2JDKA

Lectin pa-iil of p.aeruginosa complexed with disaccharide derivative
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
114
structure length
114
Chain Sequence
ATQGVFTLPANTRFGVTAFANSSGTQTVNVLVNNETAATFSGQSTNNAVIGTQVLNSGSSGKVQVQVSVNGRPSDLVSAQVILTNELNFALVGSEDGTDNDYNDAVVVINWPLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lectin
molecule keywords FUCOSE-BINDING LECTIN PA-IIL
publication title X-Ray Structures and Thermodynamics of the Interaction of Pa-Iil from Pseudomonas Aeruginosa with Disaccharide Derivatives.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
total genus 20
structure length 114
sequence length 114
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07472 PA-IIL Fucose-binding lectin II (PA-IIL)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.400 Mainly Beta Sandwich Jelly Rolls Calcium-mediated lectin 2jdkA00
2VUCA 1W8FA 4CE8A 2BP6A 2JDUA 2JDNA 1OUSA 1OVSA 4UT5A 5A6XA 2JDHA 2WRAA 2BV4A 1W8HA 2WR9A 5D2AA 2JDYA 5A6YA 2VNVA 1UQXA 4AOCA 1OUXA 2JDPA 2BOJA 5A6ZA 2BOIA 2JDMA 3ZDVA 2VUDA 5HCHA 1OVPA 2XR4A 1GZTA 5A70A 1UZVA 5A3OA 2JDKA 3DCQA 2CHHA 1OXCA 5A6QA 1OURA
chains in the Genus database with same CATH superfamily
4ATFA 1HKDA 2LALA 3BTAA 1DGWX 1MS0A 2Z79A 1XNKA 2W0XA 5GZCA 2W95A 1PM4A 2Q5TA 1QJY3 3RYKA 1RUI1 4XJZA 3ZFGC 1BZWA 1NZCA 2WR9A 4BQ4A 4AK3A 1QWRA 2B45X 1S2BA 2X5IA 1IGOA 3JB4C 2JIJA 5CVRA 1XYNA 1POV0 1YFWA 2RE9A 2DCZA 4DEQA 1VBC3 2Q30A 5FYHA 3HD8B 3OPTA 2VCMA 2IWGB 1GNZA 4NIIA 4KI5M 3KVBA 3POSA 3ES4A 1CAVA 3KM5A 2QBXA 1DBNA 2GC2A 1LU1A 2D44A 3ZYFA 4AHXA 3POWA 1ZBE2 3ZM8A 3RYPA 3VBOA 3WNXA 2RMU2 2DUQA 4BXFA 2LM3A 2A6ZA 1S0JA 5JZGC 4PBPA 4QXCA 4YGEA 3I97A 2GDFA 1FNZA 1UD1A 4CCJA 3GBFA 3BU7A 3M3CA 2W68A 1DLCA 2QQIA 3SEEA 4MVTA 4WVWA 5J3UA 5I8SA 1JMUB 4EN0A 1U5YA 1W6MA 1YQCA 2PQSA 1A8DA 1W8NA 4AI0A 4EWAA 3PVEA 3N3HA 4DXTA 4YW3A 3E6DA 4HETA 2P37A 1AVBA 5F5QA 4FTSA 2FDKA 4NVPA 4D6SA 5IT6A 4CE8A 3O12A 3ETQA 1QGLA 1ZRIA 3UK9A 2A3WA 2JECA 3QLQA 5C70A 1SLTA 4FPHA 1L7LA 3KLSA 4XQDA 3HBZA 5CYYA 3RRDA 5L7OC 4ZS2A 2AYHA 1YNAA 5FPAA 5FWJA 3WDTA 2DVDA 5B4NA 4LULA 1PGL1 4HMZA 4HXCA 2WFPA 4GKXA 5KHIA 1W0OA 5IAVA 2R0HA 2WZR3 3SH5A 5JLVA 5FY0A 1VB4A 1FOD2 2R30A 4AFAA 3O1VA 1CESA 1RUD3 2XQRA 2B5HA 2Z4FA 4JHTA 4OZXA 1UOJA 3T2PA 3I3DA 1D4VB 5T52A 5A7PA 2WAAA 3VBUC 1NQJA 4L92A 4CDXA 2FDIA 1RUI2 1H1IA 4FFGA 4GQ7A 4I0BA 4N53A 4OHYA 3NKTA 5JWPA 4ITCA 4X6RB 1YXWA 3VGIA 2TUNA 4WZCA 3USUA 1JU3A 4XBLA 3VDAA 2RVAA 1ASJ1 2UYAA 2ZJCA 3DPRB 1PGW2 4XCAA 5LWBA 4YVWC 5FPLA 1J59A 5L19A 2YPJA 5G05L 1LJ7A 4COVA 2X53S 2D6KA 3WY6A 2WFF3 3L2HA 3ST7A 5IFPA 1Q8OA 4GWNA 3ZFGB 3NJXA 1CPMA 1W8TA 5J7MA 3WW3A 3AP4A 4I02A 5FXVA 4NAOA 2YYOA 3K4DA 3OEAA 3KHCA 4JCKA 4FP3A 4NWWA 4QHOA 5FYCA 4PT6A 1R082 3ZMNA 2XPJA 1KJLA 1VLNA 5LA1A 4IE4A 5FXWA 3MW4A 3TBDA 2P17A 2FZ1A 3LFMA 3N9OA 5A7WA 3KHBA 3CHXA 4JGYA 3I2JA 4MV2A 5C5UA 4AAPA 1OPMA 4RQPA 4D94A 2JXAA 4H55A 2XOMA 3LSEA 5F2WA 1UXZA 1XSQA 5C6CA 4YZ2A 4ZZ5A 1L7RA 2DCKA 4UI9L 4CDWA 2QQNA 4K3UA 3S5AA 3HT1A 1QOOA 1CAWB 4PIYA 2WQ8A 4P5YA 2ADDA 3RNSA 1HDKA 2ZS6B 3C2UA 3MO4A 5FZOA 4BHPA 1FMD3 1H4HA 1TMF3 2P3KA 5A1LA 3ACFA 1EPWA 2B8MA 4GB31 2VGDA 4G3YC 1MVEA 1ULOA 3ZPYA 1X8MA 1NCRC 5ANQA 4ZU7A 1SBDA 3AYAA 3NV4A 1VAKA 5FYUA 3TN93 4KWLA 3MLLA 5C3SA 3LDBA 4N7IA 5BNPA 2VQ0A 4E2QA 5FY9A 2N7GA 1RITA 4XUTA 3N9PA 1YJLA 2E33A 4P9GA 2Y34A 5JI9A 1VE0A 2I07B 1TZOA 4QB1A 3SCFA 3WZ1A 3QD6A 4UFLA 5FZHA 4FTBA 2UY9A 4P9IA 1WUVA 4FBFA 5L7OB 2G1MA 4UOJA 3VZLA 2W87A 3A7QA 1TG7A 1C5HA 1W0NA 3W9AA 5GJ6A 5A3UA 1D4M1 2QUOA 1PIV3 3OY8A 5FZGA 5A80A 4XFHA 2XGXA 3KMHA 3WP5A 5EIYB 2D93A 3JZVA 2QVSB 5J96B 1UAIA 1V6KA 2VMCA 1N1TA 3M4FA 2RG4A 3TAYA 1S0GA 2VOTA 1VJ2A 3NJVA 3T1LA 3FBMA 4R52A 2G9ZA 5LBEA 3VBUB 1MEC3 3VD5A 2AUYA 1XNBA 2ZA9A 3HR9A 5A7QA 1W2NA 1LEDA 5ABJC 2Q8DA 4DEVA 4D6QA 2WWSA 1YFXA 1AXKA 1V6NA 2XR4A 5FIXA 3K4AA 1TME2 4JRLA 4ASKA 2JG8B 2HBTA 4PLOA 3M2MA 3AK0A 4YW5A 2VZUA 2PN5A 5EQUA 2GNTA 4YVWB 2E7AA 3P6BA 3AKTA 4XFCA 4Y1XA 5FTTC 5GM0A 3T0DA 3KVAA 2BP6A 1A34A 5A32B 3W20A 3MFAA 1S55A 4Q0QA 3BPSA 3C7OA 2AZ5A 5I0UA 2QDNA 4BCUA 1O4YA 4F8AA 4Y26A 1OLME 1W8HA 1VRH2 4JQTA 5FUIA 3BOWA 2V5YA 3I7DA 5LY1A 4HPKA 5FO8B 3JD73 5J09A 2OX0A 4GB32 3CZJA 1G7YA 3ZDVA 5FJKA 3BYWA 4K6BA 3WQ7A 1CAUA 2JDKA 1BEV2 3RS6A 1O6UA 1W28A 3VDCA 2YGMA 4TN7A 2CAVA 1PNGA 5E88A 3T2TA 4AVBA 4QPYA 4IEVA 4EN7B 4XUPA 5FRAA 1MQTA 1SFYA 3MUZ1 4I3PA 4LITA 2R043 4MHUA 4XJAA 2ZX1A 2OIIA 2RS51 1A3KA 3LIHA 3VZJA 1ZREA 3V0AA 4Q5OA 2DVAA 2JJ6A 1VMFA 1VMHA 2HEVF 1HQLA 4R9CA 2W1UA 1K5MC 5FLJA 4JDOA 5LEJA 5LRRA 1LU2A 5CG8A 3RMXA 1PO23 3H50A 3OJBA 4TXWA 5EPAA 5C8CA 4LO5B 3TEXA 2IVJA 1L7QA 5F3IA 3ZSLA 4D7YA 1G6NA 1S0CA 3RPQA 4QDQA 3OGRA 1IOAA 1BVVA 1GZTA 2HWE2 2H0BA 4HLTA 1PVC3 3OUHA 4DPNA 1QDOA 1C1LA 1DZRA 1XE8A 3SCHA 3KGLA 3ZN6B 4ES9A 1CX1A 2XLAA 5GALA 3D82A 4HOOA 4AW7A 5C3RA 3ILFA 1PMJX 1I9RA 5FYTA 3B7MA 2XBO2 2VQAA 4FPLA 5DQ0A 3AP7A 1FPN3 4Y5Z0 5TSWA 1PX4A 2RS12 3UETA 2ZGOA 2PHFA 4TLFA 5ISLA 2A1XA 3WDXA 3I3EA 3DECA 2GC1A 1E5HA 1FATA 2XVGA 2JE7A 2VUDA 2BTVC 1WZXA 2VE1A 2KR2A 2WO3A 4CDUA 1OH4A 1UYXA 2Y6JA 1QXJA 4IEUA 4LE3A 4XIOA 3WLUA 1UW8A 4RR3C 3AMMA 3H7YA 1NA1C 2HWC1 4OFGA 1OURA 1I3HA 1O59A 2E9QA 3KV6A 2YZ4A 4NPRA 1CJDA 1IHMA 2JD9A 3IZOA 3Q8BA 5FP8A 5AVPA 4MGIE 4Y22B 1N1SA 3NAPC 5ABJB 4BH9A 2GMMA 4AVVA 3MIDA 3WNOA 5IVEA 4MGYE 2D6NA 4QQLA 4TSVA 1NAEA 4AEDA 3SITA 3EMRA 5FAXA 4BJ0A 1JZ7A 1HRI1 1HX6A 2WSUA 3K48A 5A6ZA 5J1XA 1J3QA 4Q29A 4V2VA 1RUE3 2I45A 2P2KA 1JODA 1RUG1 1SBFA 3OPZA 1OBNA 4WVZA 1YLLA 3J8F3 4QQOA 4GH4C 2BBVA 3ATGA 4NAMA 4Q4W3 4IQPA 4QB2A 4EJRA 2XWJB 4AEMA 2VM9A 3AX4A 5JI7A 3RSJA 5LBFA 4NUBA 1QH7A 4BQ2A 3FLTA 2W91A 4N53C 5CISA 5BV6A 4K21A 4S2HA 2DURA 1JOBA 3QACA 1VAVA 1AL0G 2HWF2 2WNUA 4MH0E 4QKBA 5HBAA 1I1EA 2BV4A 1HXS2 3AL6A 2WL1A 3K75B 1QHDA 5GLTA 3JBG1 3KCCA 3OBTA 3VHRA 1U5ZA 1YFYA 4Q4X3 3MGUA 2XWBB 4LHKA 1RHI2 4XILA 3PL0A 5FZMA 3H8UA 3SHRA 1US3A 5FPVA 1W03A 2E7TA 1QJU1 1G9BA 2A6WA 1DYOA 3RJRA 1NY71 2UWBA 1OLRA 2OW4A 3OEBA 1HB2A 1WKYA 1NKGA 4J6GA 2YFUA 3R4DB 4Y20A 3D5OA 3WUDA 3ILNA 4RFRB 4XACA 1ACCA 1RINA 4DY3A 2DUPA 2WO1A 3M3IA 5FREA 4FXGB 5FYYA 1M06G 1MPXA 3I8TA 1YCIA 4LLOA 3NV2A 3WP4A 4JGYC 4XZPA 1XQNA 1Z7S3 1VBD3 4LKDA 5LA9A 5A33A 2EXHA 4M0HA 2RM23 3LFIA 2PHLA 3B02A 1PHMA 4UFJA 3U75A 3KWVA 3O14A 1GNHA 1CX4A 3BGAA 1SFPA 2ZAHA 2F6BA 4PDWA 4TTGA 3UKNA 4RS5A 3AFKA 1ZA7A 4QXBA 4PHZA 3CL1A 1O4TA 3ZN5A 1EYBA 4JHZA 2RDSA 3B9CA 2VZVA 2HJIA 3D0SA 3FHAA 4MG2A 4NHXA 2IFRA 1UU6A 1HRI2 2YXSA 3N7JA 2HKXA 5A3TA 1RMU3 1H9WA 3FWEA 2CL2A 4XQ4A 1W6OA 4RR3B 1RUG2 2GC3A 4JTOA 1OLMA 1W6NB 1NA1B 2BBAA 2NPIA 3F2ZA 3NV3A 1XNTA 2D40A 3VUOA 1H8TC 2JWPA 4N9IA 1RUH1 1J3RA 2D43A 1N1YA 2P4EA 4J1XA 1Q5OA 4UF0A 3TWIA 3ZYBA 3PU3A 3HQUA 4RHV1 2F4PA 1V9U3 3BVCA 5F7UA 4RA0A 1W04A 4MADA 2ZACA 3DPRA 3VBRC 1GMMA 2DCTA 3NVCA 3O0WA 3OPWA 4YGDA 4M00A 5C71A 2CDOA 2GN7A 5IFTA 3VBFA 5IJRA 5FPZA 2A71A 5ERLA 2JDHA 4DS0A 1T6GC 5HI0A 2CWMA 4GH4B 2LROA 4IV1C 1O4ZA 5FZAA 3ZSEA 5F1RA 3FLRA 5F8PA 5CADA 1UIKA 5FJHA 3GHMA 1EAH3 1NY72 2MEV1 3N4MA 1V6LA 2WNVC 1JBCA 2FMDA 3AZWA 1RUC1 5C4WC 1R091 1XU2A 2JDPA 3LIGA 2X29A 1OF4A 4WM7A 3I2KA 3MF6A 2TBVA 5EJ1B 1ZBA3 2ZEWA 4ZZ8A 4IEPA 2VPVA 3VBSB 1AF9A 2JIGA 3PVNA 1AR81 4NROA 1LOGA 1POQA 4KWKA 4L97A 4XUNA 3AKQA 3N9NA 3PVBB 2YU2A 2W1WA 5J98B 3RZMA 4K40A 1UXXX 5AC92 1R1ZA 1UU4A 5EFUA 1CAWA 4BWOA 3CU7A 3GZUC 3AP9A 2VNOA 4IETA 5T55A 2XJTA 3U07A 1D7PM 1V6OA 2B46X 4CEYC 5A3NA 4Z2AA 4D8MA 5F3GA 1QKQA 1PMIA 3LE0A 3AMQA 4GKYA 2XONA 2FDFA 1POV1 1NCQC 4Q4V3 2WT1A 2JEMA 4TLGA 4ZXKA 3SCGA 3A23A 5DAQA 3KV5A 2YMZA 1QH6A 4DXSA 2GH8A 3MDPA 5EV7A 1HRV1 3H1WA 3C7HA 5JXHA 4QKDA 2TNFA 4IUGA 3WDVA 3MPPG 2AGSA 1IS4A 3V0BB 3A22A 4SBVA 4UFKA 2DDUA 5T5LA 1GFF2 2QTWB 3PTRB 1IQDC 4UW5A 4KBBA 4QM9A 2HWB1 2VTXJ 4EWEA 1CONA 5FMOL 1S2KA 1Y4WA 4QX8A 1OOPC 4LIUA 3WHUA 5B2GB 1H6YA 4RGGA 3KQRA 2DBNA 2F17A 1W3XA 3SH3A 2PTMA 2Y0OA 4OUEA 3KCXA 3I59B 3N9QA 4YG3A 2D5FA 3NNFA 3E6CC 2E32A 5DUVA 1JH5A 3P5BA 2OVUA 1AR61 4HKWA 4NIAA 3J4UH 4PIXA 1W39A 3NNGA 3GJAA 5L36A 2CTVA 1XSRA 2ZTNA 1OF3A 5FZ9A 4H14A 4A41A 1IG3A 2EALA 2QQUA 3KB5A 1H8TB 2BEOA 2RDQA 1ULGA 1QJX3 1W6PB 2PHDA 4BLIA 2MEV2 3H1MA 2JE8A 3IAPA 2XL9A 3WF0A 1F4HA 1UIJA 2VNRA 1B09A 4CU9A 5DDJ1 4OHXA 2CGNA 4D7TA 4IV3B 1RC6A 4NRQA 3VBRB 4BQ3A 5T54A 5LW9A 3VDDB 1N3OA 3CJIC 2YC4A 3Q8EA 4K1YA 4XJ9A 4LQRA 5FMDA 4YVSC 1WLWA 2EIGA 4FXKB 1KFXL 4KH9A 1GBGA 4L99A 4XHXA 4ISRA 5T50A 1FV2A 3P1IA 5CFCA 3WNKA 5CFDC 4IV1B 5FZLA 1A6CA 1PX3A 5IK8A 2HLEA 3GF6A 4XE9A 2OT7A 5T3NA 2WNVB 5C9AB 3A0NA 2VMEA 5C4WB 5J36A 2J22A 1NZIA 1RJ8A 1W8UA 3O5SA 1E5IA 4QT6A 1RUJ2 2NMNA 2WN3A 4ONUA 1R1A1 2QJVA 3RWKX 2DCJA 4CA9A 2PAKA 1IKQA 4EN8B 2ZEYA 4M4PA 3PIJA 4CP9B 4OHVA 1GZCA 1LAJA 4XABA 4FPKA 2JDYA 2VZSA 5CEHA 5D1IA 1OI6A 4JAAA 1H6XA 5DZGA 3OUJA 2EAAA 4XURA 3U0ZA 1Y9GA 2RS31 1ENSA 1LR5A 4CEYB 2DF7A 3LDRA 2GH2A 1WWYA 2Q1MA 4O9GA 3WQ1A 1V70A 4NOTA 4B7EA 1NCQB 3V64A 1UY0A 5I0RA 2Z42A 3EJKA 3TEYA 5BNOA 5KR7A 2FBEA 3WF2A 2WNUC 2CNAA 3AMNA 3RI9A 3FHQA 3LPFA 1AR62 4P9LA 3I3BA 1JZ4A 4P9YA 3RYRA 1CAXA 3AKRA 4NR1A 4BOWA 5BNNC 1AYM2 1Y9QA 3KT7A 5E8AA 5FZ1A 2Q8CA 2RMU1 3ZXLA 1WBLA 2WUHA 4OUSA 2QCSB 5AFBA 2VAUA 2ZGMA 3K3NA 4W6XA 1O8PA 3NKGA 1F4AA 2JG9C 1CJPA 2FCVA 1HB1A 1UZZA 5DUWA 3HPNA 4BA6A 5CU1A 5DDJ2 4YW1A 3T08A 3VKLA 3WXPA 5A7SA 4P02B 4CCNA 3UGGA 3ZFEB 3CIHA 3H3UA 2WT0A 2W9XA 5JSRA 5FK8A 2Q8OA 3HEIA 5C7GA 3URFA 3HNBM 1AYN2 4WBBA 2OYZA 3ZVXA 4FPGA 3PU8A 2OQ6A 2D97A 1GOFA 3SKVA 1N47A 3WNMA 4XIKA 4B1LA 4PDWC 1ASJ3 2E26A 4TYSA 3T09A 2NM1A 3ZXAC 4DUXA 3WINE 5K7PA 2WS91 4KG8A 1Q43A 3OYWB 1IS3A 4XQWA 1WA4A 1QOTA 1FOD1 1H2MA 4Y1UA 5M0TA 4M4RA 4YVSB 1IG0A 5A3MA 5KC6A 5CFDB 4NIDA 4LBJA 3S30A 2JDAA 3ZXDA 5FK7A 2EA7A 2PLV2 2RS32 3ZN4A 1UQXA 2VU9A 4FOQA 3LWCA 3U11A 1ST8A 4IE6A 3WSOA 1YYNA 2VW0A 5DAXA 2IXJA 3K4ZA 1W06A 1KJRA 1D0HA 1AL22 1RUF3 2C9AA 5FZ6A 5ANNA 2JDZA 2ZEZA 1GP5A 5FUNA 2R063 3T1MA 4Q4Y2 5C33A 2PHWA 2XHKA 1PGW1 3BN6A 4H3WA 1LHOA 1Y43B 3BIWE 3I3QA 4V1PA 5EP9A 4AGGA 1KS4A 5ACA1 5APAA 2EIBA 3LDKA 1VBB3 3K3OA 1TEIA 1VRBA 1LOCA 3ZXEA 1VR3A 4YWAA 1OQDA 2Y60A 1I6XA 2A5ZA 2UURA 5HV4A 3T4VA 5C3OA 3LQCA 5C8CC 4AEJA 4UW4A 1ND3A 5FP4A 5FXXA 2XDVA 1AZDA 1B35C 1R081 2D6LX 2Z69A 3DL3A 3KS7A 4XUQA 5FBJA 4AOCA 3IDEA 4N43B 4CSWA 4DFSA 2I74A 1OD5A 4PF5A 4QX1A 3VZKA 4XF0A 4YZ4A 1UO9A 1SPPB 2VOWA 2A7AA 3PJYA 5E16A 1GQHA 4FPCA 4N8MA 4CXXA 1YUDA 2BQPA 2A3YA 5FO7B 1NE6A 4M3CB 3AFGA 3HVDA 3IM0A 2WLPA 3N7MA 4CCKA 5BNNB 1X8EA 1QMJA 4ZU4A 3WQ0A 4Y33A 3RZLA 1CN1A 3FE5A 5F5CA 4AQ2A 1Q8SA 2JG9B 4QU1A 5LCWL 1WW7A 4RYDA 4AQTA 1JZ8A 1D4M3 1JHNA 3I49A 2YU1A 3IIAA 2VY0A 4AAXA 1T2XA 5I91A 2Y64A 2ZABA 1OA2A 5C3QA 4DUVA 1GANA 3GBWA 3K51A 1ZRCA 1WCDJ 4R9BA 3O7OA 4QAWA 2VL4A 1SZBA 1S0BA 2WS92 3CNAA 4ZXEA 3S6PA 1MVQA 2V5DA 1RYYA 2GSYA 3JU9A 3POFA 5BUVA 1NE4A 1YI9A 1BQPA 4AI1A 2I2SA 4GIQA 1W6NA 2GP3A 2P34A 2AACA 5A6QA 4JDMA 3MZHA 4HT1T 2FCUA 4KWJA 1H2NA 1KFUL 2Y6KA 4PCRA 1ND2A 3SKJE 5D8AC 2XQXA 2K9ZA 2BFUS 2GALA 2QDRA 5CBLA 4ATEA 2VNVA 3GCXA 4K20A 3PLQA 4E8CA 2C4XA 1DQ2A 2R071 1GICA 2A75A 5ACA2 2YY1A 5FBZA 2HWD2 2ZEXA 2Y6GA 3KF5A 3MPBA 2A6YA 4WVVA 3TEZA 5IVFA 2WA4A 3K77A 3S7EA 2ZGKA 4XVHA 5EYXA 4AVTA 4D69A 1KGYA 2G9GA 5FMOS 4N9HA 3VBHA 1MZEA 3RMYA 3BODA 3GXUA 3ILRA 5IVBA 1TME1 3LGRA 2XJVA 4XPVA 4ES8A 2P6HA 2WBKA 5BPXA 4XFAA 3VBSA 2WDBA 4MZUA 3OBZA 3VHNA 2J1EA 2WWUA 1QQP2 1STMA 3HBKA 1COV3 5T5PA 2ZZQA 3EO6A 1AR71 3ELNA 1U0AA 2RS53 3L9JT 2VOVA 1H9PA 2BOJA 5FZKA 4CXYA 2R16A 1RVF3 1UWWA 4GWIA 5GLZA 2OPKA 5CFCC 1J58A 2KM2A 1VRH1 3ZFFC 2QZ2A 1QJY1 4CP2A 1YFUA 4QPIC 5C8CB 5FP9A 5F9TA 1DLLA 3SXWA 2WO2A 1B35B 3ZIXA 5HCBA 1APNA 3WG2A 1JZ5A 2ZGNA 5FY7A 2IXIA 1AHSA 4DMIA 3POYA 4JGZC 1BEV1 1C5IA 2NN8A 4FPEA 5K0UC 4QU2A 4KGQA 4LUKA 4WM8A 5C8WA 4Q0SA 1ZZ6A 1YQ8A 1YO8A 2W1QA 1RL3A 2C26A 3IT8A 4YW6A 4QPGA 1UOBA 1YWKA 2O0OA 4GWMA 5JR2A 4Y4YA 1JZ2A 4HK9A 5GLVA 1ZZ7A 3ZXGA 4FPYA 3LKJA 1H0BA 2WQ4A 2OXBA 3ZR5A 2ZHLA 2RDNA 2BVVA 3H9AA 1PK6A 5T5JA 2HWE1 3RZKA 3I54A 4EN9B 5FPUA 3J9SA 4M3CE 3G7DA 3ECQA 1H8VA 2R072 2RR12 3N35A 2HBUA 2DCYA 2HWC3 4OULA 3UGFA 4AI2A 4CDQC 1C4RA 2X05A 4A7YA 1HB4A 3NNJA 2XBO1 3LPGA 3NNMA 4BQ5A 3LB9A 4FP2A 4ZU5A 5KHKA 1QIQA 2VUJA 2RS11 1GZ9A 2C0ZA 1VMJA 1OLQA 1S1AA 4IV3A 5A3OA 1C8M3 1UF2C 4OZOA 2Y33A 2CHHA 3VDDA 2DV9A 1DU3D 2WKKA 3ME2A 1UYPA 5FZIA 5HXVA 2GMPA 3WDUA 4IDZA 2PHRA 4R4XA 2ZAAA 2WZR1 2FDHA 3IBMA 5I0SA 4AHWA 1NYWA 1AR72 1LGNA 4AXOA 5EYYA 1J1TA 1J3PA 2NMOA 3GNEA 5DAVA 5CB7A 4QHBA 4LHSA 1IQAA 1Y3TA 4BM8A 1XNCA 2VBDA 1GWKA 1QJY2 1TQ5A 1J84A 4K7JA 4CUBA 3LOBA 1F8VA 3IDAA 4KBZA 4MOAA 3F95A 3SLIA 3I4IA 2PELA 5FQ0B 5HCHA 1VBA3 5IVJA 3KT4A 1LRHA 5IK5A 2Q4SA 4TZDA 5FWEA 1ULCA 1RUF2 2E51A 5IUQA 2L9LA 2VCAA 1VBC2 2W46A 4NO4A 2JX9A 5FY5A 4GAZA 4CEWC 5E89A 4XDPA 1SLAA 2OQ7A 4HL0A 1QJU3 2QKDA 3OBRA 3Q8FA 4KNCA 3ABZA 2DBIA 4IEYA 4UT5A 4LR4A 1LOAA 1PO13 4UBHA 4A7KA 4FAGA 3VKNA 3ZFFB 3I2FA 3M3QA 2NZ9A 1OHFA 1VBB2 5DAPA 4QPIB 2BVBA 4ZPIA 3VKMA 1LOEA 4XDOA 4CRQA 2EVXA 1QOSA 4LA3A 1ULFA 2KA3A 1HB3A 1GUIA 3R4SA 4Q1RA 4PJYA 2ZGQA 1O3SA 5GKAC 1ODMA 2X5IC 5CG9A 5DABA 2HWF1 4GWJA 2VO5A 4KU7A 1HXS1 1LEMA 1NCRB 1E57A 2VCBA 3CBNA 4FPFA 4SLIA 5FMBA 1YQ5A 4YM2A 5K0UB 3AZYA 1H4GA 4GXLA 3T2QA 4BQYA 1WMFA 4PLNA 5FCCA 4QX7A 1XYOA 4MXWB 3FBYA 1RHI1 2SBAA 4N7UA 3EQEA 1MR5A 4YFWA 2BJSA 1OPOA 1QNWA 2E7QA 4NIHA 1O5UA 2PHXA 3DGTA 4MXVA 4RD7A 2DWRA 1C57A 2PAMA 4LA2A 3AZZA 3IPVB 3MLKA 3VBOC 5DXDA 3C3VA 2AREA 3JQWA 2ZX0A 2O14A 4Q2FA 4DXRA 1FMD1 1TMF1 4DNYA 1O3QA 4O61A 2R6QA 4BK5A 1ENRA 3AYCA 1CPNA 1UCXA 3TRSB 3ZFEA 3X29B 4Q0PA 5FYZA 2QQJA 4B29A 4A7ZA 3TN91 1OT5A 5FMCA 3AKPA 2WZR2 3HT2A 3L2YA 1LTEA 3HIFA 3VZNA 1WW5A 1AUYA 5F5AA 2VMHA 2ZMLA 4CDQB 1GKBA 1W8OA 5EHDA 1GSLA 1RUD2 1W9TA 2K2SA 3MV11 4JC1A 4NRMA 4AF9A 4AI8A 2EIDA 2OA2A 2NP0A 1U5XA 1G9CA 3MYXA 1DCSA 4RHV3 3OD0A 3AYDA 1BK1A 4HKOA 3S5QA 3THPA 1OQEA 2DTYA 1BVP1 2RJLA 3MIHA 1ZZ8A 2RHPA 4GD4A 1SCRA 4E8DA 3WX5A 5EJZB 3MEPA 1V6IA 2MHFA 2W47A 1ULEA 4IEWA 1PIV1 2A73B 4WVMB 1F35A 1W6QB 4Z92B 2ORXA 1PMHX 1W9YA 1C8NA 1YC61 2GAUA 2DTWA 2VH9A 2WSVA 4LBOA 3AP5A 3THCA 2VECA 3WCSA 4IE7A 3TB0A 2RJ2A 4R9DA 1EV13 2GMEA 4CCEA 2E31A 1MS9A 2TEPA 2WFF2 3D0JA 3BB6A 1BHGA 1UMIA 1R093 2XJUA 4S2GA 4BLJA 2B4KA 3A0KA 1U12A 1KDMA 4DUWA 4CDXC 3IN9A 1W8FA 4GMP1 4CU8A 4XBQA 2P3JA 2YGLA 4ZS3A 1GZWB 4META 2IUWA 4NPMA 4K9SA 3POBA 1AR83 1I5ZA 4UFMA 4U2AA 4YG6A 3V65A 4BPZA 3FFZA 3ES1A 2EIEA 4BQXA 3SISA 5I93A 4RGKA 5DUXA 1HV1A 2W39A 4CEWB 1GQPA 1DZTA 4A44A 2Y6LA 1UZ0A 5JXGA 1DP0A 2JDMA 3LEKA 3LSDA 5DMYA 5CNAA 5KBFA 1SEFA 2ETEA 5D21A 3WG4A 4QX5A 2VW1A 3VDBA 5L9VA 1RVF2 2W3JA 1K5MB 2ZCWA 4N43A 1YIPA 3DN7A 1FMD2 1TMF2 2VZQA 3IWZA 3JD71 3LD8A 4LKSA 3INAA 1SPPA 3UJQA 3Q8AA 1SACA 3LOIA 3B3QE 1OKQA 4HVOA 4BDVB 4O7XA 3VKFC 2BWCA 1VBE3 2VC9A 2QE3A 4QKFA 2PAEA 1WCKA 2WIIB 2XJSA 4LBMA 3H42B 3TN92 3MBWA 4RQPC 1MZ6A 2XUMA 1KITA 2YPDA 5AC91 2D6PA 1CAVB 4JX0A 4FFFA 1DDLA 4K1ZA 1NXD1 4CDWC 1LESA 2DFBA 1SMVA 1UMZA 1VAMA 3GBGA 3NRUA 4XUOA 1K42A 3WOGA 3LA7A 1UN1A 4A2UA 4MGKE 3THDA 4FQ4A 3EB7A 4YARA 4LE4A 4XFGA 3EYPA 2BNOA 4INDA 3GJBA 1Q8VA 2VZ1A 1OH3A 1D2QA 3M3EA 1NUKA 2YBPA 4CCOA 1PIV2 1QJFA 3OBAA 1W6MB 1WMEA 4NJ4A 4QX0A 4CP1A 1WCUA 3KV9A 4NWVA 5BNPC 3ZYHA 4B1MA 4LNVA 1VB2A 4WZFA 1XE0A 2BRTA 4A6SA 3J26N 1X33A 2UWCA 4E4DX 2LS6A 2R32A 1BMV2 1QDCA 1RJ7A 5F2SA 4B4QA 3DXUA 4JRAA 3NAPB 4KG0A 1MEC2 4MLOA 3GZEA 2H6BA 1Z0HA 1FYUA 4IESA 3IMMA 5IVCA 1BKZA 1PK6C 5CA6A 4BE3A 4FTEA 2XHNA 3WV6A 4OHZA 5DZFA 3CO2A 2VVFA 3OTFA 5LRSA 2EXJA 4NHLA 1SLLA 2DVFA 2OPWA 3UESA 3ZFGA 1HW5A 4PQ9A 4Y1YA 3I2IA 5GZEA 2VBBA 5JPMB 4XTMA 2VMIA 4AI3A 5JZGB 3E97A 2GNBA 5EZWA 3GZAA 4N53B 2HYXA 2KD7A 1R1A3 4A3XA 5LA0A 2J1RA 3MW2A 3JD72 2ZOEB 4Y1VA 1OSGA 3M1HA 3USUB 3O1UA 1JYIA 4LIVA 3KQ4B 4XAAA 1G9FA 3RZJA 2IFWA 3KGZA 4AQ6A 1GQGA 5FUPA 1DQ1A 1YRZA 3MIBA 1JHJA 1HIXA 1RUE1 5SV5A 3TNPB 2VMFA 2ZX3A 5FO9B 4NE9A 2R042 2VULA 2YHJA 2XVLA 4RL7A 5H9RA 5LBBA 1WW6A 5A3PA 1LHNA 4Q4W1 4Q8LA 4E4SA 3FHIB 5A3WA 3U1XA 2XB6C 1GOGA 1RUJ1 4L8QA 2WN2A 2ZX4A 2BWAA 3OD4A 1GV9A 4CU6A 1PO22 3OOXA 1DIWA 3SQOA 4Q26A 1F15A 2WLQA 4JGYB 3WF3A 4CP0A 2BGPA 1ZBE3 2PYTA 4RQPB 2RMU3 3RG0A 4XZUG 3RGBA 1PVC2 3RQ0A 3FLPA 3ZPOA 1MQTC 3VKOA 4X8PA 3N36A 3GYDA 1X7NA 2J1SA 3DXTA 3A4UA 1BBT3 1IZ3A 1RXFA 3ZX7A 3IIIA 5L7OA 1UPSA 4I30A 2G19A 5FZOB 5FY8A 1X50A 5F37A 3CMGA 1OA3A 5F5IA 1FPN2 1JTZX 4J1WA 3CZUA 2R7EB 2VCCA 2SLIA 4HANA 4OI0A 3ZXKA 5I0DA 3AJYA 3RVHA 5BNPB 5FZ8A 4LXLA 4XXAA 3A21A 1GOHA 5L9BA 1AYM1 4CCDA 1UKGA 1NLRA 5LK7B 1AR93 1Z7S1 3VBUA 3M7AA 2BUKA 5HXMA 2ILMA 1SLBA 2VTFA 4ET7A 1CWPA 2BGOA 2IXKA 2XJQA 2ZGLA 3GGLA 2GNMA 1HJFA 2D3RA 3AZVA 3PTYA 1JS9A 3LA2A 4L2NA 3OCPA 2JG8A 4LORA 5FY4A 5FP3A 3WP3A 1OFSA 4LOSA 2ET1A 5H9SA 3I2DA 1V00A 3J7HA 4NN0A 1FOD3 2ZGPA 4YVWA 3BTXA 3OY8B 4V2WA 4OI1A 1IS6A 4YYOA 5A32A 1LHVA 3ITQA 2FQPA 5F6KA 4HSLA 4LOTA 4D7SA 1G9DA 1DF0A 2GP5A 4E4ZA 2UYBA 4LBNA 5HCFA 4DIQA 1RUI3 1AYN1 2VZ3A 5GZFA 4CDUC 1RMU1 5FR3A 3WG1A 1W0PA 1RUE2 2R1BA 3M8LA 4QXHA 4DRRA 4NIGA 3ZSMA 5CAZA 3J8F2 4AZZA 1EPZA 2ZMKA 1UYYA 2JENA 2ZPXA 4Q4W2 2VXJA 5C3PA 3S57A 1ZM1A 1IPJA 4EN6B 4EZ4A 4IL7A 4PBOA 4XJ8A 5JCTA 1V9U1 4AEDC 1NOVA 4Q0VA 3QH6A 4C90A 2MPFA 5LEKA 5KXBA 2IZWA 1ZZBA 4HG6B 3LAGA 3PNAA 1JYNA 2BPA2 1UOGA 4F83A 3WQBA 4Q4X2 3WF4A 1XPWA 3TYJA 5AVAA 1LODA 1YQ2A 2PLV1 4HONA 2J1VA 2E53A 4XJUA 3VD3A 3ALQA 4XHBA 4EE2A 1H2LA 1R083 2ZGRA 1ULPA 3OGVA 2ENRA 2DVBA 4HPKB 5H9PA 1AL21 1JOPA 1NCRA 1K3IA 4QMAA 1HN1A 3M3OA 4LBLA 3PURA 4Q4Y1 1RIRA 2H0VA 4CXWA 3CDZB 1X9PA 1HV0A 1ZBA1 1CAUB 4NHKA 2BYVE 4CU7A 4XTPA 4ARYA 3WR0A 2JD4A 3ZN6A 5IK7A 1PNFA 1DZQA 2CAUA 4TWTA 2GN3A 4B8EA 2Q0AA 1MQTB 4QX3A 4YZ5A 1ONAA 3FZ3A 1Z7S2 3IPVA 1VBD2 3W59A 4UYBA 4DRVA 1S0IA 1LENA 4HN1A 3SC7X 1WW4A 3OGGA 5IVVA 3V0AB 1UZVA 2RM22 1OOPB 1XBFA 4IERA 5DG2A 1DYKA 1ZRFA 1QF3A 3JQXA 4XJWA 2GU9A 4NPLA 1JYWA 2CY6A 1UY2A 5KHHA 3UL2A 4Z8BA 3ZKYA 4AL9A 3D3AA 1O7FA 4QDSA 3IKWA 3TOJA 4IXLA 2WNOA 2GC0A 5GZDA 1HLCA 5IYYA 3I3MA 4Y5SA 2YG0A 4E2SA 3WNPA 4FT8A 2VJXA 1ZZ9A 1LECA 4FVVA 2FHRA 3O1PA 3T2OA 3BIEA 3PIGA 2B9VA 3T4HB 1RMU2 1DGRA 3DF0A 1H1MA 4YSFA 4Y22A 5ABJA 1JYVA 1O3RA 1AJOA 5LB6A 1P8JA 1QJEA 3FN9A 4C0BA 2YV8A 1FAYA 4BB3A 3PMSA 1DQ5A 1CIWA 4RS5C 2WINB 3E6BA 3T3YA 2CGOA 5FPBA 4OHWA 2FMYA 4WVMA 1F9KA 1V9U2 3CF6E 1W6QA 5FZCA 2YC2A 1CZSA 1GU3A 1SQ4A 3CJIB 4C1WA 3T30A 2JKBA 1ZVFA 4D3WA 4XMIA 1LCLA 2KXLA 3SEPA 4KGGA 3H7JA 5H9QA 4JKLA 4CDUB 2JICA 2VXRA 3J7MA 3BUCA 1JXNA 1HQNA 4YM0A 1YEWA 3Q8CA 1WMDA 4YG0A 4ORFA 4ASMB 4MGTA 4DY5A 1UX7A 5CKQA 2FZ2A 4BZ4A 1TME3 1GWMA 2WWJA 2OKXA 4ZONA 5I8TA 4BU2A 4C1XA 3GM8A 1CD3G 1EAH2 3ORJA 3BTZA 2CGPA 1OMIA 4IE0A 4DQAA 2WYSA 1LKNA 4AEDB 1KS5A 1JYCA 3DPRC 4XFIA 3B94A 5FZ7A 1ZBA2 3TNQA 3PMEA 3AL5A 4QB6A 2HWD1 1MS1A 3H3ZA 4XYXA 2Q8EA 3VBFC 5A1FA 1CQ9A 1VRH3 3B9IA 2C1FA 2WZEA 5EWSA 3ASIA 1UY1A 4PIZA 5JOXA 5CZKA 1K5MA 1ZNPA 3HWJA 3B69A 2YBSA 4XW3A 4W65A 4GB33 4A45A 4XOGA 4CTEA 3RJ2X 3SNMA 1JUIA 1UMHA 3IMNA 3KF3A 3FC0A 4IGQA 4W6YA 1BEV3 1JW6A 2LUWA 2XXZA 4WM7C 1WGPA 4PQQA 4QD2A 4FSJA 2CV6A 3PUAA 2WNUB 4Q4V2 1UOFA 1ALYA 3WNLA 1QQP1 4QX2A 4U36A 2V09A 3LCPA 4YGBA 2C5DA 3AM2A 1XB9A 3W5MA 4I0AA 5BXXA 3ZR6A 1KQRA 1T6BX 2JDUA 4M01A 4R4ZA 3WDYA 3VL9A 1NXMA 2ORZA 2XLGA 2XJPA 1TE1B 5FXZA 1JYTA 4FOWA 3AMPA 1BBT2 4Q0UA 2DVGA 2A70A 5K4LA 1JOJA 1U5IA 2HWE3 2G4IA 2YBKA 2D7FA 1WA6X 4Y20B 3OGSA 4AVSA 5C5TA 2W2IA 2BOIA 1M4WA 3MW3A 4ASLA 5F6LB 1X36A 3PUHA 4H2AA 1XU1A 1BK0A 1RGSA 3WHTA 4RR3A 1YI7A 2BU9A 1NA1A 2AC1A 2VMDA 3ZLIA 2XBO3 3N9LA 4O65A 4B4RA 5A33B 1UZWA 1AR92 3NAPA 2RS13 3ZSKA 1UY3A 1LOBA 4OQ8A 4COUA 4FOVA 3ZOIA 3RDIA 1QJX2 3C7GA 2DU0A 4PDWB 3KZ4C 1SDWA 4RS5B 4XMAA 2J42A 2QQWA 1SBEA 2R0FA 4BMEA 1C3HA 4CCLA 3EHKA 4GA9A 4E2GA 5DN2A 1JYXA 1GP6A 1AXYA 4EQVA 3MHZA 2P3YA 2IXLA 2RR11 5LBCA 3U78A 1W2UA 4GH4A 4DINB 3E5UA 4Y24A 1AX2A 4Q8KA 2YDEA 1XNDA 1XE7A 2ZHNA 1W6OB 1OKOA 4ISQA 4J25A 5JZGA 4OI2A 3DKWA 4UF0B 3VZMA 3AKSA 1E5SA 1OVSA 5LASA 1REEA 3H1YA 3O0XA 2Y26A 3JCIA 1GP4A 4RFT0 2JG8C 3ACLA 2VBPA 1YHFA 2D98A 4XFFA 4LEJA 2EF6A 3RZGA 4IE5A 4CZSA 5HPOA 4OVEA 5A6YA 5CKMA 5CKNA 1NLSA 3KV4A 5FOBB 1TNFA 3OUIA 4FFHA 1UNBA 4LK6A 5FP7A 3VBFB 4Y5TA 3N9MA 2BNMA 2WA3A 5FZDA 3ROUA 1SLIA 3DV8A 4AEKA 5GLUA 4D0QA 4A3ZA 3WG3A 1QEXA 5A6XA 2Q1ZB 2ADEA 2HWF3 1VIWB 4Y3OA 2ARCA 5C9AC 1HXS3 4JZRA 5JXIA 2IC1A 4MX3A 3ZO0B 1DG6A 4LBQB 1AXZA 4WM7B 2FDGA 1O5LA 1W2TA 2WAOA 3VLBB 1Q56A 1RUF1 4YZ3A 3UV9A 2R061 1RHI3 1VBC1 2XKOA 3MFCA 2P1BA 2W1SA 1Q8QA 3V0BA 4LBKA 2B42B 4PI0A 3THTA 2BGCA 2P6CA 1KEXA 5KXDA 2HYKA 1X9TA 3JXSA 3ZXJA 1VBB1 2HEYF 3FJSA 1JI6A 3C7FA 2AENA 1MZFA 3R0RA 3IDBB 4RSUA 1IPKA 2WABA 3I2HA 1VP6A 3OG2A 5DAWA 4X6QB 5DZEA 3QCWA 4X8NA 4B3NA 3I59A 3RZHA 2XL7A 4UBGA 4XDQA 1XJAA 1K5JA 5HV0A 1PGL2 3MF9A 5BNOC 5FZ4A 5F3CA 2NYYA 2VZTA 1FXZA 4N90A 2W52A 5SV8A 3LEGA 5FYVA 4YM3A 1GLHA 5A1AA 2D3SA 3CJXA 3ZYPA 4CUAA 3AVSA 4MYEA 1H8TA 4HFSA 3HQXA 4IEXA 4JKMA 1W6PA 4I0WB 1Z78A 4AHYA 5GLWA 4NRPA 4LT5A 1H2KA 4QKNA 2YFZA 4JV4A 5D8AB 3USSA 4C91A 1WLCA 2X09A 3WD5A 3UKTA 3AP6A 2ATFA 1DGLA 1LOFA 2DYCA 4W8JA 4GULA 3VBRA 3NWKA 1ULDA 5KXCA 1WD3A 1QJZA 1REDA 1ASJ2 1F5FA 1HRI3 1SLCA 4I3GA 3W5NA 1OUSA 2XKPA 1RUG3 2WO7A 4LPLA 1A78A 4A6OA 3BTYA 3OF1A 4IV1A 4O9EA 1RUD1 1IPSA 1NLQA 2ZKLA 4OMDA 5JSPA 2DFCA 2WNVA 5C9AA 4GMP3 3AVRA 1LNSA 5C4WA 1OUXA 3FUQA 3MIGA 1GR3A 2XUEA 4CVUA 3MICA 2QQOA 1H30A 1MACA 4BISA 2ZGUA 4L0PA 1H1AA 1W2OA 3NNLA 2PHTA 3ZXFA 1C1FA 1PZ7A 2J1TA 3PUSA 3UNPA 4RN5A 3WW2A 2IXHA 2YC0A 3JBG3 4R9AA 4CP9A 2PQQA 4LO8A 1QY4A 4OMCA 1R64A 3GALA 4FFIA 4DO0A 1YIFA 2R062 4QHZA 5FYBA 4GZ9A 4A42A 1X82A 4QQ2A 4XXPA 3WEZA 4CCMA 3O1OA 3MV01 2VOXA 4YGCA 4COWA 2RDRA 2ZXQA 5CFCB 1XOYA 2WFF1 4CEYA 2RV9A 2K0GA 3GHNA 1FI2A 4AFCA 2CWSA 2IVIB 3JUUA 1NCQA 4BQWA 3P3NA 2AEZA 5L73A 1NQDA 1NX9A 4IEQA 3ZMOA 3U4XA 1K45A 2WYFA 4FI9A 4XETA 1JUHA 1JU4A 4JGZB 1XXNA 3RZZA 3VN4A 3VD7A 3Q9OA 1W99A 3O1TA 1EUTA 3BU0A 5AC93 2OUHA 2ZHMA 4CCCA 2BNNA 3QOPA 1ENQA 2MNGA 1J1LA 3M70A 5FOJB 1COV1 3KCYA 4BK4A 5A7NA 1RVF1 2NLRA 1OOPA 2QQLA 3N7KA 5I8YA 2FDJA 1SHWB 3BPZA 4JTNA 3UT0A 2RJKA 4URAA 3GCWA 3VV1A 1FX5A 4HSJA 3CEWA 2PA7A 4MO3M 1ND3C 4XAEA 3ZYGA 2BERA 1MZ5A 4YFZA 5BNOB 3FL7A 1D4M2 4Z1VA 5JOYA 4AE2A 1ZX5A 2E6VA 4DB5A 3VL8A 4B7KA 1G9AA 4Y4RA 1E5RA 4QM8A 1YQ6A 3ZKUA 4QQHA 1BJQA 5FLIA 4UFIA 3LF7A 4OCTA 1CAXB 2ARAA 1UKRA 1G8WA 4K8RB 3NQHA 1RUH3 1XC6A 5LA2A 4QGNA 2R1DA 4QGLA 5FYIA 4E4HA 4QWNA 3GDBA 4FPJA 1UX6A 1PGSA 1OFNA 2CYFA 2ZBJA 3FX3A 4QDRA 4URTA 4DOUA 5FYSA 5JOZA 4OI4A 1BXHA 3O0VA 3OYWA 4HN0A 1MS5A 1WLTA 3CJIA 4YVSA 4CUGA 5I0TA 3SMHA 1XRUA 2LRPA 3POJA 4BXSV 5CFDA 4AFMA 5IATA 1O8SA 1ZRRA 3UKVA 1W9WA 5JDBA 2Z5WA 4JVAA 1J83A 1PZ8A 2H6CA 1JN2P 2MEV3 2D6OX 4I09A 2VD7A 2XLFA 3UGHA 5JIAA 3WW1A 5LZ6A 1BMV1 1RUC3 1O3TA 2X8KA 3O1SA 2DU1A 2BW8A 1MEC1 3PUQA 5EXOA 1RTVA 1UYZA 3MIFA 3NSTA 2EXKA 3AB0A 5A3LA 3B93A 1ND2C 5DG1A 3DKQA 3E5XA 3MUY1 2JB8A 3UJOA 3WT3A 3PDQA 3ZYJB 1YJKA 3HN1A 1DHKB 1S4CA 2FCTA 5FZEA 1C8M1 4HKLA 5FZBA 2ZGSA 1CZVA 3POGA 4LHNA 3AMHA 4XBNA 3W21A 1CVNA 2Y38A 5J37A 4AWDA 4BIFA 1WCSA 1N3PA 3PJQA 4PLMA 4P9XA 4IEOA 2ZZJA 1Y9MA 1COV2 1OVPA 1TNRA 3MIEA 4P9WA 2D6MA 1D2SA 2RS52 4Z07A 1G86A 1N3QA 3BOPA 3K2OA 4AVAA 3ZSJA 3EXUA 4DZGA 4FPOB 4Y1ZA 4AI9A 3QH7A 3NJYA 3WW4A 4LKFA 1POV3 1UL9A 1RUJ3 4XF9A 3VBHC 3DYOA 2VZRA 1SCSA 2X5IB 4OYUA 4FO9A 3NL1A 3U10A 1W3VA 2JB4A 5LK5A 3T0AA 5JVVA 4Z82A 1ZRDA 2JE9A 1HRV3 1VBA1 2ZHKA 3NMBA 4GALA 3VBSC 1RB8G 2FD8A 5BY5A 1KDKA 4ZKTB 4P9JA 4Q27A 3ETPA 4M3CA 5BNNA 2ZKNA 2DUOA 3O1MA 1Y7BA 1MS4A 2HWB3 1Q8PA 2R041 4LKEA 2JG9A 3IAQA 4LK7A 4KMQA 3VBOB 3BI3A 1PO11 4AR2A 2QNKA 1HQWA 2V4VA 4QQPA 4P14A 2VMGA 1ND3B 1GYKA 2LTNA 3DYPA 2QQPA 1OQ1A 3H0OA 2Y0IA 3POEA 1UY4A 1AX0A 1AR63 1DGRN 1PM7A 2O1QA 1PO21 2OZJA 1BCXA 2C6SA 2ZMNA 4JQRA 4KL1A 4EV0A 3FUOA 1AYM3 2PMWB 3O1RA 4LO7A 1QNYA 2J1UA 4DXZA 5HCAA 4CPBA 5E6HA 3H8OA 1LGBA 1PVC1 2Z2SB 4WM8C 3MI8A 3ZYIB 2HEWF 1WBFA 4OLLA 1QXRA 4L9BA 3GZTB 1FNYA 1O91A 5E1RA 2HWC2 4LMFA 1S2EA 4QPGC 4I01A 4F3JA 5BYNA 1S0FA 1RXGA 2VZPA 1Q3EA 2OUJA 5DDJ3 4XC9A 2UY8A 5JIUA 1FPN1 2ZGTA 5KHJA 5FZ0A 4C0HA 5KC5A 3C7EA 2K46A 5IAXA 5JSOA 1CR7A 2YUEA 3UYJA 2GNDA 2GZWA 1C8M2 2XG3A 5FZFA 4YW4A 3PUIA 1BLZA 4AFDA 1NT0A 4EWDA 4CPBD 3T0BA 1AYN3 4PI2A 3VHPA 2XMLA 2V72A 4D6RA 3J7LA 4ZHNA 3D8CA 4ARXA 2VVDA 5F32A 1KXGA 5D2AA 1F2NA 2Y6FA 3B00A 5IK4A 4YZ1A 2X10A 4LO4B 4P5HA 4GJZA 5KWRA 4CDXB 5JXJA 1ZZCA 2AEYA 3R4UA 1ND2B 4FQZA 3K46A 2CDPA 3NW4A 2ID4A 3BCWA 3RI8A 3MLJA 1LOFC 4IGOA 4IV3C 5IHRA 3HAGA 3NO8A 1VBA2 3HQRA 3VDDC 4C8DA 3JBG2 3D4KA 1OD3A 3WCRA 4LO6B 1D0GA 3LZZA 4EYUA 2JDNA 1N1VA 5B4XA 3AYEA 2PLV3 4W50A 2RS33 1VALA 1QJU2 5DUUA 1VPHA 3J8F1 4S2FA 1EV11 3ACIA 3AJZA 2QQVA 3HOBA 3ACHA 2PXJA 4GJYA 4XF1A 1PO12 1B35A 1IS5A 1AL23 1BYHA 1REFA 3P3PA 3VBHB 4B4PA 4YPJA 5FPXA 4NHYA 2WZ8A 4LBQA 5FLHA 4Q4Y3 4L11A 2B9UA 4YLZA 2D3PA 5LATA 3AZXA 5A70A 2LW8A 4G4FA 3V56A 4KU8A 1ODNA 4IW3A 1RUNA 2EXIA 3LEIA 3NV1A 2WNEA 2WQZC 4OQ9A 2AR6A 2A3XA 1JZ3A 4AHZA 5IVYA 3HMYA 3LEMA 4AVCA 5A7WB 4OUMA 2VR4A 3B01A 3DEMA 1DYPA 2CU5A 4FAHA 5GZGA 4MGQA 1LGCA 4EROA 4Q4X1 1C28A 4WV8A 1ENXA 1W8ZA 1PZ9A 5AFEA 4CDWB 1OA4A 3N7LA 5JOWA 2QQMA 1HN0A 4RGAA 1I5PA 1LULA 2WJSA 4EZHA 3BALA 1XNAA 2BFUL 1AJKA 4AGRA 1A8MA 4LBQD 1CZTA 3VD9A 5FFOC 3C8XA 1GNYA 1SFNA 3IDCB 4LLFA 5F39A 3OB8A 5G04L 1CIYA 1S0EA 3E1F1 4Q1PA 5JUVA 5DPNA 1HJGA 1SG3A 2JKXA 3KD4A 1VBE1 5JPNB 3WDWA 2UU8A 5IWFA 5FKBA 4WM8B 2V4AA 5L9RA 2VQTA 4A4AA 4CYDA 1VBD1 1EUUA 2B39A 4KQ7A 3RFRA 1UPIA 1V6MA 4QPWA 4QPGB 2RM21 1FV3A 5D8AA 1OC1A 1UU5A 1TVGA 1RUH2 4BYYA 3ACGA 5JMOA 3U4SA 1S0DA 1NG0A 2W94A 1MS8A 1XYPA 4QGMA 4UXAA 5FYMA 4RHV2 3U37A 3WNNA 2WS93 2F4LA 5T5OA 4E9KA 4F7ZA 1PK6B 5KHGA 3ZFEC 1V6JA 1WMXA 2HH9A 3E5QA 2IXCA 4MSVA 1LHUA 4HVQA 1DFQA 2ARBA 5J48A 3R6SA 4HZFA 1SDDB 2R49A 5K8SA 4MGSA 3CKHA 2YB7A 3AXDA 3DCQA 4IGPA 5JMCA 3SH4A 2NQYA 1F5JA 2ZX2A 2A6XA 3EBRA 3HNMA 4IEZA 3WF1A 5JAXA 3TEWA 3DUIA 2VUCA 1DQ4A 2WT2A 2VG9A 2QQKA 1EV12 4GMP0 5A7OA 4M3CF 1DQ0A 1RUC2 1R092 5FQ0A 3AC0A 2C9KA 1W2AX 3FMGA 2WRAA 4K8FA 4JKKA 1W9FA 3ENRA 4XFBA 1W8WA 3RWNA 3VZOA 2Q1FA 3PVOA 4AG4A 1DGWA 4AGVA 2PHUA 5FZ3A 5BNQA 3BKZA 2ERFA 4H7LA 1GWLA 1AR82 4G9SB 1WCQA 5ACA3 2P5BA 2HWD3 2VZOA 2ARXA 3APBA 2EAKA 3U14A 4P08A 2ET7A 3WP6A 2BZDA 2VW2A 4W6WA 1F31A 1ZA4A 3I2GA 4MUVA 4W4ZA 3ZFFA 4BQ1A 2P3IA 3HJRA 1V0AA 3JB8A 4QPIA 1K12A 1CGPA 1AX1A 1KD7A 1OXCA 1JZ6A 3HN3A 2EICA 5LY2A 2J7MA 1WD4A 1EAH1 2A6VA 3S7IA 3R05A 4XF3A 1ZYBA 2AH2A 3AXEA 4JGZA 4AYUA 4MGZE 3B5LB 5K0UA 3QBQA 3I2OA 1QQP3 1RUOA 4BIOA 2W5FA 4XEZA 3NJZA 4S2DA 2G9FA 3ON7A 4MXWA 4XCBA 2OS2A 2O8OA 4COZA 1HRV2 3IB3A 4LUMA 2B7YA 1VBE2 4E27A 3S0MA 4AQSA 2D5HA 3VB9A 4QXKA 3ZIWA 5EJ3A 1W90A 5F3EA 5KXEA 4ZY9A 3VHOA 5FY1A 3OSDA 2HWB2 2E63A 3HNYM 2ES3A 4XF4A 2VTXA 3H8XA 2Y6HA 4YW7A 4N43C 4KWUA 4H7MA 4PF1A 1KRIA 4Q4V1 4P00B 4M0NA 1LB2A 4LJHA 4UW6A 2QFEA 1L3JA 2WZPP 2XH6A 1W9SA 4CDQA 1FT9A 4LTAA 1URXA 1ZBE1 5IW0A 3CLPA 1WLDA 3D6EA 5FKCA 2UWAA 4UW3A 2J1AA 4FOYA 1LHWA 5FV3A 3H3LA 4JDNA 4COYA 2BDRA 1BBT1 1QXPA 2XJRA 4YRDA 2OZ6A 1US2A 4HK8A 2CSGA 2YROA 2WC2A 2V73A 1EY2A 5CIRA 2XVKA 4HVRA 4CUCA 2PFWA 4YM1A 3KT1A 2VUAA 3VD4A 3OGJA 4MHRA 4YNIA 2C24A 1EP0A 2VOKA 3J7NA 3H8RA 2R073 2RR13 3LA3A 2Y8KA 2VQUA 2VNGA 3CQOA 4FCAA 4I2OA 2QZ3A 1DQ6A 4BMBA 1PVXA 4AFBA 5FDBA 4UFHA 2W92A 2VVEA 4NHMA 3KSCA 2W08A 3W58A 4Z2WA 1W05A 1AR91 3PHMA 4LHLA 3ZYRA 4R8HA 4YW2A 1IKPA 4UAPA 1QJX1 3FFQA 1GZWA 1QU0A 2O8QA 3DYMA 4NMIA 3ZDSA 5JR7B 3POIA 4UWDA 4HBNA 3WVJA 1R1A2 1MS3A 5K9YA 3G6JB 1UZYA 4CEWA 3WUCA 1AR73
chains in the Genus database with same CATH topology
2VUCA 1W8FA 4CE8A 2BP6A 2JDUA 2JDNA 1OUSA 1OVSA 4UT5A 5A6XA 2JDHA 2WRAA 2BV4A 1W8HA 2WR9A 5D2AA 2JDYA 5A6YA 2VNVA 1UQXA 4AOCA 1OUXA 2JDPA 2BOJA 5A6ZA 2BOIA 2JDMA 3ZDVA 2VUDA 5HCHA 1OVPA 2XR4A 1GZTA 5A70A 1UZVA 5A3OA 2JDKA 3DCQA 2CHHA 1OXCA 5A6QA 1OURA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VUC A;  1W8F A;  4CE8 A;  2BP6 A;  2JDU A;  2JDN A;  1OUS A;  1OVS A;  4UT5 A;  5A6X A;  2JDH A;  2WRA A;  2BV4 A;  1W8H A;  2WR9 A;  5D2A A;  2JDY A;  5A6Y A;  2VNV A;  1UQX A;  4AOC A;  1OUX A;  2JDP A;  2BOJ A;  5A6Z A;  2BOI A;  2JDM A;  3ZDV A;  2VUD A;  5HCH A;  1OVP A;  2XR4 A;  1GZT A;  5A70 A;  1UZV A;  5A3O A;  2JDK A;  3DCQ A;  2CHH A;  1OXC A;  5A6Q A;  1OUR A; 
#chains in the Genus database with same CATH topology
 4ATF A;  1HKD A;  2LAL A;  3BTA A;  1DGW X;  1MS0 A;  2Z79 A;  1XNK A;  2W0X A;  5GZC A;  2W95 A;  1PM4 A;  2Q5T A;  1QJY 3;  3RYK A;  1RUI 1;  4XJZ A;  3ZFG C;  1BZW A;  1NZC A;  2WR9 A;  4BQ4 A;  4AK3 A;  1QWR A;  2B45 X;  1S2B A;  2X5I A;  1IGO A;  3JB4 C;  2JIJ A;  5CVR A;  1XYN A;  1POV 0;  1YFW A;  2RE9 A;  2DCZ A;  4DEQ A;  1VBC 3;  2Q30 A;  5FYH A;  3HD8 B;  3OPT A;  2VCM A;  2IWG B;  1GNZ A;  4NII A;  4KI5 M;  3KVB A;  3POS A;  3ES4 A;  1CAV A;  3KM5 A;  2QBX A;  1DBN A;  2GC2 A;  1LU1 A;  2D44 A;  3ZYF A;  4AHX A;  3POW A;  1ZBE 2;  3ZM8 A;  3RYP A;  3VBO A;  3WNX A;  2RMU 2;  2DUQ A;  4BXF A;  2LM3 A;  2A6Z A;  1S0J A;  5JZG C;  4PBP A;  4QXC A;  4YGE A;  3I97 A;  2GDF A;  1FNZ A;  1UD1 A;  4CCJ A;  3GBF A;  3BU7 A;  3M3C A;  2W68 A;  1DLC A;  2QQI A;  3SEE A;  4MVT A;  4WVW A;  5J3U A;  5I8S A;  1JMU B;  4EN0 A;  1U5Y A;  1W6M A;  1YQC A;  2PQS A;  1A8D A;  1W8N A;  4AI0 A;  4EWA A;  3PVE A;  3N3H A;  4DXT A;  4YW3 A;  3E6D A;  4HET A;  2P37 A;  1AVB A;  5F5Q A;  4FTS A;  2FDK A;  4NVP A;  4D6S A;  5IT6 A;  4CE8 A;  3O12 A;  3ETQ A;  1QGL A;  1ZRI A;  3UK9 A;  2A3W A;  2JEC A;  3QLQ A;  5C70 A;  1SLT A;  4FPH A;  1L7L A;  3KLS A;  4XQD A;  3HBZ A;  5CYY A;  3RRD A;  5L7O C;  4ZS2 A;  2AYH A;  1YNA A;  5FPA A;  5FWJ A;  3WDT A;  2DVD A;  5B4N A;  4LUL A;  1PGL 1;  4HMZ A;  4HXC A;  2WFP A;  4GKX A;  5KHI A;  1W0O A;  5IAV A;  2R0H A;  2WZR 3;  3SH5 A;  5JLV A;  5FY0 A;  1VB4 A;  1FOD 2;  2R30 A;  4AFA A;  3O1V A;  1CES A;  1RUD 3;  2XQR A;  2B5H A;  2Z4F A;  4JHT A;  4OZX A;  1UOJ A;  3T2P A;  3I3D A;  1D4V B;  5T52 A;  5A7P A;  2WAA A;  3VBU C;  1NQJ A;  4L92 A;  4CDX A;  2FDI A;  1RUI 2;  1H1I A;  4FFG A;  4GQ7 A;  4I0B A;  4N53 A;  4OHY A;  3NKT A;  5JWP A;  4ITC A;  4X6R B;  1YXW A;  3VGI A;  2TUN A;  4WZC A;  3USU A;  1JU3 A;  4XBL A;  3VDA A;  2RVA A;  1ASJ 1;  2UYA A;  2ZJC A;  3DPR B;  1PGW 2;  4XCA A;  5LWB A;  4YVW C;  5FPL A;  1J59 A;  5L19 A;  2YPJ A;  5G05 L;  1LJ7 A;  4COV A;  2X53 S;  2D6K A;  3WY6 A;  2WFF 3;  3L2H A;  3ST7 A;  5IFP A;  1Q8O A;  4GWN A;  3ZFG B;  3NJX A;  1CPM A;  1W8T A;  5J7M A;  3WW3 A;  3AP4 A;  4I02 A;  5FXV A;  4NAO A;  2YYO A;  3K4D A;  3OEA A;  3KHC A;  4JCK A;  4FP3 A;  4NWW A;  4QHO A;  5FYC A;  4PT6 A;  1R08 2;  3ZMN A;  2XPJ A;  1KJL A;  1VLN A;  5LA1 A;  4IE4 A;  5FXW A;  3MW4 A;  3TBD A;  2P17 A;  2FZ1 A;  3LFM A;  3N9O A;  5A7W A;  3KHB A;  3CHX A;  4JGY A;  3I2J A;  4MV2 A;  5C5U A;  4AAP A;  1OPM A;  4RQP A;  4D94 A;  2JXA A;  4H55 A;  2XOM A;  3LSE A;  5F2W A;  1UXZ A;  1XSQ A;  5C6C A;  4YZ2 A;  4ZZ5 A;  1L7R A;  2DCK A;  4UI9 L;  4CDW A;  2QQN A;  4K3U A;  3S5A A;  3HT1 A;  1QOO A;  1CAW B;  4PIY A;  2WQ8 A;  4P5Y A;  2ADD A;  3RNS A;  1HDK A;  2ZS6 B;  3C2U A;  3MO4 A;  5FZO A;  4BHP A;  1FMD 3;  1H4H A;  1TMF 3;  2P3K A;  5A1L A;  3ACF A;  1EPW A;  2B8M A;  4GB3 1;  2VGD A;  4G3Y C;  1MVE A;  1ULO A;  3ZPY A;  1X8M A;  1NCR C;  5ANQ A;  4ZU7 A;  1SBD A;  3AYA A;  3NV4 A;  1VAK A;  5FYU A;  3TN9 3;  4KWL A;  3MLL A;  5C3S A;  3LDB A;  4N7I A;  5BNP A;  2VQ0 A;  4E2Q A;  5FY9 A;  2N7G A;  1RIT A;  4XUT A;  3N9P A;  1YJL A;  2E33 A;  4P9G A;  2Y34 A;  5JI9 A;  1VE0 A;  2I07 B;  1TZO A;  4QB1 A;  3SCF A;  3WZ1 A;  3QD6 A;  4UFL A;  5FZH A;  4FTB A;  2UY9 A;  4P9I A;  1WUV A;  4FBF A;  5L7O B;  2G1M A;  4UOJ A;  3VZL A;  2W87 A;  3A7Q A;  1TG7 A;  1C5H A;  1W0N A;  3W9A A;  5GJ6 A;  5A3U A;  1D4M 1;  2QUO A;  1PIV 3;  3OY8 A;  5FZG A;  5A80 A;  4XFH A;  2XGX A;  3KMH A;  3WP5 A;  5EIY B;  2D93 A;  3JZV A;  2QVS B;  5J96 B;  1UAI A;  1V6K A;  2VMC A;  1N1T A;  3M4F A;  2RG4 A;  3TAY A;  1S0G A;  2VOT A;  1VJ2 A;  3NJV A;  3T1L A;  3FBM A;  4R52 A;  2G9Z A;  5LBE A;  3VBU B;  1MEC 3;  3VD5 A;  2AUY A;  1XNB A;  2ZA9 A;  3HR9 A;  5A7Q A;  1W2N A;  1LED A;  5ABJ C;  2Q8D A;  4DEV A;  4D6Q A;  2WWS A;  1YFX A;  1AXK A;  1V6N A;  2XR4 A;  5FIX A;  3K4A A;  1TME 2;  4JRL A;  4ASK A;  2JG8 B;  2HBT A;  4PLO A;  3M2M A;  3AK0 A;  4YW5 A;  2VZU A;  2PN5 A;  5EQU A;  2GNT A;  4YVW B;  2E7A A;  3P6B A;  3AKT A;  4XFC A;  4Y1X A;  5FTT C;  5GM0 A;  3T0D A;  3KVA A;  2BP6 A;  1A34 A;  5A32 B;  3W20 A;  3MFA A;  1S55 A;  4Q0Q A;  3BPS A;  3C7O A;  2AZ5 A;  5I0U A;  2QDN A;  4BCU A;  1O4Y A;  4F8A A;  4Y26 A;  1OLM E;  1W8H A;  1VRH 2;  4JQT A;  5FUI A;  3BOW A;  2V5Y A;  3I7D A;  5LY1 A;  4HPK A;  5FO8 B;  3JD7 3;  5J09 A;  2OX0 A;  4GB3 2;  3CZJ A;  1G7Y A;  3ZDV A;  5FJK A;  3BYW A;  4K6B A;  3WQ7 A;  1CAU A;  2JDK A;  1BEV 2;  3RS6 A;  1O6U A;  1W28 A;  3VDC A;  2YGM A;  4TN7 A;  2CAV A;  1PNG A;  5E88 A;  3T2T A;  4AVB A;  4QPY A;  4IEV A;  4EN7 B;  4XUP A;  5FRA A;  1MQT A;  1SFY A;  3MUZ 1;  4I3P A;  4LIT A;  2R04 3;  4MHU A;  4XJA A;  2ZX1 A;  2OII A;  2RS5 1;  1A3K A;  3LIH A;  3VZJ A;  1ZRE A;  3V0A A;  4Q5O A;  2DVA A;  2JJ6 A;  1VMF A;  1VMH A;  2HEV F;  1HQL A;  4R9C A;  2W1U A;  1K5M C;  5FLJ A;  4JDO A;  5LEJ A;  5LRR A;  1LU2 A;  5CG8 A;  3RMX A;  1PO2 3;  3H50 A;  3OJB A;  4TXW A;  5EPA A;  5C8C A;  4LO5 B;  3TEX A;  2IVJ A;  1L7Q A;  5F3I A;  3ZSL A;  4D7Y A;  1G6N A;  1S0C A;  3RPQ A;  4QDQ A;  3OGR A;  1IOA A;  1BVV A;  1GZT A;  2HWE 2;  2H0B A;  4HLT A;  1PVC 3;  3OUH A;  4DPN A;  1QDO A;  1C1L A;  1DZR A;  1XE8 A;  3SCH A;  3KGL A;  3ZN6 B;  4ES9 A;  1CX1 A;  2XLA A;  5GAL A;  3D82 A;  4HOO A;  4AW7 A;  5C3R A;  3ILF A;  1PMJ X;  1I9R A;  5FYT A;  3B7M A;  2XBO 2;  2VQA A;  4FPL A;  5DQ0 A;  3AP7 A;  1FPN 3;  4Y5Z 0;  5TSW A;  1PX4 A;  2RS1 2;  3UET A;  2ZGO A;  2PHF A;  4TLF A;  5ISL A;  2A1X A;  3WDX A;  3I3E A;  3DEC A;  2GC1 A;  1E5H A;  1FAT A;  2XVG A;  2JE7 A;  2VUD A;  2BTV C;  1WZX A;  2VE1 A;  2KR2 A;  2WO3 A;  4CDU A;  1OH4 A;  1UYX A;  2Y6J A;  1QXJ A;  4IEU A;  4LE3 A;  4XIO A;  3WLU A;  1UW8 A;  4RR3 C;  3AMM A;  3H7Y A;  1NA1 C;  2HWC 1;  4OFG A;  1OUR A;  1I3H A;  1O59 A;  2E9Q A;  3KV6 A;  2YZ4 A;  4NPR A;  1CJD A;  1IHM A;  2JD9 A;  3IZO A;  3Q8B A;  5FP8 A;  5AVP A;  4MGI E;  4Y22 B;  1N1S A;  3NAP C;  5ABJ B;  4BH9 A;  2GMM A;  4AVV A;  3MID A;  3WNO A;  5IVE A;  4MGY E;  2D6N A;  4QQL A;  4TSV A;  1NAE A;  4AED A;  3SIT A;  3EMR A;  5FAX A;  4BJ0 A;  1JZ7 A;  1HRI 1;  1HX6 A;  2WSU A;  3K48 A;  5A6Z A;  5J1X A;  1J3Q A;  4Q29 A;  4V2V A;  1RUE 3;  2I45 A;  2P2K A;  1JOD A;  1RUG 1;  1SBF A;  3OPZ A;  1OBN A;  4WVZ A;  1YLL A;  3J8F 3;  4QQO A;  4GH4 C;  2BBV A;  3ATG A;  4NAM A;  4Q4W 3;  4IQP A;  4QB2 A;  4EJR A;  2XWJ B;  4AEM A;  2VM9 A;  3AX4 A;  5JI7 A;  3RSJ A;  5LBF A;  4NUB A;  1QH7 A;  4BQ2 A;  3FLT A;  2W91 A;  4N53 C;  5CIS A;  5BV6 A;  4K21 A;  4S2H A;  2DUR A;  1JOB A;  3QAC A;  1VAV A;  1AL0 G;  2HWF 2;  2WNU A;  4MH0 E;  4QKB A;  5HBA A;  1I1E A;  2BV4 A;  1HXS 2;  3AL6 A;  2WL1 A;  3K75 B;  1QHD A;  5GLT A;  3JBG 1;  3KCC A;  3OBT A;  3VHR A;  1U5Z A;  1YFY A;  4Q4X 3;  3MGU A;  2XWB B;  4LHK A;  1RHI 2;  4XIL A;  3PL0 A;  5FZM A;  3H8U A;  3SHR A;  1US3 A;  5FPV A;  1W03 A;  2E7T A;  1QJU 1;  1G9B A;  2A6W A;  1DYO A;  3RJR A;  1NY7 1;  2UWB A;  1OLR A;  2OW4 A;  3OEB A;  1HB2 A;  1WKY A;  1NKG A;  4J6G A;  2YFU A;  3R4D B;  4Y20 A;  3D5O A;  3WUD A;  3ILN A;  4RFR B;  4XAC A;  1ACC A;  1RIN A;  4DY3 A;  2DUP A;  2WO1 A;  3M3I A;  5FRE A;  4FXG B;  5FYY A;  1M06 G;  1MPX A;  3I8T A;  1YCI A;  4LLO A;  3NV2 A;  3WP4 A;  4JGY C;  4XZP A;  1XQN A;  1Z7S 3;  1VBD 3;  4LKD A;  5LA9 A;  5A33 A;  2EXH A;  4M0H A;  2RM2 3;  3LFI A;  2PHL A;  3B02 A;  1PHM A;  4UFJ A;  3U75 A;  3KWV A;  3O14 A;  1GNH A;  1CX4 A;  3BGA A;  1SFP A;  2ZAH A;  2F6B A;  4PDW A;  4TTG A;  3UKN A;  4RS5 A;  3AFK A;  1ZA7 A;  4QXB A;  4PHZ A;  3CL1 A;  1O4T A;  3ZN5 A;  1EYB A;  4JHZ A;  2RDS A;  3B9C A;  2VZV A;  2HJI A;  3D0S A;  3FHA A;  4MG2 A;  4NHX A;  2IFR A;  1UU6 A;  1HRI 2;  2YXS A;  3N7J A;  2HKX A;  5A3T A;  1RMU 3;  1H9W A;  3FWE A;  2CL2 A;  4XQ4 A;  1W6O A;  4RR3 B;  1RUG 2;  2GC3 A;  4JTO A;  1OLM A;  1W6N B;  1NA1 B;  2BBA A;  2NPI A;  3F2Z A;  3NV3 A;  1XNT A;  2D40 A;  3VUO A;  1H8T C;  2JWP A;  4N9I A;  1RUH 1;  1J3R A;  2D43 A;  1N1Y A;  2P4E A;  4J1X A;  1Q5O A;  4UF0 A;  3TWI A;  3ZYB A;  3PU3 A;  3HQU A;  4RHV 1;  2F4P A;  1V9U 3;  3BVC A;  5F7U A;  4RA0 A;  1W04 A;  4MAD A;  2ZAC A;  3DPR A;  3VBR C;  1GMM A;  2DCT A;  3NVC A;  3O0W A;  3OPW A;  4YGD A;  4M00 A;  5C71 A;  2CDO A;  2GN7 A;  5IFT A;  3VBF A;  5IJR A;  5FPZ A;  2A71 A;  5ERL A;  2JDH A;  4DS0 A;  1T6G C;  5HI0 A;  2CWM A;  4GH4 B;  2LRO A;  4IV1 C;  1O4Z A;  5FZA A;  3ZSE A;  5F1R A;  3FLR A;  5F8P A;  5CAD A;  1UIK A;  5FJH A;  3GHM A;  1EAH 3;  1NY7 2;  2MEV 1;  3N4M A;  1V6L A;  2WNV C;  1JBC A;  2FMD A;  3AZW A;  1RUC 1;  5C4W C;  1R09 1;  1XU2 A;  2JDP A;  3LIG A;  2X29 A;  1OF4 A;  4WM7 A;  3I2K A;  3MF6 A;  2TBV A;  5EJ1 B;  1ZBA 3;  2ZEW A;  4ZZ8 A;  4IEP A;  2VPV A;  3VBS B;  1AF9 A;  2JIG A;  3PVN A;  1AR8 1;  4NRO A;  1LOG A;  1POQ A;  4KWK A;  4L97 A;  4XUN A;  3AKQ A;  3N9N A;  3PVB B;  2YU2 A;  2W1W A;  5J98 B;  3RZM A;  4K40 A;  1UXX X;  5AC9 2;  1R1Z A;  1UU4 A;  5EFU A;  1CAW A;  4BWO A;  3CU7 A;  3GZU C;  3AP9 A;  2VNO A;  4IET A;  5T55 A;  2XJT A;  3U07 A;  1D7P M;  1V6O A;  2B46 X;  4CEY C;  5A3N A;  4Z2A A;  4D8M A;  5F3G A;  1QKQ A;  1PMI A;  3LE0 A;  3AMQ A;  4GKY A;  2XON A;  2FDF A;  1POV 1;  1NCQ C;  4Q4V 3;  2WT1 A;  2JEM A;  4TLG A;  4ZXK A;  3SCG A;  3A23 A;  5DAQ A;  3KV5 A;  2YMZ A;  1QH6 A;  4DXS A;  2GH8 A;  3MDP A;  5EV7 A;  1HRV 1;  3H1W A;  3C7H A;  5JXH A;  4QKD A;  2TNF A;  4IUG A;  3WDV A;  3MPP G;  2AGS A;  1IS4 A;  3V0B B;  3A22 A;  4SBV A;  4UFK A;  2DDU A;  5T5L A;  1GFF 2;  2QTW B;  3PTR B;  1IQD C;  4UW5 A;  4KBB A;  4QM9 A;  2HWB 1;  2VTX J;  4EWE A;  1CON A;  5FMO L;  1S2K A;  1Y4W A;  4QX8 A;  1OOP C;  4LIU A;  3WHU A;  5B2G B;  1H6Y A;  4RGG A;  3KQR A;  2DBN A;  2F17 A;  1W3X A;  3SH3 A;  2PTM A;  2Y0O A;  4OUE A;  3KCX A;  3I59 B;  3N9Q A;  4YG3 A;  2D5F A;  3NNF A;  3E6C C;  2E32 A;  5DUV A;  1JH5 A;  3P5B A;  2OVU A;  1AR6 1;  4HKW A;  4NIA A;  3J4U H;  4PIX A;  1W39 A;  3NNG A;  3GJA A;  5L36 A;  2CTV A;  1XSR A;  2ZTN A;  1OF3 A;  5FZ9 A;  4H14 A;  4A41 A;  1IG3 A;  2EAL A;  2QQU A;  3KB5 A;  1H8T B;  2BEO A;  2RDQ A;  1ULG A;  1QJX 3;  1W6P B;  2PHD A;  4BLI A;  2MEV 2;  3H1M A;  2JE8 A;  3IAP A;  2XL9 A;  3WF0 A;  1F4H A;  1UIJ A;  2VNR A;  1B09 A;  4CU9 A;  5DDJ 1;  4OHX A;  2CGN A;  4D7T A;  4IV3 B;  1RC6 A;  4NRQ A;  3VBR B;  4BQ3 A;  5T54 A;  5LW9 A;  3VDD B;  1N3O A;  3CJI C;  2YC4 A;  3Q8E A;  4K1Y A;  4XJ9 A;  4LQR A;  5FMD A;  4YVS C;  1WLW A;  2EIG A;  4FXK B;  1KFX L;  4KH9 A;  1GBG A;  4L99 A;  4XHX A;  4ISR A;  5T50 A;  1FV2 A;  3P1I A;  5CFC A;  3WNK A;  5CFD C;  4IV1 B;  5FZL A;  1A6C A;  1PX3 A;  5IK8 A;  2HLE A;  3GF6 A;  4XE9 A;  2OT7 A;  5T3N A;  2WNV B;  5C9A B;  3A0N A;  2VME A;  5C4W B;  5J36 A;  2J22 A;  1NZI A;  1RJ8 A;  1W8U A;  3O5S A;  1E5I A;  4QT6 A;  1RUJ 2;  2NMN A;  2WN3 A;  4ONU A;  1R1A 1;  2QJV A;  3RWK X;  2DCJ A;  4CA9 A;  2PAK A;  1IKQ A;  4EN8 B;  2ZEY A;  4M4P A;  3PIJ A;  4CP9 B;  4OHV A;  1GZC A;  1LAJ A;  4XAB A;  4FPK A;  2JDY A;  2VZS A;  5CEH A;  5D1I A;  1OI6 A;  4JAA A;  1H6X A;  5DZG A;  3OUJ A;  2EAA A;  4XUR A;  3U0Z A;  1Y9G A;  2RS3 1;  1ENS A;  1LR5 A;  4CEY B;  2DF7 A;  3LDR A;  2GH2 A;  1WWY A;  2Q1M A;  4O9G A;  3WQ1 A;  1V70 A;  4NOT A;  4B7E A;  1NCQ B;  3V64 A;  1UY0 A;  5I0R A;  2Z42 A;  3EJK A;  3TEY A;  5BNO A;  5KR7 A;  2FBE A;  3WF2 A;  2WNU C;  2CNA A;  3AMN A;  3RI9 A;  3FHQ A;  3LPF A;  1AR6 2;  4P9L A;  3I3B A;  1JZ4 A;  4P9Y A;  3RYR A;  1CAX A;  3AKR A;  4NR1 A;  4BOW A;  5BNN C;  1AYM 2;  1Y9Q A;  3KT7 A;  5E8A A;  5FZ1 A;  2Q8C A;  2RMU 1;  3ZXL A;  1WBL A;  2WUH A;  4OUS A;  2QCS B;  5AFB A;  2VAU A;  2ZGM A;  3K3N A;  4W6X A;  1O8P A;  3NKG A;  1F4A A;  2JG9 C;  1CJP A;  2FCV A;  1HB1 A;  1UZZ A;  5DUW A;  3HPN A;  4BA6 A;  5CU1 A;  5DDJ 2;  4YW1 A;  3T08 A;  3VKL A;  3WXP A;  5A7S A;  4P02 B;  4CCN A;  3UGG A;  3ZFE B;  3CIH A;  3H3U A;  2WT0 A;  2W9X A;  5JSR A;  5FK8 A;  2Q8O A;  3HEI A;  5C7G A;  3URF A;  3HNB M;  1AYN 2;  4WBB A;  2OYZ A;  3ZVX A;  4FPG A;  3PU8 A;  2OQ6 A;  2D97 A;  1GOF A;  3SKV A;  1N47 A;  3WNM A;  4XIK A;  4B1L A;  4PDW C;  1ASJ 3;  2E26 A;  4TYS A;  3T09 A;  2NM1 A;  3ZXA C;  4DUX A;  3WIN E;  5K7P A;  2WS9 1;  4KG8 A;  1Q43 A;  3OYW B;  1IS3 A;  4XQW A;  1WA4 A;  1QOT A;  1FOD 1;  1H2M A;  4Y1U A;  5M0T A;  4M4R A;  4YVS B;  1IG0 A;  5A3M A;  5KC6 A;  5CFD B;  4NID A;  4LBJ A;  3S30 A;  2JDA A;  3ZXD A;  5FK7 A;  2EA7 A;  2PLV 2;  2RS3 2;  3ZN4 A;  1UQX A;  2VU9 A;  4FOQ A;  3LWC A;  3U11 A;  1ST8 A;  4IE6 A;  3WSO A;  1YYN A;  2VW0 A;  5DAX A;  2IXJ A;  3K4Z A;  1W06 A;  1KJR A;  1D0H A;  1AL2 2;  1RUF 3;  2C9A A;  5FZ6 A;  5ANN A;  2JDZ A;  2ZEZ A;  1GP5 A;  5FUN A;  2R06 3;  3T1M A;  4Q4Y 2;  5C33 A;  2PHW A;  2XHK A;  1PGW 1;  3BN6 A;  4H3W A;  1LHO A;  1Y43 B;  3BIW E;  3I3Q A;  4V1P A;  5EP9 A;  4AGG A;  1KS4 A;  5ACA 1;  5APA A;  2EIB A;  3LDK A;  1VBB 3;  3K3O A;  1TEI A;  1VRB A;  1LOC A;  3ZXE A;  1VR3 A;  4YWA A;  1OQD A;  2Y60 A;  1I6X A;  2A5Z A;  2UUR A;  5HV4 A;  3T4V A;  5C3O A;  3LQC A;  5C8C C;  4AEJ A;  4UW4 A;  1ND3 A;  5FP4 A;  5FXX A;  2XDV A;  1AZD A;  1B35 C;  1R08 1;  2D6L X;  2Z69 A;  3DL3 A;  3KS7 A;  4XUQ A;  5FBJ A;  4AOC A;  3IDE A;  4N43 B;  4CSW A;  4DFS A;  2I74 A;  1OD5 A;  4PF5 A;  4QX1 A;  3VZK A;  4XF0 A;  4YZ4 A;  1UO9 A;  1SPP B;  2VOW A;  2A7A A;  3PJY A;  5E16 A;  1GQH A;  4FPC A;  4N8M A;  4CXX A;  1YUD A;  2BQP A;  2A3Y A;  5FO7 B;  1NE6 A;  4M3C B;  3AFG A;  3HVD A;  3IM0 A;  2WLP A;  3N7M A;  4CCK A;  5BNN B;  1X8E A;  1QMJ A;  4ZU4 A;  3WQ0 A;  4Y33 A;  3RZL A;  1CN1 A;  3FE5 A;  5F5C A;  4AQ2 A;  1Q8S A;  2JG9 B;  4QU1 A;  5LCW L;  1WW7 A;  4RYD A;  4AQT A;  1JZ8 A;  1D4M 3;  1JHN A;  3I49 A;  2YU1 A;  3IIA A;  2VY0 A;  4AAX A;  1T2X A;  5I91 A;  2Y64 A;  2ZAB A;  1OA2 A;  5C3Q A;  4DUV A;  1GAN A;  3GBW A;  3K51 A;  1ZRC A;  1WCD J;  4R9B A;  3O7O A;  4QAW A;  2VL4 A;  1SZB A;  1S0B A;  2WS9 2;  3CNA A;  4ZXE A;  3S6P A;  1MVQ A;  2V5D A;  1RYY A;  2GSY A;  3JU9 A;  3POF A;  5BUV A;  1NE4 A;  1YI9 A;  1BQP A;  4AI1 A;  2I2S A;  4GIQ A;  1W6N A;  2GP3 A;  2P34 A;  2AAC A;  5A6Q A;  4JDM A;  3MZH A;  4HT1 T;  2FCU A;  4KWJ A;  1H2N A;  1KFU L;  2Y6K A;  4PCR A;  1ND2 A;  3SKJ E;  5D8A C;  2XQX A;  2K9Z A;  2BFU S;  2GAL A;  2QDR A;  5CBL A;  4ATE A;  2VNV A;  3GCX A;  4K20 A;  3PLQ A;  4E8C A;  2C4X A;  1DQ2 A;  2R07 1;  1GIC A;  2A75 A;  5ACA 2;  2YY1 A;  5FBZ A;  2HWD 2;  2ZEX A;  2Y6G A;  3KF5 A;  3MPB A;  2A6Y A;  4WVV A;  3TEZ A;  5IVF A;  2WA4 A;  3K77 A;  3S7E A;  2ZGK A;  4XVH A;  5EYX A;  4AVT A;  4D69 A;  1KGY A;  2G9G A;  5FMO S;  4N9H A;  3VBH A;  1MZE A;  3RMY A;  3BOD A;  3GXU A;  3ILR A;  5IVB A;  1TME 1;  3LGR A;  2XJV A;  4XPV A;  4ES8 A;  2P6H A;  2WBK A;  5BPX A;  4XFA A;  3VBS A;  2WDB A;  4MZU A;  3OBZ A;  3VHN A;  2J1E A;  2WWU A;  1QQP 2;  1STM A;  3HBK A;  1COV 3;  5T5P A;  2ZZQ A;  3EO6 A;  1AR7 1;  3ELN A;  1U0A A;  2RS5 3;  3L9J T;  2VOV A;  1H9P A;  2BOJ A;  5FZK A;  4CXY A;  2R16 A;  1RVF 3;  1UWW A;  4GWI A;  5GLZ A;  2OPK A;  5CFC C;  1J58 A;  2KM2 A;  1VRH 1;  3ZFF C;  2QZ2 A;  1QJY 1;  4CP2 A;  1YFU A;  4QPI C;  5C8C B;  5FP9 A;  5F9T A;  1DLL A;  3SXW A;  2WO2 A;  1B35 B;  3ZIX A;  5HCB A;  1APN A;  3WG2 A;  1JZ5 A;  2ZGN A;  5FY7 A;  2IXI A;  1AHS A;  4DMI A;  3POY A;  4JGZ C;  1BEV 1;  1C5I A;  2NN8 A;  4FPE A;  5K0U C;  4QU2 A;  4KGQ A;  4LUK A;  4WM8 A;  5C8W A;  4Q0S A;  1ZZ6 A;  1YQ8 A;  1YO8 A;  2W1Q A;  1RL3 A;  2C26 A;  3IT8 A;  4YW6 A;  4QPG A;  1UOB A;  1YWK A;  2O0O A;  4GWM A;  5JR2 A;  4Y4Y A;  1JZ2 A;  4HK9 A;  5GLV A;  1ZZ7 A;  3ZXG A;  4FPY A;  3LKJ A;  1H0B A;  2WQ4 A;  2OXB A;  3ZR5 A;  2ZHL A;  2RDN A;  2BVV A;  3H9A A;  1PK6 A;  5T5J A;  2HWE 1;  3RZK A;  3I54 A;  4EN9 B;  5FPU A;  3J9S A;  4M3C E;  3G7D A;  3ECQ A;  1H8V A;  2R07 2;  2RR1 2;  3N35 A;  2HBU A;  2DCY A;  2HWC 3;  4OUL A;  3UGF A;  4AI2 A;  4CDQ C;  1C4R A;  2X05 A;  4A7Y A;  1HB4 A;  3NNJ A;  2XBO 1;  3LPG A;  3NNM A;  4BQ5 A;  3LB9 A;  4FP2 A;  4ZU5 A;  5KHK A;  1QIQ A;  2VUJ A;  2RS1 1;  1GZ9 A;  2C0Z A;  1VMJ A;  1OLQ A;  1S1A A;  4IV3 A;  5A3O A;  1C8M 3;  1UF2 C;  4OZO A;  2Y33 A;  2CHH A;  3VDD A;  2DV9 A;  1DU3 D;  2WKK A;  3ME2 A;  1UYP A;  5FZI A;  5HXV A;  2GMP A;  3WDU A;  4IDZ A;  2PHR A;  4R4X A;  2ZAA A;  2WZR 1;  2FDH A;  3IBM A;  5I0S A;  4AHW A;  1NYW A;  1AR7 2;  1LGN A;  4AXO A;  5EYY A;  1J1T A;  1J3P A;  2NMO A;  3GNE A;  5DAV A;  5CB7 A;  4QHB A;  4LHS A;  1IQA A;  1Y3T A;  4BM8 A;  1XNC A;  2VBD A;  1GWK A;  1QJY 2;  1TQ5 A;  1J84 A;  4K7J A;  4CUB A;  3LOB A;  1F8V A;  3IDA A;  4KBZ A;  4MOA A;  3F95 A;  3SLI A;  3I4I A;  2PEL A;  5FQ0 B;  5HCH A;  1VBA 3;  5IVJ A;  3KT4 A;  1LRH A;  5IK5 A;  2Q4S A;  4TZD A;  5FWE A;  1ULC A;  1RUF 2;  2E51 A;  5IUQ A;  2L9L A;  2VCA A;  1VBC 2;  2W46 A;  4NO4 A;  2JX9 A;  5FY5 A;  4GAZ A;  4CEW C;  5E89 A;  4XDP A;  1SLA A;  2OQ7 A;  4HL0 A;  1QJU 3;  2QKD A;  3OBR A;  3Q8F A;  4KNC A;  3ABZ A;  2DBI A;  4IEY A;  4UT5 A;  4LR4 A;  1LOA A;  1PO1 3;  4UBH A;  4A7K A;  4FAG A;  3VKN A;  3ZFF B;  3I2F A;  3M3Q A;  2NZ9 A;  1OHF A;  1VBB 2;  5DAP A;  4QPI B;  2BVB A;  4ZPI A;  3VKM A;  1LOE A;  4XDO A;  4CRQ A;  2EVX A;  1QOS A;  4LA3 A;  1ULF A;  2KA3 A;  1HB3 A;  1GUI A;  3R4S A;  4Q1R A;  4PJY A;  2ZGQ A;  1O3S A;  5GKA C;  1ODM A;  2X5I C;  5CG9 A;  5DAB A;  2HWF 1;  4GWJ A;  2VO5 A;  4KU7 A;  1HXS 1;  1LEM A;  1NCR B;  1E57 A;  2VCB A;  3CBN A;  4FPF A;  4SLI A;  5FMB A;  1YQ5 A;  4YM2 A;  5K0U B;  3AZY A;  1H4G A;  4GXL A;  3T2Q A;  4BQY A;  1WMF A;  4PLN A;  5FCC A;  4QX7 A;  1XYO A;  4MXW B;  3FBY A;  1RHI 1;  2SBA A;  4N7U A;  3EQE A;  1MR5 A;  4YFW A;  2BJS A;  1OPO A;  1QNW A;  2E7Q A;  4NIH A;  1O5U A;  2PHX A;  3DGT A;  4MXV A;  4RD7 A;  2DWR A;  1C57 A;  2PAM A;  4LA2 A;  3AZZ A;  3IPV B;  3MLK A;  3VBO C;  5DXD A;  3C3V A;  2ARE A;  3JQW A;  2ZX0 A;  2O14 A;  4Q2F A;  4DXR A;  1FMD 1;  1TMF 1;  4DNY A;  1O3Q A;  4O61 A;  2R6Q A;  4BK5 A;  1ENR A;  3AYC A;  1CPN A;  1UCX A;  3TRS B;  3ZFE A;  3X29 B;  4Q0P A;  5FYZ A;  2QQJ A;  4B29 A;  4A7Z A;  3TN9 1;  1OT5 A;  5FMC A;  3AKP A;  2WZR 2;  3HT2 A;  3L2Y A;  1LTE A;  3HIF A;  3VZN A;  1WW5 A;  1AUY A;  5F5A A;  2VMH A;  2ZML A;  4CDQ B;  1GKB A;  1W8O A;  5EHD A;  1GSL A;  1RUD 2;  1W9T A;  2K2S A;  3MV1 1;  4JC1 A;  4NRM A;  4AF9 A;  4AI8 A;  2EID A;  2OA2 A;  2NP0 A;  1U5X A;  1G9C A;  3MYX A;  1DCS A;  4RHV 3;  3OD0 A;  3AYD A;  1BK1 A;  4HKO A;  3S5Q A;  3THP A;  1OQE A;  2DTY A;  1BVP 1;  2RJL A;  3MIH A;  1ZZ8 A;  2RHP A;  4GD4 A;  1SCR A;  4E8D A;  3WX5 A;  5EJZ B;  3MEP A;  1V6I A;  2MHF A;  2W47 A;  1ULE A;  4IEW A;  1PIV 1;  2A73 B;  4WVM B;  1F35 A;  1W6Q B;  4Z92 B;  2ORX A;  1PMH X;  1W9Y A;  1C8N A;  1YC6 1;  2GAU A;  2DTW A;  2VH9 A;  2WSV A;  4LBO A;  3AP5 A;  3THC A;  2VEC A;  3WCS A;  4IE7 A;  3TB0 A;  2RJ2 A;  4R9D A;  1EV1 3;  2GME A;  4CCE A;  2E31 A;  1MS9 A;  2TEP A;  2WFF 2;  3D0J A;  3BB6 A;  1BHG A;  1UMI A;  1R09 3;  2XJU A;  4S2G A;  4BLJ A;  2B4K A;  3A0K A;  1U12 A;  1KDM A;  4DUW A;  4CDX C;  3IN9 A;  1W8F A;  4GMP 1;  4CU8 A;  4XBQ A;  2P3J A;  2YGL A;  4ZS3 A;  1GZW B;  4MET A;  2IUW A;  4NPM A;  4K9S A;  3POB A;  1AR8 3;  1I5Z A;  4UFM A;  4U2A A;  4YG6 A;  3V65 A;  4BPZ A;  3FFZ A;  3ES1 A;  2EIE A;  4BQX A;  3SIS A;  5I93 A;  4RGK A;  5DUX A;  1HV1 A;  2W39 A;  4CEW B;  1GQP A;  1DZT A;  4A44 A;  2Y6L A;  1UZ0 A;  5JXG A;  1DP0 A;  2JDM A;  3LEK A;  3LSD A;  5DMY A;  5CNA A;  5KBF A;  1SEF A;  2ETE A;  5D21 A;  3WG4 A;  4QX5 A;  2VW1 A;  3VDB A;  5L9V A;  1RVF 2;  2W3J A;  1K5M B;  2ZCW A;  4N43 A;  1YIP A;  3DN7 A;  1FMD 2;  1TMF 2;  2VZQ A;  3IWZ A;  3JD7 1;  3LD8 A;  4LKS A;  3INA A;  1SPP A;  3UJQ A;  3Q8A A;  1SAC A;  3LOI A;  3B3Q E;  1OKQ A;  4HVO A;  4BDV B;  4O7X A;  3VKF C;  2BWC A;  1VBE 3;  2VC9 A;  2QE3 A;  4QKF A;  2PAE A;  1WCK A;  2WII B;  2XJS A;  4LBM A;  3H42 B;  3TN9 2;  3MBW A;  4RQP C;  1MZ6 A;  2XUM A;  1KIT A;  2YPD A;  5AC9 1;  2D6P A;  1CAV B;  4JX0 A;  4FFF A;  1DDL A;  4K1Z A;  1NXD 1;  4CDW C;  1LES A;  2DFB A;  1SMV A;  1UMZ A;  1VAM A;  3GBG A;  3NRU A;  4XUO A;  1K42 A;  3WOG A;  3LA7 A;  1UN1 A;  4A2U A;  4MGK E;  3THD A;  4FQ4 A;  3EB7 A;  4YAR A;  4LE4 A;  4XFG A;  3EYP A;  2BNO A;  4IND A;  3GJB A;  1Q8V A;  2VZ1 A;  1OH3 A;  1D2Q A;  3M3E A;  1NUK A;  2YBP A;  4CCO A;  1PIV 2;  1QJF A;  3OBA A;  1W6M B;  1WME A;  4NJ4 A;  4QX0 A;  4CP1 A;  1WCU A;  3KV9 A;  4NWV A;  5BNP C;  3ZYH A;  4B1M A;  4LNV A;  1VB2 A;  4WZF A;  1XE0 A;  2BRT A;  4A6S A;  3J26 N;  1X33 A;  2UWC A;  4E4D X;  2LS6 A;  2R32 A;  1BMV 2;  1QDC A;  1RJ7 A;  5F2S A;  4B4Q A;  3DXU A;  4JRA A;  3NAP B;  4KG0 A;  1MEC 2;  4MLO A;  3GZE A;  2H6B A;  1Z0H A;  1FYU A;  4IES A;  3IMM A;  5IVC A;  1BKZ A;  1PK6 C;  5CA6 A;  4BE3 A;  4FTE A;  2XHN A;  3WV6 A;  4OHZ A;  5DZF A;  3CO2 A;  2VVF A;  3OTF A;  5LRS A;  2EXJ A;  4NHL A;  1SLL A;  2DVF A;  2OPW A;  3UES A;  3ZFG A;  1HW5 A;  4PQ9 A;  4Y1Y A;  3I2I A;  5GZE A;  2VBB A;  5JPM B;  4XTM A;  2VMI A;  4AI3 A;  5JZG B;  3E97 A;  2GNB A;  5EZW A;  3GZA A;  4N53 B;  2HYX A;  2KD7 A;  1R1A 3;  4A3X A;  5LA0 A;  2J1R A;  3MW2 A;  3JD7 2;  2ZOE B;  4Y1V A;  1OSG A;  3M1H A;  3USU B;  3O1U A;  1JYI A;  4LIV A;  3KQ4 B;  4XAA A;  1G9F A;  3RZJ A;  2IFW A;  3KGZ A;  4AQ6 A;  1GQG A;  5FUP A;  1DQ1 A;  1YRZ A;  3MIB A;  1JHJ A;  1HIX A;  1RUE 1;  5SV5 A;  3TNP B;  2VMF A;  2ZX3 A;  5FO9 B;  4NE9 A;  2R04 2;  2VUL A;  2YHJ A;  2XVL A;  4RL7 A;  5H9R A;  5LBB A;  1WW6 A;  5A3P A;  1LHN A;  4Q4W 1;  4Q8L A;  4E4S A;  3FHI B;  5A3W A;  3U1X A;  2XB6 C;  1GOG A;  1RUJ 1;  4L8Q A;  2WN2 A;  2ZX4 A;  2BWA A;  3OD4 A;  1GV9 A;  4CU6 A;  1PO2 2;  3OOX A;  1DIW A;  3SQO A;  4Q26 A;  1F15 A;  2WLQ A;  4JGY B;  3WF3 A;  4CP0 A;  2BGP A;  1ZBE 3;  2PYT A;  4RQP B;  2RMU 3;  3RG0 A;  4XZU G;  3RGB A;  1PVC 2;  3RQ0 A;  3FLP A;  3ZPO A;  1MQT C;  3VKO A;  4X8P A;  3N36 A;  3GYD A;  1X7N A;  2J1S A;  3DXT A;  3A4U A;  1BBT 3;  1IZ3 A;  1RXF A;  3ZX7 A;  3III A;  5L7O A;  1UPS A;  4I30 A;  2G19 A;  5FZO B;  5FY8 A;  1X50 A;  5F37 A;  3CMG A;  1OA3 A;  5F5I A;  1FPN 2;  1JTZ X;  4J1W A;  3CZU A;  2R7E B;  2VCC A;  2SLI A;  4HAN A;  4OI0 A;  3ZXK A;  5I0D A;  3AJY A;  3RVH A;  5BNP B;  5FZ8 A;  4LXL A;  4XXA A;  3A21 A;  1GOH A;  5L9B A;  1AYM 1;  4CCD A;  1UKG A;  1NLR A;  5LK7 B;  1AR9 3;  1Z7S 1;  3VBU A;  3M7A A;  2BUK A;  5HXM A;  2ILM A;  1SLB A;  2VTF A;  4ET7 A;  1CWP A;  2BGO A;  2IXK A;  2XJQ A;  2ZGL A;  3GGL A;  2GNM A;  1HJF A;  2D3R A;  3AZV A;  3PTY A;  1JS9 A;  3LA2 A;  4L2N A;  3OCP A;  2JG8 A;  4LOR A;  5FY4 A;  5FP3 A;  3WP3 A;  1OFS A;  4LOS A;  2ET1 A;  5H9S A;  3I2D A;  1V00 A;  3J7H A;  4NN0 A;  1FOD 3;  2ZGP A;  4YVW A;  3BTX A;  3OY8 B;  4V2W A;  4OI1 A;  1IS6 A;  4YYO A;  5A32 A;  1LHV A;  3ITQ A;  2FQP A;  5F6K A;  4HSL A;  4LOT A;  4D7S A;  1G9D A;  1DF0 A;  2GP5 A;  4E4Z A;  2UYB A;  4LBN A;  5HCF A;  4DIQ A;  1RUI 3;  1AYN 1;  2VZ3 A;  5GZF A;  4CDU C;  1RMU 1;  5FR3 A;  3WG1 A;  1W0P A;  1RUE 2;  2R1B A;  3M8L A;  4QXH A;  4DRR A;  4NIG A;  3ZSM A;  5CAZ A;  3J8F 2;  4AZZ A;  1EPZ A;  2ZMK A;  1UYY A;  2JEN A;  2ZPX A;  4Q4W 2;  2VXJ A;  5C3P A;  3S57 A;  1ZM1 A;  1IPJ A;  4EN6 B;  4EZ4 A;  4IL7 A;  4PBO A;  4XJ8 A;  5JCT A;  1V9U 1;  4AED C;  1NOV A;  4Q0V A;  3QH6 A;  4C90 A;  2MPF A;  5LEK A;  5KXB A;  2IZW A;  1ZZB A;  4HG6 B;  3LAG A;  3PNA A;  1JYN A;  2BPA 2;  1UOG A;  4F83 A;  3WQB A;  4Q4X 2;  3WF4 A;  1XPW A;  3TYJ A;  5AVA A;  1LOD A;  1YQ2 A;  2PLV 1;  4HON A;  2J1V A;  2E53 A;  4XJU A;  3VD3 A;  3ALQ A;  4XHB A;  4EE2 A;  1H2L A;  1R08 3;  2ZGR A;  1ULP A;  3OGV A;  2ENR A;  2DVB A;  4HPK B;  5H9P A;  1AL2 1;  1JOP A;  1NCR A;  1K3I A;  4QMA A;  1HN1 A;  3M3O A;  4LBL A;  3PUR A;  4Q4Y 1;  1RIR A;  2H0V A;  4CXW A;  3CDZ B;  1X9P A;  1HV0 A;  1ZBA 1;  1CAU B;  4NHK A;  2BYV E;  4CU7 A;  4XTP A;  4ARY A;  3WR0 A;  2JD4 A;  3ZN6 A;  5IK7 A;  1PNF A;  1DZQ A;  2CAU A;  4TWT A;  2GN3 A;  4B8E A;  2Q0A A;  1MQT B;  4QX3 A;  4YZ5 A;  1ONA A;  3FZ3 A;  1Z7S 2;  3IPV A;  1VBD 2;  3W59 A;  4UYB A;  4DRV A;  1S0I A;  1LEN A;  4HN1 A;  3SC7 X;  1WW4 A;  3OGG A;  5IVV A;  3V0A B;  1UZV A;  2RM2 2;  1OOP B;  1XBF A;  4IER A;  5DG2 A;  1DYK A;  1ZRF A;  1QF3 A;  3JQX A;  4XJW A;  2GU9 A;  4NPL A;  1JYW A;  2CY6 A;  1UY2 A;  5KHH A;  3UL2 A;  4Z8B A;  3ZKY A;  4AL9 A;  3D3A A;  1O7F A;  4QDS A;  3IKW A;  3TOJ A;  4IXL A;  2WNO A;  2GC0 A;  5GZD A;  1HLC A;  5IYY A;  3I3M A;  4Y5S A;  2YG0 A;  4E2S A;  3WNP A;  4FT8 A;  2VJX A;  1ZZ9 A;  1LEC A;  4FVV A;  2FHR A;  3O1P A;  3T2O A;  3BIE A;  3PIG A;  2B9V A;  3T4H B;  1RMU 2;  1DGR A;  3DF0 A;  1H1M A;  4YSF A;  4Y22 A;  5ABJ A;  1JYV A;  1O3R A;  1AJO A;  5LB6 A;  1P8J A;  1QJE A;  3FN9 A;  4C0B A;  2YV8 A;  1FAY A;  4BB3 A;  3PMS A;  1DQ5 A;  1CIW A;  4RS5 C;  2WIN B;  3E6B A;  3T3Y A;  2CGO A;  5FPB A;  4OHW A;  2FMY A;  4WVM A;  1F9K A;  1V9U 2;  3CF6 E;  1W6Q A;  5FZC A;  2YC2 A;  1CZS A;  1GU3 A;  1SQ4 A;  3CJI B;  4C1W A;  3T30 A;  2JKB A;  1ZVF A;  4D3W A;  4XMI A;  1LCL A;  2KXL A;  3SEP A;  4KGG A;  3H7J A;  5H9Q A;  4JKL A;  4CDU B;  2JIC A;  2VXR A;  3J7M A;  3BUC A;  1JXN A;  1HQN A;  4YM0 A;  1YEW A;  3Q8C A;  1WMD A;  4YG0 A;  4ORF A;  4ASM B;  4MGT A;  4DY5 A;  1UX7 A;  5CKQ A;  2FZ2 A;  4BZ4 A;  1TME 3;  1GWM A;  2WWJ A;  2OKX A;  4ZON A;  5I8T A;  4BU2 A;  4C1X A;  3GM8 A;  1CD3 G;  1EAH 2;  3ORJ A;  3BTZ A;  2CGP A;  1OMI A;  4IE0 A;  4DQA A;  2WYS A;  1LKN A;  4AED B;  1KS5 A;  1JYC A;  3DPR C;  4XFI A;  3B94 A;  5FZ7 A;  1ZBA 2;  3TNQ A;  3PME A;  3AL5 A;  4QB6 A;  2HWD 1;  1MS1 A;  3H3Z A;  4XYX A;  2Q8E A;  3VBF C;  5A1F A;  1CQ9 A;  1VRH 3;  3B9I A;  2C1F A;  2WZE A;  5EWS A;  3ASI A;  1UY1 A;  4PIZ A;  5JOX A;  5CZK A;  1K5M A;  1ZNP A;  3HWJ A;  3B69 A;  2YBS A;  4XW3 A;  4W65 A;  4GB3 3;  4A45 A;  4XOG A;  4CTE A;  3RJ2 X;  3SNM A;  1JUI A;  1UMH A;  3IMN A;  3KF3 A;  3FC0 A;  4IGQ A;  4W6Y A;  1BEV 3;  1JW6 A;  2LUW A;  2XXZ A;  4WM7 C;  1WGP A;  4PQQ A;  4QD2 A;  4FSJ A;  2CV6 A;  3PUA A;  2WNU B;  4Q4V 2;  1UOF A;  1ALY A;  3WNL A;  1QQP 1;  4QX2 A;  4U36 A;  2V09 A;  3LCP A;  4YGB A;  2C5D A;  3AM2 A;  1XB9 A;  3W5M A;  4I0A A;  5BXX A;  3ZR6 A;  1KQR A;  1T6B X;  2JDU A;  4M01 A;  4R4Z A;  3WDY A;  3VL9 A;  1NXM A;  2ORZ A;  2XLG A;  2XJP A;  1TE1 B;  5FXZ A;  1JYT A;  4FOW A;  3AMP A;  1BBT 2;  4Q0U A;  2DVG A;  2A70 A;  5K4L A;  1JOJ A;  1U5I A;  2HWE 3;  2G4I A;  2YBK A;  2D7F A;  1WA6 X;  4Y20 B;  3OGS A;  4AVS A;  5C5T A;  2W2I A;  2BOI A;  1M4W A;  3MW3 A;  4ASL A;  5F6L B;  1X36 A;  3PUH A;  4H2A A;  1XU1 A;  1BK0 A;  1RGS A;  3WHT A;  4RR3 A;  1YI7 A;  2BU9 A;  1NA1 A;  2AC1 A;  2VMD A;  3ZLI A;  2XBO 3;  3N9L A;  4O65 A;  4B4R A;  5A33 B;  1UZW A;  1AR9 2;  3NAP A;  2RS1 3;  3ZSK A;  1UY3 A;  1LOB A;  4OQ8 A;  4COU A;  4FOV A;  3ZOI A;  3RDI A;  1QJX 2;  3C7G A;  2DU0 A;  4PDW B;  3KZ4 C;  1SDW A;  4RS5 B;  4XMA A;  2J42 A;  2QQW A;  1SBE A;  2R0F A;  4BME A;  1C3H A;  4CCL A;  3EHK A;  4GA9 A;  4E2G A;  5DN2 A;  1JYX A;  1GP6 A;  1AXY A;  4EQV A;  3MHZ A;  2P3Y A;  2IXL A;  2RR1 1;  5LBC A;  3U78 A;  1W2U A;  4GH4 A;  4DIN B;  3E5U A;  4Y24 A;  1AX2 A;  4Q8K A;  2YDE A;  1XND A;  1XE7 A;  2ZHN A;  1W6O B;  1OKO A;  4ISQ A;  4J25 A;  5JZG A;  4OI2 A;  3DKW A;  4UF0 B;  3VZM A;  3AKS A;  1E5S A;  1OVS A;  5LAS A;  1REE A;  3H1Y A;  3O0X A;  2Y26 A;  3JCI A;  1GP4 A;  4RFT 0;  2JG8 C;  3ACL A;  2VBP A;  1YHF A;  2D98 A;  4XFF A;  4LEJ A;  2EF6 A;  3RZG A;  4IE5 A;  4CZS A;  5HPO A;  4OVE A;  5A6Y A;  5CKM A;  5CKN A;  1NLS A;  3KV4 A;  5FOB B;  1TNF A;  3OUI A;  4FFH A;  1UNB A;  4LK6 A;  5FP7 A;  3VBF B;  4Y5T A;  3N9M A;  2BNM A;  2WA3 A;  5FZD A;  3ROU A;  1SLI A;  3DV8 A;  4AEK A;  5GLU A;  4D0Q A;  4A3Z A;  3WG3 A;  1QEX A;  5A6X A;  2Q1Z B;  2ADE A;  2HWF 3;  1VIW B;  4Y3O A;  2ARC A;  5C9A C;  1HXS 3;  4JZR A;  5JXI A;  2IC1 A;  4MX3 A;  3ZO0 B;  1DG6 A;  4LBQ B;  1AXZ A;  4WM7 B;  2FDG A;  1O5L A;  1W2T A;  2WAO A;  3VLB B;  1Q56 A;  1RUF 1;  4YZ3 A;  3UV9 A;  2R06 1;  1RHI 3;  1VBC 1;  2XKO A;  3MFC A;  2P1B A;  2W1S A;  1Q8Q A;  3V0B A;  4LBK A;  2B42 B;  4PI0 A;  3THT A;  2BGC A;  2P6C A;  1KEX A;  5KXD A;  2HYK A;  1X9T A;  3JXS A;  3ZXJ A;  1VBB 1;  2HEY F;  3FJS A;  1JI6 A;  3C7F A;  2AEN A;  1MZF A;  3R0R A;  3IDB B;  4RSU A;  1IPK A;  2WAB A;  3I2H A;  1VP6 A;  3OG2 A;  5DAW A;  4X6Q B;  5DZE A;  3QCW A;  4X8N A;  4B3N A;  3I59 A;  3RZH A;  2XL7 A;  4UBG A;  4XDQ A;  1XJA A;  1K5J A;  5HV0 A;  1PGL 2;  3MF9 A;  5BNO C;  5FZ4 A;  5F3C A;  2NYY A;  2VZT A;  1FXZ A;  4N90 A;  2W52 A;  5SV8 A;  3LEG A;  5FYV A;  4YM3 A;  1GLH A;  5A1A A;  2D3S A;  3CJX A;  3ZYP A;  4CUA A;  3AVS A;  4MYE A;  1H8T A;  4HFS A;  3HQX A;  4IEX A;  4JKM A;  1W6P A;  4I0W B;  1Z78 A;  4AHY A;  5GLW A;  4NRP A;  4LT5 A;  1H2K A;  4QKN A;  2YFZ A;  4JV4 A;  5D8A B;  3USS A;  4C91 A;  1WLC A;  2X09 A;  3WD5 A;  3UKT A;  3AP6 A;  2ATF A;  1DGL A;  1LOF A;  2DYC A;  4W8J A;  4GUL A;  3VBR A;  3NWK A;  1ULD A;  5KXC A;  1WD3 A;  1QJZ A;  1RED A;  1ASJ 2;  1F5F A;  1HRI 3;  1SLC A;  4I3G A;  3W5N A;  1OUS A;  2XKP A;  1RUG 3;  2WO7 A;  4LPL A;  1A78 A;  4A6O A;  3BTY A;  3OF1 A;  4IV1 A;  4O9E A;  1RUD 1;  1IPS A;  1NLQ A;  2ZKL A;  4OMD A;  5JSP A;  2DFC A;  2WNV A;  5C9A A;  4GMP 3;  3AVR A;  1LNS A;  5C4W A;  1OUX A;  3FUQ A;  3MIG A;  1GR3 A;  2XUE A;  4CVU A;  3MIC A;  2QQO A;  1H30 A;  1MAC A;  4BIS A;  2ZGU A;  4L0P A;  1H1A A;  1W2O A;  3NNL A;  2PHT A;  3ZXF A;  1C1F A;  1PZ7 A;  2J1T A;  3PUS A;  3UNP A;  4RN5 A;  3WW2 A;  2IXH A;  2YC0 A;  3JBG 3;  4R9A A;  4CP9 A;  2PQQ A;  4LO8 A;  1QY4 A;  4OMC A;  1R64 A;  3GAL A;  4FFI A;  4DO0 A;  1YIF A;  2R06 2;  4QHZ A;  5FYB A;  4GZ9 A;  4A42 A;  1X82 A;  4QQ2 A;  4XXP A;  3WEZ A;  4CCM A;  3O1O A;  3MV0 1;  2VOX A;  4YGC A;  4COW A;  2RDR A;  2ZXQ A;  5CFC B;  1XOY A;  2WFF 1;  4CEY A;  2RV9 A;  2K0G A;  3GHN A;  1FI2 A;  4AFC A;  2CWS A;  2IVI B;  3JUU A;  1NCQ A;  4BQW A;  3P3N A;  2AEZ A;  5L73 A;  1NQD A;  1NX9 A;  4IEQ A;  3ZMO A;  3U4X A;  1K45 A;  2WYF A;  4FI9 A;  4XET A;  1JUH A;  1JU4 A;  4JGZ B;  1XXN A;  3RZZ A;  3VN4 A;  3VD7 A;  3Q9O A;  1W99 A;  3O1T A;  1EUT A;  3BU0 A;  5AC9 3;  2OUH A;  2ZHM A;  4CCC A;  2BNN A;  3QOP A;  1ENQ A;  2MNG A;  1J1L A;  3M70 A;  5FOJ B;  1COV 1;  3KCY A;  4BK4 A;  5A7N A;  1RVF 1;  2NLR A;  1OOP A;  2QQL A;  3N7K A;  5I8Y A;  2FDJ A;  1SHW B;  3BPZ A;  4JTN A;  3UT0 A;  2RJK A;  4URA A;  3GCW A;  3VV1 A;  1FX5 A;  4HSJ A;  3CEW A;  2PA7 A;  4MO3 M;  1ND3 C;  4XAE A;  3ZYG A;  2BER A;  1MZ5 A;  4YFZ A;  5BNO B;  3FL7 A;  1D4M 2;  4Z1V A;  5JOY A;  4AE2 A;  1ZX5 A;  2E6V A;  4DB5 A;  3VL8 A;  4B7K A;  1G9A A;  4Y4R A;  1E5R A;  4QM8 A;  1YQ6 A;  3ZKU A;  4QQH A;  1BJQ A;  5FLI A;  4UFI A;  3LF7 A;  4OCT A;  1CAX B;  2ARA A;  1UKR A;  1G8W A;  4K8R B;  3NQH A;  1RUH 3;  1XC6 A;  5LA2 A;  4QGN A;  2R1D A;  4QGL A;  5FYI A;  4E4H A;  4QWN A;  3GDB A;  4FPJ A;  1UX6 A;  1PGS A;  1OFN A;  2CYF A;  2ZBJ A;  3FX3 A;  4QDR A;  4URT A;  4DOU A;  5FYS A;  5JOZ A;  4OI4 A;  1BXH A;  3O0V A;  3OYW A;  4HN0 A;  1MS5 A;  1WLT A;  3CJI A;  4YVS A;  4CUG A;  5I0T A;  3SMH A;  1XRU A;  2LRP A;  3POJ A;  4BXS V;  5CFD A;  4AFM A;  5IAT A;  1O8S A;  1ZRR A;  3UKV A;  1W9W A;  5JDB A;  2Z5W A;  4JVA A;  1J83 A;  1PZ8 A;  2H6C A;  1JN2 P;  2MEV 3;  2D6O X;  4I09 A;  2VD7 A;  2XLF A;  3UGH A;  5JIA A;  3WW1 A;  5LZ6 A;  1BMV 1;  1RUC 3;  1O3T A;  2X8K A;  3O1S A;  2DU1 A;  2BW8 A;  1MEC 1;  3PUQ A;  5EXO A;  1RTV A;  1UYZ A;  3MIF A;  3NST A;  2EXK A;  3AB0 A;  5A3L A;  3B93 A;  1ND2 C;  5DG1 A;  3DKQ A;  3E5X A;  3MUY 1;  2JB8 A;  3UJO A;  3WT3 A;  3PDQ A;  3ZYJ B;  1YJK A;  3HN1 A;  1DHK B;  1S4C A;  2FCT A;  5FZE A;  1C8M 1;  4HKL A;  5FZB A;  2ZGS A;  1CZV A;  3POG A;  4LHN A;  3AMH A;  4XBN A;  3W21 A;  1CVN A;  2Y38 A;  5J37 A;  4AWD A;  4BIF A;  1WCS A;  1N3P A;  3PJQ A;  4PLM A;  4P9X A;  4IEO A;  2ZZJ A;  1Y9M A;  1COV 2;  1OVP A;  1TNR A;  3MIE A;  4P9W A;  2D6M A;  1D2S A;  2RS5 2;  4Z07 A;  1G86 A;  1N3Q A;  3BOP A;  3K2O A;  4AVA A;  3ZSJ A;  3EXU A;  4DZG A;  4FPO B;  4Y1Z A;  4AI9 A;  3QH7 A;  3NJY A;  3WW4 A;  4LKF A;  1POV 3;  1UL9 A;  1RUJ 3;  4XF9 A;  3VBH C;  3DYO A;  2VZR A;  1SCS A;  2X5I B;  4OYU A;  4FO9 A;  3NL1 A;  3U10 A;  1W3V A;  2JB4 A;  5LK5 A;  3T0A A;  5JVV A;  4Z82 A;  1ZRD A;  2JE9 A;  1HRV 3;  1VBA 1;  2ZHK A;  3NMB A;  4GAL A;  3VBS C;  1RB8 G;  2FD8 A;  5BY5 A;  1KDK A;  4ZKT B;  4P9J A;  4Q27 A;  3ETP A;  4M3C A;  5BNN A;  2ZKN A;  2DUO A;  3O1M A;  1Y7B A;  1MS4 A;  2HWB 3;  1Q8P A;  2R04 1;  4LKE A;  2JG9 A;  3IAQ A;  4LK7 A;  4KMQ A;  3VBO B;  3BI3 A;  1PO1 1;  4AR2 A;  2QNK A;  1HQW A;  2V4V A;  4QQP A;  4P14 A;  2VMG A;  1ND3 B;  1GYK A;  2LTN A;  3DYP A;  2QQP A;  1OQ1 A;  3H0O A;  2Y0I A;  3POE A;  1UY4 A;  1AX0 A;  1AR6 3;  1DGR N;  1PM7 A;  2O1Q A;  1PO2 1;  2OZJ A;  1BCX A;  2C6S A;  2ZMN A;  4JQR A;  4KL1 A;  4EV0 A;  3FUO A;  1AYM 3;  2PMW B;  3O1R A;  4LO7 A;  1QNY A;  2J1U A;  4DXZ A;  5HCA A;  4CPB A;  5E6H A;  3H8O A;  1LGB A;  1PVC 1;  2Z2S B;  4WM8 C;  3MI8 A;  3ZYI B;  2HEW F;  1WBF A;  4OLL A;  1QXR A;  4L9B A;  3GZT B;  1FNY A;  1O91 A;  5E1R A;  2HWC 2;  4LMF A;  1S2E A;  4QPG C;  4I01 A;  4F3J A;  5BYN A;  1S0F A;  1RXG A;  2VZP A;  1Q3E A;  2OUJ A;  5DDJ 3;  4XC9 A;  2UY8 A;  5JIU A;  1FPN 1;  2ZGT A;  5KHJ A;  5FZ0 A;  4C0H A;  5KC5 A;  3C7E A;  2K46 A;  5IAX A;  5JSO A;  1CR7 A;  2YUE A;  3UYJ A;  2GND A;  2GZW A;  1C8M 2;  2XG3 A;  5FZF A;  4YW4 A;  3PUI A;  1BLZ A;  4AFD A;  1NT0 A;  4EWD A;  4CPB D;  3T0B A;  1AYN 3;  4PI2 A;  3VHP A;  2XML A;  2V72 A;  4D6R A;  3J7L A;  4ZHN A;  3D8C A;  4ARX A;  2VVD A;  5F32 A;  1KXG A;  5D2A A;  1F2N A;  2Y6F A;  3B00 A;  5IK4 A;  4YZ1 A;  2X10 A;  4LO4 B;  4P5H A;  4GJZ A;  5KWR A;  4CDX B;  5JXJ A;  1ZZC A;  2AEY A;  3R4U A;  1ND2 B;  4FQZ A;  3K46 A;  2CDP A;  3NW4 A;  2ID4 A;  3BCW A;  3RI8 A;  3MLJ A;  1LOF C;  4IGO A;  4IV3 C;  5IHR A;  3HAG A;  3NO8 A;  1VBA 2;  3HQR A;  3VDD C;  4C8D A;  3JBG 2;  3D4K A;  1OD3 A;  3WCR A;  4LO6 B;  1D0G A;  3LZZ A;  4EYU A;  2JDN A;  1N1V A;  5B4X A;  3AYE A;  2PLV 3;  4W50 A;  2RS3 3;  1VAL A;  1QJU 2;  5DUU A;  1VPH A;  3J8F 1;  4S2F A;  1EV1 1;  3ACI A;  3AJZ A;  2QQV A;  3HOB A;  3ACH A;  2PXJ A;  4GJY A;  4XF1 A;  1PO1 2;  1B35 A;  1IS5 A;  1AL2 3;  1BYH A;  1REF A;  3P3P A;  3VBH B;  4B4P A;  4YPJ A;  5FPX A;  4NHY A;  2WZ8 A;  4LBQ A;  5FLH A;  4Q4Y 3;  4L11 A;  2B9U A;  4YLZ A;  2D3P A;  5LAT A;  3AZX A;  5A70 A;  2LW8 A;  4G4F A;  3V56 A;  4KU8 A;  1ODN A;  4IW3 A;  1RUN A;  2EXI A;  3LEI A;  3NV1 A;  2WNE A;  2WQZ C;  4OQ9 A;  2AR6 A;  2A3X A;  1JZ3 A;  4AHZ A;  5IVY A;  3HMY A;  3LEM A;  4AVC A;  5A7W B;  4OUM A;  2VR4 A;  3B01 A;  3DEM A;  1DYP A;  2CU5 A;  4FAH A;  5GZG A;  4MGQ A;  1LGC A;  4ERO A;  4Q4X 1;  1C28 A;  4WV8 A;  1ENX A;  1W8Z A;  1PZ9 A;  5AFE A;  4CDW B;  1OA4 A;  3N7L A;  5JOW A;  2QQM A;  1HN0 A;  4RGA A;  1I5P A;  1LUL A;  2WJS A;  4EZH A;  3BAL A;  1XNA A;  2BFU L;  1AJK A;  4AGR A;  1A8M A;  4LBQ D;  1CZT A;  3VD9 A;  5FFO C;  3C8X A;  1GNY A;  1SFN A;  3IDC B;  4LLF A;  5F39 A;  3OB8 A;  5G04 L;  1CIY A;  1S0E A;  3E1F 1;  4Q1P A;  5JUV A;  5DPN A;  1HJG A;  1SG3 A;  2JKX A;  3KD4 A;  1VBE 1;  5JPN B;  3WDW A;  2UU8 A;  5IWF A;  5FKB A;  4WM8 B;  2V4A A;  5L9R A;  2VQT A;  4A4A A;  4CYD A;  1VBD 1;  1EUU A;  2B39 A;  4KQ7 A;  3RFR A;  1UPI A;  1V6M A;  4QPW A;  4QPG B;  2RM2 1;  1FV3 A;  5D8A A;  1OC1 A;  1UU5 A;  1TVG A;  1RUH 2;  4BYY A;  3ACG A;  5JMO A;  3U4S A;  1S0D A;  1NG0 A;  2W94 A;  1MS8 A;  1XYP A;  4QGM A;  4UXA A;  5FYM A;  4RHV 2;  3U37 A;  3WNN A;  2WS9 3;  2F4L A;  5T5O A;  4E9K A;  4F7Z A;  1PK6 B;  5KHG A;  3ZFE C;  1V6J A;  1WMX A;  2HH9 A;  3E5Q A;  2IXC A;  4MSV A;  1LHU A;  4HVQ A;  1DFQ A;  2ARB A;  5J48 A;  3R6S A;  4HZF A;  1SDD B;  2R49 A;  5K8S A;  4MGS A;  3CKH A;  2YB7 A;  3AXD A;  3DCQ A;  4IGP A;  5JMC A;  3SH4 A;  2NQY A;  1F5J A;  2ZX2 A;  2A6X A;  3EBR A;  3HNM A;  4IEZ A;  3WF1 A;  5JAX A;  3TEW A;  3DUI A;  2VUC A;  1DQ4 A;  2WT2 A;  2VG9 A;  2QQK A;  1EV1 2;  4GMP 0;  5A7O A;  4M3C F;  1DQ0 A;  1RUC 2;  1R09 2;  5FQ0 A;  3AC0 A;  2C9K A;  1W2A X;  3FMG A;  2WRA A;  4K8F A;  4JKK A;  1W9F A;  3ENR A;  4XFB A;  1W8W A;  3RWN A;  3VZO A;  2Q1F A;  3PVO A;  4AG4 A;  1DGW A;  4AGV A;  2PHU A;  5FZ3 A;  5BNQ A;  3BKZ A;  2ERF A;  4H7L A;  1GWL A;  1AR8 2;  4G9S B;  1WCQ A;  5ACA 3;  2P5B A;  2HWD 3;  2VZO A;  2ARX A;  3APB A;  2EAK A;  3U14 A;  4P08 A;  2ET7 A;  3WP6 A;  2BZD A;  2VW2 A;  4W6W A;  1F31 A;  1ZA4 A;  3I2G A;  4MUV A;  4W4Z A;  3ZFF A;  4BQ1 A;  2P3I A;  3HJR A;  1V0A A;  3JB8 A;  4QPI A;  1K12 A;  1CGP A;  1AX1 A;  1KD7 A;  1OXC A;  1JZ6 A;  3HN3 A;  2EIC A;  5LY2 A;  2J7M A;  1WD4 A;  1EAH 1;  2A6V A;  3S7I A;  3R05 A;  4XF3 A;  1ZYB A;  2AH2 A;  3AXE A;  4JGZ A;  4AYU A;  4MGZ E;  3B5L B;  5K0U A;  3QBQ A;  3I2O A;  1QQP 3;  1RUO A;  4BIO A;  2W5F A;  4XEZ A;  3NJZ A;  4S2D A;  2G9F A;  3ON7 A;  4MXW A;  4XCB A;  2OS2 A;  2O8O A;  4COZ A;  1HRV 2;  3IB3 A;  4LUM A;  2B7Y A;  1VBE 2;  4E27 A;  3S0M A;  4AQS A;  2D5H A;  3VB9 A;  4QXK A;  3ZIW A;  5EJ3 A;  1W90 A;  5F3E A;  5KXE A;  4ZY9 A;  3VHO A;  5FY1 A;  3OSD A;  2HWB 2;  2E63 A;  3HNY M;  2ES3 A;  4XF4 A;  2VTX A;  3H8X A;  2Y6H A;  4YW7 A;  4N43 C;  4KWU A;  4H7M A;  4PF1 A;  1KRI A;  4Q4V 1;  4P00 B;  4M0N A;  1LB2 A;  4LJH A;  4UW6 A;  2QFE A;  1L3J A;  2WZP P;  2XH6 A;  1W9S A;  4CDQ A;  1FT9 A;  4LTA A;  1URX A;  1ZBE 1;  5IW0 A;  3CLP A;  1WLD A;  3D6E A;  5FKC A;  2UWA A;  4UW3 A;  2J1A A;  4FOY A;  1LHW A;  5FV3 A;  3H3L A;  4JDN A;  4COY A;  2BDR A;  1BBT 1;  1QXP A;  2XJR A;  4YRD A;  2OZ6 A;  1US2 A;  4HK8 A;  2CSG A;  2YRO A;  2WC2 A;  2V73 A;  1EY2 A;  5CIR A;  2XVK A;  4HVR A;  4CUC A;  2PFW A;  4YM1 A;  3KT1 A;  2VUA A;  3VD4 A;  3OGJ A;  4MHR A;  4YNI A;  2C24 A;  1EP0 A;  2VOK A;  3J7N A;  3H8R A;  2R07 3;  2RR1 3;  3LA3 A;  2Y8K A;  2VQU A;  2VNG A;  3CQO A;  4FCA A;  4I2O A;  2QZ3 A;  1DQ6 A;  4BMB A;  1PVX A;  4AFB A;  5FDB A;  4UFH A;  2W92 A;  2VVE A;  4NHM A;  3KSC A;  2W08 A;  3W58 A;  4Z2W A;  1W05 A;  1AR9 1;  3PHM A;  4LHL A;  3ZYR A;  4R8H A;  4YW2 A;  1IKP A;  4UAP A;  1QJX 1;  3FFQ A;  1GZW A;  1QU0 A;  2O8Q A;  3DYM A;  4NMI A;  3ZDS A;  5JR7 B;  3POI A;  4UWD A;  4HBN A;  3WVJ A;  1R1A 2;  1MS3 A;  5K9Y A;  3G6J B;  1UZY A;  4CEW A;  3WUC A;  1AR7 3; 
#chains in the Genus database with same CATH homology
 2VUC A;  1W8F A;  4CE8 A;  2BP6 A;  2JDU A;  2JDN A;  1OUS A;  1OVS A;  4UT5 A;  5A6X A;  2JDH A;  2WRA A;  2BV4 A;  1W8H A;  2WR9 A;  5D2A A;  2JDY A;  5A6Y A;  2VNV A;  1UQX A;  4AOC A;  1OUX A;  2JDP A;  2BOJ A;  5A6Z A;  2BOI A;  2JDM A;  3ZDV A;  2VUD A;  5HCH A;  1OVP A;  2XR4 A;  1GZT A;  5A70 A;  1UZV A;  5A3O A;  2JDK A;  3DCQ A;  2CHH A;  1OXC A;  5A6Q A;  1OUR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...