3UK9A

Galactose-specific lectin from dolichos lablab
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
253
structure length
249
Chain Sequence
b'ANLISFTFKKFNETNLILQRDATVSSGKLRITKAAENGVPTAGSLGRAFYSTPIQIWDNTTGTVASWATSFTFNLQAPNAASPADGLAFALVPVGSQPKDKGGFLGLFDSKNYASSNQTVAVEFDTFYNGGWDPTERHIGIDVNSIKSIKTTSWDFANGENAEVLITYDSSTNLLVASLVHPSQKTSFIVSERVDLTSVLPEWVSVGFSATTGLSKGYVETNEVLSWSFASKLSINKNKLAIFNLEGKA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Legume lectin
publication title Affinity of a galactose-specific legume lectin from Dolichos lablab to adenine revealed by X-ray cystallography.
pubmed doi rcsb
molecule tags Sugar binding protein
total genus 47
structure length 249
sequence length 253
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2011-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00139 Lectin_legB Legume lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3uk9A00
1JUIA 4Q8KA 2A3WA 2YXSA 1PZ8A 3IM0A 3VKNA 3ZPYA 4M01A 2P34A 4BLIA 1VLNA 4JRAA 2GMMA 3OGGA 2FHRA 2TEPA 3HN1A 1FNYA 2ZGRA 5DUVA 5H9PA 4Y24A 1OQ1A 1W6PA 2GN3A 5GZEA 5SV8A 3VUOA 4I30A 1V6MA 1G9FA 4FPHA 4R9DA 1V6NA 4YW5A 1BQPA 1G8WA 1O4ZA 3QLQA 4SLIA 4YLZA 3V0AA 3M3CA 2WSVA 1B09A 4YZ3A 2ZGKA 1WUVA 2CTVA 4Y22B 2ZZJA 4FPKA 2H0BA 3NWKA 1ENRA 3AP6A 2VUAA 1DQ4A 4C1WA 2NP0A 2NMOA 3ASIA 4YGEA 3H0OA 3USUB 1KDMA 5EYYA 1LHUA 2W08A 4C1XA 3WDUA 4AVTA 3GALA 1CONA 4ISRA 1HKDA 1LGCA 1RINA 2JD4A 1SLTA 1Q8VA 3N7LA 2EAKA 1G9BA 1QDCA 4YZ5A 4TZDA 1LENA 3WHTA 1LOFC 1MS1A 2D43A 2GNMA 1LHOA 4K1ZA 4Y1XA 4YZ4A 3WCRA 1SBDA 1N1SA 3RS6A 1G7YA 4L8QA 3UJOA 2ZHLA 4YM3A 4XJWA 5FREA 3SITA 2VH9A 4Y1ZA 4U36A 4FOQA 1V00A 1LEDA 4XBNA 1EPWA 1LU1A 2ZABA 2ZGTA 1V6OA 3NV4A 3B3QE 3B69A 3OPZA 4K20A 4XTPA 1S0EA 3L2YA 4YGBA 1RIRA 1LECA 3WDYA 3HMYA 2D6PA 2D3RA 1VAMA 1AX0A 2EXIA 4K1YA 4DPNA 1Z78A 2R1DA 1DBNA 1AJOA 1LGNA 4PCRA 5GLUA 1D2SA 1GZWB 1UPSA 5H9SA 4FOYA 5E88A 1BXHA 1UN1A 3AYDA 4P14A 5T5JA 1H9WA 1MS4A 1O4YA 4XDQA 2A3XA 2GDFA 1LESA 1FNZA 1LODA 4UW6A 1W0PA 4XHBA 3POYA 3B00A 3AJYA 3WUCA 2PHTA 4XYXA 3ZSKA 2A5ZA 5GLWA 5KXCA 1G9CA 4FPEA 4M3CA 3W58A 2UU8A 4Q1PA 4Y20A 2Q5TA 4HL0A 3R4UA 2ZHMA 5CBLA 5JOYA 5HCFA 4LBMA 5IK7A 3WLUA 4YM1A 4DS0A 1FX5A 2ES3A 2XB6C 1DQ2A 3N3HA 2DU0A 3BODA 3LSDA 1MVEA 2CWSA 1GZCA 1GICA 3V64A 3M3QA 2NN8A 3C2UA 1UKGA 2PHRA 1U0AA 4JC1A 3AZWA 4YGCA 5KXEA 3AP7A 1CPNA 3ZXFA 1V6JA 4M00A 3HR9A 2DUPA 2A6ZA 5HCAA 1LOAA 2VW1A 4XJAA 1F9KA 4XMAA 1SLCA 4UW3A 3WUDA 2KM2A 2DVBA 3NV2A 4BMEA 1SACA 1Q8QA 1ENQA 4ATEA 2DTYA 3FLTA 1WLDA 3A0KA 1DLLA 3AP5A 1V6LA 3AXEA 1MACA 2JDZA 4FPGA 1S1AA 1S0CA 1ENSA 1N47A 4FPYA 5JOZA 1JYIA 1MZ6A 4Q26A 4XHXA 1JW6A 3IN9A 5JVVA 2D6MA 1KITA 4P9WA 4P9YA 5E8AA 5H9QA 1ULGA 3WV6A 1V6KA 1Q56A 3N7MA 1QOSA 3KQRA 2VY0A 1CVNA 1DYKA 5IUQA 3RQ0A 3OYWB 3WCSA 1I1EA 1JHNA 5GZDA 2WT0A 4F83A 2DVFA 3AZVA 1KJRA 3JU9A 4Q1RA 1N1VA 2CYFA 1LHNA 3V65A 4FPJA 3V0BA 5L73A 5H9RA 4NOTA 4ISQA 4P9XA 1MS9A 1W6NA 3OY8A 4GALA 4AVSA 2E51A 2NYYA 3SNMA 1H9PA 1N3PA 3INAA 4PF5A 2DVAA 5LK5A 4AGRA 1D0HA 4IQPA 4Z8BA 4YG3A 1JOJA 2GNDA 4LBOA 1F31A 1PZ7A 1GANA 4LBQD 5DZGA 1KDKA 2B7YA 2R49A 3AFKA 1IS5A 2RHPA 2AH2A 1KRIA 2E7TA 3FLRA 3PJQA 4AWDA 2SBAA 1JBCA 1W6MA 1LOFA 3NV3A 5HCBA 1FYUA 3ZSJA 1V6IA 4OZXA 2A70A 2ARXA 4XJ9A 1N3OA 3ATGA 2ZMKA 1CJPA 1I3HA 3CNAA 2OUJA 3N36A 3R05A 1WD4A 4YW4A 1CESA 3ZXKA 3ZSMA 1OKQA 1QU0A 4FP2A 4RA0A 4WVWA 5CNAA 4R9AA 3AZZA 2R1BA 3ZYPA 4UW5A 1ULFA 1YYNA 3IPVA 4YW3A 4XJ8A 4DRVA 2W52A 3M1HA 4GWNA 3B01A 1QOOA 1DZQA 4XMIA 2VW0A 1SBFA 2ZMLA 4XILA 4Y26A 2D3SA 2YV8A 1N3QA 1SBEA 4LBQA 5DXDA 1G9AA 2A7AA 1NLSA 1SLBA 2DYCA 1W6PB 2GMEA 4XOGA 5AVAA 1SLIA 1C57A 4ZXKA 3MPPG 1WLWA 4XXAA 2A6YA 4WZFA 1Q8OA 1ONAA 2WLQA 3V0AB 2P2KA 3MW2A 3WG2A 1SLAA 2C9AA 3FBYA 4FPLA 4XBQA 1MS3A 2YY1A 3SISA 1HLCA 1YIFA 2EF6A 1GLHA 1HQLA 3WDTA 1HQWA 2A3YA 4WVVA 1QNWA 2BQPA 2AUYA 2V5YA 3WHUA 1DQ5A 3LCPA 1AXKA 2EXJA 4FPFA 3WNXA 1W6QB 3FLPA 4BLJA 4LBJA 1TEIA 4R9BA 2ZKNA 1GYKA 4GA9A 2E6VA 3AZYA 1LJ7A 3OJBA 1W6OA 2FMDA 5F5QA 1GKBA 4AYUA 3PMEA 5DG2A 1APNA 1AJKA 5CA6A 2GNBA 1URXA 1ZM1A 3PVNA 1QF3A 1YI7A 2UWAA 3O0VA 4FPCA 2ZHNA 5KXDA 5GALA 2WJSA 4R9CA 2A6WA 1DIWA 3FUQA 3NV1A 2ZHKA 3QCWA 4XZPA 1CPMA 3W59A 3MW4A 1S0IA 4YG6A 1IS6A 5DG1A 1FV2A 2PHWA 5GZFA 1UZYA 1AVBA 4W65A 5GLVA 2CWMA 2WT1A 2OUHA 3ZXJA 1DQ1A 4CZSA 1S0FA 1SCSA 4Y1UA 1N1TA 3O5SA 1CR7A 1Q8SA 1R1ZA 2DUOA 4BM8A 3TB0A 2D6LX 1KJLA 2R16A 4Q8LA 4YFWA 5BYNA 5F9TA 1MR5A 2GNTA 5GM0A 4RL7A 3AJZA 5EXOA 3KM5A 3VKLA 2V73A 1DFQA 1DQ6A 3UK9A 5JDBA 2D3PA 1QNYA 3B9CA 2E53A 2JECA 3R4SA 1YO8A 1IKQA 1AX1A 1JYCA 4D69A 3N35A 4M3CB 1LOBA 5EYXA 2EXKA 2UWCA 4Y20B 4AGVA 1BJQA 3O0XA 3RSJA 1MS5A 3UJQA 1A78A 4FOVA 3AX4A 4HANA 3T1MA 3WG4A 1UZZA 4JCKA 5T52A 1N1YA 2ZGPA 3AZXA 1OFSA 2WT2A 1QGLA 3AXDA 4YM2A 5CB7A 1LOCA 4XBLA 2AREA 3M2MA 1IOAA 1XQNA 3SH4A 2P3KA 1IKPA 1X50A 1GZ9A 4GKYA 2A75A 4PBPA 2YZ4A 4Y22A 1YXWA 4XXPA 4U2AA 1Z0HA 2P3IA 3Q9OA 3BOPA 1LOGA 4XJUA 3USUA 3T1LA 3WDWA 3ENRA 1NXD1 3IMNA 4XJZA 1WW5A 1BKZA 1WCSA 4AGGA 5IK5A 5IK8A 2AR6A 4LBLA 1UMZA 3M3EA 3ZSLA 3A4UA 5T55A 1UAIA 3ILFA 2EXHA 5KXBA 3POSA 3WOGA 1KQRA 1GNZA 3VV1A 1W0OA 4GXLA 4KBBA 4MYEA 3UL2A 3WVJA 2DU1A 3MW3A 1SCRA 5FRAA 1LTEA 2PHXA 5T50A 1ULEA 1ZA4A 3ZXEA 4YW1A 3T2TA 1WD3A 2PHFA 2EIGA 3V0BB 5GLTA 2DURA 1W6NB 1A3KA 3OY8B 3PVEA 4Y1YA 4FP3A 2VU9A 2ZGOA 4XE9A 2A71A 4BQ1A 3OBTA 1YRZA 1ULDA 2VXRA 2AGSA 2HYKA 1S0DA 3GNEA 4GKXA 4FQ4A 4ATFA 2AYHA 3WDXA 2WSUA 3SH3A 2R0FA 3O0WA 1CQ9A 1WW7A 2CY6A 3RG0A 5T5PA 3OBRA 5JOWA 1WBFA 3D5OA 3JUUA 3M3OA 1AF9A 4NO4A 2CNAA 1GZWA 4YM0A 5IT6A 2W68A 3I8TA 4CTEA 1AXYA 1FATA 1FV3A 1LEMA 3N7KA 1CN1A 1LHWA 1W6MB 1W6QA 2GALA 2PELA 4FVVA 5EWSA 5T5LA 3AYEA 2UURA 1IS4A 2WKKA 1AZDA 5T5OA 1LGBA 1SFYA 3DUIA 2NM1A 1JXNA 5GLZA 2YMZA 1MVQA 4Q27A 4WV8A 2VW2A 3WZ1A 1MS0A 2D7FA 3A0NA 1LOEA 1GSLA 1CIWA 4FOWA 4UW4A 5DUWA 3RRDA 3SH5A 3VKFC 3AYCA 5JOXA 2ZGMA 1LULA 2NZ9A 1VAVA 3IPVB 2I2SA 1MS8A 3O12A 3VKMA 3PVOA 1LU2A 3I4IA 1ULCA 3RMYA 4YZ2A 1DHKB 4LBNA 1QOTA 4FQZA 3D4KA 2A6VA 3SLIA 1C4RA 4DFSA 3AK0A 2A6XA 4ITCA 1RITA 1GNHA 4LBQB 5GZCA 4YZ1A 3U4XA 4GWMA 1WW6A 5DZEA 2GN7A 3RMXA 2D6OX 2DUQA 2Z42A 1DYPA 1G86A 3WDVA 2DWRA 1H30A 2EALA 1WLCA 1UL9A 2D44A 2ZGNA 5IK4A 5DZFA 4YGDA 3BIWE 1C1FA 4XIOA 2G4IA 2ZMNA 1S0JA 2ZGUA 2P37A 2GMPA 1DGLA 3POWA 5GZGA 1PZ9A 1FAYA 2AENA 2OW4A 4CRQA 3VKOA 1WW4A 2ZBJA 1JN2P 4DQAA 4XIKA 1SLLA 2DVGA 4XTMA 3ZYRA 2R0HA 2PHUA 2JJ6A 5DUUA 1G9DA 1AXZA 2UWBA 3ILRA 1S0GA 4K21A 4YW2A 3OYWA 3FFZA 1IS3A 3MEPA 4ZKTB 2WQZC 1W6OB 2DV9A 1QKQA 3AP9A 5CAZA 2D6KA 1Y7BA 2ENRA 4M3CE 2ERFA 3ZXLA 1VIWB 2ZAAA 3LSEA 5JLVA 1LHVA 4Q2FA 1LCLA 2ZGLA 1Q8PA 4BPZA 2JKBA 3ZVXA 3D6EA 1WBLA 1DQ0A 1J1TA 2W39A 2C5DA 2P3JA 4Y1VA 1QDOA 4AVVA 4PQ9A 5JMCA 1F5FA 2LTNA 2WNEA 1GV9A 2NMNA 1HDKA 1QMJA 5GJ6A 1AX2A 2CL2A 3APBA 1GBGA 4ASMB 3DGTA 5E89A 4BOWA 2ARBA 2ZGSA 2ZA9A 4YFZA 4TYSA 3ILNA 1C1LA 2YROA 2DVDA 1VALA 2SLIA 2ZACA 2E7QA 1BZWA 4PBOA 4M3CF 4YG0A 4DRRA 3FUOA 2DTWA 3WG3A 3AP4A 1A8DA 3N7JA 4LBKA 3AYAA 1UX6A 1MZ5A 2D6NA 2OVUA 5T54A 2LALA 3IKWA 4BMBA 2ZGQA 1S0BA 2XG3A 5DUXA 2JE7A 2JE9A 3WG1A 3TAYA 4FPOB 1BYHA 3BTAA 4H55A
chains in the Genus database with same CATH superfamily
1XYOA 4Q8KA 4CCOA 3RDIA 4LULA 1PZ8A 3ZPYA 2W94A 3GHNA 1OSGA 1UW8A 2H6CA 4GD4A 3VZMA 2V5DA 4JRAA 5I0UA 2TEPA 3HN1A 5LA2A 5H9PA 1MQTC 4RFRB 4A7YA 1ALYA 3OEBA 3OPWA 5C8CB 4FPHA 1RUJ3 2PN5A 3OF1A 4YVSC 3WF4A 4FO9A 5IVCA 1UYYA 3HN3A 4YLZA 3ME2A 5FYBA 3V0AA 2BRTA 3NO8A 2XJVA 3ROUA 4Y22B 3ST7A 2CAVA 4FPKA 3AL5A 2WWUA 3NNLA 3OUIA 1BMV2 3CU7A 3I2KA 1E57A 3I7DA 4C1WA 2WS91 5JCTA 5DMYA 4BQWA 3ZN5A 4YNIA 5EYYA 2VMEA 1LHUA 1GNYA 1F4HA 5HXVA 2BU9A 3KS7A 3JD72 3T2QA 4C1XA 3WDUA 1W90A 3U37A 4CDWC 1ZBA3 1RINA 1PMIA 2JB8A 1SLTA 3EJKA 1Q8VA 1KS4A 3N7LA 4NHXA 1JYXA 1TME1 4GZ9A 4CUAA 2ATFA 4RN5A 3P3NA 1MS1A 2Y6FA 2GNMA 4K1ZA 4QD2A 3AM2A 2VZSA 4Q4X3 1SBDA 3NL1A 3NNGA 3ES1A 2WO3A 4CA9A 3CIHA 2D5HA 1RC6A 3E6DA 2ZHLA 2XJTA 4XJWA 2WNUC 3SITA 3VBHC 2VH9A 3E5QA 4BB3A 5KHHA 4LIUA 4IW3A 4PI0A 2WR9A 1V6OA 3E1F1 3B3QE 4XFHA 1XNCA 1H1IA 2PA7A 4YGBA 1RIRA 1LECA 1RUI2 3WDYA 1C3HA 1PO23 1W8UA 2GP3A 4K1YA 3BN6A 5F5AA 3WXPA 1AL0G 4LTAA 1TMF1 5JI7A 4OHXA 1LGNA 5GLUA 1EV12 2LUWA 5E88A 5C4WA 1DLCA 2A3XA 1RUF1 4EN7B 1FNZA 3POFA 1SZBA 2Q1ZB 1RMU2 1VBB1 1NZIA 2ORZA 1W2UA 2XJUA 3B00A 4XYXA 5FPAA 5KXCA 1G9CA 4JV4A 1O3QA 1PGW1 4FPEA 4RHV1 3R4DB 4BH9A 5FKCA 1QJX1 5DDJ3 2WO2A 4PF1A 4HL0A 2TBVA 3R4UA 5G04L 4PHZA 4JDMA 5ANQA 2MEV3 2GU9A 2ES3A 4FXGB 4AI9A 1DQ2A 3N3HA 3LSDA 3BODA 3RPQA 4D7SA 4Y33A 2R063 3V64A 2JD9A 3VB9A 3AZWA 4MGYE 2W3JA 4AQTA 4WM7A 1CPNA 1F35A 2OA2A 3ZXFA 4GQ7A 4DY5A 1NUKA 3FWEA 5CFCB 1XSRA 4X8PA 4XJAA 5HCAA 4XMAA 2YHJA 4UW3A 4E2GA 1RUC2 4LKEA 1R082 2DVBA 2R043 3I3EA 1HB2A 4K3UA 4WBBA 3ZFFC 4I0AA 4BMEA 1ENQA 2VQAA 2DTYA 1DLLA 2VNGA 3AP5A 1FPN3 4NAMA 2JDZA 3K48A 2VCBA 3NJXA 4QMAA 4R4XA 4FPYA 4IXLA 1MZ6A 4XHXA 5JVVA 4CEWA 1NCQB 4CDUB 4PDWC 1GQGA 2AACA 4D7TA 3L9JT 5I93A 1O3RA 3THPA 2WABA 3ZM8A 1QOSA 3KQRA 4MGQA 2VMDA 5GZDA 4UFJA 1RVF3 1DDLA 4F83A 1ST8A 2MHFA 3UKVA 3OBZA 2CYFA 4B3NA 3W5MA 1LHNA 4XZUG 1PVC2 2HEYF 4WM8A 3V65A 4EZHA 1DP0A 2W87A 1UXZA 1UY1A 2JG8C 4P9XA 1H8VA 1W6NA 3OY8A 4GALA 1QJU1 2E51A 2ZX3A 1JI6A 1RUD3 1U5IA 4AGRA 2DVAA 3VDBA 4IQPA 1UU5A 3RYKA 3I2FA 4J1XA 4LBOA 3MIFA 5HV4A 1GANA 1OA4A 2RDRA 4AEMA 4ARXA 4RQPA 2BVBA 4GJYA 3E6BA 5DZGA 1AR62 1IG3A 3GZUC 4N53A 3AFKA 4QQPA 3GF6A 2FQPA 4FXKB 3BYWA 3FLRA 1UOGA 3PJQA 4YPJA 1HRI1 2HEWF 2O0OA 4AWDA 1ZYBA 2WFPA 5CU1A 5C8CC 3N9PA 2FDJA 2W1SA 2ARXA 2B45X 5CEHA 1XE0A 1XNKA 1I3HA 3RYRA 1AYN1 2DBIA 3R05A 4QU2A 5ACA2 4YW4A 2D5FA 5DAQA 3AKTA 4DNYA 2EAAA 3LOIA 2XUEA 2G9FA 3GYDA 1XNDA 4OUSA 1BBT1 4FP2A 2V4VA 1ZRFA 3KCYA 5FK8A 2R1BA 3ZYPA 4AE2A 1YYNA 3GGLA 3IPVA 1SEFA 4IV3B 4XJ8A 3ZMOA 4BXFA 2P3YA 4GWNA 2HWE3 3B01A 4DRVA 2Y8KA 1YQ8A 3IAQA 4DIQA 2UY8A 2WS93 4XACA 4BK4A 2OPKA 3T08A 2JICA 1OD5A 3VL9A 4KWJA 1NKGA 4Y26A 3VHPA 5LY2A 3ZFEB 1SBEA 4LBQA 1NLSA 2Y34A 5J7MA 2DYCA 2BNMA 1TME3 1W6PB 2GMEA 2WIIB 4XOGA 1COV1 3CJXA 4Y4YA 4ZXKA 3RGBA 3MPPG 1WLWA 4XXAA 1POQA 1JTZX 2WLQA 4W4ZA 1PO13 1BK0A 4LE4A 2WLPA 3WG2A 4EJRA 4W8JA 4JRLA 5C9AB 1SLAA 4FPLA 1ASJ2 4XBQA 5K9YA 1MS3A 1W2OA 3J4UH 4ES8A 3HNYM 5BNQA 1AUYA 3WDTA 3O1TA 1QNWA 2V5YA 4QDQA 3AMQA 5J09A 4O61A 1ZNPA 1DQ5A 1I5PA 4CXYA 2FDKA 2X09A 2EXJA 5FYMA 1D4M2 3TN92 3WNXA 2C0ZA 1PMJX 1W6QB 4LUKA 5A3UA 3LE0A 1C28A 1TEIA 1GYKA 4NMIA 4QB6A 5F5QA 2FMDA 1R1A2 2JDNA 3NNFA 4AYUA 3GBWA 1WKYA 1YQ6A 2E7AA 3T4HB 4O65A 3BPSA 1PK6C 2UWAA 5KXDA 2VZVA 1MZFA 5FXWA 4QX8A 4CCEA 4XZPA 2ZHKA 3LIGA 5FP7A 1LNSA 1S0IA 1AR82 2TNFA 1QJX3 1YQ2A 3WNLA 1FV2A 5CISA 3LA3A 3MFAA 3ZXJA 4EN8B 4KNCA 2QCSB 3C3VA 1EPZA 1FOD2 3IWZA 2DF7A 4P08A 2VCAA 1Q8SA 3SC7X 1R1ZA 1D2QA 4BQ2A 3TNQA 5LZ6A 2R073 1F4AA 2R16A 1CIYA 1OUXA 4Q8LA 4XUNA 2YC0A 5HCHA 2X05A 4RL7A 3POIA 3OD0A 2J1UA 3RJ2X 3KM5A 5FMBA 3VKLA 3LKJA 2VO5A 1EAH2 4LHSA 2V73A 5CFCC 1DFQA 5JDBA 2D3PA 2Y0IA 1RUOA 2XQRA 2VMIA 3J26N 3MLLA 3R4SA 1NE4A 5F3EA 4NHLA 4AVBA 4OLLA 5FY8A 5FZ4A 3UETA 4D69A 1VBD1 5DAVA 3N35A 4M3CB 5J3UA 2EXKA 2HLEA 2UWCA 2VBBA 1SPPB 1K5MA 1BJQA 1MS5A 4RSUA 5F6KA 1A78A 5IATA 2Y6GA 3AX4A 3T1MA 4ZS2A 5FMOL 1NCQC 4CDUC 3JBG3 1XRUA 4INDA 1RGSA 1XOYA 3H1WA 1A6CA 4Q4W1 5CB7A 2YFUA 1XQNA 4PIXA 1EUTA 1IKPA 4QPYA 3KF3A 3WW4A 3TEYA 4GKYA 4IERA 2BNNA 4PBPA 2KXLA 2YBPA 4NIIA 1YXWA 5IVFA 3WNOA 5JAXA 5FYTA 4LITA 3BOPA 4WZCA 3LEGA 2VTFA 4Y5SA 4XJUA 3USUA 1H6YA 2HWC2 1OMIA 2RMU2 2RDNA 2JDKA 1HRV2 3W9AA 5IK8A 5IK5A 1UOBA 3PLQA 3ZSLA 3A4UA 4QKBA 4KU8A 2EXHA 4YVWA 5KXBA 5LEKA 1GNZA 3VV1A 1HRI3 3UL2A 4YARA 4Z82A 4B4QA 4NRPA 1FMD1 2PHXA 3PTRB 2FBEA 1EYBA 2VCCA 3ZXEA 4UFHA 2EIGA 4AFAA 3V0BB 4EN0A 1UOFA 1X9TA 4Y1YA 4BIFA 3O1MA 5JIUA 1NY71 2PAEA 4FP3A 3DEMA 3J8F1 4JAAA 5FZAA 2ZGOA 2VECA 5EFUA 4AHXA 1GQPA 4BQ1A 3OBTA 1ULDA 2VXRA 2Y33A 4IV3C 1NA1A 1S0DA 1D4VB 2WUHA 4ATFA 2AYHA 4LIVA 1QHDA 4JGYC 3PU3A 4QPGB 2OKXA 2LM3A 2R7EB 3ZOIA 5JOWA 5KHGA 1PGL1 3D5OA 5GKAC 1OFNA 3MIHA 4NO4A 2AZ5A 3ZFEC 2QQOA 1VBA1 5IT6A 2W68A 3VBOC 5FPBA 3K77A 4HVOA 5A1FA 1JZ3A 5JWPA 1ND2A 3NJZA 2HBUA 4J1WA 1MEC3 1O8PA 1VBC1 1X8EA 4L0PA 4OI4A 1QQP1 3X29B 1AZDA 5T5OA 4GAZA 1LGBA 1AR72 2X5IC 3O1VA 1JXNA 5C9AC 2YMZA 4B1LA 4ZXEA 2VW2A 3VZJA 4FOWA 3SH5A 1ZZ6A 4UW4A 4UI9L 3RRDA 3VKFC 2YGLA 1X82A 3M4FA 4BXSV 4KH9A 3O12A 3LF7A 3ZIXA 1CX4A 5L36A 3DECA 2OT7A 3KZ4C 3KCXA 4NN0A 5LATA 2G9ZA 4LBNA 1W9FA 4Q4Y3 1ZBE1 4FQZA 3D4KA 2K0GA 3DXUA 1S2KA 4N43B 4DUVA 3HJRA 4A6OA 1GU3A 3GBFA 2XXZA 3LFIA 4FCAA 1GNHA 1PHMA 2RJKA 5FPLA 1OOPB 3U4XA 2VZTA 3HIFA 3KGLA 4HSJA 2Q1FA 2DUQA 3GM8A 1B35B 1W9SA 5CFDC 1NLRA 1XU2A 1JS9A 1FT9A 2Q4SA 3MICA 5FY9A 1R093 4TLFA 1HQNA 2O14A 5DZFA 4CDXA 2VZUA 3H1MA 5A1AA 4JGZA 5EJ3A 4KI5M 3WNMA 3PHMA 1BEV3 2B4KA 2AENA 3ZMNA 4QWNA 2VE1A 2I07B 3VHOA 1KFUL 4LE3A 1SLLA 2DVGA 4XIKA 4XTMA 2R30A 3IZOA 1MPXA 3VBRB 5FYCA 4LT5A 1HN1A 1C8M1 3D0JA 1CZSA 3AVSA 1VBE2 3JQXA 5FY1A 1AXZA 5JI9A 3GXUA 5A6XA 1S0GA 2YG0A 3OYWA 3MEPA 2P17A 2WQZC 1K45A 1W6OB 3B7MA 5L7OB 3AP9A 1J59A 1JOPA 2A73B 3DV8A 4EV0A 5CAZA 4DXSA 5F5CA 5KHIA 3WF3A 2JENA 5CADA 1C5IA 5LBBA 1LCLA 2Q8DA 3EYPA 5FMDA 3B02A 4EN9B 1DQ0A 1J1TA 2WZ8A 3P6BA 4ES9A 1CAVA 5JMCA 1VBD3 1F5FA 2LTNA 5C71A 1GV9A 2NMNA 3UV9A 2Y38A 4GWJA 1GBGA 4ASMB 2NPIA 1O5UA 2DCJA 4YW7A 5FZIA 5E89A 4BOWA 2ARBA 2H6BA 2YYOA 2JB4A 4CXWA 3GBGA 4FFHA 2IFRA 2VVFA 1OH4A 4MXVA 3ZFGB 2ARAA 4GJZA 3H7YA 4AI2A 2WFF3 2OZJA 3O1PA 3FHAA 4BCUA 1BZWA 2BFUS 2DTWA 4W6XA 5JR7B 5F2SA 3N7JA 5A6QA 1H8TA 3AKRA 3VBUA 2KA3A 2QE3A 4F8AA 4UXAA 4COYA 2XJRA 4WVMA 5FZGA 2JE9A 3HWJA 4YRDA 4H55A 4XURA 1GWLA 2VL4A 2WO7A 4CP0A 3ZIWA 5FYHA 2WZPP 3VKNA 5AFEA 3URFA 3ZYBA 1RUJ1 1MQTB 2RS32 3E97A 3K4DA 4BLIA 4D6RA 5FCCA 1OD3A 2BGOA 2ZEWA 3J7MA 4G4FA 5CIRA 1FNYA 1NQDA 3AMPA 3LDKA 1OQ1A 4HK8A 3ZN6A 2GN3A 3T4VA 2WC2A 2Y6HA 1XNTA 1BCXA 1V6MA 1QJY2 1G9FA 4YW5A 1V6NA 2QQVA 1OLMA 4FFGA 5ANNA 1O4ZA 2QQPA 1QJFA 2VMHA 2WSVA 3NW4A 4YZ3A 5FUPA 5IJRA 2BWCA 2XL7A 2VOKA 2ZZJA 3H50A 1ZBA1 5FYSA 5C3SA 4GB33 4LHLA 2VUAA 5KR7A 5TSWA 4L97A 1SDDB 2JDUA 2NP0A 1W2TA 3J8F3 2NMOA 3T30A 5LRSA 1IG0A 3H0OA 1X36A 1DGRN 1KDMA 3I3DA 1JYWA 5F5IA 3CQOA 4OCTA 4IE7A 4Q4X1 3SEEA 4HONA 2G9GA 1HW5A 4QPGC 1CONA 4ISRA 2JD4A 2B8MA 1CAXA 5BNNA 4OVEA 3QD6A 3I59A 2VULA 3PJYA 1G9BA 2IXCA 1FXZA 1LENA 3WHTA 4A4AA 4ZZ8A 2D43A 4KWKA 3NMBA 1LHOA 5I8SA 4V1PA 2IXJA 4XDOA 1GP4A 2JEMA 1LAJA 3MHZA 2E63A 1N1SA 4HXCA 4UFKA 3R0RA 5BNPB 4U36A 2XLGA 1LEDA 2Q8OA 3ES4A 3DYMA 2VR4A 2ZGTA 3NV4A 3B69A 4QX5A 2QNKA 3BPZA 4E9KA 1S0EA 2PLV2 3I3MA 4XCBA 4NE9A 4WVZA 2V4AA 1S55A 5A3NA 1VAMA 1AX0A 1ODNA 2A1XA 4AAXA 5KHKA 2PYTA 4N43C 2E31A 2R1DA 2XHKA 5LCWL 4P00B 4AI0A 3LA2A 5FFOC 2HWF1 1O3SA 3OOXA 1MZEA 3E6CC 4FOYA 3T09A 1UN1A 2WZR3 5DDJ1 1MS4A 1VRBA 3K75B 4XDQA 5F39A 2WQ8A 1LESA 4XHBA 1B35C 1W0PA 4HMZA 1YJLA 3AJYA 1YQ5A 3VZLA 4JDNA 5A3LA 3WF1A 4AQ2A 1OPOA 5GLWA 4A3ZA 4LLOA 2HWB2 3VN4A 4UAPA 4CCMA 2QVSB 2UU8A 1NZCA 4Y20A 4DEQA 2R061 1NOVA 5FPXA 2LRPA 2GH8A 3WLUA 2WBKA 3BGAA 3POBA 5CYYA 1FX5A 1L7LA 4KQ7A 4QX3A 5FYZA 2XMLA 4PLMA 4XF0A 2MNGA 2DU0A 3VBRC 3W59A 3N9NA 1E5HA 3CEWA 2CWSA 1E5SA 3KMHA 4IE6A 1GICA 4L9BA 4AQ6A 1O7FA 4BK5A 2PHRA 4JC1A 4JX0A 4OMCA 5IYYA 5KXEA 4OI0A 5L7OC 2J42A 1TQ5A 2A6ZA 2ZCWA 1ZZ9A 1LOAA 1WZXA 3WUDA 5IVVA 4I02A 2KM2A 3NV2A 3Q8AA 1RXFA 1EP0A 1LRHA 3CJIA 3MBWA 1NCRB 4ATEA 3ELNA 3A0KA 3SQOA 4HPKB 1RUE2 2RS13 4Q29A 5A33B 2VOXA 2VZQA 3I2HA 1S0CA 3S7IA 4OQ8A 1RVF1 1YFUA 5A7WA 5A3OA 1W28A 1AHSA 1REDA 1RHI2 5H9QA 1ULGA 1Q56A 3RZGA 3H9AA 3N7MA 1AYM2 1DF0A 1DYKA 3RQ0A 1KS5A 1VRH3 2GC3A 2VJXA 5L9RA 1RUD1 1JHNA 3GCWA 4IEPA 4UYBA 3ZFGC 2WINB 1Z7S2 2F4PA 5IVJA 3S30A 4Q1RA 1KJRA 1N1VA 1E5RA 1O5LA 2JDYA 1W05A 2ZOEB 5ABJB 2NYYA 1IGOA 3IT8A 3O1OA 3VBSA 4DB5A 1YEWA 3MIGA 3PUQA 4Z8BA 3O1UA 4Q0UA 1F31A 1G6NA 4LBQD 5HPOA 1WWYA 3FFQA 4IGOA 1P8JA 1H4HA 1KDKA 2YUEA 3H7JA 5FLJA 5CG9A 2B7YA 1HB3A 2R49A 3JZVA 4I09A 2KD7A 3CLPA 2RHPA 2AH2A 1W8ZA 2WWSA 2E7TA 2EICA 1F5JA 3Q8BA 3JCIA 4LQRA 1W8OA 4IV1B 1C8NA 2IWGB 5JXHA 1US2A 2SBAA 3MLKA 2OX0A 1LOFA 5HCBA 1FYUA 4XC9A 1RUG2 3BTZA 3A7QA 3ATGA 1W03A 5BY5A 3OGJA 2O8QA 2HWE1 1WD4A 3ZXKA 2QQNA 4LOTA 5FO7B 3H1YA 2CGPA 1OKQA 2WN2A 3AVRA 3NQHA 3UGFA 3WEZA 5L19A 1JZ4A 4WVWA 3JD73 3KT7A 1ZREA 1ZZ8A 5A7QA 4LPLA 3LEIA 4PLOA 1WMFA 4TWTA 4ZU5A 1OKOA 1O91A 1UYZA 4B7EA 5D2AA 2W52A 1VR3A 3M1HA 1JZ5A 2P5BA 3KT4A 3T0AA 1RJ8A 5FP4A 5FWJA 1QOOA 4NROA 1GOFA 3NAPA 5JSOA 2HWD1 2ZMLA 3DL3A 4OZOA 4LO5B 4DY3A 4MUVA 1PO11 1TE1B 5LA9A 1XBFA 1N3QA 2YV8A 4KG8A 5DXDA 1W3XA 5JXJA 4BE3A 1DGWX 1SLIA 1C57A 2VZPA 3NNJA 3UT0A 5BNPC 1ONAA 3V0AB 2C9KA 2JG9C 1RUI3 1FI2A 3V56A 2C9AA 3FBYA 4AL9A 3WP3A 3RZLA 4S2HA 1YIPA 2YY1A 5DAWA 4E2SA 2EF6A 3SHRA 1HJFA 5FJKA 4A7KA 4QB2A 4BQYA 3WHUA 5FKBA 2VVEA 1UD1A 1AXKA 1IPJA 4FPFA 2IZWA 2X10A 2QUOA 3FLPA 4AI1A 1HJGA 4BLJA 4XQDA 3EB7A 4COVA 1UY3A 4GA9A 1J84A 4LOSA 4PJYA 3M8LA 1PK6B 4N7IA 1WCKA 2WNVC 2HWF3 4GMP3 4AFMA 4FAHA 3BALA 3PMEA 5D8AA 2Z2SB 5FZOA 5HBAA 1TG7A 1APNA 3EO6A 1AJKA 2ZAHA 1UOJA 3TNPB 2GNBA 1URXA 3PVNA 5HI0A 5A1LA 2W5FA 4FPCA 3J7NA 3WD5A 1UYPA 5AC91 1FOD1 2A6WA 1JODA 5A7PA 2CU5A 2RS52 2W9XA 5FY0A 1M06G 4O9GA 1CPMA 2R071 1QXRA 2RDQA 3ZXDA 4CYDA 1OBNA 2ORXA 4YG6A 2QQMA 2PHWA 5J96B 3LOBA 1UZYA 3ZN4A 1AVBA 5D1IA 5EQUA 1EAH1 2BOJA 3C7OA 2WL1A 1SCSA 1SQ4A 1JZ8A 2IC1A 1N1TA 3N4MA 1W2NA 3NRUA 4CCCA 1UO9A 2D6LX 4DXRA 5F9TA 1MR5A 1R083 5GM0A 1GWMA 4AQSA 5A80A 4QX2A 5C4WB 4H2AA 4XF3A 4RGAA 1XYPA 2FZ2A 4EE2A 2FZ1A 2MEV2 2VZOA 5A7OA 5LBCA 2G1MA 4RFT0 3UK9A 2JDMA 3B9CA 1AL22 3CO2A 1NCRC 1YO8A 3FN9A 1JYCA 3JBG1 5FZ3A 1YQCA 4QM9A 3RZZA 3N9QA 3RNSA 4PIYA 3O0XA 3K4AA 3RSJA 2WYSA 1UZWA 5J36A 1A8MA 5AFBA 3ZYGA 3AZXA 3ETPA 4CCLA 1PVC3 3ZX7A 2D98A 3AXDA 4QB1A 4WM7B 2E32A 1W8FA 4ZU7A 2D40A 5T3NA 3SH4A 3KD4A 1GZ9A 4HZFA 1BLZA 2B9UA 2GH2A 1JZ7A 3HNBM 2XBO2 5ABJC 5I8YA 2VZ3A 2WAOA 3CZUA 4XXPA 1Z0HA 4NUBA 4PLNA 1XNAA 1LOGA 3A22A 4AR2A 2J1EA 1CAWA 3T1LA 5FQ0B 3WDWA 3LB9A 3ENRA 5C3OA 3TEXA 3WQBA 3KV9A 1WCSA 4QX1A 3PDQA 1IZ3A 2BEOA 2KR2A 4IEVA 4OYUA 4CEWB 5KC5A 5BV6A 2JIGA 1UMZA 3M3EA 4XUOA 4IV1C 5CKNA 1UAIA 5KHJA 3HOBA 4LEJA 1HXS2 3BUCA 1RB8G 1KQRA 3BVCA 3FHQA 4AXOA 3T0DA 4GXLA 4KBBA 1SCRA 3MUZ1 2ET7A 1ZVFA 1HV1A 5T50A 1CD3G 1DGRA 1ZA4A 2VMFA 1JU4A 2W92A 2ZS6B 4LA3A 3VDDA 1VB2A 3SEPA 4YW1A 3T2TA 3TYJA 2PHFA 4WM8B 4A44A 2RE9A 3OB8A 1W6NB 3OY8B 3BU0A 2JIJA 3G6JB 3J9SA 3QOPA 4I3GA 3VBFA 2VU9A 2CGNA 4LKDA 4Z2AA 4JGYB 1OLRA 4XF4A 4EROA 1JYNA 2BPA2 4RQPB 3SH3A 3VBOB 1MEC1 1WW7A 4N53B 4CU8A 5T5PA 1DYOA 2PFWA 3AL6A 3OBRA 2YBSA 3VD7A 1YC61 3JUUA 3M3OA 3O14A 5FJHA 1OLQA 2HWD3 1GZWA 4YM0A 4TTGA 5F1RA 2IXIA 2JWPA 3I8TA 4QQOA 1FATA 1LEMA 3N7KA 3GZTB 3T2PA 1CN1A 1LHWA 1W6QA 2GALA 2X5IB 4OUMA 5EWSA 1ASJ3 3F2ZA 5T5LA 2W47A 4MGSA 2UURA 1IS4A 4W50A 1U5ZA 5K0UA 2WS92 1V70A 1SFYA 3DUIA 4CCKA 2G19A 3PL0A 5FZHA 1OQDA 2XDVA 3KVAA 1YI9A 4JTNA 4Q27A 4Q4Y1 1KGYA 3BB6A 1MS0A 2D7FA 1YWKA 3A0NA 1GSLA 5K8SA 1VMFA 1D4M3 4MV2A 4QQLA 4MH0E 5FUIA 2NZ9A 3IPVB 1TME2 2BJSA 1MS8A 2J7MA 3KQ4B 3VKMA 4D6SA 3GZEA 4AHYA 5FR3A 1LU2A 1ULCA 1R1A3 1DHKB 5C3QA 2A6VA 1UY0A 3VZNA 1R091 3SLIA 4ZY9A 3AK0A 4CDQA 4E8DA 4ITCA 4XCAA 5CFDB 1EY2A 4OFGA 1DZRA 4LBQB 5G05L 4DMIA 1W8HA 1W8TA 1WW6A 4IGPA 3RMXA 2W95A 1BEV1 2Z42A 3NNMA 4LMFA 4AI8A 4XQ4A 1AR83 2EALA 2K46A 1UL9A 2D44A 3AKQA 4YGDA 4Y3OA 4CEYA 3BIWE 2OQ6A 1C1FA 1H4GA 4XIOA 5AC93 2QKDA 2G4IA 1VBE1 1FOD3 2ZMNA 1S0JA 4QKDA 3U75A 4EWDA 4ZHNA 4RYDA 3JQWA 1DGLA 2QQUA 4AEDA 1TMF2 1FAYA 2VQTA 4CRQA 1IPSA 5FP3A 2ZBJA 4DQAA 2HH9A 1VB4A 1RJ7A 2AEZA 2VC9A 2XGXA 2RR12 4UF0A 1EAH3 1RUF2 2P1BA 2QTWB 4QXKA 1XU1A 5DUUA 2RM21 1V9U1 1VBB2 3DCQA 2UWBA 2B46X 3MF9A 4K21A 3VDCA 4LLFA 2WWJA 4DXZA 2J1VA 3KGZA 4AHZA 1PGW2 4RHV2 2BERA 1XXNA 4QM8A 4XUPA 5C4WC 4JQTA 1QKQA 2D6KA 1Y7BA 3HQUA 4C0BA 1W9YA 2ERFA 4M3CE 1U12A 1XE8A 2XVKA 2ZAAA 2JXAA 4Q0SA 2WZEA 1HX6A 1UX7A 1Q8PA 3GJAA 3ZVXA 4CUGA 4L99A 3ON7A 1ZRCA 2Q8CA 2W39A 1ZZBA 2C5DA 2L9LA 3FHIB 3FE5A 4PQ9A 3Q8FA 2WO1A 2WNEA 2K2SA 4AFDA 1QMJA 5FY5A 1NE6A 3IDBB 5E16A 5GJ6A 3VZKA 1PGSA 2WFF1 1ULOA 3APBA 3P5BA 4QGNA 4QXBA 5FMCA 2PQSA 3DGTA 5FTTC 2X8KA 1RYYA 2XWBB 4LJHA 5FYYA 4JTOA 4QHOA 5LK7B 4UWDA 4MGKE 2X53S 4ZPIA 4S2GA 4H14A 4YFZA 3ZPOA 3S5QA 5EHDA 1C1LA 2YROA 4WM7C 2DCKA 5DN2A 4CP1A 1HN0A 2E7QA 4HN1A 4Q4V2 4FAGA 5F37A 4YG0A 1J3RA 4BIOA 2C1FA 4FTEA 5T54A 1UX6A 2Y6LA 2DCYA 2HWC3 2JDPA 4Z07A 1UNBA 3IKWA 3UYJA 3DPRA 4C8DA 1S0BA 2RMU3 2XG3A 1R64A 3GCXA 3PUHA 4HG6B 5DUXA 3S7EA 3A21A 1CX1A 1HRV3 1K5MB 4IE0A 1Q5OA 3U14A 3IB3A 1KFXL 3JXSA 1X33A 4GMP0 2A3WA 5LB6A 2YXSA 1J58A 3IM0A 5E6HA 2OIIA 4CEWC 3K3OA 1H1AA 1NXMA 5DUVA 4L2NA 2VTXA 4EN6B 2VXJA 4COZA 2YBKA 4Y24A 2JDHA 3ABZA 1QJU2 5GZEA 5SV8A 3ZYFA 2VMGA 4QGLA 4D8MA 4GB31 2EA7A 4XVHA 1PX3A 3GZAA 5C8WA 1G8WA 3DKQA 5BNOA 4NPRA 1YFXA 3M3CA 3J7LA 4WM8C 2ETEA 4ZS3A 4ASKA 2CTVA 5FLHA 4IGQA 1J3PA 3NWKA 3PU8A 4AK3A 4DINB 2C6SA 1I5ZA 5FBJA 3ASIA 4YGEA 3USUB 5EV7A 5JSPA 5FZ7A 2N7GA 3LAGA 4RQPC 3WY6A 1PIV1 4N53C 3N9MA 3GALA 4XW3A 1HKDA 1UIJA 4R8HA 5F6LB 4D3WA 1D0GA 3LPGA 1ULPA 1AYN2 5BXXA 1RUH2 1UQXA 4K6BA 1QDCA 4D6QA 1AR73 4TZDA 1LB2A 4YVWB 3S6PA 4EWAA 3WCRA 1BBT2 4C90A 3WP6A 4C91A 4AI3A 1WCUA 1G7YA 3BCWA 4JVAA 3F95A 2WQ4A 1OOPA 4R4ZA 5FREA 3UJOA 4YM3A 4TLGA 4FOQA 2PQQA 3NJYA 1I1EA 1H6XA 1DZTA 1EPWA 4QPWA 3OPZA 5FZDA 5EZWA 2OQ7A 1GR3A 1YUDA 3CHXA 3FJSA 1NA1B 2WZR1 1QH6A 4ZZ5A 1F2NA 1PMHX 1COV2 2FCTA 2XUMA 3EQEA 4QXCA 4DPNA 1Z78A 1DBNA 1AJOA 2B42B 2BWAA 4QPIA 1K42A 1D2SA 2OZ6A 4CU6A 1UPSA 5H9SA 4NVPA 4I3PA 5T5JA 1O4YA 3RVHA 2XWJB 5EPAA 2GDFA 4A3XA 3WUCA 2XKPA 3K2OA 3CZJA 2DCTA 2PHTA 3T0BA 3ZSKA 2A5ZA 2HEVF 2YFZA 3EBRA 3WW1A 1XB9A 5F2WA 2B9VA 4D94A 1C5HA 3HBKA 4RR3A 1ZRDA 3HVDA 4X8NA 1PNFA 3KV5A 5JOYA 4AEJA 5IK7A 4JDOA 4LBMA 1VBE3 2PAMA 3PNAA 4DS0A 3ORJA 1CAUA 2J1TA 3MLJA 4QXHA 3RI9A 4MGZE 1RTVA 3RYPA 3TEZA 2ADEA 4TSVA 4CCNA 1E5IA 1U5XA 3HAGA 4D7YA 1MVEA 2XVGA 4FBFA 1GZCA 1A34A 1DG6A 1WMEA 3M3QA 2QQIA 1UKGA 3C2UA 1U0AA 1U5YA 2BTVC 3C7FA 4YGCA 2RM23 1V9U3 1ND3A 3AP7A 4UFMA 4XETA 5A3MA 1RUE1 3HR9A 4GH4A 1JZ2A 1ZRRA 2DUPA 2RS11 4XFIA 2O8OA 5K4LA 4N90A 2VW1A 3PIJA 1AR92 5DQ0A 2WA4A 4C0HA 2TUNA 1K5JA 1UXXX 4NJ4A 1VP6A 4NHKA 2OYZA 4BQ4A 4CDXB 5JZGA 1WLDA 2Z69A 3BU7A 4QKNA 4AHWA 5EJ1B 4JGZB 1IHMA 4TN7A 5I8TA 4RS5A 4QHZA 2BVVA 1VRH1 3BTYA 1S1AA 1ENSA 2CGOA 4M4RA 5F8PA 3B93A 3I54A 3MF6A 5JOZA 4RGGA 5F7UA 1JYIA 2GAUA 1JW6A 1PM4A 2Z5WA 3VDAA 1KITA 4A2UA 2CAUA 3BI3A 5E8AA 4CSWA 5A32A 1V6KA 1QWRA 2UYAA 2Y64A 4DUXA 1CVNA 1MQTA 5IUQA 3OYWB 3WCSA 4P5YA 3ZLIA 2ARCA 2WT0A 1PNGA 5I0SA 5FZFA 4YVSA 4CP9A 1ODMA 2DVFA 1UCXA 3AZVA 2Y6JA 5IAVA 3WX5A 4FPJA 3S5AA 2QJVA 1OQEA 4NOTA 4ISQA 3D0SA 1MS9A 4NAOA 4KMQA 5H9RA 3VD5A 2VPVA 4AVSA 5C5UA 1N3PA 1US3A 3MDPA 4PF5A 2WRAA 2RS33 3SKVA 5C3PA 3CMGA 1K5MC 3E5XA 1CAVB 1ZA7A 4Z2WA 3RZMA 3RZJA 1IS5A 1BMV1 4CDWA 3WR0A 4Q4W2 1KRIA 2LROA 3WW3A 1QJY3 1XSQA 2EVXA 3ETQA 4CXXA 3H8RA 1RUNA 3LPFA 3I2OA 3H8XA 1JBCA 1W6MA 3FX3A 3NV3A 3JD71 3ZSJA 1V6IA 4B29A 3IIAA 4NWVA 2QQKA 3MFCA 1N3OA 4IEXA 1UU6A 2ZMKA 3OD4A 2UY9A 3N36A 2WNUA 1CESA 2CSGA 2W1WA 3MV01 3VBHA 3BTXA 1H8TB 3VBUB 3D3AA 2XONA 4RA0A 2JDAA 5CNAA 4R9AA 4F3JA 3AZZA 4WVMB 4UW5A 1ULFA 1Y3TA 3I2GA 3WINE 4H3WA 4PIZA 1J1LA 5C3RA 3C7HA 1DZQA 1GQHA 4JHZA 1BHGA 1PIV3 1FMD2 2VM9A 2VTXJ 2D3SA 3C8XA 4QGMA 1BVVA 1RUI1 5FDBA 4CU9A 1SLBA 4YVWC 3HPNA 3ZN6B 2JG9B 1NY72 2FMYA 2WAAA 5AVAA 3J8F2 4AVCA 5J37A 1Q8OA 4UOJA 2PLV3 1EV11 3KWVA 1WLTA 3NVCA 1W04A 3POEA 4K7JA 3H3UA 4BJ0A 1OF3A 3I3QA 3SISA 3LZZA 2FDGA 1PGL2 4YSFA 1HQLA 1RMU1 3IDEA 2A3YA 4BYYA 4UT5A 4BDVB 1GFF2 1EUUA 4M4PA 1NA1C 1VBA2 1Q3EA 4GMP1 4Z1VA 2ZPXA 5B4NA 3LCPA 3KT1A 4EZ4A 2W1QA 2WNVB 2FCUA 1M4WA 3CF6E 1VBC2 1QQP2 5BNNB 1CAXB 3C7EA 5A3WA 2ZKNA 3DKWA 3DYPA 3I59B 3AZYA 1LJ7A 5F3GA 1GKBA 3PUSA 1OUSA 1ND2C 2R6QA 3PUAA 4QU1A 3MI8A 2CHHA 5DG2A 4KU7A 4QQ2A 5CA6A 4JQRA 1QF3A 4XPVA 3ZFFA 2ADDA 3D8CA 1OA2A 2QZ3A 2ZHNA 2WJSA 3HBZA 4R9CA 5JPMB 4KWUA 1YJKA 3QH7A 4HFSA 3KV6A 4OQ9A 3DYOA 1ZBE2 3MW4A 3DF0A 3LEMA 4XDPA 1Y9GA 3ALQA 1IS6A 1K12A 1R081 1RUC1 4MHUA 1TVGA 4K9SA 4W65A 5GLVA 1OVPA 2OUHA 2WT1A 4HPKA 1DQ1A 3RWNA 4CZSA 4PDWA 3O5SA 1CR7A 1WCDJ 2DUOA 1JHJA 3LDRA 1KJLA 5BYNA 4KWLA 2GNTA 4IEUA 3SCFA 5C5TA 3AJZA 5EXOA 3T2OA 3WQ0A 5BPXA 3ACHA 3TWIA 5FZ1A 1NG0A 4BU2A 2ZZQA 1DQ6A 1RUE3 1QNYA 3AMNA 4MOAA 2JG8A 5J98B 3RI8A 2E53A 2JECA 4DOUA 4CDXC 1IKQA 1AX1A 3CDZB 3IDAA 5FP9A 1CGPA 2CV6A 4HKLA 4JGZC 4Y20B 4AGVA 2BP6A 1C8M2 4MXWA 1PVC1 2PHDA 1RHI3 3UJQA 4EWEA 5C33A 2VAUA 3IMMA 4FOVA 2Y0OA 1AYM3 1UKRA 4KL1A 4P9LA 1YHFA 3AMHA 1UZZA 3H3LA 4LKSA 1N1YA 1Z7S3 4EYUA 2ZGPA 3USSA 2VG9A 2WT2A 3DXTA 4XFAA 1QGLA 4KGQA 3BIEA 1AR61 3WNNA 3MO4A 5C8CA 2RV9A 3WQ1A 3U10A 4DXTA 4MLOA 4YM2A 5A3TA 2AREA 1W9TA 2PTMA 3AKSA 2P3KA 2W91A 1LKNA 5A6YA 4XUQA 4OUEA 2YZ4A 4OMDA 4Y22A 3RFRA 4GULA 2FDFA 3CJIB 1GZTA 1W8NA 2F4LA 1VJ2A 2XQXA 4CPBD 4CUBA 5ACA1 3ZXGA 3POJA 3QH6A 1H2LA 4FSJA 2YPDA 3KV4A 3IMNA 1I6XA 1STMA 2C26A 1BKZA 1RUG3 5A7WB 3H3ZA 3WP5A 1SFNA 1QXJA 4AGGA 4NHMA 2AR6A 2QQWA 3CL1A 1OI6A 5T55A 1UU4A 4GIQA 3ILFA 3QBQA 4NRQA 5EJZB 1QY4A 3POSA 3WOGA 5KWRA 2HYXA 3R6SA 3UGHA 4B7KA 3OG2A 3WVJA 2DU1A 1UMIA 3MW3A 2BUKA 1ULEA 3PTYA 2IXKA 5GLTA 2DURA 5LA1A 1A3KA 1H8TC 2W2IA 1QXPA 1WA4A 4O7XA 5LASA 3VBUC 1RUJ2 3VBSB 2ET1A 1Y9QA 2AGSA 3LEKA 1J83A 4FQ4A 1ASJ1 2WSUA 4SBVA 3O0WA 4M0NA 2YB7A 4OHYA 4JKLA 1L7QA 2OXBA 4X6QB 1AF9A 2CNAA 3N9LA 1YLLA 4XAEA 4IE5A 3Q8EA 4MG2A 4CTEA 5FMOS 4NIHA 1AXYA 1OXCA 1F15A 2PELA 1D4M1 3TN91 1ZBA2 5JSRA 4HN0A 3AYEA 4Q0PA 3WSOA 3AC0A 1PK6A 2NM1A 3HT2A 5GLZA 2PAKA 1SDWA 2XVLA 1MVQA 4IUGA 1R1A1 3VL8A 1EV13 2E9QA 1OPMA 4Q4X2 4E4ZA 4PQQA 1H2NA 3AYCA 4CCDA 5JOXA 2ZEZA 2DFCA 2ZGMA 3ACFA 1POV1 1VAVA 1W3VA 4BHPA 1RMU3 1H2MA 3PVOA 1O59A 4YZ2A 4NPLA 4W6YA 3VGIA 2DBNA 3NAPB 3FL7A 2BGPA 2J22A 1AR81 5BNNC 1C4RA 1VAKA 2BFUL 4DFSA 2A6XA 1PO22 4COUA 5L9VA 1RITA 3WF0A 4W6WA 5FIXA 5HV0A 1YFWA 5GZCA 1QIQA 4YZ1A 5CFCA 1ZZ7A 2RS53 3PMSA 3EXUA 5DZEA 2GN7A 5JXIA 2VUJA 4E4HA 3RZKA 4QDSA 1G86A 1CWPA 4XFCA 4I01A 2GSYA 2DWRA 3IBMA 2Z79A 5K7PA 1WLCA 3O1SA 2ZGNA 1TZOA 1W9WA 2K9ZA 2RR11 4D0QA 4MZUA 3SXWA 4I2OA 2DFBA 2ZGUA 1X7NA 2GMPA 1NQJA 1PZ9A 2Y60A 2FD8A 2OW4A 2HWF2 3AKPA 5FO9B 3K51A 1RUC3 4JKMA 4AVAA 2J1RA 1NCQA 4CDUA 5DDJ2 3KLSA 3U78A 2RDSA 3ZYRA 4FTSA 2PHUA 3OUJA 2JJ6A 1G9DA 3VZOA 2VCMA 4B8EA 3ILRA 4HVRA 4YW2A 4BA6A 1IS3A 5A3PA 1AL23 1K3IA 2DV9A 3O1RA 2WNOA 4K8FA 5IW0A 4CCJA 5D8AB 3A23A 5FZOB 1D7PM 2R062 3KHBA 1VIWB 1CZTA 3LSEA 5J1XA 5JLVA 1LHVA 4DO0A 2ZGLA 1SFPA 3D6EA 4N9IA 1OA3A 1WBLA 1VE0A 4K8RB 4QDRA 4XFBA 4Y1VA 2P3JA 1QDOA 4AVVA 2BDRA 1UZ0A 2R042 3MGUA 3OTFA 2AC1A 5FY7A 2XLAA 1VMHA 2XL9A 4LO8A 1PX4A 2YU2A 4Q5OA 4IESA 2CL2A 1O6UA 4Q4V1 3AMMA 4LHKA 2ZX4A 5FQ0A 1GOGA 1IPKA 1FPN2 1W99A 2W1UA 1BVP1 2ZGSA 2VUCA 3L2HA 1W8WA 5L9BA 4J25A 1XE7A 4TYSA 3ILNA 2HWC1 3ZSEA 4AG4A 3OPTA 2DVDA 2XBO3 3FMGA 2RMU1 4L92A 2ZACA 1AR63 2VMCA 1YFYA 4XFGA 1HRV1 4PBOA 4AAPA 1JYTA 2HJIA 4DRRA 3FUOA 3WG3A 3OGVA 3P1IA 4CVUA 1MZ5A 2D6NA 5APAA 1RVF2 1Y43B 2LALA 3CJIC 4BMBA 2Y6KA 2ZGQA 5FZ0A 1CZVA 2VNVA 3WG1A 3MIEA 2E26A 4P9JA 4FPOB 4IV3A 1BYHA 3BTAA 4JHTA 1JUIA 2IUWA 2PXJA 1HXS3 5ACA3 1RUD2 4E4DX 4JGYA 2P34A 4M01A 4HVQA 4AW7A 1VLNA 4IEQA 4RGKA 1ACCA 4J6GA 4COWA 2GMMA 3OGGA 2FHRA 4R52A 3ZFEA 2ZGRA 3MPBA 3VBOA 2ZTNA 4XQWA 4CE8A 2GC2A 1GP5A 1W6PA 3GJBA 5FOBB 3VUOA 1WMXA 3VD4A 1ENXA 1UY2A 2GC0A 4I30A 3Q8CA 4R9DA 1JH5A 1BQPA 3ECQA 4LA2A 3QLQA 4SLIA 3VD3A 2X5IA 2I45A 4FTBA 5C9AA 1B09A 2ZGKA 2B39A 1WUVA 3ACLA 5F3CA 4UFLA 2H0BA 2ZX0A 1ENRA 5FYVA 3VBSC 3WNKA 1X8MA 3AP6A 1RUH1 4E27A 1DQ4A 4B1MA 3LWCA 5A70A 2VBDA 3RZHA 1AR71 1CAWB 2JKXA 4ORFA 4CPBA 2W08A 4X6RB 3WF2A 3HEIA 3VHRA 4AVTA 5FK7A 1O8SA 3K3NA 2FDHA 5C70A 5IHRA 1LGCA 2EAKA 2Q1MA 2HWE2 1UZVA 3K4ZA 4YZ5A 1NX9A 4BQ3A 2BZDA 2WDBA 1LOFC 4Y1XA 2JE8A 4YZ4A 3GDBA 1T6BX 3SKJE 5LBFA 5CFDA 4EQVA 3RS6A 1IQAA 3TN93 4ARYA 4L8QA 1RXGA 3VDDB 2VQUA 2XHNA 3TRSB 4Y1ZA 1V00A 4XBNA 1LU1A 4LNVA 2HWD2 2ZABA 3VBFB 2C4XA 2LS6A 4K20A 2QDNA 4XTPA 3L2YA 3ZR5A 1PO12 3H42B 3PUIA 5CKQA 4G9SB 3HMYA 2ZX1A 2D6PA 1POV3 2VZ1A 2D3RA 2EXIA 5IWFA 3NAPC 4UBGA 1XNBA 5FPUA 5FAXA 3UGGA 2IXHA 3ZDSA 1W39A 5FXXA 2IVJA 4NPMA 4PCRA 3SMHA 4AZZA 1GZWB 1SMVA 1BXHA 3AYDA 3O7OA 4IEZA 4IDZA 4P14A 1H9WA 5B4XA 1WGPA 1LODA 3CKHA 3MUY1 3OBAA 4META 4RD7A 3POYA 4UW6A 4URTA 5A7NA 1TMF3 5K0UB 4NRMA 1WMDA 4MHRA 4M3CA 4LKFA 5IVEA 2YDEA 2WN3A 3W58A 2F6BA 3LQCA 1SPPA 2Q5TA 4Q1PA 4LXLA 2RR13 5FUNA 1RUF3 2ZHMA 5CBLA 4S2DA 5HCFA 1VBB3 4UBHA 4YM1A 2JX9A 5I0DA 4HETA 4DUWA 1F8VA 2XKOA 2XB6C 4H7MA 5CZKA 3NKGA 2YU1A 1AR91 4RHV3 3ACIA 1S2EA 3TOJA 1OVSA 1QJX2 2V72A 3B9IA 2NN8A 1REEA 2FCVA 2WYFA 4CDQB 5AC92 4P9IA 1VPHA 1V6JA 4M00A 5LBEA 5D8AC 4TXWA 1F9KA 2ZEXA 2R072 1SLCA 3UNPA 3VHNA 1VMJA 1OT5A 1Q8QA 1SACA 1T2XA 5LRRA 2CDOA 3I2IA 2H0VA 4CEYB 3FLTA 1O3TA 5I91A 3AXEA 1V6LA 5FZ6A 1MACA 3RJRA 3ZYIB 3EMRA 4KGGA 4FPGA 4AEDB 2Z4FA 3THDA 2D93A 4A45A 1NLQA 1N47A 4Q26A 3IN9A 4OHZA 2D6MA 4JKKA 5FLIA 3VD9A 4P9WA 1TNRA 3KF5A 4UF0B 5C7GA 4P9YA 4Q4V3 5JUVA 3LDBA 4CP2A 3WV6A 1WA6X 2VY0A 5IAXA 2RS31 3JBG2 1GUIA 1ZZCA 3JU9A 3B5LB 1XPWA 3LGRA 4LO4B 1UYXA 4OHVA 5FWEA 3V0BA 4N9HA 5L73A 3OEAA 3SNMA 2DCZA 1H9PA 3INAA 3K46A 5LK5A 1QJY1 1D0HA 1DGWA 4YG3A 1JOJA 2GNDA 1PZ7A 2CDPA 4MADA 3HQRA 4MVTA 2R32A 5J48A 3WNPA 5JXGA 4DEVA 5DPNA 4ZONA 4BWOA 4XEZA 5BUVA 4O9EA 3HNMA 1QJU3 4QPGA 3P3PA 3FZ3A 3MYXA 2ZJCA 2ZXQA 3S57A 4HT1T 3U1XA 2YC2A 2XJPA 4Y5Z0 3HQXA 2VNRA 4XF9A 3U11A 2QDRA 3POGA 3AFGA 3JB4C 4ZU4A 1S4CA 4OZXA 2A70A 2XOMA 4XJ9A 1CJPA 3CNAA 2OUJA 4CUCA 5FZCA 5FOJB 4BQXA 2VGDA 5FZMA 5FO8B 2P4EA 3ZSMA 1HRI2 1QU0A 4HLTA 4BZ4A 2RJ2A 2I74A 3DPRB 4FFFA 3IIIA 4MX3A 3ZYJB 1ZRIA 3ZKYA 4YW3A 4Y4RA 1AYN3 2X29A 1RUH3 4G3YC 1W2AX 2BV4A 3I3BA 4NIDA 3TEWA 3B94A 4XUTA 1QJEA 4XMIA 2VW0A 2XLFA 1SBFA 1BBT3 4N43A 4XILA 2BOIA 2YPJA 1JYVA 2PLV1 4Q0VA 1G9AA 1S2BA 2LW8A 4MGTA 1NAEA 2A7AA 3PIGA 2E33A 5FPZA 1B35A 5DABA 3N9OA 4UFIA 4AOCA 2A6YA 2QQJA 2GC1A 4WZFA 1YNAA 2XJQA 4MGIE 3VDDC 2P2KA 5BNOB 3IAPA 3MW2A 3VLBB 3GHMA 1JZ6A 1L7RA 5FZBA 4GWIA 2VOVA 1MEC2 1Y9MA 2RJLA 1OHFA 4F7ZA 1HLCA 1YIFA 3VBFC 1GLHA 3LFMA 3M7AA 1COV3 3ZYHA 2V09A 1HQWA 2BNOA 2XH6A 4WVVA 5IFTA 5FY4A 4QX0A 2BQPA 2AUYA 4LO6B 2D97A 4HKWA 4IEYA 4V2VA 2HWB1 3M3IA 4OI2A 3VBRA 2VD7A 5FZ9A 4A41A 1UY4A 2YC4A 2BBVA 1T6GC 1PVXA 2GZWA 1ND2B 4LBJA 1HIXA 4LO7A 4R9BA 4QT6A 2E6VA 3OJBA 1W6OA 5L7OA 5A7SA 2OPWA 4P5HA 4Q4Y2 5D21A 3U4SA 1SG3A 4KBZA 2GP5A 3ZXAC 1JU3A 5IVBA 1ZM1A 5LW9A 4HOOA 1H0BA 1UPIA 1YI7A 3O0VA 5K0UC 5GALA 3I49A 1YCIA 1Y4WA 2ZX2A 2HKXA 1DIWA 3AB0A 3FUQA 2HBTA 3NV1A 3QCWA 4AFCA 4HBNA 4QQHA 2P6HA 5KC6A 5DG1A 4V2WA 1R092 5GZFA 5B2GB 2ILMA 2PMWB 2CWMA 3M70A 5FPVA 1PM7A 5FXZA 1SHWB 1S0FA 2VUDA 1LR5A 4Y1UA 5IVYA 5C6CA 2IVIB 4AEKA 4BM8A 1BEV2 3TB0A 1AR93 3T3YA 4YFWA 3WP4A 1BK1A 4CDQC 3ZFGA 5DAXA 4Z92B 4QPIB 4E4SA 4XAAA 1REFA 1RHI1 1AYM1 1XC6A 2ID4A 1L3JA 1RL3A 4CEYC 1Z7S1 1NYWA 3H8OA 1LOBA 5EYXA 4AF9A 4K40A 4RR3B 5LWBA 1GMMA 3THCA 3ZO0B 5M0TA 2J1AA 5FBZA 2RM22 1V9U2 3NKTA 4AEDC 1QEXA 4FT8A 4HANA 4DZGA 2J1SA 3ZKUA 5JMOA 3WG4A 1CAUB 2QFEA 3EHKA 4IL7A 2O1QA 4JCKA 1TNFA 4NR1A 5FXVA 5T52A 4NIGA 4OHWA 4PI2A 1VBD2 1O4TA 1OFSA 5LY1A 3NJVA 2XR4A 4FFIA 5IFPA 3H8UA 3RWKX 1ND3B 5FZKA 1LOCA 4GH4B 3M2MA 4XBLA 1IOAA 1OF4A 3IDCB 1HV0A 1X50A 2BBAA 2A75A 1NT0A 2QQLA 4Y5TA 5CKMA 1POV0 3CBNA 2WFF2 4E2QA 4B4RA 3QACA 4U2AA 2Q30A 2XJSA 1J3QA 1RUG1 2P3IA 2Q0AA 4P9GA 5JZGB 3Q9OA 2QZ2A 4Q4W3 4QHBA 1KEXA 5FYIA 2FDIA 4RS5B 4MO3M 3OUHA 5E1RA 2OS2A 2W46A 5I0TA 2QBXA 1XJAA 5SV5A 5CVRA 2NLRA 1NXD1 2F17A 2WA3A 4XJZA 4CU7A 1WW5A 5AVPA 2XPJA 3LIHA 4LBLA 3E5UA 4NWWA 4QAWA 5A32B 2RVAA 5FP8A 2VVDA 1KD7A 3WW2A 1W0OA 4MYEA 4YYOA 4E8CA 2VQ0A 1W06A 5JIAA 1GWKA 2Y26A 5FRAA 4YVSB 1LTEA 4CP9B 3W20A 4A6SA 4URAA 4NIAA 5BNPA 3KHCA 2JG9A 1WD3A 4MSVA 5F32A 3PVEA 5EIYB 5FYUA 5FV3A 2C24A 3OGRA 5FZEA 3DPRC 5FZ8A 4XE9A 2A71A 2BYVE 3D82A 1FMD3 1YRZA 3GNEA 2HYKA 2VZRA 3HT1A 3KSCA 1UMHA 1ZX5A 3OCPA 4GKXA 4IEWA 4S2FA 5F3IA 4HKOA 1OURA 3MV11 2IFWA 3UKNA 2R0FA 3WDXA 1CQ9A 2VNOA 2CY6A 4OULA 3RG0A 4LK7A 5KBFA 4GB32 4CDWB 1WBFA 3FC0A 4OI1A 4PT6A 3SCHA 1XYNA 1OLME 1FV3A 2WNVA 3LD8A 4FVVA 5FZLA 1W6MB 2IXLA 3HD8B 3MIBA 4I0WB 4XABA 4YWAA 3ZDVA 1X9PA 2VOWA 1HB1A 3I2DA 2WKKA 5JPNB 5DAPA 5HXMA 4IETA 1Q43A 3ACGA 3W21A 5BNOC 2WNUB 3VBHB 4WV8A 1VBA3 3MIDA 4AFBA 1PIV2 3WZ1A 4IEOA 4I0BA 2PHLA 4HSLA 5DUWA 1LOEA 1CIWA 3LA7A 5ISLA 3TBDA 1OC1A 1PO21 1UF2C 1W0NA 1VBC3 4BISA 4YW6A 1LULA 3THTA 1QQP3 1UWWA 4A42A 2I2SA 3SCGA 4A7ZA 4XF1A 2RS51 3I4IA 4NHYA 3U07A 3RMYA 5I0RA 5LA0A 3OGSA 1QOTA 2ZKLA 2HWB3 4FI9A 1WCQA 3JB8A 4H7LA 4HK9A 3BOWA 3UESA 2P6CA 4GWMA 5EP9A 2D6OX 2AEYA 1DYPA 2MPFA 1ZBE3 3WDVA 1JUHA 3WT3A 1H30A 1QH7A 3I97A 5IK4A 1OOPC 1NCRA 2WZR2 1UIKA 3W5NA 2EIEA 3WQ7A 5A33A 2NQYA 2DDUA 2MEV1 1H2KA 2P37A 3POWA 5GZGA 5LEJA 1DU3D 3I2JA 4LK6A 3VKOA 1WW4A 4BQ5A 1AL21 1IQDC 1JN2P 2ZEYA 4JZRA 4KG0A 2R0HA 2EIBA 3PURA 3FFZA 4QPIC 4ZKTB 4LORA 1JMUB 4ONUA 1DCSA 1KXGA 2W0XA 2YGMA 2VBPA 2R041 4L11A 1I9RA 2BGCA 2ENRA 4LR4A 3DN7A 2B5HA 3ZXLA 1C8M3 4XFFA 1JOBA 2EIDA 1V0AA 3ZFFB 1GP6A 2Q8EA 4Q2FA 5ABJA 1HB4A 4BPZA 2JKBA 1FPN1 1OH3A 4RR3C 2RG4A 3G7DA 3KCCA 4M0HA 4N7UA 4ET7A 3ZR6A 1HDKA 5ERLA 2XBO1 3OSDA 1AX2A 4QX7A 1GOHA 3J7HA 3C7GA 2RS12 2UYBA 3FBMA 4PDWB 1QJZA 4ASLA 3MZHA 4N8MA 4IV1A 2ZA9A 4LUMA 2BW8A 3U0ZA 3KB5A 1ND3C 1VALA 2VOTA 4Q0QA 5CG8A 2SLIA 4GH4C 3KVBA 1CJDA 4M3CF 3UKTA 3BKZA 4IE4A 3AP4A 4B4PA 5JR2A 1A8DA 1VRH2 1HXS1 2JG8B 4LBKA 3NSTA 3AYAA 3ITQA 5A6ZA 2OVUA 3PVBB 4LHNA 5JZGC 3S0MA 2JE7A 1H1MA 4QKFA 3TAYA 4P02B 4RS5C 4MXWB
chains in the Genus database with same CATH topology
1XYOA 4Q8KA 3RDIA 4LULA 1PZ8A 3ZPYA 3GHNA 1OSGA 1UW8A 2H6CA 3VZMA 4JRAA 5I0UA 2TEPA 3HN1A 5H9PA 1MQTC 4A7YA 1ALYA 5C8CB 4FPHA 1RUJ3 2PN5A 3OF1A 4YVSC 4FO9A 4YLZA 3V0AA 3ME2A 3NO8A 2XJVA 3ROUA 4Y22B 3ST7A 2CAVA 4FPKA 1BMV2 3CU7A 4C1WA 1E57A 3I7DA 2WS91 5JCTA 3ZN5A 4YNIA 5EYYA 1LHUA 5HXVA 3KS7A 3JD72 4C1XA 3WDUA 4CDWC 1ZBA3 1RINA 1PMIA 1SLTA 3EJKA 1Q8VA 1KS4A 3N7LA 1TME1 2ATFA 3P3NA 1MS1A 4K1ZA 2GNMA 4QD2A 3AM2A 4Q4X3 1SBDA 3NL1A 3ES1A 2D5HA 1RC6A 3E6DA 2ZHLA 2XJTA 4XJWA 2WNUC 3SITA 3VBHC 2VH9A 3E5QA 5KHHA 4XFHA 1V6OA 3B3QE 1XNCA 1H1IA 2PA7A 4YGBA 1RIRA 1LECA 1RUI2 3WDYA 1C3HA 1PO23 4K1YA 3WXPA 1AL0G 4LTAA 1TMF1 5JI7A 4OHXA 1LGNA 5GLUA 1EV12 2LUWA 5E88A 5C4WA 2A3XA 1RUF1 4EN7B 1FNZA 2Q1ZB 1RMU2 1VBB1 2XJUA 3B00A 1W2UA 4XYXA 5KXCA 1G9CA 4JV4A 1O3QA 1PGW1 4FPEA 4RHV1 3R4DB 4BH9A 1QJX1 5DDJ3 4HL0A 2TBVA 3R4UA 4JDMA 2MEV3 2GU9A 2ES3A 4FXGB 1DQ2A 3N3HA 3LSDA 3BODA 3RPQA 4D7SA 2R063 3V64A 3AZWA 4MGYE 4AQTA 4WM7A 1CPNA 2OA2A 3ZXFA 4GQ7A 4DY5A 3FWEA 5CFCB 5HCAA 4X8PA 4XJAA 4XMAA 2YHJA 4UW3A 4E2GA 1RUC2 1R082 2DVBA 2R043 4K3UA 4WBBA 3ZFFC 4BMEA 4I0AA 1ENQA 2VQAA 2DTYA 1DLLA 2VNGA 3AP5A 1FPN3 2JDZA 3K48A 4QMAA 4R4XA 4FPYA 4IXLA 1MZ6A 4XHXA 5JVVA 4CEWA 1NCQB 4CDUB 4PDWC 1GQGA 4D7TA 1O3RA 3L9JT 5I93A 3THPA 1QOSA 3KQRA 5GZDA 1RVF3 1DDLA 4F83A 2MHFA 3UKVA 4B3NA 2CYFA 1LHNA 1PVC2 2HEYF 4WM8A 3V65A 2JG8C 4P9XA 1H8VA 1W6NA 3OY8A 4GALA 1QJU1 2E51A 2ZX3A 1RUD3 1U5IA 4AGRA 2DVAA 4IQPA 1UU5A 3RYKA 4J1XA 4LBOA 3MIFA 1GANA 1OA4A 4AEMA 4RQPA 2BVBA 5DZGA 3E6BA 1AR62 3GZUC 4N53A 3AFKA 4QQPA 3GF6A 2FQPA 4FXKB 3FLRA 3PJQA 4AWDA 1HRI1 2HEWF 2O0OA 1ZYBA 2WFPA 5CU1A 5C8CC 2ARXA 2B45X 1XNKA 1I3HA 3RYRA 1AYN1 3R05A 4QU2A 5ACA2 4YW4A 2D5FA 3AKTA 4DNYA 2EAAA 3LOIA 2G9FA 3GYDA 1XNDA 4OUSA 1BBT1 4FP2A 1ZRFA 3KCYA 2R1BA 3ZYPA 4AE2A 1YYNA 3IPVA 1SEFA 4IV3B 4XJ8A 3ZMOA 4DRVA 4GWNA 2HWE3 3B01A 2UY8A 2WS93 2OPKA 2JICA 1OD5A 3VL9A 4KWJA 4Y26A 3VHPA 3ZFEB 1SBEA 4LBQA 1NLSA 5J7MA 2DYCA 2BNMA 1TME3 1W6PB 2GMEA 2WIIB 4XOGA 1COV1 3CJXA 4Y4YA 4ZXKA 3MPPG 1WLWA 4XXAA 1JTZX 2WLQA 1PO13 4LE4A 2WLPA 3WG2A 4EJRA 5C9AB 4JRLA 1SLAA 4FPLA 1ASJ2 4XBQA 5K9YA 1MS3A 3J4UH 4ES8A 5BNQA 1AUYA 3WDTA 1QNWA 2V5YA 3AMQA 5J09A 1ZNPA 1DQ5A 2EXJA 1D4M2 3TN92 3WNXA 2C0ZA 1W6QB 4LUKA 1C28A 1TEIA 1GYKA 5F5QA 2FMDA 1R1A2 4AYUA 3GBWA 2E7AA 1PK6C 2UWAA 5KXDA 1MZFA 4XZPA 2ZHKA 1S0IA 1AR82 2TNFA 1QJX3 1FV2A 3LA3A 3MFAA 3ZXJA 4EN8B 4KNCA 2QCSB 3C3VA 1EPZA 1FOD2 3IWZA 2DF7A 1Q8SA 1R1ZA 1D2QA 3TNQA 2R073 4Q8LA 2R16A 2YC0A 4RL7A 3OD0A 3RJ2X 3KM5A 3VKLA 3LKJA 1EAH2 2V73A 5CFCC 1DFQA 5JDBA 2D3PA 2Y0IA 1RUOA 2VMIA 3J26N 3MLLA 3R4SA 1NE4A 4AVBA 4NHLA 4OLLA 4D69A 1VBD1 3N35A 4M3CB 5J3UA 2EXKA 2UWCA 1K5MA 1BJQA 1MS5A 4RSUA 5F6KA 1A78A 3AX4A 3T1MA 5FMOL 1NCQC 4CDUC 3JBG3 1XRUA 4INDA 1RGSA 3H1WA 1A6CA 4Q4W1 5CB7A 1XQNA 4PIXA 1IKPA 4QPYA 3WW4A 4GKYA 4IERA 2BNNA 4PBPA 2KXLA 1YXWA 5JAXA 3BOPA 4WZCA 4XJUA 3USUA 2HWC2 1OMIA 2RMU2 1HRV2 3W9AA 5IK8A 5IK5A 3PLQA 3ZSLA 3A4UA 4KU8A 2EXHA 4YVWA 5KXBA 5LEKA 1GNZA 3VV1A 1HRI3 3UL2A 4YARA 4Z82A 4B4QA 2PHXA 1FMD1 2FBEA 1EYBA 3ZXEA 2EIGA 4AFAA 3V0BB 4EN0A 4Y1YA 4BIFA 1NY71 2PAEA 4FP3A 3J8F1 4JAAA 2ZGOA 2VECA 5EFUA 4AHXA 4BQ1A 3OBTA 1ULDA 2VXRA 4IV3C 1NA1A 1S0DA 1D4VB 4ATFA 2AYHA 1QHDA 4JGYC 1PGL1 4QPGB 5KHGA 2LM3A 5JOWA 3D5OA 5GKAC 1OFNA 3MIHA 4NO4A 2AZ5A 3ZFEC 5IT6A 1VBA1 2W68A 3VBOC 4HVOA 5JWPA 1ND2A 3NJZA 4J1WA 1MEC3 1VBC1 1X8EA 4OI4A 1QQP1 3X29B 1AZDA 5T5OA 1LGBA 1AR72 2X5IC 1JXNA 5C9AC 2YMZA 2VW2A 3VZJA 4FOWA 3SH5A 1ZZ6A 4UW4A 3VKFC 3RRDA 2YGLA 1X82A 3M4FA 4KH9A 3O12A 3ZIXA 1CX4A 5L36A 3KZ4C 3KCXA 4NN0A 4Q4Y3 4LBNA 1ZBE1 4FQZA 3D4KA 2K0GA 4N43B 1S2KA 3GBFA 4FCAA 1GNHA 1PHMA 2RJKA 1OOPB 3U4XA 3HIFA 3KGLA 4HSJA 2DUQA 1B35B 5CFDC 1NLRA 1XU2A 1FT9A 2Q4SA 3MICA 1R093 4TLFA 1HQNA 5DZFA 4CDXA 3H1MA 4JGZA 5EJ3A 3PHMA 1BEV3 2AENA 3ZMNA 2I07B 3VHOA 1KFUL 4LE3A 1SLLA 2DVGA 4XIKA 4XTMA 2R30A 3VBRB 4LT5A 1C8M1 3D0JA 3JQXA 1VBE2 5JI9A 1AXZA 1S0GA 3OYWA 3MEPA 2P17A 2WQZC 1W6OB 3B7MA 5L7OB 3AP9A 1J59A 4EV0A 2A73B 3DV8A 5CAZA 5KHIA 2JENA 5CADA 1C5IA 1LCLA 3B02A 4EN9B 1DQ0A 1J1TA 4ES9A 1CAVA 5JMCA 1VBD3 1F5FA 2LTNA 1GV9A 2NMNA 3UV9A 2Y38A 1GBGA 4ASMB 2NPIA 1O5UA 2DCJA 5E89A 4BOWA 2ARBA 2H6BA 2YYOA 3GBGA 2IFRA 2VVFA 4MXVA 3ZFGB 3H7YA 4AI2A 2WFF3 2OZJA 4BCUA 1BZWA 2BFUS 2DTWA 4W6XA 5JR7B 3N7JA 1H8TA 3AKRA 3VBUA 2KA3A 2QE3A 4F8AA 4UXAA 4COYA 2XJRA 4WVMA 2JE9A 3HWJA 4YRDA 4H55A 4CP0A 3ZIWA 2WZPP 3VKNA 5AFEA 3URFA 1RUJ1 1MQTB 2RS32 3E97A 4BLIA 5FCCA 4G4FA 5CIRA 1FNYA 1NQDA 3AMPA 1OQ1A 4HK8A 3ZN6A 2GN3A 2WC2A 1BCXA 1V6MA 1QJY2 1G9FA 4YW5A 1V6NA 1O4ZA 2QQPA 2VMHA 2WSVA 3NW4A 4YZ3A 2BWCA 2XL7A 2VOKA 2ZZJA 3H50A 1ZBA1 4GB33 4LHLA 2VUAA 5TSWA 4L97A 2NP0A 3J8F3 2NMOA 5LRSA 3H0OA 1X36A 1DGRN 1KDMA 4Q4X1 2G9GA 1HW5A 4QPGC 1CONA 4ISRA 2JD4A 2B8MA 1CAXA 5BNNA 4OVEA 3QD6A 3I59A 2VULA 3PJYA 1G9BA 2IXCA 1FXZA 1LENA 3WHTA 2D43A 4KWKA 5I8SA 1LHOA 4V1PA 2IXJA 2JEMA 2E63A 1N1SA 3R0RA 5BNPB 4U36A 2XLGA 1LEDA 2Q8OA 3ES4A 2ZGTA 3NV4A 3B69A 4QX5A 2QNKA 3BPZA 4E9KA 1S0EA 2PLV2 4WVZA 1S55A 1VAMA 1AX0A 5KHKA 2PYTA 4N43C 2R1DA 2XHKA 4AI0A 3LA2A 5FFOC 2HWF1 1O3SA 1MZEA 3E6CC 4FOYA 1UN1A 2WZR3 5DDJ1 1MS4A 4XDQA 1LESA 4XHBA 1B35C 1W0PA 4HMZA 1YJLA 3AJYA 3VZLA 4JDNA 5A3LA 4AQ2A 1OPOA 5GLWA 4LLOA 2HWB2 3VN4A 2QVSB 2UU8A 1NZCA 4Y20A 2R061 1NOVA 5FPXA 2GH8A 3WLUA 1FX5A 4KQ7A 4PLMA 4XF0A 2MNGA 2DU0A 3VBRC 3CEWA 2CWSA 3KMHA 1GICA 4L9BA 4AQ6A 1O7FA 2PHRA 4JC1A 5KXEA 4OI0A 5L7OC 1TQ5A 2A6ZA 2ZCWA 1ZZ9A 1LOAA 3WUDA 4I02A 2KM2A 3NV2A 1EP0A 1LRHA 3CJIA 1NCRB 4ATEA 3ELNA 3A0KA 4HPKB 1RUE2 2RS13 4Q29A 5A33B 2VOXA 1S0CA 3S7IA 1RVF1 1YFUA 1AHSA 1REDA 1RHI2 5H9QA 1ULGA 1Q56A 3H9AA 3N7MA 1AYM2 1DF0A 1DYKA 3RQ0A 1KS5A 1VRH3 2GC3A 3ZFGC 1I1EA 1RUD1 1JHNA 4IEPA 2WINB 1Z7S2 2F4PA 3S30A 4Q1RA 1KJRA 1N1VA 1O5LA 2ZOEB 5ABJB 2NYYA 1IGOA 3IT8A 3VBSA 4DB5A 3MIGA 4Z8BA 4Q0UA 1F31A 1G6NA 4LBQD 3FFQA 5FLJA 1H4HA 1KDKA 2YUEA 3H7JA 5CG9A 2B7YA 2R49A 3JZVA 4I09A 3CLPA 2RHPA 2AH2A 2WWSA 2E7TA 1F5JA 3JCIA 4IV1B 1C8NA 2IWGB 2SBAA 3MLKA 1LOFA 5HCBA 1FYUA 1RUG2 3ATGA 5BY5A 3OGJA 2O8QA 2HWE1 1WD4A 3ZXKA 5FO7B 2CGPA 3H1YA 1OKQA 5L19A 4WVWA 3JD73 3KT7A 1ZREA 1ZZ8A 4PLOA 4TWTA 1WMFA 4ZU5A 4B7EA 1O91A 2W52A 1VR3A 3M1HA 3KT4A 1RJ8A 1QOOA 3NAPA 5JSOA 2HWD1 2ZMLA 3DL3A 4LO5B 4DY3A 4MUVA 1PO11 1TE1B 2YV8A 1N3QA 4KG8A 5DXDA 4BE3A 1DGWX 1SLIA 1C57A 5BNPC 1ONAA 3V0AB 2JG9C 1RUI3 1FI2A 3V56A 2C9AA 3FBYA 3WP3A 4S2HA 1YIPA 2YY1A 4E2SA 2EF6A 3SHRA 4A7KA 3WHUA 2VVEA 1UD1A 1AXKA 1IPJA 4FPFA 2IZWA 4AI1A 2QUOA 3FLPA 4BLJA 4XQDA 4COVA 4GA9A 4PJYA 3M8LA 1PK6B 4N7IA 1WCKA 2WNVC 2HWF3 4GMP3 4AFMA 4FAHA 3BALA 3PMEA 5D8AA 2Z2SB 5HBAA 1APNA 3EO6A 1AJKA 2ZAHA 3TNPB 2GNBA 1URXA 3PVNA 5HI0A 4FPCA 3WD5A 5AC91 1FOD1 2A6WA 2RS52 1M06G 4O9GA 1CPMA 2R071 1QXRA 3ZXDA 4CYDA 5J96B 4YG6A 3LOBA 2PHWA 1UZYA 3ZN4A 1AVBA 5D1IA 1EAH1 2WL1A 1SCSA 1SQ4A 2IC1A 1N1TA 3N4MA 2D6LX 5F9TA 1MR5A 1R083 5GM0A 4AQSA 5C4WB 4XF3A 4RGAA 1XYPA 2FZ2A 2FZ1A 2MEV2 3UK9A 4RFT0 3B9CA 1AL22 3CO2A 1NCRC 1YO8A 1JYCA 3JBG1 4QM9A 3RZZA 3RNSA 4PIYA 3O0XA 3RSJA 5J36A 1A8MA 5AFBA 3ZYGA 3AZXA 1PVC3 3ZX7A 2D98A 3AXDA 4WM7B 4ZU7A 2D40A 5T3NA 3SH4A 3KD4A 1GZ9A 4HZFA 2B9UA 2GH2A 2XBO2 5ABJC 5I8YA 4XXPA 1Z0HA 4PLNA 1LOGA 1CAWA 3T1LA 5FQ0B 3WDWA 3LB9A 3ENRA 1WCSA 4IEVA 1IZ3A 2BEOA 4CEWB 5KC5A 5BV6A 1UMZA 3M3EA 4IV1C 1UAIA 5KHJA 4LEJA 1HXS2 1RB8G 1KQRA 4AXOA 4GXLA 4KBBA 1SCRA 2ET7A 1ZVFA 1HV1A 5T50A 1CD3G 1DGRA 1ZA4A 2ZS6B 4LA3A 3VDDA 1VB2A 3TYJA 4YW1A 3T2TA 2PHFA 4WM8B 2RE9A 1W6NB 3OY8B 3G6JB 3J9SA 3QOPA 4I3GA 3VBFA 2VU9A 2CGNA 4JGYB 1OLRA 4XF4A 4EROA 2BPA2 4RQPB 3SH3A 3VBOB 1MEC1 1WW7A 4N53B 5T5PA 2PFWA 3OBRA 3JUUA 3M3OA 3O14A 1OLQA 2HWD3 1GZWA 4YM0A 5F1RA 2IXIA 3I8TA 5JIUA 4QQOA 1FATA 1LEMA