3BIEA

X-ray structure of e coli alkb bound to dsdna containing 1mea/t with mn and 2kg
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
202
structure length
202
Chain Sequence
EPLAAGAVILRRFAFNAAEQLIRDINDVASQSPFRQMVTPGGYTMSVAMTNCGHLGWTTHRQGYLYSPIDPQTNKPWPAMPQSFHNLCQRAATAAGYPDFQPDACLINRYAPGAKLCLHQDKDEPDLRAPIVSVSLGLPAIFQFGGLKRNDPLKRLLLEHGDVVVWGGESRLFYHGIQPLKAGFHPLTIDCRYNLTFRQAGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alpha-ketoglutarate-dependent dioxygenase alkB
publication title Crystal structures of DNA/RNA repair enzymes AlkB and ABH2 bound to dsDNA
pubmed doi rcsb
source organism Escherichia coli k12
molecule tags Oxidoreductase/dna
total genus 48
structure length 202
sequence length 202
ec nomenclature ec 1.14.11.33: DNA oxidative demethylase.
pdb deposition date 2007-11-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.590 Mainly Beta Sandwich Jelly Rolls Alpha-ketoglutarate-dependent dioxygenase AlkB-like 3bieA00
4OCTA 3BU0A 4ZHNA 4O61A 3BIEA 2IUWA 3I49A 3I2OA 2FD8A 4IE7A 4QKNA 4IE4A 4IE6A 3O1VA 4NPLA 4MG2A 4ZS2A 3RZLA 4NIDA 4QHOA 4NRQA 3RZJA 5F8PA 4IE0A 3BTZA 4NIIA 3BKZA 4MGTA 3O1PA 2FDFA 3RZHA 4ZS3A 2FDHA 3RZMA 3RZGA 3BTYA 3RZKA 3LFMA 3O1SA 5DABA 3O1MA 3O1UA 3O1RA 2FDJA 4RFRB 3BTXA 3KHBA 3S5AA 3H8OA 3BUCA 2FDGA 4NROA 4JHTA 4O7XA 4QKBA 2FDKA 3I3QA 3T4VA 3S57A 3T4HB 4CXXA 4NRMA 3I3MA 4NJ4A 4NIHA 3O1OA 4NRPA 4QKFA 3H8XA 4QKDA 3BI3A 4NPMA 4CXYA 4IE5A 3O1TA 2FDIA 4IDZA 3H8RA 3KHCA 4NIGA 3T3YA 4CXWA
chains in the Genus database with same CATH superfamily
3L2YA 4X6RB 3WNNA 1XPWA 2EICA 4EN9B 5HCBA 4PIZA 5IVYA 5TSWA 4CDUB 2DUPA 4Z82A 4ZHNA 3WP5A 5J98B 4HL0A 1HXS3 1F5JA 1JN2P 2X5IA 2I07B 3JQXA 3P6BA 4IEPA 4RS5B 3ZX7A 3VZLA 4BQ5A 2G19A 2ARBA 4IE6A 2Q8CA 2YYOA 2GP3A 4XEZA 5JXHA 2YMZA 1B09A 3M2MA 4QB2A 2VBDA 2YDEA 5A1AA 1MEC2 3SCHA 4CUGA 4A7KA 1PK6B 3IN9A 1SACA 1W04A 1UWWA 1XE8A 2VZVA 2TBVA 2WO3A 1HRV1 4XF4A 1Y9MA 4I30A 1QQP1 2PHTA 4DZGA 4XIOA 5J7MA 4PT6A 1YQ8A 2R7EB 1LR5A 1PGL2 4N53B 3CMGA 3APBA 1HW5A 3PIGA 2DV9A 4Q4V2 3O0VA 4E4ZA 2D44A 2C9AA 4CVUA 3LF7A 5IAXA 2XVGA 2R061 5GLUA 2YU1A 5F3EA 4MSVA 1H2LA 1ND2A 2ZAAA 4Y3OA 1W6NB 4BQ1A 1SBFA 2P2KA 4UW4A 2XLGA 4A3ZA 3RMXA 1SFPA 1JH5A 1W6MB 5LBBA 5FO7B 3WQ7A 1F15A 4JQTA 2GU9A 2VBPA 4JQRA 3BYWA 1H1MA 3AZZA 5JSPA 1RMU1 1AYN1 1E5SA 1FNZA 3GJBA 4S2GA 4NHMA 4META 4U2AA 5GJ6A 1MEC3 1CWPA 3OGVA 1OC1A 3DV8A 3FHQA 3OGSA 1NQJA 3NJXA 2B9VA 4ZPIA 3RJ2X 3W9AA 2ZHNA 4AK3A 3DGTA 4JGYC 4WVZA 1LOFC 3UKNA 3AXEA 2QE3A 2JIJA 1GQGA 4ZU5A 5I0RA 4YZ5A 2WQZC 1VMFA 3B94A 5F9TA 1PMHX 1DLCA 4Q4V3 5F5QA 1JYXA 2A3YA 2OVUA 1V00A 4OHZA 5GLTA 3VD7A 4D0QA 1DYKA 1PK6C 5FZIA 5K4LA 1REEA 1X8EA 1TMF2 3BVCA 5LBEA 3ACLA 3NNMA 4N53C 4QXBA 4AE2A 3L2HA 2B39A 2YC0A 4AI2A 5FKBA 4RN5A 5FWJA 2VXRA 2MEV2 4CDQC 2J1UA 3ITQA 3M4FA 1NCRA 2RR12 5FO8B 1ND3A 1WCUA 1DLLA 1MS5A 1VBE1 1XRUA 1L7RA 1J3QA 1O6UA 5E6HA 3MIBA 1OF3A 1PNFA 1OT5A 2PXJA 2VVDA 3KF3A 2P5BA 1DHKB 3CU7A 3K51A 4FPGA 4XCAA 3RZZA 3WHTA 4FPEA 4BCUA 3NVCA 4CUAA 2R16A 3ZXKA 2VY0A 3C7HA 1R1A2 4KMQA 4XJWA 5JLVA 1A6CA 5C3QA 4URTA 1XQNA 5A6XA 1W2UA 5KHGA 1OBNA 2D6KA 1VBA2 4EZHA 4UF0A 4JDOA 3WP4A 4LA2A 3OPWA 2FCUA 1Y3TA 2GDFA 2D6NA 2GC3A 5F5IA 2DVGA 4UW6A 1AR62 2VUJA 4I02A 1V6NA 4KU7A 2D5HA 2W1WA 4OCTA 3VBSA 4KNCA 3BU0A 5JXIA 5A7NA 4AVAA 1EUTA 5HI0A 4DOUA 2DUOA 2MEV3 2WRAA 3HOBA 5KXBA 1D0GA 1RUOA 1VPHA 1LTEA 3JB4C 3PTRB 1QDOA 3V64A 1WW7A 1N1TA 2XMLA 2XWJB 4URAA 3TN91 4OI0A 4H7LA 4CUBA 4IEVA 3ABZA 4E8DA 5FZ1A 2ZZJA 3LFIA 4F7ZA 4AVTA 2Z79A 4CP0A 4W6XA 2YFZA 1EAH2 4HANA 5A3OA 1MZEA 1Q8SA 4CEYC 5C3OA 2HKXA 2QZ3A 2VQTA 2XJTA 5D2AA 4K8RB 4H2AA 1VBA3 3FLTA 2XUEA 1SLAA 3BCWA 4FQZA 3WDTA 4CCLA 4Y1VA 3VL9A 4TSVA 1XYNA 4YM3A 3ZYRA 2KR2A 1ONAA 4QHZA 4CDXA 2Y6KA 1AHSA 4JKMA 2OPKA 3FBYA 4FPHA 1A78A 3RZHA 3ZN6B 5LRSA 4LHKA 4XUQA 2B9UA 5LA1A 4L2NA 2HEWF 3D3AA 1BZWA 2Y6HA 5BYNA 5AFBA 4CZSA 5F1RA 2NPIA 1N1SA 1YC61 2G4IA 3H0OA 1V6LA 4HKOA 1ZA4A 5FY8A 1OF4A 1MQTA 3K48A 5FY0A 3POEA 5L9BA 1PO21 2JG8C 2VE1A 1ZZBA 4Q8LA 4M01A 2V09A 2ARCA 1UQXA 4XVHA 1D2QA 4CP2A 1STMA 1NG0A 1RUC2 1EV13 4MO3M 4DMIA 2QDRA 1UYYA 1X36A 4BQYA 2GNMA 2ZX0A 1SPPB 3PUHA 2D6PA 3V0AA 2H0VA 2E6VA 4TXWA 3O1MA 1AXKA 1PIV2 3N7KA 3U07A 3RSJA 3DUIA 2QQNA 3K4DA 2MHFA 1UOJA 1TQ5A 4G3YC 1H8TB 3H7JA 2VR4A 1VMHA 1KGYA 3KV6A 3RGBA 2RS12 1UPSA 1W8FA 1ASJ1 1OSGA 2LROA 5FYIA 5AC93 5CKMA 3RYKA 1QJX2 1YIFA 4Y33A 5LASA 5FZ0A 3UGFA 3VKFC 4FO9A 3HWJA 3RI8A 1UZWA 5FY1A 1IGOA 5FJKA 3VLBB 5IT6A 4YM2A 4YW1A 1H2KA 4FVVA 4DNYA 4EN6B 1UF2C 5JIUA 2QQIA 1J1TA 2JB8A 4ATFA 4D7TA 1WCSA 1AR71 1OOPA 2Z4FA 3PHMA 5DPNA 3KF5A 3VV1A 2E53A 3LIGA 3VBOB 3ZXFA 3UGHA 1OUSA 3CHXA 2GC2A 2D6LX 4QXCA 1W6PB 2K46A 4AYUA 4TLFA 5C9AB 4LT5A 1JHJA 1WD4A 1PIV3 2XVKA 3QD6A 2LTNA 5FYHA 4BMEA 1OUXA 2BBVA 3LEMA 1LULA 1GZCA 2WSUA 5BNOB 3AKQA 3PIJA 3O0XA 4Y4YA 3AM2A 1GQHA 3DYMA 1D4M1 4XYXA 4E4SA 2R071 4YFZA 1GWKA 1JYVA 3W59A 4CRQA 2HWF2 3PVNA 4JGYA 1LOFA 2FZ1A 1QJX3 4PI2A 4YG3A 1X8MA 5CADA 5IVCA 4AAPA 1VBC3 1SCSA 4PF1A 2EAAA 1IKPA 1DGRN 1SLTA 4PIXA 3GBFA 1H8TC 5KC5A 2WLPA 1PK6A 4MGKE 1W2NA 1W8UA 1WD3A 3BGAA 5FMDA 1QJY2 3U10A 2CDPA 3MLJA 4PQ9A 3GZEA 1ODNA 5C4WC 2FBEA 1OA4A 1AF9A 3GXUA 5A33A 3VHPA 3ROUA 1WLTA 1UPIA 3VKLA 4CDQA 3I3DA 2WNVA 4FXGB 4XILA 2ID4A 3PVOA 3QOPA 5A7WB 2P37A 5SV5A 5DMYA 4PLOA 2WKKA 4YWAA 2BEOA 2RS51 1PZ7A 1W6NA 4OUEA 4JDNA 2JIGA 4KU8A 5FLJA 3JB8A 2ES3A 2P6CA 4PQQA 1RUE3 4D6QA 2EIGA 2XKPA 2XH6A 4OI2A 1CZSA 5C9AC 3BKZA 3A21A 1W6MA 5CNAA 1ZBE2 3C2UA 1R64A 2PQQA 3K2OA 2ZGKA 5BV6A 4GAZA 1NY72 1WGPA 1O59A 1N3QA 1R091 4FFGA 5L7OB 5BNOC 1MS3A 1PVXA 1YFXA 2P3IA 3V65A 1TME3 1Q8PA 3FJSA 4XDOA 5JCTA 3N9QA 4Q1RA 1AYM3 1OKQA 3ZXJA 4ARYA 4FPFA 4LTAA 4IQPA 1JZ4A 1UMZA 1CZVA 1VIWB 3S30A 3THTA 1W2TA 4FPKA 4WZCA 2QCSB 5CISA 3KWVA 4GH4B 3INAA 3AC0A 2ARXA 4QM8A 1JW6A 4KL1A 2AH2A 2JDHA 4ASKA 1RJ8A 4N90A 1CN1A 3X29B 2DCYA 3CJXA 1IS6A 4LHSA 4CCCA 5FZ6A 1CVNA 2XXZA 2RM21 5CFDA 2VVFA 1ZREA 4V2WA 1Z7S1 5JI7A 2VOKA 3ZSKA 5CFCC 1I1EA 1DYPA 2IVJA 4CEYA 3OEAA 3H8OA 5B4NA 1BEV1 4QX3A 4W50A 3UK9A 1QJFA 4TYSA 1IPJA 4DRVA 2IXHA 1RUH1 2BNMA 3MW2A 1RHI3 1FAYA 4H7MA 1HRV2 4YZ3A 1FOD1 1QIQA 3T4VA 3D0SA 2WN2A 3T0AA 2Y6FA 1NAEA 5T5OA 1DQ5A 3K4ZA 1WW6A 1U12A 3T2QA 5L7OC 1U5XA 4N8MA 3D5OA 3RG0A 5JWPA 1QH6A 1U5YA 3FC0A 4L92A 5F3GA 5DAQA 5J96B 2R062 2XJQA 4LULA 1CQ9A 2JG8A 3B9IA 3H8XA 5CA6A 4QQ2A 2GH2A 2ZGOA 4J6GA 1YI9A 4CEWB 3RYPA 1XSRA 2NMNA 1XNAA 3B02A 2CWSA 4GH4C 2Y0OA 3O0WA 4ISRA 4N43B 4RA0A 3N4MA 3WDUA 3ZM8A 2KD7A 1JUHA 3RPQA 5F3IA 2D98A 4IDZA 4NIGA 2WIIB 1AYN2 1ENRA 1FV2A 1PGW1 1HJGA 1QXRA 2VOTA 1IKQA 4WVWA 4B4RA 2ZMLA 1OI6A 4PDWC 2IWGB 1LOGA 4P9IA 2JXAA 4GULA 4OI1A 1N3PA 1QQP3 4RR3B 5GZEA 4DO0A 5DG1A 5CB7A 1PGL1 1SDDB 2JDZA 4UAPA 5KWRA 2DCZA 4C91A 1CIWA 3CZJA 4Y1YA 3A22A 4AR2A 4CCDA 1BMV2 4Q0UA 3OCPA 5LK5A 1NCQC 2DVAA 2R063 3G7DA 2OS2A 1UNBA 2WWJA 4OZXA 5HBAA 3KVAA 1YI7A 2W68A 3ZSMA 1KEXA 4XF3A 3J26N 4NRQA 5G04L 4DPNA 1YHFA 2VUDA 1XOYA 2LALA 4A45A 4UBHA 5I8YA 4NHYA 4MGYE 3M3CA 1RMU3 2J1VA 4MHUA 4ZXKA 1VBE2 5DZGA 1XJAA 3R05A 3NJZA 4CEWC 2UWCA 3H9AA 3MW3A 4BIOA 4XJAA 4FPJA 4AFCA 1SCRA 3KCYA 1DGLA 2VOWA 3NV3A 3J7LA 4CPBD 3POBA 4XTPA 1IS3A 1YFWA 1J1LA 4XFBA 4FAGA 1IPKA 3ZMNA 1G7YA 1LNSA 3LSEA 1QHDA 2DFBA 5K9YA 1H8TA 3IBMA 3SCGA 2CSGA 2TEPA 1H1AA 4YNIA 2JEMA 3DYOA 4LK7A 2QNKA 2NMOA 1YCIA 2VTXJ 3CZUA 2CTVA 4CCOA 4QX5A 3KT4A 5C4WA 3WOGA 1DQ1A 1FPN3 2RR11 1RINA 4CA9A 2VMGA 1EUUA 1VBE3 2AUYA 4DY5A 1IHMA 1XNCA 2R1BA 5F32A 3DKQA 5LBFA 4B29A 1C4RA 1O4TA 1W9SA 1C8M2 1L7LA 4D3WA 2A6XA 1CJPA 5IVJA 3KHBA 5FFOC 3U4XA 2WT0A 4CCMA 1W0OA 4LO5B 1R1A1 4K21A 3ZYGA 4YW7A 2ZHMA 4INDA 2V4VA 3PURA 4JKKA 5C9AA 1JYWA 4OFGA 3OBTA 1XU2A 4XETA 1DZTA 2XWBB 2ZEZA 4N9HA 4EROA 5F3CA 1JYTA 3ZPYA 4GMP0 4FXKB 4QX2A 5FO9B 2WT2A 4TZDA 4M3CE 1H2NA 1AR61 1ND2B 3H1YA 2EALA 3WHUA 5C5UA 2QQJA 3H8UA 3I59B 1I9RA 4UFIA 2E9QA 3MZHA 2RDRA 1O5UA 4DUVA 1Z0HA 2CNAA 1H9PA 1DU3D 1NLQA 1WZXA 2ZGPA 2ZS6B 1R1ZA 5JVVA 4COZA 3BI3A 2D6OX 1CPMA 4IEUA 3NQHA 4IEQA 3VBHB 3UNPA 1AX0A 2R042 4NPRA 2P4EA 4YLZA 1UAIA 4B1MA 3OBRA 3TN93 2UYAA 2GALA 2QBXA 2VW2A 4LORA 2PLV1 2AREA 4OI4A 5EXOA 4E8CA 2KXLA 1UZZA 3OEBA 4ARXA 1EAH1 3ACGA 3GGLA 4YM1A 2QQKA 5L19A 1QXJA 4QX0A 2Y8KA 3GF6A 4MZUA 4Y24A 3ZKUA 3E5UA 5CFCA 1RB8G 2R49A 3HBKA 4SLIA 4QGLA 1Q43A 1XNTA 3A0KA 5FLIA 2WS92 1I6XA 3RNSA 5AFEA 2BRTA 2F17A 2YFUA 4Q1PA 2J1AA 4FBFA 5J09A 1G9DA 4MYEA 4ZONA 4P9LA 3B7MA 1CIYA 1LGBA 3BTAA 1UIKA 3MIGA 2DTYA 4BMBA 2P6HA 2YHJA 2EVXA 3DPRB 4NWWA 5I91A 4DFSA 1ASJ2 4EZ4A 4AW7A 4FPOB 3WF3A 3HBZA 1UOFA 3AFGA 4AZZA 4Q8KA 4DB5A 1NCRB 2EXJA 1COV2 1GP6A 1W0NA 5LA2A 1ND3B 2C9KA 5I0SA 5L7OA 1U5ZA 4XCBA 3AYEA 1PO23 2RS31 2QQWA 4FPYA 4O9GA 1XNDA 2WUHA 5FAXA 3WLUA 3E97A 5FYZA 1XE0A 5DAXA 1RUC1 2BFUS 1RUI2 4NIIA 2JICA 2BQPA 1QNWA 2WNUB 1H30A 2XG3A 3VBHC 4GH4A 4MVTA 2HWC2 3IAPA 2Y6LA 1VLNA 3J9SA 3J7HA 3W21A 4EJRA 3O12A 1K12A 3GHNA 4Q0PA 5IFPA 2QKDA 2VPVA 3K46A 2GZWA 3AZYA 4PDWA 1POQA 2RS11 5K8SA 5IAVA 3J7NA 3FMGA 1PO12 1ASJ3 2VM9A 1OMIA 4F8AA 3BALA 4QPGB 4R52A 4AQ6A 4YARA 1C3HA 2QQOA 3LCPA 2E26A 3M3EA 2RDQA 4BDVB 3SEPA 1GLHA 2LW8A 4IETA 4NHXA 1H1IA 2UURA 2SBAA 1NCQA 3VGIA 5KC6A 1IQAA 2BUKA 3DPRC 4LOTA 4IEYA 1S2EA 2QQMA 2OKXA 5F7UA 1CX1A 2JDPA 2V5DA 1AR73 3J4UH 4AG4A 4BISA 3PDQA 4K6BA 4K3UA 1NCRC 1W06A 2W52A 3HPNA 5DZFA 5BXXA 2VMCA 5C3PA 1ND3C 4JCKA 1WLCA 5FZ4A 5FBZA 5FZKA 2E7TA 4OMDA 4NROA 4X6QB 2CAVA 2UWBA 3E1F1 3MGUA 2XJRA 4UW5A 2D43A 4KGQA 2RS52 2DYCA 2O8QA 3T0BA 1RUJ3 2CDOA 3NV2A 2J42A 3I2GA 4FOVA 4OHVA 5APAA 4CEWA 5JUVA 1D4M3 1TG7A 1V6MA 1XSQA 2WNUC 2R073 2XKOA 2ZOEB 1HQWA 3MHZA 4CXXA 2QVSB 2WYSA 2NP0A 1LCLA 5E88A 2LRPA 1DGRA 1MS9A 1XE7A 1QJU1 3PL0A 1J84A 3AK0A 2IXJA 3VB9A 3KV5A 1R092 2O1QA 2A3WA 2RVAA 2W3JA 1MQTB 2Q1ZB 4GD4A 4UFKA 4X8NA 4QKFA 3AZWA 3FZ3A 4XUPA 5DZEA 1POV0 4BXFA 5E89A 4I3PA 3LWCA 1ZZ7A 1QJY1 2Z69A 1JOJA 3R4SA 4Q26A 2ENRA 4QPGC 1AXZA 3GZAA 4KI5M 2FDIA 4IESA 3V0AB 3ZLIA 2W94A 4QAWA 2VCAA 4YFWA 2F4LA 5JOWA 3S5QA 3OGRA 3U4SA 4FOQA 5T54A 4YZ4A 1QEXA 1WMEA 2RS53 3OG2A 2W47A 5GKAC 1R082 1A8MA 3DYPA 1J58A 5FPUA 2WDBA 4BJ0A 1KFXL 1E5IA 1N1YA 5HCAA 1QNYA 4GIQA 3W58A 5LB6A 5I93A 1ZBE1 2WO2A 3ZXGA 3KGZA 1NY71 2LUWA 1OD5A 2WLQA 4LEJA 4XPVA 4ZU4A 2AENA 2OA2A 1R093 1VAMA 2WO7A 2VMIA 4HSJA 4WM7B 4Y5SA 3TOJA 4D6SA 3KSCA 1UZYA 5H9RA 2BERA 1PM4A 4I0WB 4QX1A 1YFYA 2WFF3 5L73A 1RUH2 3VZMA 3ES4A 1SHWB 2G9FA 4MGSA 5LW9A 5CG8A 1FOD2 1OOPB 3PUSA 1AX2A 1AR82 2VNOA 4GB31 3I2HA 4XMAA 4LXLA 1NKGA 3IMMA 3BTZA 1K5MC 4YG6A 3V56A 3N35A 4BZ4A 3NV1A 1OFSA 4FFIA 5FZLA 1PMIA 3AJZA 5CKQA 2HWD3 3WZ1A 4C0BA 4H3WA 3LSDA 4I3GA 4Q4X1 1DIWA 4IW3A 4MGQA 2RM23 5GM0A 1S4CA 1O3RA 3E5QA 1S0CA 1Z7S3 2QFEA 4IV3C 3K4AA 4JGYB 4GKXA 2O0OA 2WFPA 4FP3A 5FP3A 1CAWB 2UY8A 3U1XA 3MLKA 4P08A 4EN0A 1HQNA 3A7QA 4YW3A 1BEV3 4L9BA 2N7GA 1PGW2 5DQ0A 5GLZA 2DURA 1NLSA 1YRZA 4GWIA 1RUH3 1PM7A 3VL8A 1AR92 5JAXA 5EJ3A 1YEWA 1FOD3 1V9U1 2ADEA 2JE8A 2ZGRA 4YW6A 5A33B 2Y26A 5ACA1 1LHOA 2YV8A 2RJLA 1UYZA 1FXZA 4WM7C 1AZDA 4FCAA 5FUIA 4CDQB 4Z1VA 1RL3A 4ZU7A 2WNVB 3VBFB 4IGPA 2W1QA 3NJYA 4KG8A 1SFYA 5JMOA 5EZWA 3AP4A 2R1DA 2BWCA 1XXNA 2D3PA 1OOPC 3I59A 2Z5WA 4MGZE 4QDRA 4LUMA 1ST8A 2VVEA 5DAVA 3ZDVA 3EBRA 2TNFA 1LAJA 4LLOA 5DUUA 3T2OA 2DVDA 1Y7BA 4QDSA 3VBHA 2P3JA 3M3IA 4Q29A 2WINB 5BNNC 5GLVA 5GLWA 4QX8A 1W9FA 4XZUG 2XJUA 3E6CC 4CCJA 1ULDA 1MZ5A 1W8ZA 5FK8A 4D6RA 1D7PM 4HVRA 4ZY9A 4Y5TA 2ERFA 1VR3A 1W2OA 2EXKA 3T09A 1BMV1 1UU5A 1LGNA 1W9TA 4BQWA 4XW3A 4NIAA 3O1TA 1RJ7A 3D0JA 2JKBA 4UI9L 3H3LA 1KDKA 5KXDA 3PU3A 4HN0A 3WQ0A 2I74A 1VALA 2RG4A 3ILNA 3P3NA 3R0RA 5CFDB 2ZHKA 4JDMA 3DPRA 2YPDA 3LEIA 3I2IA 5A1FA 3I2KA 4LO7A 4NOTA 3T3YA 4CEYB 3AMQA 1C5HA 2Q8EA 3V0BB 2WNVC 3VBFC 3JCIA 2B46X 2JJ6A 2ZHLA 1HN0A 3T1LA 1CGPA 4WM8B 4Z92B 1SLBA 2E7QA 2JKXA 1J3PA 4RGGA 3LPFA 3U11A 4OUMA 2JDYA 5FZOA 3I2OA 3HNYM 1YXWA 4Q4W2 5FQ0A 1HN1A 2WNUA 4XFGA 2XLFA 3ZYHA 3MLLA 3CKHA 1NUKA 5F6LB 1YIPA 3N7JA 3OYWA 1UY3A 4D8MA 2HBUA 3RZJA 4XBQA 4P9GA 2FCTA 2B7YA 4RGKA 1BVP1 2JG8B 4IE0A 4JAAA 1TMF3 5F6KA 2WNEA 3WF0A 3NKGA 3ZXLA 1DP0A 2JENA 3U14A 1NYWA 1Q8VA 1HJFA 1W39A 2PAEA 4QPGA 2ZX1A 4ZS3A 1Y9GA 1SBEA 2DWRA 4IERA 2ZGSA 1H6XA 2RR13 3BIWE 2GNBA 4BE3A 4IEZA 4Q27A 4UFHA 5T3NA 3P1IA 3NJVA 5K7PA 4A3XA 1I5ZA 1LHVA 2A6WA 3ZR6A 1GOGA 5H9QA 1C8M1 1MPXA 4ET7A 3QACA 5CFDC 4K40A 2PLV2 3IMNA 5JOZA 5LY2A 3UKVA 5EFUA 3S7IA 1Q3EA 2JX9A 4U36A 3RZKA 1R1A3 3WF2A 2PN5A 4AOCA 2JDAA 4D7SA 4WM8C 5ISLA 3VDAA 5FP4A 4CTEA 3HIFA 4PLMA 4AI8A 3KGLA 2BDRA 3HQUA 4P9XA 4CE8A 1AR63 1VAKA 5LZ6A 1GBGA 5FYMA 1NT0A 2IXIA 5D21A 1V0AA 4M4PA 1JZ6A 1DBNA 1YNAA 4YPJA 3RYRA 2HLEA 3LEGA 3ZMOA 5FCCA 3KVBA 3AVRA 5DN2A 1SDWA 4Q5OA 3O14A 4NUBA 3GALA 3VN4A 2D7FA 2R041 3H1WA 4E2SA 3WQBA 1K5MA 3WY6A 4XE9A 2RS32 1C1LA 5C70A 3ACIA 4BU2A 1UXZA 2RDSA 4IV1C 3LDKA 3VD4A 3IPVA 1EAH3 1FMD1 3AX4A 4K8FA 4R4XA 5E1RA 5FKCA 3AKTA 4C8DA 1GFF2 5JI9A 4XJZA 5FUPA 4S2FA 2Q1MA 4IV3A 4JGZB 1OHFA 5IHRA 4OHYA 4A7ZA 5CYYA 2WS91 4Q2FA 2DCKA 3KLSA 5FUNA 3ZSEA 4COVA 2EA7A 2J22A 3LE0A 3WSOA 2Z2SB 4M3CB 4XHXA 5A3WA 2BVVA 2R30A 1YWKA 4EQVA 2YU2A 4PLNA 4CXYA 5JPNB 4HK8A 4B3NA 5G05L 4LBQD 5C4WB 1F4AA 2UWAA 2ZGUA 2VJXA 3DF0A 4HPKA 1W3VA 1VB4A 1COV1 1NZIA 1UOGA 5JZGB 4ZZ5A 3SKVA 2WA3A 4WM7A 3IM0A 4J25A 2BWAA 4ASLA 1WCDJ 2R6QA 2RS33 4CXWA 1RGSA 3K75B 4RFT0 1RUI1 1RUC3 4AEJA 3W5NA 1VB2A 1ZZCA 4XJ8A 3AYAA 2GNTA 4CU6A 4YW4A 3BIEA 2CAUA 3ECQA 1S2BA 2VH9A 4QX7A 1UO9A 2HWC1 4LKSA 4O9EA 1GYKA 1VRH1 4LIUA 2FD8A 5C8CB 1X82A 4R4ZA 5LRRA 5BNNA 1G86A 5ABJC 3UYJA 3ZDSA 2VO5A 3N9OA 1O5LA 4K9SA 4EYUA 3LOBA 1ZA7A 2RS13 4XOGA 1PO11 1Y4WA 4JGZC 2CWMA 4AFAA 2VG9A 2E63A 1QWRA 4C1XA 3CDZB 1CAWA 1P8JA 1QJU2 2XL9A 1C28A 3NMBA 4RSUA 3JZVA 1U0AA 1DGWX 1VRBA 3DEMA 1DZQA 3AMHA 3FE5A 5FZ3A 3HT2A 3N9PA 3U37A 1F2NA 1FYUA 1N47A 3IKWA 4AI0A 3LGRA 4J1WA 1S2KA 4A2UA 5M0TA 4OQ8A 3JD71 1KQRA 4HVQA 4K7JA 1OA2A 4LK6A 3TBDA 1PMJX 5A70A 4LO6B 5JZGC 2W1SA 3TWIA 5CFCB 2K2SA 3IWZA 4R9CA 3SXWA 3SISA 2OXBA 3VBFA 4YSFA 4QXKA 3VUOA 3THPA 3E6BA 4OQ9A 1UU6A 2AGSA 5FYYA 5LWBA 4FSJA 3NNJA 2EIDA 3Q8AA 2IZWA 5F2SA 3NL1A 4ES9A 1RITA 2HWF3 2W0XA 3I2FA 2YC2A 5T52A 4TN7A 4Q4Y1 5CKNA 3AKPA 5C8CC 1Y9QA 2C1FA 3M8LA 5L9RA 1HLCA 4P14A 5FY9A 3O1RA 2BPA2 1QY4A 4YGDA 2C5DA 5C7GA 1LOBA 3VBUC 3CF6E 1NX9A 1Q8QA 1QJY3 4N9IA 2W9XA 5CBLA 1HRI1 4BK5A 5FPZA 2YB7A 2OX0A 4GB32 2QQPA 1V6OA 3MPPG 3PUQA 1PX3A 5CEHA 3S57A 3HAGA 3POYA 5FPBA 4GWMA 1UY1A 4FPLA 4COWA 3ELNA 1LHUA 2XOMA 2B45X 1JTZX 1QDCA 1RUNA 1BLZA 1NA1B 1NOVA 5FZBA 4DEVA 1W8NA 3KQ4B 4OHXA 2W1UA 4P00B 1SG3A 3I3MA 2SLIA 3BPZA 1R081 2GN7A 2O8OA 3H50A 4NJ4A 4ORFA 4KBZA 4RHV2 1UOBA 3KCCA 4XBNA 2XQRA 1RXFA 2A1XA 4PDWB 4Q4X2 4E2QA 1BHGA 1W6OB 3WD5A 3WDYA 1OURA 3AYCA 4MADA 2VQAA 2AZ5A 2MNGA 1ZBE3 2BU9A 5FY7A 3HT1A 1EPZA 3RI9A 1RUF1 3DXTA 2EIEA 3S6PA 3WCRA 3V0BA 4XHBA 2ZAHA 1PGSA 1UN1A 1SLCA 3KM5A 4NO4A 4WM8A 1RTVA 4FTBA 1JU3A 2PQSA 1NCQB 4RD7A 2P17A 3PMSA 3N36A 1WW4A 1SLLA 4Y1ZA 2DCJA 2WT1A 4AI9A 5CAZA 5LCWL 1AR81 1V9U2 2BBAA 4LPLA 4GB33 3EYPA 1HQLA 2JG9B 2DU1A 3WNOA 1VP6A 3OTFA 3ZKYA 5ACA2 5LEJA 5F5AA 4UT5A 4Q0QA 3MIHA 2LS6A 2D3RA 2WZPP 2DDUA 4E2GA 5ANNA 3TEZA 1JU4A 2ZA9A 4DUXA 4Q4X3 2JE7A 5E16A 3VDDB 2XJSA 5IK7A 1O3TA 3AVSA 4IV1A 2IFRA 5IATA 2OPWA 3FUQA 3RZLA 1UYXA 4NIDA 2DTWA 4CU7A 5EP9A 4AEKA 1NA1C 3MBWA 1O8PA 3DKWA 5C71A 2YPJA 3SH4A 1L3JA 1EY2A 4EWEA 1MS0A 1J3RA 2BP6A 5BPXA 4R8HA 4BLJA 1O7FA 3UGGA 5ANQA 4F83A 1A8DA 1AR91 4YG0A 2OT7A 1HRV3 4G9SB 4HONA 2D93A 4XQ4A 1V9U3 4YZ1A 5FXWA 3RZGA 3B93A 1S0BA 2GP5A 4NHKA 3JQWA 1TEIA 5FTTC 1JMUB 4DXRA 5FV3A 1IOAA 1S55A 2JE9A 1A34A 3SKJE 1DQ6A 2BNNA 2VZTA 2Z42A 4NAMA 2YROA 4C90A 1HDKA 4XC9A 3OGJA 5FZAA 4B1LA 1GZWB 2J7MA 2JG9C 1O4YA 2VTFA 3WQ1A 1CPNA 3Q8EA 1OPOA 4F3JA 1M06G 1Z78A 5J3UA 4Y26A 1BK1A 2JDUA 1ZRCA 1AYN3 1JBCA 5BY5A 5LA0A 1G6NA 1KD7A 1QJEA 2ILMA 2VXJA 4YVWB 5LK7B 4TTGA 4TLGA 4MHRA 3VDDC 3MW4A 1C5IA 1O4ZA 5IUQA 3UKTA 3POIA 1CD3G 5ABJA 4HMZA 1UIJA 1LESA 5HCHA 1D4VB 3WNKA 3N9MA 1GMMA 4HG6B 4NR1A 4QT6A 5FYCA 4WV8A 4JGZA 2VGDA 4O7XA 4UBGA 1M4WA 2MPFA 4HETA 2HYXA 3B00A 2IFWA 3BOPA 4NWVA 4A7YA 5JDBA 2PHWA 1V6KA 4LBQB 5IK4A 2G9ZA 4BQ3A 2A3XA 4HLTA 3TEYA 2XL7A 4M3CA 4GZ9A 2VBBA 4LBNA 3ZN5A 3OGGA 3KCXA 2RJ2A 4B4PA 1AXYA 5F37A 2ZGMA 2E31A 1MACA 4N7IA 4PIYA 4BH9A 2J1TA 3GBGA 1HIXA 3HNBM 4KWKA 4LBJA 5FMOS 3BPSA 3URFA 1UZVA 3WUDA 5ERLA 5J36A 5JZGA 5FYBA 3SNMA 1APNA 1HB1A 4FP2A 1E5HA 3B5LB 3QLQA 5FZHA 3POWA 2V73A 2VZSA 2FMYA 1PZ8A 2EIBA 1ZRRA 4J1XA 4Q4W1 3LA3A 4NHLA 2PYTA 4M0NA 2W95A 4HXCA 2DVBA 3GZTB 5EQUA 3CJIA 5C8CA 4YRDA 2GSYA 3Q8CA 4YVWC 3AFKA 3VZNA 2XPJA 2PHXA 2CGPA 5FIXA 1ULEA 4AL9A 3THDA 2IVIB 1V70A 2I45A 1CZTA 3VBUA 3WF1A 4AHWA 4BA6A 1SEFA 3ZYBA 5E8AA 3IDBB 4BQ2A 1SQ4A 3MUY1 3R6SA 4RL7A 1LECA 1GV9A 3K3OA 1CAUB 3DXUA 4XFFA 2B8MA 3M1HA 5FYTA 4IE7A 1OLQA 1W6QB 1UY0A 1AX1A 1PNGA 2D97A 2H0BA 2ZACA 1RIRA 3IZOA 1C8M3 2EF6A 5FZ9A 5C3SA 5JIAA 2BJSA 2HBTA 5EWSA 3U75A 3ZFFA 2ZTNA 3ILRA 1NZCA 3AB0A 5B4XA 4CP9B 1FMD2 2YXSA 4COYA 3WP6A 1KJLA 1LU1A 3CLPA 1XNBA 1GNHA 3WDXA 1WMDA 3WP3A 2ZEWA 1J83A 2B42B 4E27A 4MGTA 3CEWA 5A3PA 2GH8A 2VNVA 3JXSA 1F31A 2HEVF 2B4KA 2E51A 4N7UA 4XDQA 5FMCA 4B8EA 3S5AA 4OZOA 2ZGQA 3SLIA 4XIKA 1F4HA 4M0HA 4L8QA 5FZMA 3SHRA 1US3A 2OUHA 3GHMA 3H3ZA 3AP5A 4BK4A 1RUG1 1MVEA 2R043 2E32A 2VUAA 2HWB2 3N7MA 2G1MA 4EV0A 2D6MA 3VHOA 1G9AA 2ZEXA 2F6BA 1W99A 3ZXDA 3ST7A 3HR9A 3GNEA 4S2HA 3ZXAC 2IXKA 5FZOB 2VMFA 2GMPA 1FMD3 4MXWB 4DEQA 2YC4A 2BGPA 5FQ0B 2ATFA 1E5RA 3FL7A 3A4UA 3KD4A 4QPIB 2GAUA 4FPCA 4BWOA 4WVMA 2RMU1 4XUNA 1VRH2 1HB3A 5I8TA 2WS93 2XBO2 4D7YA 4LBLA 4LE3A 1NA1A 2OZJA 1G9FA 2ZGLA 3OYWB 1URXA 1ZZ6A 1C8NA 2ORZA 5CG9A 3NV4A 3BUCA 4W6WA 2FMDA 2XQXA 1ENXA 1W6OA 1YJKA 2WWUA 2ZABA 3KT7A 2WZR1 5T5LA 1DF0A 3JBG1 3UJQA 3T4HB 2E33A 1COV3 1GP4A 3A23A 4AFDA 3UJOA 1XNKA 1JUIA 3B69A 3MDPA 2XGXA 2XHKA 1OXCA 4SBVA 4ONUA 5A7QA 5FOBB 1RUI3 4DIQA 1UU4A 2CGOA 4Z8BA 3KQRA 3JD72 3WNMA 2JG9A 2PAMA 4KGGA 1AL0G 3WT3A 3RQ0A 2AEYA 2HWC3 1SMVA 1VBB1 4GA9A 1VRH3 4UFMA 5DAWA 5A80A 4YZ2A 1W8HA 2PMWB 1OD3A 5K0UB 5DUVA 1QXPA 2QTWB 2QDNA 5LA9A 4B4QA 3OPZA 1FV3A 3VDDA 3WCSA 4QPIC 1PO13 1W9WA 3HNMA 1V6IA 2VQUA 2OW4A 4D94A 4E9KA 3R4DB 4Q4Y2 3ATGA 2HWE1 4KWLA 2K0GA 4FTEA 4CP1A 5A1LA 5IYYA 1K5MB 1QU0A 3MI8A 3VKOA 2ZMKA 2KM2A 2GNDA 4AI1A 3RFRA 5B2GB 2VOXA 1VE0A 5I0DA 1GKBA 2W92A 3O1VA 4XF0A 2EXIA 4YVSB 1F8VA 1HRI2 3IPVB 2PAKA 5JOXA 3JD73 3GDBA 3VBRB 4MH0E 2C6SA 4IV3B 2NYYA 4ISQA 1GZTA 4PCRA 2Q30A 4OHWA 5A7PA 1CAXB 2OQ7A 3ZR5A 3K3NA 2PHRA 4UW3A 5BNPB 1F35A 3MV01 4XFAA 2Q1FA 3UETA 5C5TA 1PVC2 1JOBA 3IT8A 5T55A 2QQLA 3I97A 5HXVA 1KRIA 3GJAA 2WYFA 5FPAA 1GZWA 2FDHA 3NNGA 4QD2A 3WNXA 4AGVA 2DVFA 4KWUA 1AYM1 1F9KA 1GUIA 2AC1A 2BV4A 2WZ8A 4Q4Y3 1RUF2 4HPKB 2XJPA 5K0UC 1RVF1 3P5BA 4A6SA 4YVWA 1GP5A 3D8CA 3MIDA 1AL21 3NKTA 2GMMA 2Y38A 1Q56A 1TNRA 1NXD1 1SFNA 3ME2A 2Q8DA 3H1MA 2V4AA 5KXEA 5FP8A 1K5JA 5IVFA 1WCQA 3D6EA 4V1PA 1KITA 1N1VA 1U5IA 1UMHA 3DN7A 1CAVA 1Y43B 3PU8A 5A7OA 5EJ1B 4LBQA 5EHDA 5BNNB 2FQPA 3RWKX 3LB9A 1WBFA 4H55A 4RHV1 4MXVA 1CONA 3TNPB 1R083 2WZEA 1XYPA 3CQOA 3AMPA 3PNAA 4YVSC 3RJRA 3C7EA 3RWNA 4GJZA 3LA7A 1LHWA 4GXLA 3VBRC 1ULPA 5BNQA 4NN0A 4XQDA 3VD9A 1H6YA 1AVBA 3D82A 3G6JB 3WX5A 4OULA 4LR4A 1RUF3 2FDGA 3TEWA 4BPZA 2W46A 4O65A 5LATA 2LM3A 2RJKA 4YGBA 1W05A 3C3VA 5BNPC 1JYIA 1NE4A 4GALA 4CUCA 3PJQA 3POJA 4QQPA 4X8PA 4JC1A 1AR83 1LGCA 3MUZ1 3NNLA 4D69A 2Y0IA 4L99A 3S7EA 1JODA 3FX3A 2DU0A 1S0GA 2PFWA 3K77A 4EWAA 4MUVA 1ZRFA 4QKDA 3POFA 4CSWA 3ZYJB 4FOYA 3QBQA 3ZFEB 3T08A 1WWYA 2DBIA 1REDA 4IE5A 4DS0A 1S1AA 1ZM1A 3DL3A 4P9JA 2X8KA 2YBSA 4K1YA 1CAUA 2RDNA 3AKRA 2DFCA 2YBKA 5A7SA 2BZDA 3IDAA 2A70A 1LRHA 4BOWA 1MVQA 1W6QA 3MFCA 4NAOA 4LBMA 5FREA 3NRUA 2VC9A 4Y20A 3OB8A 4KWJA 2ZMNA 3KV4A 3SMHA 2NLRA 3VD5A 3WNLA 1AR93 3H7YA 3B01A 2VZ3A 3NAPB 1IG0A 5FXZA 5I8SA 4CP9A 3LZZA 3ZPOA 1FX5A 5FZ8A 4Q0SA 2IUWA 1UXXX 3SEEA 1OKOA 2A6VA 4HSLA 5FPVA 3BN6A 4CDWC 3NWKA 4GJYA 3ES1A 1L7QA 3TYJA 1W9YA 1LKNA 2YUEA 5KXCA 1GNYA 1IPSA 1ENQA 3HQXA 4W4ZA 1UW8A 2JDNA 1IG3A 3LPGA 4QHOA 4CDUC 4QB6A 4Y4RA 1OVSA 1OFNA 2WO1A 4RS5C 2CYFA 2BFUL 5AC92 1ZRIA 4AAXA 5A32B 2K9ZA 2WSVA 2XDVA 3RDIA 2UYBA 4E4DX 4Y22A 2WWSA 2D3SA 2WAOA 3EJKA 2FCVA 1DCSA 1BBT1 5FBJA 3ZFEC 5AVPA 4WVVA 1NQDA 1W28A 3J7MA 3LQCA 1T6BX 5KR7A 4DRRA 3USUA 2R0HA 2ZKLA 4XABA 2O14A 3WG4A 4MXWA 1NXMA 1RYYA 4K20A 4HT1T 4QPIA 4AVCA 1NLRA 2A5ZA 4JTOA 2OQ6A 1LODA 1YUDA 4OMCA 5FWEA 2R0FA 3WVJA 3ZIXA 4BB3A 1ZZ9A 4GMP1 5T5PA 1FPN1 3FN9A 2OIIA 2NZ9A 2WJSA 3TAYA 1S0IA 4KH9A 1ZRDA 3NAPC 4RQPB 2DBNA 3WEZA 3FLRA 3WW1A 1WKYA 1X9PA 4BIFA 3EO6A 3C8XA 4XTMA 3ZSLA 4IV1B 2J1RA 1I3HA 1MR5A 4AHXA 2WQ4A 1GOFA 3RRDA 3OUHA 5HV4A 1G9CA 3J8F1 3USSA 2YGMA 2CGNA 1O8SA 1SBDA 2AYHA 3M7AA 1LOCA 3I54A 4Y1XA 4KBBA 3HN1A 2VZUA 4P5YA 3ZFGA 3OBZA 1VBD1 1RUD1 3AP7A 5CVRA 5C8WA 4UOJA 2UU8A 4IEOA 5IW0A 5HV0A 3R4UA 2V5YA 4QKBA 2FDKA 4LIVA 4LKFA 4Q4W3 1CX4A 1ZNPA 1YQ2A 2PHUA 3AJYA 2BOJA 1TNFA 4NE9A 5FDBA 1QMJA 4LOSA 4AFMA 1WA4A 2ZX3A 1PX4A 1S0DA 3GYDA 5K0UA 1JOPA 1ULCA 1XBFA 2J1SA 4HKLA 2D5FA 2IC1A 3SCFA 1IS5A 3IAQA 1C1FA 4C1WA 4OVEA 2VMHA 4XJUA 4LHNA 2X09A 3UT0A 3OPTA 1JYNA 1KDMA 4PHZA 3LDRA 1AJKA 3I3EA 3MO4A 4LO4B 1UYPA 4QM9A 1EV12 1YFUA 2D40A 3PVEA 1KXGA 1KS4A 1RUG2 1OQEA 3U78A 4RQPC 5CU1A 1ZBA1 1UY2A 4I01A 3HMYA 5FZDA 3TB0A 5KHIA 2YGLA 1HKDA 2PLV3 3WUCA 3HN3A 5ABJB 2ZBJA 4YVSA 1QJZA 4HBNA 1LOEA 3VBRA 4QXHA 4QPWA 4XF1A 2CY6A 4R9BA 4XXPA 4CU9A 2HJIA 1S0FA 4QB1A 3WG1A 1G8WA 1WMXA 4P5HA 2RMU2 3HQRA 4GKYA 1CAXA 4Z07A 4O61A 5LEKA 2VTXA 4YGEA 5FPLA 5BNPA 1ULOA 4QKNA 2ZGTA 3I4IA 1GQPA 1J59A 1REFA 2C4XA 4AHYA 4AQ2A 1OQDA 4MG2A 4JRAA 5J48A 4UFJA 5JR7B 1S0EA 4BQ4A 4CCEA 1ALYA 5A6ZA 2ZKNA 1CJDA 2C24A 2WZR2 2AR6A 3RMYA 2Q8OA 1MZFA 4BXSV 3AP9A 3JBG2 2GN3A 2ET1A 5FZCA 5KHJA 1EP0A 5J1XA 3FHAA 3MF9A 1YQ6A 3OSDA 1RUG3 2HWB1 5F8PA 3ZIWA 4CPBA 2XONA 4AVVA 5IJRA 2VOVA 1Q5OA 3N3HA 2GC1A 1H4HA 3MPBA 3QCWA 4L0PA 3AKSA 3RZMA 2ZX4A 4AEDB 4AVBA 5JSOA 3PTYA 2J1EA 3DECA 5IFTA 1BK0A 1LHNA 3CJIB 1DQ4A 3ETQA 3W5MA 2RMU3 4AFBA 1VBB2 2XBO1 4C0HA 1JZ8A 2OZ6A 4QQLA 3VZOA 3I2JA 2BVBA 4M4RA 2R32A 3FWEA 2YBPA 1VBC2 5FMBA 3T2TA 2X29A 3ACHA 3VBUB 3CL1A 1EYBA 1T6GC 2AACA 3EHKA 3LFMA 2QQUA 1O3SA 1JHNA 3FUOA 5FY5A 2WZR3 1OVPA 3PUIA 5DABA 1MZ6A 1HV0A 3JBG3 5FR3A 4QWNA 1MS4A 2HWE2 3H3UA 3O1UA 4Y1UA 5DAPA 1PZ9A 3NSTA 3OY8B 2WNOA 4CDWA 5EIYB 5KBFA 4ES8A 1POV1 4CYDA 1YLLA 3BTXA 5DDJ1 5FYUA 3ZFFB 2Y60A 4QQHA 5T5JA 1GNZA 5FK7A 4CDUA 1DYOA 2RHPA 1RUJ1 3FHIB 3MF6A 3S0MA 4PI0A 4QPYA 1BJQA 2C26A 3HJRA 4RS5A 1RUE2 4XAEA 5EV7A 3UV9A 4GQ7A 5C33A 1ODMA 1TZOA 1VBB3 2VECA 1SLIA 4DXZA 4PF5A 4LBOA 3I3QA 3OD0A 1B35B 3AMMA 4JX0A 5A3UA 3ZFEA 1WUVA 4QDQA 4AHZA 4FFFA 3T0DA 5FY4A 4AEDC 1ZX5A 1QH7A 2VZRA 3ORJA 1BKZA 1TME2 4MGIE 5EYXA 1YJLA 3WNPA 5JSRA 3CJIC 3O1OA 1AYM2 1H8VA 1QJU3 2HWE3 3ZYPA 2RE9A 4UFLA 4LA3A 4N53A 1RVF2 2VAUA 5HCFA 1YYNA 4GWNA 1ZVFA 5FP9A 2VCCA 2FHRA 2W39A 1AL22 2WBKA 3IDEA 1X9TA 3NAPA 4FI9A 2XHNA 4AQTA 3LKJA 1ENSA 1UKGA 4EE2A 3VDBA 5JXGA 3H8RA 1DQ0A 2L9LA 2YZ4A 1D0HA 3WW4A 2A71A 5HXMA 2Y64A 1Q8OA 3I8TA 4XUTA 4I2OA 4WVMB 3N7LA 4LE4A 3PUAA 3VBOC 5JXJA 1UL9A 1JI6A 1H2MA 2A73B 2WC2A 1ZZ8A 2W2IA 2G9GA 2VCMA 2JDMA 2E7AA 4XF9A 4E4HA 1PVC1 3ZFFC 2XB6C 3WR0A 2HEYF 4CCNA 3CIHA 2VNRA 3PMEA 4YM0A 4JZRA 5FYVA 4JTNA 1VMJA 2GMEA 2WFF1 4DINB 2HH9A 3BU7A 3UESA 1HB2A 1RHI2 2W87A 4AWDA 5A32A 1XC6A 4IE4A 1XB9A 3VHNA 2VCBA 4YW2A 1YQCA 3A0NA 3ZVXA 4WBBA 2PHLA 1B35C 1RVF3 1OLMA 2X53S 1X33A 3MYXA 4IGOA 4FAHA 2XVLA 1AL23 3GBWA 5FZEA 1CESA 1W0PA 4RGAA 4AVSA 3AYDA 1TVGA 2Y6JA 3IIAA 2HWD1 3IIIA 3ZSJA 1HXS1 2GC0A 3O1PA 1W8OA 2FDFA 2P34A 4FT8A 2YG0A 1BQPA 3ALQA 4DQAA 1LJ7A 2ORXA 3HD8B 1GWLA 1WW5A 4RHV3 1RXGA 2Q4SA 3OJBA 3Q8BA 4OLLA 4RQPA 5F2WA 2OYZA 3SITA 3VHRA 1W8TA 4BYYA 1K42A 2BW8A 5DUXA 5AVAA 1O91A 5F39A 3BTYA 5FXVA 4TWTA 5I0UA 1WLWA 4JHZA 2W08A 2Y6GA 2NQYA 1QQP2 2Y33A 1OLME 2F4PA 1T2XA 1OH3A 1UKRA 2QQVA 2PTMA 3O1SA 2VW0A 3P3PA 4Y5Z0 4DXSA 4PBOA 2DCTA 4H14A 4JKLA 4XJ9A 1JZ3A 1GSLA 5KHKA 4LBKA 1LEDA 5I0TA 3I2DA 4LHLA 1JXNA 4XACA 5FXXA 4RFRB 4XMIA 3KB5A 5ACA3 5LY1A 1LB2A 3OUIA 3FFQA 2CU5A 5GZDA 5BUVA 2YY1A 4P02B 5FYSA 4YYOA 1GR3A 4LO8A 5J37A 1RMU2 4FTSA 1DQ2A 1UMIA 1MEC1 3WXPA 4A42A 1UD1A 2DF7A 1IZ3A 5D1IA 1W2AX 3OOXA 1US2A 4BLIA 2WQ8A 3WW3A 3AZXA 1MS1A 5A3MA 1BYHA 4NIHA 1BBT2 3W20A 4Q4V1 3MICA 4AGRA 3T2PA 3BODA 4IXLA 4YW5A 1BVVA 1VAVA 2PELA 4R9DA 5FZ7A 1HX6A 3WW2A 2NM1A 5IVEA 5JOYA 4A6OA 3ZN6A 1G9BA 2QZ2A 3E6DA 1YO8A 3C7FA 2ADDA 3VKMA 2ZEYA 3KZ4C 4A44A 1CAVB 2VNGA 3SQOA 4B7EA 1S0JA 1CR7A 1FPN2 5FZFA 1D2SA 3SC7X 2ET7A 4L11A 3NO8A 4CCKA 1WCKA 2JECA 5IK8A 4MLOA 5FPXA 3IB3A 1X50A 4XQWA 2P3KA 5AC91 2QJVA 3PJYA 4JVAA 4DUWA 5D8AB 2VZOA 3J8F2 4N43C 4QU2A 5GZFA 3EXUA 4DY3A 1SPPA 4IL7A 2ARAA 5CZKA 2X05A 1BBT3 5IVBA 4XBLA 3AL5A 2P1BA 4I0AA 2HYKA 3E5XA 4JRLA 4NPLA 1VBD2 1RUD2 3ZYFA 4LQRA 3VD3A 5A3NA 5C3RA 2UY9A 3ASIA 2NN8A 2IXLA 3OD4A 4Q0VA 4NMIA 2JD9A 1WBLA 3POGA 4P9YA 3TEXA 4AEDA 4ZKTB 4HKWA 1TMF1 3O5SA 4ATEA 2JB4A 4RR3C 2X5IB 5EJZB 4QU1A 1ZYBA 3KMHA 4FFHA 3VZJA 3U0ZA 5C6CA 3LDBA 1GWMA 3LD8A 2MEV1 4GMP3 2I2SA 3EMRA 3ETPA 1F5FA 2BOIA 4IUGA 2RV9A 4EN8B 3ZO0B 4WZFA 1X7NA 3GM8A 5FZGA 4HFSA 3CO2A 4KG0A 4COUA 3I3BA 4RYDA 2OUJA 4W65A 4AF9A 2XLAA 3KV9A 1GOHA 3TN92 1JZ5A 4IEWA 2X10A 3AXDA 3KS7A 5L9VA 1H0BA 3ILFA 4BQXA 2A7AA 3J8F3 4XFHA 4LITA 1KS5A 3OY8A 1YQ5A 5FRAA 3VBOA 3QH6A 2VZPA 4ASMB 1W6PA 4A4AA 1ZBA2 4Y20B 1VBA1 3C7OA 5A6YA 3AMNA 2ZPXA 1MS8A 1RUD3 1VBD3 4XURA 1V6JA 4MX3A 4AXOA 1JZ2A 4L97A 1C57A 5BNOA 2QUOA 4LLFA 4YGCA 5FJHA 5JPMB 5D8AC 1TE1B 1UX6A 4HN1A 2WA4A 2ZGNA 4PJYA 2WN3A 2FZ2A 3LIHA 1OA3A 1SZBA 3VDCA 1O3QA 1KFUL 5EYYA 5DXDA 1XU1A 2WR9A 1B35A 3VKNA 1UY4A 3MV11 4KQ7A 3B3QE 4MOAA 1PO22 1ACCA 1DFQA 1FNYA 1HB4A 4QQOA 3L9JT 2X5IC 4JHTA 3WDVA 3JUUA 3AL6A 3MIEA 4AGGA 4UWDA 1DGWA 3M3OA 5DUWA 3ZOIA 1EV11 5KHHA 1A3KA 3NW4A 4Y22B 5CIRA 1UX7A 4LJHA 1ZBA3 5IVVA 2P3YA 2BYVE 4NRMA 4P9WA 3OF1A 5A7WA 1FI2A 3JU9A 3USUB 3I7DA 1UZ0A 3MEPA 2BGOA 3CNAA 4S2DA 1K3IA 3ZXEA 1K45A 4FQ4A 2A75A 1RC6A 3GCWA 4B7KA 1VJ2A 5F5CA 4I0BA 2JD4A 3FFZA 1DDLA 1ND2C 2DUQA 1IQDC 4M3CF 5SV8A 1KJRA 4LKEA 3Q9OA 4K1ZA 3ACFA 1DG6A 1LU2A 4XDPA 4ITCA 5LBCA 3LAGA 4QMAA 2H6CA 2VW1A 4XFCA 1IS4A 2AEZA 4QHBA 1H4GA 1AR72 3RS6A 3SH5A 3ZN4A 4CU8A 4Z2WA 2HWB3 1OLRA 3OBAA 2EXHA 1JYCA 3N9LA 1JS9A 1PIV1 3ZFGB 1W90A 4UF0B 5DDJ2 3MFAA 1JZ7A 2CL2A 1AUYA 1QOOA 2ZJCA 1N3OA 2Y34A 2ZZQA 1E57A 1QOSA 1RUJ2 3GZUC 3HEIA 4M00A 1D4M2 3VBSB 4ZS2A 1WMFA 1QF3A 2R072 4XZPA 2XBO3 2ZXQA 4QGNA 3TNQA 5IK5A 3THCA 1QJX1 2Q5TA 3M3QA 4W8JA 1GU3A 3FBMA 1VBC1 1W3XA 3HVDA 2XR4A 4LUKA 2CV6A 5JMCA 1FATA 3WF4A 2VQ0A 2JDKA 4IGQA 5A3TA 2VU9A 4XUOA 3B9CA 3GCXA 4QGMA 2TUNA 2W91A 1QGLA 1ULFA 3LA2A 3DCQA 3PVBB 4HVOA 3WG2A 1POV3 1DZRA 1BXHA 2A6YA 3F95A 4UXAA 2WAAA 3Q8FA 5DDJ3 3I49A 5GALA 3UL2A 1AJOA 1PHMA 3IDCB 2B5HA 5HPOA 4CDXB 4MV2A 2C0ZA 4A41A 2VULA 1FT9A 3N9NA 3TRSB 1XYOA 4OUSA 1RUE1 5JR2A 1W8WA 5A3LA 1WA6X 3FLPA 4FOWA 4LKDA 4HOOA 5GZGA 2HWF1 2H6BA 2PHFA 3LOIA 4UYBA 4LNVA 4W6YA 2XJVA 4EN7B 4N43A 3ZFGC 3AZVA 2ZX2A 4V2VA 2BNOA 1OQ1A 2VUCA 2ZCWA 4HZFA 4BM8A 4GWJA 1H9WA 1TME1 4ZXEA 1OPMA 5IWFA 2FDJA 1LEMA 4XXAA 4PBPA 4HK9A 1GANA 3T30A 2WFF2 4R9AA 1LOAA 3VBSC 1W03A 3WDWA 2VZ1A 2Q0AA 4DXTA 2BTVC 4RR3A 1EPWA 3PLQA 4XAAA 3RVHA 3VZKA 3M70A 5EPAA 3LEKA 3OUJA 3ZYIB 2KA3A 1ULGA 2VD7A 5DG2A 2PA7A 3KT1A 2WABA 2VL4A 3QH7A 1GICA 2EAKA 4ZZ8A 1HRI3 3O7OA 4AI3A 1I5PA 3WG3A 3C7GA 2HWD2 2ETEA 1OH4A 2A6ZA 2WL1A 1QKQA 1HXS2 3MIFA 4BHPA 5GZCA 2RM22 5FMOL 3CBNA 4AQSA 1Z7S2 4XFIA 1QOTA 4I09A 2VMEA 2VZQA 4NRPA 1HV1A 2IXCA 3D4KA 1GZ9A 2V72A 5FLHA 2CHHA 3BOWA 1LENA 1PVC3 2W5FA 3POSA 4NVPA 4Z2AA 2BGCA 2VMDA 4IEXA 4OYUA 3WV6A 1BEV2 4CDXC 3EB7A 4NPMA 1WLDA 3H42B 2JWPA 5H9SA 3T1MA 5FOJB 1RHI1 5T50A 5L36A 1NE6A 3ON7A 5D8AA 2XUMA 5A6QA 3WINE 4G4FA 4JV4A 3KHCA 1BCXA 4LMFA 1UCXA 3AP6A 3EQEA 3F2ZA 5FP7A 4AEMA 4CDWB 4EWDA 3NNFA 3ENRA 3SH3A 1MQTC 2PHDA 3BB6A 5H9PA
chains in the Genus database with same CATH topology
4OCTA 3BU0A 4ZHNA 4O61A 3BIEA 2IUWA 3I49A 3I2OA 2FD8A 4IE7A 4QKNA 4IE4A 4IE6A 3O1VA 4NPLA 4MG2A 4ZS2A 3RZLA 4NIDA 4QHOA 4NRQA 3RZJA 5F8PA 4IE0A 3BTZA 4NIIA 3BKZA 4MGTA 3O1PA 2FDFA 3RZHA 4ZS3A 2FDHA 3RZMA 3RZGA 3BTYA 3RZKA 3LFMA 3O1SA 5DABA 3O1MA 3O1UA 3O1RA 2FDJA 4RFRB 3BTXA 3KHBA 3S5AA 3H8OA 3BUCA 2FDGA 4NROA 4JHTA 4O7XA 4QKBA 2FDKA 3I3QA 3T4VA 3S57A 3T4HB 4CXXA 4NRMA 3I3MA 4NJ4A 4NIHA 3O1OA 4NRPA 4QKFA 3H8XA 4QKDA 3BI3A 4NPMA 4CXYA 4IE5A 3O1TA 2FDIA 4IDZA 3H8RA 3KHCA 4NIGA 3T3YA 4CXWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OCT A;  3BU0 A;  4ZHN A;  4O61 A;  3BIE A;  2IUW A;  3I49 A;  3I2O A;  2FD8 A;  4IE7 A;  4QKN A;  4IE4 A;  4IE6 A;  3O1V A;  4NPL A;  4MG2 A;  4ZS2 A;  3RZL A;  4NID A;  4QHO A;  4NRQ A;  3RZJ A;  5F8P A;  4IE0 A;  3BTZ A;  4NII A;  3BKZ A;  4MGT A;  3O1P A;  2FDF A;  3RZH A;  4ZS3 A;  2FDH A;  3RZM A;  3RZG A;  3BTY A;  3RZK A;  3LFM A;  3O1S A;  5DAB A;  3O1M A;  3O1U A;  3O1R A;  2FDJ A;  4RFR B;  3BTX A;  3KHB A;  3S5A A;  3H8O A;  3BUC A;  2FDG A;  4NRO A;  4JHT A;  4O7X A;  4QKB A;  2FDK A;  3I3Q A;  3T4V A;  3S57 A;  3T4H B;  4CXX A;  4NRM A;  3I3M A;  4NJ4 A;  4NIH A;  3O1O A;  4NRP A;  4QKF A;  3H8X A;  4QKD A;  3BI3 A;  4NPM A;  4CXY A;  4IE5 A;  3O1T A;  2FDI A;  4IDZ A;  3H8R A;  3KHC A;  4NIG A;  3T3Y A;  4CXW A; 
#chains in the Genus database with same CATH topology
 3L2Y A;  4X6R B;  3WNN A;  1XPW A;  2EIC A;  4EN9 B;  5HCB A;  4PIZ A;  5IVY A;  5TSW A;  4CDU B;  2DUP A;  4Z82 A;  4ZHN A;  3WP5 A;  5J98 B;  4HL0 A;  1HXS 3;  1F5J A;  1JN2 P;  2X5I A;  2I07 B;  3JQX A;  3P6B A;  4IEP A;  4RS5 B;  3ZX7 A;  3VZL A;  4BQ5 A;  2G19 A;  2ARB A;  4IE6 A;  2Q8C A;  2YYO A;  2GP3 A;  4XEZ A;  5JXH A;  2YMZ A;  1B09 A;  3M2M A;  4QB2 A;  2VBD A;  2YDE A;  5A1A A;  1MEC 2;  3SCH A;  4CUG A;  4A7K A;  1PK6 B;  3IN9 A;  1SAC A;  1W04 A;  1UWW A;  1XE8 A;  2VZV A;  2TBV A;  2WO3 A;  1HRV 1;  4XF4 A;  1Y9M A;  4I30 A;  1QQP 1;  2PHT A;  4DZG A;  4XIO A;  5J7M A;  4PT6 A;  1YQ8 A;  2R7E B;  1LR5 A;  1PGL 2;  4N53 B;  3CMG A;  3APB A;  1HW5 A;  3PIG A;  2DV9 A;  4Q4V 2;  3O0V A;  4E4Z A;  2D44 A;  2C9A A;  4CVU A;  3LF7 A;  5IAX A;  2XVG A;  2R06 1;  5GLU A;  2YU1 A;  5F3E A;  4MSV A;  1H2L A;  1ND2 A;  2ZAA A;  4Y3O A;  1W6N B;  4BQ1 A;  1SBF A;  2P2K A;  4UW4 A;  2XLG A;  4A3Z A;  3RMX A;  1SFP A;  1JH5 A;  1W6M B;  5LBB A;  5FO7 B;  3WQ7 A;  1F15 A;  4JQT A;  2GU9 A;  2VBP A;  4JQR A;  3BYW A;  1H1M A;  3AZZ A;  5JSP A;  1RMU 1;  1AYN 1;  1E5S A;  1FNZ A;  3GJB A;  4S2G A;  4NHM A;  4MET A;  4U2A A;  5GJ6 A;  1MEC 3;  1CWP A;  3OGV A;  1OC1 A;  3DV8 A;  3FHQ A;  3OGS A;  1NQJ A;  3NJX A;  2B9V A;  4ZPI A;  3RJ2 X;  3W9A A;  2ZHN A;  4AK3 A;  3DGT A;  4JGY C;  4WVZ A;  1LOF C;  3UKN A;  3AXE A;  2QE3 A;  2JIJ A;  1GQG A;  4ZU5 A;  5I0R A;  4YZ5 A;  2WQZ C;  1VMF A;  3B94 A;  5F9T A;  1PMH X;  1DLC A;  4Q4V 3;  5F5Q A;  1JYX A;  2A3Y A;  2OVU A;  1V00 A;  4OHZ A;  5GLT A;  3VD7 A;  4D0Q A;  1DYK A;  1PK6 C;  5FZI A;  5K4L A;  1REE A;  1X8E A;  1TMF 2;  3BVC A;  5LBE A;  3ACL A;  3NNM A;  4N53 C;  4QXB A;  4AE2 A;  3L2H A;  2B39 A;  2YC0 A;  4AI2 A;  5FKB A;  4RN5 A;  5FWJ A;  2VXR A;  2MEV 2;  4CDQ C;  2J1U A;  3ITQ A;  3M4F A;  1NCR A;  2RR1 2;  5FO8 B;  1ND3 A;  1WCU A;  1DLL A;  1MS5 A;  1VBE 1;  1XRU A;  1L7R A;  1J3Q A;  1O6U A;  5E6H A;  3MIB A;  1OF3 A;  1PNF A;  1OT5 A;  2PXJ A;  2VVD A;  3KF3 A;  2P5B A;  1DHK B;  3CU7 A;  3K51 A;  4FPG A;  4XCA A;  3RZZ A;  3WHT A;  4FPE A;  4BCU A;  3NVC A;  4CUA A;  2R16 A;  3ZXK A;  2VY0 A;  3C7H A;  1R1A 2;  4KMQ A;  4XJW A;  5JLV A;  1A6C A;  5C3Q A;  4URT A;  1XQN A;  5A6X A;  1W2U A;  5KHG A;  1OBN A;  2D6K A;  1VBA 2;  4EZH A;  4UF0 A;  4JDO A;  3WP4 A;  4LA2 A;  3OPW A;  2FCU A;  1Y3T A;  2GDF A;  2D6N A;  2GC3 A;  5F5I A;  2DVG A;  4UW6 A;  1AR6 2;  2VUJ A;  4I02 A;  1V6N A;  4KU7 A;  2D5H A;  2W1W A;  4OCT A;  3VBS A;  4KNC A;  3BU0 A;  5JXI A;  5A7N A;  4AVA A;  1EUT A;  5HI0 A;  4DOU A;  2DUO A;  2MEV 3;  2WRA A;  3HOB A;  5KXB A;  1D0G A;  1RUO A;  1VPH A;  1LTE A;  3JB4 C;  3PTR B;  1QDO A;  3V64 A;  1WW7 A;  1N1T A;  2XML A;  2XWJ B;  4URA A;  3TN9 1;  4OI0 A;  4H7L A;  4CUB A;  4IEV A;  3ABZ A;  4E8D A;  5FZ1 A;  2ZZJ A;  3LFI A;  4F7Z A;  4AVT A;  2Z79 A;  4CP0 A;  4W6X A;  2YFZ A;  1EAH 2;  4HAN A;  5A3O A;  1MZE A;  1Q8S A;  4CEY C;  5C3O A;  2HKX A;  2QZ3 A;  2VQT A;  2XJT A;  5D2A A;  4K8R B;  4H2A A;  1VBA 3;  3FLT A;  2XUE A;  1SLA A;  3BCW A;  4FQZ A;  3WDT A;  4CCL A;  4Y1V A;  3VL9 A;  4TSV A;  1XYN A;  4YM3 A;  3ZYR A;  2KR2 A;  1ONA A;  4QHZ A;  4CDX A;  2Y6K A;  1AHS A;  4JKM A;  2OPK A;  3FBY A;  4FPH A;  1A78 A;  3RZH A;  3ZN6 B;  5LRS A;  4LHK A;  4XUQ A;  2B9U A;  5LA1 A;  4L2N A;  2HEW F;  3D3A A;  1BZW A;  2Y6H A;  5BYN A;  5AFB A;  4CZS A;  5F1R A;  2NPI A;  1N1S A;  1YC6 1;  2G4I A;  3H0O A;  1V6L A;  4HKO A;  1ZA4 A;  5FY8 A;  1OF4 A;  1MQT A;  3K48 A;  5FY0 A;  3POE A;  5L9B A;  1PO2 1;  2JG8 C;  2VE1 A;  1ZZB A;  4Q8L A;  4M01 A;  2V09 A;  2ARC A;  1UQX A;  4XVH A;  1D2Q A;  4CP2 A;  1STM A;  1NG0 A;  1RUC 2;  1EV1 3;  4MO3 M;  4DMI A;  2QDR A;  1UYY A;  1X36 A;  4BQY A;  2GNM A;  2ZX0 A;  1SPP B;  3PUH A;  2D6P A;  3V0A A;  2H0V A;  2E6V A;  4TXW A;  3O1M A;  1AXK A;  1PIV 2;  3N7K A;  3U07 A;  3RSJ A;  3DUI A;  2QQN A;  3K4D A;  2MHF A;  1UOJ A;  1TQ5 A;  4G3Y C;  1H8T B;  3H7J A;  2VR4 A;  1VMH A;  1KGY A;  3KV6 A;  3RGB A;  2RS1 2;  1UPS A;  1W8F A;  1ASJ 1;  1OSG A;  2LRO A;  5FYI A;  5AC9 3;  5CKM A;  3RYK A;  1QJX 2;  1YIF A;  4Y33 A;  5LAS A;  5FZ0 A;  3UGF A;  3VKF C;  4FO9 A;  3HWJ A;  3RI8 A;  1UZW A;  5FY1 A;  1IGO A;  5FJK A;  3VLB B;  5IT6 A;  4YM2 A;  4YW1 A;  1H2K A;  4FVV A;  4DNY A;  4EN6 B;  1UF2 C;  5JIU A;  2QQI A;  1J1T A;  2JB8 A;  4ATF A;  4D7T A;  1WCS A;  1AR7 1;  1OOP A;  2Z4F A;  3PHM A;  5DPN A;  3KF5 A;  3VV1 A;  2E53 A;  3LIG A;  3VBO B;  3ZXF A;  3UGH A;  1OUS A;  3CHX A;  2GC2 A;  2D6L X;  4QXC A;  1W6P B;  2K46 A;  4AYU A;  4TLF A;  5C9A B;  4LT5 A;  1JHJ A;  1WD4 A;  1PIV 3;  2XVK A;  3QD6 A;  2LTN A;  5FYH A;  4BME A;  1OUX A;  2BBV A;  3LEM A;  1LUL A;  1GZC A;  2WSU A;  5BNO B;  3AKQ A;  3PIJ A;  3O0X A;  4Y4Y A;  3AM2 A;  1GQH A;  3DYM A;  1D4M 1;  4XYX A;  4E4S A;  2R07 1;  4YFZ A;  1GWK A;  1JYV A;  3W59 A;  4CRQ A;  2HWF 2;  3PVN A;  4JGY A;  1LOF A;  2FZ1 A;  1QJX 3;  4PI2 A;  4YG3 A;  1X8M A;  5CAD A;  5IVC A;  4AAP A;  1VBC 3;  1SCS A;  4PF1 A;  2EAA A;  1IKP A;  1DGR N;  1SLT A;  4PIX A;  3GBF A;  1H8T C;  5KC5 A;  2WLP A;  1PK6 A;  4MGK E;  1W2N A;  1W8U A;  1WD3 A;  3BGA A;  5FMD A;  1QJY 2;  3U10 A;  2CDP A;  3MLJ A;  4PQ9 A;  3GZE A;  1ODN A;  5C4W C;  2FBE A;  1OA4 A;  1AF9 A;  3GXU A;  5A33 A;  3VHP A;  3ROU A;  1WLT A;  1UPI A;  3VKL A;  4CDQ A;  3I3D A;  2WNV A;  4FXG B;  4XIL A;  2ID4 A;  3PVO A;  3QOP A;  5A7W B;  2P37 A;  5SV5 A;  5DMY A;  4PLO A;  2WKK A;  4YWA A;  2BEO A;  2RS5 1;  1PZ7 A;  1W6N A;  4OUE A;  4JDN A;  2JIG A;  4KU8 A;  5FLJ A;  3JB8 A;  2ES3 A;  2P6C A;  4PQQ A;  1RUE 3;  4D6Q A;  2EIG A;  2XKP A;  2XH6 A;  4OI2 A;  1CZS A;  5C9A C;  3BKZ A;  3A21 A;  1W6M A;  5CNA A;  1ZBE 2;  3C2U A;  1R64 A;  2PQQ A;  3K2O A;  2ZGK A;  5BV6 A;  4GAZ A;  1NY7 2;  1WGP A;  1O59 A;  1N3Q A;  1R09 1;  4FFG A;  5L7O B;  5BNO C;  1MS3 A;  1PVX A;  1YFX A;  2P3I A;  3V65 A;  1TME 3;  1Q8P A;  3FJS A;  4XDO A;  5JCT A;  3N9Q A;  4Q1R A;  1AYM 3;  1OKQ A;  3ZXJ A;  4ARY A;  4FPF A;  4LTA A;  4IQP A;  1JZ4 A;  1UMZ A;  1CZV A;  1VIW B;  3S30 A;  3THT A;  1W2T A;  4FPK A;  4WZC A;  2QCS B;  5CIS A;  3KWV A;  4GH4 B;  3INA A;  3AC0 A;  2ARX A;  4QM8 A;  1JW6 A;  4KL1 A;  2AH2 A;  2JDH A;  4ASK A;  1RJ8 A;  4N90 A;  1CN1 A;  3X29 B;  2DCY A;  3CJX A;  1IS6 A;  4LHS A;  4CCC A;  5FZ6 A;  1CVN A;  2XXZ A;  2RM2 1;  5CFD A;  2VVF A;  1ZRE A;  4V2W A;  1Z7S 1;  5JI7 A;  2VOK A;  3ZSK A;  5CFC C;  1I1E A;  1DYP A;  2IVJ A;  4CEY A;  3OEA A;  3H8O A;  5B4N A;  1BEV 1;  4QX3 A;  4W50 A;  3UK9 A;  1QJF A;  4TYS A;  1IPJ A;  4DRV A;  2IXH A;  1RUH 1;  2BNM A;  3MW2 A;  1RHI 3;  1FAY A;  4H7M A;  1HRV 2;  4YZ3 A;  1FOD 1;  1QIQ A;  3T4V A;  3D0S A;  2WN2 A;  3T0A A;  2Y6F A;  1NAE A;  5T5O A;  1DQ5 A;  3K4Z A;  1WW6 A;  1U12 A;  3T2Q A;  5L7O C;  1U5X A;  4N8M A;  3D5O A;  3RG0 A;  5JWP A;  1QH6 A;  1U5Y A;  3FC0 A;  4L92 A;  5F3G A;  5DAQ A;  5J96 B;  2R06 2;  2XJQ A;  4LUL A;  1CQ9 A;  2JG8 A;  3B9I A;  3H8X A;  5CA6 A;  4QQ2 A;  2GH2 A;  2ZGO A;  4J6G A;  1YI9 A;  4CEW B;  3RYP A;  1XSR A;  2NMN A;  1XNA A;  3B02 A;  2CWS A;  4GH4 C;  2Y0O A;  3O0W A;  4ISR A;  4N43 B;  4RA0 A;  3N4M A;  3WDU A;  3ZM8 A;  2KD7 A;  1JUH A;  3RPQ A;  5F3I A;  2D98 A;  4IDZ A;  4NIG A;  2WII B;  1AYN 2;  1ENR A;  1FV2 A;  1PGW 1;  1HJG A;  1QXR A;  2VOT A;  1IKQ A;  4WVW A;  4B4R A;  2ZML A;  1OI6 A;  4PDW C;  2IWG B;  1LOG A;  4P9I A;  2JXA A;  4GUL A;  4OI1 A;  1N3P A;  1QQP 3;  4RR3 B;  5GZE A;  4DO0 A;  5DG1 A;  5CB7 A;  1PGL 1;  1SDD B;  2JDZ A;  4UAP A;  5KWR A;  2DCZ A;  4C91 A;  1CIW A;  3CZJ A;  4Y1Y A;  3A22 A;  4AR2 A;  4CCD A;  1BMV 2;  4Q0U A;  3OCP A;  5LK5 A;  1NCQ C;  2DVA A;  2R06 3;  3G7D A;  2OS2 A;  1UNB A;  2WWJ A;  4OZX A;  5HBA A;  3KVA A;  1YI7 A;  2W68 A;  3ZSM A;  1KEX A;  4XF3 A;  3J26 N;  4NRQ A;  5G04 L;  4DPN A;  1YHF A;  2VUD A;  1XOY A;  2LAL A;  4A45 A;  4UBH A;  5I8Y A;  4NHY A;  4MGY E;  3M3C A;  1RMU 3;  2J1V A;  4MHU A;  4ZXK A;  1VBE 2;  5DZG A;  1XJA A;  3R05 A;  3NJZ A;  4CEW C;  2UWC A;  3H9A A;  3MW3 A;  4BIO A;  4XJA A;  4FPJ A;  4AFC A;  1SCR A;  3KCY A;  1DGL A;  2VOW A;  3NV3 A;  3J7L A;  4CPB D;  3POB A;  4XTP A;  1IS3 A;  1YFW A;  1J1L A;  4XFB A;  4FAG A;  1IPK A;  3ZMN A;  1G7Y A;  1LNS A;  3LSE A;  1QHD A;  2DFB A;  5K9Y A;  1H8T A;  3IBM A;  3SCG A;  2CSG A;  2TEP A;  1H1A A;  4YNI A;  2JEM A;  3DYO A;  4LK7 A;  2QNK A;  2NMO A;  1YCI A;  2VTX J;  3CZU A;  2CTV A;  4CCO A;  4QX5 A;  3KT4 A;  5C4W A;  3WOG A;  1DQ1 A;  1FPN 3;  2RR1 1;  1RIN A;  4CA9 A;  2VMG A;  1EUU A;  1VBE 3;  2AUY A;  4DY5 A;  1IHM A;  1XNC A;  2R1B A;  5F32 A;  3DKQ A;  5LBF A;  4B29 A;  1C4R A;  1O4T A;  1W9S A;  1C8M 2;  1L7L A;  4D3W A;  2A6X A;  1CJP A;  5IVJ A;  3KHB A;  5FFO C;  3U4X A;  2WT0 A;  4CCM A;  1W0O A;  4LO5 B;  1R1A 1;  4K21 A;  3ZYG A;  4YW7 A;  2ZHM A;  4IND A;  2V4V A;  3PUR A;  4JKK A;  5C9A A;  1JYW A;  4OFG A;  3OBT A;  1XU2 A;  4XET A;  1DZT A;  2XWB B;  2ZEZ A;  4N9H A;  4ERO A;  5F3C A;  1JYT A;  3ZPY A;  4GMP 0;  4FXK B;  4QX2 A;  5FO9 B;  2WT2 A;  4TZD A;  4M3C E;  1H2N A;  1AR6 1;  1ND2 B;  3H1Y A;  2EAL A;  3WHU A;  5C5U A;  2QQJ A;  3H8U A;  3I59 B;  1I9R A;  4UFI A;  2E9Q A;  3MZH A;  2RDR A;  1O5U A;  4DUV A;  1Z0H A;  2CNA A;  1H9P A;  1DU3 D;  1NLQ A;  1WZX A;  2ZGP A;  2ZS6 B;  1R1Z A;  5JVV A;  4COZ A;  3BI3 A;  2D6O X;  1CPM A;  4IEU A;  3NQH A;  4IEQ A;  3VBH B;  3UNP A;  1AX0 A;  2R04 2;  4NPR A;  2P4E A;  4YLZ A;  1UAI A;  4B1M A;  3OBR A;  3TN9 3;  2UYA A;  2GAL A;  2QBX A;  2VW2 A;  4LOR A;  2PLV 1;  2ARE A;  4OI4 A;  5EXO A;  4E8C A;  2KXL A;  1UZZ A;  3OEB A;  4ARX A;  1EAH 1;  3ACG A;  3GGL A;  4YM1 A;  2QQK A;  5L19 A;  1QXJ A;  4QX0 A;  2Y8K A;  3GF6 A;  4MZU A;  4Y24 A;  3ZKU A;  3E5U A;  5CFC A;  1RB8 G;  2R49 A;  3HBK A;  4SLI A;  4QGL A;  1Q43 A;  1XNT A;  3A0K A;  5FLI A;  2WS9 2;  1I6X A;  3RNS A;  5AFE A;  2BRT A;  2F17 A;  2YFU A;  4Q1P A;  2J1A A;  4FBF A;  5J09 A;  1G9D A;  4MYE A;  4ZON A;  4P9L A;  3B7M A;  1CIY A;  1LGB A;  3BTA A;  1UIK A;  3MIG A;  2DTY A;  4BMB A;  2P6H A;  2YHJ A;  2EVX A;  3DPR B;  4NWW A;  5I91 A;  4DFS A;  1ASJ 2;  4EZ4 A;  4AW7 A;  4FPO B;  3WF3 A;  3HBZ A;  1UOF A;  3AFG A;  4AZZ A;  4Q8K A;  4DB5 A;  1NCR B;  2EXJ A;  1COV 2;  1GP6 A;  1W0N A;  5LA2 A;  1ND3 B;  2C9K A;  5I0S A;  5L7O A;  1U5Z A;  4XCB A;  3AYE A;  1PO2 3;  2RS3 1;  2QQW A;  4FPY A;  4O9G A;  1XND A;  2WUH A;  5FAX A;  3WLU A;  3E97 A;  5FYZ A;  1XE0 A;  5DAX A;  1RUC 1;  2BFU S;  1RUI 2;  4NII A;  2JIC A;  2BQP A;  1QNW A;  2WNU B;  1H30 A;  2XG3 A;  3VBH C;  4GH4 A;  4MVT A;  2HWC 2;  3IAP A;  2Y6L A;  1VLN A;  3J9S A;  3J7H A;  3W21 A;  4EJR A;  3O12 A;  1K12 A;  3GHN A;  4Q0P A;  5IFP A;  2QKD A;  2VPV A;  3K46 A;  2GZW A;  3AZY A;  4PDW A;  1POQ A;  2RS1 1;  5K8S A;  5IAV A;  3J7N A;  3FMG A;  1PO1 2;  1ASJ 3;  2VM9 A;  1OMI A;  4F8A A;  3BAL A;  4QPG B;  4R52 A;  4AQ6 A;  4YAR A;  1C3H A;  2QQO A;  3LCP A;  2E26 A;  3M3E A;  2RDQ A;  4BDV B;  3SEP A;  1GLH A;  2LW8 A;  4IET A;  4NHX A;  1H1I A;  2UUR A;  2SBA A;  1NCQ A;  3VGI A;  5KC6 A;  1IQA A;  2BUK A;  3DPR C;  4LOT A;  4IEY A;  1S2E A;  2QQM A;  2OKX A;  5F7U A;  1CX1 A;  2JDP A;  2V5D A;  1AR7 3;  3J4U H;  4AG4 A;  4BIS A;  3PDQ A;  4K6B A;  4K3U A;  1NCR C;  1W06 A;  2W52 A;  3HPN A;  5DZF A;  5BXX A;  2VMC A;  5C3P A;  1ND3 C;  4JCK A;  1WLC A;  5FZ4 A;  5FBZ A;  5FZK A;  2E7T A;  4OMD A;  4NRO A;  4X6Q B;  2CAV A;  2UWB A;  3E1F 1;  3MGU A;  2XJR A;  4UW5 A;  2D43 A;  4KGQ A;  2RS5 2;  2DYC A;  2O8Q A;  3T0B A;  1RUJ 3;  2CDO A;  3NV2 A;  2J42 A;  3I2G A;  4FOV A;  4OHV A;  5APA A;  4CEW A;  5JUV A;  1D4M 3;  1TG7 A;  1V6M A;  1XSQ A;  2WNU C;  2R07 3;  2XKO A;  2ZOE B;  1HQW A;  3MHZ A;  4CXX A;  2QVS B;  2WYS A;  2NP0 A;  1LCL A;  5E88 A;  2LRP A;  1DGR A;  1MS9 A;  1XE7 A;  1QJU 1;  3PL0 A;  1J84 A;  3AK0 A;  2IXJ A;  3VB9 A;  3KV5 A;  1R09 2;  2O1Q A;  2A3W A;  2RVA A;  2W3J A;  1MQT B;  2Q1Z B;  4GD4 A;  4UFK A;  4X8N A;  4QKF A;  3AZW A;  3FZ3 A;  4XUP A;  5DZE A;  1POV 0;  4BXF A;  5E89 A;  4I3P A;  3LWC A;  1ZZ7 A;  1QJY 1;  2Z69 A;  1JOJ A;  3R4S A;  4Q26 A;  2ENR A;  4QPG C;  1AXZ A;  3GZA A;  4KI5 M;  2FDI A;  4IES A;  3V0A B;  3ZLI A;  2W94 A;  4QAW A;  2VCA A;  4YFW A;  2F4L A;  5JOW A;  3S5Q A;  3OGR A;  3U4S A;  4FOQ A;  5T54 A;  4YZ4 A;  1QEX A;  1WME A;  2RS5 3;  3OG2 A;  2W47 A;  5GKA C;  1R08 2;  1A8M A;  3DYP A;  1J58 A;  5FPU A;  2WDB A;  4BJ0 A;  1KFX L;  1E5I A;  1N1Y A;  5HCA A;  1QNY A;  4GIQ A;  3W58 A;  5LB6 A;  5I93 A;  1ZBE 1;  2WO2 A;  3ZXG A;  3KGZ A;  1NY7 1;  2LUW A;  1OD5 A;  2WLQ A;  4LEJ A;  4XPV A;  4ZU4 A;  2AEN A;  2OA2 A;  1R09 3;  1VAM A;  2WO7 A;  2VMI A;  4HSJ A;  4WM7 B;  4Y5S A;  3TOJ A;  4D6S A;  3KSC A;  1UZY A;  5H9R A;  2BER A;  1PM4 A;  4I0W B;  4QX1 A;  1YFY A;  2WFF 3;  5L73 A;  1RUH 2;  3VZM A;  3ES4 A;  1SHW B;  2G9F A;  4MGS A;  5LW9 A;  5CG8 A;  1FOD 2;  1OOP B;  3PUS A;  1AX2 A;  1AR8 2;  2VNO A;  4GB3 1;  3I2H A;  4XMA A;  4LXL A;  1NKG A;  3IMM A;  3BTZ A;  1K5M C;  4YG6 A;  3V56 A;  3N35 A;  4BZ4 A;  3NV1 A;  1OFS A;  4FFI A;  5FZL A;  1PMI A;  3AJZ A;  5CKQ A;  2HWD 3;  3WZ1 A;  4C0B A;  4H3W A;  3LSD A;  4I3G A;  4Q4X 1;  1DIW A;  4IW3 A;  4MGQ A;  2RM2 3;  5GM0 A;  1S4C A;  1O3R A;  3E5Q A;  1S0C A;  1Z7S 3;  2QFE A;  4IV3 C;  3K4A A;  4JGY B;  4GKX A;  2O0O A;  2WFP A;  4FP3 A;  5FP3 A;  1CAW B;  2UY8 A;  3U1X A;  3MLK A;  4P08 A;  4EN0 A;  1HQN A;  3A7Q A;  4YW3 A;  1BEV 3;  4L9B A;  2N7G A;  1PGW 2;  5DQ0 A;  5GLZ A;  2DUR A;  1NLS A;  1YRZ A;  4GWI A;  1RUH 3;  1PM7 A;  3VL8 A;  1AR9 2;  5JAX A;  5EJ3 A;  1YEW A;  1FOD 3;  1V9U 1;  2ADE A;  2JE8 A;  2ZGR A;  4YW6 A;  5A33 B;  2Y26 A;  5ACA 1;  1LHO A;  2YV8 A;  2RJL A;  1UYZ A;  1FXZ A;  4WM7 C;  1AZD A;  4FCA A;  5FUI A;  4CDQ B;  4Z1V A;  1RL3 A;  4ZU7 A;  2WNV B;  3VBF B;  4IGP A;  2W1Q A;  3NJY A;  4KG8 A;  1SFY A;  5JMO A;  5EZW A;  3AP4 A;  2R1D A;  2BWC A;  1XXN A;  2D3P A;  1OOP C;  3I59 A;  2Z5W A;  4MGZ E;  4QDR A;  4LUM A;  1ST8 A;  2VVE A;  5DAV A;  3ZDV A;  3EBR A;  2TNF A;  1LAJ A;  4LLO A;  5DUU A;  3T2O A;  2DVD A;  1Y7B A;  4QDS A;  3VBH A;  2P3J A;  3M3I A;  4Q29 A;  2WIN B;  5BNN C;  5GLV A;  5GLW A;  4QX8 A;  1W9F A;  4XZU G;  2XJU A;  3E6C C;  4CCJ A;  1ULD A;  1MZ5 A;  1W8Z A;  5FK8 A;  4D6R A;  1D7P M;  4HVR A;  4ZY9 A;  4Y5T A;  2ERF A;  1VR3 A;  1W2O A;  2EXK A;  3T09 A;  1BMV 1;  1UU5 A;  1LGN A;  1W9T A;  4BQW A;  4XW3 A;  4NIA A;  3O1T A;  1RJ7 A;  3D0J A;  2JKB A;  4UI9 L;  3H3L A;  1KDK A;  5KXD A;  3PU3 A;  4HN0 A;  3WQ0 A;  2I74 A;  1VAL A;  2RG4 A;  3ILN A;  3P3N A;  3R0R A;  5CFD B;  2ZHK A;  4JDM A;  3DPR A;  2YPD A;  3LEI A;  3I2I A;  5A1F A;  3I2K A;  4LO7 A;  4NOT A;  3T3Y A;  4CEY B;  3AMQ A;  1C5H A;  2Q8E A;  3V0B B;  2WNV C;  3VBF C;  3JCI A;  2B46 X;  2JJ6 A;  2ZHL A;  1HN0 A;  3T1L A;  1CGP A;  4WM8 B;  4Z92 B;  1SLB A;  2E7Q A;  2JKX A;  1J3P A;  4RGG A;  3LPF A;  3U11 A;  4OUM A;  2JDY A;  5FZO A;  3I2O A;  3HNY M;  1YXW A;  4Q4W 2;  5FQ0 A;  1HN1 A;  2WNU A;  4XFG A;  2XLF A;  3ZYH A;  3MLL A;  3CKH A;  1NUK A;  5F6L B;  1YIP A;  3N7J A;  3OYW A;  1UY3 A;  4D8M A;  2HBU A;  3RZJ A;  4XBQ A;  4P9G A;  2FCT A;  2B7Y A;  4RGK A;  1BVP 1;  2JG8 B;  4IE0 A;  4JAA A;  1TMF 3;  5F6K A;  2WNE A;  3WF0 A;  3NKG A;  3ZXL A;  1DP0 A;  2JEN A;  3U14 A;  1NYW A;  1Q8V A;  1HJF A;  1W39 A;  2PAE A;  4QPG A;  2ZX1 A;  4ZS3 A;  1Y9G A;  1SBE A;  2DWR A;  4IER A;  2ZGS A;  1H6X A;  2RR1 3;  3BIW E;  2GNB A;  4BE3 A;  4IEZ A;  4Q27 A;  4UFH A;  5T3N A;  3P1I A;  3NJV A;  5K7P A;  4A3X A;  1I5Z A;  1LHV A;  2A6W A;  3ZR6 A;  1GOG A;  5H9Q A;  1C8M 1;  1MPX A;  4ET7 A;  3QAC A;  5CFD C;  4K40 A;  2PLV 2;  3IMN A;  5JOZ A;  5LY2 A;  3UKV A;  5EFU A;  3S7I A;  1Q3E A;  2JX9 A;  4U36 A;  3RZK A;  1R1A 3;  3WF2 A;  2PN5 A;  4AOC A;  2JDA A;  4D7S A;  4WM8 C;  5ISL A;  3VDA A;  5FP4 A;  4CTE A;  3HIF A;  4PLM A;  4AI8 A;  3KGL A;  2BDR A;  3HQU A;  4P9X A;  4CE8 A;  1AR6 3;  1VAK A;  5LZ6 A;  1GBG A;  5FYM A;  1NT0 A;  2IXI A;  5D21 A;  1V0A A;  4M4P A;  1JZ6 A;  1DBN A;  1YNA A;  4YPJ A;  3RYR A;  2HLE A;  3LEG A;  3ZMO A;  5FCC A;  3KVB A;  3AVR A;  5DN2 A;  1SDW A;  4Q5O A;  3O14 A;  4NUB A;  3GAL A;  3VN4 A;  2D7F A;  2R04 1;  3H1W A;  4E2S A;  3WQB A;  1K5M A;  3WY6 A;  4XE9 A;  2RS3 2;  1C1L A;  5C70 A;  3ACI A;  4BU2 A;  1UXZ A;  2RDS A;  4IV1 C;  3LDK A;  3VD4 A;  3IPV A;  1EAH 3;  1FMD 1;  3AX4 A;  4K8F A;  4R4X A;  5E1R A;  5FKC A;  3AKT A;  4C8D A;  1GFF 2;  5JI9 A;  4XJZ A;  5FUP A;  4S2F A;  2Q1M A;  4IV3 A;  4JGZ B;  1OHF A;  5IHR A;  4OHY A;  4A7Z A;  5CYY A;  2WS9 1;  4Q2F A;  2DCK A;  3KLS A;  5FUN A;  3ZSE A;  4COV A;  2EA7 A;  2J22 A;  3LE0 A;  3WSO A;  2Z2S B;  4M3C B;  4XHX A;  5A3W A;  2BVV A;  2R30 A;  1YWK A;  4EQV A;  2YU2 A;  4PLN A;  4CXY A;  5JPN B;  4HK8 A;  4B3N A;  5G05 L;  4LBQ D;  5C4W B;  1F4A A;  2UWA A;  2ZGU A;  2VJX A;  3DF0 A;  4HPK A;  1W3V A;  1VB4 A;  1COV 1;  1NZI A;  1UOG A;  5JZG B;  4ZZ5 A;  3SKV A;  2WA3 A;  4WM7 A;  3IM0 A;  4J25 A;  2BWA A;  4ASL A;  1WCD J;  2R6Q A;  2RS3 3;  4CXW A;  1RGS A;  3K75 B;  4RFT 0;  1RUI 1;  1RUC 3;  4AEJ A;  3W5N A;  1VB2 A;  1ZZC A;  4XJ8 A;  3AYA A;  2GNT A;  4CU6 A;  4YW4 A;  3BIE A;  2CAU A;  3ECQ A;  1S2B A;  2VH9 A;  4QX7 A;  1UO9 A;  2HWC 1;  4LKS A;  4O9E A;  1GYK A;  1VRH 1;  4LIU A;  2FD8 A;  5C8C B;  1X82 A;  4R4Z A;  5LRR A;  5BNN A;  1G86 A;  5ABJ C;  3UYJ A;  3ZDS A;  2VO5 A;  3N9O A;  1O5L A;  4K9S A;  4EYU A;  3LOB A;  1ZA7 A;  2RS1 3;  4XOG A;  1PO1 1;  1Y4W A;  4JGZ C;  2CWM A;  4AFA A;  2VG9 A;  2E63 A;  1QWR A;  4C1X A;  3CDZ B;  1CAW A;  1P8J A;  1QJU 2;  2XL9 A;  1C28 A;  3NMB A;  4RSU A;  3JZV A;  1U0A A;  1DGW X;  1VRB A;  3DEM A;  1DZQ A;  3AMH A;  3FE5 A;  5FZ3 A;  3HT2 A;  3N9P A;  3U37 A;  1F2N A;  1FYU A;  1N47 A;  3IKW A;  4AI0 A;  3LGR A;  4J1W A;  1S2K A;  4A2U A;  5M0T A;  4OQ8 A;  3JD7 1;  1KQR A;  4HVQ A;  4K7J A;  1OA2 A;  4LK6 A;  3TBD A;  1PMJ X;  5A70 A;  4LO6 B;  5JZG C;  2W1S A;  3TWI A;  5CFC B;  2K2S A;  3IWZ A;  4R9C A;  3SXW A;  3SIS A;  2OXB A;  3VBF A;  4YSF A;  4QXK A;  3VUO A;  3THP A;  3E6B A;  4OQ9 A;  1UU6 A;  2AGS A;  5FYY A;  5LWB A;  4FSJ A;  3NNJ A;  2EID A;  3Q8A A;  2IZW A;  5F2S A;  3NL1 A;  4ES9 A;  1RIT A;  2HWF 3;  2W0X A;  3I2F A;  2YC2 A;  5T52 A;  4TN7 A;  4Q4Y 1;  5CKN A;  3AKP A;  5C8C C;  1Y9Q A;  2C1F A;  3M8L A;  5L9R A;  1HLC A;  4P14 A;  5FY9 A;  3O1R A;  2BPA 2;  1QY4 A;  4YGD A;  2C5D A;  5C7G A;  1LOB A;  3VBU C;  3CF6 E;  1NX9 A;  1Q8Q A;  1QJY 3;  4N9I A;  2W9X A;  5CBL A;  1HRI 1;  4BK5 A;  5FPZ A;  2YB7 A;  2OX0 A;  4GB3 2;  2QQP A;  1V6O A;  3MPP G;  3PUQ A;  1PX3 A;  5CEH A;  3S57 A;  3HAG A;  3POY A;  5FPB A;  4GWM A;  1UY1 A;  4FPL A;  4COW A;  3ELN A;  1LHU A;  2XOM A;  2B45 X;  1JTZ X;  1QDC A;  1RUN A;  1BLZ A;  1NA1 B;  1NOV A;  5FZB A;  4DEV A;  1W8N A;  3KQ4 B;  4OHX A;  2W1U A;  4P00 B;  1SG3 A;  3I3M A;  2SLI A;  3BPZ A;  1R08 1;  2GN7 A;  2O8O A;  3H50 A;  4NJ4 A;  4ORF A;  4KBZ A;  4RHV 2;  1UOB A;  3KCC A;  4XBN A;  2XQR A;  1RXF A;  2A1X A;  4PDW B;  4Q4X 2;  4E2Q A;  1BHG A;  1W6O B;  3WD5 A;  3WDY A;  1OUR A;  3AYC A;  4MAD A;  2VQA A;  2AZ5 A;  2MNG A;  1ZBE 3;  2BU9 A;  5FY7 A;  3HT1 A;  1EPZ A;  3RI9 A;  1RUF 1;  3DXT A;  2EIE A;  3S6P A;  3WCR A;  3V0B A;  4XHB A;  2ZAH A;  1PGS A;  1UN1 A;  1SLC A;  3KM5 A;  4NO4 A;  4WM8 A;  1RTV A;  4FTB A;  1JU3 A;  2PQS A;  1NCQ B;  4RD7 A;  2P17 A;  3PMS A;  3N36 A;  1WW4 A;  1SLL A;  4Y1Z A;  2DCJ A;  2WT1 A;  4AI9 A;  5CAZ A;  5LCW L;  1AR8 1;  1V9U 2;  2BBA A;  4LPL A;  4GB3 3;  3EYP A;  1HQL A;  2JG9 B;  2DU1 A;  3WNO A;  1VP6 A;  3OTF A;  3ZKY A;  5ACA 2;  5LEJ A;  5F5A A;  4UT5 A;  4Q0Q A;  3MIH A;  2LS6 A;  2D3R A;  2WZP P;  2DDU A;  4E2G A;  5ANN A;  3TEZ A;  1JU4 A;  2ZA9 A;  4DUX A;  4Q4X 3;  2JE7 A;  5E16 A;  3VDD B;  2XJS A;  5IK7 A;  1O3T A;  3AVS A;  4IV1 A;  2IFR A;  5IAT A;  2OPW A;  3FUQ A;  3RZL A;  1UYX A;  4NID A;  2DTW A;  4CU7 A;  5EP9 A;  4AEK A;  1NA1 C;  3MBW A;  1O8P A;  3DKW A;  5C71 A;  2YPJ A;  3SH4 A;  1L3J A;  1EY2 A;  4EWE A;  1MS0 A;  1J3R A;  2BP6 A;  5BPX A;  4R8H A;  4BLJ A;  1O7F A;  3UGG A;  5ANQ A;  4F83 A;  1A8D A;  1AR9 1;  4YG0 A;  2OT7 A;  1HRV 3;  4G9S B;  4HON A;  2D93 A;  4XQ4 A;  1V9U 3;  4YZ1 A;  5FXW A;  3RZG A;  3B93 A;  1S0B A;  2GP5 A;  4NHK A;  3JQW A;  1TEI A;  5FTT C;  1JMU B;  4DXR A;  5FV3 A;  1IOA A;  1S55 A;  2JE9 A;  1A34 A;  3SKJ E;  1DQ6 A;  2BNN A;  2VZT A;  2Z42 A;  4NAM A;  2YRO A;  4C90 A;  1HDK A;  4XC9 A;  3OGJ A;  5FZA A;  4B1L A;  1GZW B;  2J7M A;  2JG9 C;  1O4Y A;  2VTF A;  3WQ1 A;  1CPN A;  3Q8E A;  1OPO A;  4F3J A;  1M06 G;  1Z78 A;  5J3U A;  4Y26 A;  1BK1 A;  2JDU A;  1ZRC A;  1AYN 3;  1JBC A;  5BY5 A;  5LA0 A;  1G6N A;  1KD7 A;  1QJE A;  2ILM A;  2VXJ A;  4YVW B;  5LK7 B;  4TTG A;  4TLG A;  4MHR A;  3VDD C;  3MW4 A;  1C5I A;  1O4Z A;  5IUQ A;  3UKT A;  3POI A;  1CD3 G;  5ABJ A;  4HMZ A;  1UIJ A;  1LES A;  5HCH A;  1D4V B;  3WNK A;  3N9M A;  1GMM A;  4HG6 B;  4NR1 A;  4QT6 A;  5FYC A;  4WV8 A;  4JGZ A;  2VGD A;  4O7X A;  4UBG A;  1M4W A;  2MPF A;  4HET A;  2HYX A;  3B00 A;  2IFW A;  3BOP A;  4NWV A;  4A7Y A;  5JDB A;  2PHW A;  1V6K A;  4LBQ B;  5IK4 A;  2G9Z A;  4BQ3 A;  2A3X A;  4HLT A;  3TEY A;  2XL7 A;  4M3C A;  4GZ9 A;  2VBB A;  4LBN A;  3ZN5 A;  3OGG A;  3KCX A;  2RJ2 A;  4B4P A;  1AXY A;  5F37 A;  2ZGM A;  2E31 A;  1MAC A;  4N7I A;  4PIY A;  4BH9 A;  2J1T A;  3GBG A;  1HIX A;  3HNB M;  4KWK A;  4LBJ A;  5FMO S;  3BPS A;  3URF A;  1UZV A;  3WUD A;  5ERL A;  5J36 A;  5JZG A;  5FYB A;  3SNM A;  1APN A;  1HB1 A;  4FP2 A;  1E5H A;  3B5L B;  3QLQ A;  5FZH A;  3POW A;  2V73 A;  2VZS A;  2FMY A;  1PZ8 A;  2EIB A;  1ZRR A;  4J1X A;  4Q4W 1;  3LA3 A;  4NHL A;  2PYT A;  4M0N A;  2W95 A;  4HXC A;  2DVB A;  3GZT B;  5EQU A;  3CJI A;  5C8C A;  4YRD A;  2GSY A;  3Q8C A;  4YVW C;  3AFK A;  3VZN A;  2XPJ A;  2PHX A;  2CGP A;  5FIX A;  1ULE A;  4AL9 A;  3THD A;  2IVI B;  1V70 A;  2I45 A;  1CZT A;  3VBU A;  3WF1 A;  4AHW A;  4BA6 A;  1SEF A;  3ZYB A;  5E8A A;  3IDB B;  4BQ2 A;  1SQ4 A;  3MUY 1;  3R6S A;  4RL7 A;  1LEC A;  1GV9 A;  3K3O A;  1CAU B;  3DXU A;  4XFF A;  2B8M A;  3M1H A;  5FYT A;  4IE7 A;  1OLQ A;  1W6Q B;  1UY0 A;  1AX1 A;  1PNG A;  2D97 A;  2H0B A;  2ZAC A;  1RIR A;  3IZO A;  1C8M 3;  2EF6 A;  5FZ9 A;  5C3S A;  5JIA A;  2BJS A;  2HBT A;  5EWS A;  3U75 A;  3ZFF A;  2ZTN A;  3ILR A;  1NZC A;  3AB0 A;  5B4X A;  4CP9 B;  1FMD 2;  2YXS A;  4COY A;  3WP6 A;  1KJL A;  1LU1 A;  3CLP A;  1XNB A;  1GNH A;  3WDX A;  1WMD A;  3WP3 A;  2ZEW A;  1J83 A;  2B42 B;  4E27 A;  4MGT A;  3CEW A;  5A3P A;  2GH8 A;  2VNV A;  3JXS A;  1F31 A;  2HEV F;  2B4K A;  2E51 A;  4N7U A;  4XDQ A;  5FMC A;  4B8E A;  3S5A A;  4OZO A;  2ZGQ A;  3SLI A;  4XIK A;  1F4H A;  4M0H A;  4L8Q A;  5FZM A;  3SHR A;  1US3 A;  2OUH A;  3GHM A;  3H3Z A;  3AP5 A;  4BK4 A;  1RUG 1;  1MVE A;  2R04 3;  2E32 A;  2VUA A;  2HWB 2;  3N7M A;  2G1M A;  4EV0 A;  2D6M A;  3VHO A;  1G9A A;  2ZEX A;  2F6B A;  1W99 A;  3ZXD A;  3ST7 A;  3HR9 A;  3GNE A;  4S2H A;  3ZXA C;  2IXK A;  5FZO B;  2VMF A;  2GMP A;  1FMD 3;  4MXW B;  4DEQ A;  2YC4 A;  2BGP A;  5FQ0 B;  2ATF A;  1E5R A;  3FL7 A;  3A4U A;  3KD4 A;  4QPI B;  2GAU A;  4FPC A;  4BWO A;  4WVM A;  2RMU 1;  4XUN A;  1VRH 2;  1HB3 A;  5I8T A;  2WS9 3;  2XBO 2;  4D7Y A;  4LBL A;  4LE3 A;  1NA1 A;  2OZJ A;  1G9F A;  2ZGL A;  3OYW B;  1URX A;  1ZZ6 A;  1C8N A;  2ORZ A;  5CG9 A;  3NV4 A;  3BUC A;  4W6W A;  2FMD A;  2XQX A;  1ENX A;  1W6O A;  1YJK A;  2WWU A;  2ZAB A;  3KT7 A;  2WZR 1;  5T5L A;  1DF0 A;  3JBG 1;  3UJQ A;  3T4H B;  2E33 A;  1COV 3;  1GP4 A;  3A23 A;  4AFD A;  3UJO A;  1XNK A;  1JUI A;  3B69 A;  3MDP A;  2XGX A;  2XHK A;  1OXC A;  4SBV A;  4ONU A;  5A7Q A;  5FOB B;  1RUI 3;  4DIQ A;  1UU4 A;  2CGO A;  4Z8B A;  3KQR A;  3JD7 2;  3WNM A;  2JG9 A;  2PAM A;  4KGG A;  1AL0 G;  3WT3 A;  3RQ0 A;  2AEY A;  2HWC 3;  1SMV A;  1VBB 1;  4GA9 A;  1VRH 3;  4UFM A;  5DAW A;  5A80 A;  4YZ2 A;  1W8H A;  2PMW B;  1OD3 A;  5K0U B;  5DUV A;  1QXP A;  2QTW B;  2QDN A;  5LA9 A;  4B4Q A;  3OPZ A;  1FV3 A;  3VDD A;  3WCS A;  4QPI C;  1PO1 3;  1W9W A;  3HNM A;  1V6I A;  2VQU A;  2OW4 A;  4D94 A;  4E9K A;  3R4D B;  4Q4Y 2;  3ATG A;  2HWE 1;  4KWL A;  2K0G A;  4FTE A;  4CP1 A;  5A1L A;  5IYY A;  1K5M B;  1QU0 A;  3MI8 A;  3VKO A;  2ZMK A;  2KM2 A;  2GND A;  4AI1 A;  3RFR A;  5B2G B;  2VOX A;  1VE0 A;  5I0D A;  1GKB A;  2W92 A;  3O1V A;  4XF0 A;  2EXI A;  4YVS B;  1F8V A;  1HRI 2;  3IPV B;  2PAK A;  5JOX A;  3JD7 3;  3GDB A;  3VBR B;  4MH0 E;  2C6S A;  4IV3 B;  2NYY A;  4ISQ A;  1GZT A;  4PCR A;  2Q30 A;  4OHW A;  5A7P A;  1CAX B;  2OQ7 A;  3ZR5 A;  3K3N A;  2PHR A;  4UW3 A;  5BNP B;  1F35 A;  3MV0 1;  4XFA A;  2Q1F A;  3UET A;  5C5T A;  1PVC 2;  1JOB A;  3IT8 A;  5T55 A;  2QQL A;  3I97 A;  5HXV A;  1KRI A;  3GJA A;  2WYF A;  5FPA A;  1GZW A;  2FDH A;  3NNG A;  4QD2 A;  3WNX A;  4AGV A;  2DVF A;  4KWU A;  1AYM 1;  1F9K A;  1GUI A;  2AC1 A;  2BV4 A;  2WZ8 A;  4Q4Y 3;  1RUF 2;  4HPK B;  2XJP A;  5K0U C;  1RVF 1;  3P5B A;  4A6S A;  4YVW A;  1GP5 A;  3D8C A;  3MID A;  1AL2 1;  3NKT A;  2GMM A;  2Y38 A;  1Q56 A;  1TNR A;  1NXD 1;  1SFN A;  3ME2 A;  2Q8D A;  3H1M A;  2V4A A;  5KXE A;  5FP8 A;  1K5J A;  5IVF A;  1WCQ A;  3D6E A;  4V1P A;  1KIT A;  1N1V A;  1U5I A;  1UMH A;  3DN7 A;  1CAV A;  1Y43 B;  3PU8 A;  5A7O A;  5EJ1 B;  4LBQ A;  5EHD A;  5BNN B;  2FQP A;  3RWK X;  3LB9 A;  1WBF A;  4H55 A;  4RHV 1;  4MXV A;  1CON A;  3TNP B;  1R08 3;  2WZE A;  1XYP A;  3CQO A;  3AMP A;  3PNA A;  4YVS C;  3RJR A;  3C7E A;  3RWN A;  4GJZ A;  3LA7 A;  1LHW A;  4GXL A;  3VBR C;  1ULP A;  5BNQ A;  4NN0 A;  4XQD A;  3VD9 A;  1H6Y A;  1AVB A;  3D82 A;  3G6J B;  3WX5 A;  4OUL A;  4LR4 A;  1RUF 3;  2FDG A;  3TEW A;  4BPZ A;  2W46 A;  4O65 A;  5LAT A;  2LM3 A;  2RJK A;  4YGB A;  1W05 A;  3C3V A;  5BNP C;  1JYI A;  1NE4 A;  4GAL A;  4CUC A;  3PJQ A;  3POJ A;  4QQP A;  4X8P A;  4JC1 A;  1AR8 3;  1LGC A;  3MUZ 1;  3NNL A;  4D69 A;  2Y0I A;  4L99 A;  3S7E A;  1JOD A;  3FX3 A;  2DU0 A;  1S0G A;  2PFW A;  3K77 A;  4EWA A;  4MUV A;  1ZRF A;  4QKD A;  3POF A;  4CSW A;  3ZYJ B;  4FOY A;  3QBQ A;  3ZFE B;  3T08 A;  1WWY A;  2DBI A;  1RED A;  4IE5 A;  4DS0 A;  1S1A A;  1ZM1 A;  3DL3 A;  4P9J A;  2X8K A;  2YBS A;  4K1Y A;  1CAU A;  2RDN A;  3AKR A;  2DFC A;  2YBK A;  5A7S A;  2BZD A;  3IDA A;  2A70 A;  1LRH A;  4BOW A;  1MVQ A;  1W6Q A;  3MFC A;  4NAO A;  4LBM A;  5FRE A;  3NRU A;  2VC9 A;  4Y20 A;  3OB8 A;  4KWJ A;  2ZMN A;  3KV4 A;  3SMH A;  2NLR A;  3VD5 A;  3WNL A;  1AR9 3;  3H7Y A;  3B01 A;  2VZ3 A;  3NAP B;  1IG0 A;  5FXZ A;  5I8S A;  4CP9 A;  3LZZ A;  3ZPO A;  1FX5 A;  5FZ8 A;  4Q0S A;  2IUW A;  1UXX X;  3SEE A;  1OKO A;  2A6V A;  4HSL A;  5FPV A;  3BN6 A;  4CDW C;  3NWK A;  4GJY A;  3ES1 A;  1L7Q A;  3TYJ A;  1W9Y A;  1LKN A;  2YUE A;  5KXC A;  1GNY A;  1IPS A;  1ENQ A;  3HQX A;  4W4Z A;  1UW8 A;  2JDN A;  1IG3 A;  3LPG A;  4QHO A;  4CDU C;  4QB6 A;  4Y4R A;  1OVS A;  1OFN A;  2WO1 A;  4RS5 C;  2CYF A;  2BFU L;  5AC9 2;  1ZRI A;  4AAX A;  5A32 B;  2K9Z A;  2WSV A;  2XDV A;  3RDI A;  2UYB A;  4E4D X;  4Y22 A;  2WWS A;  2D3S A;  2WAO A;  3EJK A;  2FCV A;  1DCS A;  1BBT 1;  5FBJ A;  3ZFE C;  5AVP A;  4WVV A;  1NQD A;  1W28 A;  3J7M A;  3LQC A;  1T6B X;  5KR7 A;  4DRR A;  3USU A;  2R0H A;  2ZKL A;  4XAB A;  2O14 A;  3WG4 A;  4MXW A;  1NXM A;  1RYY A;  4K20 A;  4HT1 T;  4QPI A;  4AVC A;  1NLR A;  2A5Z A;  4JTO A;  2OQ6 A;  1LOD A;  1YUD A;  4OMC A;  5FWE A;  2R0F A;  3WVJ A;  3ZIX A;  4BB3 A;  1ZZ9 A;  4GMP 1;  5T5P A;  1FPN 1;  3FN9 A;  2OII A;  2NZ9 A;  2WJS A;  3TAY A;  1S0I A;  4KH9 A;  1ZRD A;  3NAP C;  4RQP B;  2DBN A;  3WEZ A;  3FLR A;  3WW1 A;  1WKY A;  1X9P A;  4BIF A;  3EO6 A;  3C8X A;  4XTM A;  3ZSL A;  4IV1 B;  2J1R A;  1I3H A;  1MR5 A;  4AHX A;  2WQ4 A;  1GOF A;  3RRD A;  3OUH A;  5HV4 A;  1G9C A;  3J8F 1;  3USS A;  2YGM A;  2CGN A;  1O8S A;  1SBD A;  2AYH A;  3M7A A;  1LOC A;  3I54 A;  4Y1X A;  4KBB A;  3HN1 A;  2VZU A;  4P5Y A;  3ZFG A;  3OBZ A;  1VBD 1;  1RUD 1;  3AP7 A;  5CVR A;  5C8W A;  4UOJ A;  2UU8 A;  4IEO A;  5IW0 A;  5HV0 A;  3R4U A;  2V5Y A;  4QKB A;  2FDK A;  4LIV A;  4LKF A;  4Q4W 3;  1CX4 A;  1ZNP A;  1YQ2 A;  2PHU A;  3AJY A;  2BOJ A;  1TNF A;  4NE9 A;  5FDB A;  1QMJ A;  4LOS A;  4AFM A;  1WA4 A;  2ZX3 A;  1PX4 A;  1S0D A;  3GYD A;  5K0U A;  1JOP A;  1ULC A;  1XBF A;  2J1S A;  4HKL A;  2D5F A;  2IC1 A;  3SCF A;  1IS5 A;  3IAQ A;  1C1F A;  4C1W A;  4OVE A;  2VMH A;  4XJU A;  4LHN A;  2X09 A;  3UT0 A;  3OPT A;  1JYN A;  1KDM A;  4PHZ A;  3LDR A;  1AJK A;  3I3E A;  3MO4 A;  4LO4 B;  1UYP A;  4QM9 A;  1EV1 2;  1YFU A;  2D40 A;  3PVE A;  1KXG A;  1KS4 A;  1RUG 2;  1OQE A;  3U78 A;  4RQP C;  5CU1 A;  1ZBA 1;  1UY2 A;  4I01 A;  3HMY A;  5FZD A;  3TB0 A;  5KHI A;  2YGL A;  1HKD A;  2PLV 3;  3WUC A;  3HN3 A;  5ABJ B;  2ZBJ A;  4YVS A;  1QJZ A;  4HBN A;  1LOE A;  3VBR A;  4QXH A;  4QPW A;  4XF1 A;  2CY6 A;  4R9B A;  4XXP A;  4CU9 A;  2HJI A;  1S0F A;  4QB1 A;  3WG1 A;  1G8W A;  1WMX A;  4P5H A;  2RMU 2;  3HQR A;  4GKY A;  1CAX A;  4Z07 A;  4O61 A;  5LEK A;  2VTX A;  4YGE A;  5FPL A;  5BNP A;  1ULO A;  4QKN A;  2ZGT A;  3I4I A;  1GQP A;  1J59 A;  1REF A;  2C4X A;  4AHY A;  4AQ2 A;  1OQD A;  4MG2 A;  4JRA A;  5J48 A;  4UFJ A;  5JR7 B;  1S0E A;  4BQ4 A;  4CCE A;  1ALY A;  5A6Z A;  2ZKN A;  1CJD A;  2C24 A;  2WZR 2;  2AR6 A;  3RMY A;  2Q8O A;  1MZF A;  4BXS V;  3AP9 A;  3JBG 2;  2GN3 A;  2ET1 A;  5FZC A;  5KHJ A;  1EP0 A;  5J1X A;  3FHA A;  3MF9 A;  1YQ6 A;  3OSD A;  1RUG 3;  2HWB 1;  5F8P A;  3ZIW A;  4CPB A;  2XON A;  4AVV A;  5IJR A;  2VOV A;  1Q5O A;  3N3H A;  2GC1 A;  1H4H A;  3MPB A;  3QCW A;  4L0P A;  3AKS A;  3RZM A;  2ZX4 A;  4AED B;  4AVB A;  5JSO A;  3PTY A;  2J1E A;  3DEC A;  5IFT A;  1BK0 A;  1LHN A;  3CJI B;  1DQ4 A;  3ETQ A;  3W5M A;  2RMU 3;  4AFB A;  1VBB 2;  2XBO 1;  4C0H A;  1JZ8 A;  2OZ6 A;  4QQL A;  3VZO A;  3I2J A;  2BVB A;  4M4R A;  2R32 A;  3FWE A;  2YBP A;  1VBC 2;  5FMB A;  3T2T A;  2X29 A;  3ACH A;  3VBU B;  3CL1 A;  1EYB A;  1T6G C;  2AAC A;  3EHK A;  3LFM A;  2QQU A;  1O3S A;  1JHN A;  3FUO A;  5FY5 A;  2WZR 3;  1OVP A;  3PUI A;  5DAB A;  1MZ6 A;  1HV0 A;  3JBG 3;  5FR3 A;  4QWN A;  1MS4 A;  2HWE 2;  3H3U A;  3O1U A;  4Y1U A;  5DAP A;  1PZ9 A;  3NST A;  3OY8 B;  2WNO A;  4CDW A;  5EIY B;  5KBF A;  4ES8 A;  1POV 1;  4CYD A;  1YLL A;  3BTX A;  5DDJ 1;  5FYU A;  3ZFF B;  2Y60 A;  4QQH A;  5T5J A;  1GNZ A;  5FK7 A;  4CDU A;  1DYO A;  2RHP A;  1RUJ 1;  3FHI B;  3MF6 A;  3S0M A;  4PI0 A;  4QPY A;  1BJQ A;  2C26 A;  3HJR A;  4RS5 A;  1RUE 2;  4XAE A;  5EV7 A;  3UV9 A;  4GQ7 A;  5C33 A;  1ODM A;  1TZO A;  1VBB 3;  2VEC A;  1SLI A;  4DXZ A;  4PF5 A;  4LBO A;  3I3Q A;  3OD0 A;  1B35 B;  3AMM A;  4JX0 A;  5A3U A;  3ZFE A;  1WUV A;  4QDQ A;  4AHZ A;  4FFF A;  3T0D A;  5FY4 A;  4AED C;  1ZX5 A;  1QH7 A;  2VZR A;  3ORJ A;  1BKZ A;  1TME 2;  4MGI E;  5EYX A;  1YJL A;  3WNP A;  5JSR A;  3CJI C;  3O1O A;  1AYM 2;  1H8V A;  1QJU 3;  2HWE 3;  3ZYP A;  2RE9 A;  4UFL A;  4LA3 A;  4N53 A;  1RVF 2;  2VAU A;  5HCF A;  1YYN A;  4GWN A;  1ZVF A;  5FP9 A;  2VCC A;  2FHR A;  2W39 A;  1AL2 2;  2WBK A;  3IDE A;  1X9T A;  3NAP A;  4FI9 A;  2XHN A;  4AQT A;  3LKJ A;  1ENS A;  1UKG A;  4EE2 A;  3VDB A;  5JXG A;  3H8R A;  1DQ0 A;  2L9L A;  2YZ4 A;  1D0H A;  3WW4 A;  2A71 A;  5HXM A;  2Y64 A;  1Q8O A;  3I8T A;  4XUT A;  4I2O A;  4WVM B;  3N7L A;  4LE4 A;  3PUA A;  3VBO C;  5JXJ A;  1UL9 A;  1JI6 A;  1H2M A;  2A73 B;  2WC2 A;  1ZZ8 A;  2W2I A;  2G9G A;  2VCM A;  2JDM A;  2E7A A;  4XF9 A;  4E4H A;  1PVC 1;  3ZFF C;  2XB6 C;  3WR0 A;  2HEY F;  4CCN A;  3CIH A;  2VNR A;  3PME A;  4YM0 A;  4JZR A;  5FYV A;  4JTN A;  1VMJ A;  2GME A;  2WFF 1;  4DIN B;  2HH9 A;  3BU7 A;  3UES A;  1HB2 A;  1RHI 2;  2W87 A;  4AWD A;  5A32 A;  1XC6 A;  4IE4 A;  1XB9 A;  3VHN A;  2VCB A;  4YW2 A;  1YQC A;  3A0N A;  3ZVX A;  4WBB A;  2PHL A;  1B35 C;  1RVF 3;  1OLM A;  2X53 S;  1X33 A;  3MYX A;  4IGO A;  4FAH A;  2XVL A;  1AL2 3;  3GBW A;  5FZE A;  1CES A;  1W0P A;  4RGA A;  4AVS A;  3AYD A;  1TVG A;  2Y6J A;  3IIA A;  2HWD 1;  3III A;  3ZSJ A;  1HXS 1;  2GC0 A;  3O1P A;  1W8O A;  2FDF A;  2P34 A;  4FT8 A;  2YG0 A;  1BQP A;  3ALQ A;  4DQA A;  1LJ7 A;  2ORX A;  3HD8 B;  1GWL A;  1WW5 A;  4RHV 3;  1RXG A;  2Q4S A;  3OJB A;  3Q8B A;  4OLL A;  4RQP A;  5F2W A;  2OYZ A;  3SIT A;  3VHR A;  1W8T A;  4BYY A;  1K42 A;  2BW8 A;  5DUX A;  5AVA A;  1O91 A;  5F39 A;  3BTY A;  5FXV A;  4TWT A;  5I0U A;  1WLW A;  4JHZ A;  2W08 A;  2Y6G A;  2NQY A;  1QQP 2;  2Y33 A;  1OLM E;  2F4P A;  1T2X A;  1OH3 A;  1UKR A;  2QQV A;  2PTM A;  3O1S A;  2VW0 A;  3P3P A;  4Y5Z 0;  4DXS A;  4PBO A;  2DCT A;  4H14 A;  4JKL A;  4XJ9 A;  1JZ3 A;  1GSL A;  5KHK A;  4LBK A;  1LED A;  5I0T A;  3I2D A;  4LHL A;  1JXN A;  4XAC A;  5FXX A;  4RFR B;  4XMI A;  3KB5 A;  5ACA 3;  5LY1 A;  1LB2 A;  3OUI A;  3FFQ A;  2CU5 A;  5GZD A;  5BUV A;  2YY1 A;  4P02 B;  5FYS A;  4YYO A;  1GR3 A;  4LO8 A;  5J37 A;  1RMU 2;  4FTS A;  1DQ2 A;  1UMI A;  1MEC 1;  3WXP A;  4A42 A;  1UD1 A;  2DF7 A;  1IZ3 A;  5D1I A;  1W2A X;  3OOX A;  1US2 A;  4BLI A;  2WQ8 A;  3WW3 A;  3AZX A;  1MS1 A;  5A3M A;  1BYH A;  4NIH A;  1BBT 2;  3W20 A;  4Q4V 1;  3MIC A;  4AGR A;  3T2P A;  3BOD A;  4IXL A;  4YW5 A;  1BVV A;  1VAV A;  2PEL A;  4R9D A;  5FZ7 A;  1HX6 A;  3WW2 A;  2NM1 A;  5IVE A;  5JOY A;  4A6O A;  3ZN6 A;  1G9B A;  2QZ2 A;  3E6D A;  1YO8 A;  3C7F A;  2ADD A;  3VKM A;  2ZEY A;  3KZ4 C;  4A44 A;  1CAV B;  2VNG A;  3SQO A;  4B7E A;  1S0J A;  1CR7 A;  1FPN 2;  5FZF A;  1D2S A;  3SC7 X;  2ET7 A;  4L11 A;  3NO8 A;  4CCK A;  1WCK A;  2JEC A;  5IK8 A;  4MLO A;  5FPX A;  3IB3 A;  1X50 A;  4XQW A;  2P3K A;  5AC9 1;  2QJV A;  3PJY A;  4JVA A;  4DUW A;  5D8A B;  2VZO A;  3J8F 2;  4N43 C;  4QU2 A;  5GZF A;  3EXU A;  4DY3 A;  1SPP A;  4IL7 A;  2ARA A;  5CZK A;  2X05 A;  1BBT 3;  5IVB A;  4XBL A;  3AL5 A;  2P1B A;  4I0A A;  2HYK A;  3E5X A;  4JRL A;  4NPL A;  1VBD 2;  1RUD 2;  3ZYF A;  4LQR A;  3VD3 A;  5A3N A;  5C3R A;  2UY9 A;  3ASI A;  2NN8 A;  2IXL A;  3OD4 A;  4Q0V A;  4NMI A;  2JD9 A;  1WBL A;  3POG A;  4P9Y A;  3TEX A;  4AED A;  4ZKT B;  4HKW A;  1TMF 1;  3O5S A;  4ATE A;  2JB4 A;  4RR3 C;  2X5I B;  5EJZ B;  4QU1 A;  1ZYB A;  3KMH A;  4FFH A;  3VZJ A;  3U0Z A;  5C6C A;  3LDB A;  1GWM A;  3LD8 A;  2MEV 1;  4GMP 3;  2I2S A;  3EMR A;  3ETP A;  1F5F A;  2BOI A;  4IUG A;  2RV9 A;  4EN8 B;  3ZO0 B;  4WZF A;  1X7N A;  3GM8 A;  5FZG A;  4HFS A;  3CO2 A;  4KG0 A;  4COU A;  3I3B A;  4RYD A;  2OUJ A;  4W65 A;  4AF9 A;  2XLA A;  3KV9 A;  1GOH A;  3TN9 2;  1JZ5 A;  4IEW A;  2X10 A;  3AXD A;  3KS7 A;  5L9V A;  1H0B A;  3ILF A;  4BQX A;  2A7A A;  3J8F 3;  4XFH A;  4LIT A;  1KS5 A;  3OY8 A;  1YQ5 A;  5FRA A;  3VBO A;  3QH6 A;  2VZP A;  4ASM B;  1W6P A;  4A4A A;  1ZBA 2;  4Y20 B;  1VBA 1;  3C7O A;  5A6Y A;  3AMN A;  2ZPX A;  1MS8 A;  1RUD 3;  1VBD 3;  4XUR A;  1V6J A;  4MX3 A;  4AXO A;  1JZ2 A;  4L97 A;  1C57 A;  5BNO A;  2QUO A;  4LLF A;  4YGC A;  5FJH A;  5JPM B;  5D8A C;  1TE1 B;  1UX6 A;  4HN1 A;  2WA4 A;  2ZGN A;  4PJY A;  2WN3 A;  2FZ2 A;  3LIH A;  1OA3 A;  1SZB A;  3VDC A;  1O3Q A;  1KFU L;  5EYY A;  5DXD A;  1XU1 A;  2WR9 A;  1B35 A;  3VKN A;  1UY4 A;  3MV1 1;  4KQ7 A;  3B3Q E;  4MOA A;  1PO2 2;  1ACC A;  1DFQ A;  1FNY A;  1HB4 A;  4QQO A;  3L9J T;  2X5I C;  4JHT A;  3WDV A;  3JUU A;  3AL6 A;  3MIE A;  4AGG A;  4UWD A;  1DGW A;  3M3O A;  5DUW A;  3ZOI A;  1EV1 1;  5KHH A;  1A3K A;  3NW4 A;  4Y22 B;  5CIR A;  1UX7 A;  4LJH A;  1ZBA 3;  5IVV A;  2P3Y A;  2BYV E;  4NRM A;  4P9W A;  3OF1 A;  5A7W A;  1FI2 A;  3JU9 A;  3USU B;  3I7D A;  1UZ0 A;  3MEP A;  2BGO A;  3CNA A;  4S2D A;  1K3I A;  3ZXE A;  1K45 A;  4FQ4 A;  2A75 A;  1RC6 A;  3GCW A;  4B7K A;  1VJ2 A;  5F5C A;  4I0B A;  2JD4 A;  3FFZ A;  1DDL A;  1ND2 C;  2DUQ A;  1IQD C;  4M3C F;  5SV8 A;  1KJR A;  4LKE A;  3Q9O A;  4K1Z A;  3ACF A;  1DG6 A;  1LU2 A;  4XDP A;  4ITC A;  5LBC A;  3LAG A;  4QMA A;  2H6C A;  2VW1 A;  4XFC A;  1IS4 A;  2AEZ A;  4QHB A;  1H4G A;  1AR7 2;  3RS6 A;  3SH5 A;  3ZN4 A;  4CU8 A;  4Z2W A;  2HWB 3;  1OLR A;  3OBA A;  2EXH A;  1JYC A;  3N9L A;  1JS9 A;  1PIV 1;  3ZFG B;  1W90 A;  4UF0 B;  5DDJ 2;  3MFA A;  1JZ7 A;  2CL2 A;  1AUY A;  1QOO A;  2ZJC A;  1N3O A;  2Y34 A;  2ZZQ A;  1E57 A;  1QOS A;  1RUJ 2;  3GZU C;  3HEI A;  4M00 A;  1D4M 2;  3VBS B;  4ZS2 A;  1WMF A;  1QF3 A;  2R07 2;  4XZP A;  2XBO 3;  2ZXQ A;  4QGN A;  3TNQ A;  5IK5 A;  3THC A;  1QJX 1;  2Q5T A;  3M3Q A;  4W8J A;  1GU3 A;  3FBM A;  1VBC 1;  1W3X A;  3HVD A;  2XR4 A;  4LUK A;  2CV6 A;  5JMC A;  1FAT A;  3WF4 A;  2VQ0 A;  2JDK A;  4IGQ A;  5A3T A;  2VU9 A;  4XUO A;  3B9C A;  3GCX A;  4QGM A;  2TUN A;  2W91 A;  1QGL A;  1ULF A;  3LA2 A;  3DCQ A;  3PVB B;  4HVO A;  3WG2 A;  1POV 3;  1DZR A;  1BXH A;  2A6Y A;  3F95 A;  4UXA A;  2WAA A;  3Q8F A;  5DDJ 3;  3I49 A;  5GAL A;  3UL2 A;  1AJO A;  1PHM A;  3IDC B;  2B5H A;  5HPO A;  4CDX B;  4MV2 A;  2C0Z A;  4A41 A;  2VUL A;  1FT9 A;  3N9N A;  3TRS B;  1XYO A;  4OUS A;  1RUE 1;  5JR2 A;  1W8W A;  5A3L A;  1WA6 X;  3FLP A;  4FOW A;  4LKD A;  4HOO A;  5GZG A;  2HWF 1;  2H6B A;  2PHF A;  3LOI A;  4UYB A;  4LNV A;  4W6Y A;  2XJV A;  4EN7 B;  4N43 A;  3ZFG C;  3AZV A;  2ZX2 A;  4V2V A;  2BNO A;  1OQ1 A;  2VUC A;  2ZCW A;  4HZF A;  4BM8 A;  4GWJ A;  1H9W A;  1TME 1;  4ZXE A;  1OPM A;  5IWF A;  2FDJ A;  1LEM A;  4XXA A;  4PBP A;  4HK9 A;  1GAN A;  3T30 A;  2WFF 2;  4R9A A;  1LOA A;  3VBS C;  1W03 A;  3WDW A;  2VZ1 A;  2Q0A A;  4DXT A;  2BTV C;  4RR3 A;  1EPW A;  3PLQ A;  4XAA A;  3RVH A;  3VZK A;  3M70 A;  5EPA A;  3LEK A;  3OUJ A;  3ZYI B;  2KA3 A;  1ULG A;  2VD7 A;  5DG2 A;  2PA7 A;  3KT1 A;  2WAB A;  2VL4 A;  3QH7 A;  1GIC A;  2EAK A;  4ZZ8 A;  1HRI 3;  3O7O A;  4AI3 A;  1I5P A;  3WG3 A;  3C7G A;  2HWD 2;  2ETE A;  1OH4 A;  2A6Z A;  2WL1 A;  1QKQ A;  1HXS 2;  3MIF A;  4BHP A;  5GZC A;  2RM2 2;  5FMO L;  3CBN A;  4AQS A;  1Z7S 2;  4XFI A;  1QOT A;  4I09 A;  2VME A;  2VZQ A;  4NRP A;  1HV1 A;  2IXC A;  3D4K A;  1GZ9 A;  2V72 A;  5FLH A;  2CHH A;  3BOW A;  1LEN A;  1PVC 3;  2W5F A;  3POS A;  4NVP A;  4Z2A A;  2BGC A;  2VMD A;  4IEX A;  4OYU A;  3WV6 A;  1BEV 2;  4CDX C;  3EB7 A;  4NPM A;  1WLD A;  3H42 B;  2JWP A;  5H9S A;  3T1M A;  5FOJ B;  1RHI 1;  5T50 A;  5L36 A;  1NE6 A;  3ON7 A;  5D8A A;  2XUM A;  5A6Q A;  3WIN E;  4G4F A;  4JV4 A;  3KHC A;  1BCX A;  4LMF A;  1UCX A;  3AP6 A;  3EQE A;  3F2Z A;  5FP7 A;  4AEM A;  4CDW B;  4EWD A;  3NNF A;  3ENR A;  3SH3 A;  1MQT C;  2PHD A;  3BB6 A;  5H9P A; 
#chains in the Genus database with same CATH homology
 4OCT A;  3BU0 A;  4ZHN A;  4O61 A;  3BIE A;  2IUW A;  3I49 A;  3I2O A;  2FD8 A;  4IE7 A;  4QKN A;  4IE4 A;  4IE6 A;  3O1V A;  4NPL A;  4MG2 A;  4ZS2 A;  3RZL A;  4NID A;  4QHO A;  4NRQ A;  3RZJ A;  5F8P A;  4IE0 A;  3BTZ A;  4NII A;  3BKZ A;  4MGT A;  3O1P A;  2FDF A;  3RZH A;  4ZS3 A;  2FDH A;  3RZM A;  3RZG A;  3BTY A;  3RZK A;  3LFM A;  3O1S A;  5DAB A;  3O1M A;  3O1U A;  3O1R A;  2FDJ A;  4RFR B;  3BTX A;  3KHB A;  3S5A A;  3H8O A;  3BUC A;  2FDG A;  4NRO A;  4JHT A;  4O7X A;  4QKB A;  2FDK A;  3I3Q A;  3T4V A;  3S57 A;  3T4H B;  4CXX A;  4NRM A;  3I3M A;  4NJ4 A;  4NIH A;  3O1O A;  4NRP A;  4QKF A;  3H8X A;  4QKD A;  3BI3 A;  4NPM A;  4CXY A;  4IE5 A;  3O1T A;  2FDI A;  4IDZ A;  3H8R A;  3KHC A;  4NIG A;  3T3Y A;  4CXW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...