2JDKA

Lectin pa-iil of p.aeruginosa complexed with disaccharide derivative
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
114
structure length
114
Chain Sequence
ATQGVFTLPANTRFGVTAFANSSGTQTVNVLVNNETAATFSGQSTNNAVIGTQVLNSGSSGKVQVQVSVNGRPSDLVSAQVILTNELNFALVGSEDGTDNDYNDAVVVINWPLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FUCOSE-BINDING LECTIN PA-IIL
publication title X-Ray Structures and Thermodynamics of the Interaction of Pa-Iil from Pseudomonas Aeruginosa with Disaccharide Derivatives.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Lectin
total genus 20
structure length 114
sequence length 114
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07472 PA-IIL Fucose-binding lectin II (PA-IIL)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.400 Mainly Beta Sandwich Jelly Rolls Calcium-mediated lectin 2jdkA00
1OVSA 2XR4A 1GZTA 1W8FA 5D2AA 2BV4A 1W8HA 2BP6A 1UZVA 2WRAA 4UT5A 2BOIA 2JDNA 1OVPA 3ZDVA 1OURA 1OXCA 2WR9A 1OUSA 5A6YA 5A3OA 5A6XA 2JDUA 4CE8A 2JDHA 2VUDA 2VNVA 2CHHA 1OUXA 5A6ZA 5A6QA 2JDMA 2VUCA 4AOCA 2JDYA 1UQXA 3DCQA 5HCHA 5A70A 2JDKA 2BOJA 2JDPA
chains in the Genus database with same CATH superfamily
1GR3A 1FOD2 1H8VA 3BODA 2XPJA 1PVXA 1NXMA 4CEYB 1C5HA 3NWKA 4META 5GZDA 4ZKTB 1AR93 4HSJA 4JTOA 4XDPA 5SV8A 2CYFA 2ZAAA 2RS31 4FPGA 3BTXA 4ORFA 5FP3A 5C4WB 4AWDA 5KWRA 1QQP1 1H2MA 1PZ7A 3CJIA 4YLZA 5IW0A 4LBOA 2A1XA 3T2TA 1W6PB 2Z2SB 3SEEA 3AZYA 5EXOA 1AYN3 5F39A 1M06G 4QPYA 2E33A 2I45A 1QHDA 4N43A 4FOVA 1HQNA 5KC6A 1W0NA 4ZXKA 4CDUA 4XF4A 5EWSA 2EA7A 1DGRA 3LZZA 2L9LA 3IPVB 4OHXA 1VAKA 1BKZA 2AR6A 4J6GA 1ENQA 4KNCA 4YZ2A 3WNKA 3WEZA 2G19A 3D3AA 3T2OA 4CDWC 2BGCA 1JXNA 2VGDA 4V2VA 3RQ0A 4DINB 5FYMA 3ZXAC 5IVVA 3U1XA 2VTXA 4TWTA 2VBPA 5DAWA 4LORA 5A1LA 3ZN4A 4LXLA 1S0JA 3OY8B 4XMIA 4YM2A 3FJSA 2PLV1 3J7LA 1UIKA 5F6KA 3GNEA 3V0BA 4CDQA 2BTVC 4R4ZA 1GOGA 3SCFA 3SXWA 5T5LA 2FDIA 2ATFA 1ZZCA 4AEDC 2RR11 4Q4V1 5I0DA 1Q5OA 3VZOA 5M0TA 4NE9A 4QD2A 4Y33A 4AVVA 2B9UA 1Z0HA 1D4M1 4QHOA 4UBHA 3BB6A 4JGZC 2FHRA 4Y3OA 1DCSA 1OQDA 2JECA 4TSVA 3T08A 3O14A 4QM8A 3ABZA 2ORXA 2LW8A 1OA3A 4HPKA 1H8TC 1JODA 4JKKA 4B7KA 5GM0A 2YBKA 3KHCA 1GKBA 1GZ9A 4OHVA 3T0DA 1HX6A 2FDGA 4GIQA 1OFNA 4LNVA 3KM5A 5LA0A 5JDBA 2D5FA 1OF3A 3DUIA 4LITA 3AM2A 1XNBA 4AQ2A 4ES8A 3ST7A 3VBUA 2ORZA 1AXZA 2ZKLA 4AEJA 4XFGA 1F4HA 3SQOA 4EE2A 4I2OA 4XFBA 1SACA 1BEV1 3U4SA 2QVSB 1XE0A 3A0NA 4BDVB 3RJ2X 2XG3A 2NMNA 1AR63 4D6QA 1MZFA 3W21A 3ZXEA 5T5JA 2ARAA 1RTVA 2ETEA 1CAWA 4J25A 4XILA 2XQXA 3POGA 2WBKA 4QX7A 4RR3C 3MV11 3M2MA 2CWSA 3VZMA 2N7GA 3LD8A 3NJXA 3PIGA 2WZ8A 2HBUA 1REFA 3WDVA 2VO5A 1HQWA 3ENRA 4OMCA 3CJIB 3T4HB 1GNHA 2VNOA 1A8DA 4C0BA 3WNPA 2W52A 4N43B 1FMD2 1RB8G 4NWVA 4Y24A 1UF2C 4RL7A 1L7LA 5K0UA 4CDUB 2BJSA 2Y6HA 5JLVA 2CDOA 4HXCA 2MNGA 3O0WA 2XXZA 2ENRA 2XLFA 1OOPC 5GLUA 4RGGA 4YWAA 2XL9A 2XJQA 3SH4A 1EAH2 2IWGB 5A3WA 1LHOA 4K3UA 1UIJA 1W3VA 4Q8LA 4R9CA 1ENXA 2C4XA 2VU9A 1N3QA 1Q8QA 4OLLA 1OLRA 2ZEXA 4P5YA 3GHMA 3NV1A 4N8MA 3D0SA 3O0XA 5A7SA 3NJZA 5BV6A 4MGYE 4CP2A 2BERA 3FC0A 3N9LA 1VRH2 3K3OA 1XXNA 1XJAA 5EV7A 4CDQB 3WNMA 2DCJA 1FPN1 4AW7A 4QX3A 2ZHMA 2XJUA 1LOEA 1CAUA 4AHWA 5JOYA 3NAPA 1NA1B 4CDXA 2G9FA 2VVFA 1XYPA 3BOPA 2OKXA 4Z1VA 1LHWA 1XBFA 5E16A 1AL22 1NCRA 1S1AA 1AJOA 1DZQA 1I9RA 4QQOA 1JZ6A 2BP6A 2D6MA 2GU9A 3HMYA 5CYYA 1SDWA 2D6PA 2BOIA 1ZBA1 3CEWA 4HPKB 5A7QA 4CUCA 5ISLA 1UYYA 2VTXJ 2VZOA 4QX5A 2SBAA 4GH4C 1FMD3 1K45A 2QKDA 2DBNA 3LA2A 1J3QA 1RUC2 2W46A 1TMF1 1J84A 2Z42A 2JDUA 4QX8A 4YFZA 2YFUA 4ASLA 5JR2A 4UXAA 3GZUC 2A70A 1QNWA 1PMJX 4IDZA 5EP9A 3VBUB 5L7OB 1ASJ3 1QU0A 3RMYA 1EAH3 1OA2A 3D8CA 2ZEZA 2OQ6A 4NHMA 3LOIA 4XIKA 5GZCA 2E7TA 1WLWA 2YU2A 1GWLA 3ZMOA 5ABJC 1LJ7A 2XR4A 5LBCA 5A80A 2WNOA 1VRH3 2WSVA 1A8MA 2ZTNA 2OUHA 4F83A 5IAXA 3CZJA 2CGOA 5FY5A 1YNAA 5EJ1B 2Z5WA 4D94A 3O1RA 4BQ2A 4MGSA 1GNYA 3OCPA 4BIFA 1C1LA 1CAXA 4URTA 1WZXA 4UBGA 2FQPA 4XF9A 2QQNA 3J8F1 4KI5M 3AFGA 4YM0A 1NCQB 1RHI2 1WA6X 5HI0A 1AL23 4GWIA 2JDAA 2Q8EA 3A4UA 1X33A 1ZVFA 5K0UB 1V6JA 3OBTA 1RMU2 2D6LX 2FZ2A 4XETA 3V0AA 2NM1A 2ARXA 1U5ZA 1RUC3 4GXLA 4QDQA 1CIWA 2JB4A 3IZOA 1LKNA 2JIJA 4HN0A 1HRI3 3WOGA 2D3PA 2EVXA 5LBBA 5DZFA 2IXCA 4AYUA 5FUNA 1QWRA 2H6BA 2RS51 3NJYA 5FZOB 1TNFA 2HWD3 3SKJE 3DECA 1VBE2 3UJQA 5JZGC 3PUHA 4RSUA 4G3YC 1ZRRA 2VNGA 2MEV2 2CHHA 2WFF2 3D82A 3MLKA 1NQDA 4N7IA 1RUE1 3RG0A 3VL9A 4D7SA 3E6CC 2ZGQA 3H7YA 2A73B 3ILRA 1SPPA 2FCVA 4MGTA 2BNMA 4MGKE 5KHHA 4B7EA 4XQ4A 1ZREA 3NAPB 1WD4A 3WQ1A 1UPIA 2YXSA 3VZNA 4CDXB 1QKQA 1ST8A 4MUVA 2FCUA 5C8CA 5F6LB 2XKOA 2VOKA 3GM8A 3CLPA 2WWSA 3Q8CA 1LR5A 1ULOA 2YV8A 3VBFA 1RHI3 2PHTA 4OI4A 3IWZA 3I59B 2GC3A 3LQCA 2A6ZA 1Q43A 4I02A 4R9AA 2B39A 2Q1MA 3PL0A 1RMU3 5FZCA 2WN3A 3I8TA 3AZZA 5FPVA 2V72A 2WABA 4OUMA 5FCCA 5IK4A 2VOVA 1MEC1 5L9VA 4Q4X2 4QXBA 3LEGA 1ULPA 3ZYBA 2TNFA 3THPA 4FFFA 4AFMA 5FZ8A 2VZ1A 3TN92 1ULEA 4P9LA 3SH5A 4F3JA 4NO4A 1DGWX 4B4RA 1W9SA 2R16A 5FJHA 3I2FA 5FYZA 5IVEA 1NLQA 1G7YA 1VBE3 1YXWA 3VBSC 4OULA 4A6SA 3LE0A 3GCWA 2W95A 4CVUA 2MEV3 2WFF3 2X5IA 5FZ6A 3BIWE 1UY1A 1W39A 5FO8B 1POV0 4Z2WA 1W8OA 4TXWA 1VIWB 3FE5A 3M3IA 4HKWA 5CZKA 2R1BA 3CO2A 3FHAA 2WWUA 3PNAA 3ZXKA 1WGPA 4LBQA 4EWAA 4CU8A 3LF7A 3ZFEC 2HYKA 3THCA 2ZX2A 4B29A 1GOFA 1W8NA 3U37A 1A3KA 4NHKA 3WDXA 1OFSA 1COV1 5DDJ3 3LDRA 4FPCA 2AUYA 5K9YA 3WG3A 1QF3A 1FOD1 1NLRA 5AC92 5B4XA 2PFWA 3V0AB 3TNPB 1Q3EA 1DGWA 3BU7A 4Z2AA 5BNNC 5JI9A 1BMV1 1NQJA 3JBG3 4XTPA 1V6IA 1C57A 2RDQA 3EO6A 4F7ZA 2YHJA 3RFRA 2OZ6A 4PI2A 1D7PM 3IIIA 4W50A 3RWKX 3CQOA 2E32A 3EBRA 1GMMA 2A3YA 5JSOA 3W59A 5ANNA 3MLLA 3QCWA 1U0AA 1MVQA 4N53C 5D1IA 2ZACA 1R64A 3M8LA 3PDQA 3TN93 1JYIA 5CFCC 1YFUA 3VGIA 1JUIA 2HWF2 1GUIA 2XJVA 1W6QA 3O12A 1VBC2 3RYKA 1SPPB 3MO4A 1H6YA 2JWPA 1H1MA 4NR1A 5DAXA 5A7NA 4CRQA 4D6RA 3GF6A 3AX4A 3NL1A 4DB5A 4NUBA 3WDYA 4EJRA 4JTNA 3WSOA 3AZXA 4HK9A 2YY1A 1ZYBA 4UFMA 5C8CB 4XXAA 4E8CA 1JOBA 4GJZA 4LHSA 2FDFA 2B4KA 2SLIA 2CWMA 3VBFB 4IQPA 4W6XA 3WDTA 1HRV1 2NLRA 1VBA3 4IGQA 5JUVA 1E5IA 4NPLA 4YNIA 1STMA 3U14A 4JGYC 1TEIA 5AC93 4HN1A 3POWA 2GMEA 4MOAA 4B4QA 2RS32 4CP9B 5IATA 1F9KA 4Q4W3 3N3HA 4W6YA 3S30A 1MZEA 1QQP2 4CXXA 3Q9OA 3ETPA 1SLIA 4KG8A 2XJRA 3NV4A 4QKNA 4B1MA 1SFNA 1IPSA 3MF9A 2BFUS 5A3UA 5IK8A 2OQ7A 1OH3A 3FLPA 5FZ7A 4BM8A 4CYDA 2UURA 3D4KA 3GJAA 4UW6A 4CCDA 1UU6A 4XIOA 1TE1B 2ILMA 2K2SA 2QUOA 1WKYA 1YIPA 1W9YA 2XBO1 2W1UA 3MUY1 3R6SA 4EN8B 3J7HA 4LKDA 4Q8KA 3MZHA 5KC5A 2ZGKA 2HWF3 4UF0A 1FXZA 3RJRA 1NUKA 2RHPA 3CIHA 2V73A 1DGRN 1LENA 3L9JT 4EWDA 1S0GA 2P6CA 4LBQB 4UWDA 1CX4A 1BBT1 2HEVF 1U5IA 2LS6A 4LIUA 4NOTA 2PLV2 4XZUG 1US3A 4O65A 4N9HA 4COVA 2IXKA 4HMZA 3MLJA 2RR12 3CJXA 4Q4V2 5A70A 1G9AA 4LBNA 4XDQA 1W6OA 4WM7A 3MPBA 2K9ZA 1R1A1 2AZ5A 1XQNA 3T2PA 4QMAA 1MQTA 1D4M2 5CKNA 2RJLA 2RS33 3ITQA 1W2OA 5BNOA 3R05A 1QQP3 1UXZA 2DUQA 1PMHX 4F8AA 4UW5A 2UY9A 3R4DB 2ZGSA 5F3EA 3T1MA 4INDA 2GN3A 1IQAA 4RD7A 3KHBA 4XC9A 4JHTA 1DQ5A 1GZCA 4HVOA 5FY4A 2RG4A 2VNVA 1RUH1 1SMVA 5EJZB 3IIAA 3RPQA 4W8JA 3SH3A 2PYTA 3I3QA 1POV1 1W6QB 2BBAA 5A1FA 1UCXA 3VKLA 3WY6A 2Q30A 1LGNA 1DF0A 1KQRA 1CWPA 4Q4Y3 3ZX7A 3AVRA 4NIIA 1C8M1 4NAMA 1RJ7A 2VY0A 1AJKA 3UYJA 3IB3A 2DU0A 1X9PA 2ES3A 2GMMA 4S2GA 2YPDA 4LA2A 1O8PA 1H2NA 3BTAA 2BGPA 3JQWA 3WF4A 3OEAA 5LRSA 1SLCA 5IYYA 4Q1RA 5C9AB 3GZTB 1JZ8A 5DAVA 3OPTA 2RDRA 2RR13 4Q4V3 3VKNA 1WMXA 3P1IA 1OBNA 1LTEA 3FBMA 3OB8A 5EJ3A 3VV1A 4AFCA 2YC0A 1FAYA 4M00A 5CFDA 5CIRA 3K2OA 4XDOA 5CKQA 3WG1A 2XHKA 1C5IA 2WZR1 3G6JB 1VR3A 4HZFA 1CN1A 4Q26A 5A7WA 4WZFA 3SLIA 2JDKA 4MADA 2QQUA 4EZ4A 1X8MA 1OVSA 5CKMA 1XNAA 3K4AA 4MGQA 1W8HA 4CCOA 1OC1A 3JB8A 4LO7A 2V5YA 3FHIB 1I6XA 5LWBA 2B8MA 3CDZB 2A6WA 3QD6A 1OHFA 4UFHA 4K9SA 1WBFA 2PTMA 1N1YA 5FY9A 4NMIA 2DVFA 4NPMA 3ZR5A 2RM21 4IGPA 4XJ9A 5JXHA 3ZYIB 4GQ7A 2CGPA 2XLGA 1BEV3 1RVF2 1ZA4A 3FBYA 4PT6A 2XJSA 5KHIA 4QQHA 5BNPC 2VH9A 2VUCA 5DPNA 2QNKA 3JU9A 5B4NA 4HONA 1EPWA 1FPN2 2WO2A 2TEPA 4CPBA 2Z69A 2WNVB 3GZAA 4YG6A 3WF2A 2FDKA 1W6OB 1H30A 2BNNA 4K1ZA 3J7MA 4S2HA 4FPFA 4AVSA 1NY71 2VQTA 1HDKA 4A3ZA 2D98A 2CGNA 1VB4A 1W0OA 1JU4A 2VULA 2D40A 5FKCA 5FXXA 1VPHA 4C1WA 5BYNA 1QXPA 1DZTA 2X29A 2D5HA 1ZBA2 1S0EA 4A7KA 4GMP1 1BXHA 4MX3A 4XBLA 5JOZA 3VD4A 1BLZA 1W0PA 4BA6A 3HOBA 4HT1T 4MGIE 1K42A 1J1TA 4OZXA 3PVNA 2JDMA 3NSTA 3QH7A 1QH7A 2H0VA 3M3QA 2RJ2A 4E4DX 2Q8DA 1OF4A 4LQRA 1RUD1 4MLOA 4DUXA 4URAA 2OPWA 2GAUA 2P17A 2PHDA 1YFWA 2CSGA 3AVSA 4L97A 1Y9MA 5FK8A 4DPNA 4R8HA 3PJQA 1SEFA 4HKOA 2YMZA 4QQPA 3UKVA 1OLQA 4IERA 3AZVA 4JDNA 4XUTA 4DEVA 1ND3A 3AXEA 1IHMA 1U12A 4JQRA 4PDWB 4YARA 1YLLA 3L2HA 2GZWA 1A6CA 2J1VA 1GP5A 4HK8A 4L8QA 1ZRIA 4RS5A 1FPN3 4XXPA 1TZOA 1TQ5A 2ARBA 4IV3C 3Q8FA 4QKBA 3ECQA 1URXA 2HEWF 2OIIA 5CFDB 4K40A 1BHGA 4LBLA 2ZPXA 2WO1A 3OSDA 4RQPC 4YM1A 3FZ3A 3J8F2 5A7WB 4YVSB 2OZJA 3O1MA 3D5OA 2W92A 2Y33A 4Y22B 4QPGC 4U36A 3P3NA 4AAPA 4BPZA 1ZBA3 5GZGA 5HXMA 4HG6B 1JUHA 4FAHA 5KXDA 5K4LA 2P4EA 1CZSA 1O7FA 2JG8A 2YDEA 3N9MA 2EAAA 1TMF3 4Q2FA 1VE0A 4LR4A 3DEMA 1VBD3 1EUUA 2UWCA 5E1RA 4QPIC 2DUOA 1QXRA 3AP4A 4OUSA 4AK3A 1ZZ6A 1XRUA 3POFA 2RS52 5J09A 4XE9A 4C91A 4EN6B 1F4AA 1XSQA 1SHWB 5LA1A 3ILNA 3LDBA 3LIHA 5F5QA 3POIA 4CEWC 4FAGA 5I0RA 2WDBA 2P37A 3KQ4B 1RUE2 3GDBA 1RYYA 3C7GA 4ITCA 4PBPA 3O1UA 3HQXA 1O4YA 4ZZ8A 2DDUA 4OI0A 5FYHA 4AI2A 2E31A 1KDMA 1W8ZA 1AX1A 2E7QA 1PM7A 3O0VA 4LA3A 3ZDVA 4NHYA 2FMDA 2JKXA 2AEZA 2A3XA 4Y20A 3S7EA 3J8F3 5DAPA 3ZMNA 1DU3D 4Q0UA 1W3XA 2IVIB 5F3GA 5FUPA 4TLGA 1JOPA 1UOFA 5C5TA 1R091 1WCQA 2GNMA 4CPBD 5KHKA 1HN1A 3H42B 1VALA 5JWPA 2XOMA 1WW5A 1F35A 1V9U3 3A23A 2CU5A 5FZLA 1V6NA 1ND2B 1XOYA 2Y6LA 2VZQA 3ZYHA 2PQSA 3B02A 2BW8A 4LUMA 1BYHA 2GH8A 1MEC2 5LEJA 2GN7A 2RS11 3POBA 4MGZE 5FIXA 3EQEA 3R4SA 5HCBA 2OXBA 3AKSA 3WXPA 2IFWA 1QJY1 3DN7A 3E97A 1LHVA 2UYAA 2XHNA 5L9RA 4IETA 1E5SA 3GBWA 2VMGA 2WRAA 1O4TA 1MS4A 2QQVA 2RS53 4CDWA 1IQDC 1ND3B 4KWLA 3EXUA 3RS6A 1XNKA 1ULDA 1B09A 2IXLA 3RWNA 5F9TA 2Y6FA 2WZPP 4K6BA 3F2ZA 1RUE3 1H4HA 1YQ6A 1DDLA 5JI7A 3FLTA 1H1IA 3H0OA 5HV4A 5A32A 1QDCA 4E8DA 3OD4A 3WQBA 3AYCA 3ZKUA 2E26A 3USUB 4XJZA 4A3XA 1JH5A 1DQ0A 4AEDA 2ZX1A 3H8OA 3VD7A 1UQXA 2DU1A 4CTEA 1COV2 1WLCA 5FLIA 1H0BA 5KXEA 2VG9A 3FUOA 4JGZA 4M3CA 1WBLA 4AHYA 4OVEA 3KD4A 2BVVA 3WLUA 1BMV2 4HETA 2JG8B 4PJYA 4UYBA 1OVPA 5IK7A 2JD4A 1NG0A 2R49A 1H8TA 1S2KA 1UZ0A 4QDSA 3LB9A 4B4PA 5A6XA 3BYWA 2A6XA 2MHFA 5JPNB 2EIBA 1DYPA 2P3YA 1LEMA 5FPAA 1HV0A 1KGYA 4ET7A 2UY8A 3NJVA 5HCFA 3ZVXA 4NIDA 1PO11 3WZ1A 1FT9A 1V6MA 4A7ZA 1I5ZA 3DF0A 4TTGA 1AYM1 1W04A 4AZZA 5KBFA 3U75A 1BJQA 1KD7A 5DN2A 3OG2A 3ZXFA 1GYKA 3UKTA 1NYWA 4FPJA 5FMCA 5FO7B 4BLJA 1WCKA 1YQCA 5JIAA 2B42B 2JG9C 2NQYA 2W3JA 2I07B 4H2AA 2PHUA 4LBKA 5FZAA 1X8EA 4GJYA 3I3BA 1E5HA 4UOJA 1JHJA 2ZKNA 1LESA 2VMCA 4GWMA 3N9NA 4M4PA 4BQ1A 5IT6A 3UT0A 2C24A 4RR3A 1NAEA 2JB8A 5FYSA 4AI9A 4XCAA 1O4ZA 5FYCA 4Y20B 1VMHA 1OT5A 1HRV2 2HJIA 3H9AA 4IEQA 1IGOA 4TLFA 1GP4A 4Y5TA 4KH9A 4I3GA 2WT1A 1COV3 3UGFA 3ME2A 2IVJA 1X36A 3ALQA 2WJSA 2YUEA 4RHV1 5F1RA 4XCBA 1FOD3 3B9CA 1JYNA 1VJ2A 4UFIA 4BZ4A 3CF6E 1CPNA 4ISQA 3LGRA 4DO0A 4XFHA 4YZ5A 4WM8B 3LA7A 3U07A 1DLCA 2D6NA 3HNBM 3DXUA 4W65A 3SMHA 1OOPA 1Y43B 5H9SA 4QKDA 4Z92B 4YPJA 3SHRA 4CCLA 4GKXA 2JENA 3T30A 1UX6A 3NNFA 4CDWB 4OHYA 2QQKA 3VKMA 2H0BA 5A3MA 1AUYA 2XBO2 4E9KA 4H7MA 5FJKA 3VD3A 1JZ4A 5A7PA 3MI8A 3TEZA 4GWNA 2UYBA 5FLJA 3QOPA 4TN7A 5E88A 3WF3A 5A32B 2BEOA 3MV01 3VL8A 5JXGA 1C28A 4LEJA 4ZS2A 5DG1A 2CY6A 3Q8AA 3J9SA 2PAKA 1BBT2 3FFZA 3MUZ1 1G9CA 4PF1A 4E4SA 1HKDA 3OUIA 3JCIA 1DIWA 1JN2P 1HRV3 4ZPIA 1CONA 1F5FA 4JGZB 4M3CB 3HWJA 4Y1XA 2YYOA 1R1A2 1YFYA 2VMEA 2FDJA 4S2FA 2YZ4A 4CP1A 1ULCA 3PMSA 4X8PA 4K1YA 2VW2A 4XPVA 1KEXA 1GWMA 4GH4A 4NVPA 5HPOA 2ZX3A 1S2BA 2C5DA 4DQAA 3PUSA 4KL1A 4HVRA 4HBNA 4YG3A 4RA0A 5A6ZA 1CGPA 3L2YA 4XURA 5I0UA 4R52A 4XAAA 1W6NA 1RUH2 1DBNA 2EIGA 2WS91 4L2NA 4ZXEA 5T3NA 1PX4A 4P5HA 3BIEA 3MW4A 1W05A 3H8RA 3NQHA 1LOFC 4MHRA 1QY4A 1CAVA 2AEYA 5ABJA 2EXKA 1TG7A 1PHMA 1EV11 3MW3A 3I4IA 1C8M2 2AGSA 1G9DA 5FP7A 2I74A 4RR3B 1O5LA 1NLSA 4H55A 2ZGMA 4AVBA 4BISA 1BBT3 1RVF1 4XF3A 3GBFA 4P9GA 2VOTA 1WW6A 3NV3A 3JXSA 4C90A 4DMIA 1L3JA 1QJX2 4FCAA 3OBZA 2K46A 3BPSA 5FYYA 3T3YA 2KR2A 3V0BB 5F5AA 4FSJA 4EN7B 2WINB 3K51A 3WNXA 3EHKA 1NA1C 4DRRA 1Q8PA 3ZLIA 5GALA 1PNFA 2WLPA 5JOWA 1L7QA 3TNQA 1WD3A 4BYYA 1KJRA 1TNRA 2P34A 4XUQA 5FQ0A 2R041 4EWEA 1KFXL 2WZR2 4QQ2A 1PO21 1UO9A 4M0NA 1OOPB 4MH0E 3OBRA 4OFGA 3FMGA 3B01A 4H14A 3RI8A 4YW1A 4RYDA 2OW4A 2XL7A 1G8WA 5L7OC 1RINA 3AK0A 1N1SA 3DGTA 5F3IA 3IDEA 4XUOA 3HQRA 5JZGA 1LU1A 1LGCA 1UAIA 5K7PA 3BU0A 1VAVA 4LJHA 1GZWA 4RGKA 2RM22 4KMQA 2W9XA 4LHLA 3C7EA 2R30A 4LO8A 1F15A 1YI9A 1O8SA 2HWC1 1XSRA 3GHNA 5GZEA 2NN8A 3FX3A 4OQ8A 5JSPA 4LOSA 1O91A 1RUOA 1CAWB 3UKNA 2OYZA 3VD9A 4Y1ZA 4Y4YA 3VD5A 4GD4A 5JXIA 2ZZQA 2P1BA 3N9OA 3M7AA 1NY72 1PGW1 1NCQC 4O61A 1AF9A 4GH4B 4Q27A 1D0GA 2R0HA 3LCPA 2O14A 3D6EA 4JV4A 3TWIA 1IKQA 1AXYA 1ZBE1 1VB2A 3LEKA 4AGGA 1PGL1 2WZR3 3VBRC 1XYNA 3OD0A 4Q0PA 5FZFA 4AEMA 3T1LA 1POQA 4AFDA 3GBGA 1QOSA 4IGOA 4YYOA 4YM3A 2QQJA 4XHBA 4A45A 5ABJB 1RUD2 5FZDA 1VRBA 1YQ2A 1O5UA 5FY1A 3VBSA 5KXBA 1YWKA 5FLHA 1OXCA 1LB2A 4QB1A 3DL3A 3RDIA 2WA4A 3ZFFC 5FZ1A 2B9VA 2P6HA 5G04L 1V0AA 3WNNA 4UW4A 2ZJCA 3KV6A 4IEZA 3WF0A 1CJDA 4B1LA 1GQGA 1KS5A 1UXXX 3ZFEA 4AFAA 1WUVA 2B46X 4ONUA 4HL0A 2Q0AA 4IEXA 1X7NA 4LBJA 1MVEA 2W0XA 4LO5B 1UOBA 3ZO0B 3ZPYA 1JYCA 4KWJA 5FWJA 4YZ4A 1CAUB 2BVBA 1Y9GA 2JE7A 4O7XA 4R4XA 3AJZA 4M3CF 1OQEA 3M3OA 2AACA 2Y34A 3GZEA 1GZTA 1VP6A 1OI6A 1W8FA 1CJPA 3PTRB 4FVVA 4ZY9A 4FFGA 5EHDA 4DFSA 1NCRB 1I1EA 5BNNA 3FN9A 3WCSA 5C5UA 2ZS6B 3I2IA 5DUUA 5ACA1 5EIYB 3ES4A 4CCMA 2JJ6A 2X10A 2W1QA 1AZDA 5FREA 5CAZA 1DQ4A 1H6XA 2VZSA 3H50A 4PLMA 1K12A 4FBFA 2FZ1A 5FYUA 3ROUA 5J3UA 1IS5A 3V65A 3WW2A 5JZGB 2QZ2A 5JAXA 1CESA 2DVBA 1F2NA 3PUIA 4N53A 3HBZA 4ZU4A 5JMCA 3PIJA 1HIXA 5CFCA 2WO7A 4IV1C 3KS7A 3RRDA 1RUI1 3W20A 3ETQA 4HFSA 1GBGA 1AX2A 5AFBA 1IG0A 1W9WA 5LY1A 5C8WA 1IKPA 2UU8A 3SEPA 1SLLA 2PQQA 1ZZBA 4FP2A 3HT2A 5F2SA 5FZ9A 1G86A 3JB4C 1QH6A 2O8OA 3N7MA 2FDHA 2CL2A 4ASKA 4JHZA 4AHXA 2ZMLA 3BVCA 4XBNA 3ZXGA 5J37A 3WNLA 3IAQA 5I0SA 3UGGA 2BWCA 1OPOA 2J22A 5EPAA 1CAXB 1XYOA 2DV9A 3PURA 4YZ3A 5DG2A 5LK7B 4JGYA 1E5RA 1V6KA 4TZDA 4CCKA 1MS0A 2VVDA 1R092 1OSGA 5H9PA 1Z7S1 3A7QA 2BOJA 1PX3A 1BCXA 1OQ1A 5LRRA 3AMMA 3AP7A 5B2GB 1L7RA 1PMIA 5GLWA 1V6LA 2RS12 3H1MA 1DGLA 3N7LA 4FXGB 1W2NA 1SG3A 1OLMA 3AP5A 1QJY2 1XE8A 2J42A 3MIGA 3MPPG 4PQ9A 1W03A 2MPFA 3BOWA 5FPBA 4Q4X3 2PELA 4FPKA 3B7MA 3CKHA 4H7LA 3SC7X 4AFBA 1NE6A 5FO9B 1W8TA 1SQ4A 3TEYA 2QFEA 3M3CA 4PBOA 3HEIA 3RZKA 3RVHA 4L9BA 4XVHA 4AI0A 3MIBA 5FZEA 3ZSKA 1J59A 1XU1A 4EZHA 1LHNA 3VDBA 3W58A 3JD71 3N35A 4DOUA 4P9JA 2VQUA 4WBBA 4Q0SA 5CU1A 5LK5A 3VBFC 1ZX5A 4RFRB 1K5MC 2LALA 2JX9A 3PUAA 5BNNB 2B7YA 4DY3A 4AGVA 4FFIA 3I2JA 4ZONA 5LA2A 1JZ2A 1W6MA 4UI9L 2BYVE 2K0GA 3DPRC 3X29B 2ZBJA 3HD8B 5JXJA 5FMOS 5DAQA 4BK5A 1LRHA 2JDHA 3POSA 4FPOB 4EQVA 2EXHA 5ANQA 2RS13 4M01A 5CFCB 3VBHC 3AL5A 2Y6JA 3K77A 1PO12 1W28A 1QJY3 4OI2A 4OHWA 5LBFA 1REEA 2WKKA 1O3TA 2IZWA 1AYM2 3EJKA 3WINE 2W94A 2X53S 1AR61 1PM4A 3Q8BA 4K21A 4BMBA 3RI9A 2NPIA 3HVDA 2CV6A 2JEMA 3PU3A 3HR9A 5FPUA 2X5IB 4XJ8A 2WL1A 2LROA 4JCKA 1ZRDA 1X9TA 2X8KA 2XLAA 5FMBA 1VBC3 3CMGA 2D43A 3NNGA 2VBBA 4QKFA 2ZA9A 5D21A 3WHUA 3SITA 5IVFA 1DQ6A 3ACGA 2DVGA 4Z8BA 5T5PA 5H9QA 2BQPA 2PA7A 4IE7A 4XF1A 2G9ZA 1W90A 1HB4A 5IK5A 3B69A 1EUTA 1HN0A 4RHV2 4RGAA 2LTNA 2Y64A 4MYEA 1WMFA 2WWJA 1XE7A 5L36A 1ULFA 1RIRA 3VHPA 3GYDA 2EICA 5JSRA 4OZOA 3C7HA 5EZWA 3S0MA 3QLQA 3AKQA 4QPWA 1ZRCA 2D3SA 3K4ZA 3J26N 4LKFA 3B94A 4QXHA 4XF0A 3KT1A 1SFPA 2VE1A 4XQWA 2AENA 3ZIWA 3ZXJA 4B3NA 2WNUA 3RYPA 4MXWA 5A6YA 4LT5A 4IEUA 2FCTA 1PO13 5A3NA 4DXSA 4FPYA 4R9BA 4V2WA 1N1TA 1UY0A 4WZCA 4BQ5A 4D69A 4BCUA 1AYM3 5AVAA 2VM9A 5BPXA 5T55A 3IN9A 4KWKA 4KWUA 1GP6A 4RN5A 5L19A 4HSLA 1KRIA 4UFJA 4BU2A 4YW4A 3I2HA 2AH2A 5GLZA 2O1QA 3HBKA 3T0AA 5BNPA 1H9PA 5I8SA 2XVGA 5FBJA 2PHXA 2XUMA 4EV0A 1Y4WA 2J1SA 3OYWA 3GALA 2VCBA 2A75A 1I3HA 1AR81 2PN5A 5C9AC 1XU2A 2GNDA 3KCCA 2IUWA 1LAJA 1PZ9A 4UFKA 1UU4A 1QJX1 4LLOA 1SLBA 2PLV3 1MR5A 2C9AA 2EALA 4A7YA 5I91A 3W5MA 2Q5TA 2VUDA 1EP0A 4CCCA 3IAPA 1C8NA 4IE4A 4P02B 5FZ3A 3ZXDA 3ZFGA 1W2TA 2W5FA 1S55A 4I0AA 3KT7A 1D4M3 1ASJ1 1B35C 2LRPA 5LCWL 2CNAA 4M4RA 3I49A 4N9IA 2OX0A 1UYXA 3HAGA 2QQPA 2ZABA 2WS92 1W99A 4OI1A 2Q1ZB 1UL9A 5FZ4A 3U78A 3ZYJB 4AAXA 3BCWA 1Q8SA 1Z78A 2W1SA 4UF0B 1EV12 4I3PA 1OUSA 3K48A 4Y4RA 1WLDA 2WFPA 2WLQA 1CZTA 3HN1A 1UW8A 1XB9A 5CG9A 3U10A 5I0TA 3GXUA 1O3RA 4AI1A 2BGOA 4IV3A 2WNVC 3B3QE 1S0DA 3CL1A 5FZMA 3H8XA 2ARCA 4RQPA 2WZEA 2O8QA 4JRLA 4YGCA 1OH4A 2Y0OA 4YW6A 3VKOA 5F8PA 4GA9A 1K3IA 2X05A 1ONAA 3LFIA 1X50A 4WM7B 4OYUA 3VBOC 4QPGA 1LOGA 1MQTB 3KB5A 4PIZA 4L11A 2ZGRA 4AF9A 4YVWC 2R042 1HRI1 3MFCA 1PO22 4QHZA 5BNOB 2WNUB 5FAXA 4MXWB 2DF7A 5LY2A 4BOWA 3NV2A 1PZ8A 1R081 2ZXQA 5FXVA 3UL2A 1IPKA 2JICA 2ZCWA 4WVVA 5DZEA 5IJRA 5JOXA 1PK6C 3RZMA 1UOGA 5FWEA 2HWD1 4QAWA 4FTSA 4QPIA 2DCZA 1ZA7A 2WS93 2D44A 2VZ3A 2FMYA 2W87A 1DQ2A 3O5SA 5EFUA 4DIQA 1QJFA 4E4ZA 3S5AA 5T54A 2VW1A 1UPSA 5KXCA 5ERLA 3P6BA 4CEWA 2G1MA 1EV13 3TEWA 3KV5A 3OYWB 3VLBB 4OHZA 2Y38A 1BZWA 1UY2A 2OVUA 3AP9A 2VPVA 4WVZA 4PDWC 3UK9A 2R1DA 4ES9A 2XVKA 3CNAA 3B9IA 2J1RA 1FNYA 2HWC2 1RVF3 3LEIA 2BDRA 3MYXA 1VLNA 2PHLA 3WDWA 3S57A 3K75B 1KS4A 3O7OA 5CEHA 2Z4FA 1W2UA 4X6RB 3ACFA 1PIV2 1OLME 3UESA 4AXOA 2E63A 4FOWA 1PGW2 3MICA 1GNZA 4YVSC 5H9RA 3PVEA 3ZFGB 1Q8OA 3H1WA 4COUA 5DQ0A 1ZBE2 2P3KA 3INAA 2WSUA 1PGL2 4FQ4A 1YEWA 2XH6A 1PO23 5D8AC 3KMHA 2JDPA 4P9IA 3HPNA 5EQUA 3BI3A 2R061 1GANA 1RUF1 2C6SA 3AL6A 2VVEA 4YSFA 1UY4A 3UETA 1JW6A 4DY5A 5IVJA 1T6GC 3OPZA 2XJPA 5DXDA 1W9TA 2RV9A 1ZM1A 5FYBA 2G9GA 4N90A 4U2AA 1V6OA 5J96B 1MZ5A 2F4PA 4XABA 4BXSV 1ZZ9A 3WG2A 5AFEA 1IZ3A 4LMFA 3BKZA 3ZXLA 1QEXA 4BQ4A 3UV9A 3VZJA 3WP6A 1W8WA 1GOHA 2HWC3 2PHFA 4Q29A 3DCQA 5DDJ1 2WA3A 4RQPB 2WUHA 4ARYA 1VMJA 3FWEA 3KCXA 5DUWA 3VDDA 3DYOA 4QWNA 5J48A 1HXS1 2F4LA 2BV4A 1JYWA 4AVAA 4QPGB 2WAOA 4YRDA 1R1ZA 3H3UA 4YGEA 1PNGA 2FBEA 4AQTA 4LTAA 3P5BA 4E2SA 4BLIA 3CZUA 2CAUA 3LPGA 2WAAA 2RDNA 1KXGA 1W6PA 2YC2A 3OUJA 4NRQA 3ZYRA 5ACA2 4FT8A 1ND2C 1MS1A 4FQZA 3ZSMA 1K5JA 4BB3A 4QPIB 4GKYA 4CUGA 5FR3A 4Q0VA 3THDA 4IESA 1YQ5A 1IS6A 2Y8KA 4I30A 3WQ0A 4JDMA 2OS2A 4AQ6A 3DKQA 3IPVA 4NPRA 4PHZA 4CEWB 4XMAA 4Z82A 1M4WA 1QJZA 1QGLA 1RUI2 2E7AA 1CZVA 3U4XA 3N4MA 4ATEA 2Q8OA 1JYTA 4Y1VA 3I2OA 1AX0A 4BXFA 2ZX0A 3BPZA 5FFOC 3NW4A 2JG9A 2XUEA 2XGXA 2HWE1 1ENSA 3AKPA 4BWOA 2GNTA 1GLHA 4IL7A 5A3LA 5FKBA 2Q1FA 2O0OA 2ZEWA 5FPZA 2WT0A 4RS5B 3O1VA 3C8XA 3LIGA 3AZWA 3OGVA 1CR7A 3TBDA 3I54A 1HJFA 4Q4W1 3TEXA 1QMJA 1W2AX 3M1HA 2QBXA 3N9QA 3KQRA 1UN1A 2HWB1 1NXD1 4QX0A 1BVVA 4W4ZA 3BGAA 4CEYC 4GAZA 1DQ1A 3ZYPA 3H3LA 4G9SB 2HLEA 5CA6A 5ACA3 3FL7A 1Z7S2 2DFCA 2R0FA 2IXIA 4GWJA 4WVMA 5GLTA 4ARXA 5C4WC 5C3OA 2WR9A 2XB6C 3NMBA 2Y6KA 1S0IA 1MEC3 4AI8A 1QJEA 4QU1A 4DNYA 1RUI3 2ZGUA 3ZPOA 3ZSEA 4X8NA 2HKXA 1U5YA 5G05L 4CUBA 3VHOA 3VKFC 1UZWA 4ISRA 1DYKA 3OJBA 2ZEYA 3I3EA 2F17A 3WR0A 1O3QA 1J1LA 3VDDB 1G9FA 3VZKA 4DXTA 2ZGOA 3JD72 4JX0A 4S2DA 1D2SA 4XACA 5GJ6A 4NJ4A 1AXKA 4LK7A 5JR7B 3AYAA 4XFCA 2YGMA 4QT6A 3E6DA 1FI2A 5FY7A 3PU8A 2FD8A 3V56A 2X09A 2DVAA 1NZCA 2ZHLA 3I97A 3IT8A 5AVPA 5DMYA 1FATA 2LUWA 4Y26A 4OCTA 5FYTA 2XONA 4WM8C 1IS3A 4YW2A 1Z7S3 3K3NA 2GNBA 1TVGA 4YFWA 5C3PA 3HNYM 3TAYA 4K20A 1T2XA 1DHKB 3WX5A 2A6YA 1UZZA 4XUNA 4Q4Y1 3NO8A 1OKOA 4HANA 1DFQA 1LEDA 4G4FA 1LOFA 2JG9B 4PIXA 1ULGA 3E5XA 5GLVA 1OURA 1AR62 1F8VA 3R0RA 4XW3A 3WNOA 1AHSA 1NX9A 1V70A 1FYUA 3IKWA 3MGUA 3WD5A 5A3TA 1S0CA 2YBSA 3WT3A 4EYUA 1JYVA 3O1SA 2J1AA 5C6CA 5HCAA 1WW7A 5LW9A 1LOBA 3JD73 3WP3A 1WCDJ 1UYPA 3C7OA 5SV5A 4FFHA 1D0HA 4KG0A 1NA1A 1YRZA 4AEDB 3PUQA 1ZNPA 1KJLA 2VCMA 4X6QB 1UMZA 2R071 3KF5A 2QQIA 3ACIA 3SCHA 3VHNA 3WW1A 1RITA 5FP4A 5L73A 4A6OA 3UGHA 2YG0A 1RXFA 1RXGA 4PQQA 5IWFA 3WDUA 1HV1A 2JDNA 5FBZA 4COZA 4WVMB 1SDDB 4NHXA 4OUEA 2TUNA 3CJIC 3IMMA 4DUVA 4FPEA 4K8FA 1BK0A 1H8TB 3KF3A 2P3JA 1MS3A 2DBIA 2VZRA 1ODMA 2YC4A 4YGBA 1YHFA 1OA4A 4CE8A 5J98B 5L7OA 3WUCA 4N43C 5LB6A 3EMRA 4CDUC 4N7UA 1A78A 2A5ZA 4AR2A 1ZRFA 1TME1 4ZHNA 2C9KA 2AREA 3LDKA 3I2DA 1O3SA 4FI9A 2CDPA 2DWRA 2YFZA 3OOXA 2VNRA 3THTA 3A0KA 3IM0A 2W08A 4UW3A 2V4AA 2TBVA 5FZBA 2XBO3 1D4VB 1I5PA 1PVC1 2QE3A 3TYJA 2VZVA 4LIVA 5C3SA 2VQAA 3DKWA 4LULA 3B93A 1AVBA 5F3CA 5F37A 1JI6A 5I8YA 1RUG1 2RJKA 2W68A 5FY0A 3LKJA 3T2QA 4BE3A 4DEQA 1AR82 5C7GA 4CDQC 2UWAA 4ASMB 4XFIA 1RL3A 4GB31 2JDZA 2Z79A 1NCQA 3I7DA 5C71A 2VOWA 3KVBA 4B8EA 1DZRA 2VJXA 3A21A 4AI3A 2DURA 1CPMA 3SNMA 4EN0A 3VBRA 5IUQA 4SBVA 4AOCA 2W47A 4YZ1A 2DTYA 3GGLA 5J36A 1GU3A 1R1A3 4O9EA 1VMFA 2E53A 1XNTA 2XKPA 4QXCA 5LBEA 3SKVA 3KV4A 1ASJ2 2WYSA 4LO6B 3OGJA 4D7YA 3WP4A 2ZGLA 1J3PA 1MS9A 2CTVA 3PVBB 4I09A 1MZ6A 5IVBA 2Q8CA 5FZOA 3FFQA 2DCYA 4JC1A 2JE9A 3VZLA 3WW4A 1RUH3 3VBUC 4BHPA 5TSWA 5C3RA 1XNCA 2QCSB 3ZFFA 1H4GA 1POV3 2VZUA 3FLRA 5JPMB 4CA9A 2IC1A 3LPFA 3IDCB 5CB7A 1F31A 2ZOEB 5FZ0A 2BNOA 3EYPA 3GCXA 1C8M3 1UYZA 1QJU1 3IDBB 3ON7A 5FYIA 1H2KA 1SCSA 2XDVA 1AR83 1S2EA 3O1OA 2IFRA 4UAPA 3LAGA 1C3HA 5IVYA 1QJX3 1VBB1 3I59A 4BK4A 1PIV1 4XHXA 4XTMA 2Y6GA 3WP5A 3AKRA 1YIFA 1VBD1 1YYNA 3POEA 1HRI2 1GWKA 5A33A 4QGLA 1GQPA 2BRTA 3PLQA 4P9WA 5K0UC 1R082 4FTBA 4QM9A 2C0ZA 4RFT0 4E2GA 4PIYA 4HVQA 2GP3A 1O6UA 3EB7A 3ZN6A 2HWD2 4COWA 2QDNA 4YW5A 2NYYA 1W6NB 3AMNA 4IV1A 3AFKA 2D6OX 2WNEA 4ATFA 1BQPA 2V5DA 1KITA 2ZHNA 4LOTA 5LATA 4COYA 2J1TA 5IVCA 3SISA 2V4VA 1CAVB 2IXHA 2WO3A 4DS0A 2GP5A 1G6NA 4QU2A 1US2A 2VUJA 4J1XA 1V00A 1S0FA 3OGGA 1ODNA 4CZSA 1CQ9A 1WLTA 2OA2A 1RUJ1 4DUWA 2RM23 4PF5A 4M3CE 2WQZC 3E5UA 2RMU1 2IXJA 4BIOA 2YGLA 4JKLA 4NRPA 5DUXA 3U11A 2PHRA 5FZKA 4DRVA 1HB2A 1JOJA 2OT7A 2VZTA 3F95A 4MVTA 4QXKA 1JZ3A 3NAPC 4CDXC 3VBRB 1V9U1 1CD3G 3MDPA 5JIUA 1NCRC 1H2LA 4I0WB 2QZ3A 4KU8A 3JUUA 1H9WA 2HBTA 5FQ0B 3C3VA 4D6SA 4SLIA 1N3OA 1YI7A 4P14A 4LKEA 2VW0A 3K46A 1JS9A 3MIDA 3JQXA 2R062 3AJYA 1RUF2 1R083 1WWYA 3B00A 5FZGA 3AKTA 2LM3A 4JAAA 4GMP3 2WQ4A 2VR4A 1GQHA 1AR71 4QB2A 3HIFA 2W39A 3I2GA 4NIHA 2WC2A 2RE9A 3ZYFA 3ZFFB 3LFMA 4AEKA 3DV8A 2KD7A 1GFF2 3RSJA 4KQ7A 5KR7A 1GZWB 4ZZ5A 1QOOA 1RUD3 5T52A 2JE8A 1UX7A 1ALYA 3N36A 3M70A 3RNSA 1NE4A 5IAVA 1MS8A 3Q8EA 5DDJ2 2AC1A 5BY5A 1CVNA 2I2SA 4FPHA 2ZHKA 3S5QA 4LBMA 1K5MA 3MFAA 3OPWA 1ENRA 1HXS2 4V1PA 4UFLA 4PLOA 5FZHA 2ZGTA 4HKLA 3JBG2 1AR91 2XMLA 4P00B 5FDBA 4KGQA 5FMDA 2VUAA 3WCRA 1KFUL 4CP9A 3DPRA 5A33B 1J58A 4XBQA 2AYHA 1SCRA 2ADEA 5FP9A 4CSWA 5GZFA 5A6QA 1WMEA 4IEOA 5FZIA 3IMNA 3WQ7A 3KWVA 1AYN1 3ZN6B 3NNLA 3LA3A 3TB0A 5BNQA 2R063 3WF1A 1RUF3 2VOXA 3PMEA 4IV1B 1YJLA 3VBHA 1LOAA 2H6CA 4BQYA 1LOCA 4HOOA 1JBCA 4QGMA 1EYBA 4IE0A 4IE6A 2PXJA 1JZ7A 3WVJA 4A41A 4UT5A 5DABA 3MIFA 3VBSB 3C7FA 1RC6A 2P2KA 4QX1A 4W6WA 4P9XA 5IFPA 3PTYA 1IOAA 3IDAA 2C1FA 2HWE2 3KV9A 4KBZA 1SBFA 2VQ0A 2D97A 1FX5A 1UWWA 4AGRA 5CG8A 2W2IA 3H3ZA 4L92A 4E2QA 2JKBA 1UKRA 4JZRA 4ZU5A 1VBA2 5FTTC 1YFXA 4I0BA 3MW2A 1Y9QA 3ZFEB 4J1WA 2VTFA 5E6HA 3ZKYA 1FV2A 5C8CC 1HXS3 5HCHA 4C0HA 3OTFA 4D8MA 3IBMA 4Q4W2 4PCRA 5FXWA 1RJ8A 1W9FA 4A2UA 4Y5SA 4QHBA 1UKGA 2HWB2 4NIGA 2BBVA 4TYSA 5LA9A 3FUQA 3W5NA 2VMFA 3BTZA 3OUHA 4XZPA 1YC61 1R093 3ASIA 3PJYA 2GC2A 4MHUA 4MSVA 4NAOA 2QQMA 4P08A 2JIGA 3OF1A 1BK1A 4NN0A 3NRUA 3TOJA 3LSDA 3NVCA 4Y1UA 1QOTA 4N53B 3O1TA 1NKGA 2KA3A 3I3DA 2DVDA 4IEYA 1OPMA 1XNDA 2B45X 3OEBA 4CXYA 1CX1A 1WA4A 3E5QA 4GZ9A 3M3EA 4Y5Z0 1MACA 2HWE3 2HYXA 3PVOA 2X5IC 4IE5A 4Q1PA 4Z07A 4XAEA 3RZGA 1E57A 4JVAA 1H1AA 2ZX4A 1D2QA 3W9AA 1K5MB 1YCIA 4QGNA 5FV3A 3U0ZA 4E27A 5FRAA 5C9AA 2DYCA 4R9DA 5F7UA 5A3OA 3RZJA 4LUKA 5BXXA 5LZ6A 1UMHA 3DPRB 1RGSA 3QACA 5F2WA 2BZDA 2DCTA 3ZSJA 2R6QA 2YU1A 3NKGA 4JGYB 2D6KA 2PHWA 2HWB3 4Y1YA 5JVVA 2J1EA 2XJTA 2ZMNA 4LLFA 3DYPA 3WV6A 1GICA 3HT1A 5FMOL 3VBHB 2D93A 4IEWA 1UY3A 1G9BA 1B35A 2HH9A 2VCAA 1N47A 3ZN5A 4FO9A 4WVWA 1P8JA 2WN2A 4GMP0 5D2AA 4Q5OA 2JD9A 4CCJA 5JMOA 3BTYA 1MS5A 3URFA 1N3PA 5APAA 1OKQA 1T6BX 2BFUL 4Q4Y2 3DXTA 3R4UA 5FPXA 2UWBA 1JMUB 3QBQA 4KBBA 4E4HA 3H7JA 5F32A 3G7DA 3ES1A 1Q8VA 2R7EB 4PI0A 4EROA 4LPLA 2P3IA 2A6VA 1REDA 4JQTA 2GDFA 3LWCA 4IEVA 2ID4A 2A7AA 2WNVA 1UU5A 3RZLA 5KHGA 2VXJA 4Q0QA 2VD7A 5HXVA 4QB6A 4LBQD 4H3WA 2QQLA 1OD3A 2VMHA 1CIYA 1DLLA 1UZVA 4BH9A 2R072 4CXWA 3VBOA 5C33A 3NNJA 5HBAA 4YW3A 5A7OA 2HEYF 3H8UA 3FHQA 1W6MB 4YVWA 3OGRA 5F5CA 4AVTA 2WIIB 1S4CA 4FP3A 2WT2A 4RHV3 1FMD1 1YO8A 4AQSA 3RZZA 2QQOA 2EIDA 1KDKA 2WQ8A 1JZ5A 1HB3A 1PK6A 2ADDA 4DXRA 1SFYA 3MHZA 3CHXA 3KSCA 4NIAA 4QQLA 2DFBA 1J3RA 3KZ4C 4IXLA 1EAH1 4JDOA 4QDRA 1BEV2 4XJWA 2V09A 3VDCA 4AL9A 5C3QA 3HN3A 4CU9A 1QXJA 1ZZ7A 1TME2 4ZU7A 4MO3M 5JCTA 2VBDA 3N7KA 2A71A 4P9YA 4XEZA 2VMDA 2EXJA 1VRH1 4I01A 4PDWA 4YGDA 1PVC2 2WYFA 4MZUA 3K4DA 2XWBB 4XJAA 1NZIA 2GALA 3SCGA 4BQ3A 1RUG2 5I8TA 1J83A 1XPWA 1IPJA 1QNYA 3VUOA 2GC0A 4A42A 4HLTA 4D0QA 1LECA 4GB32 5J1XA 5IFTA 4DXZA 4YVSA 2DTWA 3AMQA 1UMIA 1AL21 2R073 1LHUA 3BALA 3T0BA 4WM7C 4Y22A 3N9PA 3M4FA 1B35B 1MQTC 3KGZA 4AVCA 4BQXA 4FOQA 1IG3A 4YW7A 5D8AA 3APBA 2BWAA 1QIQA 5BNOC 4IW3A 3DYMA 4XJUA 1RUC1 2WNUC 1VAMA 3WG4A 1DYOA 1FNZA 2ET7A 2F6BA 3HJRA 1LULA 3A22A 2XVLA 4FPLA 3LEMA 1WMDA 4CUAA 3ZIXA 3AP6A 2NMOA 1OD5A 1QDOA 1X82A 5EYXA 5GKAC 4C1XA 3LSEA 1TME3 1UNBA 3OBAA 4LE4A 4LHKA 3S6PA 3S7IA 4L0PA 2VC9A 1NT0A 2VCCA 3ZM8A 5C70A 2J7MA 4KGGA 3ZSLA 4CCEA 2YPJA 5BNPB 1PVC3 2ET1A 1ACCA 1HQLA 2B5HA 1QJU2 4NRMA 3VHRA 1RUG3 2Y60A 4L99A 3KT4A 4MV2A 2QQWA 3VBOB 3RZHA 2C26A 1W8UA 3MIHA 3VN4A 2EIEA 1MPXA 4GB33 3GJBA 5KHJA 3UNPA 3ACLA 4YVWB 1RHI1 2GSYA 1VBB2 2BUKA 2GH2A 1OMIA 1AL0G 1N1VA 1SBDA 3ZFGC 2BPA2 4MG2A 5LEKA 5CFDC 1LCLA 1WW4A 1TMF2 1JTZX 5EYYA 1RMU1 1PK6B 5FK7A 5T50A 1ND2A 1VBD2 2YBPA 3ACHA 3E1F1 5HV0A 5CVRA 1FV3A 5A1AA 1YJKA 3QH6A 5FPLA 1C4RA 1S0BA 2PAMA 2R32A 4AE2A 1BVP1 5I93A 2NZ9A 2R043 5DZGA 3KVAA 3AC0A 3WHTA 5E8AA 4GULA 1UD1A 3HNMA 3LOBA 2QDRA 2YB7A 2QTWB 4K7JA 4XFAA 3KLSA 2ZMKA 1UZYA 4K8RB 1HJGA 1VBE1 2CAVA 2ZZJA 2MEV1 4FOYA 2WFF1 5FP8A 1O59A 4IEPA 1GV9A 4BMEA 2VAUA 5J7MA 2NP0A 3MIEA 4XOGA 3ZOIA 3NNMA 4XQDA 3RGBA 1GSLA 3D0JA 1RUJ2 2ZAHA 3KCYA 4NROA 4WV8A 4D7TA 5BUVA 4O9GA 2RMU2 4LO4B 2KXLA 4OQ9A 2OUJA 3T4VA 3USUA 5A3PA 1QJU3 5CADA 1LODA 2RVAA 3ZYGA 4IV3B 3AB0A 1NOVA 3T09A 5FOBB 1DP0A 2Q4SA 1VBB3 2E9QA 1V9U2 2P5BA 5D8AB 3NKTA 4KU7A 4CEYA 2PMWB 1PIV3 2D3RA 2VECA 1U5XA 1W06A 2E6VA 2XWJB 3V64A 3CBNA 3JBG1 1JU3A 3ZDSA 3WUDA 2YROA 5IHRA 4JKMA 4OMDA 4LHNA 1Q56A 4IUGA 2J1UA 4MXVA 5C4WA 2D7FA 2RDSA 3AYEA 4Q4X1 1ZBE3 5DUVA 1IS4A 4ZS3A 2DCKA 5LASA 3O1PA 4XYXA 3AMHA 3ZR6A 2W1WA 3BN6A 3P3PA 5FOJB 4C8DA 4BJ0A 1AR72 1PGSA 3HQUA 2XQRA 4A4AA 3JZVA 2KM2A 2ERFA 4LKSA 5L9BA 3CU7A 3TN91 4XUPA 2PAEA 1SLTA 1XC6A 3BUCA 3WW3A 3AYDA 4YG0A 4GALA 2BU9A 1A34A 1YQ8A 2Y0IA 1DG6A 3MEPA 1F5JA 4CU6A 1APNA 2G4IA 2GC1A 5CBLA 3AXDA 2QJVA 4JRAA 4AHZA 3ELNA 3POJA 1ND3C 4FXKB 1RUJ3 4XFFA 2DUPA 3PHMA 2RMU3 2OPKA 1LU2A 4NWWA 3MBWA 4RS5C 1WCSA 4FTEA 3OY8A 4DZGA 4CU7A 5FYVA 1VBA1 1SBEA 3AMPA 3C2UA 3E6BA 3H1YA 5E89A 3RMXA 2EAKA 1LNSA 1AR92 1Y3TA 1HLCA 1OUXA 2E51A 2ZGPA 3J4UH 4LK6A 2VL4A 5CNAA 4EN9B 5AC91 3KGLA 3ATGA 4QX2A 1LGBA 2EXIA 2VMIA 4WM8A 2VZPA 3OGSA 3VDAA 3I2KA 3I3MA 5FXZA 3UJOA 3USSA 1AYN2 5CISA 4A44A 4NHLA 5FY8A 2JG8C 2VXRA 2W91A 1RUNA 1JHNA 3VB9A 3N7JA 2JXAA 3RYRA 1SZBA 5F5IA 1AR73 1HB1A 4CP0A 4LE3A 1EY2A 3ORJA 3MF6A 1SLAA 1C1FA 2HWF1 3J7NA 3B5LB 4M0HA 1VBC1 4D3WA 4BQWA 1YUDA 2GMPA 1EPZA 3POYA 1Y7BA 3ILFA 5T5OA 2Y26A 1JYXA 3TRSB 5FUIA 4CCNA 1HW5A 5K8SA 2A3WA 1UOJA 1WCUA 4PLNA 3VDDC 1ZZ8A 2JDYA 4AG4A 2ZGNA 2EF6A
chains in the Genus database with same CATH topology
1OVSA 2XR4A 1GZTA 1W8FA 5D2AA 2BV4A 1W8HA 2BP6A 1UZVA 2WRAA 4UT5A 2BOIA 2JDNA 1OVPA 3ZDVA 1OURA 1OXCA 2WR9A 1OUSA 5A6YA 5A3OA 5A6XA 2JDUA 4CE8A 2JDHA 2VUDA 2VNVA 2CHHA 1OUXA 5A6ZA 5A6QA 2JDMA 2VUCA 4AOCA 2JDYA 1UQXA 3DCQA 5HCHA 5A70A 2JDKA 2BOJA 2JDPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OVS A;  2XR4 A;  1GZT A;  1W8F A;  5D2A A;  2BV4 A;  1W8H A;  2BP6 A;  1UZV A;  2WRA A;  4UT5 A;  2BOI A;  2JDN A;  1OVP A;  3ZDV A;  1OUR A;  1OXC A;  2WR9 A;  1OUS A;  5A6Y A;  5A3O A;  5A6X A;  2JDU A;  4CE8 A;  2JDH A;  2VUD A;  2VNV A;  2CHH A;  1OUX A;  5A6Z A;  5A6Q A;  2JDM A;  2VUC A;  4AOC A;  2JDY A;  1UQX A;  3DCQ A;  5HCH A;  5A70 A;  2JDK A;  2BOJ A;  2JDP A; 
#chains in the Genus database with same CATH topology
 1GR3 A;  1FOD 2;  1H8V A;  3BOD A;  2XPJ A;  1PVX A;  1NXM A;  4CEY B;  1C5H A;  3NWK A;  4MET A;  5GZD A;  4ZKT B;  1AR9 3;  4HSJ A;  4JTO A;  4XDP A;  5SV8 A;  2CYF A;  2ZAA A;  2RS3 1;  4FPG A;  3BTX A;  4ORF A;  5FP3 A;  5C4W B;  4AWD A;  5KWR A;  1QQP 1;  1H2M A;  1PZ7 A;  3CJI A;  4YLZ A;  5IW0 A;  4LBO A;  2A1X A;  3T2T A;  1W6P B;  2Z2S B;  3SEE A;  3AZY A;  5EXO A;  1AYN 3;  5F39 A;  1M06 G;  4QPY A;  2E33 A;  2I45 A;  1QHD A;  4N43 A;  4FOV A;  1HQN A;  5KC6 A;  1W0N A;  4ZXK A;  4CDU A;  4XF4 A;  5EWS A;  2EA7 A;  1DGR A;  3LZZ A;  2L9L A;  3IPV B;  4OHX A;  1VAK A;  1BKZ A;  2AR6 A;  4J6G A;  1ENQ A;  4KNC A;  4YZ2 A;  3WNK A;  3WEZ A;  2G19 A;  3D3A A;  3T2O A;  4CDW C;  2BGC A;  1JXN A;  2VGD A;  4V2V A;  3RQ0 A;  4DIN B;  5FYM A;  3ZXA C;  5IVV A;  3U1X A;  2VTX A;  4TWT A;  2VBP A;  5DAW A;  4LOR A;  5A1L A;  3ZN4 A;  4LXL A;  1S0J A;  3OY8 B;  4XMI A;  4YM2 A;  3FJS A;  2PLV 1;  3J7L A;  1UIK A;  5F6K A;  3GNE A;  3V0B A;  4CDQ A;  2BTV C;  4R4Z A;  1GOG A;  3SCF A;  3SXW A;  5T5L A;  2FDI A;  2ATF A;  1ZZC A;  4AED C;  2RR1 1;  4Q4V 1;  5I0D A;  1Q5O A;  3VZO A;  5M0T A;  4NE9 A;  4QD2 A;  4Y33 A;  4AVV A;  2B9U A;  1Z0H A;  1D4M 1;  4QHO A;  4UBH A;  3BB6 A;  4JGZ C;  2FHR A;  4Y3O A;  1DCS A;  1OQD A;  2JEC A;  4TSV A;  3T08 A;  3O14 A;  4QM8 A;  3ABZ A;  2ORX A;  2LW8 A;  1OA3 A;  4HPK A;  1H8T C;  1JOD A;  4JKK A;  4B7K A;  5GM0 A;  2YBK A;  3KHC A;  1GKB A;  1GZ9 A;  4OHV A;  3T0D A;  1HX6 A;  2FDG A;  4GIQ A;  1OFN A;  4LNV A;  3KM5 A;  5LA0 A;  5JDB A;  2D5F A;  1OF3 A;  3DUI A;  4LIT A;  3AM2 A;  1XNB A;  4AQ2 A;  4ES8 A;  3ST7 A;  3VBU A;  2ORZ A;  1AXZ A;  2ZKL A;  4AEJ A;  4XFG A;  1F4H A;  3SQO A;  4EE2 A;  4I2O A;  4XFB A;  1SAC A;  1BEV 1;  3U4S A;  2QVS B;  1XE0 A;  3A0N A;  4BDV B;  3RJ2 X;  2XG3 A;  2NMN A;  1AR6 3;  4D6Q A;  1MZF A;  3W21 A;  3ZXE A;  5T5J A;  2ARA A;  1RTV A;  2ETE A;  1CAW A;  4J25 A;  4XIL A;  2XQX A;  3POG A;  2WBK A;  4QX7 A;  4RR3 C;  3MV1 1;  3M2M A;  2CWS A;  3VZM A;  2N7G A;  3LD8 A;  3NJX A;  3PIG A;  2WZ8 A;  2HBU A;  1REF A;  3WDV A;  2VO5 A;  1HQW A;  3ENR A;  4OMC A;  3CJI B;  3T4H B;  1GNH A;  2VNO A;  1A8D A;  4C0B A;  3WNP A;  2W52 A;  4N43 B;  1FMD 2;  1RB8 G;  4NWV A;  4Y24 A;  1UF2 C;  4RL7 A;  1L7L A;  5K0U A;  4CDU B;  2BJS A;  2Y6H A;  5JLV A;  2CDO A;  4HXC A;  2MNG A;  3O0W A;  2XXZ A;  2ENR A;  2XLF A;  1OOP C;  5GLU A;  4RGG A;  4YWA A;  2XL9 A;  2XJQ A;  3SH4 A;  1EAH 2;  2IWG B;  5A3W A;  1LHO A;  4K3U A;  1UIJ A;  1W3V A;  4Q8L A;  4R9C A;  1ENX A;  2C4X A;  2VU9 A;  1N3Q A;  1Q8Q A;  4OLL A;  1OLR A;  2ZEX A;  4P5Y A;  3GHM A;  3NV1 A;  4N8M A;  3D0S A;  3O0X A;  5A7S A;  3NJZ A;  5BV6 A;  4MGY E;  4CP2 A;  2BER A;  3FC0 A;  3N9L A;  1VRH 2;  3K3O A;  1XXN A;  1XJA A;  5EV7 A;  4CDQ B;  3WNM A;  2DCJ A;  1FPN 1;  4AW7 A;  4QX3 A;  2ZHM A;  2XJU A;  1LOE A;  1CAU A;  4AHW A;  5JOY A;  3NAP A;  1NA1 B;  4CDX A;  2G9F A;  2VVF A;  1XYP A;  3BOP A;  2OKX A;  4Z1V A;  1LHW A;  1XBF A;  5E16 A;  1AL2 2;  1NCR A;  1S1A A;  1AJO A;  1DZQ A;  1I9R A;  4QQO A;  1JZ6 A;  2BP6 A;  2D6M A;  2GU9 A;  3HMY A;  5CYY A;  1SDW A;  2D6P A;  2BOI A;  1ZBA 1;  3CEW A;  4HPK B;  5A7Q A;  4CUC A;  5ISL A;  1UYY A;  2VTX J;  2VZO A;  4QX5 A;  2SBA A;  4GH4 C;  1FMD 3;  1K45 A;  2QKD A;  2DBN A;  3LA2 A;  1J3Q A;  1RUC 2;  2W46 A;  1TMF 1;  1J84 A;  2Z42 A;  2JDU A;  4QX8 A;  4YFZ A;  2YFU A;  4ASL A;  5JR2 A;  4UXA A;  3GZU C;  2A70 A;  1QNW A;  1PMJ X;  4IDZ A;  5EP9 A;  3VBU B;  5L7O B;  1ASJ 3;  1QU0 A;  3RMY A;  1EAH 3;  1OA2 A;  3D8C A;  2ZEZ A;  2OQ6 A;  4NHM A;  3LOI A;  4XIK A;  5GZC A;  2E7T A;  1WLW A;  2YU2 A;  1GWL A;  3ZMO A;  5ABJ C;  1LJ7 A;  2XR4 A;  5LBC A;  5A80 A;  2WNO A;  1VRH 3;  2WSV A;  1A8M A;  2ZTN A;  2OUH A;  4F83 A;  5IAX A;  3CZJ A;  2CGO A;  5FY5 A;  1YNA A;  5EJ1 B;  2Z5W A;  4D94 A;  3O1R A;  4BQ2 A;  4MGS A;  1GNY A;  3OCP A;  4BIF A;  1C1L A;  1CAX A;  4URT A;  1WZX A;  4UBG A;  2FQP A;  4XF9 A;  2QQN A;  3J8F 1;  4KI5 M;  3AFG A;  4YM0 A;  1NCQ B;  1RHI 2;  1WA6 X;  5HI0 A;  1AL2 3;  4GWI A;  2JDA A;  2Q8E A;  3A4U A;  1X33 A;  1ZVF A;  5K0U B;  1V6J A;  3OBT A;  1RMU 2;  2D6L X;  2FZ2 A;  4XET A;  3V0A A;  2NM1 A;  2ARX A;  1U5Z A;  1RUC 3;  4GXL A;  4QDQ A;  1CIW A;  2JB4 A;  3IZO A;  1LKN A;  2JIJ A;  4HN0 A;  1HRI 3;  3WOG A;  2D3P A;  2EVX A;  5LBB A;  5DZF A;  2IXC A;  4AYU A;  5FUN A;  1QWR A;  2H6B A;  2RS5 1;  3NJY A;  5FZO B;  1TNF A;  2HWD 3;  3SKJ E;  3DEC A;  1VBE 2;  3UJQ A;  5JZG C;  3PUH A;  4RSU A;  4G3Y C;  1ZRR A;  2VNG A;  2MEV 2;  2CHH A;  2WFF 2;  3D82 A;  3MLK A;  1NQD A;  4N7I A;  1RUE 1;  3RG0 A;  3VL9 A;  4D7S A;  3E6C C;  2ZGQ A;  3H7Y A;  2A73 B;  3ILR A;  1SPP A;  2FCV A;  4MGT A;  2BNM A;  4MGK E;  5KHH A;  4B7E A;  4XQ4 A;  1ZRE A;  3NAP B;  1WD4 A;  3WQ1 A;  1UPI A;  2YXS A;  3VZN A;  4CDX B;  1QKQ A;  1ST8 A;  4MUV A;  2FCU A;  5C8C A;  5F6L B;  2XKO A;  2VOK A;  3GM8 A;  3CLP A;  2WWS A;  3Q8C A;  1LR5 A;  1ULO A;  2YV8 A;  3VBF A;  1RHI 3;  2PHT A;  4OI4 A;  3IWZ A;  3I59 B;  2GC3 A;  3LQC A;  2A6Z A;  1Q43 A;  4I02 A;  4R9A A;  2B39 A;  2Q1M A;  3PL0 A;  1RMU 3;  5FZC A;  2WN3 A;  3I8T A;  3AZZ A;  5FPV A;  2V72 A;  2WAB A;  4OUM A;  5FCC A;  5IK4 A;  2VOV A;  1MEC 1;  5L9V A;  4Q4X 2;  4QXB A;  3LEG A;  1ULP A;  3ZYB A;  2TNF A;  3THP A;  4FFF A;  4AFM A;  5FZ8 A;  2VZ1 A;  3TN9 2;  1ULE A;  4P9L A;  3SH5 A;  4F3J A;  4NO4 A;  1DGW X;  4B4R A;  1W9S A;  2R16 A;  5FJH A;  3I2F A;  5FYZ A;  5IVE A;  1NLQ A;  1G7Y A;  1VBE 3;  1YXW A;  3VBS C;  4OUL A;  4A6S A;  3LE0 A;  3GCW A;  2W95 A;  4CVU A;  2MEV 3;  2WFF 3;  2X5I A;  5FZ6 A;  3BIW E;  1UY1 A;  1W39 A;  5FO8 B;  1POV 0;  4Z2W A;  1W8O A;  4TXW A;  1VIW B;  3FE5 A;  3M3I A;  4HKW A;  5CZK A;  2R1B A;  3CO2 A;  3FHA A;  2WWU A;  3PNA A;  3ZXK A;  1WGP A;  4LBQ A;  4EWA A;  4CU8 A;  3LF7 A;  3ZFE C;  2HYK A;  3THC A;  2ZX2 A;  4B29 A;  1GOF A;  1W8N A;  3U37 A;  1A3K A;  4NHK A;  3WDX A;  1OFS A;  1COV 1;  5DDJ 3;  3LDR A;  4FPC A;  2AUY A;  5K9Y A;  3WG3 A;  1QF3 A;  1FOD 1;  1NLR A;  5AC9 2;  5B4X A;  2PFW A;  3V0A B;  3TNP B;  1Q3E A;  1DGW A;  3BU7 A;  4Z2A A;  5BNN C;  5JI9 A;  1BMV 1;  1NQJ A;  3JBG 3;  4XTP A;  1V6I A;  1C57 A;  2RDQ A;  3EO6 A;  4F7Z A;  2YHJ A;  3RFR A;  2OZ6 A;  4PI2 A;  1D7P M;  3III A;  4W50 A;  3RWK X;  3CQO A;  2E32 A;  3EBR A;  1GMM A;  2A3Y A;  5JSO A;  3W59 A;  5ANN A;  3MLL A;  3QCW A;  1U0A A;  1MVQ A;  4N53 C;  5D1I A;  2ZAC A;  1R64 A;  3M8L A;  3PDQ A;  3TN9 3;  1JYI A;  5CFC C;  1YFU A;  3VGI A;  1JUI A;  2HWF 2;  1GUI A;  2XJV A;  1W6Q A;  3O12 A;  1VBC 2;  3RYK A;  1SPP B;  3MO4 A;  1H6Y A;  2JWP A;  1H1M A;  4NR1 A;  5DAX A;  5A7N A;  4CRQ A;  4D6R A;  3GF6 A;  3AX4 A;  3NL1 A;  4DB5 A;  4NUB A;  3WDY A;  4EJR A;  4JTN A;  3WSO A;  3AZX A;  4HK9 A;  2YY1 A;  1ZYB A;  4UFM A;  5C8C B;  4XXA A;  4E8C A;  1JOB A;  4GJZ A;  4LHS A;  2FDF A;  2B4K A;  2SLI A;  2CWM A;  3VBF B;  4IQP A;  4W6X A;  3WDT A;  1HRV 1;  2NLR A;  1VBA 3;  4IGQ A;  5JUV A;  1E5I A;  4NPL A;  4YNI A;  1STM A;  3U14 A;  4JGY C;  1TEI A;  5AC9 3;  4HN1 A;  3POW A;  2GME A;  4MOA A;  4B4Q A;  2RS3 2;  4CP9 B;  5IAT A;  1F9K A;  4Q4W 3;  3N3H A;  4W6Y A;  3S30 A;  1MZE A;  1QQP 2;  4CXX A;  3Q9O A;  3ETP A;  1SLI A;  4KG8 A;  2XJR A;  3NV4 A;  4QKN A;  4B1M A;  1SFN A;  1IPS A;  3MF9 A;  2BFU S;  5A3U A;  5IK8 A;  2OQ7 A;  1OH3 A;  3FLP A;  5FZ7 A;  4BM8 A;  4CYD A;  2UUR A;  3D4K A;  3GJA A;  4UW6 A;  4CCD A;  1UU6 A;  4XIO A;  1TE1 B;  2ILM A;  2K2S A;  2QUO A;  1WKY A;  1YIP A;  1W9Y A;  2XBO 1;  2W1U A;  3MUY 1;  3R6S A;  4EN8 B;  3J7H A;  4LKD A;  4Q8K A;  3MZH A;  5KC5 A;  2ZGK A;  2HWF 3;  4UF0 A;  1FXZ A;  3RJR A;  1NUK A;  2RHP A;  3CIH A;  2V73 A;  1DGR N;  1LEN A;  3L9J T;  4EWD A;  1S0G A;  2P6C A;  4LBQ B;  4UWD A;  1CX4 A;  1BBT 1;  2HEV F;  1U5I A;  2LS6 A;  4LIU A;  4NOT A;  2PLV 2;  4XZU G;  1US3 A;  4O65 A;  4N9H A;  4COV A;  2IXK A;  4HMZ A;  3MLJ A;  2RR1 2;  3CJX A;  4Q4V 2;  5A70 A;  1G9A A;  4LBN A;  4XDQ A;  1W6O A;  4WM7 A;  3MPB A;  2K9Z A;  1R1A 1;  2AZ5 A;  1XQN A;  3T2P A;  4QMA A;  1MQT A;  1D4M 2;  5CKN A;  2RJL A;  2RS3 3;  3ITQ A;  1W2O A;  5BNO A;  3R05 A;  1QQP 3;  1UXZ A;  2DUQ A;  1PMH X;  4F8A A;  4UW5 A;  2UY9 A;  3R4D B;  2ZGS A;  5F3E A;  3T1M A;  4IND A;  2GN3 A;  1IQA A;  4RD7 A;  3KHB A;  4XC9 A;  4JHT A;  1DQ5 A;  1GZC A;  4HVO A;  5FY4 A;  2RG4 A;  2VNV A;  1RUH 1;  1SMV A;  5EJZ B;  3IIA A;  3RPQ A;  4W8J A;  3SH3 A;  2PYT A;  3I3Q A;  1POV 1;  1W6Q B;  2BBA A;  5A1F A;  1UCX A;  3VKL A;  3WY6 A;  2Q30 A;  1LGN A;  1DF0 A;  1KQR A;  1CWP A;  4Q4Y 3;  3ZX7 A;  3AVR A;  4NII A;  1C8M 1;  4NAM A;  1RJ7 A;  2VY0 A;  1AJK A;  3UYJ A;  3IB3 A;  2DU0 A;  1X9P A;  2ES3 A;  2GMM A;  4S2G A;  2YPD A;  4LA2 A;  1O8P A;  1H2N A;  3BTA A;  2BGP A;  3JQW A;  3WF4 A;  3OEA A;  5LRS A;  1SLC A;  5IYY A;  4Q1R A;  5C9A B;  3GZT B;  1JZ8 A;  5DAV A;  3OPT A;  2RDR A;  2RR1 3;  4Q4V 3;  3VKN A;  1WMX A;  3P1I A;  1OBN A;  1LTE A;  3FBM A;  3OB8 A;  5EJ3 A;  3VV1 A;  4AFC A;  2YC0 A;  1FAY A;  4M00 A;  5CFD A;  5CIR A;  3K2O A;  4XDO A;  5CKQ A;  3WG1 A;  2XHK A;  1C5I A;  2WZR 1;  3G6J B;  1VR3 A;  4HZF A;  1CN1 A;  4Q26 A;  5A7W A;  4WZF A;  3SLI A;  2JDK A;  4MAD A;  2QQU A;  4EZ4 A;  1X8M A;  1OVS A;  5CKM A;  1XNA A;  3K4A A;  4MGQ A;  1W8H A;  4CCO A;  1OC1 A;  3JB8 A;  4LO7 A;  2V5Y A;  3FHI B;  1I6X A;  5LWB A;  2B8M A;  3CDZ B;  2A6W A;  3QD6 A;  1OHF A;  4UFH A;  4K9S A;  1WBF A;  2PTM A;  1N1Y A;  5FY9 A;  4NMI A;  2DVF A;  4NPM A;  3ZR5 A;  2RM2 1;  4IGP A;  4XJ9 A;  5JXH A;  3ZYI B;  4GQ7 A;  2CGP A;  2XLG A;  1BEV 3;  1RVF 2;  1ZA4 A;  3FBY A;  4PT6 A;  2XJS A;  5KHI A;  4QQH A;  5BNP C;  2VH9 A;  2VUC A;  5DPN A;  2QNK A;  3JU9 A;  5B4N A;  4HON A;  1EPW A;  1FPN 2;  2WO2 A;  2TEP A;  4CPB A;  2Z69 A;  2WNV B;  3GZA A;  4YG6 A;  3WF2 A;  2FDK A;  1W6O B;  1H30 A;  2BNN A;  4K1Z A;  3J7M A;  4S2H A;  4FPF A;  4AVS A;  1NY7 1;  2VQT A;  1HDK A;  4A3Z A;  2D98 A;  2CGN A;  1VB4 A;  1W0O A;  1JU4 A;  2VUL A;  2D40 A;  5FKC A;  5FXX A;  1VPH A;  4C1W A;  5BYN A;  1QXP A;  1DZT A;  2X29 A;  2D5H A;  1ZBA 2;  1S0E A;  4A7K A;  4GMP 1;  1BXH A;  4MX3 A;  4XBL A;  5JOZ A;  3VD4 A;  1BLZ A;  1W0P A;  4BA6 A;  3HOB A;  4HT1 T;  4MGI E;  1K42 A;  1J1T A;  4OZX A;  3PVN A;  2JDM A;  3NST A;  3QH7 A;  1QH7 A;  2H0V A;  3M3Q A;  2RJ2 A;  4E4D X;  2Q8D A;  1OF4 A;  4LQR A;  1RUD 1;  4MLO A;  4DUX A;  4URA A;  2OPW A;  2GAU A;  2P17 A;  2PHD A;  1YFW A;  2CSG A;  3AVS A;  4L97 A;  1Y9M A;  5FK8 A;  4DPN A;  4R8H A;  3PJQ A;  1SEF A;  4HKO A;  2YMZ A;  4QQP A;  3UKV A;  1OLQ A;  4IER A;  3AZV A;  4JDN A;  4XUT A;  4DEV A;  1ND3 A;  3AXE A;  1IHM A;  1U12 A;  4JQR A;  4PDW B;  4YAR A;  1YLL A;  3L2H A;  2GZW A;  1A6C A;  2J1V A;  1GP5 A;  4HK8 A;  4L8Q A;  1ZRI A;  4RS5 A;  1FPN 3;  4XXP A;  1TZO A;  1TQ5 A;  2ARB A;  4IV3 C;  3Q8F A;  4QKB A;  3ECQ A;  1URX A;  2HEW F;  2OII A;  5CFD B;  4K40 A;  1BHG A;  4LBL A;  2ZPX A;  2WO1 A;  3OSD A;  4RQP C;  4YM1 A;  3FZ3 A;  3J8F 2;  5A7W B;  4YVS B;  2OZJ A;  3O1M A;  3D5O A;  2W92 A;  2Y33 A;  4Y22 B;  4QPG C;  4U36 A;  3P3N A;  4AAP A;  4BPZ A;  1ZBA 3;  5GZG A;  5HXM A;  4HG6 B;  1JUH A;  4FAH A;  5KXD A;  5K4L A;  2P4E A;  1CZS A;  1O7F A;  2JG8 A;  2YDE A;  3N9M A;  2EAA A;  1TMF 3;  4Q2F A;  1VE0 A;  4LR4 A;  3DEM A;  1VBD 3;  1EUU A;  2UWC A;  5E1R A;  4QPI C;  2DUO A;  1QXR A;  3AP4 A;  4OUS A;  4AK3 A;  1ZZ6 A;  1XRU A;  3POF A;  2RS5 2;  5J09 A;  4XE9 A;  4C91 A;  4EN6 B;  1F4A A;  1XSQ A;  1SHW B;  5LA1 A;  3ILN A;  3LDB A;  3LIH A;  5F5Q A;  3POI A;  4CEW C;  4FAG A;  5I0R A;  2WDB A;  2P37 A;  3KQ4 B;  1RUE 2;  3GDB A;  1RYY A;  3C7G A;  4ITC A;  4PBP A;  3O1U A;  3HQX A;  1O4Y A;  4ZZ8 A;  2DDU A;  4OI0 A;  5FYH A;  4AI2 A;  2E31 A;  1KDM A;  1W8Z A;  1AX1 A;  2E7Q A;  1PM7 A;  3O0V A;  4LA3 A;  3ZDV A;  4NHY A;  2FMD A;  2JKX A;  2AEZ A;  2A3X A;  4Y20 A;  3S7E A;  3J8F 3;  5DAP A;  3ZMN A;  1DU3 D;  4Q0U A;  1W3X A;  2IVI B;  5F3G A;  5FUP A;  4TLG A;  1JOP A;  1UOF A;  5C5T A;  1R09 1;  1WCQ A;  2GNM A;  4CPB D;  5KHK A;  1HN1 A;  3H42 B;  1VAL A;  5JWP A;  2XOM A;  1WW5 A;  1F35 A;  1V9U 3;  3A23 A;  2CU5 A;  5FZL A;  1V6N A;  1ND2 B;  1XOY A;  2Y6L A;  2VZQ A;  3ZYH A;  2PQS A;  3B02 A;  2BW8 A;  4LUM A;  1BYH A;  2GH8 A;  1MEC 2;  5LEJ A;  2GN7 A;  2RS1 1;  3POB A;  4MGZ E;  5FIX A;  3EQE A;  3R4S A;  5HCB A;  2OXB A;  3AKS A;  3WXP A;  2IFW A;  1QJY 1;  3DN7 A;  3E97 A;  1LHV A;  2UYA A;  2XHN A;  5L9R A;  4IET A;  1E5S A;  3GBW A;  2VMG A;  2WRA A;  1O4T A;  1MS4 A;  2QQV A;  2RS5 3;  4CDW A;  1IQD C;  1ND3 B;  4KWL A;  3EXU A;  3RS6 A;  1XNK A;  1ULD A;  1B09 A;  2IXL A;  3RWN A;  5F9T A;  2Y6F A;  2WZP P;  4K6B A;  3F2Z A;  1RUE 3;  1H4H A;  1YQ6 A;  1DDL A;  5JI7 A;  3FLT A;  1H1I A;  3H0O A;  5HV4 A;  5A32 A;  1QDC A;  4E8D A;  3OD4 A;  3WQB A;  3AYC A;  3ZKU A;  2E26 A;  3USU B;  4XJZ A;  4A3X A;  1JH5 A;  1DQ0 A;  4AED A;  2ZX1 A;  3H8O A;  3VD7 A;  1UQX A;  2DU1 A;  4CTE A;  1COV 2;  1WLC A;  5FLI A;  1H0B A;  5KXE A;  2VG9 A;  3FUO A;  4JGZ A;  4M3C A;  1WBL A;  4AHY A;  4OVE A;  3KD4 A;  2BVV A;  3WLU A;  1BMV 2;  4HET A;  2JG8 B;  4PJY A;  4UYB A;  1OVP A;  5IK7 A;  2JD4 A;  1NG0 A;  2R49 A;  1H8T A;  1S2K A;  1UZ0 A;  4QDS A;  3LB9 A;  4B4P A;  5A6X A;  3BYW A;  2A6X A;  2MHF A;  5JPN B;  2EIB A;  1DYP A;  2P3Y A;  1LEM A;  5FPA A;  1HV0 A;  1KGY A;  4ET7 A;  2UY8 A;  3NJV A;  5HCF A;  3ZVX A;  4NID A;  1PO1 1;  3WZ1 A;  1FT9 A;  1V6M A;  4A7Z A;  1I5Z A;  3DF0 A;  4TTG A;  1AYM 1;  1W04 A;  4AZZ A;  5KBF A;  3U75 A;  1BJQ A;  1KD7 A;  5DN2 A;  3OG2 A;  3ZXF A;  1GYK A;  3UKT A;  1NYW A;  4FPJ A;  5FMC A;  5FO7 B;  4BLJ A;  1WCK A;  1YQC A;  5JIA A;  2B42 B;  2JG9 C;  2NQY A;  2W3J A;  2I07 B;  4H2A A;  2PHU A;  4LBK A;  5FZA A;  1X8E A;  4GJY A;  3I3B A;  1E5H A;  4UOJ A;  1JHJ A;  2ZKN A;  1LES A;  2VMC A;  4GWM A;  3N9N A;  4M4P A;  4BQ1 A;  5IT6 A;  3UT0 A;  2C24 A;  4RR3 A;  1NAE A;  2JB8 A;  5FYS A;  4AI9 A;  4XCA A;  1O4Z A;  5FYC A;  4Y20 B;  1VMH A;  1OT5 A;  1HRV 2;  2HJI A;  3H9A A;  4IEQ A;  1IGO A;  4TLF A;  1GP4 A;  4Y5T A;  4KH9 A;  4I3G A;  2WT1 A;  1COV 3;  3UGF A;  3ME2 A;  2IVJ A;  1X36 A;  3ALQ A;  2WJS A;  2YUE A;  4RHV 1;  5F1R A;  4XCB A;  1FOD 3;  3B9C A;  1JYN A;  1VJ2 A;  4UFI A;  4BZ4 A;  3CF6 E;  1CPN A;  4ISQ A;  3LGR A;  4DO0 A;  4XFH A;  4YZ5 A;  4WM8 B;  3LA7 A;  3U07 A;  1DLC A;  2D6N A;  3HNB M;  3DXU A;  4W65 A;  3SMH A;  1OOP A;  1Y43 B;  5H9S A;  4QKD A;  4Z92 B;  4YPJ A;  3SHR A;  4CCL A;  4GKX A;  2JEN A;  3T30 A;  1UX6 A;  3NNF A;  4CDW B;  4OHY A;  2QQK A;  3VKM A;  2H0B A;  5A3M A;  1AUY A;  2XBO 2;  4E9K A;  4H7M A;  5FJK A;  3VD3 A;  1JZ4 A;  5A7P A;  3MI8 A;  3TEZ A;  4GWN A;  2UYB A;  5FLJ A;  3QOP A;  4TN7 A;  5E88 A;  3WF3 A;  5A32 B;  2BEO A;  3MV0 1;  3VL8 A;  5JXG A;  1C28 A;  4LEJ A;  4ZS2 A;  5DG1 A;  2CY6 A;  3Q8A A;  3J9S A;  2PAK A;  1BBT 2;  3FFZ A;  3MUZ 1;  1G9C A;  4PF1 A;  4E4S A;  1HKD A;  3OUI A;  3JCI A;  1DIW A;  1JN2 P;  1HRV 3;  4ZPI A;  1CON A;  1F5F A;  4JGZ B;  4M3C B;  3HWJ A;  4Y1X A;  2YYO A;  1R1A 2;  1YFY A;  2VME A;  2FDJ A;  4S2F A;  2YZ4 A;  4CP1 A;  1ULC A;  3PMS A;  4X8P A;  4K1Y A;  2VW2 A;  4XPV A;  1KEX A;  1GWM A;  4GH4 A;  4NVP A;  5HPO A;  2ZX3 A;  1S2B A;  2C5D A;  4DQA A;  3PUS A;  4KL1 A;  4HVR A;  4HBN A;  4YG3 A;  4RA0 A;  5A6Z A;  1CGP A;  3L2Y A;  4XUR A;  5I0U A;  4R52 A;  4XAA A;  1W6N A;  1RUH 2;  1DBN A;  2EIG A;  2WS9 1;  4L2N A;  4ZXE A;  5T3N A;  1PX4 A;  4P5H A;  3BIE A;  3MW4 A;  1W05 A;  3H8R A;  3NQH A;  1LOF C;  4MHR A;  1QY4 A;  1CAV A;  2AEY A;  5ABJ A;  2EXK A;  1TG7 A;  1PHM A;  1EV1 1;  3MW3 A;  3I4I A;  1C8M 2;  2AGS A;  1G9D A;  5FP7 A;  2I74 A;  4RR3 B;  1O5L A;  1NLS A;  4H55 A;  2ZGM A;  4AVB A;  4BIS A;  1BBT 3;  1RVF 1;  4XF3 A;  3GBF A;  4P9G A;  2VOT A;  1WW6 A;  3NV3 A;  3JXS A;  4C90 A;  4DMI A;  1L3J A;  1QJX 2;  4FCA A;  3OBZ A;  2K46 A;  3BPS A;  5FYY A;  3T3Y A;  2KR2 A;  3V0B B;  5F5A A;  4FSJ A;  4EN7 B;  2WIN B;  3K51 A;  3WNX A;  3EHK A;  1NA1 C;  4DRR A;  1Q8P A;  3ZLI A;  5GAL A;  1PNF A;  2WLP A;  5JOW A;  1L7Q A;  3TNQ A;  1WD3 A;  4BYY A;  1KJR A;  1TNR A;  2P34 A;  4XUQ A;  5FQ0 A;  2R04 1;  4EWE A;  1KFX L;  2WZR 2;  4QQ2 A;  1PO2 1;  1UO9 A;  4M0N A;  1OOP B;  4MH0 E;  3OBR A;  4OFG A;  3FMG A;  3B01 A;  4H14 A;  3RI8 A;  4YW1 A;  4RYD A;  2OW4 A;  2XL7 A;  1G8W A;  5L7O C;  1RIN A;  3AK0 A;  1N1S A;  3DGT A;  5F3I A;  3IDE A;  4XUO A;  3HQR A;  5JZG A;  1LU1 A;  1LGC A;  1UAI A;  5K7P A;  3BU0 A;  1VAV A;  4LJH A;  1GZW A;  4RGK A;  2RM2 2;  4KMQ A;  2W9X A;  4LHL A;  3C7E A;  2R30 A;  4LO8 A;  1F15 A;  1YI9 A;  1O8S A;  2HWC 1;  1XSR A;  3GHN A;  5GZE A;  2NN8 A;  3FX3 A;  4OQ8 A;  5JSP A;  4LOS A;  1O91 A;  1RUO A;  1CAW B;  3UKN A;  2OYZ A;  3VD9 A;  4Y1Z A;  4Y4Y A;  3VD5 A;  4GD4 A;  5JXI A;  2ZZQ A;  2P1B A;  3N9O A;  3M7A A;  1NY7 2;  1PGW 1;  1NCQ C;  4O61 A;  1AF9 A;  4GH4 B;  4Q27 A;  1D0G A;  2R0H A;  3LCP A;  2O14 A;  3D6E A;  4JV4 A;  3TWI A;  1IKQ A;  1AXY A;  1ZBE 1;  1VB2 A;  3LEK A;  4AGG A;  1PGL 1;  2WZR 3;  3VBR C;  1XYN A;  3OD0 A;  4Q0P A;  5FZF A;  4AEM A;  3T1L A;  1POQ A;  4AFD A;  3GBG A;  1QOS A;  4IGO A;  4YYO A;  4YM3 A;  2QQJ A;  4XHB A;  4A45 A;  5ABJ B;  1RUD 2;  5FZD A;  1VRB A;  1YQ2 A;  1O5U A;  5FY1 A;  3VBS A;  5KXB A;  1YWK A;  5FLH A;  1OXC A;  1LB2 A;  4QB1 A;  3DL3 A;  3RDI A;  2WA4 A;  3ZFF C;  5FZ1 A;  2B9V A;  2P6H A;  5G04 L;  1V0A A;  3WNN A;  4UW4 A;  2ZJC A;  3KV6 A;  4IEZ A;  3WF0 A;  1CJD A;  4B1L A;  1GQG A;  1KS5 A;  1UXX X;  3ZFE A;  4AFA A;  1WUV A;  2B46 X;  4ONU A;  4HL0 A;  2Q0A A;  4IEX A;  1X7N A;  4LBJ A;  1MVE A;  2W0X A;  4LO5 B;  1UOB A;  3ZO0 B;  3ZPY A;  1JYC A;  4KWJ A;  5FWJ A;  4YZ4 A;  1CAU B;  2BVB A;  1Y9G A;  2JE7 A;  4O7X A;  4R4X A;  3AJZ A;  4M3C F;  1OQE A;  3M3O A;  2AAC A;  2Y34 A;  3GZE A;  1GZT A;  1VP6 A;  1OI6 A;  1W8F A;  1CJP A;  3PTR B;  4FVV A;  4ZY9 A;  4FFG A;  5EHD A;  4DFS A;  1NCR B;  1I1E A;  5BNN A;  3FN9 A;  3WCS A;  5C5U A;  2ZS6 B;  3I2I A;  5DUU A;  5ACA 1;  5EIY B;  3ES4 A;  4CCM A;  2JJ6 A;  2X10 A;  2W1Q A;  1AZD A;  5FRE A;  5CAZ A;  1DQ4 A;  1H6X A;  2VZS A;  3H50 A;  4PLM A;  1K12 A;  4FBF A;  2FZ1 A;  5FYU A;  3ROU A;  5J3U A;  1IS5 A;  3V65 A;  3WW2 A;  5JZG B;  2QZ2 A;  5JAX A;  1CES A;  2DVB A;  1F2N A;  3PUI A;  4N53 A;  3HBZ A;  4ZU4 A;  5JMC A;  3PIJ A;  1HIX A;  5CFC A;  2WO7 A;  4IV1 C;  3KS7 A;  3RRD A;  1RUI 1;  3W20 A;  3ETQ A;  4HFS A;  1GBG A;  1AX2 A;  5AFB A;  1IG0 A;  1W9W A;  5LY1 A;  5C8W A;  1IKP A;  2UU8 A;  3SEP A;  1SLL A;  2PQQ A;  1ZZB A;  4FP2 A;  3HT2 A;  5F2S A;  5FZ9 A;  1G86 A;  3JB4 C;  1QH6 A;  2O8O A;  3N7M A;  2FDH A;  2CL2 A;  4ASK A;  4JHZ A;  4AHX A;  2ZML A;  3BVC A;  4XBN A;  3ZXG A;  5J37 A;  3WNL A;  3IAQ A;  5I0S A;  3UGG A;  2BWC A;  1OPO A;  2J22 A;  5EPA A;  1CAX B;  1XYO A;  2DV9 A;  3PUR A;  4YZ3 A;  5DG2 A;  5LK7 B;  4JGY A;  1E5R A;  1V6K A;  4TZD A;  4CCK A;  1MS0 A;  2VVD A;  1R09 2;  1OSG A;  5H9P A;  1Z7S 1;  3A7Q A;  2BOJ A;  1PX3 A;  1BCX A;  1OQ1 A;  5LRR A;  3AMM A;  3AP7 A;  5B2G B;  1L7R A;  1PMI A;  5GLW A;  1V6L A;  2RS1 2;  3H1M A;  1DGL A;  3N7L A;  4FXG B;  1W2N A;  1SG3 A;  1OLM A;  3AP5 A;  1QJY 2;  1XE8 A;  2J42 A;  3MIG A;  3MPP G;  4PQ9 A;  1W03 A;  2MPF A;  3BOW A;  5FPB A;  4Q4X 3;  2PEL A;  4FPK A;  3B7M A;  3CKH A;  4H7L A;  3SC7 X;  4AFB A;  1NE6 A;  5FO9 B;  1W8T A;  1SQ4 A;  3TEY A;  2QFE A;  3M3C A;  4PBO A;  3HEI A;  3RZK A;  3RVH A;  4L9B A;  4XVH A;  4AI0 A;  3MIB A;  5FZE A;  3ZSK A;  1J59 A;  1XU1 A;  4EZH A;  1LHN A;  3VDB A;  3W58 A;  3JD7 1;  3N35 A;  4DOU A;  4P9J A;  2VQU A;  4WBB A;  4Q0S A;  5CU1 A;  5LK5 A;  3VBF C;  1ZX5 A;  4RFR B;  1K5M C;  2LAL A;  2JX9 A;  3PUA A;  5BNN B;  2B7Y A;  4DY3 A;  4AGV A;  4FFI A;  3I2J A;  4ZON A;  5LA2 A;  1JZ2 A;  1W6M A;  4UI9 L;  2BYV E;  2K0G A;  3DPR C;  3X29 B;  2ZBJ A;  3HD8 B;  5JXJ A;  5FMO S;  5DAQ A;  4BK5 A;  1LRH A;  2JDH A;  3POS A;  4FPO B;  4EQV A;  2EXH A;  5ANQ A;  2RS1 3;  4M01 A;  5CFC B;  3VBH C;  3AL5 A;  2Y6J A;  3K77 A;  1PO1 2;  1W28 A;  1QJY 3;  4OI2 A;  4OHW A;  5LBF A;  1REE A;  2WKK A;  1O3T A;  2IZW A;  1AYM 2;  3EJK A;  3WIN E;  2W94 A;  2X53 S;  1AR6 1;  1PM4 A;  3Q8B A;  4K21 A;  4BMB A;  3RI9 A;  2NPI A;  3HVD A;  2CV6 A;  2JEM A;  3PU3 A;  3HR9 A;  5FPU A;  2X5I B;  4XJ8 A;  2WL1 A;  2LRO A;  4JCK A;  1ZRD A;  1X9T A;  2X8K A;  2XLA A;  5FMB A;  1VBC 3;  3CMG A;  2D43 A;  3NNG A;  2VBB A;  4QKF A;  2ZA9 A;  5D21 A;  3WHU A;  3SIT A;  5IVF A;  1DQ6 A;  3ACG A;  2DVG A;  4Z8B A;  5T5P A;  5H9Q A;  2BQP A;  2PA7 A;  4IE7 A;  4XF1 A;  2G9Z A;  1W90 A;  1HB4 A;  5IK5 A;  3B69 A;  1EUT A;  1HN0 A;  4RHV 2;  4RGA A;  2LTN A;  2Y64 A;  4MYE A;  1WMF A;  2WWJ A;  1XE7 A;  5L36 A;  1ULF A;  1RIR A;  3VHP A;  3GYD A;  2EIC A;  5JSR A;  4OZO A;  3C7H A;  5EZW A;  3S0M A;  3QLQ A;  3AKQ A;  4QPW A;  1ZRC A;  2D3S A;  3K4Z A;  3J26 N;  4LKF A;  3B94 A;  4QXH A;  4XF0 A;  3KT1 A;  1SFP A;  2VE1 A;  4XQW A;  2AEN A;  3ZIW A;  3ZXJ A;  4B3N A;  2WNU A;  3RYP A;  4MXW A;  5A6Y A;  4LT5 A;  4IEU A;  2FCT A;  1PO1 3;  5A3N A;  4DXS A;  4FPY A;  4R9B A;  4V2W A;  1N1T A;  1UY0 A;  4WZC A;  4BQ5 A;  4D69 A;  4BCU A;  1AYM 3;  5AVA A;  2VM9 A;  5BPX A;  5T55 A;  3IN9 A;  4KWK A;  4KWU A;  1GP6 A;  4RN5 A;  5L19 A;  4HSL A;  1KRI A;  4UFJ A;  4BU2 A;  4YW4 A;  3I2H A;  2AH2 A;  5GLZ A;  2O1Q A;  3HBK A;  3T0A A;  5BNP A;  1H9P A;  5I8S A;  2XVG A;  5FBJ A;  2PHX A;  2XUM A;  4EV0 A;  1Y4W A;  2J1S A;  3OYW A;  3GAL A;  2VCB A;  2A75 A;  1I3H A;  1AR8 1;  2PN5 A;  5C9A C;  1XU2 A;  2GND A;  3KCC A;  2IUW A;  1LAJ A;  1PZ9 A;  4UFK A;  1UU4 A;  1QJX 1;  4LLO A;  1SLB A;  2PLV 3;  1MR5 A;  2C9A A;  2EAL A;  4A7Y A;  5I91 A;  3W5M A;  2Q5T A;  2VUD A;  1EP0 A;  4CCC A;  3IAP A;  1C8N A;  4IE4 A;  4P02 B;  5FZ3 A;  3ZXD A;  3ZFG A;  1W2T A;  2W5F A;  1S55 A;  4I0A A;  3KT7 A;  1D4M 3;  1ASJ 1;  1B35 C;  2LRP A;  5LCW L;  2CNA A;  4M4R A;  3I49 A;  4N9I A;  2OX0 A;  1UYX A;  3HAG A;  2QQP A;  2ZAB A;  2WS9 2;  1W99 A;  4OI1 A;  2Q1Z B;  1UL9 A;  5FZ4 A;  3U78 A;  3ZYJ B;  4AAX A;  3BCW A;  1Q8S A;  1Z78 A;  2W1S A;  4UF0 B;  1EV1 2;  4I3P A;  1OUS A;  3K48 A;  4Y4R A;  1WLD A;  2WFP A;  2WLQ A;  1CZT A;  3HN1 A;  1UW8 A;  1XB9 A;  5CG9 A;  3U10 A;  5I0T A;  3GXU A;  1O3R A;  4AI1 A;  2BGO A;  4IV3 A;  2WNV C;  3B3Q E;  1S0D A;  3CL1 A;  5FZM A;  3H8X A;  2ARC A;  4RQP A;  2WZE A;  2O8Q A;  4JRL A;  4YGC A;  1OH4 A;  2Y0O A;  4YW6 A;  3VKO A;  5F8P A;  4GA9 A;  1K3I A;  2X05 A;  1ONA A;  3LFI A;  1X50 A;  4WM7 B;  4OYU A;  3VBO C;  4QPG A;  1LOG A;  1MQT B;  3KB5 A;  4PIZ A;  4L11 A;  2ZGR A;  4AF9 A;  4YVW C;  2R04 2;  1HRI 1;  3MFC A;  1PO2 2;  4QHZ A;  5BNO B;  2WNU B;  5FAX A;  4MXW B;  2DF7 A;  5LY2 A;  4BOW A;  3NV2 A;  1PZ8 A;  1R08 1;  2ZXQ A;  5FXV A;  3UL2 A;  1IPK A;  2JIC A;  2ZCW A;  4WVV A;  5DZE A;  5IJR A;  5JOX A;  1PK6 C;  3RZM A;  1UOG A;  5FWE A;  2HWD 1;  4QAW A;  4FTS A;  4QPI A;  2DCZ A;  1ZA7 A;  2WS9 3;  2D44 A;  2VZ3 A;  2FMY A;  2W87 A;  1DQ2 A;  3O5S A;  5EFU A;  4DIQ A;  1QJF A;  4E4Z A;  3S5A A;  5T54 A;  2VW1 A;  1UPS A;  5KXC A;  5ERL A;  3P6B A;  4CEW A;  2G1M A;  1EV1 3;  3TEW A;  3KV5 A;  3OYW B;  3VLB B;  4OHZ A;  2Y38 A;  1BZW A;  1UY2 A;  2OVU A;  3AP9 A;  2VPV A;  4WVZ A;  4PDW C;  3UK9 A;  2R1D A;  4ES9 A;  2XVK A;  3CNA A;  3B9I A;  2J1R A;  1FNY A;  2HWC 2;  1RVF 3;  3LEI A;  2BDR A;  3MYX A;  1VLN A;  2PHL A;  3WDW A;  3S57 A;  3K75 B;  1KS4 A;  3O7O A;  5CEH A;  2Z4F A;  1W2U A;  4X6R B;  3ACF A;  1PIV 2;  1OLM E;  3UES A;  4AXO A;  2E63 A;  4FOW A;  1PGW 2;  3MIC A;  1GNZ A;  4YVS C;  5H9R A;  3PVE A;  3ZFG B;  1Q8O A;  3H1W A;  4COU A;  5DQ0 A;  1ZBE 2;  2P3K A;  3INA A;  2WSU A;  1PGL 2;  4FQ4 A;  1YEW A;  2XH6 A;  1PO2 3;  5D8A C;  3KMH A;  2JDP A;  4P9I A;  3HPN A;  5EQU A;  3BI3 A;  2R06 1;  1GAN A;  1RUF 1;  2C6S A;  3AL6 A;  2VVE A;  4YSF A;  1UY4 A;  3UET A;  1JW6 A;  4DY5 A;  5IVJ A;  1T6G C;  3OPZ A;  2XJP A;  5DXD A;  1W9T A;  2RV9 A;  1ZM1 A;  5FYB A;  2G9G A;  4N90 A;  4U2A A;  1V6O A;  5J96 B;  1MZ5 A;  2F4P A;  4XAB A;  4BXS V;  1ZZ9 A;  3WG2 A;  5AFE A;  1IZ3 A;  4LMF A;  3BKZ A;  3ZXL A;  1QEX A;  4BQ4 A;  3UV9 A;  3VZJ A;  3WP6 A;  1W8W A;  1GOH A;  2HWC 3;  2PHF A;  4Q29 A;  3DCQ A;  5DDJ 1;  2WA3 A;  4RQP B;  2WUH A;  4ARY A;  1VMJ A;  3FWE A;  3KCX A;  5DUW A;  3VDD A;  3DYO A;  4QWN A;  5J48 A;  1HXS 1;  2F4L A;  2BV4 A;  1JYW A;  4AVA A;  4QPG B;  2WAO A;  4YRD A;  1R1Z A;  3H3U A;  4YGE A;  1PNG A;  2FBE A;  4AQT A;  4LTA A;  3P5B A;  4E2S A;  4BLI A;  3CZU A;  2CAU A;  3LPG A;  2WAA A;  2RDN A;  1KXG A;  1W6P A;  2YC2 A;  3OUJ A;  4NRQ A;  3ZYR A;  5ACA 2;  4FT8 A;  1ND2 C;  1MS1 A;  4FQZ A;  3ZSM A;  1K5J A;  4BB3 A;  4QPI B;  4GKY A;  4CUG A;  5FR3 A;  4Q0V A;  3THD A;  4IES A;  1YQ5 A;  1IS6 A;  2Y8K A;  4I30 A;  3WQ0 A;  4JDM A;  2OS2 A;  4AQ6 A;  3DKQ A;  3IPV A;  4NPR A;  4PHZ A;  4CEW B;  4XMA A;  4Z82 A;  1M4W A;  1QJZ A;  1QGL A;  1RUI 2;  2E7A A;  1CZV A;  3U4X A;  3N4M A;  4ATE A;  2Q8O A;  1JYT A;  4Y1V A;  3I2O A;  1AX0 A;  4BXF A;  2ZX0 A;  3BPZ A;  5FFO C;  3NW4 A;  2JG9 A;  2XUE A;  2XGX A;  2HWE 1;  1ENS A;  3AKP A;  4BWO A;  2GNT A;  1GLH A;  4IL7 A;  5A3L A;  5FKB A;  2Q1F A;  2O0O A;  2ZEW A;  5FPZ A;  2WT0 A;  4RS5 B;  3O1V A;  3C8X A;  3LIG A;  3AZW A;  3OGV A;  1CR7 A;  3TBD A;  3I54 A;  1HJF A;  4Q4W 1;  3TEX A;  1QMJ A;  1W2A X;  3M1H A;  2QBX A;  3N9Q A;  3KQR A;  1UN1 A;  2HWB 1;  1NXD 1;  4QX0 A;  1BVV A;  4W4Z A;  3BGA A;  4CEY C;  4GAZ A;  1DQ1 A;  3ZYP A;  3H3L A;  4G9S B;  2HLE A;  5CA6 A;  5ACA 3;  3FL7 A;  1Z7S 2;  2DFC A;  2R0F A;  2IXI A;  4GWJ A;  4WVM A;  5GLT A;  4ARX A;  5C4W C;  5C3O A;  2WR9 A;  2XB6 C;  3NMB A;  2Y6K A;  1S0I A;  1MEC 3;  4AI8 A;  1QJE A;  4QU1 A;  4DNY A;  1RUI 3;  2ZGU A;  3ZPO A;  3ZSE A;  4X8N A;  2HKX A;  1U5Y A;  5G05 L;  4CUB A;  3VHO A;  3VKF C;  1UZW A;  4ISR A;  1DYK A;  3OJB A;  2ZEY A;  3I3E A;  2F17 A;  3WR0 A;  1O3Q A;  1J1L A;  3VDD B;  1G9F A;  3VZK A;  4DXT A;  2ZGO A;  3JD7 2;  4JX0 A;  4S2D A;  1D2S A;  4XAC A;  5GJ6 A;  4NJ4 A;  1AXK A;  4LK7 A;  5JR7 B;  3AYA A;  4XFC A;  2YGM A;  4QT6 A;  3E6D A;  1FI2 A;  5FY7 A;  3PU8 A;  2FD8 A;  3V56 A;  2X09 A;  2DVA A;  1NZC A;  2ZHL A;  3I97 A;  3IT8 A;  5AVP A;  5DMY A;  1FAT A;  2LUW A;  4Y26 A;  4OCT A;  5FYT A;  2XON A;  4WM8 C;  1IS3 A;  4YW2 A;  1Z7S 3;  3K3N A;  2GNB A;  1TVG A;  4YFW A;  5C3P A;  3HNY M;  3TAY A;  4K20 A;  1T2X A;  1DHK B;  3WX5 A;  2A6Y A;  1UZZ A;  4XUN A;  4Q4Y 1;  3NO8 A;  1OKO A;  4HAN A;  1DFQ A;  1LED A;  4G4F A;  1LOF A;  2JG9 B;  4PIX A;  1ULG A;  3E5X A;  5GLV A;  1OUR A;  1AR6 2;  1F8V A;  3R0R A;  4XW3 A;  3WNO A;  1AHS A;  1NX9 A;  1V70 A;  1FYU A;  3IKW A;  3MGU A;  3WD5 A;  5A3T A;  1S0C A;  2YBS A;  3WT3 A;  4EYU A;  1JYV A;  3O1S A;  2J1A A;  5C6C A;  5HCA A;  1WW7 A;  5LW9 A;  1LOB A;  3JD7 3;  3WP3 A;  1WCD J;  1UYP A;  3C7O A;  5SV5 A;  4FFH A;  1D0H A;  4KG0 A;  1NA1 A;  1YRZ A;  4AED B;  3PUQ A;  1ZNP A;  1KJL A;  2VCM A;  4X6Q B;  1UMZ A;  2R07 1;  3KF5 A;  2QQI A;  3ACI A;  3SCH A;  3VHN A;  3WW1 A;  1RIT A;  5FP4 A;  5L73 A;  4A6O A;  3UGH A;  2YG0 A;  1RXF A;  1RXG A;  4PQQ A;  5IWF A;  3WDU A;  1HV1 A;  2JDN A;  5FBZ A;  4COZ A;  4WVM B;  1SDD B;  4NHX A;  4OUE A;  2TUN A;  3CJI C;  3IMM A;  4DUV A;  4FPE A;  4K8F A;  1BK0 A;  1H8T B;  3KF3 A;  2P3J A;  1MS3 A;  2DBI A;  2VZR A;  1ODM A;  2YC4 A;  4YGB A;  1YHF A;  1OA4 A;  4CE8 A;  5J98 B;  5L7O A;  3WUC A;  4N43 C;  5LB6 A;  3EMR A;  4CDU C;  4N7U A;  1A78 A;  2A5Z A;  4AR2 A;  1ZRF A;  1TME 1;  4ZHN A;  2C9K A;  2ARE A;  3LDK A;  3I2D A;  1O3S A;  4FI9 A;  2CDP A;  2DWR A;  2YFZ A;  3OOX A;  2VNR A;  3THT A;  3A0K A;  3IM0 A;  2W08 A;  4UW3 A;  2V4A A;  2TBV A;  5FZB A;  2XBO 3;  1D4V B;  1I5P A;  1PVC 1;  2QE3 A;  3TYJ A;  2VZV A;  4LIV A;  5C3S A;  2VQA A;  3DKW A;  4LUL A;  3B93 A;  1AVB A;  5F3C A;  5F37 A;  1JI6 A;  5I8Y A;  1RUG 1;  2RJK A;  2W68 A;  5FY0 A;  3LKJ A;  3T2Q A;  4BE3 A;  4DEQ A;  1AR8 2;  5C7G A;  4CDQ C;  2UWA A;  4ASM B;  4XFI A;  1RL3 A;  4GB3 1;  2JDZ A;  2Z79 A;  1NCQ A;  3I7D A;  5C71 A;  2VOW A;  3KVB A;  4B8E A;  1DZR A;  2VJX A;  3A21 A;  4AI3 A;  2DUR A;  1CPM A;  3SNM A;  4EN0 A;  3VBR A;  5IUQ A;  4SBV A;  4AOC A;  2W47 A;  4YZ1 A;  2DTY A;  3GGL A;  5J36 A;  1GU3 A;  1R1A 3;  4O9E A;  1VMF A;  2E53 A;  1XNT A;  2XKP A;  4QXC A;  5LBE A;  3SKV A;  3KV4 A;  1ASJ 2;  2WYS A;  4LO6 B;  3OGJ A;  4D7Y A;  3WP4 A;  2ZGL A;  1J3P A;  1MS9 A;  2CTV A;  3PVB B;  4I09 A;  1MZ6 A;  5IVB A;  2Q8C A;  5FZO A;  3FFQ A;  2DCY A;  4JC1 A;  2JE9 A;  3VZL A;  3WW4 A;  1RUH 3;  3VBU C;  4BHP A;  5TSW A;  5C3R A;  1XNC A;  2QCS B;  3ZFF A;  1H4G A;  1POV 3;  2VZU A;  3FLR A;  5JPM B;  4CA9 A;  2IC1 A;  3LPF A;  3IDC B;  5CB7 A;  1F31 A;  2ZOE B;  5FZ0 A;  2BNO A;  3EYP A;  3GCX A;  1C8M 3;  1UYZ A;  1QJU 1;  3IDB B;  3ON7 A;  5FYI A;  1H2K A;  1SCS A;  2XDV A;  1AR8 3;  1S2E A;  3O1O A;  2IFR A;  4UAP A;  3LAG A;  1C3H A;  5IVY A;  1QJX 3;  1VBB 1;  3I59 A;  4BK4 A;  1PIV 1;  4XHX A;  4XTM A;  2Y6G A;  3WP5 A;  3AKR A;  1YIF A;  1VBD 1;  1YYN A;  3POE A;  1HRI 2;  1GWK A;  5A33 A;  4QGL A;  1GQP A;  2BRT A;  3PLQ A;  4P9W A;  5K0U C;  1R08 2;  4FTB A;  4QM9 A;  2C0Z A;  4RFT 0;  4E2G A;  4PIY A;  4HVQ A;  2GP3 A;  1O6U A;  3EB7 A;  3ZN6 A;  2HWD 2;  4COW A;  2QDN A;  4YW5 A;  2NYY A;  1W6N B;  3AMN A;  4IV1 A;  3AFK A;  2D6O X;  2WNE A;  4ATF A;  1BQP A;  2V5D A;  1KIT A;  2ZHN A;  4LOT A;  5LAT A;  4COY A;  2J1T A;  5IVC A;  3SIS A;  2V4V A;  1CAV B;  2IXH A;  2WO3 A;  4DS0 A;  2GP5 A;  1G6N A;  4QU2 A;  1US2 A;  2VUJ A;  4J1X A;  1V00 A;  1S0F A;  3OGG A;  1ODN A;  4CZS A;  1CQ9 A;  1WLT A;  2OA2 A;  1RUJ 1;  4DUW A;  2RM2 3;  4PF5 A;  4M3C E;  2WQZ C;  3E5U A;  2RMU 1;  2IXJ A;  4BIO A;  2YGL A;  4JKL A;  4NRP A;  5DUX A;  3U11 A;  2PHR A;  5FZK A;  4DRV A;  1HB2 A;  1JOJ A;  2OT7 A;  2VZT A;  3F95 A;  4MVT A;  4QXK A;  1JZ3 A;  3NAP C;  4CDX C;  3VBR B;  1V9U 1;  1CD3 G;  3MDP A;  5JIU A;  1NCR C;  1H2L A;  4I0W B;  2QZ3 A;  4KU8 A;  3JUU A;  1H9W A;  2HBT A;  5FQ0 B;  3C3V A;  4D6S A;  4SLI A;  1N3O A;  1YI7 A;  4P14 A;  4LKE A;  2VW0 A;  3K46 A;  1JS9 A;  3MID A;  3JQX A;  2R06 2;  3AJY A;  1RUF 2;  1R08 3;  1WWY A;  3B00 A;  5FZG A;  3AKT A;  2LM3 A;  4JAA A;  4GMP 3;  2WQ4 A;  2VR4 A;  1GQH A;  1AR7 1;  4QB2 A;  3HIF A;  2W39 A;  3I2G A;  4NIH A;  2WC2 A;  2RE9 A;  3ZYF A;  3ZFF B;  3LFM A;  4AEK A;  3DV8 A;  2KD7 A;  1GFF 2;  3RSJ A;  4KQ7 A;  5KR7 A;  1GZW B;  4ZZ5 A;  1QOO A;  1RUD 3;  5T52 A;  2JE8 A;  1UX7 A;  1ALY A;  3N36 A;  3M70 A;  3RNS A;  1NE4 A;  5IAV A;  1MS8 A;  3Q8E A;  5DDJ 2;  2AC1 A;  5BY5 A;  1CVN A;  2I2S A;  4FPH A;  2ZHK A;  3S5Q A;  4LBM A;  1K5M A;  3MFA A;  3OPW A;  1ENR A;  1HXS 2;  4V1P A;  4UFL A;  4PLO A;  5FZH A;  2ZGT A;  4HKL A;  3JBG 2;  1AR9 1;  2XML A;  4P00 B;  5FDB A;  4KGQ A;  5FMD A;  2VUA A;  3WCR A;  1KFU L;  4CP9 A;  3DPR A;  5A33 B;  1J58 A;  4XBQ A;  2AYH A;  1SCR A;  2ADE A;  5FP9 A;  4CSW A;  5GZF A;  5A6Q A;  1WME A;  4IEO A;  5FZI A;  3IMN A;  3WQ7 A;  3KWV A;  1AYN 1;  3ZN6 B;  3NNL A;  3LA3 A;  3TB0 A;  5BNQ A;  2R06 3;  3WF1 A;  1RUF 3;  2VOX A;  3PME A;  4IV1 B;  1YJL A;  3VBH A;  1LOA A;  2H6C A;  4BQY A;  1LOC A;  4HOO A;  1JBC A;  4QGM A;  1EYB A;  4IE0 A;  4IE6 A;  2PXJ A;  1JZ7 A;  3WVJ A;  4A41 A;  4UT5 A;  5DAB A;  3MIF A;  3VBS B;  3C7F A;  1RC6 A;  2P2K A;  4QX1 A;  4W6W A;  4P9X A;  5IFP A;  3PTY A;  1IOA A;  3IDA A;  2C1F A;  2HWE 2;  3KV9 A;  4KBZ A;  1SBF A;  2VQ0 A;  2D97 A;  1FX5 A;  1UWW A;  4AGR A;  5CG8 A;  2W2I A;  3H3Z A;  4L92 A;  4E2Q A;  2JKB A;  1UKR A;  4JZR A;  4ZU5 A;  1VBA 2;  5FTT C;  1YFX A;  4I0B A;  3MW2 A;  1Y9Q A;  3ZFE B;  4J1W A;  2VTF A;  5E6H A;  3ZKY A;  1FV2 A;  5C8C C;  1HXS 3;  5HCH A;  4C0H A;  3OTF A;  4D8M A;  3IBM A;  4Q4W 2;  4PCR A;  5FXW A;  1RJ8 A;  1W9F A;  4A2U A;  4Y5S A;  4QHB A;  1UKG A;  2HWB 2;  4NIG A;  2BBV A;  4TYS A;  5LA9 A;  3FUQ A;  3W5N A;  2VMF A;  3BTZ A;  3OUH A;  4XZP A;  1YC6 1;  1R09 3;  3ASI A;  3PJY A;  2GC2 A;  4MHU A;  4MSV A;  4NAO A;  2QQM A;  4P08 A;  2JIG A;  3OF1 A;  1BK1 A;  4NN0 A;  3NRU A;  3TOJ A;  3LSD A;  3NVC A;  4Y1U A;  1QOT A;  4N53 B;  3O1T A;  1NKG A;  2KA3 A;  3I3D A;  2DVD A;  4IEY A;  1OPM A;  1XND A;  2B45 X;  3OEB A;  4CXY A;  1CX1 A;  1WA4 A;  3E5Q A;  4GZ9 A;  3M3E A;  4Y5Z 0;  1MAC A;  2HWE 3;  2HYX A;  3PVO A;  2X5I C;  4IE5 A;  4Q1P A;  4Z07 A;  4XAE A;  3RZG A;  1E57 A;  4JVA A;  1H1A A;  2ZX4 A;  1D2Q A;  3W9A A;  1K5M B;  1YCI A;  4QGN A;  5FV3 A;  3U0Z A;  4E27 A;  5FRA A;  5C9A A;  2DYC A;  4R9D A;  5F7U A;  5A3O A;  3RZJ A;  4LUK A;  5BXX A;  5LZ6 A;  1UMH A;  3DPR B;  1RGS A;  3QAC A;  5F2W A;  2BZD A;  2DCT A;  3ZSJ A;  2R6Q A;  2YU1 A;  3NKG A;  4JGY B;  2D6K A;  2PHW A;  2HWB 3;  4Y1Y A;  5JVV A;  2J1E A;  2XJT A;  2ZMN A;  4LLF A;  3DYP A;  3WV6 A;  1GIC A;  3HT1 A;  5FMO L;  3VBH B;  2D93 A;  4IEW A;  1UY3 A;  1G9B A;  1B35 A;  2HH9 A;  2VCA A;  1N47 A;  3ZN5 A;  4FO9 A;  4WVW A;  1P8J A;  2WN2 A;  4GMP 0;  5D2A A;  4Q5O A;  2JD9 A;  4CCJ A;  5JMO A;  3BTY A;  1MS5 A;  3URF A;  1N3P A;  5APA A;  1OKQ A;  1T6B X;  2BFU L;  4Q4Y 2;  3DXT A;  3R4U A;  5FPX A;  2UWB A;  1JMU B;  3QBQ A;  4KBB A;  4E4H A;  3H7J A;  5F32 A;  3G7D A;  3ES1 A;  1Q8V A;  2R7E B;  4PI0 A;  4ERO A;  4LPL A;  2P3I A;  2A6V A;  1RED A;  4JQT A;  2GDF A;  3LWC A;  4IEV A;  2ID4 A;  2A7A A;  2WNV A;  1UU5 A;  3RZL A;  5KHG A;  2VXJ A;  4Q0Q A;  2VD7 A;  5HXV A;  4QB6 A;  4LBQ D;  4H3W A;  2QQL A;  1OD3 A;  2VMH A;  1CIY A;  1DLL A;  1UZV A;  4BH9 A;  2R07 2;  4CXW A;  3VBO A;  5C33 A;  3NNJ A;  5HBA A;  4YW3 A;  5A7O A;  2HEY F;  3H8U A;  3FHQ A;  1W6M B;  4YVW A;  3OGR A;  5F5C A;  4AVT A;  2WII B;  1S4C A;  4FP3 A;  2WT2 A;  4RHV 3;  1FMD 1;  1YO8 A;  4AQS A;  3RZZ A;  2QQO A;  2EID A;  1KDK A;  2WQ8 A;  1JZ5 A;  1HB3 A;  1PK6 A;  2ADD A;  4DXR A;  1SFY A;  3MHZ A;  3CHX A;  3KSC A;  4NIA A;  4QQL A;  2DFB A;  1J3R A;  3KZ4 C;  4IXL A;  1EAH 1;  4JDO A;  4QDR A;  1BEV 2;  4XJW A;  2V09 A;  3VDC A;  4AL9 A;  5C3Q A;  3HN3 A;  4CU9 A;  1QXJ A;  1ZZ7 A;  1TME 2;  4ZU7 A;  4MO3 M;  5JCT A;  2VBD A;  3N7K A;  2A71 A;  4P9Y A;  4XEZ A;  2VMD A;  2EXJ A;  1VRH 1;  4I01 A;  4PDW A;  4YGD A;  1PVC 2;  2WYF A;  4MZU A;  3K4D A;  2XWB B;  4XJA A;  1NZI A;  2GAL A;  3SCG A;  4BQ3 A;  1RUG 2;  5I8T A;  1J83 A;  1XPW A;  1IPJ A;  1QNY A;  3VUO A;  2GC0 A;  4A42 A;  4HLT A;  4D0Q A;  1LEC A;  4GB3 2;  5J1X A;  5IFT A;  4DXZ A;  4YVS A;  2DTW A;  3AMQ A;  1UMI A;  1AL2 1;  2R07 3;  1LHU A;  3BAL A;  3T0B A;  4WM7 C;  4Y22 A;  3N9P A;  3M4F A;  1B35 B;  1MQT C;  3KGZ A;  4AVC A;  4BQX A;  4FOQ A;  1IG3 A;  4YW7 A;  5D8A A;  3APB A;  2BWA A;  1QIQ A;  5BNO C;  4IW3 A;  3DYM A;  4XJU A;  1RUC 1;  2WNU C;  1VAM A;  3WG4 A;  1DYO A;  1FNZ A;  2ET7 A;  2F6B A;  3HJR A;  1LUL A;  3A22 A;  2XVL A;  4FPL A;  3LEM A;  1WMD A;  4CUA A;  3ZIX A;  3AP6 A;  2NMO A;  1OD5 A;  1QDO A;  1X82 A;  5EYX A;  5GKA C;  4C1X A;  3LSE A;  1TME 3;  1UNB A;  3OBA A;  4LE4 A;  4LHK A;  3S6P A;  3S7I A;  4L0P A;  2VC9 A;  1NT0 A;  2VCC A;  3ZM8 A;  5C70 A;  2J7M A;  4KGG A;  3ZSL A;  4CCE A;  2YPJ A;  5BNP B;  1PVC 3;  2ET1 A;  1ACC A;  1HQL A;  2B5H A;  1QJU 2;  4NRM A;  3VHR A;  1RUG 3;  2Y60 A;  4L99 A;  3KT4 A;  4MV2 A;  2QQW A;  3VBO B;  3RZH A;  2C26 A;  1W8U A;  3MIH A;  3VN4 A;  2EIE A;  1MPX A;  4GB3 3;  3GJB A;  5KHJ A;  3UNP A;  3ACL A;  4YVW B;  1RHI 1;  2GSY A;  1VBB 2;  2BUK A;  2GH2 A;  1OMI A;  1AL0 G;  1N1V A;  1SBD A;  3ZFG C;  2BPA 2;  4MG2 A;  5LEK A;  5CFD C;  1LCL A;  1WW4 A;  1TMF 2;  1JTZ X;  5EYY A;  1RMU 1;  1PK6 B;  5FK7 A;  5T50 A;  1ND2 A;  1VBD 2;  2YBP A;  3ACH A;  3E1F 1;  5HV0 A;  5CVR A;  1FV3 A;  5A1A A;  1YJK A;  3QH6 A;  5FPL A;  1C4R A;  1S0B A;  2PAM A;  2R32 A;  4AE2 A;  1BVP 1;  5I93 A;  2NZ9 A;  2R04 3;  5DZG A;  3KVA A;  3AC0 A;  3WHT A;  5E8A A;  4GUL A;  1UD1 A;  3HNM A;  3LOB A;  2QDR A;  2YB7 A;  2QTW B;  4K7J A;  4XFA A;  3KLS A;  2ZMK A;  1UZY A;  4K8R B;  1HJG A;  1VBE 1;  2CAV A;  2ZZJ A;  2MEV 1;  4FOY A;  2WFF 1;  5FP8 A;  1O59 A;  4IEP A;  1GV9 A;  4BME A;  2VAU A;  5J7M A;  2NP0 A;  3MIE A;  4XOG A;  3ZOI A;  3NNM A;  4XQD A;  3RGB A;  1GSL A;  3D0J A;  1RUJ 2;  2ZAH A;  3KCY A;  4NRO A;  4WV8 A;  4D7T A;  5BUV A;  4O9G A;  2RMU 2;  4LO4 B;  2KXL A;  4OQ9 A;  2OUJ A;  3T4V A;  3USU A;  5A3P A;  1QJU 3;  5CAD A;  1LOD A;  2RVA A;  3ZYG A;  4IV3 B;  3AB0 A;  1NOV A;  3T09 A;  5FOB B;  1DP0 A;  2Q4S A;  1VBB 3;  2E9Q A;  1V9U 2;  2P5B A;  5D8A B;  3NKT A;  4KU7 A;  4CEY A;  2PMW B;  1PIV 3;  2D3R A;  2VEC A;  1U5X A;  1W06 A;  2E6V A;  2XWJ B;  3V64 A;  3CBN A;  3JBG 1;  1JU3 A;  3ZDS A;  3WUD A;  2YRO A;  5IHR A;  4JKM A;  4OMD A;  4LHN A;  1Q56 A;  4IUG A;  2J1U A;  4MXV A;  5C4W A;  2D7F A;  2RDS A;  3AYE A;  4Q4X 1;  1ZBE 3;  5DUV A;  1IS4 A;  4ZS3 A;  2DCK A;  5LAS A;  3O1P A;  4XYX A;  3AMH A;  3ZR6 A;  2W1W A;  3BN6 A;  3P3P A;  5FOJ B;  4C8D A;  4BJ0 A;  1AR7 2;  1PGS A;  3HQU A;  2XQR A;  4A4A A;  3JZV A;  2KM2 A;  2ERF A;  4LKS A;  5L9B A;  3CU7 A;  3TN9 1;  4XUP A;  2PAE A;  1SLT A;  1XC6 A;  3BUC A;  3WW3 A;  3AYD A;  4YG0 A;  4GAL A;  2BU9 A;  1A34 A;  1YQ8 A;  2Y0I A;  1DG6 A;  3MEP A;  1F5J A;  4CU6 A;  1APN A;  2G4I A;  2GC1 A;  5CBL A;  3AXD A;  2QJV A;  4JRA A;  4AHZ A;  3ELN A;  3POJ A;  1ND3 C;  4FXK B;  1RUJ 3;  4XFF A;  2DUP A;  3PHM A;  2RMU 3;  2OPK A;  1LU2 A;  4NWW A;  3MBW A;  4RS5 C;  1WCS A;  4FTE A;  3OY8 A;  4DZG A;  4CU7 A;  5FYV A;  1VBA 1;  1SBE A;  3AMP A;  3C2U A;  3E6B A;  3H1Y A;  5E89 A;  3RMX A;  2EAK A;  1LNS A;  1AR9 2;  1Y3T A;  1HLC A;  1OUX A;  2E51 A;  2ZGP A;  3J4U H;  4LK6 A;  2VL4 A;  5CNA A;  4EN9 B;  5AC9 1;  3KGL A;  3ATG A;  4QX2 A;  1LGB A;  2EXI A;  2VMI A;  4WM8 A;  2VZP A;  3OGS A;  3VDA A;  3I2K A;  3I3M A;  5FXZ A;  3UJO A;  3USS A;  1AYN 2;  5CIS A;  4A44 A;  4NHL A;  5FY8 A;  2JG8 C;  2VXR A;  2W91 A;  1RUN A;  1JHN A;  3VB9 A;  3N7J A;  2JXA A;  3RYR A;  1SZB A;  5F5I A;  1AR7 3;  1HB1 A;  4CP0 A;  4LE3 A;  1EY2 A;  3ORJ A;  3MF6 A;  1SLA A;  1C1F A;  2HWF 1;  3J7N A;  3B5L B;  4M0H A;  1VBC 1;  4D3W A;  4BQW A;  1YUD A;  2GMP A;  1EPZ A;  3POY A;  1Y7B A;  3ILF A;  5T5O A;  2Y26 A;  1JYX A;  3TRS B;  5FUI A;  4CCN A;  1HW5 A;  5K8S A;  2A3W A;  1UOJ A;  1WCU A;  4PLN A;  3VDD C;  1ZZ8 A;  2JDY A;  4AG4 A;  2ZGN A;  2EF6 A; 
#chains in the Genus database with same CATH homology
 1OVS A;  2XR4 A;  1GZT A;  1W8F A;  5D2A A;  2BV4 A;  1W8H A;  2BP6 A;  1UZV A;  2WRA A;  4UT5 A;  2BOI A;  2JDN A;  1OVP A;  3ZDV A;  1OUR A;  1OXC A;  2WR9 A;  1OUS A;  5A6Y A;  5A3O A;  5A6X A;  2JDU A;  4CE8 A;  2JDH A;  2VUD A;  2VNV A;  2CHH A;  1OUX A;  5A6Z A;  5A6Q A;  2JDM A;  2VUC A;  4AOC A;  2JDY A;  1UQX A;  3DCQ A;  5HCH A;  5A70 A;  2JDK A;  2BOJ A;  2JDP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...