1EAH3

Pv2l complexed with antiviral agent sch48973
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
235
structure length
235
Chain Sequence
b'GLPVLNTPGSNQYLTADNYQSPCAIPEFDVTPPIDIPGEVRNMMELAEIDTMIPLNLTNQRKNTMDMYRVELNDAAHSDTPILCLSLSPASDPRLAHTMLGEILNYYTHWAGSLKFTFLFCGSMMATGKLLVSYAPPGAEAPKSRKEAMLGTHVIWDIGLQSSCTMVVPWISNTTYRQTINDSFTEGGYISMFYQTRVVVPLSTPRKMDILGFVSACNDFSVRLLRDTTHISQEA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords POLIOVIRUS TYPE 2 COAT PROTEINS VP1 TO VP4
publication title Structure of poliovirus type 2 Lansing complexed with antiviral agent SCH48973: comparison of the structural and biological properties of three poliovirus serotypes.
pubmed doi rcsb
source organism Human poliovirus 2
molecule tags Virus
total genus 37
structure length 235
sequence length 235
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1997-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1eah300
4Q4V3 1RUC3 4RS5C 1ND3B 1QJU1 4RHV1 5L7OB 1OHFA 1AR83 2GH8A 1QJU2 4FTSA 4RHV2 4Y5Z0 1PO21 2XBO1 1PVC3 4CDQA 4WM8C 1VBC3 1AL23 4GB31 1PO22 1VRH2 4QPGB 2VQ0A 3TN92 4GB32 5C9AB 1EV11 3VBRA 1ND3C 1RUH3 2HWC1 5L7OC 5ACA2 1EV12 4RS5A 2HWE3 2PLV3 3JD73 4FSJA 1PO12 1VBD1 5LK7B 4QPGC 3JB8A 1OOPA 1R1A3 1ZBE3 1NA1B 1ASJ1 1EAH1 1VBD2 2TBVA 4WM8A 1QQP3 5C9AC 3J8F1 4IV1B 1AR63 1TMF3 1AYN3 1VB2A 3J8F2 1HRI2 1VBE3 1FOD3 1NOVA 2HWF1 1HRV2 3VBSB 4CEWB 1BMV1 4WM7B 4RFT0 1NA1C 4Q4Y1 1AYM1 2HWF2 2WS93 1RVF3 1BMV2 1R082 4IV1C 2FZ2A 1R091 4QPGA 3VBFA 5A32B 1BBT1 2WZR3 5C9AA 1R092 5A33A 1BBT2 4Q4V1 1MEC1 3ZFFB 2BFUL 4IV3A 1RUC1 4PDWA 3VBSC 4CEWC 4Q4V2 1MEC2 4WM7C 1AR81 1RUC2 1PVC1 1AR82 1A6CA 1RUD2 1AL21 1VBC1 1WCDJ 2RM23 1RUE3 5J96B 1PVC2 1VBC2 1AL22 3ZFFC 2R073 1RUH1 3HAGA 5BNOC 3FBMA 1QJX3 1RUI2 1RUH2 1MQTA 1PGW1 2HWE1 2X5IB 2PLV1 3JD71 3JB4C 4QPIA 1BEV3 2PLV2 3JD72 1R1A1 1ZBE1 1QQP1 1PIV3 1AR73 1OOPB 1AUYA 1PGL1 1TME3 1AR61 4Q4X3 1TMF1 1AYN1 1FMD3 1ZBA3 1PGL2 2X5IC 1NY71 1AR62 1TMF2 1HXS3 5BNOA 1VBE1 1FOD1 5K0UA 1NY72 1X36A 4CDWB 2WS91 1OOPC 1RVF1 2DF7A 4JGZB 2GSYA 1D4M3 2BFUS 2WZR1 2WS92 4CEYB 5ABJA 1RVF2 2XBO2 4N53A 3VBFB 3LOBA 1RMU1 2WZR2 2IZWA 1NG0A 5A33B 5C8CA 1RMU2 2RR13 1B35B 4GMP3 4IV3B 1RB8G 2X5IA 4BCUA 4PDWB 4FTBA 4CDWC 2HWC2 2MEV3 4JGZC 2RM21 4CEYC 1RUE1 4RQPA 3VBFC 3NAPA 2RM22 5DDJ3 2RS33 2RMU3 2R071 1AR93 1K5MA 1QJY3 1B35C 1ASJ2 1EAH2 4IV3C 1VBA3 2R072 1CD3G 1QJX1 1VBB1 1GFF2 4PDWC 4CDXA 1HX6A 1COV3 1VBB2 4AEDA 1MQTB 3VBUB 4EJRA 4CDWA 3DPRA 4QPIB 1V9U3 1PIV1 4JGZA 1AR71 4CEYA 3VBOA 1DDLA 4Q4Y2 1TME1 1AYM2 1PIV2 4Q4X1 1AR72 2BUKA 1FMD1 1ZBA1 1B35A 1HXS1 1MQTC 3VBUC 3VDDA 5BNOB 1HXS2 4QPIC 2FZ1A 5K0UB 1C8NA 1RUG3 4CDUB 1VRH3 3TN93 1D4M1 1SMVA 1POV0 1D4M2 5ABJB 4N53B 1F2NA 5ACA3 2RR11 4GMP1 1FPN3 5C8CB 5K0UC 1OPOA 1NCRB 1PO13 3VBUA 5FMOL 2MEV1 4CDUC 5BNPB 5JZGA 1NCQA 2RS13 1PGW2 2HWE2 2MEV2 1W39A 3ZFGA 5J98B 4RQPB 5AC93 5D8AB 3IDEA 5ABJC 2RS31 2RMU1 1VAKA 1AL0G 1AR91 4N53C 1CJDA 3NAPB 1QJY1 1R1A2 1ZBE2 1VBA1 1QQP2 2RMU2 5CFDB 1K5MB 1HRI3 2WLPA 4NWVA 5C8CC 1QJY2 4NWWA 1NCRC 3M8LA 5BNPC 1VBA2 1COV1 4GH4A 1AYN2 1HRV3 5BNNA 4CDXB 1X33A 5GKAC 1RUF3 4AEDB 1R083 4CDUA 2R063 4RQPC 2WWSA 5D8AC 1V9U1 1VBE2 1FOD2 3NAPC 4LLFA 2ZAHA 3DPRB 4RR3A 2R043 1V9U2 1C8M3 5CFDC 1RUJ3 1K5MC 3VBOB 1F8VA 3S6PA 1RHI3 4CDXC 1MEC3 3JBG3 2Y26A 5C4WB 1NCRA 4AEDC 5BNPA 1RUD3 3VDDB 1RUG1 5FOJB 3DPRC 1VRH1 3TN91 3VBOC 5D8AA 1RUG2 1QJZA 2RS53 1RUE2 1M06G 1VB4A 5CFDA 3VBHA 5ACA1 2HWB3 1RUI3 5FMOS 5C4WC 1FPN1 4Z92B 1H8TB 4N43B 3ZFEB 3VDDC 1PO11 2HWD3 3CJIB 1FPN2 4JGYB 1QJX2 1POV3 2RS11 2WFF3 1BEV1 4Q4W3 5JZGB 1NCQB 5AC91 1Z7S3 2RS12 1BEV2 3ZFGB 5AC92 1H8TC 1HRI1 4N43C 3ZFEC 3CJIC 1TME2 1IHMA 4Q4X2 1ND3A 5C4WA 4JGYC 2BPA2 1HRV1 5L7OA 1FMD2 1ZBA2 5JZGC 1RUF1 1QJU3 4GH4B 5BNNB 1ND2B 4YVWB 5CFCB 1NCQC 4RHV3 2BBVA 1R081 2R061 1E57A 1RUF2 3ZFGC 4GMP0 2R041 1PO23 2R062 2XBO3 1C8M1 1RUJ1 4GB33 4RR3B 4YVSB 2R042 1RMU3 1C8M2 1RUJ2 1RHI1 1H8TA 3JBG1 1EV13 4N43A 3ZFEA 4GH4C 5CFCC 2HWC3 1ND2C 4YVWC 5BNNC 1RHI2 3CJIA 3JBG2 4JGYA 1RUD1 2RR12 1NA1A 1VBD3 4RR3C 4YVSC 4CDQB 2RS51 4Y4YA 5DDJ1 1ASJ3 1EAH3 4IV1A 2HWB1 1RUI1 2RS52 4SBVA 5DDJ2 3J8F3 2RS32 3VBHB 1AR92 3VBRB 2HWB2 1VBB3 2HWD1 3ZXAC 5CFCA 1ND2A 1POV1 4YVWA 3VBSA 4CEWA 2WFF1 2ZZQA 2HWD2 4RS5B 4WM7A 4Q4W1 2HWF3 4CDQC 1COV2 1HQNA 1Z7S1 4Q4Y3 2WFF2 2QQPA 4Q4W2 1AYM3 5A32A 4YVSA 2XPJA 1Z7S2 1R093 2ZTNA 4WM8B 3VBHC 1BBT3 3VBRC 3ZFFA 4FTEA
chains in the Genus database with same CATH superfamily
3INAA 4XJWA 4PBPA 1CAWA 3HBZA 1CONA 5KXDA 3I7DA 3WF4A 2C0ZA 4XF0A 5FPVA 4CU6A 2DCJA 2I2SA 3MDPA 5JVVA 4CCEA 1LOCA 3WF2A 1AHSA 3ZYGA 4H14A 3K4AA 4CDQA 3IPVB 3JU9A 3W21A 4LULA 4E4SA 2FDFA 3MO4A 5EQUA 1OFSA 2DCZA 4CP9A 1XJAA 2Z69A 2HEYF 1PO22 1WD3A 2CV6A 4QPGB 3E6CC 2ZHKA 4IUGA 3T0AA 2IWGB 4GB32 4JRLA 4GWIA 3EO6A 4META 1EP0A 2ZOEB 2OXBA 2W1QA 1UNBA 2P3IA 3DYOA 3LEKA 2HWC1 1UY2A 3OGJA 3K77A 2CU5A 5FO7B 3THPA 5ACA2 3AK0A 2ZX3A 1UQXA 2GP5A 3D6EA 3QBQA 4FPKA 2JB8A 4NPLA 5CEHA 2VZ1A 4MZUA 2ZS6B 3JD73 3TYJA 4FSJA 3OPWA 1WMEA 4PJYA 1E5IA 1ZZ9A 1VBD1 4JKLA 4QHOA 2JB4A 3JB8A 3B3QE 4LE4A 1OOPA 1S0BA 1ODNA 1SCRA 1ZBE3 4RGGA 3V65A 3KSCA 1O59A 2TBVA 5CADA 2K9ZA 2W95A 1W8NA 3DXTA 3WEZA 4XTMA 3OUJA 1W0NA 4IV1B 5FPUA 4P9YA 5F5QA 1NE6A 1V0AA 3BVCA 4FI9A 2FDIA 5T5LA 4YW4A 2IFWA 3B9CA 5IK8A 3FLPA 4HSJA 2XJPA 4X6RB 3VHPA 1HRI2 3VHOA 2R1DA 5FO9B 3SHRA 1XQNA 4LBQA 4ASKA 4Z2WA 5LBBA 2NM1A 1NOVA 2P3KA 2C24A 4P9JA 1UOFA 2B7YA 2QQMA 2VMFA 4G3YC 4LHLA 4Q4Y1 3LFMA 3VL8A 4AFAA 2HWF2 5FYSA 1CAVA 5FP8A 5JPNB 1LAJA 2JG9C 1R082 2E7AA 4QX1A 2VR4A 4ZHNA 4AG4A 1O6UA 2FZ2A 2XMLA 3NJYA 1BBT1 4MGIE 4GJYA 1BVP1 4M01A 1UOGA 5FYBA 1M4WA 1KJLA 5KHGA 5C9AA 4E4ZA 3AP9A 3PVOA 3HVDA 4TLGA 1DQ4A 3PDQA 2D7FA 2WZPP 5F1RA 2ZZJA 1FYUA 3DGTA 3ZFFB 1V6LA 1RUC1 2JDZA 4K1ZA 4PDWA 4JTOA 4BU2A 1X9PA 5F32A 2HBTA 3DKQA 4Q4V2 1CAWB 1JZ5A 3LCPA 4SLIA 1YNAA 1W99A 1S4CA 3I8TA 3ZSKA 1I5ZA 1VAMA 1QIQA 2GMEA 3DEMA 1NAEA 5FYTA 5HXVA 3ZXJA 5F7UA 4ZONA 3QD6A 5GZFA 5HI0A 5IK7A 1A6CA 1XE0A 2FBEA 2DUOA 1VBC1 3LB9A 1HW5A 4L8QA 3U75A 4UW3A 2ZA9A 1PVC2 3O1PA 1UZVA 4COWA 1AL22 1AX0A 3GZAA 4AWDA 1X50A 5HV0A 5KHKA 4L2NA 1RXGA 3MIEA 3ZYPA 1IPKA 1RUH1 4LO5B 3RYRA 2SBAA 5FPXA 2LTNA 1FX5A 3AKPA 4CUAA 3PUAA 5BNOC 1S0EA 1QJX3 4H7MA 1RUI2 2HEWF 4KBBA 1LHWA 3LQCA 1YEWA 2H6BA 1Q8SA 5IVEA 5BV6A 3RRDA 2VC9A 4QPIA 1BEV3 2TNFA 5DPNA 4PLMA 3LEIA 1OH3A 1N3OA 1C28A 2PLV2 2GAUA 2X05A 3UNPA 1OVPA 1OXCA 2Q1MA 3VUOA 2JXAA 1LTEA 5CKMA 1XRUA 1JYTA 2R7EB 4QPYA 2VZ3A 5A80A 1OOPB 1UZWA 3ZXGA 4ZZ8A 5FLJA 3LFIA 4QX7A 3H0OA 1TMF1 4YZ2A 3ES1A 5FZCA 2GNTA 1W06A 4FP3A 3UKTA 4HN0A 1GWKA 1QU0A 4OMCA 1O5LA 4AEMA 2X5IC 1NY71 1K45A 5CZKA 3WHUA 1KS4A 3M7AA 1C1FA 1DLCA 3GBWA 5LY1A 1XC6A 2AR6A 3ZR6A 2CSGA 2HYKA 4LBQB 2BRTA 1LHOA 2ZACA 1UAIA 4OQ9A 2EXKA 3FLRA 4FFGA 4MHRA 1HIXA 4LEJA 2BVVA 3N9NA 5DUUA 3ZSJA 4D94A 1EUUA 1FNZA 2QUOA 2Z79A 3K51A 3M3EA 1ODMA 4KBZA 1JOJA 4YGCA 4CEYB 5ABJA 1RVF2 5J1XA 2RJKA 4N53A 5E1RA 1UOJA 1OUXA 4LITA 2WZR2 2VZOA 4Q0PA 5CBLA 1NG0A 2GN7A 5EJ3A 1RMU2 1UYPA 3GZEA 1ULFA 3U11A 3E6DA 1MVQA 4GMP3 4NO4A 4HONA 1QDOA 1W3VA 2FCVA 2R16A 1FV2A 4NHKA 4PDWB 5FP9A 4CDWC 2HWC2 4FOWA 3BIWE 3ES4A 4ISQA 5LZ6A 5C33A 3LPGA 3J7HA 2OZ6A 5JSPA 1CPMA 1RUE1 4AHXA 4AQSA 3I4IA 1W6PB 5FZIA 3VBFC 4B4QA 4O65A 3IAQA 2FCUA 3S5AA 4B29A 4HANA 4XDOA 5B4NA 2VZVA 3HNYM 1CZSA 1F31A 1GNYA 2ZGNA 4YW3A 4AGRA 5IVYA 4ORFA 1Y7BA 3T08A 3AL6A 3LA2A 2NLRA 3UT0A 2R072 3U10A 1Q8VA 3CEWA 1W2OA 5M0TA 1LESA 3H7JA 3BPSA 3K4DA 1SBFA 1SDDB 4HXCA 4P9GA 1HX6A 1CJPA 2R0HA 3IAPA 5LEKA 4YW5A 5C5TA 4Y20B 4YW1A 4Z8BA 1U5IA 1ZRRA 1OSGA 4PF1A 2ZMLA 1YI7A 4YSFA 4L92A 1OA2A 4QKNA 4DMIA 1JZ7A 1GWMA 4M4RA 3DPRA 1LGBA 4QPIB 5L73A 1HQWA 3OGGA 2JG8C 2JIJA 3EB7A 5F9TA 5FWJA 2QQWA 4Y26A 4Q4Y2 3WQ7A 4BK5A 4CCCA 1PIV2 1AR72 4XMAA 2PTMA 1DF0A 1J84A 2YGMA 3N9LA 4MGQA 5CU1A 4O61A 3HT2A 5T5JA 4A3ZA 4GWMA 3LEMA 3IM0A 4HKWA 4W6WA 3VHRA 2X09A 1B35A 1ULCA 4P9IA 1MQTC 1XB9A 3RFRA 3AB0A 4Z07A 4GZ9A 2PAMA 5F2WA 1V70A 3ZYFA 2YZ4A 3H9AA 1D0HA 4GXLA 2VNGA 4QQPA 2HJIA 3K3NA 5I91A 3AZXA 3M4FA 3CIHA 5F3GA 1OKOA 5LA9A 3TN93 5LRRA 1D4M1 1US3A 2ZEZA 4B1LA 4RD7A 4DZGA 5JXIA 3AFGA 5E6HA 3RMXA 1ENSA 2ZMNA 3SC7X 4CU9A 5DG2A 1YQ2A 3SH4A 3KT7A 5C3QA 1WKYA 5ABJB 5IHRA 4N53B 1JYIA 2WT1A 1TZOA 2RR11 4XFFA 2VCMA 1DZRA 1YYNA 2VCBA 5A7SA 3SEEA 2D40A 1CQ9A 2BGCA 2FCTA 3DYMA 4BQ5A 4ET7A 4PI2A 4QU2A 5F3CA 1NCRB 2EIBA 3VBUA 4BQ4A 1DYKA 4AR2A 1F35A 2RJLA 3POYA 5I8TA 1NYWA 4MOAA 1NXMA 1WLTA 2OQ7A 3A23A 3M3IA 1WA4A 4M3CE 3I2JA 4AL9A 1RC6A 1W39A 1SPPA 4WVMA 1E5SA 5LW9A 2RS31 1VAKA 3KHCA 3LDKA 1LOFC 3NO8A 4WVWA 5FZMA 3ZN5A 1W9SA 1DQ5A 1LOBA 4NIAA 4BK4A 2V09A 3H42B 2D5FA 2BW8A 4FPYA 4Q0SA 5A1AA 1LULA 1QJY2 4N7IA 4NWWA 4B8EA 3JQWA 4S2DA 3M8LA 1COV1 4M4PA 1OF4A 1FI2A 3ORJA 2J22A 5LA2A 3MLLA 2AUYA 3CU7A 2WSUA 4Q27A 4BIFA 1Q8OA 5FLHA 4BQYA 3WLUA 5JWPA 1J58A 4M3CA 3WD5A 1UY3A 3KQ4B 3URFA 4JQRA 4PIXA 2CY6A 2FMDA 2QJVA 3NAPC 4LLFA 2CHHA 5D1IA 4AFCA 5C5UA 5IT6A 3DPRB 3HIFA 4RR3A 5A7OA 3U0ZA 1RUOA 2DYCA 3NNFA 4R9AA 3CF6E 3OBZA 1K5MC 4QPWA 2JKBA 2IC1A 1ENQA 2P34A 3D0JA 2VCCA 1IG0A 2E31A 2E53A 3BYWA 5EV7A 4AHZA 1H1AA 1GQHA 3KCCA 4HFSA 1SCSA 4JDOA 4V1PA 3JBG3 3BU0A 4IEVA 2UYBA 5EWSA 1KD7A 1BKZA 1GU3A 5DAWA 4JDMA 2OQ6A 4YRDA 3BB6A 4L99A 3RZZA 4IEOA 2Z42A 1REFA 5FOJB 1BVVA 1VRH1 4LBOA 1MS5A 2BGOA 3TAYA 4UFJA 2LALA 2GN3A 5D8AA 1BJQA 1RUG2 3A4UA 4NHMA 2A1XA 1ACCA 3VB9A 3I2GA 4Y22A 5GLVA 5I0UA 1RUE2 3LSDA 4HZFA 4LKEA 1VB4A 3ZXKA 3WINE 3VBHA 3GZTB 4FPGA 2ZGLA 1O4TA 3ZXFA 2DWRA 4NOTA 1NQJA 4FFIA 4A2UA 1LOAA 2GZWA 5FYYA 2CDOA 3ACGA 2BERA 2I45A 3VDDC 2HWD3 4QHZA 1ZREA 3CJIB 1FPN2 2VZTA 2BYVE 3WP6A 1WUVA 1KQRA 2WR9A 4JGYB 4NHYA 1POV3 4XFIA 5KBFA 3KV9A 2QNKA 2XHKA 3IKWA 1PMHX 1GOHA 1O5UA 3HQRA 3ELNA 5A6QA 3AKSA 3S57A 4FAHA 1ST8A 3ON7A 3PHMA 1HDKA 3PUQA 1XU1A 1PVXA 4YZ1A 2OUJA 1K42A 1RIRA 2ZGPA 2OVUA 2WSVA 4BZ4A 4A41A 4JKMA 3T1MA 4WVMB 3C2UA 5FK8A 3WCSA 1MS0A 2P37A 4XZPA 1S0CA 2R1BA 4K21A 4LLOA 4N43C 3SKJE 4AF9A 2IVJA 1ULGA 1GZWA 1OC1A 3AP7A 4XIKA 4COYA 4OI2A 1DCSA 5C4WA 2BPA2 1HRV1 3MICA 2VXJA 3S30A 1DQ0A 2W1SA 1A8MA 2JDMA 4XF1A 1N1YA 1RUF1 3GF6A 4FPLA 1QJU3 3WSOA 4CTEA 4ZPIA 3H8XA 4RHV3 3D82A 2R061 4N90A 3PU3A 1N1SA 5FP7A 2GC1A 1E57A 4HT1T 3O5SA 4M3CB 2ERFA 4GMP0 2JDUA 2YFZA 4Q0VA 4AQ6A 4CXXA 4BM8A 2MPFA 2Y6GA 3GM8A 2BNMA 5B4XA 4KU8A 2DTYA 3T30A 3LF7A 4RR3B 1H4GA 5DAQA 2R042 3LKJA 4IERA 1RTVA 2BP6A 2EAKA 4INDA 3NRUA 2BZDA 2YV8A 1RUJ2 2WC2A 5FZ7A 5JUVA 2FDGA 4QQHA 4AI2A 2WBKA 4L9BA 3WNXA 4ZS3A 1W2NA 2JDNA 5FZKA 4EROA 1RHI2 2SLIA 4LHSA 2RE9A 1GR3A 1QGLA 4PLNA 2RR12 3WOGA 1H0BA 2X29A 4A7YA 2PA7A 2B4KA 4YZ4A 3VKMA 1QJFA 2A3YA 5KXBA 3T09A 3FN9A 1LENA 1PHMA 3K48A 3VZNA 1V00A 4LKFA 3KHBA 1KXGA 3P1IA 5DDJ1 3RI8A 3VHNA 1ASJ3 1XNBA 1OLME 2WO3A 3AFKA 5C71A 3T4HB 2RS52 2BEOA 2RDSA 3J8F3 3BN6A 2A73B 2RS32 3PJYA 3VBHB 4P02B 2YBPA 3ZIXA 5FYZA 3IDCB 3H8OA 1XXNA 4F83A 1O4ZA 5GZGA 1ND2A 4YVWA 4MXWB 2VZSA 3PVNA 2ZZQA 3IB3A 4Q4W1 4DUWA 3GJBA 3USUA 4AW7A 2VH9A 1SACA 1COV2 4UFMA 4M3CF 5LB6A 4BIOA 3N9PA 4CXWA 5E8AA 1HQNA 3UJQA 1S0IA 4IEUA 4MO3M 1VMJA 3GCWA 2FD8A 1OMIA 4CUCA 4JHZA 5IUQA 5A32A 1OLMA 4YVSA 2D6PA 2LRPA 4I09A 1Z7S2 4NVPA 3ZYIB 3ROUA 2W87A 1PNGA 4NR1A 4YG3A 3VBRC 1K5JA 4ASLA 3WUDA 1DYPA 2A6ZA 1GP4A 4AAPA 4URAA 2PAKA 2CGPA 2BNNA 2K0GA 3WW4A 2NMOA 3NNLA 1PMIA 1GZWB 1DGRN 4RN5A 4RS5C 1BK0A 4ZXEA 3VDAA 3I3EA 2PQQA 4MGTA 5C70A 4UOJA 2CNAA 2Y60A 3N7MA 3B7MA 1AR83 2CAVA 2QBXA 4YW6A 1MS3A 2Z2SB 3GJAA 4FTSA 2BNOA 4R9BA 2Y64A 3ZX7A 2QDNA 1PO21 5FKBA 4D69A 2BWCA 4WM8C 1GMMA 4GB31 3KV4A 4OFGA 5LASA 3DN7A 1VRH2 1JYWA 4D7SA 3V0AB 2VQ0A 4YM1A 3WZ1A 1S2BA 4LO7A 1ZZ7A 4BQWA 3MGUA 4E4HA 4JCKA 2YU2A 3GHMA 4BQ1A 1ND3C 3TEXA 4H7LA 3HBKA 1EPWA 3O14A 1EV12 1WGPA 3WP4A 3UESA 4OHYA 1QY4A 5BY5A 5LEJA 3C7GA 4KG0A 3ETQA 3MI8A 2YDEA 3ZN6A 2AYHA 4IEXA 1JH5A 4MX3A 4YM0A 3HT1A 1IS4A 3AL5A 3POEA 3AKQA 4EYUA 1W8HA 4EN7B 3PMSA 4IGOA 1EAH1 3AZWA 1OLQA 5HV4A 4OUMA 1QQP3 5FMDA 3CJXA 1W9WA 4Y1VA 5JXJA 2JG9B 2BOJA 4AI8A 4UAPA 2VUJA 4FOYA 4Y24A 2FDKA 2XJRA 1AR63 1OLRA 3P6BA 3QOPA 3AXDA 2YHJA 3LPFA 4PF5A 4EV0A 3RYPA 1SLAA 5ERLA 3PTYA 1ONAA 1ULDA 1OURA 3NVCA 5T3NA 1JU3A 3C8XA 4B4RA 1VBE3 3WQBA 1FOD3 3KVAA 5A6ZA 2HWF1 4EN9B 2XL7A 3VV1A 1HRV2 2VULA 1YFYA 2EIGA 1XYNA 4RFT0 4XUTA 3W5NA 4UW5A 2GALA 1HB3A 1AYM1 4W65A 3MV11 2A71A 2WS93 4K20A 4XF3A 4AQTA 2JD9A 3IT8A 4PIZA 3OY8A 3WW1A 2P4EA 4K8FA 4QPGA 1O4YA 4KH9A 3VBFA 1L7RA 1YO8A 2XLAA 3AX4A 2CWMA 5A32B 4P9XA 1U5ZA 5FYVA 2ES3A 2QFEA 1CAUA 2Q1ZB 2NPIA 1R092 3Q8CA 4XBQA 3O1TA 3PU8A 5ANNA 4DUVA 3MW2A 4Q4V1 3O1MA 1KJRA 3NNMA 3LIHA 2V72A 5A3UA 3VBSC 4CEWC 4WM7C 2WNUC 2ZGRA 1ZM1A 4BQ2A 2D3SA 3CZJA 2LS6A 1G9AA 3T0DA 2Y0IA 1PVC1 5EYYA 2QTWB 5C7GA 4LO8A 2AREA 1RINA 1AL21 2RM23 4Q1RA 1YC61 4BB3A 3OPTA 3R6SA 4ZU4A 3POGA 1GLHA 5J96B 3NJVA 4WVVA 1AX1A 1O7FA 1WCQA 2IFRA 3LA7A 4I0WB 2AH2A 5A3OA 2CGNA 4GJZA 1X9TA 3ZYRA 3OPZA 3SLIA 3H7YA 3HAGA 2X8KA 2JECA 1N3QA 2EXHA 2PHLA 4D7YA 2PMWB 2CGOA 2DTWA 2XG3A 1MQTA 1W6QA 2HWE1 1NXD1 1C5IA 2X5IB 5FWEA 1LHNA 4C0BA 2PLV1 4LK6A 4XHXA 1UIJA 4CE8A 3J4UH 3L2HA 4YW2A 3ZYJB 4CRQA 1Q8QA 4XPVA 3VZMA 4K8RB 1KFXL 2W3JA 4LKSA 4XCBA 5FXZA 2NQYA 3ZN6B 3JD72 2Q8DA 1R1A1 2GP3A 2L9LA 3SQOA 4LBNA 2VQAA 1AJOA 5G05L 4X6QB 1QOOA 2DU1A 3E1F1 4NE9A 3G6JB 4A7KA 4XJAA 3AC0A 4FPEA 2QE3A 1JHNA 4Q4X3 4BA6A 1AYN1 4XURA 5DMYA 4BE3A 4QWNA 1FMD3 1ZBA3 4YM2A 2LM3A 3I2KA 4XBLA 3WUCA 5F6KA 3SCHA 2XVGA 1HXS3 1V6IA 2PHWA 5AFBA 5FYHA 4XABA 3NNGA 3KMHA 1I6XA 1OBNA 3KD4A 4JAAA 4BDVB 5KHHA 1X8EA 1X36A 3IN9A 4P9WA 4CDWB 5JOXA 4Y5SA 4GULA 1RVF1 2UWCA 3HQUA 1UIKA 2DF7A 1DP0A 1MZFA 4NUBA 5IVBA 4I3GA 5L9VA 2VL4A 2WZR1 1N47A 2ZABA 5A6XA 5IYYA 3OY8B 1YQ8A 2Z5WA 3VBFB 1RMU1 3VD3A 4AI0A 4XAEA 4RYDA 4OHWA 1CAUB 1HB4A 1KRIA 4IEPA 2IXLA 4OI1A 3Q8EA 3C7FA 4LQRA 1NT0A 4MGZE 5L9BA 4URTA 4BCUA 4I30A 1US2A 4LORA 4MYEA 1HQLA 4WBBA 1W0PA 2MEV3 5GM0A 3EHKA 3MPPG 5JOZA 4XFHA 4JGZC 1G6NA 1QXPA 4Q0QA 2AZ5A 3W58A 2XR4A 2VVFA 4W6YA 3NAPA 1DG6A 4C8DA 5DDJ3 4DRVA 2JDYA 3EYPA 2RMU3 1D2QA 3ZOIA 2R071 4FPJA 3H3ZA 2JG8B 1K5MA 1WD4A 2C9AA 3VZOA 1EAH2 1YWKA 3VN4A 1VBA3 4LBQD 3HNBM 3HWJA 2D3PA 2W5FA 3I3DA 3PUIA 1GFF2 4RL7A 4YPJA 1JZ4A 3NL1A 1UKGA 4NHLA 5JR7B 3NKTA 1GBGA 1SLIA 1BYHA 4XTPA 2LW8A 5FLIA 1MQTB 3A7QA 4PT6A 1W6QB 5FZLA 3SEPA 4EJRA 2VMDA 5KXEA 4XZUG 5H9SA 2YROA 5FZ4A 4MXVA 1XYOA 5FUPA 3WNKA 5C3RA 5JAXA 3FL7A 2D6OX 1J3QA 4CU7A 1V9U3 4OLLA 1PIV1 4B3NA 1AR71 4BMEA 1N3PA 4J1WA 5E16A 4CEYA 4KU7A 2XWJB 3IMMA 1YIPA 3WG4A 1PZ9A 2NN8A 1TME1 1W90A 1AYM2 3MYXA 3SH3A 4DPNA 3RWKX 3UKNA 3WF3A 5IVCA 2BUKA 4GKXA 4DNYA 3TEWA 1E5RA 1DBNA 5A3NA 4J1XA 2I07B 4HKLA 5SV8A 1O8SA 3IMNA 3A22A 3MPBA 5DN2A 3TOJA 3VDDA 2XH6A 3GZUC 3VZJA 4CUBA 4CVUA 3MF9A 5CISA 2P6CA 3ACHA 4K7JA 3RQ0A 2Y6HA 3BU7A 2MNGA 2R30A 1REEA 2WNOA 3NV1A 4LNVA 4TSVA 5FYMA 1W6PA 5T50A 5JOYA 3JZVA 4OQ8A 5A6YA 3GXUA 2LUWA 5IAVA 3O0XA 4DY5A 5FR3A 4DQAA 2DVFA 3LEGA 4A44A 3Q8BA 4XQDA 5IATA 4YW7A 4ZU7A 3PTRB 4W4ZA 3ZLIA 4A42A 2WT0A 5J3UA 4XBNA 1ZZ6A 2ZJCA 5KHJA 1ULOA 2Q8EA 4H55A 4MUVA 2JE9A 5ACA3 2P3JA 2Z4FA 4QT6A 4IESA 4WZCA 5FZ9A 1ENXA 2PN5A 3IZOA 2WN3A 5FZ6A 1UX7A 5IJRA 5K0UC 1RITA 5EP9A 1OPOA 4Y20A 3OB8A 4K9SA 3DYPA 5FMOL 3WNLA 3FE5A 5E88A 4CDUC 1D2SA 2GC3A 5I0RA 4Y5TA 5F39A 2VMIA 3MLJA 1UKRA 1MZEA 4LK7A 1JS9A 1QF3A 2DUPA 2RS13 3OYWB 3LOIA 2OKXA 4NPRA 3CO2A 1SLCA 2HWE2 5HCFA 4FFFA 3BTXA 1LHUA 2ARXA 1QKQA 5AC93 3IDEA 4CZSA 3O1VA 3QCWA 3X29B 1AR91 1CJDA 3NAPB 2ZKNA 1QJY1 1ZNPA 1X7NA 1R1A2 4QM8A 2WUHA 1GP6A 2IUWA 1W9FA 1CWPA 2W1UA 1KGYA 1K5MB 1HRI3 3KS7A 4KWKA 4LMFA 4XJ9A 4Y1YA 2G4IA 4YG6A 4ATFA 5C8CC 1I1EA 2DVBA 2ZHLA 3QACA 2OW4A 5FIXA 1OPMA 2D6KA 5BNPC 5A3LA 1L7LA 1AYN2 1Q5OA 4JV4A 4D8MA 1S2KA 1X33A 2JJ6A 3H1WA 1REDA 4XJZA 4XC9A 4DRRA 3VD4A 2PYTA 1R083 4RQPC 5DQ0A 1IQDC 5I93A 1JYVA 5K9YA 4XYXA 4LHKA 3OEBA 1ZZCA 3GBGA 3KGZA 3FHAA 3WW2A 5JXGA 1C8M3 3POBA 4O7XA 5CFDC 2O14A 1V6MA 3B01A 4Q0UA 5F2SA 2VNVA 4DEVA 1L7QA 4I01A 3S6PA 4CPBA 4LBJA 4UW4A 4QKFA 3UK9A 1UZ0A 4QGNA 2F4LA 2VTFA 2HYXA 5LA0A 1ZRCA 4HMZA 2VTXJ 5KC5A 4FQ4A 4LUKA 5D2AA 3UJOA 5C6CA 1F4HA 1NCRA 4AEDC 1U0AA 2ZXQA 4QU1A 4Z1VA 5I0TA 1AX2A 2ET1A 2VU9A 4AFDA 2K2SA 2ZX4A 3VDDB 1RUG1 2IXIA 1PK6C 2VOXA 4Y1UA 2D93A 5A7WB 5A1LA 3P3NA 1LU2A 3BTZA 3LAGA 3NWKA 1SLLA 1TNRA 4COZA 1POQA 2Y6FA 4OCTA 2YYOA 1QJZA 1F5JA 4C91A 1GNZA 3RMYA 3DL3A 5A70A 3LDRA 2HWB3 4UW6A 1RUI3 5FMOS 2WA3A 3BPZA 4CCMA 1FPN1 1CVNA 1ZA4A 2ENRA 3KM5A 3MIBA 2WFPA 4NN0A 4OHZA 4N43B 4IQPA 4UT5A 3PVEA 1PO11 3AZZA 2D6MA 2W52A 2DDUA 2ZX1A 3QH6A 4HOOA 3OGRA 3N9QA 3A0NA 4L11A 2Q4SA 1Y43B 2WFF3 5FOBB 2DUQA 1H1MA 1STMA 5HCBA 3BKZA 2GDFA 3NQHA 4FOVA 4YGDA 1F4AA 1ZRIA 3ILFA 4M0HA 2W39A 4I02A 1YUDA 4NRPA 2VOTA 1H2LA 4NRQA 1DGLA 4EQVA 5ISLA 1H1IA 3BOWA 5FMCA 3I97A 2Y6KA 4WV8A 1H8TC 4D7TA 2VE1A 4L0PA 4FPFA 3QLQA 4KGQA 4QXCA 2O8QA 3ZFEC 3OF1A 3MIFA 3T2OA 1TME2 3EXUA 1IHMA 3ZSEA 1ND3A 2XQXA 1G9FA 2WT2A 1GKBA 5LY2A 3VZKA 3WNNA 5CKNA 1TEIA 3V0BA 3LSEA 2YBKA 2VOVA 1NCQC 5J7MA 2ID4A 4KMQA 3VZLA 4FPHA 4LO4B 4QHBA 3Q8AA 4XDPA 1OT5A 5CVRA 2C6SA 1WMFA 1UU5A 4W8JA 3RGBA 1G9BA 1UZYA 2R041 2RJ2A 2WINB 5FFOC 3WX5A 3TNQA 1H4HA 1RUJ1 3BIEA 2PELA 3FLTA 5FZGA 2QQLA 2W47A 3OEAA 1RMU3 1FT9A 1UPIA 2VJXA 1RHI1 3WG1A 3AJYA 3QH7A 3H50A 5A3PA 3WP3A 3HPNA 3E5UA 2OYZA 4GH4C 5CFCC 2HWC3 5BNNC 4YGEA 3PLQA 3VDBA 1ZZ8A 2VW0A 3CJIA 3JBG2 1LEDA 3NV2A 4JGYA 2GNBA 1RUD1 4TXWA 2C9KA 1F9KA 3THCA 4FAGA 1FV3A 1NQDA 2J1UA 2P1BA 1W9TA 3IIIA 1VBD3 4JTNA 2UYAA 2RS51 4KGGA 1TQ5A 3I49A 1W28A 3U78A 4QDSA 5EYXA 2F17A 1GICA 2VZRA 1WMXA 1W3XA 2VW1A 4BLJA 4XQ4A 4HN1A 1LR5A 4B4PA 4LBKA 5JI7A 5FUNA 1AR92 5JMOA 3VBRB 4DEQA 4U36A 1LJ7A 3S0MA 2YGLA 4AVBA 3F95A 1UWWA 2YXSA 2O0OA 3ZXAC 1LNSA 1AJKA 3MV01 2WAOA 4AVAA 3VBSA 4CEWA 4WM7A 2HWD2 1WCUA 3FJSA 4RS5B 3S7IA 4LBMA 1XNKA 4CDQC 4JZRA 3M70A 4W50A 3ZXLA 1CAXA 1H8VA 1MZ6A 1TG7A 1XNCA 5FQ0A 1YXWA 1Z7S1 1QNYA 4Q4Y3 3R4UA 3WNPA 1VE0A 3FZ3A 5FY1A 1BLZA 1LHVA 3THTA 2XPJA 4QXBA 2KR2A 1AF9A 4WM8B 4P5HA 1BBT3 4TLFA 4ZS2A 4CYDA 5IAXA 1G9DA 2R6QA 1IS3A 1UN1A 2XJUA 3WDUA 4QMAA 5FZ3A 4R9DA 3VLBB 2XL9A 5FUIA 5CG9A 1RUC3 4Z2AA 4NIIA 1ND3B 3BALA 2E9QA 2Q1FA 3HEIA 3KVBA 1OHFA 4QX0A 5LA1A 3AM2A 2WLQA 2OX0A 3V0BB 3TEZA 3LA3A 5EPAA 5JI9A 3EBRA 1QJU2 5LBEA 4BJ0A 3T3YA 2DBIA 4RHV2 4Y5Z0 3HJRA 4NAOA 3SCFA 2XBO1 1CPNA 2UY9A 2VM9A 2GNDA 4IE4A 1VBC3 4DXZA 2ARAA 1J83A 5FCCA 1EPZA 2YC0A 3PMEA 1G9CA 2XONA 3WXPA 1EV11 5KHIA 3SISA 1RUH3 3CNAA 1ZRDA 1HLCA 2PHXA 4QAWA 3SXWA 5L7OC 3AYAA 4TZDA 4Q2FA 2DVDA 3ZSLA 4TTGA 1UY0A 2P5BA 4MXWA 5CG8A 1LGNA 3WV6A 2V73A 2DVAA 2XHNA 1GP5A 1YQ5A 2W2IA 3LE0A 3DV8A 1QWRA 1PO12 1T2XA 4L97A 1KDKA 1U12A 3JCIA 3UGHA 1DQ6A 2WWJA 5LK7B 5I8YA 5H9PA 5LATA 4OUEA 3LD8A 3K46A 5C9AC 1GZTA 2P17A 1LCLA 2WIIB 3OJBA 2RHPA 1MS1A 5JMCA 4MV2A 1TMF3 1XSRA 2E7TA 1WW6A 4V2WA 1VB2A 3RZHA 1ALYA 1H9WA 3J8F2 2J42A 4LJHA 1NZCA 4HK9A 1LEMA 3OUHA 4Y1XA 4QGLA 4DUXA 2NMNA 2OT7A 3RNSA 3V64A 3H1MA 3VBSB 4CEWB 5JLVA 4WM7B 2WNUB 1NA1C 5FJHA 1J3RA 4QX5A 3UL2A 4AEKA 1CAXB 3ZIWA 3S7EA 4Y33A 5FQ0B 1BMV2 2VAUA 3ZYBA 1R091 3WDVA 3V0AA 4E8DA 5DG1A 3RWNA 4D6QA 3ASIA 4XACA 1QOSA 1IPSA 1YFUA 1Y9QA 5A33A 3B93A 3U4XA 3RZJA 3EQEA 4LA3A 1IPJA 1KFUL 3PJQA 1PX4A 2RDNA 4QX3A 5A7QA 1MEC2 2G19A 3I3QA 1ULPA 1RXFA 3MUY1 5F3IA 4LT5A 1E5HA 3HN3A 1W0OA 2EVXA 1IKPA 2D98A 2X10A 3PL0A 3C7EA 1AR82 4FXGB 5BXXA 1RUD2 1WCDJ 2IXCA 4K40A 1JUIA 1RUE3 5FZEA 3L9JT 1ZVFA 2F4PA 2WDBA 3PURA 4M00A 1MR5A 4NIHA 2J1VA 4C1XA 5GALA 4HVQA 2JG9A 1W2AX 3B5LB 4DINB 1J1TA 1W8TA 1JYCA 4N9IA 2ZMKA 3JXSA 1W6OA 2VBPA 3WNMA 2XJTA 2J7MA 3CMGA 3HR9A 3HQXA 3ACIA 3MUZ1 3OGVA 4LOSA 4Q29A 2JIGA 4AE2A 3I2OA 3JD71 3OGSA 5CIRA 1GANA 3PIGA 1R64A 1H2MA 4IEWA 2C5DA 1ZBE1 4AVVA 1GOFA 4DOUA 3RG0A 3TBDA 2KXLA 2QQUA 4UYBA 1CIYA 1AUYA 4YFZA 1O91A 5E89A 5FDBA 3CKHA 4DO0A 1SQ4A 2VNRA 4IEZA 5J36A 1PGL2 4AQ2A 1DIWA 4S2HA 1AR62 1C1LA 2WYFA 4CU8A 1B09A 2GC0A 5BNOA 3KZ4C 5K0UA 2JD4A 1YRZA 4HPKB 1JW6A 2XJVA 2V4AA 2YFUA 1N1VA 2JX9A 5DZGA 4A6SA 4BWOA 2XJSA 1IOAA 2R0FA 3AP6A 3OD0A 2C4XA 3K3OA 1D4M3 2ZKLA 1QXRA 1JHJA 4ITCA 4JGZB 4CCKA 3AZYA 2OA2A 2WS92 5FZDA 4X8PA 1SHWB 1JZ8A 3TEYA 2XBO2 2ZGUA 4UF0B 5SV5A 3LOBA 3RZMA 4ATEA 1Y3TA 3OOXA 2C1FA 2QVSB 1DHKB 3L2YA 4H3WA 4FCAA 3WF0A 2VD7A 4MGSA 1HJGA 5A33B 5EHDA 1G8WA 5C8CA 1UD1A 2RR13 4PLOA 5EJZB 4NIGA 5F5AA 2J1TA 3ST7A 1RB8G 3MW3A 2X5IA 4LHNA 4FTBA 2ZX0A 3PIJA 2NZ9A 1GWLA 4X8NA 5FYUA 2DVGA 4DB5A 4AI9A 2RDQA 4DY3A 2ZPXA 5LWBA 4QX2A 1YFWA 1YCIA 4RQPA 1JU4A 4GKYA 4CCNA 1K3IA 3NV3A 2RM22 1YJLA 3GNEA 4RSUA 5FK7A 1DZTA 2RS33 3UYJA 1V6JA 1UU6A 4DXSA 2RV9A 3OUIA 2XWBB 1B35C 1HN1A 4IV3C 2VY0A 3KCYA 2H0BA 1CD3G 1QJX1 2D6NA 1W6OB 2VZUA 2WO1A 4HG6B 2ZGMA 2BV4A 2CWSA 3I3MA 3M3OA 1QJEA 3VGIA 3VD9A 4XFBA 4AYUA 1COV3 1NKGA 1UMZA 1VBB2 4JKKA 4AEDA 4EN8B 3ZM8A 4KWJA 2W91A 3UETA 3FHQA 3WDTA 3RPQA 4CDWA 4LIVA 2BWAA 1H2NA 3ZDSA 1PK6A 2WYSA 3KWVA 1TNFA 4XJ8A 2B45X 3UGFA 2WNEA 1DQ2A 3FUOA 5T5OA 4CCLA 2VOWA 5EZWA 1WCKA 2XDVA 3N35A 3Q9OA 4ASMB 4Q8KA 5IVJA 3AYDA 3BTYA 1FATA 4AFMA 5GZDA 5FBJA 4IW3A 1DQ1A 1XU2A 3H1YA 2WRAA 3LIGA 2A75A 4HETA 2J1SA 2VUDA 4HLTA 1W8UA 2JWPA 2W68A 3FWEA 3EJKA 4R52A 3VBUC 1OI6A 2C26A 4OI0A 5LBCA 5T5PA 2Y33A 1X82A 3EMRA 4QB6A 4FP2A 4BISA 5BNOB 3AP5A 1HXS2 4EN0A 4QB1A 2XOMA 3I2IA 5K0UB 3DECA 3HOBA 4YGBA 5FXXA 3BOPA 3HMYA 4KL1A 3ZYHA 2VQUA 4BHPA 3WNOA 2G1MA 4CDUB 3LDBA 1VRH3 2A3WA 4I3PA 1HV0A 3TNPB 5AFEA 1XPWA 1VJ2A 4V2VA 4XXAA 2OS2A 2UWAA 4PQQA 1POV0 2A6VA 4XCAA 2JG8A 1QNWA 5L9RA 4BQXA 1XBFA 1A3KA 2VZQA 2E6VA 2A6YA 4RGAA 3H8UA 1JUHA 4GMP1 1GZ9A 4CDXA 1UMIA 5EIYB 4IDZA 2BBAA 5C8CB 1QDCA 3POWA 4HVOA 5FXWA 1CGPA 4MG2A 3VKFC 2V4VA 4ONUA 2ZGQA 4Y1ZA 3ECQA 2WZEA 5BNPB 5G04L 3K75B 4YFWA 2CYFA 1NCQA 1VLNA 3ZMOA 1A78A 2CTVA 2E63A 2MEV2 5JPMB 5K8SA 4XUPA 4HL0A 4AVTA 5J98B 4RQPB 3V56A 5A3MA 3B69A 2V5DA 3CZUA 4MLOA 2DFBA 2XUMA 1ZBE2 2WJSA 3D8CA 2EIEA 5JCTA 1RYYA 1D0GA 2RMU2 3WT3A 3ZKYA 1RL3A 2YC2A 4NRMA 5CFDB 2DCKA 2VXRA 1LKNA 2HLEA 5LCWL 1X8MA 3PUSA 1H2KA 4QKBA 2DFCA 2B8MA 4PHZA 2IXJA 1VBA2 3FC0A 4QQLA 5H9RA 4GH4A 3VD7A 1HRV3 2W0XA 5BNNA 5GKAC 5BNQA 4G9SB 3H8RA 2O8OA 5I0SA 1RUF3 2ZGSA 5CKQA 2XVLA 2PHFA 2A3XA 2D6LX 4AEDB 5JIUA 2R063 1NE4A 5D8AC 5F5IA 5F8PA 2EALA 5FO8B 2A6WA 1S0JA 1W6MA 1Q43A 4FXKB 4XILA 1PK6B 3E5QA 4R9CA 5KC6A 1V9U2 5ANQA 5F6LB 4QXHA 2E32A 1LODA 2Y0OA 3J26N 3R0RA 1S1AA 5FY8A 5GJ6A 1PX3A 4YG0A 3DF0A 3T0BA 5FV3A 1LOFA 2QQJA 1H6YA 5IFTA 3JQXA 4IE0A 4OYUA 1XE8A 2A6XA 4CDXC 5FXVA 5J09A 4NIDA 5DABA 4C90A 2A70A 4A45A 2Y26A 5FP4A 5BPXA 4YLZA 3ACFA 3VKNA 2E51A 1DYOA 3O1RA 1YJKA 3OYWA 1VIWB 3U4SA 3P5BA 4LR4A 3T2QA 4D3WA 4A7ZA 2QCSB 3TN91 4W6XA 3E97A 3VBOC 4NPMA 1SFNA 2NP0A 2OPWA 1PM4A 4DFSA 1UOBA 3WF1A 3WP5A 1PGSA 1RGSA 4GQ7A 1VP6A 3WQ1A 5A1FA 1M06G 3MFAA 3RI9A 4NAMA 2BDRA 2ZGTA 3BI3A 2D97A 4BPZA 5C4WC 2KM2A 2YU1A 1WBFA 1BK1A 3D0SA 2WWUA 1PZ8A 2ZBJA 1Z78A 1H8TB 3IWZA 5FKCA 5FTTC 2WA4A 3ZFEB 4Z82A 4Q8LA 1UXXX 4IE6A 1QJX2 5IK5A 1HB1A 3PNAA 3AVRA 4K6BA 4XFAA 3MZHA 2AENA 2VUAA 4Q4W3 1V6KA 4QX8A 3W9AA 1UMHA 1WBLA 3D5OA 3KLSA 1NCQB 1W8ZA 3AMHA 2JKXA 2RS12 3NV4A 1BEV2 1UYYA 3RS6A 1SBEA 4ZXKA 1Q8PA 5C3OA 2JDHA 4O9GA 2VMEA 5B2GB 5FZ8A 2J1RA 5AC92 1JN2P 5A3TA 1OKQA 1UY4A 4E2SA 2JDPA 1UPSA 2JDKA 2BOIA 3GDBA 1BCXA 2KA3A 4GWJA 4OMDA 4XF9A 5IVFA 2EAAA 3FUQA 1OVSA 3M1HA 4P14A 1YQ6A 5A7NA 3O7OA 4BOWA 3AMMA 5L7OA 1J59A 5JZGC 4QDQA 2LROA 4GH4B 5CFCB 5DUXA 5BNNB 5GLZA 3F2ZA 1W05A 2BBVA 2BVBA 1QHDA 1SLBA 5J48A 5A7WA 5KXCA 5K4LA 1JYXA 1LOEA 4QKDA 1WW5A 3I54A 4HSLA 3ZFGC 1QH7A 4QDRA 5JXHA 4GWNA 1PZ7A 1PO23 3C7HA 3I2HA 5JIAA 5IK4A 1O3SA 3FMGA 3SKVA 1W6MB 4GB33 2ARBA 3HD8B 3MW4A 4D0QA 5EJ1B 2RVAA 4QXKA 2OZJA 1C8M2 4HBNA 4B7EA 2VPVA 3VL9A 1SLTA 3CBNA 3FBYA 1GOGA 2BU9A 3JBG1 2VTXA 1OA3A 4N43A 1ND2C 4YVWC 5FMBA 2E26A 2YMZA 4HKOA 3RDIA 4EWDA 1IS6A 1JMUB 1VMHA 5LK5A 1Q56A 1K12A 2D3RA 3THDA 3AZVA 4Q5OA 4R4ZA 1W04A 4BLIA 1ZA7A 2W9XA 3CLPA 2EA7A 4PIYA 5APAA 5FBZA 2ET7A 2QDRA 2VO5A 3CL1A 1KDMA 1NA1A 4OVEA 4YVSC 4ARXA 3K2OA 4CDQB 1UL9A 3GCXA 4Q1PA 5JOWA 4LTAA 1W8FA 5C8WA 2AGSA 4TYSA 1EAH3 4CP9B 1KS5A 4N7UA 3VD5A 2B9UA 2FMYA 3B9IA 1O3TA 5I8SA 1KITA 2Y38A 2ADEA 4FFHA 4HK8A 4MHUA 2HWB2 1C57A 2WNVC 4AHWA 2AACA 2HWD1 1OA4A 3U37A 4IL7A 5FY7A 2XQRA 1POV1 4MADA 4LA2A 3USSA 2XKPA 3AYCA 3LWCA 4NHXA 3I2DA 4KQ7A 4J6GA 2HWF3 4UBHA 3U07A 4UXAA 2WL1A 3I3BA 3OG2A 5AVAA 2WFF2 1AYM3 1BHGA 4N9HA 1LRHA 1WLDA 2G9GA 4IGQA 2XLGA 4CPBD 4YM3A 1D7PM 2KD7A 1O3QA 3KF3A 5GLUA 2UWBA 5LRSA 1LECA 4XOGA 5FZBA 4ZKTB 4LO6B 5DUWA 4AI3A 4TN7A 1AXZA 2VNOA 4BMBA 5I0DA 4FTEA 4XAAA 3FFQA 3N7JA 5FYCA 2J1EA 1UXZA 4Q4V3 4GAZA 1UYXA 4CSWA 3UKVA 4Y3OA 1QJU1 1XYPA 2BJSA 2FDJA 4YWAA 4AZZA 4RHV1 1GQPA 5L7OB 4JC1A 4BXFA 3O12A 4YZ5A 3HN1A 2GH8A 2HBUA 3FX3A 3WQ0A 3C3VA 4RGKA 2VCAA 4ES9A 1PVC3 3CDZB 4EZHA 1HB2A 1DZQA 1CAVB 1AL23 2D5HA 4PBOA 1U5YA 1H9PA 2GNMA 1S0FA 1DU3D 1YIFA 3TN92 3T4VA 3ACLA 2VBDA 1FAYA 4YARA 2QQKA 3UGGA 2IXHA 3WG2A 5C9AB 3IDAA 1DGWA 3VBRA 3JUUA 3W5MA 3RZKA 1QOTA 3N36A 1NX9A 4CP2A 3AMQA 4XW3A 3MLKA 4JVAA 4UFKA 1W8OA 2F6BA 2DURA 4EZ4A 4DS0A 4N8MA 5FP3A 2N7GA 2V5YA 4RS5A 4XJUA 1Y9MA 2HWE3 1CR7A 2XXZA 3TWIA 2E7QA 2VG9A 1IQAA 1W2TA 2PLV3 4KG8A 3KGLA 5GLWA 4I0BA 1IGOA 1LOGA 1W03A 3P3PA 4XF4A 5D21A 2H0VA 4QPGC 1AVBA 1CX4A 2QZ2A 3NNJA 1UF2C 2GMPA 1R1A3 1NA1B 1UO9A 1ASJ1 2YBSA 4OZOA 1VBD2 2OIIA 4WM8A 3U1XA 3NSTA 2EICA 1RJ7A 3WR0A 3W20A 3OD4A 3J8F1 1AYN3 5FPBA 2WQ8A 5FZAA 3WVJA 3MIHA 3U14A 4EN6B 1MPXA 1J3PA 1AXKA 1C4RA 1CZTA 5JSOA 1S55A 4AHYA 3I2FA 2Q30A 2WABA 1ENRA 3OTFA 5FPZA 3AVSA 1APNA 1BMV1 2Y34A 1MS4A 1GQGA 3IIAA 2VMCA 1J1LA 1RVF3 1RJ8A 4P00B 1GV9A 4IV1C 5HBAA 1EUTA 2WZR3 1L3JA 3RYKA 4QD2A 2ZGOA 4A6OA 3ILRA 4UFHA 1NZIA 1BBT2 3VKLA 4QQOA 4HVRA 1MEC1 3BTAA 5HXMA 5L36A 2BFUL 3HNMA 4IV3A 4PCRA 3O1OA 2A7AA 1H6XA 5DZFA 3KV6A 3GHNA 4KWUA 1AR81 2DU0A 1JOBA 1RUC2 1V6OA 4PQ9A 5C3SA 5FPAA 1MZ5A 5DUVA 4EE2A 2ORZA 2FHRA 4FBFA 1EY2A 1UY1A 4UFIA 3TRSB 2UU8A 3SITA 5EXOA 2HEVF 2YG0A 1G86A 3VKOA 3KT4A 1WA6X 2HKXA 4XIOA 1VBC2 2UY8A 5FPLA 1OQDA 1T6BX 3ZFFC 2R073 2WKKA 3T2PA 3NJZA 2WO2A 4CA9A 4AOCA 3RJ2X 2ATFA 1CESA 1T6GC 3AKTA 3FBMA 4J25A 1RUH2 3KB5A 1O8PA 1MVEA 1PGW1 2UURA 3RZLA 3DUIA 1FXZA 2D44A 2VQTA 2TEPA 2PQSA 1VAVA 3BODA 3JB4C 2Y8KA 1AXYA 2WNUA 3M3QA 4LXLA 4QM9A 5FY0A 1CIWA 3DCQA 4OHXA 3AXEA 1QQP1 1PIV3 1AR73 2GC2A 4XEZA 3ZVXA 4F7ZA 1SBDA 2YC4A 1NLRA 3CHXA 1OUSA 2PHRA 2W94A 1PGL1 1TME3 1AR61 4S2GA 1F5FA 2JE7A 5DXDA 4C0HA 4OULA 3ALQA 4OZXA 5CA6A 1QMJA 1TMF2 3FFZA 4COUA 5CNAA 1VBE1 1C5HA 1F15A 1FOD1 2H6CA 2O1QA 1GSLA 3PVBB 5GZCA 1NY72 1LB2A 5T54A 4IEQA 1OF3A 2ZHMA 2X53S 3WW3A 3A0KA 5CAZA 4UFLA 2GH2A 1NLQA 2WS91 5FYIA 1XSQA 4XVHA 1OOPC 1P8JA 4FPCA 1U5XA 1IKQA 5T55A 3O0VA 2VMHA 1DLLA 2PHDA 4UWDA 2GSYA 5L19A 3N7LA 2YUEA 2BFUS 3NMBA 3ME2A 5JSRA 1Q3EA 4XFCA 3WDYA 2VBBA 1DGRA 1SFYA 3OCPA 3MBWA 4AVSA 1WW7A 2IZWA 4YNIA 3N4MA 4DXRA 1W9YA 3ZPYA 2WN2A 2K46A 3ENRA 1B35B 4XDQA 2GMMA 3ABZA 4IV3B 4ZY9A 5CYYA 5HCAA 1MACA 3N7KA 3WHTA 1SFPA 2QQIA 2A5ZA 1VRBA 3AMPA 2EXJA 3W59A 4ZZ5A 1S2EA 4AAXA 3Q8FA 2RM21 1MS8A 4CEYC 1A34A 4RFRB 2DCTA 1D4VB 3GYDA 1DGWX 3D3AA 3T2TA 4F8AA 3WDWA 4M0NA 5BYNA 1LGCA 1AR93 1Y4WA 4IE7A 4R4XA 1QJY3 2GU9A 3K4ZA 4E4DX 4B1MA 4JDNA 4NROA 2EIDA 1ASJ2 2R49A 3ZDVA 2WQ4A 3CQOA 1O3RA 4PDWC 1VBB1 5A3WA 5HCHA 4F3JA 5T52A 1N1TA 2PHTA 3T1LA 3ZMNA 3IBMA 4QGMA 1MS9A 5H9QA 3OBRA 5F3EA 2VOKA 4E9KA 5FZOA 2XUEA 4HPKA 3ITQA 3J9SA 4XHBA 4XE9A 3VBUB 2ZEWA 1YQCA 3GALA 4XUQA 2ZEYA 3IDBB 4MGYE 3RSJA 1YLLA 2CAUA 4BXSV 2YPDA 2PFWA 4JGZA 2Y6JA 5EFUA 2XVKA 1SPPB 3VBOA 1DDLA 2ZAAA 4JX0A 4QQ2A 1CZVA 3BGAA 3ZPOA 4R8HA 3J7NA 4UF0A 4AGGA 1URXA 2ZEXA 4LPLA 4Q4X1 2AC1A 4D6SA 2ZGKA 3POFA 4Y4RA 4E8CA 1FMD1 1ZBA1 1ZYBA 2VVEA 2ZX2A 5K7PA 1UYZA 2BGPA 3KT1A 1JZ6A 1OQ1A 1HXS1 1JODA 4EWEA 1IZ3A 2W08A 3POSA 4DIQA 4JHTA 4LKDA 1UX6A 4QPIC 2G9FA 2FZ1A 5C3PA 2P2KA 1C8NA 1Z0HA 1RUG3 4LOTA 1VMFA 2TUNA 3G7DA 5LBFA 5FY5A 1UZZA 4CUGA 2MHFA 1SMVA 2BQPA 3GGLA 2XLFA 3ZSMA 4AFBA 1IS5A 2B9VA 3VDCA 1I9RA 3ZR5A 5KWRA 5IW0A 5DZEA 1VALA 1WMDA 3TB0A 4ARYA 5JR2A 1D4M2 5KR7A 1Y9GA 4P5YA 3SH5A 2BTVC 1F2NA 2J1AA 3MF6A 3KV5A 4BYYA 4PI0A 2VW2A 1FPN3 2HH9A 3RVHA 3SNMA 3KQRA 2W92A 3N9MA 1GYKA 4CP1A 1PO13 4U2AA 2MEV1 1WLWA 2YB7A 2Q8OA 1NUKA 5JZGA 2YPJA 3OBAA 4CXYA 1YHFA 4TWTA 1PGW2 1A8DA 4XQWA 3H3UA 3ZFGA 1ZRFA 3DKWA 3AP4A 5D8AB 5ABJC 5F37A 3NKGA 2I74A 2RMU1 4AGVA 2ADDA 1AL0G 3MFCA 2VUCA 3NJXA 4N53C 3AKRA 2ETEA 4OI4A 4A4AA 1TVGA 1PMJX 4Y22B 2QZ3A 1G7YA 2JE8A 3ZXDA 1SDWA 1VBA1 1QQP2 2WLPA 3MEPA 4NWVA 4JQTA 2RDRA 1NCRC 3POIA 5TSWA 2D43A 1ZZBA 2XJQA 2ZHNA 3AMNA 4RA0A 5IWFA 2IVIB 1XNAA 4CDXB 1UU4A 1W8WA 4D6RA 5FZOB 2WO7A 5GLTA 2QKDA 2XGXA 3I59A 4CDUA 2WWSA 3J7MA 1V9U1 1VBE2 1FOD2 1WZXA 3WY6A 4C1WA 5BUVA 3ZXEA 5FRAA 2ZAHA 1OFNA 2R043 5FZHA 4IE5A 3WG3A 2RG4A 5AVPA 1RUJ3 4NMIA 4YZ3A 3VBOB 4OHVA 1F8VA 2VECA 4A3XA 3FHIB 1OD3A 1SG3A 4KNCA 4XUNA 2QQOA 3B02A 2VMGA 1RHI3 3BCWA 3SCGA 1MEC3 4MSVA 3ZO0B 2Q8CA 1ULEA 5DAVA 1JXNA 1SEFA 5C4WB 2WNVA 5IVVA 3KF5A 5BNPA 1OQEA 3N3HA 2NYYA 5FAXA 1RUD3 2B46X 1CX1A 5GZEA 3E5XA 4XFGA 3OSDA 4XXPA 3DPRC 3ATGA 3RJRA 3AYEA 4MH0E 2VZPA 1KEXA 2P6HA 3H3LA 4XMIA 2JEMA 4E2QA 2RS53 4G4FA 1WLCA 4JRAA 5J37A 1AZDA 4IETA 4E27A 1W6NA 3M2MA 4QB2A 5CFDA 5ACA1 1XE7A 3AJZA 1CN1A 4LBLA 4YYOA 3WDXA 4Z92B 3SMHA 3ILNA 3E6BA 2DV9A 2DBNA 5JDBA 4FOQA 2EF6A 1JTZX 4P9LA 4EWAA 1NLSA 2Q0AA 4IGPA 5DAXA 3R4SA 2RS11 4IEYA 1QXJA 4KWLA 1BEV1 5JZGB 4XUOA 4O9EA 3A21A 2W1WA 2XB6C 1Z7S3 4P08A 5AC91 4LIUA 1JZ3A 2JENA 4GA9A 2PXJA 1HV1A 2E33A 5FREA 3ZFGB 2Y6LA 1SZBA 3WCRA 1HRI1 1UW8A 5A7PA 2ILMA 5HPOA 1JYNA 4CCOA 4BQ3A 3CJIC 1EYBA 1QH6A 3R05A 4Q4X2 4JGYC 2B42B 1JI6A 1PM7A 1S0DA 1FMD2 1ZBA2 5CB7A 1JBCA 1HJFA 1V6NA 1XNTA 1ND2B 4XETA 4YVWB 3MIGA 1R081 3APBA 2G9ZA 4K1YA 5FY4A 3IPVA 3USUB 3BUCA 1UCXA 1RUF2 3B94A 1I3HA 4LE3A 4MVTA 3S5QA 3I59B 5DAPA 4ISRA 2R062 2XBO3 2CL2A 1JZ2A 1C8M1 4AVCA 2QQNA 4YVSB 2VGDA 1WWYA 3MHZA 4FO9A 3R4DB 4UBGA 1WW4A 1YI9A 3NW4A 4OUSA 4UI9L 5FZ0A 3GBFA 3MIDA 2ORXA 1H8TA 1EV13 3KCXA 1PNFA 3ZFEA 2Q5TA 1QEXA 1FNYA 4FPOB 2WAAA 4CCJA 4CCDA 4IXLA 1HN0A 1LU1A 1OH4A 1R1ZA 2B39A 4WZFA 2IXKA 2WNVB 1H30A 2QQVA 2EXIA 1HKDA 2PHUA 3M3CA 2PAEA 4CP0A 2P3YA 1DFQA 4GD4A 5F5CA 1XNDA 4AK3A 1YFXA 2W46A 3LZZA 4KI5M 3ZN4A 4RR3C 3O1SA 2JICA 2FDHA 1GNHA 4S2FA 4Y4YA 3UV9A 1BQPA 1XOYA 2ZCWA 4H2AA 1GZCA 1W2UA 4IV1A 5FZ1A 2OUHA 2VVDA 2HWB1 1S0GA 4ZU5A 1RUI1 4SBVA 2JDAA 4DXTA 2CDPA 5DDJ2 4BH9A 1W6NB 3RZGA 4WVZA 3LGRA 4FQZA 4NJ4A 3O0WA 1VBB3 1VR3A 1I5PA 2AEZA 2XKOA 1WCSA 2ARCA 1VPHA 2B5HA 4MGKE 1BXHA 4GIQA 4AI1A 3N9OA 4ES8A 3B00A 5CFCA 1ZX5A 1C3HA 4LUMA 2R32A 2WFF1 4COVA 1BZWA 1JOPA 3J7LA 5FJKA 3ZKUA 4I2OA 3PUHA 2WQZC 3D4KA 4GALA 4Q26A 3ETPA 1RUNA 4AXOA 4I0AA 5FZFA 2QQPA 4Q4W2 4K3UA 3DXUA 1GUIA 4FT8A 4AEJA 2FQPA 2OPKA 2YY1A 1R093 2ZTNA 1IG3A 2DCYA 3VBHC 5FY9A 5IFPA 2AEYA 2WZ8A 4E2GA 3O1UA 1TE1B 3ZFFA 1OD5A 3C7OA 4B7KA 3OBTA 4FVVA 3POJA
chains in the Genus database with same CATH topology
3INAA 4XJWA 4PBPA 1CAWA 3HBZA 1CONA 5KXDA 3I7DA 2C0ZA 4XF0A 2DCJA 2I2SA 3MDPA 5JVVA 1LOCA 1AHSA 3ZYGA 4H14A 4CDQA 3IPVB 3JU9A 4LULA 4E4SA 1OFSA 2DCZA 2Z69A 2HEYF 1PO22 1WD3A 2CV6A 4QPGB 3E6CC 2ZHKA 2IWGB 4GB32 4JRLA 3EO6A 4META 1EP0A 2ZOEB 2P3IA 2HWC1 3OGJA 5FO7B 3THPA 5ACA2 3AK0A 2ZX3A 3D6EA 3QBQA 4FPKA 4MZUA 2ZS6B 3JD73 3TYJA 4FSJA 1WMEA 4PJYA 1ZZ9A 1VBD1 3JB8A 3B3QE 4LE4A 1OOPA 1S0BA 1ZBE3 1SCRA 4RGGA 3V65A 4B7EA 3KSCA 2TBVA 5CADA 2K9ZA 4XTMA 4IV1B 4P9YA 5F5QA 1NE6A 5T5LA 4YW4A 2IFWA 3B9CA 5IK8A 3FLPA 4HSJA 2XJPA 4X6RB 3VHPA 1HRI2 3VHOA 2R1DA 5FO9B 3SHRA 1XQNA 4LBQA 4Z2WA 2NM1A 1NOVA 2P3KA 4P9JA 2B7YA 4G3YC 4LHLA 4Q4Y1 4AFAA 3VL8A 2HWF2 1CAVA 5JPNB 2JG9C 1R082 2E7AA 4AG4A 2FZ2A 4MGIE 1BBT1 1BVP1 4M01A 1M4WA 1KJLA 5KHGA 5C9AA 4E4ZA 3AP9A 3PVOA 1DQ4A 2D7FA 2WZPP 5F1RA 2ZZJA 1FYUA 3DGTA 3ZFFB 1V6LA 1RUC1 2JDZA 4K1ZA 4PDWA 4JTOA 4Q4V2 1CAWB 3LCPA 4SLIA 1YNAA 3I8TA 3ZSKA 3U0ZA 1I5ZA 1VAMA 2GMEA 3ZXJA 5HXVA 3QD6A 5GZFA 5HI0A 5IK7A 1A6CA 2FBEA 3LB9A 2DUOA 1VBC1 1HW5A 4L8QA 4UW3A 2ZA9A 1PVC2 4COWA 1AL22 1AX0A 3GZAA 4AWDA 1X50A 5KHKA 4L2NA 3MIEA 3ZYPA 1IPKA 1RUH1 4LO5B 3RYRA 2SBAA 5FPXA 2LTNA 1FX5A 3AKPA 5BNOC 1S0EA 1QJX3 4H7MA 1RUI2 2HEWF 4KBBA 1LHWA 2H6BA 1Q8SA 5BV6A 3RRDA 4QPIA 1BEV3 2TNFA 4PLMA 1N3OA 1C28A 2PLV2 2GAUA 3VUOA 2Q1MA 2JXAA 1LTEA 1XRUA 4QPYA 1OOPB 3ZXGA 5FLJA 3H0OA 1TMF1 4YZ2A 3ES1A 2GNTA 4FP3A 3UKTA 4HN0A 1QU0A 4AEMA 1O5LA 2X5IC 1NY71 3WHUA 1KS4A 3M7AA 1C1FA 3GBWA 2AR6A 2HYKA 4LBQB 1LHOA 2ZACA 1UAIA 2EXKA 3FLRA 1HIXA 4LEJA 2BVVA 5DUUA 3ZSJA 4D94A 1FNZA 2QUOA 2Z79A 3K51A 3M3EA 4YGCA 1JOJA 4CEYB 5ABJA 1RVF2 2RJKA 4N53A 5E1RA 2WZR2 4Q0PA 5CBLA 1NG0A 2GN7A 5EJ3A 1RMU2 1ULFA 3U11A 3E6DA 1MVQA 4GMP3 4NO4A 1QDOA 2R16A 4PDWB 1FV2A 4NHKA 4CDWC 2HWC2 4FOWA 3BIWE 3ES4A 4ISQA 5C33A 2OZ6A 5JSPA 1CPMA 1RUE1 4AHXA 4AQSA 3I4IA 1W6PB 3VBFC 4B4QA 4B29A 4HANA 1F31A 2ZGNA 4YW3A 4AGRA 4ORFA 1Y7BA 3LA2A 2NLRA 2R072 3U10A 1Q8VA 3CEWA 1LESA 3H7JA 1SBFA 4P9GA 1HX6A 1CJPA 2R0HA 5LEKA 4YW5A 4Y20B 4YW1A 4Z8BA 1U5IA 1ZRRA 1OSGA 4YSFA 2ZMLA 1YI7A 4L92A 1OA2A 4DMIA 3DPRA 1LGBA 4QPIB 5L73A 1HQWA 3OGGA 2JG8C 5F9TA 4Y26A 4Q4Y2 3WQ7A 1PIV2 1AR72 4XMAA 2PTMA 1DF0A 2YGMA 5CU1A 3HT2A 5T5JA 4GWMA 3IM0A 4HKWA 4W6WA 3VHRA 1B35A 1ULCA 4P9IA 1MQTC 3AB0A 4Z07A 2PAMA 1V70A 2YZ4A 3H9AA 1D0HA 4GXLA 2VNGA 4QQPA 2HJIA 5I91A 3AZXA 3M4FA 3TN93 5LRRA 1D4M1 4DZGA 4RD7A 3AFGA 3RMXA 1ENSA 2ZMNA 5DG2A 5ABJB 3SH4A 3KT7A 4N53B 1JYIA 2WT1A 2RR11 4XFFA 1DZRA 1YYNA 2D40A 1CQ9A 2BGCA 4QU2A 1NCRB 3VBUA 1DYKA 2RJLA 3POYA 5I8TA 1NYWA 1NXMA 1WLTA 3M3IA 1WA4A 4M3CE 1RC6A 1W39A 4WVMA 2RS31 1VAKA 1LOFC 3NO8A 4WVWA 3ZN5A 1DQ5A 1LOBA 2V09A 2D5FA 2BW8A 4FPYA 4Q0SA 1LULA 1QJY2 4N7IA 4NWWA 4B8EA 3JQWA 4S2DA 3M8LA 1COV1 1FI2A 3MLLA 2AUYA 3CU7A 2WSUA 4Q27A 4BIFA 1Q8OA 5FLHA 5JWPA 3WLUA 1J58A 4M3CA 3WD5A 3URFA 4JQRA 4PIXA 2CY6A 2FMDA 2QJVA 3NAPC 4LLFA 5D1IA 4AFCA 5IT6A 1RUOA 3DPRB 3HIFA 4RR3A 2DYCA 4R9AA 3CF6E 1K5MC 2JKBA 2IC1A 1ENQA 2P34A 3D0JA 2E53A 5EV7A 4AHZA 1H1AA 1GQHA 3KCCA 4HFSA 1SCSA 4JDOA 4V1PA 3JBG3 4IEVA 2UYBA 5EWSA 1KD7A 1BKZA 4JDMA 4YRDA 3BB6A 4L99A 3RZZA 4IEOA 2Z42A 1REFA 5FOJB 1BVVA 1VRH1 4LBOA 1MS5A 3TAYA 2LALA 2GN3A 5D8AA 1BJQA 1RUG2 3A4UA 4NHMA 4Y22A 5GLVA 5I0UA 1RUE2 3LSDA 4HZFA 3ZXKA 1VB4A 3WINE 3VBHA 3GZTB 4FPGA 2ZGLA 1O4TA 3ZXFA 2DWRA 4NOTA 1NQJA 4A2UA 1LOAA 2GZWA 2I45A 3VDDC 2HWD3 1ZREA 3CJIB 1FPN2 3WP6A 2BYVE 1WUVA 1KQRA 4JGYB 4XFIA 5KBFA 1POV3 2QNKA 2XHKA 3IKWA 1O5UA 3ELNA 3AKSA 4FAHA 3PHMA 1HDKA 1XU1A 1PVXA 4YZ1A 2OUJA 1RIRA 2ZGPA 2OVUA 2WSVA 4BZ4A 3T1MA 4WVMB 3C2UA 3WCSA 1MS0A 2P37A 4XZPA 1S0CA 2R1BA 4K21A 4LLOA 4N43C 4AF9A 1ULGA 1GZWA 4XIKA 3AP7A 4COYA 4OI2A 5C4WA 2BPA2 1HRV1 3MICA 3S30A 1DQ0A 1A8MA 4XF1A 1N1YA 1RUF1 3GF6A 4FPLA 1QJU3 4CTEA 4RHV3 3D82A 2R061 4N90A 1N1SA 2GC1A 1E57A 4HT1T 3O5SA 4M3CB 2ERFA 4GMP0 4Q0VA 4AQ6A 4BM8A 2MPFA 2BNMA 4KU8A 2DTYA 4RR3B 1H4GA 2R042 3LKJA 4IERA 1RTVA 2EAKA 4INDA 2YV8A 1RUJ2 2WC2A 4QQHA 4AI2A 4L9BA 3WNXA 4EROA 1RHI2 2SLIA 2RE9A 1GR3A 1QGLA 4PLNA 2RR12 3WOGA 1H0BA 2X29A 4A7YA 2PA7A 4YZ4A 3VKMA 2A3YA 5KXBA 1LENA 1PHMA 3K48A 3VZNA 1V00A 1KXGA 5DDJ1 3RI8A 3VHNA 1ASJ3 1XNBA 3AFKA 2RS52 2BEOA 3J8F3 2A73B 2RS32 3PJYA 3VBHB 3ZIXA 3IDCB 1XXNA 4F83A 1O4ZA 5GZGA 1ND2A 4YVWA 4MXWB 3PVNA 2ZZQA 4Q4W1 3USUA 4AW7A 2VH9A 1SACA 1COV2 4M3CF 4BIOA 5E8AA 1HQNA 3UJQA 1S0IA 4IEUA 1OMIA 5IUQA 5A32A 4YVSA 2D6PA 4I09A 1Z7S2 4NVPA 3ZYIB 3ROUA 1PNGA 4NR1A 4YG3A 3VBRC 4ASLA 3WUDA 1DYPA 2A6ZA 2PAKA 2CGPA 2BNNA 2K0GA 3WW4A 2NMOA 1PMIA 1GZWB 1DGRN 4RS5C 2PQQA 2CNAA 3N7MA 3B7MA 1AR83 2CAVA 1MS3A 2Z2SB 4FTSA 2BNOA 4R9BA 3ZX7A 2QDNA 1PO21 4D69A 2BWCA 4WM8C 4GB31 4OFGA 3DN7A 1VRH2 4D7SA 3V0AB 2VQ0A 4YM1A 3WZ1A 1S2BA 4LO7A 1ZZ7A 3MGUA 4JCKA 3GHMA 4BQ1A 1ND3C 4H7LA 1EPWA 3O14A 1EV12 1WGPA 3WP4A 4OHYA 1QY4A 5BY5A 5LEJA 4KG0A 3ETQA 3MI8A 2YDEA 3ZN6A 2AYHA 4IEXA 1JH5A 4MX3A 4YM0A 3HT1A 1IS4A 3AKQA 4EN7B 3PMSA 1EAH1 3AZWA 1OLQA 4OUMA 1QQP3 3CJXA 4Y1VA 2JG9B 4AI8A 2VUJA 4FOYA 4Y24A 2XJRA 1AR63 1OLRA 3QOPA 3AXDA 2YHJA 4PF5A 4EV0A 3RYPA 1SLAA 3PTYA 1ONAA 1ULDA 3NVCA 5T3NA 4B4RA 1VBE3 1FOD3 2HWF1 4EN9B 2XL7A 3VV1A 1HRV2 2VULA 1YFYA 2EIGA 1XYNA 4RFT0 4UW5A 2GALA 1AYM1 4W65A 2A71A 2WS93 4K20A 4XF3A 4AQTA 4PIZA 3IT8A 3OY8A 3WW1A 4QPGA 4K8FA 1O4YA 4KH9A 3VBFA 1YO8A 2XLAA 5A32B 3AX4A 2CWMA 4P9XA 1U5ZA 2ES3A 2QFEA 1CAUA 2Q1ZB 2NPIA 1R092 4XBQA 3MW2A 4Q4V1 1KJRA 3VBSC 4CEWC 4WM7C 2WNUC 2ZGRA 1ZM1A 2D3SA 1G9AA 2Y0IA 1PVC1 5EYYA 4LO8A 2AREA 1RINA 1AL21 2RM23 4Q1RA 3R6SA 4ZU4A 5J96B 1GLHA 4WVVA 1AX1A 1O7FA 2IFRA 3LA7A 4I0WB 2AH2A 2CGNA 3ZYRA 3OPZA 3SLIA 3H7YA 3HAGA 2X8KA 2JECA 1N3QA 2EXHA 2PHLA 4D7YA 2CGOA 2DTWA 2XG3A 1MQTA 1W6QA 2HWE1 1NXD1 1C5IA 2X5IB 4C0BA 1LHNA 2PLV1 4XHXA 1UIJA 3J4UH 3L2HA 4YW2A 3ZYJB 4CRQA 1Q8QA 4XPVA 3VZMA 1KFXL 2NQYA 3ZN6B 3JD72 1R1A1 4LBNA 2VQAA 1AJOA 4X6QB 1QOOA 2DU1A 3G6JB 4A7KA 4XJAA 4FPEA 2QE3A 1JHNA 4Q4X3 4BA6A 1AYN1 4BE3A 1FMD3 1ZBA3 4YM2A 2LM3A 4XBLA 3WUCA 5F6KA 3SCHA 2XVGA 1HXS3 1V6IA 2PHWA 5AFBA 3KMHA 1I6XA 3KD4A 4JAAA 5KHHA 1X8EA 1X36A 3IN9A 4P9WA 4CDWB 5JOXA 4GULA 1RVF1 2UWCA 1UIKA 2DF7A 1MZFA 4I3GA 2WZR1 1N47A 2ZABA 3OY8B 2Z5WA 3VBFB 1RMU1 4AI0A 4OHWA 1CAUB 1KRIA 4IEPA 2IXLA 4OI1A 4MGZE 4URTA 4BCUA 4I30A 4WBBA 4MYEA 1HQLA 1W0PA 2MEV3 5GM0A 3EHKA 3MPPG 5JOZA 4XFHA 4JGZC 1G6NA 1QXPA 4Q0QA 2AZ5A 3W58A 2VVFA 4W6YA 3NAPA 1DG6A 5DDJ3 4DRVA 2RMU3 1D2QA 2R071 4FPJA 3H3ZA 2JG8B 1K5MA 1WD4A 2C9AA 3VZOA 1EAH2 1YWKA 3VN4A 1VBA3 4LBQD 3HWJA 2D3PA 4RL7A 1GFF2 3NL1A 1UKGA 4NHLA 5JR7B 3NKTA 1GBGA 1SLIA 1BYHA 4XTPA 5FLIA 1MQTB 5KXEA 4EJRA 1W6QB 5H9SA 2YROA 4MXVA 1XYOA 5JAXA 2D6OX 1J3QA 1V9U3 4OLLA 1PIV1 4B3NA 1AR71 4BMEA 1N3PA 4J1WA 5E16A 4CEYA 4KU7A 2XWJB 1YIPA 3WG4A 1PZ9A 2NN8A 1TME1 1AYM2 3MYXA 3SH3A 4DPNA 3UKNA 2BUKA 4GKXA 4DNYA 1DBNA 4J1XA 2I07B 4HKLA 5SV8A 3IMNA 3MPBA 3TOJA 3VDDA 2XH6A 3GZUC 3VZJA 3MF9A 4K7JA 3RQ0A 3BU7A 2MNGA 2R30A 1REEA 3NV1A 4LNVA 5JOYA 4TSVA 1W6PA 5T50A 3JZVA 2LUWA 3O0XA 4DY5A 4DQAA 2DVFA 4XQDA 4ZU7A 5J3UA 2WT0A 4XBNA 1ZZ6A 2ZJCA 5KHJA 4H55A 4MUVA 2JE9A 5ACA3 2P3JA 4QT6A 4IESA 4WZCA 1ENXA 2PN5A 5K0UC 1RITA 1OPOA 4Y20A 4K9SA 5FMOL 3FE5A 5E88A 4CDUC 1D2SA 2GC3A 5I0RA 2VMIA 3MLJA 1UKRA 1MZEA 1QF3A 2DUPA 2RS13 3OYWB 3LOIA 4NPRA 3CO2A 1SLCA 2HWE2 5HCFA 1LHUA 2ARXA 1QKQA 5AC93 3IDEA 4CZSA 3QCWA 3X29B 1AR91 1CJDA 3NAPB 2ZKNA 1QJY1 1X7NA 1ZNPA 1R1A2 4QM8A 1K5MB 1HRI3 3KS7A 4KWKA 4XJ9A 4Y1YA 4YG6A 2G4IA 4ATFA 5C8CC 1I1EA 2DVBA 2ZHLA 3QACA 2OW4A 1OPMA 2D6KA 5BNPC 5A3LA 1AYN2 1Q5OA 4JV4A 1S2KA 1X33A 2JJ6A 3H1WA 1REDA 4XJZA 4DRRA 2PYTA 1R083 4RQPC 5I93A 5K9YA 4XYXA 4LHKA 1ZZCA 3GBGA 3KGZA 3WW2A 1C8M3 5CFDC 1V6MA 3B01A 4Q0UA 4I01A 3S6PA 4LBJA 4UW4A 3UK9A 4QGNA 1ZRCA 4HMZA 5KC5A 4FQ4A 4LUKA 3UJOA 1NCRA 4AEDC 1U0AA 4Z1VA 5I0TA 1AX2A 2ET1A 2VU9A 4AFDA 2K2SA 2ZX4A 3VDDB 1RUG1 2IXIA 1PK6C 2VOXA 4Y1UA 2D93A 3P3NA 1LU2A 3LAGA 3NWKA 1SLLA 1TNRA 4COZA 2YYOA 1QJZA 1F5JA 4C91A 1GNZA 3RMYA 3DL3A 2HWB3 4UW6A 1RUI3 5FMOS 2WA3A 3BPZA 1FPN1 1CVNA 1ZA4A 2ENRA 3KM5A 3MIBA 2WFPA 4NN0A 4OHZA 4N43B 4IQPA 3PVEA 1PO11 3AZZA 2D6MA 2W52A 2ZX1A 3QH6A 3A0NA 4L11A 2Q4SA 1Y43B 2WFF3 5FOBB 2DUQA 1H1MA 5HCBA 2GDFA 4FOVA 4YGDA 3ILFA 4M0HA 2W39A 4I02A 1YUDA 1H2LA 1DGLA 1H1IA 3BOWA 4WV8A 1H8TC 4D7TA 3ZFEC 4FPFA 3QLQA 4KGQA 2O8QA 3OF1A 3MIFA 1TME2 3EXUA 1IHMA 3ZSEA 1ND3A 1G9FA 2WT2A 1GKBA 3VZKA 1TEIA 3V0BA 3LSEA 2VOVA 1NCQC 5J7MA 3VZLA 4FPHA 4LO4B 4QHBA 5CVRA 1WMFA 1UU5A 1G9BA 1UZYA 2R041 3WX5A 2WINB 5FFOC 3TNQA 1H4HA 1RUJ1 2PELA 3FLTA 1RMU3 1FT9A 1UPIA 1RHI1 3WG1A 3AJYA 3QH7A 3H50A 3WP3A 2OYZA 3E5UA 4GH4C 5CFCC 2HWC3 5BNNC 4YGEA 3PLQA 1ZZ8A 2VW0A 3CJIA 3JBG2 1LEDA 3NV2A 4JGYA 2GNBA 1RUD1 1F9KA 4FAGA 1FV3A 1NQDA 1VBD3 4JTNA 2UYAA 2RS51 4KGGA 1TQ5A 5EYXA 1GICA 2VW1A 4BLJA 4XQ4A 4HN1A 1LR5A 4B4PA 4LBKA 1AR92 3VBRB 4U36A 1LJ7A 3S0MA 2YGLA 4AVBA 2YXSA 2O0OA 3ZXAC 1AJKA 4AVAA 3VBSA 4CEWA 4WM7A 2HWD2 3FJSA 4RS5B 3S7IA 4LBMA 1XNKA 4CDQC 3M70A 3ZXLA 1CAXA 1H8VA 1MZ6A 1XNCA 5FQ0A 1YXWA 1Z7S1 1QNYA 4Q4Y3 3R4UA 3FZ3A 1LHVA 3THTA 2XPJA 1AF9A 4WM8B 4P5HA 1BBT3 4TLFA 4CYDA 1G9DA 2R6QA 1IS3A 1UN1A 2XJUA 3WDUA 4QMAA 4R9DA 3VLBB 2XL9A 5CG9A 1RUC3 1ND3B 3BALA 2E9QA 1OHFA 3AM2A 2WLQA 3V0BB 3LA3A 5JI9A 3EBRA 1QJU2 3SCFA 4RHV2 4Y5Z0 2XBO1 1CPNA 2UY9A 2GNDA 1VBC3 4DXZA 5FCCA 1EPZA 2YC0A 3PMEA 1G9CA 3WXPA 1EV11 5KHIA 3SISA 1RUH3 3CNAA 1ZRDA 1HLCA 2PHXA 3SXWA 5L7OC 3AYAA 4TZDA 4Q2FA 2DVDA 3ZSLA 4MXWA 5CG8A 1LGNA 3WV6A 2V73A 2DVAA 3DV8A 1QWRA 1PO12 4L97A 1KDKA 1U12A 3JCIA 5LK7B 1DQ6A 5I8YA 5H9PA 5C9AC 2P17A 1LCLA 2WIIB 3OJBA 2RHPA 1MS1A 5JMCA 4MV2A 1TMF3 2E7TA 1WW6A 1VB2A 1ALYA 1H9WA 3J8F2 1NZCA 4HK9A 1LEMA 4Y1XA 4QGLA 2NMNA 3RNSA 3V64A 3H1MA 3VBSB 4CEWB 5JLVA 4WM7B 2WNUB 1NA1C 1J3RA 4QX5A 3UL2A 4AEKA 1CAXB 3ZIWA 3S7EA 5FQ0B 1BMV2 1R091 3WDVA 3V0AA 5DG1A 3RWNA 3ASIA 1QOSA 1YFUA 1Y9QA 5A33A 3B93A 3U4XA 3EQEA 4LA3A 1IPJA 1KFUL 3PJQA 1MEC2 4LT5A 1W0OA 2EVXA 1IKPA 2D98A 1AR82 4FXGB 5BXXA 1RUD2 1WCDJ 2IXCA 4K40A 1JUIA 1RUE3 3L9JT 1ZVFA 2F4PA 4M00A 1MR5A 4C1XA 5GALA 4HVQA 2JG9A 3B5LB 4DINB 1J1TA 1JYCA 4N9IA 2ZMKA 1W6OA 2XJTA 3HR9A 3HQXA 4Q29A 4AE2A 3JD71 5CIRA 1GANA 1H2MA 4IEWA 2C5DA 1ZBE1 4AVVA 4DOUA 3RG0A 3TBDA 2KXLA 1AUYA 4YFZA 1O91A 5E89A 5FDBA 1SQ4A 2VNRA 4IEZA 5J36A 1PGL2 4AQ2A 1DIWA 4S2HA 1AR62 1C1LA 1B09A 2GC0A 5BNOA 3KZ4C 5K0UA 2JD4A 1YRZA 4HPKB 1JW6A 2XJVA 1N1VA 2JX9A 5DZGA 4BWOA 2XJSA 1IOAA 2R0FA 3AP6A 3OD0A 4JGZB 4AHWA 1D4M3