2JDKA

Lectin pa-iil of p.aeruginosa complexed with disaccharide derivative
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
114
structure length
114
Chain Sequence
ATQGVFTLPANTRFGVTAFANSSGTQTVNVLVNNETAATFSGQSTNNAVIGTQVLNSGSSGKVQVQVSVNGRPSDLVSAQVILTNELNFALVGSEDGTDNDYNDAVVVINWPLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FUCOSE-BINDING LECTIN PA-IIL
publication title X-Ray Structures and Thermodynamics of the Interaction of Pa-Iil from Pseudomonas Aeruginosa with Disaccharide Derivatives.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Lectin
total genus 20
structure length 114
sequence length 114
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07472 PA-IIL Fucose-binding lectin II (PA-IIL)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.400 Mainly Beta Sandwich Jelly Rolls Calcium-mediated lectin 2jdkA00
2VUDA 2WR9A 2BOIA 5A3OA 5A6QA 5HCHA 5D2AA 5A6YA 2JDNA 1OVPA 2BOJA 3ZDVA 1OURA 1OXCA 5A6ZA 1W8HA 2CHHA 2WRAA 1GZTA 2JDKA 1OVSA 2BP6A 2JDHA 2BV4A 2JDPA 2JDMA 5A70A 1UQXA 1W8FA 4CE8A 2VUCA 1OUSA 5A6XA 4UT5A 3DCQA 2JDUA 1OUXA 2VNVA 2JDYA 2XR4A 1UZVA 4AOCA
chains in the Genus database with same CATH superfamily
1OI6A 1ZBE1 4LBKA 5DDJ2 2ZBJA 5C6CA 1V6MA 4UW5A 2ZGUA 2EXKA 2V09A 1VALA 3I2FA 2QDRA 5FY7A 5CBLA 1QQP1 1AYM3 2ZGTA 4KU7A 3SISA 5JLVA 2ZEXA 1W2TA 2WT2A 1XQNA 3FBMA 5LATA 5DUVA 4GKXA 4XFBA 4GXLA 3KCCA 1HXS1 1MZ6A 3HJRA 3A7QA 5E89A 1VP6A 3UKNA 1A3KA 3ZXLA 3D5OA 5A3UA 1V6LA 1POQA 3ZSJA 3H1MA 1UU5A 4FPEA 4NWVA 5C33A 2WA3A 2Q4SA 4CUCA 1AX0A 3GBFA 2DU1A 4QDSA 3MFAA 2XVLA 2PMWB 2HEYF 3LEIA 4YWAA 5FPUA 3N3HA 5JR2A 5EYYA 4YFWA 4H7MA 3FLTA 4XF1A 4I01A 5FJKA 1G9DA 4Q0QA 5C5TA 3NQHA 3WUCA 5C3RA 4GB31 2AEYA 5L7OB 1GLHA 1NZIA 1H9PA 1VBD1 2RMU3 3JD71 1BVVA 3EXUA 3B00A 4UW4A 1IQDC 4CP2A 5F39A 4F8AA 4OZXA 1AX2A 3VZLA 4CDWA 1Y7BA 3HMYA 2VZ1A 3SCGA 4UWDA 4RFRB 3H8UA 1R64A 2EIBA 5JOWA 1GNZA 2XHKA 4OMDA 1TME2 1RUD2 3LSDA 3LA7A 4R9BA 3TWIA 1R083 2OVUA 5DAWA 1QJU3 3N9LA 4ZU5A 4LBQD 4NOTA 3O1SA 1AXZA 4Q2FA 4YW4A 3ZDSA 1UMIA 4MXWA 4AAPA 2Q5TA 2VH9A 4PLNA 5JSOA 2VCMA 4Y33A 2VULA 2E53A 2E7TA 3NKGA 3RZKA 4MLOA 1OBNA 2WR9A 3OF1A 1MZEA 2WO7A 3KCYA 1ULDA 4R9DA 4UAPA 4AVSA 1K3IA 2QQLA 2MHFA 2IFWA 1BBT3 5LA2A 1UY1A 2PLV2 1ACCA 2YFUA 1J3PA 2D6MA 4PHZA 1G86A 3C3VA 3E5QA 4RL7A 4CDXA 1PGL1 4ZS3A 4O65A 4EE2A 5FZKA 3POEA 2UWBA 2AUYA 3ZFFC 5GZFA 1YFUA 3BOPA 1W2NA 1EV12 2QQMA 3KV5A 2F6BA 4CSWA 4YSFA 1PVC3 4WV8A 2NM1A 2GC2A 1R091 5BNQA 3KHBA 1I9RA 2JXAA 3U4SA 5FDBA 3BTZA 1MVQA 3VKLA 2QQUA 5FCCA 3EBRA 3WX5A 2L9LA 4CDWB 4TSVA 3UT0A 2GC3A 1OKQA 1T2XA 1PNGA 3CEWA 1POV0 2BQPA 4QT6A 1SHWB 1RUI2 2R0FA 3ACFA 4M4RA 4Q4X3 1VBA3 4P9YA 3L2YA 3ZFGC 4GWMA 1U0AA 4URTA 5JI7A 3WP3A 3RZZA 3ZFEC 3BIWE 3OOXA 2OZ6A 4PQQA 1ZA7A 4CXWA 5HXVA 2DUPA 1OFNA 2VUCA 4MXWB 5FMOS 4JV4A 4XJAA 2Z69A 4E27A 4YM0A 2VTFA 4LPLA 2P37A 3ZSKA 3KT4A 5GZDA 2Y38A 2YC4A 4EN8B 5K4LA 3ZKYA 5EJZB 3RI8A 4AGVA 1UY0A 3P3NA 1V0AA 3D4KA 2YHJA 5JXIA 1W8NA 2JICA 5LK7B 5JSPA 1DLLA 4DNYA 4PIXA 1CIWA 4IXLA 3KVBA 3CKHA 4LHLA 4NUBA 3WVJA 4RHV3 4XURA 5EJ1B 1RUE1 4CDXB 5ACA2 1W0OA 1MEC3 3WW3A 3K4AA 4JDNA 2Y64A 5FIXA 1HX6A 1JOBA 2VM9A 1OC1A 3VD4A 1W06A 1SLIA 1VMJA 4MGTA 3A0KA 3ETPA 4AVAA 1AYN1 2WNUC 4BDVB 5LY2A 1N1YA 2ZX0A 2BTVC 3ORJA 2WNOA 4QM9A 3J8F2 4W65A 3PIGA 2WZR3 4YG0A 3KV4A 5FZGA 4Y1VA 1UYYA 2BZDA 4QKBA 3SEEA 2WNVA 4YVSA 4MVTA 4HVOA 4B7KA 5FZOA 1RIRA 3S5QA 2IXLA 2WLPA 3IAQA 4Q26A 5CVRA 4QDRA 1PO13 4FFHA 2W9XA 2VE1A 4PF1A 2PFWA 1TVGA 2W87A 3AJZA 3CJIC 3ENRA 3ZFFA 4Z07A 2LM3A 1DGLA 5FO9B 1GYKA 1QJX3 1ULOA 4DY3A 1QEXA 3B94A 3MBWA 2QQWA 4KGQA 3NJXA 5CNAA 3VGIA 3VD3A 2R072 5AC91 4MXVA 3ES1A 2Y33A 1RVF2 3ITQA 4COVA 4QPIA 1GNYA 5JOYA 1COV3 4NPLA 3SNMA 2BBVA 2QQOA 2Z5WA 2QE3A 3MEPA 5DQ0A 4FBFA 1FOD1 1F4AA 2ZMNA 3WD5A 4HL0A 4BK4A 4COUA 1RYYA 3ALQA 3OBRA 3WW2A 4DMIA 2ZOEB 4JDOA 2VOWA 3ZYPA 4XDPA 3ZX7A 4G9SB 3ZFEA 4WZCA 2W1WA 2IVIB 1HV1A 4DO0A 1C8M2 4Y22A 3LEMA 5FUNA 5EXOA 5A32A 1TMF3 2C6SA 1O3TA 2R042 5F3GA 4ZXKA 4NIAA 4C0HA 4DEVA 4Q8KA 3PMSA 2I45A 4EN0A 4LORA 4JGZC 1QDOA 4N9HA 4P5YA 4IQPA 3OGSA 3DEMA 1MR5A 1US3A 2WNVB 3E6DA 2W3JA 1VBE2 2WWUA 2AENA 3H0OA 4KGGA 5FZOB 1MS5A 2GMEA 2VGDA 3PJQA 1H30A 1AYM1 3A22A 1HDKA 3BCWA 1UZVA 3OD0A 4K6BA 3BYWA 2WZPP 1UOJA 3F95A 2P34A 4O9EA 2JDAA 2VAUA 3ZFFB 4DOUA 4YFZA 1ODMA 1LRHA 2KA3A 2H6BA 3ZN6A 2WNUA 4H14A 4IDZA 4IGPA 4BQ1A 1QHDA 1DYOA 3GHMA 1JN2P 1UIJA 1OQEA 4KH9A 3O1UA 1JYIA 1J84A 1RUNA 1FPN3 5JWPA 4IEXA 5FQ0A 1GQPA 3AL6A 3AZYA 4JHZA 5F5IA 5JOZA 1V6JA 2WLQA 3LEGA 3OCPA 4ASMB 2PAMA 1P8JA 1Q8VA 3DCQA 1OA4A 1WMDA 4XXAA 2FDGA 2ZGSA 1R1ZA 2ES3A 1LECA 2J1UA 3HEIA 2ZGNA 3IZOA 4IETA 1ENSA 4QQ2A 5FLJA 3UV9A 5D8AC 3VZKA 4MZUA 4QKFA 5IVBA 3ZFEB 4YZ1A 1CN1A 4Q1RA 4CTEA 2AC1A 4ZONA 4JZRA 5FZHA 2JB4A 1LCLA 4Y22B 1W6PA 1HRI1 2C9AA 4IUGA 4YM2A 5A32B 1QJY2 3ATGA 1SLAA 2GU9A 3R05A 2JDKA 1FYUA 1QJU1 2W0XA 1CWPA 2C5DA 2FDIA 2UYAA 3HR9A 3R4UA 3VLBB 4Y4RA 4QQHA 2D6KA 2IUWA 2VCAA 5FZEA 3LFIA 1PX3A 4EN6B 4XW3A 1GU3A 1VBC1 4BQXA 1TNRA 4FP3A 2ZHLA 2BRTA 2YFZA 4BU2A 4W50A 1S4CA 5I8YA 3NV2A 5DDJ3 2IC1A 1WA4A 2XR4A 5E1RA 4OI1A 4RGKA 3ZN6B 5FZBA 5L9RA 2WNUB 1DYKA 4LUMA 4JQTA 3BU0A 2OT7A 4OUEA 1IG0A 4B4RA 1Y9MA 3AFGA 3V56A 2AH2A 1XNAA 2ZABA 4I30A 3ECQA 2JD4A 1PVC1 4AEKA 5FXZA 1RUH2 2MEV2 2E31A 1NY72 1L7LA 3AL5A 3PJYA 1HJGA 2CAUA 2ZKLA 1MS8A 3BUCA 4HETA 1F35A 5ANQA 3W5MA 3CJIB 3OPZA 3RFRA 3TEWA 2KD7A 2R30A 2QVSB 1W6PB 4Q4X1 3UESA 2XWBB 3QACA 5DN2A 1I5PA 1TZOA 4FPOB 4QB6A 1NT0A 4FFIA 1VPHA 5L19A 1AR93 3N9PA 3RDIA 3L9JT 1OXCA 3O0WA 3OGGA 4QX1A 4RSUA 4P5HA 1TEIA 4X6QB 1ZRCA 1AJOA 1TME3 1WCKA 3FUQA 1JYWA 3JBG2 4LK7A 5D8AA 2YBKA 4PBPA 3BKZA 5CKQA 3PIJA 4XAEA 1NCQC 3GBGA 3UKTA 4L9BA 4N7IA 4LXLA 5C70A 5F9TA 4N8MA 1MEC1 4KNCA 3N9MA 3VBUA 4A41A 3OBZA 3HN3A 5C71A 3I3DA 5EFUA 1XNCA 5AFBA 1DIWA 1SEFA 2VZ3A 4QD2A 3BPSA 4B29A 3ZYFA 4CYDA 3WDUA 2PLV3 4XUPA 1YO8A 4I0WB 3EJKA 3SITA 5L36A 3ZN5A 1JODA 1QJEA 2GAUA 3JXSA 1UY3A 3LPFA 3CMGA 2WZR1 2BV4A 3KLSA 5EPAA 3MF9A 1A34A 3AVRA 4QB1A 4XAAA 1IS5A 2QBXA 3BTAA 3KVAA 5E8AA 1EV13 3WF0A 1CAUA 5FP3A 5FKCA 4LKSA 3WHTA 4BJ0A 1IOAA 2A3YA 4ASLA 4BXFA 1OKOA 5LA0A 4R8HA 1AR82 1PZ9A 3ON7A 3E6CC 3ILRA 4FO9A 2PQQA 1WMXA 2BYVE 3EB7A 1H0BA 2J1TA 1QJX1 4FCAA 5T3NA 3VZJA 3WQ1A 2ZKNA 3W9AA 2XUMA 1RUI3 1YNAA 4B7EA 4CCJA 2XQRA 3L2HA 4U2AA 3K75B 3H3ZA 3VBRC 5A3PA 1BQPA 1ND3C 4CA9A 1OD3A 2D43A 2JDHA 5D8AB 1COV1 4S2FA 4OFGA 4AQ2A 3TEXA 1I5ZA 3P3PA 1PM4A 4M00A 4QX7A 3HPNA 4Z2AA 1GQHA 3ETQA 1DZQA 2P3JA 3AP6A 1DQ4A 2B42B 3POFA 2CWMA 1WLWA 2XOMA 2B4KA 3PDQA 1QDCA 5I91A 1IZ3A 3OD4A 4CU6A 2XG3A 4LKFA 3POWA 3J9SA 4DXTA 2VTXJ 2HBTA 3POSA 4E2QA 1GICA 2CNAA 3WNXA 1O91A 1K5JA 5ACA3 1W8TA 3T08A 4AHXA 2QQVA 4YM1A 5T55A 1YQ2A 2WYSA 4FP2A 4AI1A 4AI2A 3FZ3A 1CX4A 1Q8QA 2QZ3A 5A7OA 1NCQA 1IS6A 1CAUB 2WS93 3FFQA 3G6JB 2VQTA 4K3UA 4N43C 3RG0A 4DXZA 5K9YA 5JXHA 3MW3A 4XYXA 1SLCA 1UQXA 5ERLA 2RDQA 2DVFA 1NQJA 3ES4A 4DRVA 2RR12 2VMFA 4W4ZA 4LKEA 2Z79A 2XGXA 2BUKA 3LKJA 3DUIA 3N9OA 4KMQA 4BK5A 4IEUA 2RS11 3ROUA 4L0PA 2E33A 1RTVA 1RUC1 1HN1A 1YJLA 2E51A 4OQ9A 3K51A 1V9U3 3BIEA 1J59A 1EY2A 1H2NA 1N3QA 1V6KA 2VQ0A 3RQ0A 5LASA 4XBNA 1F8VA 1Z7S1 2BFUL 2WRAA 2WBKA 5FMDA 1BBT2 2VZVA 2A5ZA 1NXD1 2ZZQA 2FMDA 3DXUA 4CCLA 3DYOA 4GWJA 1VB4A 1RVF3 1D4VB 4FI9A 4OI2A 1GNHA 3TB0A 4JVAA 1KJLA 3P6BA 1W6OB 1Q8OA 2ATFA 3S0MA 4IGOA 1ND2A 1DBNA 4RQPC 3T1LA 1GP4A 2B9UA 2YBPA 3IDBB 4GAZA 3VDCA 2R49A 4CP0A 5C3PA 1QF3A 2Q30A 1OQDA 1DQ6A 2FMYA 2AGSA 4EWAA 3ZMOA 3RRDA 1ND3A 4Q4V2 1VE0A 4XJ8A 1HN0A 1BKZA 5KBFA 2FDHA 1Q8SA 3ZR5A 4PLOA 5GZEA 3ZVXA 1NCQB 1BEV2 1R1A2 4J6GA 1C8M3 4XBQA 2Y8KA 3CU7A 3ZPYA 1K42A 2YU2A 2HWD1 3O12A 2A6VA 1GWMA 3ZYJB 1SFPA 2R043 2XJQA 4FOQA 5FFOC 2K2SA 1OPMA 1ZRDA 2OIIA 1XXNA 3WQ0A 2WFF2 1ULGA 1VBA2 2RVAA 4LBNA 2G9ZA 2OZJA 2YUEA 5DDJ1 5DUXA 1SG3A 2BGCA 3D82A 3FC0A 4NWWA 1VBE3 4A3ZA 3WP5A 4LK6A 1JYNA 2XL9A 1AR72 4KL1A 4BMEA 3DGTA 3H3LA 1LENA 3N35A 1VAMA 2IXIA 2JENA 1L7RA 3FWEA 3RS6A 5IHRA 5KHKA 3FHIB 4XXPA 4XHBA 3NRUA 2ARCA 4BH9A 2SLIA 4N43A 3HD8B 2G9GA 1OPOA 4DPNA 3WXPA 1W3VA 3AP9A 3WNPA 3E5XA 4RHV2 2VL4A 1NKGA 3EYPA 3C7GA 3URFA 1S2EA 3WG2A 1QMJA 1WW7A 2RJ2A 3ZIXA 2E7QA 3U07A 3PVEA 1D2QA 1XNKA 2QJVA 3WUDA 1N47A 1ND2B 3GXUA 3SCFA 1G9FA 3ZYIB 1KS5A 4M3CA 3NW4A 4EZ4A 4A6OA 5IVEA 3LDBA 4DRRA 1EPZA 1OH3A 2CGOA 5KHIA 3VBRB 1ND3B 3KGZA 1VJ2A 1X8MA 1BYHA 3WNLA 4Y5Z0 4DB5A 4OHWA 3VHRA 4QX3A 5JMOA 5FY5A 2DCYA 3MIBA 4QPGC 1EPWA 1AL0G 3WF4A 1GANA 1PGW2 1QJY3 1RUD1 1TME1 4XMAA 2OKXA 3WT3A 1JZ2A 5IATA 4FQ4A 1PO12 1LJ7A 1GSLA 1F4HA 2FCVA 2NYYA 3A0NA 3MW2A 4NHKA 4H55A 3NJZA 5EZWA 2BP6A 3D3AA 2VZRA 4L92A 4KG8A 5CFDA 2JDMA 3LIGA 5H9RA 4HKLA 2ZHNA 3RJRA 4AEDC 4ZZ5A 5JUVA 2LTNA 2RS52 4ES9A 3GGLA 3ZXJA 3OSDA 2GZWA 2PHXA 4Q4W2 4AFBA 1LU1A 2G4IA 3M2MA 4HFSA 4IE5A 1X9PA 4N43B 2RJLA 1MS3A 4QMAA 1ALYA 3S30A 2VUDA 4BM8A 4D7YA 3PVBB 3VDAA 3K46A 1Q3EA 1PIV2 4BLJA 2CGNA 1QIQA 2BOJA 3OB8A 1EV11 4FPLA 5D1IA 3V64A 3T09A 1XE7A 2W1SA 1RUH3 1KFUL 2MEV3 4C91A 4A45A 4D0QA 5J48A 4M3CB 1A6CA 3A23A 3M3EA 5SV5A 4XFIA 1WLTA 1TMF2 3ACGA 4FPCA 4ZS2A 3SH4A 4YGDA 1XNBA 3ACIA 5A80A 2R7EB 1JS9A 2Y0OA 1KITA 3C7HA 4YW7A 1KXGA 1PK6A 4K7JA 5F5AA 5KHJA 3MLJA 4K9SA 4N53C 2DVBA 2VNVA 4NJ4A 5DUWA 5ISLA 5CG8A 2JKXA 2J42A 4LO5B 4LO7A 2J7MA 3NV4A 4ASKA 2VUJA 2R16A 3AMMA 3MV01 1URXA 3U10A 3DL3A 2D93A 4KG0A 1WCDJ 5I8TA 4R52A 5CFDB 4AGRA 3UK9A 2GNTA 2P3KA 3OGVA 4YLZA 1F5FA 1LGBA 1ZBA2 3E6BA 2PHUA 5FWEA 4NVPA 3M70A 3WQ7A 2YDEA 1AJKA 1FPN2 2G9FA 3B01A 1ZYBA 4L99A 3LDRA 5B4XA 1H6XA 1MZ5A 4AHYA 5C3OA 4UT5A 1IPKA 1EAH2 4V2WA 4GMP3 4LMFA 5ACA1 4XUTA 4MADA 2O1QA 2CWSA 4HOOA 2BFUS 1RMU2 1HRV3 4LO6B 4OI0A 5LEKA 1XSQA 4HSLA 1NYWA 1S0JA 3JQXA 2QQPA 5FP9A 1UXZA 3LE0A 5F6LB 1KRIA 3AKTA 4JTNA 5CEHA 4HBNA 1WW5A 2XVKA 1BCXA 3BN6A 2CL2A 2XL7A 2FHRA 1RUG3 3J8F1 5L7OA 1O5UA 1SDDB 2RS33 2ARXA 3I54A 3J4UH 4Q4Y2 5GZCA 5LBEA 2DUQA 2VZSA 4XFAA 2OUHA 3LIHA 3ASIA 1S0IA 1PK6B 3LCPA 2WQ4A 1NX9A 4LITA 4QDQA 4QU2A 2XH6A 4XCBA 3S6PA 3VZNA 3VL9A 5BPXA 1AR83 3IDCB 2A6XA 2NLRA 5L9VA 4MHUA 1RINA 3RZHA 3ZMNA 2BEOA 2BNNA 4IERA 4A7YA 4D7TA 4CPBA 1JYXA 5LRSA 3SKJE 1ASJ1 4X8NA 4E4ZA 4F7ZA 5FY0A 2R071 4IEPA 3SH5A 1DU3D 2GH2A 1BXHA 5JPMB 5IW0A 2PQSA 1RVF1 3AM2A 3KGLA 3KV9A 4BQWA 4CEWC 1NXMA 3DPRC 5C8CC 5T5PA 1W8OA 1NG0A 3M3IA 2BDRA 3A21A 4BISA 3HBKA 4N53A 4QPGB 2FCTA 3W58A 1S0DA 5I93A 4XFCA 2GN3A 1ULFA 1QXJA 3O0VA 1AF9A 1YYNA 2ETEA 3I97A 4S2HA 4BXSV 2SBAA 1H2MA 2YROA 3J26N 1C8M1 3HN1A 4J1WA 2B9VA 1KQRA 2NZ9A 2R041 3SC7X 3QD6A 4AEDB 2G1MA 4XTMA 2DDUA 3HWJA 4Y1UA 1UNBA 1MPXA 5F3EA 2EIEA 1K12A 4QPYA 5F7UA 4L8QA 1ZZBA 2DF7A 3J7NA 1AR92 3VBSA 2RM21 1PO22 5FK7A 1O4YA 4Z1VA 2XKOA 4DUWA 3AZVA 1JUHA 5IFTA 5FZ7A 4P00B 2V5DA 2B7YA 2RR13 3IB3A 4CE8A 4DUVA 1LB2A 2W1UA 2VJXA 2RJKA 4BIOA 1GP6A 2QNKA 4K1ZA 4O9GA 1KDKA 3TNQA 2HWB2 3OBTA 4LKDA 4YM3A 1VRH3 4ISRA 4GZ9A 4EZHA 3MPPG 2D3RA 4GD4A 3S5AA 3K3NA 5KR7A 1QOSA 3M3CA 1DGWA 2A70A 2F4LA 1RUJ2 1JOJA 3RMYA 1FNZA 2EAKA 1N1TA 2IZWA 4NIIA 3AP4A 2R6QA 4KWUA 3SXWA 3U14A 1DZRA 4QQPA 4N53B 2ARBA 4CCNA 4QKNA 3VN4A 1UMZA 1VLNA 1DCSA 1STMA 1GV9A 1UOGA 3AXEA 1DZTA 2ENRA 1MS4A 4XQWA 1AL22 1GWKA 1REEA 4H7LA 4Q8LA 2Y34A 5FP8A 2HYXA 1JYCA 2GNDA 1ZZCA 1ENRA 5JSRA 1HQNA 4CEYC 3ZN4A 5JMCA 2R062 1QJY1 5CADA 2PHLA 2WT1A 5FY8A 3O5SA 2NQYA 1ZA4A 1DGRN 2D6LX 4TXWA 4LQRA 4Q4V3 3RNSA 4CEWA 1XJAA 1OT5A 3VBSB 3DPRA 3RJ2X 2ZAAA 1R1A3 1BEV3 5D2AA 4HG6B 3MW4A 2DU0A 5GJ6A 1WMFA 1CAVA 5H9PA 1SDWA 1DQ0A 2DTYA 2ORXA 3WEZA 3CF6E 3J7HA 1X50A 2WFF3 4FFFA 3I3BA 2DFBA 4OCTA 4CRQA 4XOGA 1W2UA 1XBFA 1XYNA 1LESA 3OGJA 5DUUA 1LOCA 4M0HA 2Z4FA 1AR73 3APBA 2GC1A 4ONUA 4KWLA 4GH4C 4E9KA 4BQ3A 5CG9A 2YMZA 2GALA 3BALA 1TQ5A 4TWTA 5FY1A 1W9FA 2R1DA 3H50A 4RFT0 1RUH1 4AQTA 1NY71 1DDLA 1W28A 1WMEA 2TNFA 2E9QA 2PAEA 4JX0A 4ATFA 2PXJA 1ZRFA 3MUZ1 5JVVA 5M0TA 4LIUA 1B09A 4YYOA 3PL0A 2RE9A 4GULA 4BQ2A 4IEQA 2ZEYA 2VECA 2V4AA 1JYTA 4CDUC 2FZ2A 4YW3A 3BTYA 4NAOA 5FZ3A 2WS92 4LIVA 3I3MA 2Q8CA 3RZJA 3AYDA 3MFCA 5I0SA 4X8PA 3ZSEA 1QWRA 1MS0A 1W6QA 1WZXA 4LEJA 3AMPA 1X7NA 3K4ZA 4IE4A 5FO7B 4CEWB 5LBBA 3DPRB 5C8CB 1QGLA 2ZGLA 3OTFA 1YUDA 2JB8A 4B8EA 2NMOA 2VZUA 3WDTA 2A75A 1CAVB 1DHKB 1NUKA 3M1HA 4FTSA 1GZWA 1XC6A 3MO4A 2YBSA 2J1SA 3JBG1 3LAGA 3USUA 1V9U2 5CB7A 1RB8G 1OF4A 2OQ6A 5A3WA 5FBZA 2GMPA 2PN5A 5BYNA 1JZ4A 2VCCA 3ZYHA 5LWBA 1UMHA 4M4PA 4GMP1 3FUOA 4CEYA 2BW8A 1FAYA 4HSJA 2RS53 3AXDA 2HWE2 1LNSA 3LF7A 5F2WA 5J98B 5LBCA 4Q4W3 4C1XA 3RZMA 1CJDA 2FCUA 4AYUA 1N3OA 1HB1A 4NIHA 4N9IA 2WN2A 1C1FA 3BB6A 2D44A 1ST8A 2DCZA 4M01A 4QB2A 4NR1A 1PIV3 1FMD2 1UYZA 2HWC2 2XJTA 4B3NA 3ZFGA 5A3OA 4AK3A 1QOOA 2C4XA 4TLFA 4C8DA 2W08A 2QQIA 2V4VA 5DG1A 1M06G 2PTMA 3HQRA 4RYDA 1I1EA 4QHBA 4E4SA 5DG2A 5A7QA 1AR81 2VOTA 2DCKA 4I09A 4JC1A 4LE3A 5ABJC 3IIAA 5F3IA 5BUVA 4GH4A 3SHRA 4D3WA 1F2NA 1W6QB 5A70A 4D6SA 1O3QA 2DBNA 2B46X 4IV1C 4KI5M 2I74A 4IV3C 3RVHA 1AX1A 3GJAA 2H0VA 3ZXDA 1HXS2 1K5MC 3FBYA 1XB9A 1SFYA 3C7FA 5C5UA 1Q43A 1GZWB 1V6NA 3OUIA 5C7GA 1V00A 3O1VA 2RG4A 4Y26A 3USUB 3N7JA 1D2SA 3INAA 3B7MA 3B9CA 1AR63 1DGWX 2AREA 4PJYA 1UPSA 3ZR6A 2D97A 2XLGA 1W9TA 5KXDA 1O3RA 2W5FA 1SLLA 3PUQA 4CEYB 2YPDA 1T6GC 1ZBA3 4IE0A 5FYTA 2VTXA 3I8TA 1ENQA 3T0DA 1W90A 4ZY9A 4LBJA 3I2KA 4JHTA 2O8OA 2DURA 5CU1A 3T2PA 5BNPC 1EAH3 1V6OA 4PIZA 3U37A 1ODNA 1QU0A 1S55A 2Z42A 1LHWA 1RMU3 2RMU1 2JE9A 3H1WA 2GDFA 5TSWA 3WW4A 3ZFGB 2IFRA 4EV0A 3BU7A 1AUYA 2VCBA 3CJIA 4OHXA 1DF0A 1N1VA 3OG2A 4XF3A 4QGMA 5DMYA 3J7MA 2HBUA 1ENXA 1RL3A 5J96B 2ERFA 3CHXA 5FP7A 2X05A 2HEWF 4AWDA 4K8FA 3ZYRA 5KXCA 5IK8A 5FAXA 1N1SA 1GFF2 2O0OA 2RR11 4GH4B 2CHHA 4Q4Y3 4UW6A 1R081 1VAVA 4UBHA 4UFMA 4YGCA 1HW5A 1UWWA 1GOFA 2C26A 3KSCA 4P9JA 4Y20A 2P3YA 2J1AA 2WWJA 3VB9A 2C0ZA 3HOBA 4P9LA 2IXKA 4XZPA 5GLUA 3LD8A 3T4HB 5LEJA 4ARXA 5J1XA 4YW6A 3KQRA 4CUAA 2W46A 1BBT1 5IJRA 4EJRA 2LS6A 1FATA 2JJ6A 1DLCA 2YGMA 1HJFA 4K1YA 2EAAA 4PCRA 1YIFA 1LKNA 1D0HA 4LLFA 4SBVA 2WFPA 5FXXA 5ABJA 3RYPA 3WDXA 4UF0A 3X29B 5IAVA 4IV1A 3H1YA 1W8HA 3M3OA 3C7OA 2WQZC 4JGZA 4Q0UA 2XJPA 3UL2A 4AI3A 3AJYA 5LB6A 4KBBA 1K5MA 2BVVA 3TRSB 2FDJA 2OYZA 3KZ4C 1HIXA 2YC2A 1PX4A 5CZKA 4ITCA 4NROA 2IXHA 4IESA 3T1MA 2ZX1A 4META 2QTWB 1YI7A 1SCRA 1R1A1 1WW6A 2HYKA 5DABA 3OPWA 1CIYA 4IEVA 1IS4A 2A3WA 1PGSA 1LEDA 2ZGQA 2WFF1 5JOXA 1VBA1 1J3QA 2Q1ZB 3POBA 2HJIA 5F8PA 1PO23 5EJ3A 4Y20B 4XJZA 5FZLA 5BNPA 1J1TA 3VKMA 1S0EA 5G04L 5FYMA 4BYYA 3ZXEA 4GQ7A 2VC9A 1C8NA 3WF2A 4UXAA 4BLIA 3UGGA 2WT0A 5FYYA 1OUSA 3HT1A 5HCFA 4NE9A 2HWB3 5EWSA 3QLQA 2P6CA 5HI0A 3IT8A 5EQUA 4AI0A 4TZDA 2ZGOA 4RHV1 2D98A 5ABJB 1UYXA 2J1RA 4E4HA 2ZGMA 1G9BA 2BGOA 4MO3M 5KXBA 2D3PA 3OYWA 5I8SA 1GR3A 1CAXB 4UF0B 2C1FA 1UCXA 4HPKB 4IV1B 1HRV2 1RUJ3 1H8VA 1NA1C 2LROA 4RD7A 3IMMA 1SMVA 2XLAA 4JGZB 3VHNA 5JXGA 3MLKA 1H9WA 1ZZ8A 4GMP0 3MI8A 4P9WA 1K5MB 5BXXA 4XFHA 4XZUG 1W04A 1Y4WA 2H6CA 5IVFA 2KR2A 2I2SA 4XF0A 1RUG2 1QH7A 2RS32 2XJUA 1AL23 1FI2A 1O5LA 3FHQA 2VMEA 3PLQA 3ILFA 4UFKA 4AFDA 2Q1FA 1JH5A 2VVDA 4PI2A 1JI6A 4XIOA 4COWA 2Y6JA 4JTOA 2R063 3RGBA 4QU1A 4D69A 1HQLA 1EP0A 4Z2WA 1PO11 3IWZA 5C4WC 3NNGA 2EIDA 1AXYA 2YPJA 4QXHA 2VZOA 2K9ZA 2ZA9A 1SACA 3B02A 3VZOA 1TG7A 3C2UA 5BNPB 4KWJA 2PHTA 2CTVA 3TNPB 1BHGA 1X9TA 3NV1A 3PUHA 1H1MA 2CAVA 5AVAA 2QCSB 4AGGA 4CCDA 2RS51 1G6NA 3W20A 5FYHA 4CU7A 4DXRA 4X6RB 3VKNA 1JZ3A 3KHCA 4FVVA 3ZYBA 5BNOC 3VKOA 4W6XA 2D6PA 2UWAA 3PU3A 2PELA 3PUSA 5FY9A 3U78A 5LA1A 5FZ9A 2FZ1A 1AXKA 1C3HA 3AP5A 3B5LB 4XILA 5FMCA 5HCBA 1HB3A 1POV3 3BTXA 2E7AA 2EVXA 1XSRA 3WR0A 2GN7A 2OPWA 2WNEA 3OYWB 2Z2SB 3NNMA 1OHFA 1W8WA 3P5BA 1W99A 2LW8A 4PLMA 5GLVA 1W6OA 3UJOA 1FXZA 3T2QA 3H3UA 3O1PA 2O14A 1TMF1 1LGNA 1H2LA 4WVMA 2XBO2 3T0BA 4BZ4A 3FL7A 3UYJA 3VD7A 1DQ1A 2OA2A 4JRLA 4WBBA 4W8JA 1JHJA 1FV2A 3K77A 4AHWA 1L7QA 3O7OA 4GWNA 4JQRA 4FTBA 4NHLA 4BQ5A 4Q27A 1GMMA 2A3XA 2GSYA 3MIDA 3KT1A 2Y6GA 1H2KA 5FREA 2JIGA 4BWOA 1NA1A 4NN0A 2ZPXA 2DVDA 4XETA 4AFCA 1ONAA 4JGYC 4XDQA 1A8DA 4XUQA 1US2A 1VRH2 1REFA 1ZBA1 3I2HA 4AL9A 5A6QA 4XJ9A 4RR3C 5F3CA 3CLPA 1FPN1 2P2KA 3PU8A 3NNFA 3ZOIA 2UY8A 1SBFA 2PHWA 4AE2A 1EAH1 2Y0IA 5FTTC 4ZPIA 1O8PA 3OPTA 1ZREA 4Z8BA 2JDPA 4NRQA 2A73B 2HWE3 1RMU1 2A6WA 3ZSLA 5C4WA 5FZAA 3OBAA 2YV8A 3EQEA 2X10A 3ZLIA 1TE1B 1WBLA 2ZJCA 1UZWA 2OQ7A 2OPKA 4ARYA 4OULA 4Q0SA 5JXJA 1G9AA 1FMD3 3N36A 2HWC3 4WVMB 3VV1A 1Z78A 4OVEA 4ZU7A 1ZVFA 1T6BX 4DIQA 3VBRA 2WO3A 1PM7A 2JDNA 1CPNA 1S2BA 2W2IA 4NPRA 4FAGA 5A3NA 5KXEA 1ZBE3 4CU8A 1RITA 1O6UA 5FYBA 2EA7A 1XNDA 2BWCA 1VMHA 3GCWA 4E8CA 1LHUA 2JG8C 4OZOA 1PNFA 3AMNA 4AW7A 1W9YA 4CP1A 1NA1B 3TAYA 4CCKA 2WAOA 1BMV2 1QKQA 1HXS3 2BU9A 3UJQA 3AFKA 3ZXKA 4XF4A 2AR6A 5FPVA 4LE4A 4J1XA 1UKRA 1YQ8A 4YZ3A 2W92A 1GZ9A 3UGFA 2OUJA 2WINB 4Z92B 5FZFA 1KD7A 5IK7A 1DP0A 2EICA 4K20A 4CUGA 4GB33 4A7ZA 5BY5A 4I2OA 5L73A 1RJ7A 2QDNA 5C4WB 2BJSA 1QH6A 3JD73 4ZU4A 1C57A 1W6MA 3AZWA 4D8MA 4CVUA 4MGZE 3R4SA 5C3QA 2H0BA 3I49A 1W39A 5FP4A 2ID4A 3DN7A 5J37A 4LOTA 4DQAA 1DQ5A 4JGYA 1YQCA 3WOGA 3K2OA 1WD4A 2VBPA 4XMIA 5I0TA 3V65A 3WG3A 1APNA 3AVSA 3WDVA 4RR3A 1AR91 2YC0A 3EO6A 2NN8A 4CZSA 5E6HA 1NCRC 3NAPC 4A3XA 2HKXA 5BNNC 1RXGA 1VAKA 2BPA2 1O4TA 3GDBA 1A78A 1KJRA 1WCUA 4QHOA 2XWJB 3BI3A 5J3UA 1JYVA 2HLEA 4DUXA 4WM8C 4MGQA 4COZA 5LA9A 1E5RA 2CGPA 2QKDA 1LTEA 1PZ8A 1OVSA 5F6KA 1UD1A 4LBQA 2ET1A 2HWB1 1W3XA 3FE5A 3IBMA 3GJBA 3MLLA 5T5OA 1YXWA 4RQPA 3G7DA 2W95A 2W47A 5JIAA 4XPVA 3UGHA 2EIGA 1QNWA 2TBVA 3TYJA 3TN92 2P3IA 3WNMA 1OLRA 2WABA 2IWGB 1RUJ1 5L9BA 4XJUA 4XJWA 4FXKB 2ZCWA 1ZZ9A 3CDZB 4LHNA 2PLV1 3DYPA 3RWKX 1SBDA 1PMHX 1XOYA 3I2DA 3RZLA 4CCOA 1R093 2JG8A 4XUOA 4OHYA 5A6YA 1LOFC 2UYBA 3MGUA 4HVRA 1X82A 1AL21 1J58A 1W6MB 3AKRA 3R4DB 4LBLA 4PT6A 4QX8A 2HWF2 3LFMA 2G19A 2OXBA 2GP5A 1ULPA 2R061 4JGYB 1NOVA 4R9AA 5FYUA 3VHPA 5K0UC 2WO2A 1RJ8A 2ZHKA 1LHOA 3GBWA 4RR3B 2BWAA 1E57A 4LUKA 4LA3A 4RGGA 5F5QA 1GP5A 3CQOA 4PF5A 2NP0A 1IPSA 2ZX3A 2XLFA 1D7PM 2GNBA 5CA6A 3WF1A 1RUI1 1BJQA 1IGOA 3K4DA 5IVYA 2XUEA 2W1QA 5FUPA 5IVCA 4IEYA 4GJZA 4UW3A 5T5LA 3QOPA 2Y6HA 3HNBM 4MH0E 2VNRA 2UWCA 4LBQB 5IFPA 2EF6A 1ZRIA 1OURA 1V6IA 1LODA 5A7NA 1AR62 3NL1A 4RQPB 2ADEA 3FLPA 2A6YA 3SLIA 4P9GA 2IXJA 2AYHA 5I0UA 3H9AA 1RUE3 3LSEA 2F4PA 3S7EA 2OS2A 3PVOA 3LPGA 2VVFA 3QCWA 3M8LA 4FPGA 4AFMA 1CGPA 3MZHA 4ET7A 3GM8A 5FZ1A 3D0JA 1UY2A 1NCRA 5LY1A 5A6XA 5FYZA 4RN5A 1Q56A 4PQ9A 4QPGA 4XBLA 4AVCA 4MGYE 1G8WA 1XE8A 1VR3A 1CZVA 2JG8B 2XB6C 1IS3A 2WZ8A 1OSGA 3PNAA 4WM8A 1Y9QA 4XC9A 2IVJA 5J09A 3N9QA 2P1BA 3AKQA 3KV6A 4QXCA 3PURA 1EUTA 2W68A 1VIWB 1WA6X 4M3CE 5IUQA 3WHUA 4AI8A 1UY4A 2WS91 1IKQA 1CONA 5HBAA 4RGAA 4CUBA 4AEDA 2RS12 1ZM1A 4MYEA 3AZXA 3C8XA 1RUC2 3GZTB 2DFCA 1SFNA 4LO4B 3RWNA 3HIFA 3AZZA 4AEMA 1WLCA 4IE6A 1Z7S2 3JB4C 3I59B 5AFEA 2I07B 1LOFA 1QXPA 1V9U1 3GHNA 2ZACA 3ZPOA 4B4QA 5FZ4A 2ZTNA 3PVNA 4YW2A 4AVTA 1YIPA 3LDKA 4LA2A 3BGAA 4OYUA 1FV3A 2ZMKA 2R32A 1GWLA 3GNEA 5K0UA 2UY9A 3CZJA 1XYPA 2VBDA 3WG4A 3VL8A 1A8MA 2WL1A 4NPMA 4XQDA 1V70A 2VQAA 3LQCA 2ILMA 5DZGA 5IT6A 3QH6A 1NCRB 3AKPA 4FQZA 3BVCA 2ZGRA 4MG2A 1UYPA 4DEQA 5JPNB 2VW0A 3JUUA 4S2GA 2HWC1 1C4RA 1SZBA 3MPBA 4I02A 3CBNA 5F5CA 3HVDA 4IEZA 4WM8B 4LULA 3IAPA 4XF9A 1YHFA 3UETA 2RDSA 4BCUA 3NV3A 4MSVA 4NRMA 5FOJB 1LOAA 4NIDA 3MV11 3KQ4B 4HN1A 5DPNA 4DFSA 5FYVA 2MNGA 2VMIA 4OMCA 2JG9C 2XQXA 1AVBA 2XBO3 1UX7A 2VXJA 5FWJA 5JZGC 4QX2A 2O8QA 5B4NA 2GC0A 3VUOA 3H7YA 2ADDA 2DCJA 4K8RB 4QHZA 3A4UA 2E6VA 4QAWA 2D5FA 2FDKA 1VBE1 3HBZA 3NMBA 3LGRA 2BBAA 1LOGA 1UZZA 2E32A 2UU8A 3JCIA 3JZVA 1IQAA 4RS5C 4AQSA 5KC5A 3V0BA 4MGSA 4JDMA 5A33A 5JAXA 2WA4A 1E5HA 4HK9A 1O59A 2JWPA 4NMIA 4YGEA 5A1AA 2JDUA 5DAXA 1OD5A 5E16A 5AVPA 3I2OA 3O1RA 1QY4A 4B1MA 5IVJA 2A7AA 3AYEA 1F31A 3LOIA 4D94A 3AC0A 4YNIA 4A42A 5C9AC 5K0UB 1SBEA 5FR3A 3AYAA 1KS4A 4FOVA 4K21A 2R1BA 2XONA 3RYKA 1YWKA 3OGRA 3SKVA 3T30A 4LLOA 2YGLA 4E4DX 1RUF2 2XPJA 4OLLA 1HRI3 3THCA 2C24A 3ELNA 1W8UA 1C5HA 4KU8A 2F17A 4XE9A 4R4XA 1RGSA 4AEJA 1NZCA 5H9SA 4IGQA 1W05A 1LULA 3HT2A 4QM8A 1VBC3 3I2JA 3H8RA 1H6YA 4KQ7A 5C8CA 3IM0A 3Q8BA 2QUOA 2WNVC 2DWRA 3HQXA 3KF5A 1ZX5A 1W2AX 3N7KA 4JKLA 4YVSC 3H8OA 3DKQA 3WG1A 3V0BB 2CDOA 1AHSA 1EUUA 4XHXA 3VKFC 5CFCC 5A33B 1VMFA 4D6RA 2DVAA 2XDVA 4HXCA 4BQYA 4E2SA 3MIHA 3PHMA 4FTEA 1OOPC 2E26A 4NIGA 2DCTA 2IXCA 1W8FA 2AZ5A 3AK0A 3HAGA 4N7UA 5JR7B 3FFZA 3WDWA 4BA6A 5JZGB 4XFFA 2K46A 2D3SA 3PMEA 3VBHC 3H42B 2JG9A 5JZGA 1GQGA 2J1EA 5I0RA 1D4M2 5EP9A 4YPJA 4HONA 4Z82A 4QPIC 4PIYA 2A6ZA 1O3SA 1HB4A 2GMMA 2MEV1 2JX9A 1RHI2 2WZEA 2ZS6B 4RS5A 4HLTA 1LOBA 1SPPA 1XU2A 1C5IA 2W94A 4QWNA 4BIFA 1DG6A 3GCXA 2Q8EA 4XDOA 3WZ1A 1G7YA 1Y9GA 4LOSA 4HZFA 2XJVA 2Y6LA 2UURA 4CCEA 4FSJA 3AB0A 2Y26A 4XCAA 4XQ4A 4BMBA 3LOBA 3OEAA 4NRPA 5C9AA 2VU9A 1DGRA 1S2KA 4J25A 4M3CF 4MUVA 3M3QA 1UOFA 5H9QA 4BQ4A 5KC6A 5HXMA 3CJXA 5IK4A 1FX5A 4CCCA 2VW2A 5LCWL 1F9KA 4QQOA 5LZ6A 1YFXA 2CSGA 4MGIE 4V1PA 5BV6A 1WKYA 1KFXL 3I2GA 1ULEA 4HK8A 4R4ZA 2D40A 2AEZA 1KDMA 1U5XA 4I0BA 5JDBA 3VDBA 1L3JA 3ZO0B 2A1XA 4AQ6A 3GF6A 1JU4A 2A71A 4XABA 2Q8OA 5GLZA 1UW8A 4IE7A 1GZCA 1UU6A 1SCSA 2JG9B 2JEMA 1VRBA 2TUNA 3H7JA 3TN93 4NHXA 3WNNA 3ZXGA 5IVVA 2PA7A 1YQ5A 4Q5OA 1HRV1 2QQKA 2WYFA 4HT1T 5A7SA 3VDDC 3NSTA 1PZ7A 4UFLA 1VBB2 2VO5A 4NHYA 1LU2A 2WN3A 4RS5B 3E97A 5C8WA 4ORFA 3OUHA 5CFCA 1RUG1 2VQUA 2WSUA 1WCQA 2Q0AA 1SPPB 2RS31 3M4FA 4L97A 1OVPA 1OOPA 2HWF3 1PHMA 4INDA 4QX0A 4YRDA 4CPBD 4MV2A 1UF2C 1ZBE2 1ASJ2 3N7MA 4IL7A 3VBHA 1W6NA 2X09A 3KD4A 4QGLA 4H2AA 5FZ6A 5C9AB 1QQP2 2YG0A 3B69A 1NLSA 4JCKA 4O61A 3AMHA 3PTRB 5A3MA 4CXYA 5FZIA 2BVBA 2QQJA 4ZKTB 1B35C 1IKPA 1UZ0A 1OUXA 2FD8A 3BPZA 2W39A 1YLLA 4TLGA 3VHOA 2P17A 3OUJA 4HKWA 1O8SA 2WUHA 5EYXA 3RPQA 4ZZ8A 3CNAA 4AXOA 4HN0A 4CDUA 5EHDA 1CR7A 2KM2A 4QKDA 5LW9A 2X5IC 3PUAA 4GB32 2VMHA 3I3EA 1OH4A 1VBD2 2ZXQA 3JD72 4MGKE 4OHVA 4AFAA 1XE0A 4RA0A 3LZZA 3DXTA 2FBEA 2WQ8A 2RM22 4Q1PA 4YVSB 5FZDA 3VBOC 3ZSMA 2Q1MA 5I0DA 2PYTA 5CKNA 4H3WA 1Z0HA 2XBO1 5CFCB 3WV6A 4EN9B 3DYMA 3I3QA 3NVCA 3AYCA 2D7FA 1JXNA 4NHMA 2ET7A 2VVEA 1F5JA 2YY1A 3T3YA 4LT5A 1CZTA 1OOPB 1O7FA 1X8EA 1QOTA 2RDRA 3FLRA 5FO8B 4YVWC 1DYPA 4Q0PA 3ZXFA 4AR2A 1PVXA 2RS13 3VBHB 1W6NB 1RUC3 2Y6FA 5FJHA 2FDFA 4FPKA 5FPXA 1OQ1A 4QPIB 3VDDA 2CU5A 4ZHNA 2ZEZA 1Z7S3 4CU9A 1VRH1 3SMHA 5DAVA 2VD7A 2GP3A 4FPYA 3SCHA 3N9NA 1CZSA 1S0FA 1PGL2 5FPAA 1JUIA 2ARAA 2V5YA 5CIRA 1UAIA 3WY6A 4CDUB 1MACA 4EN7B 3H8XA 1LAJA 3WW1A 3KCXA 1UKGA 4UOJA 1U5ZA 1OA2A 4QXBA 4GKYA 1R092 1W2OA 2XXZA 3OEBA 1CAXA 3VBUC 4HPKA 2Y60A 4CDQC 4IV3A 2CYFA 5LRRA 2WC2A 2ZAHA 1XNTA 4UBGA 5KWRA 1B35A 1MQTC 4UFJA 2HWD3 5ANNA 3MUY1 2KXLA 4WM7C 2XKPA 3JU9A 2CY6A 4P9IA 1NLRA 4Q4V1 3DECA 4UYBA 1H8TC 3MDPA 3NKTA 4EWDA 3FJSA 3R6SA 4C0BA 4P02B 4YZ5A 3KS7A 4AHZA 1LHNA 1BEV1 3NJYA 5IYYA 4FFGA 3M7AA 1GZTA 1U12A 4V2VA 5JI9A 2DYCA 3FX3A 1K45A 3Q8CA 1HB2A 4Y1XA 3MIFA 4AG4A 4I3GA 1GKBA 2X5IA 5SV8A 3USSA 1CQ9A 5GM0A 2PHRA 1QJFA 2V72A 2R0HA 3FHAA 1BMV1 3TEZA 5FQ0B 3VDDB 1HV0A 2Y6KA 4HKOA 3KWVA 3VBOA 2WKKA 1AR71 3NNLA 3Q8AA 2RDNA 5FZ0A 4ZXEA 1S0GA 5APAA 1HLCA 4AI9A 3ZXAC 4JKMA 2ZX4A 3HNYM 3LB9A 1RUE2 3N7LA 3DF0A 5T50A 2YZ4A 4TYSA 5T5JA 3WNKA 3KM5A 4YVWA 4Y1ZA 2DBIA 1PMJX 1AYN2 4QXKA 3PTYA 1YQ6A 4KBZA 4LJHA 4GIQA 4AAXA 2K0GA 5A3LA 3U75A 2XJRA 3UKVA 3RZGA 1SLBA 1WD3A 5F1RA 2GH8A 1LOEA 3WDYA 4CCMA 2D6OX 4IV3B 5A1FA 2VNGA 3U11A 3Q8FA 1GBGA 3GZUC 4BB3A 1B35B 1RUF3 5GLTA 3IMNA 3I4IA 1LGCA 1RUD3 1EYBA 2WWSA 3ACLA 2QFEA 2DVGA 3E5UA 4MHRA 4A2UA 2WDBA 1XRUA 3IN9A 2W91A 4BHPA 3POYA 4Y5SA 3D6EA 1PGW1 1ZNPA 2VOVA 3V0AA 3VD9A 2XHNA 2X5IB 4A7KA 2Q8DA 5AC92 1ZZ6A 4CDQA 2B5HA 2FQPA 2ZEWA 1CESA 2BOIA 3PUIA 4QQLA 2CDPA 2D6NA 5FV3A 1C1LA 1JU3A 1UZYA 3VBOB 1MQTA 3WQBA 3O1TA 3WP6A 4YW1A 3TN91 2JKBA 1CVNA 3AP7A 1GOGA 1FOD2 3HQUA 3Q8EA 4IW3A 4WM7A 5FBJA 5T52A 1H8TA 3BOWA 3FN9A 4U36A 2ZZJA 4Q4W1 5GALA 2VR4A 3QBQA 3IPVA 3TBDA 3FMGA 1QNYA 5JIUA 2DV9A 4YVWB 3S7IA 3THPA 3NNJA 5DAQA 3U4XA 1H1AA 1D4M3 1PIV1 2D5HA 2YXSA 4F3JA 3R0RA 1S0CA 4YG6A 2HWF1 1FNYA 4D7SA 4UFIA 3UNPA 1ND2C 3ZM8A 3J7LA 3MF6A 1RHI3 3POIA 1BLZA 1JZ8A 4JRAA 1W0PA 3WNOA 4A4AA 2HEVF 5FYSA 4EQVA 4XUNA 1W03A 2P5BA 5FY4A 1RXFA 5FPLA 2WO1A 4S2DA 5DXDA 2ZGKA 1AYM2 5DAPA 1JTZX 4COYA 5FLIA 1I3HA 3E1F1 3LWCA 3I7DA 4HVQA 2YU1A 3ST7A 4P14A 1N3PA 1WUVA 4WVZA 3V0AB 2VUAA 5FOBB 1YFYA 2OW4A 4PDWC 3ABZA 4P08A 3MIEA 2V73A 3KB5A 3VBUB 5HPOA 1C28A 2XVGA 1AR61 5FPZA 4CDQB 2JDYA 1MZFA 3W21A 5C3SA 3MIGA 3TEYA 1UOBA 2PHFA 1DQ2A 4FOYA 5LK5A 4XIKA 4I3PA 1MQTB 3KT7A 3SEPA 4KWKA 4UI9L 5T54A 3WSOA 4WM7B 1XPWA 3VBFC 2RMU2 2LUWA 1H8TB 5HCAA 4BPZA 1OLMA 4OQ8A 1M4WA 3IPVB 2WAAA 1LEMA 4FPHA 3RI9A 3B9IA 4AZZA 2DUOA 3KMHA 4QGNA 3J8F3 1HRI2 3CL1A 2X53S 2EXIA 1R082 5G05L 4A44A 4XFGA 1QJU2 3LA3A 1YJKA 5A1LA 1VBB3 3K3OA 1GOHA 1J3RA 3OJBA 3SQOA 5CKMA 3LEKA 1W9WA 4Q4Y1 2MPFA 3POGA 4URAA 2C9KA 2JE8A 2VG9A 2B39A 3P1IA 1VBC2 2YYOA 3CIHA 4EROA 5BNOA 5CAZA 3CZUA 5B2GB 4LTAA 4L2NA 4E2GA 1ASJ3 5FK8A 3ZIWA 3O1MA 3GZAA 1KGYA 2R073 1TNFA 1NE4A 2WIIB 1QQP3 2EALA 3GALA 5HV0A 4O7XA 4HMZA 3AKSA 1Y43B 5F32A 3ZKUA 1G9CA 3IDEA 2EXJA 4JAAA 1JMUB 2VNOA 5CFDC 1BK0A 2JIJA 2XMLA 1PVC2 3WP4A 4YGBA 4BE3A 4XEZA 3BODA 4YZ4A 2DTWA 3EMRA 1E5SA 2X8KA 4LR4A 4XACA 1J1LA 2VZQA 2VZTA 3B3QE 3I2IA 3THTA 2OX0A 4TTGA 5FLHA 1WWYA 5A6ZA 1UXXX 4GA9A 4C1WA 3WLUA 3NWKA 1AZDA 1WCSA 3AX4A 4CP9A 3ME2A 1YCIA 4PDWA 4Q4X2 4DXSA 1VBD3 3T0AA 4WVVA 1REDA 1UN1A 3ZYGA 3B93A 2WSVA 2RM23 1BK1A 1ZRRA 4AF9A 3W59A 1YC61 2QZ2A 1SQ4A 3IDAA 2VW1A 5CYYA 4FPJA 4AVVA 2E63A 1JW6A 1E5IA 1YEWA 5FRAA 2B8MA 1UIKA 1XYOA 3VBFA 4AVBA 4B4PA 1Q8PA 4W6WA 1WGPA 4DY5A 1PO21 5BNOB 1PK6C 3OY8A 4N90A 4QX5A 5IWFA 1W0NA 4MOAA 3NO8A 5FZCA 3U0ZA 4WZFA 2VMDA 4FOWA 5CISA 2CV6A 1VB2A 4LO8A 1MEC2 3CO2A 5FPBA 5FXVA 4IEWA 4GALA 5JCTA 2GNMA 4G4FA 4YW5A 1OA3A 3WF3A 1NQDA 4K40A 3O14A 1UPIA 4IEOA 3S57A 1JBCA 5DZEA 1JZ6A 3RMXA 2ZX2A 3WCRA 1OLME 3O1OA 3DV8A 4LHKA 4OUSA 4XVHA 1BVP1 1YFWA 2LALA 3SH3A 3T2TA 4PBOA 2WZR2 1JOPA 3LA2A 2J1VA 1CD3G 4UFHA 4FAHA 1H1IA 4XTPA 1RUF1 4BOWA 5K8SA 2J22A 2PHDA 4C90A 1LHVA 3QH7A 4YG3A 3WCSA 3RSJA 4CP9B 4OHZA 1W9SA 1XU1A 5EIYB 3MYXA 3ZDVA 4PDWB 5F37A 1UU4A 1S1AA 5A3TA 4P9XA 2JE7A 1NAEA 1Y3TA 3ILNA 2RV9A 3K48A 5DZFA 1QJX2 3MICA 1U5YA 1WLDA 2ZMLA 4FT8A 4M0NA 5L7OC 1MS9A 4Y3OA 4LBOA 5GLWA 5KHGA 3VBFB 3T4VA 2VY0A 3VZMA 5FZMA 4CXXA 4DS0A 4I0AA 1CAWA 4G3YC 2XJSA 2NPIA 1COV2 1O4ZA 3OY8B 5GKAC 1GUIA 4W6YA 5IK5A 3RYRA 3TOJA 4LBMA 4AOCA 3I59A 3F2ZA 4PI0A 5KHHA 1YRZA 2VPVA 4A6SA 4DZGA 1WW4A 4YARA 5FKBA 3AMQA 2ZGPA 1IPJA 2B45X 2BERA 1LR5A 1DFQA 3JB8A 1OMIA 1IG3A 1U5IA 2PAKA 3NJVA 5J7MA 4Y24A 1F15A 5FYCA 5HV4A 1UX6A 5E88A 1QJZA 3GZEA 2P4EA 4Q0VA 1D4M1 2W52A 1POV1 3EHKA 3O0XA 3W5NA 4EYUA 4D6QA 2QQNA 1FT9A 1HKDA 2VXRA 5FXWA 3KF3A 4FXGB 5FYIA 3NAPA 1RHI1 3C7EA 1RUOA 5BNNA 5A7WA 3U1XA 2BNMA 4QPWA 2YB7A 4Y5TA 5GZGA 4F83A 1AYN3 1H4HA 1UL9A 5A7PA 5IAXA 3DKWA 1BZWA 4SLIA 4Y1YA 5FMOL 5D21A 4R9CA 5F2SA 3WINE 4MX3A 3HNMA 3IKWA 2VOXA 4LHSA 2BGPA 3JQWA 4ES8A 5J36A 3N4MA 2JECA 3IIIA 4FPFA 4L11A 4YZ2A 1HQWA 1Q5OA 1ZZ7A 5LBFA 4GJYA 2AACA 2EXHA 3JBG3 1MVEA 1ULCA 2ZHMA 1I6XA 3VBSC 4TN7A 1CAWB 2BNOA 4LNVA 1S0BA 4CDWC 1MS1A 2TEPA 1NE6A 4EWEA 4HANA 2JD9A 5FUIA 2JDZA 4NO4A 2HH9A 3POJA 3Q9OA 5AC93 1OLQA 1RC6A 4DINB 1JZ7A 3GYDA 1IHMA 4Q29A 4ISQA 4E8DA 2VBBA 1JZ5A 2VZPA 1OFSA 4OUMA 1W8ZA 1UO9A 1CJPA 3ACHA 3D8CA 4WVWA 5HCHA 2VOKA 3MHZA 1JHNA 3THDA 5FMBA 1SLTA 2N7GA 2VMGA 1J83A 1FOD3 2HWE1 4Y4YA 2X29A 1CPMA 2RHPA 1NLQA 3VD5A 1OF3A 1H4GA 1VBB1 4NAMA 2LRPA 1QXRA 2NMNA 3NAPB 1CX1A 4GWIA 1X33A 2VMCA 5BNNB 5EV7A 5A7WB 4OI4A 4ATEA 1FMD1 2HWD2 4JKKA 4CDXC 1X36A 2ORZA 1YI9A 5K7PA 3T2OA 1KEXA 1D0GA 2P6HA 2WJSA 4B1LA 3D0SA 1PMIA 1WBFA 5FZ8A
chains in the Genus database with same CATH topology
2VUDA 2WR9A 2BOIA 5A3OA 5A6QA 5HCHA 5D2AA 5A6YA 2JDNA 1OVPA 2BOJA 3ZDVA 1OURA 1OXCA 5A6ZA 1W8HA 2CHHA 2WRAA 1GZTA 2JDKA 1OVSA 2BP6A 2JDHA 2BV4A 2JDPA 2JDMA 5A70A 1UQXA 1W8FA 4CE8A 2VUCA 1OUSA 5A6XA 4UT5A 3DCQA 2JDUA 1OUXA 2VNVA 2JDYA 2XR4A 1UZVA 4AOCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VUD A;  2WR9 A;  2BOI A;  5A3O A;  5A6Q A;  5HCH A;  5D2A A;  5A6Y A;  2JDN A;  1OVP A;  2BOJ A;  3ZDV A;  1OUR A;  1OXC A;  5A6Z A;  1W8H A;  2CHH A;  2WRA A;  1GZT A;  2JDK A;  1OVS A;  2BP6 A;  2JDH A;  2BV4 A;  2JDP A;  2JDM A;  5A70 A;  1UQX A;  1W8F A;  4CE8 A;  2VUC A;  1OUS A;  5A6X A;  4UT5 A;  3DCQ A;  2JDU A;  1OUX A;  2VNV A;  2JDY A;  2XR4 A;  1UZV A;  4AOC A; 
#chains in the Genus database with same CATH topology
 1OI6 A;  1ZBE 1;  4LBK A;  5DDJ 2;  2ZBJ A;  5C6C A;  1V6M A;  4UW5 A;  2ZGU A;  2EXK A;  2V09 A;  1VAL A;  3I2F A;  2QDR A;  5FY7 A;  5CBL A;  1QQP 1;  1AYM 3;  2ZGT A;  4KU7 A;  3SIS A;  5JLV A;  2ZEX A;  1W2T A;  2WT2 A;  1XQN A;  3FBM A;  5LAT A;  5DUV A;  4GKX A;  4XFB A;  4GXL A;  3KCC A;  1HXS 1;  1MZ6 A;  3HJR A;  3A7Q A;  5E89 A;  1VP6 A;  3UKN A;  1A3K A;  3ZXL A;  3D5O A;  5A3U A;  1V6L A;  1POQ A;  3ZSJ A;  3H1M A;  1UU5 A;  4FPE A;  4NWV A;  5C33 A;  2WA3 A;  2Q4S A;  4CUC A;  1AX0 A;  3GBF A;  2DU1 A;  4QDS A;  3MFA A;  2XVL A;  2PMW B;  2HEY F;  3LEI A;  4YWA A;  5FPU A;  3N3H A;  5JR2 A;  5EYY A;  4YFW A;  4H7M A;  3FLT A;  4XF1 A;  4I01 A;  5FJK A;  1G9D A;  4Q0Q A;  5C5T A;  3NQH A;  3WUC A;  5C3R A;  4GB3 1;  2AEY A;  5L7O B;  1GLH A;  1NZI A;  1H9P A;  1VBD 1;  2RMU 3;  3JD7 1;  1BVV A;  3EXU A;  3B00 A;  4UW4 A;  1IQD C;  4CP2 A;  5F39 A;  4F8A A;  4OZX A;  1AX2 A;  3VZL A;  4CDW A;  1Y7B A;  3HMY A;  2VZ1 A;  3SCG A;  4UWD A;  4RFR B;  3H8U A;  1R64 A;  2EIB A;  5JOW A;  1GNZ A;  2XHK A;  4OMD A;  1TME 2;  1RUD 2;  3LSD A;  3LA7 A;  4R9B A;  3TWI A;  1R08 3;  2OVU A;  5DAW A;  1QJU 3;  3N9L A;  4ZU5 A;  4LBQ D;  4NOT A;  3O1S A;  1AXZ A;  4Q2F A;  4YW4 A;  3ZDS A;  1UMI A;  4MXW A;  4AAP A;  2Q5T A;  2VH9 A;  4PLN A;  5JSO A;  2VCM A;  4Y33 A;  2VUL A;  2E53 A;  2E7T A;  3NKG A;  3RZK A;  4MLO A;  1OBN A;  2WR9 A;  3OF1 A;  1MZE A;  2WO7 A;  3KCY A;  1ULD A;  4R9D A;  4UAP A;  4AVS A;  1K3I A;  2QQL A;  2MHF A;  2IFW A;  1BBT 3;  5LA2 A;  1UY1 A;  2PLV 2;  1ACC A;  2YFU A;  1J3P A;  2D6M A;  4PHZ A;  1G86 A;  3C3V A;  3E5Q A;  4RL7 A;  4CDX A;  1PGL 1;  4ZS3 A;  4O65 A;  4EE2 A;  5FZK A;  3POE A;  2UWB A;  2AUY A;  3ZFF C;  5GZF A;  1YFU A;  3BOP A;  1W2N A;  1EV1 2;  2QQM A;  3KV5 A;  2F6B A;  4CSW A;  4YSF A;  1PVC 3;  4WV8 A;  2NM1 A;  2GC2 A;  1R09 1;  5BNQ A;  3KHB A;  1I9R A;  2JXA A;  3U4S A;  5FDB A;  3BTZ A;  1MVQ A;  3VKL A;  2QQU A;  5FCC A;  3EBR A;  3WX5 A;  2L9L A;  4CDW B;  4TSV A;  3UT0 A;  2GC3 A;  1OKQ A;  1T2X A;  1PNG A;  3CEW A;  1POV 0;  2BQP A;  4QT6 A;  1SHW B;  1RUI 2;  2R0F A;  3ACF A;  4M4R A;  4Q4X 3;  1VBA 3;  4P9Y A;  3L2Y A;  3ZFG C;  4GWM A;  1U0A A;  4URT A;  5JI7 A;  3WP3 A;  3RZZ A;  3ZFE C;  3BIW E;  3OOX A;  2OZ6 A;  4PQQ A;  1ZA7 A;  4CXW A;  5HXV A;  2DUP A;  1OFN A;  2VUC A;  4MXW B;  5FMO S;  4JV4 A;  4XJA A;  2Z69 A;  4E27 A;  4YM0 A;  2VTF A;  4LPL A;  2P37 A;  3ZSK A;  3KT4 A;  5GZD A;  2Y38 A;  2YC4 A;  4EN8 B;  5K4L A;  3ZKY A;  5EJZ B;  3RI8 A;  4AGV A;  1UY0 A;  3P3N A;  1V0A A;  3D4K A;  2YHJ A;  5JXI A;  1W8N A;  2JIC A;  5LK7 B;  5JSP A;  1DLL A;  4DNY A;  4PIX A;  1CIW A;  4IXL A;  3KVB A;  3CKH A;  4LHL A;  4NUB A;  3WVJ A;  4RHV 3;  4XUR A;  5EJ1 B;  1RUE 1;  4CDX B;  5ACA 2;  1W0O A;  1MEC 3;  3WW3 A;  3K4A A;  4JDN A;  2Y64 A;  5FIX A;  1HX6 A;  1JOB A;  2VM9 A;  1OC1 A;  3VD4 A;  1W06 A;  1SLI A;  1VMJ A;  4MGT A;  3A0K A;  3ETP A;  4AVA A;  1AYN 1;  2WNU C;  4BDV B;  5LY2 A;  1N1Y A;  2ZX0 A;  2BTV C;  3ORJ A;  2WNO A;  4QM9 A;  3J8F 2;  4W65 A;  3PIG A;  2WZR 3;  4YG0 A;  3KV4 A;  5FZG A;  4Y1V A;  1UYY A;  2BZD A;  4QKB A;  3SEE A;  2WNV A;  4YVS A;  4MVT A;  4HVO A;  4B7K A;  5FZO A;  1RIR A;  3S5Q A;  2IXL A;  2WLP A;  3IAQ A;  4Q26 A;  5CVR A;  4QDR A;  1PO1 3;  4FFH A;  2W9X A;  2VE1 A;  4PF1 A;  2PFW A;  1TVG A;  2W87 A;  3AJZ A;  3CJI C;  3ENR A;  3ZFF A;  4Z07 A;  2LM3 A;  1DGL A;  5FO9 B;  1GYK A;  1QJX 3;  1ULO A;  4DY3 A;  1QEX A;  3B94 A;  3MBW A;  2QQW A;  4KGQ A;  3NJX A;  5CNA A;  3VGI A;  3VD3 A;  2R07 2;  5AC9 1;  4MXV A;  3ES1 A;  2Y33 A;  1RVF 2;  3ITQ A;  4COV A;  4QPI A;  1GNY A;  5JOY A;  1COV 3;  4NPL A;  3SNM A;  2BBV A;  2QQO A;  2Z5W A;  2QE3 A;  3MEP A;  5DQ0 A;  4FBF A;  1FOD 1;  1F4A A;  2ZMN A;  3WD5 A;  4HL0 A;  4BK4 A;  4COU A;  1RYY A;  3ALQ A;  3OBR A;  3WW2 A;  4DMI A;  2ZOE B;  4JDO A;  2VOW A;  3ZYP A;  4XDP A;  3ZX7 A;  4G9S B;  3ZFE A;  4WZC A;  2W1W A;  2IVI B;  1HV1 A;  4DO0 A;  1C8M 2;  4Y22 A;  3LEM A;  5FUN A;  5EXO A;  5A32 A;  1TMF 3;  2C6S A;  1O3T A;  2R04 2;  5F3G A;  4ZXK A;  4NIA A;  4C0H A;  4DEV A;  4Q8K A;  3PMS A;  2I45 A;  4EN0 A;  4LOR A;  4JGZ C;  1QDO A;  4N9H A;  4P5Y A;  4IQP A;  3OGS A;  3DEM A;  1MR5 A;  1US3 A;  2WNV B;  3E6D A;  2W3J A;  1VBE 2;  2WWU A;  2AEN A;  3H0O A;  4KGG A;  5FZO B;  1MS5 A;  2GME A;  2VGD A;  3PJQ A;  1H30 A;  1AYM 1;  3A22 A;  1HDK A;  3BCW A;  1UZV A;  3OD0 A;  4K6B A;  3BYW A;  2WZP P;  1UOJ A;  3F95 A;  2P34 A;  4O9E A;  2JDA A;  2VAU A;  3ZFF B;  4DOU A;  4YFZ A;  1ODM A;  1LRH A;  2KA3 A;  2H6B A;  3ZN6 A;  2WNU A;  4H14 A;  4IDZ A;  4IGP A;  4BQ1 A;  1QHD A;  1DYO A;  3GHM A;  1JN2 P;  1UIJ A;  1OQE A;  4KH9 A;  3O1U A;  1JYI A;  1J84 A;  1RUN A;  1FPN 3;  5JWP A;  4IEX A;  5FQ0 A;  1GQP A;  3AL6 A;  3AZY A;  4JHZ A;  5F5I A;  5JOZ A;  1V6J A;  2WLQ A;  3LEG A;  3OCP A;  4ASM B;  2PAM A;  1P8J A;  1Q8V A;  3DCQ A;  1OA4 A;  1WMD A;  4XXA A;  2FDG A;  2ZGS A;  1R1Z A;  2ES3 A;  1LEC A;  2J1U A;  3HEI A;  2ZGN A;  3IZO A;  4IET A;  1ENS A;  4QQ2 A;  5FLJ A;  3UV9 A;  5D8A C;  3VZK A;  4MZU A;  4QKF A;  5IVB A;  3ZFE B;  4YZ1 A;  1CN1 A;  4Q1R A;  4CTE A;  2AC1 A;  4ZON A;  4JZR A;  5FZH A;  2JB4 A;  1LCL A;  4Y22 B;  1W6P A;  1HRI 1;  2C9A A;  4IUG A;  4YM2 A;  5A32 B;  1QJY 2;  3ATG A;  1SLA A;  2GU9 A;  3R05 A;  2JDK A;  1FYU A;  1QJU 1;  2W0X A;  1CWP A;  2C5D A;  2FDI A;  2UYA A;  3HR9 A;  3R4U A;  3VLB B;  4Y4R A;  4QQH A;  2D6K A;  2IUW A;  2VCA A;  5FZE A;  3LFI A;  1PX3 A;  4EN6 B;  4XW3 A;  1GU3 A;  1VBC 1;  4BQX A;  1TNR A;  4FP3 A;  2ZHL A;  2BRT A;  2YFZ A;  4BU2 A;  4W50 A;  1S4C A;  5I8Y A;  3NV2 A;  5DDJ 3;  2IC1 A;  1WA4 A;  2XR4 A;  5E1R A;  4OI1 A;  4RGK A;  3ZN6 B;  5FZB A;  5L9R A;  2WNU B;  1DYK A;  4LUM A;  4JQT A;  3BU0 A;  2OT7 A;  4OUE A;  1IG0 A;  4B4R A;  1Y9M A;  3AFG A;  3V56 A;  2AH2 A;  1XNA A;  2ZAB A;  4I30 A;  3ECQ A;  2JD4 A;  1PVC 1;  4AEK A;  5FXZ A;  1RUH 2;  2MEV 2;  2E31 A;  1NY7 2;  1L7L A;  3AL5 A;  3PJY A;  1HJG A;  2CAU A;  2ZKL A;  1MS8 A;  3BUC A;  4HET A;  1F35 A;  5ANQ A;  3W5M A;  3CJI B;  3OPZ A;  3RFR A;  3TEW A;  2KD7 A;  2R30 A;  2QVS B;  1W6P B;  4Q4X 1;  3UES A;  2XWB B;  3QAC A;  5DN2 A;  1I5P A;  1TZO A;  4FPO B;  4QB6 A;  1NT0 A;  4FFI A;  1VPH A;  5L19 A;  1AR9 3;  3N9P A;  3RDI A;  3L9J T;  1OXC A;  3O0W A;  3OGG A;  4QX1 A;  4RSU A;  4P5H A;  1TEI A;  4X6Q B;  1ZRC A;  1AJO A;  1TME 3;  1WCK A;  3FUQ A;  1JYW A;  3JBG 2;  4LK7 A;  5D8A A;  2YBK A;  4PBP A;  3BKZ A;  5CKQ A;  3PIJ A;  4XAE A;  1NCQ C;  3GBG A;  3UKT A;  4L9B A;  4N7I A;  4LXL A;  5C70 A;  5F9T A;  4N8M A;  1MEC 1;  4KNC A;  3N9M A;  3VBU A;  4A41 A;  3OBZ A;  3HN3 A;  5C71 A;  3I3D A;  5EFU A;  1XNC A;  5AFB A;  1DIW A;  1SEF A;  2VZ3 A;  4QD2 A;  3BPS A;  4B29 A;  3ZYF A;  4CYD A;  3WDU A;  2PLV 3;  4XUP A;  1YO8 A;  4I0W B;  3EJK A;  3SIT A;  5L36 A;  3ZN5 A;  1JOD A;  1QJE A;  2GAU A;  3JXS A;  1UY3 A;  3LPF A;  3CMG A;  2WZR 1;  2BV4 A;  3KLS A;  5EPA A;  3MF9 A;  1A34 A;  3AVR A;  4QB1 A;  4XAA A;  1IS5 A;  2QBX A;  3BTA A;  3KVA A;  5E8A A;  1EV1 3;  3WF0 A;  1CAU A;  5FP3 A;  5FKC A;  4LKS A;  3WHT A;  4BJ0 A;  1IOA A;  2A3Y A;  4ASL A;  4BXF A;  1OKO A;  5LA0 A;  4R8H A;  1AR8 2;  1PZ9 A;  3ON7 A;  3E6C C;  3ILR A;  4FO9 A;  2PQQ A;  1WMX A;  2BYV E;  3EB7 A;  1H0B A;  2J1T A;  1QJX 1;  4FCA A;  5T3N A;  3VZJ A;  3WQ1 A;  2ZKN A;  3W9A A;  2XUM A;  1RUI 3;  1YNA A;  4B7E A;  4CCJ A;  2XQR A;  3L2H A;  4U2A A;  3K75 B;  3H3Z A;  3VBR C;  5A3P A;  1BQP A;  1ND3 C;  4CA9 A;  1OD3 A;  2D43 A;  2JDH A;  5D8A B;  1COV 1;  4S2F A;  4OFG A;  4AQ2 A;  3TEX A;  1I5Z A;  3P3P A;  1PM4 A;  4M00 A;  4QX7 A;  3HPN A;  4Z2A A;  1GQH A;  3ETQ A;  1DZQ A;  2P3J A;  3AP6 A;  1DQ4 A;  2B42 B;  3POF A;  2CWM A;  1WLW A;  2XOM A;  2B4K A;  3PDQ A;  1QDC A;  5I91 A;  1IZ3 A;  3OD4 A;  4CU6 A;  2XG3 A;  4LKF A;  3POW A;  3J9S A;  4DXT A;  2VTX J;  2HBT A;  3POS A;  4E2Q A;  1GIC A;  2CNA A;  3WNX A;  1O91 A;  1K5J A;  5ACA 3;  1W8T A;  3T08 A;  4AHX A;  2QQV A;  4YM1 A;  5T55 A;  1YQ2 A;  2WYS A;  4FP2 A;  4AI1 A;  4AI2 A;  3FZ3 A;  1CX4 A;  1Q8Q A;  2QZ3 A;  5A7O A;  1NCQ A;  1IS6 A;  1CAU B;  2WS9 3;  3FFQ A;  3G6J B;  2VQT A;  4K3U A;  4N43 C;  3RG0 A;  4DXZ A;  5K9Y A;  5JXH A;  3MW3 A;  4XYX A;  1SLC A;  1UQX A;  5ERL A;  2RDQ A;  2DVF A;  1NQJ A;  3ES4 A;  4DRV A;  2RR1 2;  2VMF A;  4W4Z A;  4LKE A;  2Z79 A;  2XGX A;  2BUK A;  3LKJ A;  3DUI A;  3N9O A;  4KMQ A;  4BK5 A;  4IEU A;  2RS1 1;  3ROU A;  4L0P A;  2E33 A;  1RTV A;  1RUC 1;  1HN1 A;  1YJL A;  2E51 A;  4OQ9 A;  3K51 A;  1V9U 3;  3BIE A;  1J59 A;  1EY2 A;  1H2N A;  1N3Q A;  1V6K A;  2VQ0 A;  3RQ0 A;  5LAS A;  4XBN A;  1F8V A;  1Z7S 1;  2BFU L;  2WRA A;  2WBK A;  5FMD A;  1BBT 2;  2VZV A;  2A5Z A;  1NXD 1;  2ZZQ A;  2FMD A;  3DXU A;  4CCL A;  3DYO A;  4GWJ A;  1VB4 A;  1RVF 3;  1D4V B;  4FI9 A;  4OI2 A;  1GNH A;  3TB0 A;  4JVA A;  1KJL A;  3P6B A;  1W6O B;  1Q8O A;  2ATF A;  3S0M A;  4IGO A;  1ND2 A;  1DBN A;  4RQP C;  3T1L A;  1GP4 A;  2B9U A;  2YBP A;  3IDB B;  4GAZ A;  3VDC A;  2R49 A;  4CP0 A;  5C3P A;  1QF3 A;  2Q30 A;  1OQD A;  1DQ6 A;  2FMY A;  2AGS A;  4EWA A;  3ZMO A;  3RRD A;  1ND3 A;  4Q4V 2;  1VE0 A;  4XJ8 A;  1HN0 A;  1BKZ A;  5KBF A;  2FDH A;  1Q8S A;  3ZR5 A;  4PLO A;  5GZE A;  3ZVX A;  1NCQ B;  1BEV 2;  1R1A 2;  4J6G A;  1C8M 3;  4XBQ A;  2Y8K A;  3CU7 A;  3ZPY A;  1K42 A;  2YU2 A;  2HWD 1;  3O12 A;  2A6V A;  1GWM A;  3ZYJ B;  1SFP A;  2R04 3;  2XJQ A;  4FOQ A;  5FFO C;  2K2S A;  1OPM A;  1ZRD A;  2OII A;  1XXN A;  3WQ0 A;  2WFF 2;  1ULG A;  1VBA 2;  2RVA A;  4LBN A;  2G9Z A;  2OZJ A;  2YUE A;  5DDJ 1;  5DUX A;  1SG3 A;  2BGC A;  3D82 A;  3FC0 A;  4NWW A;  1VBE 3;  4A3Z A;  3WP5 A;  4LK6 A;  1JYN A;  2XL9 A;  1AR7 2;  4KL1 A;  4BME A;  3DGT A;  3H3L A;  1LEN A;  3N35 A;  1VAM A;  2IXI A;  2JEN A;  1L7R A;  3FWE A;  3RS6 A;  5IHR A;  5KHK A;  3FHI B;  4XXP A;  4XHB A;  3NRU A;  2ARC A;  4BH9 A;  2SLI A;  4N43 A;  3HD8 B;  2G9G A;  1OPO A;  4DPN A;  3WXP A;  1W3V A;  3AP9 A;  3WNP A;  3E5X A;  4RHV 2;  2VL4 A;  1NKG A;  3EYP A;  3C7G A;  3URF A;  1S2E A;  3WG2 A;  1QMJ A;  1WW7 A;  2RJ2 A;  3ZIX A;  2E7Q A;  3U07 A;  3PVE A;  1D2Q A;  1XNK A;  2QJV A;  3WUD A;  1N47 A;  1ND2 B;  3GXU A;  3SCF A;  1G9F A;  3ZYI B;  1KS5 A;  4M3C A;  3NW4 A;  4EZ4 A;  4A6O A;  5IVE A;  3LDB A;  4DRR A;  1EPZ A;  1OH3 A;  2CGO A;  5KHI A;  3VBR B;  1ND3 B;  3KGZ A;  1VJ2 A;  1X8M A;  1BYH A;  3WNL A;  4Y5Z 0;  4DB5 A;  4OHW A;  3VHR A;  4QX3 A;  5JMO A;  5FY5 A;  2DCY A;  3MIB A;  4QPG C;  1EPW A;  1AL0 G;  3WF4 A;  1GAN A;  1PGW 2;  1QJY 3;  1RUD 1;  1TME 1;  4XMA A;  2OKX A;  3WT3 A;  1JZ2 A;  5IAT A;  4FQ4 A;  1PO1 2;  1LJ7 A;  1GSL A;  1F4H A;  2FCV A;  2NYY A;  3A0N A;  3MW2 A;  4NHK A;  4H55 A;  3NJZ A;  5EZW A;  2BP6 A;  3D3A A;  2VZR A;  4L92 A;  4KG8 A;  5CFD A;  2JDM A;  3LIG A;  5H9R A;  4HKL A;  2ZHN A;  3RJR A;  4AED C;  4ZZ5 A;  5JUV A;  2LTN A;  2RS5 2;  4ES9 A;  3GGL A;  3ZXJ A;  3OSD A;  2GZW A;  2PHX A;  4Q4W 2;  4AFB A;  1LU1 A;  2G4I A;  3M2M A;  4HFS A;  4IE5 A;  1X9P A;  4N43 B;  2RJL A;  1MS3 A;  4QMA A;  1ALY A;  3S30 A;  2VUD A;  4BM8 A;  4D7Y A;  3PVB B;  3VDA A;  3K46 A;  1Q3E A;  1PIV 2;  4BLJ A;  2CGN A;  1QIQ A;  2BOJ A;  3OB8 A;  1EV1 1;  4FPL A;  5D1I A;  3V64 A;  3T09 A;  1XE7 A;  2W1S A;  1RUH 3;  1KFU L;  2MEV 3;  4C91 A;  4A45 A;  4D0Q A;  5J48 A;  4M3C B;  1A6C A;  3A23 A;  3M3E A;  5SV5 A;  4XFI A;  1WLT A;  1TMF 2;  3ACG A;  4FPC A;  4ZS2 A;  3SH4 A;  4YGD A;  1XNB A;  3ACI A;  5A80 A;  2R7E B;  1JS9 A;  2Y0O A;  1KIT A;  3C7H A;  4YW7 A;  1KXG A;  1PK6 A;  4K7J A;  5F5A A;  5KHJ A;  3MLJ A;  4K9S A;  4N53 C;  2DVB A;  2VNV A;  4NJ4 A;  5DUW A;  5ISL A;  5CG8 A;  2JKX A;  2J42 A;  4LO5 B;  4LO7 A;  2J7M A;  3NV4 A;  4ASK A;  2VUJ A;  2R16 A;  3AMM A;  3MV0 1;  1URX A;  3U10 A;  3DL3 A;  2D93 A;  4KG0 A;  1WCD J;  5I8T A;  4R52 A;  5CFD B;  4AGR A;  3UK9 A;  2GNT A;  2P3K A;  3OGV A;  4YLZ A;  1F5F A;  1LGB A;  1ZBA 2;  3E6B A;  2PHU A;  5FWE A;  4NVP A;  3M70 A;  3WQ7 A;  2YDE A;  1AJK A;  1FPN 2;  2G9F A;  3B01 A;  1ZYB A;  4L99 A;  3LDR A;  5B4X A;  1H6X A;  1MZ5 A;  4AHY A;  5C3O A;  4UT5 A;  1IPK A;  1EAH 2;  4V2W A;  4GMP 3;  4LMF A;  5ACA 1;  4XUT A;  4MAD A;  2O1Q A;  2CWS A;  4HOO A;  2BFU S;  1RMU 2;  1HRV 3;  4LO6 B;  4OI0 A;  5LEK A;  1XSQ A;  4HSL A;  1NYW A;  1S0J A;  3JQX A;  2QQP A;  5FP9 A;  1UXZ A;  3LE0 A;  5F6L B;  1KRI A;  3AKT A;  4JTN A;  5CEH A;  4HBN A;  1WW5 A;  2XVK A;  1BCX A;  3BN6 A;  2CL2 A;  2XL7 A;  2FHR A;  1RUG 3;  3J8F 1;  5L7O A;  1O5U A;  1SDD B;  2RS3 3;  2ARX A;  3I54 A;  3J4U H;  4Q4Y 2;  5GZC A;  5LBE A;  2DUQ A;  2VZS A;  4XFA A;  2OUH A;  3LIH A;  3ASI A;  1S0I A;  1PK6 B;  3LCP A;  2WQ4 A;  1NX9 A;  4LIT A;  4QDQ A;  4QU2 A;  2XH6 A;  4XCB A;  3S6P A;  3VZN A;  3VL9 A;  5BPX A;  1AR8 3;  3IDC B;  2A6X A;  2NLR A;  5L9V A;  4MHU A;  1RIN A;  3RZH A;  3ZMN A;  2BEO A;  2BNN A;  4IER A;  4A7Y A;  4D7T A;  4CPB A;  1JYX A;  5LRS A;  3SKJ E;  1ASJ 1;  4X8N A;  4E4Z A;  4F7Z A;  5FY0 A;  2R07 1;  4IEP A;  3SH5 A;  1DU3 D;  2GH2 A;  1BXH A;  5JPM B;  5IW0 A;  2PQS A;  1RVF 1;  3AM2 A;  3KGL A;  3KV9 A;  4BQW A;  4CEW C;  1NXM A;  3DPR C;  5C8C C;  5T5P A;  1W8O A;  1NG0 A;  3M3I A;  2BDR A;  3A21 A;  4BIS A;  3HBK A;  4N53 A;  4QPG B;  2FCT A;  3W58 A;  1S0D A;  5I93 A;  4XFC A;  2GN3 A;  1ULF A;  1QXJ A;  3O0V A;  1AF9 A;  1YYN A;  2ETE A;  3I97 A;  4S2H A;  4BXS V;  2SBA A;  1H2M A;  2YRO A;  3J26 N;  1C8M 1;  3HN1 A;  4J1W A;  2B9V A;  1KQR A;  2NZ9 A;  2R04 1;  3SC7 X;  3QD6 A;  4AED B;  2G1M A;  4XTM A;  2DDU A;  3HWJ A;  4Y1U A;  1UNB A;  1MPX A;  5F3E A;  2EIE A;  1K12 A;  4QPY A;  5F7U A;  4L8Q A;  1ZZB A;  2DF7 A;  3J7N A;  1AR9 2;  3VBS A;  2RM2 1;  1PO2 2;  5FK7 A;  1O4Y A;  4Z1V A;  2XKO A;  4DUW A;  3AZV A;  1JUH A;  5IFT A;  5FZ7 A;  4P00 B;  2V5D A;  2B7Y A;  2RR1 3;  3IB3 A;  4CE8 A;  4DUV A;  1LB2 A;  2W1U A;  2VJX A;  2RJK A;  4BIO A;  1GP6 A;  2QNK A;  4K1Z A;  4O9G A;  1KDK A;  3TNQ A;  2HWB 2;  3OBT A;  4LKD A;  4YM3 A;  1VRH 3;  4ISR A;  4GZ9 A;  4EZH A;  3MPP G;  2D3R A;  4GD4 A;  3S5A A;  3K3N A;  5KR7 A;  1QOS A;  3M3C A;  1DGW A;  2A70 A;  2F4L A;  1RUJ 2;  1JOJ A;  3RMY A;  1FNZ A;  2EAK A;  1N1T A;  2IZW A;  4NII A;  3AP4 A;  2R6Q A;  4KWU A;  3SXW A;  3U14 A;  1DZR A;  4QQP A;  4N53 B;  2ARB A;  4CCN A;  4QKN A;  3VN4 A;  1UMZ A;  1VLN A;  1DCS A;  1STM A;  1GV9 A;  1UOG A;  3AXE A;  1DZT A;  2ENR A;  1MS4 A;  4XQW A;  1AL2 2;  1GWK A;  1REE A;  4H7L A;  4Q8L A;  2Y34 A;  5FP8 A;  2HYX A;  1JYC A;  2GND A;  1ZZC A;  1ENR A;  5JSR A;  1HQN A;  4CEY C;  3ZN4 A;  5JMC A;  2R06 2;  1QJY 1;  5CAD A;  2PHL A;  2WT1 A;  5FY8 A;  3O5S A;  2NQY A;  1ZA4 A;  1DGR N;  2D6L X;  4TXW A;  4LQR A;  4Q4V 3;  3RNS A;  4CEW A;  1XJA A;  1OT5 A;  3VBS B;  3DPR A;  3RJ2 X;  2ZAA A;  1R1A 3;  1BEV 3;  5D2A A;  4HG6 B;  3MW4 A;  2DU0 A;  5GJ6 A;  1WMF A;  1CAV A;  5H9P A;  1SDW A;  1DQ0 A;  2DTY A;  2ORX A;  3WEZ A;  3CF6 E;  3J7H A;  1X50 A;  2WFF 3;  4FFF A;  3I3B A;  2DFB A;  4OCT A;  4CRQ A;  4XOG A;  1W2U A;  1XBF A;  1XYN A;  1LES A;  3OGJ A;  5DUU A;  1LOC A;  4M0H A;  2Z4F A;  1AR7 3;  3APB A;  2GC1 A;  4ONU A;  4KWL A;  4GH4 C;  4E9K A;  4BQ3 A;  5CG9 A;  2YMZ A;  2GAL A;  3BAL A;  1TQ5 A;  4TWT A;  5FY1 A;  1W9F A;  2R1D A;  3H50 A;  4RFT 0;  1RUH 1;  4AQT A;  1NY7 1;  1DDL A;  1W28 A;  1WME A;  2TNF A;  2E9Q A;  2PAE A;  4JX0 A;  4ATF A;  2PXJ A;  1ZRF A;  3MUZ 1;  5JVV A;  5M0T A;  4LIU A;  1B09 A;  4YYO A;  3PL0 A;  2RE9 A;  4GUL A;  4BQ2 A;  4IEQ A;  2ZEY A;  2VEC A;  2V4A A;  1JYT A;  4CDU C;  2FZ2 A;  4YW3 A;  3BTY A;  4NAO A;  5FZ3 A;  2WS9 2;  4LIV A;  3I3M A;  2Q8C A;  3RZJ A;  3AYD A;  3MFC A;  5I0S A;  4X8P A;  3ZSE A;  1QWR A;  1MS0 A;  1W6Q A;  1WZX A;  4LEJ A;  3AMP A;  1X7N A;  3K4Z A;  4IE4 A;  5FO7 B;  4CEW B;  5LBB A;  3DPR B;  5C8C B;  1QGL A;  2ZGL A;  3OTF A;  1YUD A;  2JB8 A;  4B8E A;  2NMO A;  2VZU A;  3WDT A;  2A75 A;  1CAV B;  1DHK B;  1NUK A;  3M1H A;  4FTS A;  1GZW A;  1XC6 A;  3MO4 A;  2YBS A;  2J1S A;  3JBG 1;  3LAG A;  3USU A;  1V9U 2;  5CB7 A;  1RB8 G;  1OF4 A;  2OQ6 A;  5A3W A;  5FBZ A;  2GMP A;  2PN5 A;  5BYN A;  1JZ4 A;  2VCC A;  3ZYH A;  5LWB A;  1UMH A;  4M4P A;  4GMP 1;  3FUO A;  4CEY A;  2BW8 A;  1FAY A;  4HSJ A;  2RS5 3;  3AXD A;  2HWE 2;  1LNS A;  3LF7 A;  5F2W A;  5J98 B;  5LBC A;  4Q4W 3;  4C1X A;  3RZM A;  1CJD A;  2FCU A;  4AYU A;  1N3O A;  1HB1 A;  4NIH A;  4N9I A;  2WN2 A;  1C1F A;  3BB6 A;  2D44 A;  1ST8 A;  2DCZ A;  4M01 A;  4QB2 A;  4NR1 A;  1PIV 3;  1FMD 2;  1UYZ A;  2HWC 2;  2XJT A;  4B3N A;  3ZFG A;  5A3O A;  4AK3 A;  1QOO A;  2C4X A;  4TLF A;  4C8D A;  2W08 A;  2QQI A;  2V4V A;  5DG1 A;  1M06 G;  2PTM A;  3HQR A;  4RYD A;  1I1E A;  4QHB A;  4E4S A;  5DG2 A;  5A7Q A;  1AR8 1;  2VOT A;  2DCK A;  4I09 A;  4JC1 A;  4LE3 A;  5ABJ C;  3IIA A;  5F3I A;  5BUV A;  4GH4 A;  3SHR A;  4D3W A;  1F2N A;  1W6Q B;  5A70 A;  4D6S A;  1O3Q A;  2DBN A;  2B46 X;  4IV1 C;  4KI5 M;  2I74 A;  4IV3 C;  3RVH A;  1AX1 A;  3GJA A;  2H0V A;  3ZXD A;  1HXS 2;  1K5M C;  3FBY A;  1XB9 A;  1SFY A;  3C7F A;  5C5U A;  1Q43 A;  1GZW B;  1V6N A;  3OUI A;  5C7G A;  1V00 A;  3O1V A;  2RG4 A;  4Y26 A;  3USU B;  3N7J A;  1D2S A;  3INA A;  3B7M A;  3B9C A;  1AR6 3;  1DGW X;  2ARE A;  4PJY A;  1UPS A;  3ZR6 A;  2D97 A;  2XLG A;  1W9T A;  5KXD A;  1O3R A;  2W5F A;  1SLL A;  3PUQ A;  4CEY B;  2YPD A;  1T6G C;  1ZBA 3;  4IE0 A;  5FYT A;  2VTX A;  3I8T A;  1ENQ A;  3T0D A;  1W90 A;  4ZY9 A;  4LBJ A;  3I2K A;  4JHT A;  2O8O A;  2DUR A;  5CU1 A;  3T2P A;  5BNP C;  1EAH 3;  1V6O A;  4PIZ A;  3U37 A;  1ODN A;  1QU0 A;  1S55 A;  2Z42 A;  1LHW A;  1RMU 3;  2RMU 1;  2JE9 A;  3H1W A;  2GDF A;  5TSW A;  3WW4 A;  3ZFG B;  2IFR A;  4EV0 A;  3BU7 A;  1AUY A;  2VCB A;  3CJI A;  4OHX A;  1DF0 A;  1N1V A;  3OG2 A;  4XF3 A;  4QGM A;  5DMY A;  3J7M A;  2HBU A;  1ENX A;  1RL3 A;  5J96 B;  2ERF A;  3CHX A;  5FP7 A;  2X05 A;  2HEW F;  4AWD A;  4K8F A;  3ZYR A;  5KXC A;  5IK8 A;  5FAX A;  1N1S A;  1GFF 2;  2O0O A;  2RR1 1;  4GH4 B;  2CHH A;  4Q4Y 3;  4UW6 A;  1R08 1;  1VAV A;  4UBH A;  4UFM A;  4YGC A;  1HW5 A;  1UWW A;  1GOF A;  2C26 A;  3KSC A;  4P9J A;  4Y20 A;  2P3Y A;  2J1A A;  2WWJ A;  3VB9 A;  2C0Z A;  3HOB A;  4P9L A;  2IXK A;  4XZP A;  5GLU A;  3LD8 A;  3T4H B;  5LEJ A;  4ARX A;  5J1X A;  4YW6 A;  3KQR A;  4CUA A;  2W46 A;  1BBT 1;  5IJR A;  4EJR A;  2LS6 A;  1FAT A;  2JJ6 A;  1DLC A;  2YGM A;  1HJF A;  4K1Y A;  2EAA A;  4PCR A;  1YIF A;  1LKN A;  1D0H A;  4LLF A;  4SBV A;  2WFP A;  5FXX A;  5ABJ A;  3RYP A;  3WDX A;  4UF0 A;  3X29 B;  5IAV A;  4IV1 A;  3H1Y A;  1W8H A;  3M3O A;  3C7O A;  2WQZ C;  4JGZ A;  4Q0U A;  2XJP A;  3UL2 A;  4AI3 A;  3AJY A;  5LB6 A;  4KBB A;  1K5M A;  2BVV A;  3TRS B;  2FDJ A;  2OYZ A;  3KZ4 C;  1HIX A;  2YC2 A;  1PX4 A;  5CZK A;  4ITC A;  4NRO A;  2IXH A;  4IES A;  3T1M A;  2ZX1 A;  4MET A;  2QTW B;  1YI7 A;  1SCR A;  1R1A 1;  1WW6 A;  2HYK A;  5DAB A;  3OPW A;  1CIY A;  4IEV A;  1IS4 A;  2A3W A;  1PGS A;  1LED A;  2ZGQ A;  2WFF 1;  5JOX A;  1VBA 1;  1J3Q A;  2Q1Z B;  3POB A;  2HJI A;  5F8P A;  1PO2 3;  5EJ3 A;  4Y20 B;  4XJZ A;  5FZL A;  5BNP A;  1J1T A;  3VKM A;  1S0E A;  5G04 L;  5FYM A;  4BYY A;  3ZXE A;  4GQ7 A;  2VC9 A;  1C8N A;  3WF2 A;  4UXA A;  4BLI A;  3UGG A;  2WT0 A;  5FYY A;  1OUS A;  3HT1 A;  5HCF A;  4NE9 A;  2HWB 3;  5EWS A;  3QLQ A;  2P6C A;  5HI0 A;  3IT8 A;  5EQU A;  4AI0 A;  4TZD A;  2ZGO A;  4RHV 1;  2D98 A;  5ABJ B;  1UYX A;  2J1R A;  4E4H A;  2ZGM A;  1G9B A;  2BGO A;  4MO3 M;  5KXB A;  2D3P A;  3OYW A;  5I8S A;  1GR3 A;  1CAX B;  4UF0 B;  2C1F A;  1UCX A;  4HPK B;  4IV1 B;  1HRV 2;  1RUJ 3;  1H8V A;  1NA1 C;  2LRO A;  4RD7 A;  3IMM A;  1SMV A;  2XLA A;  4JGZ B;  3VHN A;  5JXG A;  3MLK A;  1H9W A;  1ZZ8 A;  4GMP 0;  3MI8 A;  4P9W A;  1K5M B;  5BXX A;  4XFH A;  4XZU G;  1W04 A;  1Y4W A;  2H6C A;  5IVF A;  2KR2 A;  2I2S A;  4XF0 A;  1RUG 2;  1QH7 A;  2RS3 2;  2XJU A;  1AL2 3;  1FI2 A;  1O5L A;  3FHQ A;  2VME A;  3PLQ A;  3ILF A;  4UFK A;  4AFD A;  2Q1F A;  1JH5 A;  2VVD A;  4PI2 A;  1JI6 A;  4XIO A;  4COW A;  2Y6J A;  4JTO A;  2R06 3;  3RGB A;  4QU1 A;  4D69 A;  1HQL A;  1EP0 A;  4Z2W A;  1PO1 1;  3IWZ A;  5C4W C;  3NNG A;  2EID A;  1AXY A;  2YPJ A;  4QXH A;  2VZO A;  2K9Z A;  2ZA9 A;  1SAC A;  3B02 A;  3VZO A;  1TG7 A;  3C2U A;  5BNP B;  4KWJ A;  2PHT A;  2CTV A;  3TNP B;  1BHG A;  1X9T A;  3NV1 A;  3PUH A;  1H1M A;  2CAV A;  5AVA A;  2QCS B;  4AGG A;  4CCD A;  2RS5 1;  1G6N A;  3W20 A;  5FYH A;  4CU7 A;  4DXR A;  4X6R B;  3VKN A;  1JZ3 A;  3KHC A;  4FVV A;  3ZYB A;  5BNO C;  3VKO A;  4W6X A;  2D6P A;  2UWA A;  3PU3 A;  2PEL A;  3PUS A;  5FY9 A;  3U78 A;  5LA1 A;  5FZ9 A;  2FZ1 A;  1AXK A;  1C3H A;  3AP5 A;  3B5L B;  4XIL A;  5FMC A;  5HCB A;  1HB3 A;  1POV 3;  3BTX A;  2E7A A;  2EVX A;  1XSR A;  3WR0 A;  2GN7 A;  2OPW A;  2WNE A;  3OYW B;  2Z2S B;  3NNM A;  1OHF A;  1W8W A;  3P5B A;  1W99 A;  2LW8 A;  4PLM A;  5GLV A;  1W6O A;  3UJO A;  1FXZ A;  3T2Q A;  3H3U A;  3O1P A;  2O14 A;  1TMF 1;  1LGN A;  1H2L A;  4WVM A;  2XBO 2;  3T0B A;  4BZ4 A;  3FL7 A;  3UYJ A;  3VD7 A;  1DQ1 A;  2OA2 A;  4JRL A;  4WBB A;  4W8J A;  1JHJ A;  1FV2 A;  3K77 A;  4AHW A;  1L7Q A;  3O7O A;  4GWN A;  4JQR A;  4FTB A;  4NHL A;  4BQ5 A;  4Q27 A;  1GMM A;  2A3X A;  2GSY A;  3MID A;  3KT1 A;  2Y6G A;  1H2K A;  5FRE A;  2JIG A;  4BWO A;  1NA1 A;  4NN0 A;  2ZPX A;  2DVD A;  4XET A;  4AFC A;  1ONA A;  4JGY C;  4XDQ A;  1A8D A;  4XUQ A;  1US2 A;  1VRH 2;  1REF A;  1ZBA 1;  3I2H A;  4AL9 A;  5A6Q A;  4XJ9 A;  4RR3 C;  5F3C A;  3CLP A;  1FPN 1;  2P2K A;  3PU8 A;  3NNF A;  3ZOI A;  2UY8 A;  1SBF A;  2PHW A;  4AE2 A;  1EAH 1;  2Y0I A;  5FTT C;  4ZPI A;  1O8P A;  3OPT A;  1ZRE A;  4Z8B A;  2JDP A;  4NRQ A;  2A73 B;  2HWE 3;  1RMU 1;  2A6W A;  3ZSL A;  5C4W A;  5FZA A;  3OBA A;  2YV8 A;  3EQE A;  2X10 A;  3ZLI A;  1TE1 B;  1WBL A;  2ZJC A;  1UZW A;  2OQ7 A;  2OPK A;  4ARY A;  4OUL A;  4Q0S A;  5JXJ A;  1G9A A;  1FMD 3;  3N36 A;  2HWC 3;  4WVM B;  3VV1 A;  1Z78 A;  4OVE A;  4ZU7 A;  1ZVF A;  1T6B X;  4DIQ A;  3VBR A;  2WO3 A;  1PM7 A;  2JDN A;  1CPN A;  1S2B A;  2W2I A;  4NPR A;  4FAG A;  5A3N A;  5KXE A;  1ZBE 3;  4CU8 A;  1RIT A;  1O6U A;  5FYB A;  2EA7 A;  1XND A;  2BWC A;  1VMH A;  3GCW A;  4E8C A;  1LHU A;  2JG8 C;  4OZO A;  1PNF A;  3AMN A;  4AW7 A;  1W9Y A;  4CP1 A;  1NA1 B;  3TAY A;  4CCK A;  2WAO A;  1BMV 2;  1QKQ A;  1HXS 3;  2BU9 A;  3UJQ A;  3AFK A;  3ZXK A;  4XF4 A;  2AR6 A;  5FPV A;  4LE4 A;  4J1X A;  1UKR A;  1YQ8 A;  4YZ3 A;  2W92 A;  1GZ9 A;  3UGF A;  2OUJ A;  2WIN B;  4Z92 B;  5FZF A;  1KD7 A;  5IK7 A;  1DP0 A;  2EIC A;  4K20 A;  4CUG A;  4GB3 3;  4A7Z A;  5BY5 A;  4I2O A;  5L73 A;  1RJ7 A;  2QDN A;  5C4W B;  2BJS A;  1QH6 A;  3JD7 3;  4ZU4 A;  1C57 A;  1W6M A;  3AZW A;  4D8M A;  4CVU A;  4MGZ E;  3R4S A;  5C3Q A;  2H0B A;  3I49 A;  1W39 A;  5FP4 A;  2ID4 A;  3DN7 A;  5J37 A;  4LOT A;  4DQA A;  1DQ5 A;  4JGY A;  1YQC A;  3WOG A;  3K2O A;  1WD4 A;  2VBP A;  4XMI A;  5I0T A;  3V65 A;  3WG3 A;  1APN A;  3AVS A;  3WDV A;  4RR3 A;  1AR9 1;  2YC0 A;  3EO6 A;  2NN8 A;  4CZS A;  5E6H A;  1NCR C;  3NAP C;  4A3X A;  2HKX A;  5BNN C;  1RXG A;  1VAK A;  2BPA 2;  1O4T A;  3GDB A;  1A78 A;  1KJR A;  1WCU A;  4QHO A;  2XWJ B;  3BI3 A;  5J3U A;  1JYV A;  2HLE A;  4DUX A;  4WM8 C;  4MGQ A;  4COZ A;  5LA9 A;  1E5R A;  2CGP A;  2QKD A;  1LTE A;  1PZ8 A;  1OVS A;  5F6K A;  1UD1 A;  4LBQ A;  2ET1 A;  2HWB 1;  1W3X A;  3FE5 A;  3IBM A;  3GJB A;  3MLL A;  5T5O A;  1YXW A;  4RQP A;  3G7D A;  2W95 A;  2W47 A;  5JIA A;  4XPV A;  3UGH A;  2EIG A;  1QNW A;  2TBV A;  3TYJ A;  3TN9 2;  2P3I A;  3WNM A;  1OLR A;  2WAB A;  2IWG B;  1RUJ 1;  5L9B A;  4XJU A;  4XJW A;  4FXK B;  2ZCW A;  1ZZ9 A;  3CDZ B;  4LHN A;  2PLV 1;  3DYP A;  3RWK X;  1SBD A;  1PMH X;  1XOY A;  3I2D A;  3RZL A;  4CCO A;  1R09 3;  2JG8 A;  4XUO A;  4OHY A;  5A6Y A;  1LOF C;  2UYB A;  3MGU A;  4HVR A;  1X82 A;  1AL2 1;  1J58 A;  1W6M B;  3AKR A;  3R4D B;  4LBL A;  4PT6 A;  4QX8 A;  2HWF 2;  3LFM A;  2G19 A;  2OXB A;  2GP5 A;  1ULP A;  2R06 1;  4JGY B;  1NOV A;  4R9A A;  5FYU A;  3VHP A;  5K0U C;  2WO2 A;  1RJ8 A;  2ZHK A;  1LHO A;  3GBW A;  4RR3 B;  2BWA A;  1E57 A;  4LUK A;  4LA3 A;  4RGG A;  5F5Q A;  1GP5 A;  3CQO A;  4PF5 A;  2NP0 A;  1IPS A;  2ZX3 A;  2XLF A;  1D7P M;  2GNB A;  5CA6 A;  3WF1 A;  1RUI 1;  1BJQ A;  1IGO A;  3K4D A;  5IVY A;  2XUE A;  2W1Q A;  5FUP A;  5IVC A;  4IEY A;  4GJZ A;  4UW3 A;  5T5L A;  3QOP A;  2Y6H A;  3HNB M;  4MH0 E;  2VNR A;  2UWC A;  4LBQ B;  5IFP A;  2EF6 A;  1ZRI A;  1OUR A;  1V6I A;  1LOD A;  5A7N A;  1AR6 2;  3NL1 A;  4RQP B;  2ADE A;  3FLP A;  2A6Y A;  3SLI A;  4P9G A;  2IXJ A;  2AYH A;  5I0U A;  3H9A A;  1RUE 3;  3LSE A;  2F4P A;  3S7E A;  2OS2 A;  3PVO A;  3LPG A;  2VVF A;  3QCW A;  3M8L A;  4FPG A;  4AFM A;  1CGP A;  3MZH A;  4ET7 A;  3GM8 A;  5FZ1 A;  3D0J A;  1UY2 A;  1NCR A;  5LY1 A;  5A6X A;  5FYZ A;  4RN5 A;  1Q56 A;  4PQ9 A;  4QPG A;  4XBL A;  4AVC A;  4MGY E;  1G8W A;  1XE8 A;  1VR3 A;  1CZV A;  2JG8 B;  2XB6 C;  1IS3 A;  2WZ8 A;  1OSG A;  3PNA A;  4WM8 A;  1Y9Q A;  4XC9 A;  2IVJ A;  5J09 A;  3N9Q A;  2P1B A;  3AKQ A;  3KV6 A;  4QXC A;  3PUR A;  1EUT A;  2W68 A;  1VIW B;  1WA6 X;  4M3C E;  5IUQ A;  3WHU A;  4AI8 A;  1UY4 A;  2WS9 1;  1IKQ A;  1CON A;  5HBA A;  4RGA A;  4CUB A;  4AED A;  2RS1 2;  1ZM1 A;  4MYE A;  3AZX A;  3C8X A;  1RUC 2;  3GZT B;  2DFC A;  1SFN A;  4LO4 B;  3RWN A;  3HIF A;  3AZZ A;  4AEM A;  1WLC A;  4IE6 A;  1Z7S 2;  3JB4 C;  3I59 B;  5AFE A;  2I07 B;  1LOF A;  1QXP A;  1V9U 1;  3GHN A;  2ZAC A;  3ZPO A;  4B4Q A;  5FZ4 A;  2ZTN A;  3PVN A;  4YW2 A;  4AVT A;  1YIP A;  3LDK A;  4LA2 A;  3BGA A;  4OYU A;  1FV3 A;  2ZMK A;  2R32 A;  1GWL A;  3GNE A;  5K0U A;  2UY9 A;  3CZJ A;  1XYP A;  2VBD A;  3WG4 A;  3VL8 A;  1A8M A;  2WL1 A;  4NPM A;  4XQD A;  1V70 A;  2VQA A;  3LQC A;  2ILM A;  5DZG A;  5IT6 A;  3QH6 A;  1NCR B;  3AKP A;  4FQZ A;  3BVC A;  2ZGR A;  4MG2 A;  1UYP A;  4DEQ A;  5JPN B;  2VW0 A;  3JUU A;  4S2G A;  2HWC 1;  1C4R A;  1SZB A;  3MPB A;  4I02 A;  3CBN A;  5F5C A;  3HVD A;  4IEZ A;  4WM8 B;  4LUL A;  3IAP A;  4XF9 A;  1YHF A;  3UET A;  2RDS A;  4BCU A;  3NV3 A;  4MSV A;  4NRM A;  5FOJ B;  1LOA A;  4NID A;  3MV1 1;  3KQ4 B;  4HN1 A;  5DPN A;  4DFS A;  5FYV A;  2MNG A;  2VMI A;  4OMC A;  2JG9 C;  2XQX A;  1AVB A;  2XBO 3;  1UX7 A;  2VXJ A;  5FWJ A;  5JZG C;  4QX2 A;  2O8Q A;  5B4N A;  2GC0 A;  3VUO A;  3H7Y A;  2ADD A;  2DCJ A;  4K8R B;  4QHZ A;  3A4U A;  2E6V A;  4QAW A;  2D5F A;  2FDK A;  1VBE 1;  3HBZ A;  3NMB A;  3LGR A;  2BBA A;  1LOG A;  1UZZ A;  2E32 A;  2UU8 A;  3JCI A;  3JZV A;  1IQA A;  4RS5 C;  4AQS A;  5KC5 A;  3V0B A;  4MGS A;  4JDM A;  5A33 A;  5JAX A;  2WA4 A;  1E5H A;  4HK9 A;  1O59 A;  2JWP A;  4NMI A;  4YGE A;  5A1A A;  2JDU A;  5DAX A;  1OD5 A;  5E16 A;  5AVP A;  3I2O A;  3O1R A;  1QY4 A;  4B1M A;  5IVJ A;  2A7A A;  3AYE A;  1F31 A;  3LOI A;  4D94 A;  3AC0 A;  4YNI A;  4A42 A;  5C9A C;  5K0U B;  1SBE A;  5FR3 A;  3AYA A;  1KS4 A;  4FOV A;  4K21 A;  2R1B A;  2XON A;  3RYK A;  1YWK A;  3OGR A;  3SKV A;  3T30 A;  4LLO A;  2YGL A;  4E4D X;  1RUF 2;  2XPJ A;  4OLL A;  1HRI 3;  3THC A;  2C24 A;  3ELN A;  1W8U A;  1C5H A;  4KU8 A;  2F17 A;  4XE9 A;  4R4X A;  1RGS A;  4AEJ A;  1NZC A;  5H9S A;  4IGQ A;  1W05 A;  1LUL A;  3HT2 A;  4QM8 A;  1VBC 3;  3I2J A;  3H8R A;  1H6Y A;  4KQ7 A;  5C8C A;  3IM0 A;  3Q8B A;  2QUO A;  2WNV C;  2DWR A;  3HQX A;  3KF5 A;  1ZX5 A;  1W2A X;  3N7K A;  4JKL A;  4YVS C;  3H8O A;  3DKQ A;  3WG1 A;  3V0B B;  2CDO A;  1AHS A;  1EUU A;  4XHX A;  3VKF C;  5CFC C;  5A33 B;  1VMF A;  4D6R A;  2DVA A;  2XDV A;  4HXC A;  4BQY A;  4E2S A;  3MIH A;  3PHM A;  4FTE A;  1OOP C;  2E26 A;  4NIG A;  2DCT A;  2IXC A;  1W8F A;  2AZ5 A;  3AK0 A;  3HAG A;  4N7U A;  5JR7 B;  3FFZ A;  3WDW A;  4BA6 A;  5JZG B;  4XFF A;  2K46 A;  2D3S A;  3PME A;  3VBH C;  3H42 B;  2JG9 A;  5JZG A;  1GQG A;  2J1E A;  5I0R A;  1D4M 2;  5EP9 A;  4YPJ A;  4HON A;  4Z82 A;  4QPI C;  4PIY A;  2A6Z A;  1O3S A;  1HB4 A;  2GMM A;  2MEV 1;  2JX9 A;  1RHI 2;  2WZE A;  2ZS6 B;  4RS5 A;  4HLT A;  1LOB A;  1SPP A;  1XU2 A;  1C5I A;  2W94 A;  4QWN A;  4BIF A;  1DG6 A;  3GCX A;  2Q8E A;  4XDO A;  3WZ1 A;  1G7Y A;  1Y9G A;  4LOS A;  4HZF A;  2XJV A;  2Y6L A;  2UUR A;  4CCE A;  4FSJ A;  3AB0 A;  2Y26 A;  4XCA A;  4XQ4 A;  4BMB A;  3LOB A;  3OEA A;  4NRP A;  5C9A A;  2VU9 A;  1DGR A;  1S2K A;  4J25 A;  4M3C F;  4MUV A;  3M3Q A;  1UOF A;  5H9Q A;  4BQ4 A;  5KC6 A;  5HXM A;  3CJX A;  5IK4 A;  1FX5 A;  4CCC A;  2VW2 A;  5LCW L;  1F9K A;  4QQO A;  5LZ6 A;  1YFX A;  2CSG A;  4MGI E;  4V1P A;  5BV6 A;  1WKY A;  1KFX L;  3I2G A;  1ULE A;  4HK8 A;  4R4Z A;  2D40 A;  2AEZ A;  1KDM A;  1U5X A;  4I0B A;  5JDB A;  3VDB A;  1L3J A;  3ZO0 B;  2A1X A;  4AQ6 A;  3GF6 A;  1JU4 A;  2A71 A;  4XAB A;  2Q8O A;  5GLZ A;  1UW8 A;  4IE7 A;  1GZC A;  1UU6 A;  1SCS A;  2JG9 B;  2JEM A;  1VRB A;  2TUN A;  3H7J A;  3TN9 3;  4NHX A;  3WNN A;  3ZXG A;  5IVV A;  2PA7 A;  1YQ5 A;  4Q5O A;  1HRV 1;  2QQK A;  2WYF A;  4HT1 T;  5A7S A;  3VDD C;  3NST A;  1PZ7 A;  4UFL A;  1VBB 2;  2VO5 A;  4NHY A;  1LU2 A;  2WN3 A;  4RS5 B;  3E97 A;  5C8W A;  4ORF A;  3OUH A;  5CFC A;  1RUG 1;  2VQU A;  2WSU A;  1WCQ A;  2Q0A A;  1SPP B;  2RS3 1;  3M4F A;  4L97 A;  1OVP A;  1OOP A;  2HWF 3;  1PHM A;  4IND A;  4QX0 A;  4YRD A;  4CPB D;  4MV2 A;  1UF2 C;  1ZBE 2;  1ASJ 2;  3N7M A;  4IL7 A;  3VBH A;  1W6N A;  2X09 A;  3KD4 A;  4QGL A;  4H2A A;  5FZ6 A;  5C9A B;  1QQP 2;  2YG0 A;  3B69 A;  1NLS A;  4JCK A;  4O61 A;  3AMH A;  3PTR B;  5A3M A;  4CXY A;  5FZI A;  2BVB A;  2QQJ A;  4ZKT B;  1B35 C;  1IKP A;  1UZ0 A;  1OUX A;  2FD8 A;  3BPZ A;  2W39 A;  1YLL A;  4TLG A;  3VHO A;  2P17 A;  3OUJ A;  4HKW A;  1O8S A;  2WUH A;  5EYX A;  3RPQ A;  4ZZ8 A;  3CNA A;  4AXO A;  4HN0 A;  4CDU A;  5EHD A;  1CR7 A;  2KM2 A;  4QKD A;  5LW9 A;  2X5I C;  3PUA A;  4GB3 2;  2VMH A;  3I3E A;  1OH4 A;  1VBD 2;  2ZXQ A;  3JD7 2;  4MGK E;  4OHV A;  4AFA A;  1XE0 A;  4RA0 A;  3LZZ A;  3DXT A;  2FBE A;  2WQ8 A;  2RM2 2;  4Q1P A;  4YVS B;  5FZD A;  3VBO C;  3ZSM A;  2Q1M A;  5I0D A;  2PYT A;  5CKN A;  4H3W A;  1Z0H A;  2XBO 1;  5CFC B;  3WV6 A;  4EN9 B;  3DYM A;  3I3Q A;  3NVC A;  3AYC A;  2D7F A;  1JXN A;  4NHM A;  2ET7 A;  2VVE A;  1F5J A;  2YY1 A;  3T3Y A;  4LT5 A;  1CZT A;  1OOP B;  1O7F A;  1X8E A;  1QOT A;  2RDR A;  3FLR A;  5FO8 B;  4YVW C;  1DYP A;  4Q0P A;  3ZXF A;  4AR2 A;  1PVX A;  2RS1 3;  3VBH B;  1W6N B;  1RUC 3;  2Y6F A;  5FJH A;  2FDF A;  4FPK A;  5FPX A;  1OQ1 A;  4QPI B;  3VDD A;  2CU5 A;  4ZHN A;  2ZEZ A;  1Z7S 3;  4CU9 A;  1VRH 1;  3SMH A;  5DAV A;  2VD7 A;  2GP3 A;  4FPY A;  3SCH A;  3N9N A;  1CZS A;  1S0F A;  1PGL 2;  5FPA A;  1JUI A;  2ARA A;  2V5Y A;  5CIR A;  1UAI A;  3WY6 A;  4CDU B;  1MAC A;  4EN7 B;  3H8X A;  1LAJ A;  3WW1 A;  3KCX A;  1UKG A;  4UOJ A;  1U5Z A;  1OA2 A;  4QXB A;  4GKY A;  1R09 2;  1W2O A;  2XXZ A;  3OEB A;  1CAX A;  3VBU C;  4HPK A;  2Y60 A;  4CDQ C;  4IV3 A;  2CYF A;  5LRR A;  2WC2 A;  2ZAH A;  1XNT A;  4UBG A;  5KWR A;  1B35 A;  1MQT C;  4UFJ A;  2HWD 3;  5ANN A;  3MUY 1;  2KXL A;  4WM7 C;  2XKP A;  3JU9 A;  2CY6 A;  4P9I A;  1NLR A;  4Q4V 1;  3DEC A;  4UYB A;  1H8T C;  3MDP A;  3NKT A;  4EWD A;  3FJS A;  3R6S A;  4C0B A;  4P02 B;  4YZ5 A;  3KS7 A;  4AHZ A;  1LHN A;  1BEV 1;  3NJY A;  5IYY A;  4FFG A;  3M7A A;  1GZT A;  1U12 A;  4V2V A;  5JI9 A;  2DYC A;  3FX3 A;  1K45 A;  3Q8C A;  1HB2 A;  4Y1X A;  3MIF A;  4AG4 A;  4I3G A;  1GKB A;  2X5I A;  5SV8 A;  3USS A;  1CQ9 A;  5GM0 A;  2PHR A;  1QJF A;  2V72 A;  2R0H A;  3FHA A;  1BMV 1;  3TEZ A;  5FQ0 B;  3VDD B;  1HV0 A;  2Y6K A;  4HKO A;  3KWV A;  3VBO A;  2WKK A;  1AR7 1;  3NNL A;  3Q8A A;  2RDN A;  5FZ0 A;  4ZXE A;  1S0G A;  5APA A;  1HLC A;  4AI9 A;  3ZXA C;  4JKM A;  2ZX4 A;  3HNY M;  3LB9 A;  1RUE 2;  3N7L A;  3DF0 A;  5T50 A;  2YZ4 A;  4TYS A;  5T5J A;  3WNK A;  3KM5 A;  4YVW A;  4Y1Z A;  2DBI A;  1PMJ X;  1AYN 2;  4QXK A;  3PTY A;  1YQ6 A;  4KBZ A;  4LJH A;  4GIQ A;  4AAX A;  2K0G A;  5A3L A;  3U75 A;  2XJR A;  3UKV A;  3RZG A;  1SLB A;  1WD3 A;  5F1R A;  2GH8 A;  1LOE A;  3WDY A;  4CCM A;  2D6O X;  4IV3 B;  5A1F A;  2VNG A;  3U11 A;  3Q8F A;  1GBG A;  3GZU C;  4BB3 A;  1B35 B;  1RUF 3;  5GLT A;  3IMN A;  3I4I A;  1LGC A;  1RUD 3;  1EYB A;  2WWS A;  3ACL A;  2QFE A;  2DVG A;  3E5U A;  4MHR A;  4A2U A;  2WDB A;  1XRU A;  3IN9 A;  2W91 A;  4BHP A;  3POY A;  4Y5S A;  3D6E A;  1PGW 1;  1ZNP A;  2VOV A;  3V0A A;  3VD9 A;  2XHN A;  2X5I B;  4A7K A;  2Q8D A;  5AC9 2;  1ZZ6 A;  4CDQ A;  2B5H A;  2FQP A;  2ZEW A;  1CES A;  2BOI A;  3PUI A;  4QQL A;  2CDP A;  2D6N A;  5FV3 A;  1C1L A;  1JU3 A;  1UZY A;  3VBO B;  1MQT A;  3WQB A;  3O1T A;  3WP6 A;  4YW1 A;  3TN9 1;  2JKB A;  1CVN A;  3AP7 A;  1GOG A;  1FOD 2;  3HQU A;  3Q8E A;  4IW3 A;  4WM7 A;  5FBJ A;  5T52 A;  1H8T A;  3BOW A;  3FN9 A;  4U36 A;  2ZZJ A;  4Q4W 1;  5GAL A;  2VR4 A;  3QBQ A;  3IPV A;  3TBD A;  3FMG A;  1QNY A;  5JIU A;  2DV9 A;  4YVW B;  3S7I A;  3THP A;  3NNJ A;  5DAQ A;  3U4X A;  1H1A A;  1D4M 3;  1PIV 1;  2D5H A;  2YXS A;  4F3J A;  3R0R A;  1S0C A;  4YG6 A;  2HWF 1;  1FNY A;  4D7S A;  4UFI A;  3UNP A;  1ND2 C;  3ZM8 A;  3J7L A;  3MF6 A;  1RHI 3;  3POI A;  1BLZ A;  1JZ8 A;  4JRA A;  1W0P A;  3WNO A;  4A4A A;  2HEV F;  5FYS A;  4EQV A;  4XUN A;  1W03 A;  2P5B A;  5FY4 A;  1RXF A;  5FPL A;  2WO1 A;  4S2D A;  5DXD A;  2ZGK A;  1AYM 2;  5DAP A;  1JTZ X;  4COY A;  5FLI A;  1I3H A;  3E1F 1;  3LWC A;  3I7D A;  4HVQ A;  2YU1 A;  3ST7 A;  4P14 A;  1N3P A;  1WUV A;  4WVZ A;  3V0A B;  2VUA A;  5FOB B;  1YFY A;  2OW4 A;  4PDW C;  3ABZ A;  4P08 A;  3MIE A;  2V73 A;  3KB5 A;  3VBU B;  5HPO A;  1C28 A;  2XVG A;  1AR6 1;  5FPZ A;  4CDQ B;  2JDY A;  1MZF A;  3W21 A;  5C3S A;  3MIG A;  3TEY A;  1UOB A;  2PHF A;  1DQ2 A;  4FOY A;  5LK5 A;  4XIK A;  4I3P A;  1MQT B;  3KT7 A;  3SEP A;  4KWK A;  4UI9 L;  5T54 A;  3WSO A;  4WM7 B;  1XPW A;  3VBF C;  2RMU 2;  2LUW A;  1H8T B;  5HCA A;  4BPZ A;  1OLM A;  4OQ8 A;  1M4W A;  3IPV B;  2WAA A;  1LEM A;  4FPH A;  3RI9 A;  3B9I A;  4AZZ A;  2DUO A;  3KMH A;  4QGN A;  3J8F 3;  1HRI 2;  3CL1 A;  2X53 S;  2EXI A;  1R08 2;  5G05 L;  4A44 A;  4XFG A;  1QJU 2;  3LA3 A;  1YJK A;  5A1L A;  1VBB 3;  3K3O A;  1GOH A;  1J3R A;  3OJB A;  3SQO A;  5CKM A;  3LEK A;  1W9W A;  4Q4Y 1;  2MPF A;  3POG A;  4URA A;  2C9K A;  2JE8 A;  2VG9 A;  2B39 A;  3P1I A;  1VBC 2;  2YYO A;  3CIH A;  4ERO A;  5BNO A;  5CAZ A;  3CZU A;  5B2G B;  4LTA A;  4L2N A;  4E2G A;  1ASJ 3;  5FK8 A;  3ZIW A;  3O1M A;  3GZA A;  1KGY A;  2R07 3;  1TNF A;  1NE4 A;  2WII B;  1QQP 3;  2EAL A;  3GAL A;  5HV0 A;  4O7X A;  4HMZ A;  3AKS A;  1Y43 B;  5F32 A;  3ZKU A;  1G9C A;  3IDE A;  2EXJ A;  4JAA A;  1JMU B;  2VNO A;  5CFD C;  1BK0 A;  2JIJ A;  2XML A;  1PVC 2;  3WP4 A;  4YGB A;  4BE3 A;  4XEZ A;  3BOD A;  4YZ4 A;  2DTW A;  3EMR A;  1E5S A;  2X8K A;  4LR4 A;  4XAC A;  1J1L A;  2VZQ A;  2VZT A;  3B3Q E;  3I2I A;  3THT A;  2OX0 A;  4TTG A;  5FLH A;  1WWY A;  5A6Z A;  1UXX X;  4GA9 A;  4C1W A;  3WLU A;  3NWK A;  1AZD A;  1WCS A;  3AX4 A;  4CP9 A;  3ME2 A;  1YCI A;  4PDW A;  4Q4X 2;  4DXS A;  1VBD 3;  3T0A A;  4WVV A;  1RED A;  1UN1 A;  3ZYG A;  3B93 A;  2WSV A;  2RM2 3;  1BK1 A;  1ZRR A;  4AF9 A;  3W59 A;  1YC6 1;  2QZ2 A;  1SQ4 A;  3IDA A;  2VW1 A;  5CYY A;  4FPJ A;  4AVV A;  2E63 A;  1JW6 A;  1E5I A;  1YEW A;  5FRA A;  2B8M A;  1UIK A;  1XYO A;  3VBF A;  4AVB A;  4B4P A;  1Q8P A;  4W6W A;  1WGP A;  4DY5 A;  1PO2 1;  5BNO B;  1PK6 C;  3OY8 A;  4N90 A;  4QX5 A;  5IWF A;  1W0N A;  4MOA A;  3NO8 A;  5FZC A;  3U0Z A;  4WZF A;  2VMD A;  4FOW A;  5CIS A;  2CV6 A;  1VB2 A;  4LO8 A;  1MEC 2;  3CO2 A;  5FPB A;  5FXV A;  4IEW A;  4GAL A;  5JCT A;  2GNM A;  4G4F A;  4YW5 A;  1OA3 A;  3WF3 A;  1NQD A;  4K40 A;  3O14 A;  1UPI A;  4IEO A;  3S57 A;  1JBC A;  5DZE A;  1JZ6 A;  3RMX A;  2ZX2 A;  3WCR A;  1OLM E;  3O1O A;  3DV8 A;  4LHK A;  4OUS A;  4XVH A;  1BVP 1;  1YFW A;  2LAL A;  3SH3 A;  3T2T A;  4PBO A;  2WZR 2;  1JOP A;  3LA2 A;  2J1V A;  1CD3 G;  4UFH A;  4FAH A;  1H1I A;  4XTP A;  1RUF 1;  4BOW A;  5K8S A;  2J22 A;  2PHD A;  4C90 A;  1LHV A;  3QH7 A;  4YG3 A;  3WCS A;  3RSJ A;  4CP9 B;  4OHZ A;  1W9S A;  1XU1 A;  5EIY B;  3MYX A;  3ZDV A;  4PDW B;  5F37 A;  1UU4 A;  1S1A A;  5A3T A;  4P9X A;  2JE7 A;  1NAE A;  1Y3T A;  3ILN A;  2RV9 A;  3K48 A;  5DZF A;  1QJX 2;  3MIC A;  1U5Y A;  1WLD A;  2ZML A;  4FT8 A;  4M0N A;  5L7O C;  1MS9 A;  4Y3O A;  4LBO A;  5GLW A;  5KHG A;  3VBF B;  3T4V A;  2VY0 A;  3VZM A;  5FZM A;  4CXX A;  4DS0 A;  4I0A A;  1CAW A;  4G3Y C;  2XJS A;  2NPI A;  1COV 2;  1O4Z A;  3OY8 B;  5GKA C;  1GUI A;  4W6Y A;  5IK5 A;  3RYR A;  3TOJ A;  4LBM A;  4AOC A;  3I59 A;  3F2Z A;  4PI0 A;  5KHH A;  1YRZ A;  2VPV A;  4A6S A;  4DZG A;  1WW4 A;  4YAR A;  5FKB A;  3AMQ A;  2ZGP A;  1IPJ A;  2B45 X;  2BER A;  1LR5 A;  1DFQ A;  3JB8 A;  1OMI A;  1IG3 A;  1U5I A;  2PAK A;  3NJV A;  5J7M A;  4Y24 A;  1F15 A;  5FYC A;  5HV4 A;  1UX6 A;  5E88 A;  1QJZ A;  3GZE A;  2P4E A;  4Q0V A;  1D4M 1;  2W52 A;  1POV 1;  3EHK A;  3O0X A;  3W5N A;  4EYU A;  4D6Q A;  2QQN A;  1FT9 A;  1HKD A;  2VXR A;  5FXW A;  3KF3 A;  4FXG B;  5FYI A;  3NAP A;  1RHI 1;  3C7E A;  1RUO A;  5BNN A;  5A7W A;  3U1X A;  2BNM A;  4QPW A;  2YB7 A;  4Y5T A;  5GZG A;  4F83 A;  1AYN 3;  1H4H A;  1UL9 A;  5A7P A;  5IAX A;  3DKW A;  1BZW A;  4SLI A;  4Y1Y A;  5FMO L;  5D21 A;  4R9C A;  5F2S A;  3WIN E;  4MX3 A;  3HNM A;  3IKW A;  2VOX A;  4LHS A;  2BGP A;  3JQW A;  4ES8 A;  5J36 A;  3N4M A;  2JEC A;  3III A;  4FPF A;  4L11 A;  4YZ2 A;  1HQW A;  1Q5O A;  1ZZ7 A;  5LBF A;  4GJY A;  2AAC A;  2EXH A;  3JBG 3;  1MVE A;  1ULC A;  2ZHM A;  1I6X A;  3VBS C;  4TN7 A;  1CAW B;  2BNO A;  4LNV A;  1S0B A;  4CDW C;  1MS1 A;  2TEP A;  1NE6 A;  4EWE A;  4HAN A;  2JD9 A;  5FUI A;  2JDZ A;  4NO4 A;  2HH9 A;  3POJ A;  3Q9O A;  5AC9 3;  1OLQ A;  1RC6 A;  4DIN B;  1JZ7 A;  3GYD A;  1IHM A;  4Q29 A;  4ISQ A;  4E8D A;  2VBB A;  1JZ5 A;  2VZP A;  1OFS A;  4OUM A;  1W8Z A;  1UO9 A;  1CJP A;  3ACH A;  3D8C A;  4WVW A;  5HCH A;  2VOK A;  3MHZ A;  1JHN A;  3THD A;  5FMB A;  1SLT A;  2N7G A;  2VMG A;  1J83 A;  1FOD 3;  2HWE 1;  4Y4Y A;  2X29 A;  1CPM A;  2RHP A;  1NLQ A;  3VD5 A;  1OF3 A;  1H4G A;  1VBB 1;  4NAM A;  2LRP A;  1QXR A;  2NMN A;  3NAP B;  1CX1 A;  4GWI A;  1X33 A;  2VMC A;  5BNN B;  5EV7 A;  5A7W B;  4OI4 A;  4ATE A;  1FMD 1;  2HWD 2;  4JKK A;  4CDX C;  1X36 A;  2ORZ A;  1YI9 A;  5K7P A;  3T2O A;  1KEX A;  1D0G A;  2P6H A;  2WJS A;  4B1L A;  3D0S A;  1PMI A;  1WBF A;  5FZ8 A; 
#chains in the Genus database with same CATH homology
 2VUD A;  2WR9 A;  2BOI A;  5A3O A;  5A6Q A;  5HCH A;  5D2A A;  5A6Y A;  2JDN A;  1OVP A;  2BOJ A;  3ZDV A;  1OUR A;  1OXC A;  5A6Z A;  1W8H A;  2CHH A;  2WRA A;  1GZT A;  2JDK A;  1OVS A;  2BP6 A;  2JDH A;  2BV4 A;  2JDP A;  2JDM A;  5A70 A;  1UQX A;  1W8F A;  4CE8 A;  2VUC A;  1OUS A;  5A6X A;  4UT5 A;  3DCQ A;  2JDU A;  1OUX A;  2VNV A;  2JDY A;  2XR4 A;  1UZV A;  4AOC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...