4D0QA

Hyaluronan binding module of the streptococcal pneumoniae hyaluronate lyase
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
161
structure length
161
Chain Sequence
MQNLVENGDFGQTEDGSSPWTGSKAQGWSAWVDQKNSADASTRVIEAKDGAITISSHEKLRAALHRMVPIEAKKKYKLRFKIKTDNKIGIAKVRIIEESGKDKRLWNSATTSGTKDWQTIEADYSPTLDVDKIKLELFYETGTGTVSFKDIELVEVADQLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords HYALURONATE LYASE
publication title Conformational Analysis of the Streptococcus Pneumoniae Hyaluronate Lyase and Characterization of its Hyaluronan-Specific Carbohydrate-Binding Module.
pubmed doi rcsb
source organism Streptococcus pneumoniae tigr4
total genus 35
structure length 161
sequence length 161
ec nomenclature ec 4.2.2.1: Hyaluronate lyase.
pdb deposition date 2014-04-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 4d0qA00
3SKVA 2QQJA 1OF3A 2WDBA 4P02B 1PX4A 4DEQA 2VZSA 4E8CA 2Y6JA 2VZTA 2VZOA 2JE8A 4P5YA 2EIEA 4A45A 4OMDA 1BHGA 1KGYA 3K4DA 3MO4A 5JR2A 1F4AA 3U37A 1W9SA 2J1RA 2RJ2A 1NUKA 2KD7A 3GDBA 2YB7A 1MPXA 4FI9A 4KWUA 1LNSA 3T0BA 3WNKA 1NX9A 4HG6B 3WNLA 2Y8KA 2BERA 5A1AA 4A4AA 1D7PM 4TXWA 3ZM8A 3DECA 1GU3A 3I2GA 1P8JA 3I2IA 3UESA 3I3EA 1PMHX 1OD3A 4A3ZA 1US2A 2V4VA 1GOGA 4QB6A 2QQNA 1JZ6A 5LA2A 2C9KA 2VC9A 1JU3A 4P08A 3K46A 4IUGA 2V72A 4CUCA 5JMOA 2XHNA 5B4XA 3I2KA 3VD4A 3C8XA 4ZY9A 3D3AA 4M4PA 4D0QA 1SDDB 1JZ8A 3C7OA 5C7GA 2W3JA 3VD7A 3WNMA 5G05L 1UXXX 4JHZA 2WAAA 5JXIA 5G04L 3LEKA 4DXRA 5HPOA 3MUZ1 4UAPA 3T09A 1O59A 3T0AA 2VQUA 3A22A 1OF4A 2R7EB 1YQ2A 3NNGA 3P1IA 4DEVA 3VD5A 4ZZ5A 3CZJA 1CX1A 4P00B 2QQIA 2J1TA 4ET7A 1US3A 3DYPA 1W8NA 4MGQA 2ZEYA 1K45A 3LPFA 4AG4A 4DUWA 1GNYA 4D8MA 4LPLA 3AC0A 4A41A 2J1VA 4XUPA 2YG0A 4QAWA 5JUVA 5LA0A 4M4RA 2CDPA 2VZRA 3HJRA 2W9XA 3P6BA 4JX0A 1XNTA 4QPWA 2QQOA 2YFUA 2VTFA 1F4HA 4TTGA 3GXUA 3THDA 1DP0A 3BN6A 2Y6LA 1IQDC 5IFPA 5LA1A 2PQSA 1J83A 3FL7A 1UY2A 1DYOA 1L7RA 4A6OA 2YC4A 3I97A 2LW8A 4MO3M 2CDOA 2VMDA 1L7QA 3LE0A 3NQHA 3T0DA 2WZEA 3A21A 2J1EA 3EYPA 1UX7A 2J1SA 5FUIA 4DXTA 1UYYA 4GZ9A 4LKSA 4KI5M 5EJZB 2WYSA 3E1F1 3CDZB 3MUY1 2WO3A 3WF1A 1W8OA 1J84A 2X05A 4QX1A 1UYZA 4JKLA 2QQMA 2C26A 4RYDA 1K3IA 4UOJA 3JXSA 2W5FA 3CIHA 3ACIA 3UNPA 3HN3A 1XC6A 2HLEA 2E33A 1W9WA 2Y6GA 2VMFA 3LPGA 5IFTA 2VZQA 3HPNA 3UETA 1H6YA 3MBWA 4ARYA 3T08A 1UY0A 5B4NA 2ORXA 2W94A 1UWWA 4OZOA 2VZ3A 3VDAA 3DYMA 2EIDA 2VL4A 1JI6A 3IB3A 3IIIA 1W9TA 2W1UA 1GUIA 2XQXA 3ACFA 1ULPA 4XUTA 1O8PA 3OB8A 2JDAA 2WN3A 5DQ0A 2Z4FA 5J1XA 2VJXA 3GM8A 4QDRA 1OT5A 2VCBA 2XOMA 3ABZA 3C7HA 4CUBA 4DUVA 2V5DA 2VZVA 4OMCA 4CU7A 1DLCA 3CQOA 1UMIA 1GOFA 2W95A 4W4ZA 2WUHA 4QDSA 1PMJX 2VCCA 3OGVA 3OGSA 4XUOA 2JKXA 1GMMA 4L0PA 1JHJA 2YFZA 4PQQA 4PT6A 2EIBA 4MADA 3I3BA 1JZ3A 2VO5A 3NRUA 1JYVA 2WBKA 3HNBM 3A7QA 1ULOA 3CZUA 4KMQA 4BK5A 3GGLA 4MGSA 2EICA 2XONA 4CU8A 2W1QA 1UY3A 5JXJA 1XPWA 2BZDA 3VD3A 1RYYA 4PF1A 3NJXA 3WSOA 1HN1A 3FN9A 3FHQA 2BGOA 4ARXA 2X10A 1R64A 3T2OA 3A23A 2WZ8A 3OEAA 3HNMA 3PUHA 2RV9A 3WQBA 5C70A 3WF0A 5IJRA 2W46A 2C4XA 2W91A 3ACHA 4BJ0A 1UYXA 2LS6A 2DDUA 1EUTA 1JZ7A 4Z2AA 2QQKA 4CU6A 2VCAA 3WF4A 3C7GA 5DN2A 2YC2A 1JYNA 3ETPA 2WABA 3THCA 5EIYB 2Y6HA 4OUEA 4QDQA 4DUXA 2VQTA 1JZ4A 2J22A 2DCJA 3WNNA 4A42A 2VM9A 2BBAA 3SEEA 3ECQA 5DPNA 3EB7A 2WO1A 2ZEWA 3K77A 1XNAA 4LQRA 1K12A 4ZZ8A 3LEGA 2VOTA 2BGPA 3I2HA 1CZVA 4W8JA 3IAPA 1UZ0A 4RN5A 5F7UA 4UI9L 3I2FA 4BXSV 2VMCA 2W47A 3HNYM 2E32A 3VD9A 5CYYA 2W87A 3OGRA 3OEBA 3IDAA 5LCWL 5IYYA 3BGAA 2J1AA 2VZ1A 5HXMA 3MV11 2RVAA 5C71A 2ZEXA 2DCKA 3IAQA 4A44A 1JU4A 1K42A 5EJ1B 5I0DA 3MV01 2ZEZA 3K75B 1CZTA 2QQLA 4XUQA 1WKYA 3WF2A 4DXSA 1SHWB 5DMYA 1JZ2A 1H6XA 1JYWA 2VMEA 4AAXA 2VZPA 3K4ZA 1EUUA 1WCQA 1W0NA 2W92A 3I3DA 3ACGA 1O8SA 2W1SA 2Y6KA 3CMGA 1TVGA 4CU9A 1NAEA 4QX2A 4E8DA 3FHAA 3OG2A 4QB2A 5JXHA 1NKGA 3CKHA 3LQCA 3C7EA 1UXZA 4XUNA 2WN2A 3SKJE 1OH4A 2ZXQA 3F2ZA 3W5MA 1CIYA 2HYXA 3I2JA 1JZ5A 1I5PA 1PX3A 1SG3A 4W50A 4CVUA 2B9VA 1KEXA 4XURA 2VZUA 2E26A 1GQPA 2Y64A 3T2PA 3WNOA 3WNPA 1UY4A 3J7HA 1UY1A 4XZUG 3HEIA 4OYUA 4GWJA 3C7FA 2WQ8A 3HOBA 1TG7A 3NJVA 1UMHA 2J1UA 3K4AA 3VDCA 3WEZA 4MOAA 2J7MA 4YPJA 5IHRA 3T2QA 1JYXA 2ORZA 2L9LA 2E31A 2WAOA 4BDVB 3LEIA 4XVHA 1CZSA 4QX3A 2JD9A 4BK4A 2W1WA 3OBAA 3W5NA 3WF3A 2QBXA 4QX0A 2X09A 4ZXEA 4QB1A 1T2XA 2OKXA 3VDBA 4GWIA 5JXGA 2B4KA 2ID4A 3PUIA 4JKKA 2VR4A 4LHSA 5CZKA 3DYOA 4CUAA 3SEPA 2WO2A 4JKMA 1W99A 1GOHA
chains in the Genus database with same CATH superfamily
1W0OA 1PGW1 4KQ7A 5CKMA 3ZYBA 4YFZA 2QQJA 1FV2A 2CSGA 1DYPA 3FUOA 5FUNA 1OF3A 3GBGA 1Y4WA 4P02B 4PLOA 4MGKE 4DEQA 2EVXA 4L92A 2XJPA 4WVWA 1JOBA 3HQUA 4GB33 4K40A 2VTXJ 2VNOA 2VZOA 3D82A 4AF9A 1HQLA 1TMF2 5JWPA 2RM22 2OQ6A 3UK9A 2EIEA 2WFPA 4FT8A 4TWTA 5FLHA 1BHGA 1PNFA 3MO4A 2AH2A 1F4AA 4CDUB 2PTMA 3VBSA 3N35A 3WR0A 1S1AA 4G3YC 5FZHA 2B42B 1MPXA 2KR2A 3CJIB 4KWUA 5JI7A 2F6BA 3WNKA 3WG3A 4BQ5A 4COZA 5L7OA 2Y8KA 1E5IA 1YNAA 2RS32 3N4MA 1WZXA 3M1HA 3UJQA 4ORFA 4OI1A 1GU3A 1P8JA 2NP0A 1XU2A 4X6QB 2BEOA 2BV4A 1C8M3 2CGNA 1QKQA 1YI7A 4EWDA 1ZRFA 5FMOL 4V2WA 1OQEA 2K46A 2JG9A 3MW4A 3MICA 1R081 1UAIA 3O14A 3AK0A 1CAUB 2JDHA 5KWRA 5J96B 1ASJ2 2V72A 1PK6C 5KHKA 2YHJA 2XHNA 2UYAA 2HWE2 3I59A 4PF5A 1BXHA 5JMOA 4NUBA 4BCUA 1RUNA 2D93A 2XBO2 4RA0A 2OW4A 2PHLA 3C8XA 1ZBE3 4QU1A 1PHMA 3GYDA 1EAH1 5FZFA 2YV8A 1J1LA 2A6VA 4QQLA 2WNVA 3RZJA 4XMIA 4ZKTB 4TLFA 5KXBA 4XPVA 2JICA 3PNAA 2Y34A 2JDNA 3C7OA 1C1LA 1GICA 1NXMA 5G05L 2VBBA 4YW4A 3HBZA 4JHZA 5EYYA 1GQHA 4PJYA 4XQ4A 4GJYA 2Q8DA 2WAAA 3AX4A 3VLBB 3KM5A 1VBB3 2OZJA 3MFCA 1WMFA 3LEMA 1RUH3 2IVIB 2XG3A 3E6DA 4IEPA 4LULA 1W9YA 2ZHMA 5T5JA 4UAPA 3H7YA 3VBFC 3WUCA 4IDZA 5CVRA 5EV7A 2EALA 2RM21 3MIGA 4E4HA 4CPBA 4TN7A 2P4EA 1DQ1A 4YW7A 3VKLA 3MLKA 1OF4A 3TWIA 3ZPOA 1YQ2A 3NNGA 3R0RA 3KT4A 1BBT1 2A7AA 5FPZA 4I30A 3P1IA 3AZZA 4FPGA 5JLVA 5CFDB 4WM7A 2QQIA 4IV1A 1BCXA 2J1TA 2YU2A 5D8AB 5C3QA 3SCHA 1W8NA 2ZEYA 1B35A 5C6CA 3HT1A 3LFIA 4A41A 4QQ2A 1CX4A 4XFIA 1F8VA 4QAWA 1O7FA 1QH6A 2BGCA 3B01A 3MLJA 1LHOA 5GJ6A 5LA0A 2VAUA 1ENXA 3U1XA 4FPHA 5EJ3A 4M4RA 1OPOA 2V5YA 1RUI2 3ZXLA 2QFEA 4S2HA 4CEWA 3LSEA 5JOXA 1T6BX 4W6XA 5HBAA 2O8QA 2P3IA 3BN6A 1RINA 3ZIWA 2ETEA 3RJ2X 3ZR5A 3LAGA 4I3GA 5LA1A 2R30A 2UURA 2XUEA 5GZEA 4XAAA 2HKXA 5FOJB 3ZFGA 1WMEA 5FYTA 1DGRN 3VZNA 2WYFA 1KDMA 4QKNA 4RQPA 3HWJA 3I4IA 1NZCA 1YEWA 2Y33A 2ZCWA 5DDJ1 4NIHA 1XE8A 2LW8A 3AL6A 4XE9A 3ZSMA 4MO3M 4Q4Y1 5HI0A 3LE0A 1H8TA 4LBKA 4HBNA 5T55A 3O0VA 2CY6A 2J1EA 1ALYA 1EV12 1D4VB 1UIKA 1UX7A 2WWJA 4JC1A 4CDXC 4H55A 5FUIA 2GNTA 1CD3G 4FTEA 2V4AA 4Q4X2 1RUJ2 3THTA 3ZFEB 3ZN6A 4GZ9A 1NY71 2ZGKA 3IBMA 2Q5TA 1VJ2A 1ND2C 1W6MB 2R0FA 1UN1A 2FQPA 4XILA 1ZRDA 3CDZB 1XSRA 2ZGUA 1PO22 1ZRCA 1CQ9A 3WF1A 5C4WC 2CWMA 1W8OA 4DINB 4SBVA 1J84A 1ONAA 5FY0A 2ET7A 1K5MA 3VBOC 1GZ9A 5LK5A 1ZZBA 1JUHA 1RTVA 2K2SA 1XBFA 4C1XA 5I91A 1RJ7A 5T3NA 1SBEA 1OXCA 2VNGA 4EV0A 3JXSA 4N7IA 4OVEA 4ASKA 3ZKYA 3NNFA 2A75A 1WGPA 3ES1A 5F39A 2BYVE 3KV4A 5T54A 3DV8A 3VHRA 5B2GB 1CN1A 5BNOB 4QQPA 2DVAA 3AZXA 1XC6A 1NCQA 2P3YA 3POWA 1GZTA 4GQ7A 2Q30A 4RS5A 1Y9GA 1HB3A 1W8FA 2PHTA 4JAAA 5JR7B 3RFRA 5JMCA 1W9WA 5EP9A 4OCTA 3NAPB 3I7DA 4TYSA 4BQ3A 2V09A 1FX5A 1VBA2 4P9JA 1W8UA 2VZQA 3TEXA 1WA6X 3RZHA 2ZGTA 1RMU1 4JQTA 1KJRA 1XE0A 5B4NA 3I2OA 2ORXA 3M70A 2VD7A 2NPIA 3USUA 3HN1A 4DQAA 1GP4A 4ISQA 1F15A 3VDAA 2FHRA 3VBRC 2RMU3 4CDQB 2ZX3A 2EIDA 4GH4C 1R092 4NWVA 3WINE 3IB3A 3N9OA 4Q0PA 5GLUA 2W08A 3NNLA 1GUIA 3NV4A 3CBNA 3OB8A 5FP7A 3ZFFB 2WN3A 3VDDB 1HV0A 1VB2A 5BPXA 2SLIA 4RL7A 5ACA2 1LESA 3ZIXA 5CB7A 4QDRA 1OT5A 4Z82A 3WDUA 4Y20B 4A3XA 4CUBA 1TNRA 4DUVA 1H4HA 2VZVA 2MPFA 1XYNA 4WVMA 2XJUA 4JRLA 3T1LA 4CDWB 2G9FA 2A6XA 2Q8CA 4RGKA 5BNNA 2RR12 3R4UA 4IERA 4N9IA 1G9BA 2JDPA 2H6BA 2XJVA 3CEWA 1LKNA 1PMJX 3V0BB 4JV4A 1TMF3 3OGVA 1AYM1 4XUOA 3FUQA 4CCNA 1GMMA 1HRV2 1JHJA 4AFAA 1QEXA 4R4XA 5A7QA 3O1UA 2R1DA 1VRH2 3RG0A 3U10A 3DCQA 3J4UH 1JZ3A 4AE2A 2VO5A 4NOTA 3IMNA 3CJIC 3ZR6A 3S57A 3CZUA 1VIWB 2JDYA 3IM0A 4LOTA 4BK5A 5FP9A 4LOSA 4MHUA 3GGLA 4MGSA 2Q1MA 2VXRA 5AC93 1BQPA 1OI6A 2VVEA 3DEMA 2RS33 2XONA 1FAYA 2GNDA 4LJHA 4JGYB 1SQ4A 1XNDA 2YZ4A 5CBLA 4D94A 1XPWA 2OYZA 1W6PB 1RYYA 3TRSB 3WSOA 2JE7A 4K1YA 4CP9A 1HN1A 4JGZB 4XIOA 2FDIA 5F3IA 3M3OA 3MF6A 1AR83 1OBNA 2GC1A 1R64A 2IXLA 3OY8B 2WZ8A 3OUIA 4YM0A 4XBNA 5JPNB 4L8QA 5J7MA 2JB4A 4R4ZA 3WF0A 1ASJ3 1JYIA 2W46A 4NIIA 3QACA 2PXJA 1LOFC 2CL2A 4EN6B 2HWE3 4PLNA 1EUTA 3AP6A 1RUOA 4YZ4A 4FPJA 4YVSA 5A6ZA 4XTPA 2XBO3 3POIA 5FAXA 5KHHA 4ES9A 4R8HA 1SACA 4K1ZA 4CU6A 4PBOA 1JS9A 4A2UA 4BQ2A 3C7GA 5FREA 1UKGA 3E5UA 5EYXA 3GZUC 3IDEA 3ETPA 2EAKA 3DPRB 5ACA1 4OUEA 1FMD1 5FKBA 5CFCA 5I93A 5K0UB 3BKZA 5LA9A 2A3YA 2DCJA 4LBMA 4A42A 3QH6A 1SMVA 3WP5A 1QJY1 2DVFA 4OZXA 4YZ3A 4LKEA 3ECQA 5DPNA 3O1PA 2QVSB 2Q0AA 3AMPA 4EWEA 1WBFA 2VTXA 3J26N 4YGDA 3IKWA 1YYNA 4XBQA 3ZSLA 2A3XA 2K9ZA 2YDEA 3H1YA 4L9BA 5A32B 1K12A 2DV9A 4HSLA 2CGOA 2VOTA 1VALA 4YGEA 5BY5A 4EQVA 3U0ZA 4OHVA 1UZ0A 3T30A 4N53B 4QX5A 1GNZA 4QXBA 5FZ3A 2OZ6A 1DLLA 1NA1A 2WNUA 4JTNA 2YXSA 4DPNA 1MEC2 3AKPA 1RVF2 3P5BA 1CJPA 3AP4A 5D8AC 1U5IA 1DQ2A 1EPZA 3IDAA 5KHGA 2DF7A 2JKBA 1G9CA 2XVLA 5LBBA 1S2KA 2QJVA 2J1AA 3MZHA 2EAAA 1YCIA 2RVAA 4RHV2 2WQ4A 2I07B 3OCPA 2ZEXA 5A7SA 1H9WA 4CCCA 3U4SA 2MHFA 3SHRA 2C24A 1MQTA 4XQWA 1RUI3 5JZGB 3SC7X 3KQRA 1RUG2 3GZTB 3BTZA 2HWD1 1UF2C 3WDYA 4URAA 3D6EA 2B45X 2DVBA 3H50A 4BQYA 3DKWA 3MV01 2ZEZA 1YQ5A 2YBPA 2QQLA 3L2YA 3GJAA 3EHKA 3WF2A 3B3QE 5BNPC 5C5UA 2WWSA 1H6XA 4IE5A 5E88A 3WDWA 5JSPA 1H1IA 1BLZA 2WNEA 3LDBA 2VZPA 1RUD2 4N90A 4XMAA 4YLZA 1WCQA 5GZGA 5FK7A 1OKQA 1RHI2 2W92A 4DMIA 1BK1A 2W1SA 3GF6A 1EV13 5FZKA 4CU9A 2NQYA 3N9NA 3ITQA 4Q29A 2JX9A 3N9QA 4GB32 1U0AA 4R52A 4Q4X3 1RUJ3 1DYKA 1H30A 1SFYA 5DG1A 3ZFEC 1OOPB 3I59B 4LIVA 3FHAA 3LA7A 1WCUA 2DBIA 1UQXA 3EO6A 2LTNA 4JTOA 1CWPA 1Q3EA 3LIHA 2F4PA 5LEJA 1PO23 2ADDA 4YW1A 1OH4A 4I02A 3BTXA 1RUE2 2IFWA 1MS1A 2IVJA 2P3JA 2ZGPA 1XRUA 2ZXQA 1CIYA 1O4TA 2CNAA 4QD2A 5IVBA 1UZZA 2HYXA 4URTA 5H9SA 3ALQA 3DGTA 2LRPA 3ST7A 4GALA 1SG3A 2NZ9A 4FFFA 4UFMA 1RB8G 3NO8A 3AMMA 5FMOS 4KL1A 4Y24A 2Y64A 1CIWA 3WNOA 3NNMA 3VGIA 5C8CB 3WNPA 1VLNA 4FAGA 2VG9A 1A6CA 1FATA 1MEC1 1U5YA 1RVF1 1YUDA 3NKTA 5BNOC 1W6OA 3KHBA 2WLPA 1F5FA 3KVAA 1TG7A 2G9GA 5F3EA 2J1UA 4AQTA 3WW1A 4AW7A 4D7SA 1QDOA 4N8MA 4PIXA 1PM7A 1VBC1 4RHV1 3VDCA 1HW5A 1NG0A 1V6OA 3NV2A 1VP6A 1W3XA 4IEXA 4LA2A 4AGRA 1JYXA 2ZPXA 3NAPC 4N43A 3O12A 4AVSA 2E31A 1RUC2 4UW3A 1VBA3 3ZVXA 1W9FA 4E4ZA 3WVJA 4WZFA 3O1OA 3LEIA 2EXJA 4Q4V2 1QJU1 3CHXA 3PDQA 4CZSA 3O5SA 4Y22B 1L7LA 4OLLA 1RUF1 3H9AA 2FCUA 4MLOA 1QF3A 2IFRA 4AEKA 4BIFA 1PO12 4ZXEA 3V56A 4CDQC 1R093 4QB1A 5FZ8A 2OKXA 4K9SA 1MZEA 4A6SA 3VDBA 1JN2P 5JXGA 1GWLA 4LO5B 1JXNA 2VQAA 3ZFFC 2PMWB 1I6XA 3N7KA 3OOXA 1X9TA 3MIDA 3VDDC 4EN0A 2HJIA 4CUAA 1VBB2 4QQOA 3I8TA 4UT5A 1AX0A 4QPGA 1RUH2 3OBRA 3ZYPA 5F3GA 1ZA4A 1W99A 1W8HA 4HSJA 4Q27A 3PIJA 1A34A 1HXS3 4BQWA 1RXFA 4GB31 3TYJA 2HBTA 4YVWA 2WDBA 4Z92B 1UOGA 1NLSA 5FCCA 4CDWC 2VZSA 4ZS3A 3VUOA 5FZ1A 2RR13 1S0BA 3WP3A 3ZYRA 3TN92 4OI2A 4XF0A 3DN7A 4CCDA 2XWBB 4YGBA 1X8MA 5A6XA 4B8EA 4BQ1A 2ILMA 3SH3A 3PVBB 1ZA7A 5JI9A 2BNMA 5JVVA 3WQ1A 4UF0A 3K4DA 1HRV3 4S2DA 5JR2A 3IPVB 1ENSA 1W9SA 5FPXA 3ATGA 1VRH3 2DTWA 2XJSA 3GDBA 4MVTA 4CCOA 2QE3A 2YB7A 1VAMA 2ZKLA 3KGLA 3W20A 3RSJA 2NMNA 3ZXFA 3H3UA 3SCFA 1LHWA 5CIRA 1QY4A 1YHFA 2ZMLA 5GLWA 3WNLA 4B4RA 3HBKA 2WZR3 5F5AA 3ZN5A 2QZ3A 1C8M1 4AOCA 2WQZC 4LNVA 3EBRA 4JGYC 3I2GA 5LBCA 1VRBA 3UESA 2W39A 3TBDA 1K5MB 4QX8A 1CESA 4QU2A 5GLVA 1PIV2 1PMHX 2H6CA 3B9IA 1OD3A 1O3RA 2GSYA 4BXFA 1US2A 1O6UA 2V4VA 1E5HA 5F6LB 4JGZC 2GP5A 1JTZX 1LGBA 3B69A 1IQAA 5FZOB 5LA2A 2D6OX 2C9KA 2VC9A 4HONA 4P08A 3VHOA 3USSA 2DYCA 3JBG2 4QPIB 5F6KA 1ZBE1 2JIGA 2IXCA 2VW1A 5DAWA 5I8SA 5FZLA 1NCRA 4FO9A 4IE7A 4ZY9A 3SNMA 2DTYA 4IETA 2WSUA 3D3AA 1YWKA 2C0ZA 2D7FA 3RPQA 1YRZA 3AMHA 1LB2A 1T6GC 1S0GA 2JENA 1RJ8A 1SDDB 2G4IA 1IKPA 3DPRC 5C9AA 2ZGQA 1VBB1 5K0UC 1WLTA 3POYA 1UXXX 4QM9A 4CP0A 3VV1A 4DNYA 3KV9A 1GSLA 2X5IB 1XU1A 5FPUA 1MACA 5G04L 4AQSA 1A3KA 5DUXA 1FPN3 1YIFA 2DUOA 5A6YA 4XDOA 1QMJA 4YW2A 2UWBA 2WA3A 1O59A 1NYWA 1PGSA 2VQUA 4I01A 4BLJA 4N53C 4Q1RA 5FPBA 3LSDA 3VB9A 5LBEA 2WKKA 4XDQA 3PMSA 2AENA 4XF4A 3PVEA 1KD7A 1YXWA 4AEJA 4INDA 3AP9A 4BZ4A 3MIHA 5A3OA 2H0VA 2XKPA 4KGQA 4P00B 4EN9B 3OD0A 4D3WA 4ET7A 2ZOEB 3ME2A 1K45A 2I74A 5AFBA 4ASLA 1G9AA 5D21A 3ZDVA 1LRHA 1OLMA 2YG0A 5L9VA 5FY4A 1QWRA 1VBD2 1UYPA 4CRQA 2OPKA 4QGLA 2CDPA 3HJRA 2E7TA 3I54A 4QPWA 2ERFA 1S0FA 2QQOA 3CNAA 5JZGC 1RUG3 4I0WB 4J1XA 4UFKA 5D2AA 2RMU2 3O1SA 1W3VA 5SV8A 4FSJA 4LHLA 4NHMA 2BOJA 1WD4A 3GHMA 5IFPA 2WR9A 2GC0A 3MW2A 1LHUA 3BIEA 5I0RA 2PQSA 1ZYBA 3FBYA 5FXVA 1HQNA 3LWCA 4P14A 3VL8A 3RZKA 3VHNA 1UY2A 2BFUL 2EXHA 1OPMA 1JH5A 1RUD3 2P5BA 4A6OA 3I97A 2WFF3 5IAVA 4XXAA 1LHNA 4IGPA 5C33A 4M3CE 1L7QA 2Q8EA 1RHI3 5F8PA 3WQ7A 4AHWA 4IEWA 3H8UA 2YPJA 4IQPA 1FT9A 3OD4A 1POV3 5FV3A 3WHTA 3HMYA 2AGSA 3MGUA 4FFHA 4H2AA 4NPRA 1OOPC 5FZ9A 3AYDA 4MV2A 5EJZB 3RQ0A 4M3CF 1PGL2 1NE4A 4EROA 4ZU4A 5DXDA 4LO7A 3VKOA 1NLQA 2WO3A 4RR3B 5HCBA 4C0HA 5LEKA 1PZ7A 1OKOA 3C3VA 1PZ8A 1IG0A 4LK6A 4QX1A 1RUE3 4BMBA 1BVVA 1PVC3 2CAUA 3B9CA 1COV2 1I3HA 3WT3A 5CFCB 1JYTA 5FLIA 3H1MA 1D4M2 3NV1A 4LBQA 4Y5TA 4YW3A 5AC92 5A33A 2GU9A 1VAKA 3JQWA 5DG2A 1UPSA 2PAMA 3OBZA 3O1VA 2W5FA 4EE2A 5I8TA 3KV6A 2B5HA 5C8CC 3AFGA 4ZPIA 2QQVA 1YFWA 4RGGA 1AF9A 4XW3A 2VBPA 1C5IA 2HWF1 2JDUA 1WLDA 5H9RA 4P9YA 1AR82 3ZX7A 4AZZA 1ND3A 2JG8B 1TME1 2JIJA 2YBSA 4GKXA 4MGIE 1CPNA 4W6YA 5FY7A 3RNSA 1BMV1 4AVCA 4AK3A 1R1A2 3VBHA 1QNWA 3AXEA 1TZOA 2ZJCA 1N1YA 1NA1B 2VMFA 2XB6C 3PUAA 1DQ5A 2ZTNA 5GLTA 3AMQA 5IFTA 1RUC3 1WD3A 1H6YA 2RMU1 3OF1A 1I9RA 4ARYA 4Q4V3 2VH9A 2WINB 3WW4A 1UY0A 4FFGA 4WBBA 2NM1A 3AP5A 1UWWA 4Y5SA 4C91A 1SBDA 3M3QA 2WT1A 3WXPA 5J98B 1CAWA 1RC6A 3DYMA 1PO13 2VUCA 2AEYA 3IIIA 2HWB2 4EJRA 2W1UA 2WT2A 3V0AA 1O8PA 4Q4W2 3PJQA 5ISLA 2RDRA 3B93A 1C8NA 3DL3A 2Z4FA 4HMZA 5FMCA 5F37A 2ZA9A 1K5JA 4RFRB 4WM8B 2XH6A 1CAVB 4IE6A 3ABZA 1E5RA 4NROA 1UZVA 5H9PA 2V5DA 1YJLA 1SDWA 4OMCA 2EA7A 5HXVA 4CU7A 4KU8A 2PHXA 2VOWA 4IEOA 4ATFA 1GOFA 1TMF1 4NPLA 3BCWA 2R062 4AFMA 4OI0A 2X29A 5A7WB 3NJZA 3WDXA 5A80A 4LBNA 2J42A 3TN93 1RXGA 2WUHA 3GZAA 4KNCA 3MW3A 4CEYC 3M7AA 3I3QA 3OGSA 4F8AA 3ILRA 4Q0VA 2KXLA 4L0PA 3AZYA 2YFZA 4YG0A 1YIPA 1QOSA 2EIBA 3RMXA 2CV6A 4AAPA 2QNKA 3I3BA 2VPVA 2PFWA 3NRUA 5FUPA 1JYVA 1MS0A 5AC91 1UOFA 2RS31 4KMQA 3RGBA 2GZWA 2ZZQA 3U11A 5IK7A 3FE5A 1UCXA 3FMGA 4P9IA 2EICA 3TNQA 4LE4A 5L73A 2PELA 1ZBA3 2HWC2 4HPKA 3L9JT 1MZFA 1PNGA 5T5OA 1UY3A 4H14A 4HKOA 4BLIA 5T50A 2ZHLA 5JXJA 2XPJA 1AR81 3IMMA 4XHXA 1K5MC 3NV3A 1X33A 5I0TA 2IXIA 1PIV3 3FN9A 5A7OA 3UKTA 4ARXA 1HDKA 4K3UA 1ASJ1 1AUYA 2F4LA 1U12A 3A23A 1AJOA 2HWE1 2RV9A 3PUHA 3N7JA 5IWFA 4CTEA 2C4XA 2XBO1 4IGOA 3JBG3 1UYXA 3LB9A 4BJ0A 4BH9A 4QPIC 3W59A 5FZ0A 3RMYA 4B7KA 1J3PA 1QJZA 1OLME 2WZPP 1J1TA 5IT6A 4Z2AA 1QJX3 4XJWA 3ZYIB 2GALA 3NVCA 2A3WA 2AREA 4KBZA 2JDMA 3U14A 4K20A 4XDPA 4MXWA 1HLCA 2Y6FA 4FQ4A 3OJBA 3AM2A 3UKVA 2Y6HA 5SV5A 4NO4A 3ORJA 3VBFA 2VQTA 4AI3A 4NRQA 2AZ5A 5FY1A 1W04A 2QUOA 1UU6A 4OQ9A 3APBA 4Y1ZA 3EB7A 2VVFA 2X5IC 1S2EA 3DKQA 5DABA 2Y26A 3TEWA 1KRIA 2XGXA 1S0DA 3IT8A 4EZHA 4QXCA 2XR4A 5FZIA 5FMDA 3JCIA 4NWWA 5FJKA 1V6IA 5IAXA 3I49A 1CZVA 1DQ4A 3ZXAC 2ZABA 1DZTA 3POFA 4LKFA 5IK4A 3BVCA 1WLWA 3LA3A 1HB2A 1X50A 2QTWB 1Z7S2 1W28A 1UOJA 2GN3A 2VMCA 3KCXA 1OLRA 3PU3A 4JRAA 4MHRA 3ROUA 1YFYA 2XLGA 4OHZA 2E32A 3WNXA 4KBBA 2AYHA 4AVVA 5IK8A 1QGLA 3ELNA 4XC9A 2W87A 3OGRA 2WNOA 3NJYA 3OEBA 3PJYA 4FXKB 4HETA 5FFOC 5LCWL 2ARCA 1N1TA 3BU0A 3KCYA 2FDHA 3GCXA 5A3LA 4PDWB 3BGAA 3KLSA 3VL9A 2HYKA 1RUI1 3VN4A 3MV11 5J3UA 4IV3B 2WL1A 1VBD3 2DCKA 5C3OA 5ABJC 4ZONA 5ANQA 3AKQA 1ST8A 4EYUA 5A1LA 4XFCA 4FOWA 4NRPA 4BE3A 5F2SA 5K9YA 5I0DA 4QQHA 4HOOA 4OULA 3NNJA 4JZRA 5HCHA 3K75B 4DS0A 4OHXA 1CZTA 5FZDA 2D44A 2E7AA 1JODA 2WS93 4RGAA 4CDXA 1A8MA 1MS4A 1W6QB 1W8ZA 4UYBA 2VMEA 3PUQA 1HKDA 1W03A 3K4ZA 5I0SA 1R083 1ZZ7A 3SH4A 5FQ0A 1ND2A 3J9SA 1EV11 2C1FA 1VR3A 1Z0HA 4FPCA 4GA9A 5EZWA 3KB5A 5FY8A 4YGCA 4OHYA 2OS2A 1HXS2 3I3DA 4Q4X1 1RUJ1 1O8SA 5L9BA 3WG2A 1SCRA 2XJQA 3OPWA 4CA9A 5C4WA 1OMIA 2EF6A 4B29A 2IWGB 4W65A 4IE4A 2NN8A 2Z5WA 4GKYA 2XDVA 3VBOA 4QX2A 3OBTA 1FYUA 1PO21 4AVAA 1OC1A 1OLQA 3K51A 3K3OA 2Y60A 4Y4YA 2FCTA 3X29B 1PMIA 1IPJA 2C5DA 1AX2A 1W6NB 2YPDA 3BALA 3FBMA 1ULEA 3LQCA 5FYMA 5T5PA 4CDUC 2RDSA 4XIKA 4RR3C 5LBFA 5BYNA 3B00A 3AYEA 3R4DB 4YZ2A 4R9BA 1ZREA 5C9AB 1REEA 1COV3 1I5PA 1XNCA 3ASIA 1S0IA 4CVUA 1KEXA 1YQ8A 1D4M3 2WZR2 4XURA 2E26A 2GC3A 1GQPA 3T4HB 1LHVA 3R6SA 3CLPA 3T2PA 2PAKA 1JBCA 2K0GA 4HKWA 4ZS2A 1UY4A 4PCRA 1NOVA 3SCGA 2BJSA 4OYUA 5CAZA 2R043 3H8RA 3C7FA 4YYOA 4FPLA 5A3TA 1H4GA 3NJVA 4XJ9A 1QU0A 2G19A 2EXKA 2JG8C 1CAXA 3FHIB 4UBGA 2NLRA 1C3HA 1VBA1 5M0TA 2CYFA 1R1A3 2D43A 4MOAA 2J7MA 3VBRA 2QQUA 5IHRA 3T2QA 2UWAA 2D98A 3EJKA 4GH4A 3F95A 1YO8A 1NA1C 4Z8BA 4BDVB 3AZWA 4DB5A 5AVPA 3VKMA 4LBJA 4Q0QA 5IW0A 3G7DA 3VBUB 5A1FA 4XVHA 1R091 2ZX1A 4LITA 1W2TA 4BK4A 2W1WA 4QMAA 3PU8A 2WIIB 4FOQA 3OBAA 4J6GA 5IATA 1WA4A 1S0EA 4E27A 2WLQA 1PVXA 5DAXA 4FAHA 1H1AA 2HWB3 2FDJA 3G6JB 1VE0A 4CE8A 3LCPA 4Q4W3 2E9QA 4DIQA 2X8KA 5FWJA 3D5OA 4AR2A 3B94A 4UFHA 3RZGA 4ONUA 2B9UA 4D69A 4LBQD 2WO2A 4Y5Z0 4CXXA 1FPN2 4WM8C 5FXZA 4FOYA 1LEMA 1KS4A 1W2UA 2RR11 3E6BA 5DDJ3 3SKVA 3TEZA 3IDCB 4LHNA 4B3NA 4HN0A 3OUHA 1G86A 1S0CA 2R063 2RG4A 3KCCA 2VZTA 5FIXA 2FZ2A 3CJIA 2LROA 1HRV1 1FXZA 2JE8A 4P5YA 3WDTA 3AKSA 4KWKA 1VRH1 1DQ0A 1KGYA 2D3RA 2GN7A 3KZ4C 3AKRA 4ES8A 2XLFA 3U37A 3Q8AA 4UFLA 4P9XA 5CFDC 1H1MA 5K4LA 4A7ZA 3GCWA 2XMLA 1I1EA 4FI9A 2WZR1 1LNSA 3AFKA 4GMP3 4NHYA 1OVSA 1R1ZA 2TEPA 2ZAHA 4OUMA 1NX9A 4HT1T 4Z1VA 4XTMA 4KG8A 3VBSB 2OUHA 3HVDA 2LALA 2HWC3 1HJFA 5KC6A 4N7UA 1CAUA 3I2IA 1NZIA 3TOJA 1N3PA 1LOFA 2BFUS 5L7OB 4LBQB 4A3ZA 2P3KA 4LO6B 2QQNA 3MYXA 1WLCA 4KWJA 3RZMA 1ZRRA 2Q1ZB 3W58A 1JU3A 2JWPA 3PIGA 4IUGA 1OUSA 4YARA 2WO7A 5A3UA 4CUCA 4HFSA 2WFF2 3L2HA 3WG1A 4F83A 1QQP2 3AYAA 1V9U2 3ZYHA 1WUVA 5FO8B 1DGWX 4BPZA 2JG9B 5CG8A 3I2KA 4CPBD 3VD4A 2IC1A 3TEYA 3JZVA 4HZFA 2D40A 1N1VA 4FOVA 5F5QA 4NPMA 2XQRA 3LZZA 3C2UA 2FD8A 4LE3A 1ZZ8A 3ZO0B 3O7OA 4C90A 5FWEA 4D0QA 1NE6A 1IZ3A 1W05A 1JUIA 1V6NA 5J36A 1LGCA 1OQDA 3AJZA 3POGA 4HVQA 4HL0A 2VUAA 4MGZE 2W3JA 3VD7A 3WNMA 4D7TA 1VPHA 1FPN1 5C71A 2DUQA 1AR73 3B7MA 1LJ7A 2ZX4A 1NQJA 3JD72 3PTRB 2WNVB 2GMPA 4XF9A 4Y3OA 1PVC2 1UOBA 3OSDA 2DCYA 2BTVC 1JOJA 1QJFA 2CHHA 1FNZA 3NW4A 5TSWA 3OPTA 2B7YA 4IESA 2XXZA 3GALA 4QKBA 3WLUA 4WVVA 4ZU7A 5JIAA 3VZOA 3A22A 2BW8A 1AR62 4IL7A 3A0NA 2R7EB 1DHKB 3W9AA 1Z7S3 1REFA 3ACLA 5FTTC 5CNAA 1KDKA 4PIZA 4O7XA 4DEVA 4EZ4A 2GNMA 4ZZ5A 1AL23 1CX1A 4XOGA 1US3A 1HV1A 2ARAA 4AVBA 2NMOA 4MGQA 5LK7B 2H0BA 4QM8A 1H9PA 4AG4A 1VBE2 1N47A 4D8MA 4DY3A 4M3CA 3AC0A 4TZDA 1WW7A 4PDWC 5DAVA 5DUVA 5BNPA 4AXOA 4WM7B 5LWBA 4AEDA 4IV1B 1RUG1 4IV3C 4I0AA 4X8NA 4PQ9A 3LDKA 2W9XA 3N7MA 4JX0A 5FXXA 2ZS6B 4P5HA 5DAQA 1B35B 3LGRA 2AC1A 2YFUA 1SLIA 4QHZA 4TTGA 3GXUA 2GDFA 4A7KA 2Y6LA 4W6WA 4FP2A 3ZLIA 4Q26A 4R9CA 2RDQA 1RUD1 1V00A 2WFF1 4Y1VA 4LTAA 4CEWB 1KFXL 1Q8QA 2OT7A 2D6MA 3MF9A 1RHI1 4M0NA 2JDKA 3ZFEA 1AL0G 1L7RA 2YC4A 4KWLA 5LY2A 5K7PA 1LTEA 2HEYF 4UFJA 2Q4SA 1W6MA 2YGLA 3KGZA 3BB6A 4KGGA 4XACA 4Z07A 3NQHA 1O3SA 4LR4A 2BWAA 4ZHNA 2R072 2J1SA 4QX7A 5CA6A 3URFA 4MXVA 3ZFGB 4DXTA 1W2OA 3HD8B 4AQ6A 4YZ1A 4XCBA 4RQPB 3WY6A 1MS3A 2C9AA 4RFT0 3VZKA 2FDGA 5C3SA 1ENQA 2UWCA 2WYSA 1H8TB 5FPLA 4P9WA 2DVGA 3E1F1 1RUE1 1Y9MA 4FCAA 4E4DX 1PVC1 3D4KA 4COYA 3KD4A 4L11A 4XEZA 3ZN6B 3RDIA 1I5ZA 1PM4A 2Z2SB 1HRI2 2JB8A 2XLAA 2X05A 5CADA 2UU8A 1W2NA 2BVVA 5FYYA 3FLTA 5ERLA 1UYZA 3ON7A 3ZXJA 5BNOA 3KHCA 5EFUA 5C9AC 3H3LA 3WP6A 4HKLA 4CCEA 1ZBA2 5A3MA 1URXA 1L3JA 2BBVA 2BUKA 1YQ6A 3BTYA 3S7EA 3LD8A 1UD1A 1WMDA 4AHXA 2A6YA 3NAPA 2O8OA 2VECA 3QD6A 2O14A 2RS12 3AXDA 4MZUA 5DUWA 3ACIA 4O65A 2P1BA 3QH7A 4BYYA 4ISRA 4V1PA 1GZWA 1BZWA 4Q1PA 1H2MA 2I2SA 1REDA 4UW4A 4Y1UA 1RUC1 3K3NA 2D6LX 4LKDA 4Z2WA 5EPAA 5FZEA 3RS6A 3WCRA 2XVKA 4XFAA 2OVUA 3N36A 4Q4V1 4CDQA 1X36A 1GWMA 3LPGA 3ZXGA 1BEV3 2R32A 5FZMA 1NCQB 3ZDSA 5BNQA 4MGTA 3SMHA 3MBWA 4RS5B 4X6RB 3R05A 3TNPB 1M4WA 1QJX2 1PO11 1AR92 2W94A 5F2WA 3VBUC 3VDDA 4FTSA 1AYN2 3UGFA 1QHDA 2VZ3A 3ZSJA 4Y20A 4PI2A 5LASA 3RVHA 1POV0 1X82A 3BODA 3GNEA 4RSUA 3JB4C 3ILNA 3PMEA 4DRRA 4AI1A 2EIGA 2XQXA 3ACFA 2A71A 2XJRA 2GC2A 2JDAA 1RUH1 1OA2A 5DQ0A 4CSWA 3H8OA 3J8F2 5FZ4A 5J1XA 3KWVA 1N3OA 4YM3A 3GM8A 4Q2FA 3USUB 1CJDA 1F35A 1LOGA 1U5XA 2XOMA 1OFNA 3AVRA 2OX0A 2JE9A 2XVGA 2GP3A 3C7HA 1GLHA 4XQDA 1C5HA 4A7YA 4IE0A 3AB0A 2Z69A 4ZU5A 5IVYA 3TN91 3WDVA 1DLCA 4GXLA 4YW5A 2FZ1A 1UMIA 3WUDA 2FDKA 1PGW2 2W95A 4LUKA 4YW6A 4W4ZA 3NWKA 4BU2A 1YLLA 1V6LA 1TE1B 4MH0E 1CR7A 4QDSA 2VNRA 3H7JA 2WSVA 3W21A 1V6JA 1W8WA 5KC5A 4FPOB 4WVMB 4PQQA 4PT6A 5BNNB 3MHZA 4MADA 2ARXA 2G9ZA 4K8FA 1JHNA 4NRMA 4HK8A 5L9RA 5FRAA 1HB1A 2WBKA 1W6PA 5AVAA 3HNBM 1ULCA 4O9EA 3UT0A 1ZBA1 2CAVA 1ULOA 1QOTA 3A7QA 3UL2A 1GBGA 3P3PA 4K7JA 4JGZA 4S2GA 2QDNA 4AI2A 1SLCA 2VBDA 3LF7A 3VBSC 5KBFA 3OY8A 4S2FA 1PIV1 2W1QA 1XNKA 2BZDA 3VD3A 2VOVA 3RJRA 2VGDA 4PF1A 2NYYA 3NJXA 2ZBJA 5LB6A 1BVP1 4LBOA 2DVDA 5F9TA 2BGOA 1SPPA 3MIBA 4LIUA 5L7OC 1WBLA 2GMEA 1ENRA 2WS92 1FOD3 1IKQA 4Q8LA 5EXOA 3JBG1 2V73A 3INAA 3T2OA 4AHYA 1MS8A 4IEZA 2HEWF 2JECA 4XAEA 1QDCA 2E51A 4NAOA 1YI9A 3ZSKA 2WRAA 4DY5A 1ZZCA 5C70A 4XJUA 1R082 4XABA 3M2MA 5IJRA 1J3RA 1SLBA 2FBEA 2LS6A 4CP9B 1QJX1 2UY8A 3DPRA 4XFGA 1QQP3 1JW6A 1V9U3 4ASMB 5K0UA 3ZSEA 1F2NA 3JU9A 3O0XA 4MSVA 3BOWA 5EQUA 3VZJA 2JG9C 1CAXB 1JZ7A 2WA4A 2QQKA 5IK5A 1XJAA 3UYJA 3WF4A 5FYHA 1XYOA 3DXTA 5DN2A 3LOIA 4WV8A 4D6RA 4XJ8A 2W68A 4IEQA 3THCA 1EAH2 4QDQA 5CU1A 3N9LA 3BPZA 5A32A 3VZLA 3RWNA 1OURA 1SZBA 3B5LB 4YVSB 2VM9A 1WWYA 2XKOA 5D1IA 2VNVA 4FFIA 3SEEA 1GKBA 2Y38A 4OUSA 4N53A 3WZ1A 1UIJA 2GH2A 2WO1A 1IS4A 3JD73 4OFGA 5BXXA 1WCKA 2IXKA 2ZEWA 2SBAA 2WNVC 4IGQA 4COUA 1XNAA 4LQRA 5LY1A 3BTAA 1WMXA 1XE7A 4YZ5A 1S2BA 2BGPA 3I2HA 3HQXA 2OA2A 3IAPA 5F7UA 1X8EA 3IIAA 1AR63 4UI9L 4BXSV 2XWJB 4XBLA 1TQ5A 5JPMB 3MPPG 5J48A 4QXHA 2R042 2JDZA 2FDFA 2KM2A 1DDLA 3SITA 4NIAA 4PLMA 3VD9A 2ZACA 1BBT2 4AI0A 3S0MA 2OXBA 4ITCA 2ZGRA 3AP7A 4IEUA 1ULDA 5JZGA 1OA3A 1QH7A 3Q8FA 3S6PA 2BQPA 2ATFA 1A78A 1VBD1 5IYYA 1VBE3 4CUGA 4LLFA 2LUWA 3J7LA 3T2TA 4LHKA 5HXMA 3IDBB 1FV3A 4JQRA 2P17A 2WNUB 4FP3A 5E8AA 4K8RB 3GHNA 2P6CA 4IV1C 4WM7C 1JU4A 2ZGNA 4NMIA 3UKNA 2BRTA 1K42A 3Q9OA 2VMHA 5EJ1B 2D97A 4U2AA 4BOWA 5FJHA 1B35C 1LOCA 2WS91 5CEHA 5HCAA 5J09A 1D0GA 4XCAA 1LODA 1STMA 4XUQA 1V6KA 4HLTA 4BB3A 1WCDJ 4U36A 5DMYA 3VZMA 2D6NA 1F5JA 2OUJA 1MQTB 2N7GA 4CEWC 3D0JA 5DZFA 3SISA 2P6HA 4K21A 3LOBA 1Q5OA 5DZEA 2ARBA 1OOPA 3T1MA 1LEDA 3ZXEA 1CGPA 3IZOA 2BU9A 5GM0A 2RS53 4JDOA 1LOBA 5DDJ2 3ACGA 1AZDA 1OH3A 4UXAA 3E6CC 3CMGA 4PBPA 1OSGA 4H7LA 1TVGA 2R073 3IWZA 4Q4Y2 3WP4A 1NAEA 5AFEA 4IEYA 1PGL1 1B09A 4B7EA 3ZFGC 5F1RA 3HQRA 2A5ZA 1D2QA 1Q56A 4RQPC 3O1RA 4E8DA 1Y7BA 2GAUA 3V64A 3OG2A 4CXWA 1NY72 1H8TC 4AVTA 3OGJA 2IXHA 3C7EA 4XUNA 4AFBA 2WN2A 2MEV3 1IS5A 1COV1 3AKTA 4BA6A 5C8CA 4L99A 1JMUB 3W5MA 1D4M1 1HRI3 4DXZA 2YMZA 1GQGA 3E97A 2PLV3 2JJ6A 1JZ5A 4R9DA 3KF5A 3FFZA 2ES3A 1V0AA 4W50A 1IPSA 2B9VA 4JDMA 3U4XA 1Q8SA 4NJ4A 5CKQA 3A4UA 1O3TA 2R041 3H8XA 1KJLA 2ZKNA 5IVVA 1H2NA 1U5ZA 5EWSA 1UU4A 3MIFA 3J7HA 3PVOA 4GAZA 4XZUG 5A3NA 1PK6A 1XSQA 2P2KA 4GWJA 5IVEA 3HAGA 5DUUA 1O91A 1VMHA 2RS13 4PIYA 2WQ8A 1W0PA 1R1A1 1UPIA 3HOBA 1ZX5A 2DFCA 4M00A 4B4QA 1BJQA 3K4AA 1Y9QA 4LK7A 2D6PA 3GBWA 4Y22A 1C4RA 2AEZA 3WEZA 3RYRA 2A1XA 2D5HA 1O5UA 1EPWA 5FMBA 2ORZA 4FBFA 1GP6A 1UL9A 1W6OB 4R9AA 2WAOA 3KSCA 1HX6A 2BDRA 2QQPA 5T5LA 1NCQC 4QPYA 5CKNA 1UMZA 4RS5C 2YUEA 1CZSA 1DFQA 2VUJA 1UO9A 2JD9A 2VE1A 1AR93 2CWSA 2Y0IA 3KMHA 1PZ9A 1AYN3 4M3CB 1EY2A 1ULFA 2FMDA 2HWB1 1RMU2 2YGMA 4H3WA 2HBUA 4WZCA 3W5NA 4MG2A 4N43B 4Q4W1 4QX0A 5GKAC 3WF3A 5BNPB 1OQ1A 1T2XA 3RRDA 4AEDB 2PN5A 1AHSA 2E6VA 5IVFA 2B4KA 2ID4A 3PUIA 4JKKA 1ZNPA 2VR4A 4FPEA 3SXWA 1HN0A 4LHSA 1AR72 3DYOA 3OUJA 3J8F3 4CEYA 3EMRA 4QWNA 3LDRA 4ZXKA 2WT0A 3ENRA 2R061 2ZHNA 5KXEA 5LW9A 3IPVA 1PX4A 3N9PA 4J25A 1H2LA 5DZGA 4D6SA 4E8CA 4FVVA 2ZMKA 2Y6JA 1EYBA 4QPGB 4XJZA 3THPA 5BUVA 4NIGA 2P37A 1W06A 4A45A 5DAPA 1NXD1 3OPZA 3LIGA 4OMDA 1G6NA 4YVWB 2CU5A 1AL22 3K48A 1AYM2 4GMP1 4AI9A 2J1RA 2RJ2A 4CCMA 1NUKA 2KD7A 5BNNC 2GMMA 1UZWA 5E6HA 3SQOA 4LO8A 3T0BA 2QZ2A 3S5AA 2G1MA 2OIIA 2HWC1 4HN1A 3M3IA 3J7NA 4AFCA 1MZ5A 2E63A 4UF0B 5J37A 3CO2A 4HG6B 3VKNA 2BERA 4E2GA 4A4AA 4QGMA 5A1AA 5KHJA 5FZOA 1D7PM 1RL3A 1XYPA 4TXWA 1HQWA 4XFHA 1LOEA 3ZM8A 3DECA 4NIDA 3M8LA 3ILFA 4GWMA 4DOUA 3U07A 2XHKA 1CPMA 5FY5A 1G9FA 2YU1A 5KR7A 3I3EA 2I45A 4QPIA 3ZN4A 1RITA 1CVNA 4FQZA 4FXGB 1J3QA 4EN8B 1GOGA 3WW2A 4QB6A 1DGLA 5A7PA 3NKGA 1KXGA 1JZ6A 1QXJA 5FXWA 1LU1A 2HWF3 1WW5A 2PHRA 4QKDA 4QHOA 1ZVFA 3LKJA 4I0BA 4TLGA 1QOOA 1ZZ9A 2DU1A 2B8MA 3K46A 3PVNA 4CCKA 1TME3 3FZ3A 3UJOA 2VXJA 2AUYA 5EHDA 3DUIA 1GZCA 3ETQA 1GZWB 3J7MA 1O3QA 4GD4A 5B4XA 2E53A 5HCFA 2CTVA 4M4PA 1OA4A 2X5IA 4AHZA 4P9GA 1Y3TA 4JDNA 3CL1A 3D8CA 2HH9A 1LULA 2BP6A 3WX5A 2GH8A 1AR71 1D2SA 1EAH3 3ZKUA 1JZ8A 5C7GA 3H42B 4COVA 4FTBA 1NCRB 3LFMA 3DXUA 4YVSC 3ZMOA 4QGNA 1FMD2 1GV9A 2VOKA 3KT1A 5JXIA 3LEKA 5E89A 4DXRA 5FYCA 1QJY2 2R49A 4LUMA 5HPOA 3MUZ1 2ZGOA 4XJAA 5LZ6A 5FP3A 5A70A 2IUWA 1N3QA 3FC0A 5CFCC 4GMP0 3T09A 1AJKA 1Z7S1 3MDPA 3MEPA 2D3SA 1JOPA 3T0AA 4F7ZA 3IN9A 3VHPA 1GFF2 3OYWA 1C28A 1MZ6A 3CJXA 3AYCA 1AL21 4E2SA 1O4YA 2RM23 5E16A 2QQWA 4F3JA 1KS5A 4MGYE 2RDNA 4JVAA 1SFNA 3VD5A 4C0BA 5APAA 1HJGA 3CZJA 4Q0SA 2DCZA 5ABJA 5FBJA 1LOAA 1NLRA 1BBT3 1YJKA 4NHXA 3DYPA 5GZFA 4GIQA 4Y4RA 5JDBA 3LPFA 4DUWA 3O1MA 1OFSA 2ZMNA 3N7LA 4I3PA 1GNYA 5LATA 2VCMA 3QBQA 4LPLA 4AI8A 2RJLA 1VMFA 2J1VA 3AJYA 4OHWA 4XUPA 5FLJA 5JUVA 4E2QA 1BEV2 1UNBA 5K8SA 1OD5A 2WNUC 3RZZA 1QXPA 5JCTA 1GWKA 2VZRA 3P6BA 1XNTA 1CONA 4HVRA 1IHMA 4D6QA 1QJEA 3Q8CA 5JOZA 3V0AB 2VTFA 2BNNA 1F4HA 1XQNA 4BQ4A 3THDA 1DP0A 2R6QA 3HT2A 4NHKA 1IQDC 1V6MA 3QOPA 1YFUA 4JHTA 2HWD2 4LO4B 1SCSA 5C3RA 5KHIA 2XJTA 1J83A 1YC61 2R0HA 3FL7A 4XETA 3QCWA 4E9KA 1MQTC 2VOXA 1HXS1 1DYOA 4YG6A 2BNOA 1VAVA 2PYTA 3OTFA 4KH9A 5T52A 4HVOA 1G9DA 1GYKA 1SPPB 1AVBA 1IS3A 2CDOA 2VMDA 3T0DA 2DBNA 1IGOA 2WZEA 3A21A 1HIXA 3EYPA 1G7YA 1SLTA 2XL9A 1BKZA 4LLOA 4OI4A 4AWDA 1WW4A 2XUMA 3EQEA 3GZEA 4CDUA 4RR3A 2ZAAA 3M3EA 1UYYA 1SLLA 4Q4Y3 3RI8A 3O1TA 1ODNA 2VUDA 3POSA 4LKSA 2ENRA 1XOYA 4XF3A 4CCLA 2WWUA 1XXNA 3EXUA 4KI5M 3KF3A 3BOPA 2WC2A 1KQRA 5F32A 3S7IA 3UGHA 1LENA 2BWCA 2DFBA 2PQQA 4NN0A 3MUY1 4BQXA 5F5IA 2ZGMA 1Q43A 5H9QA 5HV4A 2TNFA 2ET1A 3KS7A 4PHZA 5FZCA 3ZYJB 1MVQA 2Y0OA 2GNBA 3H0OA 5L36A 4JKLA 3FLPA 1G8WA 2QQMA 3WD5A 2C26A 2VY0A 3V65A 4RYDA 1K3IA 2JG8A 4UOJA 4QHBA 4G9SB 3H1WA 4QT6A 3CIHA 2B39A 3DF0A 2EXIA 2A70A 1ZZ6A 5FO9B 1POQA 1BK0A 1XB9A 3HN3A 1GNHA 4HK9A 4Y1YA 4YWAA 2FMYA 3UNPA 1GR3A 1WCSA 4LBLA 1H0BA 4XXPA 3M3CA 5FZ6A 5FZBA 5A33B 1FOD2 2HLEA 2E33A 5GALA 1APNA 1BEV1 3RWKX 2DWRA 3MI8A 2Y6GA 1DF0A 5JIUA 3T3YA 1ODMA 1VBC2 1N1SA 3BIWE 4C1WA 4EWAA 2DURA 3BYWA 3HPNA 4UWDA 3UETA 1ND3B 5KXDA 4V2VA 2AACA 1MS5A 3T08A 5LRSA 1W8TA 4AFDA 3VBHB 4OZOA 5GZDA 2Z42A 1J58A 1W2AX 4AEMA 4DRVA 1QJU2 2WJSA 1RMU3 1CAVA 2LM3A 2YROA 4IEVA 4WM8A 2VL4A 4ATEA 1JI6A 2HEVF 2QKDA 4N43C 3Q8BA 4YG3A 1RUF2 1W9TA 5A6QA 2R16A 4AEDC 1ULPA 4MYEA 4UW5A 4XUTA 4XZPA 5IUQA 5CISA 4Q8KA 1Q8OA 5A7WA 4BWOA 2VJXA 4J1WA 2O0OA 1FI2A 2VU9A 4TSVA 4Q5OA 5FZGA 2VCBA 1CAWB 1DCSA 3RYPA 2W52A 4AL9A 4XHBA 4B1LA 1IOAA 3ZXKA 1NQDA 4FPYA 3CQOA 5CFDA 3U75A 3I3MA 1SFPA 5D8AA 2YC0A 5FYUA 2Q8OA 2ZX0A 2RJKA 2PAEA 4QPGC 2VCCA 2XL7A 4XYXA 3VKFC 1YFXA 2JKXA 4BISA 5FO7B 1MR5A 4PI0A 1VMJA 2OQ7A 4LXLA 3HR9A 3TAYA 4HXCA 2UYBA 4YVWC 5IVCA 3WV6A 1AYM3 4GULA 5JOYA 2JXAA 3AL5A 1LCLA 3QLQA 2A73B 3FWEA 5JAXA 1VB4A 5LRRA 3WCSA 3POBA 1QIQA 1Q8VA 1UX6A 3JQXA 5BV6A 1UU5A 4CXYA 1GP5A 3K2OA 4CU8A 5FYIA 2VW2A 4KG0A 3BPSA 4EN7B 3AMNA 1OUXA 2DUPA 2MNGA 2YYOA 2Z79A 4D7YA 1J59A 4BHPA 1C8M2 1LECA 1FOD1 3U78A 4B4PA 5A3WA 1UKRA 1H8VA 3FJSA 1IS6A 1LGNA 3MIEA 3FHQA 1RIRA 5FBZA 3N9MA 1UZYA 4AYUA 4M0HA 2X10A 4META 4HPKB 3WQ0A 1DQ6A 3NSTA 4DFSA 2IZWA 4COWA 4C8DA 3OEAA 3HNMA 4CP2A 1QQP1 4DZGA 1V9U1 3WQBA 1PK6B 2VMGA 3ZYGA 2QDRA 2W91A 3ACHA 1A8DA 5FDBA 4G4FA 4AGGA 1IPKA 4IW3A 2RS52 1SBFA 2DDUA 5A3PA 1POV1 3A0KA 1RGSA 5GLZA 1O4ZA 4QKFA 1KFUL 1ZBE2 4UBHA 1S55A 2VMIA 3MPBA 4XFFA 1Y43B 5JSOA 1Q8PA 2VCAA 3MLLA 2B46X 4AGVA 3RYKA 1X9PA 3N3HA 4GJZA 2YC2A 4YSFA 2ZHKA 3FFQA 2WABA 3PHMA 5EIYB 1JYNA 3M4FA 3POJA 2UY9A 2ZZJA 4DUXA 1JZ4A 2J22A 3JD71 4IXLA 3WNNA 2YY1A 5CG9A 2BBAA 4E4SA 1NCRC 2MEV2 3OGGA 5ACA3 4CYDA 1FMD3 4LEJA 1DU3D 5HV0A 4MXWB 5FYSA 5KXCA 1QJY3 3K77A 4NE9A 3PURA 4LT5A 2PLV2 3VBFB 1AR61 1NT0A 4ZZ8A 1QXRA 3LEGA 4AQ2A 4NAMA 4W8JA 1H2KA 1TEIA 3E5QA 3UV9A 5I0UA 3AVSA 4RN5A 1E57A 3E5XA 2ADEA 3I2FA 4CEYB 1QNYA 2RE9A 4XFBA 2JD4A 2A6WA 1ULGA 3KVBA 4PDWA 4LA3A 2W47A 5F5CA 3HNYM 4QXKA 2KA3A 3RZLA 1WW6A 4XF1A 5FZAA 1DZQA 2VULA 4IV3A 4YM1A 5ANNA 1VBE1 5CYYA 4NHLA 2CGPA 1IG3A 4NVPA 5FPVA 3FX3A 1AXYA 3I2DA 4Y26A 3ZYFA 1M06G 1FNYA 4MUVA 2ZX2A 2VZ1A 3ZOIA 1LR5A 5FPAA 2F17A 2D3PA 2DCTA 3KV5A 4NR1A 4P9LA 3IAQA 4A44A 3ZFFA 1W6QA 3SH5A 1X7NA 1HB4A 3Q8EA 4JCKA 1BYHA 4SLIA 1DZRA 1F31A 2O1QA 5C8WA 1S4CA 4KU7A 2W2IA 1XNBA 1DG6A 1WKYA 4L2NA 2HWD3 4DXSA 1SHWB 1JZ2A 3PUSA 1MS9A 4K6BA 1JYWA 1TNFA 4WVZA 1C57A 4LMFA 5FP8A 4CDWA 3BI3A 2RS51 1GANA 3CU7A 2BVBA 4YFWA 1OVPA 4AAXA 4UFIA 1EP0A 3S5QA 1EUUA 1AXZA 2D6KA 3LA2A 4M01A 1KITA 2R071 4GWNA 3V0BA 5JOWA 1W0NA 2R1BA 3B02A 1W90A 3GJBA 1LU2A 4O61A 2BPA2 3WW3A 4CDXB 2Y6KA 3AZVA 3JB8A 1F9KA 1W6NA 3GBFA 2PHWA 3NMBA 2ZGLA 3ZPYA 3HIFA 4OQ8A 4I09A 5FQ0B 4O9GA 1ND2B 2FCVA 2MEV1 1UW8A 4QB2A 5GZCA 2TBVA 1JYCA 2PA7A 3KT7A 4Q0UA 4UW6A 5JXHA 1HRI1 1NKGA 3CKHA 2QCSB 2YBKA 5FZ7A 1UXZA 5C4WB 1C1FA 3SKJE 2PLV1 2P34A 4JGYA 5L19A 1MVEA 3F2ZA 1E5SA 1V70A 3FLRA 2C6SA 3VBOB 3NL1A 3TB0A 4I2OA 3I2JA 4YRDA 4BIOA 4CP1A 2RHPA 1PX3A 3ZMNA 4HANA 2E7QA 2VW0A 2VZUA 5FOBB 3BUCA 1ACCA 4FPKA 4H7MA 1DIWA 1W39A 3P3NA 2RS11 1SEFA 1DBNA 2VVDA 1YQCA 5F3CA 1UY1A 3PLQA 3HEIA 4MX3A 1AX1A 2PHDA 5FR3A 1DGRA 2ZGSA 3MFAA 1DGWA 2TUNA 3RI9A 5FKCA 2W0XA 3WHUA 5I8YA 3CF6E 1MEC3 1RVF3 1SLAA 1UMHA 3OYWB 1O5LA 2HWF2 2IXJA 2JEMA 3VBUA 4Y1XA 5E1RA 3ES4A 1ZM1A 4YNIA 5FK8A 3BU7A 5C3PA 4RD7A 4YPJA 1TME2 1BMV2 2AR6A 2PHFA 3O0WA 2L9LA 1AR91 1VBC3 1AXKA 3POEA 4RHV3 5ABJB 1AYN1 2Q1FA 5FYVA 2BOIA 3D0SA 5JSRA 1ND3C 3T4VA 2X53S 2PHUA 1S0JA 2A6ZA 3R4SA 4N9HA 4QX3A 5A7NA 3WOGA 1ZRIA 3SLIA 4LORA 3UGGA 3VBRB 1D0HA 5FP4A 3VBHC 4GH4B 3PL0A 3S30A 1QJU3 5C5TA 1Z78A 2QBXA 4FPFA 2X09A 1LAJA 5FYZA 3J8F1 2OPWA 1OHFA 1RUF3 4GWIA 4X8PA 4DO0A 2D5FA 3ZXDA 2VQ0A 3JUUA 5CZKA 3KQ4B 5FY9A 3H3ZA 4Y33A 4YM2A 5FYBA 4CCJA 4L97A 4BMEA 5IVJA 3SEPA 3WG4A 4JKMA 2DU0A 3PTYA 4BM8A 1GOHA 4B1MA
chains in the Genus database with same CATH topology
3SKVA 2QQJA 1OF3A 2WDBA 4P02B 1PX4A 4DEQA 2VZSA 4E8CA 2Y6JA 2VZTA 2VZOA 2JE8A 4P5YA 2EIEA 4A45A 4OMDA 1BHGA 1KGYA 3K4DA 3MO4A 5JR2A 1F4AA 3U37A 1W9SA 2J1RA 2RJ2A 1NUKA 2KD7A 3GDBA 2YB7A 1MPXA 4FI9A 4KWUA 1LNSA 3T0BA 3WNKA 1NX9A 4HG6B 3WNLA 2Y8KA 2BERA 5A1AA 4A4AA 1D7PM 4TXWA 3ZM8A 3DECA 1GU3A 3I2GA 1P8JA 3I2IA 3UESA 3I3EA 1PMHX 1OD3A 4A3ZA 1US2A 2V4VA 1GOGA 4QB6A 2QQNA 1JZ6A 5LA2A 2C9KA 2VC9A 1JU3A 4P08A 3K46A 4IUGA 2V72A 4CUCA 5JMOA 2XHNA 5B4XA 3I2KA 3VD4A 3C8XA 4ZY9A 3D3AA 4M4PA 4D0QA 1SDDB 1JZ8A 3C7OA 5C7GA 2W3JA 3VD7A 3WNMA 5G05L 1UXXX 4JHZA 2WAAA 5JXIA 5G04L 3LEKA 4DXRA 5HPOA 3MUZ1 4UAPA 3T09A 1O59A 3T0AA 2VQUA 3A22A 1OF4A 2R7EB 1YQ2A 3NNGA 3P1IA 4DEVA 3VD5A 4ZZ5A 3CZJA 1CX1A 4P00B 2QQIA 2J1TA 4ET7A 1US3A 3DYPA 1W8NA 4MGQA 2ZEYA 1K45A 3LPFA 4AG4A 4DUWA 1GNYA 4D8MA 4LPLA 3AC0A 4A41A 2J1VA 4XUPA 2YG0A 4QAWA 5JUVA 5LA0A 4M4RA 2CDPA 2VZRA 3HJRA 2W9XA 3P6BA 4JX0A 1XNTA 4QPWA 2QQOA 2YFUA 2VTFA 1F4HA 4TTGA 3GXUA 3THDA 1DP0A 3BN6A 2Y6LA 1IQDC 5IFPA 5LA1A 2PQSA 1J83A 3FL7A 1UY2A 1DYOA 1L7RA 4A6OA 2YC4A 3I97A 2LW8A 4MO3M 2CDOA 2VMDA 1L7QA 3LE0A 3NQHA 3T0DA 2WZEA 3A21A 2J1EA 3EYPA 1UX7A 2J1SA 5FUIA 4DXTA 1UYYA 4GZ9A 4LKSA 4KI5M 5EJZB 2WYSA 3E1F1 3CDZB 3MUY1 2WO3A 3WF1A 1W8OA 1J84A 2X05A 4QX1A 1UYZA 4JKLA 2QQMA 2C26A 4RYDA 1K3IA 4UOJA 3JXSA 2W5FA 3CIHA 3ACIA 3UNPA 3HN3A 1XC6A 2HLEA 2E33A 1W9WA 2Y6GA 2VMFA 3LPGA 5IFTA 2VZQA 3HPNA 3UETA 1H6YA 3MBWA 4ARYA 3T08A 1UY0A 5B4NA 2ORXA 2W94A 1UWWA 4OZOA 2VZ3A 3VDAA 3DYMA 2EIDA 2VL4A 1JI6A 3IB3A 3IIIA 1W9TA 2W1UA 1GUIA 2XQXA 3ACFA 1ULPA 4XUTA 1O8PA 3OB8A 2JDAA 2WN3A 5DQ0A 2Z4FA 5J1XA 2VJXA 3GM8A 4QDRA 1OT5A 2VCBA 2XOMA 3ABZA 3C7HA 4CUBA 4DUVA 2V5DA 2VZVA 4OMCA 4CU7A 1DLCA 3CQOA 1UMIA 1GOFA 2W95A 4W4ZA 2WUHA 4QDSA 1PMJX 2VCCA 3OGVA 3OGSA 4XUOA 2JKXA 1GMMA 4L0PA 1JHJA 2YFZA 4PQQA 4PT6A 2EIBA 4MADA 3I3BA 1JZ3A 2VO5A 3NRUA 1JYVA 2WBKA 3HNBM 3A7QA 1ULOA 3CZUA 4KMQA 4BK5A 3GGLA 4MGSA 2EICA 2XONA 4CU8A 2W1QA 1UY3A 5JXJA 1XPWA 2BZDA 3VD3A 1RYYA 4PF1A 3NJXA 3WSOA 1HN1A 3FN9A 3FHQA 2BGOA 4ARXA 2X10A 1R64A 3T2OA 3A23A 2WZ8A 3OEAA 3HNMA 3PUHA 2RV9A 3WQBA 5C70A 3WF0A 5IJRA 2W46A 2C4XA 2W91A 3ACHA 4BJ0A 1UYXA 2LS6A 2DDUA 1EUTA 1JZ7A 4Z2AA 2QQKA 4CU6A 2VCAA 3WF4A 3C7GA 5DN2A 2YC2A 1JYNA 3ETPA 2WABA 3THCA 5EIYB 2Y6HA 4OUEA 4QDQA 4DUXA 2VQTA 1JZ4A 2J22A 2DCJA 3WNNA 4A42A 2VM9A 2BBAA 3SEEA 3ECQA 5DPNA 3EB7A 2WO1A 2ZEWA 3K77A 1XNAA 4LQRA 1K12A 4ZZ8A 3LEGA 2VOTA 2BGPA 3I2HA 1CZVA 4W8JA 3IAPA 1UZ0A 4RN5A 5F7UA 4UI9L 3I2FA 4BXSV 2VMCA 2W47A 3HNYM 2E32A 3VD9A 5CYYA 2W87A 3OGRA 3OEBA 3IDAA 5LCWL 5IYYA 3BGAA 2J1AA 2VZ1A 5HXMA 3MV11 2RVAA 5C71A 2ZEXA 2DCKA 3IAQA 4A44A 1JU4A 1K42A 5EJ1B 5I0DA 3MV01 2ZEZA 3K75B 1CZTA 2QQLA 4XUQA 1WKYA 3WF2A 4DXSA 1SHWB 5DMYA 1JZ2A 1H6XA 1JYWA 2VMEA 4AAXA 2VZPA 3K4ZA 1EUUA 1WCQA 1W0NA 2W92A 3I3DA 3ACGA 1O8SA 2W1SA 2Y6KA 3CMGA 1TVGA 4CU9A 1NAEA 4QX2A 4E8DA 3FHAA 3OG2A 4QB2A 5JXHA 1NKGA 3CKHA 3LQCA 3C7EA 1UXZA 4XUNA 2WN2A 3SKJE 1OH4A 2ZXQA 3F2ZA 3W5MA 1CIYA 2HYXA 3I2JA 1JZ5A 1I5PA 1PX3A 1SG3A 4W50A 4CVUA 2B9VA 1KEXA 4XURA 2VZUA 2E26A 1GQPA 2Y64A 3T2PA 3WNOA 3WNPA 1UY4A 3J7HA 1UY1A 4XZUG 3HEIA 4OYUA 4GWJA 3C7FA 2WQ8A 3HOBA 1TG7A 3NJVA 1UMHA 2J1UA 3K4AA 3VDCA 3WEZA 4MOAA 2J7MA 4YPJA 5IHRA 3T2QA 1JYXA 2ORZA 2L9LA 2E31A 2WAOA 4BDVB 3LEIA 4XVHA 1CZSA 4QX3A 2JD9A 4BK4A 2W1WA 3OBAA 3W5NA 3WF3A 2QBXA 4QX0A 2X09A 4ZXEA 4QB1A 1T2XA 2OKXA 3VDBA 4GWIA 5JXGA 2B4KA 2ID4A 3PUIA 4JKKA 2VR4A 4LHSA 5CZKA 3DYOA 4CUAA 3SEPA 2WO2A 4JKMA 1W99A 1GOHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SKV A;  2QQJ A;  1OF3 A;  2WDB A;  4P02 B;  1PX4 A;  4DEQ A;  2VZS A;  4E8C A;  2Y6J A;  2VZT A;  2VZO A;  2JE8 A;  4P5Y A;  2EIE A;  4A45 A;  4OMD A;  1BHG A;  1KGY A;  3K4D A;  3MO4 A;  5JR2 A;  1F4A A;  3U37 A;  1W9S A;  2J1R A;  2RJ2 A;  1NUK A;  2KD7 A;  3GDB A;  2YB7 A;  1MPX A;  4FI9 A;  4KWU A;  1LNS A;  3T0B A;  3WNK A;  1NX9 A;  4HG6 B;  3WNL A;  2Y8K A;  2BER A;  5A1A A;  4A4A A;  1D7P M;  4TXW A;  3ZM8 A;  3DEC A;  1GU3 A;  3I2G A;  1P8J A;  3I2I A;  3UES A;  3I3E A;  1PMH X;  1OD3 A;  4A3Z A;  1US2 A;  2V4V A;  1GOG A;  4QB6 A;  2QQN A;  1JZ6 A;  5LA2 A;  2C9K A;  2VC9 A;  1JU3 A;  4P08 A;  3K46 A;  4IUG A;  2V72 A;  4CUC A;  5JMO A;  2XHN A;  5B4X A;  3I2K A;  3VD4 A;  3C8X A;  4ZY9 A;  3D3A A;  4M4P A;  4D0Q A;  1SDD B;  1JZ8 A;  3C7O A;  5C7G A;  2W3J A;  3VD7 A;  3WNM A;  5G05 L;  1UXX X;  4JHZ A;  2WAA A;  5JXI A;  5G04 L;  3LEK A;  4DXR A;  5HPO A;  3MUZ 1;  4UAP A;  3T09 A;  1O59 A;  3T0A A;  2VQU A;  3A22 A;  1OF4 A;  2R7E B;  1YQ2 A;  3NNG A;  3P1I A;  4DEV A;  3VD5 A;  4ZZ5 A;  3CZJ A;  1CX1 A;  4P00 B;  2QQI A;  2J1T A;  4ET7 A;  1US3 A;  3DYP A;  1W8N A;  4MGQ A;  2ZEY A;  1K45 A;  3LPF A;  4AG4 A;  4DUW A;  1GNY A;  4D8M A;  4LPL A;  3AC0 A;  4A41 A;  2J1V A;  4XUP A;  2YG0 A;  4QAW A;  5JUV A;  5LA0 A;  4M4R A;  2CDP A;  2VZR A;  3HJR A;  2W9X A;  3P6B A;  4JX0 A;  1XNT A;  4QPW A;  2QQO A;  2YFU A;  2VTF A;  1F4H A;  4TTG A;  3GXU A;  3THD A;  1DP0 A;  3BN6 A;  2Y6L A;  1IQD C;  5IFP A;  5LA1 A;  2PQS A;  1J83 A;  3FL7 A;  1UY2 A;  1DYO A;  1L7R A;  4A6O A;  2YC4 A;  3I97 A;  2LW8 A;  4MO3 M;  2CDO A;  2VMD A;  1L7Q A;  3LE0 A;  3NQH A;  3T0D A;  2WZE A;  3A21 A;  2J1E A;  3EYP A;  1UX7 A;  2J1S A;  5FUI A;  4DXT A;  1UYY A;  4GZ9 A;  4LKS A;  4KI5 M;  5EJZ B;  2WYS A;  3E1F 1;  3CDZ B;  3MUY 1;  2WO3 A;  3WF1 A;  1W8O A;  1J84 A;  2X05 A;  4QX1 A;  1UYZ A;  4JKL A;  2QQM A;  2C26 A;  4RYD A;  1K3I A;  4UOJ A;  3JXS A;  2W5F A;  3CIH A;  3ACI A;  3UNP A;  3HN3 A;  1XC6 A;  2HLE A;  2E33 A;  1W9W A;  2Y6G A;  2VMF A;  3LPG A;  5IFT A;  2VZQ A;  3HPN A;  3UET A;  1H6Y A;  3MBW A;  4ARY A;  3T08 A;  1UY0 A;  5B4N A;  2ORX A;  2W94 A;  1UWW A;  4OZO A;  2VZ3 A;  3VDA A;  3DYM A;  2EID A;  2VL4 A;  1JI6 A;  3IB3 A;  3III A;  1W9T A;  2W1U A;  1GUI A;  2XQX A;  3ACF A;  1ULP A;  4XUT A;  1O8P A;  3OB8 A;  2JDA A;  2WN3 A;  5DQ0 A;  2Z4F A;  5J1X A;  2VJX A;  3GM8 A;  4QDR A;  1OT5 A;  2VCB A;  2XOM A;  3ABZ A;  3C7H A;  4CUB A;  4DUV A;  2V5D A;  2VZV A;  4OMC A;  4CU7 A;  1DLC A;  3CQO A;  1UMI A;  1GOF A;  2W95 A;  4W4Z A;  2WUH A;  4QDS A;  1PMJ X;  2VCC A;  3OGV A;  3OGS A;  4XUO A;  2JKX A;  1GMM A;  4L0P A;  1JHJ A;  2YFZ A;  4PQQ A;  4PT6 A;  2EIB A;  4MAD A;  3I3B A;  1JZ3 A;  2VO5 A;  3NRU A;  1JYV A;  2WBK A;  3HNB M;  3A7Q A;  1ULO A;  3CZU A;  4KMQ A;  4BK5 A;  3GGL A;  4MGS A;  2EIC A;  2XON A;  4CU8 A;  2W1Q A;  1UY3 A;  5JXJ A;  1XPW A;  2BZD A;  3VD3 A;  1RYY A;  4PF1 A;  3NJX A;  3WSO A;  1HN1 A;  3FN9 A;  3FHQ A;  2BGO A;  4ARX A;  2X10 A;  1R64 A;  3T2O A;  3A23 A;  2WZ8 A;  3OEA A;  3HNM A;  3PUH A;  2RV9 A;  3WQB A;  5C70 A;  3WF0 A;  5IJR A;  2W46 A;  2C4X A;  2W91 A;  3ACH A;  4BJ0 A;  1UYX A;  2LS6 A;  2DDU A;  1EUT A;  1JZ7 A;  4Z2A A;  2QQK A;  4CU6 A;  2VCA A;  3WF4 A;  3C7G A;  5DN2 A;  2YC2 A;  1JYN A;  3ETP A;  2WAB A;  3THC A;  5EIY B;  2Y6H A;  4OUE A;  4QDQ A;  4DUX A;  2VQT A;  1JZ4 A;  2J22 A;  2DCJ A;  3WNN A;  4A42 A;  2VM9 A;  2BBA A;  3SEE A;  3ECQ A;  5DPN A;  3EB7 A;  2WO1 A;  2ZEW A;  3K77 A;  1XNA A;  4LQR A;  1K12 A;  4ZZ8 A;  3LEG A;  2VOT A;  2BGP A;  3I2H A;  1CZV A;  4W8J A;  3IAP A;  1UZ0 A;  4RN5 A;  5F7U A;  4UI9 L;  3I2F A;  4BXS V;  2VMC A;  2W47 A;  3HNY M;  2E32 A;  3VD9 A;  5CYY A;  2W87 A;  3OGR A;  3OEB A;  3IDA A;  5LCW L;  5IYY A;  3BGA A;  2J1A A;  2VZ1 A;  5HXM A;  3MV1 1;  2RVA A;  5C71 A;  2ZEX A;  2DCK A;  3IAQ A;  4A44 A;  1JU4 A;  1K42 A;  5EJ1 B;  5I0D A;  3MV0 1;  2ZEZ A;  3K75 B;  1CZT A;  2QQL A;  4XUQ A;  1WKY A;  3WF2 A;  4DXS A;  1SHW B;  5DMY A;  1JZ2 A;  1H6X A;  1JYW A;  2VME A;  4AAX A;  2VZP A;  3K4Z A;  1EUU A;  1WCQ A;  1W0N A;  2W92 A;  3I3D A;  3ACG A;  1O8S A;  2W1S A;  2Y6K A;  3CMG A;  1TVG A;  4CU9 A;  1NAE A;  4QX2 A;  4E8D A;  3FHA A;  3OG2 A;  4QB2 A;  5JXH A;  1NKG A;  3CKH A;  3LQC A;  3C7E A;  1UXZ A;  4XUN A;  2WN2 A;  3SKJ E;  1OH4 A;  2ZXQ A;  3F2Z A;  3W5M A;  1CIY A;  2HYX A;  3I2J A;  1JZ5 A;  1I5P A;  1PX3 A;  1SG3 A;  4W50 A;  4CVU A;  2B9V A;  1KEX A;  4XUR A;  2VZU A;  2E26 A;  1GQP A;  2Y64 A;  3T2P A;  3WNO A;  3WNP A;  1UY4 A;  3J7H A;  1UY1 A;  4XZU G;  3HEI A;  4OYU A;  4GWJ A;  3C7F A;  2WQ8 A;  3HOB A;  1TG7 A;  3NJV A;  1UMH A;  2J1U A;  3K4A A;  3VDC A;  3WEZ A;  4MOA A;  2J7M A;  4YPJ A;  5IHR A;  3T2Q A;  1JYX A;  2ORZ A;  2L9L A;  2E31 A;  2WAO A;  4BDV B;  3LEI A;  4XVH A;  1CZS A;  4QX3 A;  2JD9 A;  4BK4 A;  2W1W A;  3OBA A;  3W5N A;  3WF3 A;  2QBX A;  4QX0 A;  2X09 A;  4ZXE A;  4QB1 A;  1T2X A;  2OKX A;  3VDB A;  4GWI A;  5JXG A;  2B4K A;  2ID4 A;  3PUI A;  4JKK A;  2VR4 A;  4LHS A;  5CZK A;  3DYO A;  4CUA A;  3SEP A;  2WO2 A;  4JKM A;  1W99 A;  1GOH A; 
#chains in the Genus database with same CATH topology
 1W0O A;  1PGW 1;  4KQ7 A;  5CKM A;  3ZYB A;  4YFZ A;  2QQJ A;  1FV2 A;  2CSG A;  1DYP A;  3FUO A;  5FUN A;  1OF3 A;  3GBG A;  1Y4W A;  4P02 B;  4PLO A;  4MGK E;  4DEQ A;  2EVX A;  4L92 A;  2XJP A;  4WVW A;  1JOB A;  3HQU A;  4GB3 3;  4K40 A;  2VTX J;  2VNO A;  2VZO A;  3D82 A;  4AF9 A;  1HQL A;  1TMF 2;  5JWP A;  2RM2 2;  2OQ6 A;  3UK9 A;  2EIE A;  2WFP A;  4FT8 A;  4TWT A;  5FLH A;  1BHG A;  1PNF A;  3MO4 A;  2AH2 A;  1F4A A;  4CDU B;  2PTM A;  3VBS A;  3N35 A;  3WR0 A;  1S1A A;  4G3Y C;  5FZH A;  2B42 B;  1MPX A;  2KR2 A;  3CJI B;  4KWU A;  5JI7 A;  2F6B A;  3WNK A;  3WG3 A;  4BQ5 A;  4COZ A;  5L7O A;  2Y8K A;  1E5I A;  1YNA A;  2RS3 2;  3N4M A;  1WZX A;  3M1H A;  3UJQ A;  4ORF A;  4OI1 A;  1GU3 A;  1P8J A;  2NP0 A;  1XU2 A;  4X6Q B;  2BEO A;  2BV4 A;  1C8M 3;  2CGN A;  1QKQ A;  1YI7 A;  4EWD A;  1ZRF A;  5FMO L;  4V2W A;  1OQE A;  2K46 A;  2JG9 A;  3MW4 A;  3MIC A;  1R08 1;  1UAI A;  3O14 A;  3AK0 A;  1CAU B;  2JDH A;  5KWR A;  5J96 B;  1ASJ 2;  2V72 A;  1PK6 C;  5KHK A;  2YHJ A;  2XHN A;  2UYA A;  2HWE 2;  3I59 A;  4PF5 A;  1BXH A;  5JMO A;  4NUB A;  4BCU A;  1RUN A;  2D93 A;  2XBO 2;  4RA0 A;  2OW4 A;  2PHL A;  3C8X A;  1ZBE 3;  4QU1 A;  1PHM A;  3GYD A;  1EAH 1;  5FZF A;  2YV8 A;  1J1L A;  2A6V A;  4QQL A;  2WNV A;  3RZJ A;  4XMI A;  4ZKT B;  4TLF A;  5KXB A;  4XPV A;  2JIC A;  3PNA A;  2Y34 A;  2JDN A;  3C7O A;  1C1L A;  1GIC A;  1NXM A;  5G05 L;  2VBB A;  4YW4 A;  3HBZ A;  4JHZ A;  5EYY A;  1GQH A;  4PJY A;  4XQ4 A;  4GJY A;  2Q8D A;  2WAA A;  3AX4 A;  3VLB B;  3KM5 A;  1VBB 3;  2OZJ A;  3MFC A;  1WMF A;  3LEM A;  1RUH 3;  2IVI B;  2XG3 A;  3E6D A;  4IEP A;  4LUL A;  1W9Y A;  2ZHM A;  5T5J A;  4UAP A;  3H7Y A;  3VBF C;  3WUC A;  4IDZ A;  5CVR A;  5EV7 A;  2EAL A;  2RM2 1;  3MIG A;  4E4H A;  4CPB A;  4TN7 A;  2P4E A;  1DQ1 A;  4YW7 A;  3VKL A;  3MLK A;  1OF4 A;  3TWI A;  3ZPO A;  1YQ2 A;  3NNG A;  3R0R A;  3KT4 A;  1BBT 1;  2A7A A;  5FPZ A;  4I30 A;  3P1I A;  3AZZ A;  4FPG A;  5JLV A;  5CFD B;  4WM7 A;  2QQI A;  4IV1 A;  1BCX A;  2J1T A;  2YU2 A;  5D8A B;  5C3Q A;  3SCH A;  1W8N A;  2ZEY A;  1B35 A;  5C6C A;  3HT1 A;  3LFI A;  4A41 A;  4QQ2 A;  1CX4 A;  4XFI A;  1F8V A;  4QAW A;  1O7F A;  1QH6 A;  2BGC A;  3B01 A;  3MLJ A;  1LHO A;  5GJ6 A;  5LA0 A;  2VAU A;  1ENX A;  3U1X A;  4FPH A;  5EJ3 A;  4M4R A;  1OPO A;  2V5Y A;  1RUI 2;  3ZXL A;  2QFE A;  4S2H A;  4CEW A;  3LSE A;  5JOX A;  1T6B X;  4W6X A;  5HBA A;  2O8Q A;  2P3I A;  3BN6 A;  1RIN A;  3ZIW A;  2ETE A;  3RJ2 X;  3ZR5 A;  3LAG A;  4I3G A;  5LA1 A;  2R30 A;  2UUR A;  2XUE A;  5GZE A;  4XAA A;  2HKX A;  5FOJ B;  3ZFG A;  1WME A;  5FYT A;  1DGR N;  3VZN A;  2WYF A;  1KDM A;  4QKN A;  4RQP A;  3HWJ A;  3I4I A;  1NZC A;  1YEW A;  2Y33 A;  2ZCW A;  5DDJ 1;  4NIH A;  1XE8 A;  2LW8 A;  3AL6 A;  4XE9 A;  3ZSM A;  4MO3 M;  4Q4Y 1;  5HI0 A;  3LE0 A;  1H8T A;  4LBK A;  4HBN A;  5T55 A;  3O0V A;  2CY6 A;  2J1E A;  1ALY A;  1EV1 2;  1D4V B;  1UIK A;  1UX7 A;  2WWJ A;  4JC1 A;  4CDX C;  4H55 A;  5FUI A;  2GNT A;  1CD3 G;  4FTE A;  2V4A A;  4Q4X 2;  1RUJ 2;  3THT A;  3ZFE B;  3ZN6 A;  4GZ9 A;  1NY7 1;  2ZGK A;  3IBM A;  2Q5T A;  1VJ2 A;  1ND2 C;  1W6M B;  2R0F A;  1UN1 A;  2FQP A;  4XIL A;  1ZRD A;  3CDZ B;  1XSR A;  2ZGU A;  1PO2 2;  1ZRC A;  1CQ9 A;  3WF1 A;  5C4W C;  2CWM A;  1W8O A;  4DIN B;  4SBV A;  1J84 A;  1ONA A;  5FY0 A;  2ET7 A;  1K5M A;  3VBO C;  1GZ9 A;  5LK5 A;  1ZZB A;  1JUH A;  1RTV A;  2K2S A;  1XBF A;  4C1X A;  5I91 A;  1RJ7 A;  5T3N A;  1SBE A;  1OXC A;  2VNG A;  4EV0 A;  3JXS A;  4N7I A;  4OVE A;  4ASK A;  3ZKY A;  3NNF A;  2A75 A;  1WGP A;  3ES1 A;  5F39 A;  2BYV E;  3KV4 A;  5T54 A;  3DV8 A;  3VHR A;  5B2G B;  1CN1 A;  5BNO B;  4QQP A;  2DVA A;  3AZX A;  1XC6 A;  1NCQ A;  2P3Y A;  3POW A;  1GZT A;  4GQ7 A;  2Q30 A;  4RS5 A;  1Y9G A;  1HB3 A;  1W8F A;  2PHT A;  4JAA A;  5JR7 B;  3RFR A;  5JMC A;  1W9W A;  5EP9 A;  4OCT A;  3NAP B;  3I7D A;  4TYS A;  4BQ3 A;  2V09 A;  1FX5 A;  1VBA 2;  4P9J A;  1W8U A;  2VZQ A;  3TEX A;  1WA6 X;  3RZH A;  2ZGT A;  1RMU 1;  4JQT A;  1KJR A;  1XE0 A;  5B4N A;  3I2O A;  2ORX A;  3M70 A;  2VD7 A;  2NPI A;  3USU A;  3HN1 A;  4DQA A;  1GP4 A;  4ISQ A;  1F15 A;  3VDA A;  2FHR A;  3VBR C;  2RMU 3;  4CDQ B;  2ZX3 A;  2EID A;  4GH4 C;  1R09 2;  4NWV A;  3WIN E;  3IB3 A;  3N9O A;  4Q0P A;  5GLU A;  2W08 A;  3NNL A;  1GUI A;  3NV4 A;  3CBN A;  3OB8 A;  5FP7 A;  3ZFF B;  2WN3 A;  3VDD B;  1HV0 A;  1VB2 A;  5BPX A;  2SLI A;  4RL7 A;  5ACA 2;  1LES A;  3ZIX A;  5CB7 A;  4QDR A;  1OT5 A;  4Z82 A;  3WDU A;  4Y20 B;  4A3X A;  4CUB A;  1TNR A;  4DUV A;  1H4H A;  2VZV A;  2MPF A;  1XYN A;  4WVM A;  2XJU A;  4JRL A;  3T1L A;  4CDW B;  2G9F A;  2A6X A;  2Q8C A;  4RGK A;  5BNN A;  2RR1 2;  3R4U A;  4IER A;  4N9I A;  1G9B A;  2JDP A;  2H6B A;  2XJV A;  3CEW A;  1LKN A;  1PMJ X;  3V0B B;  4JV4 A;  1TMF 3;  3OGV A;  1AYM 1;  4XUO A;  3FUQ A;  4CCN A;  1GMM A;  1HRV 2;  1JHJ A;  4AFA A;  1QEX A;  4R4X A;  5A7Q A;  3O1U A;  2R1D A;  1VRH 2;  3RG0 A;  3U10 A;  3DCQ A;  3J4U H;  1JZ3 A;  4AE2 A;  2VO5 A;  4NOT A;  3IMN A;  3CJI C;  3ZR6 A;  3S57 A;  3CZU A;  1VIW B;  2JDY A;  3IM0 A;  4LOT A;  4BK5 A;  5FP9 A;  4LOS A;  4MHU A;  3GGL A;  4MGS A;  2Q1M A;  2VXR A;  5AC9 3;  1BQP A;  1OI6 A;  2VVE A;  3DEM A;  2RS3 3;  2XON A;  1FAY A;  2GND A;  4LJH A;  4JGY B;  1SQ4 A;  1XND A;  2YZ4 A;  5CBL A;  4D94 A;  1XPW A;  2OYZ A;  1W6P B;  1RYY A;  3TRS B;  3WSO A;  2JE7 A;  4K1Y A;  4CP9 A;  1HN1 A;  4JGZ B;  4XIO A;  2FDI A;  5F3I A;  3M3O A;  3MF6 A;  1AR8 3;  1OBN A;  2GC1 A;  1R64 A;  2IXL A;  3OY8 B;  2WZ8 A;  3OUI A;  4YM0 A;  4XBN A;  5JPN B;  4L8Q A;  5J7M A;  2JB4 A;  4R4Z A;  3WF0 A;  1ASJ 3;  1JYI A;  2W46 A;  4NII A;  3QAC A;  2PXJ A;  1LOF C;  2CL2 A;  4EN6 B;  2HWE 3;  4PLN A;  1EUT A;  3AP6 A;  1RUO A;  4YZ4 A;  4FPJ A;  4YVS A;  5A6Z A;  4XTP A;  2XBO 3;  3POI A;  5FAX A;  5KHH A;  4ES9 A;  4R8H A;  1SAC A;  4K1Z A;  4CU6 A;  4PBO A;  1JS9 A;  4A2U A;  4BQ2 A;  3C7G A;  5FRE A;  1UKG A;  3E5U A;  5EYX A;  3GZU C;  3IDE A;  3ETP A;  2EAK A;  3DPR B;  5ACA 1;  4OUE A;  1FMD 1;  5FKB A;  5CFC A;  5I93 A;  5K0U B;  3BKZ A;  5LA9 A;  2A3Y A;  2DCJ A;  4LBM A;  4A42 A;  3QH6 A;  1SMV A;  3WP5 A;  1QJY 1;  2DVF A;  4OZX A;  4YZ3 A;  4LKE A;  3ECQ A;  5DPN A;  3O1P A;  2QVS B;  2Q0A A;  3AMP A;  4EWE A;  1WBF A;  2VTX A;  3J26 N;  4YGD A;  3IKW A;  1YYN A;  4XBQ A;  3ZSL A;  2A3X A;  2K9Z A;  2YDE A;  3H1Y A;  4L9B A;  5A32 B;  1K12 A;  2DV9 A;  4HSL A;  2CGO A;  2VOT A;  1VAL A;  4YGE A;  5BY5 A;  4EQV A;  3U0Z A;  4OHV A;  1UZ0 A;  3T30 A;  4N53 B;  4QX5 A;  1GNZ A;  4QXB A;  5FZ3 A;  2OZ6 A;  1DLL A;  1NA1 A;  2WNU A;  4JTN A;  2YXS A;  4DPN A;  1MEC 2;  3AKP A;  1RVF 2;  3P5B A;  1CJP A;  3AP4 A;  5D8A C;  1U5I A;  1DQ2 A;  1EPZ A;  3IDA A;  5KHG A;  2DF7 A;  2JKB A;  1G9C A;  2XVL A;  5LBB A;  1S2K A;  2QJV A;  2J1A A;  3MZH A;  2EAA A;  1YCI A;  2RVA A;  4RHV 2;  2WQ4 A;  2I07 B;  3OCP A;  2ZEX A;  5A7S A;  1H9W A;  4CCC A;  3U4S A;  2MHF A;  3SHR A;  2C24 A;  1MQT A;  4XQW A;  1RUI 3;  5JZG B;  3SC7 X;  3KQR A;  1RUG 2;  3GZT B;  3BTZ A;  2HWD 1;  1UF2 C;  3WDY A;  4URA A;  3D6E A;  2B45 X;  2DVB A;  3H50 A;  4BQY A;  3DKW A;  3MV0 1;  2ZEZ A;  1YQ5 A;  2YBP A;  2QQL A;  3L2Y A;  3GJA A;  3EHK A;  3WF2 A;  3B3Q E;  5BNP C;  5C5U A;  2WWS A;  1H6X A;  4IE5 A;  5E88 A;  3WDW A;  5JSP A;  1H1I A;  1BLZ A;  2WNE A;  3LDB A;  2VZP A;  1RUD 2;  4N90 A;  4XMA A;  4YLZ A;  1WCQ A;  5GZG A;  5FK7 A;  1OKQ A;  1RHI 2;  2W92 A;  4DMI A;  1BK1 A;  2W1S A;  3GF6 A;  1EV1 3;  5FZK A;  4CU9 A;  2NQY A;  3N9N A;  3ITQ A;  4Q29 A;  2JX9 A;  3N9Q A;  4GB3 2;  1U0A A;  4R52 A;  4Q4X 3;  1RUJ 3;  1DYK A;  1H30 A;  1SFY A;  5DG1 A;  3ZFE C;  1OOP B;  3I59 B;  4LIV A;  3FHA A;  3LA7 A;  1WCU A;  2DBI A;  1UQX A;  3EO6 A;  2LTN A;  4JTO A;  1CWP A;  1Q3E A;  3LIH A;  2F4P A;  5LEJ A;  1PO2 3;  2ADD A;  4YW1 A;  1OH4 A;  4I02 A;  3BTX A;  1RUE 2;  2IFW A;  1MS1 A;  2IVJ A;  2P3J A;  2ZGP A;  1XRU A;  2ZXQ A;  1CIY A;  1O4T A;  2CNA A;  4QD2 A;  5IVB A;  1UZZ A;  2HYX A;  4URT A;  5H9S A;  3ALQ A;  3DGT A;  2LRP A;  3ST7 A;  4GAL A;  1SG3 A;  2NZ9 A;  4FFF A;  4UFM A;  1RB8 G;  3NO8 A;  3AMM A;  5FMO S;  4KL1 A;  4Y24 A;  2Y64 A;  1CIW A;  3WNO A;  3NNM A;  3VGI A;  5C8C B;  3WNP A;  1VLN A;  4FAG A;  2VG9 A;  1A6C A;  1FAT A;  1MEC 1;  1U5Y A;  1RVF 1;  1YUD A;  3NKT A;  5BNO C;  1W6O A;  3KHB A;  2WLP A;  1F5F A;  3KVA A;  1TG7 A;  2G9G A;  5F3E A;  2J1U A;  4AQT A;  3WW1 A;  4AW7 A;  4D7S A;  1QDO A;  4N8M A;  4PIX A;  1PM7 A;  1VBC 1;  4RHV 1;  3VDC A;  1HW5 A;  1NG0 A;  1V6O A;  3NV2 A;  1VP6 A;  1W3X A;  4IEX A;  4LA2 A;  4AGR A;  1JYX A;  2ZPX A;  3NAP C;  4N43 A;  3O12 A;  4AVS A;  2E31 A;  1RUC 2;  4UW3 A;  1VBA 3;  3ZVX A;  1W9F A;  4E4Z A;  3WVJ A;  4WZF A;  3O1O A;  3LEI A;  2EXJ A;  4Q4V 2;  1QJU 1;  3CHX A;  3PDQ A;  4CZS A;  3O5S A;  4Y22 B;  1L7L A;  4OLL A;  1RUF 1;  3H9A A;  2FCU A;  4MLO A;  1QF3 A;  2IFR A;  4AEK A;  4BIF A;  1PO1 2;  4ZXE A;  3V56 A;  4CDQ C;  1R09 3;  4QB1 A;  5FZ8 A;  2OKX A;  4K9S A;  1MZE A;  4A6S A;  3VDB A;  1JN2 P;  5JXG A;  1GWL A;  4LO5 B;  1JXN A;  2VQA A;  3ZFF C;  2PMW B;  1I6X A;  3N7K A;  3OOX A;  1X9T A;  3MID A;  3VDD C;  4EN0 A;  2HJI A;  4CUA A;  1VBB 2;  4QQO A;  3I8T A;  4UT5 A;  1AX0 A;  4QPG A;  1RUH 2;  3OBR A;  3ZYP A;  5F3G A;  1ZA4 A;  1W99 A;  1W8H A;  4HSJ A;  4Q27 A;  3PIJ A;  1A34 A;  1HXS 3;  4BQW A;  1RXF A;  4GB3 1;  3TYJ A;  2HBT A;  4YVW A;  2WDB A;  4Z92 B;  1UOG A;  1NLS A;  5FCC A;  4CDW C;  2VZS A;  4ZS3 A;  3VUO A;  5FZ1 A;  2RR1 3;  1S0B A;  3WP3 A;  3ZYR A;  3TN9 2;  4OI2 A;  4XF0 A;  3DN7 A;  4CCD A;  2XWB B;  4YGB A;  1X8M A;  5A6X A;  4B8E A;  4BQ1 A;  2ILM A;  3SH3 A;  3PVB B;  1ZA7 A;  5JI9 A;  2BNM A;  5JVV A;  3WQ1 A;  4UF0 A;  3K4D A;  1HRV 3;  4S2D A;  5JR2 A;  3IPV B;  1ENS A;  1W9S A;  5FPX A;  3ATG A;  1VRH 3;  2DTW A;  2XJS A;  3GDB A;  4MVT A;  4CCO A;  2QE3 A;  2YB7 A;  1VAM A;  2ZKL A;  3KGL A;  3W20 A;  3RSJ A;  2NMN A;  3ZXF A;  3H3U A;  3SCF A;  1LHW A;  5CIR A;  1QY4 A;  1YHF A;  2ZML A;  5GLW A;  3WNL A;  4B4R A;  3HBK A;  2WZR 3;  5F5A A;  3ZN5 A;  2QZ3 A;  1C8M 1;  4AOC A;  2WQZ C;  4LNV A;  3EBR A;  4JGY C;  3I2G A;  5LBC A;  1VRB A;  3UES A;  2W39 A;  3TBD A;  1K5M B;  4QX8 A;  1CES A;  4QU2 A;  5GLV A;  1PIV 2;  1PMH X;  2H6C A;  3B9I A;  1OD3 A;  1O3R A;  2GSY A;  4BXF A;  1US2 A;  1O6U A;  2V4V A;  1E5H A;  5F6L B;  4JGZ C;  2GP5 A;  1JTZ X;  1LGB A;  3B69 A;  1IQA A;  5FZO B;  5LA2 A;  2D6O X;  2C9K A;  2VC9 A;  4HON A;  4P08 A;  3VHO A;  3USS A;  2DYC A;  3JBG 2;  4QPI B;  5F6K A;  1ZBE 1;  2JIG A;  2IXC A;  2VW1 A;  5DAW A;  5I8S A;  5FZL A;  1NCR A;  4FO9 A;  4IE7 A;  4ZY9 A;  3SNM A;  2DTY A;  4IET A;  2WSU A;  3D3A A;  1YWK A;  2C0Z A;  2D7F A;  3RPQ A;  1YRZ A;  3AMH A;  1LB2 A;  1T6G C;  1S0G A;  2JEN A;  1RJ8 A;  1SDD B;  2G4I A;  1IKP A;  3DPR C;  5C9A A;  2ZGQ A;  1VBB 1;  5K0U C;  1WLT A;  3POY A;  1UXX X;  4QM9 A;  4CP0 A;  3VV1 A;  4DNY A;  3KV9 A;  1GSL A;  2X5I B;  1XU1 A;  5FPU A;  1MAC A;  5G04 L;  4AQS A;  1A3K A;  5DUX A;  1FPN 3;  1YIF A;  2DUO A;  5A6Y A;  4XDO A;  1QMJ A;  4YW2 A;  2UWB A;  2WA3 A;  1O59 A;  1NYW A;  1PGS A;  2VQU A;  4I01 A;  4BLJ A;  4N53 C;  4Q1R A;  5FPB A;  3LSD A;  3VB9 A;  5LBE A;  2WKK A;  4XDQ A;  3PMS A;  2AEN A;  4XF4 A;  3PVE A;  1KD7 A;  1YXW A;  4AEJ A;  4IND A;  3AP9 A;  4BZ4 A;  3MIH A;  5A3O A;  2H0V A;  2XKP A;  4KGQ A;  4P00 B;  4EN9 B;  3OD0 A;  4D3W A;  4ET7 A;  2ZOE B;  3ME2 A;  1K45 A;  2I74 A;  5AFB A;  4ASL A;  1G9A A;  5D21 A;  3ZDV A;  1LRH A;  1OLM A;  2YG0 A;  5L9V A;  5FY4 A;  1QWR A;  1VBD 2;  1UYP A;  4CRQ A;  2OPK A;  4QGL A;  2CDP A;  3HJR A;  2E7T A;  3I54 A;  4QPW A;  2ERF A;  1S0F A;  2QQO A;  3CNA A;  5JZG C;  1RUG 3;  4I0W B;  4J1X A;  4UFK A;  5D2A A;  2RMU 2;  3O1S A;  1W3V A;  5SV8 A;  4FSJ A;  4LHL A;  4NHM A;  2BOJ A;  1WD4 A;  3GHM A;  5IFP A;  2WR9 A;  2GC0 A;  3MW2 A;  1LHU A;  3BIE A;  5I0R A;  2PQS A;  1ZYB A;  3FBY A;  5FXV A;  1HQN A;  3LWC A;  4P14 A;  3VL8 A;  3RZK A;  3VHN A;  1UY2 A;  2BFU L;  2EXH A;  1OPM A;  1JH5 A;  1RUD 3;  2P5B A;  4A6O A;  3I97 A;  2WFF 3;  5IAV A;  4XXA A;  1LHN A;  4IGP A;  5C33 A;  4M3C E;  1L7Q A;  2Q8E A;  1RHI 3;  5F8P A;  3WQ7 A;  4AHW A;  4IEW A;  3H8U A;  2YPJ A;  4IQP A;  1FT9 A;  3OD4 A;  1POV 3;  5FV3 A;  3WHT A;  3HMY A;  2AGS A;  3MGU A;  4FFH A;  4H2A A;  4NPR A;  1OOP C;  5FZ9 A;  3AYD A;  4MV2 A;  5EJZ B;  3RQ0 A;  4M3C F;  1PGL 2;  1NE4 A;  4ERO A;  4ZU4 A;  5DXD A;  4LO7 A;  3VKO A;  1NLQ A;  2WO3 A;  4RR3 B;  5HCB A;  4C0H A;  5LEK A;  1PZ7 A;  1OKO A;  3C3V A;  1PZ8 A;  1IG0 A;  4LK6 A;  4QX1 A;  1RUE 3;  4BMB A;  1BVV A;  1PVC 3;  2CAU A;  3B9C A;  1COV 2;  1I3H A;  3WT3 A;  5CFC B;  1JYT A;  5FLI A;  3H1M A;  1D4M 2;  3NV1 A;  4LBQ A;  4Y5T A;  4YW3 A;  5AC9 2;  5A33 A;  2GU9 A;  1VAK A;  3JQW A;  5DG2 A;  1UPS A;  2PAM A;  3OBZ A;  3O1V A;  2W5F A;  4EE2 A;  5I8T A;  3KV6 A;  2B5H A;  5C8C C;  3AFG A;  4ZPI A;  2QQV A;  1YFW A;  4RGG A;  1AF9 A;  4XW3 A;  2VBP A;  1C5I A;  2HWF 1;  2JDU A;  1WLD A;  5H9R A;  4P9Y A;  1AR8 2;  3ZX7 A;  4AZZ A;  1ND3 A;  2JG8 B;  1TME 1;  2JIJ A;  2YBS A;  4GKX A;  4MGI E;  1CPN A;  4W6Y A;  5FY7 A;  3RNS A;  1BMV 1;  4AVC A;  4AK3 A;  1R1A 2;  3VBH A;  1QNW A;  3AXE A;  1TZO A;  2ZJC A;  1N1Y A;  1NA1 B;  2VMF A;  2XB6 C;  3PUA A;  1DQ5 A;  2ZTN A;  5GLT A;  3AMQ A;  5IFT A;  1RUC 3;  1WD3 A;  1H6Y A;  2RMU 1;  3OF1 A;  1I9R A;  4ARY A;  4Q4V 3;  2VH9 A;  2WIN B;  3WW4 A;  1UY0 A;  4FFG A;  4WBB A;  2NM1 A;  3AP5 A;  1UWW A;  4Y5S A;  4C91 A;  1SBD A;  3M3Q A;  2WT1 A;  3WXP A;  5J98 B;  1CAW A;  1RC6 A;  3DYM A;  1PO1 3;  2VUC A;  2AEY A;  3III A;  2HWB 2;  4EJR A;  2W1U A;  2WT2 A;  3V0A A;  1O8P A;  4Q4W 2;  3PJQ A;  5ISL A;  2RDR A;  3B93 A;  1C8N A;  3DL3 A;  2Z4F A;  4HMZ A;  5FMC A;  5F37 A;  2ZA9 A;  1K5J A;  4RFR B;  4WM8 B;  2XH6 A;  1CAV B;  4IE6 A;  3ABZ A;  1E5R A;  4NRO A;  1UZV A;  5H9P A;  2V5D A;  1YJL A;  1SDW A;  4OMC A;  2EA7 A;  5HXV A;  4CU7 A;  4KU8 A;  2PHX A;  2VOW A;  4IEO A;  4ATF A;  1GOF A;  1TMF 1;  4NPL A;  3BCW A;  2R06 2;  4AFM A;  4OI0 A;  2X29 A;  5A7W B;  3NJZ A;  3WDX A;  5A80 A;  4LBN A;  2J42 A;  3TN9 3;  1RXG A;  2WUH A;  3GZA A;  4KNC A;  3MW3 A;  4CEY C;  3M7A A;  3I3Q A;  3OGS A;  4F8A A;  3ILR A;  4Q0V A;  2KXL A;  4L0P A;  3AZY A;  2YFZ A;  4YG0 A;  1YIP A;  1QOS A;  2EIB A;  3RMX A;  2CV6 A;  4AAP A;  2QNK A;  3I3B A;  2VPV A;  2PFW A;  3NRU A;  5FUP A;  1JYV A;  1MS0 A;  5AC9 1;  1UOF A;  2RS3 1;  4KMQ A;  3RGB A;  2GZW A;  2ZZQ A;  3U11 A;  5IK7 A;  3FE5 A;  1UCX A;  3FMG A;  4P9I A;  2EIC A;  3TNQ A;  4LE4 A;  5L73 A;  2PEL A;  1ZBA 3;  2HWC 2;  4HPK A;  3L9J T;  1MZF A;  1PNG A;  5T5O A;  1UY3 A;  4H14 A;  4HKO A;  4BLI A;  5T50 A;  2ZHL A;  5JXJ A;  2XPJ A;  1AR8 1;  3IMM A;  4XHX A;  1K5M C;  3NV3 A;  1X33 A;  5I0T A;  2IXI A;  1PIV 3;  3FN9 A;  5A7O A;  3UKT A;  4ARX A;  1HDK A;  4K3U A;  1ASJ 1;  1AUY A;  2F4L A;  1U12 A;  3A23 A;  1AJO A;  2HWE 1;  2RV9 A;  3PUH A;  3N7J A;  5IWF A;  4CTE A;  2C4X A;  2XBO 1;  4IGO A;  3JBG 3;  1UYX A;  3LB9 A;  4BJ0 A;  4BH9 A;  4QPI C;  3W59 A;  5FZ0 A;  3RMY A;  4B7K A;  1J3P A;  1QJZ A;  1OLM E;  2WZP P;  1J1T A;  5IT6 A;  4Z2A A;  1QJX 3;  4XJW A;  3ZYI B;  2GAL A;  3NVC A;  2A3W A;  2ARE A;  4KBZ A;  2JDM A;  3U14 A;  4K20 A;  4XDP A;  4MXW A;  1HLC A;  2Y6F A;  4FQ4 A;  3OJB A;  3AM2 A;  3UKV A;  2Y6H A;  5SV5 A;  4NO4 A;  3ORJ A;  3VBF A;  2VQT A;  4AI3 A;  4NRQ A;  2AZ5 A;  5FY1 A;  1W04 A;  2QUO A;  1UU6 A;  4OQ9 A;  3APB A;  4Y1Z A;  3EB7 A;  2VVF A;  2X5I C;  1S2E A;  3DKQ A;  5DAB A;  2Y26 A;  3TEW A;  1KRI A;  2XGX A;  1S0D A;  3IT8 A;  4EZH A;  4QXC A;  2XR4 A;  5FZI A;  5FMD A;  3JCI A;  4NWW A;  5FJK A;  1V6I A;  5IAX A;  3I49 A;  1CZV A;  1DQ4 A;  3ZXA C;  2ZAB A;  1DZT A;  3POF A;  4LKF A;  5IK4 A;  3BVC A;  1WLW A;  3LA3 A;  1HB2 A;  1X50 A;  2QTW B;  1Z7S 2;  1W28 A;  1UOJ A;  2GN3 A;  2VMC A;  3KCX A;  1OLR A;  3PU3 A;  4JRA A;  4MHR A;  3ROU A;  1YFY A;  2XLG A;  4OHZ A;  2E32 A;  3WNX A;  4KBB A;  2AYH A;  4AVV A;  5IK8 A;  1QGL A;  3ELN A;  4XC9 A;  2W87 A;  3OGR A;  2WNO A;  3NJY A;  3OEB A;  3PJY A;  4FXK B;  4HET A;  5FFO C;  5LCW L;  2ARC A;  1N1T A;  3BU0 A;  3KCY A;  2FDH A;  3GCX A;  5A3L A;  4PDW B;  3BGA A;  3KLS A;  3VL9 A;  2HYK A;  1RUI 1;  3VN4 A;  3MV1 1;  5J3U A;  4IV3 B;  2WL1 A;  1VBD 3;  2DCK A;  5C3O A;  5ABJ C;  4ZON A;  5ANQ A;  3AKQ A;  1ST8 A;  4EYU A;  5A1L A;  4XFC A;  4FOW A;  4NRP A;  4BE3 A;  5F2S A;  5K9Y A;  5I0D A;  4QQH A;  4HOO A;  4OUL A;  3NNJ A;  4JZR A;  5HCH A;  3K75 B;  4DS0 A;  4OHX A;  1CZT A;  5FZD A;  2D44 A;  2E7A A;  1JOD A;  2WS9 3;  4RGA A;  4CDX A;  1A8M A;  1MS4 A;  1W6Q B;  1W8Z A;  4UYB A;  2VME A;  3PUQ A;  1HKD A;  1W03 A;  3K4Z A;  5I0S A;  1R08 3;  1ZZ7 A;  3SH4 A;  5FQ0 A;  1ND2 A;  3J9S A;  1EV1 1;  2C1F A;  1VR3 A;  1Z0H A;  4FPC A;  4GA9 A;  5EZW A;  3KB5 A;  5FY8 A;  4YGC A;  4OHY A;  2OS2 A;  1HXS 2;  3I3D A;  4Q4X 1;  1RUJ 1;  1O8S A;  5L9B A;  3WG2 A;  1SCR A;  2XJQ A;  3OPW A;  4CA9 A;  5C4W A;  1OMI A;  2EF6 A;  4B29 A;  2IWG B;  4W65 A;  4IE4 A;  2NN8 A;  2Z5W A;  4GKY A;  2XDV A;  3VBO A;  4QX2 A;  3OBT A;  1FYU A;  1PO2 1;  4AVA A;  1OC1 A;  1OLQ A;  3K51 A;  3K3O A;  2Y60 A;  4Y4Y A;  2FCT A;  3X29 B;  1PMI A;  1IPJ A;  2C5D A;  1AX2 A;  1W6N B;  2YPD A;  3BAL A;  3FBM A;  1ULE A;  3LQC A;  5FYM A;  5T5P A;  4CDU C;  2RDS A;  4XIK A;  4RR3 C;  5LBF A;  5BYN A;  3B00 A;  3AYE A;  3R4D B;  4YZ2 A;  4R9B A;  1ZRE A;  5C9A B;  1REE A;  1COV 3;  1I5P A;  1XNC A;  3ASI A;  1S0I A;  4CVU A;  1KEX A;  1YQ8 A;  1D4M 3;  2WZR 2;  4XUR A;  2E26 A;  2GC3 A;  1GQP A;  3T4H B;  1LHV A;  3R6S A;  3CLP A;  3T2P A;  2PAK A;  1JBC A;  2K0G A;  4HKW A;  4ZS2 A;  1UY4 A;  4PCR A;  1NOV A;  3SCG A;  2BJS A;  4OYU A;  5CAZ A;  2R04 3;  3H8R A;  3C7F A;  4YYO A;  4FPL A;  5A3T A;  1H4G A;  3NJV A;  4XJ9 A;  1QU0 A;  2G19 A;  2EXK A;  2JG8 C;  1CAX A;  3FHI B;  4UBG A;  2NLR A;  1C3H A;  1VBA 1;  5M0T A;  2CYF A;  1R1A 3;  2D43 A;  4MOA A;  2J7M A;  3VBR A;  2QQU A;  5IHR A;  3T2Q A;  2UWA A;  2D98 A;  3EJK A;  4GH4 A;  3F95 A;  1YO8 A;  1NA1 C;  4Z8B A;  4BDV B;  3AZW A;  4DB5 A;  5AVP A;  3VKM A;  4LBJ A;  4Q0Q A;  5IW0 A;  3G7D A;  3VBU B;  5A1F A;  4XVH A;  1R09 1;  2ZX1 A;  4LIT A;  1W2T A;  4BK4 A;  2W1W A;  4QMA A;  3PU8 A;  2WII B;  4FOQ A;  3OBA A;  4J6G A;  5IAT A;  1WA4 A;  1S0E A;  4E27 A;  2WLQ A;  1PVX A;  5DAX A;  4FAH A;  1H1A A;  2HWB 3;  2FDJ A;  3G6J B;  1VE0 A;  4CE8 A;  3LCP A;  4Q4W 3;  2E9Q A;  4DIQ A;  2X8K A;  5FWJ A;  3D5O A;  4AR2 A;  3B94 A;  4UFH A;  3RZG A;  4ONU A;  2B9U A;  4D69 A;  4LBQ D;  2WO2 A;  4Y5Z 0;  4CXX A;  1FPN 2;  4WM8 C;  5FXZ A;  4FOY A;  1LEM A;  1KS4 A;  1W2U A;  2RR1 1;  3E6B A;  5DDJ 3;  3SKV A;  3TEZ A;  3IDC B;  4LHN A;  4B3N A;  4HN0 A;  3OUH A;  1G86 A;  1S0C A;  2R06 3;  2RG4 A;  3KCC A;  2VZT A;  5FIX A;  2FZ2 A;  3CJI A;  2LRO A;  1HRV 1;  1FXZ A;  2JE8 A;  4P5Y A;  3WDT A;  3AKS A;  4KWK A;  1VRH 1;  1DQ0 A;  1KGY A;  2D3R A;  2GN7 A;  3KZ4 C;  3AKR A;  4ES8 A;  2XLF A;  3U37 A;  3Q8A A;  4UFL A;  4P9X A;  5CFD C;  1H1M A;  5K4L A;  4A7Z A;  3GCW A;  2XML A;  1I1E A;  4FI9 A;  2WZR 1;  1LNS A;  3AFK A;  4GMP 3;  4NHY A;  1OVS A;  1R1Z A;  2TEP A;  2ZAH A;  4OUM A;  1NX9 A;  4HT1 T;  4Z1V A;  4XTM A;  4KG8 A;  3VBS B;  2OUH A;  3HVD A;  2LAL A;  2HWC 3;  1HJF A;  5KC6 A;  4N7U A;  1CAU A;  3I2I A;  1NZI A;  3TOJ A;  1N3P A;  1LOF A;  2BFU S;  5L7O B;  4LBQ B;  4A3Z A;  2P3K A;  4LO6 B;  2QQN A;  3MYX A;  1WLC A;  4KWJ A;  3RZM A;  1ZRR A;  2Q1Z B;  3W58 A;  1JU3 A;  2JWP A;  3PIG A;  4IUG A;  1OUS A;  4YAR A;  2WO7 A;  5A3U A;  4CUC A;  4HFS A;  2WFF 2;  3L2H A;  3WG1 A;  4F83 A;  1QQP 2;  3AYA A;  1V9U 2;  3ZYH A;  1WUV A;  5FO8 B;  1DGW X;  4BPZ A;  2JG9 B;  5CG8 A;  3I2K A;  4CPB D;  3VD4 A;  2IC1 A;  3TEY A;  3JZV A;  4HZF A;  2D40 A;  1N1V A;  4FOV A;  5F5Q A;  4NPM A;  2XQR A;  3LZZ A;  3C2U A;  2FD8 A;  4LE3 A;  1ZZ8 A;  3ZO0 B;  3O7O A;  4C90 A;  5FWE A;  4D0Q A;  1NE6 A;  1IZ3 A;  1W05 A;  1JUI A;  1V6N A;  5J36 A;  1LGC A;  1OQD A;  3AJZ A;  3POG A;  4HVQ A;  4HL0 A;  2VUA A;  4MGZ E;  2W3J A;  3VD7 A;  3WNM A;  4D7T A;  1VPH A;  1FPN 1;  5C71 A;  2DUQ A;  1AR7 3;  3B7M A;  1LJ7 A;  2ZX4 A;  1NQJ A;  3JD7 2;  3PTR B;  2WNV B;  2GMP A;  4XF9 A;  4Y3O A;  1PVC 2;  1UOB A;  3OSD A;  2DCY A;  2BTV C;  1JOJ A;  1QJF A;  2CHH A;  1FNZ A;  3NW4 A;  5TSW A;  3OPT A;  2B7Y A;  4IES A;  2XXZ A;  3GAL A;  4QKB A;  3WLU A;  4WVV A;  4ZU7 A;  5JIA A;  3VZO A;  3A22 A;  2BW8 A;  1AR6 2;  4IL7 A;  3A0N A;  2R7E B;  1DHK B;  3W9A A;  1Z7S 3;  1REF A;  3ACL A;  5FTT C;  5CNA A;  1KDK A;  4PIZ A;  4O7X A;  4DEV A;  4EZ4 A;  2GNM A;  4ZZ5 A;  1AL2 3;  1CX1 A;  4XOG A;  1US3 A;  1HV1 A;  2ARA A;  4AVB A;  2NMO A;  4MGQ A;  5LK7 B;  2H0B A;  4QM8 A;  1H9P A;  4AG4 A;  1VBE 2;  1N47 A;  4D8M A;  4DY3 A;  4M3C A;  3AC0 A;  4TZD A;  1WW7 A;  4PDW C;  5DAV A;  5DUV A;  5BNP A;  4AXO A;  4WM7 B;  5LWB A;  4AED A;  4IV1 B;  1RUG 1;  4IV3 C;  4I0A A;  4X8N A;  4PQ9 A;  3LDK A;  2W9X A;  3N7M A;  4JX0 A;  5FXX A;  2ZS6 B;  4P5H A;  5DAQ A;  1B35 B;  3LGR A;  2AC1 A;  2YFU A;  1SLI A;  4QHZ A;  4TTG A;  3GXU A;  2GDF A;  4A7K A;  2Y6L A;  4W6W A;  4FP2 A;  3ZLI A;  4Q26 A;  4R9C A;  2RDQ A;  1RUD 1;  1V00 A;  2WFF 1;  4Y1V A;  4LTA A;  4CEW B;  1KFX L;  1Q8Q A;  2OT7 A;  2D6M A;  3MF9 A;  1RHI 1;  4M0N A;  2JDK A;  3ZFE A;  1AL0 G;  1L7R A;  2YC4 A;  4KWL A;  5LY2 A;  5K7P A;  1LTE A;  2HEY F;  4UFJ A;  2Q4S A;  1W6M A;  2YGL A;  3KGZ A;  3BB6 A;  4KGG A;  4XAC A;  4Z07 A;  3NQH A;  1O3S A;  4LR4 A;  2BWA A;  4ZHN A;  2R07 2;  2J1S A;  4QX7 A;  5CA6 A;  3URF A;  4MXV A;  3ZFG B;  4DXT A;  1W2O A;  3HD8 B;  4AQ6 A;  4YZ1 A;  4XCB A;  4RQP B;  3WY6 A;  1MS3 A;  2C9A A;  4RFT 0;  3VZK A;  2FDG A;  5C3S A;  1ENQ A;  2UWC A;  2WYS A;  1H8T B;  5FPL A;  4P9W A;  2DVG A;  3E1F 1;  1RUE 1;  1Y9M A;  4FCA A;  4E4D X;  1PVC 1;  3D4K A;  4COY A;  3KD4 A;  4L11 A;  4XEZ A;  3ZN6 B;  3RDI A;  1I5Z A;  1PM4 A;  2Z2S B;  1HRI 2;  2JB8 A;  2XLA A;  2X05 A;  5CAD A;  2UU8 A;  1W2N A;  2BVV A;  5FYY A;  3FLT A;  5ERL A;  1UYZ A;  3ON7 A;  3ZXJ A;  5BNO A;  3KHC A;  5EFU A;  5C9A C;  3H3L A;  3WP6 A;  4HKL A;  4CCE A;  1ZBA 2;  5A3M A;  1URX A;  1L3J A;  2BBV A;  2BUK A;  1YQ6 A;  3BTY A;  3S7E A;  3LD8 A;  1UD1 A;  1WMD A;  4AHX A;  2A6Y A;  3NAP A;  2O8O A;  2VEC A;  3QD6 A;  2O14 A;  2RS1 2;  3AXD A;  4MZU A;  5DUW A;  3ACI A;  4O65 A;  2P1B A;  3QH7 A;  4BYY A;  4ISR A;  4V1P A;  1GZW A;  1BZW A;  4Q1P A;  1H2M A;  2I2S A;  1RED A;  4UW4 A;  4Y1U A;  1RUC 1;  3K3N A;  2D6L X;  4LKD A;  4Z2W A;  5EPA A;  5FZE A;  3RS6 A;  3WCR A;  2XVK A;  4XFA A;  2OVU A;  3N36 A;  4Q4V 1;  4CDQ A;  1X36 A;  1GWM A;  3LPG A;  3ZXG A;  1BEV 3;  2R32 A;  5FZM A;  1NCQ B;  3ZDS A;  5BNQ A;  4MGT A;  3SMH A;  3MBW A;  4RS5 B;  4X6R B;  3R05 A;  3TNP B;  1M4W A;  1QJX 2;  1PO1 1;  1AR9 2;  2W94 A;  5F2W A;  3VBU C;  3VDD A;  4FTS A;  1AYN 2;  3UGF A;  1QHD A;  2VZ3 A;  3ZSJ A;  4Y20 A;  4PI2 A;  5LAS A;  3RVH A;  1POV 0;  1X82 A;  3BOD A;  3GNE A;  4RSU A;  3JB4 C;  3ILN A;  3PME A;  4DRR A;  4AI1 A;  2EIG A;  2XQX A;  3ACF A;  2A71 A;  2XJR A;  2GC2 A;  2JDA A;  1RUH 1;  1OA2 A;  5DQ0 A;  4CSW A;  3H8O A;  3J8F 2;  5FZ4 A;  5J1X A;  3KWV A;  1N3O A;  4YM3 A;  3GM8 A;  4Q2F A;  3USU B;  1CJD A;  1F35 A;  1LOG A;  1U5X A;  2XOM A;  1OFN A;  3AVR A;  2OX0 A;  2JE9 A;  2XVG A;  2GP3 A;  3C7H A;  1GLH A;  4XQD A;  1C5H A;  4A7Y A;  4IE0 A;  3AB0 A;  2Z69 A;  4ZU5 A;  5IVY A;  3TN9 1;  3WDV A;  1DLC A;  4GXL A;  4YW5 A;  2FZ1 A;  1UMI A;  3WUD A;  2FDK A;  1PGW 2;  2W95 A;  4LUK A;  4YW6 A;  4W4Z A;  3NWK A;  4BU2 A;  1YLL A;  1V6L A;  1TE1 B;  4MH0 E;  1CR7 A;  4QDS A;  2VNR A;  3H7J A;  2WSV A;  3W21 A;  1V6J A;  1W8W A;  5KC5 A;  4FPO B;  4WVM B;  4PQQ A;  4PT6 A;  5BNN B;  3MHZ A;  4MAD A;  2ARX A;  2G9Z A;  4K8F A;  1JHN A;  4NRM A;  4HK8 A;  5L9R A;  5FRA A;  1HB1 A;  2WBK A;  1W6P A;  5AVA A;  3HNB M;  1ULC A;  4O9E A;  3UT0 A;  1ZBA 1;  2CAV A;  1ULO A;  1QOT A;  3A7Q A;  3UL2 A;  1GBG A;  3P3P A;  4K7J A;  4JGZ A;  4S2G A;  2QDN A;  4AI2 A;  1SLC A;  2VBD A;  3LF7 A;  3VBS C;  5KBF A;  3OY8 A;  4S2F A;  1PIV 1;  2W1Q A;  1XNK A;  2BZD A;  3VD3 A;  2VOV A;  3RJR A;  2VGD A;  4PF1 A;  2NYY A;  3NJX A;  2ZBJ A;  5LB6 A;  1BVP 1;  4LBO A;  2DVD A;  5F9T A;  2BGO A;  1SPP A;  3MIB A;  4LIU A;  5L7O C;  1WBL A;  2GME A;  1ENR A;  2WS9 2;  1FOD 3;  1IKQ A;  4Q8L A;  5EXO A;  3JBG 1;  2V73 A;  3INA A;  3T2O A;  4AHY A;  1MS8 A;  4IEZ A;  2HEW F;  2JEC A;  4XAE A;  1QDC A;  2E51 A;  4NAO A;  1YI9 A;  3ZSK A;  2WRA A;  4DY5 A;  1ZZC A;  5C70 A;  4XJU A;  1R08 2;  4XAB A;  3M2M A;  5IJR A;  1J3R A;  1SLB A;  2FBE A;  2LS6 A;  4CP9 B;  1QJX 1;  2UY8 A;  3DPR A;  4XFG A;  1QQP 3;  1JW6 A;  1V9U 3;  4ASM B;  5K0U A;  3ZSE A;  1F2N A;  3JU9 A;  3O0X A;  4MSV A;  3BOW A;  5EQU A;  3VZJ A;  2JG9 C;  1CAX B;  1JZ7 A;  2WA4 A;  2QQK A;  5IK5 A;  1XJA A;  3UYJ A;  3WF4 A;  5FYH A;  1XYO A;  3DXT A;  5DN2 A;  3LOI A;  4WV8 A;  4D6R A;  4XJ8 A;  2W68 A;  4IEQ A;  3THC A;  1EAH 2;  4QDQ A;  5CU1 A;  3N9L A;  3BPZ A;  5A32 A;  3VZL A;  3RWN A;  1OUR A;  1SZB A;  3B5L B;  4YVS B;  2VM9 A;  1WWY A;  2XKO A;  5D1I A;  2VNV A;  4FFI A;  3SEE A;  1GKB A;  2Y38 A;  4OUS A;  4N53 A;  3WZ1 A;  1UIJ A;  2GH2 A;  2WO1 A;  1IS4 A;  3JD7 3;  4OFG A;  5BXX A;  1WCK A;  2IXK A;  2ZEW A;  2SBA A;  2WNV C;  4IGQ A;  4COU A;  1XNA A;  4LQR A;  5LY1 A;  3BTA A;  1WMX A;  1XE7 A;  4YZ5 A;  1S2B A;  2BGP A;  3I2H A;  3HQX A;  2OA2 A;  3IAP A;  5F7U A;  1X8E A;  3IIA A;  1AR6 3;  4UI9 L;  4BXS V;  2XWJ B;  4XBL A;  1TQ5 A;  5JPM B;  3MPP G;  5J48 A;  4QXH A;  2R04 2;  2JDZ A;  2FDF A;  2KM2 A;  1DDL A;  3SIT A;  4NIA A;  4PLM A;  3VD9 A;  2ZAC A;  1BBT 2;  4AI0 A;  3S0M A;  2OXB A;  4ITC A;  2ZGR A;  3AP7 A;  4IEU A;  1ULD A;  5JZG A;  1OA3 A;  1QH7 A;  3Q8F A;  3S6P A;  2BQP A;  2ATF A;  1A78 A;  1VBD 1;  5IYY A;  1VBE 3;  4CUG A;  4LLF A;  2LUW A;  3J7L A;  3T2T A;  4LHK A;  5HXM A;  3IDB B;  1FV3 A;  4JQR A;  2P17 A;  2WNU B;  4FP3 A;  5E8A A;  4K8R B;  3GHN A;  2P6C A;  4IV1 C;  4WM7 C;  1JU4 A;  2ZGN A;  4NMI A;  3UKN A;  2BRT A;  1K42 A;  3Q9O A;  2VMH A;  5EJ1 B;  2D97 A;  4U2A A;  4BOW A;  5FJH A;  1B35 C;  1LOC A;  2WS9 1;  5CEH A;  5HCA A;  5J09 A;  1D0G A;  4XCA A;  1LOD A;  1STM A;  4XUQ A;  1V6K A;  4HLT A;  4BB3 A;  1WCD J;  4U36 A;  5DMY A;  3VZM A;  2D6N A;  1F5J A;  2OUJ A;  1MQT B;  2N7G A;  4CEW C;  3D0J A;  5DZF A;  3SIS A;  2P6H A;  4K21 A;  3LOB A;  1Q5O A;  5DZE A;  2ARB A;  1OOP A;  3T1M A;  1LED A;  3ZXE A;  1CGP A;  3IZO A;  2BU9 A;  5GM0 A;  2RS5 3;  4JDO A;  1LOB A;  5DDJ 2;  3ACG A;  1AZD A;  1OH3 A;  4UXA A;  3E6C C;  3CMG A;  4PBP A;  1OSG A;  4H7L A;  1TVG A;  2R07 3;  3IWZ A;  4Q4Y 2;  3WP4 A;  1NAE A;  5AFE A;  4IEY A;  1PGL 1;  1B09 A;  4B7E A;  3ZFG C;  5F1R A;  3HQR A;  2A5Z A;  1D2Q A;  1Q56 A;  4RQP C;  3O1R A;  4E8D A;  1Y7B A;  2GAU A;  3V64 A;  3OG2 A;  4CXW A;  1NY7 2;  1H8T C;  4AVT A;  3OGJ A;  2IXH A;  3C7E A;  4XUN A;  4AFB A;  2WN2 A;  2MEV 3;  1IS5 A;  1COV 1;  3AKT A;  4BA6 A;  5C8C A;  4L99 A;  1JMU B;  3W5M A;  1D4M 1;  1HRI 3;  4DXZ A;  2YMZ A;  1GQG A;  3E97 A;  2PLV 3;  2JJ6 A;  1JZ5 A;  4R9D A;  3KF5 A;  3FFZ A;  2ES3 A;  1V0A A;  4W50 A;  1IPS A;  2B9V A;  4JDM A;  3U4X A;  1Q8S A;  4NJ4 A;  5CKQ A;  3A4U A;  1O3T A;  2R04 1;  3H8X A;  1KJL A;  2ZKN A;  5IVV A;  1H2N A;  1U5Z A;  5EWS A;  1UU4 A;  3MIF A;  3J7H A;  3PVO A;  4GAZ A;  4XZU G;  5A3N A;  1PK6 A;  1XSQ A;  2P2K A;  4GWJ A;  5IVE A;  3HAG A;  5DUU A;  1O91 A;  1VMH A;  2RS1 3;  4PIY A;  2WQ8 A;  1W0P A;  1R1A 1;  1UPI A;  3HOB A;  1ZX5 A;  2DFC A;  4M00 A;  4B4Q A;  1BJQ A;  3K4A A;  1Y9Q A;  4LK7 A;  2D6P A;  3GBW A;  4Y22 A;  1C4R A;  2AEZ A;  3WEZ A;  3RYR A;  2A1X A;  2D5H A;  1O5U A;  1EPW A;  5FMB A;  2ORZ A;  4FBF A;  1GP6 A;  1UL9 A;  1W6O B;  4R9A A;  2WAO A;  3KSC A;  1HX6 A;  2BDR A;  2QQP A;  5T5L A;  1NCQ C;  4QPY A;  5CKN A;  1UMZ A;  4RS5 C;  2YUE A;  1CZS A;  1DFQ A;  2VUJ A;  1UO9 A;  2JD9 A;  2VE1 A;  1AR9 3;  2CWS A;  2Y0I A;  3KMH A;  1PZ9 A;  1AYN 3;  4M3C B;  1EY2 A;  1ULF A;  2FMD A;  2HWB 1;  1RMU 2;  2YGM A;  4H3W A;  2HBU A;  4WZC A;  3W5N A;  4MG2 A;  4N43 B;  4Q4W 1;  4QX0 A;  5GKA C;  3WF3 A;  5BNP B;  1OQ1 A;  1T2X A;  3RRD A;  4AED B;  2PN5 A;  1AHS A;  2E6V A;  5IVF A;  2B4K A;  2ID4 A;  3PUI A;  4JKK A;  1ZNP A;  2VR4 A;  4FPE A;  3SXW A;  1HN0 A;  4LHS A;  1AR7 2;  3DYO A;  3OUJ A;  3J8F 3;  4CEY A;  3EMR A;  4QWN A;  3LDR A;  4ZXK A;  2WT0 A;  3ENR A;  2R06 1;  2ZHN A;  5KXE A;  5LW9 A;  3IPV A;  1PX4 A;  3N9P A;  4J25 A;  1H2L A;  5DZG A;  4D6S A;  4E8C A;  4FVV A;  2ZMK A;  2Y6J A;  1EYB A;  4QPG B;  4XJZ A;  3THP A;  5BUV A;  4NIG A;  2P37 A;  1W06 A;  4A45 A;  5DAP A;  1NXD 1;  3OPZ A;  3LIG A;  4OMD A;  1G6N A;  4YVW B;  2CU5 A;  1AL2 2;  3K48 A;  1AYM 2;  4GMP 1;  4AI9 A;  2J1R A;  2RJ2 A;  4CCM A;  1NUK A;  2KD7 A;  5BNN C;  2GMM A;  1UZW A;  5E6H A;  3SQO A;  4LO8 A;  3T0B A;  2QZ2 A;  3S5A A;  2G1M A;  2OII A;  2HWC 1;  4HN1 A;  3M3I A;  3J7N A;  4AFC A;  1MZ5 A;  2E63 A;  4UF0 B;  5J37 A;  3CO2 A;  4HG6 B;  3VKN A;  2BER A;  4E2G A;  4A4A A;  4QGM A;  5A1A A;  5KHJ A;  5FZO A;  1D7P M;  1RL3 A;  1XYP A;  4TXW A;  1HQW A;  4XFH A;  1LOE A;  3ZM8 A;  3DEC A;  4NID A;  3M8L A;  3ILF A;  4GWM A;  4DOU A;  3U07 A;  2XHK A;  1CPM A;  5FY5 A;  1G9F A;  2YU1 A;  5KR7 A;  3I3E A;  2I45 A;  4QPI A;  3ZN4 A;  1RIT A;  1CVN A;  4FQZ A;  4FXG B;  1J3Q A;  4EN8 B;  1GOG A;  3WW2 A;  4QB6 A;  1DGL A;  5A7P A;  3NKG A;  1KXG A;  1JZ6 A;  1QXJ A;  5FXW A;  1LU1 A;  2HWF 3;  1WW5 A;  2PHR A;  4QKD A;  4QHO A;  1ZVF A;  3LKJ A;  4I0B A;  4TLG A;  1QOO A;  1ZZ9 A;  2DU1 A;  2B8M A;  3K46 A;  3PVN A;  4CCK A;  1TME 3;  3FZ3 A;  3UJO A;  2VXJ A;  2AUY A;  5EHD A;  3DUI A;  1GZC A;  3ETQ A;  1GZW B;  3J7M A;  1O3Q A;  4GD4 A;  5B4X A;  2E53 A;  5HCF A;  2CTV A;  4M4P A;  1OA4 A;  2X5I A;  4AHZ A;  4P9G A;  1Y3T A;  4JDN A;  3CL1 A;  3D8C A;  2HH9 A;  1LUL A;  2BP6 A;  3WX5 A;  2GH8 A;  1AR7 1;  1D2S A;  1EAH 3;  3ZKU A;  1JZ8 A;  5C7G A;  3H42 B;  4COV A;  4FTB A;  1NCR B;  3LFM A;  3DXU A;  4YVS C;  3ZMO A;  4QGN A;  1FMD 2;  1GV9 A;  2VOK A;  3KT1 A;  5JXI A;  3LEK A;  5E89 A;  4DXR A;  5FYC A;  1QJY 2;  2R49 A;  4LUM A;  5HPO A;  3MUZ 1;  2ZGO A;  4XJA A;  5LZ6 A;  5FP3 A;  5A70 A;  2IUW A;  1N3Q A;  3FC0 A;  5CFC C;  4GMP 0;  3T09 A;  1AJK A;  1Z7S 1;  3MDP A;  3MEP A;  2D3S A;  1JOP A;  3T0A A;  4F7Z A;  3IN9 A;  3VHP A;  1GFF 2;  3OYW A;  1C28 A;  1MZ6 A;  3CJX A;  3AYC A;  1AL2 1;  4E2S A;  1O4Y A;  2RM2 3;  5E16 A;  2QQW A;  4F3J A;  1KS5 A;  4MGY E;  2RDN A;  4JVA A;  1SFN A;  3VD5 A;  4C0B A;  5APA A;  1HJG A;  3CZJ A;  4Q0S A;  2DCZ A;  5ABJ A;  5FBJ A;  1LOA A;  1NLR A;  1BBT 3;  1YJK A;  4NHX A;  3DYP A;  5GZF A;  4GIQ A;  4Y4R A;  5JDB A;  3LPF A;  4DUW A;  3O1M A;  1OFS A;  2ZMN A;  3N7L A;  4I3P A;  1GNY A;  5LAT A;  2VCM A;  3QBQ A;  4LPL A;  4AI8 A;  2RJL A;  1VMF A;  2J1V A;  3AJY A;  4OHW A;  4XUP A;  5FLJ A;  5JUV A;  4E2Q A;  1BEV 2;  1UNB A;  5K8S A;  1OD5 A;  2WNU C;  3RZZ A;  1QXP A;  5JCT A;  1GWK A;  2VZR A;  3P6B A;  1XNT A;  1CON A;  4HVR A;  1IHM A;  4D6Q A;  1QJE A;  3Q8C A;  5JOZ A;  3V0A B;  2VTF A;  2BNN A;  1F4H A;  1XQN A;  4BQ4 A;  3THD A;  1DP0 A;  2R6Q A;  3HT2 A;  4NHK A;  1IQD C;  1V6M A;  3QOP A;  1YFU A;  4JHT A;  2HWD 2;  4LO4 B;  1SCS A;  5C3R A;  5KHI A;  2XJT A;  1J83 A;  1YC6 1;  2R0H A;  3FL7 A;  4XET A;  3QCW A;  4E9K A;  1MQT C;  2VOX A;  1HXS 1;  1DYO A;  4YG6 A;  2BNO A;  1VAV A;  2PYT A;  3OTF A;  4KH9 A;  5T52 A;  4HVO A;  1G9D A;  1GYK A;  1SPP B;  1AVB A;  1IS3 A;  2CDO A;  2VMD A;  3T0D A;  2DBN A;  1IGO A;  2WZE A;  3A21 A;  1HIX A;  3EYP A;  1G7Y A;  1SLT A;  2XL9 A;  1BKZ A;  4LLO A;  4OI4 A;  4AWD A;  1WW4 A;  2XUM A;  3EQE A;  3GZE A;  4CDU A;  4RR3 A;  2ZAA A;  3M3E A;  1UYY A;  1SLL A;  4Q4Y 3;  3RI8 A;  3O1T A;  1ODN A;  2VUD A;  3POS A;  4LKS A;  2ENR A;  1XOY A;  4XF3 A;  4CCL A;  2WWU A;  1XXN A;  3EXU A;  4KI5 M;  3KF3 A;  3BOP A;  2WC2 A;  1KQR A;  5F32 A;  3S7I A;  3UGH A;  1LEN A;  2BWC A;  2DFB A;  2PQQ A;  4NN0 A;  3MUY 1;  4BQX A;  5F5I A;  2ZGM A;  1Q43 A;  5H9Q A;  5HV4 A;  2TNF A;  2ET1 A;  3KS7 A;  4PHZ A;  5FZC A;  3ZYJ B;  1MVQ A;  2Y0O A;  2GNB A;  3H0O A;  5L36 A;  4JKL A;  3FLP A;  1G8W A;  2QQM A;  3WD5 A;  2C26 A;  2VY0 A;  3V65 A;  4RYD A;  1K3I A;  2JG8 A;  4UOJ A;  4QHB A;  4G9S B;  3H1W A;  4QT6 A;  3CIH A;  2B39 A;  3DF0 A;  2EXI A;  2A70 A;  1ZZ6 A;  5FO9 B;  1POQ A;  1BK0 A;  1XB9 A;  3HN3 A;  1GNH A;  4HK9 A;  4Y1Y A;  4YWA A;  2FMY A;  3UNP A;  1GR3 A;  1WCS A;  4LBL A;  1H0B A;  4XXP A;  3M3C A;  5FZ6 A;  5FZB A;  5A33 B;  1FOD 2;  2HLE A;  2E33 A;  5GAL A;  1APN A;  1BEV 1;  3RWK X;  2DWR A;  3MI8 A;  2Y6G A;  1DF0 A;  5JIU A;  3T3Y A;  1ODM A;  1VBC 2;  1N1S A;  3BIW E;  4C1W A;  4EWA A;  2DUR A;  3BYW A;  3HPN A;  4UWD A;  3UET A;  1ND3 B;  5KXD A;  4V2V A;  2AAC A;  1MS5 A;  3T08 A;  5LRS A;  1W8T A;  4AFD A;  3VBH B;  4OZO A;  5GZD A;  2Z42 A;  1J58 A;  1W2A X;  4AEM A;  4DRV A;  1QJU 2;  2WJS A;  1RMU 3;  1CAV A;  2LM3 A;  2YRO A;  4IEV A;  4WM8 A;  2VL4 A;  4ATE A;  1JI6 A;  2HEV F;  2QKD A;  4N43 C;  3Q8B A;  4YG3 A;  1RUF 2;  1W9T A;  5A6Q A;  2R16 A;  4AED C;  1ULP A;  4MYE A;  4UW5 A;  4XUT A;  4XZP A;  5IUQ A;  5CIS A;  4Q8K A;  1Q8O A;  5A7W A;  4BWO A;  2VJX A;  4J1W A;  2O0O A;  1FI2 A;  2VU9 A;  4TSV A;  4Q5O A;  5FZG A;  2VCB A;  1CAW B;  1DCS A;  3RYP A;  2W52 A;  4AL9 A;  4XHB A;  4B1L A;  1IOA A;  3ZXK A;  1NQD A;  4FPY A;  3CQO A;  5CFD A;  3U75 A;  3I3M A;  1SFP A;  5D8A A;  2YC0 A;  5FYU A;  2Q8O A;  2ZX0 A;  2RJK A;  2PAE A;  4QPG C;  2VCC A;  2XL7 A;  4XYX A;  3VKF C;  1YFX A;  2JKX A;  4BIS A;  5FO7 B;  1MR5 A;  4PI0 A;  1VMJ A;  2OQ7 A;  4LXL A;  3HR9 A;  3TAY A;  4HXC A;  2UYB A;  4YVW C;  5IVC A;  3WV6 A;  1AYM 3;  4GUL A;  5JOY A;  2JXA A;  3AL5 A;  1LCL A;  3QLQ A;  2A73 B;  3FWE A;  5JAX A;  1VB4 A;  5LRR A;  3WCS A;  3POB A;  1QIQ A;  1Q8V A;  1UX6 A;  3JQX A;  5BV6 A;  1UU5 A;  4CXY A;  1GP5 A;  3K2O A;  4CU8 A;  5FYI A;  2VW2 A;  4KG0 A;  3BPS A;  4EN7 B;  3AMN A;  1OUX A;  2DUP A;  2MNG A;  2YYO A;  2Z79 A;  4D7Y A;  1J59 A;  4BHP A;  1C8M 2;  1LEC A;  1FOD 1;  3U78 A;  4B4P A;  5A3W A;  1UKR A;  1H8V A;  3FJS A;  1IS6 A;  1LGN A;  3MIE A;  3FHQ A;  1RIR A;  5FBZ A;  3N9M A;  1UZY A;  4AYU A;  4M0H A;  2X10 A;  4MET A;  4HPK B;  3WQ0 A;  1DQ6 A;  3NST A;  4DFS A;  2IZW A;  4COW A;  4C8D A;  3OEA A;  3HNM A;  4CP2 A;  1QQP 1;  4DZG A;  1V9U 1;  3WQB A;  1PK6 B;  2VMG A;  3ZYG A;  2QDR A;  2W91 A;  3ACH A;  1A8D A;  5FDB A;  4G4F A;  4AGG A;  1IPK A;  4IW3 A;  2RS5 2;  1SBF A;  2DDU A;  5A3P A;  1POV 1;  3A0K A;  1RGS A;  5GLZ A;  1O4Z A;  4QKF A;  1KFU L;  1ZBE 2;  4UBH A;  1S55 A;  2VMI A;  3MPB A;  4XFF A;  1Y43 B;  5JSO A;  1Q8P A;  2VCA A;  3MLL A;  2B46 X;  4AGV A;  3RYK A;  1X9P A;  3N3H A;  4GJZ A;  2YC2 A;  4YSF A;  2ZHK A;  3FFQ A;  2WAB A;  3PHM A;  5EIY B;  1JYN A;  3M4F A;  3POJ A;  2UY9 A;  2ZZJ A;  4DUX A;  1JZ4 A;  2J22 A;  3JD7 1;  4IXL A;  3WNN A;  2YY1 A;  5CG9 A;  2BBA A;  4E4S A;  1NCR C;  2MEV 2;  3OGG A;  5ACA 3;  4CYD A;  1FMD 3;  4LEJ A;  1DU3 D;  5HV0 A;  4MXW B;  5FYS A;  5KXC A;  1QJY 3;  3K77 A;  4NE9 A;  3PUR A;  4LT5 A;  2PLV 2;  3VBF B;  1AR6 1;  1NT0 A;  4ZZ8 A;  1QXR A;  3LEG A;  4AQ2 A;  4NAM A;  4W8J A;  1H2K A;  1TEI A;  3E5Q A;  3UV9 A;  5I0U A;  3AVS A;  4RN5 A;  1E57 A;  3E5X A;  2ADE A;  3I2F A;  4CEY B;  1QNY A;  2RE9 A;  4XFB A;  2JD4 A;  2A6W A;  1ULG A;  3KVB A;  4PDW A;  4LA3 A;  2W47 A;  5F5C A;  3HNY M;  4QXK A;  2KA3 A;  3RZL A;  1WW6 A;  4XF1 A;  5FZA A;  1DZQ A;  2VUL A;  4IV3 A;  4YM1 A;  5ANN A;  1VBE 1;  5CYY A;  4NHL A;  2CGP A;  1IG3 A;  4NVP A;  5FPV A;  3FX3 A;  1AXY A;  3I2D A;  4Y26 A;  3ZYF A;  1M06 G;  1FNY A;  4MUV A;  2ZX2 A;  2VZ1 A;  3ZOI A;  1LR5 A;  5FPA A;  2F17 A;  2D3P A;  2DCT A;  3KV5 A;  4NR1 A;  4P9L A;  3IAQ A;  4A44 A;  3ZFF A;  1W6Q A;  3SH5 A;  1X7N A;  1HB4 A;  3Q8E A;  4JCK A;  1BYH A;  4SLI A;  1DZR A;  1F31 A;  2O1Q A;  5C8W A;  1S4C A;  4KU7 A;  2W2I A;  1XNB A;  1DG6 A;  1WKY A;  4L2N A;  2HWD 3;  4DXS A;  1SHW B;  1JZ2 A;  3PUS A;  1MS9 A;  4K6B A;  1JYW A;  1TNF A;  4WVZ A;  1C57 A;  4LMF A;  5FP8 A;  4CDW A;  3BI3 A;  2RS5 1;  1GAN A;  3CU7 A;  2BVB A;  4YFW A;  1OVP A;  4AAX A;  4UFI A;  1EP0 A;  3S5Q A;  1EUU A;  1AXZ A;  2D6K A;  3LA2 A;  4M01 A;  1KIT A;  2R07 1;  4GWN A;  3V0B A;  5JOW A;  1W0N A;  2R1B A;  3B02 A;  1W90 A;  3GJB A;  1LU2 A;  4O61 A;  2BPA 2;  3WW3 A;  4CDX B;  2Y6K A;  3AZV A;  3JB8 A;  1F9K A;  1W6N A;  3GBF A;  2PHW A;  3NMB A;  2ZGL A;  3ZPY A;  3HIF A;  4OQ8 A;  4I09 A;  5FQ0 B;  4O9G A;  1ND2 B;  2FCV A;  2MEV 1;  1UW8 A;  4QB2 A;  5GZC A;  2TBV A;  1JYC A;  2PA7 A;  3KT7 A;  4Q0U A;  4UW6 A;  5JXH A;  1HRI 1;  1NKG A;  3CKH A;  2QCS B;  2YBK A;  5FZ7 A;  1UXZ A;  5C4W B;  1C1F A;  3SKJ E;  2PLV 1;  2P34 A;  4JGY A;  5L19 A;  1MVE A;  3F2Z A;  1E5S A;  1V70 A;  3FLR A;  2C6S A;  3VBO B;  3NL1 A;  3TB0 A;  4I2O A;  3I2J A;  4YRD A;  4BIO A;  4CP1 A;  2RHP A;  1PX3 A;  3ZMN A;  4HAN A;  2E7Q A;  2VW0 A;  2VZU A;  5FOB B;  3BUC A;  1ACC A;  4FPK A;  4H7M A;  1DIW A;  1W39 A;  3P3N A;  2RS1 1;  1SEF A;  1DBN A;  2VVD A;  1YQC A;  5F3C A;  1UY1 A;  3PLQ A;  3HEI A;  4MX3 A;  1AX1 A;  2PHD A;  5FR3 A;  1DGR A;  2ZGS A;  3MFA A;  1DGW A;  2TUN A;  3RI9 A;  5FKC A;  2W0X A;  3WHU A;  5I8Y A;  3CF6 E;  1MEC 3;  1RVF 3;  1SLA A;  1UMH A;  3OYW B;  1O5L A;  2HWF 2;  2IXJ A;  2JEM A;  3VBU A;  4Y1X A;  5E1R A;  3ES4 A;  1ZM1 A;  4YNI A;  5FK8 A;  3BU7 A;  5C3P A;  4RD7 A;  4YPJ A;  1TME 2;  1BMV 2;  2AR6 A;  2PHF A;  3O0W A;  2L9L A;  1AR9 1;  1VBC 3;  1AXK A;  3POE A;  4RHV 3;  5ABJ B;  1AYN 1;  2Q1F A;  5FYV A;  2BOI A;  3D0S A;  5JSR A;  1ND3 C;  3T4V A;  2X53 S;  2PHU A;  1S0J A;  2A6Z A;  3R4S A;  4N9H A;  4QX3 A;  5A7N A;  3WOG A;  1ZRI A;  3SLI A;  4LOR A;  3UGG A;  3VBR B;  1D0H A;  5FP4 A;  3VBH C;  4GH4 B;  3PL0 A;  3S30 A;  1QJU 3;  5C5T A;  1Z78 A;  2QBX A;  4FPF A;  2X09 A;  1LAJ A;  5FYZ A;  3J8F 1;  2OPW A;  1OHF A;  1RUF 3;  4GWI A;  4X8P A;  4DO0 A;  2D5F A;  3ZXD A;  2VQ0 A;  3JUU A;  5CZK A;  3KQ4 B;  5FY9 A;  3H3Z A;  4Y33 A;  4YM2 A;  5FYB A;  4CCJ A;  4L97 A;  4BME A;  5IVJ A;  3SEP A;  3WG4 A;  4JKM A;  2DU0 A;  3PTY A;  4BM8 A;  1GOH A;  4B1M A; 
#chains in the Genus database with same CATH homology
 3SKV A;  2QQJ A;  1OF3 A;  2WDB A;  4P02 B;  1PX4 A;  4DEQ A;  2VZS A;  4E8C A;  2Y6J A;  2VZT A;  2VZO A;  2JE8 A;  4P5Y A;  2EIE A;  4A45 A;  4OMD A;  1BHG A;  1KGY A;  3K4D A;  3MO4 A;  5JR2 A;  1F4A A;  3U37 A;  1W9S A;  2J1R A;  2RJ2 A;  1NUK A;  2KD7 A;  3GDB A;  2YB7 A;  1MPX A;  4FI9 A;  4KWU A;  1LNS A;  3T0B A;  3WNK A;  1NX9 A;  4HG6 B;  3WNL A;  2Y8K A;  2BER A;  5A1A A;  4A4A A;  1D7P M;  4TXW A;  3ZM8 A;  3DEC A;  1GU3 A;  3I2G A;  1P8J A;  3I2I A;  3UES A;  3I3E A;  1PMH X;  1OD3 A;  4A3Z A;  1US2 A;  2V4V A;  1GOG A;  4QB6 A;  2QQN A;  1JZ6 A;  5LA2 A;  2C9K A;  2VC9 A;  1JU3 A;  4P08 A;  3K46 A;  4IUG A;  2V72 A;  4CUC A;  5JMO A;  2XHN A;  5B4X A;  3I2K A;  3VD4 A;  3C8X A;  4ZY9 A;  3D3A A;  4M4P A;  4D0Q A;  1SDD B;  1JZ8 A;  3C7O A;  5C7G A;  2W3J A;  3VD7 A;  3WNM A;  5G05 L;  1UXX X;  4JHZ A;  2WAA A;  5JXI A;  5G04 L;  3LEK A;  4DXR A;  5HPO A;  3MUZ 1;  4UAP A;  3T09 A;  1O59 A;  3T0A A;  2VQU A;  3A22 A;  1OF4 A;  2R7E B;  1YQ2 A;  3NNG A;  3P1I A;  4DEV A;  3VD5 A;  4ZZ5 A;  3CZJ A;  1CX1 A;  4P00 B;  2QQI A;  2J1T A;  4ET7 A;  1US3 A;  3DYP A;  1W8N A;  4MGQ A;  2ZEY A;  1K45 A;  3LPF A;  4AG4 A;  4DUW A;  1GNY A;  4D8M A;  4LPL A;  3AC0 A;  4A41 A;  2J1V A;  4XUP A;  2YG0 A;  4QAW A;  5JUV A;  5LA0 A;  4M4R A;  2CDP A;  2VZR A;  3HJR A;  2W9X A;  3P6B A;  4JX0 A;  1XNT A;  4QPW A;  2QQO A;  2YFU A;  2VTF A;  1F4H A;  4TTG A;  3GXU A;  3THD A;  1DP0 A;  3BN6 A;  2Y6L A;  1IQD C;  5IFP A;  5LA1 A;  2PQS A;  1J83 A;  3FL7 A;  1UY2 A;  1DYO A;  1L7R A;  4A6O A;  2YC4 A;  3I97 A;  2LW8 A;  4MO3 M;  2CDO A;  2VMD A;  1L7Q A;  3LE0 A;  3NQH A;  3T0D A;  2WZE A;  3A21 A;  2J1E A;  3EYP A;  1UX7 A;  2J1S A;  5FUI A;  4DXT A;  1UYY A;  4GZ9 A;  4LKS A;  4KI5 M;  5EJZ B;  2WYS A;  3E1F 1;  3CDZ B;  3MUY 1;  2WO3 A;  3WF1 A;  1W8O A;  1J84 A;  2X05 A;  4QX1 A;  1UYZ A;  4JKL A;  2QQM A;  2C26 A;  4RYD A;  1K3I A;  4UOJ A;  3JXS A;  2W5F A;  3CIH A;  3ACI A;  3UNP A;  3HN3 A;  1XC6 A;  2HLE A;  2E33 A;  1W9W A;  2Y6G A;  2VMF A;  3LPG A;  5IFT A;  2VZQ A;  3HPN A;  3UET A;  1H6Y A;  3MBW A;  4ARY A;  3T08 A;  1UY0 A;  5B4N A;  2ORX A;  2W94 A;  1UWW A;  4OZO A;  2VZ3 A;  3VDA A;  3DYM A;  2EID A;  2VL4 A;  1JI6 A;  3IB3 A;  3III A;  1W9T A;  2W1U A;  1GUI A;  2XQX A;  3ACF A;  1ULP A;  4XUT A;  1O8P A;  3OB8 A;  2JDA A;  2WN3 A;  5DQ0 A;  2Z4F A;  5J1X A;  2VJX A;  3GM8 A;  4QDR A;  1OT5 A;  2VCB A;  2XOM A;  3ABZ A;  3C7H A;  4CUB A;  4DUV A;  2V5D A;  2VZV A;  4OMC A;  4CU7 A;  1DLC A;  3CQO A;  1UMI A;  1GOF A;  2W95 A;  4W4Z A;  2WUH A;  4QDS A;  1PMJ X;  2VCC A;  3OGV A;  3OGS A;  4XUO A;  2JKX A;  1GMM A;  4L0P A;  1JHJ A;  2YFZ A;  4PQQ A;  4PT6 A;  2EIB A;  4MAD A;  3I3B A;  1JZ3 A;  2VO5 A;  3NRU A;  1JYV A;  2WBK A;  3HNB M;  3A7Q A;  1ULO A;  3CZU A;  4KMQ A;  4BK5 A;  3GGL A;  4MGS A;  2EIC A;  2XON A;  4CU8 A;  2W1Q A;  1UY3 A;  5JXJ A;  1XPW A;  2BZD A;  3VD3 A;  1RYY A;  4PF1 A;  3NJX A;  3WSO A;  1HN1 A;  3FN9 A;  3FHQ A;  2BGO A;  4ARX A;  2X10 A;  1R64 A;  3T2O A;  3A23 A;  2WZ8 A;  3OEA A;  3HNM A;  3PUH A;  2RV9 A;  3WQB A;  5C70 A;  3WF0 A;  5IJR A;  2W46 A;  2C4X A;  2W91 A;  3ACH A;  4BJ0 A;  1UYX A;  2LS6 A;  2DDU A;  1EUT A;  1JZ7 A;  4Z2A A;  2QQK A;  4CU6 A;  2VCA A;  3WF4 A;  3C7G A;  5DN2 A;  2YC2 A;  1JYN A;  3ETP A;  2WAB A;  3THC A;  5EIY B;  2Y6H A;  4OUE A;  4QDQ A;  4DUX A;  2VQT A;  1JZ4 A;  2J22 A;  2DCJ A;  3WNN A;  4A42 A;  2VM9 A;  2BBA A;  3SEE A;  3ECQ A;  5DPN A;  3EB7 A;  2WO1 A;  2ZEW A;  3K77 A;  1XNA A;  4LQR A;  1K12 A;  4ZZ8 A;  3LEG A;  2VOT A;  2BGP A;  3I2H A;  1CZV A;  4W8J A;  3IAP A;  1UZ0 A;  4RN5 A;  5F7U A;  4UI9 L;  3I2F A;  4BXS V;  2VMC A;  2W47 A;  3HNY M;  2E32 A;  3VD9 A;  5CYY A;  2W87 A;  3OGR A;  3OEB A;  3IDA A;  5LCW L;  5IYY A;  3BGA A;  2J1A A;  2VZ1 A;  5HXM A;  3MV1 1;  2RVA A;  5C71 A;  2ZEX A;  2DCK A;  3IAQ A;  4A44 A;  1JU4 A;  1K42 A;  5EJ1 B;  5I0D A;  3MV0 1;  2ZEZ A;  3K75 B;  1CZT A;  2QQL A;  4XUQ A;  1WKY A;  3WF2 A;  4DXS A;  1SHW B;  5DMY A;  1JZ2 A;  1H6X A;  1JYW A;  2VME A;  4AAX A;  2VZP A;  3K4Z A;  1EUU A;  1WCQ A;  1W0N A;  2W92 A;  3I3D A;  3ACG A;  1O8S A;  2W1S A;  2Y6K A;  3CMG A;  1TVG A;  4CU9 A;  1NAE A;  4QX2 A;  4E8D A;  3FHA A;  3OG2 A;  4QB2 A;  5JXH A;  1NKG A;  3CKH A;  3LQC A;  3C7E A;  1UXZ A;  4XUN A;  2WN2 A;  3SKJ E;  1OH4 A;  2ZXQ A;  3F2Z A;  3W5M A;  1CIY A;  2HYX A;  3I2J A;  1JZ5 A;  1I5P A;  1PX3 A;  1SG3 A;  4W50 A;  4CVU A;  2B9V A;  1KEX A;  4XUR A;  2VZU A;  2E26 A;  1GQP A;  2Y64 A;  3T2P A;  3WNO A;  3WNP A;  1UY4 A;  3J7H A;  1UY1 A;  4XZU G;  3HEI A;  4OYU A;  4GWJ A;  3C7F A;  2WQ8 A;  3HOB A;  1TG7 A;  3NJV A;  1UMH A;  2J1U A;  3K4A A;  3VDC A;  3WEZ A;  4MOA A;  2J7M A;  4YPJ A;  5IHR A;  3T2Q A;  1JYX A;  2ORZ A;  2L9L A;  2E31 A;  2WAO A;  4BDV B;  3LEI A;  4XVH A;  1CZS A;  4QX3 A;  2JD9 A;  4BK4 A;  2W1W A;  3OBA A;  3W5N A;  3WF3 A;  2QBX A;  4QX0 A;  2X09 A;  4ZXE A;  4QB1 A;  1T2X A;  2OKX A;  3VDB A;  4GWI A;  5JXG A;  2B4K A;  2ID4 A;  3PUI A;  4JKK A;  2VR4 A;  4LHS A;  5CZK A;  3DYO A;  4CUA A;  3SEP A;  2WO2 A;  4JKM A;  1W99 A;  1GOH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...