3UK9A

Galactose-specific lectin from dolichos lablab
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
253
structure length
249
Chain Sequence
ANLISFTFKKFNETNLILQRDATVSSGKLRITKAAENGVPTAGSLGRAFYSTPIQIWDNTTGTVASWATSFTFNLQAPNAASPADGLAFALVPVGSQPKDKGGFLGLFDSKNYASSNQTVAVEFDTFYNGGWDPTERHIGIDVNSIKSIKTTSWDFANGENAEVLITYDSSTNLLVASLVHPSQKTSFIVSERVDLTSVLPEWVSVGFSATTGLSKGYVETNEVLSWSFASKLSINKNKLAIFNLEGKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords Legume lectin
publication title Affinity of a galactose-specific legume lectin from Dolichos lablab to adenine revealed by X-ray cystallography.
pubmed doi rcsb
total genus 47
structure length 249
sequence length 253
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2011-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00139 Lectin_legB Legume lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3uk9A00
4FPHA 1HKDA 1MZ5A 1RITA 1Z0HA 3ASIA 4DRVA 5T5JA 5GLVA 3UL2A 1NLSA 1N1SA 3AXEA 5EYXA 1G9CA 3LSDA 4K21A 1VAMA 1W0PA 1O4YA 1N1VA 3M1HA 3ZVXA 3A0NA 3O5SA 4XJ9A 4XJAA 4LBLA 2AENA 5GM0A 4YFWA 1OQ1A 4HANA 3VKMA 1QKQA 5E89A 1ZA4A 4XJUA 1BQPA 4YZ1A 4YGEA 1SACA 3AZZA 5JOWA 1Q8PA 2TEPA 3PVOA 3ATGA 2Q5TA 5BYNA 1GZWA 3D4KA 4DFSA 4BOWA 3HN1A 1LJ7A 1SBEA 1LHOA 1W6NB 1W6NA 2C5DA 2A7AA 2R1DA 3GALA 4ASMB 3ZSLA 4Y22B 4Y22A 3MW4A 5FRAA 2ZMNA 1IKQA 1LESA 2DVAA 5T54A 3B00A 1WLWA 1LENA 2DU0A 1MVQA 3FLPA 1BYHA 3AYEA 3FUOA 2D6OX 3POSA 2P3JA 4R9DA 4AYUA 4BPZA 1N1YA 1G9BA 3WG4A 1YYNA 2C9AA 4LBKA 2A3XA 2YV8A 2VUAA 1QOSA 3DGTA 1WBFA 1FYUA 2ZGLA 4XMAA 2GDFA 1LOGA 1DHKB 5T50A 2P34A 3AP6A 5T55A 3AP4A 1LOCA 3D6EA 3UJOA 2NMNA 3V0BB 2YZ4A 3V0BA 5CBLA 1SLTA 3LSEA 1APNA 3SH4A 2NZ9A 3OBTA 4M3CF 4C1WA 5CA6A 4ISQA 1A8DA 2E53A 2DUOA 2YXSA 4Q27A 2OVUA 2AYHA 4LBMA 1GZ9A 5HCFA 2VH9A 5E88A 1AZDA 2PHTA 5DUUA 3WUCA 1Q56A 4YZ4A 3ZXFA 1WD3A 1AJKA 4YM3A 5JOYA 1FAYA 2EF6A 5T52A 1SBDA 4AVTA 4XE9A 3WG3A 2E6VA 4LBQD 2VXRA 1YRZA 1IS6A 5GLZA 3I8TA 4DPNA 2WKKA 1W6OB 1W6OA 1AXZA 4BLIA 4YGBA 3SH5A 3ILRA 2JE9A 3NV1A 4FPYA 2HYKA 4R9CA 5EXOA 4FPGA 4MYEA 2WJSA 3BODA 1WLCA 1ONAA 3M3QA 3AP7A 3HMYA 1V6MA 2A3YA 1DQ2A 3GNEA 4WV8A 1MS0A 1N3PA 4XOGA 1UX6A 1V6LA 1G9DA 1S0EA 5L73A 4GWNA 2EALA 1JYCA 4XYXA 4YG6A 3SITA 4UW3A 3RQ0A 2XB6C 4RA0A 4PF5A 3VKFC 2PHRA 4Y20A 3WHUA 1IKPA 4AGVA 2VY0A 2VW2A 4ZKTB 2V5YA 3N7MA 1GLHA 4GXLA 2DVDA 3B01A 5FREA 4YM1A 1LOFA 3OGGA 2A6VA 2ZMLA 2GNDA 3MPPG 1BXHA 1SFYA 1LGBA 2CL2A 3TB0A 2ZHKA 1CPMA 5CNAA 4C1XA 1N47A 3OPZA 5JMCA 3AZXA 2DVBA 2GMEA 2W08A 2P37A 1WW4A 2ZABA 1DBNA 1JBCA 2WT0A 1TEIA 4FPEA 1PZ9A 4UW4A 1S1AA 2OW4A 1JYIA 3ZPYA 1DYPA 1ENRA 1DZQA 2A5ZA 2VW1A 1WCSA 1YIFA 3MEPA 1HQWA 1JW6A 1YXWA 1B09A 1CN1A 2CY6A 3RRDA 3MW2A 1GZCA 3CNAA 1F9KA 3FFZA 1CONA 5T5PA 1WD4A 5GZEA 4AWDA 4K20A 3M2MA 5H9PA 1Q8OA 1UZYA 3VUOA 1QOOA 2ZBJA 1LGNA 2CYFA 4ITCA 2ZGMA 5DUXA 1V6KA 2D6MA 4P9XA 3WDUA 4HL0A 1UL9A 2JE7A 1ULEA 3B3QE 1VAVA 1ULDA 2ZGQA 2ARBA 3WDTA 2R16A 3JU9A 1FNYA 1OKQA 5DZFA 3NWKA 4FPLA 3ZYPA 4YZ2A 1C4RA 1SLCA 3HR9A 2ZA9A 4M01A 2P2KA 4Y24A 2ZGRA 1QNYA 1V6IA 1C1LA 1G9FA 3L2YA 1CJPA 4DS0A 2GMMA 1FV2A 1FX5A 1ULFA 4JC1A 4XJZA 1WW7A 3OBRA 4XIKA 1MZ6A 3AYCA 3VKLA 5EWSA 2NYYA 1GZWB 1WW5A 2LALA 1D2SA 2ZGOA 4Y1VA 2ZHNA 2A6WA 1GYKA 4FOQA 1YO8A 3AYAA 4Y1XA 3IN9A 4H55A 3WZ1A 4CTEA 2GN7A 4PBOA 4XTMA 2A6YA 2ZHMA 1CESA 1LEDA 4M3CB 1S0DA 4M3CA 4Y26A 3NV3A 3AYDA 1SCRA 4FPKA 5E8AA 2YROA 1JN2P 1UZZA 3O0WA 5KXDA 1MR5A 2DVFA 1IOAA 3WDVA 3OJBA 5DG1A 4YGDA 1UN1A 4R9BA 2DV9A 2ZGNA 5KXCA 1CQ9A 2D44A 5CB7A 5JOXA 1XQNA 1SLLA 2ZGUA 4YW5A 1H9WA 2DTYA 4GKYA 3PVNA 1S0IA 4XDQA 1AX2A 4YG3A 1VLNA 4FVVA 1LHVA 3FUQA 1ENSA 3KQRA 2WT1A 2OUJA 4L8QA 1O4ZA 2PHUA 1MS1A 3UK9A 4Z8BA 3ZXEA 1AX1A 1Q8SA 3FBYA 3B9CA 4BMBA 1LEMA 1ULGA 4FQ4A 4I30A 4Y1ZA 3RMXA 1LOFC 1KDMA 2UWCA 1DQ6A 2RHPA 3VKOA 5IK8A 3NV2A 2ZACA 4XHBA 1KQRA 1YI7A 1G9AA 2GMPA 5GLTA 2D3RA 2R49A 1UMZA 5H9QA 1W0OA 3R4UA 5T5LA 4FOYA 3O0VA 1SCSA 1WUVA 1W6MA 2DU1A 1I1EA 4TZDA 3JUUA 3O12A 1GANA 1F31A 1WLDA 1G8WA 1N1TA 2A75A 4XHXA 3SH3A 5GZDA 5IK4A 1SLBA 1LHUA 2AREA 2CTVA 5GALA 1MS3A 1AJOA 1WW6A 2ARXA 2BQPA 4FQZA 3VV1A 1LOBA 4PBPA 3VKNA 1LCLA 1Q8VA 1MS9A 4M00A 4P14A 1AF9A 1SBFA 1PZ7A 5GJ6A 5T5OA 3N35A 1C1FA 4ATEA 3N7KA 4Y20B 3N7JA 1QF3A 3UJQA 1KJRA 2AH2A 5GLWA 1G86A 3M3EA 1LU1A 2JDZA 4FPJA 5F5QA 3WG2A 4TYSA 1OFSA 1SLAA 4LBOA 1LODA 1UAIA 5KXBA 2NP0A 3T1LA 2E7QA 4DRRA 4XXAA 3ZSMA 1CIWA 5DUWA 3NV4A 2H0BA 5HCBA 1R1ZA 1H30A 4NO4A 4XBQA 1Q8QA 1MS8A 3V65A 4FP2A 1CVNA 2PHFA 4P9WA 3U4XA 4W65A 4Y1UA 5DZEA 4WVVA 2UU8A 1LU2A 3AP5A 4FPOB 1RIRA 1ULCA 1AXKA 1Z78A 4WVWA 2AGSA 2PELA 4XJ8A 1V6NA 2D6NA 2P3KA 5DUVA 1A3KA 3AFKA 2D7FA 3ZYRA 2NN8A 1LHNA 3N36A 1LECA 1IS4A 2UURA 1QDOA 5DZGA 4YW3A 4XBLA 1S0FA 3OYWB 3OYWA 3OY8A 1GBGA 5DXDA 3WVJA 2EXJA 4KBBA 2FHRA 3WDXA 4YG0A 1F5FA 2YY1A 4ZXKA 3SNMA 1UPSA 2I2SA 1KJLA 4GALA 3ZXJA 4AGRA 4UW6A 2WLQA 3IM0A 3R4SA 4P9YA 1GSLA 1VALA 5IK7A 5AVAA 4LBQA 2DUPA 1QU0A 1CR7A 4F83A 1JXNA 4Q8KA 2D6LX 3ZXLA 3ZSKA 1GV9A 4PCRA 2CWSA 1S0GA 2A70A 1V00A 2LTNA 1WBLA 4BQ1A 2EIGA 1AXYA 2ZGTA 5JDBA 2ZGPA 4YM2A 5F9TA 1EPWA 2ZGSA 3ENRA 2DURA 4YZ5A 3USUB 3USUA 4BM8A 1MS5A 2YMZA 4FOWA 5IK5A 2EXIA 2D3SA 4M3CE 3D5OA 4XILA 3WG1A 4FPCA 1KRIA 3LCPA 3POYA 1DQ0A 2VU9A 3ILFA 4XIOA 1V6JA 1ZM1A 5GZFA 3WV6A 3AX4A 3ILNA 4BLJA 5HCAA 3SISA 1DFQA 1J1TA 3AZVA 3RMYA 1GICA 3RSJA 1JOJA 4NOTA 2UWAA 1U0AA 4Q1PA 4U36A 3N3HA 4XBNA 4JRAA 1FNZA 1GNHA 2ZMKA 4PQ9A 5DG2A 1V6OA 1HLCA 2DUQA 3A4UA 3PJQA 4WZFA 3B69A 5SV8A 1CPNA 2WSUA 1S0CA 1QMJA 2CWMA 1BZWA 2EXKA 3V64A 1LOEA 3A0KA 5H9RA 2GN3A 1URXA 2SLIA 3SLIA 1FV3A 2JECA 1IS3A 5JLVA 4YM0A 2VW0A 1X50A 3T1MA 2D6PA 3ZXKA 2JKBA 1BKZA 3T2TA 4RL7A 4D69A 1DYKA 1LHWA 4R9AA 1QDCA 4XJWA 2WT2A 5GZCA 1HDKA 1DQ4A 2EXHA 5EYYA 3APBA 1S0BA 3MW3A 3Q9OA 4IQPA 3FLTA 4GA9A 3AZWA 1JUIA 4AGGA 2PHWA 5H9SA 3WNXA 1HQLA 1PZ8A 3M3OA 4LBJA 3WDWA 1W6MB 2GNBA 3AJYA 3W58A 3W59A 2OUHA 2A3WA 2WSVA 1DLLA 1QGLA 4SLIA 4FP3A 1QOTA 2V73A 1MVEA 2ZAAA 4U2AA 4K1YA 3QLQA 1ENQA 3IKWA 1NXD1 1A78A 1AVBA 3O0XA 4LBNA 3RG0A 3TAYA 4ATFA 1LOAA 3R05A 5CAZA 1LULA 4YGCA 1AX0A 1Y7BA 2A6ZA 4UW5A 2DTWA 2WQZC 4Q8LA 3KM5A 3ZSJA 3BIWE 1LGCA 4CRQA 3WCRA 4JCKA 3FLRA 2SBAA 3BTAA 4YW2A 1KITA 1N3QA 3WUDA 1MACA 2ES3A 2AUYA 1JHNA 3N7LA 2Z42A 3QCWA 1SLIA 2PHXA 2R1BA 4Q26A 4YW1A 4CZSA 1GKBA 2ENRA 3PVEA 4YW4A 3AZYA 4YFZA 1S0JA 1RINA 2D6KA 3AP9A 2NM1A 3H0OA 5JVVA 2A71A 1DIWA 2CNAA 2UWBA 3IMNA 4BMEA 2E7TA 4Q2FA 5GLUA 1MS4A 4Y1YA 4YLZA 1UKGA 1G7YA 1IS5A 1DQ1A 1GNZA 3DUIA 2GNMA 3AJZA 3WHTA 2DVGA 1W6PB 1W6PA 3I4IA 4XTPA 1W6QB 1W6QA 2JD4A 4OZXA 4Q1RA 1D0HA 4FPFA 4XMIA 2JJ6A 3OY8B 4XXPA 3WOGA 2ERFA 3BOPA 2G4IA 3INAA 1VIWB 2AR6A 4AVVA 5LK5A 4AVSA 4K1ZA 5IUQA 3V0AB 3V0AA 3RS6A 5IT6A 2DYCA 3AK0A 1N3OA 2E51A 1C57A 2NMOA 4GKXA 2KM2A 2GALA 2ZHLA 4FOVA 4LBQB 3WLUA 2D3PA 4XZPA 3WCSA 1LTEA 2W39A 5GZGA 2XG3A 1FATA 2ZGKA 3C2UA 2ZKNA 1DQ5A 1KDKA 2A6XA 5JOZA 1I3HA 2ZZJA 3POWA 2D43A 2W68A 4YZ3A 1QNWA 2R0FA 2P3IA 5KXEA 2R0HA 2GNTA 2B7YA 1BJQA 1DGLA 2FMDA 3AXDA 2EAKA 3IPVA 3IPVB 1H9PA 3M3CA 4GWMA 3WDYA 2WNEA 4DQAA 2DWRA 4ISRA 3PMEA 2W52A
chains in the Genus database with same CATH superfamily
3VB9A 1MZ5A 1RITA 3E5XA 3D0SA 4DRVA 2ZX3A 3KGZA 1NLQA 2FDHA 3LOBA 1S4CA 2JG8B 2WNVC 5DAXA 1YFWA 4BA6A 3K4DA 1CAUA 2R30A 3WP3A 1HRV3 4OI0A 1EV13 1AR93 1POV3 1I5ZA 3M1HA 1RUOA 3O5SA 4LE3A 4LO6B 2AENA 2PQQA 1WCUA 2I45A 2R073 1OOPB 5F3EA 5CVRA 1C5HA 2TEPA 2VL4A 3PVOA 4K7JA 2Q5TA 3GBFA 2YPDA 1AHSA 4Q4X1 3FX3A 3BVCA 1LJ7A 4YVWA 4BOWA 1LHOA 3KLSA 5J48A 2C5DA 2XJUA 3IT8A 3TEWA 5M0TA 5A6QA 1QJY3 3HBZA 3TEZA 5I91A 3KT7A 3B00A 1US3A 4MGKE 3BB6A 3LQCA 1H8VA 1YQ2A 2NPIA 2IWGB 4Z07A 3WNMA 1BYHA 4QPIB 5L7OC 4AEJA 3ZR5A 2P3JA 1RUE2 2HWF2 3WG4A 1YYNA 1QOSA 3DGTA 1WBFA 2ZGLA 4FXGB 4S2HA 5J98B 1LOGA 2O8QA 4NHLA 4TSVA 3AP6A 5T55A 3AP4A 1LOCA 1AUYA 3ZN4A 2NMNA 2YZ4A 1NG0A 1SLTA 1YJLA 4IE4A 1H8TC 3TNQA 2JDHA 4D6QA 3NQHA 1APNA 3SH4A 2WZPP 4YPJA 1H1AA 1SQ4A 2GU9A 2DUOA 3B94A 3I2GA 1VBC3 2D93A 3SCFA 4BQ5A 5BNQA 2CU5A 2ID4A 2W94A 5FYTA 3B9IA 4TXWA 5DUUA 2OA2A 3WUCA 3W21A 2TUNA 4MGYE 1ZBA3 4XF0A 1WD3A 1AJKA 3FE5A 1UWWA 1WMXA 4RFRB 5FZDA 1DYOA 5LCWL 5CG8A 4GB31 1J59A 4K6BA 1ST8A 1SBDA 3RZHA 2J1AA 4XE9A 1VRH3 2WWSA 5ANQA 3U14A 3CDZB 4LUMA 4DPNA 3NNFA 2QQMA 2WKKA 4RQPB 1W6OB 1YQ8A 4N9HA 1TME3 3SH5A 3VZLA 1TZOA 2HEVF 2JE9A 3ILRA 3NV1A 2HYKA 4HOOA 3U10A 3SKJE 4MYEA 4LEJA 1O3TA 1W2UA 1WLCA 4GJYA 3VDDA 1RL3A 2H6CA 5KC5A 4KGQA 2G9ZA 1O6UA 3GNEA 4LHNA 4QXKA 2XVKA 2RS33 1MS0A 3P5BA 4XOGA 5CKMA 1G9DA 5K0UC 1HRV2 3I54A 2EALA 1EV12 1AR92 4QQLA 5A3NA 2AEYA 3RQ0A 2XB6C 1COV3 2BVBA 3VBSC 3WHUA 4RGAA 2VVDA 3N4MA 4QHBA 1IKPA 2R072 4AGVA 4ZKTB 3ST7A 1OD5A 2HYXA 3HWJA 4CA9A 1CAWA 3B01A 3DV8A 3ETQA 4HK9A 1OF3A 1W99A 4YM1A 3T2OA 1VMJA 2JG8C 4QHOA 4PIXA 4MLOA 2CL2A 3ETPA 2WR9A 4JGYA 1CPMA 2EVXA 2JIJA 3I3EA 1QJY2 4BQWA 4DY3A 1RUH2 2JG9A 2UY8A 1RHI3 4OHYA 4CXWA 2WT0A 2YBSA 4FPEA 3MGUA 2JDAA 3OF1A 1PZ9A 5I8SA 2EAAA 1W8NA 4AL9A 1JYIA 3BOWA 1C8NA 4MXWA 1DYPA 4L97A 3ZYFA 4BK5A 3T2QA 3W20A 3GXUA 5C3PA 5FUIA 2XL9A 3MF6A 1EPZA 3P3NA 1VE0A 5FBJA 1XPWA 3JXSA 1CONA 4CU6A 4UFKA 1X9TA 3IBMA 5FO7B 4FAGA 4AVBA 2VQTA 2LS6A 1PGL1 4W4ZA 2PFWA 2ORXA 3DKWA 4QPIC 2ZGMA 4G9SB 1F2NA 1L7QA 2D6MA 4HL0A 3Q8FA 4COVA 3MFAA 4PLOA 4CDUA 3B3QE 1VBC2 4N53C 4MOAA 2BNMA 3WDTA 5FKBA 3O1VA 1C8M1 3RJRA 1OKQA 3ZSEA 2V5DA 1MZFA 1CAUB 4YZ2A 4R52A 3FMGA 1ULPA 1ZBA2 1QWRA 1ULOA 2P2KA 3CLPA 3GZUC 2BZDA 1C1LA 1VBB1 2KA3A 4MHRA 3VBHB 2VOWA 5BNOC 1VB4A 3RNSA 1VRH2 2W5FA 1X8EA 2BNNA 1EAH2 1FX5A 3GBWA 3CEWA 1TME2 1W90A 4XJZA 4FFGA 3SXWA 4CDWC 2J1TA 3AYCA 3OTFA 4RD7A 4AFCA 2YC4A 4ONUA 1YO8A 4Y1XA 3UGGA 1OA2A 4CTEA 1QEXA 2GN7A 4H3WA 2GH2A 1O4TA 3LDBA 2RS32 4RSUA 4B3NA 1LEDA 3LIGA 3ZXGA 4UF0A 1PGSA 1SCRA 3AYDA 1XB9A 3D3AA 5E8AA 1UYYA 4RQPC 1COV2 1GWMA 4COWA 1RXFA 4D94A 1CAXB 1IOAA 2V4VA 2VCCA 2C4XA 5FZ1A 2VNOA 4DO0A 1AL23 2XUMA 1UN1A 4XFAA 1FI2A 2ZGNA 5FK7A 5FUPA 1PVC1 2VMCA 2DCZA 2Q8CA 3QH6A 3ABZA 2FDKA 5JOXA 3H8OA 4JZRA 2MEV1 1SLLA 4JTOA 2BGPA 4KH9A 1H9WA 4YG3A 2FZ2A 2DCKA 4Q0UA 2RR11 2WT1A 2OUJA 3T09A 1RHI2 1MS1A 2E63A 5FZGA 1SFPA 1AX1A 2I07B 2JDUA 3WP5A 5IVFA 3B9CA 4BMBA 1PO23 1ULGA 4MSVA 4Y1ZA 4XURA 3Q8EA 1H2LA 1J84A 2RHPA 2UWCA 5FFOC 5LY1A 1NKGA 3H1MA 1XSRA 3GJAA 2QBXA 1QJEA 2CDPA 2XKPA 2R49A 4RS5A 3VGIA 1W0OA 1CWPA 2HEWF 3GCWA 3RYPA 2LW8A 2BOJA 3GJBA 3H7YA 2J42A 3N9LA 4TWTA 1W6MA 3P3PA 1ODMA 3JUUA 3O12A 1O8PA 4UI9L 5FQ0B 3WF2A 3O1MA 3I49A 2A75A 3SH3A 5C4WA 1H4HA 1PVXA 1SLBA 3AMHA 1UIKA 5CADA 3J4UH 4QU2A 1D7PM 1OFNA 1JU3A 1O5LA 5I8YA 4COZA 4K9SA 4CU9A 4D8MA 1ND3C 1VP6A 3H8UA 2B9UA 3A22A 3O1UA 4QX0A 2XOMA 1QF3A 3N7JA 2QKDA 3WX5A 5DMYA 3OB8A 1KJRA 2AH2A 2WWJA 4TLGA 4QKDA 4F7ZA 4HSJA 3KB5A 5FO9B 5J3UA 4FPJA 2IXIA 4Q4X3 3W5NA 5FZ3A 2WN2A 1EY2A 1OFSA 4BB3A 2RM23 3H8RA 3J7MA 2EA7A 2HWC1 3RDIA 3T1LA 2E7QA 2YBPA 1V9U3 4JGYB 1OQEA 2QDNA 2VPVA 4XDPA 1H6YA 1POV0 2VM9A 3NAPA 4XXAA 3THPA 3ZSMA 2ATFA 5HCBA 1BMV1 4PDWA 4BJ0A 3MHZA 4KMQA 3VBHC 1XNTA 1Q8QA 3LWCA 1LAJA 2XJQA 4ZS2A 2G9FA 3V65A 4XF3A 4P9WA 5DN2A 2RS51 2VTXA 1BEV2 3WR0A 3WW2A 1UIJA 1QJU3 1O91A 4FPOB 3LE0A 4BQXA 1XNAA 1AL22 1PIV1 4OHZA 4Q29A 4C90A 1A3KA 2W87A 2W3JA 3AFKA 1OA4A 4BQYA 4RYDA 2XLAA 4S2GA 2VUJA 3NVCA 5C9AA 3RZJA 1LECA 5I0DA 5FO8B 1JS9A 4BQ2A 2BFUS 3OYWB 4TLFA 3VD7A 5CG9A 2EXJA 1AR73 2JB4A 5FXXA 3WDXA 1OSGA 2BU9A 2LRPA 3VD9A 5BY5A 3SNMA 1UPSA 2I2SA 4AGRA 4CU8A 2V4AA 5FZMA 2WLQA 2XVGA 5FTTC 1PO22 1C3HA 1TMF1 3IM0A 3R4SA 4P9IA 3E6DA 1CZVA 4LOSA 3KCYA 4UYBA 3VBFA 1VALA 5AVAA 5FMOL 1VMHA 1WCDJ 3OD0A 1ZZBA 1CR7A 1U5YA 3OBZA 5DAWA 3S30A 2HH9A 2D6LX 2H0VA 5I0RA 2A70A 2WO3A 1FOD3 1WBLA 4Z2WA 3MYXA 1J3PA 2YB7A 3I2JA 4YM2A 5JIUA 3VD3A 2K9ZA 3LA7A 4HZFA 1VBA1 4ZY9A 1KXGA 3USUA 4DIQA 1R1A3 5FPLA 3C3VA 1HJGA 2GC3A 5IK5A 3FL7A 4M3CE 3D5OA 3M8LA 3CZUA 1GWLA 4CDUB 1KRIA 3PTYA 4PIZA 5F2WA 3POYA 2VU9A 1XYOA 1MQTA 5A7QA 3WV6A 3CZJA 3AX4A 3NNLA 4IV3B 3ILNA 3VZJA 4EN6B 4BQ3A 1RUNA 1XE0A 3ZKUA 1GP6A 2R061 4GULA 3SISA 3B93A 1TVGA 5FPXA 1JOJA 4LOTA 4Q1PA 4Q4X2 5J96B 2W9XA 3KS7A 1GNHA 3O14A 5IVBA 4PI0A 2RM22 1BVVA 1KFUL 3VHOA 4X6RB 3RGBA 1CPNA 1RUI3 4JKLA 4B7EA 1V9U2 3AMQA 3B5LB 2RG4A 2CWMA 3BGAA 2DDUA 3DPRB 4Z82A 5GKAC 3SLIA 2UYBA 3ALQA 2ZCWA 4I0WB 3KGLA 2WNUB 4QQPA 5JLVA 1LNSA 4X8PA 1UMHA 1OC1A 3ZXKA 2JKBA 3T2TA 1YHFA 4D69A 1LHWA 2Q30A 3L2HA 1QJU2 3NJVA 4R9AA 2IFWA 2PXJA 2WO1A 2Q4SA 5FZ9A 4MG2A 3BN6A 2OKXA 1DQ4A 3ROUA 3APBA 5K7PA 3HVDA 3DXUA 3DKQA 4RS5B 2WNVA 4GA9A 4JRLA 3IDEA 4IETA 4Q0QA 4Z92B 3MDPA 1F35A 4BZ4A 2VO5A 1W6MB 1AR72 3AJYA 3UYJA 1AL0G 4NUBA 2HKXA 1V0AA 3W59A 3WW4A 1VJ2A 3FBMA 3IIIA 4PHZA 4A45A 4B4RA 2VNRA 5C4WB 3THCA 1RMU1 1W2OA 4FP3A 1X82A 1RUJ3 2Y6KA 1ENQA 1A78A 1BCXA 2RS11 3RG0A 3S5AA 3BALA 3R05A 1UKRA 1Y7BA 1R091 4GZ9A 1ALYA 4PIYA 4HVRA 2VR4A 2ZX4A 3I7DA 4MHUA 2C1FA 2BP6A 3WNOA 2WQZC 2XBO3 1W06A 1R081 3BIWE 1FOD2 3WNPA 1W3XA 2ADEA 3AKRA 4ZZ8A 1X8MA 1HQNA 1ND2B 1UY4A 5FZHA 4DXTA 5L7OA 1JYWA 1SDWA 2VZPA 1R1A2 4DNYA 4AFBA 5CFDC 3UKNA 5J09A 3QCWA 1SLIA 2WNOA 3NAPB 5ABJC 4CU7A 5LA0A 2W0XA 5J37A 2B45X 2CAUA 1MEC3 1H8TA 3AP9A 2YC2A 2QZ2A 5JVVA 2A71A 3JD71 2CNAA 4LKSA 4CUBA 2WRAA 2UWBA 3IMNA 4BMEA 4PT6A 1QQP3 4YLZA 4IGQA 4P9GA 1W9SA 1IS5A 1DQ1A 3DUIA 3OEAA 4LQRA 4CEYB 1JYVA 1XYNA 1CZTA 1YCIA 2DVGA 5LBFA 1W6PA 3AL6A 2RR13 5G05L 2JD4A 1RUI2 3VL8A 5JXJA 4IV3C 3VD4A 1F15A 2X5IB 3MIGA 5BNNB 4NIIA 4BE3A 1O59A 2F17A 1UY0A 3MIDA 2ERFA 3BOPA 1GQGA 4OMCA 5L9RA 4BU2A 1VIWB 2AR6A 1JHJA 4OI1A 1W05A 4ZZ5A 4AVSA 4K1ZA 3MIEA 4MVTA 2IVJA 4LPLA 5A7SA 2VD7A 1YI9A 3MF9A 3I2DA 3VBFB 3BTXA 2KM2A 3WLUA 3POBA 1JOBA 2D3PA 4XZPA 3WCSA 4QDSA 4JGZA 1FATA 1DQ5A 3DPRC 1PGL2 5CEHA 1I5PA 4KNCA 3WF3A 5K4LA 3SQOA 3N9OA 2ADDA 4UFHA 2D43A 3TEYA 2VVFA 5K0UA 4UFIA 3CBNA 3ZIWA 4AXOA 2WNUC 2P3IA 5EPAA 4ES8A 5KXEA 3VBSA 4GWMA 4JTNA 3WW1A 3S7EA 1PO11 1OD3A 3GHNA 4COYA 3AZYA 1WMDA 3UNPA 1KGYA 1VBE1 1DDLA 1RUC1 2Q0AA 3ASIA 3QACA 4GMP1 2JG8A 5GLVA 3KQ4B 1NLSA 1SHWB 3AXEA 3K77A 4E2SA 3LSDA 4NPRA 5E1RA 1VAMA 3H1WA 1N1VA 4AI8A 1JZ3A 3IDBB 1IQAA 4LBLA 1SPPA 3IDCB 4UT5A 2XBO2 1HV1A 3AKSA 1ZA4A 2N7GA 3Q8AA 4PJYA 1BQPA 5LWBA 3UESA 5A32A 4RR3B 4YGEA 5JAXA 2QCSB 1Q8PA 1SZBA 2VTXJ 5JOWA 4HN0A 5L19A 3F95A 1PX3A 1GZWA 4NHYA 4QDRA 1BLZA 1SBEA 1W6NB 1UZ0A 2BERA 3GALA 3SMHA 4IW3A 3AMPA 4XFCA 2P1BA 4JDMA 4Y22B 5FZCA 2D98A 1W39A 2ZX0A 1A34A 5FRAA 2ZMNA 3BPZA 5J36A 4QGLA 1MEC2 1WLWA 3MI8A 2BPA2 1DZTA 1LENA 1MVQA 1ND2C 3ITQA 3MIFA 3FUOA 4QPIA 1PM4A 5F6KA 5IJRA 4AF9A 5FZKA 1MZEA 4OI2A 4LHKA 3GF6A 1N1YA 3OOXA 4R9DA 4RN5A 1HB1A 2WAAA 3U78A 2C9AA 1QQP2 3MV11 2YV8A 1W03A 1K3IA 2VNGA 1FYUA 4N53A 4XMAA 1NZIA 1DHKB 3C7FA 3MO4A 5JI9A 4CP0A 2RR12 4C0BA 3OPTA 5LY2A 4CEWB 2YGMA 1TMF3 1DGWX 5A80A 2BEOA 2Z79A 4M3CF 5BNOA 5F5CA 3KCXA 1PK6B 2YXSA 4B1LA 1DLCA 2Y8KA 4Q27A 4DXRA 5FP3A 4CEYC 3A23A 4XF4A 5C5UA 2BVVA 4CDWA 2J7MA 2VOTA 1UYXA 2AACA 2X5IC 3EMRA 5BNNC 1GOGA 4YZ4A 4P00B 3ZXFA 5AFEA 4H2AA 2Q8EA 1J58A 5JOYA 2J22A 4EZ4A 3ORJA 3E6BA 3FJSA 1E5SA 4E2GA 3EO6A 1CGPA 1WCQA 4LBQD 2VXRA 1YRZA 2WWUA 1H2NA 4LO5B 3JQXA 2FDGA 4RQPA 2VZ3A 1W6OA 3ACHA 2J1VA 2BRTA 2K46A 2GP5A 4PLMA 4EN7B 2XJTA 4XFIA 5EXOA 4AFAA 1OXCA 1NLRA 2E7AA 1B35C 2WJSA 3H1YA 4I3GA 5ANNA 1ONAA 3N9QA 1CX1A 2QQIA 2A3YA 1DQ2A 1XRUA 5C3QA 3RZMA 2OYZA 1JH5A 1NE6A 4EWAA 3KD4A 4GWNA 3SITA 1JYCA 4YG6A 1O3SA 1T6BX 4NN0A 4Q4W3 1KS5A 5KWRA 4OI4A 4E2QA 2WL1A 3AVRA 1AR61 2ETEA 2VW2A 2ZPXA 3BI3A 1GLHA 5FY1A 3LEKA 1L3JA 3ACFA 4V1PA 1JYXA 3OG2A 2R041 3MBWA 4HK8A 3DYOA 3I3BA 3H3UA 4Q4Y3 4KWUA 4DUVA 4UFJA 1OLQA 4FFFA 2CSGA 4A42A 2GMEA 3LFMA 2W91A 4X6QB 5JUVA 4QPGC 2JIGA 1F5JA 1TEIA 1W8OA 4RHV3 4MGTA 3ZPYA 1BBT3 3CF6E 1ENRA 1DZQA 2A5ZA 4RR3C 4AEKA 4QXBA 1JODA 3PIGA 4AHZA 2X09A 5FK8A 3MEPA 2X05A 1HQWA 1M06G 1JW6A 2D40A 1YXWA 2CGOA 1B09A 1JU4A 4JGZB 5FAXA 2CY6A 1OPOA 1FMD3 2ET7A 3LEIA 3FFZA 3T3YA 3VZNA 1WD4A 5GZEA 4FO9A 1SMVA 2ZTNA 2JKXA 5FYUA 1ND3A 4AWDA 1IPSA 4JHZA 4CVUA 2P17A 1TMF2 3S57A 3VUOA 2FZ1A 1HRI1 1POQA 2CYFA 2D5FA 4ITCA 1HXS1 4AFDA 3WDUA 2QJVA 4TTGA 2IUWA 4OHXA 2K0GA 1NQJA 2NQYA 4RGKA 4FSJA 2ZGQA 3HBKA 1YEWA 2ARBA 1NX9A 1J3QA 4A3ZA 3JB4C 1JZ4A 4L11A 3U1XA 3ZYPA 1Z7S1 3HR9A 4CEWC 4X8NA 2ZA9A 3CJIC 2XWJB 2BUKA 2QUOA 3GZEA 4HBNA 2C24A 1SPPB 3N9NA 3TYJA 3VBHA 3JCIA 5I0TA 1QJX1 1XNKA 4KGGA 1PK6C 4ZXEA 2GMMA 1FV2A 5A32B 1ULFA 4YARA 4L2NA 1JMUB 3OBRA 4XIKA 5ACA1 2HWB1 5IK4A 3D8CA 1GZWB 2IXLA 2C26A 1SEFA 2LALA 5LEJA 1X9PA 2ZHNA 3BIEA 2JDYA 1U5IA 1OPMA 3WZ1A 2XONA 3IN9A 2Z5WA 1E5IA 1RUH3 2BWCA 1ASJ3 2MNGA 2ZHMA 4HVOA 1CESA 5FR3A 5F8PA 2PHLA 5HCAA 4FPKA 1JYNA 4Q4W2 5JXGA 1NUKA 1O8SA 5C6CA 4K8FA 3T08A 3ACLA 3O0WA 3THTA 4NRQA 4AHXA 4AOCA 5A3PA 4KBZA 3VBOC 1CAXA 3POFA 3WDVA 1NQDA 2HBUA 3OJBA 2JEMA 2ILMA 1VBD1 2P6CA 3CJXA 4R9BA 4YGDA 4L9BA 3H3LA 3URFA 4W6XA 5CB7A 4N53B 1ZRRA 4QX2A 1XYPA 2ZGUA 4BK4A 3ES4A 4Q4Y2 2RDSA 2W1UA 4XZUG 1S0IA 1YFXA 1AX2A 3QD6A 1VLNA 5F6LB 3HNMA 4N43C 4QX1A 1LHVA 2B42B 3UKTA 3ZFFC 1TNRA 4BDVB 5FPUA 3V56A 1LB2A 4A6SA 5BNOB 5FYZA 3KZ4C 3THDA 4XF1A 2WZEA 4RHV2 2W2IA 3RZZA 4XQDA 4B4QA 5K8SA 4I30A 3RMXA 1BBT2 1LOFC 2GAUA 5F32A 4DUXA 1DQ6A 1H0BA 1XBFA 2ZACA 4CDWB 3RZLA 1KQRA 1UNBA 2ZX1A 3LA3A 2XLGA 4BYYA 1AR81 1FMD2 1RUF3 1Y9GA 1UMZA 1XE8A 4IV1B 4RFT0 5A1AA 1UW8A 4K8RB 2P4EA 1RMU2 1H4GA 1SCSA 4SBVA 1I1EA 1EAH3 4DB5A 2EIDA 5FQ0A 4H7MA 1G8WA 4Y4YA 5GZDA 1DGWA 1LHUA 4GH4A 3OSDA 5IHRA 5T3NA 4JGZC 2WZR3 2ARXA 5FZ7A 2BQPA 3VV1A 2FCTA 5JI7A 4PBPA 1R092 1ZYBA 3HN3A 3U0ZA 3O1SA 4DUWA 5FXZA 1Q8VA 1K45A 1RUD3 2Y38A 3I2IA 4M00A 1EP0A 5A7OA 3N35A 2XUEA 4ATEA 1FPN3 2RJKA 4KL1A 4NR1A 1G86A 3M3EA 2XR4A 2JDZA 3WG2A 1I6XA 2WUHA 2ZEYA 2J1RA 3I59B 2W1WA 5KXBA 1UAIA 3I2OA 2Q8DA 4S2DA 4UBGA 4P9JA 1RUG3 2QNKA 4Q4V3 5DUWA 2JD9A 1R1ZA 3VDBA 4EN0A 1ASJ2 1H30A 4NO4A 4DEVA 2OPKA 2XWBB 5A3UA 1CVNA 3U37A 4HMZA 1ZZ9A 3ZYGA 4Y3OA 3EYPA 4IESA 4OMDA 4W65A 4Z1VA 4Y1UA 5LA1A 4HKLA 3KVBA 1CAVB 2UU8A 2YBKA 2YU2A 5JZGB 2VUDA 1RIRA 2RJ2A 3KT4A 1ULCA 3CL1A 4LLFA 5EFUA 4WVWA 1J1LA 5DUVA 3OD4A 1OH4A 2D7FA 3WF4A 2VQAA 3I3QA 4KQ7A 4XUQA 2E9QA 5C5TA 1LHNA 4EV0A 4Q5OA 4JVAA 2VC9A 1QDOA 4YW3A 5FPBA 1ND3B 1IGOA 4FI9A 4QX7A 3OYWA 2E31A 1GBGA 3LGRA 3WVJA 1BVP1 4NHKA 4EWDA 3U4SA 2XLFA 4Y5Z0 4ZXKA 1ZZ7A 5A1LA 3KWVA 3ZO0B 2VUCA 2VXJA 2VCBA 4QMAA 2OQ7A 1GSLA 5F3GA 3USSA 4LO8A 1QXJA 1U12A 1UZWA 3K4AA 3PURA 1UY3A 3ZPOA 1OT5A 2DUPA 5CFDA 1D0GA 1CZSA 5JPNB 4IGPA 1JXNA 3JBG3 5ABJA 1RUF2 4I01A 3ZSKA 2HWE3 3BUCA 4WBBA 3OGVA 4AG4A 1V00A 4ET7A 5KHGA 4BQ1A 2EIGA 4OFGA 5JDBA 3T0DA 2V09A 1RUC2 3RI8A 3DL3A 5F9TA 2QQOA 4YZ5A 4DEQA 4IEOA 1ZREA 2WN3A 3GGLA 5AC91 3N9PA 5FWEA 1J83A 2W1SA 3KF3A 1XJAA 2D3SA 4LULA 4DINB 2WZR2 4FPCA 3WY6A 3LCPA 5LATA 1GQHA 3J8F1 4B29A 3JZVA 5I93A 2TNFA 4IV1C 1DF0A 4IV3A 1RUD2 4KWJA 2IXJA 1PNFA 2J1UA 1KFXL 4Y33A 2B4KA 4IEPA 2PLV3 1W8ZA 3T2PA 2Z4FA 5BUVA 5FKCA 1BEV3 1FPN2 3RMYA 1IG0A 3IAPA 4QX8A 5FMCA 3W9AA 4LKFA 3A21A 4WVZA 4NOTA 3DF0A 1D4M1 4XBNA 1FNZA 2ZMKA 5DG2A 1Q5OA 2VBPA 1V6OA 3AM2A 2DUQA 5FY7A 5JCTA 1W0NA 2WSUA 3C7EA 5BNPC 4IGOA 1RUG2 4Q4V2 3DPRA 2EXKA 1W8UA 3AC0A 4NIAA 1OUXA 4AQ2A 2ARCA 1FV3A 2JECA 4AE2A 3ZFGC 3ZYJB 2WNUA 2VW0A 1X50A 4IXLA 1HV0A 3RYRA 4D6RA 5KHIA 1LKNA 2Y34A 4P08A 5FLIA 2WT2A 2B5HA 2DCTA 5GZCA 1UY1A 2WFF3 3WF0A 4AR2A 3MW3A 4MGQA 1ZBE1 4CP2A 4N9IA 3PUSA 3AZWA 5LK7B 3IB3A 4GWIA 4YW7A 2WYSA 4AGGA 1S55A 2Q1MA 4LBJA 3WDWA 2GNBA 3RWNA 2F4PA 1VAKA 5IVEA 4O61A 4JHTA 4WVMA 3W58A 3LOIA 2A3WA 5JZGC 1SFNA 5FOBB 4GH4B 1GR3A 3LA2A 5EIYB 5CIRA 4NROA 1XE7A 4K1YA 3QLQA 4OQ9A 4D7TA 1UY2A 4LKEA 3O0XA 4LBNA 1QJX3 1LOAA 2EIBA 3JBG2 1ZRDA 3U75A 2HWE2 4UW5A 5I0UA 1LR5A 4GQ7A 5LEKA 2YFUA 4CRQA 1LGCA 4CYDA 5F2SA 5FZOA 4JCKA 1AYN1 2SBAA 1ND2A 2EIEA 3BTAA 2DCJA 4QM8A 4YW2A 3S7IA 3MUZ1 4CXYA 5C7GA 3SHRA 2JDKA 5EZWA 1JHNA 3N7LA 4CZSA 1GZTA 2R6QA 4LO7A 2P3YA 1JTZX 2A1XA 3PVEA 1IG3A 4M0NA 4YW4A 5C71A 1S0JA 1RINA 1VBD3 2PLV2 2QQLA 2B39A 2NM1A 3H0OA 3CMGA 4Y5SA 1DIWA 5FYHA 3TEXA 3RFRA 4XDOA 5JXHA 5GLUA 4Y1YA 3TOJA 1UKGA 4LKDA 3WHTA 4CEYA 3WINE 2GNMA 4NIGA 3I4IA 4XTPA 2WS91 2QDRA 4OZXA 2Y6HA 2X5IA 4Q1RA 5BNNA 2QVSB 2JJ6A 2DFCA 2QZ3A 4AI3A 2BDRA 5LK5A 2XVLA 5F7UA 4XUNA 3LEMA 2O14A 5IT6A 3AK0A 3ZMNA 5C8CB 5A7WB 2Y6FA 4C8DA 2ZHLA 4FOVA 4GWJA 1QH6A 1LTEA 4GB33 4LE4A 5CFDB 2WFF2 3AVSA 1B35A 2GSYA 2ZGKA 3C2UA 4AK3A 1W2AX 5ABJB 2GC1A 1I3HA 4Q0SA 4XAAA 3KT1A 3POWA 4OLLA 4QAWA 3NNGA 2W68A 3BTYA 2EICA 2RMU1 1GOFA 4YYOA 2R0FA 2ZJCA 4INDA 2R0HA 3SEPA 4XUTA 5A6XA 5LRRA 4I0BA 2VMFA 3M3CA 3KCCA 3TN91 1FT9A 4LHSA 3VD5A 2WNEA 4CDXC 3IWZA 2E32A 3PMEA 2W52A 4LHLA 4FPHA 1HKDA 3CHXA 4J6GA 3O1TA 4R4ZA 5T5JA 3LF7A 5C70A 3UL2A 3WNKA 2CGPA 3IMMA 3J9SA 1TE1B 4K21A 1QJX2 1W0PA 1XU2A 3PU8A 3Q8CA 2Y60A 3A0NA 1H2KA 3AFGA 3CO2A 4HANA 4QPGA 3VKMA 5JMOA 2HWB2 2YDEA 3WP6A 1XNDA 2GZWA 4GH4C 4BH9A 3BPSA 3C8XA 1SACA 4RR3A 3LD8A 5EJZB 1W8FA 4NWVA 3ATGA 5F39A 5BYNA 3HN1A 3AKQA 3UT0A 1W6NA 2R1DA 2A7AA 4XQ4A 2BWAA 1WMFA 1W9TA 2FDJA 3ZSLA 1OVSA 2W1QA 1GP5A 3MW4A 4Y22A 1T6GC 1RXGA 3LB9A 5CFCB 1LESA 1O3QA 4H14A 3H50A 3RYKA 4I02A 4AQ6A 1VBD2 4XPVA 5B2GB 4C91A 3FLPA 3AYEA 4UWDA 3POSA 1EYBA 2YYOA 4GAZA 4BPZA 1UOJA 4Y5TA 3T30A 2OS2A 3RZGA 3ZN5A 2A3XA 1O7FA 3WQ7A 5FYSA 5JIAA 5T50A 3HJRA 5F1RA 1W9YA 2W47A 3N9MA 5FY9A 2HWF1 2WO2A 5CZKA 3V0BB 1H6XA 4KWKA 3LKJA 4ZHNA 3QH7A 4CEWA 3W5MA 3EQEA 2BJSA 1HB3A 3CJIA 1NT0A 3P6BA 3ACGA 2NZ9A 5IAVA 1YQCA 3OBTA 4C1WA 1JOPA 4CCEA 2X10A 2VVEA 4WVMB 4NHXA 4ISQA 4CP1A 1C8M3 2FQPA 1PK6A 5LBBA 1DZRA 4BCUA 2VG9A 2OVUA 5FJKA 3UGHA 1AR82 3SCHA 2VOXA 4LBMA 5IWFA 2QQKA 1VBB3 4G4FA 4GB32 5E88A 4YVSA 4LT5A 2OX0A 2K2SA 2PHTA 1R64A 1Q56A 5ERLA 1YUDA 4WM8B 2HWD1 3VHNA 1OMIA 5JR7B 2EF6A 2Y26A 5T52A 1S2BA 4ZU5A 1UYPA 3WG3A 2E6VA 4IUGA 5FZOB 2DCYA 2J1EA 5SV5A 1K42A 5C8CC 3WXPA 5IW0A 4AEDA 1QH7A 2FD8A 4UFLA 1REFA 3VBOA 5B4NA 4FPYA 2VE1A 4BQ4A 4O9GA 1YFUA 3E5QA 3WEZA 1ZZ6A 2DFBA 1MPXA 3M3QA 4AI9A 4MO3M 1V6MA 1QJFA 3TBDA 5L9VA 3CQOA 1N3PA 1V6LA 2XJRA 4UAPA 5L73A 2VZQA 4XYXA 3ZKYA 4N43A 4FT8A 3ZFFA 3VKFC 1PVC3 4Y20A 5FMDA 2MEV3 1HRV1 2V5YA 3DYPA 1EV11 1AR91 1POV1 2X53S 3N7MA 4META 2YPJA 4E8DA 5A33B 3HT2A 1LOFA 3OGGA 5FYMA 1W28A 2R071 2NLRA 4XEZA 3MPPG 3OGRA 1SFYA 1LGBA 3K75B 3IIAA 2VGDA 5IVJA 4QQOA 2JDMA 3K48A 3OPZA 3AMMA 5JMCA 3AZXA 4XCBA 4JV4A 2HLEA 2W08A 4QX5A 1WW4A 4GJZA 5DAVA 4KU8A 3NSTA 1QJY1 2OW4A 4LUKA 4QXCA 5LRSA 4AHWA 3R4DB 4ZPIA 3AKPA 2Z69A 3NJYA 1UX7A 1YIFA 4P9LA 5BV6A 2XHKA 1IPJA 4JDOA 4E4HA 3ZN6A 1B35B 1OHFA 1CN1A 1UMIA 5FPZA 2Z2SB 3CNAA 3VBRB 5T5PA 5CFCC 4CPBD 4IEQA 4KG0A 1RTVA 3M2MA 1Q8OA 3SCGA 4BISA 1QOOA 2ZBJA 1LGNA 5HBAA 3ZX7A 3S5QA 1GMMA 1C8M2 3EJKA 3PTRB 4B4PA 1W3VA 1CX4A 3ELNA 1ULEA 4IEWA 1EUTA 5A7PA 1VAVA 1ULDA 2KR2A 1HX6A 2R16A 2W95A 1FNYA 1VBB2 2B46X 3JU9A 2CDOA 3NWKA 1NCRA 1VBC1 3AMNA 4M01A 2ZGRA 1QNYA 1V6IA 1PGW1 5L9BA 5TSWA 2WO7A 1G9FA 3L2YA 4I2OA 4QPGB 5AC92 1A6CA 5CU1A 2HWC3 4CXXA 1CJPA 1ZBA1 2CHHA 1YJKA 1GNYA 3MPBA 2HEYF 4QWNA 3T4VA 4JC1A 3G6JB 4OQ8A 4PQQA 4ARYA 2AEZA 1CJDA 5C8WA 3VKLA 1VRH1 5EWSA 2NYYA 1NOVA 2ZGOA 3NJXA 4Y1VA 1GYKA 4HKWA 5D1IA 1TME1 1ZZCA 4WM8C 4H55A 2RS53 4XTMA 4ES9A 4B1MA 4M3CB 1S0DA 4NRMA 3WD5A 1OI6A 4Y26A 4K40A 4LR4A 3EBRA 2YROA 1PIV3 1JN2P 4QDQA 1PVC2 2RS31 2MEV2 5KXDA 5FMBA 2DVFA 1UU4A 1PMJX 4XVHA 5IFPA 1COV1 2Y33A 2PYTA 1CQ9A 2D5HA 1PNGA 2D44A 4HSLA 4ZS3A 1FXZA 4P5YA 1XQNA 4NRPA 4AI0A 3E6CC 2G1MA 5JR2A 4FTBA 2DTYA 2VZOA 3PVNA 3I2KA 4GKYA 4XDQA 4CCKA 4FVVA 4URAA 3CJIB 3HQRA 2X29A 3FUQA 4CDQA 3ZXAC 3KQRA 2GP3A 2QQVA 4Z8BA 3FC0A 2PHUA 3CU7A 1WKYA 2QQJA 2VCMA 4HLTA 4WM7B 4FQ4A 1JUHA 3WQBA 3T0AA 1UU6A 5KHJA 4XABA 5F5IA 3VKOA 3LPGA 5IK8A 3NV2A 4HFSA 2ZEWA 1NYWA 4JAAA 4YVSB 1YI7A 2PMWB 2RMU3 3EB7A 1G9AA 4A3XA 1EUUA 2BBAA 2ARAA 2ZZQA 2D3RA 2BTVC 5GLTA 4EN9B 3HOBA 3HPNA 1DU3D 5H9QA 5T5LA 3UKVA 1VBA3 3C7GA 4FOYA 4IV1A 3WT3A 4ASLA 1YLLA 5FOJB 4A7ZA 3HQUA 2DU1A 3MLJA 4AEDB 5APAA 3G7DA 1UOFA 4F8AA 1WLDA 1F31A 4XHXA 3VBOB 5FWJA 1NA1B 1AYM1 2CTVA 4M0HA 1MS3A 1AJOA 1WW6A 4XFGA 4Z2AA 3O1RA 4Q0VA 2JXAA 1OLRA 1LOBA 2OIIA 4FQZA 3GZAA 1LCLA 3VKNA 1JYTA 2R063 2VZRA 3VBRC 5A6ZA 2XJVA 4C0HA 3H42B 4P14A 2G19A 2XGXA 5BNPA 1AF9A 1SBFA 2C0ZA 4HN1A 4N43B 4OVEA 5T5OA 3ZFFB 1C1FA 1GUIA 4Y20B 3ZYIB 3UJQA 3MICA 3VZMA 3K46A 4O7XA 3NKGA 1ZA7A 4QQHA 2HWC2 3ZFGA 1LU1A 4HONA 5F5QA 1VB2A 1XOYA 4YW6A 4TYSA 3ZIXA 1BMV2 3I59A 4LBOA 1LODA 4L92A 1V70A 2NP0A 5FPVA 4LIUA 5FP7A 4P5HA 4I3PA 1PM7A 1YWKA 2H0BA 1XC6A 2RS52 3LDRA 5LA9A 5F5AA 1MS8A 5IVYA 2PHFA 2ZOEB 3EXUA 1PIV2 1QXRA 3OUHA 1CAVA 1LU2A 3AP5A 4HPKA 1E57A 5JZGA 3C7HA 1Z78A 1PX4A 3HNBM 3VBUB 3DECA 3I3DA 5EP9A 3VZOA 2PELA 4XJ8A 1V6NA 3ZN6B 2ZKLA 5CISA 5KR7A 4AQSA 3ZYRA 5KC6A 2WA4A 1OLMA 2NN8A 5FLHA 2VULA 3N36A 1AL21 3IAQA 3M4FA 3VHPA 1IS4A 2UURA 2PN5A 5LBCA 5DZGA 3RWKX 4CCCA 3I3MA 4XC9A 1RMU3 1O5UA 4P02B 5KXCA 2YY1A 4JQTA 1IPKA 4GALA 3ZXJA 2Y0OA 2OZ6A 2RS13 4OUEA 2CAVA 3VDCA 2ZEXA 5IK7A 1R093 2LROA 4LBQA 2RDQA 3RJ2X 5FZFA 3FHQA 1NCQC 1PO21 1R083 1NCRB 2RMU2 4H7LA 2IXCA 4MZUA 3KSCA 3ZXLA 1GV9A 1S2EA 2XHNA 2WC2A 1VBA2 1S0GA 3K3NA 4XAEA 4OCTA 4UBHA 1AXYA 2ZGTA 4EQVA 4QKBA 4WM7C 3NW4A 1UPIA 5E6HA 4XACA 3ENRA 4LLOA 1C28A 3M70A 3JQWA 4LO4B 4BM8A 4NIHA 4FOWA 4YVSC 2IZWA 3E5UA 4IE5A 3WG1A 2LUWA 1UOGA 1DQ0A 2RVAA 3ILFA 4XIOA 3ZFEA 5A3LA 2R062 3JD73 4AQTA 1X36A 4QXHA 4FAHA 4BLJA 1QXPA 4AEDC 1DFQA 1GP4A 3AZVA 3C7OA 3POEA 5FUNA 3RSJA 5EQUA 3WP4A 1NA1C 2QTWB 1U0AA 4U36A 3DYMA 4KG8A 2YG0A 4HG6B 4PQ9A 2OPWA 3A4UA 3PJQA 4UOJA 1ZRIA 2FBEA 4N7UA 3B69A 5SV8A 5LBEA 1WA4A 3ZLIA 5C3RA 3MLKA 3OBAA 2RM21 3V64A 4CDQB 1WCKA 3PJYA 3BU7A 2SLIA 3ZYHA 1HN1A 5E16A 1V9U1 1HJFA 5HV0A 1IS3A 5FY5A 3T1MA 2D6PA 4QHZA 3WSOA 1UYZA 1Q43A 2PAMA 1QDCA 3LAGA 3TNPB 4CDXA 2XDVA 2EXHA 5EYYA 4HVQA 1S0BA 1QJU1 4IQPA 2WFPA 3FLTA 4CCJA 1STMA 4LA3A 1HN0A 1JUIA 3QBQA 1PO13 2C6SA 4BIOA 4AEMA 2VQUA 1HQLA 3M3OA 1VBE3 1IQDC 1BK0A 1RUC3 4GMP3 2OUHA 2WSVA 5FZ4A 3VBUC 2RS12 1AR71 4IE6A 3IZOA 1QOTA 4XCAA 4FTEA 2ZAAA 2HWD2 3NNJA 1K12A 1PMHX 1YNAA 3PNAA 4O9EA 5HCHA 1AVBA 4B7KA 1R082 4HXCA 4D6SA 3O1PA 5BNPB 5FBZA 1AX0A 5CKNA 2A6ZA 4EJRA 2PA7A 2XXZA 4OULA 4XUOA 1W2NA 4Q8LA 3VLBB 1T2XA 4J1WA 1SDDB 3ZFGB 5FZIA 4NIDA 2WA3A 5FDBA 5D8AB 5HXVA 3ZDVA 1N3QA 5IATA 3H8XA 1FOD1 2JB8A 3NJZA 2ES3A 2ZAHA 4AZZA 3UGFA 4CP9B 1NCRC 2WQ4A 2Z42A 4YW1A 2R1BA 2PHXA 4Q26A 3U11A 4CCNA 3I2HA 1R1A1 4LTAA 3JD72 4KU7A 2UY9A 5FJHA 1ZRCA 3HEIA 4XFFA 4YFZA 1K5MA 3HIFA 4AAXA 1GOHA 1QIQA 3O7OA 4HPKB 3QOPA 4KWLA 5FYIA 5CYYA 3PL0A 3ZXDA 1G7YA 3FHAA 5EV7A 4IEYA 2XQRA 2WIIB 4OHWA 2BFUL 3AJZA 3AL5A 2PQSA 2VZVA 3KV9A 4R4XA 1F4AA 1W6QB 3FWEA 4ZU4A 4N90A 2DF7A 1D0HA 1TNFA 3OPWA 4FPFA 4XMIA 2Y6LA 4BWOA 4DZGA 3INAA 1BK1A 2JWPA 1P8JA 4AVVA 1RUI1 4TN7A 3ME2A 1RVF1 3V0AB 1OOPC 3RS6A 2DYCA 2ET1A 5C8CA 1PMIA 1OF4A 1C57A 2NMOA 4GKXA 2BOIA 5A7WA 2GALA 4LBQB 5FYCA 1C5IA 3ZYBA 4DMIA 3KV5A 5EJ1B 3IDAA 2DBIA 2R32A 4OUSA 4KI5M 4CDQC 4CCDA 2GC0A 2QQNA 2RV9A 1M4WA 1PO12 2B8MA 1PHMA 2FDIA 1AYM3 5KHKA 4W8JA 1VBE2 2GNTA 4N8MA 3IPVB 2EAKA 2VBBA 1H9PA 5DAQA 2A73B 3AB0A 4DQAA 2DWRA 3K4ZA 4ISRA 1YFYA 3TWIA 4LJHA 1W8HA 3BKZA 1W8TA 1Z0HA 1RGSA 4HETA 3POIA 3ZFEB 1W2TA 1XXNA 4QX3A 1PGW2 4DXSA 1N1SA 5A70A 5EYXA 1G9CA 4PI2A 1AR63 1H1MA 4YSFA 1GU3A 1NE4A 1O4YA 3ZVXA 1RJ8A 5C3SA 1RUJ1 3WQ0A 4XJ9A 4XJAA 3MV01 2VJXA 3J26N 5GM0A 4YFWA 1OQ1A 2R043 2IFRA 1XNBA 1JI6A 1QKQA 4IERA 4UFMA 5E89A 4NAOA 2Y6GA 4XJUA 5ISLA 2L9LA 4YZ1A 3AZZA 2XBO1 1ZVFA 4GIQA 5J7MA 1NXMA 4PLNA 2OXBA 3D4KA 4YVWB 4DFSA 2VMEA 5IAXA 1OVPA 4ASMB 3RI9A 4ARXA 4XF9A 5DABA 2VZTA 4QQ2A 4JX0A 5DDJ1 3PMSA 5FYBA 5LA2A 4LITA 2TBVA 3FN9A 1NY71 1W8WA 2KXLA 5CFCA 1IKQA 2DVAA 5T54A 2VOKA 4DOUA 3LFIA 5FZBA 4COUA 1RC6A 2WINB 3ZM8A 4MGIE 2DU0A 2VCAA 2WLPA 4M4RA 2D6OX 1ZX5A 5D8AC 4AYUA 1XSQA 4JQRA 4CDXB 1MEC1 4LBKA 2WBKA 2VUAA 4MX3A 2GDFA 1TG7A 2P34A 2YU1A 3D6EA 3UJOA 1HRI3 2XL7A 1QQP1 2YUEA 5HXMA 3V0BA 1HXS3 2XH6A 4NPLA 5CBLA 3LSEA 4QPWA 3NMBA 5L36A 5FY0A 3X29B 3AKTA 3SEEA 1Y43B 1WLTA 1UZVA 4R8HA 1JZ8A 4LK7A 2I74A 3PUQA 4FTSA 1A8DA 2E53A 3GM8A 5FZEA 3WF1A 4CUGA 2Y0IA 1Z7S3 2AYHA 3WQ1A 5FZ0A 5FYYA 2RDNA 1GZ9A 2MPFA 3VL9A 5HCFA 2VH9A 3GCXA 1AZDA 4FBFA 2IXHA 4WM8A 5G04L 3ACIA 4YM3A 1FAYA 1L7LA 2XMLA 4AVTA 5ACA3 2HWB3 5GLZA 4MGSA 1AYM2 1IS6A 3I8TA 3PU3A 1DP0A 4A7YA 1AXZA 2GC2A 4BLIA 4YGBA 3M7AA 5AFBA 1UO9A 4OYUA 5FLJA 4R9CA 3VHRA 4FPGA 5FZ6A 3BODA 3VDDB 4CUCA 3AP7A 3HMYA 4MH0E 4WV8A 1QJZA 1UX6A 1YIPA 1S0EA 2E26A 2VMDA 3PDQA 1AR62 1K5MB 1ACCA 4HT1T 5A7NA 2FMYA 1CIYA 4UW3A 4RA0A 4PF5A 4M4PA 2PHRA 5LASA 2R042 1BHGA 2VY0A 5A3MA 4LA2A 4GXLA 5JPMB 4I0AA 3S0MA 5A33A 1CAWB 2DVDA 5FREA 3I97A 3I2FA 4CCMA 1E5HA 2A6VA 2ZMLA 1ENXA 2GNDA 3ZFEC 2QQPA 1BXHA 1K5JA 4E9KA 3E1F1 3TB0A 3ZR6A 2IC1A 5JSRA 4E4ZA 2ZHKA 5FZLA 5CNAA 4C1XA 1N47A 1LRHA 2BW8A 4AAPA 4GD4A 5IYYA 2DVBA 2JG9B 4W6YA 2P37A 1XU1A 2ZABA 1DBNA 1D4VB 1JBCA 2FCUA 4UW4A 1S1AA 1JZ2A 3D82A 4MXWB 3BTZA 2VW1A 1AR83 1WCSA 2WYFA 3PHMA 1D2QA 2VAUA 5HI0A 4YVWC 4MXVA 3HT1A 3RRDA 1RYYA 2Q1FA 5FIXA 3MW2A 1GZCA 1F9KA 4D7SA 3POJA 1HRI2 3VBRA 3PLQA 4FFIA 5DQ0A 1HXS2 1X7NA 2HBTA 4QB2A 1QY4A 2JENA 3VZKA 4O65A 1NZCA 5CKQA 3P1IA 2UYAA 4K20A 5H9PA 1UZYA 5FV3A 1IHMA 5DUXA 2VECA 1V6KA 4D0QA 3OGSA 2YGLA 4FXKB 4IDZA 1UL9A 4P9XA 5BXXA 2JE7A 5J1XA 4XW3A 1Z7S2 2W92A 4NVPA 3LZZA 2ZXQA 5DZFA 3J7HA 1W04A 4FPLA 4URTA 4EZHA 1C4RA 1SLCA 4E4DX 4Y24A 1ZNPA 2QFEA 2V72A 3GHMA 3B02A 4GMP0 3HQXA 4L99A 5ACA2 1DGRA 4DS0A 1HB4A 5C3OA 1OKOA 1WW7A 4NPMA 2VMIA 2JE8A 4G3YC 1MZ6A 3MFCA 3WOGA 5JSOA 1WW5A 2VZ1A 1D2SA 2A6WA 2JICA 4FOQA 3AYAA 2BNOA 2HJIA 1US2A 4PBOA 2A6YA 2XPJA 2BGCA 1WGPA 4M3CA 4UF0B 4IE0A 2WZ8A 3NV3A 1DCSA 1UF2C 4QB6A 1UZZA 3ZDSA 5A6YA 3OCPA 1MR5A 4QKNA 3VDAA 3OEBA 5DG1A 4Q4W1 2VZSA 2DV9A 2ZEZA 3VDDC 1WWYA 2PAKA 4NJ4A 1ODNA 5FXVA 4LK6A 1RUE1 4YW5A 4NAMA 5KHHA 3NO8A 2J1SA 1NCQA 3MIHA 1RVF3 1K5MC 4DY5A 2QE3A 3BYWA 1JZ5A 1ENSA 4L8QA 4N7IA 4BIFA 1O4ZA 4Q4Y1 3UK9A 1G6NA 1J3RA 3ZXEA 2VMHA 1Q8SA 1UQXA 3FBYA 4LXLA 1LEMA 2VQ0A 4WM7A 1NAEA 1UU5A 1KDMA 4W50A 3GZTB 3NKTA 4LIVA 4YWAA 4RHV1 2BYVE 4XHBA 5IVVA 1H1IA 4JGYC 1BBT1 1KEXA 4E8CA 1Y9MA 2GMPA 3K2OA 5F3IA 2JG9C 3LPFA 3R4UA 1IZ3A 3O0VA 3FZ3A 5AC93 4A6OA 1FMD1 3JB8A 1ZZ8A 1WUVA 5JWPA 4TZDA 5A3OA 4Y4RA 1GANA 3J8F3 1N1TA 1NA1A 3EHKA 2AREA 3R6SA 5GALA 2D97A 3KVAA 5EJ3A 5LW9A 2VMGA 3NL1A 3HD8B 3KHBA 3PUAA 2AZ5A 1MS9A 3GYDA 5FXWA 5GJ6A 1PZ7A 1U5ZA 4E27A 5KBFA 1D4M3 3MIBA 2RDRA 3FHIB 3N7KA 3ZMOA 3M3IA 3T4HB 4XQWA 3DXTA 5GLWA 2ZX2A 4CDUC 4NMIA 1OUSA 1SLAA 5DDJ3 5F3CA 1JZ6A 4MV2A 4EWEA 2KD7A 5FP4A 3PUHA 4DRRA 1L7RA 1OA3A 1UOBA 2F6BA 3E97A 1CIWA 3NRUA 5A1FA 2LM3A 3NV4A 4PDWB 1X33A 1VPHA 3KF5A 3NNMA 4XBQA 4PF1A 4FP2A 1UD1A 2XJSA 4XFHA 4BHPA 3ECQA 3U4XA 1RUH1 4QGMA 1ASJ1 4WVVA 2ZS6B 3PUIA 4XETA 5DZEA 3VN4A 1ZBE3 2QQWA 4ASKA 4QGNA 1G9BA 1AXKA 3VBUA 3RPQA 2AGSA 2GH8A 3H7JA 3SC7X 3UV9A 2D6NA 2P3KA 4IEVA 1HB2A 5C9AB 3KV4A 5EHDA 4B8EA 2WQ8A 1U5XA 4OHVA 4ORFA 1RVF2 2JX9A 2VZUA 3HNYM 4XBLA 1S0FA 4DXZA 3OY8A 4W6WA 5DXDA 3HAGA 4IEZA 4KBBA 2FHRA 2CGNA 4YG0A 3OUJA 1F5FA 5FZAA 1CD3G 1KJLA 2R7EB 3KMHA 4UW6A 4A4AA 4YNIA 3J7NA 4P9YA 3WW3A 2PAEA 4A44A 4XUPA 4CCLA 3K51A 3L9JT 4RGGA 4AW7A 4FFHA 2DBNA 3CKHA 3FFQA 3H3ZA 4IE7A 5DPNA 1DG6A 2Y6JA 3ZOIA 5I0SA 1QU0A 3ON7A 4F83A 4Q8KA 3MUY1 1O3RA 1AYN3 5FMOS 4QM9A 4PCRA 3CIHA 2CWSA 3R0RA 2CV6A 2PTMA 4EN8B 3KV6A 2LTNA 2WDBA 3WNNA 4A7KA 2G9GA 5CA6A 1RUF1 2ZGPA 2Y64A 3PVBB 4IL7A 5AVPA 1EPWA 2OZJA 2ZGSA 2DURA 3DCQA 3J8F2 3USUB 5F37A 1MS5A 4NE9A 2YMZA 2EXIA 4QB1A 1EAH1 5FYVA 4XILA 2P5BA 4BXSV 1OBNA 1RUJ2 2Q1ZB 2IVIB 4RS5C 4JKMA 1JZ7A 1MQTB 1V6JA 1W9FA 2O1QA 3H9AA 4Q0PA 1ZM1A 1VMFA 5GZFA 2QQUA 4YRDA 2Q8OA 1Q3EA 2FCVA 2VBDA 2WZR1 1GFF2 4CUAA 2AC1A 5A3TA 1D4M2 4V2WA 1OH3A 1J1TA 5BPXA 1GICA 1YQ6A 1RUD1 5C4WC 3MZHA 1OOPA 2UWAA 1YQ5A 2WS93 3N3HA 2H6BA 5LB6A 4JRAA 3RVHA 2FDFA 4OZOA 1FPN1 1HLCA 5DDJ2 4V2VA 1Y4WA 4IEXA 4AI1A 4J25A 4AVCA 3LDKA 4WZFA 1NY72 3PIJA 5K9YA 1NCQB 1S0CA 1QMJA 1YC61 2WABA 3B7MA 4NHMA 2BV4A 5B4XA 1WA6X 1BZWA 3TRSB 2RE9A 1LOEA 3A0KA 3GDBA 4JDNA 4EYUA 5H9RA 2GN3A 1URXA 2W46A 3LIHA 4QD2A 4MUVA 4FCAA 4L0PA 1RUG1 4Q4V1 4YM0A 1S2KA 1BKZA 4CPBA 4RL7A 1DGRN 1DYKA 1WMEA 5HV4A 3DN7A 1QHDA 1RHI1 4A2UA 1ZBE2 4XJWA 4CSWA 1H2MA 3F2ZA 1W9WA 3T0BA 1HDKA 1TQ5A 5D2AA 4HKOA 2JDNA 3NAPC 3Q9OA 4EE2A 2WNVB 2ORZA 2OQ6A 4WZCA 1HW5A 1SG3A 4PDWC 1VR3A 3TN93 2O8OA 4BXFA 1Y9QA 5DAPA 4A41A 2PHWA 3OGJA 5H9SA 3WNXA 3KHCA 4QU1A 1PZ8A 1RB8G 1GWKA 2YHJA 4QT6A 1VRBA 3O1OA 1DLLA 1QGLA 4SLIA 2VNVA 2V73A 1KS4A 4IEUA 1MVEA 5JXIA 4U2AA 3OUIA 5C9AC 3IKWA 1NXD1 4J1XA 4ATFA 4D3WA 4F3JA 5HPOA 3TAYA 5CAZA 1ZRFA 2OT7A 1LULA 4YGCA 5D21A 5FY4A 2BBVA 4E4SA 4MADA 1AYN2 1GQPA 4CE8A 2DTWA 3KM5A 3ZSJA 2B9VA 1KD7A 1E5RA 3POGA 3WCRA 3JBG1 4ZU7A 3FLRA 2HWE1 5IFTA 3GBGA 1WZXA 5L7OB 3VBFC 5D8AA 1KITA 4LMFA 3WUDA 2BGOA 1MACA 2E33A 2AUYA 1UXZA 4UXAA 4CP9A 1UCXA 1REEA 4AFMA 2JDPA 1RJ7A 5FZ8A 3K3OA 3DEMA 2VTFA 3J7LA 4I09A 1GKBA 1XNCA 2ENRA 5FPAA 4OUMA 4QPYA 3SKVA 2XJPA 2YC0A 1H8TB 3BCWA 2D6KA 4JKKA 1RUE3 2PHDA 2HWF3 1OURA 5I8TA 1OLME 2E7TA 3MLLA 4Q2FA 2WS92 1MS4A 5FP9A 4AHYA 2PLV1 2MHFA 3BU0A 3RZKA 1F8VA 4XFBA 1GNZA 1BEV1 5A3WA 4AVAA 1W6PB 1MQTC 2F4LA 1I9RA 2O0OA 1W6QA 4K3UA 3S6PA 3OY8B 2XKOA 4XXPA 5JSPA 2G4IA 4CCOA 5C33A 4S2FA 5IUQA 5FCCA 3V0AA 3Q8BA 4AI2A 4EROA 1N3OA 2X8KA 2E51A 1A8MA 2WAOA 4MGZE 4D7YA 3U07A 2HWD3 4LNVA 4LORA 3UETA 1UXXX 2W39A 2YFZA 2RJLA 2XG3A 4QKFA 5GZGA 5LZ6A 4ZONA 2ZKNA 1Y3TA 1KDKA 2A6XA 5FY8A 5JOZA 2ZZJA 3TN92 1HIXA 2WFF1 3A7QA 4YZ3A 5K0UB 1QNWA 3LEGA 5IVCA 3D0JA 1REDA 2B7YA 1BJQA 1DGLA 1F4HA 2FMDA 2IXKA 3AXDA 3IPVA 2C9KA 3VBSB 3WDYA 2VOVA 4NWWA 2P6HA 5FP8A 3ES1A 3WNLA 2XQXA 1OQDA
chains in the Genus database with same CATH topology
1MZ5A 1RITA 3E5XA 3D0SA 4DRVA 2ZX3A 3KGZA 3LOBA 2JG8B 2WNVC 1YFWA 4BA6A 1CAUA 2R30A 3WP3A 1HRV3 4OI0A 1EV13 1AR93 1POV3 1I5ZA 3M1HA 1RUOA 3O5SA 4LE3A 4LO6B 2AENA 2PQQA 2I45A 2R073 1OOPB 5CVRA 1C5HA 2TEPA 3PVOA 4K7JA 2Q5TA 3GBFA 1AHSA 4Q4X1 3FX3A 4YVWA 1LJ7A 4BOWA 5J48A 1LHOA 3KLSA 2C5DA 2XJUA 3IT8A 1QJY3 3HBZA 5I91A 3KT7A 3B00A 4MGKE 3BB6A 1H8VA 2NPIA 4Z07A 2IWGB 1BYHA 4QPIB 5L7OC 4AEJA 2P3JA 1RUE2 2HWF2 3WG4A 1YYNA 1QOSA 3DGTA 1WBFA 2ZGLA 4FXGB 4S2HA 5J98B 1LOGA 2O8QA 4NHLA 4TSVA 3AP6A 5T55A 3AP4A 1LOCA 1AUYA 3ZN4A 2NMNA 2YZ4A 1NG0A 1SLTA 1YJLA 1H8TC 3TNQA 1APNA 3SH4A 2WZPP 1H1AA 1SQ4A 2GU9A 2DUOA 3B94A 1VBC3 2D93A 3SCFA 5BNQA 3B9IA 5DUUA 2OA2A 3WUCA 2TUNA 4MGYE 1ZBA3 4XF0A 1WD3A 1AJKA 3FE5A 1J59A 5CG8A 4GB31 4K6BA 1SBDA 4XE9A 1VRH3 2WWSA 4LUMA 4DPNA 2WKKA 4RQPB 1W6OB 4N9HA 1TME3 3SH5A 3VZLA 3ILRA 2HEVF 2JE9A 3NV1A 2HYKA 3U10A 4MYEA 4LEJA 1O3TA 1W2UA 1WLCA 3VDDA 1RL3A 2H6CA 5KC5A 4KGQA 3GNEA 4LHNA 4QXKA 2XVKA 2RS33 1MS0A 4XOGA 1G9DA 5K0UC 1HRV2 3I54A 2EALA 1EV12 1AR92 4QQLA 3RQ0A 2XB6C 1COV3 2BVBA 3VBSC 3WHUA 4RGAA 2VVDA 3N4MA 4QHBA 1IKPA 2R072 4AGVA 4ZKTB 3ST7A 1OD5A 3HWJA 1CAWA 3B01A 3DV8A 3ETQA 4HK9A 4YM1A 2JG8C 4PIXA 4MLOA 2CL2A 4JGYA 1CPMA 2EVXA 1QJY2 4DY3A 1RUH2 2JG9A 2UY8A 1RHI3 4OHYA 2WT0A 4FPEA 3MGUA 3OF1A 5I8SA 1PZ9A 2EAAA 1JYIA 3BOWA 1C8NA 4MXWA 1DYPA 4L97A 2XL9A 3MF6A 1EPZA 3P3NA 1CONA 3IBMA 5FO7B 4FAGA 4AVBA 1PGL1 2PFWA 3DKWA 4QPIC 2ZGMA 4G9SB 1F2NA 2D6MA 4HL0A 4COVA 3MFAA 4PLOA 4CDUA 3B3QE 1VBC2 4N53C 2BNMA 3WDTA 1C8M1 3RJRA 1OKQA 3ZSEA 1MZFA 1CAUB 4YZ2A 4R52A 3FMGA 1ZBA2 1QWRA 3GZUC 2P2KA 3CLPA 1C1LA 1VBB1 2KA3A 3VBHB 5BNOC 2VOWA 1VB4A 3RNSA 1VRH2 1X8EA 2BNNA 1EAH2 1FX5A 3GBWA 3CEWA 1TME2 4XJZA 3SXWA 4CDWC 3AYCA 3OTFA 4RD7A 4AFCA 4ONUA 1YO8A 4Y1XA 1OA2A 4CTEA 2GN7A 4H3WA 2GH2A 1O4TA 4RSUA 2RS32 4B3NA 1LEDA 3ZXGA 1PGSA 1SCRA 3AYDA 5E8AA 4RQPC 1COV2 4COWA 4D94A 1CAXB 1IOAA 2VNOA 1AL23 2XUMA 1UN1A 4XFAA 1FI2A 2ZGNA 1PVC1 2DCZA 3QH6A 5JOXA 2MEV1 1SLLA 4JTOA 4KH9A 1H9WA 4YG3A 2DCKA 4Q0UA 2RR11 2WT1A 2OUJA 1RHI2 1MS1A 2E63A 1AX1A 2I07B 3WP5A 3B9CA 4BMBA 1PO23 1ULGA 4MSVA 4Y1ZA 1H2LA 2RHPA 2UWCA 5FFOC 3H1MA 2XKPA 3VGIA 2R49A 4RS5A 1W0OA 2HEWF 3RYPA 3H7YA 4TWTA 1W6MA 3P3PA 3JUUA 3O12A 5FQ0B 2A75A 3SH3A 5C4WA 1H4HA 1PVXA 1SLBA 3AMHA 1UIKA 5CADA 3J4UH 4QU2A 1OFNA 1O5LA 5I8YA 4COZA 4K9SA 1ND3C 1VP6A 3H8UA 2B9UA 3N7JA 1QF3A 3WX5A 2QKDA 1KJRA 2AH2A 4F7ZA 5FO9B 4HSJA 3KB5A 5J3UA 4FPJA 2IXIA 4Q4X3 1EY2A 1OFSA 2RM23 2EA7A 2HWC1 3RDIA 3T1LA 2E7QA 1V9U3 4JGYB 1OQEA 2QDNA 2VPVA 3THPA 4XXAA 1POV0 3NAPA 3ZSMA 2FZ2A 1BMV1 2ATFA 5HCBA 4PDWA 3VBHC 1Q8QA 3LWCA 2XJQA 3V65A 2G9FA 4XF3A 4P9WA 2RS51 1BEV2 3WR0A 3WW2A 1UIJA 1QJU3 1O91A 4FPOB 1AL22 1PIV1 4OHZA 4Q29A 4C90A 1A3KA 3AFKA 1OA4A 2XLAA 4S2GA 2VUJA 3NVCA 5C9AA 1LECA 5FO8B 2BFUS 3OYWB 4TLFA 5CG9A 2EXJA 1AR73 3WDXA 1OSGA 5BY5A 3SNMA 1UPSA 2I2SA 4AGRA 2WLQA 2XVGA 5FTTC 1PO22 1C3HA 1TMF1 3IM0A 3R4SA 4P9IA 3E6DA 3WW4A 4CDUB 3KCYA 3VBFA 1VALA 5AVAA 5FMOL 1WCDJ 3OD0A 1ZZBA 1CR7A 1U5YA 3S30A 2D6LX 2H0VA 5I0RA 2A70A 1FOD3 1WBLA 4Z2WA 3MYXA 1J3PA 4YM2A 5JIUA 2K9ZA 3LA7A 4HZFA 1VBA1 1KXGA 3USUA 1R1A3 3C3VA 2GC3A 5IK5A 4M3CE 3D5OA 3M8LA 1KRIA 3PTYA 4PIZA 3POYA 2VU9A 1XYOA 1MQTA 3WV6A 3AX4A 4IV3B 4EN6B 3ILNA 3VZJA 1RUNA 2R061 4GULA 3SISA 3B93A 5FPXA 1JOJA 4Q1PA 4Q4X2 5J96B 3KS7A 1GNHA 3O14A 2RM22 1BVVA 1KFUL 3VHOA 4X6RB 1CPNA 1RUI3 4B7EA 1V9U2 3AMQA 3B5LB 2CWMA 3DPRB 4Z82A 5GKAC 3SLIA 2UYBA 3ALQA 2ZCWA 4I0WB 3KGLA 2WNUB 4QQPA 5JLVA 4X8PA 3ZXKA 2JKBA 3T2TA 1YHFA 4D69A 1LHWA 2Q30A 3L2HA 1QJU2 4R9AA 2IFWA 2Q4SA 1DQ4A 3ROUA 3APBA 5K7PA 4RS5B 2WNVA 4GA9A 4JRLA 3IDEA 4IETA 4Q0QA 4Z92B 3MDPA 4BZ4A 1W6MB 1AR72 3AJYA 1AL0G 2HKXA 3W59A 1VJ2A 3FBMA 5C4WB 4B4RA 2VNRA 1RMU1 4FP3A 1X82A 1RUJ3 1ENQA 1A78A 1BCXA 2RS11 3RG0A 3BALA 3R05A 1UKRA 1Y7BA 1R091 1ALYA 4PIYA 4HVRA 2ZX4A 3I7DA 2C1FA 2WQZC 2XBO3 1R081 3BIWE 1FOD2 3AKRA 1X8MA 1HQNA 1ND2B 5L7OA 1SDWA 1R1A2 4DNYA 4AFBA 5CFDC 3UKNA 5J09A 3QCWA 1SLIA 3NAPB 5ABJC 2W0XA 5J37A 2B45X 2CAUA 1MEC3 1H8TA 3AP9A 2QZ2A 5JVVA 2A71A 3JD71 2CNAA 2UWBA 3IMNA 4BMEA 1QQP3 4YLZA 4P9GA 1IS5A 1DQ1A 3DUIA 4CEYB 1XYNA 1YCIA 2DVGA 1W6PA 2RR13 2JD4A 1RUI2 3VL8A 4IV3C 2X5IB 3MIGA 5BNNB 4BE3A 3MIDA 2ERFA 3BOPA 1GQGA 1VIWB 2AR6A 4OI1A 4AVSA 4K1ZA 3MIEA 4MVTA 1YI9A 3MF9A 3I2DA 3VBFB 2KM2A 3WLUA 2D3PA 4XZPA 3WCSA 4JGZA 1FATA 1DQ5A 3DPRC 1PGL2 4KNCA 2D43A 2VVFA 5K0UA 3ZIWA 4AXOA 2WNUC 2P3IA 5KXEA 4ES8A 3VBSA 4GWMA 4JTNA 3WW1A 3S7EA 1PO11 3GHNA 4COYA 3AZYA 1WMDA 1VBE1 1DDLA 1RUC1 2Q0AA 3ASIA 3QACA 4GMP1 2JG8A 5GLVA 1NLSA 4E2SA 3AXEA 3LSDA 4NPRA 5E1RA 1VAMA 3H1WA 1N1VA 4AI8A 3IDBB 1IQAA 4LBLA 3IDCB 2XBO2 1HV1A 3AKSA 1ZA4A 2N7GA 4PJYA 1BQPA 5A32A 4RR3B 4YGEA 5JAXA 2QCSB 1Q8PA 5JOWA 4HN0A 5L19A 1GZWA 1SBEA 1W6NB 3SMHA 3GALA 3AMPA 4XFCA 4JDMA 4Y22B 2D98A 1W39A 2ZX0A 5FRAA 2ZMNA 3BPZA 5J36A 4QGLA 1MEC2 1WLWA 3MI8A 2BPA2 1DZTA 1LENA 1MVQA 1ND2C 3MIFA 5F6KA 3FUOA 4QPIA 4AF9A 1MZEA 4OI2A 4LHKA 3GF6A 1N1YA 4R9DA 1G9BA 2C9AA 1QQP2 2YV8A 2VNGA 1FYUA 4N53A 4XMAA 1DHKB 5JI9A 4CP0A 2RR12 4C0BA 4CEWB 2YGMA 1TMF3 1DGWX 2BEOA 2Z79A 4M3CF 5BNOA 3KCXA 1PK6B 2YXSA 4Q27A 4CEYC 4XF4A 2BVVA 4CDWA 2X5IC 5BNNC 4YZ4A 3ZXFA 5AFEA 1J58A 5JOYA 3E6BA 3FJSA 4E2GA 3EO6A 1CGPA 4LBQD 2VXRA 1YRZA 4LO5B 1H2NA 3JQXA 4RQPA 1W6OA 4PLMA 4EN7B 2XJTA 4XFIA 5EXOA 4AFAA 1NLRA 2E7AA 1B35C 2WJSA 3H1YA 4I3GA 1ONAA 2A3YA 1DQ2A 1XRUA 2OYZA 1JH5A 1NE6A 4EWAA 3KD4A 4GWNA 3SITA 1JYCA 4YG6A 1O3SA 4Q4W3 4NN0A 1KS5A 5KWRA 4OI4A 4E2QA 2WL1A 1AR61 2ETEA 2VW2A 2ZPXA 1GLHA 1L3JA 4V1PA 2R041 4HK8A 3H3UA 4Q4Y3 1OLQA 2GMEA 4X6QB 4QPGC 1F5JA 1TEIA 4RHV3 3ZPYA 1BBT3 3CF6E 1ENRA 1DZQA 2A5ZA 4RR3C 4AEKA 4AHZA 3MEPA 1M06G 1HQWA 1JW6A 2D40A 1YXWA 2CGOA 1B09A 4JGZB 5FAXA 2CY6A 1OPOA 1FMD3 2ET7A 3FFZA 3VZNA 1WD4A 5GZEA 4FO9A 1SMVA 2ZTNA 4AWDA 1ND3A 2P17A 1TMF2 3VUOA 2FZ1A 1HRI1 2CYFA 2D5FA 4ITCA 1HXS1 4AFDA 3WDUA 2QJVA 4OHXA 2K0GA 1NQJA 2NQYA 4FSJA 2ZGQA 2ARBA 1J3QA 3JB4C 4L11A 3ZYPA 1Z7S1 3HR9A 4CEWC 4X8NA 2ZA9A 3CJIC 2XWJB 2BUKA 2QUOA 4HBNA 3VBHA 3TYJA 3JCIA 5I0TA 1QJX1 1XNKA 4KGGA 1PK6C 2GMMA 1FV2A 5A32B 1ULFA 4YARA 4L2NA 3OBRA 4XIKA 5ACA1 2HWB1 5IK4A 3D8CA 1GZWB 2IXLA 2LALA 1SEFA 5LEJA 2ZHNA 1U5IA 1OPMA 3WZ1A 3IN9A 2Z5WA 1RUH3 2BWCA 1ASJ3 2MNGA 2ZHMA 4HVOA 1CESA 2PHLA 4FPKA 4Q4W2 5C6CA 4K8FA 3ACLA 3O0WA 3THTA 4AHXA 3VBOC 1CAXA 3WDVA 1NQDA 3OJBA 2JEMA 2ILMA 1VBD1 3CJXA 4R9BA 4YGDA 4L9BA 3URFA 4W6XA 5CB7A 4N53B 1ZRRA 1XYPA 2ZGUA 3ES4A 4Q4Y2 1S0IA 1YFXA 1AX2A 3QD6A 1VLNA 5F6LB 4N43C 3UKTA 1LHVA 2B42B 3ZFFC 1TNRA 3V56A 1LB2A 5BNOB 3KZ4C 4XF1A 4RHV2 4B4QA 3RZZA 4XQDA 5K8SA 4I30A 3RMXA 1BBT2 1LOFC 2GAUA 1DQ6A 1H0BA 2ZACA 4CDWB 1KQRA 2ZX1A 3LA3A 2XLGA 4BYYA 1AR81 1FMD2 1RUF3 1UMZA 1XE8A 4IV1B 4RFT0 1UW8A 1RMU2 1H4GA 1SCSA 4SBVA 1I1EA 1EAH3 4DB5A 5FQ0A 4H7MA 1G8WA 4Y4YA 5GZDA 1DGWA 1LHUA 4GH4A 5T3NA 4JGZC 2WZR3 2ARXA 2BQPA 3VV1A 5JI7A 4PBPA 1R092 1ZYBA 3U0ZA 1Q8VA 1RUD3 2Y38A 4M00A 1EP0A 3N35A 4ATEA 1FPN3 2RJKA 4KL1A 4NR1A 1G86A 3M3EA 2JDZA 3WG2A 1I6XA 3I59B 5KXBA 1UAIA 4S2DA 4UBGA 4P9JA 1RUG3 2QNKA 4Q4V3 5DUWA 1R1ZA 4EN0A 1ASJ2 1H30A 4NO4A 2OPKA 2XWBB 1CVNA 4HMZA 1ZZ9A 3ZYGA 4IESA 4W65A 4Z1VA 4Y1UA 4HKLA 1CAVB 2UU8A 5JZGB 1RIRA 3KT4A 4LLFA 1ULCA 3CL1A 5EFUA 4WVWA 1J1LA 5DUVA 3OD4A 2D7FA 2VQAA 4KQ7A 2E9QA 1LHNA 4EV0A 4JVAA 1QDOA 4YW3A 1ND3B 1IGOA 3WVJA 3OYWA 1GBGA 3LGRA 1BVP1 4NHKA 4EWDA 2XLFA 4Y5Z0 4ZXKA 1ZZ7A 3ZO0B 4QMAA 3USSA 1GSLA 4LO8A 1QXJA 1U12A 2DUPA 5CFDA 1D0GA 5JPNB 1JXNA 3JBG3 5ABJA 1RUF2 4I01A 3ZSKA 2HWE3 4WBBA 4AG4A 1V00A 5KHGA 4BQ1A 2EIGA 4OFGA 5JDBA 2V09A 1RUC2 3RI8A 3DL3A 5F9TA 4YZ5A 1ZREA 4IEOA 5AC91 4LULA 2D3SA 4DINB 2WZR2 4FPCA 3WY6A 3LCPA 1GQHA 3J8F1 4B29A 3JZVA 5I93A 2TNFA 4IV1C 1DF0A 4IV3A