5C4WC

Crystal structure of coxsackievirus a16
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
242
structure length
242
Chain Sequence
GIPTELKPGTNQFLTTDDGVSAPILPGFHPTPPIHIPGEVHNLLEICRVETILEVNNLKTNETTPMQRLCFPVSVQSKTGELCAAFRADPGRDGPWQSTILGQLCRYYTQWSGSLEVTFMFAGSFMATGKMLIAYTPPGGNVPADRITAMLGTHVIWDFGLQSSVTLVVPWISNTHYRAHARAGYFDYYTTGIITIWYQTNYVVPIGAPTTAYIVALAAAQDNFTMKLCKDTEDIEQTANIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords VP1
publication title Structures of Coxsackievirus A16 Capsids with Native Antigenicity: Implications for Particle Expansion, Receptor Binding, and Immunogenicity.
pubmed doi rcsb
molecule tags Virus
total genus 41
structure length 242
sequence length 242
ec nomenclature
pdb deposition date 2015-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5c4wC00
1HXS3 1AR81 2WFF3 2WZR2 3M8LA 4Y4YA 4CDQB 5BNPB 2GSYA 1RHI1 4YVSC 1NG0A 1VBD2 3JD71 4CEYB 1AL23 1AYM3 5FMOL 2PLV1 1X33A 2RM22 5K0UC 1PGW1 1AYN3 4CDXB 4CDWA 1R082 1RVF3 4N53B 2BBVA 1MEC3 1HQNA 1QJX3 3VDDA 1QJU1 3ZFEB 2BFUL 2RS12 3DPRA 4CDXA 1RUD3 4JGYA 3JBG3 2R061 1EAH1 1RUJ3 1PVC2 5CFCA 4Q4X3 4IV1B 1AR63 5BNOA 4GH4B 4Q4Y1 5ABJC 4YVWC 2WS93 4Q4W3 3VBHC 4AEDA 1RUG2 1RUC1 4N53C 3VBRB 5D8AC 1C8NA 1HRV1 2RR11 1AL0G 2R042 3LOBA 1ZBE1 5C8CC 1HRI1 2WFF2 1R1A2 1VBA2 3ZFFB 4FTEA 1B35B 5AC91 1OOPA 3CJIC 1R091 1V9U2 3VBSA 1AYN1 2TBVA 2Y26A 4CEWB 4FSJA 1RVF1 2RS51 1AYM2 1RMU2 4RFT0 1D4M3 5J96B 2XBO2 2HWF3 1NA1C 1PO22 1Z7S1 4LLFA 2WZR3 5C9AA 1TMF1 4RS5A 1A6CA 3ZFGB 5J98B 4WM7A 1QJY2 3JBG2 1PGL1 1NOVA 1RUF2 1VBB1 1ASJ1 4IV3B 2RM23 5JZGC 4Q4X2 2HWB1 1AR62 1R083 1ND2B 1AR91 4RR3A 1FOD1 4JGZB 4GMP3 1VBC1 3NAPA 1BMV1 1MQTA 1H8TB 4QPGC 1C8M1 1FMD1 1FPN1 3IDEA 2HWE1 4CDUB 5L7OA 1NCRB 2X5IA 1COV3 1VBE3 4FTBA 1RUG3 5BNNC 2HWC2 2WZR1 3VBOA 1VAKA 4RHV2 4WM8C 5CFDC 4QPIC 2R043 1VBD1 2GH8A 4Q4V2 1K5MC 2RS32 1NCQA 1R1A3 1VBA3 5C4WC 2RMU1 5ACA3 1W39A 1EV12 4RQPB 1V9U3 4CDWB 4GB33 1RUH1 1RMU3 1E57A 3VDDB 4Y5Z0 2XBO3 4RQPA 3DPRB 5DDJ3 1PO23 2RS11 1OPOA 1QQP1 4GMP1 1RUI2 5K0UA 4JGYB 4PDWC 1ND3A 3TN91 5CFCB 1PVC1 1ZBA2 5BNOB 5A33A 1QJY3 1AR82 1BBT1 4CDQC 5BNPC 1RUF3 3J8F2 4AEDB 4CDWC 1RHI2 5A32A 1F2NA 3JD72 1POV3 4CEYC 1RUE3 1PO13 1NY72 1AR71 1COV2 4N43B 4CDXC 1HXS1 1VBE2 1PGW2 4YVWA 3VBHA 2WFF1 5FMOS 1OOPB 3VBSB 3ZFEC 4N43A 1QJU2 4NWVA 1AL21 1VRH3 1AYM1 4SBVA 5C8CA 5ACA2 2R062 1CD3G 1BEV3 1PIV3 2BFUS 4NWWA 4IV1C 3CJIA 4GB32 2HWC3 5C9AB 4GH4C 3VBFA 1MEC1 1QJX1 4RS5B 4Q4Y2 4RHV3 5DDJ2 4WM7B 3VBRC 4Q4V3 1NA1A 1RUD1 1RUC2 2RS33 3JBG1 1EV13 1HRV2 2RR12 1RUJ1 1M06G 4Q4X1 1AR61 1ZBE2 3ZFFC 1B35C 4RR3B 2WS91 4Q4W1 5AC92 1R092 4CEWC 1RUE2 1PO12 1RUI3 3NAPB 2RS52 5JZGA 1MQTB 2WLPA 3JB4C 2R073 1ZBA3 1Z7S2 1AR83 5GKAC 5L7OB 1TMF2 2X5IB 1OHFA 3J8F3 3ZFGC 2IZWA 4BCUA 1RHI3 1VRH2 3JD73 3VBOB 3VBUA 2MEV2 1D4M1 4QPGA 1BEV2 1PIV2 4IV3C 2HWF1 1TME2 1ASJ2 2PLV3 1GFF2 1NCQB 2HWB2 1VB4A 5BNNA 1ND2C 1EV11 4EJRA 1SMVA 2ZAHA 1DDLA 1AUYA 1AR92 1QJU3 4JGZC 1FOD2 4GMP0 4WM8A 2ZZQA 5CFDA 4QPIA 1F8VA 1HX6A 1VBC2 1K5MA 2R063 1EAH3 5C4WA 1H8TC 2RM21 5K0UB 1R081 2DF7A 4YVSA 1RB8G 1ND3B 4CDUC 1FMD2 2WWSA 1FPN2 4Q4Y3 1NCRC 5A33B 1RUC3 3ZXAC 2HWD2 4PDWA 1X36A 1HRV3 2RR13 3J8F1 2R072 5A32B 1ZBE3 1HRI3 1NY71 2RMU2 4RQPC 1VB2A 5AC93 5ABJB 1COV1 4CDQA 4YVWB 1R093 5BNPA 1VBE1 3VBHB 1RUG1 5FOJB 3VDDC 1ND3C 1RUH2 2RS53 4CEYA 5D8AB 4Z92B 3DPRC 2PLV2 5ABJA 2R041 4JGYC 1QQP2 1R1A1 1Z7S3 5C8CB 1VBA1 2XPJA 4N53A 5ACA1 1TMF3 5D8AA 5CFCC 2BPA2 1V9U1 3TN92 3CJIB 2ZTNA 3ZFEA 5BNOC 4GB31 3VBFB 1RMU1 2MEV3 3S6PA 1BBT2 4AEDC 1EAH2 1VBB3 2XBO1 1TME3 5DDJ1 2FZ1A 1ASJ3 1PO21 1NA1B 1POV0 2BUKA 2HWB3 4IV1A 4N43C 4GH4A 1AR72 1AR93 1FOD3 1HXS2 1QJY1 2VQ0A 3VBRA 1OOPC 1VBC3 2QQPA 1RUF1 3JB8A 3VBSC 3VBFC 1POV1 1HRI2 1RUE1 5JZGB 1PO11 3HAGA 1AL22 1C8M3 1FMD3 1FPN3 2HWE3 3ZFFA 1B35A 4FTSA 1AYN2 5C9AC 1CJDA 1RVF2 4CEWA 4RS5C 1MEC2 1QJX2 2HWD3 2FZ2A 4WM7C 3VBUB 1VBD3 1VRH1 1QJZA 4QPGB 1RUD2 2MEV1 1WCDJ 2RMU3 1BEV1 1PIV1 1TME1 1RUJ2 5LK7B 3ZFGA 2HWC1 1RUH3 5BNNB 1PGL2 4RR3C 1VBB2 4RHV1 2WS92 4Q4W2 4WM8B 4IV3A 4Q4V1 5CFDB 4QPIB 2RS13 2RS31 3NAPC 1QQP3 1K5MB 1MQTC 5C4WB 3FBMA 3TN93 1ND2A 4YVSB 1PVC3 3VBUC 5L7OC 4JGZA 2X5IC 1BBT3 1BMV2 3VBOC 1RUI1 1H8TA 1C8M2 2HWE2 1D4M2 4PDWB 2HWD1 4CDUA 1AR73 2HWF2 2R071 1NCQC 1IHMA 1NCRA 1ZBA1
chains in the Genus database with same CATH superfamily
1UNBA 4CYDA 5I91A 2XKOA 2BJSA 1AR81 1JZ2A 4OMCA 1WW5A 4URTA 4CDQB 1OUSA 5F32A 4CXYA 1NG0A 1VBD2 1ONAA 3SH4A 5FBJA 2C5DA 3GZEA 3ZDVA 4JZRA 1V6OA 3PU8A 4CXXA 1OSGA 3W58A 3TWIA 1DQ5A 2VZUA 5J3UA 4Q26A 3MO4A 1PGW1 2VGDA 3NRUA 4X6QB 1T2XA 4HK8A 1UZ0A 4OVEA 1S1AA 3AZXA 4E2QA 1JN2P 1FYUA 1MEC3 3KGZA 4WVZA 4XEZA 4QX8A 5FFOC 4ZXEA 5FP9A 4HL0A 3KV4A 4FAGA 3BTXA 3NVCA 4D6RA 1AF9A 1HKDA 2RS12 2YY1A 1KJRA 1NUKA 2G9FA 4GZ9A 4OFGA 1S0GA 4ZS3A 1Q5OA 1RUD3 1HN0A 1W8WA 1TE1B 1MVEA 4LBLA 4AI2A 2OQ6A 4GULA 1XRUA 4UFJA 1W90A 5LA0A 4QXBA 1QH7A 1AR63 1UKRA 1DQ4A 2F17A 2GMPA 3WDUA 4AI3A 3HT1A 3FHAA 5ABJC 3DV8A 4YVWC 3P1IA 2XJPA 4IGOA 4ZY9A 3GBFA 4XUOA 1A34A 3IB3A 4HFSA 4AEJA 1Y9MA 1S55A 1JOBA 2DVBA 3MHZA 4IEWA 1K12A 1RUC1 1RUG2 4UT5A 2ZMLA 3TEWA 3R0RA 1C8NA 5I93A 1G9BA 5FYUA 4BXSV 3U0ZA 3WOGA 2ZA9A 3EHKA 3SCHA 5FP3A 4DEVA 1AL0G 2R042 1ZBE1 3UGHA 2W5FA 5GLZA 3ZIWA 5JXJA 1VAVA 1G7YA 1BCXA 3WP6A 3WQ1A 1H6YA 4DO0A 3CJIC 4A7KA 2ZGMA 3VBSA 2TBVA 2CL2A 2W39A 2ZGOA 3K3NA 2D6MA 2PHTA 1RMU2 3KT1A 1REDA 4RFT0 3RYKA 1AJKA 1D4M3 3ME2A 5FK7A 3MZHA 1V6NA 5DG1A 5L9VA 4KWLA 3ATGA 1NZCA 1SFYA 1UAIA 5FZ4A 3HBKA 3HD8B 3U11A 2JKBA 4LLFA 5G04L 2WZR3 3WUDA 1PZ8A 1YCIA 4LBQB 5FZOB 3SLIA 4AVVA 3WF0A 2V5YA 1WWYA 5JSOA 5A7NA 1GLHA 2XXZA 1UYXA 4Q0VA 1BJQA 1FT9A 3PVNA 2D6KA 5J98B 5FPVA 4RSUA 1J58A 1W8ZA 2AREA 2DBNA 4N90A 5FPLA 3K2OA 3LA2A 4IV3B 1NE4A 2RM23 4X6RB 4MUVA 3RZMA 3RQ0A 3VDBA 2HWB1 2CWMA 3LDRA 4DIQA 1AR62 4MGTA 1R083 5A80A 3D5OA 2OA2A 4L9BA 2VNRA 3LZZA 1OVSA 1IPKA 3URFA 1DQ0A 4NHMA 5FYIA 5F1RA 1UYYA 2DCJA 4LKDA 4RR3A 2QE3A 5A1LA 4JGZB 2BGOA 3FLRA 2WQ8A 3EB7A 4QX5A 5FIXA 1YLLA 1RXFA 3OD0A 2R32A 4XTPA 5GLVA 3MIGA 5DAWA 4HANA 4IE4A 1MQTA 4B3NA 5CA6A 3GM8A 1DZRA 4FO9A 2QDRA 3NV1A 3MI8A 4QPGC 2JB8A 1N47A 2D6NA 2B39A 2VXRA 3PTRB 4P9WA 3IDEA 5D2AA 2ADEA 1O7FA 3LQCA 3CQOA 2JECA 2VG9A 4NRQA 1F31A 4LHSA 4OHWA 4C91A 4FTBA 2DCKA 3NQHA 1MS8A 5FZ3A 1QDCA 3IMMA 1J3PA 1YFUA 2HEWF 1POQA 3PLQA 4RHV2 4YW2A 3HQXA 3EYPA 1G9AA 1UOFA 1S0CA 2BQPA 3TOJA 5JOZA 3ORJA 1VBD1 1CZTA 1H2KA 1W8HA 1NAEA 3INAA 1QNYA 5E88A 2A75A 1C5IA 2XDVA 3ON7A 5C4WC 2RMU1 4KMQA 4BA6A 5FZGA 2PELA 4ZXKA 2VTXJ 2ORXA 4RQPB 2VZSA 3FUOA 3M2MA 2VBDA 1VMFA 4CDWB 3T1MA 4HLTA 4YG0A 3AJZA 3ZOIA 3OB8A 5A3LA 5CYYA 3NNLA 4QB1A 5FKBA 3HOBA 4EZHA 3K4DA 4XCBA 4XC9A 4MYEA 3GZTB 2CV6A 1BKZA 3PNAA 5K4LA 4RQPA 5CZKA 2EXIA 4BH9A 4XETA 3RVHA 1PO23 2RS11 1E5IA 1QQP1 3RGBA 4HPKB 3T4HB 3RZKA 4PDWC 1KS5A 3WW1A 3LPFA 4NRMA 3TBDA 1ND3A 1O4YA 1W2OA 4LORA 4Y22A 3TN91 3ZSMA 5IVEA 3O1UA 1RL3A 2J1UA 4ZZ8A 5CFCB 2WAAA 4QWNA 3AYAA 2BNOA 3NW4A 1IKQA 3RWKX 2HYXA 3MICA 5F7UA 2B45X 5BNOB 4YG6A 1NYWA 1QJY3 1TQ5A 4E27A 4J1XA 4F7ZA 1BBT1 1MS3A 3HT2A 1RUF3 5BNPC 2VZ1A 4H55A 4D7TA 3LEKA 5JXHA 4YGEA 1POV3 1OLMA 4OHZA 1XE8A 1BZWA 2XWBB 1PNFA 3KQ4B 3VZKA 1KD7A 4Y26A 1J83A 1AR71 3JCIA 3DN7A 3ILRA 4B7KA 1N3PA 1JHJA 4HT1T 1UOBA 1W2NA 3VBHA 4LBKA 1GOHA 4AVCA 4JRAA 3O0XA 2CSGA 2WSVA 4D8MA 5A3UA 3L2HA 4ASKA 4B8EA 2C6SA 4HN1A 1QJU2 1JOPA 4M3CF 4OUEA 4QQPA 1W6PB 4XFBA 3VDCA 2KA3A 4MHUA 1GZWA 3HMYA 2VY0A 1YUDA 4SBVA 3WNPA 1JI6A 3KZ4C 2BP6A 5AVAA 5C8CA 2R062 2YPJA 3G6JB 5T3NA 4CUGA 2BGPA 2LUWA 1BEV3 2JDYA 4M4RA 4GKYA 1Z78A 2JDUA 2CDPA 4IV1C 5FXZA 2KM2A 2P37A 2WNEA 4MXWA 3OBAA 4GH4C 5C9AB 1MEC1 3HNMA 2VE1A 4Q29A 1VMJA 4RS5B 3S5AA 2EAKA 1DZQA 5LA2A 1BVVA 3RYRA 1OT5A 4IE7A 2RJ2A 4BQ1A 5F2WA 1WLTA 5A7WA 1NA1A 1RUD1 2RS33 2WFPA 5A6ZA 3I3QA 4MGSA 4J6GA 2NP0A 3VHNA 2Y0OA 1VE0A 3ZYIB 1EV13 1HRV2 3IIIA 3DXUA 3FN9A 4QX0A 3VN4A 1X7NA 3WXPA 4XF0A 3QH7A 1O8PA 4PIZA 4AGVA 5K8SA 1M06G 5FP7A 1AR61 2GC2A 2DFBA 4E2SA 4YGDA 1B35C 2VD7A 1WKYA 2BTVC 5EIYB 3Q8AA 1OKQA 2XONA 3DL3A 2E32A 2IC1A 5AC92 2VZRA 3LIGA 3RMXA 3D0SA 4AGGA 4AVBA 4FQ4A 4MO3M 4CEWC 5DZEA 4I3GA 4L11A 3NAPB 5JZGA 4XZPA 3N9OA 3N9QA 2KR2A 4AFAA 1UU5A 1W8UA 3I2HA 2FD8A 2CNAA 2ID4A 3D8CA 2AC1A 3HR9A 4IW3A 1ENQA 4S2GA 5JIAA 1SCSA 3PMSA 4I30A 3AMQA 1TMF2 3E5XA 5C7GA 2X5IB 4RGKA 1OHFA 3DYOA 3ZFGC 2CGOA 5AFBA 4QMAA 3RRDA 5FYSA 4Q5OA 3VBOB 2D43A 2A7AA 2VQAA 3OYWA 2MEV2 1D4M1 3VBUA 5JPNB 3AVRA 4OULA 3UNPA 1BEV2 4XJZA 3U37A 2UU8A 2RHPA 1F9KA 3MPPG 1UW8A 3OTFA 2VOTA 3PVOA 3N7LA 2ZMKA 3KV9A 1WLCA 2WA4A 2RE9A 4O65A 2EIGA 4FVVA 4PIYA 3V56A 5BNNA 1J3RA 1ND2C 4EJRA 4XF1A 1DDLA 1NLSA 4A42A 1AR92 3USUA 4FPYA 3ACHA 1FOD2 2R30A 3OBZA 4UI9L 3ZKUA 3TEYA 2W87A 4QM8A 2CGPA 3J7LA 2YGMA 5D1IA 1HX6A 1VBC2 2E33A 2Q1MA 4AR2A 3B7MA 3ABZA 1ULEA 4PT6A 1EAH3 2RM21 1LNSA 5FQ0A 1R081 2DF7A 1PX4A 2XJTA 5I0DA 4KL1A 4QB2A 1FMD2 2WWSA 2J1EA 4A2UA 2BV4A 4BQ3A 4NHYA 1OFNA 3VZNA 4CU6A 1C5HA 2WNUA 2BNMA 4Y1XA 3QCWA 5A3TA 3LWCA 3WW3A 1QEXA 4E4HA 4AFCA 1N1VA 1H2MA 1T6GC 4YGCA 1WW4A 2KXLA 2RR13 2D5FA 4W4ZA 3N35A 4J1WA 4EZ4A 4Y1VA 2HYKA 5FZHA 4XHBA 5KC5A 2A6ZA 1TNRA 4IEXA 1HRI3 2JICA 5DUVA 4AF9A 2VOXA 4TYSA 2YUEA 5FZEA 4NE9A 3WDWA 5ABJB 4W6WA 4YVWB 1R093 4EWAA 5HCHA 1ULGA 3H1MA 3IBMA 3NNGA 5FXVA 5FOJB 1E5SA 4FT8A 3USSA 2C9AA 2WZPP 2RS53 5FMBA 2B46X 3T08A 4CEYA 4Z92B 1SBFA 3PVEA 3LPGA 1W2AX 2ZGUA 5ABJA 3WG1A 2VZPA 5GLTA 4BMEA 3IAQA 5C3PA 5HXVA 2MPFA 4B4RA 1Z7S3 2BVVA 2EF6A 4ISRA 2HEYF 3IKWA 5T54A 4Y24A 4QQHA 1W6MA 3HN3A 3LSDA 3SHRA 3BU0A 1RJ8A 3GJAA 3MUY1 3CJIB 2ZHNA 4XYXA 4DUVA 3W5MA 1ULOA 4L2NA 3KVBA 3VBFB 2NPIA 4QHBA 4CP9B 5L19A 2DV9A 4TWTA 3Q8EA 4LO8A 4XFCA 4OUSA 5FZ0A 1EAH2 2VVEA 3T0AA 4Y5SA 2P3IA 4YZ1A 1TME3 3ILNA 1ASJ3 1PO21 1POV0 2A71A 5FP8A 1V6MA 2DU1A 2Y6GA 4BE3A 2GZWA 3I3BA 3U75A 1NT0A 2O8OA 2PQQA 4N43C 4PCRA 4PI2A 2DUQA 1SDDB 5FZ1A 3K3OA 3CDZB 1CAXA 1IS3A 1QJY1 1TVGA 1X8MA 3KVAA 3NL1A 3VBRA 1GQPA 4V2VA 4XUQA 1RUF1 3R4DB 4KNCA 5F5CA 3VBSC 3O1RA 4Q0QA 4FP3A 4CCOA 3FZ3A 4EQVA 4XAAA 2VZQA 1POV1 4NHXA 1HRI2 4CP1A 4CRQA 1H9WA 3BIWE 3GGLA 4AL9A 1AL22 3TNQA 1C8M3 3TEZA 4CSWA 1FPN3 2VQUA 3ZFFA 5F39A 5LASA 4NMIA 1SPPB 1AYN2 1MR5A 1OUXA 3IM0A 3LSEA 4Q0PA 4EN8B 4K7JA 3ZYPA 2PHDA 3C2UA 3ETPA 4Q8LA 4ZS2A 1JYTA 4LHKA 2JG9C 1QJX2 3KHCA 2FZ2A 4MV2A 4LPLA 5BYNA 4PF5A 2JDHA 4A6SA 4I02A 3IWZA 2XJQA 1RINA 4QPGB 4UW5A 3V0BA 2MEV1 4AVAA 5FY9A 4G9SB 2WT1A 1BVP1 5FXXA 1BEV1 2R6QA 2Q8DA 1Y9QA 5LK7B 5H9RA 1XNCA 5A7PA 3VL8A 2C24A 1B09A 2P6CA 4W65A 1RUH3 3EO6A 4RR3C 2JENA 2VULA 3MFCA 3KF3A 4YFZA 1JOJA 3JZVA 3M3EA 4R9BA 2WS92 4Q4W2 4BM8A 1IQDC 4DNYA 1SACA 2XVKA 2RS31 4XJUA 4GKXA 3GBWA 2VM9A 3PHMA 3GNEA 5HBAA 1MQTC 5C4WB 5IK7A 4AVTA 2QQWA 4IESA 3AZWA 4YVSB 2Q1FA 1BYHA 1VMHA 1UIKA 3IAPA 4Y3OA 4NIGA 3S7IA 2ZPXA 4FPLA 4MGQA 2EXKA 2PHUA 5IVYA 2K9ZA 4LMFA 2XVLA 3E6DA 4BHPA 4ZZ5A 5A70A 1F5FA 2VU9A 1DFQA 3OSDA 5HXMA 1CGPA 1OBNA 3UT0A 2C1FA 1C8M2 1REEA 4PDWB 4E8DA 4F3JA 2A3YA 3HQUA 4CDUA 4H3WA 2FCUA 1C57A 1GSLA 2VUDA 2QZ3A 1NCRA 2X8KA 4NUBA 4E9KA 3U4SA 3A21A 4P08A 2AEYA 3M8LA 1W8OA 2VOKA 5BNPB 4I0WB 2W91A 4XJWA 3NJXA 2R7EB 5FBZA 1ZNPA 5FY1A 5HI0A 1SCRA 3ZXGA 2UYBA 1AYM3 3M3OA 3KT7A 3KWVA 3SMHA 3POYA 3V0AB 5FMOL 3B01A 3BTYA 2PHFA 3THDA 4OLLA 3PURA 4ES8A 4YSFA 5C33A 1PMJX 1CVNA 1X9TA 5APAA 5FZKA 5IJRA 4N53B 2GP3A 1CN1A 4OMDA 2BBVA 5CBLA 2ZHLA 3AP4A 5IHRA 1XB9A 2OKXA 1XOYA 1Q8QA 1UMHA 1UZYA 3FWEA 3R05A 3DPRA 1I5ZA 2OW4A 5I8YA 3QBQA 4A7YA 2JD9A 4JGYA 3JBG3 4L0PA 4LEJA 1EAH1 1XQNA 2X10A 1ENSA 4BWOA 1WMFA 1RUJ3 1UX7A 3GCXA 2DYCA 3NJVA 1JMUB 4Q4X3 1KDMA 4IV1B 1WBFA 3SH3A 4AQ6A 2ILMA 4GH4B 3U1XA 1CAVB 1GOFA 1DYOA 1OMIA 2GMEA 2Z42A 2B42B 2ZGPA 1XYPA 4LLOA 3FC0A 3VBHC 4AEDA 3VZJA 3NJYA 5ERLA 1LR5A 3WNLA 1NE6A 5C71A 3AK0A 5D8AC 3SKJE 2E63A 1W6OB 2RR11 3WZ1A 4GXLA 1O5UA 2YV8A 5JVVA 3PJQA 3B3QE 4XF9A 3LOBA 4LNVA 4MX3A 5C8CC 1HRI1 3H8UA 1R1A2 3BUCA 5A1FA 3EBRA 1B35B 1JHNA 3WV6A 3N7KA 1OOPA 1YJLA 1R091 2JIGA 4CPBD 1AYN1 1GP6A 5FV3A 4CEWB 2FDGA 2RS51 4CUCA 5IK8A 1AYM2 4B4QA 4YW5A 3ZN4A 3AXDA 4BLIA 2HWF3 1NA1C 4PJYA 5JOWA 1V70A 1Z7S1 2AYHA 5A7QA 2ZCWA 1H1IA 1DF0A 2AR6A 2BGCA 2RV9A 2WNOA 3GBGA 3KCYA 3RSJA 1YI7A 4O61A 4NPLA 5C70A 1Z0HA 2JDMA 2C26A 2IWGB 3ZFGB 2PTMA 2PAKA 5FKCA 4QU2A 2JDZA 3BALA 2FDKA 1ST8A 3A7QA 5F5AA 5FZIA 3VKNA 1APNA 1W04A 3JBG2 1NOVA 2W0XA 3B9IA 1Q8OA 1OA2A 3IMNA 1QF3A 4LHNA 1ASJ1 1IG0A 3OEAA 5J09A 4Y20A 4N9HA 3SC7X 5JZGC 4Q4X2 3FHQA 3BI3A 1FATA 5LRRA 1KS4A 4M0HA 3BODA 5LEKA 4CZSA 1ND2B 5J1XA 1QGLA 5DABA 4TZDA 2VZVA 1ALYA 2QJVA 4RGAA 1ODNA 1S4CA 1US3A 4XF3A 4Z8BA 4FPHA 1FX5A 2P5BA 2FDIA 2BNNA 4QXCA 1FAYA 2DCYA 3WY6A 5LATA 3WNXA 4GALA 1G86A 4CXWA 4B7EA 4XIOA 3N9NA 2ZBJA 4PLOA 4YFWA 5JOYA 1C8M1 2PHLA 5BV6A 1E5RA 1FPN1 1PK6A 1JBCA 1W8FA 2ERFA 2OXBA 3FLPA 3ILFA 2IXJA 4AG4A 1UZZA 4QX1A 4JC1A 5LZ6A 1JZ8A 4IEZA 1RUG3 3DCQA 2IFWA 3BB6A 4QB6A 4YGBA 5FYBA 3WVJA 1GQGA 5BNNC 5FYZA 5DUWA 2Y33A 1G8WA 1W0OA 1BK1A 2OIIA 2R1DA 5DQ0A 1YFXA 2CU5A 4BQYA 4A41A 4AGRA 4DRVA 3K48A 2ENRA 2R043 4GWMA 2GH8A 3M3QA 4QGMA 1V0AA 5C6CA 1QDOA 2WKKA 2XKPA 2ET1A 1DGRA 1CIYA 1W39A 4PLMA 4OZXA 1ZZ9A 3DUIA 2YFUA 1KJLA 2A3WA 2ZKLA 2QBXA 3FLTA 4IETA 5F37A 1OURA 1RUH1 2DVAA 3EJKA 3Q8FA 1RMU3 4YG3A 5BUVA 1S2EA 2YBKA 1W0PA 3DGTA 2WO3A 4Q1RA 3RZGA 2WNUC 4QKDA 5JI7A 4YW4A 3WNNA 3ZPOA 1JH5A 1OPOA 2G9GA 2ZACA 3VD3A 1RUI2 2IXIA 1W6QA 1UWWA 2VVDA 1EUUA 2P2KA 4XHXA 2LS6A 2QQVA 3ZXJA 5AVPA 3FHIB 2F4PA 2QQNA 1IZ3A 3AMPA 5A33A 1BK0A 2XLGA 1OQEA 4QX2A 4JQTA 2YU2A 5T5JA 3K46A 4AHZA 1PZ7A 3VD9A 2DURA 4X8PA 1V6LA 3OJBA 1RHI2 1ODMA 3JD72 4CEYC 5A6YA 1RUE3 5T55A 4AVSA 1SLIA 3AP9A 3KSCA 3WF2A 2F6BA 1OD5A 5FMDA 1DCSA 2LTNA 3WEZA 4EYUA 1MS9A 3CKHA 4N43B 3M1HA 4IL7A 5KHHA 5FOBB 3T4VA 1ZZCA 4INDA 1LOGA 3AFGA 1LODA 5FMOS 3W5NA 2FMYA 1YO8A 4P14A 3VBSB 1H1AA 1NX9A 4N43A 3RYPA 1YYNA 4NWVA 4IEVA 1N1TA 3H0OA 1QMJA 4E4ZA 4EV0A 3J26N 2B8MA 3AKSA 5DUXA 1AYM1 4COWA 5FTTC 2ATFA 3B93A 4EE2A 1ZRCA 1W2UA 2A6YA 2E7AA 2XG3A 4NWWA 2I2SA 1JYVA 2O14A 2I45A 1UIJA 5GZDA 5DZGA 1URXA 4Q4Y2 5JLVA 1O6UA 2JG9B 4RHV3 5FLHA 4ZU7A 1O4ZA 4XBLA 5A3PA 2WR9A 2RDSA 2OUJA 3VBRC 3WNMA 4JX0A 2WWUA 5IAXA 1F5JA 1VALA 3JBG1 4ET7A 1HQWA 1GZTA 4LIVA 3O1PA 2JG9A 1RUJ1 3A0NA 4KGGA 5E1RA 5FZ7A 3AMMA 1IS4A 4Q4X1 3I54A 3C7FA 3ZFFC 4UWDA 2JKXA 3LA7A 3O0WA 3AFKA 3PIJA 3TYJA 5JMOA 4RR3B 1RYYA 4DPNA 4LOTA 4XACA 1VR3A 4LOSA 1UN1A 3AL6A 1RUE2 1T6BX 1S0DA 3B69A 3KT4A 4H2AA 2VNVA 2JE9A 5KHJA 3RZJA 2G4IA 4W6XA 4XBNA 4CP0A 1MQTB 1H8VA 3HWJA 4FOWA 2NN8A 1J1TA 2WLPA 2MHFA 3P3NA 4LTAA 2JG8A 2V72A 3GZUC 4KQ7A 3HEIA 1HJFA 4R9AA 2UYAA 3MLKA 3J9SA 3I2FA 4ONUA 1MZ6A 1D4VB 2TUNA 1NXD1 5K9YA 1QU0A 1UOGA 3MLJA 4Z2AA 5DG2A 2ZJCA 1Q8PA 1J59A 3VZMA 5DAPA 5C3QA 2W95A 4IGQA 5JSRA 2ADDA 1S2KA 2VMEA 4XUNA 1SFPA 4D69A 1GKBA 1Q56A 3AC0A 4FPFA 1N3QA 2JDKA 4ZPIA 2QKDA 5AFEA 2HWF1 3MIDA 4BPZA 4CUBA 3PJYA 4LXLA 4ES9A 2D6OX 1VIWB 1AX1A 4KI5M 2BZDA 2O8QA 3DECA 1UY3A 4OUMA 4BDVB 3HNBM 3WG2A 1IPJA 1ZRRA 2CWSA 2YYOA 4AXOA 1JYIA 2PAEA 1P8JA 3H3LA 4XDQA 5FYVA 1QJU3 1GUIA 1JXNA 2A6WA 3IZOA 3U10A 4WM8A 2ORZA 1CESA 2VCBA 2ZZQA 3AP5A 1SBEA 4MSVA 2VOVA 2YC0A 4QPIA 5LA1A 1F8VA 3N9MA 1K5MA 3B5LB 4D0QA 1MVQA 2R063 4I3PA 1C1FA 4FFIA 4MZUA 1LESA 1ND3B 4Y22B 4CDUC 1IPSA 4NPRA 1NCRC 1BQPA 4N9IA 5LBBA 3TNPB 1NZIA 3PVBB 1NKGA 4EN0A 1XNAA 4FFHA 1YNAA 1ACCA 4AYUA 3H8OA 2XL7A 1Q43A 2O0OA 3ZXAC 4ISQA 5GALA 3WP5A 2CAUA 4Q0SA 2HWD2 1X36A 1HRV3 3ZXDA 2DCTA 2XJVA 4OZOA 5J48A 1PMIA 3ZN6A 4JDNA 3S57A 3HIFA 4HKWA 5JR7B 2BBAA 2CAVA 3O12A 3NNJA 1QXRA 4LHLA 3THPA 3EQEA 5AC93 2JWPA 2R0HA 3THCA 3VBHB 1RUG1 3AKPA 5E8AA 1OH3A 3P5BA 4C90A 5D8AB 2FMDA 4OQ8A 3DPRC 1DU3D 1OF3A 4QKNA 3FL7A 2P4EA 5FZCA 2R041 1AXYA 1NXMA 4LBJA 1GZWB 1LHUA 4JGYC 3AL5A 3P6BA 5C8CB 4PBPA 1CAUA 5CVRA 1YHFA 5EJ1B 3VDAA 1TMF3 5D8AA 2DTYA 5SV8A 5JCTA 1VRBA 5FPBA 5DAQA 3I97A 2NLRA 3NMBA 2H0BA 1HW5A 2C4XA 2IXKA 2J7MA 2QQIA 1YQ2A 1H30A 4MXWB 3ZFEA 4MGIE 3FFZA 1RMU1 2VCMA 4OYUA 2MEV3 2I07B 4XIKA 1VPHA 2VMDA 1EUTA 5IVCA 4AEDC 1VBB3 1L7LA 5FO7B 2K46A 2OPKA 4JDMA 2FZ1A 3D4KA 3FX3A 4NAOA 4IEOA 3MIFA 2GU9A 1NA1B 2BW8A 2SBAA 3M70A 5A7WB 2AZ5A 4YLZA 2HH9A 1XU1A 3MW4A 2BWAA 5F9TA 3ZYGA 2PA7A 4BLJA 1W9SA 5ISLA 2OPWA 1QOSA 2NMOA 5KC6A 1ZZ6A 2QTWB 3D82A 4TSVA 2IVIB 3ES4A 5FZ8A 3RFRA 1AR93 2YPDA 2WYSA 5I0TA 1FOD3 1HXS2 2D44A 2Q30A 3NV4A 4IXLA 5FY0A 1AXKA 3W21A 2J1SA 3WHUA 1O3QA 1YIFA 5FJKA 2VNGA 1OOPC 1BXHA 1VBC3 2AUYA 2EIBA 2P34A 4HETA 3JB8A 4JTOA 4NAMA 5F3GA 4AZZA 3U14A 3Q8CA 4RN5A 3LAGA 2X05A 3H7YA 1RUE1 5JZGB 3HJRA 1O4TA 3HAGA 2YG0A 4DEQA 1AZDA 2W9XA 1FMD3 2E7TA 4LKSA 4P9LA 1W8NA 3CZJA 3W20A 3JU9A 3GYDA 2A6XA 2LW8A 3MF9A 4YM0A 5HCAA 1RVF2 3O14A 3CBNA 4PI0A 2VJXA 1V6IA 3WDXA 3FMGA 5FWJA 2B9VA 2ARBA 4FI9A 3PUAA 4LUKA 3WDYA 1QY4A 3MGUA 4LBOA 1LCLA 1DGWA 1IGOA 3C3VA 3OYWB 3S7EA 3VBUB 1QJZA 1NLRA 5FPAA 1CJPA 3O0VA 4ITCA 1I9RA 4P5YA 1OA3A 1WCDJ 3C7OA 1W03A 5EXOA 1GU3A 2GC3A 4HVOA 3IPVA 3JQXA 2HKXA 1F4AA 5KXEA 4QQLA 2HJIA 4QDSA 4CCKA 5BNNB 5IVFA 1PGL2 2JIJA 1VBB2 4RHV1 1QNWA 4UFLA 4Y1UA 2A3XA 3USUB 4QX7A 5FLJA 4FOQA 2YHJA 2EALA 5A7OA 2VW2A 1JYXA 3VD5A 1DIWA 3CJXA 4QAWA 3OPTA 2PYTA 4FCAA 4LKEA 4R9DA 5FPUA 5FQ0B 3WINE 3WP3A 3BCWA 3O1TA 3T0BA 1S0IA 1PK6C 2CHHA 3ZXKA 4META 1VP6A 3C7HA 3JQWA 3WR0A 2WNUB 1XNTA 4DY3A 2DFCA 3NV2A 5FPXA 1H8TA 4KU8A 4AI1A 4HSJA 4A44A 5FZLA 2KD7A 3ZVXA 4B4PA 4OHYA 5IT6A 2HWD1 4BU2A 2PXJA 1D0GA 1MPXA 4DQAA 4PQ9A 2VH9A 1K5JA 2JE7A 2QZ2A 1Q3EA 1U0AA 2Z5WA 5CISA 5IK4A 4QPWA 5JOXA 1ZX5A 5C3OA 4Y4YA 1DQ6A 3BPSA 3LFMA 5E89A 5KXBA 2XVGA 4P9JA 2C0ZA 2A73B 3AXEA 4ATFA 1J1LA 4QX3A 1G6NA 2VR4A 4YW7A 5FLIA 2VUCA 4JKLA 3LEGA 5F3EA 1AL23 2ZEXA 3KGLA 2DBIA 4CEYB 1LULA 3MIHA 4XURA 3ZYJB 1ULDA 4XPVA 3AP7A 5DAXA 4G3YC 1XSRA 3PUSA 5EZWA 1UZWA 1X33A 5GZEA 1UYPA 3RI8A 4LK7A 1AYN3 5HPOA 2NYYA 4TTGA 4BQ4A 2E31A 1W6MB 3T1LA 3VUOA 5T5PA 5LCWL 2HEVF 3KHBA 1QJX3 3VDDA 2Q8CA 4H7MA 3MUZ1 4S2HA 2J1VA 3VKMA 2WABA 1QJU1 2VO5A 4GWJA 4QD2A 4Y33A 3LKJA 3ACFA 3ZDSA 1W9YA 3WT3A 4UFIA 2TNFA 3ZR6A 1RC6A 1JS9A 2R061 4YM3A 3OGRA 3WG3A 3BOWA 3I2DA 4XCAA 2V73A 5H9QA 4P5HA 2VL4A 3PL0A 3OY8A 3RS6A 1MZEA 2UY8A 2ZX3A 3POBA 3RDIA 4XAEA 1OF4A 1UX6A 5FUIA 4D7SA 2WS93 4NJ4A 4Q4W3 1CAXB 4YPJA 3KF5A 4XJAA 1PVXA 1A78A 4ORFA 3I3EA 4PIXA 5A7SA 3T2PA 3VBRB 3AP6A 3E97A 2P1BA 1HRV1 3UGFA 4BOWA 1Y3TA 1GMMA 3CIHA 3BN6A 2ZX1A 3M7AA 2OT7A 3POSA 2J22A 1VBA2 1DBNA 3I2IA 4XJ8A 3ZFFB 3ASIA 5AC91 1U5ZA 2D6PA 3AZZA 1V9U2 3T09A 2A5ZA 4AQSA 3NWKA 3TB0A 2Y26A 3ENRA 3KS7A 5HV0A 3E6CC 1RVF1 1CONA 4WVWA 3ACGA 2XB6C 3J7NA 4A6OA 3J7MA 4DB5A 4MADA 1XNBA 4XOGA 3RPQA 1IOAA 1UF2C 5DN2A 1LOBA 1CR7A 2XBO2 4CCEA 4R4ZA 5FZ9A 3CF6E 3O1OA 3JUUA 4IERA 1FV2A 3V0BB 5FAXA 4OHXA 1GANA 2ZX0A 1TMF1 3KMHA 2QQKA 2VW0A 1CZSA 4P9XA 3WX5A 1A6CA 3ITQA 1HB2A 4CCJA 3O1VA 2QQOA 1LJ7A 2ZGQA 4WM7A 3VKFC 5CADA 1PGL1 5J7MA 5EWSA 4LO7A 2ET7A 1VBB1 2XUMA 5IW0A 1J3QA 3ZSEA 4AWDA 1GOGA 4AQTA 3ZM8A 5EP9A 1W9FA 4KG0A 4MOAA 4CCDA 4Z1VA 1JZ5A 3N4MA 4BQXA 2E51A 5EYXA 2EXHA 2VMIA 3AYCA 3B94A 4HKLA 5FYHA 3ZLIA 1H6XA 3IDAA 2JG8C 1AR91 4JCKA 1SLCA 1FOD1 5CKQA 1DZTA 1A8DA 2WNVA 1OA4A 4GWIA 3ZKYA 1VBC1 2Z69A 4QXHA 2OZJA 5EJZB 4AK3A 4WVVA 4FPKA 3OBRA 3GZAA 3ZYFA 2UWAA 1ZZ8A 1JZ4A 1F4HA 5FR3A 2QUOA 1FMD1 5IK5A 4QHOA 1KITA 1M4WA 4UF0A 4CDUB 2CY6A 1LOFA 2XUEA 2VCCA 4LJHA 5E6HA 3VZOA 5K7PA 2QNKA 1NCRB 2ZGNA 4Q0UA 1COV3 5EYYA 1VBE3 1I5PA 2HWC2 2VXJA 3K51A 1UQXA 4DFSA 4GIQA 3QOPA 1ULPA 1W3VA 4XFGA 1VAKA 3I8TA 4WM8C 5F8PA 3POEA 3M3IA 2VMFA 4QPIC 3POGA 4Q4V2 2D3PA 1K5MC 1RJ7A 1NCQA 4AAPA 1R1A3 4MG2A 3LD8A 3RNSA 5LW9A 4YM2A 4BJ0A 4I0BA 4RYDA 1Q8SA 1WMXA 2D7FA 4E2GA 4N7UA 2VBBA 3KCXA 1DYPA 4OQ9A 1BHGA 4GB33 1MS4A 1GV9A 1E57A 1W06A 1FNZA 1H1MA 3TAYA 2Y6FA 5EHDA 3D0JA 1O3RA 3GXUA 3DPRB 2C9KA 4XFAA 2ZXQA 4GMP1 3H3ZA 1LEDA 5K0UA 4JGYB 4OI2A 1DGLA 1GBGA 2Q0AA 2EXJA 4HVQA 3SEPA 4AI8A 2XR4A 1I6XA 2OYZA 5L36A 4K6BA 5BPXA 1ZBA2 1S2BA 1QOOA 2ZHMA 1AR82 1ENRA 1XXNA 2YZ4A 4M00A 1JW6A 1LTEA 2A70A 3J8F2 4AEDB 4LK6A 3ETQA 3I2KA 1UMZA 1W9WA 4CDWC 2ZOEB 5A32A 4KBZA 1F2NA 4JAAA 2Y6KA 1PO13 1KFXL 1O59A 3CO2A 2BRTA 2ZEWA 5LBEA 4C0BA 3IDBB 1NQJA 3SITA 4S2FA 4DXRA 1UY4A 2WBKA 1COV2 2X53S 3MIEA 4CDXC 1VBE2 4Z2WA 1PGW2 3E5UA 2YDEA 3W59A 1Q8VA 5DUUA 3CZUA 3OEBA 3ALQA 1LHNA 1L3JA 3NKGA 4NR1A 3MV01 1OOPB 4QT6A 3E1F1 5FREA 3SXWA 2BERA 2J1RA 4DZGA 3ZFEC 4YW6A 4Q8KA 2GNMA 4OHVA 2XQXA 4GD4A 4ZU5A 3ACLA 3AKRA 3WDVA 1AL21 2WLQA 4YW1A 4YYOA 3MYXA 1E5HA 2EIEA 4XILA 1WMDA 1ZVFA 1ZREA 1CQ9A 1CD3G 2J1AA 4UFMA 3ZSJA 4GB32 1RIRA 1G9DA 1A3KA 3VHRA 1QJX1 4XBQA 4LQRA 1W0NA 2RJLA 3KLSA 4NHLA 4WBBA 4LBMA 2OX0A 2JE8A 1WZXA 1QXJA 2W3JA 3POFA 4TLGA 4XFIA 2W1QA 1JUHA 4AI0A 2L9LA 1RUC2 1UU4A 4FFFA 4BQ2A 4E4DX 3LFIA 4C0HA 2YGLA 1YIPA 1CAWA 4OI1A 4Y20B 5KXDA 2VZ3A 3K77A 1ZBE2 1ZRDA 1QH6A 1QJFA 2TEPA 4UBHA 1MZFA 5GZFA 3FFQA 2GN3A 2WS91 1W2TA 4K1YA 4Q4W1 3RJRA 3UGGA 4BQ5A 3AM2A 2JB4A 1S0FA 2VOWA 3CL1A 4IE0A 4XFHA 3RZHA 3WQ7A 1PO12 1RUI3 1R1ZA 1UKGA 1ZYBA 2EICA 4UAPA 2PMWB 1YEWA 2UWBA 2W1SA 5CG8A 1OD3A 2VBPA 2E9QA 3P3PA 4WV8A 3EMRA 1QXPA 2VMGA 3I7DA 2BWCA 3RWNA 1W9TA 4AW7A 5C3SA 4BMBA 1JODA 2WYFA 4M3CA 1PK6B 1LECA 3GJBA 5GKAC 2D3SA 5HV4A 1GNYA 2E7QA 2IZWA 2RG4A 3L2YA 2EVXA 4G4FA 1MZ5A 5EPAA 4BCUA 5IVBA 1RHI3 1WCSA 3JD73 2EIDA 5C3RA 2JXAA 4MXVA 4XMIA 2WWJA 1ZRFA 3POWA 5L73A 1MS0A 3OGSA 3RZLA 1UL9A 2PLV3 1KQRA 1YRZA 1XYNA 3UL2A 1EY2A 2HWB2 3N36A 4LO5B 4UFKA 1VB4A 4HBNA 4DUWA 3BVCA 2WQ4A 3MV11 4CP2A 1OXCA 2QVSB 4LE3A 4COZA 3H3UA 3O1SA 3H8XA 2XHNA 1AUYA 5JMCA 3N7MA 4QDRA 1K45A 1OFSA 1UPSA 3J7HA 4D6QA 5CFDA 1ULFA 5F6LB 2SLIA 3NNMA 4HXCA 2DCZA 1W6NA 3NO8A 1GWLA 4HMZA 1ZM1A 1AHSA 3CHXA 1H8TC 4K9SA 4FPCA 2GH2A 4GJYA 5LB6A 3K75B 4KG8A 3ZO0B 1UPIA 2NMNA 3H1YA 4YARA 1W6QB 3KD4A 5EV7A 1C4RA 3WNOA 2WO1A 4AFDA 1KXGA 2B9UA 4Q4Y3 4CTEA 1MACA 1D0HA 3OF1A 5CIRA 5A33B 1R64A 4CE8A 1OQDA 4AHWA 5L9RA 4BK5A 4M0NA 5FZDA 3J8F1 1WMEA 2QQJA 3R6SA 3HQRA 5C8WA 3Q9OA 1H4HA 4YZ4A 1YQ6A 4JKMA 1DYKA 1SHWB 4HOOA 1X9PA 2RMU2 4EROA 5FRAA 3U4XA 1K42A 1COV1 4GWNA 4BZ4A 4CDQA 4Q27A 3BKZA 2WC2A 4M4PA 1GNZA 1VBE1 1JTZX 3AKTA 4NN0A 5A1AA 2E26A 2HBTA 3PDQA 4BQWA 2FBEA 3G7DA 1RTVA 4V2WA 3VDDC 4XDPA 2WRAA 3BU7A 3VHOA 1LRHA 5JPMB 3PIGA 5FO8B 2GAUA 1YJKA 1HIXA 2PLV2 2NQYA 2XMLA 5ANQA 3SCFA 1J84A 2XH6A 4IGPA 4UW4A 5BXXA 2H0VA 3WCRA 4GAZA 5CU1A 1HJGA 1GWKA 1QQP2 1R1A1 1W8TA 2GC0A 2BDRA 4M01A 3ZYRA 2XPJA 3OCPA 2P3JA 3I49A 2DVFA 4N8MA 3V65A 1RGSA 2BPA2 4O7XA 3TN92 3H9AA 1G9CA 2WUHA 2JDNA 5CEHA 4NVPA 3ES1A 4GB31 3TRSB 1D2SA 3OGJA 2VZOA 2ZGKA 2QFEA 1YI9A 4Q1PA 3S6PA 4W8JA 1BBT2 2IVJA 2XJUA 1TG7A 1GICA 2EAAA 3F2ZA 2IXHA 4HZFA 2V4VA 2V5DA 2UWCA 3SKVA 3VB9A 5KBFA 5KHIA 3CEWA 4QQ2A 5CKNA 3DKWA 5FZFA 4FBFA 2PAMA 4OCTA 2VZTA 3AYDA 2D3RA 4WZCA 5FO9B 1CPMA 2WT2A 1JYWA 1AR72 1EPZA 4JKKA 4K8FA 4NOTA 4FFGA 5DXDA 3E5QA 4PLNA 1X82A 3WCSA 2W68A 2DUPA 4BB3A 4D94A 1W3XA 2F4LA 4XE9A 2DWRA 4LBQD 4U36A 4NO4A 1I1EA 1S0BA 2Q8OA 3VKLA 1XPWA 4LULA 4CCLA 3VBFC 5HCFA 2AACA 4ASMB 3F95A 1PO11 4AHXA 3LDKA 4AEMA 4AOCA 2VMHA 4QDQA 4MHRA 3B00A 2YMZA 2HWE3 2JDAA 3VLBB 1SG3A 5FYYA 3I2JA 3KV5A 4ZONA 3WF3A 1CIWA 2JG8B 1JZ7A 1NQDA 1GYKA 2DTWA 4UYBA 3BOPA 1MEC2 4JTNA 1ZRIA 2OVUA 2HWD3 2VECA 4XDOA 2JJ6A 1YXWA 5CAZA 4UW3A 2BEOA 1H0BA 2VVFA 1JUIA 2WJSA 1OQ1A 4FPEA 4WM7C 5GJ6A 5LK5A 1UY2A 2GC1A 3ZSLA 1RUD2 4RA0A 4RFRB 2D97A 4LBQA 5FZOA 4COUA 2VC9A 4DUXA 3C7GA 1GP5A 3UETA 1XE7A 3ZXLA 4EN6B 3LA3A 4CCMA 4XUPA 4L8QA 4MVTA 1LOAA 2ZABA 2WNVC 4UXAA 4WM8B 4IV3A 5JI9A 1REFA 4QPIB 4XQWA 4A7ZA 1K5MB 3QH6A 1LOEA 1V00A 5A6QA 3R4SA 3U78A 2ZEYA 2YFZA 1STMA 3AX4A 1PVC3 5FUPA 2XGXA 1L7QA 2DDUA 4XXAA 3VV1A 4A3ZA 5L7OC 1LOFC 4JGZA 5FZBA 4R9CA 1GNHA 4Y1ZA 2ZX4A 2GP5A 1HQLA 1GR3A 4JQRA 1UMIA 3ZR5A 4URAA 1BMV2 4IUGA 1UZVA 1X50A 1WCQA 1YWKA 4U2AA 1D7PM 1RUI1 1WUVA 4L92A 4XXPA 3H50A 2AH2A 3MPBA 3UV9A 2HWE2 1D4M2 2GDFA 3APBA 3H42B 2HLEA 5FUNA 5F3IA 3EXUA 2ZAAA 3AMNA 4ASLA 3ZN6B 1LHWA 1NCQC 1DP0A 5FZAA 2QQMA 1HXS3 2I74A 3SEEA 2PFWA 5TSWA 1XE0A 3ZSKA 5T5LA 2WFF3 2JD4A 2WZR2 4FP2A 2J1TA 4KGQA 3KCCA 4R8HA 2GSYA 3B9CA 1RHI1 4YVSC 3VZLA 2WO7A 3JD71 3CMGA 4NROA 3OOXA 2K0GA 5A3WA 1LU1A 4C8DA 5BNQA 2VNOA 2PLV1 1YQ8A 1U5XA 5T52A 2RM22 5B4XA 5K0UC 1VLNA 4CDXB 4CDWA 1IS6A 1KFUL 2A6VA 1R082 1RVF3 2B4KA 1CAUB 2YC4A 3LOIA 4KH9A 3C8XA 4MH0E 2NM1A 1HQNA 1OC1A 3I4IA 2FDJA 4QKBA 4I09A 2RDRA 4HVRA 1UY1A 5DZFA 3ZFEB 5KHGA 5EJ3A 4ZHNA 2BFUL 3MEPA 1C3HA 5FZMA 4CDXA 3PU3A 4EWEA 1K3IA 1LHOA 3HVDA 2P3KA 4HPKA 5H9SA 5B2GB 2G19A 1UY0A 2CTVA 1KEXA 2Y34A 3N7JA 4FPJA 5I0RA 3AJYA 4SLIA 1OI6A 5T50A 1PVC2 2VCAA 4CU9A 2D5HA 5CFCA 3ZXFA 2BOIA 1G9FA 3N3HA 4HG6B 5IUQA 2FCTA 1SEFA 1DLCA 1HV1A 3A0KA 3S30A 5BNOA 4Q4Y1 5IVJA 1OH4A 3KV6A 2ARAA 3NNFA 3OUHA 3OBTA 3OPZA 4A3XA 3BGAA 3QD6A 4KBBA 2WN3A 4N53C 3WHTA 4IEUA 2Y60A 4FPOB 1LENA 3ZPYA 4LT5A 4ATEA 4JVAA 2QQLA 5A3OA 2LM3A 2W1UA 3AZYA 3NSTA 1SQ4A 1JZ6A 2YBSA 1OLRA 4IEYA 2WFF2 2X29A 4P9IA 4I01A 1SBDA 3MF6A 4FTEA 4W6YA 2X09A 3POIA 5GLWA 1XNKA 2XHKA 1WA4A 4D6SA 4FAHA 2VTFA 1DQ2A 4B29A 4AE2A 1XJAA 1XSQA 2GNTA 2AEZA 3O5SA 1UO9A 1W6PA 3BPZA 1PHMA 4FSJA 2VQTA 2DVDA 1SLLA 1Y7BA 4YM1A 2GNDA 2K2SA 3MW3A 1F15A 2ZX2A 1QJEA 4FXGB 5J96B 2LALA 4COVA 1PO22 1QIQA 4LR4A 4XQ4A 2WSUA 4JV4A 4KWKA 3DF0A 4KWUA 4PHZA 5FJHA 3JXSA 3I3MA 1U5IA 2R0FA 3LF7A 3PTYA 3WD5A 5C9AA 1SZBA 5EFUA 1ZZ7A 4RS5A 4QPYA 1CPNA 1YFWA 1N1SA 2NZ9A 2Z79A 3GHMA 3IPVB 5FYCA 5LY2A 3UYJA 5IFPA 5FY4A 1ZA4A 2AENA 4LO6B 3VHPA 1DGRN 2Q4SA 3S0MA 1QJY2 4XW3A 4GA9A 3VD4A 4JHZA 2JX9A 4P02B 4K40A 3TEXA 1RUF2 3AB0A 3MFAA 3BIEA 1XBFA 5KXCA 3WP4A 4Z07A 2ZGTA 5T5OA 5GZGA 3ZN5A 4NHKA 1W28A 1N1YA 2XLAA 5JIUA 2WL1A 4NIAA 3ZMNA 1IG3A 1HN1A 3GHNA 5B4NA 1EPWA 4K3UA 3GF6A 1BLZA 1US2A 2DUOA 1SLBA 3E6BA 3O1MA 4NIHA 3VL9A 1QOTA 2AGSA 2Z2SB 4XABA 4IE5A 4P00B 2G1MA 2D40A 1LU2A 1WW6A 4GMP3 4KU7A 3T0DA 4P9YA 1V6JA 5IATA 3NAPA 3LEMA 4AFMA 2VTXA 4YNIA 3ZMOA 4LE4A 2J42A 3N9LA 2OUHA 1BMV1 3ZX7A 3ZYBA 1H8TB 2GNBA 3C7EA 2BVBA 1LGNA 1UCXA 2Y6HA 2E6VA 4RD7A 3WF4A 1NLQA 5JXIA 1PM7A 2HWE1 3D3AA 3SH5A 5FY7A 1AVBA 1FXZA 2X5IA 4FOVA 4COYA 4EN7B 5A6XA 3WQBA 1DHKB 3I2GA 2WZR1 3VBOA 4CCNA 2IXCA 2Y8KA 5F2SA 2BYVE 5IAVA 3WLUA 1KRIA 1UD1A 4H14A 5CFDC 4K20A 1PNGA 4RL7A 3OGGA 2RS32 4OI0A 3DYPA 4M3CE 1VBA3 2IFRA 1PM4A 3MDPA 4GJZA 5LBFA 5ACA3 1EV12 3O7OA 3KM5A 1V9U3 1LHVA 1DGWX 1V6KA 2PHWA 5M0TA 2EA7A 2RJKA 3RJ2X 2ZEZA 1N3OA 4IQPA 4L99A 4HK9A 2B7YA 2E53A 3VDDB 3ZYHA 2ZGRA 4XFFA 1Y43B 2LROA 2FQPA 3IIAA 3SNMA 2ZGLA 4F83A 3AYEA 3AKQA 4Y5Z0 1UXXX 2XBO3 1O8SA 3ECQA 1O91A 5LBCA 5DDJ3 2VPVA 4L97A 2XJRA 3FBYA 3ELNA 2BOJA 4N7IA 3A23A 3H1WA 3UK9A 3WW2A 5FY5A 1LEMA 2GN7A 2YXSA 2ES3A 4E8CA 4YZ2A 4HKOA 3SCGA 4DS0A 1WD4A 2IXLA 4C1XA 3FE5A 3MW2A 4HSLA 1PVC1 3OY8B 5I8TA 1GWMA 2WDBA 2W46A 2V4AA 2WZEA 3M3CA 4O9GA 3U07A 4RGGA 4AQ2A 4K1ZA 1HB3A 2Z4FA 4LITA 4LBNA 1EYBA 4LA3A 4CDQC 4YZ5A 5FPZA 2FHRA 4QXKA 4BIFA 4O9EA 3H8RA 2P17A 2UURA 1DLLA 1S0JA 2YC2A 1YQCA 1O3SA 4NIDA 3LIHA 1NY72 1U12A 3CU7A 3HPNA 2Y6LA 3X29B 4PQQA 1AJOA 1TNFA 2ZS6B 1HXS1 1L7RA 3WG4A 3T2OA 4YVWA 4XF4A 2WFF1 2W94A 1HB4A 3KB5A 4QGLA 4LKFA 2ETEA 3RMYA 4XVHA 2VW1A 1LB2A 2ARCA 1S0EA 4YW3A 1O3TA 2Y6JA 3T3YA 1VRH3 2DU0A 5CNAA 3RI9A 4CU8A 4AAXA 1RUOA 5ACA2 2GALA 5IYYA 3M4FA 5SV5A 3A22A 1PIV3 2BFUS 4GQ7A 1W99A 2H6BA 1XNDA 3CJIA 3ROUA 3PUHA 3LCPA 2HWC3 3VGIA 3VBFA 1QKQA 3HNYM 4CP9A 3NJZA 2WIIB 1HDKA 5F3CA 3D6EA 5E16A 1RITA 3THTA 3UKNA 5L7OA 5DDJ2 1I3HA 1SFNA 5LEJA 2P3YA 5JAXA 5JWPA 4WM7B 4Q4V3 4D7YA 2WT0A 4Y4RA 4Q2FA 4BK4A 5F6KA 1IKPA 1IQAA 2A1XA 4DXZA 3T2TA 5FCCA 3VD7A 1HB1A 2RR12 3MLLA 3PMEA 3UKVA 4Y1YA 3DEMA 3FJSA 3OGVA 4FPGA 3LE0A 4E4SA 1PZ9A 2YU1A 4YRDA 3UKTA 1VJ2A 1R092 5C5TA 3ZIXA 2W92A 2WNVB 4XUTA 3S5QA 3MIBA 5FMCA 2JEMA 2RS52 5GM0A 1QHDA 4C1WA 4A4AA 2XJSA 2Q5TA 2W1WA 4WZFA 3J4UH 5CB7A 2FDFA 3JB4C 2R073 1SPPA 1ZBA3 1Z7S2 3HBZA 4IEQA 4LUMA 1AR83 4UF0B 4DRRA 3WF1A 5L7OB 1LOCA 2RVAA 1LAJA 1AXZA 4BYYA 1W05A 1GQHA 2R16A 5KWRA 3J8F3 1FV3A 1DQ1A 3NKTA 3WQ0A 4W50A 1IS5A 4QU1A 1SDWA 1YQ5A 4H7LA 2D93A 1VRH2 1ENXA 3CNAA 4R4XA 4QPGA 4Z82A 2D98A 2ZHKA 3UESA 1PIV2 4IV3C 1TME2 2PHRA 1ASJ2 1GFF2 5F5QA 2UY9A 5L9BA 3SISA 1NCQB 3RG0A 4YWAA 2XQRA 2XWJB 1PX3A 2QCSB 2WZ8A 3LEIA 1JYNA 1UXZA 2G9ZA 3B02A 3IT8A 1EV11 5GZCA 2P6HA 2WN2A 1SMVA 2ZAHA 3PUQA 1H9PA 4JGZC 4TLFA 4GMP0 4QHZA 5FXWA 4AEKA 3WW4A 4ARYA 4MGYE 5DPNA 4NRPA 3W9AA 3AVSA 2WINB 3AMHA 3HN1A 5LY1A 1WBLA 4CCCA 2HBUA 5FDBA 2IUWA 2WAOA 5C4WA 1U5YA 5KHKA 4MGZE 2QQUA 2Y0IA 1WLWA 5K0UB 4S2DA 4YVSA 2YB7A 4AFBA 1RB8G 1OPMA 2LRPA 3K4ZA 5A3NA 2FDHA 1FPN2 1ZZBA 2YROA 3BTAA 3OD4A 1PGSA 3N9PA 4LIUA 4FXKB 4XTMA 4BXFA 3I2OA 3IDCB 4PBOA 4BISA 4K8RB 1SLAA 1CX4A 5LWBA 5I0SA 1RUC3 1CWPA 3POJA 3BYWA 1LGCA 1RXGA 1C1LA 4IDZA 3BTZA 1HV0A 4PDWA 4R52A 4B1LA 1JZ3A 3OPWA 4F8AA 2R072 2R1BA 1LGBA 2B5HA 4XQDA 5A32B 2FCVA 3DXTA 3OUIA 3PUIA 4UFHA 1ZBE3 3ST7A 5CG9A 2QDNA 3OG2A 3AZVA 4K21A 1NY71 2VUAA 4MGKE 4RQPC 2CGNA 4XZUG 1VB2A 1FNYA 2YBPA 3LB9A 5C5UA 5JSPA 3RZZA 5J37A 5BNPA 3SQOA 4KWJA 3QACA 4X8NA 1ND3C 1RUH2 4QM9A 4XJ9A 3WDTA 5CKMA 1WCKA 3KQRA 3V0AA 1Y4WA 3T2QA 1EP0A 2ZGSA 1OLQA 4LA2A 2XLFA 4A45A 1VBA1 1WD3A 5FZ6A 4N53A 5ACA1 5G05L 4CUAA 3T30A 5BY5A 2D6LX 3K4AA 1V9U1 5CFCC 5LRSA 3DKQA 2ZKNA 3ACIA 2WQZC 3FUQA 2ZTNA 5DAVA 2PQSA 5BNOC 2DVGA 1H2LA 5IWFA 4BIOA 1SLTA 1MS1A 5DMYA 5ANNA 2XBO1 2W2IA 1XYOA 5EQUA 5FYTA 2PHXA 5DDJ1 4DMIA 4OI4A 2BUKA 5FYMA 4AI9A 3MBWA 2HWB3 4I2OA 4JRLA 4NIIA 4IV1A 1CAWB 4MLOA 5LA9A 3ZXEA 4DXTA 4UBGA 4UOJA 4D3WA 1GZCA 4GH4A 1CAVA 4UW6A 3VKOA 5F5IA 3A4UA 1TEIA 1VAMA 4CA9A 5A3MA 2VQ0A 2V09A 2QQPA 3DYMA 4NPMA 2Y38A 2ZMNA 2ZZJA 1W6OA 4EN9B 3V64A 2PN5A 1C28A 5FWEA 2MNGA 4DINB 1A8MA 1OKOA 1OLME 4Y5TA 5FY8A 4QQOA 3IN9A 5FK8A 1UU6A 1Y9GA 4CVUA 3GDBA 1B35A 1YC61 2CYFA 1JU4A 4TN7A 4WVMB 2WO2A 5J36A 4FTSA 2VUJA 5C9AC 1FI2A 1CJDA 4M3CB 1KGYA 4CEWA 1QWRA 4RS5C 5FP4A 2Q8EA 3UJQA 1AX0A 2N7GA 1RUNA 1WCUA 2W52A 3GCWA 2ARXA 4JHTA 4QGNA 4WVMA 4FOYA 1XU2A 1VBD3 1VRH1 1WGPA 3LGRA 1JU3A 2OS2A 3WNKA 4YZ3A 5JR2A 2RMU3 5HCBA 2W47A 3UJOA 1PIV1 3WUCA 4DOUA 1TME1 1CZVA 1F35A 1RUJ2 1ULCA 3H7JA 4ZU4A 3R4UA 4HONA 2HWC1 4IEPA 3ZFGA 5I0UA 4CPBA 1GZ9A 4DXSA 1CX1A 2WA3A 3L9JT 1H4GA 5JXGA 4EWDA 4QKFA 4V1PA 3QLQA 1LKNA 3LDBA 3CLPA 1H2NA 4Q4V1 2OZ6A 3OUJA 5CFDB 2RS13 3NAPC 2RDQA 1YFYA 1QQP3 1X8EA 1KDKA 1MS5A 1UYZA 1WLDA 2VAUA 3I59B 4AHYA 5H9PA 1W6NB 3FBMA 2RDNA 2R49A 4LO4B 2W08A 3Q8BA 3TN93 4B1MA 3GALA 5JDBA 1ZA7A 1ND2A 1UOJA 1XC6A 3NV3A 1TZOA 1PMHX 1WW7A 4I0AA 4HN0A 4JDOA 4PF1A 1JYCA 3VBUC 5IVVA 2CDOA 2OQ7A 5KR7A 2X5IC 3I59A 1BBT3 2GMMA 2BU9A 2JDPA 4DY5A 4IE6A 4ZKTB 2XOMA 1O5LA 2H6CA 5I8SA 4P9GA 3VBOC 4ARXA 3I3DA 1OVPA 5GLUA 5D21A 2VMCA 2O1QA 2XL9A 2Q1ZB 1D2QA 4J25A 5IFTA 5JUVA 1GP4A 1WA6X 1HLCA 4CU7A 1DG6A 3WSOA 2Y64A 1AX2A 1AR73 2HWF2 4XMAA 2R071 4TXWA 1IHMA 1ZBA1 4FQZA
chains in the Genus database with same CATH topology
4CYDA 5I91A 2XKOA 1AR81 1WW5A 4URTA 4CDQB 1NG0A 1VBD2 1ONAA 3SH4A 2C5DA 1V6OA 1OSGA 3W58A 3TWIA 1DQ5A 5J3UA 4Q26A 1PGW1 2VGDA 4X6QB 4HK8A 4OVEA 1S1AA 3AZXA 4E2QA 1JN2P 1FYUA 1MEC3 3KGZA 4WVZA 4XEZA 5FFOC 4HL0A 4FAGA 3NVCA 1AF9A 1HKDA 2RS12 2YY1A 1KJRA 4OFGA 2G9FA 1S0GA 1Q5OA 1RUD3 1TE1B 1MVEA 4LBLA 4AI2A 4GULA 1XRUA 1QH7A 1AR63 1UKRA 1DQ4A 2GMPA 3WDUA 4AI3A 3HT1A 5ABJC 3DV8A 4YVWC 2XJPA 3GBFA 4HFSA 4AEJA 1S55A 4IEWA 2DVBA 1RUG2 1RUC1 2ZMLA 3R0RA 1C8NA 5I93A 1G9BA 3U0ZA 3WOGA 2ZA9A 3EHKA 3SCHA 1AL0G 2R042 1ZBE1 5GLZA 3ZIWA 1VAVA 1G7YA 1BCXA 3WP6A 3WQ1A 3CJIC 4A7KA 2ZGMA 3VBSA 2TBVA 2CL2A 2W39A 2ZGOA 2D6MA 2PHTA 1RMU2 3KT1A 1REDA 4RFT0 3RYKA 1AJKA 1D4M3 3ME2A 3MZHA 1V6NA 5DG1A 4KWLA 3ATGA 1NZCA 1SFYA 1UAIA 3HD8B 3U11A 2JKBA 4LLFA 2WZR3 3WUDA 1PZ8A 1YCIA 4LBQB 3SLIA 4AVVA 2V5YA 5JSOA 1GLHA 4Q0VA 1BJQA 1FT9A 3PVNA 2D6KA 5J98B 4RSUA 1J58A 2AREA 4N90A 3LA2A 4IV3B 1NE4A 2RM23 4X6RB 4MUVA 3RQ0A 2HWB1 2CWMA 1AR62 1R083 3D5OA 2OA2A 4L9BA 2VNRA 3LZZA 1IPKA 3URFA 1DQ0A 4NHMA 5F1RA 2DCJA 4RR3A 2QE3A 4JGZB 3FLRA 4QX5A 1YLLA 3OD0A 4XTPA 2R32A 5GLVA 3MIGA 4HANA 4B3NA 1MQTA 5CA6A 1DZRA 4FO9A 2QDRA 3NV1A 3MI8A 4QPGC 2VXRA 1N47A 2D6NA 2B39A 4P9WA 3IDEA 1O7FA 2JECA 2VG9A 1F31A 4OHWA 4C91A 4FTBA 2DCKA 1MS8A 1QDCA 1J3PA 1YFUA 2HEWF 3PLQA 4RHV2 4YW2A 3HQXA 1G9AA 1S0CA 2BQPA 3TOJA 5JOZA 1VBD1 1H2KA 3INAA 5E88A 1QNYA 2A75A 1C5IA 5C4WC 2RMU1 4BA6A 2PELA 4ZXKA 4RQPB 3FUOA 3M2MA 4CDWB 3T1MA 4HLTA 4YG0A 3AJZA 4MYEA 3GZTB 2CV6A 1BKZA 3PNAA 4RQPA 2EXIA 4XETA 1PO23 2RS11 1QQP1 4HPKB 4PDWC 1KS5A 3WW1A 3TBDA 1ND3A 1O4YA 4Y22A 3ZSMA 3TN91 1RL3A 5CFCB 3AYAA 2BNOA 3NW4A 1IKQA 3MICA 2B45X 5BNOB 4YG6A 1NYWA 1QJY3 1TQ5A 4E27A 4J1XA 4F7ZA 1BBT1 1MS3A 3HT2A 1RUF3 5BNPC 4H55A 4D7TA 4YGEA 1POV3 4OHZA 1XE8A 1BZWA 2XWBB 1PNFA 3VZKA 1KD7A 4Y26A 1AR71 3JCIA 3DN7A 3ILRA 4B7KA 1N3PA 4HT1T 3VBHA 4AVCA 4LBKA 4JRAA 3O0XA 2WSVA 3L2HA 4B8EA 4HN1A 1QJU2 4M3CF 4XFBA 4QQPA 1W6PB 2KA3A 1GZWA 3HMYA 2VY0A 1YUDA 4SBVA 5C8CA 3KZ4C 5AVAA 2R062 2YPJA 3G6JB 5T3NA 2LUWA 1BEV3 4GKYA 1Z78A 4IV1C 2KM2A 2P37A 2WNEA 4MXWA 4GH4C 5C9AB 1MEC1 4Q29A 4RS5B 2EAKA 1DZQA 1BVVA 3RYRA 4BQ1A 1WLTA 1NA1A 1RUD1 2RS33 2WFPA 4J6GA 2NP0A 3VHNA 2Y0OA 3ZYIB 1EV13 1HRV2 3VN4A 5K8SA 1X7NA 3WXPA 4XF0A 3QH7A 4PIZA 4AGVA 1M06G 1AR61 2GC2A 2DFBA 4E2SA 4YGDA 1B35C 2BTVC 1OKQA 3DL3A 2IC1A 5AC92 3RMXA 4AGGA 3D0SA 4AVBA 4FQ4A 4CEWC 5DZEA 4I3GA 4L11A 3NAPB 5JZGA 4XZPA 4AFAA 1UU5A 2CNAA 3D8CA 3HR9A 1ENQA 4S2GA 5JIAA 1SCSA 3PMSA 4I30A 3AMQA 1TMF2 3E5XA 2X5IB 1OHFA 3ZFGC 2CGOA 5AFBA 4QMAA 3RRDA 3VBOB 2D43A 2A7AA 2VQAA 3OYWA 2MEV2 1D4M1 3VBUA 5JPNB 4OULA 1BEV2 4XJZA 2UU8A 2RHPA 1F9KA 3MPPG 1UW8A 3OTFA 3PVOA 3N7LA 2ZMKA 1WLCA 2WA4A 2RE9A 2EIGA 4FVVA 4PIYA 3V56A 5BNNA 1J3RA 1ND2C 4EJRA 4XF1A 1DDLA 1NLSA 1AR92 3USUA 4FPYA 1FOD2 2R30A 4QM8A 2CGPA 2YGMA 5D1IA 1HX6A 1VBC2 2Q1MA 3B7MA 1ULEA 1EAH3 2RM21 5FQ0A 1R081 2DF7A 2XJTA 4KL1A 1FMD2 2WWSA 4A2UA 1OFNA 3VZNA 1C5HA 2WNUA 2BNMA 4Y1XA 3QCWA 3LWCA 3WW3A 4AFCA 1N1VA 1H2MA 1T6GC 4YGCA 1WW4A 2KXLA 2RR13 2D5FA 3N35A 4J1WA 4Y1VA 2HYKA 4XHBA 5KC5A 2A6ZA 1TNRA 4IEXA 1HRI3 2JICA 5DUVA 4AF9A 2VOXA 4TYSA 2YUEA 3WDWA 5ABJB 4W6WA 4YVWB 1R093 1ULGA 3H1MA 3IBMA 5FOJB 4FT8A 3USSA 2C9AA 2WZPP 2RS53 2B46X 4CEYA 4Z92B 1SBFA 3PVEA 2ZGUA 5ABJA 3WG1A 5GLTA 4BMEA 5HXVA 2MPFA 4B4RA 1Z7S3 2BVVA 2EF6A 4ISRA 2HEYF 3IKWA 5T54A 4Y24A 4QQHA 1W6MA 3LSDA 3SHRA 1RJ8A 3CJIB 2ZHNA 4XYXA 4L2NA 3VBFB 2NPIA 4QHBA 5L19A 2DV9A 4TWTA 4LO8A 4XFCA 4OUSA 1EAH2 2VVEA 2P3IA 4YZ1A 1TME3 3ILNA 1ASJ3 1PO21 1POV0 2A71A 1V6MA 2DU1A 4BE3A 2GZWA 2O8OA 2PQQA 4N43C 4PCRA 2DUQA 1CAXA 1IS3A 1QJY1 3NL1A 1X8MA 3VBRA 1RUF1 3R4DB 4KNCA 3VBSC 4Q0QA 4FP3A 3FZ3A 1POV1 1HRI2 4CP1A 4CRQA 1H9WA 3BIWE 1AL22 3TNQA 1C8M3 1FPN3 3ZFFA 1AYN2 1MR5A 3IM0A 3LSEA 4Q0PA 4EN8B 4K7JA 3ZYPA 2PHDA 3C2UA 4Q8LA 4LHKA 2JG9C 1QJX2 2FZ2A 4MV2A 5BYNA 4PF5A 4I02A 3IWZA 2XJQA 1RINA 4QPGB 4UW5A 3V0BA 2MEV1 4G9SB 2WT1A 1BVP1 1BEV1 2R6QA 1Y9QA 5LK7B 5H9RA 1XNCA 3VL8A 1B09A 4W65A 1RUH3 3EO6A 4RR3C 2JENA 2VULA 3MFCA 4YFZA 1JOJA 3JZVA 3M3EA 4R9BA 2WS92 4Q4W2 4BM8A 4DNYA 1SACA 2XVKA 2RS31 4XJUA 4GKXA 3GBWA 3PHMA 3GNEA 5HBAA 1MQTC 5C4WB 5IK7A 4AVTA 4IESA 3AZWA 4YVSB 1BYHA 1UIKA 3S7IA 2ZPXA 4FPLA 2EXKA 2PHUA 2K9ZA 2XVLA 3E6DA 4BHPA 1F5FA 2VU9A 1DFQA 1CGPA 2C1FA 1C8M2 1REEA 4PDWB 4F3JA 2A3YA 4CDUA 4H3WA 1C57A 2X8KA 1GSLA 2QZ3A 1NCRA 4E9KA 3M8LA 2VOKA 5BNPB 4I0WB 4XJWA 5FBZA 1ZNPA 5HI0A 1SCRA 3ZXGA 2UYBA 1AYM3 3M3OA 3KT7A 3SMHA 3POYA 3V0AB 5FMOL 3B01A 2PHFA 4OLLA 4ES8A 4YSFA 5C33A 1CVNA 4N53B 1CN1A 2BBVA 5CBLA 2ZHLA 3AP4A 1Q8QA 1UZYA 3FWEA 3R05A 3DPRA 1I5ZA 2OW4A 5I8YA 3QBQA 4A7YA 4JGYA 3JBG3 4LEJA 1EAH1 1XQNA 1ENSA 4BWOA 1WMFA 1RUJ3 2DYCA 4Q4X3 1KDMA 4IV1B 1WBFA 3SH3A 4AQ6A 2ILMA 4GH4B 1CAVB 1OMIA 2GMEA 4LLOA 2Z42A 2B42B 2ZGPA 1XYPA 3FC0A 3VBHC 4AEDA 3VZJA 1LR5A 1NE6A 3AK0A 5D8AC 2E63A 1W6OB 2RR11 3WZ1A 4GXLA 1O5UA 2YV8A 5JVVA 3PJQA 3B3QE 4XF9A 3LOBA 4LNVA 4MX3A 5C8CC 1HRI1 3H8UA 1R1A2 3EBRA 1B35B 1JHNA 3WV6A 3N7KA 1OOPA 1YJLA 1R091 1AYN1 4CEWB 2RS51 5IK8A 1AYM2 4B4QA 4YW5A 3ZN4A 3AXDA 4BLIA 2HWF3 1NA1C 4PJYA 5JOWA 1V70A 1Z7S1 2AYHA 2ZCWA 1H1IA 1DF0A 2AR6A 2BGCA 3GBGA 3KCYA 3RSJA 1YI7A 1Z0HA 2IWGB 3ZFGB 2PTMA 2PAKA 4QU2A 2JDZA 3BALA 3VKNA 1APNA 3JBG2 1NOVA 2W0XA 3B9IA 1Q8OA 1OA2A 3IMNA 1QF3A 4LHNA 1ASJ1 5J09A 4Y20A 4N9HA 5JZGC 4Q4X2 1FATA 5LRRA 1KS4A 4M0HA 3BODA 5LEKA 4CZSA 1ND2B 4TZDA 1QGLA 1ALYA 2QJVA 4RGAA 4XF3A 4Z8BA 4FPHA 1FX5A 2BNNA 1FAYA 2DCYA 3WY6A 3WNXA 4GALA 1G86A 4B7EA 4XIOA 2ZBJA 4PLOA 4YFWA 5JOYA 1C8M1 2PHLA 5BV6A 1FPN1 1PK6A 1JBCA 2ERFA 3FLPA 3ILFA 2IXJA 4AG4A 1UZZA 4JC1A 4IEZA 1RUG3 4YGBA 2IFWA 3BB6A 5BNNC 3WVJA 1GQGA 5DUWA 1G8WA 1W0OA 1BK1A 2OIIA 2R1DA 1YFXA 4AGRA 3K48A 2ENRA 2R043 4GWMA 2GH8A 3M3QA 4QGMA 5C6CA 1QDOA 2WKKA 2XKPA 2ET1A 1DGRA 1W39A 4PLMA 4OZXA 1ZZ9A 3DUIA 4IETA 1KJLA 2A3WA 2ZKLA 3FLTA 1RUH1 2DVAA 3EJKA 4YG3A 1RMU3 5BUVA 1W0PA 3DGTA 4Q1RA 2WNUC 5JI7A 4YW4A 1JH5A 1OPOA 2G9GA 2ZACA 1RUI2 2IXIA 1W6QA 2VVDA 2P2KA 4XHXA 3ZXJA 5AVPA 3FHIB 2F4PA 1IZ3A 3AMPA 5A33A 2XLGA 1OQEA 5T5JA 4AHZA 1PZ7A 2DURA 4X8PA 1V6LA 3OJBA 1RHI2 3JD72 4CEYC 1RUE3 5T55A 4AVSA 1SLIA 3AP9A 3KSCA 2F6BA 1OD5A 2LTNA 1MS9A 4N43B 3M1HA 4IL7A 5KHHA 5FOBB 1ZZCA 4INDA 1LOGA 3AFGA 1LODA 5FMOS 2FMYA 1YO8A 4P14A 3VBSB 1H1AA 4N43A 3RYPA 1YYNA 4NWVA 4IEVA 1N1TA 3H0OA 1QMJA 4E4ZA 4EV0A 3J26N 2B8MA 3AKSA 5DUXA 1AYM1 4COWA 5FTTC 2ATFA 3B93A 1ZRCA 1W2UA 2A6YA 2E7AA 2XG3A 4NWWA 2I2SA 2I45A 1UIJA 5GZDA 5DZGA 1URXA 4Q4Y2 5JLVA 4RHV3 2JG9B 5FLHA 4ZU7A 1O4ZA 4XBLA 2OUJA 3VBRC 1F5JA 1VALA 3JBG1 1HQWA 2JG9A 1RUJ1 3A0NA 4KGGA 5E1RA 3AMMA 1IS4A 4Q4X1 3I54A 3ZFFC 3LA7A 3O0WA 3AFKA 3TYJA 4RR3B 4DPNA 1VR3A 1UN1A 1RUE2 1S0DA 3B69A 3KT4A 2JE9A 5KHJA 2G4IA 4W6XA 4XBNA 4CP0A 1MQTB 1H8VA 3HWJA 4FOWA 2NN8A 1J1TA 2WLPA 2MHFA 3P3NA 4LTAA 2JG8A 3GZUC 4KQ7A 4R9AA 2UYAA 3MLKA 3J9SA 4ONUA 1MZ6A 1D4VB 2TUNA 1NXD1 5K9YA 1QU0A 3MLJA 5DG2A 2ZJCA 1Q8PA 1J59A 3VZMA 5JSRA 1S2KA 4D69A 1GKBA 1Q56A 4FPFA 1N3QA 2QKDA 5AFEA 2HWF1 3MIDA 4BPZA 3PJYA 4ES9A 2D6OX 1VIWB 1AX1A 2O8QA 4OUMA 3WG2A 1IPJA 1ZRRA 2CWSA 2YYOA 4AXOA 1JYIA 2PAEA 4XDQA 1QJU3 1JXNA 2A6WA 3U10A 4WM8A 1CESA 2ZZQA 3AP5A 1SBEA 4MSVA 2VOVA 2YC0A 4QPIA 1F8VA 1K5MA 3B5LB 1MVQA 2R063 4I3PA 1C1FA 4MZUA 1LESA 1ND3B 4Y22B 4CDUC 4NPRA 1NCRC 1BQPA 4N9IA 3TNPB 3PVBB 4EN0A 1YNAA 4AYUA 2XL7A 1Q43A 2O0OA 3ZXAC 4ISQA 5GALA 3WP5A 2CAUA 4Q0SA 2HWD2 1X36A 1HRV3 3ZXDA 2DCTA 2XJVA 5J48A 1PMIA 3ZN6A 4JDNA 3HIFA 4HKWA 5JR7B 2CAVA 3O12A 1QXRA 4LHLA 3THPA 3EQEA 5AC93 2R0HA 3VBHB 1RUG1 3AKPA 5E8AA 4C90A 5D8AB 2FMDA 3DPRC 1DU3D 2R041 1AXYA 1NXMA 4LBJA 1GZWB 1LHUA 4JGYC 5C8CB 4PBPA 1CAUA 5CVRA 1YHFA 1TMF3 5D8AA 2DTYA 5SV8A 5JCTA 2NLRA 2H0BA 1HW5A 2IXKA 4MXWB 3ZFEA 1H30A 4MGIE 3FFZA 1RMU1 2MEV3 2I07B 4XIKA 4AEDC 1VBB3 5FO7B 2OPKA 4JDMA 2FZ1A 3D4KA 3FX3A 4IEOA 3MIFA 2SBAA 2GU9A 1NA1B 2BW8A 3M70A 2AZ5A 4YLZA 1XU1A 3MW4A 2BWAA 5F9TA 3ZYGA 2PA7A 4BLJA 1QOSA 2NMOA 5KC6A 1ZZ6A 3D82A 4TSVA 3ES4A 1AR93 5I0TA 1HXS2 1FOD3 2D44A 2Q30A 3NV4A 4IXLA 3WHUA 1AXKA 4YZ5A 1O3QA 1YIFA 2VNGA 1OOPC 1BXHA 1VBC3 2AUYA 2P34A 4HETA 4JTOA 3JB8A 4DRVA 3LAGA 3H7YA 1RUE1 5JZGB 1O4TA 3HAGA 1AZDA 1FMD3 2E7TA 4P9LA 3JU9A 3GYDA 2A6XA 3MF9A 4YM0A 5HCAA 1RVF2 3O14A 1V6IA 3WDXA 3FMGA 2ARBA 4LUKA 3WDYA 1QY4A 3MGUA 4LBOA 1LCLA 1DGWA 1IGOA 3C3VA 3OYWB 3S7EA 3VBUB 1QJZA 1NLRA 1CJPA 3O0VA 4ITCA 1I9RA 1OA3A 1WCDJ 5EXOA 2GC3A 4HVOA 3IPVA 3JQXA 2HKXA 5KXEA 4QQLA 2HJIA 1PGL2 5BNNB 1VBB2 4RHV1 1QNWA 4Y1UA 2A3XA 3USUB 5FLJA 4FOQA 2YHJA 2EALA 2VW2A 1DIWA 3CJXA 4FCAA 2PYTA 4R9DA 5FQ0B 3WINE 3WP3A 3BCWA 1S0IA 1PK6C 3ZXKA 4META 1VP6A 3WR0A 3JQWA 2WNUB 4DY3A 2DFCA 3NV2A 5FPXA 1H8TA 4KU8A 4AI1A 4HSJA 4B4PA 4OHYA 3ZVXA 5IT6A 2HWD1 1D0GA 4DQAA 4PQ9A 2VH9A 2JE7A 2QZ2A 1Q3EA 1U0AA 2Z5WA 5IK4A 5JOXA 1ZX5A 4Y4YA 1DQ6A 5E89A 5KXBA 2XVGA 4P9JA 2C0ZA 2A73B 3AXEA 4ATFA 1J1LA 1G6NA 5FLIA 4CEYB 1AL23 3KGLA 1LULA 3MIHA 3ZYJB 1ULDA 4XPVA 3AP7A 4G3YC 5EZWA 1X33A 5GZEA 3RI8A 1AYN3 2NYYA 1W6MB 3T1LA 3VUOA 5T5PA 2HEVF 1QJX3 3VDDA 4H7MA 4S2HA 3VKMA 1QJU1 4QD2A 3LKJA 3ZDSA 3WT3A 2TNFA 1RC6A 2R061 4YM3A 3WG3A 3BOWA 3I2DA 2V73A 5H9QA 4P5HA 3OY8A 3RS6A 1MZEA 2UY8A 2ZX3A 3RDIA 1UX6A 4D7SA 2WS93 4Q4W3 1CAXB 4XJAA 1PVXA 1A78A 4ORFA 4PIXA 3VBRB 3AP6A 3E97A 1HRV1 4BOWA 1Y3TA 2ZX1A 3M7AA 3POSA 1VBA2 1DBNA 3ZFFB 4XJ8A 3ASIA 5AC91 1U5ZA 2D6PA 3AZZA 1V9U2 2A5ZA 4AQSA 3NWKA 3TB0A 2Y26A 3ENRA 3KS7A 3E6CC 1RVF1 1CONA 4WVWA 2XB6C 4DB5A 1XNBA 4XOGA 3RPQA 1IOAA 1UF2C 1LOBA 1CR7A 2XBO2 4R4ZA 3CF6E 3JUUA 4IERA 1FV2A 3V0BB 5FAXA 4OHXA 1GANA 2ZX0A 1TMF1 3KMHA 2VW0A 4P9XA 3WX5A 1A6CA 1LJ7A 2ZGQA 4WM7A 3VKFC 5CADA 1PGL1 5J7MA 5EWSA 4LO7A 2ET7A 1VBB1 2XUMA 1J3QA 3ZSEA 4AWDA 4AQTA 4Z1VA 4KG0A 3N4MA 2E51A 5EYXA 2EXHA 2VMIA 3AYCA 3B94A 4HKLA 2JG8C 1AR91 4JCKA 1SLCA 1FOD1 1DZTA 1A8DA 2WNVA 1OA4A 1VBC1 2Z69A 2OZJA 4AK3A 4WVVA 4FPKA 3OBRA 3GZAA 2UWAA 1ZZ8A 2QUOA 1FMD1 5IK5A 1KITA 1M4WA 4CDUB 5L7OA 2CY6A 1LOFA 3VZOA 5K7PA 2QNKA 1NCRB 2ZGNA 4Q0UA 1COV3 5EYYA 1VBE3 2HWC2 3K51A 4DFSA 4GIQA 3QOPA 4XFGA 1VAKA 3I8TA 4WM8C 3M3IA 4QPIC 4Q4V2 2D3PA 1K5MC 1RJ7A 1NCQA 1R1A3 3RNSA 4YM2A 4I0BA 1Q8SA 2D7FA 4E2GA 4N7UA 3KCXA 1DYPA 4GB33 1MS4A 1GV9A 1E57A 1FNZA 1H1MA 3TAYA 3D0JA 1O3RA 3DPRB 4XFAA 4GMP1 3H3ZA 1LEDA 5K0UA 4JGYB 4OI2A 1DGLA 1GBGA 2Q0AA 2EXJA 4HVQA 4AI8A 1I6XA 2OYZA 5L36A 4K6BA 5BPXA 1ZBA2 1S2BA 1QOOA 2ZHMA 1AR82 1ENRA 1XXNA 2YZ4A 4M00A 1JW6A 1LTEA 2A70A 3J8F2 4AEDB