3UK9A

Galactose-specific lectin from dolichos lablab
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
253
structure length
249
Chain Sequence
b'ANLISFTFKKFNETNLILQRDATVSSGKLRITKAAENGVPTAGSLGRAFYSTPIQIWDNTTGTVASWATSFTFNLQAPNAASPADGLAFALVPVGSQPKDKGGFLGLFDSKNYASSNQTVAVEFDTFYNGGWDPTERHIGIDVNSIKSIKTTSWDFANGENAEVLITYDSSTNLLVASLVHPSQKTSFIVSERVDLTSVLPEWVSVGFSATTGLSKGYVETNEVLSWSFASKLSINKNKLAIFNLEGKA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Legume lectin
molecule tags Sugar binding protein
publication title Affinity of a galactose-specific legume lectin from Dolichos lablab to adenine revealed by X-ray cystallography.
pubmed doi rcsb
total genus 47
structure length 249
sequence length 253
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2011-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00139 Lectin_legB Legume lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3uk9A00
5T50A 2LALA 3FBYA 2VW2A 4AYUA 1G8WA 4Q1RA 1GNHA 2G4IA 1LTEA 2JE9A 3SISA 2AUYA 1DLLA 4GWMA 4YG0A 4XTPA 1BZWA 2P34A 3JUUA 4UW4A 3ENRA 3M3QA 5CNAA 1DGLA 1N1SA 3TB0A 1Q8OA 1VAVA 3AJYA 1G9AA 4GWNA 1GZWB 3WG4A 2XG3A 1BJQA 1EPWA 2PHXA 3PMEA 5E88A 5HCAA 4FOWA 1NLSA 4YG6A 4K1ZA 4LBKA 4FPKA 4L8QA 3Q9OA 1S0JA 2R49A 5DUWA 4M3CB 3SNMA 1APNA 1MZ5A 3T2TA 1CONA 1FV2A 3LSEA 5IK7A 5DUXA 2C9AA 1U0AA 1KDMA 2EXHA 2H0BA 2ZGSA 2V5YA 2DU0A 5L73A 2PHUA 5GLUA 3MW2A 3PVNA 4BLIA 4YW5A 1DQ6A 1SCRA 3CNAA 4U36A 1DQ1A 1LOEA 1UMZA 1WBLA 2Q5TA 2OUJA 1LENA 2ZGRA 4UW6A 1WW5A 3AZXA 1G7YA 3WZ1A 4UW3A 2NMNA 2WT0A 2DURA 1SBEA 2YV8A 2A6YA 3WHUA 1UZYA 4GXLA 1H9WA 1AX1A 1S0BA 2GALA 5GALA 3D5OA 2D3RA 5GLWA 3N36A 4BMBA 1SCSA 2GNMA 4ITCA 4XBQA 2ZAAA 2R16A 2OW4A 1SBDA 3M3OA 1MVQA 1YI7A 2DVFA 1Y7BA 1QF3A 3ATGA 4AVSA 2A70A 3A0KA 3GNEA 3BIWE 1IS5A 1NXD1 5H9SA 2JKBA 5IUQA 1ULGA 3AXEA 3MEPA 3B01A 1W6MA 1I1EA 1R1ZA 3WDYA 2WJSA 4LBMA 4XJ9A 1RITA 1JW6A 3D6EA 2DUQA 1LU1A 1AJKA 3O0XA 4R9DA 2NMOA 5DG1A 3C2UA 5JOYA 1ZA4A 3AP4A 1CPMA 1N3PA 5DG2A 3I8TA 3RG0A 3DUIA 2YY1A 1KRIA 2E7TA 2R1BA 2I2SA 1HQLA 5DXDA 2D3PA 4LBLA 1RINA 4Q1PA 4DRVA 4PQ9A 2P3IA 2NZ9A 2UWCA 5CA6A 3B69A 4XOGA 1LECA 5DUUA 1LGBA 3V65A 2ZKNA 1QNYA 3INAA 3L2YA 5T5JA 1DYKA 1LJ7A 1LHWA 4RL7A 5T5LA 4YW1A 3ZXJA 2GMPA 5T52A 1WW4A 1Q56A 2CYFA 3WHTA 4AVVA 2GMEA 1LHUA 4FOYA 1ENSA 2UWAA 4Y20B 1G9FA 1TEIA 2D6PA 4R9CA 4FVVA 5GZDA 2SBAA 3M1HA 4FPGA 4XJAA 2ZA9A 1YYNA 2A75A 4FPYA 5GZEA 2XB6C 2EF6A 2PHTA 2NYYA 2ZZJA 2VUAA 4DS0A 1QDCA 4YZ4A 2ZGOA 2E53A 3R4SA 1W6OA 3T1MA 4P9XA 3V0AA 3UJOA 3A4UA 4GKYA 3OBRA 4GALA 3VV1A 2P3JA 2ZGQA 4PCRA 1CN1A 3APBA 3WDXA 1CR7A 1V6LA 2GNDA 4ASMB 3R05A 5GZGA 1Q8PA 1Z78A 3AYEA 4BMEA 3NV4A 3ZYRA 3N7MA 1W0PA 3ZXFA 1WW6A 1AVBA 3KM5A 3N35A 3V0BB 1LHOA 2DVDA 4ZXKA 1C1FA 3IPVB 4YW4A 1FNYA 2OVUA 1N1VA 2ZHLA 3FLPA 3ZSMA 3VUOA 4YM2A 3WVJA 1GLHA 2NP0A 1OFSA 1LHNA 2P2KA 2D6OX 1GBGA 3I4IA 4JCKA 3OGGA 4DQAA 4NO4A 2ZGUA 1DFQA 3UK9A 4CZSA 1AJOA 5LK5A 1PZ8A 3NV1A 5GZFA 4IQPA 4RA0A 2EXJA 3BTAA 4WVWA 1BYHA 1LHVA 2ZMNA 1IOAA 1QOOA 3FFZA 4MYEA 4YFWA 1IS3A 4I30A 1GSLA 5HCFA 3PVEA 2D7FA 2ZGNA 1N3QA 3N7JA 4LBQA 4WVVA 5HCBA 1KITA 1F31A 1JYCA 1LCLA 1AXYA 1UAIA 1W6NA 2A6ZA 3DGTA 1JBCA 5CBLA 3AZVA 4FOQA 4JC1A 4BOWA 5DUVA 1BXHA 1LEDA 1S1AA 1VALA 4FPFA 1LULA 3LCPA 3WNXA 3RQ0A 4M3CF 4YM3A 3HN1A 1DQ5A 5T5OA 4AGGA 4M3CE 2R0FA 5KXDA 4WZFA 4YG3A 3HR9A 3ZSJA 1DZQA 1FATA 2VH9A 1CIWA 2JD4A 2JDZA 2NN8A 1MS3A 3TAYA 3ZVXA 2ZGPA 1LOAA 1YIFA 1JYIA 2JJ6A 4TYSA 4Z8BA 1PZ9A 3HMYA 4ATEA 4M3CA 3A0NA 1A3KA 3OY8B 5GLVA 1PZ7A 3B9CA 1ENRA 1SLAA 4YM0A 2Z42A 1ZM1A 3IN9A 5T54A 2FHRA 4YGDA 5GLTA 1SLBA 5EXOA 1D0HA 2CY6A 2ZHKA 2WT1A 2ERFA 2C5DA 2UURA 2WSVA 5JVVA 3AXDA 5FREA 1W6PB 4ATFA 2WT2A 1QKQA 3WG3A 1HQWA 2YZ4A 1V6IA 4Q26A 1FX5A 5KXCA 1Q8VA 3ZSKA 2PELA 2D43A 1CQ9A 1DHKB 1C1LA 1DQ4A 3OPZA 4UW5A 1A8DA 1N1TA 4M00A 4XIOA 2JECA 1HKDA 3QLQA 2YROA 1QOTA 2VY0A 5KXBA 2DV9A 1YXWA 2GNTA 1LOFC 4HANA 5GM0A 2KM2A 4C1WA 3IMNA 1AX2A 1S0IA 4Q8KA 2A3WA 1O4ZA 1V6OA 5IK5A 4DFSA 1HLCA 4DPNA 1H9PA 1JN2P 5IK4A 4PBPA 1CPNA 1CVNA 4LBOA 4R9AA 1ULEA 1DQ2A 3SLIA 2CWMA 2AH2A 1N1YA 1WBFA 1FNZA 3M2MA 1FV3A 1UL9A 2EALA 1ONAA 1LOFA 2WQZC 3PVOA 4JRAA 5SV8A 2DTWA 4LBNA 5GZCA 2A3YA 4XYXA 2D3SA 1MS8A 3NV2A 1FYUA 1QU0A 3B3QE 5JOXA 3M3EA 4YLZA 5JOZA 1W0OA 2A6VA 3IKWA 2AR6A 4CTEA 4FPLA 2W52A 4WV8A 5EYYA 4TZDA 4Y1XA 4Y24A 2ZMLA 2AGSA 2GDFA 4U2AA 1CESA 1WLDA 3WG2A 1DIWA 1KDKA 1SFYA 1Q8QA 1VLNA 1ENQA 1JOJA 1C57A 3O12A 1N47A 3FLTA 2GMMA 3T1LA 1V6MA 3GALA 1GZ9A 4LBQD 2VU9A 1LGNA 3AP9A 5FRAA 2DWRA 3VKOA 4AWDA 1D2SA 3AK0A 2E51A 1G9BA 2D6NA 5IT6A 2CNAA 4LBQB 5E8AA 1LGCA 2GN3A 1OKQA 3SH5A 4YZ3A 2RHPA 2ZMKA 4XMAA 2ZGLA 3AJZA 1UN1A 2DVGA 1QOSA 4ISRA 4XILA 3USUB 3WUCA 5JDBA 2JE7A 2A7AA 1LU2A 1AXKA 5F5QA 4AGVA 2DVAA 4DRRA 4ISQA 3KQRA 1S0EA 5JMCA 2NM1A 1DBNA 3R4UA 4Q27A 1BKZA 1G9DA 1WCSA 4YW2A 4C1XA 4M01A 1S0CA 2UWBA 1Q8SA 3ZXKA 4H55A 4Q2FA 2BQPA 1IS6A 2ZGTA 5IK8A 4P9WA 1GZWA 5JOWA 3V0AB 3H0OA 3MPPG 2B7YA 1GYKA 1F5FA 2ARBA 2WSUA 4SLIA 4F83A 1VAMA 2D44A 4Y1ZA 1G9CA 1YRZA 1V00A 4HL0A 4XXAA 4XBLA 2CTVA 1V6KA 4BPZA 4K1YA 1W6PA 1MS1A 2DUOA 2VW0A 3SH4A 3NWKA 3V0BA 2AYHA 2R1DA 4ZKTB 4FPEA 4XBNA 5H9QA 2ZABA 1MACA 4Q8LA 3UL2A 3VKNA 3RMYA 1WUVA 2E7QA 1KQRA 1SLIA 2TEPA 1YO8A 4FPJA 4FOVA 3POSA 2EAKA 4Y22B 4Y22A 3WCSA 4YZ5A 3RRDA 4YW3A 4PBOA 4FP3A 2W39A 2P37A 4Y1YA 3W59A 3ZXEA 1SBFA 2D6LX 5AVAA 4PF5A 3WDWA 1H30A 4OZXA 2VW1A 1ULDA 5EWSA 3RMXA 1J1TA 1SACA 2ENRA 2DTYA 1URXA 2V73A 3QCWA 1S0GA 2DYCA 5GLZA 3WV6A 1AZDA 2EXKA 5DZEA 4YFZA 2PHWA 3POWA 3JU9A 3RSJA 3V64A 4Y20A 1IS4A 1W6NB 1LEMA 3OBTA 4XJWA 4XXPA 4BM8A 4P9YA 1MS0A 3WG1A 3O0VA 1S0DA 1A78A 5DZGA 1MS9A 2A71A 2HYKA 2W68A 3ASIA 2VXRA 5E89A 4XJ8A 2DU1A 1GICA 4W65A 3WLUA 3IPVA 4K20A 3VKLA 4AVTA 3ZYPA 3ZXLA 1MZ6A 3LSDA 1IKQA 3M3CA 4D69A 4XJUA 1GANA 2CWSA 1GNZA 2YXSA 4Y26A 2PHRA 4YGCA 2ZHMA 5BYNA 3AYDA 1WW7A 4XHXA 3AZWA 3FUOA 3OY8A 1UX6A 2UU8A 4CRQA 1AX0A 2A3XA 2ZHNA 3WDUA 3SITA 3ILRA 1WLWA 2LTNA 1B09A 1CJPA 1QGLA 2WKKA 3MW3A 4FPHA 4YGEA 2YMZA 3SH3A 3WUDA 4Y1VA 3VKMA 4YM1A 3U4XA 1JUIA 1QNWA 5T55A 2WNEA 1LOBA 1W6MB 1ULCA 4FPCA 2AENA 2E6VA 1UZZA 1HDKA 5T5PA 3BOPA 2GN7A 3WCRA 3ZPYA 1X50A 3O0WA 1QDOA 3FUQA 1MS4A 1GV9A 2DUPA 1LOGA 1WLCA 3OJBA 1SLLA 3D4KA 1G86A 3AYAA 5F9TA 4XTMA 3MW4A 1KJLA 1LESA 5JLVA 4BLJA 2ZGMA 1Z0HA 3AZYA 4XMIA 1ULFA 4AGRA 3ILNA 1JHNA 4YZ1A 2A6WA 3NV3A 2ARXA 1V6NA 2ES3A 3AFKA 3OYWA 2SLIA 3PJQA 1FAYA 1N3OA 1F9KA 4YZ2A 4GKXA 3AX4A 1MR5A 1SLTA 4NOTA 4P14A 3AP6A 3ILFA 4FQZA 1DYPA 1RIRA 1JXNA 1S0FA 5H9RA 4XZPA 5CB7A 3POYA 3WDTA 4BQ1A 3VKFC 1BQPA 3FLRA 1KJRA 1W6QB 1V6JA 1W6QA 5KXEA 4XIKA 1LODA 2FMDA 3AZZA 1AF9A 3USUA 5H9PA 4R9BA 2CL2A 2WLQA 2D6KA 3N3HA 3O5SA 2W08A 4GA9A 3N7LA 1UKGA 3AYCA 4XDQA 3IM0A 1W6OB 2ZGKA 1MVEA 1IKPA 2A5ZA 3AP5A 1QMJA 1WD4A 1XQNA 3BODA 4LBJA 1AXZA 4FP2A 1GKBA 1LOCA 2EIGA 5CAZA 3RS6A 2D6MA 1SLCA 2ZACA 2R0HA 4XJZA 2A6XA 2P3KA 3N7KA 4Y1UA 5DZFA 1OQ1A 1O4YA 5EYXA 3W58A 3WOGA 4KBBA 3ZSLA 2DVBA 1MS5A 3AP7A 1I3HA 1WD3A 2ZBJA 1UPSA 4XE9A 5GJ6A 4K21A 1VIWB 2AREA 1C4RA 3B00A 3WDVA 4YGBA 1DQ0A 4FQ4A 2GNBA 4FPOB 3UJQA 3OYWB 2PHFA 2OUHA 4XHBA 1GZCA 2EXIA
chains in the Genus database with same CATH superfamily
1OF3A 1ALYA 1MQTA 4YVWC 4MZUA 4NAMA 1HRI2 1PHMA 1W8WA 4LMFA 4OHZA 1PVC2 4QX7A 3DN7A 1ND2B 4I0BA 3FMGA 2VMDA 4PHZA 2ZEWA 5A80A 2BZDA 4XTPA 1BZWA 3AMHA 5D1IA 5JIAA 5CNAA 1N1SA 3T08A 4KWUA 2DFCA 4QKFA 2I74A 2XONA 3FE5A 1BLZA 3WQ7A 1G9AA 4GWNA 1GFF2 4CDWA 4XUOA 1VBD3 1RUD2 4DMIA 1Y9MA 3CO2A 2Q8EA 3PMEA 3MIBA 1TMF2 3MUY1 4RHV2 5FYYA 4K1ZA 2GZWA 2C1FA 4LBKA 4CCMA 3PU8A 4MLOA 3VDDC 4L8QA 2HWD1 1KGYA 3SNMA 2K2SA 1BBT2 3I3BA 1CONA 5IK7A 3DPRC 5DUXA 2C9AA 2WO1A 1V70A 1U0AA 1YFUA 2H0BA 2YGMA 4BE3A 1Q43A 1ZYBA 2DU0A 2GC0A 3MW2A 3PVNA 2IVIB 1B35C 4E2GA 1H2KA 3ACIA 2WQ4A 1WBLA 1CZTA 3UYJA 4QHBA 2XLFA 4B4PA 4L0PA 1PO22 2XMLA 3DPRB 4UXAA 1SHWB 5CIRA 2X05A 3U4SA 3E6CC 4IE6A 3PUSA 1BCXA 5A3PA 2BDRA 2FMYA 3N36A 4BMBA 1SCSA 4ITCA 1PGSA 1PMHX 3K3OA 1QXJA 1H1AA 2OW4A 2RM23 4HG6B 4JGZC 4XBQA 1K5MB 1I5ZA 1K5MA 2A73B 2ZX4A 3LEMA 4MADA 4CXXA 2DVFA 4FBFA 4NROA 3D8CA 1W28A 4I0WB 3GNEA 1DDLA 3OUHA 1RVF1 2OYZA 4BK4A 1QJX2 2JKBA 5I0SA 4IETA 1AR63 4S2FA 5APAA 3B01A 1DU3D 3WDYA 2VPVA 4NJ4A 3H7JA 3J26N 3O0XA 1AJKA 4R9DA 4XDPA 5DG1A 4FTBA 3C2UA 4A44A 4Q4Y1 3VBUA 4MXWA 2WFF2 4QPGC 2YY1A 1R081 4L9BA 3J8F1 2ZJCA 5IYYA 3BALA 1OXCA 3K48A 1O3QA 3CBNA 3NL1A 4W6YA 1S2EA 2WO2A 1RINA 4Q1PA 4UF0A 4B7EA 3A23A 4PQ9A 2XJVA 2LW8A 3WW4A 3B69A 4XOGA 1HIXA 4DEVA 5DUUA 3VZJA 4OI2A 5FCCA 5FY5A 2ZKNA 1QNYA 3INAA 3RI9A 4X6QB 5EPAA 5F5IA 1B35B 2P1BA 4AHWA 2V09A 2HWE1 4OHYA 1NCRC 2ZEZA 4LKDA 4AVVA 1QXRA 5HI0A 3R4DB 2IWGB 2ZEXA 4LO7A 4YVSB 3ME2A 2BP6A 4OULA 2RDQA 1G9FA 2Q8CA 4FVVA 2CAUA 1JZ4A 1PNGA 1VBB3 3KCXA 4CEWA 2VNVA 1UZ0A 2B46X 4UBHA 3O1PA 3EQEA 3K4DA 1TE1B 2P3YA 2ZZJA 3LA2A 2O8OA 3LB9A 4QHZA 2E53A 3VL9A 4CDQC 2KR2A 1W6OA 4XQDA 4D7YA 5ACA2 1AYN1 2IXCA 4M0NA 3J4UH 1ZBE2 3VN4A 3VV1A 4CEWC 1Z7S3 4IE4A 1T6GC 4M0HA 3APBA 5DN2A 3NAPC 5EJZB 1V6LA 3ZYJB 5FMOL 3J7NA 3BVCA 5FZ6A 2XXZA 3R05A 2QDRA 4XFBA 4BMEA 3NSTA 3NV4A 3MLLA 3WF4A 2VCMA 5FYCA 3ZYRA 1RMU3 3H8XA 2WN3A 3B5LB 4QDRA 1JYNA 3PU3A 3T3YA 1CX1A 1QJY3 3JZVA 5LCWL 5ABJB 1FNYA 1DG6A 5C5TA 3VUOA 3ZSMA 4Q4V2 3G7DA 1PK6A 4AI2A 4DINB 2BFUL 1FMD1 4GMP0 3GM8A 3OGGA 2VUDA 3J8F3 4YVSC 3UGHA 4KBZA 2FDFA 5L7OB 1RUG3 2HEYF 3OGSA 2YHJA 5C4WA 1JYWA 4A7KA 2J1RA 4JTOA 4RSUA 1KS4A 1W39A 2VCCA 1RUF3 1BYHA 1QOOA 1XC6A 4LK6A 2C9KA 1UIKA 3PUQA 5IVBA 1W2NA 1N3QA 4LBQA 4WVVA 5T3NA 1KITA 5FP9A 2QQJA 2FCUA 1AXYA 4OFGA 2BBVA 1JOBA 4ZONA 5LBBA 2Y33A 3NKTA 4JC1A 5CBLA 1BXHA 1LEDA 3ABZA 1D4VB 4CCNA 1S1AA 2C6SA 2OZJA 1ZZCA 4GIQA 1VALA 4FAGA 1PMIA 1LULA 1XJAA 2IXKA 3KT7A 3LCPA 4M3CF 4QKNA 4BXFA 5FO9B 5C4WC 3OCPA 4AGGA 2QQKA 4WZFA 1HB3A 5B4XA 1AYM3 2HWF2 1PM4A 3LDRA 1ZRIA 2J1UA 1XBFA 2FDJA 4XZUG 3IAQA 4QAWA 5FZKA 2PAEA 3TAYA 4AI8A 4JDOA 4XUQA 4IERA 1JYIA 2JJ6A 4TYSA 4Z8BA 4M3CA 3A0NA 2X10A 2XQRA 4PJYA 2D97A 2RJ2A 5GLVA 1C3HA 1ENRA 4B3NA 1YFWA 4CP0A 3IN9A 4ES9A 5HCHA 5C3PA 1VMFA 1QXPA 5GLTA 2VOTA 5LATA 1SLBA 5EXOA 2VUCA 5LY1A 5FUNA 4PDWC 4KL1A 4NN0A 1NCQA 4AFCA 4QB1A 2RJKA 1BEV2 2OXBA 2Y26A 2Y6JA 1OVPA 2XWBB 1DQ4A 4NPLA 1UXXX 5AVPA 5J96B 4R8HA 1N1TA 2KXLA 1KS5A 2AZ5A 1HKDA 2W1SA 3QLQA 2YROA 1NQDA 4XIOA 5FWEA 3X29B 2R063 4BU2A 1FXZA 5GM0A 4C1WA 2IXIA 3IMNA 1AX2A 5K7PA 4Q8KA 4P02B 4PLMA 5C3OA 1L7QA 4Q5OA 2GH2A 1HLCA 4Z82A 1UY0A 1H9PA 2LRPA 5IK4A 4CDWB 4LBOA 2BU9A 2Y34A 5ACA1 3SLIA 2VMFA 4ASLA 5A6YA 4LO6B 3I3DA 2MHFA 2AH2A 1N1YA 4MX3A 4UFIA 3M2MA 4W8JA 1FV3A 2HEVF 1UL9A 5SV8A 4QGNA 1EY2A 4I3PA 3ZYHA 3VZNA 3K46A 2VZUA 1MS8A 3WQBA 5BNNA 5CFCB 2Z79A 4XFCA 2VM9A 3VBOB 3T0DA 5LBFA 1AYN3 1AR92 1YNAA 5A3LA 2AR6A 2RS53 5F3GA 3CL1A 4WV8A 3C8XA 2I45A 3DL3A 4CUCA 5D21A 4U2AA 4QX5A 1D0GA 2XLGA 3ZYGA 2WZEA 4MGKE 2Z4FA 4BB3A 5LW9A 1REFA 1VLNA 3PMSA 4ONUA 3O12A 1N47A 1VBE2 1O8PA 3FLTA 1IPKA 1V6MA 1CGPA 1HN0A 2J1TA 4LBQD 5B4NA 2DWRA 5K0UA 2VZPA 4AWDA 5JZGA 5AFBA 3TEYA 1CAVA 1H4GA 1TQ5A 2Q1FA 1WMXA 4OMCA 1H2LA 4QM9A 1LGCA 4WM7A 4YW7A 1OH4A 3S30A 3SH5A 2VXJA 3DF0A 3DYMA 1DLCA 2ZGLA 5FPVA 1W04A 5F3IA 4AZZA 3POGA 2PYTA 2JE7A 2A7AA 1LU2A 1AXKA 4AGVA 2DVAA 4DRRA 1FPN3 4ISQA 2Y64A 1S0EA 3KQRA 4E4ZA 2ZX0A 1M06G 3R4UA 5FYZA 4AFDA 2WDBA 2P17A 1BKZA 3IIAA 4WVZA 5BXXA 1G9DA 3TEZA 1GUIA 2OIIA 2FZ2A 4QQOA 4A45A 2UWBA 4KWJA 5FP7A 1JYVA 4W6XA 2BFUS 5L9BA 3HEIA 2ZGTA 3TRSB 2XWJB 3E6DA 4BHPA 4SLIA 1F5FA 2ARBA 4H2AA 1VRH2 4L99A 3GBGA 5FQ0A 4RYDA 3DYOA 1YRZA 5DABA 1OKOA 4DY3A 3B94A 1QJY1 2P4EA 2WYFA 2RS11 3H8OA 4QPGB 2VMCA 3NWKA 4CP9B 1NYWA 2Z2SB 4TLFA 1EAH1 2IFWA 2OS2A 2WNVA 3K4AA 2R1DA 1LR5A 4I01A 2PHDA 1JZ5A 5BNPB 2VBPA 3Q8BA 4CP1A 3J7MA 1QJU1 5FK8A 1WUVA 2CGOA 2OX0A 2XR4A 4Y22A 5FXVA 2EAKA 5B2GB 1UY1A 4HVOA 2P37A 4QX1A 4UBGA 4Y1YA 3HVDA 5AVAA 4PF5A 3IB3A 4OZXA 4D6QA 4D7TA 5EWSA 4KG0A 3VD5A 1SACA 2XBO1 1S0GA 1JZ6A 3SKVA 5I8SA 3HJRA 2W94A 3WV6A 1I6XA 1AZDA 2EXKA 3JU9A 3JCIA 4YNIA 1RVF2 1LEMA 4OYUA 3O1UA 1LRHA 3RFRA 2DBNA 4RGAA 1FOD1 5IVFA 4LO5B 2A71A 3SHRA 5K9YA 3K2OA 2ATFA 3ASIA 5E16A 3W21A 3GDBA 4XJ8A 3U14A 2QTWB 1GICA 5FZHA 1OMIA 3ZKYA 1OQEA 4QPIC 3THCA 2PXJA 4FFIA 3IPVA 3ZXLA 1MZ6A 2GH8A 1IKQA 1W2OA 2WFF1 3LD8A 3LSDA 5CYYA 5F7UA 3AKRA 4RR3C 3TBDA 4CEYA 1F35A 3GF6A 5FZMA 3AZWA 3Q8CA 4LHKA 2WL1A 3JB8A 2VZTA 1UX6A 3OY8A 3PNAA 2UU8A 4NMIA 4CRQA 5IATA 3UESA 1ZRFA 1HQNA 5F5CA 2OA2A 3ILRA 5KBFA 1ZZ8A 1B09A 5JPMB 4QX0A 4MVTA 2ORZA 4COYA 4LEJA 2BWCA 4N43A 3U37A 1PVXA 2O14A 1DGWX 3ZFEC 1ODNA 3WUDA 4LPLA 1LAJA 4Y1VA 2PHLA 4LA2A 3U4XA 1JUIA 5T55A 1W0NA 2ZAHA 1XYOA 3RNSA 1GR3A 2E6VA 1W8OA 1UZZA 1HDKA 1K12A 5T5PA 3BOPA 1UU4A 1UOBA 4IV1B 3ZPYA 3NNLA 3FUQA 5JCTA 2XUMA 3RZGA 1UX7A 3JXSA 4NIIA 1QJEA 4KH9A 4BQWA 5F9TA 2ZOEB 1T2XA 3MW4A 4LIVA 1LESA 3ZR6A 5JLVA 3JQWA 2QQMA 3AKSA 3AZYA 4FTSA 1E5RA 4DIQA 1F2NA 1NLQA 3B02A 4YZ1A 2A6WA 1Q3EA 2B39A 2WZPP 2J1SA 1V6NA 2QVSB 5FKBA 2HWB2 4JRLA 5FLIA 2SLIA 2QFEA 3PJQA 1N3OA 1POQA 1EAH3 1F9KA 3P5BA 4ZPIA 1UOFA 3AP6A 4CCJA 4FQZA 1S0FA 3GHNA 3BKZA 1AR93 4OUEA 1W6QB 2VZ3A 4JZRA 5KXEA 4XIKA 2YPJA 3PHMA 3BCWA 3N4MA 4P9GA 3N3HA 4GA9A 1RGSA 2I07B 1U5IA 2B45X 2W08A 1UKGA 3AYCA 3NVCA 4Q0SA 4RQPC 4YRDA 5FLJA 1ZX5A 5F37A 4GB31 4PDWB 1W6OB 2J1EA 4K40A 5FYUA 2BUKA 4D8MA 1REEA 2ZEYA 1J59A 2EICA 1JMUB 5FJKA 1E5SA 1QMJA 1WD4A 1XE8A 4QU1A 1VPHA 2HH9A 3SQOA 2D5HA 4FP2A 1LOCA 2RS13 3RS6A 4ET7A 2V5DA 4XJZA 3B93A 1ULOA 4P9LA 5CG8A 2Y0IA 4JV4A 1E5HA 3VBFB 1O4YA 5IVEA 5A32B 3FBMA 2Q30A 4KBBA 2FDKA 2VECA 2YYOA 4XE9A 5F8PA 4CDXA 3MI8A 1YJLA 1C4RA 2R062 4DOUA 1DQ0A 2GNBA 2BNNA 2PHFA 1PK6C 5FMCA 5G05L 4NRPA 4DO0A 5FO7B 4HETA 3CJIA 3BU0A 4XHBA 5T50A 4WM7B 2LALA 4BQ5A 5JMOA 2BJSA 4IW3A 3TN91 4C90A 1A6CA 2ET7A 2VW2A 4P00B 4KU7A 1G8WA 3OBZA 3VDCA 5LB6A 4AVCA 1JTZX 1X33A 5HXMA 1LTEA 3SISA 1NCQC 4K7JA 4RGKA 3M3QA 4FFGA 1RUI1 5FY7A 5AC92 4GB33 3TB0A 1O3RA 1Q8OA 1F15A 4UFJA 5D8AB 4SBVA 4A41A 4LQRA 4HLTA 1GZWB 1ZNPA 5FPAA 3VHRA 4LUMA 2PHXA 4QDQA 4AK3A 1A34A 2PQSA 3JD72 1NLSA 3WQ1A 2VR4A 4FT8A 1ND2C 4YG6A 4A4AA 2JXAA 2YC2A 5F2SA 3SXWA 1AYM2 2HWF3 2ZCWA 3HWJA 1FI2A 5A3NA 1VBC2 4JDMA 3Q9OA 4LE3A 4QPGA 4M3CB 1OF4A 1MZ5A 1UU6A 2TNFA 3KCCA 4KMQA 2XJRA 4LOTA 2CDOA 2Q1ZB 5J37A 2V5YA 2PHUA 5C8CA 4HZFA 4QHOA 4NR1A 1QWRA 1ZBA3 3C7FA 4Q0PA 3URFA 3CNAA 4U36A 2VULA 3MIEA 1X8MA 3VBHA 5CZKA 4CCOA 2JICA 2ZGRA 3AZXA 5FFOC 4COVA 4UW3A 2MNGA 2YV8A 4QXKA 2JIJA 4D3WA 2A6YA 3DPRA 1UZYA 4GXLA 4AL9A 1AX1A 2GALA 3VLBB 1XOYA 5C3QA 5JSOA 1RUH2 3MIGA 3D5OA 1QHDA 1D7PM 2ZAAA 3M3OA 1MVQA 1SEFA 1J3RA 1YI7A 1QF3A 2RDSA 1LB2A 5FZGA 2FQPA 1HX6A 2PQQA 2WQ8A 4HN0A 3ELNA 3THDA 3KGZA 5H9SA 4LO4B 5BNNB 5CFCA 5J3UA 4LHLA 5HXVA 1ULGA 1GWMA 4AEDB 3MEPA 2EIBA 4AEDA 3LOBA 1NCQB 5BNOC 1R1ZA 4WZCA 2CHHA 3D6EA 2J1VA 4NRQA 1RMU2 2NMOA 2ZX1A 4WM8A 4F7ZA 2XPJA 3POBA 5JOYA 1HV0A 2RMU1 1COV3 4BWOA 5J7MA 2Y60A 4IESA 1N3PA 5C8CB 3I8TA 2XKOA 3DUIA 4NVPA 2E7TA 3IT8A 4IV1A 3KHCA 2I2SA 5DXDA 4ZZ5A 2B42B 5I0DA 1Z7S2 4DRVA 2VQUA 5CKMA 5F39A 3NW4A 4V2WA 3QH7A 5CA6A 2YUEA 2VZRA 3CKHA 2QCSB 5DAVA 4WBBA 3H50A 5FPLA 3L2YA 5T5JA 4KG8A 4GH4B 1COV2 4RL7A 3KGLA 4CDUA 5T5LA 2X5IC 3I2KA 2VZOA 2XHKA 5FZAA 1Q56A 1RUNA 3VBRC 2GMEA 1LHUA 3OEAA 2UWAA 3H8RA 2RS33 4LUKA 4NIDA 3I2OA 4QX8A 1JODA 2PLV2 3OGVA 4PLNA 3N9LA 4Q4X1 3CZJA 4IGOA 5I0UA 1OA4A 1YYNA 2A75A 1EP0A 4FPYA 2X09A 4N90A 4BQXA 4N53A 5GZEA 5JAXA 4N43C 2XOMA 3CJXA 4DS0A 2Q8OA 3NQHA 1O5LA 3NAPB 2BVBA 1YUDA 3NNJA 4X8NA 1UMIA 3WF1A 4ZS3A 4P9XA 2IC1A 2QJVA 3TEWA 3JBG3 3A4UA 1UO9A 3HQRA 3I2DA 4MHUA 3FL7A 4CU7A 2ZGQA 3CHXA 1EV11 4AQSA 1CN1A 2C4XA 2C0ZA 4RR3B 1QJFA 2VGDA 5FZ8A 5AFEA 4DUXA 4KWLA 2WZR3 4QXHA 4ASMB 1C5IA 4MXVA 5FLHA 2B4KA 1V9U3 1Z78A 2HWC2 1JS9A 3AYEA 4J1WA 2XJSA 2GP5A 4FXGB 2QQWA 3ZXFA 3O1TA 3ZFGB 4HVQA 1JU4A 1AVBA 1C5HA 3IDAA 5L36A 1IQAA 3VD9A 1VB2A 2JDPA 2WS91 2QZ2A 4XVHA 4XETA 5KC5A 1UW8A 5I0RA 3JD73 2OVUA 3FLPA 3OTFA 3ZLIA 4Q4V1 5J1XA 4OI4A 2VOVA 1W9WA 2H0VA 1NE6A 1OFSA 2P2KA 2CDPA 2D6OX 1FMD2 1GBGA 3I4IA 4C91A 2JE8A 4MH0E 5FYIA 1OC1A 3TOJA 4DQAA 5JI7A 4NO4A 1O6UA 4WM8C 3W9AA 1DFQA 5FQ0B 4BH9A 3UK9A 2E7AA 4CZSA 2FDIA 1PZ8A 1WMDA 1VAKA 3HQXA 1AHSA 3NV1A 4RA0A 4MYEA 4CEYC 3NNMA 3KF5A 4JKLA 1QIQA 5LBEA 1W06A 2ZGNA 5HCBA 3DCQA 4B4QA 1JYCA 4GWJA 1JZ7A 2HWE3 3N9QA 4B1LA 1JBCA 4AFMA 2B9VA 1UOJA 2OKXA 4ZU5A 1VRBA 1NCRA 3P1IA 5I0TA 3T4HB 4FPFA 2AEZA 1AUYA 5T5OA 1R64A 4XDOA 1NA1C 2XJUA 4CVUA 3ZSJA 1FATA 1U12A 2VH9A 2VCAA 4L2NA 2JD4A 4E27A 5CEHA 2BRTA 1YC61 1GU3A 3B7MA 3MFAA 1AR61 2YC4A 2ZGPA 1LOAA 5HV4A 2JG8C 2J7MA 4JQRA 5JXJA 4W50A 4UOJA 1EUTA 1PZ9A 1ZZ6A 2VZ1A 3EJKA 3BGAA 3OY8B 1UU5A 1PZ7A 4E4HA 3E5XA 1ZM1A 1NA1B 2LUWA 3H7YA 1O8SA 1SMVA 2RE9A 1T6BX 2WR9A 2ZPXA 1JYXA 3WP3A 2OZ6A 3T0AA 3H1YA 2WN2A 3AMNA 5D8AC 1MEC1 1PVC3 2UURA 2VAUA 5JVVA 5FREA 4Z2AA 1W6PB 1HQWA 4DZGA 2WNVB 2XQXA 1FX5A 3ZSKA 3AL5A 1I9RA 1XU1A 3OUIA 3OPZA 4UW5A 3ZMOA 2WRAA 2RJLA 3A21A 4M00A 4YARA 2YBKA 2JECA 3W20A 2KD7A 5A3MA 1RL3A 3N9OA 2DV9A 2JB4A 2WNUC 1TME3 4P9IA 5FP4A 3UV9A 1LOFC 2WZ8A 5ANNA 3RZMA 2D40A 5EZWA 5FYSA 2P6HA 2A3WA 1PNFA 4UF0B 1O4ZA 4CEYB 3T30A 5IK5A 2WO7A 4OUMA 4DPNA 3ROUA 1NT0A 4HKOA 4PBPA 1CVNA 1X7NA 4IEXA 1G6NA 5FZEA 1QJX1 3LQCA 1DQ2A 4CU9A 2YFZA 2EA7A 2BOIA 3I2HA 3LPGA 4BXSV 1X9TA 1LOFA 2DTWA 4XYXA 1HRV1 4Q4Y2 2D3SA 5A70A 2BEOA 2D98A 5FYTA 4ZXEA 1QU0A 2Q0AA 3B3QE 1RUJ2 4KU8A 4QX3A 4YLZA 1HJFA 1CAWA 2R073 3VZOA 3NJYA 3WNKA 3WD5A 4IGPA 1YQCA 4HVRA 5EYYA 3VHOA 4Y24A 2P5BA 3UT0A 2AGSA 2ADEA 4EWAA 3M7AA 3ZYBA 3WG2A 5BNPC 2F6BA 2PMWB 1BVVA 1SFYA 2BW8A 3LFMA 4J6GA 2AACA 5FTTC 4CDXB 2GMMA 2HWE2 2WA3A 3AMMA 1HXS1 3GZEA 5C8CC 2VU9A 1LGNA 1CX4A 3I59A 4QQHA 5BUVA 4S2GA 4R4ZA 2E51A 1G9BA 5FPXA 4IGQA 3UKNA 1O7FA 4COWA 3O7OA 5E8AA 1OKQA 2RHPA 2ZMKA 4QX2A 5DAXA 3ZFFC 1DGWA 4BQ3A 1L7LA 3LE0A 3O1VA 1RVF3 3V56A 1UN1A 3AFGA 1ND2A 3NNGA 4XILA 3USUB 4CCEA 3N9NA 1FMD3 2Y38A 4EN8B 2ZXQA 1WLTA 2NQYA 3EB7A 2QNKA 4GZ9A 5BNOB 1XRUA 3TYJA 4QB2A 3E97A 1WCSA 3Q8AA 3ZFFB 3ZIWA 3KZ4C 4YW2A 5JI9A 2VZQA 4M01A 4TXWA 1S0CA 3T2OA 3ZXKA 4CXYA 1RUI2 1NZIA 1JZ8A 1JYTA 1S55A 2ET1A 4Q2FA 3EBRA 2BQPA 1IS6A 2OPKA 4META 1J1LA 4YPJA 5IK8A 2HWC3 3VBSA 3H0OA 3V0AB 3VBFA 1XNKA 4F83A 1SPPA 2DCTA 2W1UA 2QUOA 1VAMA 2WZR2 1G9CA 3K51A 4XXAA 1CD3G 4HL0A 5C5UA 4LHSA 3LF7A 4K1YA 1MS1A 1IGOA 1R1A1 3PDQA 2VW0A 5HPOA 3AKPA 1YQ8A 2Y6FA 1UYXA 1CAVB 3VD4A 3VHPA 4XBNA 1MACA 1R091 3QOPA 3D0SA 3GBFA 4QD2A 4Q8LA 3UL2A 1AR83 5FXXA 5F1RA 2Y8KA 1HRV3 1VBD1 3KS7A 4PT6A 5FY1A 2E7QA 5DAWA 1KQRA 1KEXA 1OQDA 1SLIA 1YO8A 2TEPA 3POSA 4Y22B 4AHXA 4AHZA 5BNNC 1H6YA 2G1MA 3W59A 2YPDA 1RB8G 1DP0A 4OHVA 2OPWA 2PLV3 1C8NA 1K3IA 1H30A 1VB4A 1W8HA 3GXUA 4N43B 1K42A 2RS32 4PIYA 1IPSA 1HW5A 2PA7A 4GJYA 1J1TA 3RMXA 2ENRA 2GSYA 3OF1A 2L9LA 3LEKA 3QCWA 1WWYA 5GLZA 4QM8A 3HN3A 2PHWA 1POV0 3POWA 3RSJA 5FYVA 3V64A 3I49A 4MUVA 1C8M1 1IS4A 1W6NB 4DXTA 1P8JA 4HMZA 4XXPA 1TME1 4P9YA 4O61A 1A78A 1ZZ9A 4IE0A 2HYKA 1REDA 2W68A 2JB8A 1TVGA 5E89A 3IBMA 5L7OC 2VVDA 1W8FA 4JGYB 4YWAA 1OT5A 2BTVC 1MEC3 1PVC1 2J1AA 2JG9A 4MGYE 5FV3A 5I91A 4DB5A 3MICA 3ZOIA 4XJUA 3MLKA 1GNZA 2PFWA 2ZHMA 5C33A 2G9GA 2YU1A 4B29A 3VBUC 1D4M2 2ZHNA 3HPNA 2WAOA 5LRSA 3MW3A 3HT1A 3PVBB 1CJPA 3AC0A 4AG4A 2WKKA 4M4PA 1TMF1 4RHV1 1YFYA 4ZU7A 2BPA2 4Y5SA 3SH3A 3TN93 3WP4A 3PL0A 4CDUB 2RR12 3VL8A 4E4SA 1QNWA 5FZLA 1FPN1 1LOBA 1W6MB 1ULCA 3MHZA 4FPCA 4N53B 4XAAA 2XHNA 5KR7A 1UCXA 1CZVA 4EYUA 4NAOA 1QDOA 1GV9A 2VZSA 3KQ4B 1LOGA 5KHJA 5FMBA 3AYAA 4CDUC 2VL4A 3SEEA 4TSVA 4WM7C 4BLJA 3ZO0B 4OUSA 4KQ7A 1PGL2 1ZBA2 5LASA 1ASJ1 2LROA 2ETEA 1ULFA 2RDRA 4GH4A 1J3QA 5CKQA 1QEXA 2VOWA 3ILNA 5A3OA 5C4WB 3NV3A 2ARXA 3AFKA 5A7QA 4Y4YA 4CCKA 4V1PA 1X82A 4YZ2A 4GKXA 5LBCA 1MR5A 4KNCA 4CDQA 1U5XA 2W46A 3ZPOA 4GMP3 3ILFA 5JR7B 1RIRA 5H9RA 1PMJX 1RHI1 3KV9A 1XB9A 4RGGA 5CB7A 1ZRDA 4L97A 3IAPA 4L11A 5FP3A 1LODA 1PGW2 4W4ZA 3ZDVA 4R9BA 3H1WA 2D6KA 3O5SA 4FCAA 1Q5OA 3N7LA 4NE9A 4GB32 2XVKA 4GMP1 1W8TA 4N7IA 4EN0A 1OLRA 1XXNA 5FBZA 2GC2A 2W1WA 4AAPA 3CF6E 4LA3A 3VD7A 4D7SA 3J7HA 1CAWB 3THPA 2H6CA 1IKPA 4XPVA 2A5ZA 1MPXA 3M8LA 3TWIA 3ZMNA 1XQNA 1XSRA 1O3SA 5BNOA 1PK6B 3CMGA 2D6MA 1PO12 2A6XA 2P3KA 1CAXA 3NJVA 1POV3 4JHZA 5DZFA 3KLSA 3AP7A 1WA6X 1WD3A 2ZBJA 1ZA7A 2QQOA 1AR81 1SG3A 2RG4A 4YGBA 4PF1A 4HOOA 2BNOA 4FPOB 2W3JA 4EN6B 4CE8A 3LPFA 1QQP1 2VNRA 3AMPA 4CUAA 3POFA 5IWFA 2EXIA 3U11A 1XNAA 2XUEA 2VTXA 5HV0A 1SDDB 3FBYA 1ZRCA 4LJHA 1YQ2A 1ZREA 3NJZA 3GYDA 1GQPA 4Q1RA 5FPZA 1GNHA 1EYBA 4DXSA 5ABJA 2G4IA 2X5IA 4NHMA 4XW3A 3FJSA 2JE9A 4ZY9A 2AUYA 2CGPA 4YG0A 3J8F2 2P34A 5SV5A 4L92A 3VBOC 1RUF1 4LNVA 1OD5A 1VAVA 3UGGA 3AJYA 2RR13 2PTMA 4H14A 3WG4A 3I54A 1BJQA 1HB1A 3JD71 4G3YC 3BTYA 4FOWA 5A1LA 4XACA 3ZDSA 1YCIA 1ZBE1 1AYM1 2D93A 1QJY2 3SEPA 4FPKA 5A7SA 1XE7A 2WNUB 5DUWA 2R49A 1EAH2 4IE7A 3LSEA 1W9FA 2WABA 1YQ6A 2XL7A 2XKPA 4LLFA 5A32A 4PI0A 1KDMA 4I2OA 3FFQA 5L73A 4BLIA 4K8FA 3ZFGA 1WCUA 3POIA 3C7GA 1SCRA 2JG8A 3OEBA 4O7XA 4UI9L 2AEYA 2EAAA 1LOEA 4Z1VA 1UMZA 2OUJA 3ACLA 1LENA 2CGNA 4LOSA 1OVSA 3WZ1A 2VQTA 2NMNA 2DURA 3KVBA 4B7KA 1H9WA 3R0RA 4P5HA 3VBRA 4IEUA 5GALA 2AC1A 4ZS2A 1WCKA 2D3RA 3OOXA 4KI5M 2JWPA 2HBUA 1WZXA 1C28A 1SBDA 4QGLA 3UGFA 2Z69A 5F3CA 3MIFA 3HNMA 1PGL1 3KWVA 3VHNA 3A0KA 2J42A 1PIV2 1IS5A 1H1IA 1NXD1 1W05A 3ZX7A 1IG0A 1VBB2 2Z5WA 5IUQA 1RUG1 3AXEA 1VE0A 4B8EA 1I1EA 2DCKA 4XJ9A 1RITA 1JW6A 2B5HA 3H3LA 3AL6A 3WF2A 2V4VA 5EFUA 1LKNA 5KHGA 1ZA4A 3LDKA 2BGOA 3H9AA 4BJ0A 1OPMA 3LDBA 4LHNA 5DG2A 3RG0A 1NAEA 1OA2A 4D6RA 2YDEA 5IAXA 1OLME 3VDAA 1AL22 1ST8A 1WGPA 2R1BA 1W2AX 3IDEA 4GQ7A 1HQLA 2VTFA 4JKMA 5CFDB 4XFAA 5FXWA 4HONA 3H3UA 4JAAA 1YI9A 2NZ9A 2UWCA 3S5QA 1GOFA 2IUWA 1LGBA 3KD4A 3H3ZA 3PUIA 4ARYA 2ZTNA 4S2DA 4AQ6A 4Q29A 4FFHA 1DYKA 3NRUA 4XCAA 5EV7A 3IWZA 2GC1A 5FZ9A 3E1F1 4YW1A 3WX5A 3ZXJA 1UQXA 1WW4A 4I3GA 5BNQA 5C3SA 2CYFA 3WHTA 1XNBA 4CP9A 3UKTA 4FOYA 3AKTA 3QACA 4R9CA 1TEIA 2D6PA 2YU2A 4IDZA 5GZDA 4CDQB 3ES4A 4AXOA 2SBAA 5IFTA 3SKJE 1QJX3 4COZA 3WNPA 2BGPA 5GKAC 1C8M3 1W8ZA 1GWKA 2B9UA 2ZA9A 3GJBA 3S5AA 5A3UA 4YYOA 3ETQA 4Y4RA 2FCVA 2XJTA 1QDCA 2ZGOA 4DUWA 4MGIE 5J09A 5FY0A 1MQTC 2DDUA 4YVWA 5A3WA 3MBWA 3T1MA 3VBSB 3V0AA 3UJOA 1W8UA 2J22A 3OBRA 1PO23 2V4AA 4AEDC 3E5QA 4GALA 3ZFGC 4LORA 2Y0OA 1CJDA 2YBSA 2G9ZA 2WNUA 1BBT1 1CR7A 1QY4A 4Z92B 4Q0VA 2VMGA 2GNDA 3C7EA 1VRH3 5G04L 1Q8PA 5FZ3A 4K8RB 4COUA 3N7MA 3OGRA 4IV3A 1WW6A 4XUPA 1SQ4A 3KM5A 3RI8A 3U75A 5KXBA 5LZ6A 5A1FA 1LHOA 1NY72 3PURA 2DVDA 3EHKA 3BUCA 4MGQA 4A3XA 2E9QA 4LKFA 3BI3A 1V9U1 1N1VA 2R072 2ZHLA 3LEIA 1VBD2 1VMHA 4LIUA 3KSCA 2Y6GA 4XF1A 4LE4A 5FZBA 3T2QA 3VZLA 4CPBA 4Q4Y3 2NP0A 5FUPA 3CLPA 3LKJA 1BHGA 1GZTA 4OZOA 2MPFA 3RPQA 2W1QA 2OQ7A 1ND3A 2PN5A 4JCKA 5FYBA 4D6SA 3OB8A 1IPJA 4QQPA 2VZVA 2JDKA 1BK1A 1IQDC 1VBE1 2P6CA 2VUJA 5GZFA 4PI2A 1LHVA 1HRI3 1LNSA 3JB4C 5FZ1A 1GSLA 5HCFA 3N7JA 3RWNA 3ZXDA 4Y3OA 5A3TA 4C8DA 1LCLA 4RS5A 4C0HA 1UAIA 1VBE3 2A6ZA 3DGTA 2VQAA 3MPBA 4FOQA 4BOWA 4OI0A 5DUVA 3VZKA 2ORXA 3FC0A 1VMJA 2UY8A 2FDHA 3C7OA 1AR91 3L9JT 1DCSA 1RYYA 2W91A 1CIYA 1H2NA 1DQ5A 3HN1A 4HPKA 4LKSA 5JSRA 1H6XA 4K3UA 5DMYA 2R0FA 5KXDA 2R32A 4TTGA 2RS52 3HR9A 1DZQA 5HBAA 1YLLA 2JDZA 1CIWA 2JKXA 2DCZA 2NN8A 4UWDA 1AYN2 5C9AC 1RTVA 4XFFA 3ZVXA 4CUGA 3VDBA 5CKNA 4E8DA 3I2IA 4N53C 1UYZA 1F8VA 2R042 1F4HA 1DGRN 1YFXA 4QQLA 1B35A 1EPZA 4N9IA 1X36A 4ATEA 1D4M1 3WW2A 3HT2A 5T54A 1SLAA 2Z42A 2IFRA 1Y3TA 5LA1A 4DXRA 2CY6A 1UOGA 1UY2A 3U1XA 3U07A 4HBNA 2WSVA 4MG2A 2JG8B 1GQGA 5DDJ1 2BNMA 1V6IA 2YZ4A 4BIFA 5FXZA 2PELA 3GHMA 1CQ9A 1DHKB 1KFXL 4QB6A 4MXWB 1QQP3 4HXCA 4F3JA 1QOTA 5K0UC 1YXWA 2GP3A 5JZGC 1VBA3 5A7NA 2WWUA 2KM2A 3THTA 3LWCA 1S0IA 3NKGA 4AVBA 1EV13 1Y43B 1V6OA 3HQUA 3CEWA 2WC2A 3P3PA 3AKQA 2VJXA 3BTXA 1RUC3 1U5ZA 5EP9A 1CPNA 3FX3A 1SZBA 1UNBA 4R9AA 5FZDA 4NHLA 2BGCA 1S2BA 3LGRA 2WNOA 3U10A 4GULA 2H6BA 3RZKA 1EUUA 1JOPA 3FHAA 2WQZC 3PVOA 3GZUC 4LBNA 1ACCA 1VBC1 2A3YA 2VCBA 1QJU3 1YJKA 4GJZA 4Q0QA 3BPZA 3UKVA 5J48A 3VBOA 5JOZA 3BU7A 1W0OA 2A6VA 5K8SA 1FOD3 2W52A 1WA4A 2QQUA 5DAPA 2K9ZA 1NOVA 4EWEA 1Z7S1 1HXS3 3T2PA 3ZIXA 3UETA 2BERA 5F6KA 2RMU2 1WLDA 4ZU4A 3ZXAC 1UPIA 4BQYA 3OD4A 3C7HA 4GAZA 1KDKA 1V9U2 2R071 1ZZ7A 4URTA 3I2GA 1JOJA 1CWPA 4RQPA 1C57A 2DBIA 3T1LA 3GALA 1TNFA 2CU5A 1GZ9A 1HN1A 1PO11 3AP9A 3MGUA 3QH6A 5BV6A 1UF2C 1D2SA 3CJIB 3KB5A 2RM21 1BMV1 4BIOA 5FYHA 2D6NA 5IT6A 3HBZA 4LBQB 3JBG2 2GN3A 4PIZA 3PIJA 2R30A 1IHMA 4YZ3A 1DZTA 4XMAA 3AJZA 4NWWA 4NRMA 2DVGA 3M70A 3RVHA 3WUCA 3GBWA 5JDBA 3MV11 2YGLA 1H1MA 5F5QA 5CU1A 4RFRB 5JMCA 5LA0A 1OURA 4IL7A 1S4CA 1JI6A 2NM1A 4LTAA 4RFT0 1DBNA 4Q27A 1RXGA 4PIXA 3PUHA 4AI1A 2O1QA 1VJ2A 3S57A 3W5NA 1BVP1 1Q8SA 3KMHA 4P9JA 4H55A 3AVSA 1IZ3A 1W9YA 2X8KA 1GP6A 3AMQA 3KT1A 1GZWA 1UMHA 5F2WA 3WNLA 3MPPG 1GYKA 2B7YA 5JOWA 2WSUA 5EQUA 4QT6A 3P3NA 5IVYA 5FMDA 3S0MA 1W99A 2R041 1V00A 2W0XA 4EQVA 4XBLA 2VNGA 1V6KA 3F95A 2YB7A 3L2HA 2DUOA 3W5MA 3SH4A 3PLQA 1BEV1 2XGXA 4AI9A 1ZBE3 1PX3A 4GH4C 2WS92 4EV0A 2UYAA 1R083 2JG9B 4ZKTB 5BNPA 4FPEA 2YBPA 5H9QA 1R092 3FWEA 3MIDA 2VVEA 4LKEA 3RZHA 4QU2A 4P08A 4ASKA 2ZX3A 5CVRA 4UFHA 3LFIA 3VKNA 1UXZA 4BCUA 2C26A 2GC3A 1ASJ3 5FO8B 5LRRA 3LEGA 3P6BA 4BQ2A 4PDWA 4YZ5A 3WCSA 3RRDA 4YW3A 4AEJA 4PBOA 4FP3A 2W39A 2QQNA 5A6QA 4KGGA 5K4LA 4Q4W1 2D6LX 1W2UA 3KF3A 1IG3A 3VBHC 1SFPA 4A42A 4DXZA 4QKBA 2DTYA 1URXA 5F3EA 4CCDA 4FTEA 5KHIA 3LAGA 1US3A 3M4FA 4J25A 1NE4A 1J83A 5C6CA 2V72A 1KD7A 3OBTA 4S2HA 1K5JA 2R061 4WVMA 4BM8A 1RUH3 3B9IA 4XF0A 3PUAA 1S0DA 3WG1A 3MLJA 4CEWB 1O91A 5A6XA 1R082 2VXRA 5CISA 1XE0A 1MQTB 4BYYA 2DU1A 2RVAA 3UNPA 3ZN4A 3N9MA 4JVAA 3J7LA 2W95A 4RD7A 4AVTA 3ZYPA 3T4VA 2X5IB 3M3IA 4XF3A 2FBEA 2X53S 2YXSA 3MV01 4INDA 2PHRA 4YGCA 3RJ2X 3AYDA 4XHXA 1OHFA 2Y6KA 3FUOA 4XFHA 3NNFA 2QQVA 1VBC3 1GWLA 3PTYA 3ZN5A 4OVEA 1RJ8A 4JGYC 3WDUA 4K9SA 3ACGA 2LTNA 1QH7A 2JG9C 1QGLA 4FPHA 1AR62 3D0JA 1O59A 2YMZA 4KGQA 2LM3A 2IVJA 3OSDA 2JDUA 4YM1A 1YWKA 2XH6A 1OLMA 5IHRA 1NKGA 5AC93 4MGSA 3HAGA 3KHBA 3VBSC 2RM22 1BMV2 2B8MA 4RS5B 1DF0A 2JDYA 3WCRA 3BIEA 3ZYIB 2CSGA 1Y9QA 4GD4A 1ZVFA 2G9FA 4CPBD 2DUPA 5A33B 5IVVA 3OJBA 1SLLA 3D4KA 1G86A 4O9GA 1RUC1 3EO6A 5LY2A 3ORJA 4XTMA 1KJLA 3NJXA 4D94A 5BY5A 3T0BA 2XDVA 2ZGMA 1Z0HA 3LA3A 1S2KA 3BTZA 3RYPA 4LXLA 5M0TA 2MEV2 3O14A 3I2JA 3I3QA 3S7EA 1X9PA 4OLLA 1O3TA 3OYWA 5JZGB 5K0UB 2DFBA 1GP5A 5FY9A 2RS12 4YW6A 4IEYA 5FKCA 4Y5Z0 4CU6A 1DYPA 1JXNA 3WDTA 1FOD2 3POYA 5FZ0A 4BQ1A 1TMF3 1BQPA 3FLRA 1O4TA 1KJRA 4RHV3 1W6QA 1H8VA 1PGW1 2WBKA 1DYOA 3AZZA 4MGTA 3WXPA 3WF3A 1YEWA 1GMMA 1QJU2 2XJQA 2VNOA 1OOPC 3WT3A 4AFAA 1UZWA 3VBFC 3IM0A 1W8NA 3CIHA 4J1XA 5A7PA 3RZZA 1MVEA 3MDPA 2JIGA 1CZSA 3AP5A 1XYNA 3BODA 5L7OA 1KXGA 4LBJA 1GNYA 3ACHA 1GKBA 1SLCA 2ZACA 3IDCB 2HEWF 3GZAA 5A7OA 2R0HA 4AQ2A 3N7KA 3WOGA 3POJA 1Y9GA 2HWB3 4Q4W2 3O1MA 1MS5A 2GAUA 2TUNA 1I3HA 3WY6A 4W6WA 1UPSA 1UY3A 4K21A 3WW1A 4CXWA 3WDVA 4FQ4A 2ID4A 1K45A 2R6QA 4JGZA 1QQP2 3CZUA 3OYWB 4FFFA 3UJQA 5A6ZA 5A1AA 4IEPA 1GZCA 3F2ZA 5KHHA 4E4DX 3U0ZA 1YHFA 1XSQA 1HRI1 5A7WA 1PM7A 4AYUA 4JGYA 1W9TA 2PLV1 5DAQA 4E8CA 4I09A 2FCTA 5C7GA 1RUJ1 3ALQA 4GWMA 1DLLA 2E32A 3JUUA 4UW4A 3ENRA 5CFCC 2F4PA 4YSFA 4NUBA 1DGLA 1AR72 4X8PA 4AE2A 4A6SA 2BOJA 2RS51 4HN1A 2UY9A 2R043 2WA4A 3ETPA 3IMMA 4JX0A 5FPUA 2XG3A 3HBKA 1EPWA 1RUD1 1OUXA 3EMRA 4LO8A 5E88A 1OFNA 2TBVA 4EROA 5HCAA 4LK7A 4HT1T 1E57A 5CFDC 3LOIA 5FP8A 5EJ3A 4RR3A 1S0JA 1MZFA 3PIGA 3T2TA 1APNA 2ZS6B 4QWNA 4EJRA 4I02A 3WINE 1FV2A 4MO3M 3ZR5A 2WYSA 3FHQA 4URAA 2EXHA 2ZGSA 1JU3A 3Q8FA 5L19A 3LZZA 2WZR1 4IUGA 1RXFA 4IEZA 5GLUA 4BZ4A 4YW5A 1DQ6A 5DDJ2 5FJHA 4GWIA 1STMA 1DQ1A 4Q4X2 3VDDB 2Q5TA 1WKYA 1ENXA 4UW6A 1WW5A 4CDXC 1G7YA 3C3VA 2WT0A 4KWKA 1SBEA 1PO21 4A2UA 2VO5A 3WHUA 1S0BA 3WSOA 1XNCA 1MZEA 3PJYA 4CA9A 1M4WA 3CJIC 5FAXA 1I5PA 5GLWA 1TZOA 2XJPA 2GNMA 4TLGA 2R16A 4CCLA 4XUNA 1HB4A 2W92A 3QD6A 1Y7BA 3MUZ1 4MSVA 3ATGA 5FK7A 4AVSA 2A70A 2VG9A 4QPIA 3BIWE 4UAPA 2RS31 1U5YA 1VBB1 1SPPB 2ARCA 2VBDA 3AVRA 1DGRA 3MYXA 3WP6A 2VMEA 2XLAA 1HJGA 3ZN6B 3R6SA 3ZN6A 1W6MA 1XYPA 4CUBA 2JD9A 2Q1MA 2WJSA 2HWD3 3I7DA 4LBMA 4XQ4A 2DUQA 1LU1A 2G19A 4ZHNA 3AP4A 1CPMA 3HNBM 5A33A 3IIIA 1KRIA 2C24A 3DKWA 3EXUA 5ISLA 3ZFEA 2D3PA 4E2SA 1OLQA 5CG9A 3DV8A 4LBLA 1WMEA 1JZ2A 4BDVB 1GP4A 2JEMA 2P3IA 5FY8A 2JDMA 4H7LA 3POEA 4QDSA 1LECA 3GZTB 2F17A 4IXLA 4LLOA 3V65A 2XL9A 4HK9A 1W9SA 1Y4WA 4UFKA 3HIFA 5FZOB 4HKWA 1OSGA 1LJ7A 1LHWA 2F4LA 2RR11 2VE1A 3JQXA 2GMPA 5T52A 1JH5A 4MOAA 2O0OA 2XBO3 3BN6A 1ENSA 2JX9A 4QKDA 4Y20B 4YVSA 1UYYA 1AL0G 2W5FA 1OPOA 4A6OA 4FSJA 3OG2A 1C8M2 3M1HA 1ND3C 4FPGA 4BQ4A 4XJAA 4MV2A 5FOBB 2HLEA 3OPWA 1FPN2 2CV6A 5JIUA 2XB6C 4PQQA 2EF6A 2PHTA 2NYYA 4AFBA 2QBXA 5EIYB 2VUAA 4XFIA 4YZ4A 1O5UA 1ZBA1 5IAVA 5FPBA 3R4SA 5ANQA 4CSWA 5FIXA 3USSA 5C3RA 1VBA1 1VRH1 1TNRA 4R52A 4GKYA 3KT4A 2DCYA 4XC9A 2WINB 1RHI3 4EWDA 3OUJA 2P3JA 2E26A 4PCRA 2VMIA 3NMBA 3MIHA 1GQHA 1NG0A 4XFGA 3VB9A 2JDAA 5DDJ3 3T09A 1AL23 3WDXA 3O1RA 4Y5TA 1QH6A 1JHJA 2FZ1A 1RUOA 5GZGA 1JZ3A 3WNNA 5TSWA 4XF9A 1W0PA 5JXGA 3MFCA 1HV1A 4UT5A 3N35A 3V0BB 1RUE3 5FYMA 1J84A 2JENA 4ZXKA 1C1FA 2X29A 3IPVB 4IEVA 3O1SA 4YW4A 3TNPB 5EHDA 2Q4SA 1PIV3 4YM2A 3WVJA 3H42B 1GLHA 1VR3A 4I0AA 2YG0A 1LHNA 1UY4A 2WO3A 3WQ0A 2WWJA 4DEQA 1E5IA 2HKXA 1XPWA 4QMAA 2ZGUA 2BBAA 3WF0A 1OOPB 2ILMA 1AJOA 2O8QA 5LK5A 2NLRA 2Y6LA 4IQPA 5JXHA 2EXJA 3BTAA 4WVWA 2ZMNA 3FFZA 3RYRA 1IOAA 3GGLA 3HNYM 3K75B 3Q8EA 4YFWA 1IS3A 4NIGA 4ARXA 4I30A 3PVEA 2D7FA 4CDWC 4PLOA 1F31A 3VZMA 1W6NA 4HSJA 4WM8B 3AZVA 2ZKLA 5JWPA 4Q4W3 4N8MA 3SMHA 2D5FA 3RQ0A 3WNXA 3GCXA 1SDWA 4BK5A 3K77A 4NPRA 4YM3A 3WEZA 1RUE1 4FAHA 4M3CE 1BEV3 5LK7B 5C8WA 3RZLA 4YG3A 2WLPA 5BPXA 1FT9A 2HWF1 3RWKX 3H8UA 3RJRA 1MS3A 1VP6A 2VVFA 4XF4A 3MF9A 4H7MA 1YIFA 2W87A 2HJIA 1KFUL 4CP2A 3HMYA 4IV1C 5KC6A 1A3KA 4OHWA 5LEKA 4C0BA 3B9CA 3D3AA 4YM0A 4NIAA 1NQJA 5J36A 4P5YA 2FHRA 4IEOA 4XURA 4YGDA 5I8YA 1D0HA 3BB6A 2HWC1 2ZHKA 5FY4A 3RDIA 2WT1A 2ERFA 4EN7B 2C5DA 5D2AA 1X8EA 3AXDA 4ATFA 5LWBA 2WT2A 1QKQA 2XVGA 4IEQA 3WG3A 4AF9A 4Q26A 1UZVA 5EJ1B 3WR0A 3DXTA 5KXCA 1Q8VA 2D43A 5FDBA 4XAEA 1C1LA 1A8DA 3I2FA 1CAUA 1CAUB 2VY0A 3DYPA 2GNTA 2IXJA 5I8TA 2MEV3 4HANA 4UYBA 4QPYA 2QQLA 3J9SA 4N7UA 4E9KA 2HWB1 4DFSA 1PO13 3MZHA 5LA9A 1H8TC 2ADDA 1OD3A 3E5UA 3FHIB 3I59B 1JN2P 1RUF2 1PX4A 2W9XA 3SCGA 5C70A 2MEV1 1ULEA 1RUG2 2CWMA 4AQTA 1WBFA 1UYPA 1OH3A 3QBQA 4FO9A 1ZRRA 1FNZA 2EVXA 3K4ZA 4K6BA 4NHYA 2EALA 2HBTA 1ONAA 1J58A 3RYKA 1V0AA 4JRAA 1DZRA 3CDZB 4AEKA 1W90A 3DXUA 5GZCA 4NHKA 5LEJA 1US2A 3GCWA 3NV2A 1FYUA 5JOXA 4Q4V3 3M3EA 4G4FA 4HK8A 4EZHA 1A8MA 4EN9B 3IKWA 2VC9A 4CTEA 4FPLA 4F8AA 2RV9A 4XEZA 2BYVE 2QE3A 4TZDA 4Y1XA 4UFMA 2WAAA 2ZMLA 2FDGA 3BYWA 4MGZE 2GDFA 3ST7A 4FXKB 3E6BA 1CESA 3S7IA 4JQTA 4BISA 3ZSEA 1DIWA 2BV4A 3CU7A 1RC6A 1Q8QA 1H4HA 4Z07A 3ZKUA 1ENQA 3LA7A 4QXCA 4A7ZA 1WMFA 2EIEA 5DQ0A 4YVWB 2ARAA 3H1MA 4ES8A 5FZ4A 1HB2A 5IJRA 3VKOA 1UIJA 5FRAA 1XU2A 5ERLA 4AR2A 4DNYA 4NPMA 3SCFA 3AK0A 4QXBA 5C9AA 2QQPA 3JBG1 5IVCA 2CNAA 2QQIA 3G6JB 5ACA3 2DF7A 3VD3A 4HFSA 1PIV1 3BPSA 2QZ3A 4XQWA 5JPNB 4JDNA 4OHXA 2VTXJ 3FZ3A 1QOSA 4ISRA 4FI9A 3IDBB 3EYPA 3U78A 2KA3A 4A7YA 4EZ4A 5AC91 3NAPA 3ECQA 3WW3A 3TN92 5A7WB 3FN9A 3VBRB 2LS6A 5E6HA 5JUVA 4D0QA 2HYXA 3TNQA 4C1XA 1BK0A 3LIHA 1AL21 1D4M3 3K3NA 3SCHA 1W3VA 1RUE2 1AR71 2ZZQA 2FD8A 2YC0A 4AI3A 4DUVA 1ASJ2 1W2TA 1L3JA 1CAXB 4P9WA 3MO4A 1WCQA 4WVMB 1JUHA 1NXMA 3TEXA 1R093 4ORFA 5FUIA 2D44A 4Y1ZA 1MEC2 1YQ5A 1ZZBA 2CTVA 2WS93 1YIPA 4Y33A 4BPZA 1W6PA 4A3ZA 1W3XA 3V0BA 4HKLA 1RHI2 2AYHA 1H2MA 5FBJA 4O9EA 2ZABA 1RJ7A 1NCRB 2WFF3 1K5MC 4QQ2A 3KV6A 4IEWA 2ZX2A 2JDHA 3RMYA 5IW0A 5CFDA 5D8AA 2Y6HA 5J98B 4FPJA 1GOGA 4FOVA 2XVLA 4O65A 3DEMA 3ON7A 2WUHA 3ZXEA 4R4XA 5E1RA 3ZYFA 1SBFA 1H0BA 3WDWA 1WCDJ 3O1OA 2K46A 4ZZ8A 4NIHA 1RUH1 1ULDA 2VW1A 3CQOA 4RN5A 1L7RA 2V73A 2XBO2 2DYCA 2EIDA 2UYBA 5DZEA 4OI1A 4YFZA 2NPIA 2QKDA 2VOKA 5L9RA 4Y20A 1OBNA 1HRV2 4NHXA 4OQ8A 4XJWA 1AR82 1NA1A 1MS0A 3ITQA 4OCTA 3O0VA 5CADA 5DZGA 1MS9A 5DPNA 1OA3A 3VBHB 4LT5A 2A1XA 3KVAA 3ZM8A 5F6LB 2GU9A 3OGJA 3PTRB 4V2VA 3WP5A 4BA6A 4JHTA 4N9HA 4LITA 5JR2A 1SFNA 1UD1A 3HD8B 4W65A 1RMU1 3WLUA 4K20A 3RZJA 4EE2A 3OPTA 1NY71 3VKLA 4AI0A 3M3CA 4DY5A 4D69A 3OBAA 1GANA 1UKRA 2CWSA 4XUTA 4Y26A 5BYNA 5JSPA 4XABA 5L9VA 1WW7A 4RQPB 2RMU3 1BBT3 4X6RB 3NO8A 1HXS2 3WNMA 1ND3B 2HWD2 4NWVA 1RUI3 1AX0A 2A3XA 3ACFA 3SITA 1WLWA 2VQ0A 2E63A 1D2QA 5F5AA 3WNOA 1OOPA 2VMHA 4YGEA 4Z2WA 1F4AA 3IZOA 3VGIA 5JXIA 4AEMA 1RUD3 1COV1 3S6PA 2CAVA 3VKMA 4AOCA 2IXHA 2VBBA 4QGMA 1W03A 3KV5A 5KHKA 3DKQA 2WNEA 2PAKA 2AENA 4TN7A 3KV4A 4MHRA 5FZFA 2GN7A 2DCJA 1NLRA 1OI6A 1NUKA 2JDNA 1X50A 3O0WA 2PAMA 1MS4A 3LIGA 4OMDA 5IFPA 1WLCA 2BWAA 3ZFEB 5C71A 3VDDA 1RUC2 2K0GA 1XNTA 1J3PA 4H3WA 4CCCA 4Q4X3 1EV12 2R7EB 3A22A 3RGBA 4B4RA 3GJAA 4IE5A 2WIIB 2IZWA 3I3EA 1OUSA 4RS5C 4XMIA 2WNVC 5FZOA 3ZXGA 4AGRA 1JHNA 2VD7A 1QJZA 1GOHA 1VBA2 2RDNA 4TWTA 4AW7A 2ES3A 3I3MA 2E33A 2YFUA 4AAXA 4E2QA 1FAYA 3BOWA 4AVAA 4B1MA 3AM2A 5ABJC 2IXLA 3AX4A 2Q8DA 4NOTA 1SLTA 1R1A2 4P14A 4Q0UA 4QPIB 2E31A 1ODMA 1ULPA 3D82A 4OQ9A 4XZPA 4HSLA 5FWJA 2WFPA 3VKFC 1NZCA 1H8TB 1V6JA 1H8TA 2QDNA 2FMDA 1RUJ3 1UWWA 1AF9A 2OQ6A 5FZIA 5H9PA 3USUA 2CL2A 2WLQA 5FZCA 3I97A 2VOXA 4XDQA 1AR73 3KCYA 4HPKB 3AB0A 3VBUB 2ZGKA 4UFLA 2OT7A 2WWSA 1F5JA 1TG7A 3MF6A 4IV3C 4JTNA 5I93A 5FOJB 1AXZA 5KWRA 2EIGA 4M4RA 5LA2A 4G9SB 1R1A3 3ZFFA 5CAZA 5FR3A 3DECA 3HOBA 4QPWA 4CU8A 4LR4A 5FZ7A 2BVVA 4XCBA 4Y1UA 5EYXA 1OQ1A 4AHYA 3W58A 3ZSLA 5F32A 2DVBA 5FMOS 5IVJA 3SC7X 2W47A 5GJ6A 1VIWB 3ES1A 1TME2 2AREA 3B00A 3OD0A 2N7GA 1NX9A 4IV3B 4JGZB 4JKKA 3N9PA 2OUHA 3A7QA 2W2IA 4LULA 4CYDA 5C9AB 1POV1 1XNDA
chains in the Genus database with same CATH topology
1ALYA 1MQTA 4YVWC 4MZUA 1HRI2 1PHMA 4OHZA 1PVC2 3DN7A 1ND2B 4I0BA 3FMGA 4XTPA 1BZWA 3AMHA 5D1IA 5JIAA 5CNAA 1N1SA 2DFCA 2I74A 3WQ7A 3FE5A 1G9AA 4GWNA 1GFF2 4CDWA 1VBD3 1RUD2 4DMIA 3CO2A 3PMEA 3MIBA 1TMF2 4RHV2 4K1ZA 2GZWA 2C1FA 4LBKA 4MLOA 3VDDC 4L8QA 2HWD1 3SNMA 2K2SA 1BBT2 1CONA 5IK7A 3DPRC 5DUXA 2C9AA 1V70A 1U0AA 1YFUA 2H0BA 2YGMA 4BE3A 1Q43A 1ZYBA 2DU0A 2GC0A 3MW2A 3PVNA 1B35C 4E2GA 1H2KA 2WQ4A 1WBLA 4QHBA 2XLFA 4B4PA 1PO22 3DPRB 4UXAA 5CIRA 3E6CC 1BCXA 2FMYA 3N36A 4BMBA 1SCSA 4ITCA 1PGSA 4JGZC 4XBQA 1QXJA 1H1AA 2OW4A 2RM23 1K5MB 1I5ZA 1K5MA 2A73B 2ZX4A 4FBFA 2DVFA 3D8CA 4I0WB 3GNEA 1DDLA 2OYZA 1RVF1 1QJX2 2JKBA 5I0SA 4IETA 1AR63 4S2FA 3B01A 1DU3D 3WDYA 2VPVA 3H7JA 3J26N 3O0XA 1AJKA 4R9DA 5DG1A 4FTBA 3C2UA 4Q4Y1 3VBUA 4MXWA 2WFF2 4QPGC 2YY1A 1R081 4L9BA 3J8F1 2ZJCA 3BALA 3K48A 1O3QA 3NL1A 4W6YA 4B7EA 1RINA 4Q1PA 3WW4A 4PQ9A 2XJVA 3B69A 4XOGA 1HIXA 5DUUA 3VZJA 4OI2A 5FCCA 2ZKNA 1QNYA 3INAA 3RI9A 4X6QB 1B35B 4AHWA 2V09A 2HWE1 4OHYA 1NCRC 4AVVA 1QXRA 5HI0A 3R4DB 2IWGB 4LO7A 4YVSB 3ME2A 4OULA 1G9FA 4FVVA 2CAUA 1PNGA 1VBB3 3KCXA 4CEWA 2B46X 4UBHA 3EQEA 1TE1B 2ZZJA 3LA2A 2O8OA 3LB9A 2E53A 3VL9A 4CDQC 1W6OA 4XQDA 4D7YA 5ACA2 1AYN1 2IXCA 4M0NA 3J4UH 1ZBE2 3VN4A 3VV1A 4CEWC 1Z7S3 1T6GC 4M0HA 3APBA 3NAPC 3ZYJB 1V6LA 5FMOL 3R05A 2QDRA 4XFBA 4BMEA 3NSTA 3NV4A 3MLLA 3ZYRA 1RMU3 3B5LB 1QJY3 3JZVA 5ABJB 1FNYA 1DG6A 3VUOA 3ZSMA 4Q4V2 3G7DA 1PK6A 4AI2A 4DINB 2BFUL 1FMD1 4GMP0 3OGGA 3J8F3 4YVSC 5L7OB 1RUG3 2HEYF 5C4WA 2YHJA 4A7KA 4JTOA 4RSUA 1KS4A 1W39A 1RUF3 1BYHA 1QOOA 1UIKA 1N3QA 4LBQA 4WVVA 5T3NA 1KITA 1AXYA 4OFGA 2BBVA 5CBLA 3NKTA 4JC1A 1BXHA 1LEDA 1D4VB 1S1AA 4FAGA 2OZJA 1ZZCA 4GIQA 1VALA 1PMIA 1LULA 3LCPA 2IXKA 3KT7A 4M3CF 5FO9B 5C4WC 3OCPA 4AGGA 4WZFA 1AYM3 2HWF2 2PAEA 3TAYA 4AI8A 4JDOA 4IERA 1JYIA 2JJ6A 4TYSA 4Z8BA 4M3CA 3A0NA 4PJYA 5GLVA 4B3NA 2D97A 4CP0A 1C3HA 1ENRA 1YFWA 4ES9A 3IN9A 1QXPA 5GLTA 1SLBA 5EXOA 4PDWC 4KL1A 4NN0A 1NCQA 4AFCA 2RJKA 1BEV2 2Y26A 2XWBB 1DQ4A 5AVPA 5J96B 4R8HA 1N1TA 2KXLA 1KS5A 2AZ5A 1HKDA 3QLQA 4XIOA 2YROA 1NQDA 3X29B 2R063 1FXZA 5GM0A 4C1WA 2IXIA 3IMNA 1AX2A 5K7PA 4Q8KA 4PLMA 2GH2A 1HLCA 4Z82A 1H9PA 5IK4A 4CDWB 4LBOA 5ACA1 3SLIA 4ASLA 4LO6B 2MHFA 2AH2A 1N1YA 4MX3A 3M2MA 1FV3A 2HEVF 1UL9A 5SV8A 4QGNA 1EY2A 4I3PA 3VZNA 1MS8A 5BNNA 5CFCB 2Z79A 4XFCA 3VBOB 1AYN3 1AR92 1YNAA 5A3LA 2AR6A 2RS53 3CL1A 4WV8A 2I45A 3DL3A 4U2AA 4QX5A 1D0GA 2XLGA 3ZYGA 4MGKE 1REFA 1VLNA 3PMSA 4ONUA 3O12A 1N47A 1VBE2 3FLTA 1IPKA 1V6MA 1CGPA 4LBQD 2DWRA 5K0UA 4AWDA 5JZGA 5AFBA 1CAVA 1H4GA 1TQ5A 3RYKA 4QM9A 1H2LA 4WM7A 1LGCA 3S30A 3SH5A 3DF0A 2ZGLA 2PYTA 2JE7A 2A7AA 1LU2A 1AXKA 4AGVA 2DVAA 4DRRA 1FPN3 4ISQA 3KQRA 1S0EA 4E4ZA 2ZX0A 1M06G 3R4UA 4AFDA 2P17A 1BKZA 3IIAA 4WVZA 5BXXA 1G9DA 2OIIA 2FZ2A 4QQOA 2UWBA 4KWJA 4W6XA 2BFUS 2ZGTA 3TRSB 2XWJB 3E6DA 4BHPA 4SLIA 1F5FA 2ARBA 1VRH2 4L99A 3GBGA 5FQ0A 1YRZA 4DY3A 3B94A 1QJY1 2RS11 4QPGB 3NWKA 1NYWA 2Z2SB 4TLFA 1EAH1 2IFWA 2WNVA 2R1DA 1LR5A 4I01A 2PHDA 5BNPB 4CP1A 1QJU1 1WUVA 2CGOA 4Y22A 2EAKA 5B2GB 4HVOA 2P37A 4UBGA 4Y1YA 5AVAA 4PF5A 4OZXA 4D7TA 5EWSA 4KG0A 1SACA 2XBO1 1S0GA 5I8SA 3WV6A 1I6XA 1AZDA 2EXKA 3JU9A 3JCIA 4YNIA 1RVF2 1LEMA 1LRHA 4RGAA 1FOD1 4LO5B 2A71A 3SHRA 5K9YA 2ATFA 3ASIA 5E16A 4XJ8A 1GICA 1OMIA 1OQEA 4QPIC 3IPVA 3ZXLA 1MZ6A 2GH8A 1IKQA 2WFF1 3LSDA 3AKRA 4RR3C 3TBDA 4CEYA 3GF6A 3AZWA 4LHKA 2WL1A 3JB8A 3OY8A 1UX6A 3PNAA 2UU8A 4CRQA 1ZRFA 1HQNA 2OA2A 3ILRA 5KBFA 1ZZ8A 1B09A 5JPMB 4MVTA 4COYA 4LEJA 2BWCA 4N43A 1PVXA 1DGWX 3ZFEC 3WUDA 4Y1VA 2PHLA 4LA2A 3U4XA 1JUIA 5T55A 2ZAHA 1XYOA 3RNSA 1GR3A 2E6VA 1UZZA 1HDKA 5T5PA 3BOPA 1UU4A 4IV1B 3ZPYA 3FUQA 5JCTA 2XUMA 4KH9A 5F9TA 2ZOEB 3MW4A 1LESA 5JLVA 3JQWA 3AKSA 3AZYA 4FTSA 1F2NA 3B02A 4YZ1A 2A6WA 1Q3EA 2B39A 2WZPP 2QVSB 1V6NA 2HWB2 4JRLA 5FLIA 2SLIA 2QFEA 3PJQA 1N3OA 1EAH3 1F9KA 3AP6A 4FQZA 1S0FA 3GHNA 1AR93 1W6QB 5KXEA 4XIKA 2YPJA 3PHMA 3BCWA 3N4MA 4P9GA 3N3HA 4GA9A 2W08A 1RGSA 1U5IA 2B45X 2I07B 1UKGA 3AYCA 3NVCA 4Q0SA 4RQPC 4YRDA 5FLJA 1ZX5A 4GB31 4PDWB 1W6OB 4K40A 2BUKA 1REEA 1J59A 1QMJA 1WD4A 1XE8A 2D5HA 4FP2A 1LOCA 2RS13 3RS6A 4XJZA 3B93A 4P9LA 5CG8A 2Y0IA 4JV4A 3VBFB 1O4YA 5A32B 3FBMA 2Q30A 4KBBA 2VECA 2YYOA 4XE9A 4CDXA 3MI8A 1YJLA 1C4RA 2R062 4DOUA 1DQ0A 2GNBA 2BNNA 2PHFA 1PK6C 5FO7B 4HETA 3CJIA 4XHBA 5T50A 4WM7B 2LALA 3TN91 4C90A 1A6CA 2ET7A 2VW2A 4KU7A 1G8WA 4AVCA 1JTZX 1X33A 1LTEA 3SISA 1NCQC 4K7JA 3M3QA 1RUI1 5AC92 4GB33 3TB0A 1O3RA 1Q8OA 5D8AB 4SBVA 4HLTA 1GZWB 1ZNPA 3VHRA 4LUMA 2PHXA 4AK3A 3JD72 3WQ1A 1NLSA 4YG6A 4FT8A 1ND2C 2JXAA 3SXWA 1AYM2 2HWF3 2ZCWA 3HWJA 1FI2A 1VBC2 4JDMA 3Q9OA 4LE3A 4QPGA 4M3CB 1MZ5A 1UU6A 2TNFA 3KCCA 2XJRA 2Q1ZB 5J37A 2V5YA 2PHUA 5C8CA 4HZFA 4NR1A 1QWRA 1ZBA3 4Q0PA 3URFA 3CNAA 4U36A 2VULA 3MIEA 1X8MA 3VBHA 2JICA 2ZGRA 3AZXA 5FFOC 4COVA 4UW3A 2MNGA 2YV8A 4QXKA 4D3WA 2A6YA 3DPRA 1UZYA 4GXLA 1AX1A 2GALA 3VLBB 5JSOA 1RUH2 3MIGA 3D5OA 1QHDA 2ZAAA 3M3OA 1MVQA 1SEFA 1J3RA 1YI7A 1QF3A 1LB2A 2FQPA 1HX6A 2PQQA 4HN0A 3ELNA 3KGZA 5H9SA 4LO4B 5BNNB 5CFCA 5J3UA 4LHLA 5HXVA 1ULGA 4AEDB 3MEPA 4AEDA 3LOBA 1NCQB 5BNOC 1R1ZA 4WZCA 3D6EA 1RMU2 2NMOA 2ZX1A 4WM8A 4F7ZA 5JOYA 1HV0A 2RMU1 1COV3 4BWOA 5J7MA 4IESA 1N3PA 5C8CB 3I8TA 2XKOA 3DUIA 4NVPA 2E7TA 3IT8A 4IV1A 2I2SA 5DXDA 2B42B 1Z7S2 4DRVA 3NW4A 5CA6A 3QH7A 2YUEA 2QCSB 4WBBA 3H50A 3L2YA 5T5JA 4KG8A 4GH4B 1COV2 4RL7A 3KGLA 4CDUA 5T5LA 2X5IC 2XHKA 1Q56A 1RUNA 3VBRC 2GMEA 1LHUA 2UWAA 2RS33 4LUKA 2PLV2 4PLNA 4Q4X1 5I0UA 1OA4A 1YYNA 2A75A 1EP0A 4FPYA 4N90A 4N53A 5GZEA 5JAXA 4N43C 3CJXA 4DS0A 2Q8OA 1O5LA 3NAPB 2BVBA 1YUDA 4X8NA 4P9XA 2IC1A 2QJVA 3JBG3 3A4UA 3I2DA 2ZGQA 1EV11 4AQSA 1CN1A 2C0ZA 4RR3B 2VGDA 5AFEA 4KWLA 2WZR3 4ASMB 1C5IA 4MXVA 5FLHA 1V9U3 1Z78A 2HWC2 3AYEA 4J1WA 2XJSA 4FXGB 3ZXFA 3ZFGB 4HVQA 1AVBA 1C5HA 5L36A 1IQAA 1VB2A 2WS91 2QZ2A 4XETA 5KC5A 1UW8A 5I0RA 3JD73 2OVUA 3FLPA 3OTFA 4Q4V1 4OI4A 2VOVA 2H0VA 1NE6A 1OFSA 2P2KA 2D6OX 1FMD2 1GBGA 3I4IA 4C91A 4MH0E 3TOJA 4DQAA 5JI7A 4NO4A 4WM8C 3W9AA 1DFQA 5FQ0B 4BH9A 3UK9A 2E7AA 4CZSA 1PZ8A 1WMDA 1VAKA 3HQXA 1AHSA 3NV1A 4RA0A 4MYEA 4CEYC 2ZGNA 5HCBA 4B4QA 1JYCA 2HWE3 1JBCA 4AFMA 4ZU5A 1NCRA 5I0TA 4FPFA 1AUYA 5T5OA 1NA1C 2XJUA 3ZSJA 2VH9A 1FATA 1U12A 4L2NA 2JD4A 4E27A 3B7MA 3MFAA 1AR61 2ZGPA 1LOAA 2JG8C 4JQRA 1PZ9A 1ZZ6A 3EJKA 3OY8B 1UU5A 1PZ7A 3E5XA 1ZM1A 1NA1B 2LUWA 3H7YA 1SMVA 2RE9A 2ZPXA 3WP3A 2OZ6A 3H1YA 3AMNA 5D8AC 1MEC1 1PVC3 2UURA 5JVVA 5FREA 1W6PB 1HQWA 4DZGA 2WNVB 1FX5A 3ZSKA 3ZMOA 1I9RA 1XU1A 3OPZA 4UW5A 2RJLA 4M00A 4YARA 5A3MA 2JECA 1RL3A 4P9IA 2DV9A 2WNUC 3UV9A 1TME3 5KXBA 1LOFC 2D40A 5EZWA 2A3WA 1PNFA 1O4ZA 4CEYB 5IK5A 4OUMA 4DPNA 3ROUA 4HKOA 4PBPA 1CVNA 1X7NA 4IEXA 1G6NA 1QJX1 1DQ2A 2EA7A 1LOFA 2DTWA 4XYXA 1HRV1 4Q4Y2 2D3SA 2BEOA 2D98A 1QU0A 2Q0AA 3B3QE 1RUJ2 4KU8A 4YLZA 2R073 1CAWA 3VZOA 3WD5A 5EYYA 4HVRA 3VHOA 4Y24A 2AGSA 4EWAA 3M7AA 3WG2A 5BNPC 2F6BA 1BVVA 1SFYA 2BW8A 4J6GA 5FTTC 4CDXB 2GMMA 2HWE2 2WA3A 3AMMA 1HXS1 5C8CC 2VU9A 1LGNA 1CX4A 3I59A 4QQHA 5BUVA 4S2GA 4R4ZA 2E51A 1G9BA 5FPXA 3UKNA 1O7FA 4COWA 3O7OA 5E8AA 1OKQA 2RHPA 2ZMKA 3ZFFC 1DGWA 1RVF3 3V56A 1UN1A 3AFGA 1ND2A 4XILA 3USUB 1FMD3 2Y38A 4EN8B 1WLTA 2NQYA 2QNKA 5BNOB 1XRUA 3TYJA 3E97A 1WCSA 3ZFFB 5JI9A 3ZIWA 3KZ4C 4YW2A 2XPJA 4M01A 1S0CA 3ZXKA 1RUI2 1S55A 2ET1A 4Q2FA 3EBRA 2BQPA 1IS6A 2OPKA 4META 1J1LA 5IK8A 2HWC3 3VBSA 3H0OA 3V0AB 3VBFA 1XNKA 4F83A 2DCTA 2QUOA 1VAMA 2WZR2 1G9CA 3K51A 4XXAA 1CD3G 4HL0A 4K1YA 1MS1A 1IGOA 1R1A1 2VW0A 3AKPA 1CAVB 3VHPA 4XBNA 1MACA 1R091 3QOPA 3D0SA 3GBFA 4QD2A 4Q8LA 3UL2A 1AR83 5F1RA 1HRV3 1VBD1 3KS7A 2E7QA 1KQRA 1OQDA 1SLIA 1YO8A 2TEPA 4Y22B 3POSA 4AHXA 4AHZA 5BNNC 3W59A 1RB8G 4OHVA 2PLV3 1C8NA 1H30A 1VB4A 4N43B 2RS32 4PIYA 1HW5A 2PA7A 3RMXA 1J1TA 2ENRA 2GSYA