3BIEA

X-ray structure of e coli alkb bound to dsdna containing 1mea/t with mn and 2kg
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
202
structure length
202
Chain Sequence
EPLAAGAVILRRFAFNAAEQLIRDINDVASQSPFRQMVTPGGYTMSVAMTNCGHLGWTTHRQGYLYSPIDPQTNKPWPAMPQSFHNLCQRAATAAGYPDFQPDACLINRYAPGAKLCLHQDKDEPDLRAPIVSVSLGLPAIFQFGGLKRNDPLKRLLLEHGDVVVWGGESRLFYHGIQPLKAGFHPLTIDCRYNLTFRQAGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/dna
molecule keywords Alpha-ketoglutarate-dependent dioxygenase alkB
publication title Crystal structures of DNA/RNA repair enzymes AlkB and ABH2 bound to dsDNA
pubmed doi rcsb
source organism Escherichia coli k12
total genus 48
structure length 202
sequence length 202
ec nomenclature ec 1.14.11.33: DNA oxidative demethylase.
pdb deposition date 2007-11-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.590 Mainly Beta Sandwich Jelly Rolls Alpha-ketoglutarate-dependent dioxygenase AlkB-like 3bieA00
3H8OA 4NIGA 4QKDA 3O1MA 3RZMA 3O1VA 4ZS3A 3BKZA 2FDGA 4ZS2A 4OCTA 3BTZA 4ZHNA 4O61A 2FD8A 4NPMA 3O1RA 4NIHA 3BTXA 4QKBA 4O7XA 2IUWA 3T4VA 4RFRB 3RZGA 4JHTA 5F8PA 3KHCA 3I49A 3T4HB 3RZLA 4IE5A 3RZKA 3BTYA 2FDIA 4NPLA 4QKNA 4QHOA 4NJ4A 3O1UA 3RZJA 4IE6A 3KHBA 4CXWA 3H8XA 4NIDA 3O1SA 4CXXA 4IDZA 3S57A 3RZHA 3I3MA 4IE7A 2FDFA 3S5AA 4IE0A 3BI3A 4CXYA 3H8RA 3T3YA 3I2OA 4NRQA 3BIEA 3LFMA 4NRMA 3BUCA 4QKFA 3O1TA 4MG2A 2FDKA 2FDJA 4IE4A 5DABA 4NIIA 3O1OA 2FDHA 4NRPA 3BU0A 4MGTA 3O1PA 3I3QA 4NROA
chains in the Genus database with same CATH superfamily
3MW4A 4CDQC 5JOZA 5BXXA 4NIGA 4DFSA 1RHI1 1NCQA 1PNGA 2VH9A 3ELNA 2JDHA 4AVVA 2G1MA 3O1MA 1JYTA 2VOWA 1BEV1 1CESA 2DV9A 4Q8KA 5FP8A 2VMCA 2WS93 3JBG1 2HBUA 3GJBA 2YC4A 2W1UA 2W08A 1UKRA 1BQPA 1VBE1 1EV11 4FFIA 4XBNA 5A3MA 3OYWA 4K8FA 3H0OA 1W8ZA 4Q4Y3 3UJOA 1V6NA 3M3QA 5DQ0A 2WWSA 4AVCA 4XZUG 3THPA 1KRIA 3C7HA 4AAXA 1OUSA 1AZDA 3ZXEA 1SBDA 4GWNA 5HXVA 3AX4A 4ARXA 5FZKA 1HW5A 1PVC1 4LO5B 2P1BA 3WW2A 1RUH2 1DLCA 1AYM3 2RDRA 3AZVA 1WLDA 4UFHA 4BLJA 5BNQA 3FE5A 5C70A 5HBAA 4XC9A 2Z69A 2BU9A 3BN6A 1O3TA 3LWCA 1LOCA 4QT6A 3MYXA 3P3PA 2PFWA 3OUIA 1YQ8A 1PGL1 1MVEA 2AC1A 5FYVA 5FYTA 1HRI1 4YGBA 2Q1MA 4L9BA 2Y0IA 2JD4A 4LBOA 2O1QA 3GCWA 2OA2A 4OYUA 2FMYA 3MLLA 4PIZA 1OT5A 1OMIA 5FMDA 4QU1A 5GZEA 1TME1 1V6IA 3KHBA 5LA9A 3K3OA 4LOTA 1OC1A 4GMP1 3T2TA 2Y0OA 5A70A 2HWF1 2QQKA 5ABJA 1GP6A 3W20A 4IDZA 3S57A 2O8QA 1REEA 4Y22A 3KT4A 1GLHA 3ZKYA 4KH9A 1HV1A 4M00A 3V56A 5JXIA 4YG3A 3KVBA 4TLFA 3WW4A 3T2PA 1HQLA 4EYUA 3N9QA 2RVAA 4TN7A 2CDPA 3HMYA 2VZPA 3D0JA 1W04A 1AL22 3ZR6A 2KXLA 1TNFA 1XPWA 3SQOA 4Q4X1 4ZXEA 1PHMA 4ASKA 3GJAA 2G9ZA 5BNNA 2PLV1 1YI9A 2A5ZA 5HV4A 1LECA 2K46A 4XW3A 3AFKA 2BWAA 2GMEA 4X6QB 4CDQB 3KM5A 1I9RA 4I02A 4COUA 5FYUA 1MEC1 1DLLA 2YDEA 2R0FA 4S2DA 1H30A 4YZ5A 2ZGNA 3CJIC 3VBOB 2OPWA 5F37A 1BMV2 2D7FA 1GWLA 1ULDA 3ALQA 4KWKA 5FYMA 5J96B 5A6QA 2CY6A 4HLTA 1BHGA 5FR3A 3IN9A 1P8JA 1M4WA 3VD3A 4LLFA 1VE0A 3APBA 1I1EA 1NA1A 1UMHA 3JQWA 1GMMA 4ZU5A 1SACA 3QBQA 2NLRA 3EQEA 2V72A 4Y4RA 5IHRA 3I3QA 3O14A 3MW2A 5CNAA 1RUE1 4DEVA 4PDWA 1ND2C 3ES4A 3GXUA 3MI8A 4Q0QA 3S7IA 1UAIA 1UQXA 3KMHA 5LA2A 4JZRA 2ZCWA 1DYOA 1PO21 4QGMA 1HQWA 5FYHA 5FP4A 3ATGA 5FIXA 3BOWA 1S55A 2JB4A 1XE0A 2B46X 4KI5M 4OUEA 1XE8A 1NT0A 4S2FA 1QU0A 2UWCA 5IFPA 4XAAA 2C1FA 3N9LA 3RMXA 2O0OA 3RGBA 4KG0A 1VJ2A 1VBB1 2WFF3 2B42B 3WF2A 3IB3A 4JQTA 3LQCA 1DYKA 2Q8OA 5FY9A 4P08A 4GWIA 1YIPA 3N7JA 5FWEA 2A7AA 1LHNA 3K4AA 1R1A2 4MGQA 2JG9A 3OY8B 2BGCA 3HR9A 1ND3A 1YQCA 4F83A 5FFOC 3AJYA 2R0HA 1O8PA 5GM0A 4BMEA 3CJXA 4QQ2A 3OGRA 3JB4C 3EO6A 4Q2FA 3I59A 4B4PA 4B4RA 4LO6B 1LHVA 5C4WC 1UY3A 1QH6A 1QY4A 5FYYA 3U14A 1QJFA 1Q56A 4GB32 3J7LA 2YC2A 2A6ZA 1ODMA 2OX0A 2ZGQA 3N7KA 2HWC1 4FP2A 4OI2A 4Z07A 5HXMA 5T5OA 4V2VA 1C4RA 1VBC2 4XILA 5FZHA 3M70A 4XJWA 4KNCA 1NCRC 2VUAA 2WN3A 2L9LA 1VIWB 2BGPA 4HN0A 3A22A 4WBBA 1LULA 3JD73 1W9TA 2RS33 2VZVA 3B94A 4GULA 4NHXA 4OHWA 3WDYA 4AEDC 4JDMA 1OURA 3HD8B 2F4PA 2E33A 2CV6A 2YFZA 3PU3A 4JC1A 1C5HA 1E5HA 2GDFA 5A80A 3ON7A 1J1TA 5A3NA 4A45A 3CJIB 2BERA 2W0XA 5ISLA 3TRSB 1LNSA 4I09A 1UYXA 1H4HA 1RUC2 1QEXA 1O5LA 1QHDA 3MW3A 4P02B 2XGXA 1JYVA 4PI2A 1DCSA 3DUIA 3ZYIB 3MEPA 1D4VB 3OEBA 2X05A 3WG3A 4IGQA 3JD72 2RS32 5C33A 1N1YA 1E57A 4YRDA 1JUIA 3KF5A 4NRMA 5EXOA 5KXDA 1TNRA 1ULFA 2H0BA 2C4XA 2VL4A 1ALYA 4WVMB 4EWEA 2MEV1 3LCPA 5JR2A 2YC0A 1OH4A 1AX1A 4YFWA 2VCAA 4QB2A 1QQP3 3GBGA 1B35B 4JDNA 4ZONA 4NIAA 4R9BA 5FZOB 3JUUA 4RQPA 3MUY1 2P5BA 1RUF3 2E7TA 4JGYB 3FLRA 4UT5A 3MUZ1 1OPMA 1H9WA 2VY0A 2R042 5FXVA 5A3PA 4OUMA 1ULGA 2PHWA 3U78A 2R1BA 5JAXA 4E2SA 3ZN6B 3OBAA 4XQWA 5H9SA 3ZSEA 3V64A 4JDOA 4DY5A 4E2GA 3ACFA 4YNIA 1X8EA 1YQ5A 1O3SA 4XJ9A 1VBD3 3O1VA 4BE3A 1UX7A 3VBHA 2DUPA 2NZ9A 4UF0B 1W6PA 3CEWA 1QQP2 3SH5A 3WCSA 3FN9A 3OEAA 4QU2A 5F3GA 2R073 1OOPA 2JICA 1RUF2 3WDTA 3DECA 2QQLA 4DUXA 3PMEA 1FNZA 4S2HA 4K6BA 1VP6A 1YFWA 3ZXFA 1I5ZA 3LEIA 1ZZ7A 3BCWA 5GLWA 2HEYF 1U5XA 1W9SA 3AP5A 4CUBA 2XVGA 4IV1C 1Z78A 2XHNA 4AEDB 4URAA 2W5FA 1HXS1 1PM7A 4XEZA 5F5CA 1UYPA 2XH6A 4PIYA 1DGWX 3VBFC 4B1MA 2VW0A 4BIFA 1VBD2 2YGMA 5JSPA 1H9PA 3PDQA 2Q1ZB 4QGNA 3SKVA 2FDIA 1QJX1 3POJA 4D6RA 3LE0A 4XF1A 4P9JA 4QHOA 2BYVE 2AZ5A 3NSTA 3B02A 3DXTA 2EALA 5F6KA 2YYOA 3MO4A 5JLVA 1JU4A 1RUI3 5FCCA 3PU8A 3D3AA 2AEZA 2K0GA 4RR3A 1W99A 1W6NA 4AFBA 3RVHA 2VOVA 3T0AA 4OFGA 4AXOA 4BHPA 1VBA3 5C8CB 2JKXA 2KM2A 4XDOA 4MGIE 3WR0A 5JOXA 1TQ5A 1WKYA 4NIDA 1AR63 1N1SA 4MZUA 1QOSA 2VQ0A 3VKNA 3CU7A 5FJHA 4Q4W3 1S0DA 3C2UA 1Q5OA 3H1MA 3MIEA 1EAH1 2JJ6A 3ZYPA 4AGVA 1SLLA 3WP3A 2VZQA 2I07B 2J1RA 5FXZA 4ORFA 3K2OA 4QXKA 2VC9A 1OQ1A 2JDAA 5EIYB 5FZ6A 4LT5A 5A7WB 2WZR1 1WMXA 3PHMA 5FY1A 5I0UA 4QDQA 4XMAA 3GZTB 1BBT1 2EXKA 2VGDA 1U12A 4UW4A 3BI3A 2WNUC 4ASLA 1WZXA 3AKQA 3S30A 3W5MA 1QKQA 3BGAA 4XBLA 4YM2A 3T0DA 2Q8CA 2MPFA 3AM2A 1PNFA 4SLIA 2QQJA 3BUCA 4GKXA 2UY9A 1AR62 2ZGMA 1OD3A 1NX9A 3DGTA 2OZJA 4X8NA 2W68A 5FAXA 5CFDC 4RSUA 2X8KA 1V9U2 3J8F3 4UFMA 3SITA 5A6ZA 4FOYA 1HB4A 2R30A 4FTSA 3E97A 4YWAA 1UWWA 2OW4A 1LEMA 4YVWB 4NUBA 2Q8EA 1DG6A 1EY2A 3VZNA 3ZFFA 5IVFA 3TEZA 2GN7A 4QPWA 1CZVA 3WEZA 3ZFGB 1PZ7A 3WQBA 1AR91 1AVBA 3H42B 3S5QA 1LCLA 3CZUA 5T5LA 2WWJA 1HB2A 1OA3A 2CAVA 5JZGA 4LEJA 4AR2A 2D97A 1UU4A 1C1LA 1D2SA 1JW6A 2W52A 3IMNA 4IEXA 4YLZA 5CFCC 4CZSA 2ET7A 4UFLA 4QQHA 1YJKA 3TWIA 1ZRRA 2YU1A 3TNPB 3URFA 5AC91 2C0ZA 2XBO3 2A71A 4QXBA 4TSVA 2VMHA 1OKQA 4UAPA 1ENSA 2VNVA 2ZGRA 4LKEA 4XMIA 5FZCA 3ENRA 4CEWC 1AXYA 4PJYA 1ZBE1 1JTZX 5JDBA 1AUYA 5CVRA 2RDSA 4JGZA 1WMFA 4XUQA 1I5PA 2XHKA 4AEMA 3TNQA 4LBNA 4AWDA 4PLNA 5FUNA 1ZA7A 3OGVA 5T50A 1ZREA 5A32A 2C5DA 2QTWB 3OG2A 1RUJ1 4NPRA 4MHUA 1QGLA 2SLIA 4LO7A 1BYHA 3FMGA 1ZBA1 2BBAA 2XOMA 4YSFA 3NKTA 5FY0A 4AQ2A 3VD9A 2ENRA 2XBO2 1FV3A 4LO8A 1GICA 5A3OA 2DVDA 3UT0A 5AVPA 4MGSA 4AHZA 4JTOA 3U11A 5I0RA 5I0SA 4CE8A 1D4M3 1KJLA 1XB9A 2Y6LA 5F5AA 3S0MA 4YZ3A 5GLZA 4Z92B 3CMGA 3GCXA 5J3UA 2ZX1A 2HWB1 3GYDA 5HPOA 5F2SA 1EYBA 4CEYA 3WINE 1RIRA 2ID4A 1DP0A 3G6JB 5JSOA 4HANA 4BJ0A 1MS1A 1UY0A 1XYPA 2YFUA 4BDVB 4CDQA 3TEYA 4FPKA 4YW1A 1IPKA 2D3PA 1DBNA 2ZEXA 3ASIA 4IV3B 4KWLA 4Y26A 1R091 1OH3A 1PMJX 1SCSA 1OSGA 2R32A 5CFDB 3GHMA 1C8NA 4YZ1A 1UYZA 4COZA 4MUVA 1HJFA 1N1VA 3NKGA 2B4KA 5IVJA 5FZ7A 1D7PM 4OMDA 4RHV1 4MXWB 2E32A 1AYN1 1WCKA 4LA3A 4LBJA 2Y6FA 3JCIA 5H9RA 3GALA 5IJRA 3ZYJB 5FP9A 1DQ1A 2JG8C 4B4QA 5JOWA 4LXLA 1POQA 2PAKA 1QJY3 2XONA 3ZFEC 4FAHA 4A3XA 1VLNA 2WRAA 1Q43A 2P37A 2X5IC 2UYAA 1WLCA 3DCQA 4GH4C 1GOFA 1CONA 3A0KA 1ZYBA 4GMP0 3N9PA 4R4ZA 5JWPA 3LIHA 4TZDA 5H9QA 1B09A 5HCFA 1V00A 2VOXA 1Q8PA 2RMU3 4EN9B 3VDDB 4FVVA 4Y33A 1HRV3 3N35A 2CTVA 2HYXA 3N3HA 4YW5A 3ORJA 4N7IA 1AXZA 2VVEA 1DU3D 1XNDA 3GZUC 5A7QA 2W95A 4QX3A 5K0UB 4C91A 1ZM1A 3DYMA 2XQRA 2JKBA 4CUAA 2GC3A 4MSVA 4PQ9A 3ES1A 4YGCA 5FYIA 4AQSA 5GZCA 4PF1A 2D6NA 3ACHA 2JDZA 1CGPA 1K5JA 4FFHA 2P3JA 2W46A 1JOBA 2WQ8A 3AXEA 1LRHA 1J59A 5B4NA 4OHYA 3QH7A 5KWRA 1FMD1 3N9OA 1IKQA 2RMU2 4FPEA 2VECA 2ZGLA 3A21A 1HIXA 1YJLA 3C3VA 1W8UA 3KQ4B 5F32A 2NPIA 4ATFA 4ZKTB 1LJ7A 4WVZA 3V0AB 1VRH2 2ZMNA 3TN93 5IVVA 1QMJA 1PK6A 2DCKA 2BQPA 2WDBA 2WZ8A 1PMIA 3C7GA 3CO2A 3HQUA 1WLWA 3NW4A 4QX0A 1IQDC 4CDXB 1ASJ2 2QDRA 2IXHA 3KT1A 3AVRA 4QPIB 4E4SA 3O1RA 4L99A 4IEQA 4GWJA 2JIJA 4Q4V1 2G9FA 1K5MC 2RM23 2CDOA 5L9BA 3WNOA 2WQ4A 3AXDA 4TWTA 3WY6A 4BOWA 1ONAA 1DGRN 2BFUS 3NO8A 4Q26A 3RYPA 2AR6A 1OFSA 1HB1A 4P9WA 3E6BA 1W0OA 2CU5A 2QFEA 1J3QA 3O7OA 5D8AC 3WW3A 5IK5A 3J4UH 4XCBA 2A1XA 1W2UA 3MBWA 1ODNA 1CWPA 3VL8A 1CZSA 2YU2A 5GLVA 1S0EA 5A7NA 4FPGA 5FOJB 4JCKA 4S2GA 5CKQA 5B4XA 5FZFA 2JG8B 2P6HA 1W8HA 1VAKA 3OB8A 4YW3A 2RS12 1E5RA 1ND2A 4GH4B 4IEOA 4I0WB 1RUD1 4L97A 1S2EA 3ZMOA 1MPXA 4AFAA 1NXD1 2YROA 3BYWA 1FNYA 1QXJA 4XFIA 2J1UA 1F35A 4XBQA 5FZIA 4ASMB 3N4MA 5HCHA 5CBLA 5T54A 1KD7A 4QX8A 2P4EA 3I8TA 2EXHA 3WX5A 2B9VA 2H0VA 1CR7A 4M3CF 1SFYA 4W65A 2RR13 5FMCA 1MZFA 2BP6A 4IQPA 1GYKA 1IHMA 3ZMNA 2WO1A 4EROA 1Z7S1 2A6XA 4CUCA 2RS52 2V5YA 3H50A 4AL9A 5LZ6A 4DZGA 1IGOA 5J1XA 1JHNA 1AR82 1NLQA 2FCTA 4RFT0 1H8TC 5DAQA 2PQQA 2CYFA 2WS91 1SLCA 2ZGPA 1EUTA 2XVKA 3JQXA 3MF6A 3N9NA 3WUDA 4DB5A 2C26A 2R062 2WA3A 5LRSA 4LKDA 1URXA 3TAYA 4XFGA 1NY71 2WO7A 2WNEA 3E5XA 3M3IA 4Q4Y1 1H2LA 3I2JA 4CP9A 1KQRA 2A6YA 2Q5TA 1UX6A 3K51A 1UPIA 4HONA 5C4WA 1RVF2 1POV0 4AEJA 4ARYA 1UIJA 5A33A 3HN1A 4NVPA 4P9YA 3AP9A 5DAVA 4QX5A 1SQ4A 4LULA 5CAZA 2YMZA 5IT6A 5LY1A 1UCXA 4NWVA 3ST7A 1NCRA 2XLFA 3AC0A 5DUVA 1ZRFA 3Q8FA 4MV2A 1XU1A 1OI6A 1AYM1 4P9IA 4PLMA 4AGGA 3O1PA 3WF3A 1RUG3 1BK1A 2EIEA 1K5MB 1ULOA 2I2SA 2PTMA 4I30A 5FZ4A 1SPPB 1VAVA 4FXKB 5EWSA 3H3ZA 1AR73 2Y6GA 3Q9OA 4QKDA 3KZ4C 5AFEA 3LF7A 3OD4A 1H8VA 3E5QA 4CCKA 1ZZ6A 2GC2A 4IETA 3ZR5A 2E31A 5D8AB 4UOJA 5CISA 3VKMA 4K3UA 3CLPA 3UESA 2J1VA 4XF3A 1ENQA 1X36A 2F6BA 4CSWA 5C7GA 5HI0A 1TMF1 1DZTA 1WA6X 2IVIB 2ZX2A 2YBSA 4O61A 2BBVA 2QKDA 1LGNA 2V09A 2ZGTA 2O8OA 5T55A 2DCZA 5IVYA 5FK7A 2BGOA 1JZ3A 1V6MA 5A7SA 5L36A 4CCOA 3UK9A 3LDKA 5LK7B 4C0HA 1RJ7A 2VR4A 2DU0A 1RUG2 2K2SA 2WFPA 3HNBM 4Q1PA 1O4YA 3UV9A 4CDUA 5SV8A 1AR72 1Q8QA 1W0PA 5C3PA 1RUNA 3N36A 1RUH3 2VE1A 1VB4A 3VBOC 3HBZA 3PUAA 4AGRA 4AW7A 5C3OA 3G7DA 4QHZA 4IE5A 4CCNA 3BODA 2LM3A 5C8WA 4E27A 1TZOA 2VUCA 1GZCA 1EP0A 4OMCA 1NOVA 3T09A 3V65A 3SCFA 3HN3A 2EIGA 5FP3A 3F95A 1FOD2 4QM9A 3WV6A 4E8DA 1BKZA 1XBFA 2DURA 1J84A 2JENA 1CX1A 1LHWA 2ADDA 4WM8A 1COV1 1H8TB 1MACA 2D5FA 4QQLA 3UGHA 1AX0A 4B29A 2XJPA 1GZWB 3FLTA 2XQXA 3A4UA 2XVLA 1O3QA 4BK4A 1XU2A 3IDBB 4EJRA 4L0PA 2ZHLA 3IMMA 3W9AA 5EYYA 2QQIA 1CN1A 2XJUA 3DKWA 4FP3A 4UBHA 1GWKA 2RJKA 4D8MA 3USUB 3WDWA 1F15A 1UMIA 5JPMB 4KWJA 5F7UA 2DWRA 3X29B 3NV1A 1GBGA 3NAPA 1AL23 2W3JA 4XETA 4A4AA 2BTVC 5C9AA 3ABZA 3H3UA 3HVDA 1OLRA 2JDYA 5KHJA 3WSOA 4A7YA 4IV1A 5KHKA 4CCEA 3HJRA 4CRQA 1AHSA 1IG3A 4ES8A 3I3DA 3THCA 1F5FA 4LHSA 1UU5A 3FHAA 3PL0A 4QB1A 3WOGA 5FWJA 3KGLA 5E89A 1RL3A 3MV01 3U1XA 3VBFA 2TEPA 3GBWA 1C8M1 2HWD3 4XTMA 2XMLA 1QOOA 1JZ8A 4I3PA 2WFF1 5DAXA 3VDCA 2VD7A 2BVBA 1KXGA 5EQUA 2DFCA 2UURA 1PIV2 2GC1A 4HPKA 1CVNA 1W90A 3FJSA 3HNYM 1H1MA 3WDUA 1IQAA 1DQ6A 3GF6A 4YVSB 1G86A 3JB8A 1LU2A 2JB8A 2HLEA 3O0XA 2PHTA 1TG7A 5FK8A 2VZTA 1F9KA 1EPWA 3ME2A 1C57A 3T30A 3WQ1A 3OF1A 3LSDA 4Q0PA 3UGGA 1JODA 3NNGA 4XF0A 5C71A 3NNFA 5A7PA 2VOTA 3NNMA 1SLIA 5BNOC 2LUWA 4U2AA 2J1EA 3CNAA 1IG0A 5CB7A 1OQEA 2Q1FA 1YFYA 1BXHA 3Q8AA 2HWD2 1DQ5A 3VZMA 1W8NA 2SBAA 4M3CB 5FZ1A 5I0TA 1GP5A 4ZU4A 2AEYA 1YFXA 4CYDA 3O12A 3VB9A 1BVP1 2HH9A 2PYTA 3JD71 1O4TA 3INAA 3NNJA 4Q1RA 3JBG3 3VKFC 3VUOA 2FD8A 3B69A 1V0AA 2WNUA 4RD7A 2NMNA 5KHIA 4OHXA 1VBE3 5I8TA 2GZWA 3QOPA 2CGPA 5I91A 3RZGA 5FKCA 3DPRC 5LY2A 1RITA 4B7KA 3EJKA 4LO4B 4D3WA 3ZLIA 2VQAA 2VCCA 1JS9A 1R1A3 2IXJA 5T5PA 4CCCA 5BPXA 3POSA 2ARBA 5C5UA 4QB6A 1RHI2 2CAUA 3DYPA 1V70A 4K40A 2JWPA 1B35C 1HV0A 1OVSA 1CAUA 1BEV2 5GALA 2VAUA 2YV8A 4LITA 4GB33 5JXGA 2UWBA 3JBG2 2B45X 1CPMA 4JGYC 4N53C 4N43C 3SNMA 5FDBA 2PXJA 4AVBA 4Z2WA 3AK0A 4IEVA 1VBC3 4BB3A 5FMOS 1MQTA 1VBE2 2ZHMA 1UMZA 3H9AA 4TLGA 4AEKA 1EV12 3M3CA 5C5TA 3V0BA 2PHXA 4X6RB 5CFCA 5FQ0B 2YPDA 2VVDA 1V6KA 2Y33A 2ZPXA 5JMOA 3POGA 4K8RB 3I2DA 3OOXA 1RJ8A 3T2OA 1AJKA 1QQP1 2W39A 1XSQA 3ACGA 5C3SA 4BPZA 5LW9A 1JH5A 1E5IA 5FBZA 3VBRA 4CEWA 1W3XA 1RUF1 4L11A 1PVC2 4FOWA 2VZUA 3VZOA 3LDBA 4B3NA 4GJZA 3WZ1A 1N3PA 2A73B 3C7EA 2D6PA 2AGSA 3R6SA 1RUC3 1X82A 2XXZA 2Y8KA 4Y1YA 2WT1A 4LLOA 4P5YA 2Y6KA 3NWKA 4XVHA 3S5AA 5FZAA 3IZOA 1NXMA 4H55A 4WM7C 2VMFA 3R4SA 1CAXA 5LEJA 2KD7A 2ZA9A 4LJHA 3FUOA 5FREA 3BIEA 1PGL2 2ZHNA 3A23A 1HRI2 4BXSV 1W6MB 5K9YA 1ULPA 5ANNA 5DPNA 3RJRA 2XJVA 4I01A 4Q4X3 4KU8A 4BZ4A 5KXCA 5LASA 5APAA 4XFCA 4W8JA 2VBPA 2BOJA 1TME2 5BNOB 1G9AA 2R071 5D2AA 1T6BX 1NE4A 4CDWC 3T1LA 1S0FA 1GSLA 2E51A 4NIIA 2XUEA 3KS7A 1DDLA 4XUPA 4BQWA 5FPXA 2HWF2 1DZQA 1MEC3 3ETPA 3HWJA 4HXCA 3NV3A 4IGPA 4UW3A 4OQ9A 4ISRA 2R16A 2OVUA 3IKWA 5LA0A 4R4XA 4AHWA 1XNKA 4HZFA 4XACA 3HQRA 3P3NA 1AL0G 1CIYA 1LR5A 2GMMA 2PA7A 3O0VA 4FQZA 3AMPA 4MGTA 1W6QB 3SEEA 2YXSA 4FXGB 3U10A 4CCMA 4QPGA 3ZO0B 5F3CA 3EMRA 2R043 4UYBA 5C8CC 3H8OA 3VN4A 4EN0A 4V1PA 5SV5A 3DPRB 4H14A 4DNYA 1CAVB 4Q4X2 5E8AA 4INDA 3ZIXA 4BM8A 2PLV2 1GQHA 2ZXQA 4ITCA 1OUXA 3BTAA 4Y20B 5L7OA 1RUI1 1Y3TA 2VZ3A 5GLUA 5JPNB 3BKZA 1F4AA 3LFIA 1ZRCA 1MEC2 5BNPA 1DFQA 4AI1A 1HX6A 1PO23 4HKWA 3VDAA 5IFTA 1AX2A 2V4VA 1WLTA 4A42A 1PVXA 3DN7A 1VBA1 2YBPA 4KBZA 4AYUA 4D7SA 1AR61 1UZ0A 4N53B 3NV2A 4N43B 3ZFEA 5IVCA 4HN1A 5FPVA 1UYYA 2X5IA 4O7XA 1XYNA 3R4UA 4Q4W1 5E16A 1QXRA 2E26A 3T4VA 4QX2A 3IM0A 3RMYA 4CA9A 4ZU7A 5KHHA 2HBTA 4L2NA 4YW4A 1CAWB 1S0CA 4CU7A 1NCQC 4KL1A 1H6YA 1VBB3 4E2QA 1LTEA 1K45A 3KCXA 2WT0A 3SISA 3PLQA 3T0BA 2VZRA 5HCAA 1RUE2 1UXXX 4EN8B 4I3GA 4D7TA 3KT7A 4PBPA 2MHFA 4YVWC 2ZZQA 3KV5A 1PO22 2B39A 3AYEA 3WP6A 5JMCA 1YXWA 3NJZA 4Q29A 4FCAA 5FPZA 4FPLA 1KDMA 4MYEA 3ZFGC 2BEOA 2B7YA 4BQ2A 1WUVA 3KF3A 1OLME 2OUHA 3LPFA 4LE4A 4N9IA 3W5NA 1HQNA 4IE6A 3K75B 1LHOA 5FLHA 3OBTA 2LALA 3J8F1 4WM7B 4H7LA 2HWC3 4KU7A 4AI9A 4LIVA 4BIOA 1G7YA 1VBB2 3RQ0A 1A78A 2Y38A 5IK8A 1DGLA 4Q0VA 4UBGA 1DZRA 1ZZ9A 3WF1A 3U75A 4DINB 5JUVA 3PJYA 2VTXJ 2PHFA 2N7GA 3B93A 5DDJ3 1QDOA 5F2WA 3VL9A 3ZN4A 4CDWB 1W0NA 2AH2A 1LOAA 1JYXA 3EXUA 3AMMA 1NG0A 4WZCA 1W39A 1POV3 3PVNA 1M06G 2NQYA 4LBKA 4AI2A 2GMPA 2JDMA 1BCXA 2VBBA 2HWC2 3RJ2X 2OUJA 4LBMA 3LFMA 2WNVB 2RE9A 2ZX3A 3IDCB 3RPQA 3KWVA 3WT3A 5M0TA 3HOBA 1RXFA 4QWNA 1GZTA 2Q0AA 3CZJA 4XXAA 4YYOA 1JZ4A 3VKLA 1W9YA 1U5YA 3OPWA 1W9FA 3THTA 1V9U3 2G19A 3OBRA 3UJQA 4LBQB 4O9EA 5DDJ2 1W03A 4FPHA 3M3EA 4ES9A 3O0WA 2RJLA 1JYIA 3AP4A 5BYNA 2MEV3 1R64A 1CPNA 2W1SA 2HWE3 4RS5B 1MS9A 1UY1A 4EE2A 4N8MA 5BUVA 2IXKA 3OBZA 4NHLA 4AHYA 5BNNC 4AK3A 2QDNA 2CNAA 3MFAA 4FBFA 5FOBB 4NE9A 4NROA 1QDCA 1J1LA 2P3YA 4GA9A 2IVJA 3U37A 4B8EA 1W28A 1SG3A 1D4M1 1MR5A 3R0RA 4A2UA 3FBMA 3FHQA 3NV4A 1NCQB 2WJSA 2IXLA 3AKPA 2Z79A 4IV3C 3OGGA 3PUSA 1Y9MA 2WAOA 2V73A 3AYCA 3DV8A 1UPSA 3PVOA 5FO8B 2QQOA 3RWNA 4FI9A 1RGSA 4UFJA 4M4RA 5C6CA 2XG3A 4AVSA 3K48A 4Y1UA 2MEV2 1RTVA 1KS4A 3RG0A 4CCDA 4XF4A 1W8WA 2A75A 3WP4A 4KGQA 2HWE2 1GFF2 1X9PA 3OYWB 5FKBA 2Q8DA 3BPZA 4IGOA 1GNHA 4A44A 1WBLA 4JRAA 3S6PA 4JHTA 4PDWC 5EFUA 2QQWA 2DTYA 2EICA 1HN1A 4Y1XA 1JHJA 2D6MA 1V6JA 4IUGA 5AFBA 5CKNA 2RDQA 5FY5A 3VDDC 1GQGA 1ZZBA 1LOGA 1R081 3AL5A 3P1IA 1UNBA 5LK5A 5K0UC 1QJY1 4HG6B 2VPVA 1UY2A 2AENA 1HXS3 2WIIB 3PIJA 4IEYA 3SEPA 1D0GA 1XC6A 1NE6A 1PO11 4GIQA 2IFRA 4M01A 3K4DA 3MFCA 4KGGA 2ORZA 3WQ7A 3R05A 5IAVA 3IPVB 4Y3OA 2GH8A 1QJX3 1X33A 2UY8A 3VGIA 3IDEA 1PX4A 5GZFA 3WG4A 3O1UA 3ZIWA 2J1AA 4C0BA 4O9GA 2GNBA 1HRV1 3H7YA 1OKOA 2FCVA 2XJSA 5A6YA 5L9VA 4IXLA 3MGUA 3T2QA 1V6LA 1S0GA 3PIGA 4GZ9A 3VV1A 5IK4A 1Q8VA 2X29A 1HB3A 5ANQA 3WG1A 5ERLA 1ND3C 1CQ9A 1Q3EA 5ABJB 5LCWL 1O91A 3M2MA 3WF4A 2DCJA 4KWUA 4FPFA 1H2NA 2P3IA 2ZX4A 5FY4A 1G6NA 4Q8LA 3ZSJA 1G8WA 2JE7A 2DDUA 1HXS2 2OT7A 2DFBA 4J1WA 2CL2A 2OPKA 5CYYA 3EHKA 1IS6A 2D5HA 4AFMA 4CDXC 4PBOA 4QPIC 1QJX2 4O65A 3VHRA 5FLJA 2ARAA 3H8RA 5F39A 3H7JA 1LAJA 1I3HA 4UXAA 5BNNB 3I7DA 2YPJA 4JTNA 4CCLA 4Y5Z0 2GAUA 1KDKA 4LKFA 1WW7A 3P5BA 3TN91 4XABA 3VBOA 2R49A 5DMYA 1RUOA 1UOBA 2KA3A 2E9QA 2ORXA 1KJRA 2WR9A 2FDJA 1U0AA 2AACA 3WDXA 2FMDA 5FZDA 4QAWA 1ENRA 1QNYA 2DBNA 1SFPA 2G4IA 5ACA1 1VMJA 2LRPA 2RM21 2VQTA 4JQRA 3VD4A 1EAH2 4FFGA 2F4LA 3FX3A 1DQ4A 5A6XA 4IW3A 5J98B 3RZZA 2OZ6A 2XPJA 4HK8A 4YG6A 2Z42A 4Y24A 2MNGA 3GZEA 2WZR2 3B01A 4FSJA 2WABA 2FQPA 1MS3A 4OUSA 5EV7A 3KVAA 5A3WA 4D6SA 2WAAA 1BBT2 2OS2A 1US3A 4R9DA 4PDWB 3ZXGA 5C3QA 1WMDA 2YG0A 4MXVA 3WVJA 3ITQA 5A3TA 1SCRA 1WCSA 1JZ2A 5GKAC 2CSGA 1YYNA 3HT1A 3POFA 4QDSA 1GZ9A 4YGEA 5FBJA 2QVSB 2XJQA 3L9JT 1QNWA 3VDBA 3QCWA 3NJYA 2JE9A 2ZGUA 2BOIA 2R1DA 2CGOA 3AL6A 3ZPOA 4F8AA 2X09A 1IS3A 5DAPA 5JIAA 3TOJA 4XYXA 3MPBA 3QACA 1UKGA 1GOHA 1A8DA 1TVGA 1VRH3 1QF3A 1WBFA 2JD9A 4I0BA 4RQPC 3MLJA 4P14A 5CG8A 1UL9A 3K4ZA 1UY4A 3M4FA 1ASJ3 3ILFA 3TEXA 1H2MA 3OPZA 2NMOA 2J1SA 3GM8A 1AR92 3TEWA 4BU2A 1E5SA 5LBBA 3POIA 5A3UA 3OY8A 4LHLA 2VG9A 2ZTNA 4LIUA 5FRAA 3W58A 4EN7B 1RMU3 4HMZA 3ZPYA 2JG9B 1OPOA 2QZ2A 3PTRB 2RR11 1ND3B 1MVQA 4NOTA 1XOYA 1ZBA3 2DVFA 3VBHC 1J3PA 1SZBA 2Z4FA 4Q0UA 5AC92 4PHZA 1S2KA 5FPAA 5J36A 2HEVF 5L19A 3GZAA 2LW8A 4FPCA 2YGLA 1FPN1 3D5OA 4QX7A 3O5SA 4GJYA 5JCTA 3RZJA 1OOPC 3ILNA 4J25A 2FCUA 5CA6A 1WD4A 1ZBE2 2PAMA 2W87A 3LOIA 3OGSA 1ENXA 1OA2A 2BNMA 4META 1ZVFA 4XCAA 4W50A 5FYZA 1W6MA 1K42A 2ZAHA 4CXWA 2OQ7A 2B9UA 2RS13 5LWBA 2TBVA 2XLAA 3WP5A 3FL7A 2QJVA 3SCGA 2WZEA 2Y26A 2QNKA 3VZJA 1RMU2 1RUJ2 1H4GA 3MF9A 3RSJA 3ZDVA 5BNOA 3MIFA 4XFHA 1A8MA 1JXNA 1W06A 2WWUA 3CJIA 1J83A 4HK9A 1ZBA2 2ZMKA 5GZDA 1N47A 3OSDA 5E6HA 2W94A 1R093 4QXHA 1TEIA 2C6SA 1L7LA 1BZWA 1UOGA 4BQ3A 2DVAA 4OI0A 1RUG1 2E7QA 2V5DA 3K46A 4RGAA 2FDFA 4FPYA 4MGKE 4YARA 3BPSA 3I2GA 1W8OA 4CU9A 4Z2AA 4K7JA 4RR3C 1VB2A 5EJ3A 5FPLA 3T3YA 3LSEA 2RS53 4GKYA 4RHV3 5CZKA 4DOUA 3MPPG 4NRQA 1CAVA 1AR83 2HWB2 2VMIA 1UZZA 4Y5TA 1WW6A 1LGBA 4WVMA 4V2WA 2VMGA 4Q27A 5CG9A 2BV4A 1BK0A 1QOTA 2R063 3DYOA 4L92A 4L8QA 4QGLA 3VZKA 1RINA 1ULCA 4CPBD 2EA7A 1W8TA 2W92A 1YNAA 3IWZA 5DABA 2BW8A 3WNKA 1B35A 1CD3G 3OGJA 4XFFA 1R092 2G9GA 3BIWE 3CQOA 2AREA 1XNTA 3R4DB 2P2KA 1RVF3 2ATFA 2P34A 5FZOA 3C7FA 3B9CA 2GP3A 5BV6A 4YPJA 3AMNA 4JGYA 4RQPB 4XJUA 4NRPA 5DZFA 1MZEA 4KQ7A 2EXJA 2Y60A 3CKHA 2DTWA 3J26N 3KSCA 2D98A 4RHV2 1RUH1 4K1ZA 5EPAA 3ILRA 1AYN2 3BB6A 5D21A 3ZN6A 2P3KA 2Q4SA 5JVVA 4IEZA 4HT1T 1X9TA 3RFRA 3JXSA 3B5LB 1YI7A 1H1IA 2GNTA 2XUMA 5FUPA 3VD7A 4C8DA 3DL3A 1GP4A 4NMIA 3D6EA 3AKRA 4AAPA 4ZZ8A 2DU1A 3FZ3A 2X53S 4UF0A 3VD5A 4TYSA 3N9MA 3VBHB 4E4DX 2OKXA 1W6PB 3ZFFC 2ZEZA 4WVVA 3BTZA 3B00A 2XKPA 2QQNA 3B9IA 3ZYGA 2Y6JA 3A0NA 2ZJCA 1OOPB 4JKLA 2TUNA 2PHLA 1JBCA 3I2KA 4BWOA 1G9DA 4WM7A 1OF4A 4P9LA 2E6VA 2DF7A 1UN1A 5J09A 4PLOA 2IUWA 4RFRB 3UGFA 5GLTA 1XE7A 1FI2A 4PT6A 4AEDA 1L3JA 1ZZ8A 5F1RA 2ZEYA 1QJU3 4BQ1A 2XDVA 3WNNA 5JXHA 2R7EB 3T4HB 2ZKLA 5FV3A 2D3RA 1A34A 5J37A 1JYNA 1AL21 1KFXL 1FMD2 4JGZC 5EZWA 1HJGA 2ES3A 3MIDA 1IKPA 4C1WA 2Z2SB 1OLMA 4E4ZA 5K8SA 2ZZJA 4PQQA 2VU9A 1S0IA 2E53A 3CL1A 4YVSC 1UF2C 2GNDA 1ST8A 2DBIA 3SLIA 3ZM8A 1OQDA 4ET7A 1JYWA 1FOD3 2FZ1A 1XYOA 1W05A 1W6NB 3C7OA 3KV9A 4RR3B 1SLBA 5A1AA 1JU3A 5C8CA 3BVCA 4MHRA 1BMV1 3KV4A 3OPTA 3M7AA 4XJZA 1STMA 1NLRA 4Q4V2 3VBSA 1QJU2 2VTXA 4D7YA 2VCBA 2XLGA 4LMFA 1PGSA 4EQVA 3OD0A 2LS6A 2ZACA 2W91A 2Z5WA 2WZPP 2JE8A 2VW2A 2ERFA 1JN2P 3MICA 5CEHA 3PNAA 1MS0A 5A7WA 3ROUA 1W2TA 1LKNA 1V6OA 3DKQA 1YC61 1JMUB 4A6OA 4RGKA 5CKMA 1XRUA 2ZGSA 3POYA 4Z1VA 3POEA 5FMBA 3IAQA 1S0BA 1D0HA 3IIIA 4JKMA 1Y43B 4GD4A 5DN2A 1PGW2 2ZABA 3NJXA 1Z7S3 1AJOA 1ZA4A 3HNMA 4JVAA 4BQXA 5CADA 3MDPA 3NNLA 4QKFA 3O1TA 3RS6A 3WG2A 3AP6A 1SLTA 4XXPA 2DUQA 2ARCA 3D82A 1K12A 3MIHA 1RUD2 4GQ7A 4IESA 5DZEA 2LROA 2ZBJA 5DUXA 4YVWA 5T52A 1FXZA 1YHFA 4XIKA 3O1OA 5FLIA 1PM4A 4N90A 3ZFGA 4C1XA 4PCRA 1H0BA 3ZFFB 4YM3A 1X50A 4ZY9A 1LOFC 3SXWA 5LRRA 1PIV3 5T5JA 4BISA 3UKTA 1HLCA 2OQ6A 3AMQA 1YWKA 1F31A 1R1A1 5L73A 3NJVA 1SHWB 5JZGB 1DHKB 1YUDA 4JHZA 2EVXA 2XJRA 5IYYA 4QD2A 1Z7S2 1FATA 4A7KA 2W9XA 3IDAA 4Z82A 1X8MA 2OXBA 3HAGA 3N7LA 5DG1A 1YFUA 3I4IA 3ZXLA 3U07A 4P00B 3LB9A 4XHXA 1LESA 1SEFA 2OYZA 3ECQA 4GB31 2WS92 4HVRA 1LOBA 3VZLA 2DCTA 3PVEA 5F9TA 4ZS3A 2RHPA 1S4CA 4M3CE 3L2HA 1FYUA 3GDBA 3KLSA 5FJKA 1VBC1 4HL0A 3ZYRA 2FDGA 3C8XA 3U0ZA 1C5IA 4OCTA 1GNYA 1GV9A 1NY72 1VRBA 5CU1A 5JXJA 3E5UA 4Q4Y2 4JGZB 3IPVA 1WGPA 2JEMA 3FHIB 3I2IA 2EIBA 3AP7A 5DG2A 3LIGA 5FZMA 3AZZA 4NIHA 1BJQA 2WKKA 1SBFA 2XR4A 5A32B 1TMF3 1BVVA 3D0SA 1W9WA 3WD5A 1LHUA 4P5HA 1WCQA 3ACIA 4FAGA 5IVBA 2VXRA 3T08A 1ZRIA 1CZTA 1XNAA 2J42A 1AYM2 4OZXA 5DUWA 2W1QA 1NQJA 1RUC1 5LB6A 1G9CA 1KGYA 2Q30A 3CDZB 1GWMA 1VAMA 2GSYA 4IEPA 4BXFA 4D69A 1RHI3 4W4ZA 1FV2A 4YG0A 1SBEA 4R8HA 2ZS6B 1PK6C 1SFNA 4MVTA 1BEV3 4LUKA 4XFBA 4XUTA 4DPNA 1SDDB 2RS31 2IXIA 2JX9A 1EPZA 3MHZA 5KBFA 1JUHA 3B3QE 4H2AA 1GU3A 3VHNA 4CEYB 1TMF2 5HV0A 1W2OA 3KD4A 4ISQA 4MH0E 1EV13 1RXGA 1GNZA 4CU6A 1Z0HA 2DVGA 3LZZA 5IUQA 1J58A 1MS4A 1XQNA 2WA4A 3GGLA 4IV3A 3UL2A 1Y7BA 3VHPA 3WNMA 5CFDA 4UWDA 4CXXA 5LEKA 4LKSA 2ZKNA 1O7FA 4LK7A 1COV3 5JSRA 3ZYHA 3RZHA 1MZ6A 3MIBA 3H1WA 3I97A 3VBUC 1A3KA 1GQPA 1GOGA 1PVC3 1YIFA 3GNEA 3DF0A 1GUIA 4RA0A 4NHMA 5IW0A 2ILMA 4MXWA 2R041 1IOAA 2CWSA 5G04L 3ACLA 3LGRA 3OTFA 4N9HA 1QH7A 1YQ2A 4LBQD 4P9GA 4XIOA 5A1LA 5JI9A 2VM9A 1DQ0A 1SDWA 3PVBB 4X8PA 2GNMA 4BCUA 1FT9A 1AF9A 1CX4A 3MIGA 3RZLA 1UO9A 3HBKA 2QQVA 2YY1A 4IEWA 3KCYA 2VULA 1HRI3 2TNFA 3M8LA 4COWA 3Q8EA 4LUMA 4A7ZA 2C9AA 4F3JA 3VDDA 3M1HA 3H1YA 2W1WA 4TTGA 2JIGA 2DYCA 1COV2 2VUDA 1TME3 1OF3A 4FPOB 4G9SB 4UW6A 1OBNA 5K0UA 4FQ4A 4GMP3 2BFUL 2B5HA 4EWDA 5FP7A 1O6UA 3BU7A 3LEMA 1OHFA 2VQUA 2HWF3 2XWBB 3QLQA 5EYXA 4CCJA 5KC6A 2A3XA 4H3WA 4ZXKA 2PHRA 1UW8A 1BLZA 3ZVXA 3SMHA 2VNRA 1C8M3 2IZWA 2GN3A 1NYWA 3CIHA 3H8UA 3K3NA 4YM0A 4K1YA 3T1MA 3CBNA 2QQPA 4YW7A 1MS8A 2BVVA 1GKBA 2V4AA 1OD5A 5IWFA 1VBD1 4BA6A 3AFGA 5I8YA 2RV9A 1DIWA 1YEWA 3AZWA 4QQOA 2JDKA 3J9SA 1JI6A 2PLV3 3IIAA 1EUUA 4HVOA 4LR4A 2RG4A 4OI4A 3J7MA 4M4PA 4Y1ZA 3SKJE 1LGCA 3V0AA 4ZS2A 3DEMA 2BJSA 4P9XA 3E1F1 4ZHNA 4MGZE 1IS4A 4LA2A 1PK6B 1REDA 4CDXA 1C8M2 4YW2A 4QPIA 2Y6HA 3ZN5A 2WFF2 1LENA 1UU6A 1CJDA 4K9SA 1W8FA 4DQAA 4QM8A 1XNBA 5FZ8A 1S1AA 4NN0A 4DIQA 2YHJA 4HOOA 4Z8BA 2WNVC 3PJQA 4OVEA 2KR2A 4HKLA 3PUHA 5DDJ1 1QIQA 1XNCA 4LPLA 3EYPA 5AVAA 5JOYA 5IATA 5EHDA 3I49A 4URTA 5DZGA 1RUE3 4YGDA 1POV1 4MO3M 3RZKA 1YO8A 5TSWA 3MZHA 2WL1A 3VBUB 2J22A 4NPLA 1F8VA 2NYYA 2NM1A 3THDA 2VNGA 3VHOA 4RS5C 2VJXA 4FTEA 1NKGA 2PMWB 2JG8A 2WYSA 5I93A 1QXPA 5A7OA 4HSJA 4DRRA 5GJ6A 4GH4A 1V9U1 4AVTA 1ND2B 2XKOA 3LEGA 1UOFA 4FFFA 4CDUC 3H8XA 4XF9A 3M3OA 4COVA 2VZ1A 1NQDA 1APNA 1YRZA 2Y34A 1OA4A 4XQ4A 4YM1A 2VMEA 1R1ZA 1SMVA 1IS5A 3AYAA 1OFNA 2HWE1 5LBFA 4AE2A 3DXUA 4KMQA 1UZVA 2JECA 3NL1A 3AVSA 4FOQA 4LTAA 5FPBA 4NAMA 4FT8A 2PAEA 3I2FA 5FZGA 4IE7A 3WW1A 3AZYA 1L7QA 5F5QA 3RWKX 5HCBA 4CP1A 1W6OB 4GAZA 4CXYA 1CIWA 3KV6A 4PIXA 4WM8C 4TXWA 1KITA 3AKSA 5IK7A 1X7NA 4QPYA 5KXEA 2RJ2A 2YUEA 4DXTA 3VKOA 5KR7A 4R52A 2WYFA 2BPA2 1JZ7A 4WVWA 2ZMLA 4CP9B 1LU1A 1VR3A 3IBMA 3KB5A 3ZSLA 3KQRA 5I0DA 5K7PA 2VNOA 4DXRA 3WDVA 5C4WB 3WCRA 3PURA 1UXZA 1HN0A 3KCCA 2VXJA 3PUQA 4W6XA 4DXZA 1GANA 4NHYA 5A33B 1PZ8A 4E8CA 5FY7A 3I54A 3NAPC 4K21A 4NR1A 3FWEA 1ZX5A 4OHZA 2VOKA 1NCRB 5C9AC 1DF0A 2EAKA 2XBO1 4ATEA 3A7QA 5FO9B 1K5MA 1SPPA 5IAXA 3L2YA 3FLPA 5FTTC 4MLOA 3JU9A 4U36A 3WHUA 1F4HA 2QUOA 2Y64A 5ABJC 1QWRA 2F17A 3RZMA 5D8AA 3OUHA 5EP9A 3I3EA 4HKOA 1LODA 2WC2A 2VVFA 2QBXA 2R072 4FOVA 2FZ2A 5FZ3A 3LOBA 4OULA 5F5IA 1KS5A 3KGZA 2HJIA 1YCIA 4E9KA 4NPMA 3CHXA 5DUUA 3BTXA 2ET1A 2IFWA 1ZZCA 2X10A 3VBSC 1OXCA 4NHKA 4AQ6A 4YFZA 1H6XA 3MV11 4GWMA 4CDUB 4PI0A 5F8PA 5KC5A 2BDRA 4CUGA 3B7MA 5FYBA 2R6QA 1ZRDA 4OLLA 3WF0A 4Y4YA 3BTYA 3N7MA 3QD6A 1NUKA 4SBVA 3WUCA 2VZOA 4COYA 4BLIA 2PN5A 3RNSA 1DGWA 1RUI2 2CGNA 3WXPA 5FZ0A 2J7MA 4Q0SA 1NA1C 1NZIA 3NMBA 4AVAA 5KHGA 3S7EA 2VUJA 4MADA 3ZXDA 1VBA2 3ZSKA 1H8TA 4QDRA 2UYBA 4GALA 1UZYA 4XOGA 5GZGA 4AFDA 4WM8B 3MLKA 1NAEA 2EAAA 1GZWA 4Q4W2 1O5UA 5FO7B 4LE3A 3ZKUA 3OUJA 2ZEWA 3ZX7A 4AG4A 3HIFA 4Y5SA 4LORA 4G4FA 2RDNA 2A6VA 3WQ0A 1XSRA 3USUA 3K77A 2ETEA 2J1TA 3AJZA 3I3MA 2YB7A 4LHNA 1FAYA 1UZWA 3AZXA 5E88A 1DYPA 3LEKA 3Q8CA 4AOCA 2I74A 1MQTC 4AHXA 4XE9A 3NAPB 1XJAA 4NWWA 5LATA 3LA2A 2RMU1 5C9AB 1W3VA 2WLPA 1LOEA 5T3NA 3UNPA 2QQUA 1UD1A 4IV1B 1F5JA 2DCYA 1NLSA 3JZVA 3LD8A 4XAEA 5FYSA 3J8F2 2JG9C 2WSVA 2FDKA 2WN2A 4J1XA 1VRH1 3VBRC 4DEQA 4LHKA 5J48A 3ZXJA 1YQ6A 2C24A 1MS5A 1YLLA 3SH3A 3VBFB 1WD3A 3HT2A 5F3EA 5A3LA 4ZPIA 4Y22B 3HQXA 3RYKA 1ASJ1 3UYJA 1DGRA 1OLQA 2D3SA 1VMHA 1VPHA 4AQTA 3FC0A 4FTBA 1IZ3A 2AYHA 2FDHA 2B8MA 2HEWF 3LKJA 4HPKB 1EAH3 4YVSA 3BU0A 1IPJA 1RMU1 4PF5A 4FPJA 3ZXAC 3WNLA 2EF6A 4OI1A 3UKNA 2GP5A 3VBSB 4CPBA 2WZR3 1N1TA 2QQMA 4ONUA 3J7NA 1BBT3 1HDKA 3J7HA 4UW5A 3Q8BA 4H7MA 5FMOL 4DUVA 3U4XA 3ZDSA 1Y9GA 1N3QA 3D4KA 4A41A 4JKKA 3EBRA 4MX3A 3POBA 1KFUL 4M3CA 1PMHX 2JDPA 2VO5A 2BUKA 1AXKA 3CF6E 2JDNA 5EJZB 5FZLA 2WT2A 1O3RA 2XB6C 3GBFA 2WQZC 4XUNA 2RS11 5KXBA 1VALA 2HKXA 1T6GC 4IL7A 3SH4A 2PHDA 1WW4A 5C3RA 5FPUA 5G05L 4EZHA 1KEXA 2PHUA 1NA1B 1D2QA 2WNUB 3I2HA 4QKBA 5JI7A 5JIUA 4QPGC 1GR3A 3RYRA 4AI8A 1W2AX 4IEUA 1JOJA 2FBEA 3W59A 2EIDA 2A3YA 1AR93 5F6LB 1FX5A 4ZZ5A 1L7RA 5IVEA 1O59A 4D6QA 3KHCA 1G9FA 3LA3A 4R9AA 4XQDA 5FZBA 3ZYBA 5L7OC 4XDPA 2C9KA 1D4M2 2GC0A 2XWJB 3IAPA 2BZDA 5BNPC 4A3ZA 1U5ZA 2VMDA 2ZAAA 5AC93 2RS51 4QKNA 4NJ4A 1CAUB 4CTEA 1LOFA 1PZ9A 1REFA 1Y4WA 1R083 1AR81 4DY3A 1U5IA 1ZBE3 3TBDA 4HVQA 2YBKA 2BRTA 3AMHA 4YZ4A 2R061 1MQTB 2DVBA 1PO13 5FY8A 5FQ0A 3V0BB 1W2NA 2EXIA 4BK5A 5CFCB 2XL9A 2ZX0A 4AF9A 4B1LA 4XJAA 4DO0A 1HKDA 4J6GA 4R9CA 3SHRA 3O1SA 1RVF1 1QJZA 1RUJ3 2D6KA 4LBLA 3RRDA 4KG8A 1F2NA 3VBRB 4CEWB 2D44A 2ZHKA 4CP0A 1H1AA 2CHHA 2E63A 3F2ZA 1S0JA 3GHNA 2BNOA 2UWAA 3I59B 2OIIA 4I0AA 1LEDA 2P17A 1R082 1XXNA 3ZXKA 4RL7A 1ULEA 1QJY2 4BQ4A 1ACCA 4IE0A 1WWYA 2PELA 1PO12 1WCDJ 3I2OA 1CAXB 4JAAA 2HWB3 5J7MA 1RB8G 4GXLA 3D8CA 5JR7B 1WMEA 4BYYA 4BMBA 1VMFA 2ARXA 1C3HA 3POWA 1HRV2 1K3IA 2D40A 4OHVA 5LBCA 3TB0A 1ZNPA 1UOJA 2IWGB 1DQ2A 4IE4A 4AI0A 1UIKA 4M0HA 5LBEA 2A70A 3LDRA 3BOPA 2H6BA 4E4HA 3HPNA 4DXSA 5I8SA 4JX0A 4WV8A 2FHRA 3E6CC 4JRLA 1WCUA 1W6QA 3AKTA 4RN5A 3I3BA 4OZOA 4WZFA 3AYDA 5FXWA 1JOPA 1AR71 1QJU1 3WLUA 5ACA3 3LA7A 4YZ2A 4XJ8A 3NRUA 3OJBA 5DAWA 4LK6A 4QPGB 5B2GB 1AYN3 1N3OA 3DPRA 3QH6A 2WLQA 4XTPA 4K20A 2H6CA 3SCHA 1G9BA 1Q8OA 2WNOA 5F3IA 3OCPA 4N7UA 2JDUA 3FFZA 2HYKA 3IT8A 4Y20A 4F7ZA 1TE1B 1SLAA 2D6OX 4QXCA 4XPVA 2VZSA 4MOAA 2GH2A 5FZEA 3VBUA 5L7OB 1JZ5A 1PX3A 1C1FA 2WINB 1Y9QA 4CP2A 4OQ8A 3TN92 1QJEA 2D43A 4HETA 4Q5OA 5BNPB 4XZPA 1FOD1 3RI9A 4LOSA 3E6DA 1NZCA 5FUIA 3LPGA 1PGW1 1RYYA 4XUOA 4BH9A 4N53A 5E1RA 4N43A 3PMSA 4QMAA 4W6YA 1WW5A 2E7AA 2K9ZA 3ZFEB 5ACA2 2RM22 5FXXA 2VCMA 2X5IB 2QCSB 2D93A 1CAWA 1A6CA 2ZGOA 3SC7X 4NO4A 2VTFA 5CIRA 4DS0A 3ZSMA 1Q8SA 4UFIA 3LAGA 4EN6B 2AUYA 4EWAA 3BALA 1O8SA 2QE3A 4NAOA 1I6XA 3UKVA 1JZ6A 1FMD3 4XURA 4DUWA 3WNPA 4B7EA 2NP0A 4QHBA 1CJPA 4AI3A 1J3RA 1W6OA 5D1IA 4DMIA 1C28A 4MGYE 2WSUA 1US2A 2I45A 5H9PA 3TYJA 2BNNA 1FPN3 5JZGC 1H2KA 4JV4A 4RYDA 3FUQA 4I2OA 1O4ZA 2D6LX 1IPSA 3PTYA 4HFSA 4Q4V3 4AFCA 2IXCA 1PIV1 5EJ1B 3NVCA 3UETA 2DUOA 2A3WA 4FO9A 4CDWA 3W21A 2NN8A 1S2BA 2BWCA 1OVPA 2RR12 2ZOEB 4KBBA 3U4SA 2XJTA 3VLBB 4C90A 4CVUA 4UFKA 4RGGA 3H3LA 3ZYFA 4IERA 2GU9A 4M0NA 4D0QA 2WBKA 5A1FA 4XFAA 2CWMA 2WO2A 3ETQA 3PUIA 1FPN2 2W2IA 3RDIA 1JYCA 4BQYA 2IC1A 4LNVA 5FYCA 2VBDA 2YZ4A 4D94A 2LTNA 2WNVA 4HSLA 3USSA 3WHTA 5L9RA 2PQSA 5FZ9A 4BQ5A 2HWD1 2A6WA 4DRVA 1RC6A 4XDQA 2WO3A 3P6BA 4MG2A 5K4LA 4W6WA 3FBYA 4YW6A 2VW1A 3NQHA 1MZ5A 4LBQA 4A6SA 4AZZA 1RUD3 3WNXA 2QZ3A 3FFQA 5LA1A 5BY5A 3EB7A 4CU8A 2O14A 3AB0A 4QQPA 5DXDA 4QX1A 4EZ4A 4RS5A 2ZGKA 4LQRA 2GALA 2WUHA 4UI9L 1T2XA 4G3YC 2JXAA 4Y1VA 2XL7A 3RI8A 2UU8A 4CEYC 4HBNA 2P6CA 4EV0A 2ADEA 3HEIA 1WA4A 3ZOIA 4XHBA 2W47A 1LB2A
chains in the Genus database with same CATH topology
3H8OA 4NIGA 4QKDA 3O1MA 3RZMA 3O1VA 4ZS3A 3BKZA 2FDGA 4ZS2A 4OCTA 3BTZA 4ZHNA 4O61A 2FD8A 4NPMA 3O1RA 4NIHA 3BTXA 4QKBA 4O7XA 2IUWA 3T4VA 4RFRB 3RZGA 4JHTA 5F8PA 3KHCA 3I49A 3T4HB 3RZLA 4IE5A 3RZKA 3BTYA 2FDIA 4NPLA 4QKNA 4QHOA 4NJ4A 3O1UA 3RZJA 4IE6A 3KHBA 4CXWA 3H8XA 4NIDA 3O1SA 4CXXA 4IDZA 3S57A 3RZHA 3I3MA 4IE7A 2FDFA 3S5AA 4IE0A 3BI3A 4CXYA 3H8RA 3T3YA 3I2OA 4NRQA 3BIEA 3LFMA 4NRMA 3BUCA 4QKFA 3O1TA 4MG2A 2FDKA 2FDJA 4IE4A 5DABA 4NIIA 3O1OA 2FDHA 4NRPA 3BU0A 4MGTA 3O1PA 3I3QA 4NROA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H8O A;  4NIG A;  4QKD A;  3O1M A;  3RZM A;  3O1V A;  4ZS3 A;  3BKZ A;  2FDG A;  4ZS2 A;  4OCT A;  3BTZ A;  4ZHN A;  4O61 A;  2FD8 A;  4NPM A;  3O1R A;  4NIH A;  3BTX A;  4QKB A;  4O7X A;  2IUW A;  3T4V A;  4RFR B;  3RZG A;  4JHT A;  5F8P A;  3KHC A;  3I49 A;  3T4H B;  3RZL A;  4IE5 A;  3RZK A;  3BTY A;  2FDI A;  4NPL A;  4QKN A;  4QHO A;  4NJ4 A;  3O1U A;  3RZJ A;  4IE6 A;  3KHB A;  4CXW A;  3H8X A;  4NID A;  3O1S A;  4CXX A;  4IDZ A;  3S57 A;  3RZH A;  3I3M A;  4IE7 A;  2FDF A;  3S5A A;  4IE0 A;  3BI3 A;  4CXY A;  3H8R A;  3T3Y A;  3I2O A;  4NRQ A;  3BIE A;  3LFM A;  4NRM A;  3BUC A;  4QKF A;  3O1T A;  4MG2 A;  2FDK A;  2FDJ A;  4IE4 A;  5DAB A;  4NII A;  3O1O A;  2FDH A;  4NRP A;  3BU0 A;  4MGT A;  3O1P A;  3I3Q A;  4NRO A; 
#chains in the Genus database with same CATH topology
 3MW4 A;  4CDQ C;  5JOZ A;  5BXX A;  4NIG A;  4DFS A;  1RHI 1;  1NCQ A;  1PNG A;  2VH9 A;  3ELN A;  2JDH A;  4AVV A;  2G1M A;  3O1M A;  1JYT A;  2VOW A;  1BEV 1;  1CES A;  2DV9 A;  4Q8K A;  5FP8 A;  2VMC A;  2WS9 3;  3JBG 1;  2HBU A;  3GJB A;  2YC4 A;  2W1U A;  2W08 A;  1UKR A;  1BQP A;  1VBE 1;  1EV1 1;  4FFI A;  4XBN A;  5A3M A;  3OYW A;  4K8F A;  3H0O A;  1W8Z A;  4Q4Y 3;  3UJO A;  1V6N A;  3M3Q A;  5DQ0 A;  2WWS A;  4AVC A;  4XZU G;  3THP A;  1KRI A;  3C7H A;  4AAX A;  1OUS A;  1AZD A;  3ZXE A;  1SBD A;  4GWN A;  5HXV A;  3AX4 A;  4ARX A;  5FZK A;  1HW5 A;  1PVC 1;  4LO5 B;  2P1B A;  3WW2 A;  1RUH 2;  1DLC A;  1AYM 3;  2RDR A;  3AZV A;  1WLD A;  4UFH A;  4BLJ A;  5BNQ A;  3FE5 A;  5C70 A;  5HBA A;  4XC9 A;  2Z69 A;  2BU9 A;  3BN6 A;  1O3T A;  3LWC A;  1LOC A;  4QT6 A;  3MYX A;  3P3P A;  2PFW A;  3OUI A;  1YQ8 A;  1PGL 1;  1MVE A;  2AC1 A;  5FYV A;  5FYT A;  1HRI 1;  4YGB A;  2Q1M A;  4L9B A;  2Y0I A;  2JD4 A;  4LBO A;  2O1Q A;  3GCW A;  2OA2 A;  4OYU A;  2FMY A;  3MLL A;  4PIZ A;  1OT5 A;  1OMI A;  5FMD A;  4QU1 A;  5GZE A;  1TME 1;  1V6I A;  3KHB A;  5LA9 A;  3K3O A;  4LOT A;  1OC1 A;  4GMP 1;  3T2T A;  2Y0O A;  5A70 A;  2HWF 1;  2QQK A;  5ABJ A;  1GP6 A;  3W20 A;  4IDZ A;  3S57 A;  2O8Q A;  1REE A;  4Y22 A;  3KT4 A;  1GLH A;  3ZKY A;  4KH9 A;  1HV1 A;  4M00 A;  3V56 A;  5JXI A;  4YG3 A;  3KVB A;  4TLF A;  3WW4 A;  3T2P A;  1HQL A;  4EYU A;  3N9Q A;  2RVA A;  4TN7 A;  2CDP A;  3HMY A;  2VZP A;  3D0J A;  1W04 A;  1AL2 2;  3ZR6 A;  2KXL A;  1TNF A;  1XPW A;  3SQO A;  4Q4X 1;  4ZXE A;  1PHM A;  4ASK A;  3GJA A;  2G9Z A;  5BNN A;  2PLV 1;  1YI9 A;  2A5Z A;  5HV4 A;  1LEC A;  2K46 A;  4XW3 A;  3AFK A;  2BWA A;  2GME A;  4X6Q B;  4CDQ B;  3KM5 A;  1I9R A;  4I02 A;  4COU A;  5FYU A;  1MEC 1;  1DLL A;  2YDE A;  2R0F A;  4S2D A;  1H30 A;  4YZ5 A;  2ZGN A;  3CJI C;  3VBO B;  2OPW A;  5F37 A;  1BMV 2;  2D7F A;  1GWL A;  1ULD A;  3ALQ A;  4KWK A;  5FYM A;  5J96 B;  5A6Q A;  2CY6 A;  4HLT A;  1BHG A;  5FR3 A;  3IN9 A;  1P8J A;  1M4W A;  3VD3 A;  4LLF A;  1VE0 A;  3APB A;  1I1E A;  1NA1 A;  1UMH A;  3JQW A;  1GMM A;  4ZU5 A;  1SAC A;  3QBQ A;  2NLR A;  3EQE A;  2V72 A;  4Y4R A;  5IHR A;  3I3Q A;  3O14 A;  3MW2 A;  5CNA A;  1RUE 1;  4DEV A;  4PDW A;  1ND2 C;  3ES4 A;  3GXU A;  3MI8 A;  4Q0Q A;  3S7I A;  1UAI A;  1UQX A;  3KMH A;  5LA2 A;  4JZR A;  2ZCW A;  1DYO A;  1PO2 1;  4QGM A;  1HQW A;  5FYH A;  5FP4 A;  3ATG A;  5FIX A;  3BOW A;  1S55 A;  2JB4 A;  1XE0 A;  2B46 X;  4KI5 M;  4OUE A;  1XE8 A;  1NT0 A;  4S2F A;  1QU0 A;  2UWC A;  5IFP A;  4XAA A;  2C1F A;  3N9L A;  3RMX A;  2O0O A;  3RGB A;  4KG0 A;  1VJ2 A;  1VBB 1;  2WFF 3;  2B42 B;  3WF2 A;  3IB3 A;  4JQT A;  3LQC A;  1DYK A;  2Q8O A;  5FY9 A;  4P08 A;  4GWI A;  1YIP A;  3N7J A;  5FWE A;  2A7A A;  1LHN A;  3K4A A;  1R1A 2;  4MGQ A;  2JG9 A;  3OY8 B;  2BGC A;  3HR9 A;  1ND3 A;  1YQC A;  4F83 A;  5FFO C;  3AJY A;  2R0H A;  1O8P A;  5GM0 A;  4BME A;  3CJX A;  4QQ2 A;  3OGR A;  3JB4 C;  3EO6 A;  4Q2F A;  3I59 A;  4B4P A;  4B4R A;  4LO6 B;  1LHV A;  5C4W C;  1UY3 A;  1QH6 A;  1QY4 A;  5FYY A;  3U14 A;  1QJF A;  1Q56 A;  4GB3 2;  3J7L A;  2YC2 A;  2A6Z A;  1ODM A;  2OX0 A;  2ZGQ A;  3N7K A;  2HWC 1;  4FP2 A;  4OI2 A;  4Z07 A;  5HXM A;  5T5O A;  4V2V A;  1C4R A;  1VBC 2;  4XIL A;  5FZH A;  3M70 A;  4XJW A;  4KNC A;  1NCR C;  2VUA A;  2WN3 A;  2L9L A;  1VIW B;  2BGP A;  4HN0 A;  3A22 A;  4WBB A;  1LUL A;  3JD7 3;  1W9T A;  2RS3 3;  2VZV A;  3B94 A;  4GUL A;  4NHX A;  4OHW A;  3WDY A;  4AED C;  4JDM A;  1OUR A;  3HD8 B;  2F4P A;  2E33 A;  2CV6 A;  2YFZ A;  3PU3 A;  4JC1 A;  1C5H A;  1E5H A;  2GDF A;  5A80 A;  3ON7 A;  1J1T A;  5A3N A;  4A45 A;  3CJI B;  2BER A;  2W0X A;  5ISL A;  3TRS B;  1LNS A;  4I09 A;  1UYX A;  1H4H A;  1RUC 2;  1QEX A;  1O5L A;  1QHD A;  3MW3 A;  4P02 B;  2XGX A;  1JYV A;  4PI2 A;  1DCS A;  3DUI A;  3ZYI B;  3MEP A;  1D4V B;  3OEB A;  2X05 A;  3WG3 A;  4IGQ A;  3JD7 2;  2RS3 2;  5C33 A;  1N1Y A;  1E57 A;  4YRD A;  1JUI A;  3KF5 A;  4NRM A;  5EXO A;  5KXD A;  1TNR A;  1ULF A;  2H0B A;  2C4X A;  2VL4 A;  1ALY A;  4WVM B;  4EWE A;  2MEV 1;  3LCP A;  5JR2 A;  2YC0 A;  1OH4 A;  1AX1 A;  4YFW A;  2VCA A;  4QB2 A;  1QQP 3;  3GBG A;  1B35 B;  4JDN A;  4ZON A;  4NIA A;  4R9B A;  5FZO B;  3JUU A;  4RQP A;  3MUY 1;  2P5B A;  1RUF 3;  2E7T A;  4JGY B;  3FLR A;  4UT5 A;  3MUZ 1;  1OPM A;  1H9W A;  2VY0 A;  2R04 2;  5FXV A;  5A3P A;  4OUM A;  1ULG A;  2PHW A;  3U78 A;  2R1B A;  5JAX A;  4E2S A;  3ZN6 B;  3OBA A;  4XQW A;  5H9S A;  3ZSE A;  3V64 A;  4JDO A;  4DY5 A;  4E2G A;  3ACF A;  4YNI A;  1X8E A;  1YQ5 A;  1O3S A;  4XJ9 A;  1VBD 3;  3O1V A;  4BE3 A;  1UX7 A;  3VBH A;  2DUP A;  2NZ9 A;  4UF0 B;  1W6P A;  3CEW A;  1QQP 2;  3SH5 A;  3WCS A;  3FN9 A;  3OEA A;  4QU2 A;  5F3G A;  2R07 3;  1OOP A;  2JIC A;  1RUF 2;  3WDT A;  3DEC A;  2QQL A;  4DUX A;  3PME A;  1FNZ A;  4S2H A;  4K6B A;  1VP6 A;  1YFW A;  3ZXF A;  1I5Z A;  3LEI A;  1ZZ7 A;  3BCW A;  5GLW A;  2HEY F;  1U5X A;  1W9S A;  3AP5 A;  4CUB A;  2XVG A;  4IV1 C;  1Z78 A;  2XHN A;  4AED B;  4URA A;  2W5F A;  1HXS 1;  1PM7 A;  4XEZ A;  5F5C A;  1UYP A;  2XH6 A;  4PIY A;  1DGW X;  3VBF C;  4B1M A;  2VW0 A;  4BIF A;  1VBD 2;  2YGM A;  5JSP A;  1H9P A;  3PDQ A;  2Q1Z B;  4QGN A;  3SKV A;  2FDI A;  1QJX 1;  3POJ A;  4D6R A;  3LE0 A;  4XF1 A;  4P9J A;  4QHO A;  2BYV E;  2AZ5 A;  3NST A;  3B02 A;  3DXT A;  2EAL A;  5F6K A;  2YYO A;  3MO4 A;  5JLV A;  1JU4 A;  1RUI 3;  5FCC A;  3PU8 A;  3D3A A;  2AEZ A;  2K0G A;  4RR3 A;  1W99 A;  1W6N A;  4AFB A;  3RVH A;  2VOV A;  3T0A A;  4OFG A;  4AXO A;  4BHP A;  1VBA 3;  5C8C B;  2JKX A;  2KM2 A;  4XDO A;  4MGI E;  3WR0 A;  5JOX A;  1TQ5 A;  1WKY A;  4NID A;  1AR6 3;  1N1S A;  4MZU A;  1QOS A;  2VQ0 A;  3VKN A;  3CU7 A;  5FJH A;  4Q4W 3;  1S0D A;  3C2U A;  1Q5O A;  3H1M A;  3MIE A;  1EAH 1;  2JJ6 A;  3ZYP A;  4AGV A;  1SLL A;  3WP3 A;  2VZQ A;  2I07 B;  2J1R A;  5FXZ A;  4ORF A;  3K2O A;  4QXK A;  2VC9 A;  1OQ1 A;  2JDA A;  5EIY B;  5FZ6 A;  4LT5 A;  5A7W B;  2WZR 1;  1WMX A;  3PHM A;  5FY1 A;  5I0U A;  4QDQ A;  4XMA A;  3GZT B;  1BBT 1;  2EXK A;  2VGD A;  1U12 A;  4UW4 A;  3BI3 A;  2WNU C;  4ASL A;  1WZX A;  3AKQ A;  3S30 A;  3W5M A;  1QKQ A;  3BGA A;  4XBL A;  4YM2 A;  3T0D A;  2Q8C A;  2MPF A;  3AM2 A;  1PNF A;  4SLI A;  2QQJ A;  3BUC A;  4GKX A;  2UY9 A;  1AR6 2;  2ZGM A;  1OD3 A;  1NX9 A;  3DGT A;  2OZJ A;  4X8N A;  2W68 A;  5FAX A;  5CFD C;  4RSU A;  2X8K A;  1V9U 2;  3J8F 3;  4UFM A;  3SIT A;  5A6Z A;  4FOY A;  1HB4 A;  2R30 A;  4FTS A;  3E97 A;  4YWA A;  1UWW A;  2OW4 A;  1LEM A;  4YVW B;  4NUB A;  2Q8E A;  1DG6 A;  1EY2 A;  3VZN A;  3ZFF A;  5IVF A;  3TEZ A;  2GN7 A;  4QPW A;  1CZV A;  3WEZ A;  3ZFG B;  1PZ7 A;  3WQB A;  1AR9 1;  1AVB A;  3H42 B;  3S5Q A;  1LCL A;  3CZU A;  5T5L A;  2WWJ A;  1HB2 A;  1OA3 A;  2CAV A;  5JZG A;  4LEJ A;  4AR2 A;  2D97 A;  1UU4 A;  1C1L A;  1D2S A;  1JW6 A;  2W52 A;  3IMN A;  4IEX A;  4YLZ A;  5CFC C;  4CZS A;  2ET7 A;  4UFL A;  4QQH A;  1YJK A;  3TWI A;  1ZRR A;  2YU1 A;  3TNP B;  3URF A;  5AC9 1;  2C0Z A;  2XBO 3;  2A71 A;  4QXB A;  4TSV A;  2VMH A;  1OKQ A;  4UAP A;  1ENS A;  2VNV A;  2ZGR A;  4LKE A;  4XMI A;  5FZC A;  3ENR A;  4CEW C;  1AXY A;  4PJY A;  1ZBE 1;  1JTZ X;  5JDB A;  1AUY A;  5CVR A;  2RDS A;  4JGZ A;  1WMF A;  4XUQ A;  1I5P A;  2XHK A;  4AEM A;  3TNQ A;  4LBN A;  4AWD A;  4PLN A;  5FUN A;  1ZA7 A;  3OGV A;  5T50 A;  1ZRE A;  5A32 A;  2C5D A;  2QTW B;  3OG2 A;  1RUJ 1;  4NPR A;  4MHU A;  1QGL A;  2SLI A;  4LO7 A;  1BYH A;  3FMG A;  1ZBA 1;  2BBA A;  2XOM A;  4YSF A;  3NKT A;  5FY0 A;  4AQ2 A;  3VD9 A;  2ENR A;  2XBO 2;  1FV3 A;  4LO8 A;  1GIC A;  5A3O A;  2DVD A;  3UT0 A;  5AVP A;  4MGS A;  4AHZ A;  4JTO A;  3U11 A;  5I0R A;  5I0S A;  4CE8 A;  1D4M 3;  1KJL A;  1XB9 A;  2Y6L A;  5F5A A;  3S0M A;  4YZ3 A;  5GLZ A;  4Z92 B;  3CMG A;  3GCX A;  5J3U A;  2ZX1 A;  2HWB 1;  3GYD A;  5HPO A;  5F2S A;  1EYB A;  4CEY A;  3WIN E;  1RIR A;  2ID4 A;  1DP0 A;  3G6J B;  5JSO A;  4HAN A;  4BJ0 A;  1MS1 A;  1UY0 A;  1XYP A;  2YFU A;  4BDV B;  4CDQ A;  3TEY A;  4FPK A;  4YW1 A;  1IPK A;  2D3P A;  1DBN A;  2ZEX A;  3ASI A;  4IV3 B;  4KWL A;  4Y26 A;  1R09 1;  1OH3 A;  1PMJ X;  1SCS A;  1OSG A;  2R32 A;  5CFD B;  3GHM A;  1C8N A;  4YZ1 A;  1UYZ A;  4COZ A;  4MUV A;  1HJF A;  1N1V A;  3NKG A;  2B4K A;  5IVJ A;  5FZ7 A;  1D7P M;  4OMD A;  4RHV 1;  4MXW B;  2E32 A;  1AYN 1;  1WCK A;  4LA3 A;  4LBJ A;  2Y6F A;  3JCI A;  5H9R A;  3GAL A;  5IJR A;  3ZYJ B;  5FP9 A;  1DQ1 A;  2JG8 C;  4B4Q A;  5JOW A;  4LXL A;  1POQ A;  2PAK A;  1QJY 3;  2XON A;  3ZFE C;  4FAH A;  4A3X A;  1VLN A;  2WRA A;  1Q43 A;  2P37 A;  2X5I C;  2UYA A;  1WLC A;  3DCQ A;  4GH4 C;  1GOF A;  1CON A;  3A0K A;  1ZYB A;  4GMP 0;  3N9P A;  4R4Z A;  5JWP A;  3LIH A;  4TZD A;  5H9Q A;  1B09 A;  5HCF A;  1V00 A;  2VOX A;  1Q8P A;  2RMU 3;  4EN9 B;  3VDD B;  4FVV A;  4Y33 A;  1HRV 3;  3N35 A;  2CTV A;  2HYX A;  3N3H A;  4YW5 A;  3ORJ A;  4N7I A;  1AXZ A;  2VVE A;  1DU3 D;  1XND A;  3GZU C;  5A7Q A;  2W95 A;  4QX3 A;  5K0U B;  4C91 A;  1ZM1 A;  3DYM A;  2XQR A;  2JKB A;  4CUA A;  2GC3 A;  4MSV A;  4PQ9 A;  3ES1 A;  4YGC A;  5FYI A;  4AQS A;  5GZC A;  4PF1 A;  2D6N A;  3ACH A;  2JDZ A;  1CGP A;  1K5J A;  4FFH A;  2P3J A;  2W46 A;  1JOB A;  2WQ8 A;  3AXE A;  1LRH A;  1J59 A;  5B4N A;  4OHY A;  3QH7 A;  5KWR A;  1FMD 1;  3N9O A;  1IKQ A;  2RMU 2;  4FPE A;  2VEC A;  2ZGL A;  3A21 A;  1HIX A;  1YJL A;  3C3V A;  1W8U A;  3KQ4 B;  5F32 A;  2NPI A;  4ATF A;  4ZKT B;  1LJ7 A;  4WVZ A;  3V0A B;  1VRH 2;  2ZMN A;  3TN9 3;  5IVV A;  1QMJ A;  1PK6 A;  2DCK A;  2BQP A;  2WDB A;  2WZ8 A;  1PMI A;  3C7G A;  3CO2 A;  3HQU A;  1WLW A;  3NW4 A;  4QX0 A;  1IQD C;  4CDX B;  1ASJ 2;  2QDR A;  2IXH A;  3KT1 A;  3AVR A;  4QPI B;  4E4S A;  3O1R A;  4L99 A;  4IEQ A;  4GWJ A;  2JIJ A;  4Q4V 1;  2G9F A;  1K5M C;  2RM2 3;  2CDO A;  5L9B A;  3WNO A;  2WQ4 A;  3AXD A;  4TWT A;  3WY6 A;  4BOW A;  1ONA A;  1DGR N;  2BFU S;  3NO8 A;  4Q26 A;  3RYP A;  2AR6 A;  1OFS A;  1HB1 A;  4P9W A;  3E6B A;  1W0O A;  2CU5 A;  2QFE A;  1J3Q A;  3O7O A;  5D8A C;  3WW3 A;  5IK5 A;  3J4U H;  4XCB A;  2A1X A;  1W2U A;  3MBW A;  1ODN A;  1CWP A;  3VL8 A;  1CZS A;  2YU2 A;  5GLV A;  1S0E A;  5A7N A;  4FPG A;  5FOJ B;  4JCK A;  4S2G A;  5CKQ A;  5B4X A;  5FZF A;  2JG8 B;  2P6H A;  1W8H A;  1VAK A;  3OB8 A;  4YW3 A;  2RS1 2;  1E5R A;  1ND2 A;  4GH4 B;  4IEO A;  4I0W B;  1RUD 1;  4L97 A;  1S2E A;  3ZMO A;  1MPX A;  4AFA A;  1NXD 1;  2YRO A;  3BYW A;  1FNY A;  1QXJ A;  4XFI A;  2J1U A;  1F35 A;  4XBQ A;  5FZI A;  4ASM B;  3N4M A;  5HCH A;  5CBL A;  5T54 A;  1KD7 A;  4QX8 A;  2P4E A;  3I8T A;  2EXH A;  3WX5 A;  2B9V A;  2H0V A;  1CR7 A;  4M3C F;  1SFY A;  4W65 A;  2RR1 3;  5FMC A;  1MZF A;  2BP6 A;  4IQP A;  1GYK A;  1IHM A;  3ZMN A;  2WO1 A;  4ERO A;  1Z7S 1;  2A6X A;  4CUC A;  2RS5 2;  2V5Y A;  3H50 A;  4AL9 A;  5LZ6 A;  4DZG A;  1IGO A;  5J1X A;  1JHN A;  1AR8 2;  1NLQ A;  2FCT A;  4RFT 0;  1H8T C;  5DAQ A;  2PQQ A;  2CYF A;  2WS9 1;  1SLC A;  2ZGP A;  1EUT A;  2XVK A;  3JQX A;  3MF6 A;  3N9N A;  3WUD A;  4DB5 A;  2C26 A;  2R06 2;  2WA3 A;  5LRS A;  4LKD A;  1URX A;  3TAY A;  4XFG A;  1NY7 1;  2WO7 A;  2WNE A;  3E5X A;  3M3I A;  4Q4Y 1;  1H2L A;  3I2J A;  4CP9 A;  1KQR A;  2A6Y A;  2Q5T A;  1UX6 A;  3K51 A;  1UPI A;  4HON A;  5C4W A;  1RVF 2;  1POV 0;  4AEJ A;  4ARY A;  1UIJ A;  5A33 A;  3HN1 A;  4NVP A;  4P9Y A;  3AP9 A;  5DAV A;  4QX5 A;  1SQ4 A;  4LUL A;  5CAZ A;  2YMZ A;  5IT6 A;  5LY1 A;  1UCX A;  4NWV A;  3ST7 A;  1NCR A;  2XLF A;  3AC0 A;  5DUV A;  1ZRF A;  3Q8F A;  4MV2 A;  1XU1 A;  1OI6 A;  1AYM 1;  4P9I A;  4PLM A;  4AGG A;  3O1P A;  3WF3 A;  1RUG 3;  1BK1 A;  2EIE A;  1K5M B;  1ULO A;  2I2S A;  2PTM A;  4I30 A;  5FZ4 A;  1SPP B;  1VAV A;  4FXK B;  5EWS A;  3H3Z A;  1AR7 3;  2Y6G A;  3Q9O A;  4QKD A;  3KZ4 C;  5AFE A;  3LF7 A;  3OD4 A;  1H8V A;  3E5Q A;  4CCK A;  1ZZ6 A;  2GC2 A;  4IET A;  3ZR5 A;  2E31 A;  5D8A B;  4UOJ A;  5CIS A;  3VKM A;  4K3U A;  3CLP A;  3UES A;  2J1V A;  4XF3 A;  1ENQ A;  1X36 A;  2F6B A;  4CSW A;  5C7G A;  5HI0 A;  1TMF 1;  1DZT A;  1WA6 X;  2IVI B;  2ZX2 A;  2YBS A;  4O61 A;  2BBV A;  2QKD A;  1LGN A;  2V09 A;  2ZGT A;  2O8O A;  5T55 A;  2DCZ A;  5IVY A;  5FK7 A;  2BGO A;  1JZ3 A;  1V6M A;  5A7S A;  5L36 A;  4CCO A;  3UK9 A;  3LDK A;  5LK7 B;  4C0H A;  1RJ7 A;  2VR4 A;  2DU0 A;  1RUG 2;  2K2S A;  2WFP A;  3HNB M;  4Q1P A;  1O4Y A;  3UV9 A;  4CDU A;  5SV8 A;  1AR7 2;  1Q8Q A;  1W0P A;  5C3P A;  1RUN A;  3N36 A;  1RUH 3;  2VE1 A;  1VB4 A;  3VBO C;  3HBZ A;  3PUA A;  4AGR A;  4AW7 A;  5C3O A;  3G7D A;  4QHZ A;  4IE5 A;  4CCN A;  3BOD A;  2LM3 A;  5C8W A;  4E27 A;  1TZO A;  2VUC A;  1GZC A;  1EP0 A;  4OMC A;  1NOV A;  3T09 A;  3V65 A;  3SCF A;  3HN3 A;  2EIG A;  5FP3 A;  3F95 A;  1FOD 2;  4QM9 A;  3WV6 A;  4E8D A;  1BKZ A;  1XBF A;  2DUR A;  1J84 A;  2JEN A;  1CX1 A;  1LHW A;  2ADD A;  4WM8 A;  1COV 1;  1H8T B;  1MAC A;  2D5F A;  4QQL A;  3UGH A;  1AX0 A;  4B29 A;  2XJP A;  1GZW B;  3FLT A;  2XQX A;  3A4U A;  2XVL A;  1O3Q A;  4BK4 A;  1XU2 A;  3IDB B;  4EJR A;  4L0P A;  2ZHL A;  3IMM A;  3W9A A;  5EYY A;  2QQI A;  1CN1 A;  2XJU A;  3DKW A;  4FP3 A;  4UBH A;  1GWK A;  2RJK A;  4D8M A;  3USU B;  3WDW A;  1F15 A;  1UMI A;  5JPM B;  4KWJ A;  5F7U A;  2DWR A;  3X29 B;  3NV1 A;  1GBG A;  3NAP A;  1AL2 3;  2W3J A;  4XET A;  4A4A A;  2BTV C;  5C9A A;  3ABZ A;  3H3U A;  3HVD A;  1OLR A;  2JDY A;  5KHJ A;  3WSO A;  4A7Y A;  4IV1 A;  5KHK A;  4CCE A;  3HJR A;  4CRQ A;  1AHS A;  1IG3 A;  4ES8 A;  3I3D A;  3THC A;  1F5F A;  4LHS A;  1UU5 A;  3FHA A;  3PL0 A;  4QB1 A;  3WOG A;  5FWJ A;  3KGL A;  5E89 A;  1RL3 A;  3MV0 1;  3U1X A;  3VBF A;  2TEP A;  3GBW A;  1C8M 1;  2HWD 3;  4XTM A;  2XML A;  1QOO A;  1JZ8 A;  4I3P A;  2WFF 1;  5DAX A;  3VDC A;  2VD7 A;  2BVB A;  1KXG A;  5EQU A;  2DFC A;  2UUR A;  1PIV 2;  2GC1 A;  4HPK A;  1CVN A;  1W90 A;  3FJS A;  3HNY M;  1H1M A;  3WDU A;  1IQA A;  1DQ6 A;  3GF6 A;  4YVS B;  1G86 A;  3JB8 A;  1LU2 A;  2JB8 A;  2HLE A;  3O0X A;  2PHT A;  1TG7 A;  5FK8 A;  2VZT A;  1F9K A;  1EPW A;  3ME2 A;  1C57 A;  3T30 A;  3WQ1 A;  3OF1 A;  3LSD A;  4Q0P A;  3UGG A;  1JOD A;  3NNG A;  4XF0 A;  5C71 A;  3NNF A;  5A7P A;  2VOT A;  3NNM A;  1SLI A;  5BNO C;  2LUW A;  4U2A A;  2J1E A;  3CNA A;  1IG0 A;  5CB7 A;  1OQE A;  2Q1F A;  1YFY A;  1BXH A;  3Q8A A;  2HWD 2;  1DQ5 A;  3VZM A;  1W8N A;  2SBA A;  4M3C B;  5FZ1 A;  5I0T A;  1GP5 A;  4ZU4 A;  2AEY A;  1YFX A;  4CYD A;  3O12 A;  3VB9 A;  1BVP 1;  2HH9 A;  2PYT A;  3JD7 1;  1O4T A;  3INA A;  3NNJ A;  4Q1R A;  3JBG 3;  3VKF C;  3VUO A;  2FD8 A;  3B69 A;  1V0A A;  2WNU A;  4RD7 A;  2NMN A;  5KHI A;  4OHX A;  1VBE 3;  5I8T A;  2GZW A;  3QOP A;  2CGP A;  5I91 A;  3RZG A;  5FKC A;  3DPR C;  5LY2 A;  1RIT A;  4B7K A;  3EJK A;  4LO4 B;  4D3W A;  3ZLI A;  2VQA A;  2VCC A;  1JS9 A;  1R1A 3;  2IXJ A;  5T5P A;  4CCC A;  5BPX A;  3POS A;  2ARB A;  5C5U A;  4QB6 A;  1RHI 2;  2CAU A;  3DYP A;  1V70 A;  4K40 A;  2JWP A;  1B35 C;  1HV0 A;  1OVS A;  1CAU A;  1BEV 2;  5GAL A;  2VAU A;  2YV8 A;  4LIT A;  4GB3 3;  5JXG A;  2UWB A;  3JBG 2;  2B45 X;  1CPM A;  4JGY C;  4N53 C;  4N43 C;  3SNM A;  5FDB A;  2PXJ A;  4AVB A;  4Z2W A;  3AK0 A;  4IEV A;  1VBC 3;  4BB3 A;  5FMO S;  1MQT A;  1VBE 2;  2ZHM A;  1UMZ A;  3H9A A;  4TLG A;  4AEK A;  1EV1 2;  3M3C A;  5C5T A;  3V0B A;  2PHX A;  4X6R B;  5CFC A;  5FQ0 B;  2YPD A;  2VVD A;  1V6K A;  2Y33 A;  2ZPX A;  5JMO A;  3POG A;  4K8R B;  3I2D A;  3OOX A;  1RJ8 A;  3T2O A;  1AJK A;  1QQP 1;  2W39 A;  1XSQ A;  3ACG A;  5C3S A;  4BPZ A;  5LW9 A;  1JH5 A;  1E5I A;  5FBZ A;  3VBR A;  4CEW A;  1W3X A;  1RUF 1;  4L11 A;  1PVC 2;  4FOW A;  2VZU A;  3VZO A;  3LDB A;  4B3N A;  4GJZ A;  3WZ1 A;  1N3P A;  2A73 B;  3C7E A;  2D6P A;  2AGS A;  3R6S A;  1RUC 3;  1X82 A;  2XXZ A;  2Y8K A;  4Y1Y A;  2WT1 A;  4LLO A;  4P5Y A;  2Y6K A;  3NWK A;  4XVH A;  3S5A A;  5FZA A;  3IZO A;  1NXM A;  4H55 A;  4WM7 C;  2VMF A;  3R4S A;  1CAX A;  5LEJ A;  2KD7 A;  2ZA9 A;  4LJH A;  3FUO A;  5FRE A;  3BIE A;  1PGL 2;  2ZHN A;  3A23 A;  1HRI 2;  4BXS V;  1W6M B;  5K9Y A;  1ULP A;  5ANN A;  5DPN A;  3RJR A;  2XJV A;  4I01 A;  4Q4X 3;  4KU8 A;  4BZ4 A;  5KXC A;  5LAS A;  5APA A;  4XFC A;  4W8J A;  2VBP A;  2BOJ A;  1TME 2;  5BNO B;  1G9A A;  2R07 1;  5D2A A;  1T6B X;  1NE4 A;  4CDW C;  3T1L A;  1S0F A;  1GSL A;  2E51 A;  4NII A;  2XUE A;  3KS7 A;  1DDL A;  4XUP A;  4BQW A;  5FPX A;  2HWF 2;  1DZQ A;  1MEC 3;  3ETP A;  3HWJ A;  4HXC A;  3NV3 A;  4IGP A;  4UW3 A;  4OQ9 A;  4ISR A;  2R16 A;  2OVU A;  3IKW A;  5LA0 A;  4R4X A;  4AHW A;  1XNK A;  4HZF A;  4XAC A;  3HQR A;  3P3N A;  1AL0 G;  1CIY A;  1LR5 A;  2GMM A;  2PA7 A;  3O0V A;  4FQZ A;  3AMP A;  4MGT A;  1W6Q B;  3SEE A;  2YXS A;  4FXG B;  3U10 A;  4CCM A;  4QPG A;  3ZO0 B;  5F3C A;  3EMR A;  2R04 3;  4UYB A;  5C8C C;  3H8O A;  3VN4 A;  4EN0 A;  4V1P A;  5SV5 A;  3DPR B;  4H14 A;  4DNY A;  1CAV B;  4Q4X 2;  5E8A A;  4IND A;  3ZIX A;  4BM8 A;  2PLV 2;  1GQH A;  2ZXQ A;  4ITC A;  1OUX A;  3BTA A;  4Y20 B;  5L7O A;  1RUI 1;  1Y3T A;  2VZ3 A;  5GLU A;  5JPN B;  3BKZ A;  1F4A A;  3LFI A;  1ZRC A;  1MEC 2;  5BNP A;  1DFQ A;  4AI1 A;  1HX6 A;  1PO2 3;  4HKW A;  3VDA A;  5IFT A;  1AX2 A;  2V4V A;  1WLT A;  4A42 A;  1PVX A;  3DN7 A;  1VBA 1;  2YBP A;  4KBZ A;  4AYU A;  4D7S A;  1AR6 1;  1UZ0 A;  4N53 B;  3NV2 A;  4N43 B;  3ZFE A;  5IVC A;  4HN1 A;  5FPV A;  1UYY A;  2X5I A;  4O7X A;  1XYN A;  3R4U A;  4Q4W 1;  5E16 A;  1QXR A;  2E26 A;  3T4V A;  4QX2 A;  3IM0 A;  3RMY A;  4CA9 A;  4ZU7 A;  5KHH A;  2HBT A;  4L2N A;  4YW4 A;  1CAW B;  1S0C A;  4CU7 A;  1NCQ C;  4KL1 A;  1H6Y A;  1VBB 3;  4E2Q A;  1LTE A;  1K45 A;  3KCX A;  2WT0 A;  3SIS A;  3PLQ A;  3T0B A;  2VZR A;  5HCA A;  1RUE 2;  1UXX X;  4EN8 B;  4I3G A;  4D7T A;  3KT7 A;  4PBP A;  2MHF A;  4YVW C;  2ZZQ A;  3KV5 A;  1PO2 2;  2B39 A;  3AYE A;  3WP6 A;  5JMC A;  1YXW A;  3NJZ A;  4Q29 A;  4FCA A;  5FPZ A;  4FPL A;  1KDM A;  4MYE A;  3ZFG C;  2BEO A;  2B7Y A;  4BQ2 A;  1WUV A;  3KF3 A;  1OLM E;  2OUH A;  3LPF A;  4LE4 A;  4N9I A;  3W5N A;  1HQN A;  4IE6 A;  3K75 B;  1LHO A;  5FLH A;  3OBT A;  2LAL A;  3J8F 1;  4WM7 B;  4H7L A;  2HWC 3;  4KU7 A;  4AI9 A;  4LIV A;  4BIO A;  1G7Y A;  1VBB 2;  3RQ0 A;  1A78 A;  2Y38 A;  5IK8 A;  1DGL A;  4Q0V A;  4UBG A;  1DZR A;  1ZZ9 A;  3WF1 A;  3U75 A;  4DIN B;  5JUV A;  3PJY A;  2VTX J;  2PHF A;  2N7G A;  3B93 A;  5DDJ 3;  1QDO A;  5F2W A;  3VL9 A;  3ZN4 A;  4CDW B;  1W0N A;  2AH2 A;  1LOA A;  1JYX A;  3EXU A;  3AMM A;  1NG0 A;  4WZC A;  1W39 A;  1POV 3;  3PVN A;  1M06 G;  2NQY A;  4LBK A;  4AI2 A;  2GMP A;  2JDM A;  1BCX A;  2VBB A;  2HWC 2;  3RJ2 X;  2OUJ A;  4LBM A;  3LFM A;  2WNV B;  2RE9 A;  2ZX3 A;  3IDC B;  3RPQ A;  3KWV A;  3WT3 A;  5M0T A;  3HOB A;  1RXF A;  4QWN A;  1GZT A;  2Q0A A;  3CZJ A;  4XXA A;  4YYO A;  1JZ4 A;  3VKL A;  1W9Y A;  1U5Y A;  3OPW A;  1W9F A;  3THT A;  1V9U 3;  2G19 A;  3OBR A;  3UJQ A;  4LBQ B;  4O9E A;  5DDJ 2;  1W03 A;  4FPH A;  3M3E A;  4ES9 A;  3O0W A;  2RJL A;  1JYI A;  3AP4 A;  5BYN A;  2MEV 3;  1R64 A;  1CPN A;  2W1S A;  2HWE 3;  4RS5 B;  1MS9 A;  1UY1 A;  4EE2 A;  4N8M A;  5BUV A;  2IXK A;  3OBZ A;  4NHL A;  4AHY A;  5BNN C;  4AK3 A;  2QDN A;  2CNA A;  3MFA A;  4FBF A;  5FOB B;  4NE9 A;  4NRO A;  1QDC A;  1J1L A;  2P3Y A;  4GA9 A;  2IVJ A;  3U37 A;  4B8E A;  1W28 A;  1SG3 A;  1D4M 1;  1MR5 A;  3R0R A;  4A2U A;  3FBM A;  3FHQ A;  3NV4 A;  1NCQ B;  2WJS A;  2IXL A;  3AKP A;  2Z79 A;  4IV3 C;  3OGG A;  3PUS A;  1Y9M A;  2WAO A;  2V73 A;  3AYC A;  3DV8 A;  1UPS A;  3PVO A;  5FO8 B;  2QQO A;  3RWN A;  4FI9 A;  1RGS A;  4UFJ A;  4M4R A;  5C6C A;  2XG3 A;  4AVS A;  3K48 A;  4Y1U A;  2MEV 2;  1RTV A;  1KS4 A;  3RG0 A;  4CCD A;  4XF4 A;  1W8W A;  2A75 A;  3WP4 A;  4KGQ A;  2HWE 2;  1GFF 2;  1X9P A;  3OYW B;  5FKB A;  2Q8D A;  3BPZ A;  4IGO A;  1GNH A;  4A44 A;  1WBL A;  4JRA A;  3S6P A;  4JHT A;  4PDW C;  5EFU A;  2QQW A;  2DTY A;  2EIC A;  1HN1 A;  4Y1X A;  1JHJ A;  2D6M A;  1V6J A;  4IUG A;  5AFB A;  5CKN A;  2RDQ A;  5FY5 A;  3VDD C;  1GQG A;  1ZZB A;  1LOG A;  1R08 1;  3AL5 A;  3P1I A;  1UNB A;  5LK5 A;  5K0U C;  1QJY 1;  4HG6 B;  2VPV A;  1UY2 A;  2AEN A;  1HXS 3;  2WII B;  3PIJ A;  4IEY A;  3SEP A;  1D0G A;  1XC6 A;  1NE6 A;  1PO1 1;  4GIQ A;  2IFR A;  4M01 A;  3K4D A;  3MFC A;  4KGG A;  2ORZ A;  3WQ7 A;  3R05 A;  5IAV A;  3IPV B;  4Y3O A;  2GH8 A;  1QJX 3;  1X33 A;  2UY8 A;  3VGI A;  3IDE A;  1PX4 A;  5GZF A;  3WG4 A;  3O1U A;  3ZIW A;  2J1A A;  4C0B A;  4O9G A;  2GNB A;  1HRV 1;  3H7Y A;  1OKO A;  2FCV A;  2XJS A;  5A6Y A;  5L9V A;  4IXL A;  3MGU A;  3T2Q A;  1V6L A;  1S0G A;  3PIG A;  4GZ9 A;  3VV1 A;  5IK4 A;  1Q8V A;  2X29 A;  1HB3 A;  5ANQ A;  3WG1 A;  5ERL A;  1ND3 C;  1CQ9 A;  1Q3E A;  5ABJ B;  5LCW L;  1O91 A;  3M2M A;  3WF4 A;  2DCJ A;  4KWU A;  4FPF A;  1H2N A;  2P3I A;  2ZX4 A;  5FY4 A;  1G6N A;  4Q8L A;  3ZSJ A;  1G8W A;  2JE7 A;  2DDU A;  1HXS 2;  2OT7 A;  2DFB A;  4J1W A;  2CL2 A;  2OPK A;  5CYY A;  3EHK A;  1IS6 A;  2D5H A;  4AFM A;  4CDX C;  4PBO A;  4QPI C;  1QJX 2;  4O65 A;  3VHR A;  5FLJ A;  2ARA A;  3H8R A;  5F39 A;  3H7J A;  1LAJ A;  1I3H A;  4UXA A;  5BNN B;  3I7D A;  2YPJ A;  4JTN A;  4CCL A;  4Y5Z 0;  2GAU A;  1KDK A;  4LKF A;  1WW7 A;  3P5B A;  3TN9 1;  4XAB A;  3VBO A;  2R49 A;  5DMY A;  1RUO A;  1UOB A;  2KA3 A;  2E9Q A;  2ORX A;  1KJR A;  2WR9 A;  2FDJ A;  1U0A A;  2AAC A;  3WDX A;  2FMD A;  5FZD A;  4QAW A;  1ENR A;  1QNY A;  2DBN A;  1SFP A;  2G4I A;  5ACA 1;  1VMJ A;  2LRP A;  2RM2 1;  2VQT A;  4JQR A;  3VD4 A;  1EAH 2;  4FFG A;  2F4L A;  3FX3 A;  1DQ4 A;  5A6X A;  4IW3 A;  5J98 B;  3RZZ A;  2OZ6 A;  2XPJ A;  4HK8 A;  4YG6 A;  2Z42 A;  4Y24 A;  2MNG A;  3GZE A;  2WZR 2;  3B01 A;  4FSJ A;  2WAB A;  2FQP A;  1MS3 A;  4OUS A;  5EV7 A;  3KVA A;  5A3W A;  4D6S A;  2WAA A;  1BBT 2;  2OS2 A;  1US3 A;  4R9D A;  4PDW B;  3ZXG A;  5C3Q A;  1WMD A;  2YG0 A;  4MXV A;  3WVJ A;  3ITQ A;  5A3T A;  1SCR A;  1WCS A;  1JZ2 A;  5GKA C;  2CSG A;  1YYN A;  3HT1 A;  3POF A;  4QDS A;  1GZ9 A;  4YGE A;  5FBJ A;  2QVS B;  2XJQ A;  3L9J T;  1QNW A;  3VDB A;  3QCW A;  3NJY A;  2JE9 A;  2ZGU A;  2BOI A;  2R1D A;  2CGO A;  3AL6 A;  3ZPO A;  4F8A A;  2X09 A;  1IS3 A;  5DAP A;  5JIA A;  3TOJ A;  4XYX A;  3MPB A;  3QAC A;  1UKG A;  1GOH A;  1A8D A;  1TVG A;  1VRH 3;  1QF3 A;  1WBF A;  2JD9 A;  4I0B A;  4RQP C;  3MLJ A;  4P14 A;  5CG8 A;  1UL9 A;  3K4Z A;  1UY4 A;  3M4F A;  1ASJ 3;  3ILF A;  3TEX A;  1H2M A;  3OPZ A;  2NMO A;  2J1S A;  3GM8 A;  1AR9 2;  3TEW A;  4BU2 A;  1E5S A;  5LBB A;  3POI A;  5A3U A;  3OY8 A;  4LHL A;  2VG9 A;  2ZTN A;  4LIU A;  5FRA A;  3W58 A;  4EN7 B;  1RMU 3;  4HMZ A;  3ZPY A;  2JG9 B;  1OPO A;  2QZ2 A;  3PTR B;  2RR1 1;  1ND3 B;  1MVQ A;  4NOT A;  1XOY A;  1ZBA 3;  2DVF A;  3VBH C;  1J3P A;  1SZB A;  2Z4F A;  4Q0U A;  5AC9 2;  4PHZ A;  1S2K A;  5FPA A;  5J36 A;  2HEV F;  5L19 A;  3GZA A;  2LW8 A;  4FPC A;  2YGL A;  1FPN 1;  3D5O A;  4QX7 A;  3O5S A;  4GJY A;  5JCT A;  3RZJ A;  1OOP C;  3ILN A;  4J25 A;  2FCU A;  5CA6 A;  1WD4 A;  1ZBE 2;  2PAM A;  2W87 A;  3LOI A;  3OGS A;  1ENX A;  1OA2 A;  2BNM A;  4MET A;  1ZVF A;  4XCA A;  4W50 A;  5FYZ A;  1W6M A;  1K42 A;  2ZAH A;  4CXW A;  2OQ7 A;  2B9U A;  2RS1 3;  5LWB A;  2TBV A;  2XLA A;  3WP5 A;  3FL7 A;  2QJV A;  3SCG A;  2WZE A;  2Y26 A;  2QNK A;  3VZJ A;  1RMU 2;  1RUJ 2;  1H4G A;  3MF9 A;  3RSJ A;  3ZDV A;  5BNO A;  3MIF A;  4XFH A;  1A8M A;  1JXN A;  1W06 A;  2WWU A;  3CJI A;  1J83 A;  4HK9 A;  1ZBA 2;  2ZMK A;  5GZD A;  1N47 A;  3OSD A;  5E6H A;  2W94 A;  1R09 3;  4QXH A;  1TEI A;  2C6S A;  1L7L A;  1BZW A;  1UOG A;  4BQ3 A;  2DVA A;  4OI0 A;  1RUG 1;  2E7Q A;  2V5D A;  3K46 A;  4RGA A;  2FDF A;  4FPY A;  4MGK E;  4YAR A;  3BPS A;  3I2G A;  1W8O A;  4CU9 A;  4Z2A A;  4K7J A;  4RR3 C;  1VB2 A;  5EJ3 A;  5FPL A;  3T3Y A;  3LSE A;  2RS5 3;  4GKY A;  4RHV 3;  5CZK A;  4DOU A;  3MPP G;  4NRQ A;  1CAV A;  1AR8 3;  2HWB 2;  2VMI A;  1UZZ A;  4Y5T A;  1WW6 A;  1LGB A;  4WVM A;  4V2W A;  2VMG A;  4Q27 A;  5CG9 A;  2BV4 A;  1BK0 A;  1QOT A;  2R06 3;  3DYO A;  4L92 A;  4L8Q A;  4QGL A;  3VZK A;  1RIN A;  1ULC A;  4CPB D;  2EA7 A;  1W8T A;  2W92 A;  1YNA A;  3IWZ A;  5DAB A;  2BW8 A;  3WNK A;  1B35 A;  1CD3 G;  3OGJ A;  4XFF A;  1R09 2;  2G9G A;  3BIW E;  3CQO A;  2ARE A;  1XNT A;  3R4D B;  2P2K A;  1RVF 3;  2ATF A;  2P34 A;  5FZO A;  3C7F A;  3B9C A;  2GP3 A;  5BV6 A;  4YPJ A;  3AMN A;  4JGY A;  4RQP B;  4XJU A;  4NRP A;  5DZF A;  1MZE A;  4KQ7 A;  2EXJ A;  2Y60 A;  3CKH A;  2DTW A;  3J26 N;  3KSC A;  2D98 A;  4RHV 2;  1RUH 1;  4K1Z A;  5EPA A;  3ILR A;  1AYN 2;  3BB6 A;  5D21 A;  3ZN6 A;  2P3K A;  2Q4S A;  5JVV A;  4IEZ A;  4HT1 T;  1X9T A;  3RFR A;  3JXS A;  3B5L B;  1YI7 A;  1H1I A;  2GNT A;  2XUM A;  5FUP A;  3VD7 A;  4C8D A;  3DL3 A;  1GP4 A;  4NMI A;  3D6E A;  3AKR A;  4AAP A;  4ZZ8 A;  2DU1 A;  3FZ3 A;  2X53 S;  4UF0 A;  3VD5 A;  4TYS A;  3N9M A;  3VBH B;  4E4D X;  2OKX A;  1W6P B;  3ZFF C;  2ZEZ A;  4WVV A;  3BTZ A;  3B00 A;  2XKP A;  2QQN A;  3B9I A;  3ZYG A;  2Y6J A;  3A0N A;  2ZJC A;  1OOP B;  4JKL A;  2TUN A;  2PHL A;  1JBC A;  3I2K A;  4BWO A;  1G9D A;  4WM7 A;  1OF4 A;  4P9L A;  2E6V A;  2DF7 A;  1UN1 A;  5J09 A;  4PLO A;  2IUW A;  4RFR B;  3UGF A;  5GLT A;  1XE7 A;  1FI2 A;  4PT6 A;  4AED A;  1L3J A;  1ZZ8 A;  5F1R A;  2ZEY A;  1QJU 3;  4BQ1 A;  2XDV A;  3WNN A;  5JXH A;  2R7E B;  3T4H B;  2ZKL A;  5FV3 A;  2D3R A;  1A34 A;  5J37 A;  1JYN A;  1AL2 1;  1KFX L;  1FMD 2;  4JGZ C;  5EZW A;  1HJG A;  2ES3 A;  3MID A;  1IKP A;  4C1W A;  2Z2S B;  1OLM A;  4E4Z A;  5K8S A;  2ZZJ A;  4PQQ A;  2VU9 A;  1S0I A;  2E53 A;  3CL1 A;  4YVS C;  1UF2 C;  2GND A;  1ST8 A;  2DBI A;  3SLI A;  3ZM8 A;  1OQD A;  4ET7 A;  1JYW A;  1FOD 3;  2FZ1 A;  1XYO A;  1W05 A;  1W6N B;  3C7O A;  3KV9 A;  4RR3 B;  1SLB A;  5A1A A;  1JU3 A;  5C8C A;  3BVC A;  4MHR A;  1BMV 1;  3KV4 A;  3OPT A;  3M7A A;  4XJZ A;  1STM A;  1NLR A;  4Q4V 2;  3VBS A;  1QJU 2;  2VTX A;  4D7Y A;  2VCB A;  2XLG A;  4LMF A;  1PGS A;  4EQV A;  3OD0 A;  2LS6 A;  2ZAC A;  2W91 A;  2Z5W A;  2WZP P;  2JE8 A;  2VW2 A;  2ERF A;  1JN2 P;  3MIC A;  5CEH A;  3PNA A;  1MS0 A;  5A7W A;  3ROU A;  1W2T A;  1LKN A;  1V6O A;  3DKQ A;  1YC6 1;  1JMU B;  4A6O A;  4RGK A;  5CKM A;  1XRU A;  2ZGS A;  3POY A;  4Z1V A;  3POE A;  5FMB A;  3IAQ A;  1S0B A;  1D0H A;  3III A;  4JKM A;  1Y43 B;  4GD4 A;  5DN2 A;  1PGW 2;  2ZAB A;  3NJX A;  1Z7S 3;  1AJO A;  1ZA4 A;  3HNM A;  4JVA A;  4BQX A;  5CAD A;  3MDP A;  3NNL A;  4QKF A;  3O1T A;  3RS6 A;  3WG2 A;  3AP6 A;  1SLT A;  4XXP A;  2DUQ A;  2ARC A;  3D82 A;  1K12 A;  3MIH A;  1RUD 2;  4GQ7 A;  4IES A;  5DZE A;  2LRO A;  2ZBJ A;  5DUX A;  4YVW A;  5T52 A;  1FXZ A;  1YHF A;  4XIK A;  3O1O A;  5FLI A;  1PM4 A;  4N90 A;  3ZFG A;  4C1X A;  4PCR A;  1H0B A;  3ZFF B;  4YM3 A;  1X50 A;  4ZY9 A;  1LOF C;  3SXW A;  5LRR A;  1PIV 3;  5T5J A;  4BIS A;  3UKT A;  1HLC A;  2OQ6 A;  3AMQ A;  1YWK A;  1F31 A;  1R1A 1;  5L73 A;  3NJV A;  1SHW B;  5JZG B;  1DHK B;  1YUD A;  4JHZ A;  2EVX A;  2XJR A;  5IYY A;  4QD2 A;  1Z7S 2;  1FAT A;  4A7K A;  2W9X A;  3IDA A;  4Z82 A;  1X8M A;  2OXB A;  3HAG A;  3N7L A;  5DG1 A;  1YFU A;  3I4I A;  3ZXL A;  3U07 A;  4P00 B;  3LB9 A;  4XHX A;  1LES A;  1SEF A;  2OYZ A;  3ECQ A;  4GB3 1;  2WS9 2;  4HVR A;  1LOB A;  3VZL A;  2DCT A;  3PVE A;  5F9T A;  4ZS3 A;  2RHP A;  1S4C A;  4M3C E;  3L2H A;  1FYU A;  3GDB A;  3KLS A;  5FJK A;  1VBC 1;  4HL0 A;  3ZYR A;  2FDG A;  3C8X A;  3U0Z A;  1C5I A;  4OCT A;  1GNY A;  1GV9 A;  1NY7 2;  1VRB A;  5CU1 A;  5JXJ A;  3E5U A;  4Q4Y 2;  4JGZ B;  3IPV A;  1WGP A;  2JEM A;  3FHI B;  3I2I A;  2EIB A;  3AP7 A;  5DG2 A;  3LIG A;  5FZM A;  3AZZ A;  4NIH A;  1BJQ A;  2WKK A;  1SBF A;  2XR4 A;  5A32 B;  1TMF 3;  1BVV A;  3D0S A;  1W9W A;  3WD5 A;  1LHU A;  4P5H A;  1WCQ A;  3ACI A;  4FAG A;  5IVB A;  2VXR A;  3T08 A;  1ZRI A;  1CZT A;  1XNA A;  2J42 A;  1AYM 2;  4OZX A;  5DUW A;  2W1Q A;  1NQJ A;  1RUC 1;  5LB6 A;  1G9C A;  1KGY A;  2Q30 A;  3CDZ B;  1GWM A;  1VAM A;  2GSY A;  4IEP A;  4BXF A;  4D69 A;  1RHI 3;  4W4Z A;  1FV2 A;  4YG0 A;  1SBE A;  4R8H A;  2ZS6 B;  1PK6 C;  1SFN A;  4MVT A;  1BEV 3;  4LUK A;  4XFB A;  4XUT A;  4DPN A;  1SDD B;  2RS3 1;  2IXI A;  2JX9 A;  1EPZ A;  3MHZ A;  5KBF A;  1JUH A;  3B3Q E;  4H2A A;  1GU3 A;  3VHN A;  4CEY B;  1TMF 2;  5HV0 A;  1W2O A;  3KD4 A;  4ISQ A;  4MH0 E;  1EV1 3;  1RXG A;  1GNZ A;  4CU6 A;  1Z0H A;  2DVG A;  3LZZ A;  5IUQ A;  1J58 A;  1MS4 A;  1XQN A;  2WA4 A;  3GGL A;  4IV3 A;  3UL2 A;  1Y7B A;  3VHP A;  3WNM A;  5CFD A;  4UWD A;  4CXX A;  5LEK A;  4LKS A;  2ZKN A;  1O7F A;  4LK7 A;  1COV 3;  5JSR A;  3ZYH A;  3RZH A;  1MZ6 A;  3MIB A;  3H1W A;  3I97 A;  3VBU C;  1A3K A;  1GQP A;  1GOG A;  1PVC 3;  1YIF A;  3GNE A;  3DF0 A;  1GUI A;  4RA0 A;  4NHM A;  5IW0 A;  2ILM A;  4MXW A;  2R04 1;  1IOA A;  2CWS A;  5G04 L;  3ACL A;  3LGR A;  3OTF A;  4N9H A;  1QH7 A;  1YQ2 A;  4LBQ D;  4P9G A;  4XIO A;  5A1L A;  5JI9 A;  2VM9 A;  1DQ0 A;  1SDW A;  3PVB B;  4X8P A;  2GNM A;  4BCU A;  1FT9 A;  1AF9 A;  1CX4 A;  3MIG A;  3RZL A;  1UO9 A;  3HBK A;  2QQV A;  2YY1 A;  4IEW A;  3KCY A;  2VUL A;  1HRI 3;  2TNF A;  3M8L A;  4COW A;  3Q8E A;  4LUM A;  4A7Z A;  2C9A A;  4F3J A;  3VDD A;  3M1H A;  3H1Y A;  2W1W A;  4TTG A;  2JIG A;  2DYC A;  1COV 2;  2VUD A;  1TME 3;  1OF3 A;  4FPO B;  4G9S B;  4UW6 A;  1OBN A;  5K0U A;  4FQ4 A;  4GMP 3;  2BFU L;  2B5H A;  4EWD A;  5FP7 A;  1O6U A;  3BU7 A;  3LEM A;  1OHF A;  2VQU A;  2HWF 3;  2XWB B;  3QLQ A;  5EYX A;  4CCJ A;  5KC6 A;  2A3X A;  4H3W A;  4ZXK A;  2PHR A;  1UW8 A;  1BLZ A;  3ZVX A;  3SMH A;  2VNR A;  1C8M 3;  2IZW A;  2GN3 A;  1NYW A;  3CIH A;  3H8U A;  3K3N A;  4YM0 A;  4K1Y A;  3T1M A;  3CBN A;  2QQP A;  4YW7 A;  1MS8 A;  2BVV A;  1GKB A;  2V4A A;  1OD5 A;  5IWF A;  1VBD 1;  4BA6 A;  3AFG A;  5I8Y A;  2RV9 A;  1DIW A;  1YEW A;  3AZW A;  4QQO A;  2JDK A;  3J9S A;  1JI6 A;  2PLV 3;  3IIA A;  1EUU A;  4HVO A;  4LR4 A;  2RG4 A;  4OI4 A;  3J7M A;  4M4P A;  4Y1Z A;  3SKJ E;  1LGC A;  3V0A A;  4ZS2 A;  3DEM A;  2BJS A;  4P9X A;  3E1F 1;  4ZHN A;  4MGZ E;  1IS4 A;  4LA2 A;  1PK6 B;  1RED A;  4CDX A;  1C8M 2;  4YW2 A;  4QPI A;  2Y6H A;  3ZN5 A;  2WFF 2;  1LEN A;  1UU6 A;  1CJD A;  4K9S A;  1W8F A;  4DQA A;  4QM8 A;  1XNB A;  5FZ8 A;  1S1A A;  4NN0 A;  4DIQ A;  2YHJ A;  4HOO A;  4Z8B A;  2WNV C;  3PJQ A;  4OVE A;  2KR2 A;  4HKL A;  3PUH A;  5DDJ 1;  1QIQ A;  1XNC A;  4LPL A;  3EYP A;  5AVA A;  5JOY A;  5IAT A;  5EHD A;  3I49 A;  4URT A;  5DZG A;  1RUE 3;  4YGD A;  1POV 1;  4MO3 M;  3RZK A;  1YO8 A;  5TSW A;  3MZH A;  2WL1 A;  3VBU B;  2J22 A;  4NPL A;  1F8V A;  2NYY A;  2NM1 A;  3THD A;  2VNG A;  3VHO A;  4RS5 C;  2VJX A;  4FTE A;  1NKG A;  2PMW B;  2JG8 A;  2WYS A;  5I93 A;  1QXP A;  5A7O A;  4HSJ A;  4DRR A;  5GJ6 A;  4GH4 A;  1V9U 1;  4AVT A;  1ND2 B;  2XKO A;  3LEG A;  1UOF A;  4FFF A;  4CDU C;  3H8X A;  4XF9 A;  3M3O A;  4COV A;  2VZ1 A;  1NQD A;  1APN A;  1YRZ A;  2Y34 A;  1OA4 A;  4XQ4 A;  4YM1 A;  2VME A;  1R1Z A;  1SMV A;  1IS5 A;  3AYA A;  1OFN A;  2HWE 1;  5LBF A;  4AE2 A;  3DXU A;  4KMQ A;  1UZV A;  2JEC A;  3NL1 A;  3AVS A;  4FOQ A;  4LTA A;  5FPB A;  4NAM A;  4FT8 A;  2PAE A;  3I2F A;  5FZG A;  4IE7 A;  3WW1 A;  3AZY A;  1L7Q A;  5F5Q A;  3RWK X;  5HCB A;  4CP1 A;  1W6O B;  4GAZ A;  4CXY A;  1CIW A;  3KV6 A;  4PIX A;  4WM8 C;  4TXW A;  1KIT A;  3AKS A;  5IK7 A;  1X7N A;  4QPY A;  5KXE A;  2RJ2 A;  2YUE A;  4DXT A;  3VKO A;  5KR7 A;  4R52 A;  2WYF A;  2BPA 2;  1JZ7 A;  4WVW A;  2ZML A;  4CP9 B;  1LU1 A;  1VR3 A;  3IBM A;  3KB5 A;  3ZSL A;  3KQR A;  5I0D A;  5K7P A;  2VNO A;  4DXR A;  3WDV A;  5C4W B;  3WCR A;  3PUR A;  1UXZ A;  1HN0 A;  3KCC A;  2VXJ A;  3PUQ A;  4W6X A;  4DXZ A;  1GAN A;  4NHY A;  5A33 B;  1PZ8 A;  4E8C A;  5FY7 A;  3I54 A;  3NAP C;  4K21 A;  4NR1 A;  3FWE A;  1ZX5 A;  4OHZ A;  2VOK A;  1NCR B;  5C9A C;  1DF0 A;  2EAK A;  2XBO 1;  4ATE A;  3A7Q A;  5FO9 B;  1K5M A;  1SPP A;  5IAX A;  3L2Y A;  3FLP A;  5FTT C;  4MLO A;  3JU9 A;  4U36 A;  3WHU A;  1F4H A;  2QUO A;  2Y64 A;  5ABJ C;  1QWR A;  2F17 A;  3RZM A;  5D8A A;  3OUH A;  5EP9 A;  3I3E A;  4HKO A;  1LOD A;  2WC2 A;  2VVF A;  2QBX A;  2R07 2;  4FOV A;  2FZ2 A;  5FZ3 A;  3LOB A;  4OUL A;  5F5I A;  1KS5 A;  3KGZ A;  2HJI A;  1YCI A;  4E9K A;  4NPM A;  3CHX A;  5DUU A;  3BTX A;  2ET1 A;  2IFW A;  1ZZC A;  2X10 A;  3VBS C;  1OXC A;  4NHK A;  4AQ6 A;  4YFZ A;  1H6X A;  3MV1 1;  4GWM A;  4CDU B;  4PI0 A;  5F8P A;  5KC5 A;  2BDR A;  4CUG A;  3B7M A;  5FYB A;  2R6Q A;  1ZRD A;  4OLL A;  3WF0 A;  4Y4Y A;  3BTY A;  3N7M A;  3QD6 A;  1NUK A;  4SBV A;  3WUC A;  2VZO A;  4COY A;  4BLI A;  2PN5 A;  3RNS A;  1DGW A;  1RUI 2;  2CGN A;  3WXP A;  5FZ0 A;  2J7M A;  4Q0S A;  1NA1 C;  1NZI A;  3NMB A;  4AVA A;  5KHG A;  3S7E A;  2VUJ A;  4MAD A;  3ZXD A;  1VBA 2;  3ZSK A;  1H8T A;  4QDR A;  2UYB A;  4GAL A;  1UZY A;  4XOG A;  5GZG A;  4AFD A;  4WM8 B;  3MLK A;  1NAE A;  2EAA A;  1GZW A;  4Q4W 2;  1O5U A;  5FO7 B;  4LE3 A;  3ZKU A;  3OUJ A;  2ZEW A;  3ZX7 A;  4AG4 A;  3HIF A;  4Y5S A;  4LOR A;  4G4F A;  2RDN A;  2A6V A;  3WQ0 A;  1XSR A;  3USU A;  3K77 A;  2ETE A;  2J1T A;  3AJZ A;  3I3M A;  2YB7 A;  4LHN A;  1FAY A;  1UZW A;  3AZX A;  5E88 A;  1DYP A;  3LEK A;  3Q8C A;  4AOC A;  2I74 A;  1MQT C;  4AHX A;  4XE9 A;  3NAP B;  1XJA A;  4NWW A;  5LAT A;  3LA2 A;  2RMU 1;  5C9A B;  1W3V A;  2WLP A;  1LOE A;  5T3N A;  3UNP A;  2QQU A;  1UD1 A;  4IV1 B;  1F5J A;  2DCY A;  1NLS A;  3JZV A;  3LD8 A;  4XAE A;  5FYS A;  3J8F 2;  2JG9 C;  2WSV A;  2FDK A;  2WN2 A;  4J1X A;  1VRH 1;  3VBR C;  4DEQ A;  4LHK A;  5J48 A;  3ZXJ A;  1YQ6 A;  2C24 A;  1MS5 A;  1YLL A;  3SH3 A;  3VBF B;  1WD3 A;  3HT2 A;  5F3E A;  5A3L A;  4ZPI A;  4Y22 B;  3HQX A;  3RYK A;  1ASJ 1;  3UYJ A;  1DGR A;  1OLQ A;  2D3S A;  1VMH A;  1VPH A;  4AQT A;  3FC0 A;  4FTB A;  1IZ3 A;  2AYH A;  2FDH A;  2B8M A;  2HEW F;  3LKJ A;  4HPK B;  1EAH 3;  4YVS A;  3BU0 A;  1IPJ A;  1RMU 1;  4PF5 A;  4FPJ A;  3ZXA C;  3WNL A;  2EF6 A;  4OI1 A;  3UKN A;  2GP5 A;  3VBS B;  4CPB A;  2WZR 3;  1N1T A;  2QQM A;  4ONU A;  3J7N A;  1BBT 3;  1HDK A;  3J7H A;  4UW5 A;  3Q8B A;  4H7M A;  5FMO L;  4DUV A;  3U4X A;  3ZDS A;  1Y9G A;  1N3Q A;  3D4K A;  4A41 A;  4JKK A;  3EBR A;  4MX3 A;  3POB A;  1KFU L;  4M3C A;  1PMH X;  2JDP A;  2VO5 A;  2BUK A;  1AXK A;  3CF6 E;  2JDN A;  5EJZ B;  5FZL A;  2WT2 A;  1O3R A;  2XB6 C;  3GBF A;  2WQZ C;  4XUN A;  2RS1 1;  5KXB A;  1VAL A;  2HKX A;  1T6G C;  4IL7 A;  3SH4 A;  2PHD A;  1WW4 A;  5C3R A;  5FPU A;  5G05 L;  4EZH A;  1KEX A;  2PHU A;  1NA1 B;  1D2Q A;  2WNU B;  3I2H A;  4QKB A;  5JI7 A;  5JIU A;  4QPG C;  1GR3 A;  3RYR A;  4AI8 A;  1W2A X;  4IEU A;  1JOJ A;  2FBE A;  3W59 A;  2EID A;  2A3Y A;  1AR9 3;  5F6L B;  1FX5 A;  4ZZ5 A;  1L7R A;  5IVE A;  1O59 A;  4D6Q A;  3KHC A;  1G9F A;  3LA3 A;  4R9A A;  4XQD A;  5FZB A;  3ZYB A;  5L7O C;  4XDP A;  2C9K A;  1D4M 2;  2GC0 A;  2XWJ B;  3IAP A;  2BZD A;  5BNP C;  4A3Z A;  1U5Z A;  2VMD A;  2ZAA A;  5AC9 3;  2RS5 1;  4QKN A;  4NJ4 A;  1CAU B;  4CTE A;  1LOF A;  1PZ9 A;  1REF A;  1Y4W A;  1R08 3;  1AR8 1;  4DY3 A;  1U5I A;  1ZBE 3;  3TBD A;  4HVQ A;  2YBK A;  2BRT A;  3AMH A;  4YZ4 A;  2R06 1;  1MQT B;  2DVB A;  1PO1 3;  5FY8 A;  5FQ0 A;  3V0B B;  1W2N A;  2EXI A;  4BK5 A;  5CFC B;  2XL9 A;  2ZX0 A;  4AF9 A;  4B1L A;  4XJA A;  4DO0 A;  1HKD A;  4J6G A;  4R9C A;  3SHR A;  3O1S A;  1RVF 1;  1QJZ A;  1RUJ 3;  2D6K A;  4LBL A;  3RRD A;  4KG8 A;  1F2N A;  3VBR B;  4CEW B;  2D44 A;  2ZHK A;  4CP0 A;  1H1A A;  2CHH A;  2E63 A;  3F2Z A;  1S0J A;  3GHN A;  2BNO A;  2UWA A;  3I59 B;  2OII A;  4I0A A;  1LED A;  2P17 A;  1R08 2;  1XXN A;  3ZXK A;  4RL7 A;  1ULE A;  1QJY 2;  4BQ4 A;  1ACC A;  4IE0 A;  1WWY A;  2PEL A;  1PO1 2;  1WCD J;  3I2O A;  1CAX B;  4JAA A;  2HWB 3;  5J7M A;  1RB8 G;  4GXL A;  3D8C A;  5JR7 B;  1WME A;  4BYY A;  4BMB A;  1VMF A;  2ARX A;  1C3H A;  3POW A;  1HRV 2;  1K3I A;  2D40 A;  4OHV A;  5LBC A;  3TB0 A;  1ZNP A;  1UOJ A;  2IWG B;  1DQ2 A;  4IE4 A;  4AI0 A;  1UIK A;  4M0H A;  5LBE A;  2A70 A;  3LDR A;  3BOP A;  2H6B A;  4E4H A;  3HPN A;  4DXS A;  5I8S A;  4JX0 A;  4WV8 A;  2FHR A;  3E6C C;  4JRL A;  1WCU A;  1W6Q A;  3AKT A;  4RN5 A;  3I3B A;  4OZO A;  4WZF A;  3AYD A;  5FXW A;  1JOP A;  1AR7 1;  1QJU 1;  3WLU A;  5ACA 3;  3LA7 A;  4YZ2 A;  4XJ8 A;  3NRU A;  3OJB A;  5DAW A;  4LK6 A;  4QPG B;  5B2G B;  1AYN 3;  1N3O A;  3DPR A;  3QH6 A;  2WLQ A;  4XTP A;  4K20 A;  2H6C A;  3SCH A;  1G9B A;  1Q8O A;  2WNO A;  5F3I A;  3OCP A;  4N7U A;  2JDU A;  3FFZ A;  2HYK A;  3IT8 A;  4Y20 A;  4F7Z A;  1TE1 B;  1SLA A;  2D6O X;  4QXC A;  4XPV A;  2VZS A;  4MOA A;  2GH2 A;  5FZE A;  3VBU A;  5L7O B;  1JZ5 A;  1PX3 A;  1C1F A;  2WIN B;  1Y9Q A;  4CP2 A;  4OQ8 A;  3TN9 2;  1QJE A;  2D43 A;  4HET A;  4Q5O A;  5BNP B;  4XZP A;  1FOD 1;  3RI9 A;  4LOS A;  3E6D A;  1NZC A;  5FUI A;  3LPG A;  1PGW 1;  1RYY A;  4XUO A;  4BH9 A;  4N53 A;  5E1R A;  4N43 A;  3PMS A;  4QMA A;  4W6Y A;  1WW5 A;  2E7A A;  2K9Z A;  3ZFE B;  5ACA 2;  2RM2 2;  5FXX A;  2VCM A;  2X5I B;  2QCS B;  2D93 A;  1CAW A;  1A6C A;  2ZGO A;  3SC7 X;  4NO4 A;  2VTF A;  5CIR A;  4DS0 A;  3ZSM A;  1Q8S A;  4UFI A;  3LAG A;  4EN6 B;  2AUY A;  4EWA A;  3BAL A;  1O8S A;  2QE3 A;  4NAO A;  1I6X A;  3UKV A;  1JZ6 A;  1FMD 3;  4XUR A;  4DUW A;  3WNP A;  4B7E A;  2NP0 A;  4QHB A;  1CJP A;  4AI3 A;  1J3R A;  1W6O A;  5D1I A;  4DMI A;  1C28 A;  4MGY E;  2WSU A;  1US2 A;  2I45 A;  5H9P A;  3TYJ A;  2BNN A;  1FPN 3;  5JZG C;  1H2K A;  4JV4 A;  4RYD A;  3FUQ A;  4I2O A;  1O4Z A;  2D6L X;  1IPS A;  3PTY A;  4HFS A;  4Q4V 3;  4AFC A;  2IXC A;  1PIV 1;  5EJ1 B;  3NVC A;  3UET A;  2DUO A;  2A3W A;  4FO9 A;  4CDW A;  3W21 A;  2NN8 A;  1S2B A;  2BWC A;  1OVP A;  2RR1 2;  2ZOE B;  4KBB A;  3U4S A;  2XJT A;  3VLB B;  4C90 A;  4CVU A;  4UFK A;  4RGG A;  3H3L A;  3ZYF A;  4IER A;  2GU9 A;  4M0N A;  4D0Q A;  2WBK A;  5A1F A;  4XFA A;  2CWM A;  2WO2 A;  3ETQ A;  3PUI A;  1FPN 2;  2W2I A;  3RDI A;  1JYC A;  4BQY A;  2IC1 A;  4LNV A;  5FYC A;  2VBD A;  2YZ4 A;  4D94 A;  2LTN A;  2WNV A;  4HSL A;  3USS A;  3WHT A;  5L9R A;  2PQS A;  5FZ9 A;  4BQ5 A;  2HWD 1;  2A6W A;  4DRV A;  1RC6 A;  4XDQ A;  2WO3 A;  3P6B A;  4MG2 A;  5K4L A;  4W6W A;  3FBY A;  4YW6 A;  2VW1 A;  3NQH A;  1MZ5 A;  4LBQ A;  4A6S A;  4AZZ A;  1RUD 3;  3WNX A;  2QZ3 A;  3FFQ A;  5LA1 A;  5BY5 A;  3EB7 A;  4CU8 A;  2O14 A;  3AB0 A;  4QQP A;  5DXD A;  4QX1 A;  4EZ4 A;  4RS5 A;  2ZGK A;  4LQR A;  2GAL A;  2WUH A;  4UI9 L;  1T2X A;  4G3Y C;  2JXA A;  4Y1V A;  2XL7 A;  3RI8 A;  2UU8 A;  4CEY C;  4HBN A;  2P6C A;  4EV0 A;  2ADE A;  3HEI A;  1WA4 A;  3ZOI A;  4XHB A;  2W47 A;  1LB2 A; 
#chains in the Genus database with same CATH homology
 3H8O A;  4NIG A;  4QKD A;  3O1M A;  3RZM A;  3O1V A;  4ZS3 A;  3BKZ A;  2FDG A;  4ZS2 A;  4OCT A;  3BTZ A;  4ZHN A;  4O61 A;  2FD8 A;  4NPM A;  3O1R A;  4NIH A;  3BTX A;  4QKB A;  4O7X A;  2IUW A;  3T4V A;  4RFR B;  3RZG A;  4JHT A;  5F8P A;  3KHC A;  3I49 A;  3T4H B;  3RZL A;  4IE5 A;  3RZK A;  3BTY A;  2FDI A;  4NPL A;  4QKN A;  4QHO A;  4NJ4 A;  3O1U A;  3RZJ A;  4IE6 A;  3KHB A;  4CXW A;  3H8X A;  4NID A;  3O1S A;  4CXX A;  4IDZ A;  3S57 A;  3RZH A;  3I3M A;  4IE7 A;  2FDF A;  3S5A A;  4IE0 A;  3BI3 A;  4CXY A;  3H8R A;  3T3Y A;  3I2O A;  4NRQ A;  3BIE A;  3LFM A;  4NRM A;  3BUC A;  4QKF A;  3O1T A;  4MG2 A;  2FDK A;  2FDJ A;  4IE4 A;  5DAB A;  4NII A;  3O1O A;  2FDH A;  4NRP A;  3BU0 A;  4MGT A;  3O1P A;  3I3Q A;  4NRO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...