5I0UA 4AXOA 5ABJC 3DF0A 5CA6A 3VBHB 1W6PB 2HWC3 3WQ1A 4CCNA 1EYBA 2EXIA 2V5YA 1LHUA 3M8LA 2W95A 2A6YA 2D3PA 4O9EA 2X5IB 2W87A 2OW4A 3PVNA 1HRI1 1H1MA 1HV1A 3DECA 4PBOA 3ZXKA 4CDQC 2DU0A 4GA9A 2WFF3 5T5OA 4CP9B 1ZX5A 4PBPA 4Y4RA 4PDWA 1ALYA 4BMBA 1GV9A 2W1UA 2PHUA 2NM1A 2XJPA 5IW0A 1MACA 4V1PA 1MZFA 1VBA1 3NV2A 5DAXA 5FY8A 2VZOA 1Q3EA 5IYYA 3E6DA 1RINA 4LE3A 1RTVA 3RZJA 1BCXA 2WYFA 2QQUA 4LBQB 2Y8KA 4Q4X3 3TNQA 4KWLA 1WW4A 4H14A 3VB9A 4P9XA 1G8WA 1W6MA 2UYAA 3FWEA 4RGGA 1IS5A 4P5YA 5DG1A 4P02B 4C91A 1EPWA 3ZDSA 4PHZA 4IETA 5FTTC 3O1PA 1O3RA 2HWE3 2JWPA 3LEMA 1GICA 1OQDA 1WCUA 5BNOB 2W92A 4OHVA 4C0HA 5CFCA 2NQYA 3NV4A 2Q0AA 4N53C 4YVSB 4CE8A 4DB5A 1I3HA 2D98A 4QX7A 1S0IA 2LRPA 4FXGB 1SDWA 3LSEA 2UURA 1W3VA 3KQ4B 4QQ2A 4XFHA 3VDBA 4Z82A 4Y5TA 5FZMA 3BU7A 2CAUA 3AMHA 3GYDA 1GZ9A 5JPNB 3B69A 2OQ7A 3ZSKA 4CUBA 2DCYA 4WZCA 2WSVA 1ULOA 2B7YA 2WS92 5DAWA 1X82A 2YMZA 4FSJA 1NCQC 2ERFA 1V9U3 2XJRA 1XU1A 1BVVA 1XYPA 2RJLA 2V72A 2P17A 3AKQA 1JUHA 2YHJA 3WW1A 4B3NA 3BN6A 3KCXA 4YW6A 1P8JA 2YBPA 4R9DA 1QWRA 5FZEA 2JG9B 4QD2A 4QX0A 1X50A 4XTPA 4IE7A 4YVWB 1CAVA 2HWC1 5FO9B 4LXLA 1H6YA 3URFA 1X7NA 2JD4A 4OZOA 3NNJA 4R8HA 2K0GA 2R1BA 4XAEA 5T52A 2WFF1 1W6QA 4FPLA 2MEV3 2E7AA 3VD7A 5IVJA 1DGWX 1V6LA 3EXUA 1HJGA 5FZ9A 4AI3A 4UAPA 5L7OB 4CCKA 5F5CA 1W8TA 1XU2A 5CKQA 1O91A 3ROUA 3VKMA 5ABJB 3BPZA 3LSDA 2FDGA 4A2UA 4AQTA 2WQ8A 2Z5WA 4LR4A 2VMHA 3OB8A 4CDXC 5H9QA 3AJZA 3HAGA 5FYZA 3WG1A 2VZUA 3SQOA 3W58A 4CDQB 4XIKA 5LK7B 4Q4X1 4Q27A 5JIAA 1OT5A 4A45A 4AVSA 4BQ2A 3KV6A 2JDUA 1CN1A 3JBG3 4IV1A 3OF1A 2BV4A 1FXZA 5E16A 2GC0A 3AMPA 3OD0A 4Y22A 1QMJA 4KBZA 4XCBA 4K8FA 4CSWA 4AFBA 4HVQA 4I2OA 4QX8A 5KHJA 1TVGA 4DY5A 5H9SA 1LOEA 2EAAA 3C7EA 4LORA 1NZCA 1V6NA 1W9SA 4A3XA 4E4DX 3ZIWA 4FOWA 2E53A 2UU8A 4NPLA 4CCLA 1G9AA 1APNA 2VMEA 3MLJA 4GQ7A 3I2KA 4MX3A 4N7IA 1C4RA 4YZ2A 2Y6GA 1Q8QA 3WQ0A 2VCAA 1W6NB 4RQPA 4ES9A 4TZDA 3RG0A 5LBCA 1US3A 2A7AA 4Q2FA 5J09A 3POSA 1AZDA 5FZ8A 2MPFA 5G05L 5FKBA 1OLQA 3J7MA 2P4EA 3B3QE 1FPN2 1FMD2 2NPIA 1F15A 3N9PA 3OPZA 4IEPA 1HB2A 2DVFA 4IGOA 4UFHA 4OCTA 4ARXA 5CISA 2CGOA 3IB3A 3UKTA 1OKOA 5FREA 1RVF3 4FPGA 4N53B 4D6SA 4LUMA 3VDDC 3O0VA 1RMU3 4YW2A 4AF9A 1YIFA 1URXA 1V9U1 4HL0A 4NRPA 2VE1A 1DQ4A 4XQDA 5GKAC 2TNFA 1ZRDA 2PXJA 3I3QA 2BOIA 5L9BA 2GC3A 4IE6A 1DGRA 1W6OA 3WP4A 4AE2A 4AQ2A 2D7FA 5EPAA 1HLCA 1R1A2 1KGYA 3UJOA 3HEIA 4IW3A 3FHAA 1ZBE3 3NW4A 1W0PA 1IQDC 4MXVA 2VOWA 1NCQB 2DFBA 2MEV1 1XNDA 4F8AA 1G9FA 2V09A 1UXZA 1MS0A 3ACGA 5D8AA 5JI7A 3RZZA 1E5RA 1AYN3 2A75A 2UWAA 4C1WA 3ZOIA 3T2OA 1POQA 1J3QA 3ZXFA 1LECA 3MW2A 4RHV2 1UX7A 2XKPA 5FPAA 2J7MA 3BODA 1D0GA 5KXDA 5F5AA 4ZS2A 2PMWB 4FPJA 2YYOA 5F7UA 4NHLA 4CZSA 2N7GA 2R16A 5JOXA 4Q4W3 1V6IA 4MGQA 4YG3A 4HXCA 1V6KA 4P9WA 4OI1A 1F2NA 3J7LA 4IEZA 3JBG1 3D0SA 3ZXAC 2J1TA 1Q8PA 5FP9A 2WAAA 3RGBA 4B8EA 3IMNA 2Y33A 2B39A 4ATEA 4CDXB 3DKWA 4UI9L 2E7QA 4MGYE 1S0EA 1QHDA 3M2MA 4XPVA 1X8EA 5IFTA 1LEMA 3MF6A 2PHTA 4OHZA 1O7FA 2CDPA 4QXCA 3MFCA 4FQ4A 2W5FA 5EV7A 5C7GA 4UFKA 5FMOL 4Y1VA 3WY6A 1L7LA 1RUC3 3K51A 4QPIC 4ZXEA 1UYZA 5LA0A 4M3CE 4I3PA 3LDKA 3LPGA 3ZPYA 5A3PA 2CGNA 3H50A 4GZ9A 1YNAA 5A32B 3GHNA 5DABA 3PTYA 1TME3 3ZYHA 3J4UH 2VZTA 1ULEA 3U14A 1RXGA 4AAXA 1VR3A 5FZ6A 4BCUA 1R092 1FV3A 2JE7A 1DFQA 1RVF1 1UF2C 1UKGA 1RMU1 5ANQA 1TG7A 3NJVA 5A6QA 3G7DA 3MIDA 2PLV3 2P2KA 4C90A 4DO0A 1FV2A 1RUF2 4RYDA 2D6MA 3P1IA 4Y20A 2W0XA 1QQP3 1UNBA 1AR73 5FZOB 5KHHA 3FLPA 2A6ZA 2V4AA 5A3TA 1WMXA 3KT7A 4QB2A 5L9RA 3KV4A 3VDDB 2PHLA 1XYNA 2GNBA 3UETA 5DUVA 3ZM8A 4CPBA 1UN1A 3JCIA 1DCSA 3B93A 2Q1ZB 1ZBA2 4QGLA 4ISRA 3LCPA 1STMA 3VBRA 4LA3A 4BB3A 1AYN1 2GP5A 1YI9A 1O5UA 1TZOA 4JC1A 3VBSC 3AYEA 3NVCA 2QE3A 4NE9A 2WFPA 4L0PA 2WAOA 1W9TA 3J8F3 4V2WA 5CBLA 1DLLA 1YIPA 4Q4W1 3BCWA 4Q26A 4DPNA 3RFRA 2G9FA 4NHKA 5JXIA 4NIAA 4FQZA 4NAMA 1GZCA 1JXNA 1OVSA 5A7WA 3VGIA 1CR7A 1AJKA 2AEZA 2R32A 2RR13 3DUIA 4PIZA 3WG2A 5BV6A 1FOD1 2ARAA 3RNSA 3CF6E 2WQZC 5I93A 1NQDA 3BU0A 1COV3 1QJU3 2Z42A 4FTBA 1Q8SA 5A7NA 2D6OX 2QNKA 1XE7A 4D7TA 1QEXA 1O8PA 5DAPA 2PAMA 1CJPA 2Q30A 4IV3A 4K1YA 1RUC1 3HNYM 3JXSA 4WV8A 5FZLA 5CFDA 4BQ3A 1YI7A 1AR62 3PUHA 4ZU5A 3KT4A 2RV9A 1LTEA 4QX3A 1TME1 4GJYA 3ZYJB 1J1LA 5I0DA 2A73B 4B4PA 5DXDA 5HCAA 4GXLA 1CWPA 1YQCA 2LM3A 1S0CA 3GGLA 3NJZA 4KGQA 5FZHA 1JZ4A 1VBD3 3IIIA 3DXUA 4Q0PA 2ATFA 4BPZA 2RS13 4QPIB 2PLV1 1NA1A 2NZ9A 3C2UA 3OGGA 3POYA 1E5SA 3K46A 1C1LA 4DEQA 1ND3A 3HVDA 3RYPA 1SG3A 5C5UA 3CU7A 4CP2A 1BQPA 2D6PA 2DVBA 1QQP1 4K3UA 1AR71 2Y34A 1UU4A 5CYYA 5GZEA 3HWJA 3RZMA 2ARXA 3S7IA 4BLJA 1GSLA 4FI9A 1FI2A 1QJX3 1US2A 4UW6A 1S1AA 1AHSA 1AYM3 2A1XA 3T4VA 1PNFA 1U5XA 2VGDA 3E5QA 3VL9A 2GU9A 3WNOA 5D1IA 1GOHA 1LOBA 2BDRA 3WXPA 1ULFA 3ZYPA 5JR2A 3SH5A 3GHMA 1VP6A 3ZN6A 2R0HA 2RHPA 1DLCA 3C7FA 5T55A 1WMEA 2D3RA 1VRH2 3FJSA 3WDUA 2CV6A 1F8VA 2PHWA 2E51A 2Q8EA 4QDSA 1S4CA 2JG8C 4OVEA 3H3LA 2XVGA 1LENA 1VBE1 3TOJA 3V65A 3TEZA 2XQRA 4D3WA 2CAVA 5E88A 5I0SA 3WV6A 1FNYA 2KM2A 5BNNC 1SLLA 1WLWA 3WP5A 4DRRA 2RMU2 3ES1A 2HWB3 1UYXA 3WD5A 3GCWA 1NE6A 2Y0OA 3VBSB 4V2VA 2RR11 4XZPA 4GWNA 1YO8A 3SISA 3FN9A 3LF7A 3O1OA 3ZXLA 4CCOA 1YFXA 3K77A 3TAYA 2VXRA 4ZXKA 4FVVA 4WM8C 1UOGA 4OI4A 3RZKA 4OUMA 5FWJA 2XVKA 4QPGC 4YM3A 2QZ2A 4QX5A 1VMFA 5F3CA 5FR3A 2RDNA 1XNAA 4QKBA 4WVZA 2OYZA 3GZEA 5FPBA 3P3PA 4AFMA 1QU0A 4AEMA 1MVQA 2PHFA 1HRV2 1TMF3 1ZRIA 1M4WA 2E26A 2HEWF 5G04L 2JDZA 1FX5A 2ILMA 3ACHA 4MGSA 5LA2A 1PMHX 1PO12 2KR2A 1VBD1 1D4VB 1Q8OA 3AZYA 1GWMA 3DYMA 4GB33 1S2KA 1SBEA 2RS11 1RXFA 1VMJA 5JSOA 4WVMA 5C9AA 1UMZA 2AREA 3B7MA 2ZGUA 4HKOA 1CPNA 4QM9A 2EICA 4NVPA 1MS4A 4QQPA 4RR3A 2AC1A 2UY9A 1MEC3 1UU6A 5F2WA 2DUQA 4XF1A 4Z07A 4AOCA 2HWF2 1VLNA 3EYPA 4RSUA 1YHFA 1QJX1 5K0UA 1RUD3 2PHRA 4QKNA 2JB8A 1AYM1 1CAWB 4XDPA 1WW7A 3AXEA 5A7SA 1EY2A 4EZHA 4Z1VA 2PHDA 2XG3A 4L11A 1W2UA 3N9QA 1Z7S2 5FZBA 1BK0A 2JE9A 3X29B 4BIOA 4DZGA 1W0NA 3R4SA 3GJAA 2XGXA 1GYKA 2WL1A 4LOTA 3QLQA 4XFIA 3POFA 1NLRA 5F3IA 5IHRA 1QOOA 2OPWA 3ZSMA 3I2JA 2FCTA 2P3IA 4YW7A 5IATA 5JUVA 4AK3A 2HKXA 1EP0A 1PVXA 2W68A 2ZCWA 4GALA 1YCIA 5FJKA 3LA2A 4N9HA 5HBAA 4NO4A 4EE2A 5J3UA 4A7YA 4XJ9A 3I2OA 3GXUA 4FXKB 2HWB1 4B4RA 4CTEA 1W2TA 1PMJX 3MW3A 4XJUA 4PCRA 1UMIA 2W9XA 2VQUA 3AL5A 4ASKA 1QJY3 4D6RA 5AFBA 5FBJA 2ET1A 2W91A 3AB0A 1LGBA 3L9JT 4QWNA 1BYHA 1U0AA 2VG9A 5GLUA 1PGL2 2ZHMA 2JG8B 1ODNA 2VMCA 3AP9A 3U11A 2LS6A 1JTZX 2AEYA 4M4PA 3ZYIB 5IVVA 1YWKA 4OMDA 2DUOA 3WOGA 1LU2A 1WMFA 5BNNB 4BMEA 1B35A 1XNBA 5A7PA 2RS52 2WBKA 1BVP1 4QMAA 2BU9A 5JDBA 2ZX0A 3HR9A 1BXHA 3W21A 3QBQA 3ZSLA 3O0XA 4A44A 3S0MA 5C71A 2NLRA 5F37A 4FFGA 5LA1A 4LUKA 1MVEA 1U5YA 4TSVA 1RYYA 3HQRA 1PVC3 2E31A 4WM8B 4PLMA 5DPNA 2OZ6A 4QPGB 5FIXA 4CPBD 5FK7A 4Z8BA 2VQ0A 4BXFA 1DIWA 3OEAA 4BJ0A 1REEA 3VBOC 4ASMB 2L9LA 2BFUL 1S0GA 5JVVA 4W65A 5A7OA 4E2SA 3B9IA 1I5PA 1QOTA 2VW2A 4ET7A 1RUH3 4JZRA 3O14A 1MEC1 2DURA 2XPJA 2VOXA 3Q8AA 1T6GC 1BBT2 3U1XA 1JZ8A 2R7EB 2FD8A 3KCYA 4N43A 3W5NA 3IAQA 3SCGA 3AFGA 1XNCA 3R6SA 2CU5A 2WNVA 3UV9A 2WZR2 3N7LA 1Q43A 1NY72 1AR93 4P14A 1G7YA 2IXCA 4LKSA 2KXLA 1SMVA 2VOTA 4GIQA 3WT3A 4EROA 2XVLA 3AFKA 1PZ9A 4LJHA 2DDUA 4CUCA 1DU3D 1K5JA 1NLQA 5FP7A 3AP4A 4AEKA 4CA9A 5EHDA 1HB1A 3GBFA 1K5MC 1SACA 5FLHA 1UOBA 4PDWC 1A6CA 1D2QA 1WLCA 2XKOA 5JMCA 1ZYBA 3N9NA 4GAZA 1H9WA 1SDDB 5DMYA 5FP3A 1O4TA 3HN3A 4CXXA 2C5DA 1RUJ2 4PIYA 4AWDA 1XNKA 5C8WA 4KU8A 3ZKYA 3KWVA 4BQ4A 2H6CA 2PFWA 1AR83 2QQWA 3L2YA 3NV3A 3O1RA 1W8NA 4MHUA 3T30A 3NKTA 1AXYA 2DUPA 4FCAA 4ZZ8A 5BNPA 4L2NA 4IL7A 1A34A 1UU5A 2X09A 2ZGLA 1ZVFA 1W8FA 5ACA2 2ZXQA 3EBRA 2J1RA 3N9OA 4XHXA 5I8TA 3V0AA 2ZX4A 2IXHA 4OZXA 1AJOA 4IESA 1JS9A 2QZ3A 5IAXA 1CJDA 1JMUB 2DYCA 2ZOEB 3WHTA 1YEWA 2R0FA 4I3GA 1N3PA 5DDJ3 2QCSB 3B02A 2GH2A 2GSYA 2XUMA 3W59A 4GJZA 4G3YC 3I2GA 2CNAA 1PZ8A 1GP6A 3ZVXA 3H7JA 1WA4A 3OJBA 1J83A 1RUH1 4KH9A 3U07A 4GULA 4KNCA 4GH4A 1RJ8A 4JKLA 1O4YA 1ZRRA 5HPOA 2IFRA 4A42A 1KDMA 2X8KA 3ZFEA 4IE0A 1ZRCA 5FYBA 2ZGPA 1BEV2 2OVUA 1DHKB 2PAKA 5KBFA 2CSGA 1AR91 5JWPA 3JU9A 1W2OA 5CU1A 3VBOB 5CG8A 1RL3A 1AX2A 2JJ6A 3K4ZA 1SLIA 4MLOA 3T1MA 2VZVA 5CB7A 3B5LB 3ZYBA 1KDKA 1H30A 3K3OA 1OUSA 1JU4A 1V6JA 2VO5A 1YLLA 1XE8A 3AZZA 4M3CB 3SLIA 4AI1A 3WW2A 3UT0A 3GCXA 3TEYA 2VY0A 4DQAA 2VU9A 2IXKA 2XONA 1UMHA 2D44A 3W5MA 4AR2A 3VHNA 1JZ6A 1EAH2 4FPCA 5LRSA 2WS93 1Z0HA 3KF5A 1UQXA 1PK6C 5FZGA 1RJ7A 5A6YA 1AR81 3MZHA 3PNAA 1K5MB 4IV1C 4U36A 5T5JA 3GZAA 1ND2A 4Q8KA 2VZPA 3GBWA 5FPLA 1H1AA 1RHI2 3ETPA 1MS9A 3AK0A 4PDWB 1KRIA 3GZUC 4P9IA 2ZAAA 2JDPA 2A6XA 4KL1A 4XIOA 3KSCA 1H6XA 1XNTA 4AHWA 4NIIA 3BIEA 1OOPA 3VDAA 5FQ0B 5C8CA 1AF9A 1ENXA 2QQLA 4LKDA 4TN7A 2BFUS 3AM2A 5I8SA 2R061 3OPTA 3POJA 1NX9A 2HJIA 5DUUA 2BPA2 1HDKA 1LOAA 2X29A 4FTSA 4HT1T 1RUI3 1W6MB 3K3NA 3KF3A 1O3QA 4E8CA 3C7OA 3AYAA 2WZEA 5DDJ1 3WDXA 3WINE 1DYPA 2JXAA 2B9UA 5A3OA 1Y3TA 2ZABA 4J1XA 2J1UA 2XDVA 3L2HA 1DYKA 1GNZA 3WVJA 4OHWA 5B4NA 2CL2A 3THCA 4LHNA 3TNPB 3POGA 3WNLA 3MIFA 2XJUA 4QX2A 1JZ3A 2YPDA 3O1VA 2XWBB 4CCJA 2HWD3 3H0OA 5T50A 1RUG3 5FYMA 4BQXA 2JKBA 2UWCA 4A3ZA 4CVUA 4Q4Y3 2EVXA 2IFWA 1FYUA 2W08A 1OQEA 2ID4A 4QPYA 4JGYC 4QDRA 1WD4A 3HD8B 1PM7A 1UIJA 2ARBA 2CWSA 2XLAA 3PIGA 2Y60A 2DWRA 1XOYA 1LULA 2XQXA 1W90A 2A5ZA 1OPOA 4YW5A 5GZGA 2WT1A 3M1HA 4FO9A 3T0BA 5D8AC 2VTXJ 2A70A 3KV9A 4O65A 1VB2A 4NN0A 1BKZA 2FDJA 2HEYF 2C0ZA 2V73A 4WM7C 2BEOA 2NMNA 4YZ1A 4OLLA 2BVBA 2VZRA 1SLBA 2WS91 1CIYA 3PU8A 3ZDVA 4AGRA 4OHXA 2IVJA 4OFGA 4U2AA 5FYCA 5FPXA 1LEDA 1MZ6A 2HBUA 5LATA 4XILA 2W1SA 4AL9A 4JGZC 4Q4V1 5C3PA 4FTEA 1R64A 1DQ1A 1O6UA 2IWGB 3HT1A 4QXKA 2ETEA 4CRQA 1LRHA 1DZQA 4LNVA 2CHHA 3Q8FA 4OQ8A 3B94A 3TYJA 2XL7A 1NUKA 2WWUA 4FOVA 3M3IA 2FDKA 3VZKA 1PK6B 4XDQA 1RIRA 2HEVF 3RSJA 4HSLA 1LCLA 1CVNA 4IV1B 4XXPA 1IHMA 1MQTA 1RUI1 4L99A 4XXAA 3LEKA 1N1SA 4Y1YA 1LOCA 2VNRA 4K20A 5AC92 2F4LA 1OF3A 1F4HA 3BB6A 1OI6A 3CL1A 4L97A 2E7TA 4B7KA 1AL22 1DDLA 2QQNA 2VOVA 5IVBA 4S2GA 3RDIA 4YW4A 2YC4A 3QACA 2JIJA 4ZHNA 2HH9A 5FMBA 4EYUA 5CKMA 4YWAA 2E32A 3H1MA 3UKNA 2HWD1 2ZHNA 4X6RB 4XTMA 1RUG1 5FZDA 5AFEA 5K7PA 1KD7A 2K46A 4FPYA 4I30A 4Q4Y1 3SNMA 5DAQA 4BYYA 5FYIA 1GWKA 2B5HA 2R073 4L8QA 1SCRA 1D4M3 1T6BX 4JCKA 5JCTA 1JHJA 1ODMA 5SV5A 4MUVA 2DV9A 3NKGA 2BYVE 5KC5A 1IKQA 5K4LA 1X9TA 3HQXA 1BJQA 4M4RA 4Y5Z0 4ZU7A 1VBA2 3VBRC 3DYOA 2HBTA 3D8CA 2ARCA 1QXRA 4JGYB 1QGLA 3CZUA 2YGMA 1UL9A 3EJKA 4CP9A 3AMNA 2RDRA 3KVBA 3USSA 1R093 2I45A 3ILRA 3FLRA 2Q8DA 3JUUA 4E4SA 2BP6A 4NRMA 2YROA 1PGW1 5D8AB 4IEXA 5JLVA 4E2GA 4OHYA 1EUTA 1F5JA 4XF9A 2VPVA 2WO2A 5FYTA 1TE1B 2ADDA 3AKSA 4Q29A 4ATFA 4DUWA 2BRTA 4WM7B 4LBQA 4PF1A 4ASLA 2HWE1 3A21A 4P9YA 1YQ6A 5DQ0A 5LZ6A 2C9AA 3FE5A 3PLQA 3IDBB 2ZKNA 4IV3C 2JEMA 1ZBA3 4JGZB 4A4AA 4BM8A 5CFDC 1JOBA 4CDUA 1WLDA 2WN3A 4MYEA 4P9JA 5CNAA 3OUJA 2LTNA 4LO7A 2EF6A 2VBPA 3IBMA 4YVSA 2BERA 3NNGA 5FPZA 3USUB 4B1LA 1MPXA 1XC6A 3ETQA 4K1ZA 2GC2A 1SBDA 3OG2A 2Q1MA 1GNHA 1C1FA 3BTYA 2HWC2 5EP9A 2ZX3A 5B2GB 4M0NA 1KS4A 1O3TA 4YW3A 4LHSA 1VBC2 1CQ9A 3GDBA 2P6CA 4XFFA 5DN2A 3J26N 2WFF2 4ES8A 1B09A 2OX0A 2QQJA 2R071 3M3QA 2X05A 3KGZA 1D4M1 4ORFA 2A71A 3C7GA 1OURA 1DG6A 1UO9A 3AJYA 5T54A 1LOFC 1K42A 2P6HA 4QXBA 4ARYA 2QUOA 2VTFA 4HZFA 4YZ3A 4PF5A 5FMDA 2XLGA 1LODA 4QHZA 1AR63 1W9YA 1U12A 4Q4X2 1VPHA 2XUEA 1GQGA 5HV0A 3WF2A 2AGSA 2GNMA 5FZ3A 1NG0A 2MNGA 4D8MA 3VHPA 5JOWA 2WLPA 5KWRA 1ZA4A 3K75B 5JXGA 2YU1A 2WZPP 3ZFFC 5K9YA 2C4XA 5ABJA 1EUUA 2WN2A 4MH0E 4KI5M 3VBRB 2R043 1H8TA 2VD7A 4A7ZA 3MO4A 2PQQA 3WP3A 4E9KA 5JOYA 5IVYA 4L9BA 5FFOC 2UWBA 4H7MA 4XABA 2XHKA 3WR0A 1MR5A 2Q1FA 2GH8A 5GJ6A 3M4FA 1Q5OA 5A1AA 2RS33 4LHKA 3OBRA 4QU2A 2D5HA 2E6VA 5F1RA 4Y1XA 2R6QA 2VMIA 1C8M2 1ZBA1 2QBXA 2UY8A 5EZWA 2Z2SB 2WA4A 3THDA 4BQYA 5A7WB 4QB1A 4FPEA 2QDRA 3NL1A 4IGPA 4XZUG 1CD3G 4S2FA 3ZMNA 5LBEA 3SC7X 5DG2A 1V9U2 2W1QA 4MGKE 1GU3A 3VZLA 3RS6A 1UYYA 1VAKA 2B4KA 5C33A 2VUCA 1UOJA 1YYNA 2JDHA 3IPVB 3OY8B 4OI2A 1ULPA 4HBNA 1CAXA 5DZEA 4UFMA 4BDVB 3N7MA 4IV3B 2OUJA 5CFDB 2D43A 2E63A 2VNGA 4TTGA 3O1TA 2JD9A 1YC61 2Z69A 4JHZA 2FDHA 2VZSA 2Y6LA 2MEV2 1I6XA 2XJSA 2VW0A 3LQCA 3WNNA 2CYFA 1UY2A 2BVVA 2VMFA 5EJ3A 4CU7A 1PM4A 3GJBA 1ZBE1 5K0UC 4BQWA 3FZ3A 3S5QA 1VRBA 3ZYGA 2CWMA 3D3AA 3WDVA 5JSPA 1O8SA 3K4AA 2XHNA 5IJRA 4YM1A 1JUIA 2O8QA 3JBG2 2XJTA 2WINB 2ZGNA 3DCQA 1HRV3 2H0VA 2PELA 3JD73 3HBZA 5FBZA 2QQMA 2IZWA 4PI0A 5A1FA 3LIHA 1KEXA 3S7EA 5J96B 3V56A 2ZBJA 1D7PM 3RVHA 3NO8A 4JTOA 2A6VA 1GANA 3I2FA 5CKNA 4W50A 2SLIA 2ZGTA 1I5ZA 2R041 2GN3A 3OOXA 3R05A 3I3MA 2ES3A 1HB3A 1QJZA 3LFMA 3LZZA 3OUIA 3SCHA 3RZLA 1VIWB 4MADA 2BBVA 5ISLA 2ZS6B 3OEBA 3IDEA 3KGLA 1SLTA 3WW3A 4IDZA 3H8UA 2BGPA 3B01A
chains in the Genus database with same CATH topology
3O0WA 3ZFFB 2RS31 1ZM1A 4XYXA 4EN9B 5FOJB 3FUOA 1B35C 4BA6A 3OD4A 1RVF2 2C1FA 3POWA 4Q1RA 4W6XA 3OTFA 4X8NA 1KITA 1ZZBA 1VBB3 1POV3 1HXS3 1RMU2 1HV0A 4AVBA 1BMV2 1DQ2A 3GBGA 3ME2A 1OA4A 1R083 2EA7A 2A6WA 3UJQA 3BIWE 2VECA 1FAYA 1GQHA 3MYXA 3E6CC 4AFCA 3LA3A 2CGPA 2XB6C 4YGBA 2ZHKA 2TBVA 3WZ1A 4AEDA 1WD3A 4P9GA 2RE9A 5LK5A 4YARA 1BK1A 4QM8A 4MGZE 3WDTA 3ELNA 1AYN2 2LALA 4HK8A 1G9DA 4N43C 1SFYA 4KGGA 3DPRC 5F6KA 5FRAA 4I0WB 1LKNA 5FAXA 2CY6A 4WVMB 3OGJA 1N3QA 2FBEA 1YRZA 3MI8A 3CJIC 4Y4YA 4PLOA 3VUOA 1DQ5A 1WBFA 4Q4W2 4MVTA 2D6LX 4LBQD 2DTWA 2YPJA 3WCRA 1C3HA 4UBGA 2NYYA 4D7SA 3ZFGA 3JD71 1LHWA 3J8F1 4JQRA 4AVCA 1IOAA 5K0UB 3D6EA 4Y26A 3O7OA 4I02A 1FOD2 4MXWA 4FP2A 3CLPA 2PTMA 4CEWA 1ZZ6A 3LA7A 3VLBB 4D7YA 1F9KA 2QDNA 4N9IA 4YYOA 3RI9A 2VVFA 4GKXA 1GFF2 5TSWA 1QKQA 1BBT3 1KS5A 2Y38A 4ZKTB 2XWJB 4ONUA 4COZA 4AW7A 1COV1 1QJU1 1UZZA 5BNPC 5JI9A 4BE3A 1TME2 1CX4A 3TN93 3KLSA 4EWDA 1C57A 2XBO3 4RS5C 3NAPC 1VBB1 1POV1 1HXS1 3IWZA 1ZRFA 5JSRA 2PLV2 4M01A 1S0JA 1R081 4KBBA 2ZX1A 3VBFC 4Q0UA 2GZWA 3WP6A 4I09A 5KC6A 1A8DA 2AYHA 1QQP2 3ZIXA 1B35B 1AR72 4AI2A 3ZXJA 4WVVA 5JAXA 1RUJ3 3LGRA 3RJ2X 1CAUB 5BXXA 4IEVA 1PGSA 5LEKA 1PGL1 4GH4C 1EV12 2GMMA 4XFGA 1DBNA 1PO23 2EAKA 4Q0VA 3VBUC 2JENA 4K6BA 5I0TA 1TQ5A 1A8MA 4LE4A 3SMHA 1VBE2 3LKJA 2RM22 1WCDJ 5FO8B 2WLQA 1DGLA 3VHOA 3RI8A 2AR6A 1ZZ8A 4N43B 3H3ZA 3DPRB 2RR12 1ENRA 4XF3A 2FQPA 2ZACA 3CJIB 4MGIE 1SLAA 3VZNA 1UZYA 2GDFA 5KHKA 3MF9A 3U4XA 3EQEA 2BW8A 4H7LA 2ZPXA 1N3OA 1GZWB 3MEPA 3I7DA 4HSJA 3U10A 4XF0A 3AKPA 1EPZA 3VBSA 4A7KA 5KXCA 1N1VA 5JZGA 4HPKB 4JVAA 2LUWA 3TN91 4AFDA 3V0BB 4ZU4A 2XBO1 1OOPC 3FFQA 2MHFA 2RS12 4XMIA 4LO4B 3ZSJA 3A4UA 1TMF1 1N1TA 4DMIA 1HIXA 3I59B 5BNPB 3D4KA 2CTVA 4GB31 4CEYA 4XBLA 4EJRA 1LHOA 1LESA 2VH9A 4IXLA 4RS5B 3NAPB 3V0AB 4R9CA 3OCPA 1QJX2 1EAH3 1RUJ1 4XJWA 5F6LB 2WNUA 5L73A 1RUE2 4D94A 4TLFA 5IT6A 1Q56A 1ASJ3 4CDWC 2B46X 3VBFB 2B45X 5AVAA 3AKRA 3MIBA 1RHI3 2H0BA 1PO21 4KG8A 1JHNA 2K2SA 1RUD1 4XJZA 4TWTA 1OQ1A 1KQRA 2BNNA 2ZA9A 1CONA 5BNQA 1ULGA 4JV4A 5J36A 2BNMA 4H55A 1CAWA 4GH4B 1AL0G 2HWB2 3CEWA 5BPXA 3VBUB 1E57A 5JOZA 1Q8VA 2W52A 3KB5A 4NR1A 4BHPA 2EALA 4JRLA 4IEWA 4WVWA 3O12A 4AHYA 4Y24A 1NOVA 1QJY1 4NOTA 5DUWA 1OA2A 4BZ4A 1LR5A 1GKBA 4UW5A 1HQNA 4YW1A 3KD4A 4BWOA 1OSGA 4EWEA 4YFZA 5FDBA 1X8MA 4TYSA 5A33B 4FPOB 2P37A 1PIV2 3RMXA 3ST7A 5BNNA 5CFCC 5E89A 1MQTC 1PVC1 4BLIA 4DXZA 3KM5A 1KFXL 5FOBB 3FBYA 3IKWA 4K7JA 4AI0A 3QH6A 5IUQA 1C28A 1QDOA 4I01A 4WZFA 3ZYRA 3T1LA 3KT1A 4WM8A 1OOPB 2ZTNA 2GN7A 1LGNA 2AENA 1YFYA 1ASJ1 4YG6A 3RRDA 1RHI1 5GLVA 4F7ZA 2ZKLA 4R9BA 4CP0A 2H6BA 4OUSA 4R52A 5HCFA 3H1YA 3PJQA 3VKNA 1C5HA 4FAGA 1JOJA 3ZMOA 3VKFC 5HI0A 1LU1A 3R4UA 2ET7A 4M3CF 3AP5A 2GMPA 3VHRA 2PYTA 3KS7A 1G86A 4CDWB 2I74A 4G4FA 5IK4A 4GMP0 2DVAA 4X6QB 3AP6A 2PHXA 1NYWA 3W9AA 2G9GA 2A3XA 1DGRN 2GNTA 3RQ0A 4HANA 3VN4A 1OD5A 2OIIA 5DUXA 1LOGA 3UK9A 4JDNA 1OHFA 2IXIA 4YSFA 5C4WA 3FBMA 2EXHA 2Q4SA 2D93A 1RC6A 3LWCA 4N7UA 2PA7A 3TBDA 4KQ7A 2XJQA 3FC0A 3PMSA 4Q0SA 3IIAA 3ILFA 4CYDA 3C3VA 1ONAA 1RB8G 5CAZA 4CDUC 4RQPC 4LLFA 2Y26A 3THTA 1RUH2 1UW8A 1H0BA 4YG0A 1ZNPA 5EYYA 5L19A 5CFCB 2ZAHA 2VUAA 1A3KA 2VQAA 1MQTB 4XBQA 2JECA 2IXLA 3MPPG 1IGOA 1WLTA 4XQWA 3SXWA 2Q8OA 4JDMA 2ZJCA 2YC0A 3N7JA 3NSTA 3ZO0B 3A0KA 4OI0A 1A78A 3H7YA 5DZGA 1JYIA 4M0HA 1H2LA 4NHMA 2GALA 4FOYA 2NMOA 1HX6A 1WCKA 2WWSA 2D5FA 4EWAA 4KG0A 4GWMA 5FLJA 2XLFA 1G9CA 2JICA 3KMHA 2WNEA 3MIEA 4S2HA 1NCRA 3VV1A 1AXZA 1AR82 4Y1UA 1CAVB 1QXJA 5A3LA 1FPN3 1FMD3 1H2MA 2O0OA 1IS3A 1YUDA 3M7AA 3HMYA 2QQPA 1W6QB 4XHBA 3G6JB 3WG3A 1QY4A 1M06G 4X8PA 1ULCA 1H8TC 1VBC3 1QNYA 1U5IA 2R062 3WNXA 1H9PA 2ZMLA 5KXEA 5GZDA 1CPMA 1K5MA 4AYUA 5DDJ2 1R1A3 1IS4A 4COUA 2JX9A 2XJVA 1SCSA 1WBLA 2VOKA 1VB4A 1D2SA 4Y22B 4HN1A 1HQWA 3TB0A 5FQ0A 4JDOA 1FATA 4RHV3 1JN2P 3EHKA 4DNYA 4R9AA 4NWVA 4AGGA 2WJSA 2P3JA 2X53S 3GF6A 3WLUA 2AUYA 2OZJA 1SBFA 4FT8A 5CG9A 3N36A 2ZGRA 1Z78A 1VAVA 4LTAA 1SLCA 4CDUB 1JH5A 4RQPB 3D0JA 3SITA 5HXVA 4KWKA 3ATGA 1HRI2 4W6WA 2BUKA 4Z92B 4GKYA 4YGDA 5BUVA 5F5QA 4YFWA 3H9AA 1ENSA 3PVEA 4XBNA 3JQXA 1C8M3 4AVAA 2RJKA 4ISQA 3VBHA 3VKOA 1W6PA 1I1EA 3ILNA 3TWIA 2X5IA 2NN8A 2TEPA 1W6OB 1IPJA 1FPN1 1FMD1 1V00A 4Q4V2 5LEJA 1Y7BA 5I0RA 3SHRA 1Y43B 2FMDA 4XJ8A 3FFZA 2G4IA 3BOWA 5LRRA 1VBC1 1RUF3 1J58A 4INDA 3ZN4A 3QD6A 3O5SA 4HN0A 3ZXEA 2KA3A 1RUI2 1GR3A 4FPFA 1UCXA 1R1A1 4LBNA 2K9ZA 3K48A 4LO6B 3UL2A 3EO6A 1H8TB 2ZGMA 3LB9A 4Y1ZA 2Y0IA 3ENRA 3HIFA 4HFSA 3SCFA 3VZJA 2YY1A 2QKDA 5BNOA 1PK6A 1AX0A 1BZWA 1S0DA 2HWD2 4RHV1 1RUG2 2D40A 4DRVA 1G6NA 4Q4Y2 3ZXGA 1DZRA 4BOWA 1QH6A 2E9QA 3CO2A 4DFSA 1NA1C 3JB4C 4AQSA 4AEDC 4YZ4A 1PHMA 1ND3C 2A3YA 3MIHA 5BYNA 2XL9A 1MZ5A 3OYWA 1CAXB 1REFA 3WDWA 1LGCA 1QOSA 1LJ7A 2WKKA 4JAAA 1C8M1 1QDCA 2JG9A 3INAA 4K40A 4YVWA 3M3OA 5A3MA 4COWA 4QHBA 4Y20B 3AXDA 2ZX2A 5L36A 1PGW2 4RGAA 3ZFGC 1UIKA 4P9LA 1PMIA 3WW4A 1YJLA 1R091 4F3JA 3RPQA 3E5XA 5L7OA 2A3WA 4JGYA 4LO8A 2HWE2 5IK7A 2BTVC 1UX6A 2FHRA 4AHZA 4CEWC 1WCSA 1RUF1 1KXGA 1CIWA 1KJLA 1IS6A 4CDQA 4HVRA 3R4DB 2UYBA 1VJ2A 1MS3A 3AZXA 5FLIA 4F83A 2BQPA 3D5OA 4URTA 4HETA 4WM7A 1F31A 1NQJA 3RWNA 3RYKA 3HT2A 2Q5TA 1X33A 3FX3A 3B9CA 4XQ4A 1S0FA 2GAUA 4OULA 4YGCA 4B4QA 1I9RA 1YFUA 4UW4A 2O1QA 1VRH3 4Q0QA 3VL8A 4JGZA 2GNDA 5GZCA 1W6NA 3CNAA 3IM0A 1NXMA 1WMDA 4R4XA 5H9PA 3UKVA 1O4ZA 1QNWA 4UBHA 2R072 1YJKA 1FOD3 1D4M2 3USUA 4XFAA 1RGSA 1NE4A 1W39A 5C9AC 2RMU3 3AZWA 1QH7A 4N53A 4RR3C 1MS5A 3ZX7A 5GM0A 1OMIA 5AVPA 2DF7A 4IEOA 3ALQA 1IPKA 1NA1B 4SBVA 2VNOA 2Z79A 4AEDB 2O8OA 1ND3B 1AR61 3AYCA 2IC1A 1OPMA 4AFAA 1BMV1 3PMEA 5I8YA 1NCQA 1AXKA 3VZMA 2BWAA 4XE9A 1G9BA 2FZ2A 3AKTA 5H9RA 5EXOA 1PO13 4YM2A 4PQ9A 4AHXA 3RMYA 1L3JA 1TNFA 1H2KA 3DL3A 1V6MA 2GC1A 3ZN6B 2EXJA 3ZFGB 4E4ZA 4XFCA 1OLRA 1EV13 3LOIA 4YZ5A 3R0RA 2B8MA 3KZ4C 2HWF3 4MXWB 5JZGC 4CDXA 4CEWB 3I4IA 3CJXA 1Y9QA 3WG4A 2DCKA 1VBE3 1Z7S3 3M3EA 4L92A 2ZGKA 2RM23 1FT9A 1DZTA 1VRH1 2QFEA 1RITA 3SH4A 3IT8A 1DQ0A 1ZZCA 3RJRA 3N4MA 4CEYC 5A32A 1HQLA 2DVDA 2YGLA 3WUCA 1HW5A 1QXPA 5EFUA 2RMU1 5F9TA 4BQ1A 1ENQA 3OY8A 1ZBE2 3IPVA 3ACLA 2WNUC 4XOGA 4BIFA 4W6YA 2VUJA 3WQ7A 2ENRA 4JTNA 1V70A 2ZGQA 4COYA 2BWCA 2YDEA 5DZFA 2WSUA 2WT2A 2WC2A 2WQ4A 4KU7A 2WNVC 2OUHA 5C9AB 2EXKA 5JPMB 2RS53 4XF4A 2QVSB 3AMMA 1XQNA 4RR3B 4IERA 3VDDA 4FOQA 3PVOA 1GBGA 3MGUA 4XW3A 4SLIA 2R042 4HVOA 1HRV1 2ZMNA 3LOBA 4AGVA 1IKPA 1PO11 5FCCA 3V64A 3M3CA 5SV8A 2RS32 3ZXDA 3AX4A 3A0NA 1LOFA 1RUE3 3MICA 1RUC2 1EV11 4HKWA 5E1RA 1UKRA 2FMYA 2ZGSA 1OFSA 2HWF1 1H2NA 4YLZA 1ZZ7A 2WZR3 2DVGA 4AQ6A 2DTYA 2TUNA 4XMAA 1Z7S1 3ZFFA 1WW5A 2RM21 3DN7A 3WHUA 3PHMA 3N7KA 5FMOS 3MPBA 4DY3A 3MW4A 1TEIA 2B42B 4HK9A 5JZGB 4CP1A 4MZUA 2DU1A 4YM0A 1H4GA 3MLKA 1F5FA 3MDPA 1H1IA 4LLOA 1SQ4A 3IN9A 4FP3A 3FMGA 5JR7B 1ZZ9A 5T5LA 5J98B 4QPIA 4O9GA 2D3SA 4XJAA 4CEYB 4JRAA 4J6GA 5JIUA 3ZFEC 2BGCA 3M70A 3JD72 4NWWA 4RFT0 3J8F2 1D0HA 4PLNA 5EYXA 5ACA3 2YV8A 1C8NA 2RS51 2WNUB 4M00A 4I0AA 1XXNA 1PIV3 4AVTA 3MLLA 4Z2WA 3Q9OA 3D82A 3ECQA 1HKDA 3WDYA 1AX1A 5J7MA 3T2TA 3AYDA 4UXAA 4MSVA 2WNVB 2BNOA 1POV0 4NPRA 4COVA 4HMZA 1COV2 1QJU2 3BALA 4EN6B 3VKLA 1RUE1 5C4WC 4G9SB 5E8AA 3THPA 4E2QA 1VALA 2I2SA 1UD1A 1BBT1 1ND2C 2F4PA 3GZTB 1QF3A 2P34A 5J48A 1VBB2 1J3PA 1HXS2 2I07B 4R4ZA 3WUDA 3DGTA 4YGEA 1BEV3 1R082 4XFBA 2WZR1 2ZZQA 4YNIA 1NY71 4H3WA 4AVVA 4EN7B 3FHIB 3JB8A 1UPIA 3I54A 1J3RA 4XEZA 1LHNA 1VBD2 5C8CC 4LBMA 5GLZA 3PVBB 2PN5A 5HCBA 4DOUA 4B29A 3ASIA 4QQHA 2ZHLA 2HYKA 5IK8A 1YFWA 2YUEA 2VULA 4GMP3 3MFAA 2VVEA 1AYM2 5EWSA 4LBKA 1UPSA 3BTAA 2WA3A 3APBA 1TNRA 3KQRA 5J37A 2R30A 2VMGA 1CAUA 3JZVA 2IXJA 1REDA 1J1TA 4LULA 4PJYA 4QQLA 5ACA1 1O5LA 1IZ3A 2VW1A 1PIV1 2AZ5A 4C1XA 1H8VA 1S2BA 1CESA 3B00A 4LT5A 1C5IA 3J9SA 1CGPA 1NCRC 2ZZJA 3HN1A 3ZFEB 4QGNA 2F6BA 1MS1A 4DS0A 2ZGOA 4D69A 4DINB 1NLSA 1N1YA 1OKQA 5IK5A 5T5PA 2R1DA 1WW6A 1S55A 3JQWA 3AP7A 3DPRA 4Q8LA 4RD7A 4HKLA 5GZFA 2QJVA 2D6KA 1OFNA 3MIGA 1ULDA 3TN92 3CJIA 2GMEA 2XBO2 4EN0A 2DCZA 3RYRA 1BEV1 4KWJA 1TMF2 1GZWA 1JYCA 3ZSEA 4PIXA 2JG8A 2XH6A 1MS8A 5C4WB 3U0ZA 3H1WA 4GB32 5GALA 4LO5B 1W0OA 3SH3A 4HPKA 1ND2B 3S6PA 3NWKA 2SBAA 3V0BA 4LHLA 4FPKA 4BH9A 4AI8A 1AVBA 1MEC2 4N90A 1PNGA 1J59A 3PJYA 3I2DA 1PO22 3I59A 5C8CB 1EAH1 1KFUL 1RUD2 4GMP1 4QPGA 1R1ZA 4K21A 3AZVA 2P3KA 5I91A 5BY5A 4J1WA 4Q1PA 3NAPA 1H4HA 4RS5A 1FNZA 1X36A 2WT0A 1KJRA 2R063 1MZEA 1LHVA 4META 1RUOA 3TRSB 4YRDA 3VBFA 3QCWA 2OA2A 4FPHA 4I0BA 1SEFA 1DF0A 3LAGA 3VBHC 3E6BA 1UAIA 4IEUA 1QJY2 4IEQA 3FLTA 5CVRA 1ZREA 5AC93 4XETA 3VZOA 2DCJA 2X5IC 4LBLA 5GLTA 4AEJA 1AL23 2DFCA 5C6CA 4LBJA 3VBUA 4HLTA 3GALA 1DQ6A 1O3SA 4P5HA 1NCRB 2W39A 3E97A 4FBFA 3WX5A 1HRI3 4E27A 1PVC2 1JW6A 4LEJA 3S30A 2NP0A 2D6NA 1WUVA 3BOPA 4AG4A 5KHIA 5T3NA 1XYOA 1YXWA 1N47A 4S2DA 4EV0A 5A33A 2R49A 3WCSA 4WBBA 1VBA3 5BNOC 4QQOA 3N35A 1AUYA 1ASJ2 3DV8A 4YVSC 2ZMKA 1IQAA 4B7EA 2YZ4A 4Q4V3 1RUNA 1LB2A 3I8TA 1JBCA 3AMQA 5GLWA 1WGPA 5KHGA 1AR92 1U5ZA 3FUQA 3OBTA 5KXBA 1V6OA 3IDCB 2WIIB 3KCCA 5K8SA 4QGMA 2AH2A 4IEYA 4K9SA 5CIRA 1SFNA 1OA3A 1NXD1 4C0BA 1PZ7A 4FAHA 4RL7A 3H3UA 2PAEA 3ES4A 4QT6A 3GNEA 1GLHA 5CADA 2JG9C 2VVDA 2EIGA 4YVWC 4RA0A 2DCTA 4MV2A 1DGWA 3VBOA 2YXSA 5AC91 2FZ1A 4UW3A 1S0BA 4CDWA 4ITCA 5FO7B 3QH7A 2D97A 3N3HA 1AL21 3P3NA 3NV1A 3ZN5A 4LBOA 3E5UA 1XRUA 1VAMA 5L7OC 4M3CA 2OPKA 4LA2A 3QOPA 4IQPA 5I0UA 5ABJC 4AXOA 5CA6A 3DF0A 3VBHB 1W6PB 2HWC3 3WQ1A 1EYBA 2EXIA 2V5YA 1LHUA 3M8LA 2A6YA 2D3PA 4O9EA 2X5IB 4PBOA 2OW4A 3PVNA 1HRI1 1H1MA 1HV1A 3ZXKA 4CDQC 2DU0A 4GA9A 2WFF3 5T5OA 1ZX5A 4PBPA 4PDWA 1ALYA 4BMBA 1GV9A 2PHUA 2NM1A 2XJPA 1MACA 4V1PA 1MZFA 1VBA1 3NV2A 1Q3EA 3E6DA 1RINA 4LE3A 1RTVA 1BCXA 4LBQB 4Q4X3 3TNQA 4KWLA 1WW4A 4H14A 4P9XA 1G8WA 1W6MA 2UYAA 3FWEA 4RGGA 1IS5A 5DG1A 4C91A 1EPWA 3ZDSA 4IETA 5FTTC 1O3RA 2HWE3 1GICA 1OQDA 5BNOB 4OHVA 4C0HA 5CFCA 2NQYA 3NV4A 2Q0AA 4N53C 4YVSB 4DB5A 1I3HA 2D98A 1S0IA 4FXGB 1SDWA 3LSEA 2UURA 4XFHA 4QQ2A 4Z82A 3BU7A 2CAUA 3AMHA 3GYDA 1GZ9A 5JPNB 3B69A 3ZSKA 2DCYA 4WZCA 2WSVA 2B7YA 2WS92 1X82A 2YMZA 4FSJA 2XJRA 1NCQC 1V9U3 2ERFA 1XU1A 1BVVA 1XYPA 2RJLA 3AKQA 2P17A 3OYWB 1JUHA 2YHJA 3WW1A 4B3NA 3KCXA 4R9DA 1QWRA 3VKMA 2JG9B 4QD2A 4XTPA 1X50A 5FO9B 4YVWB 1CAVA 2HWC1 3URFA 1X7NA 2JD4A 4R8HA 2K0GA 2R1BA 5T52A 2WFF1 1W6QA 4FPLA 2MEV3 2E7AA 1DGWX 1V6LA 3EXUA 4AI3A 5L7OB 1XU2A 3ROUA 1O91A 5ABJB 3BPZA 3LSDA 4A2UA 4AQTA 2Z5WA 4CDXC 4LR4A 2VMHA 5H9QA 3AJZA 3HAGA 3WG1A 3W58A 4CDQB 4XIKA 5LK7B 4Q4X1 4Q27A 5JIAA