2JDKA

Lectin pa-iil of p.aeruginosa complexed with disaccharide derivative
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
114
structure length
114
Chain Sequence
b'ATQGVFTLPANTRFGVTAFANSSGTQTVNVLVNNETAATFSGQSTNNAVIGTQVLNSGSSGKVQVQVSVNGRPSDLVSAQVILTNELNFALVGSEDGTDNDYNDAVVVINWPLG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FUCOSE-BINDING LECTIN PA-IIL
publication title X-Ray Structures and Thermodynamics of the Interaction of Pa-Iil from Pseudomonas Aeruginosa with Disaccharide Derivatives.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Lectin
total genus 20
structure length 114
sequence length 114
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07472 PA-IIL Fucose-binding lectin II (PA-IIL)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.400 Mainly Beta Sandwich Jelly Rolls Calcium-mediated lectin 2jdkA00
3ZDVA 2WRAA 5A6QA 5A70A 2JDUA 4CE8A 2JDPA 1OVPA 1UQXA 2VUCA 2BOIA 4AOCA 1OUSA 2XR4A 2BV4A 5A6YA 5HCHA 2BP6A 5D2AA 1OUXA 1W8HA 2VNVA 1UZVA 1OXCA 2JDKA 1OURA 2JDMA 2WR9A 2CHHA 2JDHA 2JDYA 2BOJA 3DCQA 2JDNA 5A3OA 5A6ZA 1W8FA 4UT5A 5A6XA 1OVSA 2VUDA 1GZTA
chains in the Genus database with same CATH superfamily
4FP3A 2XHNA 4XFIA 3VHOA 4QDQA 1QU0A 2R30A 3B69A 4IUGA 5FY0A 5FZOB 3WF0A 4AE2A 4CP0A 3CJIB 4PLNA 3JBG1 5A3MA 3ZSJA 5IW0A 5HCHA 1XNCA 5LASA 2CNAA 5L19A 3NSTA 1AR71 3ZFGC 1S1AA 4Z2AA 1W8HA 3AZYA 2VNVA 1VRBA 1I5PA 3T2PA 2VZTA 1ULPA 3QLQA 2ZGPA 4XF9A 4LKFA 1HRI2 1V6JA 1YJLA 4YZ5A 4N53C 1AYM2 1ZZ7A 3OGGA 2R49A 5A3WA 3ZFEC 3RDIA 1Z0HA 4LULA 4ONUA 4XIOA 5H9SA 3ZXAC 4NHMA 2GZWA 4R52A 2XWJB 1XB9A 1YQ8A 1POV1 4MXWB 5J09A 4YPJA 3MUZ1 3ME2A 1ASJ2 2QQOA 3ACLA 5GLUA 4E8DA 3NAPB 2VZ1A 1F5FA 1UPIA 4LA2A 4MZUA 5F39A 3H9AA 4CXYA 1ZVFA 1AZDA 3FLRA 5EV7A 3OY8A 2WS91 3IDCB 1XBFA 3C8XA 1XC6A 5C33A 2IXJA 3SH5A 1LECA 4A3ZA 3ALQA 3I3BA 3RZJA 4LITA 3BUCA 3UJQA 5K0UA 5K7PA 2XWBB 4DEVA 3MLKA 5BUVA 3FZ3A 2VMCA 3R05A 1Q8VA 3HT2A 4WVZA 3VKNA 2IVJA 1QOSA 2W2IA 1HJFA 1LKNA 2QDRA 5DXDA 1OOPB 1ND2C 2UY9A 3FL7A 4BPZA 1LCLA 2GMPA 2G4IA 2BV4A 2QQWA 1JYNA 1RUJ3 5FPLA 4BLIA 2JG8C 4P9YA 4PI0A 1Q43A 4Q29A 5SV8A 5AC93 4UAPA 1X9TA 1RVF1 2JKXA 3V65A 3UETA 4Y5TA 5FPXA 1GQPA 4N43B 2WKKA 2ZGLA 4BQ2A 4RS5C 4X6RB 3AYEA 3TWIA 1RUF1 4FTSA 1W9FA 2DURA 2WN2A 1PX4A 4PT6A 4COZA 3LDBA 2VW1A 1LU1A 2R061 4PF5A 4ZU5A 1J3QA 1JZ6A 3IBMA 2BGPA 1COV1 1VBA3 2A7AA 2NZ9A 4LEJA 4KWJA 1KXGA 1IKPA 3CIHA 4V2WA 2I07B 4YM3A 5JI7A 3W9AA 1PO22 1Q8PA 1DYPA 4GH4B 4LUKA 3OD4A 4JV4A 5DUUA 1PIV1 2BQPA 4HL0A 5GLTA 4K9SA 1BK0A 1YIPA 4Q4X1 2OXBA 2VE1A 2YDEA 1LOBA 1O4ZA 1H9WA 1SFYA 3I8TA 2R041 2BP6A 3MI8A 4K1YA 1W6MA 1MZFA 1YI9A 4KNCA 4PLOA 3T09A 3ZXFA 4LJHA 4NPMA 4KMQA 4BHPA 1UZ0A 3MUY1 1TME2 2ZACA 1DLCA 4XBQA 1TE1B 1OH3A 2DU1A 2X05A 1DF0A 3HBZA 3WP3A 2J1VA 3CO2A 5CFCB 1ENSA 2JEMA 3V0AA 3PUIA 2DVFA 2LW8A 1J58A 1YQ5A 3VBUC 5KXCA 1IGOA 2VZVA 1XNKA 3OGSA 1F9KA 1JTZX 1ZNPA 2VOWA 3IDEA 2W1WA 3K3OA 1SMVA 4JAAA 2YBPA 1UU4A 1F5JA 3B01A 4FPOB 4WM7A 4YFWA 2VZPA 5APAA 1WLCA 5BPXA 2VMIA 5FZEA 4MUVA 3H3ZA 5JZGB 3W58A 4DUWA 4NIDA 3MPPG 1QJEA 1ZX5A 3ZFFA 3TEZA 4J6GA 4XW3A 2CDPA 3LWCA 1X36A 5T50A 3MIHA 2A3YA 2GN7A 3FHIB 5DUVA 3HR9A 5CFDB 1S0EA 5CAZA 3VBRC 2JG9B 4AFMA 1V9U1 1UIKA 3MF9A 3RZKA 2ZGUA 1S55A 4FCAA 2ZTNA 5FZFA 3IKWA 3BVCA 4R4ZA 4O9GA 3P5BA 3B9IA 4LO5B 4XIKA 1JZ8A 2CTVA 3IT8A 4YW6A 4LNVA 1W2UA 3I2GA 5FZDA 4PQQA 5FXVA 1LHOA 3AYAA 2KD7A 2W47A 4CDWA 2AGSA 5A3NA 4GD4A 2WNUA 4N9HA 4AVAA 1D7PM 2HWC3 3JBG3 1H9PA 2WZR2 1IKQA 2ATFA 4Q27A 4YM0A 4F7ZA 1W06A 3O1VA 3K51A 4RFRB 3ZX7A 1MS3A 4NWVA 5FMCA 5A3PA 1CZTA 1YHFA 2ZGKA 3ZXEA 1ULOA 1SPPB 1AXYA 2BOIA 3QBQA 4N7UA 3WF2A 4KI5M 1EUUA 3W20A 4QKDA 5JOWA 2PQQA 3IMMA 3NO8A 4AEKA 4HLTA 3VBHB 2GU9A 4ZY9A 1GICA 4YGDA 1LGNA 3LEKA 3MIEA 3VDCA 4CTEA 5FP7A 3O1PA 2YC0A 4EWEA 1K12A 3AMHA 1RMU2 4K8RB 3VL8A 4P9WA 4CEYA 4LBLA 3SH3A 5L9VA 1POV3 1PM7A 4LO4B 3ZYPA 5IJRA 3FJSA 2VU9A 4P00B 4AWDA 4E4ZA 4MV2A 4X8PA 4IQPA 3I3MA 4LBQA 2W92A 4HSLA 5FTTC 2ZGQA 1RUD1 1JU3A 1PVC1 3BPSA 2BFUL 2UURA 4OI0A 2ES3A 3DPRB 3PVOA 4UW4A 4H55A 2FCVA 2GNDA 4Q1PA 5FQ0A 1PO11 3AP4A 3HNBM 1AR91 4IE0A 4E9KA 3RZLA 5I8SA 2SLIA 1Y3TA 3NW4A 3MDPA 5FYCA 2Y38A 1FMD2 3MV01 1H1AA 2VNOA 1UY2A 2UY8A 3I97A 3I59A 3TB0A 4L99A 1LGCA 1UU5A 1D2QA 4DS0A 4JQRA 3AXEA 4I3GA 2HWD3 4AFCA 4LA3A 5FLHA 3OCPA 2P17A 3VBOA 5ACA3 5IK7A 2D6KA 4DMIA 2OW4A 1R64A 2OUJA 2W08A 2FMYA 4W50A 4Y1XA 5IVEA 4K21A 1C1FA 2EIGA 2YGMA 4CXXA 5KHJA 1RVF3 1CIYA 2QBXA 2XL9A 4XILA 4AEMA 3B02A 4Z1VA 4OFGA 3BTZA 4OQ8A 5LBFA 4BU2A 3CJIC 3RVHA 3CZJA 1WW7A 4FAGA 1IPSA 4YZ3A 1HXS3 2ZGOA 1GANA 1OSGA 4PI2A 2WSVA 3ZFGA 1HRI1 2CAUA 3AJZA 3NL1A 5FZBA 2YROA 3T2OA 2ZKLA 1QMJA 3H1WA 5FKCA 1AYM1 1G9DA 3PVNA 4ASMB 3WF1A 1PVXA 1FPN3 3N9MA 2A70A 4YARA 1GWMA 4LKSA 5FZ9A 3S30A 3QH7A 4YW3A 3VKMA 3ZR5A 5A32A 3ZFEA 2D97A 1HQWA 4ZKTB 2DUPA 5KC6A 3ZPOA 2OQ6A 2VUDA 1QY4A 3KB5A 1ASJ1 5AVPA 4A41A 2H0VA 2EXHA 4URAA 5LA2A 5FY9A 1CX4A 3MLJA 5JXIA 3J26N 3WT3A 3JQWA 2TEPA 5I0TA 4RGGA 5A80A 1OUSA 4C8DA 1MZ6A 3NRUA 1T6GC 3N3HA 5C6CA 2DCKA 2VL4A 3KWVA 3NAPC 1LOAA 3PU8A 4YW4A 5IAVA 4AGRA 4DZGA 3AMQA 4XFGA 3M3QA 1DZQA 3V0BB 4KBBA 1O59A 1W9SA 4DOUA 3BN6A 4XFFA 5F8PA 3MIDA 1JHJA 2MNGA 1DYOA 2HEWF 5A3LA 5ABJA 1VB4A 1IS5A 3LEMA 1GYKA 1CWPA 2D6MA 1ND2A 5IFPA 3I2JA 2IUWA 1OOPC 1RUJ2 3USUB 2VUCA 4XJ8A 5BNQA 5ANQA 3AMNA 3ATGA 3N9NA 1BVVA 5FXXA 3GF6A 4QQLA 4JDMA 5D21A 2JG8A 3VDDC 2CY6A 3SKVA 4D69A 1MR5A 4AAXA 4URTA 5F3CA 3TNQA 1CAVA 2CV6A 2V73A 2ADDA 1QJFA 4XE9A 3SMHA 4O65A 2A75A 3HNYM 2C9AA 3QH6A 1CX1A 3AKRA 1PO21 3DYPA 4JX0A 1DP0A 1SBEA 1W8WA 1NLSA 1UOFA 3AP7A 2AEZA 3EO6A 5F6LB 3ELNA 1V0AA 1S0CA 1ZZCA 3WQBA 2WAAA 2NPIA 2Y60A 2KXLA 2ZABA 4QAWA 5B4NA 3I3DA 1SCRA 4GH4C 4LIUA 1WW5A 1VBE3 3WDVA 3WP6A 3CMGA 3U4XA 1TME1 2WFF2 5T3NA 2R1DA 3OPWA 1U0AA 3ZYFA 5BNOB 2ZGSA 4XETA 2RJKA 3ZSMA 1F4HA 3CLPA 1HB1A 2XQRA 1F8VA 4F3JA 2D6PA 4CDXB 2DUQA 2OT7A 5L36A 4U36A 4CPBA 5J48A 1XOYA 4AGVA 1ZREA 4COVA 1JZ5A 1XE7A 2WJSA 1HQLA 3VBUA 1E5HA 1CZVA 2GC1A 1DQ5A 1DGRN 2D98A 1OVPA 2K2SA 1K5JA 1UD1A 2VZRA 3D5OA 1D2SA 3FN9A 4XDOA 4D0QA 2PHWA 2O14A 2W52A 2ZX4A 3WP5A 3ZN6B 1BZWA 2DCTA 4BQ4A 2DVBA 3WR0A 4LK6A 4MOAA 1LAJA 3WDTA 1HN1A 2WO1A 3KCYA 3MPBA 5JZGC 2VCBA 1UW8A 4C1WA 1NE4A 2FCTA 1PVC3 2AUYA 4JGYB 5C4WB 3WW3A 1EP0A 2WZPP 4Q0UA 3KD4A 1ST8A 2ID4A 4PCRA 4KGGA 3LF7A 3O1TA 3SCHA 2YFZA 2ZBJA 1XYNA 2D6NA 3WUCA 1HB4A 5HXMA 2DFBA 2JG9C 1UYPA 2VZSA 3D6EA 5CKQA 5FBJA 3VD7A 2AR6A 3HNMA 3FMGA 1LU2A 3I7DA 4AG4A 1MQTB 3L9JT 1GOHA 2P4EA 5KC5A 1WMEA 3LDKA 2IZWA 1GMMA 2WZR1 3PDQA 4E4DX 5C3PA 3MW4A 2CYFA 4N9IA 1SQ4A 2AACA 2E51A 2HWC2 5FIXA 5A33A 4CDQA 4AI3A 1W6NB 2IXKA 1VAKA 3O12A 1UKGA 4PLMA 3D0SA 4OCTA 5C3SA 3LEGA 4N53B 3VKLA 1L7LA 2K0GA 4W4ZA 1HRI3 2H0BA 2Y26A 4H2AA 2F4LA 2PAKA 1J3RA 4WVMB 2XJTA 3AP9A 4OZXA 3T3YA 5HV4A 3H1MA 3D82A 3LIHA 4NWWA 2VBPA 2HYXA 5DPNA 5EQUA 4YW2A 5LA0A 3B93A 2J1UA 1NT0A 2RJLA 4Y4RA 1GNHA 3ZMNA 1RMU1 4R4XA 3GYDA 4CYDA 4QX3A 3OUJA 3B5LB 1W0OA 2C26A 4LLOA 4CUBA 1LOEA 2HBUA 1SDWA 2WA4A 2ZXQA 3LFMA 4GMP0 4OUMA 4AI2A 4COUA 5FJKA 5C8WA 5F1RA 4XURA 5BNNB 3VZKA 1QOTA 2VMDA 4FPEA 1D4VB 4LBJA 1W28A 1RUE2 2WO3A 2BERA 4LHLA 4Q8LA 1NA1A 2FDFA 5C70A 1YFUA 2NLRA 5A7SA 2LTNA 1PMJX 1GZTA 3A0NA 3DYOA 1JYWA 4C1XA 1OI6A 1FYUA 1TVGA 5GLZA 1HQNA 1JZ2A 2DBIA 2JE7A 3ACFA 1FMD1 2ORXA 5ISLA 1V6LA 4N7IA 1YO8A 4FXGB 4HKLA 4QGLA 4BB3A 4CCNA 4BQ3A 1DG6A 4MGYE 1ACCA 4GWNA 3VBFC 3WG3A 2YMZA 5D2AA 2VMEA 1W6QA 1CAUA 1W8ZA 2JKBA 1IQDC 3EYPA 3WLUA 3MO4A 2HWD2 2ZX1A 4FPGA 4MO3M 2R16A 5I91A 3AB0A 4RS5B 1VR3A 2WABA 5ACA2 1WUVA 1JZ4A 4AFAA 5EXOA 1M4WA 5F6KA 4L9BA 1W04A 3MIFA 3RSJA 5KHHA 3RNSA 2XVGA 4TLFA 5I0SA 5FLIA 4AEDB 1GLHA 1SBDA 3JXSA 4H7MA 3ST7A 1HXS2 2ZKNA 1OBNA 5FZOA 3TNPB 2W1SA 2D6OX 3KMHA 3AMPA 3CJIA 4M3CF 4W6YA 4YVSB 2XH6A 4BMBA 1NZIA 2ZS6B 3S0MA 1PO23 3GCWA 3ZR6A 4K20A 4R9DA 1CJDA 2BRTA 2YZ4A 1RC6A 2I2SA 2QCSB 1UXZA 4MGKE 4SLIA 5JOZA 1NCQC 1J83A 1YXWA 1WW4A 1FPN2 3ZYRA 4XHXA 5M0TA 4GXLA 1IG0A 3I3EA 4B1MA 2VTXJ 1AUYA 2A71A 4WZCA 3Q8FA 5A3TA 2QQJA 1XPWA 5HI0A 1PNFA 3NJYA 1F35A 2D6LX 2Z2SB 3O14A 1ZYBA 4K3UA 2ARXA 3K4ZA 5KXBA 4AVVA 5C9AC 2PAMA 3INAA 4O61A 4KU7A 1W0NA 3NNLA 4MXWA 4OHXA 3SC7X 4UFJA 1NXMA 2BTVC 1WKYA 3NAPA 3C7FA 1UX6A 1UKRA 1OFNA 2VW2A 1AL0G 4M3CB 1LGBA 2F4PA 2VQTA 3KT4A 2FQPA 1OLRA 2D40A 1V00A 4BM8A 1QNWA 5JLVA 1V6KA 2J1AA 1RUOA 2MEV2 4AYUA 5K9YA 1TQ5A 4AF9A 4RL7A 1MS1A 1AL23 1BCXA 1RUJ1 2CWSA 2XONA 4HKWA 4OMCA 4Q2FA 4D7TA 4YLZA 1UOGA 1ZM1A 3ZN4A 2OS2A 1W6OB 3C7EA 1Z7S2 3O0VA 1A6CA 1H4GA 2Z5WA 5FPBA 3U07A 1OOPA 2ZX2A 1QXRA 1S4CA 1QH6A 2DF7A 3VBRB 1CD3G 2DCZA 2VTFA 3BOWA 4A7YA 4YVWB 4KL1A 4M4PA 4OI1A 1JOJA 2P3JA 3MLLA 2G9GA 1FATA 4NUBA 4UW3A 4W6WA 1XYPA 1IHMA 2SBAA 2ZHNA 5KHKA 2R0HA 3LD8A 4ZXEA 1JYVA 5HV0A 2VNRA 1WCSA 2WN3A 3NVCA 2JD9A 1Z78A 3H1YA 4BQ5A 1NCRB 2C0ZA 3IZOA 1O4YA 1PK6B 4N43A 4F83A 3B94A 4DQAA 4IEVA 2J1SA 2DDUA 2WQ8A 5DUXA 3PTRB 4IDZA 1OFSA 2Y34A 5FAXA 2RE9A 5FYTA 2WFF1 4X6QB 3ZDVA 3VB9A 3N9LA 2DWRA 2WZR3 3WDWA 3VKFC 3WNNA 4COWA 1VBE2 2B42B 2EICA 4GH4A 4XUOA 3NNFA 4XBLA 5EHDA 3OOXA 4RSUA 1R093 4XDQA 3D3AA 1W8OA 4Q0QA 1RUH2 4Q4Y2 3T0AA 3ZXKA 1UZYA 2YPJA 3KGZA 2AYHA 2Q1MA 1OA4A 1W2TA 2YPDA 2ZA9A 5T55A 4DRRA 3UGHA 2ERFA 2QNKA 4EE2A 1N1YA 3B00A 1QHDA 1VMFA 2VOVA 3VV1A 3VD9A 1VLNA 1LHNA 3S5QA 5EPAA 1SLBA 3N4MA 2ET1A 4GQ7A 4CDXC 3RZMA 1HIXA 5IYYA 5A6XA 5CFCA 2ZPXA 3KT7A 2BPA2 1QDCA 3HQRA 2A6VA 3FWEA 3T4VA 4AFBA 2JJ6A 3RJ2X 3I3QA 3WOGA 4CXWA 1QJY3 4EV0A 4N8MA 4F8AA 3ACGA 5L7OB 1NG0A 5F2SA 4FAHA 5A1LA 3RZZA 4BCUA 1JS9A 5JZGA 5DMYA 3H8XA 1H2MA 2PHFA 4XXPA 2WC2A 2JDMA 1BKZA 2K9ZA 1UO9A 5E6HA 5FZMA 4FP2A 5B4XA 2QQLA 2W9XA 3WD5A 4DNYA 3ROUA 5DN2A 3ACHA 1GOGA 2X5IB 1MS5A 2XUMA 4MADA 1WLDA 5T5LA 3RGBA 4D3WA 1M06G 4AR2A 1KQRA 1OF3A 3M1HA 3PNAA 5CFDA 4YG3A 5LBEA 3OUIA 2JDPA 2XLFA 1YRZA 2A6WA 2JG9A 3HBKA 2HWC1 5BNPB 1QIQA 2WZ8A 3THCA 1O5UA 3E5XA 2XVLA 4I0BA 5I93A 1MQTC 1UN1A 4AI8A 1CJPA 1E5RA 3LSDA 3ORJA 2YFUA 4IE7A 3ZIWA 1SHWB 3WF4A 5IHRA 1CESA 5J36A 4IEUA 1O3QA 4M01A 1OXCA 2Q8OA 2CL2A 3T1LA 3ITQA 1XRUA 4Q0VA 3PJQA 3MYXA 5IK8A 2E7AA 4OHYA 4MGQA 2FBEA 1SLIA 3T2TA 4UT5A 1I1EA 3OSDA 4GALA 2JX9A 5C3QA 4IEPA 1U5YA 2VQUA 4ATEA 1AJKA 3FE5A 3ZLIA 1ODMA 3E6BA 4IGPA 3UESA 5JOXA 4LT5A 1SPPA 1QJU3 2PFWA 4BK5A 2VR4A 1JYXA 1UMHA 5EJ1B 5A3UA 4WV8A 1JBCA 2Q0AA 3PVEA 4XABA 4D94A 1RUE1 1KRIA 1LENA 2XDVA 1BLZA 1O6UA 2IXIA 1V70A 4JHTA 3VBHA 4QPGA 3EQEA 4E2QA 4DRVA 1XE8A 3AM2A 3GDBA 4RA0A 2FZ2A 1UCXA 3O1UA 2HEYF 1OURA 3H42B 5IVCA 5BNNC 5C3RA 1ZA4A 4LIVA 1DQ0A 2VBDA 4MHRA 4UFHA 1LODA 3I4IA 1NOVA 3F2ZA 2GP3A 4NHYA 4FI9A 5I0DA 2VJXA 4I30A 4UXAA 5F5CA 1X33A 1SBFA 1GP4A 1LOGA 3N9QA 5LY1A 1X8EA 3RRDA 3VZJA 1IOAA 2VY0A 5FKBA 5J1XA 3DPRA 1ZRIA 2DCJA 2HWD1 2JB4A 4LBNA 5JSOA 2QE3A 1W2OA 3EBRA 3J7LA 4IV3B 5ACA1 2WT2A 3BPZA 3RQ0A 1B35B 1YI7A 1RITA 3LPGA 3NV2A 1AR63 1GQGA 3VDDB 1Q8OA 2EAKA 4I02A 2I45A 1AX2A 2ZHKA 1OUXA 2C24A 3JZVA 5DG1A 5LY2A 3UL2A 1OLMA 1UZVA 1KGYA 3THTA 1K5MC 1AF9A 2OPWA 4JRAA 4NVPA 1H6XA 3M3IA 3GBFA 1HXS1 1HLCA 1F15A 2VMGA 3B3QE 3H0OA 3HVDA 4KWKA 1OT5A 1RL3A 1TMF3 4WZFA 4QU2A 3LEIA 1LOFC 2ZHLA 4UWDA 3MEPA 3P1IA 3ABZA 2P3YA 1OKOA 5F5IA 2NP0A 4Y1ZA 2RS13 1BVP1 1RHI3 3WSOA 4AEDC 4CU8A 4PIZA 1VMJA 2B7YA 3AVSA 2VECA 3USSA 3JB4C 1X82A 4NRPA 1FPN1 3IN9A 4IEQA 4YVSC 4IL7A 4XTMA 4Y5SA 2HWE3 1W9YA 3CEWA 5F7UA 4Q8KA 4HVOA 3WNKA 1YLLA 3ETQA 2E32A 2VNGA 5DDJ3 2WQZC 3V64A 2VM9A 4ITCA 2WFF3 4I3PA 4LBMA 3AMMA 1GP5A 3C7OA 4KBZA 3W5MA 2N7GA 1IPJA 4IV1C 3VZOA 3KHCA 3J7HA 1K45A 2QZ2A 5GM0A 3DKWA 3IB3A 4PIXA 2JDNA 4QKNA 5F3IA 1AYN3 1C28A 4I0AA 1D0HA 1GU3A 2W1UA 3UGGA 4AEJA 2A73B 4QD2A 3FUQA 5IVBA 1OMIA 5HXVA 3WQ7A 5CU1A 4M4RA 1VIWB 2VZQA 1OD3A 4XUTA 4IEYA 2XVKA 1STMA 2JDAA 5FY8A 5L9RA 4HMZA 2MEV1 3O1MA 3MICA 3DECA 1MS9A 1NYWA 1SLCA 1NKGA 3I2FA 2WLPA 1UXXX 3T30A 1BBT3 1EPWA 1AL22 1DU3D 1Z7S1 1EY2A 2LROA 4Y33A 1HN0A 3V0BA 2V5YA 3NKGA 4YZ2A 4QGNA 2BYVE 1BHGA 1I5ZA 3IAPA 1V6NA 1GZWB 4CDUB 4BIFA 2W39A 3T0BA 3RYRA 2DUOA 3ASIA 4WM8B 5BYNA 3PUHA 4XFBA 4ZXKA 5DZEA 5IWFA 1ULEA 5A7WB 4CP9B 5JXJA 2V72A 4YVWC 2DVDA 4O7XA 4XJAA 4KG8A 5JVVA 3ACIA 4Z07A 2AZ5A 2H6CA 1GZ9A 3ZM8A 1HKDA 4PIYA 2WA3A 5EP9A 3ZPYA 1JW6A 3RJRA 1XNDA 4JHZA 4CUCA 1NCRC 1VBE1 1PK6C 2A3WA 4Q4V2 5CADA 5C8CB 1H2NA 1HRV3 4NPLA 2Q8CA 2WQ4A 2P37A 3FC0A 3KF3A 1NLQA 1RUH1 2PLV3 4CCMA 2XBO3 3EHKA 4FT8A 1H1IA 1G9AA 1R092 4AI9A 1AX1A 2PAEA 4FFIA 4AFDA 2VCCA 3GCXA 5H9QA 1ZRRA 4CUGA 1W6PB 2ZGNA 3N7MA 4GJZA 3CHXA 5JIAA 2OYZA 2ILMA 4QKBA 2BFUS 2DBNA 2Q4SA 5BNOA 3C7HA 5FK7A 3ETPA 3P3NA 2RHPA 2Y6JA 1DFQA 4OHVA 3U1XA 3LFIA 3CDZB 2R1BA 5E1RA 5K8SA 2AENA 3N7JA 1FV2A 2PQSA 1MACA 2IFRA 3DN7A 4FQ4A 3HPNA 1CZSA 4LBQD 1PGSA 2ZEYA 2JXAA 3A23A 3OUHA 1RUE3 2WRAA 2LUWA 3U0ZA 4NR1A 3AKTA 1UY0A 2BNOA 1RJ7A 4FQZA 1QJY2 3UKNA 2YY1A 1CAWB 1F2NA 5JR7B 1WBFA 2XB6C 2YU1A 3K48A 4EWAA 1ZZ8A 3W59A 2WNEA 3VBFB 3ZN6A 4BQXA 5F9TA 4QHBA 4EROA 3NV1A 1WW6A 4CCLA 3MW2A 3LSEA 5L7OC 4FVVA 2ZAAA 1CVNA 4MH0E 4FPLA 2Q8DA 3ZDSA 3ZKUA 2A6ZA 4ASKA 3RI8A 4B3NA 4LBKA 1Y9MA 3OGRA 2CGOA 4JGYA 2D7FA 2E53A 5FMOL 1HX6A 5C4WA 4XUNA 3RMYA 4QXHA 1ZZ9A 3PLQA 4XUPA 2X5IC 5FRAA 3AZVA 5FY4A 3T1MA 4AHZA 1UWWA 5JMCA 3ZYGA 4Q0SA 5LRSA 2E63A 4D8MA 1DDLA 1T6BX 4AVSA 4BDVB 1GWLA 4G3YC 1OQ1A 4XOGA 2W87A 5K4LA 5BNPC 4XQWA 5FZHA 3IIAA 1JI6A 1MQTA 3NQHA 4UI9L 3UYJA 5GJ6A 4BXFA 2FCUA 5FXWA 3POIA 2D43A 4E8CA 1GV9A 1NCQB 4XHBA 1DQ2A 3TEXA 2OKXA 4KH9A 4YFZA 4Y26A 1W6NA 2C9KA 1H2KA 4YG6A 4DXTA 3WCSA 1MPXA 3M7AA 4LE4A 4N53A 1O3RA 4BK4A 1YJKA 4HPKB 2FHRA 4BWOA 4YW7A 3GZUC 3WEZA 3ILRA 3DKQA 4WVMA 1QJU2 5C9AB 1WMXA 4E4HA 2Y64A 5EFUA 4Y1VA 3PVBB 4LO8A 2W94A 3ILNA 5F32A 4LPLA 1CAXB 2EA7A 4HETA 3H8OA 1FX5A 5FZKA 3I49A 2V4AA 2CWMA 3VZLA 5E88A 2HLEA 3E6DA 4TWTA 1OPOA 2P2KA 3IDBB 1WA4A 4DPNA 2XL7A 2HWF3 4TSVA 4LKDA 2B45X 2ARAA 2VPVA 5BNNA 5LW9A 4OHWA 2ZJCA 4TXWA 4UOJA 4XJ9A 1JYTA 2MEV3 4GWIA 4E2GA 1JZ7A 2G19A 4HVQA 2YV8A 3ECQA 3ON7A 4IEOA 4RR3B 4SBVA 2EIBA 2YXSA 4YRDA 3O1RA 3LIGA 4E2SA 1JZ3A 3RWNA 1Z7S3 3ENRA 1AR62 1O5LA 2P1BA 2E31A 4KQ7A 5T5PA 4IV3C 3Q9OA 1ZRFA 1HJGA 3KZ4C 1B35C 4XPVA 2R0FA 1W3XA 2Q30A 3KM5A 5LA9A 3QOPA 4CZSA 2VO5A 3HEIA 1TMF2 2JB8A 2XLGA 3NV3A 4FOQA 4PBOA 4RS5A 4P08A 1AXZA 5FK8A 3MFCA 1ALYA 1QNYA 2CAVA 1ENRA 4XXAA 1UZWA 1RHI2 2RS12 4QX2A 2BVBA 2DTWA 1AXKA 1WGPA 2OA2A 3DL3A 4IEWA 2VOKA 2YBKA 5FLJA 5FPVA 4W6XA 4ZPIA 1UYZA 3TYJA 1HDKA 1SLAA 4AEDA 3LA3A 1XSRA 4D7SA 2HWE2 1WMFA 1E5SA 4YVSA 2J1TA 1LHUA 3PUAA 4A7KA 1PNGA 1SG3A 1WWYA 5DDJ2 4A3XA 5FYZA 2RR13 2VW0A 3I2KA 1YFXA 4ASLA 5GZDA 1VB2A 4J1XA 4EJRA 1WCUA 4WVWA 4YNIA 2WIIB 1RUH3 4Q4Y3 5IFTA 2WWJA 2XJVA 3W21A 1H8TC 2Y6HA 3EJKA 1RUI3 4LR4A 2WNUB 4LXLA 4IE6A 5JPNB 1GFF2 4CPBD 1AYN2 1R1ZA 5DUWA 3BI3A 2KA3A 5FP4A 5A7NA 2BU9A 1BQPA 1RUG3 2JIJA 3KQRA 1VBD3 3AL6A 2LM3A 4IETA 5D8AB 2QDNA 2VBBA 3M8LA 3S7EA 3WCRA 4ARYA 3JB8A 4FOVA 5FYVA 1X50A 4BZ4A 1RUNA 2O8OA 5I0RA 1RGSA 4GMP1 3ZYBA 3LA7A 3M2MA 3PU3A 2WO2A 1UMZA 3PMSA 1AL21 1UY3A 3U11A 5A6YA 1KDMA 4LHKA 1VAMA 1BBT2 3E1F1 4QX1A 4M3CA 1BYHA 4GKYA 2OPKA 1C3HA 1ENXA 3AKSA 1YNAA 1IPKA 2RG4A 4NPRA 4XEZA 4HT1T 4X8NA 4Z8BA 4XVHA 4LHNA 4EN7B 4ISRA 2ZOEB 4CDUC 3J8F3 1W6OA 2WFPA 2PN5A 4GKXA 2XJQA 1A78A 1VBB2 5A70A 1OLQA 4WM8C 2P5BA 2W68A 2GN3A 2YUEA 3VBRA 4GWJA 1H1MA 3RYKA 1DZTA 1O91A 5GLWA 4YVWA 5FYMA 1TEIA 2BWAA 2DFCA 4CCKA 1JU4A 4DIQA 4Q4V1 2A6YA 3VBSC 4YGBA 2E33A 1DQ4A 4AHWA 4Y22B 1UIJA 4QXBA 1Y9QA 1K42A 1UZZA 3WQ1A 3ZKYA 2VTXA 1NCRA 1CPNA 1HRV2 1PK6A 2CGNA 4QGMA 4XMAA 1R091 1SCSA 3TBDA 3IIIA 5LZ6A 1Q56A 4OI2A 1XNTA 2PLV2 1G8WA 3B7MA 2XBO2 4K8FA 4LTAA 5CB7A 4FFFA 5A7QA 5C8CC 4Z92B 4FBFA 1BEV2 3R4UA 3SEEA 3AKPA 2VXRA 4QDRA 1UY4A 1RXFA 3KHBA 3GXUA 4LKEA 3WVJA 3ZMOA 5DAVA 4EQVA 5C71A 5IVVA 1J1LA 2RS53 4J1WA 3UGFA 3PMEA 3AZZA 1CQ9A 3PIGA 2HEVF 2A6XA 4CCJA 4MG2A 2C1FA 3K4DA 3ZYIB 3WP4A 2IXLA 1URXA 3OEBA 4MHUA 5FYYA 2W0XA 2QFEA 4H14A 4GULA 1GBGA 1W9TA 4OVEA 1QJY1 3ZO0B 3TAYA 1F31A 3POBA 2P6CA 2EXJA 3LPFA 4FPKA 4I0WB 4AQSA 5C5TA 1A34A 2EALA 4FTEA 3HMYA 2LRPA 3P3PA 4OZOA 1YQCA 3MGUA 1ULFA 1C1LA 3N9PA 4JRLA 4R9CA 4BQ1A 4CA9A 1X8MA 3OJBA 2QQUA 3KV4A 2XOMA 1KDKA 3AYDA 2VCMA 5CNAA 5ERLA 4P5YA 5L7OA 1VJ2A 4UF0B 2G1MA 2JENA 3WXPA 2BBVA 1HW5A 1O4TA 1Q8QA 3IPVB 5FY5A 5J96B 1UYXA 2Q5TA 2XQXA 3Q8AA 1K5MB 4QDSA 4QPWA 4QHOA 4CP9A 4K40A 2YB7A 1REEA 3AC0A 5FR3A 4QMAA 2PHUA 2VQ0A 1G7YA 3VHRA 2X5IA 3VL9A 4TTGA 3WHTA 4B29A 2E7QA 3ZXDA 3W5NA 4XAEA 5E89A 3KF5A 4NAOA 1OPMA 1HV1A 4Y3OA 4I01A 3H7YA 4NIAA 5C7GA 4ZS3A 2Q1FA 1W9WA 2QQPA 1IS3A 4B7KA 4J25A 5BNPA 4PDWB 1QH7A 3SXWA 3BODA 4XACA 3VDAA 2D5FA 3N36A 3WZ1A 4L0PA 3AP5A 2MPFA 2BGOA 5FP3A 1R1A2 4UYBA 3HQUA 1U12A 3VD3A 5IT6A 4JKLA 1GKBA 1WCDJ 4XAAA 1H4HA 1JUHA 1QJU1 1W39A 3LAGA 4IV1B 3CBNA 1XE0A 3VKOA 5F37A 2B39A 1YIFA 5A3OA 1H30A 5DG2A 5FP8A 1I9RA 5FCCA 5FFOC 2DVAA 3WNPA 1OH4A 2BNMA 2RMU2 1UX7A 3RPQA 3OG2A 4GB33 4JGZB 3AXDA 3JUUA 3OBTA 4C0BA 3U75A 1N1TA 2YC4A 5DAPA 2B5HA 3POYA 5FP9A 4JVAA 3FLPA 4QX8A 3E5QA 4YGCA 3FUOA 2HWF2 5FUPA 2R073 2V5DA 2OZ6A 3VHNA 3PIJA 4GMP3 3ES1A 3TEWA 2VULA 1W8TA 2VH9A 3TN92 2OVUA 1QOOA 1WZXA 3LZZA 1J84A 1AJOA 1AR61 2HKXA 3U78A 4L2NA 4CEWB 4YG0A 1MS4A 3T0DA 4XF3A 2GC3A 5E8AA 1DBNA 4CU6A 2AEYA 1KJLA 5KHIA 1JOBA 3AYCA 3HWJA 4RR3C 1MS8A 4ZZ5A 3OF1A 1QQP3 3POSA 2BGCA 4FOWA 4N90A 4XMIA 4OQ9A 3N9OA 1TMF1 4Z82A 2ZEZA 1WD3A 4IV3A 1DQ1A 4P9GA 4MYEA 1KFUL 1MEC3 4WM7C 5CA6A 3VDDA 3H7JA 4YW1A 3QCWA 2YBSA 2AREA 1RHI1 2RS11 1VBC3 1BJQA 3A0KA 3L2YA 3S6PA 3RWKX 4DFSA 3VZMA 5FMDA 4EN9B 4CCOA 5IAXA 1MVEA 3K3NA 4ZU7A 1A3KA 2HWE1 4IEXA 4YZ4A 2VXJA 3KSCA 3NNJA 3KS7A 2VC9A 4IERA 1W8FA 2JICA 3THDA 4BISA 1FV3A 4U2AA 5EIYB 2ZMKA 3KLSA 1UL9A 5DDJ1 3MV11 2XJRA 1OLME 4YWAA 4Q4V3 2E6VA 5FO7B 3SISA 3A4UA 1MS0A 1F4AA 3RYPA 2CU5A 4GIQA 2RR12 1RB8G 5EWSA 3ZSKA 5BXXA 5LWBA 5FYHA 1AYN1 4P9JA 1FXZA 4NIHA 3EXUA 4NOTA 4LO6B 1RUI2 2HBTA 2ARBA 3HN3A 3KVBA 3NV4A 1S0IA 1FNZA 1NAEA 5JPMB 3VDBA 1RUG2 4XDPA 1PX3A 1VBD2 2WNUC 1W8NA 1WCKA 4FOYA 4MXVA 3SH4A 5CG8A 1C8M3 4YW5A 1P8JA 5FY7A 2VZOA 2HWB3 5D8AC 1S2BA 4FPYA 1ZBE3 3D8CA 4BH9A 4UBHA 1BXHA 1BBT1 2WNVB 4LMFA 3AZWA 1YYNA 3BKZA 3PTYA 2BZDA 4JZRA 4RQPB 1U5ZA 5BY5A 3LCPA 2Y6FA 3ZIXA 2J1EA 1QEXA 2ZZJA 2ZX0A 1NZCA 2Z4FA 5IVJA 4QQOA 4HK9A 4P14A 1FAYA 1OKQA 3WNXA 2QQKA 3K75B 2NMNA 3AP6A 2WBKA 3OBRA 4S2FA 1N1SA 3X29B 2RJ2A 2WSUA 1VBB1 3J8F2 1NA1B 1QJX3 2BOJA 1GZWA 2P6HA 4CDUA 5FZ1A 5TSWA 4I2OA 5FZGA 4DB5A 1OHFA 3CKHA 4QXCA 3M3CA 1LR5A 2XUEA 1V6OA 3BIEA 2YG0A 4AQ6A 1XQNA 4NE9A 5A7WA 1AVBA 2E26A 2Y0OA 1KS4A 4OUEA 4XJUA 1EPZA 1HRV1 1B09A 1US3A 1W8UA 2E9QA 2PMWB 4XQDA 5E16A 3MIGA 5GZFA 1JODA 1W6QB 4IGQA 2IC1A 3FHAA 4Y20B 2PLV1 3URFA 4BLJA 2XBO1 1H0BA 1OQDA 3OTFA 3THPA 4QWNA 1BEV1 3N7LA 4FPHA 2WR9A 1IZ3A 1RUC2 2VCAA 3KGLA 1PGL2 3OBZA 5C8CA 4Q4W3 3S7IA 3WX5A 1UOBA 5A6QA 2RS52 4OULA 3LA2A 4B4PA 4W8JA 1GQHA 3RZGA 1UQXA 3WG4A 2GC0A 1OC1A 4JKKA 1W6PA 5EJZB 2W1QA 4DXSA 2EAAA 1RXGA 3JU9A 4FFHA 5A7OA 3KQ4B 2V4VA 3DF0A 1TNFA 4MGZE 2BNNA 3A21A 4CCEA 1QF3A 1L3JA 2Y6KA 2LS6A 2JWPA 2VZUA 3CL1A 3WDXA 3LB9A 4Y24A 5F5QA 4MX3A 4B4QA 2BBAA 1UPSA 2W46A 4NJ4A 4XJZA 2OQ7A 3I54A 4JTNA 1V6IA 4DUVA 2JDYA 1L7RA 3DCQA 4QKFA 5AFEA 3ZXGA 4AL9A 5L73A 1U5IA 1KD7A 1W05A 3NNMA 4PBPA 5FO9B 4W65A 1UAIA 2WLQA 3KCCA 5T54A 4AZZA 1CAWA 1YUDA 5T5OA 2JIGA 2WUHA 3VBFA 2FDJA 2VD7A 2QQMA 4ES8A 1VRH3 5H9RA 1LTEA 4NRMA 4CSWA 3S57A 3BTYA 3UJOA 1DZRA 3OEAA 4E4SA 5A1FA 3E5UA 2RM23 2F6BA 2XKOA 1EV13 1APNA 1H8VA 2QTWB 3ZSEA 3VN4A 2XGXA 5FZIA 4QB2A 4XQ4A 5BV6A 1I3HA 5ABJC 3RZHA 4FXKB 3E97A 1D4M3 5CVRA 1N47A 2PHTA 4KGQA 4XF1A 4S2DA 1IQAA 4WBBA 4B1LA 3FBYA 4HONA 4QM8A 4QQPA 4RN5A 3SHRA 4L92A 1R1A1 4DXRA 1KS5A 1H6YA 3N7KA 1O8PA 4PDWC 2VMFA 1JYCA 2O0OA 4ES9A 5IATA 2ZZQA 4M0HA 5F2WA 1SDDB 3BCWA 4ZONA 1NCQA 5T52A 4A44A 2FDIA 3AFKA 1H8TB 2RMU1 5T5JA 4A6SA 5EYXA 2KM2A 2ETEA 1MVQA 4QPIB 1R083 1JOPA 5EJ3A 2VVFA 3HIFA 2VQAA 3J9SA 1FI2A 3PUSA 1GOFA 2ADEA 4GB32 4Y5Z0 3GGLA 4HPKA 1YFYA 5GZGA 4FPJA 1YEWA 1H2LA 2HWF1 2ZEXA 4JGZC 1LEMA 1X7NA 1AR82 1ZZ6A 1MZEA 3OYWB 1W2NA 4RYDA 4AGGA 4C91A 5C9AA 5FYSA 2G9FA 1OA3A 4Y4YA 2QQIA 4IGOA 5F5AA 5FMBA 1A8DA 1CAXA 4INDA 2R072 2XJSA 3LGRA 3APBA 3TN91 1NUKA 3OGJA 2A1XA 2J42A 3RMXA 3WW4A 5J3UA 1LRHA 3D4KA 3GZEA 4FPFA 3N35A 4ORFA 4HANA 1EAH3 1ND3B 1WLTA 3NJZA 3POJA 3O0XA 4AQTA 1POV0 3UKVA 1ZBA3 3U10A 2AH2A 4Z2WA 5AVAA 1TZOA 3GJAA 4HVRA 3F95A 1JXNA 2X53S 5ANNA 1KEXA 3AX4A 4CEWC 1O3TA 1QQP2 5DABA 3MW3A 5SV5A 3WQ0A 4RR3A 1TG7A 4Q1RA 2ZX3A 5LA1A 5LATA 1MEC2 4NAMA 1LJ7A 4ATFA 1BK1A 1VBB3 4GWMA 3I2HA 3USUA 4CU7A 1G9FA 1VBC2 2GNMA 4XJWA 3VBSB 3WUDA 1ULDA 2NQYA 4FPCA 5HBAA 2PTMA 5LK5A 2JE9A 3FX3A 5FZ6A 3ZYHA 4XTPA 1FT9A 3GNEA 1N1VA 2V09A 1FOD3 1G86A 4P9IA 3U14A 1HB3A 2O8QA 3VHPA 1NQJA 2HH9A 1QXJA 2FZ1A 2BJSA 2RR11 3PJYA 1ONAA 1JN2P 1SACA 1W99A 5LK7B 3BYWA 3JD72 1Y43B 3BIWE 4HXCA 4IW3A 2D3SA 4RHV2 5FOJB 5CG9A 4Q4Y1 4MVTA 1T2XA 3M3EA 1RUI1 3NNGA 1UNBA 2OX0A 1BEV3 5DQ0A 4RGAA 3DYMA 3MIBA 3TRSB 4PQ9A 3DXTA 1REFA 1RUG1 3MHZA 1WMDA 2DU0A 1VBD1 2JECA 2P3KA 2YYOA 1POQA 4R9AA 2FD8A 4ISQA 4L97A 4NHXA 5JR2A 5FYUA 1BMV2 5FREA 3MZHA 4CDQC 1C8M2 2HJIA 2ZGMA 1W0PA 2RS32 2WT1A 3T4HB 3VZNA 2HWB2 5H9PA 2JDHA 2GSYA 1ZBE2 3M70A 4DEQA 4JDOA 4CDXA 5IVYA 1AR73 5D8AA 4AAPA 4YYOA 5FMOS 3H8RA 3P6BA 3KV6A 2WNVC 3LOIA 4RQPC 2WYFA 4M00A 5AFBA 2ZAHA 2D5HA 1DYKA 5D1IA 1LHVA 4IESA 1GZCA 2ET7A 3HN1A 3J8F1 4NRQA 4Y1UA 4A4AA 5LCWL 3HD8B 2YU2A 4QPGB 4UBGA 3OY8B 1YWKA 2EIEA 4A45A 4BYYA 2PHRA 3IDAA 1E57A 3TEYA 2BUKA 1QGLA 3R4SA 3IAQA 1QJX2 5F3GA 3AK0A 3NMBA 1VAVA 4LQRA 1S2EA 1FNYA 1NA1C 4XYXA 5K0UB 5A7PA 5JDBA 2DTYA 3AFGA 4HBNA 4M3CE 4META 3QACA 5CIRA 4A7ZA 4ARXA 2XLAA 3MF6A 3ZSLA 3DEMA 2WS93 5CEHA 4KWUA 3I2IA 4E27A 4DUXA 3LQCA 3I2DA 2PELA 3PL0A 3ES4A 1EYBA 4AW7A 2NN8A 4FTBA 1RUC1 3K2OA 3JQXA 1RTVA 1PGL1 4XBNA 5LEJA 2GNTA 4Y22A 2VG9A 3ZN5A 5KBFA 1G9CA 1DIWA 2VGDA 5FZLA 2ZMNA 1ZA7A 4ET7A 1N3OA 2RS51 4Q4W2 4Q26A 1S2KA 3CNAA 5FYIA 1R1A3 2X29A 5G05L 4HZFA 5DZGA 1JHNA 2Y6GA 1C5HA 2C4XA 4R9BA 1PMHX 3BTXA 3FFZA 1J59A 2IVIB 2XMLA 1I6XA 4LBOA 2FDKA 3GHMA 1Y4WA 3U4SA 1W2AX 2J7MA 3WINE 4AVBA 2EF6A 2OZJA 2ZEWA 2GC2A 1X9PA 2RMU3 4TN7A 3RS6A 2A5ZA 4BA6A 1RUF3 3BU7A 3S5AA 3LOBA 5FV3A 5HCBA 1WCQA 3NJXA 2R063 1GP6A 1W6MB 1COV3 3CZUA 5FZCA 4C0HA 4OYUA 3O5SA 1SLLA 2DVGA 3SQOA 1DHKB 2PHLA 2VVDA 4XZUG 1JMUB 3B9CA 1PIV3 3LKJA 4QX0A 4XF0A 5I0UA 5GALA 3H8UA 3TOJA 2XKPA 3J7MA 1PZ9A 3L2HA 4Q4X3 2YHJA 1U5XA 4QPYA 4UW6A 2W91A 4Q5OA 2R043 4IEZA 2CSGA 2JD4A 3V0AB 3TN93 3GALA 2WAOA 3GM8A 1XYOA 2XG3A 4PJYA 2CGPA 4BXSV 1VRH2 5FWJA 2BW8A 5FJHA 4GA9A 2JDZA 1CONA 4XFCA 2IXHA 4WM7B 4IE5A 1GNYA 3WHUA 2RM22 1PGW2 3SKJE 4A42A 4UF0A 1S0FA 4XZPA 1J3PA 1EV12 1QWRA 4QX5A 3ZXJA 4HKOA 3IPVA 5FZ0A 5KXDA 1DGLA 3K46A 1K5MA 3ZFFB 4QX7A 1D4M2 4L8QA 1K3IA 3K77A 4XF4A 1YFWA 3BGAA 2J22A 1HV0A 1GR3A 1KITA 1LOFA 2XXZA 4D6QA 4BMEA 4P02B 4DO0A 5C5UA 1PMIA 2VOXA 3DXUA 4JKMA 4CE8A 3OBAA 1NY72 2Q1ZB 4PHZA 2B9VA 3RG0A 2GMEA 4CCDA 5AC92 3SITA 1S0BA 4RFT0 4PDWA 4BE3A 4HG6B 4CU9A 1OQEA 2QQNA 5I8TA 5KWRA 2ENRA 1Q5OA 3POEA 3WDYA 4P9LA 4GB31 3POWA 4ZZ8A 1R082 2F17A 2WINB 5FOBB 3G7DA 2GALA 4CDWB 4N43C 1A8MA 1VBA2 1V9U3 2WWSA 4IV1A 4MLOA 2XHKA 1AR81 4QPIC 4RD7A 3FBMA 4QQHA 1CGPA 5DAWA 2QZ3A 2CDOA 4EYUA 4EZ4A 2GH2A 4JDNA 4AVTA 2R071 5JUVA 2D3RA 3R4DB 1G9BA 1ULGA 4JGZA 5FZ7A 5KR7A 5FUNA 2BDRA 3I2OA 3K4AA 4B8EA 5J98B 4UFKA 2WT0A 1VALA 3G6JB 5FDBA 1Y7BA 1O8SA 1AX0A 4Q0PA 3C7GA 2EXKA 5FUIA 1OA2A 1EAH2 3POGA 1GSLA 1EUTA 4MGIE 2Y8KA 5FZ3A 3BTAA 1ZBA2 3V56A 3O1SA 4HOOA 1QQP1 1C57A 2GNBA 4CEYB 1ZRCA 1ND3C 3O0WA 3UK9A 3GHNA 4GJYA 1YQ6A 3KVAA 3C3VA 1MEC1 5CFCC 3NWKA 5FZ4A 1XNAA 3GZAA 5JSPA 1QJZA 1SLTA 4PF1A 2DYCA 1VBC1 4LBQB 3IWZA 4CEWA 2X10A 3IMNA 5HCFA 2BEOA 2VVEA 1JH5A 4QM9A 2Y33A 4ZS2A 4XFHA 1GWKA 4YSFA 5FQ0B 3Q8CA 1UMIA 1ENQA 3DGTA 4V1PA 4Y1YA 3OD0A 2WZEA 4LUMA 4UFLA 2GAUA 1PHMA 4P5HA 1QDOA 4S2HA 1W3VA 3MFAA 4LO7A 5FXZA 3HQXA 5JIUA 2ZMLA 5JXGA 1ZRDA 1FOD2 1O7FA 3JD71 3I59B 4RHV1 4AK3A 1RUD3 3A7QA 3CQOA 1PZ7A 3AZXA 1DGWA 3M4FA 3MBWA 4YM2A 1GUIA 3BB6A 4OHZA 3WW1A 3GBGA 5EZWA 1D0GA 3VBOB 1PO13 1E5IA 1NQDA 1AR93 4QU1A 3ZVXA 3GZTB 1PZ8A 4CVUA 1IS6A 1RUC3 1LESA 5CFDC 2JDUA 1N3PA 2X8KA 3ILFA 1ULCA 4KWLA 4P9XA 5F3EA 2XPJA 3J4UH 5IK4A 2W5FA 3WDUA 4TZDA 1SEFA 1BMV1 1XU1A 3POFA 3WW2A 1YCIA 3VUOA 1C8M1 1OD5A 3ZFGB 1KJRA 3UNPA 2RS31 2HWB1 5JSRA 1ZBE1 5HPOA 2GDFA 2VUJA 3JBG2 1CIWA 4DY3A 3WY6A 1L7QA 2JDKA 1SFNA 4EN8B 1AR72 2CHHA 1CN1A 4LE3A 5A32B 2D44A 3ZFEB 4A2UA 4AI0A 4OUSA 4D7YA 4CUAA 4BJ0A 2LALA 3VD4A 3SLIA 4AHYA 2DCYA 1AYM3 3BALA 2Z69A 2PYTA 2WNVA 4QHZA 1VE0A 5C3OA 4NN0A 4EZHA 5J37A 1N3QA 4RQPA 4IE4A 5FBZA 2TUNA 5I8YA 1QJX1 5CZKA 4XC9A 2JE8A 5JXHA 2Z79A 1NLRA 2RDNA 4FFGA 5FZAA 5LRRA 3H3UA 3VBHC 2UYAA 4AI1A 1XSQA 1ASJ3 4QPGC 4AVCA 3VLBB 2XJUA 3WG2A 2G9ZA 2KR2A 4L11A 4S2GA 2B46X 1UF2C 1HB2A 2B8MA 2UU8A 4D6SA 4NHLA 5FO8B 2UWBA 4XUQA 1LNSA 2OUHA 2Y0IA 2ZHMA 4I09A 2PHDA 2EIDA 2TBVA 5K0UC 5ABJB 2WS92 3A22A 3EMRA 2QJVA 2ARCA 3M3OA 3EB7A 4B4RA 1WA6X 4H3WA 4XFAA 1ND2B 4C90A 2VAUA 3KV9A 2IXCA 2L9LA 3DPRC 4M0NA 1DGRA 4QXKA 1XU2A 2ZGTA 4CP2A 2WO7A 3UT0A 2P3IA 1VMHA 4OMDA 1SZBA 2JG8B 4KG0A 2PA7A 4Q4W1 4Y20A 1CAVB 2D3PA 1CR7A 2X09A 3WNLA 1DCSA 1Q3EA 2QVSB 3NJVA 4FO9A 2IFWA 4G9SB 4EWDA 4ZHNA 3HJRA 5KHGA 5GZEA 2RV9A 1REDA 3PUQA 1UOJA 3Q8EA 4NHKA 4LHSA 3IM0A 1Q8SA 2ZCWA 4LOTA 2FDGA 2VZ3A 2EXIA 4NO4A 3O1OA 4TLGA 4EN6B 1RVF2 3HOBA 4A6OA 1QXPA 1YQ2A 2R7EB 3SNMA 1DLLA 5HCAA 4MGTA 1RUF2 1V6MA 3H50A 3WF3A 2R062 3KCXA 5GZCA 1COV2 3PURA 2PHXA 3T08A 3PHMA 1AR83 3AVRA 2C5DA 2Z42A 2RDRA 5CYYA 1PIV2 3HT1A 2R32A 1ZZBA 4LK7A 1S0JA 1IG3A 2HYKA 4Q4X2 1W90A 3AL5A 4UFMA 3ZYJB 2C6SA 2UYBA 5IK5A 2R042 3WNOA 1TME3 2A3XA 1VRH1 2GH8A 3LDRA 3SCFA 4JQTA 4NMIA 3GJBA 4BIOA 3D0JA 2FMDA 4B7EA 1S0DA 3VBUB 5GLVA 3DUIA 2R6QA 2RM21 2Y6LA 1PGW1 4HN1A 4AHXA 3OPTA 2RVAA 5LBBA 5CISA 1EV11 1DGWX 1J1TA 4IXLA 1C4RA 2QUOA 2B9UA 2XR4A 3OPZA 2D93A 1IS4A 2I74A 2VOTA 4KU8A 4UW5A 3RFRA 2VUAA 4R8HA 5B2GB 4NIGA 2DV9A 1CPMA 1D4M1 1WLWA 3CJXA 3UKTA 1B35A 4FSJA 2EVXA 2FDHA 5FPAA 5CKNA 3BOPA 5LEKA 2WL1A 2QQVA 3DV8A 2MHFA 2H6BA 4GAZA 4QB1A 4BOWA 1NY71 3ZFFC 5AC91 1C8NA 1XNBA 2O1QA 4K1ZA 1AHSA 2VMHA 4HK8A 3SEPA 4MSVA 2PXJA 3T2QA 3OGVA 1LEDA 4XCAA 4OLLA 1KFXL 4YM1A 4D6RA 4JC1A 3JD73 1VP6A 4RHV3 2UWCA 5LBCA 1R081 1UY1A 3BU0A 5FYBA 4YZ1A 4COYA 4AOCA 5DAXA 1W03A 1LULA 4HSJA 1VBA1 4K6BA 3U37A 3WNMA 4NIIA 2B4KA 4DXZA 4XCBA 5JCTA 1SFPA 1S0GA 5CBLA 5JMOA 1LB2A 1V9U2 3WG1A 4CCCA 5A33B 4GZ9A 4CDQB 1H8TA 4CDWC 4CP1A 4QB6A 4CRQA 4LORA 5FZ8A 1JYIA 4QPIA 4HN0A 1WD4A 2AC1A 2WNOA 3KV5A 3AJYA 1US2A 1TNRA 2K46A 1PM4A 2W95A 1YC61 2WDBA 2XJPA 5GKAC 5LB6A 5A6ZA 5FPUA 3UV9A 1RIRA 3ZOIA 1QKQA 2ORZA 2RS33 3LE0A 2W3JA 4K7JA 3OB8A 4JCKA 4UFIA 2P34A 4AQ2A 1RJ8A 1EAH1 3OYWA 5IUQA 4LLFA 3E6CC 2OIIA 2NYYA 1C5IA 1ZBA1 1XXNA 3VD5A 1DQ6A 5JAXA 4DINB 2WWUA 4G4FA 5DAQA 3FLTA 5BNOC 5JI9A 2RDQA 1WBLA 1O3SA 1NXD1 3RI9A 3CF6E 3HAGA 3J7NA 2QKDA 1NE6A 3QD6A 4YGEA 3NKTA 2YC2A 1XJAA 1ND3A 5JWPA 4CEYC 1MZ5A 3C2UA 4TYSA 4O9EA 1OF4A 2RDSA 1ODNA 1RMU3 3CU7A 4BQWA 3ZXLA 5IVFA 1G6NA 1OVSA 1Y9GA 1NX9A 3AKQA 3JCIA 2UWAA 3KT1A 5A1AA 2WYSA 2NM1A 2TNFA 4AXOA 4HFSA 2E7TA 4LOSA 4RGKA 4WM8A 5G04L 3SCGA 5DZFA 2GP5A 3GBWA 4H7LA 1FOD1 4QQ2A 1RINA 2NMOA 2ZGRA 5FY1A 4DY5A 1JUIA 3FFQA 4QT6A 4EN0A 4BQYA 1LOCA 3FHQA 3WV6A 4V2VA 2BWCA 2IWGB 2YGLA 3H3LA 1RUD2 3VBSA 1LHWA 1PVC2 2GMMA 1CAUB 1GNZA 4JTOA 5FWEA 5L9BA 5FPZA 4MGSA 3O7OA 3VGIA 1PO12 5CKMA 4ZU4A 4OI4A 1UYYA 2Q8EA 1AR92 1FMD3 3Q8BA 5J7MA 5KXEA 1VPHA 2J1RA 4JGYC 5JOYA 5C4WC 2BVVA 4NROA 4WVVA 3R6SA 5EYYA 3VBOC 1RYYA 1UU6A 3R0RA
chains in the Genus database with same CATH topology
3ZDVA 2WRAA 5A6QA 5A70A 2JDUA 4CE8A 2JDPA 1OVPA 1UQXA 2VUCA 2BOIA 4AOCA 1OUSA 2XR4A 2BV4A 5A6YA 5HCHA 2BP6A 5D2AA 1OUXA 1W8HA 2VNVA 1UZVA 1OXCA 2JDKA 1OURA 2JDMA 2WR9A 2CHHA 2JDHA 2JDYA 2BOJA 3DCQA 2JDNA 5A3OA 5A6ZA 1W8FA 4UT5A 5A6XA 1OVSA 2VUDA 1GZTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZDV A;  2WRA A;  5A6Q A;  5A70 A;  2JDU A;  4CE8 A;  2JDP A;  1OVP A;  1UQX A;  2VUC A;  2BOI A;  4AOC A;  1OUS A;  2XR4 A;  2BV4 A;  5A6Y A;  5HCH A;  2BP6 A;  5D2A A;  1OUX A;  1W8H A;  2VNV A;  1UZV A;  1OXC A;  2JDK A;  1OUR A;  2JDM A;  2WR9 A;  2CHH A;  2JDH A;  2JDY A;  2BOJ A;  3DCQ A;  2JDN A;  5A3O A;  5A6Z A;  1W8F A;  4UT5 A;  5A6X A;  1OVS A;  2VUD A;  1GZT A; 
#chains in the Genus database with same CATH topology
 4FP3 A;  2XHN A;  4XFI A;  3VHO A;  4QDQ A;  1QU0 A;  2R30 A;  3B69 A;  4IUG A;  5FY0 A;  5FZO B;  3WF0 A;  4AE2 A;  4CP0 A;  3CJI B;  4PLN A;  3JBG 1;  5A3M A;  3ZSJ A;  5IW0 A;  5HCH A;  1XNC A;  5LAS A;  2CNA A;  5L19 A;  3NST A;  1AR7 1;  3ZFG C;  1S1A A;  4Z2A A;  1W8H A;  3AZY A;  2VNV A;  1VRB A;  1I5P A;  3T2P A;  2VZT A;  1ULP A;  3QLQ A;  2ZGP A;  4XF9 A;  4LKF A;  1HRI 2;  1V6J A;  1YJL A;  4YZ5 A;  4N53 C;  1AYM 2;  1ZZ7 A;  3OGG A;  2R49 A;  5A3W A;  3ZFE C;  3RDI A;  1Z0H A;  4LUL A;  4ONU A;  4XIO A;  5H9S A;  3ZXA C;  4NHM A;  2GZW A;  4R52 A;  2XWJ B;  1XB9 A;  1YQ8 A;  1POV 1;  4MXW B;  5J09 A;  4YPJ A;  3MUZ 1;  3ME2 A;  1ASJ 2;  2QQO A;  3ACL A;  5GLU A;  4E8D A;  3NAP B;  2VZ1 A;  1F5F A;  1UPI A;  4LA2 A;  4MZU A;  5F39 A;  3H9A A;  4CXY A;  1ZVF A;  1AZD A;  3FLR A;  5EV7 A;  3OY8 A;  2WS9 1;  3IDC B;  1XBF A;  3C8X A;  1XC6 A;  5C33 A;  2IXJ A;  3SH5 A;  1LEC A;  4A3Z A;  3ALQ A;  3I3B A;  3RZJ A;  4LIT A;  3BUC A;  3UJQ A;  5K0U A;  5K7P A;  2XWB B;  4DEV A;  3MLK A;  5BUV A;  3FZ3 A;  2VMC A;  3R05 A;  1Q8V A;  3HT2 A;  4WVZ A;  3VKN A;  2IVJ A;  1QOS A;  2W2I A;  1HJF A;  1LKN A;  2QDR A;  5DXD A;  1OOP B;  1ND2 C;  2UY9 A;  3FL7 A;  4BPZ A;  1LCL A;  2GMP A;  2G4I A;  2BV4 A;  2QQW A;  1JYN A;  1RUJ 3;  5FPL A;  4BLI A;  2JG8 C;  4P9Y A;  4PI0 A;  1Q43 A;  4Q29 A;  5SV8 A;  5AC9 3;  4UAP A;  1X9T A;  1RVF 1;  2JKX A;  3V65 A;  3UET A;  4Y5T A;  5FPX A;  1GQP A;  4N43 B;  2WKK A;  2ZGL A;  4BQ2 A;  4RS5 C;  4X6R B;  3AYE A;  3TWI A;  1RUF 1;  4FTS A;  1W9F A;  2DUR A;  2WN2 A;  1PX4 A;  4PT6 A;  4COZ A;  3LDB A;  2VW1 A;  1LU1 A;  2R06 1;  4PF5 A;  4ZU5 A;  1J3Q A;  1JZ6 A;  3IBM A;  2BGP A;  1COV 1;  1VBA 3;  2A7A A;  2NZ9 A;  4LEJ A;  4KWJ A;  1KXG A;  1IKP A;  3CIH A;  4V2W A;  2I07 B;  4YM3 A;  5JI7 A;  3W9A A;  1PO2 2;  1Q8P A;  1DYP A;  4GH4 B;  4LUK A;  3OD4 A;  4JV4 A;  5DUU A;  1PIV 1;  2BQP A;  4HL0 A;  5GLT A;  4K9S A;  1BK0 A;  1YIP A;  4Q4X 1;  2OXB A;  2VE1 A;  2YDE A;  1LOB A;  1O4Z A;  1H9W A;  1SFY A;  3I8T A;  2R04 1;  2BP6 A;  3MI8 A;  4K1Y A;  1W6M A;  1MZF A;  1YI9 A;  4KNC A;  4PLO A;  3T09 A;  3ZXF A;  4LJH A;  4NPM A;  4KMQ A;  4BHP A;  1UZ0 A;  3MUY 1;  1TME 2;  2ZAC A;  1DLC A;  4XBQ A;  1TE1 B;  1OH3 A;  2DU1 A;  2X05 A;  1DF0 A;  3HBZ A;  3WP3 A;  2J1V A;  3CO2 A;  5CFC B;  1ENS A;  2JEM A;  3V0A A;  3PUI A;  2DVF A;  2LW8 A;  1J58 A;  1YQ5 A;  3VBU C;  5KXC A;  1IGO A;  2VZV A;  1XNK A;  3OGS A;  1F9K A;  1JTZ X;  1ZNP A;  2VOW A;  3IDE A;  2W1W A;  3K3O A;  1SMV A;  4JAA A;  2YBP A;  1UU4 A;  1F5J A;  3B01 A;  4FPO B;  4WM7 A;  4YFW A;  2VZP A;  5APA A;  1WLC A;  5BPX A;  2VMI A;  5FZE A;  4MUV A;  3H3Z A;  5JZG B;  3W58 A;  4DUW A;  4NID A;  3MPP G;  1QJE A;  1ZX5 A;  3ZFF A;  3TEZ A;  4J6G A;  4XW3 A;  2CDP A;  3LWC A;  1X36 A;  5T50 A;  3MIH A;  2A3Y A;  2GN7 A;  3FHI B;  5DUV A;  3HR9 A;  5CFD B;  1S0E A;  5CAZ A;  3VBR C;  2JG9 B;  4AFM A;  1V9U 1;  1UIK A;  3MF9 A;  3RZK A;  2ZGU A;  1S55 A;  4FCA A;  2ZTN A;  5FZF A;  3IKW A;  3BVC A;  4R4Z A;  4O9G A;  3P5B A;  3B9I A;  4LO5 B;  4XIK A;  1JZ8 A;  2CTV A;  3IT8 A;  4YW6 A;  4LNV A;  1W2U A;  3I2G A;  5FZD A;  4PQQ A;  5FXV A;  1LHO A;  3AYA A;  2KD7 A;  2W47 A;  4CDW A;  2AGS A;  5A3N A;  4GD4 A;  2WNU A;  4N9H A;  4AVA A;  1D7P M;  2HWC 3;  3JBG 3;  1H9P A;  2WZR 2;  1IKQ A;  2ATF A;  4Q27 A;  4YM0 A;  4F7Z A;  1W06 A;  3O1V A;  3K51 A;  4RFR B;  3ZX7 A;  1MS3 A;  4NWV A;  5FMC A;  5A3P A;  1CZT A;  1YHF A;  2ZGK A;  3ZXE A;  1ULO A;  1SPP B;  1AXY A;  2BOI A;  3QBQ A;  4N7U A;  3WF2 A;  4KI5 M;  1EUU A;  3W20 A;  4QKD A;  5JOW A;  2PQQ A;  3IMM A;  3NO8 A;  4AEK A;  4HLT A;  3VBH B;  2GU9 A;  4ZY9 A;  1GIC A;  4YGD A;  1LGN A;  3LEK A;  3MIE A;  3VDC A;  4CTE A;  5FP7 A;  3O1P A;  2YC0 A;  4EWE A;  1K12 A;  3AMH A;  1RMU 2;  4K8R B;  3VL8 A;  4P9W A;  4CEY A;  4LBL A;  3SH3 A;  5L9V A;  1POV 3;  1PM7 A;  4LO4 B;  3ZYP A;  5IJR A;  3FJS A;  2VU9 A;  4P00 B;  4AWD A;  4E4Z A;  4MV2 A;  4X8P A;  4IQP A;  3I3M A;  4LBQ A;  2W92 A;  4HSL A;  5FTT C;  2ZGQ A;  1RUD 1;  1JU3 A;  1PVC 1;  3BPS A;  2BFU L;  2UUR A;  4OI0 A;  2ES3 A;  3DPR B;  3PVO A;  4UW4 A;  4H55 A;  2FCV A;  2GND A;  4Q1P A;  5FQ0 A;  1PO1 1;  3AP4 A;  3HNB M;  1AR9 1;  4IE0 A;  4E9K A;  3RZL A;  5I8S A;  2SLI A;  1Y3T A;  3NW4 A;  3MDP A;  5FYC A;  2Y38 A;  1FMD 2;  3MV0 1;  1H1A A;  2VNO A;  1UY2 A;  2UY8 A;  3I97 A;  3I59 A;  3TB0 A;  4L99 A;  1LGC A;  1UU5 A;  1D2Q A;  4DS0 A;  4JQR A;  3AXE A;  4I3G A;  2HWD 3;  4AFC A;  4LA3 A;  5FLH A;  3OCP A;  2P17 A;  3VBO A;  5ACA 3;  5IK7 A;  2D6K A;  4DMI A;  2OW4 A;  1R64 A;  2OUJ A;  2W08 A;  2FMY A;  4W50 A;  4Y1X A;  5IVE A;  4K21 A;  1C1F A;  2EIG A;  2YGM A;  4CXX A;  5KHJ A;  1RVF 3;  1CIY A;  2QBX A;  2XL9 A;  4XIL A;  4AEM A;  3B02 A;  4Z1V A;  4OFG A;  3BTZ A;  4OQ8 A;  5LBF A;  4BU2 A;  3CJI C;  3RVH A;  3CZJ A;  1WW7 A;  4FAG A;  1IPS A;  4YZ3 A;  1HXS 3;  2ZGO A;  1GAN A;  1OSG A;  4PI2 A;  2WSV A;  3ZFG A;  1HRI 1;  2CAU A;  3AJZ A;  3NL1 A;  5FZB A;  2YRO A;  3T2O A;  2ZKL A;  1QMJ A;  3H1W A;  5FKC A;  1AYM 1;  1G9D A;  3PVN A;  4ASM B;  3WF1 A;  1PVX A;  1FPN 3;  3N9M A;  2A70 A;  4YAR A;  1GWM A;  4LKS A;  5FZ9 A;  3S30 A;  3QH7 A;  4YW3 A;  3VKM A;  3ZR5 A;  5A32 A;  3ZFE A;  2D97 A;  1HQW A;  4ZKT B;  2DUP A;  5KC6 A;  3ZPO A;  2OQ6 A;  2VUD A;  1QY4 A;  3KB5 A;  1ASJ 1;  5AVP A;  4A41 A;  2H0V A;  2EXH A;  4URA A;  5LA2 A;  5FY9 A;  1CX4 A;  3MLJ A;  5JXI A;  3J26 N;  3WT3 A;  3JQW A;  2TEP A;  5I0T A;  4RGG A;  5A80 A;  1OUS A;  4C8D A;  1MZ6 A;  3NRU A;  1T6G C;  3N3H A;  5C6C A;  2DCK A;  2VL4 A;  3KWV A;  3NAP C;  1LOA A;  3PU8 A;  4YW4 A;  5IAV A;  4AGR A;  4DZG A;  3AMQ A;  4XFG A;  3M3Q A;  1DZQ A;  3V0B B;  4KBB A;  1O59 A;  1W9S A;  4DOU A;  3BN6 A;  4XFF A;  5F8P A;  3MID A;  1JHJ A;  2MNG A;  1DYO A;  2HEW F;  5A3L A;  5ABJ A;  1VB4 A;  1IS5 A;  3LEM A;  1GYK A;  1CWP A;  2D6M A;  1ND2 A;  5IFP A;  3I2J A;  2IUW A;  1OOP C;  1RUJ 2;  3USU B;  2VUC A;  4XJ8 A;  5BNQ A;  5ANQ A;  3AMN A;  3ATG A;  3N9N A;  1BVV A;  5FXX A;  3GF6 A;  4QQL A;  4JDM A;  5D21 A;  2JG8 A;  3VDD C;  2CY6 A;  3SKV A;  4D69 A;  1MR5 A;  4AAX A;  4URT A;  5F3C A;  3TNQ A;  1CAV A;  2CV6 A;  2V73 A;  2ADD A;  1QJF A;  4XE9 A;  3SMH A;  4O65 A;  2A75 A;  3HNY M;  2C9A A;  3QH6 A;  1CX1 A;  3AKR A;  1PO2 1;  3DYP A;  4JX0 A;  1DP0 A;  1SBE A;  1W8W A;  1NLS A;  1UOF A;  3AP7 A;  2AEZ A;  3EO6 A;  5F6L B;  3ELN A;  1V0A A;  1S0C A;  1ZZC A;  3WQB A;  2WAA A;  2NPI A;  2Y60 A;  2KXL A;  2ZAB A;  4QAW A;  5B4N A;  3I3D A;  1SCR A;  4GH4 C;  4LIU A;  1WW5 A;  1VBE 3;  3WDV A;  3WP6 A;  3CMG A;  3U4X A;  1TME 1;  2WFF 2;  5T3N A;  2R1D A;  3OPW A;  1U0A A;  3ZYF A;  5BNO B;  2ZGS A;  4XET A;  2RJK A;  3ZSM A;  1F4H A;  3CLP A;  1HB1 A;  2XQR A;  1F8V A;  4F3J A;  2D6P A;  4CDX B;  2DUQ A;  2OT7 A;  5L36 A;  4U36 A;  4CPB A;  5J48 A;  1XOY A;  4AGV A;  1ZRE A;  4COV A;  1JZ5 A;  1XE7 A;  2WJS A;  1HQL A;  3VBU A;  1E5H A;  1CZV A;  2GC1 A;  1DQ5 A;  1DGR N;  2D98 A;  1OVP A;  2K2S A;  1K5J A;  1UD1 A;  2VZR A;  3D5O A;  1D2S A;  3FN9 A;  4XDO A;  4D0Q A;  2PHW A;  2O14 A;  2W52 A;  2ZX4 A;  3WP5 A;  3ZN6 B;  1BZW A;  2DCT A;  4BQ4 A;  2DVB A;  3WR0 A;  4LK6 A;  4MOA A;  1LAJ A;  3WDT A;  1HN1 A;  2WO1 A;  3KCY A;  3MPB A;  5JZG C;  2VCB A;  1UW8 A;  4C1W A;  1NE4 A;  2FCT A;  1PVC 3;  2AUY A;  4JGY B;  5C4W B;  3WW3 A;  1EP0 A;  2WZP P;  4Q0U A;  3KD4 A;  1ST8 A;  2ID4 A;  4PCR A;  4KGG A;  3LF7 A;  3O1T A;  3SCH A;  2YFZ A;  2ZBJ A;  1XYN A;  2D6N A;  3WUC A;  1HB4 A;  5HXM A;  2DFB A;  2JG9 C;  1UYP A;  2VZS A;  3D6E A;  5CKQ A;  5FBJ A;  3VD7 A;  2AR6 A;  3HNM A;  3FMG A;  1LU2 A;  3I7D A;  4AG4 A;  1MQT B;  3L9J T;  1GOH A;  2P4E A;  5KC5 A;  1WME A;  3LDK A;  2IZW A;  1GMM A;  2WZR 1;  3PDQ A;  4E4D X;  5C3P A;  3MW4 A;  2CYF A;  4N9I A;  1SQ4 A;  2AAC A;  2E51 A;  2HWC 2;  5FIX A;  5A33 A;  4CDQ A;  4AI3 A;  1W6N B;  2IXK A;  1VAK A;  3O12 A;  1UKG A;  4PLM A;  3D0S A;  4OCT A;  5C3S A;  3LEG A;  4N53 B;  3VKL A;  1L7L A;  2K0G A;  4W4Z A;  1HRI 3;  2H0B A;  2Y26 A;  4H2A A;  2F4L A;  2PAK A;  1J3R A;  4WVM B;  2XJT A;  3AP9 A;  4OZX A;  3T3Y A;  5HV4 A;  3H1M A;  3D82 A;  3LIH A;  4NWW A;  2VBP A;  2HYX A;  5DPN A;  5EQU A;  4YW2 A;  5LA0 A;  3B93 A;  2J1U A;  1NT0 A;  2RJL A;  4Y4R A;  1GNH A;  3ZMN A;  1RMU 1;  4R4X A;  3GYD A;  4CYD A;  4QX3 A;  3OUJ A;  3B5L B;  1W0O A;  2C26 A;  4LLO A;  4CUB A;  1LOE A;  2HBU A;  1SDW A;  2WA4 A;  2ZXQ A;  3LFM A;  4GMP 0;  4OUM A;  4AI2 A;  4COU A;  5FJK A;  5C8W A;  5F1R A;  4XUR A;  5BNN B;  3VZK A;  1QOT A;  2VMD A;  4FPE A;  1D4V B;  4LBJ A;  1W28 A;  1RUE 2;  2WO3 A;  2BER A;  4LHL A;  4Q8L A;  1NA1 A;  2FDF A;  5C70 A;  1YFU A;  2NLR A;  5A7S A;  2LTN A;  1PMJ X;  1GZT A;  3A0N A;  3DYO A;  1JYW A;  4C1X A;  1OI6 A;  1FYU A;  1TVG A;  5GLZ A;  1HQN A;  1JZ2 A;  2DBI A;  2JE7 A;  3ACF A;  1FMD 1;  2ORX A;  5ISL A;  1V6L A;  4N7I A;  1YO8 A;  4FXG B;  4HKL A;  4QGL A;  4BB3 A;  4CCN A;  4BQ3 A;  1DG6 A;  4MGY E;  1ACC A;  4GWN A;  3VBF C;  3WG3 A;  2YMZ A;  5D2A A;  2VME A;  1W6Q A;  1CAU A;  1W8Z A;  2JKB A;  1IQD C;  3EYP A;  3WLU A;  3MO4 A;  2HWD 2;  2ZX1 A;  4FPG A;  4MO3 M;  2R16 A;  5I91 A;  3AB0 A;  4RS5 B;  1VR3 A;  2WAB A;  5ACA 2;  1WUV A;  1JZ4 A;  4AFA A;  5EXO A;  1M4W A;  5F6K A;  4L9B A;  1W04 A;  3MIF A;  3RSJ A;  5KHH A;  3RNS A;  2XVG A;  4TLF A;  5I0S A;  5FLI A;  4AED B;  1GLH A;  1SBD A;  3JXS A;  4H7M A;  3ST7 A;  1HXS 2;  2ZKN A;  1OBN A;  5FZO A;  3TNP B;  2W1S A;  2D6O X;  3KMH A;  3AMP A;  3CJI A;  4M3C F;  4W6Y A;  4YVS B;  2XH6 A;  4BMB A;  1NZI A;  2ZS6 B;  3S0M A;  1PO2 3;  3GCW A;  3ZR6 A;  4K20 A;  4R9D A;  1CJD A;  2BRT A;  2YZ4 A;  1RC6 A;  2I2S A;  2QCS B;  1UXZ A;  4MGK E;  4SLI A;  5JOZ A;  1NCQ C;  1J83 A;  1YXW A;  1WW4 A;  1FPN 2;  3ZYR A;  4XHX A;  5M0T A;  4GXL A;  1IG0 A;  3I3E A;  4B1M A;  2VTX J;  1AUY A;  2A71 A;  4WZC A;  3Q8F A;  5A3T A;  2QQJ A;  1XPW A;  5HI0 A;  1PNF A;  3NJY A;  1F35 A;  2D6L X;  2Z2S B;  3O14 A;  1ZYB A;  4K3U A;  2ARX A;  3K4Z A;  5KXB A;  4AVV A;  5C9A C;  2PAM A;  3INA A;  4O61 A;  4KU7 A;  1W0N A;  3NNL A;  4MXW A;  4OHX A;  3SC7 X;  4UFJ A;  1NXM A;  2BTV C;  1WKY A;  3NAP A;  3C7F A;  1UX6 A;  1UKR A;  1OFN A;  2VW2 A;  1AL0 G;  4M3C B;  1LGB A;  2F4P A;  2VQT A;  3KT4 A;  2FQP A;  1OLR A;  2D40 A;  1V00 A;  4BM8 A;  1QNW A;  5JLV A;  1V6K A;  2J1A A;  1RUO A;  2MEV 2;  4AYU A;  5K9Y A;  1TQ5 A;  4AF9 A;  4RL7 A;  1MS1 A;  1AL2 3;  1BCX A;  1RUJ 1;  2CWS A;  2XON A;  4HKW A;  4OMC A;  4Q2F A;  4D7T A;  4YLZ A;  1UOG A;  1ZM1 A;  3ZN4 A;  2OS2 A;  1W6O B;  3C7E A;  1Z7S 2;  3O0V A;  1A6C A;  1H4G A;  2Z5W A;  5FPB A;  3U07 A;  1OOP A;  2ZX2 A;  1QXR A;  1S4C A;  1QH6 A;  2DF7 A;  3VBR B;  1CD3 G;  2DCZ A;  2VTF A;  3BOW A;  4A7Y A;  4YVW B;  4KL1 A;  4M4P A;  4OI1 A;  1JOJ A;  2P3J A;  3MLL A;  2G9G A;  1FAT A;  4NUB A;  4UW3 A;  4W6W A;  1XYP A;  1IHM A;  2SBA A;  2ZHN A;  5KHK A;  2R0H A;  3LD8 A;  4ZXE A;  1JYV A;  5HV0 A;  2VNR A;  1WCS A;  2WN3 A;  3NVC A;  2JD9 A;  1Z78 A;  3H1Y A;  4BQ5 A;  1NCR B;  2C0Z A;  3IZO A;  1O4Y A;  1PK6 B;  4N43 A;  4F83 A;  3B94 A;  4DQA A;  4IEV A;  2J1S A;  2DDU A;  2WQ8 A;  5DUX A;  3PTR B;  4IDZ A;  1OFS A;  2Y34 A;  5FAX A;  2RE9 A;  5FYT A;  2WFF 1;  4X6Q B;  3ZDV A;  3VB9 A;  3N9L A;  2DWR A;  2WZR 3;  3WDW A;  3VKF C;  3WNN A;  4COW A;  1VBE 2;  2B42 B;  2EIC A;  4GH4 A;  4XUO A;  3NNF A;  4XBL A;  5EHD A;  3OOX A;  4RSU A;  1R09 3;  4XDQ A;  3D3A A;  1W8O A;  4Q0Q A;  1RUH 2;  4Q4Y 2;  3T0A A;  3ZXK A;  1UZY A;  2YPJ A;  3KGZ A;  2AYH A;  2Q1M A;  1OA4 A;  1W2T A;  2YPD A;  2ZA9 A;  5T55 A;  4DRR A;  3UGH A;  2ERF A;  2QNK A;  4EE2 A;  1N1Y A;  3B00 A;  1QHD A;  1VMF A;  2VOV A;  3VV1 A;  3VD9 A;  1VLN A;  1LHN A;  3S5Q A;  5EPA A;  1SLB A;  3N4M A;  2ET1 A;  4GQ7 A;  4CDX C;  3RZM A;  1HIX A;  5IYY A;  5A6X A;  5CFC A;  2ZPX A;  3KT7 A;  2BPA 2;  1QDC A;  3HQR A;  2A6V A;  3FWE A;  3T4V A;  4AFB A;  2JJ6 A;  3RJ2 X;  3I3Q A;  3WOG A;  4CXW A;  1QJY 3;  4EV0 A;  4N8M A;  4F8A A;  3ACG A;  5L7O B;  1NG0 A;  5F2S A;  4FAH A;  5A1L A;  3RZZ A;  4BCU A;  1JS9 A;  5JZG A;  5DMY A;  3H8X A;  1H2M A;  2PHF A;  4XXP A;  2WC2 A;  2JDM A;  1BKZ A;  2K9Z A;  1UO9 A;  5E6H A;  5FZM A;  4FP2 A;  5B4X A;  2QQL A;  2W9X A;  3WD5 A;  4DNY A;  3ROU A;  5DN2 A;  3ACH A;  1GOG A;  2X5I B;  1MS5 A;  2XUM A;  4MAD A;  1WLD A;  5T5L A;  3RGB A;  4D3W A;  1M06 G;  4AR2 A;  1KQR A;  1OF3 A;  3M1H A;  3PNA A;  5CFD A;  4YG3 A;  5LBE A;  3OUI A;  2JDP A;  2XLF A;  1YRZ A;  2A6W A;  2JG9 A;  3HBK A;  2HWC 1;  5BNP B;  1QIQ A;  2WZ8 A;  3THC A;  1O5U A;  3E5X A;  2XVL A;  4I0B A;  5I93 A;  1MQT C;  1UN1 A;  4AI8 A;  1CJP A;  1E5R A;  3LSD A;  3ORJ A;  2YFU A;  4IE7 A;  3ZIW A;  1SHW B;  3WF4 A;  5IHR A;  1CES A;  5J36 A;  4IEU A;  1O3Q A;  4M01 A;  1OXC A;  2Q8O A;  2CL2 A;  3T1L A;  3ITQ A;  1XRU A;  4Q0V A;  3PJQ A;  3MYX A;  5IK8 A;  2E7A A;  4OHY A;  4MGQ A;  2FBE A;  1SLI A;  3T2T A;  4UT5 A;  1I1E A;  3OSD A;  4GAL A;  2JX9 A;  5C3Q A;  4IEP A;  1U5Y A;  2VQU A;  4ATE A;  1AJK A;  3FE5 A;  3ZLI A;  1ODM A;  3E6B A;  4IGP A;  3UES A;  5JOX A;  4LT5 A;  1SPP A;  1QJU 3;  2PFW A;  4BK5 A;  2VR4 A;  1JYX A;  1UMH A;  5EJ1 B;  5A3U A;  4WV8 A;  1JBC A;  2Q0A A;  3PVE A;  4XAB A;  4D94 A;  1RUE 1;  1KRI A;  1LEN A;  2XDV A;  1BLZ A;  1O6U A;  2IXI A;  1V70 A;  4JHT A;  3VBH A;  4QPG A;  3EQE A;  4E2Q A;  4DRV A;  1XE8 A;  3AM2 A;  3GDB A;  4RA0 A;  2FZ2 A;  1UCX A;  3O1U A;  2HEY F;  1OUR A;  3H42 B;  5IVC A;  5BNN C;  5C3R A;  1ZA4 A;  4LIV A;  1DQ0 A;  2VBD A;  4MHR A;  4UFH A;  1LOD A;  3I4I A;  1NOV A;  3F2Z A;  2GP3 A;  4NHY A;  4FI9 A;  5I0D A;  2VJX A;  4I30 A;  4UXA A;  5F5C A;  1X33 A;  1SBF A;  1GP4 A;  1LOG A;  3N9Q A;  5LY1 A;  1X8E A;  3RRD A;  3VZJ A;  1IOA A;  2VY0 A;  5FKB A;  5J1X A;  3DPR A;  1ZRI A;  2DCJ A;  2HWD 1;  2JB4 A;  4LBN A;  5JSO A;  2QE3 A;  1W2O A;  3EBR A;  3J7L A;  4IV3 B;  5ACA 1;  2WT2 A;  3BPZ A;  3RQ0 A;  1B35 B;  1YI7 A;  1RIT A;  3LPG A;  3NV2 A;  1AR6 3;  1GQG A;  3VDD B;  1Q8O A;  2EAK A;  4I02 A;  2I45 A;  1AX2 A;  2ZHK A;  1OUX A;  2C24 A;  3JZV A;  5DG1 A;  5LY2 A;  3UL2 A;  1OLM A;  1UZV A;  1KGY A;  3THT A;  1K5M C;  1AF9 A;  2OPW A;  4JRA A;  4NVP A;  1H6X A;  3M3I A;  3GBF A;  1HXS 1;  1HLC A;  1F15 A;  2VMG A;  3B3Q E;  3H0O A;  3HVD A;  4KWK A;  1OT5 A;  1RL3 A;  1TMF 3;  4WZF A;  4QU2 A;  3LEI A;  1LOF C;  2ZHL A;  4UWD A;  3MEP A;  3P1I A;  3ABZ A;  2P3Y A;  1OKO A;  5F5I A;  2NP0 A;  4Y1Z A;  2RS1 3;  1BVP 1;  1RHI 3;  3WSO A;  4AED C;  4CU8 A;  4PIZ A;  1VMJ A;  2B7Y A;  3AVS A;  2VEC A;  3USS A;  3JB4 C;  1X82 A;  4NRP A;  1FPN 1;  3IN9 A;  4IEQ A;  4YVS C;  4IL7 A;  4XTM A;  4Y5S A;  2HWE 3;  1W9Y A;  3CEW A;  5F7U A;  4Q8K A;  4HVO A;  3WNK A;  1YLL A;  3ETQ A;  2E32 A;  2VNG A;  5DDJ 3;  2WQZ C;  3V64 A;  2VM9 A;  4ITC A;  2WFF 3;  4I3P A;  4LBM A;  3AMM A;  1GP5 A;  3C7O A;  4KBZ A;  3W5M A;  2N7G A;  1IPJ A;  4IV1 C;  3VZO A;  3KHC A;  3J7H A;  1K45 A;  2QZ2 A;  5GM0 A;  3DKW A;  3IB3 A;  4PIX A;  2JDN A;  4QKN A;  5F3I A;  1AYN 3;  1C28 A;  4I0A A;  1D0H A;  1GU3 A;  2W1U A;  3UGG A;  4AEJ A;  2A73 B;  4QD2 A;  3FUQ A;  5IVB A;  1OMI A;  5HXV A;  3WQ7 A;  5CU1 A;  4M4R A;  1VIW B;  2VZQ A;  1OD3 A;  4XUT A;  4IEY A;  2XVK A;  1STM A;  2JDA A;  5FY8 A;  5L9R A;  4HMZ A;  2MEV 1;  3O1M A;  3MIC A;  3DEC A;  1MS9 A;  1NYW A;  1SLC A;  1NKG A;  3I2F A;  2WLP A;  1UXX X;  3T30 A;  1BBT 3;  1EPW A;  1AL2 2;  1DU3 D;  1Z7S 1;  1EY2 A;  2LRO A;  4Y33 A;  1HN0 A;  3V0B A;  2V5Y A;  3NKG A;  4YZ2 A;  4QGN A;  2BYV E;  1BHG A;  1I5Z A;  3IAP A;  1V6N A;  1GZW B;  4CDU B;  4BIF A;  2W39 A;  3T0B A;  3RYR A;  2DUO A;  3ASI A;  4WM8 B;  5BYN A;  3PUH A;  4XFB A;  4ZXK A;  5DZE A;  5IWF A;  1ULE A;  5A7W B;  4CP9 B;  5JXJ A;  2V72 A;  4YVW C;  2DVD A;  4O7X A;  4XJA A;  4KG8 A;  5JVV A;  3ACI A;  4Z07 A;  2AZ5 A;  2H6C A;  1GZ9 A;  3ZM8 A;  1HKD A;  4PIY A;  2WA3 A;  5EP9 A;  3ZPY A;  1JW6 A;  3RJR A;  1XND A;  4JHZ A;  4CUC A;  1NCR C;  1VBE 1;  1PK6 C;  2A3W A;  4Q4V 2;  5CAD A;  5C8C B;  1H2N A;  1HRV 3;  4NPL A;  2Q8C A;  2WQ4 A;  2P37 A;  3FC0 A;  3KF3 A;  1NLQ A;  1RUH 1;  2PLV 3;  4CCM A;  2XBO 3;  3EHK A;  4FT8 A;  1H1I A;  1G9A A;  1R09 2;  4AI9 A;  1AX1 A;  2PAE A;  4FFI A;  4AFD A;  2VCC A;  3GCX A;  5H9Q A;  1ZRR A;  4CUG A;  1W6P B;  2ZGN A;  3N7M A;  4GJZ A;  3CHX A;  5JIA A;  2OYZ A;  2ILM A;  4QKB A;  2BFU S;  2DBN A;  2Q4S A;  5BNO A;  3C7H A;  5FK7 A;  3ETP A;  3P3N A;  2RHP A;  2Y6J A;  1DFQ A;  4OHV A;  3U1X A;  3LFI A;  3CDZ B;  2R1B A;  5E1R A;  5K8S A;  2AEN A;  3N7J A;  1FV2 A;  2PQS A;  1MAC A;  2IFR A;  3DN7 A;  4FQ4 A;  3HPN A;  1CZS A;  4LBQ D;  1PGS A;  2ZEY A;  2JXA A;  3A23 A;  3OUH A;  1RUE 3;  2WRA A;  2LUW A;  3U0Z A;  4NR1 A;  3AKT A;  1UY0 A;  2BNO A;  1RJ7 A;  4FQZ A;  1QJY 2;  3UKN A;  2YY1 A;  1CAW B;  1F2N A;  5JR7 B;  1WBF A;  2XB6 C;  2YU1 A;  3K48 A;  4EWA A;  1ZZ8 A;  3W59 A;  2WNE A;  3VBF B;  3ZN6 A;  4BQX A;  5F9T A;  4QHB A;  4ERO A;  3NV1 A;  1WW6 A;  4CCL A;  3MW2 A;  3LSE A;  5L7O C;  4FVV A;  2ZAA A;  1CVN A;  4MH0 E;  4FPL A;  2Q8D A;  3ZDS A;  3ZKU A;  2A6Z A;  4ASK A;  3RI8 A;  4B3N A;  4LBK A;  1Y9M A;  3OGR A;  2CGO A;  4JGY A;  2D7F A;  2E53 A;  5FMO L;  1HX6 A;  5C4W A;  4XUN A;  3RMY A;  4QXH A;  1ZZ9 A;  3PLQ A;  4XUP A;  2X5I C;  5FRA A;  3AZV A;  5FY4 A;  3T1M A;  4AHZ A;  1UWW A;  5JMC A;  3ZYG A;  4Q0S A;  5LRS A;  2E63 A;  4D8M A;  1DDL A;  1T6B X;  4AVS A;  4BDV B;  1GWL A;  4G3Y C;  1OQ1 A;  4XOG A;  2W87 A;  5K4L A;  5BNP C;  4XQW A;  5FZH A;  3IIA A;  1JI6 A;  1MQT A;  3NQH A;  4UI9 L;  3UYJ A;  5GJ6 A;  4BXF A;  2FCU A;  5FXW A;  3POI A;  2D43 A;  4E8C A;  1GV9 A;  1NCQ B;  4XHB A;  1DQ2 A;  3TEX A;  2OKX A;  4KH9 A;  4YFZ A;  4Y26 A;  1W6N A;  2C9K A;  1H2K A;  4YG6 A;  4DXT A;  3WCS A;  1MPX A;  3M7A A;  4LE4 A;  4N53 A;  1O3R A;  4BK4 A;  1YJK A;  4HPK B;  2FHR A;  4BWO A;  4YW7 A;  3GZU C;  3WEZ A;  3ILR A;  3DKQ A;  4WVM A;  1QJU 2;  5C9A B;  1WMX A;  4E4H A;  2Y64 A;  5EFU A;  4Y1V A;  3PVB B;  4LO8 A;  2W94 A;  3ILN A;  5F32 A;  4LPL A;  1CAX B;  2EA7 A;  4HET A;  3H8O A;  1FX5 A;  5FZK A;  3I49 A;  2V4A A;  2CWM A;  3VZL A;  5E88 A;  2HLE A;  3E6D A;  4TWT A;  1OPO A;  2P2K A;  3IDB B;  1WA4 A;  4DPN A;  2XL7 A;  2HWF 3;  4TSV A;  4LKD A;  2B45 X;  2ARA A;  2VPV A;  5BNN A;  5LW9 A;  4OHW A;  2ZJC A;  4TXW A;  4UOJ A;  4XJ9 A;  1JYT A;  2MEV 3;  4GWI A;  4E2G A;  1JZ7 A;  2G19 A;  4HVQ A;  2YV8 A;  3ECQ A;  3ON7 A;  4IEO A;  4RR3 B;  4SBV A;  2EIB A;  2YXS A;  4YRD A;  3O1R A;  3LIG A;  4E2S A;  1JZ3 A;  3RWN A;  1Z7S 3;  3ENR A;  1AR6 2;  1O5L A;  2P1B A;  2E31 A;  4KQ7 A;  5T5P A;  4IV3 C;  3Q9O A;  1ZRF A;  1HJG A;  3KZ4 C;  1B35 C;  4XPV A;  2R0F A;  1W3X A;  2Q30 A;  3KM5 A;  5LA9 A;  3QOP A;  4CZS A;  2VO5 A;  3HEI A;  1TMF 2;  2JB8 A;  2XLG A;  3NV3 A;  4FOQ A;  4PBO A;  4RS5 A;  4P08 A;  1AXZ A;  5FK8 A;  3MFC A;  1ALY A;  1QNY A;  2CAV A;  1ENR A;  4XXA A;  1UZW A;  1RHI 2;  2RS1 2;  4QX2 A;  2BVB A;  2DTW A;  1AXK A;  1WGP A;  2OA2 A;  3DL3 A;  4IEW A;  2VOK A;  2YBK A;  5FLJ A;  5FPV A;  4W6X A;  4ZPI A;  1UYZ A;  3TYJ A;  1HDK A;  1SLA A;  4AED A;  3LA3 A;  1XSR A;  4D7S A;  2HWE 2;  1WMF A;  1E5S A;  4YVS A;  2J1T A;  1LHU A;  3PUA A;  4A7K A;  1PNG A;  1SG3 A;  1WWY A;  5DDJ 2;  4A3X A;  5FYZ A;  2RR1 3;  2VW0 A;  3I2K A;  1YFX A;  4ASL A;  5GZD A;  1VB2 A;  4J1X A;  4EJR A;  1WCU A;  4WVW A;  4YNI A;  2WII B;  1RUH 3;  4Q4Y 3;  5IFT A;  2WWJ A;  2XJV A;  3W21 A;  1H8T C;  2Y6H A;  3EJK A;  1RUI 3;  4LR4 A;  2WNU B;  4LXL A;  4IE6 A;  5JPN B;  1GFF 2;  4CPB D;  1AYN 2;  1R1Z A;  5DUW A;  3BI3 A;  2KA3 A;  5FP4 A;  5A7N A;  2BU9 A;  1BQP A;  1RUG 3;  2JIJ A;  3KQR A;  1VBD 3;  3AL6 A;  2LM3 A;  4IET A;  5D8A B;  2QDN A;  2VBB A;  3M8L A;  3S7E A;  3WCR A;  4ARY A;  3JB8 A;  4FOV A;  5FYV A;  1X50 A;  4BZ4 A;  1RUN A;  2O8O A;  5I0R A;  1RGS A;  4GMP 1;  3ZYB A;  3LA7 A;  3M2M A;  3PU3 A;  2WO2 A;  1UMZ A;  3PMS A;  1AL2 1;  1UY3 A;  3U11 A;  5A6Y A;  1KDM A;  4LHK A;  1VAM A;  1BBT 2;  3E1F 1;  4QX1 A;  4M3C A;  1BYH A;  4GKY A;  2OPK A;  1C3H A;  1ENX A;  3AKS A;  1YNA A;  1IPK A;  2RG4 A;  4NPR A;  4XEZ A;  4HT1 T;  4X8N A;  4Z8B A;  4XVH A;  4LHN A;  4EN7 B;  4ISR A;  2ZOE B;  4CDU C;  3J8F 3;  1W6O A;  2WFP A;  2PN5 A;  4GKX A;  2XJQ A;  1A78 A;  1VBB 2;  5A70 A;  1OLQ A;  4WM8 C;  2P5B A;  2W68 A;  2GN3 A;  2YUE A;  3VBR A;  4GWJ A;  1H1M A;  3RYK A;  1DZT A;  1O91 A;  5GLW A;  4YVW A;  5FYM A;  1TEI A;  2BWA A;  2DFC A;  4CCK A;  1JU4 A;  4DIQ A;  4Q4V 1;  2A6Y A;  3VBS C;  4YGB A;  2E33 A;  1DQ4 A;  4AHW A;  4Y22 B;  1UIJ A;  4QXB A;  1Y9Q A;  1K42 A;  1UZZ A;  3WQ1 A;  3ZKY A;  2VTX A;  1NCR A;  1CPN A;  1HRV 2;  1PK6 A;  2CGN A;  4QGM A;  4XMA A;  1R09 1;  1SCS A;  3TBD A;  3III A;  5LZ6 A;  1Q56 A;  4OI2 A;  1XNT A;  2PLV 2;  1G8W A;  3B7M A;  2XBO 2;  4K8F A;  4LTA A;  5CB7 A;  4FFF A;  5A7Q A;  5C8C C;  4Z92 B;  4FBF A;  1BEV 2;  3R4U A;  3SEE A;  3AKP A;  2VXR A;  4QDR A;  1UY4 A;  1RXF A;  3KHB A;  3GXU A;  4LKE A;  3WVJ A;  3ZMO A;  5DAV A;  4EQV A;  5C71 A;  5IVV A;  1J1L A;  2RS5 3;  4J1W A;  3UGF A;  3PME A;  3AZZ A;  1CQ9 A;  3PIG A;  2HEV F;  2A6X A;  4CCJ A;  4MG2 A;  2C1F A;  3K4D A;  3ZYI B;  3WP4 A;  2IXL A;  1URX A;  3OEB A;  4MHU A;  5FYY A;  2W0X A;  2QFE A;  4H14 A;  4GUL A;  1GBG A;  1W9T A;  4OVE A;  1QJY 1;  3ZO0 B;  3TAY A;  1F31 A;  3POB A;  2P6C A;  2EXJ A;  3LPF A;  4FPK A;  4I0W B;  4AQS A;  5C5T A;  1A34 A;  2EAL A;  4FTE A;  3HMY A;  2LRP A;  3P3P A;  4OZO A;  1YQC A;  3MGU A;  1ULF A;  1C1L A;  3N9P A;  4JRL A;  4R9C A;  4BQ1 A;  4CA9 A;  1X8M A;  3OJB A;  2QQU A;  3KV4 A;  2XOM A;  1KDK A;  3AYD A;  2VCM A;  5CNA A;  5ERL A;  4P5Y A;  5L7O A;  1VJ2 A;  4UF0 B;  2G1M A;  2JEN A;  3WXP A;  2BBV A;  1HW5 A;  1O4T A;  1Q8Q A;  3IPV B;  5FY5 A;  5J96 B;  1UYX A;  2Q5T A;  2XQX A;  3Q8A A;  1K5M B;  4QDS A;  4QPW A;  4QHO A;  4CP9 A;  4K40 A;  2YB7 A;  1REE A;  3AC0 A;  5FR3 A;  4QMA A;  2PHU A;  2VQ0 A;  1G7Y A;  3VHR A;  2X5I A;  3VL9 A;  4TTG A;  3WHT A;  4B29 A;  2E7Q A;  3ZXD A;  3W5N A;  4XAE A;  5E89 A;  3KF5 A;  4NAO A;  1OPM A;  1HV1 A;  4Y3O A;  4I01 A;  3H7Y A;  4NIA A;  5C7G A;  4ZS3 A;  2Q1F A;  1W9W A;  2QQP A;  1IS3 A;  4B7K A;  4J25 A;  5BNP A;  4PDW B;  1QH7 A;  3SXW A;  3BOD A;  4XAC A;  3VDA A;  2D5F A;  3N36 A;  3WZ1 A;  4L0P A;  3AP5 A;  2MPF A;  2BGO A;  5FP3 A;  1R1A 2;  4UYB A;  3HQU A;  1U12 A;  3VD3 A;  5IT6 A;  4JKL A;  1GKB A;  1WCD J;  4XAA A;  1H4H A;  1JUH A;  1QJU 1;  1W39 A;  3LAG A;  4IV1 B;  3CBN A;  1XE0 A;  3VKO A;  5F37 A;  2B39 A;  1YIF A;  5A3O A;  1H30 A;  5DG2 A;  5FP8 A;  1I9R A;  5FCC A;  5FFO C;  2DVA A;  3WNP A;  1OH4 A;  2BNM A;  2RMU 2;  1UX7 A;  3RPQ A;  3OG2 A;  4GB3 3;  4JGZ B;  3AXD A;  3JUU A;  3OBT A;  4C0B A;  3U75 A;  1N1T A;  2YC4 A;  5DAP A;  2B5H A;  3POY A;  5FP9 A;  4JVA A;  3FLP A;  4QX8 A;  3E5Q A;  4YGC A;  3FUO A;  2HWF 2;  5FUP A;  2R07 3;  2V5D A;  2OZ6 A;  3VHN A;  3PIJ A;  4GMP 3;  3ES1 A;  3TEW A;  2VUL A;  1W8T A;  2VH9 A;  3TN9 2;  2OVU A;  1QOO A;  1WZX A;  3LZZ A;  1J84 A;  1AJO A;  1AR6 1;  2HKX A;  3U78 A;  4L2N A;  4CEW B;  4YG0 A;  1MS4 A;  3T0D A;  4XF3 A;  2GC3 A;  5E8A A;  1DBN A;  4CU6 A;  2AEY A;  1KJL A;  5KHI A;  1JOB A;  3AYC A;  3HWJ A;  4RR3 C;  1MS8 A;  4ZZ5 A;  3OF1 A;  1QQP 3;  3POS A;  2BGC A;  4FOW A;  4N90 A;  4XMI A;  4OQ9 A;  3N9O A;  1TMF 1;  4Z82 A;  2ZEZ A;  1WD3 A;  4IV3 A;  1DQ1 A;  4P9G A;  4MYE A;  1KFU L;  1MEC 3;  4WM7 C;  5CA6 A;  3VDD A;  3H7J A;  4YW1 A;  3QCW A;  2YBS A;  2ARE A;  1RHI 1;  2RS1 1;  1VBC 3;  1BJQ A;  3A0K A;  3L2Y A;  3S6P A;  3RWK X;  4DFS A;  3VZM A;  5FMD A;  4EN9 B;  4CCO A;  5IAX A;  1MVE A;  3K3N A;  4ZU7 A;  1A3K A;  2HWE 1;  4IEX A;  4YZ4 A;  2VXJ A;  3KSC A;  3NNJ A;  3KS7 A;  2VC9 A;  4IER A;  1W8F A;  2JIC A;  3THD A;  4BIS A;  1FV3 A;  4U2A A;  5EIY B;  2ZMK A;  3KLS A;  1UL9 A;  5DDJ 1;  3MV1 1;  2XJR A;  1OLM E;  4YWA A;  4Q4V 3;  2E6V A;  5FO7 B;  3SIS A;  3A4U A;  1MS0 A;  1F4A A;  3RYP A;  2CU5 A;  4GIQ A;  2RR1 2;  1RB8 G;  5EWS A;  3ZSK A;  5BXX A;  5LWB A;  5FYH A;  1AYN 1;  4P9J A;  1FXZ A;  4NIH A;  3EXU A;  4NOT A;  4LO6 B;  1RUI 2;  2HBT A;  2ARB A;  3HN3 A;  3KVB A;  3NV4 A;  1S0I A;  1FNZ A;  1NAE A;  5JPM B;  3VDB A;  1RUG 2;  4XDP A;  1PX3 A;  1VBD 2;  2WNU C;  1W8N A;  1WCK A;  4FOY A;  4MXV A;  3SH4 A;  5CG8 A;  1C8M 3;  4YW5 A;  1P8J A;  5FY7 A;  2VZO A;  2HWB 3;  5D8A C;  1S2B A;  4FPY A;  1ZBE 3;  3D8C A;  4BH9 A;  4UBH A;  1BXH A;  1BBT 1;  2WNV B;  4LMF A;  3AZW A;  1YYN A;  3BKZ A;  3PTY A;  2BZD A;  4JZR A;  4RQP B;  1U5Z A;  5BY5 A;  3LCP A;  2Y6F A;  3ZIX A;  2J1E A;  1QEX A;  2ZZJ A;  2ZX0 A;  1NZC A;  2Z4F A;  5IVJ A;  4QQO A;  4HK9 A;  4P14 A;  1FAY A;  1OKQ A;  3WNX A;  2QQK A;  3K75 B;  2NMN A;  3AP6 A;  2WBK A;  3OBR A;  4S2F A;  1N1S A;  3X29 B;  2RJ2 A;  2WSU A;  1VBB 1;  3J8F 2;  1NA1 B;  1QJX 3;  2BOJ A;  1GZW A;  2P6H A;  4CDU A;  5FZ1 A;  5TSW A;  4I2O A;  5FZG A;  4DB5 A;  1OHF A;  3CKH A;  4QXC A;  3M3C A;  1LR5 A;  2XUE A;  1V6O A;  3BIE A;  2YG0 A;  4AQ6 A;  1XQN A;  4NE9 A;  5A7W A;  1AVB A;  2E26 A;  2Y0O A;  1KS4 A;  4OUE A;  4XJU A;  1EPZ A;  1HRV 1;  1B09 A;  1US3 A;  1W8U A;  2E9Q A;  2PMW B;  4XQD A;  5E16 A;  3MIG A;  5GZF A;  1JOD A;  1W6Q B;  4IGQ A;  2IC1 A;  3FHA A;  4Y20 B;  2PLV 1;  3URF A;  4BLJ A;  2XBO 1;  1H0B A;  1OQD A;  3OTF A;  3THP A;  4QWN A;  1BEV 1;  3N7L A;  4FPH A;  2WR9 A;  1IZ3 A;  1RUC 2;  2VCA A;  3KGL A;  1PGL 2;  3OBZ A;  5C8C A;  4Q4W 3;  3S7I A;  3WX5 A;  1UOB A;  5A6Q A;  2RS5 2;  4OUL A;  3LA2 A;  4B4P A;  4W8J A;  1GQH A;  3RZG A;  1UQX A;  3WG4 A;  2GC0 A;  1OC1 A;  4JKK A;  1W6P A;  5EJZ B;  2W1Q A;  4DXS A;  2EAA A;  1RXG A;  3JU9 A;  4FFH A;  5A7O A;  3KQ4 B;  2V4V A;  3DF0 A;  1TNF A;  4MGZ E;  2BNN A;  3A21 A;  4CCE A;  1QF3 A;  1L3J A;  2Y6K A;  2LS6 A;  2JWP A;  2VZU A;  3CL1 A;  3WDX A;  3LB9 A;  4Y24 A;  5F5Q A;  4MX3 A;  4B4Q A;  2BBA A;  1UPS A;  2W46 A;  4NJ4 A;  4XJZ A;  2OQ7 A;  3I54 A;  4JTN A;  1V6I A;  4DUV A;  2JDY A;  1L7R A;  3DCQ A;  4QKF A;  5AFE A;  3ZXG A;  4AL9 A;  5L73 A;  1U5I A;  1KD7 A;  1W05 A;  3NNM A;  4PBP A;  5FO9 B;  4W65 A;  1UAI A;  2WLQ A;  3KCC A;  5T54 A;  4AZZ A;  1CAW A;  1YUD A;  5T5O A;  2JIG A;  2WUH A;  3VBF A;  2FDJ A;  2VD7 A;  2QQM A;  4ES8 A;  1VRH 3;  5H9R A;  1LTE A;  4NRM A;  4CSW A;  3S57 A;  3BTY A;  3UJO A;  1DZR A;  3OEA A;  4E4S A;  5A1F A;  3E5U A;  2RM2 3;  2F6B A;  2XKO A;  1EV1 3;  1APN A;  1H8V A;  2QTW B;  3ZSE A;  3VN4 A;  2XGX A;  5FZI A;  4QB2 A;  4XQ4 A;  5BV6 A;  1I3H A;  5ABJ C;  3RZH A;  4FXK B;  3E97 A;  1D4M 3;  5CVR A;  1N47 A;  2PHT A;  4KGQ A;  4XF1 A;  4S2D A;  1IQA A;  4WBB A;  4B1L A;  3FBY A;  4HON A;  4QM8 A;  4QQP A;  4RN5 A;  3SHR A;  4L92 A;  1R1A 1;  4DXR A;  1KS5 A;  1H6Y A;  3N7K A;  1O8P A;  4PDW C;  2VMF A;  1JYC A;  2O0O A;  4ES9 A;  5IAT A;  2ZZQ A;  4M0H A;  5F2W A;  1SDD B;  3BCW A;  4ZON A;  1NCQ A;  5T52 A;  4A44 A;  2FDI A;  3AFK A;  1H8T B;  2RMU 1;  5T5J A;  4A6S A;  5EYX A;  2KM2 A;  2ETE A;  1MVQ A;  4QPI B;  1R08 3;  1JOP A;  5EJ3 A;  2VVF A;  3HIF A;  2VQA A;  3J9S A;  1FI2 A;  3PUS A;  1GOF A;  2ADE A;  4GB3 2;  4Y5Z 0;  3GGL A;  4HPK A;  1YFY A;  5GZG A;  4FPJ A;  1YEW A;  1H2L A;  2HWF 1;  2ZEX A;  4JGZ C;  1LEM A;  1X7N A;  1AR8 2;  1ZZ6 A;  1MZE A;  3OYW B;  1W2N A;  4RYD A;  4AGG A;  4C91 A;  5C9A A;  5FYS A;  2G9F A;  1OA3 A;  4Y4Y A;  2QQI A;  4IGO A;  5F5A A;  5FMB A;  1A8D A;  1CAX A;  4IND A;  2R07 2;  2XJS A;  3LGR A;  3APB A;  3TN9 1;  1NUK A;  3OGJ A;  2A1X A;  2J42 A;  3RMX A;  3WW4 A;  5J3U A;  1LRH A;  3D4K A;  3GZE A;  4FPF A;  3N35 A;  4ORF A;  4HAN A;  1EAH 3;  1ND3 B;  1WLT A;  3NJZ A;  3POJ A;  3O0X A;  4AQT A;  1POV 0;  3UKV A;  1ZBA 3;  3U10 A;  2AH2 A;  4Z2W A;  5AVA A;  1TZO A;  3GJA A;  4HVR A;  3F95 A;  1JXN A;  2X53 S;  5ANN A;  1KEX A;  3AX4 A;  4CEW C;  1O3T A;  1QQP 2;  5DAB A;  3MW3 A;  5SV5 A;  3WQ0 A;  4RR3 A;  1TG7 A;  4Q1R A;  2ZX3 A;  5LA1 A;  5LAT A;  1MEC 2;  4NAM A;  1LJ7 A;  4ATF A;  1BK1 A;  1VBB 3;  4GWM A;  3I2H A;  3USU A;  4CU7 A;  1G9F A;  1VBC 2;  2GNM A;  4XJW A;  3VBS B;  3WUD A;  1ULD A;  2NQY A;  4FPC A;  5HBA A;  2PTM A;  5LK5 A;  2JE9 A;  3FX3 A;  5FZ6 A;  3ZYH A;  4XTP A;  1FT9 A;  3GNE A;  1N1V A;  2V09 A;  1FOD 3;  1G86 A;  4P9I A;  3U14 A;  1HB3 A;  2O8Q A;  3VHP A;  1NQJ A;  2HH9 A;  1QXJ A;  2FZ1 A;  2BJS A;  2RR1 1;  3PJY A;  1ONA A;  1JN2 P;  1SAC A;  1W99 A;  5LK7 B;  3BYW A;  3JD7 2;  1Y43 B;  3BIW E;  4HXC A;  4IW3 A;  2D3S A;  4RHV 2;  5FOJ B;  5CG9 A;  4Q4Y 1;  4MVT A;  1T2X A;  3M3E A;  1RUI 1;  3NNG A;  1UNB A;  2OX0 A;  1BEV 3;  5DQ0 A;  4RGA A;  3DYM A;  3MIB A;  3TRS B;  4PQ9 A;  3DXT A;  1REF A;  1RUG 1;  3MHZ A;  1WMD A;  2DU0 A;  1VBD 1;  2JEC A;  2P3K A;  2YYO A;  1POQ A;  4R9A A;  2FD8 A;  4ISQ A;  4L97 A;  4NHX A;  5JR2 A;  5FYU A;  1BMV 2;  5FRE A;  3MZH A;  4CDQ C;  1C8M 2;  2HJI A;  2ZGM A;  1W0P A;  2RS3 2;  2WT1 A;  3T4H B;  3VZN A;  2HWB 2;  5H9P A;  2JDH A;  2GSY A;  1ZBE 2;  3M70 A;  4DEQ A;  4JDO A;  4CDX A;  5IVY A;  1AR7 3;  5D8A A;  4AAP A;  4YYO A;  5FMO S;  3H8R A;  3P6B A;  3KV6 A;  2WNV C;  3LOI A;  4RQP C;  2WYF A;  4M00 A;  5AFB A;  2ZAH A;  2D5H A;  1DYK A;  5D1I A;  1LHV A;  4IES A;  1GZC A;  2ET7 A;  3HN1 A;  3J8F 1;  4NRQ A;  4Y1U A;  4A4A A;  5LCW L;  3HD8 B;  2YU2 A;  4QPG B;  4UBG A;  3OY8 B;  1YWK A;  2EIE A;  4A45 A;  4BYY A;  2PHR A;  3IDA A;  1E57 A;  3TEY A;  2BUK A;  1QGL A;  3R4S A;  3IAQ A;  1QJX 2;  5F3G A;  3AK0 A;  3NMB A;  1VAV A;  4LQR A;  1S2E A;  1FNY A;  1NA1 C;  4XYX A;  5K0U B;  5A7P A;  5JDB A;  2DTY A;  3AFG A;  4HBN A;  4M3C E;  4MET A;  3QAC A;  5CIR A;  4A7Z A;  4ARX A;  2XLA A;  3MF6 A;  3ZSL A;  3DEM A;  2WS9 3;  5CEH A;  4KWU A;  3I2I A;  4E27 A;  4DUX A;  3LQC A;  3I2D A;  2PEL A;  3PL0 A;  3ES4 A;  1EYB A;  4AW7 A;  2NN8 A;  4FTB A;  1RUC 1;  3K2O A;  3JQX A;  1RTV A;  1PGL 1;  4XBN A;  5LEJ A;  2GNT A;  4Y22 A;  2VG9 A;  3ZN5 A;  5KBF A;  1G9C A;  1DIW A;  2VGD A;  5FZL A;  2ZMN A;  1ZA7 A;  4ET7 A;  1N3O A;  2RS5 1;  4Q4W 2;  4Q26 A;  1S2K A;  3CNA A;  5FYI A;  1R1A 3;  2X29 A;  5G05 L;  4HZF A;  5DZG A;  1JHN A;  2Y6G A;  1C5H A;  2C4X A;  4R9B A;  1PMH X;  3BTX A;  3FFZ A;  1J59 A;  2IVI B;  2XML A;  1I6X A;  4LBO A;  2FDK A;  3GHM A;  1Y4W A;  3U4S A;  1W2A X;  2J7M A;  3WIN E;  4AVB A;  2EF6 A;  2OZJ A;  2ZEW A;  2GC2 A;  1X9P A;  2RMU 3;  4TN7 A;  3RS6 A;  2A5Z A;  4BA6 A;  1RUF 3;  3BU7 A;  3S5A A;  3LOB A;  5FV3 A;  5HCB A;  1WCQ A;  3NJX A;  2R06 3;  1GP6 A;  1W6M B;  1COV 3;  3CZU A;  5FZC A;  4C0H A;  4OYU A;  3O5S A;  1SLL A;  2DVG A;  3SQO A;  1DHK B;  2PHL A;  2VVD A;  4XZU G;  1JMU B;  3B9C A;  1PIV 3;  3LKJ A;  4QX0 A;  4XF0 A;  5I0U A;  5GAL A;  3H8U A;  3TOJ A;  2XKP A;  3J7M A;  1PZ9 A;  3L2H A;  4Q4X 3;  2YHJ A;  1U5X A;  4QPY A;  4UW6 A;  2W91 A;  4Q5O A;  2R04 3;  4IEZ A;  2CSG A;  2JD4 A;  3V0A B;  3TN9 3;  3GAL A;  2WAO A;  3GM8 A;  1XYO A;  2XG3 A;  4PJY A;  2CGP A;  4BXS V;  1VRH 2;  5FWJ A;  2BW8 A;  5FJH A;  4GA9 A;  2JDZ A;  1CON A;  4XFC A;  2IXH A;  4WM7 B;  4IE5 A;  1GNY A;  3WHU A;  2RM2 2;  1PGW 2;  3SKJ E;  4A42 A;  4UF0 A;  1S0F A;  4XZP A;  1J3P A;  1EV1 2;  1QWR A;  4QX5 A;  3ZXJ A;  4HKO A;  3IPV A;  5FZ0 A;  5KXD A;  1DGL A;  3K46 A;  1K5M A;  3ZFF B;  4QX7 A;  1D4M 2;  4L8Q A;  1K3I A;  3K77 A;  4XF4 A;  1YFW A;  3BGA A;  2J22 A;  1HV0 A;  1GR3 A;  1KIT A;  1LOF A;  2XXZ A;  4D6Q A;  4BME A;  4P02 B;  4DO0 A;  5C5U A;  1PMI A;  2VOX A;  3DXU A;  4JKM A;  4CE8 A;  3OBA A;  1NY7 2;  2Q1Z B;  4PHZ A;  2B9V A;  3RG0 A;  2GME A;  4CCD A;  5AC9 2;  3SIT A;  1S0B A;  4RFT 0;  4PDW A;  4BE3 A;  4HG6 B;  4CU9 A;  1OQE A;  2QQN A;  5I8T A;  5KWR A;  2ENR A;  1Q5O A;  3POE A;  3WDY A;  4P9L A;  4GB3 1;  3POW A;  4ZZ8 A;  1R08 2;  2F17 A;  2WIN B;  5FOB B;  3G7D A;  2GAL A;  4CDW B;  4N43 C;  1A8M A;  1VBA 2;  1V9U 3;  2WWS A;  4IV1 A;  4MLO A;  2XHK A;  1AR8 1;  4QPI C;  4RD7 A;  3FBM A;  4QQH A;  1CGP A;  5DAW A;  2QZ3 A;  2CDO A;  4EYU A;  4EZ4 A;  2GH2 A;  4JDN A;  4AVT A;  2R07 1;  5JUV A;  2D3R A;  3R4D B;  1G9B A;  1ULG A;  4JGZ A;  5FZ7 A;  5KR7 A;  5FUN A;  2BDR A;  3I2O A;  3K4A A;  4B8E A;  5J98 B;  4UFK A;  2WT0 A;  1VAL A;  3G6J B;  5FDB A;  1Y7B A;  1O8S A;  1AX0 A;  4Q0P A;  3C7G A;  2EXK A;  5FUI A;  1OA2 A;  1EAH 2;  3POG A;  1GSL A;  1EUT A;  4MGI E;  2Y8K A;  5FZ3 A;  3BTA A;  1ZBA 2;  3V56 A;  3O1S A;  4HOO A;  1QQP 1;  1C57 A;  2GNB A;  4CEY B;  1ZRC A;  1ND3 C;  3O0W A;  3UK9 A;  3GHN A;  4GJY A;  1YQ6 A;  3KVA A;  3C3V A;  1MEC 1;  5CFC C;  3NWK A;  5FZ4 A;  1XNA A;  3GZA A;  5JSP A;  1QJZ A;  1SLT A;  4PF1 A;  2DYC A;  1VBC 1;  4LBQ B;  3IWZ A;  4CEW A;  2X10 A;  3IMN A;  5HCF A;  2BEO A;  2VVE A;  1JH5 A;  4QM9 A;  2Y33 A;  4ZS2 A;  4XFH A;  1GWK A;  4YSF A;  5FQ0 B;  3Q8C A;  1UMI A;  1ENQ A;  3DGT A;  4V1P A;  4Y1Y A;  3OD0 A;  2WZE A;  4LUM A;  4UFL A;  2GAU A;  1PHM A;  4P5H A;  1QDO A;  4S2H A;  1W3V A;  3MFA A;  4LO7 A;  5FXZ A;  3HQX A;  5JIU A;  2ZML A;  5JXG A;  1ZRD A;  1FOD 2;  1O7F A;  3JD7 1;  3I59 B;  4RHV 1;  4AK3 A;  1RUD 3;  3A7Q A;  3CQO A;  1PZ7 A;  3AZX A;  1DGW A;  3M4F A;  3MBW A;  4YM2 A;  1GUI A;  3BB6 A;  4OHZ A;  3WW1 A;  3GBG A;  5EZW A;  1D0G A;  3VBO B;  1PO1 3;  1E5I A;  1NQD A;  1AR9 3;  4QU1 A;  3ZVX A;  3GZT B;  1PZ8 A;  4CVU A;  1IS6 A;  1RUC 3;  1LES A;  5CFD C;  2JDU A;  1N3P A;  2X8K A;  3ILF A;  1ULC A;  4KWL A;  4P9X A;  5F3E A;  2XPJ A;  3J4U H;  5IK4 A;  2W5F A;  3WDU A;  4TZD A;  1SEF A;  1BMV 1;  1XU1 A;  3POF A;  3WW2 A;  1YCI A;  3VUO A;  1C8M 1;  1OD5 A;  3ZFG B;  1KJR A;  3UNP A;  2RS3 1;  2HWB 1;  5JSR A;  1ZBE 1;  5HPO A;  2GDF A;  2VUJ A;  3JBG 2;  1CIW A;  4DY3 A;  3WY6 A;  1L7Q A;  2JDK A;  1SFN A;  4EN8 B;  1AR7 2;  2CHH A;  1CN1 A;  4LE3 A;  5A32 B;  2D44 A;  3ZFE B;  4A2U A;  4AI0 A;  4OUS A;  4D7Y A;  4CUA A;  4BJ0 A;  2LAL A;  3VD4 A;  3SLI A;  4AHY A;  2DCY A;  1AYM 3;  3BAL A;  2Z69 A;  2PYT A;  2WNV A;  4QHZ A;  1VE0 A;  5C3O A;  4NN0 A;  4EZH A;  5J37 A;  1N3Q A;  4RQP A;  4IE4 A;  5FBZ A;  2TUN A;  5I8Y A;  1QJX 1;  5CZK A;  4XC9 A;  2JE8 A;  5JXH A;  2Z79 A;  1NLR A;  2RDN A;  4FFG A;  5FZA A;  5LRR A;  3H3U A;  3VBH C;  2UYA A;  4AI1 A;  1XSQ A;  1ASJ 3;  4QPG C;  4AVC A;  3VLB B;  2XJU A;  3WG2 A;  2G9Z A;  2KR2 A;  4L11 A;  4S2G A;  2B46 X;  1UF2 C;  1HB2 A;  2B8M A;  2UU8 A;  4D6S A;  4NHL A;  5FO8 B;  2UWB A;  4XUQ A;  1LNS A;  2OUH A;  2Y0I A;  2ZHM A;  4I09 A;  2PHD A;  2EID A;  2TBV A;  5K0U C;  5ABJ B;  2WS9 2;  3A22 A;  3EMR A;  2QJV A;  2ARC A;  3M3O A;  3EB7 A;  4B4R A;  1WA6 X;  4H3W A;  4XFA A;  1ND2 B;  4C90 A;  2VAU A;  3KV9 A;  2IXC A;  2L9L A;  3DPR C;  4M0N A;  1DGR A;  4QXK A;  1XU2 A;  2ZGT A;  4CP2 A;  2WO7 A;  3UT0 A;  2P3I A;  1VMH A;  4OMD A;  1SZB A;  2JG8 B;  4KG0 A;  2PA7 A;  4Q4W 1;  4Y20 A;  1CAV B;  2D3P A;  1CR7 A;  2X09 A;  3WNL A;  1DCS A;  1Q3E A;  2QVS B;  3NJV A;  4FO9 A;  2IFW A;  4G9S B;  4EWD A;  4ZHN A;  3HJR A;  5KHG A;  5GZE A;  2RV9 A;  1RED A;  3PUQ A;  1UOJ A;  3Q8E A;  4NHK A;  4LHS A;  3IM0 A;  1Q8S A;  2ZCW A;  4LOT A;  2FDG A;  2VZ3 A;  2EXI A;  4NO4 A;  3O1O A;  4TLG A;  4EN6 B;  1RVF 2;  3HOB A;  4A6O A;  1QXP A;  1YQ2 A;  2R7E B;  3SNM A;  1DLL A;  5HCA A;  4MGT A;  1RUF 2;  1V6M A;  3H50 A;  3WF3 A;  2R06 2;  3KCX A;  5GZC A;  1COV 2;  3PUR A;  2PHX A;  3T08 A;  3PHM A;  1AR8 3;  3AVR A;  2C5D A;  2Z42 A;  2RDR A;  5CYY A;  1PIV 2;  3HT1 A;  2R32 A;  1ZZB A;  4LK7 A;  1S0J A;  1IG3 A;  2HYK A;  4Q4X 2;  1W90 A;  3AL5 A;  4UFM A;  3ZYJ B;  2C6S A;  2UYB A;  5IK5 A;  2R04 2;  3WNO A;  1TME 3;  2A3X A;  1VRH 1;  2GH8 A;  3LDR A;  3SCF A;  4JQT A;  4NMI A;  3GJB A;  4BIO A;  3D0J A;  2FMD A;  4B7E A;  1S0D A;  3VBU B;  5GLV A;  3DUI A;  2R6Q A;  2RM2 1;  2Y6L A;  1PGW 1;  4HN1 A;  4AHX A;  3OPT A;  2RVA A;  5LBB A;  5CIS A;  1EV1 1;  1DGW X;  1J1T A;  4IXL A;  1C4R A;  2QUO A;  2B9U A;  2XR4 A;  3OPZ A;  2D93 A;  1IS4 A;  2I74 A;  2VOT A;  4KU8 A;  4UW5 A;  3RFR A;  2VUA A;  4R8H A;  5B2G B;  4NIG A;  2DV9 A;  1CPM A;  1D4M 1;  1WLW A;  3CJX A;  3UKT A;  1B35 A;  4FSJ A;  2EVX A;  2FDH A;  5FPA A;  5CKN A;  3BOP A;  5LEK A;  2WL1 A;  2QQV A;  3DV8 A;  2MHF A;  2H6B A;  4GAZ A;  4QB1 A;  4BOW A;  1NY7 1;  3ZFF C;  5AC9 1;  1C8N A;  1XNB A;  2O1Q A;  4K1Z A;  1AHS A;  2VMH A;  4HK8 A;  3SEP A;  4MSV A;  2PXJ A;  3T2Q A;  3OGV A;  1LED A;  4XCA A;  4OLL A;  1KFX L;  4YM1 A;  4D6R A;  4JC1 A;  3JD7 3;  1VP6 A;  4RHV 3;  2UWC A;  5LBC A;  1R08 1;  1UY1 A;  3BU0 A;  5FYB A;  4YZ1 A;  4COY A;  4AOC A;  5DAX A;  1W03 A;  1LUL A;  4HSJ A;  1VBA 1;  4K6B A;  3U37 A;  3WNM A;  4NII A;  2B4K A;  4DXZ A;  4XCB A;  5JCT A;  1SFP A;  1S0G A;  5CBL A;  5JMO A;  1LB2 A;  1V9U 2;  3WG1 A;  4CCC A;  5A33 B;  4GZ9 A;  4CDQ B;  1H8T A;  4CDW C;  4CP1 A;  4QB6 A;  4CRQ A;  4LOR A;  5FZ8 A;  1JYI A;  4QPI A;  4HN0 A;  1WD4 A;  2AC1 A;  2WNO A;  3KV5 A;  3AJY A;  1US2 A;  1TNR A;  2K46 A;  1PM4 A;  2W95 A;  1YC6 1;  2WDB A;  2XJP A;  5GKA C;  5LB6 A;  5A6Z A;  5FPU A;  3UV9 A;  1RIR A;  3ZOI A;  1QKQ A;  2ORZ A;  2RS3 3;  3LE0 A;  2W3J A;  4K7J A;  3OB8 A;  4JCK A;  4UFI A;  2P34 A;  4AQ2 A;  1RJ8 A;  1EAH 1;  3OYW A;  5IUQ A;  4LLF A;  3E6C C;  2OII A;  2NYY A;  1C5I A;  1ZBA 1;  1XXN A;  3VD5 A;  1DQ6 A;  5JAX A;  4DIN B;  2WWU A;  4G4F A;  5DAQ A;  3FLT A;  5BNO C;  5JI9 A;  2RDQ A;  1WBL A;  1O3S A;  1NXD 1;  3RI9 A;  3CF6 E;  3HAG A;  3J7N A;  2QKD A;  1NE6 A;  3QD6 A;  4YGE A;  3NKT A;  2YC2 A;  1XJA A;  1ND3 A;  5JWP A;  4CEY C;  1MZ5 A;  3C2U A;  4TYS A;  4O9E A;  1OF4 A;  2RDS A;  1ODN A;  1RMU 3;  3CU7 A;  4BQW A;  3ZXL A;  5IVF A;  1G6N A;  1OVS A;  1Y9G A;  1NX9 A;  3AKQ A;  3JCI A;  2UWA A;  3KT1 A;  5A1A A;  2WYS A;  2NM1 A;  2TNF A;  4AXO A;  4HFS A;  2E7T A;  4LOS A;  4RGK A;  4WM8 A;  5G04 L;  3SCG A;  5DZF A;  2GP5 A;  3GBW A;  4H7L A;  1FOD 1;  4QQ2 A;  1RIN A;  2NMO A;  2ZGR A;  5FY1 A;  4DY5 A;  1JUI A;  3FFQ A;  4QT6 A;  4EN0 A;  4BQY A;  1LOC A;  3FHQ A;  3WV6 A;  4V2V A;  2BWC A;  2IWG B;  2YGL A;  3H3L A;  1RUD 2;  3VBS A;  1LHW A;  1PVC 2;  2GMM A;  1CAU B;  1GNZ A;  4JTO A;  5FWE A;  5L9B A;  5FPZ A;  4MGS A;  3O7O A;  3VGI A;  1PO1 2;  5CKM A;  4ZU4 A;  4OI4 A;  1UYY A;  2Q8E A;  1AR9 2;  1FMD 3;  3Q8B A;  5J7M A;  5KXE A;  1VPH A;  2J1R A;  4JGY C;  5JOY A;  5C4W C;  2BVV A;  4NRO A;  4WVV A;  3R6S A;  5EYY A;  3VBO C;  1RYY A;  1UU6 A;  3R0R A; 
#chains in the Genus database with same CATH homology
 3ZDV A;  2WRA A;  5A6Q A;  5A70 A;  2JDU A;  4CE8 A;  2JDP A;  1OVP A;  1UQX A;  2VUC A;  2BOI A;  4AOC A;  1OUS A;  2XR4 A;  2BV4 A;  5A6Y A;  5HCH A;  2BP6 A;  5D2A A;  1OUX A;  1W8H A;  2VNV A;  1UZV A;  1OXC A;  2JDK A;  1OUR A;  2JDM A;  2WR9 A;  2CHH A;  2JDH A;  2JDY A;  2BOJ A;  3DCQ A;  2JDN A;  5A3O A;  5A6Z A;  1W8F A;  4UT5 A;  5A6X A;  1OVS A;  2VUD A;  1GZT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...