5C4WC

Crystal structure of coxsackievirus a16
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
242
structure length
242
Chain Sequence
GIPTELKPGTNQFLTTDDGVSAPILPGFHPTPPIHIPGEVHNLLEICRVETILEVNNLKTNETTPMQRLCFPVSVQSKTGELCAAFRADPGRDGPWQSTILGQLCRYYTQWSGSLEVTFMFAGSFMATGKMLIAYTPPGGNVPADRITAMLGTHVIWDFGLQSSVTLVVPWISNTHYRAHARAGYFDYYTTGIITIWYQTNYVVPIGAPTTAYIVALAAAQDNFTMKLCKDTEDIEQTANIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords VP1
publication title Structures of Coxsackievirus A16 Capsids with Native Antigenicity: Implications for Particle Expansion, Receptor Binding, and Immunogenicity.
pubmed doi rcsb
total genus 41
structure length 242
sequence length 242
ec nomenclature
pdb deposition date 2015-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5c4wC00
1R082 4RHV3 2BFUL 1EV11 1RUG3 1RHI2 4N53B 1POV1 2MEV2 2X5IB 5JZGB 4JGZB 3JBG3 3VBSB 1VRH2 4CEYB 3ZFFA 3IDEA 3VBFB 4CDQA 1HRI3 1VBD1 1PO11 1ASJ1 4N43C 1PO22 2WS93 4QPIC 2HWD1 2WLPA 1NA1A 1RUC3 2R041 1NCQC 1R081 4CDWA 3JB8A 1D4M2 1TMF3 4FTSA 4FTBA 3NAPA 4RFT0 5C8CC 3S6PA 1SMVA 1AR81 1FOD3 1QJY2 2MEV1 4PDWA 1RUF2 5BNNB 3VBSC 1NCRB 2PLV2 1B35B 1VRH1 5C9AA 2WFF3 1HX6A 1QJZA 2DF7A 1RUD1 4CEWA 5C4WC 5FOJB 1ND3B 4AEDB 3VBHB 2RR12 1PVC3 5BNOB 5ABJC 4IV3A 5A33B 3ZFGC 1PO21 4GH4A 2WZR2 2R073 4WM8B 1VB2A 1OPOA 1D4M1 2IZWA 5A32A 1QQP2 1EAH2 1MEC2 4RQPB 1RUE1 4GB31 4QPGB 1FMD3 1MQTA 1B35C 1FOD1 2PLV1 1ZBE3 1PGL2 3VBUB 1VBA1 1AR62 2XPJA 1ND3C 1W39A 4IV1C 3ZFEA 4NWWA 1H8TB 3JD71 3FBMA 2TBVA 2RR11 1HXS3 3M8LA 1M06G 1AYN3 2HWB3 3CJIC 4WM8C 4CDUC 1VBC2 2HWF3 3VDDB 1X36A 5FMOS 1RUI2 1BBT3 2RS13 1RUJ3 4CDXC 1QQP1 1EAH1 1K5MA 1MEC1 2QQPA 4JGYA 4YVWB 3TN91 4YVSB 2RS53 1QJX3 1AYM3 2HWC2 1VBE2 1RVF3 1HRV3 1TME2 5GKAC 2FZ1A 4WM7C 1Z7S3 5K0UA 1AR73 5ACA2 4Q4V3 4Z92B 3VBRA 3ZFFB 5J98B 1VBC1 1X33A 3DPRC 1ASJ2 4RR3B 4CDQB 2HWB1 1RUI1 1FPN3 1C8M1 1RMU3 1BEV3 4GMP0 1ND2A 2BUKA 5CFDC 1NA1B 5AC92 1BBT1 4CDWB 1AR82 2RS11 2HWC1 3VBOC 1VBE1 3NAPB 4RHV2 4Q4W3 1ZBA3 3LOBA 1TME1 2RMU3 5L7OA 4PDWB 5ACA1 1CJDA 1RVF1 2BFUS 5C9AB 2HWE3 1RUD2 4RR3C 5BNPC 3JBG2 1AR71 4CEWB 3J8F3 4Q4V1 5CFCC 4IV3B 2FZ2A 1C8NA 1HRI2 1R093 2ZZQA 1CD3G 4GH4B 5AC91 4N53C 1RMU1 2X5IC 5JZGC 1OOPA 4JGZC 1RUC2 4GMP1 2R063 4RHV1 1IHMA 4Q4Y3 1RUE2 1RUG1 4GB32 1TMF2 4N43A 1FOD2 2RS33 4Y4YA 4CEYC 1PGW1 4QPIA 1MQTB 2RM23 1VBA2 3VBFC 4Q4W1 1NCQA 1QJY3 1COV3 3JD72 1RUF3 3JBG1 5C8CA 4RS5A 3ZFEB 3HAGA 2WFF2 5DDJ3 1RB8G 1R1A3 1HRI1 4BCUA 1PVC2 2WS91 1RUC1 2R072 5BNNC 5C4WA 1R091 3TN92 1PIV3 1TMF1 1NCRC 2XBO3 5ABJA 1K5MB 4JGYB 3ZFGA 1RUH3 1BMV1 4AEDC 3VBHC 5BNOC 1ZBE2 4Q4X3 2RM21 2WFF1 1V9U3 5K0UB 1GFF2 1PVC1 1VB4A 4SBVA 1HXS2 4NWVA 3VBRB 1AYN2 2HWB2 1C8M2 2R071 4RQPC 1AL23 1ND3A 1AR93 4IV1A 4QPGC 5FMOL 2HWF2 1VBB3 1QJU3 2ZTNA 1HQNA 4FSJA 1BBT2 1ND2B 2RS12 2Y26A 1RUJ2 3VBUC 3CJIA 2BPA2 1H8TC 1DDLA 1FMD1 4CDUA 2XBO1 4LLFA 2VQ0A 2RS52 1AYM2 1ZBE1 1EV13 5L7OB 4CDXA 1RVF2 1HRV2 1POV3 3VDDC 1Z7S2 5LK7B 1AR72 1HXS1 1WCDJ 1NY71 1AYN1 4Q4V2 1F2NA 4YVWC 2HWF1 4WM7A 4YVSC 2WWSA 1FPN2 1VBD3 1RMU2 1BEV2 1RUJ1 1PO13 2BBVA 1OOPB 1RUG2 2HWD3 3DPRA 2R043 2GSYA 1R083 1QJX1 1AYM1 2RS51 5D8AA 1PGW2 1RHI3 4N43B 4Q4W2 1ZBA2 1AR83 1HRV1 3ZFFC 2RMU2 2MEV3 4QPIB 5CFDA 4EJRA 1Z7S1 4CDQC 1NCQB 3VBOA 5C8CB 2HWE2 1VRH3 4RS5B 1NA1C 4FTEA 1NG0A 1RUD3 3J8F2 4CDWC 1FPN1 2WS92 1BEV1 3NAPC 1NOVA 1E57A 1A6CA 1OOPC 1PO23 1R092 5A32B 4RR3A 3JB4C 4PDWC 5BNPA 5C4WB 5CFCA 1D4M3 5ABJB 2R062 5C9AC 4Q4Y2 1ZBA1 3ZFGB 1BMV2 2RMU1 2RS32 4CEWC 4N53A 1RUE3 4GB33 5JZGA 2X5IA 1RHI1 4JGZA 2RM22 4IV3C 4RS5C 2PLV3 2HWE1 1COV2 1VBA3 4GH4C 3VBSA 4Y5Z0 4CEYA 3J8F1 5DDJ2 3JD73 2RR13 3VBFA 1R1A2 5J96B 2WZR3 4IV1B 1MQTC 2R061 4Q4Y1 1PIV2 1FMD2 2XBO2 3CJIB 1QQP3 1EAH3 1MEC3 2RS31 3ZFEC 3TN93 4CDUB 1RUH2 5BNNA 1QJY1 1COV1 1AR63 1RUF1 4CDXB 1NCRA 1B35A 1NY72 4Q4X2 5DDJ1 1V9U2 1AL0G 1VAKA 2ZAHA 1AUYA 1R1A1 4AEDA 1OHFA 3VBHA 5BNOA 1K5MC 4JGYC 5A33A 1VBC3 4WM7B 1AL22 1F8VA 1AR92 4WM8A 1RUI3 1PIV1 1C8M3 1VBB2 1QJU2 2WZR1 1QJX2 3DPRB 5K0UC 1RUH1 4RQPA 1POV0 4QPGA 5D8AB 2HWC3 1VBE3 3VBRC 1EV12 4Q4X1 1TME3 5CFDB 1V9U1 3VBUA 3ZXAC 5ACA3 1H8TA 1PGL1 1AR61 3VBOB 1ND2C 1ASJ3 1AL21 1AR91 2GH8A 3VDDA 1VBB1 1QJU1 1VBD2 1PO12 5BNPB 5L7OC 5AC93 5D8AC 4YVWA 2HWD2 5CFCB 4YVSA 2R042 4GMP3
chains in the Genus database with same CATH superfamily
3ZR6A 3CZJA 1RUG3 4W50A 3SISA 3ORJA 3GCWA 5CVRA 2BNNA 3SNMA 4ZONA 4LBOA 4D0QA 1W2UA 4N53B 1LNSA 1POV1 1LHUA 2MEV2 3L9JT 4CXYA 4JGZB 1PMIA 4R9BA 3EXUA 1CJPA 1EYBA 3DYPA 4AQSA 3PVNA 1Y9QA 4KWLA 5FOBB 2R7EB 3CIHA 3POYA 5GLUA 4AVTA 4NOTA 4E4DX 3MIFA 4E4HA 2A73B 2DWRA 2JX9A 3IDEA 3QACA 4P9IA 2BWCA 1BYHA 1US2A 2PELA 1HRI3 3OCPA 4XFBA 4OHWA 1PO11 1QY4A 3LF7A 4N43C 4AHYA 1OFNA 1UYPA 2CDPA 5IVJA 4MGSA 3WCRA 1PO22 2IXLA 2WS93 3RJRA 2VPVA 4K6BA 2OZJA 3UK9A 4CCKA 1RUC3 1OI6A 2R041 4PLMA 4AOCA 4JKKA 5IAVA 2D98A 4M0NA 5EIYB 2R0FA 2BQPA 2DUPA 5EPAA 1D4M2 2OVUA 4FTSA 2ETEA 2GZWA 2XR4A 3TAYA 2HKXA 3WG4A 4DEQA 1W8UA 2OKXA 1CZTA 1ZM1A 3IWZA 5HCFA 2J22A 4UFIA 4YG0A 5FZMA 2JE7A 2XWJB 4NJ4A 5FZHA 1LKNA 3PVEA 4LBMA 5C9AA 3UGGA 4YPJA 1SCRA 4BXSV 4NRPA 5A3UA 3VUOA 4EN6B 3AKPA 4U36A 2F4PA 4QGLA 1KQRA 3FN9A 2WQ4A 2KA3A 5DAVA 1OMIA 1DGWA 5FBJA 5B2GB 2YROA 4IL7A 4LA3A 5IW0A 1S4CA 1PK6A 2Y33A 5C71A 2IFWA 2HEVF 1VAMA 4KWUA 1FYUA 5BXXA 2Y0IA 1VB2A 2XB6C 4GAZA 1XPWA 1UIKA 2IZWA 2WL1A 3I49A 1HLCA 2RDSA 1YFUA 2WO7A 4FOWA 4C8DA 3WXPA 4OUMA 1W6OA 1B09A 4U2AA 2PAEA 4P5HA 4RQPB 5K4LA 4QB2A 5T52A 5CYYA 4CXXA 4MGZE 1B35C 3ZO0B 4AW7A 1YIPA 2LROA 2ZGRA 4D6SA 4EWEA 3OSDA 3T30A 5KBFA 2W08A 4AR2A 3NJXA 2WNVC 5FIXA 2GAUA 3M2MA 1GOFA 1FX5A 5ISLA 1CESA 1ND3C 1OLQA 1YUDA 3X29B 3H8XA 4NWWA 3WG1A 1FAYA 3JD71 3AB0A 4CYDA 3AP7A 4HXCA 4LKEA 1VMJA 3M8LA 2A71A 4C0BA 3AL5A 2J1EA 1VPHA 4Y5SA 2DUQA 3HVDA 3CJIC 4YW7A 1XQNA 2JG9B 5KXEA 5C70A 1YCIA 1VALA 2C9AA 4LK7A 3N9LA 1U12A 4OI4A 1X36A 2FMDA 4EQVA 4IESA 4B4RA 1WMXA 2AUYA 1XB9A 5IVEA 3RQ0A 2N7GA 5HXMA 4G4FA 3BIEA 1AXZA 1WW4A 1W05A 3R4DB 3TN91 4AQTA 2A7AA 3KT4A 3CLPA 4I09A 5L36A 2JDNA 2E26A 3ACFA 5C3QA 1LOFC 2WNUB 2RS53 1QJX3 1SG3A 4XBNA 2HWC2 2VW1A 5C3SA 4B3NA 4BXFA 3OUJA 1PHMA 3FHIB 4LORA 2D6MA 1XE8A 1RVF3 5FZ4A 1HRV3 1LGCA 4XJAA 2GC1A 2JD4A 3CBNA 3NW4A 5E8AA 1KITA 2FZ1A 4ASKA 1NZCA 2YMZA 1AR73 1WD4A 4CU9A 3I4IA 4HK8A 3E6CC 4Q4V3 4D8MA 3B69A 3FMGA 1DGWX 3ETPA 4KI5M 4NUBA 3VBRA 3E6DA 5J98B 5JOYA 2Q30A 1GZ9A 2LS6A 2OQ7A 4BMBA 1RXFA 4RR3B 2Q8CA 4CCOA 4QXBA 3MUZ1 4YLZA 4YW2A 4NRQA 1LESA 3WNLA 1XE0A 2VBDA 1AX2A 2TEPA 4M4RA 5GJ6A 4PF5A 1N47A 3UJOA 2BUKA 1US3A 2ERFA 1NA1B 2GN3A 3AYEA 2VXRA 3DXTA 4H55A 3TBDA 2IVIB 3PUQA 1XNCA 4FI9A 3VBOC 1VBE1 3NAPB 4DXRA 4QHOA 1SBFA 1ZBA3 2XLFA 1TME1 4A6OA 1GZWA 2B9UA 4Z82A 2A1XA 2O14A 1GZTA 4BJ0A 1REEA 1V6JA 5CZKA 3V0BA 3J7LA 1CJDA 2QUOA 4MGYE 1R64A 1JYXA 3KVBA 4PIZA 1RVF1 3J7MA 1NXD1 1ZVFA 2XUMA 2DCZA 1AR71 5FJKA 1W2OA 1WA6X 3RYRA 2G4IA 4LO6B 2D6LX 4IEPA 3J8F3 4Q4V1 1ZRDA 2AGSA 2BVVA 1J3PA 1CAUA 1YWKA 2FCUA 4FPEA 5E88A 4XF1A 3NJYA 4YFWA 2X8KA 5A6ZA 3QLQA 3BCWA 3KV5A 2HEWF 5L9BA 5T50A 3AL6A 4FBFA 4UAPA 4N53C 2YDEA 1GNZA 3IIAA 4FPJA 4JGZC 4LBLA 5T3NA 3H3ZA 2DV9A 1Y9MA 1WCKA 2YXSA 4LIVA 5FP8A 1MS5A 1IHMA 4LBKA 2A70A 2EA7A 1RUE2 3HT1A 3NSTA 3CEWA 4QDQA 2ARAA 4YGEA 3GZUC 1RXGA 5CKQA 1TE1B 2ATFA 2RS33 4WZFA 2XL9A 4FPKA 1G9CA 3C7OA 4QPIA 1MQTB 1D0HA 1YI7A 2RM23 3MPPG 1VBA2 3MFAA 4M0HA 1QMJA 1WW5A 1ZA7A 4YWAA 3JBG1 5FO7B 3M4FA 5C8CA 2LRPA 4RS5A 4AZZA 3HAGA 4LO7A 4JAAA 4JRAA 4LPLA 1W8OA 2AYHA 2VBPA 3V0AB 2K0GA 2ZGLA 2D44A 4CCLA 3ZSJA 1OA2A 4BPZA 3LE0A 4HANA 4XFGA 3A4UA 3THDA 1Y3TA 1JYWA 3HN3A 1H8VA 3WNNA 1U5YA 2J7MA 1PIV3 5FZGA 1GV9A 4AEKA 2ZGUA 4P9LA 3USUA 2K9ZA 3ELNA 1URXA 2XXZA 4UBGA 5I0RA 4CUBA 4DUVA 4TLFA 2ZX2A 4LBQB 1RUH3 4PBOA 3KHCA 1BMV1 4BQXA 1SEFA 2VTXA 4RSUA 2QTWB 4E9KA 4C91A 4I2OA 3NL1A 1MACA 1ZBE2 4INDA 1JZ2A 1DQ1A 5FPAA 2RM21 2WFF1 5CKMA 1V9U3 2ZX1A 4HKLA 1C3HA 3GZTB 1CPNA 4FFHA 4L9BA 3HD8B 2YUEA 1QU0A 3VDAA 2Y6KA 4OUSA 4YW1A 5JIUA 1ULGA 3ITQA 5L9VA 1HXS2 1UXXX 4Q0UA 3UKTA 1CIWA 2W1SA 3EO6A 5I8TA 4BOWA 4RN5A 4HKWA 2R071 1UY1A 4RQPC 4IV1A 3ZYHA 2RJKA 1LHNA 1G9BA 1GNHA 5AFEA 3N36A 3WP3A 2ZTNA 1HQNA 2JE8A 4PLNA 4FSJA 5FZ6A 2RS12 1RUJ2 2W47A 1L7QA 3KCCA 2LM3A 2X29A 3FL7A 3GCXA 4TSVA 1OD3A 4CDUA 4GIQA 2C26A 3MW4A 3DEMA 3C7EA 2VZOA 1YC61 4XE9A 5CIRA 2JXAA 3PUAA 2VMCA 2WABA 2DUOA 4LBQD 3UKNA 1AXYA 1IS6A 4QDRA 5L7OB 3IMMA 4PIYA 1LODA 3LA7A 2OPKA 3P3NA 1Z7S2 4Z07A 5LK7B 3C2UA 3I8TA 4JDOA 4IEVA 4XBQA 4D3WA 3P6BA 1Q8VA 1K5JA 3IT8A 4NHKA 2VO5A 4I30A 4BHPA 2PQQA 2JICA 3GJAA 2UWBA 4NIHA 2BERA 1GQGA 4CP9A 1ZYBA 3WG2A 1MZFA 4FXGB 5J37A 4A7KA 1CIYA 2WNUC 4H7LA 4XFHA 1FPN2 1BEV2 2PHTA 2ZCWA 2Y6LA 4KBZA 2VOKA 3ZDVA 5I91A 1RUG2 2Y6GA 4YG3A 5DUXA 3WW3A 4NHYA 2XVGA 2EF6A 1AYM1 3N7MA 4ZU5A 2B8MA 2XJPA 4IQPA 4MLOA 3WT3A 3OGSA 4Q4W2 2QQNA 2QFEA 1IS4A 5JR7B 2QNKA 1S0FA 1XSQA 2MEV3 1CAXA 5EXOA 1OQEA 2GMEA 4XF3A 2H6BA 5CFDA 2JG8B 5FAXA 5T5PA 3SKJE 1W0OA 1DZQA 3K4AA 4LHNA 1PM7A 4OMCA 1LENA 5C7GA 1WBFA 2VTFA 4DXTA 1WCSA 4MHUA 5J48A 1W3VA 1E5RA 1NA1C 3O12A 2QBXA 3T0BA 4B4QA 4PHZA 2WS92 5C33A 1UYXA 4YW4A 3NAPC 2IXJA 1QH7A 3ZXLA 1RJ8A 4Y5TA 1PO23 4XJZA 5A32B 3L2HA 1V6KA 2YPDA 3AKRA 3JB4C 5BNPA 3GBFA 3ZM8A 2VNOA 2XH6A 5C3RA 1SLLA 1X8MA 1D4M3 3NNFA 3WF0A 1DLCA 1QNYA 2JE9A 2P3KA 3TYJA 4Q4Y2 2W9XA 3LA2A 1NAEA 1SDDB 3NWKA 4GKXA 4YG6A 3ZFGB 4Z2WA 1R1ZA 3KB5A 4JCKA 2IUWA 2Y60A 3WW2A 4AL9A 4HLTA 2A6YA 1NYWA 2X5IA 2D3RA 4IE4A 4QKFA 2VD7A 3KSCA 4NROA 3CMGA 3I59A 1WGPA 4RS5C 1ACCA 5F3EA 4LR4A 4XTPA 1F5JA 2WN3A 4R52A 1RC6A 3R0RA 2I07B 2HEYF 1SPPA 4L11A 5J7MA 1S0BA 2Z69A 1OQ1A 4W65A 4DOUA 3QH7A 5EWSA 5FK7A 2WINB 3WUCA 5J96B 4TYSA 4A2UA 3U10A 2JDYA 4NHMA 1UY2A 1MQTC 3RNSA 3BGAA 4A44A 2BRTA 4FP3A 4YM0A 1GYKA 5DG2A 4XW3A 3NRUA 1JH5A 5FPZA 3NNMA 1BHGA 1CR7A 5CAZA 2XBO2 2FDKA 4OQ8A 3O1RA 2WSUA 5FY0A 2UY8A 2GNBA 2XOMA 3KT7A 4NAOA 1COV1 2VNGA 3THCA 3QH6A 4Y24A 4K3UA 2EIGA 1WMFA 1G86A 1YYNA 4Q4X2 4RYDA 2KM2A 2V73A 2K46A 3AVRA 1R1A1 3VHOA 3VL8A 3ZMOA 4ZZ5A 3H3LA 4OI0A 3G7DA 5D2AA 3ILRA 4DUXA 3PTYA 3SITA 4DMIA 5FYSA 4WM7B 4BQWA 1YFWA 4NIIA 4CP2A 2YGLA 1O8SA 2X05A 2P3YA 4RA0A 2GU9A 2IWGB 2PTMA 1C8M3 3NV3A 1QJU2 1UAIA 2WO1A 4DFSA 2VVFA 5T5LA 1VE0A 1QJX2 4YGDA 1X7NA 4Y1YA 5HCAA 3DPRB 3ECQA 3UGFA 2VCAA 1QOOA 2ZGTA 2O1QA 3PJYA 4KGGA 4XXPA 4ISQA 3N35A 4QPGA 4V2VA 2HWC3 5JSPA 3N7KA 1DFQA 4LULA 1EV12 2CU5A 3M1HA 2E33A 4QQHA 3WDWA 2X09A 4E2GA 2ZMNA 4QGNA 4E8DA 2DCKA 2V5YA 1Z0HA 5FZCA 3BPSA 1H8TA 2DU1A 5I0UA 3RMXA 3SXWA 1UIJA 1S0GA 2XQRA 2R30A 1F15A 2UY9A 4XUQA 2Q8OA 3ZVXA 3H8OA 1UO9A 3OYWA 3CL1A 2QQUA 2WWJA 3CF6E 4K21A 2VMFA 4GWNA 2Z42A 3HMYA 3ENRA 2GH8A 4MOAA 1FATA 1GUIA 4FFGA 1GP4A 4XOGA 3JQWA 3JCIA 3EB7A 1C5HA 4BU2A 2GMMA 3CQOA 5L7OC 5EQUA 4BZ4A 1O91A 1SLTA 2HWD2 2ZEXA 3DF0A 3IZOA 5CFCB 1H1AA 4B8EA 4LHKA 4XQWA 2H0VA 3KQ4B 4FXKB 4GXLA 4P08A 4NPMA 3ASIA 3AP9A 3HWJA 3LAGA 5KR7A 5JZGB 3W58A 1CGPA 1N1YA 5L9RA 5LRSA 3MLLA 3OGGA 4BMEA 4KL1A 4LE3A 2OT7A 2ZACA 4A3ZA 5D1IA 4CEYB 1YFYA 3M3CA 4QDSA 5FZFA 4O7XA 1CZVA 1LOAA 3IBMA 5A3LA 3GNEA 1GQPA 1VBD1 2WR9A 4IE5A 1SFNA 3JZVA 4FO9A 5H9RA 2YC0A 3F2ZA 3MI8A 4RGKA 2GP5A 2B9VA 5FP7A 4DO0A 2PFWA 2WLPA 2JG8C 4E2SA 1FV3A 4JDMA 1KJLA 1R081 1YIFA 2Q0AA 1EPWA 2WWUA 5GM0A 3SMHA 4FTBA 3DV8A 3I2JA 1SMVA 1DIWA 3J26N 4UI9L 2PHLA 4DY5A 2ZAAA 2PN5A 1E5HA 5BNNB 2NLRA 4XYXA 4MADA 4IE7A 3SH5A 3K75B 3VZKA 4O61A 3PLQA 2PLV2 2OQ6A 1B35B 1VRH1 4MGKE 3AJYA 1KFUL 3O1PA 4FPLA 1AJOA 2WNVB 5A3OA 3SEPA 1ND3B 3RWKX 3VBHB 2RDRA 4XAAA 3VZMA 5A70A 5BNOB 2EXJA 3TNQA 3ZFGC 4DB5A 2R16A 4GH4A 1S0JA 2KD7A 1XRUA 2IFRA 1HB3A 2YZ4A 2ZGKA 4R9AA 3WP6A 4BM8A 1OPOA 1NLRA 2EAKA 1J83A 3O14A 2WAOA 1LULA 4X8NA 1QQP2 1HJFA 2DDUA 4PIXA 4CUGA 5FZLA 1MEC2 4NRMA 1CAVA 1RUE1 1G9FA 1D0GA 2CSGA 4M3CB 4UF0A 4CVUA 1ODMA 3OUHA 3POSA 5LK5A 3ZYRA 1ZBE3 2ZHKA 3OPWA 1PGL2 1DYKA 1VBA1 4ZXEA 3VBUB 4PI2A 3ZIXA 4S2DA 4EROA 2XPJA 1W39A 3ZFEA 5G04L 3FBMA 4WZCA 5HI0A 2P4EA 2P2KA 2RR11 2TBVA 5LA0A 5H9PA 3O1SA 1HXS3 1UOJA 3IPVB 2VNVA 5AFBA 1AVBA 2W46A 5FYYA 4DY3A 2K2SA 5IAXA 4JKMA 2NQYA 3E5QA 4YGBA 1VBC2 4K8RB 3VDDB 3LA3A 2G1MA 1YXWA 1UMHA 4DEVA 2QKDA 3M3EA 1LOCA 1J84A 1VAVA 2Q4SA 3O1MA 2RS13 5B4XA 1RUJ3 1EP0A 3N7LA 5KC5A 1EAH1 1K5MA 4BE3A 4JGYA 1ULOA 3AXEA 4P9WA 3CHXA 1HJGA 4MX3A 2WLQA 2ILMA 2O8QA 2BGOA 1DGRA 3FX3A 4CCNA 3LIGA 1JUHA 4XZPA 1UN1A 4XPVA 4M00A 1WD3A 1OSGA 1OLRA 5GKAC 4WM7C 1Z7S3 1MS9A 1X82A 3FUQA 5K0UA 1OKQA 3OOXA 1XBFA 5JOXA 2XJUA 3TNPB 1J1TA 3DL3A 4Z92B 4QB6A 2B4KA 2VOVA 4LA2A 3BB6A 5JOZA 3DPRC 5I93A 4XETA 1RUI1 1FPN3 1BEV3 3OUIA 4GMP0 5FXZA 2VL4A 3TOJA 1ND2A 1PZ8A 3O5SA 3AKQA 5D21A 3EQEA 4CUAA 5AC92 4JVAA 1W6NA 5C8WA 2RS11 4CP0A 4FFFA 2JDZA 4WBBA 4MGTA 4LBJA 4YZ4A 1CONA 2HYKA 4RHV2 4Q4W3 2CAVA 4W6WA 4XIKA 5HBAA 2W52A 3W9AA 3E5XA 4AGGA 5FZEA 5FP4A 2VOTA 3U07A 3VD9A 4JTNA 1CZSA 1POQA 1HQLA 5ACA1 1WLWA 3POIA 4NIDA 1KGYA 1NX9A 1XNKA 2BFUS 2CV6A 3LDRA 4KMQA 5C9AB 2P17A 1O3QA 3POGA 4JQTA 4UFJA 1XXNA 2G9ZA 4K1ZA 5FV3A 4OQ9A 4LXLA 1XOYA 5EJ1B 3U14A 5CFCC 2XGXA 4ZXKA 4JX0A 3UT0A 1LU1A 3M3QA 2SLIA 1N3PA 3LEIA 1LTEA 2ZMKA 3GGLA 1UU6A 4FOQA 2CGNA 1DYOA 1PK6B 4I0AA 1PMHX 3HNYM 3I3DA 3MICA 3VKLA 5JZGC 1OOPA 3SLIA 5CU1A 3T4VA 3VN4A 3AP5A 4GMP1 2B46X 4D7YA 2VGDA 4Q4Y3 1RUG1 1UXZA 2ZGMA 3LDBA 1TMF2 3H1WA 5EHDA 1W6OB 1FOD2 2R32A 3SHRA 1HKDA 4CEYC 2GC3A 2VW0A 5FP3A 4Q5OA 5F3CA 4OFGA 4Q4W1 3ACHA 1NCQA 4HVQA 1SBDA 3MW3A 1QJY3 1NE4A 2XVLA 4IEWA 2DCJA 1NE6A 1RUF3 1XNBA 3BYWA 2E7TA 3BALA 4AHZA 4FOVA 2ZHNA 5A7OA 1TZOA 5HXVA 4P14A 3H1YA 1GICA 2VZPA 1ZA4A 2GC0A 2Q1FA 2VULA 2TNFA 3PU3A 5CA6A 1RB8G 1HRI1 2W2IA 4AEJA 2FCTA 3ATGA 2P34A 1PVC2 2AH2A 1QXJA 4AI9A 1OXCA 2AEYA 4HPKA 4ORFA 3LKJA 3RZHA 2Z79A 4QXHA 2FDFA 4ISRA 3AMPA 2WS91 4MV2A 2Y6HA 2O8OA 3BTAA 1RUC1 2IXKA 2WYFA 4NVPA 4QX7A 3OBAA 5BNNC 5FYBA 5C4WA 5EYXA 1LOGA 3U78A 5FYVA 1H6YA 5FFOC 2XBO3 5CG8A 5ABJA 5FR3A 4H14A 1JW6A 1AXKA 3MFCA 4JDNA 1ULPA 3B7MA 1CWPA 2Y8KA 3PIJA 4LTAA 3DXUA 3ZN5A 3WP5A 4XMIA 4XF4A 4YNIA 3VBHC 5IFTA 2DVGA 5BNOC 1UZYA 1O5UA 3B01A 3MDPA 2D97A 5HCBA 4TWTA 3WW1A 1OC1A 1LU2A 5KWRA 4Q4X3 3TRSB 3AMMA 4YM3A 3M3OA 3LPFA 1DCSA 1ENQA 3OF1A 2VZ1A 5DUWA 4IEXA 5EZWA 4IGOA 4SBVA 3W21A 2WA4A 3VBRB 1AYN2 2HWB2 4OUEA 5DG1A 3SQOA 2GC2A 4XURA 1C8M2 3TB0A 4ZS3A 4JV4A 4XDOA 1VIWB 2XHNA 1HN0A 2HWF2 2ZA9A 3NVCA 3LDKA 4WVMA 1PMJX 4AGVA 1W06A 3IM0A 3RS6A 1QJU3 3SH4A 4BK5A 1UY4A 1QNWA 4Q2FA 2LUWA 2CL2A 5A1LA 1A3KA 4EN8B 2Y26A 4GKYA 5LBFA 3VBUC 2BPA2 1Z78A 3AK0A 1EPZA 5HV4A 4JQRA 4XC9A 1LCLA 2XBO1 4GQ7A 3FE5A 5I8SA 5HV0A 4FPHA 4CU6A 1W04A 3S5QA 1EV13 2BOIA 4IE6A 2YV8A 4PQQA 1GZWB 4CDXA 3WY6A 3V0BB 3GALA 3VDDC 2BWAA 2ZPXA 3MPBA 4KNCA 1IGOA 1KEXA 3MEPA 3WF2A 1JZ6A 3IB3A 4XZUG 5F9TA 4XILA 5AVPA 5IUQA 1XNDA 3JUUA 1UY3A 1W2TA 5G05L 2QDRA 3A7QA 4Y20A 1CAUB 2B7YA 2BNOA 4HVOA 4W6YA 5LBBA 3VD3A 3ZSMA 3TEZA 3N3HA 1RMU2 1U5IA 2JG9A 4GWIA 5SV5A 3POBA 3RZZA 3LEKA 5JXHA 3T0DA 5JWPA 1GLHA 2DCTA 4XIOA 3NKGA 2HWD3 2BV4A 1NLSA 3BPZA 1APNA 3AKSA 2V5DA 4TN7A 2RS51 1QJX1 3UGHA 3FFQA 3OBTA 4TXWA 3WG3A 1PGW2 3K46A 3U4XA 3AVSA 5DXDA 4YZ1A 2NZ9A 5F5QA 1UOGA 1AR83 1HRV1 2ARXA 2VZVA 3MHZA 2RMU2 4QPIB 3ZN6A 2JJ6A 2Q1MA 1G9AA 3MF6A 5JXGA 2PHWA 2J1SA 1LOBA 1YRZA 3O1UA 2JDHA 5C8CB 2HWE2 4RS5B 1U5ZA 1Q43A 1W9WA 2YPJA 4AG4A 4DNYA 5A3NA 1ZZ6A 1C28A 1ZX5A 2EXIA 2YGMA 3MIHA 4UFMA 5JIAA 1NG0A 3NV1A 1RUD3 4MYEA 4BLIA 2R1BA 1X9PA 4XUNA 3WCSA 1O4YA 1A6CA 2Y6JA 3P3PA 3E97A 1OOPC 3P1IA 4A3XA 4A7ZA 4BA6A 1R092 1SQ4A 4UT5A 4RR3A 3MGUA 2E9QA 5JPNB 3DN7A 1IPJA 1D2QA 1TEIA 2VCCA 4OHXA 2R062 3USUB 1JOPA 3VD7A 3WINE 5C9AC 1ZBA1 2OUJA 2DTWA 4B1MA 5C5TA 5IFPA 4P9JA 4GB33 5FKBA 5DPNA 1UU4A 3N9OA 5BNQA 5BV6A 1BZWA 3MO4A 3H3UA 2PLV3 3HQRA 4QX2A 2XDVA 3A21A 2P6HA 5FO9B 2B5HA 1PK6C 2DBIA 3AYDA 3VBSA 1A78A 4RGGA 3J8F1 1FNZA 5DDJ2 4AFAA 4KU8A 4AHWA 2BEOA 4AEMA 1L3JA 2ORXA 3VBFA 5IHRA 2ES3A 1W0NA 3SEEA 4FCAA 4Q29A 5DAQA 5A7QA 2R0HA 1BQPA 2XL7A 1W8FA 2AEZA 3Q9OA 4IV1B 4AFMA 4RL7A 5FXWA 4KWJA 2ZOEB 1CX1A 4F8AA 4LOTA 1GQHA 2VBBA 4LUKA 3U37A 1XC6A 3FHQA 3KV4A 3PIGA 1QQP3 5IYYA 1MEC3 2RS31 5DUUA 3WNOA 3OG2A 4FAGA 4CDUB 1GKBA 4URAA 5F39A 1LGNA 1T6BX 5DABA 1MR5A 5A6QA 1HQWA 1NCRA 4BDVB 1YJLA 5LASA 1XYPA 2VZUA 2FD8A 1VR3A 3DKQA 1F4AA 3B00A 3KV6A 4GULA 1PZ7A 1AUYA 1TQ5A 4MVTA 1O59A 2Q1ZB 4AEDA 1Q3EA 3ZYJB 2VTXJ 5GLWA 2JENA 2QQJA 1H6XA 2RJLA 4L97A 1LEDA 3MIGA 5IK5A 3PJQA 5A33A 2UURA 1VLNA 4AWDA 4UWDA 4FPGA 1VBC3 2ET7A 5FBZA 4CP9B 4DRRA 5T55A 1AL22 4N7IA 1AR92 1F8VA 4UFKA 2PXJA 4WM8A 4I01A 4N9HA 1AHSA 1PIV1 3NNJA 5IWFA 4MG2A 5C3OA 1VBB2 1OH3A 3Q8CA 4H7MA 3RPQA 3VD5A 3FJSA 4M01A 3NNLA 4FPCA 2ARBA 5JSOA 2E51A 3ETQA 4IEQA 5FRAA 3DECA 4HOOA 1RIRA 1RUH1 1UOBA 4K1YA 3CNAA 1NUKA 4LKDA 4YW5A 5FZKA 3OEBA 2P6CA 1K3IA 2WSVA 2WC2A 1QDOA 3VBRC 3NNGA 4MO3M 4CA9A 4L2NA 3CZUA 3DGTA 3K4DA 5CFDB 1V9U1 5FYTA 2F4LA 5GLTA 4AFCA 4LO5B 1J1LA 2NN8A 2WO3A 1SBEA 1PGL1 1TVGA 3C3VA 3IDBB 5I0SA 3JU9A 1VMHA 1HV1A 4KH9A 1DQ5A 3BTXA 5FP9A 3UL2A 4K40A 1IS3A 4ARYA 5FYIA 3OD0A 4AXOA 3I2DA 2WAAA 5CADA 2FMYA 1RTVA 1PO12 4UBHA 5BNPB 5FY1A 5KHGA 1ZZ7A 5AC93 3BODA 3R6SA 2CAUA 4FPOB 5DZEA 2Y34A 2A3YA 3MV01 4YVWA 3CJXA 3WHUA 4CXWA 4ZKTB 4JTOA 4YVSA 2R042 3MIDA 4HETA 1V6NA 3ST7A 4BLJA 4RHV3 4YM1A 5BY5A 1WA4A 2O0OA 2QDNA 2XQXA 3HQXA 5F32A 4CCEA 5KC6A 3GHMA 4D7SA 2XWBB 3MIBA 4AHXA 5IVCA 2X5IB 3SCHA 5JVVA 4BIFA 1H1MA 3BU7A 3N4MA 3I59B 1W2AX 1LJ7A 4LKSA 1DG6A 1WCQA 1OA4A 4N7UA 5K8SA 3KQRA 2I45A 1UF2C 4NE9A 4OULA 3ZFFA 5T5JA 1W90A 1SPPB 1NZIA 1WLTA 5L73A 2RDNA 2I74A 4HVRA 3T2PA 3I2OA 1H0BA 4GA9A 4CDQA 3AYAA 1PZ9A 5IVFA 1O6UA 4P9XA 1DF0A 2RE9A 2QQVA 3ZMNA 3N9PA 3O7OA 4LE4A 4AF9A 2W95A 3FZ3A 4QPIC 3THPA 5FYZA 4MZUA 4Z2AA 1OKOA 4J6GA 2E6VA 4CDWA 5L19A 4Q0QA 3WDUA 3JB8A 2GN7A 1TMF3 1ZNPA 3GYDA 4RFT0 4XQ4A 5C8CC 5A7WA 1FOD3 1F9KA 3PU8A 1GWKA 1IG3A 3AJZA 1W6QA 1QJY2 2MEV1 3H7YA 4XDQA 1HIXA 2V09A 5HCHA 4PDWA 1RUF2 2EXKA 5FLIA 5LW9A 1HB2A 1JZ7A 1LHWA 5FYUA 5LA9A 3PMEA 3VBSC 1LRHA 4NMIA 4AI3A 4Y22A 3FUOA 5CEHA 1OFSA 1OLME 2QZ2A 3D5OA 3OY8A 1HX6A 1QJZA 2DF7A 4X6QB 5EP9A 5LA1A 2A3XA 3AM2A 1IPSA 4CEWA 4CCDA 1PVC3 1T6GC 5FMDA 4IV3A 2W68A 3FWEA 2JDPA 4JKLA 4QX1A 2WN2A 3DUIA 4NPLA 1VP6A 2Z2SB 1PO21 4ATEA 4BISA 3ZN4A 3E6BA 2WKKA 3FLPA 3LQCA 4MUVA 2WZR2 3UETA 4D7TA 2B45X 2XONA 1PNGA 1NLQA 2FDGA 1UMZA 1CN1A 1D4M1 1F5FA 5FZ9A 4YARA 1QJEA 2QVSB 1DQ2A 3KCYA 3ES4A 4NPRA 5A32A 2W91A 3ZX7A 3HPNA 5DAPA 3PHMA 3ACIA 4HN1A 4KQ7A 2ZGQA 4CPBA 2XJQA 3OGVA 4QPGB 1FMD3 4W4ZA 2W87A 3GM8A 1FOD1 3QD6A 5GZCA 1V70A 2DVFA 3T4HB 4OZXA 1W8HA 1Q8SA 5F6KA 1UD1A 3KCXA 3O0VA 4L0PA 2ZX4A 3WQ0A 1AR62 2FDIA 5FMBA 2IXIA 4ITCA 4IV1C 3PTRB 2P3IA 1H8TB 5IVVA 1FI2A 1XYNA 4EN7B 4BQ4A 4HONA 2CHHA 2WYSA 3OYWB 3PVOA 1AYN3 2HWB3 4UW4A 3ZXGA 2DVDA 1GWLA 1Y43B 4XQDA 1QKQA 4WM8C 1LHOA 1MVQA 5LRRA 1SCSA 3O0XA 3VGIA 4CDUC 2HWF3 3PMSA 3WNPA 3WF1A 3A0NA 1MZ5A 3LGRA 4B7KA 3BN6A 3LD8A 4QX3A 2BBAA 5IK7A 5FMOS 1A8DA 2EIDA 4D69A 5F5AA 2BGCA 1JBCA 2OZ6A 2OW4A 5FZ7A 4AAPA 2QQPA 2W5FA 2VCMA 5KHHA 3HQUA 3ILFA 5FTTC 1RITA 2ZHMA 1IQDC 3AP6A 3T1MA 1QOTA 1ULFA 3I3MA 3NO8A 1G7YA 1S0IA 2HYXA 4AFBA 5LCWL 2ZHLA 1VBE2 1WKYA 5E6HA 3WUDA 1ZZCA 2C6SA 4NO4A 2E53A 2BTVC 1TME2 1S2BA 1YQ8A 4XJ9A 1F4HA 1SLBA 2V4VA 1GNYA 4J1XA 4MGIE 2YY1A 3LSEA 4D94A 3NV2A 1JXNA 2CWSA 4MXVA 1G9DA 2FCVA 2MPFA 1ASJ2 3W5MA 2HWB1 2VMHA 1JOJA 4MXWB 5F8PA 1C8M1 1RMU3 3BOPA 1W6MA 4Z8BA 5BYNA 1JOBA 4E4SA 5CFDC 4LQRA 3NKTA 4PLOA 1VMFA 4COWA 4K9SA 3PDQA 1AR82 3OTFA 1XE7A 2HWC1 2E7AA 2PHDA 4NHLA 2VZRA 2WO2A 1D7PM 4DPNA 2CY6A 4GWJA 3OBZA 4Y4RA 3K48A 2AACA 4QD2A 4LKFA 2VUAA 4AE2A 2RMU3 4LUMA 1CQ9A 1TG7A 3WQ1A 2YHJA 4EWDA 1LB2A 4HL0A 5DQ0A 3M3IA 2QZ3A 2VZQA 5LY2A 1KDMA 5FZBA 2HWE3 1RUD2 1SLCA 4KG8A 3E5UA 1ONAA 3SH3A 1S1AA 5BNPC 3JBG2 1SLAA 5A3WA 1WCUA 1SFPA 2VMIA 1ALYA 4OHYA 2EAAA 4AQ2A 1UMIA 3DKWA 4NHXA 4EWAA 1C8NA 2VZTA 4NAMA 2A75A 1AZDA 3H8RA 1R093 2YU1A 2ZZQA 1CD3G 4GH4B 4QXCA 4S2HA 2Y64A 3HN1A 1S2KA 1RMU1 2X5IC 3AFGA 3GF6A 3THTA 1GANA 3FLTA 2SBAA 2R063 2C0ZA 3USSA 4LO4B 3PL0A 4EZHA 1HB1A 4GB32 1HB4A 5ERLA 3G6JB 4CCJA 4N43A 5FCCA 4XFCA 3WV6A 2WFPA 1CAVB 2D5FA 1PGW1 2F6BA 4K20A 1Q5OA 4YW3A 3S7EA 5FQ0A 3C7GA 3KVAA 5IJRA 2DYCA 3RGBA 4KGQA 4ATFA 2NP0A 2VU9A 4IXLA 4XHBA 2YU2A 3LOIA 3BVCA 3M70A 1UZVA 3ZFEB 4Q0VA 1L7RA 2WFF2 5DDJ3 4ZY9A 4DQAA 3VB9A 2AREA 5SV8A 5DZFA 5BUVA 5JDBA 2Q8DA 1N1SA 2WJSA 5JUVA 3AYCA 1W6PA 4Z1VA 4ZHNA 1BK1A 3ABZA 3O0WA 4FAHA 5A3TA 4OMDA 2H0BA 1KDKA 2A5ZA 2HJIA 2D6OX 2FQPA 3ILNA 1RUNA 5FZOB 3RI9A 2R072 1DHKB 4ASLA 2D6NA 3KF3A 1R091 3K4ZA 2H6CA 4C1WA 2WUHA 3ME2A 1K5MB 3WR0A 2VUCA 1LECA 4JGYB 3K3OA 1OPMA 1J3QA 4JC1A 2DBNA 3A0KA 3U1XA 1CAWA 1OVPA 3V65A 1DGRN 3GJBA 2ZBJA 5DAXA 1PX3A 5FPBA 1MS8A 1QXPA 1Y9GA 3BI3A 2XG3A 3RDIA 1H2KA 1BCXA 1REDA 2ZGSA 1ULDA 3KMHA 3KF5A 5A7SA 5K0UB 2YC4A 4Y1UA 5FREA 1UZ0A 2QQLA 2YFZA 3AZWA 1RGSA 2WNVA 4R4XA 1EY2A 1DQ0A 1YEWA 3T2OA 2VMEA 1AL23 1ND3A 1AR93 4QPGC 5FMOL 3T2QA 1UL9A 3AXDA 1DZRA 3L2YA 3O1VA 1GZCA 1VBB3 2P37A 1ZZ8A 1BBT2 1ND2B 3AZXA 3A23A 4QX8A 1K42A 1PNFA 3CJIA 1UPIA 4OZOA 2JWPA 3RZKA 1W6NB 4IEOA 3ZLIA 3TEWA 3WSOA 1H8TC 4JHZA 1DDLA 2W0XA 3I2FA 3RSJA 1RINA 4A42A 5ANQA 3MYXA 3NQHA 2Z4FA 1BK0A 2AC1A 2CDOA 2VQ0A 3F95A 1AYM2 3PUSA 1ZBE1 2E31A 4LHSA 3WNXA 4YZ2A 4HN0A 3B3QE 4IEYA 1YI9A 3WX5A 3I3EA 2Y6FA 4BQ1A 4L8QA 4EN9B 1POV3 2ZABA 1DBNA 1DQ6A 1HXS1 2ZEZA 3D8CA 5FY4A 4PJYA 1LOFA 3UJQA 1F31A 4LIUA 4X8PA 3B93A 4BB3A 1H30A 1OURA 1V6MA 1H9WA 1JUIA 3ALQA 1F2NA 2ZMLA 3D3AA 3IMNA 2A6WA 3RYPA 1ENSA 1OA3A 1DP0A 4I0WB 3AX4A 3IPVA 4QX0A 5JPMB 4HSLA 5FK8A 4OHVA 3POEA 5FY9A 5JMOA 3ACLA 4KG0A 2ZGNA 4LBNA 5F1RA 1RUJ1 1PO13 1VJ2A 2BBVA 5C3PA 4HSJA 2PQSA 3ZSLA 4E4ZA 1ODNA 4MHRA 1EUUA 1OOPB 2QE3A 1UYYA 2R1DA 3N9QA 4FP2A 5FZ3A 3W59A 2R043 1OT5A 3RWNA 3U0ZA 3ZYGA 5D8AA 4BQ2A 4HK9A 4XCBA 2W39A 4OVEA 1SFYA 4ASMB 4ES9A 2P3JA 5IT6A 1NQJA 2BJSA 1Q8PA 3T3YA 3VKOA 1Z7S1 2D40A 1NCQB 4XACA 4QPWA 3VBOA 1V6OA 1W8NA 5FYMA 5JSRA 4CCCA 1HV0A 4BYYA 1H4GA 2A6XA 2PYTA 3E1F1 5C6CA 4FTEA 3OPTA 1C1LA 2A6ZA 1FPN1 1MZ6A 1JZ3A 1BEV1 5KXCA 4HPKB 1REFA 4ONUA 1JHNA 4EZ4A 1M4WA 1AF9A 5F37A 2WQZC 3N9NA 3DYOA 4F7ZA 5JI9A 1HN1A 1JMUB 3K51A 4PBPA 5C4WB 2CGPA 4O9GA 2JECA 2EIBA 4BK4A 5ABJB 1KFXL 4YM2A 1ULEA 5JMCA 1JYVA 1S2EA 2LW8A 1ZZBA 4LLOA 4CTEA 4COUA 1UNBA 1MPXA 4N53A 2XKPA 2Y38A 2WT2A 1BVP1 4P9GA 3WVJA 4GALA 4NR1A 4JGZA 1IKQA 5FWEA 2I2SA 3RI8A 3AZZA 3JQXA 4XXAA 2DCYA 3IAPA 4I3PA 4XCAA 4OI1A 1AX0A 1COV2 2CYFA 2ZGPA 4P02B 4ZU4A 3GDBA 4GH4C 4SLIA 4Y5Z0 3SCGA 2VQTA 3JD73 2G19A 1R1A2 1JN2P 4P5YA 5FUPA 5K7PA 5KXDA 3WQBA 2RHPA 3B9CA 1ST8A 3OGRA 3B5LB 5IVYA 3KM5A 4Q1PA 2UWAA 5B4NA 1XSRA 2WZR3 3SC7X 1ULCA 2C1FA 3AFKA 3T09A 3KWVA 3OGJA 3M7AA 4A7YA 4WVMB 4ARXA 3MZHA 5F2WA 2AENA 4QGMA 2E7QA 5FZ0A 4YGCA 4Q4Y1 1FMD2 1X50A 1JTZX 1XYOA 2ADDA 5GZEA 3VHNA 3LFMA 3GXUA 4BH9A 4F3JA 5JCTA 3ZFEC 1QEXA 2BNMA 3TN93 1YFXA 1BKZA 3PURA 4YRDA 2KXLA 1BLZA 4COZA 1C1FA 3O1OA 2UYBA 2VY0A 1GOHA 2BZDA 1QJY1 3UKVA 1LOEA 1AR63 1RUF1 4CDXB 5CB7A 1NY72 1W8ZA 4TLGA 1UPSA 4FOYA 4Y1VA 3WEZA 3ZYPA 2VZ3A 4A41A 1VAKA 2ZAHA 3H9AA 3NV4A 5JAXA 3ZDSA 1IQAA 3GBGA 4ZS2A 3I97A 4UFHA 3MUY1 1K5MC 2HH9A 1JU3A 1QH6A 3HNMA 1J3RA 1XNAA 4JGYC 4UXAA 2QQOA 4XEZA 5A3PA 1O3TA 3POFA 4Y20B 1K12A 4S2FA 5F2SA 3HNBM 1P8JA 4QAWA 1I6XA 1IPKA 1IS5A 4IERA 3KS7A 4HT1T 1HW5A 1PGSA 2WZR1 3VKNA 2VAUA 5FO8B 4HKOA 4RD7A 5F5IA 4R9CA 2WZPP 2AZ5A 4LEJA 1WLCA 4XBLA 2YG0A 4YZ5A 1YHFA 5K0UC 2JDKA 4DINB 3HOBA 4RQPA 1QWRA 2ID4A 1W3XA 5EJZB 1OLMA 2MHFA 1E5SA 2JDMA 1VBE3 1OF4A 1DYPA 4AVAA 4FT8A 3D0JA 1JZ4A 3C7FA 4Q4X1 5FDBA 1DGLA 1KRIA 5FPVA 1TME3 3HEIA 3ZN6B 1UKGA 1W8TA 3U4SA 3EMRA 3ZXAC 3B9IA 4PCRA 4NIGA 2F17A 1AR61 2VG9A 3OB8A 5T5OA 4DIQA 3AP4A 1ND2C 3VZJA 3Q8AA 4Q8LA 1ASJ3 3GZAA 5CG9A 1WW6A 4DUWA 2XHKA 4EV0A 2PHUA 1N1TA 5KHKA 1SLIA 3DCQA 5DN2A 1V6LA 1QJU1 2W1UA 2E32A 4YSFA 2GNTA 5A7NA 1VBD2 4AGRA 4BQ5A 5A6XA 1H2MA 3CU7A 3KV9A 4JHTA 4NN0A 4EYUA 3KGLA 1UCXA 4R9DA 5D8AC 4QM8A 5KHJA 2L9LA 4M3CF 2NYYA 3R4SA 2GMPA 4QQ2A 4WVVA 1QHDA 3RZMA 1R082 4URTA 3KLSA 1KS4A 2BFUL 1EV11 2WNUA 2XJRA 3PVBB 3QOPA 2G9GA 1RHI2 1VRBA 4UOJA 3LFIA 3OPZA 2D3PA 1WW7A 2C4XA 3EJKA 3FFZA 5F3IA 1DZTA 1J59A 2BVBA 2VMGA 4AI8A 5E89A 4M4PA 4Q26A 5LB6A 4OI2A 2HBUA 3AMNA 3AC0A 3FC0A 3VKMA 3VZOA 5J36A 3JBG3 3VBSB 1VRH2 1OQDA 2DFCA 4ZPIA 1GBGA 4ET7A 4COYA 1ZRFA 3I2IA 3SKVA 3VBFB 3RZJA 2D43A 3H50A 5FKCA 4XF0A 1NT0A 2RJ2A 4W6XA 4DS0A 3UESA 1ASJ1 3S57A 1H9PA 1WBLA 2EXHA 2FDJA 4AVVA 5HPOA 2HWD1 2B42B 1NA1A 3ZIWA 3NJZA 4I0BA 3ZPYA 2BYVE 4Q0SA 1NCQC 2HLEA 3MIEA 2XLGA 4FFIA 4QQOA 4V2WA 4S2GA 5KXBA 2Y0OA 3NAPA 2EICA 3S6PA 3R4UA 1AR81 3KGZA 1W28A 2VVEA 3P5BA 4QWNA 4QU2A 1JI6A 1ENRA 5FPXA 4E27A 1BXHA 2YBSA 4AAXA 5CISA 3W5NA 3VHPA 2BW8A 2VUDA 3WOGA 2VUJA 4B7EA 1ENXA 1NCRB 2B39A 2QQWA 3LPGA 5GZGA 2CWMA 4AFDA 4M3CE 4AI1A 4DXZA 1MS1A 5FY7A 2WFF3 4GWMA 1SDWA 4H3WA 2VXJA 4QHZA 4CZSA 2RVAA 5JI7A 1RUD1 2FHRA 5C4WC 1IKPA 1C4RA 3WP4A 3ZXJA 4AYUA 4AEDB 3IKWA 5FOJB 2RR12 4F83A 1N1VA 3POWA 2D5HA 4QKNA 4DXSA 5ABJC 3LCPA 1PVXA 3APBA 1ZZ9A 5A33B 1T2XA 1CVNA 4QM9A 1I3HA 4AVCA 4J25A 2R073 1UWWA 4QPYA 4QU1A 4Y1ZA 4COVA 4WM8B 3V56A 1YQ5A 2BOJA 4AK3A 4QXKA 2ZKNA 4K7JA 4OYUA 2VH9A 3RJ2X 1EAH2 3O1TA 1S0CA 4QQLA 3VV1A 4R8HA 3MBWA 5LEJA 2DTYA 2G9FA 4GB31 4CU7A 2W1QA 1FXZA 1MQTA 4IDZA 1W9YA 5LBCA 2C24A 1I5PA 2D6PA 2PLV1 4KBBA 4LHLA 4BQ3A 3ACGA 2X10A 4QQPA 3I2GA 2D93A 2VQUA 3A22A 3I3BA 5FY5A 1OBNA 1QXRA 3WF4A 2P1BA 4UW3A 4MGQA 4O9EA 4A45A 3WD5A 2IXHA 4HZFA 1YNAA 3LEGA 4FVVA 3V0AA 3RFRA 1PM4A 1M06G 2XMLA 5T54A 5DZGA 1GOGA 2IVJA 1JHJA 3EBRA 1K45A 3T2TA 1UU5A 1GWMA 1I9RA 5JOWA 4IGPA 3WDXA 4ZZ8A 5FPUA 1O4ZA 5DUVA 1RUI2 1BBT3 4P00B 2ZEYA 4O65A 2NMOA 3H1MA 1QQP1 4Y26A 4CDXC 3ZR5A 1MEC1 1TNRA 4YVWB 2WRAA 4LMFA 1X9TA 5J1XA 1CAXB 1AX1A 2BU9A 4YVSB 5J3UA 4LBQA 2J1VA 2ARCA 5EYYA 4C90A 2VE1A 5A80A 1AYM3 2VC9A 1QIQA 4GJZA 3Q8EA 1OVSA 2W3JA 5J09A 2X53S 5CNAA 4WV8A 1O3RA 3J7NA 3HBZA 2ZXQA 3U11A 5FZDA 3RYKA 2FBEA 4IEZA 3ZSEA 4CE8A 4EE2A 2VOWA 1S0DA 3VZNA 1U0AA 5A7PA 4PT6A 5ACA2 4G9SB 2OS2A 2JG9C 3GBWA 4UW5A 2J1RA 2WNOA 1QDCA 1SHWB 3RMYA 3ZFFB 2ADEA 2VM9A 1VBC1 1X33A 3D4KA 3QCWA 1O3SA 4CDQB 3ZPOA 3AZVA 2XLAA 3LB9A 4RFRB 4GJYA 4C0HA 3AKTA 1YLLA 4FQ4A 3TEYA 1YJKA 5APAA 4MSVA 4QX5A 4Y33A 4XJWA 3JXSA 4E2QA 1ZREA 3T1LA 2RDQA 1BBT1 1GMMA 3H42B 2JEMA 4CDWB 3C8XA 5A1FA 2XJVA 2GNMA 4XUOA 5JXJA 3ZKYA 1LR5A 4V1PA 3BU0A 2ZEWA 2Z5WA 5A7WB 3ES1A 3LOBA 1W6QB 3QBQA 2UYAA 4RGAA 4A6SA 3TEXA 1Q8OA 4PDWB 5L7OA 3NJVA 2JIJA 4GZ9A 3ZYFA 4B1LA 1A34A 5FMCA 4Y22B 2JB4A 3Q8BA 4RR3C 1TNFA 3OY8B 4QT6A 4XAEA 3RVHA 1WUVA 2V72A 4CEWB 2BP6A 5EFUA 1W03A 4CP1A 4DRVA 3WHTA 5CKNA 3S0MA 1IOAA 3BTYA 3NMBA 4IV3B 3VKFC 1UY0A 3S7IA 1HDKA 5LWBA 1WWYA 2FZ2A 1HRI2 3POJA 1LEMA 5IATA 3VD4A 2PA7A 4XUTA 2JIGA 2PAMA 5ANNA 5AC91 3HJRA 5FXXA 3OD4A 1GP6A 1Y7BA 5F6LB 2WZEA 3I3QA 5DAWA 5LATA 3H8UA 1RUC2 2QQMA 3FLRA 4RHV1 3RZLA 1H4HA 2VQAA 4XABA 3VZLA 3AMQA 2EIEA 2A6VA 4QMAA 3PNAA 4Y4YA 5LY1A 4YW6A 3CO2A 1YO8A 2YB7A 2NMNA 3VBFC 1UKRA 4CRQA 1OUSA 2JG8A 5FUIA 2ZKLA 1UX7A 1XNTA 3EYPA 5FXVA 1COV3 3JD72 3MV11 5FLHA 1OUXA 1O8PA 3I2HA 3UV9A 3H7JA 3I54A 4NIAA 2QQKA 1CX4A 1STMA 3MW2A 4LOSA 4BQYA 5FYHA 3WLUA 2HBTA 4AVSA 5FPLA 1R1A3 4LK6A 4BCUA 1RYYA 2XKOA 5A6YA 4I02A 1O7FA 2VW2A 2EVXA 2LTNA 4HMZA 1NKGA 1IZ3A 4JZRA 4I3GA 2UWCA 3IN9A 2ZZJA 5H9QA 1FT9A 1MZEA 4QKDA 1UZZA 3TN92 3K2OA 1MS3A 3CKHA 1TMF1 4META 5FUNA 1NCRC 3S30A 3ZKUA 2YBKA 4Y1XA 1JZ5A 2GDFA 2VMDA 3ZFGA 4A4AA 3RRDA 2YC2A 1G6NA 2JB8A 1ZRCA 2WT0A 4LNVA 2V4AA 2W92A 1UX6A 3D0SA 2D7FA 5I0TA 4KU7A 3BOWA 4AEDC 3WQ7A 2VZSA 4Q8KA 5CBLA 4CPBD 2VVDA 3LIHA 2W1WA 2XUEA 5FZAA 3S5AA 1KD7A 1GU3A 3HT2A 3Q8FA 4W8JA 4D6RA 3WDYA 3KZ4C 2WZ8A 3B94A 3D6EA 4XF9A 4FQZA 3GZEA 1W2NA 4XJUA 1GFF2 1PVC1 1VB4A 2WDBA 4HBNA 4XFAA 1WZXA 1Q56A 1G8WA 4NWVA 3VHRA 1MS0A 1U5XA 3D82A 3ZXEA 3MLJA 3HIFA 5A3MA 2WNEA 2XVKA 3ZYIB 1NXMA 3GHNA 2IXCA 3ZXFA 4OCTA 3J7HA 3U75A 2VNRA 1W6MB 5EV7A 3VLBB 4Q0PA 5LZ6A 2OIIA 5LA2A 3C7HA 4PF1A 4IUGA 3BTZA 1ZRRA 2OUHA 5GLVA 3AZYA 1QGLA 5H9SA 1O4TA 2E63A 2PHXA 4KWKA 1FMD1 2BGPA 2YYOA 3IIIA 5K9YA 1I5ZA 4LLFA 4E8CA 2WBKA 2RS52 3SCFA 5KHIA 4H2AA 2J1AA 4CUCA 2ET1A 3LWCA 1RVF2 1Q8QA 1HRV2 4IETA 4B29A 1S55A 4AVBA 2NPIA 3I2KA 3ZXKA 4IEUA 1H2NA 3MF9A 1AJKA 2ZGOA 1AR72 1WCDJ 4DZGA 1QJFA 1NY71 4YFZA 2D6KA 3IDCB 1AYN1 4Q4V2 1NQDA 1ZRIA 3CDZB 5E16A 3R05A 2VR4A 4LITA 4YVWC 4AI2A 2HWF1 1YQ6A 3HR9A 3T0AA 1H2LA 4WM7A 4YVSC 4D6QA 2WWSA 3MLKA 1VBD3 1YQ2A 4AQ6A 2XJTA 4IE0A 4XDPA 1DQ4A 5GZFA 3DYMA 4GD4A 4L92A 2OXBA 3DPRA 5FY8A 1KXGA 2GSYA 5DMYA 1R083 5JR2A 4BWOA 1JS9A 3ZYBA 4XMAA 1KJRA 1V0AA 5FLJA 1RHI3 4N43B 4X6RB 1ZBA2 3WDVA 3ZFFC 2DURA 5GALA 2OYZA 2GP3A 4EJRA 1MVEA 5FZIA 1FV2A 1W9FA 2NM1A 5FQ0B 1JZ8A 2VJXA 4WVZA 1QOSA 2IC1A 1D4VB 5GZDA 1O5LA 4CDQC 1RUOA 4XTMA 4HG6B 5JXIA 4PI0A 1D2SA 1VRH3 1I1EA 3FHAA 4N8MA 4IGQA 3WNKA 1F35A 2ENRA 2J1UA 3VL9A 3J8F2 4CDWC 2DVBA 1W6PB 2J1TA 4JRLA 3KHBA 5I0DA 5FWJA 1NOVA 1E57A 3TWIA 3ROUA 2QCSB 4TZDA 4ES8A 2W94A 1JYIA 4PQ9A 4QHBA 4PDWC 4MXWA 4FPFA 1N3QA 4N90A 1LHVA 3OBRA 2ZX0A 1UYZA 4UF0B 5CFCA 3UYJA 2QQIA 3BKZA 5LBEA 2OA2A 1WMEA 1JU4A 2QJVA 1OH4A 1BMV2 3B02A 5F3GA 1W8WA 1YQCA 3ZXDA 2RMU1 2JD9A 3WNMA 2PAKA 2RS32 4CEWC 1CAWB 1RUE3 1UW8A 5JZGA 1RHI1 4IW3A 5F5CA 2RM22 2RV9A 4J1WA 3VDCA 2ZX3A 4IV3C 5M0TA 4QKBA 1V00A 2HWE1 1KS5A 3FBYA 2DU0A 2JKBA 1MS4A 4LO8A 1VBA3 2JDAA 3BUCA 3J4UH 1PX4A 4Y3OA 4OHZA 4CEYA 2MNGA 4OLLA 1W99A 2CNAA 3I7DA 2RR13 3WZ1A 5LEKA 2C9KA 1UQXA 2VCBA 3OEAA 5IK8A 3V64A 1J58A 1S0EA 4CSWA 4QB1A 4FPYA 3ZOIA 2D3SA 2JKXA 3INAA 4HFSA 1W0PA 3EHKA 3AMHA 4AI0A 5F7UA 2Q5TA 2R061 2TUNA 3LEMA 1PIV2 3CJIB 1UOFA 4LJHA 1EAH3 2GALA 1OD5A 2ORZA 2ZS6B 5BPXA 5I8YA 1E5IA 3PUHA 1Y4WA 1XJAA 2DFBA 3KT1A 4UW6A 3PUIA 5FJHA 1UZWA 5IK4A 1RUH2 2R49A 5BNNA 2WQ8A 5EJ3A 3LSDA 4XUPA 1X8EA 4XVHA 5E1RA 1A8MA 2FDHA 2WT1A 1B35A 3WW4A 3WDTA 4C1XA 4K8FA 1XU1A 3LZZA 2GNDA 2LALA 1V9U2 2PHFA 5DDJ1 3N7JA 1JYNA 1AL0G 1WMDA 4MH0E 4XFFA 5JLVA 3W20A 3OJBA 1OHFA 3VBHA 2YBPA 5FZ1A 5BNOA 1IG0A 2VOXA 2AR6A 3J9SA 4ZU7A 3WF3A 4TTGA 5FYCA 5GLZA 1GSLA 5A1AA 1JYTA 1RL3A 4UYBA 3IAQA 3UNPA 1GR3A 1RUI3 1SZBA 1W9SA 3ZSKA 2JDUA 4LT5A 3RG0A 1EUTA 3N9MA 4CCMA 1LAJA 5IVBA 1H1IA 1LGBA 2BDRA 5FZOA 4N9IA 1DLLA 3IDAA 5AVAA 1GP5A 5TSWA 3RZGA 1BVVA 3URFA 4XFIA 1POV0 1V6IA 4M3CA 1CPMA 5D8AB 1C57A 2CTVA 3T08A 4XJ8A 2WA3A 5C5UA 3K3NA 3VBUA 4G3YC 2CGOA 4XHXA 2VECA 3HBKA 2J42A 2GH2A 4BIOA 2DVAA 5ACA3 3ON7A 1BJQA 1JODA 4R4ZA 3VBOB 1DU3D 3VDBA 1W9TA 2UU8A 3KD4A 2WIIB 2PMWB 2OX0A 4UFLA 4EN0A 1QF3A 1WLDA 4Q27A 4Q1RA 1AL21 1C5IA 1AR91 1FNYA 1JYCA 1L7LA 1RJ7A 2RG4A 3H0OA 4P9YA 1N3OA 5FZ8A 3VDDA 3BIWE 1VBB1 2EALA 2OPWA 4L99A 2PHRA 2C5DA 2XJSA 3K77A 4B4PA 4YZ3A 2A3WA 4YYOA 2P5BA 1OF3A 4CU8A 4WVWA 2R6QA 2Q8EA 1SACA 2ZJCA 2KR2A 2YFUA 1XU2A 4GMP3
chains in the Genus database with same CATH topology
1RUG3 3SISA 5CVRA 2BNNA 3SNMA 4LBOA 1W2UA 4N53B 1POV1 1LHUA 2MEV2 3L9JT 4JGZB 1PMIA 4R9BA 3EXUA 1CJPA 1EYBA 4AQSA 3PVNA 1Y9QA 4KWLA 5FOBB 3POYA 5GLUA 4AVTA 4NOTA 4E4DX 3MIFA 2A73B 2DWRA 2JX9A 3IDEA 3QACA 4P9IA 2BWCA 1BYHA 2PELA 1HRI3 3OCPA 4XFBA 4OHWA 1PO11 1QY4A 4AHYA 4N43C 1OFNA 3WCRA 1PO22 2IXLA 2WS93 3RJRA 2VPVA 4K6BA 2OZJA 3UK9A 1RUC3 1OI6A 2R041 4PLMA 2D98A 4M0NA 2R0FA 2BQPA 2DUPA 1D4M2 2OVUA 4FTSA 2ETEA 2GZWA 3TAYA 2HKXA 3WG4A 1ZM1A 3IWZA 5HCFA 4YG0A 2JE7A 2XWJB 1LKNA 3PVEA 4LBMA 5C9AA 1SCRA 3VUOA 4EN6B 3AKPA 4U36A 2F4PA 4QGLA 1KQRA 2WQ4A 2KA3A 1OMIA 1DGWA 5B2GB 2YROA 4IL7A 4LA3A 1PK6A 2IFWA 2HEVF 1VAMA 5BXXA 1FYUA 2Y0IA 1VB2A 2XB6C 1UIKA 2IZWA 2WL1A 1HLCA 1YFUA 4FOWA 3WXPA 4OUMA 1W6OA 1B09A 4U2AA 2PAEA 4P5HA 4RQPB 5T52A 4MGZE 1B35C 3ZO0B 4AW7A 1YIPA 2ZGRA 4EWEA 5KBFA 2W08A 2WNVC 2GAUA 3M2MA 1FX5A 1CESA 1ND3C 1OLQA 1YUDA 3X29B 4NWWA 3WG1A 1FAYA 3JD71 3AB0A 4CYDA 3AP7A 3M8LA 2A71A 4C0BA 2DUQA 3CJIC 1XQNA 2JG9B 5KXEA 1YCIA 1VALA 2C9AA 4OI4A 1U12A 1X36A 2FMDA 4IESA 4B4RA 2AUYA 3RQ0A 2N7GA 4G4FA 1AXZA 1WW4A 3R4DB 3TN91 4AQTA 2A7AA 3KT4A 3CLPA 4I09A 5L36A 1LOFC 2WNUB 2RS53 1QJX3 4XBNA 2HWC2 2VW1A 4B3NA 1PHMA 3FHIB 2D6MA 1XE8A 1RVF3 1HRV3 1LGCA 4XJAA 2JD4A 2GC1A 3NW4A 5E8AA 1KITA 2FZ1A 1NZCA 2YMZA 1AR73 1WD4A 3I4IA 4HK8A 3E6CC 4Q4V3 3B69A 3FMGA 1DGWX 3VBRA 3E6DA 5J98B 5JOYA 2Q30A 1GZ9A 4BMBA 4RR3B 4YLZA 4YW2A 1LESA 1AX2A 2TEPA 5GJ6A 4PF5A 1N47A 3UJOA 2BUKA 2ERFA 1NA1B 2GN3A 3AYEA 2VXRA 4H55A 3TBDA 1XNCA 3VBOC 1VBE1 3NAPB 1SBFA 1ZBA3 2XLFA 1TME1 1GZWA 2B9UA 4Z82A 3V0BA 1REEA 1V6JA 1CJDA 2QUOA 4MGYE 4PIZA 1RVF1 1NXD1 1ZVFA 2XUMA 2DCZA 1AR71 3RYRA 2G4IA 4LO6B 2D6LX 4IEPA 3J8F3 4Q4V1 1ZRDA 2AGSA 2BVVA 1J3PA 1CAUA 1YWKA 4FPEA 5E88A 4XF1A 4YFWA 2X8KA 3QLQA 3BCWA 5T50A 2HEWF 4FBFA 4N53C 2YDEA 1GNZA 3IIAA 4FPJA 4JGZC 4LBLA 5T3NA 3H3ZA 2DV9A 1WCKA 2YXSA 1MS5A 1IHMA 4LBKA 2A70A 2EA7A 1RUE2 3HT1A 3NSTA 3CEWA 4YGEA 3GZUC 1TE1B 2ATFA 2RS33 4WZFA 2XL9A 4FPKA 1G9CA 4QPIA 1MQTB 1D0HA 1YI7A 2RM23 3MPPG 1VBA2 3MFAA 4M0HA 1QMJA 1WW5A 3JBG1 5FO7B 3M4FA 5C8CA 4RS5A 3HAGA 4LO7A 4JAAA 4JRAA 2AYHA 3V0AB 2K0GA 2ZGLA 2D44A 3ZSJA 1OA2A 4BPZA 4HANA 4XFGA 3A4UA 1Y3TA 1H8VA 1U5YA 1PIV3 1GV9A 4AEKA 2ZGUA 4P9LA 3USUA 2K9ZA 3ELNA 1URXA 4UBGA 5I0RA 4TLFA 2ZX2A 4LBQB 1RUH3 4PBOA 1BMV1 1SEFA 4RSUA 4E9KA 4C91A 4I2OA 3NL1A 1MACA 1ZBE2 4INDA 1DQ1A 2RM21 2WFF1 1V9U3 2ZX1A 4HKLA 1C3HA 3GZTB 1CPNA 4L9BA 3HD8B 2YUEA 1QU0A 4OUSA 4YW1A 5JIUA 1ULGA 1HXS2 4Q0UA 3UKTA 1CIWA 3EO6A 5I8TA 4BOWA 4HKWA 2R071 4RQPC 4IV1A 2RJKA 1LHNA 1G9BA 1GNHA 5AFEA 3N36A 3WP3A 2ZTNA 1HQNA 4PLNA 4FSJA 2RS12 1RUJ2 3KCCA 2LM3A 2X29A 4TSVA 4CDUA 4GIQA 3MW4A 4XE9A 5CIRA 2JXAA 4LBQD 2DUOA 3UKNA 5L7OB 1AXYA 1IS6A 4PIYA 1LODA 3LA7A 2OPKA 3P3NA 1Z7S2 4Z07A 5LK7B 3C2UA 3I8TA 4JDOA 4IEVA 4XBQA 4D3WA 1Q8VA 3IT8A 4NHKA 4I30A 4BHPA 2PQQA 2JICA 2UWBA 1GQGA 1ZYBA 3WG2A 1MZFA 4FXGB 5J37A 4A7KA 2WNUC 4XFHA 4H7LA 1FPN2 1BEV2 2PHTA 2ZCWA 2VOKA 5I91A 1RUG2 4YG3A 5DUXA 3WW3A 2XVGA 2EF6A 1AYM1 3N7MA 4ZU5A 2B8MA 2XJPA 4IQPA 4MLOA 3WT3A 4Q4W2 2QFEA 1IS4A 5JR7B 2QNKA 1S0FA 5EXOA 2MEV3 1CAXA 5CFDA 1OQEA 2GMEA 4XF3A 2H6BA 2JG8B 5FAXA 5T5PA 1W0OA 1DZQA 4LHNA 1PM7A 1LENA 1WBFA 1WCSA 5J48A 1NA1C 3O12A 4B4QA 2WS92 5C33A 4YW4A 3NAPC 2IXJA 1QH7A 3ZXLA 1RJ8A 1PO23 4XJZA 5A32B 3L2HA 1V6KA 3AKRA 3JB4C 5BNPA 3GBFA 2VNOA 2XH6A 1SLLA 1X8MA 1D4M3 1QNYA 2JE9A 3TYJA 2P3KA 4AFBA 4Q4Y2 4GKXA 3LA2A 4Z2WA 3NWKA 4YG6A 3ZFGB 5IK5A 1R1ZA 3KB5A 4JCKA 3WW2A 4HLTA 2A6YA 1NYWA 2X5IA 2D3RA 3KSCA 3I59A 1WGPA 4RS5C 4LR4A 4XTPA 1F5JA 4R52A 1RC6A 3R0RA 2I07B 2HEYF 4L11A 5J7MA 1S0BA 2Z69A 1OQ1A 4W65A 4DOUA 3QH7A 5EWSA 2WINB 3WUCA 5J96B 4TYSA 4A2UA 3U10A 4NHMA 1MQTC 3RNSA 4YM0A 4FP3A 1GYKA 5DG2A 4XW3A 1JH5A 5FPZA 1CR7A 5CAZA 2XBO2 2WSUA 2UY8A 2GNBA 3KT7A 1COV1 2VNGA 3QH6A 4Y24A 4K3UA 2EIGA 1WMFA 1G86A 1YYNA 4Q4X2 2KM2A 2V73A 1R1A1 3VHOA 3VL8A 3ZMOA 4OI0A 3G7DA 3ILRA 3PTYA 3SITA 4DMIA 4WM7B 1YFWA 4CP2A 2YGLA 4RA0A 2GU9A 2IWGB 2PTMA 1C8M3 3NV3A 1QJU2 1UAIA 4DFSA 2VVFA 5T5LA 1QJX2 4YGDA 1X7NA 4Y1YA 5HCAA 3DPRB 3ECQA 4XXPA 1QOOA 2ZGTA 2O1QA 3PJYA 4KGGA 4ISQA 3N35A 4QPGA 2HWC3 5JSPA 3N7KA 1DFQA 4LULA 1EV12 3M1HA 4QQHA 3WDWA 4E2GA 2ZMNA 4QGNA 2DCKA 2V5YA 1Z0HA 1H8TA 2DU1A 5I0UA 3RMXA 3SXWA 1UIJA 1S0GA 2R30A 2UY9A 2Q8OA 3ZVXA 3OYWA 3CL1A 3CF6E 4K21A 4GWNA 2Z42A 3HMYA 3ENRA 2GH8A 1FATA 4XOGA 3JQWA 3JCIA 1C5HA 5L7OC 2GMMA 4BZ4A 1O91A 1SLTA 2HWD2 3DF0A 5CFCB 1H1AA 4B8EA 4LHKA 4XQWA 2H0VA 4FXKB 4GXLA 3ASIA 3AP9A 3HWJA 3LAGA 5JZGB 3W58A 1CGPA 1N1YA 5LRSA 3MLLA 3OGGA 4BMEA 4KL1A 4LE3A 2ZACA 5D1IA 4CEYB 1YFYA 3M3CA 1LOAA 3IBMA 5A3LA 3GNEA 1VBD1 1SFNA 3JZVA 4FO9A 5H9RA 2YC0A 3MI8A 2PFWA 2WLPA 2JG8C 4E2SA 1FV3A 4JDMA 1KJLA 1R081 1YIFA 2Q0AA 1EPWA 5GM0A 3SMHA 4FTBA 3DV8A 1SMVA 1DIWA 3J26N 2PHLA 4DY5A 2ZAAA 2PN5A 5BNNB 2NLRA 4XYXA 3SH5A 3VZKA 3PLQA 2PLV2 1B35B 1VRH1 4MGKE 3AJYA 1KFUL 4FPLA 1AJOA 2WNVB 1ND3B 3VBHB 3VZMA 5BNOB 2EXJA 3TNQA 3ZFGC 4DB5A 2R16A 4GH4A 1S0JA 1XRUA 2IFRA 2YZ4A 2ZGKA 4BM8A 4R9AA 3WP6A 1OPOA 1NLRA 2EAKA 3O14A 1LULA 4X8NA 1QQP2 4PIXA 1MEC2 1CAVA 1RUE1 1G9FA 1D0GA 4M3CB 3POSA 5LK5A 3ZYRA 1ZBE3 2ZHKA 1PGL2 1DYKA 1VBA1 3VBUB 3ZIXA 4EROA 4S2DA 2XPJA 1W39A 3ZFEA 3FBMA 4WZCA 5HI0A 2TBVA 2P2KA 2RR11 5H9PA 1HXS3 3IPVB 5AFBA 1AVBA 4DY3A 2K2SA 2NQYA 3E5QA 4YGBA 1VBC2 3VDDB 3LA3A 1YXWA 2QKDA 3M3EA 1LOCA 2Q4SA 1VAVA 2RS13 1RUJ3 1EP0A 3N7LA 5KC5A 1EAH1 1K5MA 4BE3A 4JGYA 3AXEA 4P9WA 4MX3A 2WLQA 2ILMA 2O8QA 1DGRA 3FX3A 4XZPA 1JUHA 1UN1A 4XPVA 4M00A 1WD3A 1OSGA 1OLRA 5GKAC 4WM7C 1Z7S3 1MS9A 1X82A 3FUQA 5K0UA 1OKQA 5JOXA 2XJUA 3TNPB 1J1TA 3DL3A 4Z92B 2VOVA 4LA2A 3BB6A 5JOZA 3DPRC 5I93A 4XETA 1RUI1 1FPN3 1BEV3 4GMP0 3TOJA 1ND2A 1PZ8A 3O5SA 3AKQA 3EQEA 5AC92 4JVAA 1W6NA 5C8WA 2RS11 4CP0A 2JDZA 4WBBA 4LBJA 4YZ4A 1CONA 2HYKA 4RHV2 4Q4W3 2CAVA 4W6WA 4XIKA 5HBAA 2W52A 3W9AA 3E5XA 4AGGA 3U07A 4JTNA 5ACA1 1HQLA 1WLWA 1XNKA 2BFUS 5C9AB 2CV6A 2P17A 1O3QA 1XXNA 4K1ZA 5CFCC 2XGXA 4ZXKA 1LU1A 3M3QA 2SLIA 1N3PA 1LTEA 2ZMKA 1UU6A 4FOQA 2CGNA 1PK6B 4I0AA 3MICA 3VKLA 5JZGC 1OOPA 3SLIA 5CU1A 3VN4A 3AP5A 4GMP1 2B46X 4D7YA 2VGDA 4Q4Y3 1RUG1 2ZGMA 1TMF2 3H1WA 1W6OB 1FOD2 2R32A 3SHRA 1HKDA 4CEYC 2GC3A 2VW0A 4OFGA 4Q4W1 1NCQA 4HVQA 1SBDA 3MW3A 1QJY3 1NE4A 2XVLA 4IEWA 2DCJA 1NE6A 1RUF3 1XNBA 2E7TA 3BALA 4AHZA 4FOVA 2ZHNA 5HXVA 4P14A 3H1YA 1GICA 1ZA4A 2GC0A 2VULA 2TNFA 5CA6A 1RB8G 1HRI1 4AEJA 3ATGA 2P34A 1PVC2 2AH2A 1QXJA 4HPKA 4ORFA 3LKJA 2Z79A 4ISRA 3AMPA 2WS91 4MV2A 2O8OA 3BTAA 1RUC1 2IXKA 4NVPA 5BNNC 5C4WA 5EYXA 1LOGA 5FFOC 2XBO3 5CG8A 5ABJA 4H14A 1JW6A 1AXKA 3MFCA 4JDNA 3B7MA 4LTAA 3ZN5A 3WP5A 4XMIA 4XF4A 4YNIA 3VBHC 2DVGA 5BNOC 1UZYA 1O5UA 3B01A 3MDPA 2D97A 5HCBA 4TWTA 3WW1A 5KWRA 1LU2A 4Q4X3 3TRSB 3AMMA 4YM3A 3M3OA 1ENQA 3OF1A 5DUWA 4IEXA 5EZWA 4SBVA 2WA4A 3VBRB 1AYN2 2HWB2 5DG1A 2GC2A 3TB0A 1C8M2 4JV4A 1VIWB 2HWF2 2ZA9A 3NVCA 4WVMA 4AGVA 3IM0A 3RS6A 3SH4A 1QJU3 4Q2FA 1QNWA 2LUWA 2CL2A 1A3KA 4EN8B 2Y26A 4GKYA 3VBUC 2BPA2 1Z78A 3AK0A 1EPZA 4JQRA 1LCLA 2XBO1 4GQ7A 3FE5A 5I8SA 4FPHA 1EV13 2YV8A 1GZWB 4CDXA 3WY6A 3V0BB 3GALA 3VDDC 2BWAA 2ZPXA 3MPBA 4KNCA 1IGOA 3MEPA 5F9TA 4XILA 5AVPA 5IUQA 1XNDA 3JUUA 2QDRA 4Y20A 1CAUB 2B7YA 2BNOA 4HVOA 4W6YA 3ZSMA 3N3HA 1RMU2 1U5IA 2JG9A 5SV5A 3RZZA 5JWPA 1GLHA 2DCTA 4XIOA 3NKGA 2HWD3 1NLSA 3BPZA 1APNA 3AKSA 2RS51 1QJX1 3FFQA 3OBTA 3WG3A 3U4XA 1PGW2 5DXDA 4YZ1A 2NZ9A 5F5QA 1AR83 1HRV1 2ARXA 2RMU2 4QPIB 3ZN6A 2JJ6A 2Q1MA 1G9AA 3MF6A 2PHWA 1LOBA 1YRZA 5C8CB 2HWE2 4RS5B 1U5ZA 1Q43A 4AG4A 2YPJA 4DNYA 1ZZ6A 1C28A 1ZX5A 2EXIA 2YGMA 3MIHA 5JIAA 1NG0A 3NV1A 1RUD3 4MYEA 4BLIA 2R1BA 3WCSA 1O4YA 1A6CA 3P3PA 3E97A 1OOPC 4A3XA 4A7ZA 4BA6A 1R092 1SQ4A 4RR3A 3MGUA 2E9QA 5JPNB 3DN7A 1IPJA 1D2QA 1TEIA 4OHXA 3USUB 2R062 3WINE 5C9AC 1ZBA1 2OUJA 2DTWA 4P9JA 4GB33 1UU4A 5BNQA 5BV6A 1BZWA 3H3UA 2PLV3 5FO9B 2B5HA 1PK6C 3AYDA 3VBSA 1A78A 4RGGA 3J8F1 1FNZA 5DDJ2 4AFAA 4KU8A 4AHWA 2BEOA 4AEMA 1L3JA 3VBFA 2ES3A 4FCAA 4Q29A 2R0HA 1BQPA 2XL7A 3Q9OA 4IV1B 4AFMA 4RL7A 4KWJA 2ZOEB 4F8AA 1GQHA 4LUKA 1QQP3 1MEC3 2RS31 5DUUA 4FAGA 4CDUB 1GKBA 1LGNA 1MR5A 1HQWA 1NCRA 1YJLA 1XYPA 1VR3A 3B00A 4GULA 1PZ7A 1AUYA 1TQ5A 4MVTA 2Q1ZB 4AEDA 1Q3EA 3ZYJB 5GLWA 2JENA 4L97A 2RJLA 1LEDA 3MIGA 3PJQA 5A33A 2UURA 1VLNA 4AWDA 4FPGA 1VBC3 2ET7A 5FBZA 4DRRA 5T55A 1AL22 4N7IA 1AR92 1F8VA 4WM8A 4I01A 4N9HA 1AHSA 1PIV1 1VBB2 4H7MA 3RPQA 3FJSA 4M01A 4FPCA 2ARBA 5JSOA 2E51A 3ETQA 4IEQA 5FRAA 1RIRA 1RUH1 4K1YA 3CNAA 4YW5A 2WSVA 2WC2A 1QDOA 3VBRC 4L2NA 3DGTA 5CFDB 1V9U1 5GLTA 4AFCA 4LO5B 1J1LA 2NN8A 1SBEA 1PGL1 3C3VA 3IDBB 5I0SA 3JU9A 1HV1A 4KH9A 1DQ5A 3UL2A 4K40A 1IS3A 3OD0A 4AXOA 3I2DA 5CADA 2FMYA 1RTVA 1PO12 4UBHA 5BNPB 5KHGA 1ZZ7A 5AC93 3BODA 3R6SA 2CAUA 4FPOB 5DZEA 4YVWA 2A3YA 3CJXA 3WHUA 4ZKTB 4JTOA 4YVSA 2R042 3MIDA 4HETA 1V6NA 3ST7A 4BLJA 4RHV3 4YM1A 5BY5A 1WA4A 2O0OA 2QDNA 3HQXA 5KC6A 3GHMA 4D7SA 2XWBB 3MIBA 4AHXA 2X5IB 3SCHA 5JVVA 4BIFA 1H1MA 3BU7A 3N4MA 3I59B 1LJ7A 1DG6A 1OA4A 4N7UA 5K8SA 3KQRA 2I45A 1UF2C 4OULA 3ZFFA 5T5JA 1WLTA 5L73A 2I74A 4HVRA 1H0BA 4GA9A 4CDQA 3AYAA 1PZ9A 4P9XA 1DF0A 2RE9A 3ZMNA 3O7OA 4LE4A 4AF9A 3FZ3A 4QPIC 3THPA 4MZUA 4J6GA 2E6VA 4CDWA 5L19A 4Q0QA 3WDUA 3JB8A 2GN7A 1TMF3 1ZNPA 3GYDA 4RFT0 4XQ4A 5C8CC 1FOD3 1F9KA 3AJZA 3H7YA 1W6QA 1QJY2 2MEV1 4XDQA 1HIXA 2V09A 4PDWA 1RUF2 2EXKA 5FLIA 1LHWA 3PMEA 3VBSC 1LRHA 4AI3A 4Y22A 3FUOA 1OFSA 2QZ2A 3D5OA 3OY8A 1HX6A 1QJZA 2DF7A 4X6QB 2A3XA 3AM2A 4CEWA 1PVC3 1T6GC 4IV3A 2W68A 3FWEA 3DUIA 1VP6A 2Z2SB 1PO21 4ATEA 3ZN4A 3E6BA 2WKKA 3FLPA 4MUVA 2WZR2 4D7TA 2B45X 1PNGA 1UMZA 1CN1A 1D4M1 1F5FA 4YARA 2QVSB 4NPRA 1DQ2A 3KCYA 3ES4A 5A32A 3ZX7A 3PHMA 4HN1A 4KQ7A 2ZGQA 2XJQA 4QPGB 1FMD3 1FOD1 3QD6A 5GZCA 1V70A 2DVFA 4OZXA 5F6KA 1Q8SA 1UD1A 3KCXA 3O0VA 2ZX4A 3WQ0A 1AR62 2IXIA 4ITCA 4IV1C 2P3IA 1H8TB 1FI2A 1XYNA 4EN7B 3OYWB 3PVOA 4UW4A 1AYN3 2HWB3 3ZXGA 2DVDA 1Y43B 4XQDA 1QKQA 4WM8C 1LHOA 1MVQA 5LRRA 1SCSA 3O0XA 3VGIA 4CDUC 2HWF3 3PMSA 3A0NA 1MZ5A 3LGRA 4B7KA 5IK7A 5FMOS 1A8DA 4D69A 2BGCA 1JBCA 2OZ6A 2OW4A 2QQPA 5KHHA 3ILFA 5FTTC 1RITA 2ZHMA 3AP6A 3T1MA 1QOTA 1ULFA 3NO8A 1G7YA 1S0IA 2ZHLA 1VBE2 3WUDA 1ZZCA 4NO4A 2E53A 2BTVC 1TME2 1S2BA 4XJ9A 1SLBA 4MGIE 4J1XA 2YY1A 3LSEA 4D94A 3NV2A 1JXNA 2CWSA 4MXVA 1G9DA 2MPFA 1ASJ2 2HWB1 2VMHA 1JOJA 4MXWB 1C8M1 1RMU3 3BOPA 1W6MA 4Z8BA 5BYNA 4E4SA 5CFDC 3NKTA 4PLOA 4COWA 4K9SA 1AR82 3OTFA 1XE7A 2HWC1 2E7AA 2PHDA 4NHLA 4DPNA 2CY6A 3K48A 4QD2A 4AE2A 2VUAA 2RMU3 4LUMA 1CQ9A 3WQ1A