3UK9A

Galactose-specific lectin from dolichos lablab
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
253
structure length
249
Chain Sequence
ANLISFTFKKFNETNLILQRDATVSSGKLRITKAAENGVPTAGSLGRAFYSTPIQIWDNTTGTVASWATSFTFNLQAPNAASPADGLAFALVPVGSQPKDKGGFLGLFDSKNYASSNQTVAVEFDTFYNGGWDPTERHIGIDVNSIKSIKTTSWDFANGENAEVLITYDSSTNLLVASLVHPSQKTSFIVSERVDLTSVLPEWVSVGFSATTGLSKGYVETNEVLSWSFASKLSINKNKLAIFNLEGKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Affinity of a galactose-specific legume lectin from Dolichos lablab to adenine revealed by X-ray cystallography.
pubmed doi rcsb
molecule tags Sugar binding protein
molecule keywords Legume lectin
total genus 47
structure length 249
sequence length 253
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2011-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00139 Lectin_legB Legume lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3uk9A00
1FYUA 2P34A 4LBOA 4Q8KA 1G86A 2VW0A 3SITA 2E6VA 2EF6A 1KQRA 1GZ9A 3N7KA 4YW2A 3WV6A 1A3KA 3AXEA 1FATA 1BKZA 2AYHA 1UKGA 5EYXA 4YW4A 1KRIA 1CR7A 1V6NA 3M3EA 1Q8QA 1WUVA 4FP2A 5EYYA 2CWMA 2W08A 1DQ2A 3VKFC 1LOGA 4Y1YA 1G7YA 1MS9A 2DTYA 1AVBA 3AZXA 5CAZA 1LGNA 5IK4A 4XILA 1BZWA 3WG3A 4PF5A 3ZYRA 3RQ0A 1FAYA 2A70A 3T1MA 1V00A 2GN3A 1MZ6A 1IS3A 5EWSA 1D0HA 1QDCA 3USUB 1GSLA 1SCSA 5GLZA 1W6PA 3USUA 5GZDA 2NP0A 2ZHKA 3WG2A 3LSDA 3V0AA 1CESA 1AJKA 4Q1PA 1LESA 4ZXKA 3MW2A 3VKMA 3WZ1A 2OVUA 3RSJA 3HN1A 1LU2A 2A3WA 1SBFA 2GMEA 2VUAA 4Y1XA 5HCFA 5T5JA 3WOGA 4UW6A 2CWSA 1O4ZA 4XIKA 1V6OA 2W52A 1HKDA 4PCRA 3SH3A 2ZACA 2UWBA 3L2YA 4XYXA 1LENA 4BMEA 1W6QA 3FUOA 4AVSA 4GKXA 4YZ4A 1NXD1 3SLIA 4YFWA 1G9DA 1WD4A 1DLLA 1TEIA 2JECA 1BQPA 4LBQA 2SBAA 2VXRA 2ZGSA 1WBFA 2P2KA 3M3CA 1PZ7A 3WHTA 3O5SA 3WG4A 1GZWB 2AREA 4M3CB 4HL0A 1MS5A 4WVVA 5GLTA 3ZPYA 1C1FA 4H55A 1S0CA 1MVQA 3KM5A 3WHUA 1DYKA 3RMXA 4ASMB 1LU1A 1MVEA 1LOCA 4BM8A 3PVNA 1QMJA 4P9WA 4JCKA 5EXOA 3FLTA 2R0FA 1GZWA 1ULDA 2D6MA 1HQLA 4M01A 4M3CA 3SH5A 5F5QA 3ATGA 3OGGA 1BYHA 2DTWA 2EXKA 3VUOA 1S0IA 4FPCA 3DGTA 5IK5A 4XIOA 1EPWA 4CTEA 3IM0A 1QF3A 1QNWA 2D6NA 3WDYA 2DU1A 5KXBA 1JUIA 2WSUA 1C1LA 1MR5A 5E8AA 4YLZA 1BJQA 3M3QA 1WW7A 2DVBA 4MYEA 1MS4A 5JOWA 1YRZA 4FOVA 2A6VA 2DVAA 2JE9A 5JOZA 2JKBA 1LOEA 3OJBA 5T5PA 2D6KA 2PHXA 3NV2A 1QGLA 1S0FA 1F9KA 2UWCA 4PQ9A 4AGVA 4XDQA 2EIGA 1A78A 2YMZA 2JDZA 1KJRA 1AZDA 1ULCA 2ZGPA 3T2TA 3Q9OA 1ULGA 4FPEA 4BMBA 3AK0A 3B00A 1NLSA 2A6WA 5BYNA 3AP5A 1APNA 2DVGA 3HR9A 3N35A 4YZ2A 1IKQA 4YM3A 5DZEA 2ZHNA 3WDWA 1J1TA 2HYKA 4FQ4A 2G4IA 3WCSA 2V73A 1LHVA 4FPYA 2GNBA 1DGLA 5DUUA 2ZGMA 4AVTA 2ZGTA 2CL2A 2YY1A 3AYEA 1W6QB 4YW1A 1SLIA 1JN2P 2WLQA 1N47A 4SLIA 1S0JA 4XOGA 3PJQA 3ZVXA 4DQAA 4Z8BA 4TZDA 1G9FA 2ZGLA 3ZXKA 2P37A 1OKQA 3R4UA 2GNTA 2I2SA 3HMYA 1DQ6A 4P9XA 5H9PA 2AR6A 1Y7BA 4FPKA 4Q2FA 1N1VA 3AFKA 2ZGRA 1IOAA 4D69A 3V0AB 1URXA 2UWAA 4XHXA 1C4RA 1LEDA 1G9BA 5GLWA 3D5OA 2GMMA 5GZGA 2ARBA 1CN1A 2NYYA 4P14A 4UW4A 1MS0A 4L8QA 3O0WA 1LCLA 1SLAA 3T1LA 3MW3A 4ZKTB 5JMCA 1DFQA 1LOBA 1CONA 3A0KA 1KDMA 3RMYA 1ENRA 2YZ4A 3AZZA 3V0BB 3BTAA 1V6JA 2D3PA 4ATFA 3AP6A 1S0GA 3GNEA 1DQ4A 1Z0HA 2DVFA 2GNDA 3INAA 1JW6A 3AZVA 1LTEA 1R1ZA 3UK9A 4DPNA 2OUHA 4XHBA 1WLWA 2ZGKA 1LOAA 3ZXFA 5T55A 1DQ0A 1G9CA 3IKWA 3ILFA 5DXDA 3N36A 5IUQA 3FLPA 1LJ7A 3N7JA 1GKBA 2ERFA 4Q26A 2KM2A 4NO4A 4YG6A 4AGGA 4NOTA 4R9AA 4DFSA 3RG0A 2ZKNA 2NMNA 1LODA 3WG1A 3OY8A 3FFZA 4PBPA 2ZMNA 3OY8B 1JXNA 1PZ8A 4YW3A 3ZXLA 2A75A 3WUDA 1QOTA 2ZAAA 2D6OX 2PHUA 3AP7A 4K20A 3NV4A 1FX5A 2D3RA 3A0NA 3FUQA 1GLHA 4ISRA 3UJQA 3PVOA 2YXSA 4BLJA 3O0VA 3N7MA 3QCWA 4GWNA 4YZ3A 4Q27A 2GN7A 4YGDA 3BIWE 5F9TA 5T5OA 1LHUA 3RRDA 2ZMLA 4XBQA 2XB6C 1JYCA 3LSEA 4LBQB 3AP4A 1LGBA 3VKNA 2A3XA 5CNAA 5DG2A 1W6MB 2DV9A 2YROA 3PMEA 3AYCA 4GWMA 3NV1A 1UX6A 2EXIA 5HCBA 4HANA 2R1BA 1V6MA 1WCSA 1AJOA 1HQWA 1H9WA 2WJSA 1WW6A 4DRVA 1W6MA 2AUYA 2EXJA 4I30A 1FV2A 1SFYA 1ULFA 4YG3A 4IQPA 1KITA 4AWDA 1N3QA 5JDBA 2D43A 2TEPA 2PHTA 4P9YA 2VW2A 4XBNA 4Y1UA 1ENQA 3QLQA 1UL9A 5DUVA 1GNZA 3OBRA 3OPZA 5GZFA 1AXYA 1BXHA 2CNAA 4Y22B 3M2MA 2B7YA 2W39A 2ZA9A 4AVVA 4GKYA 1Z78A 2CYFA 4XJ8A 1Q8PA 5IK7A 1G9AA 1ZM1A 1DBNA 2EAKA 4PBOA 2ZGUA 3N7LA 4XXPA 1VIWB 1UPSA 1QOSA 5JLVA 1LHOA 2ZBJA 4FP3A 1RITA 1LOFC 2E7TA 4YZ5A 1AF9A 1S1AA 4FPFA 4FPJA 4XTPA 1YIFA 1ENSA 1WD3A 4C1XA 2H0BA 1KJLA 1VAMA 3AJYA 4AYUA 4YW5A 1MS1A 2UU8A 4BPZA 1SLBA 2PHWA 2WT0A 5GLUA 1LGCA 5L73A 3AZYA 4Y26A 4ATEA 4YG0A 3I4IA 4YM2A 2PELA 3NV3A 3JU9A 1V6IA 4YM0A 4FVVA 4Y24A 3ZXJA 2D6PA 2SLIA 1CJPA 1W6OB 3MW4A 3IN9A 3ILNA 1W0PA 1FNZA 3V65A 1AXKA 1LULA 1GV9A 1LEMA 2A6YA 5GLVA 1WW5A 1IKPA 2GNMA 3ILRA 1RINA 1F5FA 1DYPA 2ZHMA 1GICA 2E53A 3AJZA 2A6XA 5DZFA 1SLTA 5FREA 4JC1A 4W65A 2LTNA 2P3JA 4FQZA 1QNYA 3B3QE 1WLCA 4RA0A 3H0OA 2R0HA 3MEPA 1N3OA 4GXLA 2ZMKA 2P3KA 3KQRA 3M3OA 5CB7A 4CZSA 1S0DA 4LBLA 3WDTA 2VY0A 1DQ1A 1AX0A 3CNAA 2ZABA 3VKLA 1OFSA 3UL2A 4U2AA 3B69A 5GJ6A 5JVVA 5CBLA 2C5DA 4R9DA 1DIWA 1I3HA 4YZ1A 3U4XA 4OZXA 1V6KA 4R9CA 4XJ9A 1SLLA 3A4UA 2ZZJA 1YO8A 4WVWA 2NMOA 2EALA 4Q8LA 5GM0A 2AENA 5E89A 1SACA 1C57A 2WNEA 2ARXA 1U0AA 5DUWA 5DZGA 1HDKA 2A6ZA 5DUXA 3VKOA 1ULEA 3N3HA 3IMNA 5HCAA 1LECA 2GALA 4GALA 2DVDA 2NM1A 4K1YA 3SNMA 2XG3A 4FOQA 2P3IA 2DWRA 1W6NA 1X50A 3B9CA 3WLUA 1WW4A 1QKQA 1YXWA 3M1HA 5DG1A 2Q5TA 4XJWA 4Y20A 4XZPA 2PHFA 4K21A 4LBQD 4Y20B 3POWA 5GALA 2ZGQA 1N3PA 3V0BA 1MACA 1CIWA 4RL7A 1IS4A 3AZWA 3TAYA 2ENRA 1GZCA 4BLIA 3AP9A 1DQ5A 1DZQA 1HLCA 2RHPA 1W0OA 1WLDA 2PHRA 1AX2A 2VU9A 3NWKA 3AXDA 2DUQA 4JRAA 4LBMA 1I1EA 1F31A 1IS5A 2DUPA 2WT2A 1UN1A 1G8WA 1LOFA 3R05A 5JOYA 3C2UA 5IK8A 1JYIA 1CVNA 4AGRA 1VALA 2WT1A 1UZYA 2E7QA 4XMAA 1IS6A 3B01A 2E51A 2V5YA 2VW1A 3MPPG 2CTVA 1RIRA 2DURA 1GNHA 4Y1ZA 2JJ6A 4XTMA 3TB0A 2A71A 1FNYA 2FHRA 2DU0A 3WVJA 4K1ZA 4GA9A 1LHNA 3D4KA 4FOYA 1JOJA 3OYWA 5T5LA 4WV8A 1FV3A 4WZFA 3PVEA 4KBBA 5SV8A 3ZSKA 5GZCA 3ZXEA 2CY6A 4FOWA 3W58A 4U36A 2OUJA 5E88A 5IT6A 4M3CE 2VH9A 4C1WA 4BQ1A 1SBDA 3OYWB 2D6LX 1OQ1A 4FPLA 1CQ9A 4ITCA 1JHNA 1AX1A 1QDOA 2D7FA 5T50A 3WCRA 3ZYPA 4FPOB 4YFZA 1QU0A 4CRQA 1AXZA 4M00A 1GANA 5CA6A 1V6LA 3AX4A 3WUCA 1W6PB 2A7AA 4LBJA 4DRRA 3SH4A 3OBTA 2W68A 3V64A 1H30A 1O4YA 5H9SA 3GALA 4YGBA 1S0BA 4BOWA 3RS6A 1UAIA 3BODA 1GYKA 1SBEA 1W6NB 2R49A 1CPNA 1VLNA 4YGEA 4Y22A 2FMDA 1SCRA 3ZSMA 3R4SA 1Q8VA 2D44A 1YI7A 3JUUA 1XQNA 2ZGNA 3O12A 4Y1VA 3ZSLA 2WKKA 1MZ5A 2R16A 1B09A 3APBA 1MS3A 3WDUA 2DYCA 4DS0A 1N1YA 1Q8SA 2AGSA 3POYA 2ZGOA 5H9QA 3AYDA 1D2SA 1N1TA 1W6OA 1CPMA 5LK5A 3ZSJA 1PZ9A 3D6EA 3WDXA 4FPGA 3WDVA 4XJZA 2EXHA 4R9BA 4XE9A 3VV1A 1VAVA 5AVAA 2C9AA 1ONAA 2A3YA 3ENRA 4Q1RA 3FBYA 5KXCA 5KXDA 5KXEA 2ZHLA 3W59A 2Z42A 3POSA 1DHKB 1UZZA 1YYNA 4XBLA 3BOPA 2YV8A 3LCPA 2D3SA 2UURA 2WQZC 2LALA 2JE7A 4FPHA 2BQPA 3UJOA 3WNXA 2NN8A 5FRAA 4YM1A 1WBLA 2OW4A 4XXAA 3SISA 5H9RA 3O0XA 4LBKA 2NZ9A 2AH2A 3AYAA 1JBCA 2A5ZA 1N1SA 4LBNA 1SLCA 1KDKA 1LHWA 2DUOA 5T52A 1Q8OA 1GBGA 1ZA4A 3IPVB 1S0EA 4XJUA 4UW5A 5JOXA 4ISQA 2ES3A 2R1DA 3FLRA 3DUIA 4XJAA 3I8TA 4YGCA 1H9PA 1Q56A 2JD4A 1UMZA 5T54A 2GDFA 4UW3A 1QOOA 2GMPA 4TYSA 4XMIA 5GZEA 1MS8A 3ASIA 1A8DA 2WSVA 3IPVA 4F83A 4M3CF
chains in the Genus database with same CATH superfamily
5JIAA 5KC5A 1G86A 3BOWA 4RGKA 3SITA 2X53S 1ZZBA 5C4WC 1Z7S1 2O8OA 3C7EA 5JIUA 2XJPA 4IEOA 4B7EA 1IPKA 3AXEA 2WZR2 1PVXA 3E5UA 4XABA 4AHXA 1NY71 1H1MA 1W2TA 2WS91 5BY5A 1O3TA 2CWMA 2O14A 5L9BA 2JG9C 1DQ2A 1OVPA 3IIAA 1R1A1 1G7YA 2DTYA 1AVBA 2VECA 1HXS3 2XR4A 1LGNA 1XYNA 2HJIA 2OXBA 3CJIB 1QJX1 2ZJCA 4PI2A 4UOJA 1ZNPA 1NKGA 1VMFA 1IPSA 1RMU1 4FFHA 3U75A 3RQ0A 4HETA 3U78A 3T1MA 2Q1FA 3H9AA 2C6SA 4OI0A 3I2DA 5AC93 5FK7A 3Q8CA 4LTAA 4QDQA 2ZPXA 2NP0A 3LOIA 3WG2A 5FQ0A 3LSDA 1W04A 3WQ0A 5A7WA 3GZAA 4I01A 5LCWL 5FZ7A 3W20A 2BNMA 5LEJA 3VBSA 2YG0A 1RUH3 4UW6A 5J96B 2W52A 1HJGA 2CV6A 2QZ2A 2ZACA 4EN8B 3L2YA 3VBFB 3JD73 1F8VA 1UY4A 3GHNA 3NRUA 1SHWB 4LNVA 3RNSA 2KA3A 2D5FA 1TVGA 1JZ4A 1NXD1 3KWVA 1HX6A 1ZZ8A 2SBAA 2I45A 1UOBA 1JZ6A 3J7LA 2FDFA 5BNOC 3ZN5A 1GZWB 2ET7A 4HL0A 3OBAA 3MGUA 1FMD1 3KM5A 4MH0E 3IDEA 4NROA 5FY8A 3WHUA 3GJBA 1LU1A 1PVC2 1MVEA 1R1A2 5IAXA 3PVNA 4GWIA 1QMJA 4JCKA 3K51A 1REDA 4ZY9A 1ULDA 1ZZCA 1ZBA2 3SH5A 3RZKA 5F37A 3AL5A 5DDJ2 4BQ5A 5A1FA 3ATGA 2EXKA 4EN0A 1MZEA 1S0IA 4FSJA 1EPWA 3I59A 3U1XA 3IM0A 3ZFFB 4IW3A 5KXBA 1JUIA 1NQDA 2W3JA 4M0NA 5FYTA 5HPOA 1NCQB 1RUI2 3OUHA 5FZHA 1U12A 3M3QA 2E31A 1MS4A 3NSTA 5FYMA 2JE9A 1EUTA 2DVAA 3ME2A 3MIHA 2JKBA 2XXZA 5EFUA 1O3RA 4Q4V2 1F4HA 1K5MC 5FO9B 1CWPA 1F5JA 1QHDA 2PHXA 4AEDB 4PQ9A 4XUQA 1O7FA 3VBUC 4B1LA 1C5HA 2WWSA 4XDQA 3FBMA 4BQ4A 1ULCA 2K46A 4B4PA 1ND3C 1ALYA 4FPEA 4X6RB 3AK0A 5C4WA 4BMBA 3JB4C 1F2NA 2ZX1A 1GR3A 4CDQB 4YZ2A 3VBOC 5FXVA 1OMIA 5DZEA 2DF7A 2ZHNA 4QKFA 2HYKA 1W8FA 2DFCA 1UPIA 2B45X 2ZGTA 4EWEA 1H1AA 3NAPA 3O1PA 2YY1A 3AYEA 3BCWA 1O8SA 4AK3A 1W6QB 5HXMA 4YW1A 2J22A 1SLIA 5FYVA 3KV4A 1STMA 1PIV1 1UOJA 4TZDA 3PJQA 3ZVXA 3GYDA 3WINE 4LK6A 4UAPA 2ZGLA 2RDNA 2X29A 3R4UA 1W8ZA 4P9XA 1AR63 4TN7A 2AR6A 3LF7A 1VPHA 2VVEA 1ZRRA 1IOAA 4Q4Y3 4D69A 1C8NA 1URXA 4XHXA 4TWTA 2ARBA 2HWD2 2OZJA 2XPJA 3FHAA 1QJY1 4PDWC 3WP6A 2IXCA 4QX8A 5K0UC 2ZEXA 4CP9A 2MEV2 3O0WA 1SLAA 4FTEA 3KV9A 5A70A 3ZFGA 2GP5A 3MUY1 2WL1A 4I0AA 3GF6A 1UOGA 4UF0B 3UYJA 3CJIC 4L0PA 2GNDA 1DDLA 4QPGA 3K3NA 3USSA 5FYZA 3AMNA 5D8AB 2NQYA 1UWWA 1W03A 1WLWA 2E33A 2XWJB 1ODMA 2W1WA 3IKWA 3N36A 4LA3A 5IUQA 1CAWB 3X29B 1GKBA 2ERFA 2J7MA 4IL7A 4NO4A 4YG6A 4YVSC 3NNLA 4AGGA 4AE2A 4R9AA 1LB2A 4P9JA 5LRRA 2JXAA 4ZPIA 3H8OA 1LODA 5A3UA 3OY8A 3FFZA 3K4ZA 1JXNA 2HWE2 4GH4A 3FWEA 1HRI3 1YWKA 5A3PA 1PO22 3I2FA 1W9WA 4X8NA 5D1IA 2PHUA 5FBZA 5K0UA 3SCFA 3LPFA 3ZN4A 2W46A 4DOUA 2PAMA 1P8JA 4MGIE 2RS12 1VRBA 1OF4A 5K9YA 2D3RA 2ZEYA 5FYSA 2QUOA 1RUH1 4KU8A 5BNPC 3JQWA 4BLJA 1XNDA 3E6BA 3QCWA 4RR3A 1L7QA 4A6OA 3BIWE 1VJ2A 5T5OA 1AL0G 4AI0A 4XBQA 2XB6C 4LBQB 3AP4A 4QPGB 1LGBA 4XF1A 2PAEA 4GMP3 5CNAA 5IJRA 2VUJA 4E8CA 4FFIA 2HEWF 4HVOA 1UX6A 5HCBA 1EPZA 2R1BA 1GWKA 1D4M1 5ACA2 5C8WA 3KV6A 4RS5B 4ES8A 1W99A 1WCSA 5FMOS 1AJOA 1HQWA 3K4AA 4LUKA 3SXWA 1WW6A 4D6SA 1OSGA 3H42B 1JMUB 1OUXA 5LA1A 2ORXA 4I30A 4YG3A 3GDBA 1JOPA 4JVAA 3VZKA 1U5XA 4IQPA 4P9GA 1JZ5A 1HRV3 5F5AA 5A6XA 4L11A 1OLMA 2WYSA 4Q29A 4HKLA 4Y1UA 3QLQA 4JDMA 1HRV2 4IEPA 1W8UA 2OX0A 2XUEA 4C90A 1H8TA 3E6CC 3ON7A 4DMIA 1AXYA 3I54A 4WM7B 3M2MA 4ORFA 1ZREA 1Z78A 3K77A 5BXXA 3ROUA 5IK7A 4O9GA 3Q8AA 1DBNA 2EAKA 3PL0A 4JKMA 4PBOA 4UFIA 3UETA 4QU2A 4KWUA 4XXPA 1TMF2 1POV0 2ADEA 4JTOA 5F3GA 2ZBJA 4FP3A 3TBDA 4OUSA 4QT6A 2RS51 3IIIA 1ULPA 1TE1B 1W0NA 2C9KA 4ZU4A 4FPFA 5JR7B 5LZ6A 4XTPA 3W9AA 1IGOA 1WD3A 4LHSA 2H0BA 1KFXL 5FZ3A 5LW9A 3EYPA 1EAH3 1V9U1 1SLBA 2UU8A 4OYUA 5GLUA 1LGCA 4IE5A 2BU9A 3AZYA 1BEV3 3URFA 4ATEA 4Y4RA 3ACLA 1NCQA 3TYJA 4XAAA 1DF0A 1AR61 4JKLA 2ZX4A 3KSCA 4FVVA 4Y24A 1Z7S3 2QNKA 3UESA 4H14A 4HBNA 4QXCA 2WAOA 5G05L 2BNNA 1CJPA 4D6QA 5FZCA 3LFMA 3IN9A 1VBD2 3MW4A 1PIV3 4K40A 4LO5B 1W0PA 3RJRA 1RUD1 3EB7A 3TNQA 2IVIB 3VDCA 4AAXA 2QE3A 1IKPA 2GNMA 2W95A 3HNBM 1RINA 3T2OA 5JPMB 2ZHMA 2A6XA 1M4WA 1R082 4QQHA 5FREA 1O5UA 1UZWA 1POQA 2VQAA 4FQZA 1GOFA 4E2SA 5FR3A 1VB2A 4AQSA 2E7AA 3OF1A 5SV8A 2XKPA 2CAUA 2VZQA 2XGXA 3NO8A 1XC6A 2Y6FA 4JDOA 4XFCA 1CAXA 3KQRA 1H2MA 5CB7A 3POGA 4CZSA 1S0DA 4B4QA 4EZ4A 5C5TA 2QQWA 4G9SB 4LBLA 3S7IA 3EJKA 2VY0A 1UD1A 4BIOA 4LKDA 3CNAA 2XL7A 3VKLA 2EVXA 5FZMA 4CDUA 5F5IA 5GJ6A 1W8TA 1JYWA 2C5DA 1IQDC 1DIWA 4JGZB 3M4FA 1YFYA 5BV6A 1XSQA 3U4XA 1J1LA 4R9CA 4XJ9A 3VDDB 4LO8A 3DYMA 2VMGA 4WVWA 5GM0A 2EALA 3I3BA 4H2AA 5KHGA 4BJ0A 5JSPA 1RUG3 2AENA 1CIYA 1UX7A 2WO1A 5E89A 4GB33 4Q4X3 4P08A 4LLOA 1H4HA 1HDKA 2A6ZA 5DUXA 4AQTA 4BQXA 1LECA 1QXPA 5CFDC 2VTXJ 3SNMA 3PNAA 4FOQA 2RS53 3HVDA 1QKQA 4UFHA 1FMD2 2WRAA 1UMIA 4LE4A 2Q5TA 5HBAA 2WR9A 4Y20A 5IVVA 2OPKA 1X9PA 1HRI2 4HVRA 2ZGQA 3NMBA 5FZ1A 3WX5A 3NL1A 5DPNA 4CCNA 4RL7A 5I0SA 3RFRA 1VBE2 3TAYA 4J25A 4IGQA 3TN93 4BLIA 3GM8A 2YDEA 3AP9A 3NW4A 1DZQA 1RUF2 1HLCA 4KGGA 1AR93 1WLDA 4JRAA 1I1EA 4LBMA 4RN5A 3JBG2 5FXXA 4NJ4A 2NPIA 2DUPA 1YJLA 2FCVA 4FCAA 3C2UA 3N9QA 1BBT2 4MOAA 4PIXA 3ZXGA 1VALA 4AGRA 1UZYA 1JTZX 4HVQA 3P6BA 2E51A 1OH3A 2WFPA 5FYIA 4QHBA 5JZGC 2ARAA 2DURA 1GNHA 1RUD3 2RG4A 1GZTA 3DV8A 1BEV1 2A71A 4XCBA 1OA4A 2FHRA 5A33A 2DU0A 3I2KA 3TB0A 3LKJA 2JE8A 4K1ZA 4NAOA 1VB4A 3D4KA 3K46A 5FY4A 5FP3A 3IAQA 2PQQA 3R0RA 2W1SA 4UT5A 1UU5A 3T09A 2VMDA 3PVEA 1JS9A 2PYTA 1VBB1 3OOXA 4OHWA 5FMCA 2EICA 5FPBA 3LB9A 3BB6A 4YARA 5IATA 5ISLA 3UT0A 5JR2A 5E88A 5IT6A 4QDSA 2HWB1 3IDBB 1VBB3 4BWOA 1GMMA 2D6LX 1VBC1 1CQ9A 1JHNA 3L2HA 1GNYA 3O1TA 3WCRA 3ZYPA 3WNMA 1UIKA 4B3NA 1I5PA 4YFZA 1FOD1 3MIFA 2FDHA 1AR62 2PA7A 4BH9A 1IZ3A 1ND3B 1U5ZA 3WUCA 1K45A 1NT0A 4TLGA 1JZ3A 3V64A 1H30A 1Q5OA 5M0TA 1O4YA 4RQPB 5H9SA 3ZM8A 4E27A 1XE0A 3I2GA 1HB1A 3ZXDA 2X8KA 2VUCA 1VE0A 3RS6A 4RHV3 4B1MA 4BOWA 2R49A 3MLLA 1QQP3 2YB7A 4BCUA 4QD2A 4OVEA 1C28A 1NXMA 3O12A 4QU1A 4Y1VA 5FUIA 3H1WA 2WKKA 2YYOA 1MZ5A 2R16A 3ZFEC 4EYUA 2QQPA 2Y6LA 3WDUA 4ASLA 3PJYA 1N1YA 1Q8SA 3POYA 2W2IA 4YPJA 4QM8A 3B7MA 2RMU2 4FAGA 3BU0A 4YNIA 1N1TA 1W6OA 2P5BA 1OKOA 5EP9A 3WQ7A 3WF0A 4OHYA 1PZ9A 1SQ4A 3PLQA 3WDVA 4R9BA 4XE9A 1VAVA 3BN6A 1EV12 1OFNA 4EJRA 4O65A 1K12A 3MIGA 4Q1RA 4R4XA 3ZYBA 2BGOA 1J84A 2XLGA 3TNPB 3WD5A 5KXCA 1VP6A 4PJYA 3RZHA 5FYHA 4CEYA 1DHKB 1YYNA 3EHKA 3M3IA 4JAAA 2XH6A 5LBFA 2IXJA 1K5JA 3BOPA 2R073 2VOTA 4Q4W3 2WC2A 2BQPA 2VVFA 1Y43B 4LULA 4CCEA 4CP2A 4YM1A 4XXAA 2XJUA 1ACCA 1BVP1 3CLPA 2Z4FA 3WT3A 1GUIA 2GC3A 3VBRB 4AQ2A 3AYAA 1PO12 4HN0A 5A32B 1CZVA 2BGPA 2A73B 2DUOA 1HJFA 5T52A 4DNYA 2F4LA 3IPVB 1S0EA 3FHQA 4QX7A 5FZDA 4UW5A 3I3MA 2FDIA 4NPMA 5T54A 2GDFA 2KR2A 2X5IA 3M7AA 1QOOA 4NMIA 4XMIA 2R072 4XUOA 1TME1 1UIJA 2WSVA 2GC2A 5FAXA 4F83A 1X33A 2P17A 5A3LA 4XQDA 4LBOA 3U14A 1DGWX 3D8CA 3JBG1 1KQRA 5A7QA 3N7KA 2Y6KA 3H7JA 3PIGA 4YW2A 3ST7A 1A3KA 2Q8DA 2PMWB 2K9ZA 1PVC3 2HWC3 3D0JA 1VMHA 4XUTA 3VBSC 1Q8QA 1BLZA 1WUVA 2ATFA 2UYBA 3B9IA 3GCWA 4FP2A 4Y5Z0 3KT1A 2W08A 1WZXA 4OLLA 2ZXQA 5ABJC 3VKFC 5F1RA 2Y38A 2MPFA 4Y1YA 4XFBA 1MS9A 2HYXA 5CAZA 4A45A 1XYOA 2WA3A 2RJKA 4MHRA 4PF5A 2HLEA 1FAYA 2RS33 5JWPA 5CADA 3KT7A 5EWSA 5D8AA 1QDCA 1F4AA 4HG6B 5I0UA 5C6CA 1UF2C 3USUA 4XVHA 4N43A 1CESA 1AJKA 4Q1PA 2B4KA 1LESA 3BTYA 3GCXA 4KNCA 3WZ1A 1OLME 2RMU1 2OVUA 2YC2A 3HN1A 3RWNA 1WA4A 2A3WA 4X8PA 2VUAA 4Y1XA 5FZOA 5T5JA 2X05A 3WW2A 1O4ZA 2B9VA 1JOBA 1V6OA 3MI8A 3SH3A 2WQ4A 4HXCA 1LENA 4BMEA 4EQVA 1DU3D 1WLTA 1W6QA 2XHNA 4DB5A 2R32A 3LPGA 3ZFFC 4MLOA 4GIQA 3WW4A 4WVMB 4YFWA 3T4HB 3F2ZA 1TEIA 5DABA 3OEBA 2JECA 1NA1B 1BQPA 3BPSA 5E6HA 3M3CA 1X36A 4CP1A 3WHTA 1W8NA 5FY0A 3LZZA 2QQUA 4WVVA 3WNNA 3ZPYA 3ZKUA 1WMFA 4H55A 1S0CA 2BBVA 1MVQA 3CIHA 3RMXA 4S2HA 4ASMB 4XUPA 2Y6GA 4OQ9A 3H7YA 1BMV1 2YPJA 5EXOA 5IYYA 3FLTA 1GZWA 2D6MA 1ND2A 3WF3A 3N9MA 3VGIA 1BYHA 1PGL1 3VUOA 3MUZ1 1KEXA 3GJAA 1EUUA 4CTEA 1ASJ3 4J6GA 3GBGA 4HK8A 4A42A 2D6NA 3WDYA 1OD5A 1UCXA 1WA6X 2WSUA 2IXKA 4QX3A 1V9U3 4ZS2A 2WDBA 4IE7A 2YFUA 3UKVA 5F8PA 3AMQA 5G04L 5DQ0A 1AL23 1CGPA 4ZONA 3ZFFA 2WZEA 3RGBA 2VGDA 1RJ7A 4NPRA 3KCCA 5T5PA 4AEDA 2UWCA 5FZAA 4ZU5A 1WCQA 2TUNA 2EIGA 1A78A 2LROA 2YMZA 5CU1A 1KJRA 1RUE2 3IDAA 3PHMA 1ND3A 3ZIWA 4LPLA 1D0GA 5A7NA 1PX3A 1ULGA 3HT1A 4NRQA 3G6JB 3B00A 3KLSA 3D0SA 5BYNA 2DVGA 2XKOA 1TNFA 4MGTA 3WDWA 1WKYA 4FQ4A 1ND2B 3IWZA 3UGGA 5A3TA 2V73A 2VZTA 2Y34A 4E2GA 1FOD3 2VBBA 2VD7A 2ZGMA 3KCYA 3ZFGC 3O7OA 4F8AA 4RGAA 4W4ZA 5LWBA 1JN2P 2JKXA 4XETA 4OCTA 4SLIA 4JTNA 3J7MA 4NPLA 4A7ZA 4Z8BA 4AXOA 5J3UA 2L9LA 1J3RA 4H7LA 1M06G 1O5LA 3RYPA 3ZXKA 1OKQA 4QB1A 1RMU3 3HMYA 2BOJA 1DQ6A 5FY9A 4IEVA 3SEEA 1H1IA 2BEOA 4LO4B 4B7KA 1VBC3 1Y7BA 2VUDA 4OHZA 3AFKA 4GMP1 5CISA 2ZGRA 3T0AA 2R30A 5DAWA 2QQJA 3ZYGA 2Y60A 2BGCA 3NKGA 5FZKA 5C7GA 1G9BA 2GMMA 5FZBA 1CN1A 4QX1A 3KMHA 1WCDJ 4N8MA 3AMPA 1ND2C 4E9KA 3AB0A 3RZGA 1AYN3 2PTMA 1LCLA 1W06A 3MW3A 5A6QA 4AR2A 1S2BA 1DFQA 2ZAHA 1LOBA 3OGJA 4YVWC 4A4AA 4QKBA 3A0KA 3RMYA 5FMBA 3V0BB 4ATFA 2D3PA 4AZZA 3ZR5A 3ES4A 3INAA 4CU6A 1JYTA 4O61A 3AZVA 1R1ZA 1NA1C 2HEVF 5A3OA 4AI2A 2OUHA 1BEV2 1J58A 4XHBA 3ZXFA 4CXXA 3U37A 4AVBA 4KBZA 1AR91 1WWYA 1ZRIA 4XFIA 4G4FA 5DXDA 4PLNA 1HV1A 4ZHNA 2CGOA 4JGYA 3FJSA 3F95A 4DFSA 4K8FA 4N90A 4N9HA 2IUWA 2NMNA 2R061 2ZOEB 1PM7A 2VZ3A 5DAVA 2DDUA 2YFZA 3THCA 4PBPA 3U4SA 2XVLA 1PZ8A 1DLCA 1HQNA 2A75A 5FFOC 2PFWA 4BQWA 2YU2A 3ETQA 3KHBA 1XYPA 1QOTA 2P6CA 4CPBA 3AP7A 3CHXA 3S0MA 1ZZ6A 2OS2A 4D0QA 4K20A 3T2PA 3NV4A 1FX5A 3A0NA 2PLV2 3UJQA 3PVOA 2G9FA 4PLOA 2RVAA 4P5HA 1C5IA 4Q27A 2GN7A 3IBMA 4OHVA 1GOGA 2CHHA 4YGDA 5FJKA 5FYUA 4F3JA 1H6YA 4QQOA 1ZA7A 3VHNA 2ZMLA 1JYCA 1RYYA 5C3PA 1RUJ3 2A3XA 5DG2A 1W6MB 5A6ZA 4OZOA 4CCCA 1V6MA 5IVJA 4CCLA 1YEWA 5FUPA 4DY3A 4I0BA 5F6KA 2XJQA 4IV3B 4DRVA 5CFCC 2I07B 3CU7A 5EZWA 5C71A 4WVZA 3FZ3A 3MICA 4BE3A 5ACA3 1FV2A 1DYOA 2YHJA 1PNFA 1KITA 1XPWA 2AC1A 4AWDA 4KH9A 2WO2A 2ZEZA 2AZ5A 5CKMA 2HH9A 5ERLA 1RUOA 3P3PA 1R081 2GZWA 5ANQA 4QHOA 2VNVA 4XF0A 4QPWA 2XOMA 3OBRA 1BXHA 2BFUS 1DG6A 3I3DA 4HT1T 3PTRB 1S2EA 3O14A 5CIRA 2ZA9A 4OI1A 3HJRA 3S7EA 3UGFA 1W8WA 1JU4A 2CYFA 5DMYA 1OXCA 2XWBB 3MIEA 4KI5M 4YW6A 3N9NA 3WR0A 4BQYA 4X6QB 4BU2A 4RYDA 5FYYA 5I8TA 1IPJA 1EY2A 2QQMA 2ZGUA 4E2QA 3N7LA 4Y4YA 1RVF2 1EAH1 1QOSA 5FOBB 1LHOA 3DECA 4P5YA 2R7EB 1IG0A 1LOFC 4GAZA 1J3QA 2E7TA 1C3HA 2ET1A 1S1AA 1GQHA 2VE1A 4XW3A 3VBSB 2JG8B 4GWJA 4FPJA 2X09A 1YIFA 2QQNA 4CDQA 3VHOA 2J1RA 3E5XA 4RQPA 5L73A 4Y26A 4PDWB 4YM2A 4BDVB 1TNRA 3NV3A 1PVC1 2VO5A 3JU9A 3BTZA 1ZZ9A 1ZBA3 1V6IA 4XQWA 3NNFA 4YM0A 3P1IA 5KHKA 2SLIA 4XQ4A 5JUVA 3ZYFA 2YGMA 3DXUA 3LA2A 4OULA 4DUWA 1H2LA 3V65A 5A1LA 1LULA 1REEA 2A6YA 5GLVA 3SHRA 1DYPA 4YVSB 3AJZA 3ELNA 4LKSA 5DZFA 3CQOA 4UFKA 1SLTA 4JC1A 1JODA 4W65A 3ZPOA 2YBSA 3VBOA 2TNFA 1JHJA 2Q30A 1YHFA 5I91A 1YFWA 2X5IC 2Y33A 3I2JA 3VD7A 2ARCA 1QJZA 2VBPA 3S5AA 2BZDA 2EIEA 5CG9A 1LAJA 2OQ7A 4MSVA 2E26A 3SC7X 3ETPA 4NN0A 2QQLA 1AX0A 2PN5A 3U11A 4MG2A 3WQBA 3BI3A 4Q4W1 1TQ5A 1AYM1 3UL2A 4U2AA 3B69A 5I8YA 5CBLA 2LM3A 1X9TA 3MLKA 3OGVA 2WO7A 4XEZA 1V6KA 3VBUB 3HQRA 3J7NA 1ZRCA 1XBFA 2VOWA 1SMVA 2ZZJA 4MXWA 4AEDC 2ZS6B 1QJY3 2HBTA 1U0AA 4CEWC 4HMZA 5CFCA 1AR81 1NCRC 4QB6A 3PUIA 1YC61 1WCUA 4YVSA 1RUI3 3VKOA 5BNNC 5IFPA 5HCAA 4LO7A 3JZVA 2GALA 3KCXA 1ZBE1 1U5YA 4UXAA 1IHMA 4LHLA 2DWRA 5IVBA 5JZGA 3B9CA 4HOOA 5LBEA 3WLUA 1KXGA 3PIJA 5DDJ3 1US2A 2QJVA 4GJZA 1W05A 3HEIA 5DG1A 4EROA 2CDOA 3DYOA 2PHFA 1OUSA 2R042 4K21A 3POWA 4L97A 4Q4V3 4XDPA 4EWDA 1N3PA 3V0BA 1A34A 3AZWA 3VBHB 3WSOA 4DXRA 3TEYA 1GZCA 1SFNA 4C91A 5CZKA 2F4PA 1W0OA 4XDOA 2VU9A 4XUNA 5FZ0A 1Y9MA 2FD8A 4BYYA 5BNOB 1PO21 4IGPA 4OHXA 3WNPA 1IS5A 2MEV1 2ZCWA 1PGL2 3AKRA 1G8WA 1LOFA 2WAAA 2H0VA 5IK8A 2DCJA 2W91A 5IAVA 2E7QA 3O1MA 1AYM2 2OKXA 1FPN2 3MPPG 2Q8OA 1TZOA 4AHWA 1RIRA 1UXXX 2CTVA 3AKQA 2F6BA 2JJ6A 3VBFC 1I6XA 1FNYA 2RMU3 5CFDB 4GA9A 1LHNA 4XACA 4FAHA 1JOJA 3IZOA 3OYWA 3K3OA 4AVCA 1FV3A 1CX4A 4WZFA 1GU3A 2EIBA 3NJXA 5GZCA 1LNSA 3NAPC 3OG2A 4COYA 2FZ1A 1KGYA 1FT9A 4AHYA 4FOWA 3W58A 5BUVA 2CDPA 2OUJA 5FPXA 1NG0A 4C1WA 4O9EA 1QJFA 1ZBE2 4DUVA 4FPLA 5B4XA 5CYYA 2VMHA 4ITCA 2FDKA 1GP6A 2BNOA 5T50A 5FBJA 4BK4A 1CAVA 3D82A 4FPOB 4M00A 5CA6A 3LWCA 2B9UA 4ZZ8A 3AX4A 2YBKA 1PMHX 1BVVA 1H8VA 5FKCA 5A3NA 5LK7B 2VZRA 3GALA 1RUC3 3QH7A 4YGBA 1R093 2WYFA 1S0BA 4MGKE 4BXFA 1UAIA 3BODA 1IQAA 1GYKA 1SBEA 1W6NB 3VD9A 4YGEA 3RZZA 3VD4A 5C4WB 2WBKA 4Y22A 3ZSMA 1O59A 3ACIA 3R4SA 2D44A 1XQNA 2JDUA 2ZGNA 4QWNA 3OTFA 3VLBB 2EAAA 4W50A 4NIDA 1XOYA 3APBA 3FX3A 2TBVA 4UBHA 2DYCA 3W5MA 4BK5A 5H9QA 2ZGOA 5J36A 3GXUA 1RVF3 2YBPA 4OI4A 3AYDA 2W9XA 3L9JT 4LR4A 1CPMA 3K2OA 4LO6B 4MXWB 1JH5A 2WZR3 5DDJ1 5FYCA 2W92A 1OF3A 2FCUA 3WDXA 3S57A 4TTGA 2EXHA 4HK9A 3WNOA 5CFCB 5JSOA 4CCJA 2HWB2 1RUJ1 3ALQA 5KXDA 4URTA 1O3QA 3W59A 4EZHA 5J7MA 1W9FA 3Q8BA 2JG8C 5FZ4A 2PXJA 3N9OA 1S2KA 3RDIA 4C8DA 2JG9B 5FZ6A 1GOHA 4MADA 3V56A 1AR82 1WBLA 2R063 3OCPA 4JHTA 3PURA 4Y5TA 4M4PA 5DN2A 4Z2AA 3IDCB 1SZBA 4FT8A 3HQUA 4YVWA 1E5IA 3BU7A 4DEVA 1JBCA 2IZWA 1N1SA 2X10A 3DPRA 3ZX7A 1FMD3 5FY7A 2RS52 2VTXA 1I9RA 4BA6A 3BUCA 1GBGA 5FK8A 3BGAA 4LXLA 1SDDB 4WM8A 5FZEA 3CO2A 2R1DA 3FLRA 3JD71 5FYBA 4IGOA 1H9PA 5CKNA 2JD4A 2ADDA 1ZVFA 4UW3A 2J1VA 4MX3A 5GZEA 4E8DA 2JDPA 4QXHA 1W2AX 2PLV3 2Q1ZB 3FUQA 3IPVA 2P3YA 1FYUA 3PUAA 5FXZA 5CFDA 2VW0A 4CP0A 4FTSA 2EF6A 4UFLA 5F3CA 1FI2A 4Z82A 1CAUB 3KGLA 5D2AA 3WV6A 2UY9A 2BUKA 3KD4A 5KC6A 4XFFA 1BKZA 2AYHA 1YJKA 5EYXA 4YW4A 4QPIB 1CR7A 1XU2A 3M3EA 3VHPA 4CDUC 5KWRA 1H2NA 3JCIA 1XNCA 3RPQA 5DAXA 4HN1A 4NHYA 4IE6A 1F15A 2WINB 4KWKA 2BBAA 1QJX3 3HBZA 5A7PA 1BMV2 3WG3A 1NQJA 1C8M3 2A70A 2IC1A 5LB6A 1OOPA 3VBHC 2VOKA 2OZ6A 1D0HA 3AVSA 5IVYA 3C7OA 1C8M1 4AI9A 3USUB 2Z69A 4B29A 5GLZA 1W6PA 5GZDA 2ZHKA 4CDXC 1NZIA 3V0AA 2EA7A 4N53C 5F5CA 3UGHA 1RUF1 1XNAA 1LU2A 4IXLA 5HCFA 3CBNA 3KGZA 4HKWA 3WP3A 4CP9B 5A33B 1VBD3 4OI2A 4I0WB 4XYXA 3DL3A 3MIDA 3VZJA 5I93A 3KZ4C 1PGW2 5JPNB 1K42A 3HOBA 3FUOA 4AVSA 3WW3A 4GKXA 4YZ4A 4RSUA 5F39A 1FXZA 1S4CA 3SLIA 1G9DA 1WD4A 1J59A 1MQTA 2R6QA 2DCKA 1YUDA 4I3PA 3ZDSA 2W1QA 3VDDA 1RL3A 2HWD1 2VXRA 2ZGSA 1WBFA 3J9SA 4A3ZA 1PZ7A 3IT8A 1OD3A 4H3WA 3O5SA 3WG4A 4M3CB 5C33A 2HWE1 1MS5A 5GLTA 4XF3A 1C1FA 5HV0A 1TMF3 1VRH2 4WVMA 1H6XA 1X8MA 4PIZA 4DXSA 1RC6A 3I2OA 2C24A 2O8QA 1OH4A 1LOCA 5BNNA 4CCDA 3AFGA 4MGQA 5K0UB 2R0FA 2QQOA 1LR5A 4M01A 4XC9A 3IMMA 5F5QA 1CZSA 3LDRA 5F3IA 2B8MA 5LA2A 5IK5A 1H2KA 1QF3A 1UY1A 1QNWA 2F17A 2QKDA 1NOVA 2Z5WA 1RUJ2 3DPRC 4TLFA 5E8AA 2RJ2A 4YLZA 4TXWA 4CE8A 1BJQA 1W9TA 1WW7A 2DVBA 4EWAA 5AVPA 3CJXA 1YRZA 2JD9A 2A6VA 1Y9QA 3KT4A 4FOVA 4CUBA 5JOZA 5L36A 1W3VA 2D6KA 1QGLA 1BHGA 1F9KA 2WZR1 4HPKB 5L19A 4AFCA 2B39A 4KL1A 4NHXA 3WEZA 1RTVA 2BW8A 2XJRA 3O1VA 1AZDA 1DZTA 4OQ8A 3Q9OA 4IESA 5FIXA 1PMIA 3LEMA 3WXPA 1NLSA 2B42B 2A6WA 4AI3A 4A44A 3AP5A 3ES1A 3HNYM 3ZMNA 3HAGA 3HR9A 1IKQA 1CAUA 4NRPA 4YM3A 4LJHA 1GP5A 2XVGA 4QM9A 2G4IA 2XBO3 4MV2A 4MVTA 3E6DA 4J1XA 1LHVA 4FPYA 2GNBA 1DGLA 4AVTA 1E5SA 3WY6A 2WFF3 3T3YA 5A1AA 2VCMA 4QQLA 4QPIC 4CDUB 1O6UA 4EN7B 1TME3 2VNOA 2G9ZA 1XB9A 2QDNA 1K5MB 4AEKA 4BISA 4AVAA 2R062 1F35A 1BK1A 5EJ3A 4DQAA 1NYWA 3KV5A 4LOSA 4NHLA 1NY72 2GNTA 3N9PA 4KMQA 1AYN1 5H9PA 3LOBA 4IEZA 4KWJA 4FPKA 4BQ3A 1N1VA 1PGW1 3WNKA 4CEYC 1CJDA 1O4TA 1Y9GA 3V0AB 1ASJ2 1LEDA 3RYRA 5GLWA 3ZYIB 3WF4A 5GZGA 4QQPA 1D4M3 1QJU1 5E16A 3QD6A 3OPWA 1W2NA 4NE9A 4P14A 4UW4A 5JXGA 5KR7A 2QTWB 4IV3C 1REFA 1UOFA 4P02B 5JMCA 2WFF1 3FE5A 4RFT0 2E32A 5A7WB 2OYZA 2QQKA 5FY1A 4JDNA 1KDMA 4AF9A 4FBFA 3AZZA 2IWGB 3AP6A 4AAPA 1S0GA 3GNEA 5FPVA 1DQ4A 3VDAA 1JW6A 1LTEA 2WLPA 4JHZA 4DPNA 1WCKA 5J1XA 3H1YA 4DIQA 1AR71 3TWIA 2P4EA 1K5MA 1DGRA 2FMYA 5T55A 5FLHA 3NJVA 1G9CA 3ILFA 1RUC2 4K9SA 4JGYB 1E57A 1LJ7A 3N7JA 5J37A 1Q43A 4LORA 4QGLA 5FZGA 2J1AA 3RG0A 2ZKNA 4LT5A 5FLIA 3OBZA 4Q0QA 3WG1A 1OPOA 2BP6A 3KB5A 4Q0UA 1GQPA 4YW3A 2ZMNA 3I59B 2J42A 5JCTA 3CL1A 1CX1A 4AFBA 3WUDA 1POV1 2ZAAA 4JGZA 1K3IA 5IW0A 1W2OA 2HWC2 2WNOA 5JSRA 4R52A 2J1UA 4N7IA 1QEXA 2RE9A 4ISRA 1GLHA 1W2UA 4LQRA 4GWNA 4YZ3A 5D8AC 1W8HA 3PUHA 1PHMA 4AFAA 3DXTA 2YUEA 3A21A 4IE4A 3RRDA 4QPGC 1UO9A 1T6BX 1V9U2 1R64A 3VKNA 2CGNA 4CDWB 3PMEA 2W94A 2X5IB 4CCKA 1DP0A 5C5UA 3NV1A 2VQ0A 1V70A 2RV9A 3NNMA 2WNVB 4WBBA 2XJTA 3CF6E 2Y6HA 5C3QA 5CG8A 4QQ2A 3H8RA 4W8JA 2R043 4LEJA 3WNLA 1XNTA 3VBFA 4QB2A 2WJSA 4V2VA 4OMDA 1W6MA 4QMAA 2EXJA 3HIFA 2XL9A 1SFYA 1HXS1 3P3NA 3AMHA 4RHV1 3ZR6A 1YFUA 2JWPA 4BHPA 4COVA 1RXFA 5FMOL 5JDBA 5C8CB 3DF0A 3NAPB 2ZKLA 4LHNA 5C8CC 1NE6A 1ZX5A 4P9YA 1COV2 2RM23 2BWAA 2VW2A 5I0RA 3POEA 2WIIB 4BIFA 1YI9A 3ZIXA 1NX9A 1QJU2 4F7ZA 1IG3A 2GU9A 4CPBD 5TSWA 1QJY2 2Q1MA 2B7YA 3H3UA 4GKYA 1B35A 1Q8PA 1QWRA 2OT7A 4D7TA 5E1RA 3VL9A 1G9AA 1EV13 2WN2A 4IV1A 4AOCA 4QKNA 2W0XA 4AHZA 3DYPA 2Q8EA 4L9BA 1MEC2 4V1PA 5AC91 4XURA 1GWLA 2B5HA 4CDWA 2N7GA 1L7RA 4Q4W2 3RVHA 4ARXA 2Y8KA 5A6YA 3CZJA 2XUMA 1RB8G 4CDQC 5FPUA 4C1XA 4Z2WA 1QQP2 4YW5A 1MS1A 5FOJB 2C4XA 4BPZA 1Y3TA 2PHWA 2BWCA 3BTXA 4GB31 2VZUA 4CA9A 4LKEA 4K8RB 3HD8B 4IEQA 5F7UA 5FP8A 4NRMA 3EO6A 2BPA2 2CU5A 5C8CA 1L7LA 1YLLA 3ILNA 3ACHA 4CCMA 2XBO1 4RR3C 2D98A 1H8TC 2QZ3A 5JXJA 3M70A 1WW5A 1HV0A 4CU9A 3ILRA 4HONA 4CXWA 2WS92 1GICA 1NCRB 4NHMA 3BYWA 3BKZA 3H8XA 1QNYA 4FO9A 1U5IA 3B3QE 3C7GA 2JDYA 4I09A 2O0OA 3NNJA 4RA0A 4IE0A 1N3OA 4GXLA 2ZMKA 2P3KA 3SEPA 3POBA 4QX5A 5LY2A 1OBNA 3J8F2 2BDRA 3VBOB 1D7PM 3WDTA 3WW1A 5JI9A 1DQ1A 1OLRA 1MEC3 2KD7A 2VZSA 3OGSA 5BNQA 3NQHA 1OFSA 1HB2A 4PF1A 1XU1A 4UI9L 3OD0A 4R9DA 4I2OA 3T0BA 4OZXA 5FP9A 4FI9A 3G7DA 2VQTA 1JU3A 4QX0A 1H0BA 2GP3A 4L99A 3WF2A 3A4UA 5DAQA 1GFF2 4META 2NMOA 4AI1A 3ZN6A 3AL6A 4CEYB 3I49A 4LK7A 4Y3OA 1NE4A 2XVKA 2WNEA 2ARXA 1RUF3 4Q4X1 1KFUL 1A8MA 1GP4A 5DUWA 4MHUA 5DZGA 4HFSA 5FO8B 4S2GA 2W47A 4AI8A 3OGRA 4KG8A 1NCRA 4D8MA 4Q0VA 2LW8A 2VMFA 3N3HA 4MGYE 4GALA 2DVDA 3MBWA 4CEWB 2NM1A 3HQXA 4K1YA 5FZ8A 2QDRA 1XJAA 2XG3A 3TN92 2C1FA 1UKRA 2P3IA 1RUD2 4RFRB 1W6NA 1X50A 5JZGB 2BVBA 3THPA 2W5FA 1WW4A 1YXWA 3M1HA 4KWLA 4N43B 4XJWA 4XZPA 5EQUA 4LBQD 3FN9A 3JQXA 5GALA 1QY4A 1SEFA 3SKVA 1MACA 1CIWA 5EJ1B 1IS4A 2XHKA 4QPIA 2ENRA 4MXVA 2ZZQA 1FPN1 2FCTA 4YWAA 4COZA 4AL9A 1DQ5A 1UU4A 4AEJA 3CMGA 1HW5A 3S5QA 3VV1A 4M4RA 3AXDA 2DUQA 1F31A 4GB32 2VC9A 2Y6JA 1OQEA 1UN1A 2JDMA 2WT2A 3R05A 1COV1 3PUSA 5CKQA 3B94A 3HWJA 5JOYA 1JYIA 1W39A 2WT1A 1IS6A 2V5YA 5I0TA 3LIGA 4JQRA 3J26N 4I3GA 3VZLA 2WABA 2VOVA 2VOXA 5KHIA 4P00B 3WQ1A 4XFAA 1JZ7A 4UYBA 1JYXA 3FFQA 2VG9A 4SBVA 3WVJA 4IV3A 2GC1A 4FOYA 2W1UA 4OMCA 3TEXA 3W5NA 4WV8A 1E5HA 4K6BA 4YSFA 1AL21 4EE2A 2XJSA 3ZSKA 1G6NA 1YNAA 2VZVA 2Y0IA 4IUGA 3ZKYA 5FTTC 3ZXEA 4ASKA 2CY6A 1EP0A 4Z92B 4M3CE 2MHFA 3RZMA 3R6SA 1SBDA 3OYWB 4Y33A 2WNUA 1VAKA 1OQ1A 3WP4A 2D5HA 2CGPA 4URAA 4PI0A 4LMFA 2D7FA 1AX1A 1RHI2 1ZZ7A 3ZO0B 2GSYA 2JDNA 3PU3A 2WNVC 1JYVA 1AXZA 1PM4A 1V6LA 2PLV1 3ITQA 3LEIA 4N9IA 2A7AA 4LBJA 4LOTA 3CEWA 1VBE1 4AW7A 1OC1A 1PIV2 3B5LB 2VULA 3SCHA 1WMEA 2W68A 3GZUC 5B2GB 1MZFA 5IWFA 3THTA 3Q8FA 4G3YC 4N43C 5L9RA 1AUYA 2ZX0A 1YFXA 5HCHA 1POV3 4KG0A 1AYN2 3KF3A 2JG8A 2RR11 2ZTNA 3A7QA 1CPNA 4GMP0 1BBT3 3KF5A 2C26A 4WM7A 5IFTA 1VR3A 1Q8VA 1EAH2 3JUUA 1YI7A 1D2QA 3VD3A 3ZSLA 4QX2A 2WN3A 4UF0A 1MS3A 4DS0A 4AFDA 2VMEA 1ZRFA 4RGGA 2BV4A 3H50A 1VBE3 1B35B 1D2SA 2V72A 3ZXAC 3UV9A 3AM2A 3D6EA 4DO0A 1Z7S2 3I3EA 4FPGA 4GZ9A 1AR73 3KVBA 3AC0A 2WNUB 4XJZA 3O1RA 4QGNA 5SV5A 4JGYC 1W8OA 1UZ0A 1QIQA 3ENRA 4QHZA 4AQ6A 2XONA 3VN4A 3ORJA 2CSGA 5K7PA 2ZHLA 1QH6A 2Z42A 3KVAA 3ABZA 3POSA 4ONUA 3LEGA 1UZZA 1OPMA 4RQPC 1OA3A 1VBC2 4NIHA 1OA2A 2Q0AA 2RS31 3LCPA 3POJA 5DAPA 2C0ZA 5FUNA 2UURA 3EBRA 4Q4X2 3WNXA 1PK6B 1RUG2 1A6CA 4R4ZA 4UBGA 5CEHA 2OW4A 2VAUA 3LFIA 4CUGA 4YVWB 4LBKA 1H4GA 3AKTA 4NHKA 2VCCA 4LBNA 2DBNA 2JG9A 4XCAA 1KDKA 1LHWA 3NJYA 2V09A 2WNUC 5FZFA 1WMXA 1L3JA 1ST8A 2YC0A 4QGMA 4ZS3A 2QFEA 2VCAA 3GZEA 4S2FA 4XF4A 4N7UA 2ES3A 5FDBA 1AL22 5LY1A 3DUIA 4XJAA 2BRTA 4YGCA 5FJHA 3QBQA 4N53B 1OVSA 2XQRA 4P9LA 4YYOA 2HWC1 4C0BA 3LA3A 4PLMA 4CSWA 5JXHA 5AFEA 2P34A 1X7NA 2RS13 3NJZA 2PAKA 3NNGA 4Q8KA 2E6VA 5FKBA 3B93A 1GZ9A 2Q8CA 1PO23 5I0DA 3MFAA 1JZ2A 1FATA 2GH2A 2KXLA 1UKGA 1KRIA 1OURA 1V6NA 1R083 4QXKA 3T4VA 4XAEA 3HT2A 4DZGA 5EYYA 1YQ5A 5EHDA 3VD5A 4D3WA 1DGWA 4FXKB 1LOGA 2XLFA 4L2NA 4JX0A 3LEKA 3AZXA 4LA2A 4EN9B 5IK4A 4E4HA 4XILA 2K0GA 1BZWA 2JB4A 2IFWA 4KU7A 2W87A 3ZYRA 1V00A 2GN3A 4JRLA 1MZ6A 4IEUA 2HKXA 1IS3A 1KD7A 2XLAA 4Q4Y1 1TG7A 1RUG1 1GSLA 1SCSA 2XDVA 5A3WA 4E4SA 3E1F1 1CD3G 1RUI1 3B02A 2GAUA 1PO11 3MFCA 1QJX2 3MW2A 4GH4B 4ZXKA 3VKMA 4IEWA 3E5QA 4OUEA 1GWMA 3RSJA 2VXJA 1RMU2 3OPTA 4P9IA 4CUAA 1SBFA 2GMEA 3KQ4B 5A3MA 3WOGA 2CWSA 1AHSA 3A23A 4XIKA 3T30A 4A2UA 2WZ8A 1HKDA 1MEC1 4PCRA 2UWBA 3DPRB 3W21A 5FP7A 3VHRA 5T3NA 2VZOA 1KS4A 2MEV3 2PHDA 5BNPA 1S55A 3J7HA 5ACA1 1QXRA 2BVVA 3VDDC 2RM21 1DLLA 3DN7A 4LBQA 1MQTC 2BYVE 2IXHA 2RS32 2P2KA 3ECQA 4BZ4A 3MPBA 4V2WA 4NAMA 1OI6A 4EV0A 2AREA 3VZNA 4RS5A 5EJZB 5HXVA 4YW7A 1DYKA 2XMLA 4OUMA 1XE7A 4BM8A 1RUE3 1UQXA 3LDKA 3GGLA 4P9WA 4M3CA 4XPVA 1HQLA 3GZTB 4DXTA 5J98B 4QKDA 1ZBE3 2DTWA 3OGGA 1VBD1 2VCBA 5FCCA 4FPCA 3DGTA 1PGSA 4XIOA 3C3VA 4D7SA 3OB8A 2DU1A 1NAEA 3I2IA 1C1LA 4CCOA 1SG3A 1MR5A 2QCSB 3RI8A 3ZFEB 3OD4A 4MYEA 3ZOIA 5JOWA 4QPYA 1ZBA1 1NCQC 1JYNA 1DZRA 1J83A 1LOEA 3OJBA 5C9AB 3J8F1 3NV2A 4HPKA 5FMDA 5A7SA 3MZHA 1S0FA 5D21A 1AYM3 1VBA3 3GBFA 4LE3A 4AGVA 1Y4WA 1OT5A 3MLJA 4CEWA 4PIYA 2JDZA 3U0ZA 2ZGPA 1DCSA 2RR13 4LKFA 3T2TA 1XNKA 4ES9A 3MV01 2HWE3 5FZ9A 4BXSV 1US3A 3EQEA 3MDPA 1COV3 2RM22 3I2HA 3I97A 1APNA 3N35A 3CDZB 3VL8A 5EPAA 3MHZA 1SPPB 1UZVA 1J1TA 3WCSA 3PUQA 1X8EA 4XZUG 1JI6A 2QBXA 4XFHA 5DUUA 5ABJB 1JZ8A 5FLJA 2CL2A 2YGLA 2ZX2A 1UYYA 2V4AA 2H6BA 5FWEA 3OUJA 2WLQA 2AEZA 3QH6A 1N47A 3VBUA 1S0JA 4XOGA 1UY3A 1VBA1 1G9FA 3TN91 4Y5SA 2G9GA 3J8F3 2P37A 3ZLIA 5FXWA 5BNNB 3LA7A 2I2SA 2VM9A 2Z2SB 4RR3B 3M8LA 2VJXA 3NKTA 5F6LB 3VDBA 4IDZA 4Q2FA 1WGPA 4LUMA 4Q0SA 2UWAA 1C4RA 3AKPA 3D5OA 2WWUA 2DFBA 3RZJA 1RJ8A 2VVDA 5C3RA 4XFGA 4PDWA 1CAXB 2CAVA 2NYYA 1R092 4IEXA 5LA9A 2JICA 2QQVA 4PHZA 1MS0A 4L8QA 3ZDVA 4DXZA 5IHRA 3C8XA 3T1LA 2AEYA 1NZCA 4Q4Y2 4LIUA 4ZKTB 1R1A3 2LS6A 2JDKA 1BCXA 3JD72 4TSVA 5EIYB 4ET7A 1CONA 2VR4A 2WS93 3CJIA 5F2WA 1ENRA 2YZ4A 3RWKX 2VMIA 1RUE1 3BTAA 1V6JA 4Q0PA 5A7OA 1Z0HA 2DVFA 2DCTA 5FPAA 3UK9A 5APAA 1FPN3 1T6GC 2WO3A 3RJ2X 4ARYA 4NIGA 2WZPP 2ZGKA 1LOAA 1V0AA 3MF6A 3MV11 5HI0A 1DQ0A 5L7OC 2JB8A 5JAXA 1XSRA 3JXSA 4RHV2 3O1UA 1OOPC 1VBB2 3VBHA 1O91A 2V5DA 4QAWA 2FDGA 3FLPA 1QXJA 4LHKA 1CAWA 2J1SA 4Q26A 2KM2A 1UYZA 3WP5A 5KBFA 4NOTA 4CDXA 2BOIA 4JZRA 1CZTA 2UYAA 4IETA 5K4LA 1NLRA 1RUH2 1WMDA 2D40A 1BK0A 4FXGB 4GH4C 3OY8B 5KHJA 3ZXLA 1LKNA 3TEZA 2DCYA 5LBBA 5C70A 1UY0A 3PVBB 3T08A 1RHI1 2D6OX 4COUA 3ACGA 5ANNA 1PO13 1ASJ1 4B8EA 2ZX3A 1D4M2 3H8UA 4K3UA 3EXUA 3VBRC 2XQXA 3ZYHA 2FBEA 1W3XA 2B46X 2ZEWA 2YXSA 5L7OB 2WQ8A 3O0VA 3N7MA 4GULA 5F9TA 4H7MA 2J1TA 1QJU3 2UY8A 4A7YA 4D7YA 5LEKA 1LHUA 5FWJA 1OLQA 1XE8A 3LSEA 4FFGA 1HXS2 3TEWA 3LQCA 1ZYBA 4MGSA 2DV9A 2YROA 2JX9A 3FC0A 3AYCA 2RR12 4GWMA 4LITA 5C3OA 2Y64A 2EXIA 4HANA 2OA2A 3BPZA 4A3XA 2OPWA 4PQQA 5GKAC 1HB3A 1CAVB 3GHMA 3GBWA 3H1MA 1H9WA 1O8PA 2VNRA 3UKTA 1PK6A 5C3SA 1VBA2 1PNGA 2AUYA 2D93A 1GQGA 2VZPA 4O7XA 3ZMOA 5JMOA 4IEYA 1SPPA 2XBO2 1ULFA 3JBG3 3S30A 1RUC1 1N3QA 1AR92 1HN0A 2D43A 2PHLA 3IAPA 2TEPA 1UU6A 3R4DB 4ZXEA 5JXIA 2PHTA 4BB3A 4XBNA 1EV11 1ENQA 1UL9A 2IFRA 5DUVA 4CU8A 1GNZA 3VZMA 1QJEA 2JDAA 3OPZA 3PU8A 5GZFA 3SQOA 4CYDA 4IERA 4LLFA 1SFPA 2CNAA 4Y22B 2W39A 1NA1A 4AVVA 5A32A 1OOPB 5IVEA 4XJ8A 4D94A 5L7OA 1W9YA 2IXIA 3H3LA 1ZM1A 2DCZA 4RD7A 5CVRA 5FPLA 1XRUA 4L92A 4MUVA 1DGRN 1VIWB 1UPSA 2R041 4CDWC 5JLVA 1HRV1 4CUCA 3AKSA 1RITA 2RDSA 3VB9A 2OQ6A 4YZ5A 2HWF1 1AF9A 1YIPA 2P6HA 3C7HA 3RYKA 3ACFA 4LIVA 4Q4V1 4IV1B 5JI7A 3PMSA 1ENSA 3AJYA 1KJLA 1VAMA 2K2SA 2LUWA 2VL4A 4AYUA 4HLTA 4JQTA 2WT0A 1QH7A 3LGRA 4OFGA 1RGSA 3I4IA 4YG0A 2PELA 4AEMA 5AC92 3ZFEA 5FY5A 3AVRA 5F32A 3FHIB 3BIEA 3LIHA 1B35C 2D6PA 3SCGA 3ZXJA 2R071 2Y0OA 1W6OB 2ORZA 2VMCA 1HIXA 2AACA 1FNZA 5C9AA 1AXKA 3K75B 1GV9A 4S2DA 1LEMA 1F5FA 2ID4A 1HB4A 4UFJA 2E53A 2XJVA 2Z79A 2FZ2A 3S6PA 2LTNA 2P3JA 3P5BA 2PQSA 2BERA 4RS5C 2RJLA 3CZUA 1OQDA 2HEYF 2WUHA 1YQCA 3LE0A 5F3EA 1WLCA 4WM8B 5FO7B 2IVJA 1D4VB 2G1MA 3H0OA 3PDQA 4HSLA 2R0HA 3MEPA 2NLRA 3M3OA 5FZIA 4E4ZA 5FZOB 2JEMA 4JV4A 3T2QA 3VBRA 2YPDA 1UW8A 2ZABA 4HKOA 1UNBA 5JVVA 3K4DA 3LAGA 1UYPA 2RDQA 1TME2 3DKWA 4AFMA 2HWF2 2IXLA 1ZRDA 3POIA 1I3HA 4YZ1A 2P1BA 4NIAA 2WA4A 1SLLA 4C0HA 3BALA 2WFF2 4A7KA 1YO8A 2HBUA 4Q8LA 3N4MA 5FPZA 5C9AC 2BFUL 2ETEA 1SACA 1C57A 2I74A 4I02A 5AFBA 3AMMA 3MIBA 1ODNA 3FL7A 1HRI1 4QDRA 5FQ0B 3HN3A 4A41A 3OEAA 1ULEA 3IMNA 5B4NA 2E9QA 2V4VA 1UY2A 2BTVC 2JIGA 3MO4A 5I8SA 1W28A 3ZN6B 1XNBA 5FZLA 1YQ2A 5A80A 4J1WA 4KQ7A 4UWDA 1RXGA 2OIIA 2VNGA 5EV7A 4JKKA 1RVF1 4JGZC 4Y20B 1BBT1 4NR1A 1W90A 1XXNA 3TRSB 1Q3EA 2GC0A 3T0DA 3LDBA 2FQPA 2GH8A 4W6XA 2VBDA 2RHPA 3NWKA 4CXYA 2J1EA 1AX2A 2PHRA 2EIDA 4FFFA 3E97A 5HV4A 2H6CA 1KS5A 4NVPA 4Z07A 3FMGA 1MQTB 1CVNA 1YCIA 3QOPA 3SMHA 3DKQA 3KHCA 2DBIA 4WM8C 4XMAA 5L9VA 4K7JA 3B01A 5LATA 3WF1A 2VW1A 2D97A 2WNVA 4Y1ZA 4XTMA 1AR72 4INDA 1UYXA 5K8SA 3RI9A 1E5RA 3EMRA 1SDWA 5FV3A 5KHHA 3BVCA 1VMJA 4ZU7A 1VRH3 5T5LA 2JENA 3THDA 2LRPA 4KBBA 1X82A 3DEMA 3Q8EA 2E63A 3N9LA 2FDJA 3ZFGB 4U36A 3MYXA 4W6YA 2O1QA 2VH9A 4BQ1A 2Q4SA 4CVUA 3U10A 4PT6A 2HWF3 4DUXA 3PTYA 4Z1VA 1QDOA 1LRHA 2BJSA 1QU0A 1YQ6A 2RS11 4IV1C 3NVCA 4CRQA 1GANA 2A1XA 2Y26A 3K48A 5F2SA 1UXZA 1W6PB 3HPNA 4MZUA 4DRRA 3O1SA 2MNGA 3OBTA 3SH4A 4DINB 4DY5A 3D3AA 4MGZE 1RHI3 5LASA 4WZCA 4YRDA 1HN1A 3HNMA 3H3ZA 3VZOA 1VLNA 1FOD2 5LBCA 2HWD3 4EN6B 2FMDA 5J48A 4HZFA 1SCRA 2QVSB 1ULOA 1C8M2 4WM7C 1TMF1 3O1OA 4XF9A 2G19A 1T2XA 1OHFA 1B09A 3OUIA 1R091 4BQ2A 3ZSEA 5BPXA 2AGSA 3CKHA 1J3PA 4GQ7A 4E4DX 5J09A 1RUNA 1QQP1 1W9SA 5IVFA 5LK5A 3ZSJA 4CU7A 4Q5OA 4CDXB 3ZYJB 1NUKA 4NWVA 5AVAA 1MPXA 1NLQA 2C9AA 3C7FA 1ONAA 3A22A 4KGQA 3TOJA 5LRSA 2A3YA 2VZ1A 3SKJE 3OSDA 5IVCA 3FBYA 1JUHA 4DEQA 5KXEA 3RZLA 1AR83 2JDHA 2RDRA 1YQ8A 4XBLA 2VTFA 2VQUA 3LD8A 1PK6C 4GJYA 3U07A 4D6RA 4HSJA 3KS7A 3QACA 2YV8A 2ILMA 2D3SA 2WQZC 4FPHA 2LALA 1UMHA 2JE7A 3I7DA 3UJOA 3UKNA 2NN8A 5FRAA 2YU1A 1VRH1 4QXBA 3UNPA 4W6WA 3SISA 2HWB3 3I3QA 4NUBA 5H9RA 3O0XA 5BNPB 2NZ9A 3HBKA 2AH2A 1EYBA 2A5ZA 5ABJA 3IB3A 1SLCA 5FP4A 4COWA 4FTBA 1PX4A 2YC4A 1Q8OA 2QQIA 5BNOA 1ZA4A 4NIIA 1H8TB 3POFA 4XJUA 4ZZ5A 5JOXA 4ISQA 4MO3M 4M0HA 4AG4A 4GD4A 1I5ZA 1O3SA 3I8TA 4N53A 1Q56A 1UMZA 2WWJA 4NWWA 3DCQA 4A6SA 2GMPA 1PMJX 2JIJA 3JB8A 4R8HA 1MS8A 4TYSA 1ENXA 2VPVA 3ASIA 3MF9A 1A8DA 4UFMA 4B4RA 3J4UH 5LA0A 4M3CF
chains in the Genus database with same CATH topology
5JIAA 5KC5A 1G86A 3BOWA 3SITA 2X53S 1ZZBA 5C4WC 1Z7S1 2O8OA 5JIUA 2XJPA 4IEOA 4B7EA 1IPKA 3AXEA 2WZR2 1PVXA 3E5UA 4AHXA 1NY71 1H1MA 2WS91 5BY5A 1O3TA 2CWMA 2JG9C 1DQ2A 3IIAA 1R1A1 1G7YA 2DTYA 1AVBA 2VECA 1HXS3 3CJIB 1LGNA 1XYNA 2HJIA 1QJX1 2ZJCA 1ZNPA 1RMU1 3RQ0A 4HETA 3T1MA 3H9AA 4OI0A 3I2DA 5AC93 4LTAA 2ZPXA 2NP0A 3LOIA 3WG2A 5FQ0A 3LSDA 3WQ0A 3GZAA 4I01A 2BNMA 5LEJA 3VBSA 1RUH3 4UW6A 5J96B 2W52A 2CV6A 2QZ2A 2ZACA 4EN8B 3L2YA 3VBFB 3JD73 1F8VA 3GHNA 4LNVA 3RNSA 2KA3A 2D5FA 1NXD1 1HX6A 1ZZ8A 2SBAA 2I45A 5BNOC 3ZN5A 1GZWB 2ET7A 4HL0A 3MGUA 1FMD1 3KM5A 4MH0E 3IDEA 3WHUA 1LU1A 1PVC2 1MVEA 1R1A2 3PVNA 1QMJA 4JCKA 3K51A 1REDA 1ULDA 1ZZCA 1ZBA2 3SH5A 5DDJ2 3ATGA 2EXKA 4EN0A 1MZEA 1S0IA 4FSJA 1EPWA 3I59A 3IM0A 3ZFFB 5KXBA 1JUIA 1NQDA 4M0NA 1NCQB 1RUI2 1U12A 3M3QA 3NSTA 1MS4A 2JE9A 2DVAA 3ME2A 3MIHA 2JKBA 5EFUA 1O3RA 4Q4V2 1K5MC 5FO9B 1F5JA 1QHDA 2PHXA 4AEDB 4PQ9A 1O7FA 3VBUC 1C5HA 2WWSA 4XDQA 3FBMA 1ULCA 4B4PA 1ND3C 1ALYA 4FPEA 4X6RB 3AK0A 5C4WA 4BMBA 3JB4C 1F2NA 2ZX1A 1GR3A 4CDQB 4YZ2A 3VBOC 1OMIA 5DZEA 2DF7A 2ZHNA 2HYKA 2DFCA 1UPIA 2B45X 2ZGTA 4EWEA 1H1AA 3NAPA 2YY1A 3AYEA 3BCWA 4AK3A 1W6QB 4YW1A 1SLIA 1PIV1 4TZDA 3PJQA 3ZVXA 3GYDA 3WINE 2ZGLA 2X29A 3R4UA 4P9XA 1AR63 2AR6A 2VVEA 1ZRRA 1IOAA 4Q4Y3 4D69A 1C8NA 1URXA 4XHXA 4TWTA 2ARBA 2HWD2 2OZJA 2XPJA 4PDWC 1QJY1 3WP6A 2IXCA 5K0UC 2MEV2 3O0WA 1SLAA 4FTEA 3ZFGA 2WL1A 4I0AA 3GF6A 3CJIC 2GNDA 1DDLA 4QPGA 3USSA 3AMNA 5D8AB 2NQYA 1WLWA 2XWJB 3IKWA 3N36A 4LA3A 5IUQA 1CAWB 3X29B 1GKBA 2ERFA 4IL7A 4NO4A 4YVSC 4YG6A 4AGGA 4AE2A 4R9AA 1LB2A 4P9JA 5LRRA 2JXAA 1LODA 3OY8A 3FFZA 1JXNA 2HWE2 4GH4A 3FWEA 1HRI3 1YWKA 1PO22 5FBZA 3SCFA 4X8NA 5D1IA 2PHUA 5K0UA 3ZN4A 4DOUA 2PAMA 4MGIE 2RS12 5K9YA 2D3RA 2QUOA 1RUH1 4KU8A 5BNPC 3JQWA 4BLJA 1XNDA 3E6BA 3QCWA 4RR3A 3BIWE 1VJ2A 5T5OA 1AL0G 4AI0A 4XBQA 2XB6C 4LBQB 3AP4A 4QPGB 1LGBA 4XF1A 2PAEA 4GMP3 5CNAA 2VUJA 2HEWF 4HVOA 1UX6A 5HCBA 1EPZA 2R1BA 1D4M1 5ACA2 5C8WA 4RS5B 4ES8A 5FMOS 1WCSA 1AJOA 1HQWA 4LUKA 3SXWA 1WW6A 1OSGA 4I30A 4YG3A 4JVAA 3VZKA 1U5XA 4IQPA 4P9GA 1HRV3 4L11A 4Q29A 4HKLA 4Y1UA 3QLQA 4JDMA 1HRV2 4IEPA 4C90A 1H8TA 3E6CC 4DMIA 1AXYA 3I54A 4WM7B 3M2MA 4ORFA 1ZREA 1Z78A 5BXXA 3ROUA 5IK7A 4O9GA 1DBNA 2EAKA 4PBOA 4QU2A 4XXPA 1TMF2 1POV0 4JTOA 2ZBJA 4FP3A 3TBDA 4OUSA 4QT6A 2RS51 1TE1B 4ZU4A 4FPFA 5JR7B 4XTPA 3W9AA 1IGOA 1WD3A 2H0BA 1KFXL 1EAH3 1V9U1 1SLBA 2UU8A 5GLUA 1LGCA 3URFA 3AZYA 1BEV3 4ATEA 3ACLA 1NCQA 3TYJA 1DF0A 1AR61 2ZX4A 3KSCA 4FVVA 4Y24A 1Z7S3 2QNKA 4H14A 4HBNA 2BNNA 1CJPA 3MW4A 3IN9A 1VBD2 1PIV3 4K40A 4LO5B 1W0PA 3RJRA 1RUD1 3TNQA 2QE3A 1IKPA 2GNMA 1RINA 5JPMB 2ZHMA 2A6XA 1M4WA 1R082 4QQHA 5FREA 1O5UA 2VQAA 4FQZA 4E2SA 1VB2A 4AQSA 2E7AA 3OF1A 2XKPA 2CAUA 2XGXA 3NO8A 4XFCA 4JDOA 1CAXA 3KQRA 1H2MA 5CB7A 4CZSA 1S0DA 4B4QA 4G9SB 4LBLA 3S7IA 3EJKA 2VY0A 1UD1A 4BIOA 3CNAA 2XL7A 3VKLA 2EVXA 4CDUA 5GJ6A 2C5DA 1DIWA 4JGZB 3M4FA 1YFYA 5BV6A 3U4XA 1J1LA 4R9CA 4XJ9A 3VDDB 4LO8A 2VMGA 4WVWA 5GM0A 2EALA 5KHGA 5JSPA 1RUG3 2AENA 5E89A 4GB33 4Q4X3 4LLOA 1H4HA 1HDKA 2A6ZA 5DUXA 4AQTA 1LECA 1QXPA 5CFDC 3SNMA 3PNAA 4FOQA 2RS53 1QKQA 1FMD2 4LE4A 2Q5TA 5HBAA 4Y20A 2OPKA 1HRI2 4HVRA 2ZGQA 3WX5A 3NL1A 5I0SA 4RL7A 1VBE2 3TAYA 3TN93 4BLIA 2YDEA 3AP9A 3NW4A 1DZQA 1RUF2 1HLCA 4KGGA 1AR93 1WLDA 4JRAA 1I1EA 4LBMA 3JBG2 2DUPA 1YJLA 2NPIA 4FCAA 3C2UA 1BBT2 3ZXGA 4PIXA 4AGRA 1VALA 1UZYA 1JTZX 4HVQA 2E51A 2WFPA 4QHBA 5JZGC 2DURA 1GNHA 1RUD3 3DV8A 2QQPA 1BEV1 2A71A 3TB0A 1OA4A 2FHRA 5A33A 2DU0A 3LKJA 4K1ZA 1VB4A 3D4KA 2PQQA 3R0RA 1UU5A 3PVEA 5SV8A 2PYTA 1VBB1 4OHWA 4YARA 3LB9A 3BB6A 5E88A 5IT6A 2HWB1 3IDBB 1VBB3 4BWOA 2D6LX 1VBC1 1CQ9A 1JHNA 3L2HA 3WCRA 3ZYPA 1UIKA 4B3NA 4YFZA 1FOD1 3MIFA 1AR62 2PA7A 4BH9A 1IZ3A 1ND3B 1U5ZA 3WUCA 3V64A 1H30A 1Q5OA 1O4YA 4RQPB 5H9SA 4E27A 4BOWA 3ZXDA 2X8KA 3RS6A 4RHV3 2R49A 3MLLA 1QQP3 4BCUA 4QD2A 4OVEA 1C28A 1NXMA 3O12A 4Y1VA 3H1WA 2WKKA 2YYOA 1MZ5A 2R16A 3ZFEC 3WDUA 4ASLA 3PJYA 1N1YA 1Q8SA 3POYA 4QM8A 3B7MA 2RMU2 4FAGA 4YNIA 1N1TA 1W6OA 3WQ7A 4OHYA 1PZ9A 1SQ4A 3PLQA 3WDVA 4R9BA 4XE9A 1VAVA 1EV12 1OFNA 4EJRA 4Q1RA 4R4XA 3MIGA 2XLGA 3TNPB 5KXCA 3WD5A 1VP6A 4PJYA 4CEYA 1DHKB 1YYNA 3EHKA 3M3IA 4JAAA 2XH6A 2IXJA 3BOPA 2R073 4Q4W3 2WC2A 2BQPA 2VVFA 1Y43B 4LULA 4CP2A 4YM1A 4XXAA 2XJUA 1BVP1 3CLPA 3WT3A 2GC3A 3VBRB 4AQ2A 3AYAA 1PO12 4HN0A 5A32B 2A73B 2DUOA 5T52A 4DNYA 3IPVB 1S0EA 4UW5A 5T54A 2GDFA 2X5IA 3M7AA 1QOOA 4XMIA 2R072 1TME1 2WSVA 1UIJA 2GC2A 5FAXA 4F83A 1X33A 2P17A 5A3LA 4XQDA 4LBOA 1DGWX 3D8CA 3JBG1 1KQRA 3ST7A 3N7KA 3H7JA 4YW2A 1A3KA 2K9ZA 1PVC3 2HWC3 3D0JA 3VBSC 1Q8QA 1WUVA 2ATFA 2UYBA 3B9IA 4FP2A 4Y5Z0 5ABJC 3KT1A 2W08A 4OLLA 5F1RA 3VKFC 2Y38A 2MPFA 4Y1YA 4XFBA 1MS9A 5CAZA 1XYOA 2WA3A 2RJKA 4PF5A 1FAYA 2RS33 5JWPA 5CADA 3KT7A 5EWSA 5D8AA 1QDCA 5I0UA 5C6CA 1UF2C 3USUA 4N43A 1CESA 1AJKA 4Q1PA 1LESA 4KNCA 3WZ1A 2RMU1 2OVUA 3HN1A 3RWNA 1WA4A 2A3WA 4X8PA 2VUAA 4Y1XA 3WW2A 5T5JA 1O4ZA 1V6OA 3MI8A 3SH3A 2WQ4A 1LENA 4BMEA 1DU3D 1WLTA 1W6QA 4DB5A 2R32A 3ZFFC 4MLOA 4GIQA 3WW4A 4WVMB 4YFWA 1TEIA 2JECA 1NA1B 1BQPA 3M3CA 1X36A 4CP1A 3WHTA 3LZZA 4WVVA 3ZPYA 1WMFA 4H55A 1S0CA 2BBVA 1MVQA 3RMXA 4S2HA 4ASMB 3H7YA 1BMV1 2YPJA 5EXOA 3FLTA 1GZWA 2D6MA 1ND2A 3VGIA 1BYHA 1PGL1 3VUOA 4CTEA 1ASJ3 4J6GA 3GBGA 4HK8A 2D6NA 3WDYA 1OD5A 1UCXA 2WSUA 2IXKA 1V9U3 3UKVA 3AMQA 1AL23 1CGPA 3ZFFA 2VGDA 1RJ7A 4NPRA 3KCCA 5T5PA 4AEDA 2UWCA 4ZU5A 2TUNA 2EIGA 1A78A 2YMZA 5CU1A 1KJRA 1RUE2 3PHMA 3ZIWA 1ND3A 1D0GA 1ULGA 3HT1A 3G6JB 3B00A 3KLSA 3D0SA 5BYNA 2DVGA 2XKOA 1TNFA 3WDWA 4FQ4A 1ND2B 3IWZA 2V73A 4E2GA 1FOD3 2ZGMA 3KCYA 3ZFGC 3O7OA 4F8AA 4RGAA 1JN2P 4XETA 4SLIA 4JTNA 4A7ZA 4Z8BA 4AXOA 5J3UA 1J3RA 4H7LA 1M06G 1O5LA 3RYPA 3ZXKA 1OKQA 1RMU3 3HMYA 1DQ6A 4IEVA 1H1IA 2BEOA 4LO4B 4B7KA 1VBC3 1Y7BA 4OHZA 3AFKA 4GMP1 2ZGRA 2R30A 3ZYGA 2BGCA 3NKGA 1G9BA 2GMMA 1CN1A 3KMHA 1WCDJ 3AMPA 1ND2C 4E9KA 3AB0A 1AYN3 2PTMA 1LCLA 3MW3A 1S2BA 1DFQA 2ZAHA 1LOBA 3OGJA 4YVWC 3A0KA 3RMYA 3V0BB 4ATFA 2D3PA 3ES4A 3INAA 3AZVA 1R1ZA 1NA1C 2HEVF 4AI2A 2OUHA 1BEV2 1J58A 4XHBA 3ZXFA 4AVBA 1AR91 4XFIA 4G4FA 5DXDA 4PLNA 1HV1A 2CGOA 4JGYA 3FJSA 4DFSA 4K8FA 4N90A 4N9HA 2NMNA 2R061 2ZOEB 1PM7A 4PBPA 2XVLA 1PZ8A 1HQNA 2A75A 5FFOC 2PFWA 3ETQA 1XYPA 1QOTA 3AP7A 3S0MA 1ZZ6A 4K20A 3NV4A 1FX5A 3A0NA 2PLV2 3UJQA 3PVOA 2G9FA 4PLOA 4P5HA 1C5IA 4Q27A 2GN7A 3IBMA 4OHVA 4YGDA 4F3JA 4QQOA 3VHNA 2ZMLA 1JYCA 1RUJ3 2A3XA 5DG2A 1W6MB 1V6MA 4DY3A 4I0BA 5F6KA 2XJQA 4IV3B 4DRVA 5CFCC 2I07B 3CU7A 5EZWA 4WVZA 3FZ3A 3MICA 4BE3A 5ACA3 1FV2A 2YHJA 1PNFA 1KITA 4AWDA 4KH9A 2AZ5A 1RUOA 3P3PA 1R081 2GZWA 4XF0A 3OBRA 1BXHA 2BFUS 1DG6A 4HT1T 3O14A 5CIRA 3S7EA 2ZA9A 4OI1A 2CYFA 3MIEA 2XWBB 3WR0A 4X6QB 5I8TA 1IPJA 1EY2A 4E2QA 2ZGUA 3N7LA 4Y4YA 1RVF2 1EAH1 1QOSA 5FOBB 1LHOA 1LOFC 1J3QA 2E7TA 1C3HA 2ET1A 1S1AA 1GQHA 4XW3A 3VBSB 2JG8B 4FPJA 1YIFA 4CDQA 3VHOA 3E5XA 4RQPA 5L73A 4Y26A 4PDWB 4YM2A 1TNRA 3NV3A 1PVC1 3JU9A 1ZZ9A 1ZBA3 1V6IA 4XQWA 5KHKA 4YM0A 2SLIA 4XQ4A 2YGMA 3LA2A 4OULA 1H2LA 3V65A 1LULA 1REEA 2A6YA 5GLVA 3SHRA 1DYPA 4YVSB 3AJZA 3ELNA 5DZFA 1SLTA 4JC1A 4W65A 3VBOA 2TNFA 2Q30A 1YHFA 5I91A 1YFWA 2X5IC 1QJZA 5CG9A 4MSVA 4NN0A 1AX0A 2PN5A 3U11A 4Q4W1 1TQ5A 1AYM1 3UL2A 4U2AA 3B69A 5I8YA 5CBLA 2LM3A 3MLKA 4XEZA 1V6KA 3VBUB 1ZRCA 2VOWA 1SMVA 2ZZJA 4MXWA 4AEDC 2ZS6B 1QJY3 1U0AA 4CEWC 4HMZA 5CFCA 1AR81 1NCRC 5BNNC 4YVSA 3VKOA 1RUI3 5HCAA 4LO7A 3JZVA 2GALA 3KCXA 1ZBE1 1U5YA 4UXAA 1IHMA 4LHLA 2DWRA 5JZGA 3B9CA 3WLUA 1KXGA 5DDJ3 2QJVA 4EROA 5DG1A 4EWDA 2PHFA 2R042 4K21A 4Q4V3 3POWA 4L97A 1N3PA 3V0BA 3AZWA 3VBHB 1GZCA 1SFNA 4C91A 2F4PA 1W0OA 2VU9A 4BYYA 5BNOB 1PO21 4OHXA 1PGL2 2ZCWA 1IS5A 2MEV1 3AKRA 1G8WA 1LOFA 5IK8A 2H0VA 2DCJA 2E7QA 1AYM2 1FPN2 3MPPG 2Q8OA 4AHWA 1RIRA 2CTVA 3AKQA 2F6BA 2JJ6A