4D0QA

Hyaluronan binding module of the streptococcal pneumoniae hyaluronate lyase
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
161
structure length
161
Chain Sequence
MQNLVENGDFGQTEDGSSPWTGSKAQGWSAWVDQKNSADASTRVIEAKDGAITISSHEKLRAALHRMVPIEAKKKYKLRFKIKTDNKIGIAKVRIIEESGKDKRLWNSATTSGTKDWQTIEADYSPTLDVDKIKLELFYETGTGTVSFKDIELVEVADQLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational Analysis of the Streptococcus Pneumoniae Hyaluronate Lyase and Characterization of its Hyaluronan-Specific Carbohydrate-Binding Module.
pubmed doi rcsb
source organism Streptococcus pneumoniae tigr4
molecule tags Lyase
molecule keywords HYALURONATE LYASE
total genus 35
structure length 161
sequence length 161
ec nomenclature ec 4.2.2.1: Hyaluronate lyase.
pdb deposition date 2014-04-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 4d0qA00
2VJXA 4XUPA 3DYOA 2E33A 2ZXQA 2XONA 2XOMA 3CZJA 3PUIA 1W0NA 2C4XA 5LA0A 2WABA 4W50A 3T08A 1GUIA 1JI6A 4DXTA 3J7HA 1JYVA 1CZSA 3MO4A 2DCKA 3OGVA 4JKKA 3C7FA 1UYXA 4RN5A 1GOGA 1UY0A 4BK4A 2BGPA 1UY4A 1OH4A 3OGSA 2BERA 3I2GA 4XVHA 4E8CA 1O8PA 1UMIA 3GM8A 3WNLA 2VC9A 3LEIA 5DQ0A 3MBWA 2E32A 1GOFA 4ET7A 3CZUA 4JX0A 3GXUA 4CUBA 2YC4A 3VD4A 2Y6HA 2Y64A 2KD7A 2WQ8A 2B4KA 2W46A 4PQQA 1XC6A 4LKSA 5G05L 3C7HA 2VMDA 3C7OA 2YC2A 2E31A 1MPXA 3MUZ1 4BJ0A 4XUNA 2ZEXA 4ZY9A 1CZTA 1NAEA 2Y6LA 3WF4A 3DYMA 2J1TA 1NKGA 3HNMA 3HPNA 1W9TA 2X10A 1JZ8A 2Z4FA 1DLCA 2HYXA 4L0PA 4LPLA 2WZ8A 2BZDA 3OG2A 2VR4A 3I2JA 2LS6A 3LQCA 3AC0A 3THDA 1CIYA 2J1SA 3WF1A 1UY1A 4TTGA 5LA2A 1JHJA 2VMEA 4KMQA 2VO5A 5IHRA 2XHNA 4QX1A 2W92A 1UXZA 1YQ2A 4QB2A 5F7UA 3T2PA 2J1RA 2J7MA 1PMJX 2V5DA 5A1AA 1L7RA 2W1WA 3W5MA 3SKVA 3T0DA 1JZ4A 2ZEYA 4PF1A 2J1EA 3IB3A 2Y8KA 1UY3A 2VZ1A 2VM9A 1WCQA 2QQMA 2VQUA 1SDDB 2VMFA 2VZTA 5J1XA 3ACHA 1KGYA 5DMYA 2WBKA 3I2FA 5DN2A 4MO3M 1R64A 2ZEZA 1JU4A 1W99A 3W5NA 3K75B 3UESA 4Z2AA 1OF3A 2VZSA 4P02B 3OGRA 4P08A 2V72A 5IYYA 3NRUA 3OB8A 4M4RA 1JYNA 3K77A 2W94A 2VCCA 2W1UA 3HN3A 3IAPA 3WNOA 1EUTA 3MV11 2X09A 3I3DA 4JHZA 2VZPA 5JXIA 1H6XA 4A45A 2VMCA 4CU9A 2J1VA 3OEAA 1GOHA 4DEQA 2W5FA 1ULOA 3EYPA 1PMHX 2QQIA 5IFTA 3FHQA 3VD3A 2WAOA 5IFPA 4OYUA 3CKHA 4ZXEA 3VD5A 4QDSA 1J83A 3WNMA 4M4PA 5B4XA 4QX2A 3FL7A 4XUQA 4A44A 4CUCA 4KWUA 3P1IA 4TXWA 3FHAA 1UYZA 1NX9A 5G04L 3VDBA 5HXMA 3WNNA 2LW8A 4AAXA 4UOJA 2VCBA 2WO1A 4XZUG 2EIEA 1US3A 2WAAA 3WNPA 4DXRA 4QDRA 1JZ3A 3ACFA 1SHWB 2VZQA 3LEGA 3FN9A 3UETA 2JKXA 3K4ZA 2DDUA 3WSOA 3WF3A 3D3AA 3JXSA 2VZVA 3WEZA 4DEVA 2VCAA 2WN2A 3CMGA 5EIYB 3HJRA 1W8OA 3GGLA 1GMMA 2JDAA 2QQJA 2VL4A 1PX3A 4OMCA 1JYXA 3HOBA 3ETPA 5C7GA 3HNBM 4MGQA 1UMHA 2W1QA 4A42A 5C70A 3SEEA 4OUEA 4QB1A 3K4AA 2HLEA 2VTFA 5I0DA 4JKLA 3ECQA 3EB7A 3U37A 3I3EA 1XNTA 2W95A 2WDBA 2WUHA 4ARXA 1CX1A 4W8JA 2EICA 3VD7A 5LCWL 1JZ6A 2W91A 2VZ3A 5DPNA 4ARYA 3A23A 4MOAA 1UX7A 4W4ZA 1UWWA 4XURA 1K3IA 3C7GA 5HPOA 1NUKA 4P5YA 4QDQA 3MUY1 2EIBA 3BGAA 3P6BA 2VZRA 2X05A 4RYDA 1UXXX 1UY2A 1ULPA 3LPFA 4HG6B 1O8SA 3T2QA 1K12A 4CVUA 4ZZ5A 2J1AA 3SEPA 1IQDC 4GWJA 3WNKA 5IJRA 1P8JA 1L7QA 1OD3A 4FI9A 5C71A 4DUXA 2QQLA 3C7EA 3MV01 2WN3A 5JUVA 3LEKA 3A21A 3OBAA 4OZOA 2XQXA 4QX0A 2PQSA 4UI9L 3K4DA 1JZ2A 3ABZA 4A41A 1DYOA 3ZM8A 3ACGA 1WKYA 2ID4A 2C9KA 2W87A 4A3ZA 1OF4A 3LE0A 4AG4A 1XNAA 1LNSA 2J1UA 1HN1A 3IIIA 2YFUA 4QPWA 5EJ1B 4A6OA 2ORXA 1I5PA 3T2OA 3NJVA 1UYYA 3WF2A 3I2KA 4LHSA 2QQNA 1W9WA 2WO2A 3DECA 1H6YA 4CU7A 3DYPA 3CDZB 1F4HA 4DUVA 1DP0A 5FUIA 2QQKA 4CUAA 2QBXA 2RV9A 3UNPA 3LPGA 3A7QA 1TG7A 3CIHA 4D0QA 3WF0A 2WO3A 3SKJE 3C8XA 1JYWA 4DUWA 4OMDA 3T09A 1JZ5A 2L9LA 4A4AA 4QAWA 3I3BA 4IUGA 2DCJA 2J22A 2JE8A 2Y6JA 3GDBA 3IAQA 4XUOA 3CQOA 2OKXA 5JMOA 3VD9A 2JD9A 4BDVB 4KI5M 1GU3A 2R7EB 5EJZB 3NQHA 3VDCA 2W9XA 1K45A 3K46A 2WYSA 3VDAA 2V4VA 3I2IA 1D7PM 1T2XA 5JR2A 1KEXA 1W9SA 2VZUA 1GQPA 1RYYA 1US2A 5CYYA 1EUUA 4XUTA 3T0AA 5B4NA 3WQBA 1K42A 5JXJA 4UAPA 1UZ0A 4D8MA 2C26A 3ACIA 3IDAA 2B9VA 2YG0A 1CZVA 2VQTA 4E8DA 4P00B 5JXGA 4GWIA 1F4AA 5JXHA 4DXSA 1GNYA 2Y6KA 4YPJA 5CZKA 2YFZA 4QB6A 3OEBA 2W3JA 3I97A 1JU3A 1PX4A 2RJ2A 4PT6A 4LQRA 1JZ7A 2QQOA 2E26A 2VOTA 2YB7A 2CDPA 2WZEA 2W47A 4BK5A 2ZEWA 2W1SA 1OT5A 1SG3A 4GZ9A 5LA1A 4ZZ8A 1W8NA 2BBAA 3THCA 2VZOA 3NNGA 4MGSA 1XPWA 4CU8A 2CDOA 1J84A 2EIDA 3BN6A 3HNYM 2BGOA 3A22A 4QX3A 4JKMA 2Y6GA 3F2ZA 3I2HA 3HEIA 1TVGA 3PUHA 1BHGA 2ORZA 4CU6A 2RVAA 4BXSV 3T0BA 3E1F1 4MADA 3NJXA 1O59A
chains in the Genus database with same CATH superfamily
5E89A 3ZDSA 2BJSA 1JYIA 2EXIA 1G7YA 1W0OA 2XONA 4QX5A 3TN92 3ZXFA 3CZJA 1UKRA 1W6MA 3AZYA 4W50A 3UT0A 1I3HA 2D6MA 1SLTA 3B9CA 1CZSA 1NCQA 1AR71 1RUH3 1V6IA 3WG4A 3BU0A 1JHNA 4LIVA 3BCWA 3PURA 5A3NA 2RS32 4FXKB 3NJYA 1ZRCA 5GLZA 3KCYA 4EJRA 5DUWA 4UBGA 3S30A 4NIGA 2R1DA 1I6XA 3V65A 2D3SA 5FKBA 3KT7A 1OH4A 4K20A 4DNYA 1N1TA 1POQA 1OPMA 1BZWA 4E8CA 2F4PA 2X8KA 4QXBA 5BNOA 2GMEA 2WNUA 4IEUA 3ROUA 1DQ5A 1NCQB 3AXEA 3H3LA 1ZBE2 3TRSB 1R1A1 1W8HA 3J9SA 1ZNPA 2PHXA 4L92A 1G9DA 2VBBA 3DXTA 4GH4B 3W59A 4FAGA 3LEIA 3TN91 1BCXA 2XG3A 4YYOA 2E32A 2BFUS 3KCXA 2RMU1 4JX0A 5FY9A 3EJKA 3VN4A 1UU5A 3P3PA 2LTNA 3VD4A 1ALYA 3A0KA 4IE4A 1O5LA 1UAIA 1ZZ7A 5JOWA 1W3XA 1N1SA 2B4KA 2W46A 3N7KA 3OPTA 4H14A 3UGFA 2IXLA 3T3YA 3LEMA 4M01A 4PQQA 1XC6A 3H3ZA 4LKSA 2DF7A 2HWC3 5G05L 4PIXA 5JAXA 3J26N 5L36A 2FQPA 3VBRC 2YBPA 3C7OA 1MS0A 4FPCA 2OIIA 4IGOA 4YWAA 4AZZA 1H1AA 2E31A 1WW7A 2WRAA 2CL2A 5C3OA 4XJ8A 3UK9A 2I2SA 1H8TC 1OA3A 2W39A 1URXA 2D6PA 4BQ3A 2DCZA 1CAVA 1NAEA 3BTYA 2PN5A 5ABJB 2AGSA 3OD4A 4WM7C 2GN3A 5FYIA 2P17A 4HPKB 2ZGLA 3RSJA 1CGPA 2WO7A 3URFA 4BIFA 3D82A 4C1WA 1JZ8A 3S57A 3JD73 3WD5A 1SBDA 1RUI2 4LBQD 5JDBA 2CWMA 4XTMA 2VXJA 1MS3A 2A3XA 1CAUA 1OFNA 1R1ZA 2CU5A 2J1SA 4RL7A 1CN1A 3NNLA 5FLJA 1E5SA 1JHJA 2XJPA 5A33B 2EVXA 2VPVA 2W92A 4Q4W2 4ES8A 2QQPA 2A71A 2J1RA 2ZGKA 1SLBA 1NLQA 3D0JA 3VL8A 2V5DA 3O14A 4OHWA 3USUA 1L7RA 3W5MA 4ES9A 3EQEA 2UYBA 1WWYA 3ACLA 3D6EA 5CKQA 5FK8A 1RUF3 1FV3A 4P9WA 3VKLA 4Q27A 2CV6A 4PF1A 3TEXA 4G4FA 4PF5A 1EY2A 4FOVA 5F2WA 1OKQA 3WLUA 4YSFA 2GC0A 4ZKTB 2HEYF 3LAGA 1W2OA 3FLPA 1F8VA 5A6ZA 2QFEA 5T54A 1Z7S1 2A6WA 3PVNA 1WW5A 2ZX4A 1RVF2 3M3EA 4AVCA 1HJFA 1W8ZA 2PHTA 4R4ZA 1U5YA 3FBMA 2WBKA 2DBNA 3I2FA 5DN2A 3GCWA 1QXJA 1R64A 2GNBA 3CO2A 2K46A 4MO3M 4Q8LA 4R9BA 4XDOA 2OA2A 2DYCA 4BM8A 3UESA 1Z7S2 4DQAA 1REDA 4YW2A 4P08A 5FZ3A 1ONAA 5IYYA 1UW8A 2XMLA 4FPKA 4M4RA 2EAKA 4XJAA 3IM0A 4BQ4A 3AKTA 2VCCA 1REEA 1MEC1 5FUNA 4CCKA 3DF0A 1QJX1 3OY8A 1GZWA 2CHHA 2UWCA 3QH7A 4YFZA 5FZFA 3QD6A 3TNPB 2X09A 5C3QA 1YFUA 2VZPA 1ST8A 1W8TA 3Q8CA 5FFOC 4A45A 3CJIC 4KQ7A 2VMCA 1NCRA 1PGSA 2J1VA 4QQOA 5FZ8A 3VDDA 1H30A 3RRDA 4CU9A 1GOHA 1QWRA 4Q4W3 1NOVA 1KITA 5BV6A 2QQIA 4X8PA 4BISA 2O8QA 1KXGA 2WAOA 3DL3A 3CKHA 4OYUA 3VD5A 5EJ3A 5IFPA 4QDSA 4M4PA 3K51A 4HN0A 4OZXA 3D8CA 4QX2A 3AYAA 1C8M3 1PO11 2W2IA 4N43B 4AWDA 3PVEA 4SLIA 3JD72 1YI9A 4A44A 5LY1A 1C4RA 2PHDA 1AHSA 1UYZA 4K8FA 5G04L 4COYA 4DO0A 3VDBA 3ZN4A 2DWRA 2VOVA 5DAVA 5GLTA 3U0ZA 4Y20B 4AQ2A 3LOBA 1R081 4CDXC 2JECA 4YRDA 1I5ZA 4AAXA 5GM0A 4UOJA 3RZGA 5FIXA 2OPWA 4XZUG 5FPLA 1K5MC 2CSGA 1SLIA 1N1YA 4CP0A 2WLPA 3M3OA 1US3A 2ZAAA 1OQDA 2D5FA 3NV1A 1BK1A 2OUJA 3N9PA 2VBPA 4UW5A 5GZDA 4AFAA 4DXRA 5DDJ2 3RZKA 4QDRA 3NSTA 5FWJA 1SHWB 3MLLA 4OHVA 2BPA2 1RVF1 2HWC2 3IMNA 1JW6A 3K4ZA 2QUOA 5FXVA 3VBFB 1PZ7A 4YW3A 3V0BA 2Z42A 3SISA 2R063 5IW0A 5BNPB 2Q8DA 1GICA 2AC1A 2XH6A 4CP2A 3H8XA 3U14A 2VCAA 3WDXA 2PQQA 1OVPA 3ZIWA 4EZHA 1Y43B 1QH7A 3POEA 3PLQA 4PIYA 5HI0A 3POGA 3HJRA 4L8QA 2QQJA 3GGLA 4NHKA 1X9TA 1GP6A 2JJ6A 2KA3A 2X53S 2OVUA 4NIDA 2D3PA 4Z92B 4COVA 1X8EA 3LD8A 4LXLA 2K0GA 4IV1C 5LRSA 1ZBE3 1UX6A 4UYBA 3K2OA 3NO8A 1HW5A 5BNOB 3ZXAC 4N8MA 1PHMA 2ET1A 1GLHA 2W1QA 2I07B 4FQ4A 4A7KA 4YM0A 2E6VA 4GH4A 2TUNA 4Q0UA 4JZRA 2WSUA 4PBPA 4YW5A 1ACCA 2HBUA 1Z7S3 2CNAA 2D97A 1S2BA 3MEPA 3NAPB 3HD8B 3K4AA 3KB5A 3ILNA 3Q8EA 2RM22 4JKLA 1RUE1 2QQWA 4A2UA 3I3EA 1XNTA 4ARXA 1LGCA 4DB5A 4QM8A 5CA6A 2EICA 3R4DB 4I3PA 1W90A 3KWVA 1DFQA 1TZOA 3FC0A 1U5XA 5SV5A 1YCIA 4CEYB 1JZ6A 2W91A 3KT1A 4LBOA 5DPNA 1MR5A 3A23A 2Z5WA 1H4HA 3MIHA 1J3RA 2PFWA 5K8SA 1UWWA 3V56A 5EHDA 5LBEA 1S1AA 5F39A 4XURA 1K3IA 4M00A 1RUF2 2O1QA 3O0VA 1NUKA 5FYVA 5CU1A 4N53A 5BPXA 2EXHA 1W2UA 3A4UA 1X82A 3BGAA 4N7IA 2JENA 4QKBA 1I1EA 2WIIB 1HRV1 4RR3A 4CEYA 4JQTA 4RYDA 1UXXX 3LZZA 4W6WA 5I0UA 5FMDA 4GAZA 1XSRA 2JDYA 3IBMA 5I0SA 1H4GA 4FOYA 4IV1A 5FBZA 2VQAA 4ZZ5A 4JGYC 5T5JA 2J1AA 4QGNA 2RJKA 3M2MA 4BLIA 4P14A 5IT6A 5BNNB 4FT8A 5IJRA 1ZVFA 5C8CB 1L7QA 1PNGA 3RZLA 4QKFA 1SFYA 2C0ZA 2H0VA 4HN1A 4FI9A 1UO9A 4K8RB 2YC0A 1Q56A 2XJTA 4UFJA 2RR12 3L9JT 4YG3A 3SCFA 3WP3A 4AFDA 4Y3OA 3BOPA 2WN3A 4P9YA 1Q43A 1UL9A 2PTMA 3WW4A 1UPIA 3ZMNA 4DMIA 2ET7A 1VBB1 1PNFA 1AYM3 3WQ0A 4FBFA 1VMFA 4QT6A 4BXFA 1NE4A 4RD7A 4JTNA 5I0RA 1DBNA 5FPXA 3BALA 1B09A 5CFCB 3ACGA 2ID4A 3D5OA 1D4VB 1ENXA 1RJ7A 2VVDA 4DPNA 1OMIA 4EN7B 2CGNA 1TE1B 2B7YA 5DAXA 4HSJA 1T6GC 2VH9A 3LE0A 1MS8A 2X5IB 1DZQA 3KZ4C 4LO8A 5HCBA 4AYUA 1GR3A 1YQ8A 4OQ9A 2BRTA 1M4WA 1X33A 2ZHKA 1WD3A 4Q4V2 1QJY1 4XFHA 4XF0A 1SEFA 4OCTA 5T5LA 4A6OA 1I5PA 3WCRA 3MF6A 5BYNA 4PIZA 3NJVA 1ZX5A 4XFCA 1NZIA 1X7NA 4GWMA 1OHFA 2A75A 2WS92 4I0WB 4LK6A 3FJSA 4M3CF 2DBIA 2WO2A 3JQWA 2JICA 1IPJA 2MEV2 3AMQA 2HWE1 1TMF1 3KS7A 4ASKA 2NP0A 2I45A 4CUAA 5DZFA 1SPPA 2XJVA 3WVJA 1XYPA 4P9GA 4R8HA 4CA9A 1SLLA 2WNOA 1YWKA 3JU9A 3NJZA 5FP9A 1XNDA 1BBT2 2WR9A 4AF9A 1AF9A 4QXKA 1QOOA 1OA2A 5IVYA 3IKWA 4D0QA 5DDJ3 2XBO1 4XF9A 2RS33 1NCRB 2YU1A 3HN1A 4K3UA 3VDDB 5I91A 2WO3A 1YO8A 1AYN1 1PIV1 3C8XA 1ND2B 2A3YA 3R4SA 3OD0A 5FDBA 4EWEA 2ZGUA 5FOBB 1SPPB 5C6CA 3SCHA 3CBNA 4OMDA 4HFSA 4LJHA 2L9LA 3T09A 1JZ5A 1UZZA 4GD4A 4QAWA 1E5RA 4IUGA 4UF0B 5A3MA 5L73A 2XPJA 1DQ0A 3ZYFA 4MX3A 3IAQA 1LEMA 1HB4A 3GF6A 3OUJA 4E4SA 5BNQA 5JPMB 5LZ6A 5CG9A 3CL1A 3CQOA 1ZRRA 1NY72 3WQ1A 3VD9A 1S0CA 2ZKNA 1Q8VA 2EALA 3ASIA 2JG9B 3G7DA 4BDVB 4D6RA 2BGCA 2BNOA 2WNUC 3MIDA 3NQHA 5GZEA 1LEDA 2D43A 1X50A 2V73A 1LKNA 3M3IA 1CONA 1DGWA 5FZ1A 5A7OA 3VDCA 4AEKA 1IOAA 1Y7BA 3KV9A 1YQ5A 3K46A 2CGOA 5JSPA 4RGAA 3O1MA 1W3VA 3I2IA 1D7PM 4YVWC 1T2XA 1BXHA 5JR2A 5DUVA 1OUXA 5F5IA 1KEXA 4PLOA 3NAPC 1AR62 1NA1C 4LHKA 3UKNA 4E9KA 1US2A 5CYYA 5DAQA 4CDQB 1XXNA 3T0AA 3I7DA 2GALA 5LY2A 4CDWA 1RJ8A 4A3XA 1HV1A 1K42A 3CF6E 3R05A 3VZMA 3B3QE 4IV3B 4ZU4A 5A3WA 5LW9A 1AR61 2VG9A 4D3WA 3BB6A 2OQ7A 1VBA3 3AP7A 1FMD1 2YG0A 1IS6A 1LOCA 2ZJCA 3DPRC 3ZFGA 4EN8B 1TNFA 4LKEA 4FXGB 1YJLA 4I02A 3U4XA 2BU9A 2RS52 1W6OA 2ZACA 5LWBA 1AYN2 2CYFA 3B93A 2Y6KA 4FPEA 5A70A 1CVNA 5CADA 2XJUA 4XHXA 4AI8A 1RVF3 2UURA 5JSRA 2YFZA 1DQ2A 3IMMA 1YQ6A 4L97A 1EV13 1FPN3 5LB6A 4GALA 5EP9A 4XIOA 4QU1A 1PX4A 3S5QA 1Y9MA 2RMU2 5C3RA 4CEWB 3AYCA 3B01A 2JDZA 3FX3A 4R9DA 4XABA 4XOGA 2QQOA 2E26A 2YB7A 4IESA 2RR11 3VB9A 4J6GA 2MEV1 2WA4A 4BOWA 3AP4A 5KXCA 5JSOA 2ZEWA 3RYKA 4LE4A 1R083 1JYCA 3GZTB 2WC2A 2R072 4GZ9A 4Q4X2 5LA1A 4IEPA 2A6VA 2Y60A 2VULA 2HEVF 1HN0A 3ZFFB 5JLVA 1DZRA 3DKWA 2D98A 2VOXA 3NNGA 3PUQA 4MGSA 5C5TA 5K0UC 1S2EA 3NV3A 1WLTA 3ORJA 1W05A 3BN6A 1LODA 1QXPA 2BGOA 1DGWX 4YZ5A 1SACA 4ZXKA 4MLOA 1GWKA 5KC5A 4M0NA 3PU3A 1RUI3 2VU9A 3PUHA 5A3UA 4ZPIA 4Z07A 4CP9A 4IV1B 3NJXA 1NY71 1XU2A 3ZN6B 4QQLA 1GV9A 4Q2FA 3ITQA 2HWD1 5EXOA 2R0FA 3AZZA 2ILMA 3B00A 5CKNA 2XOMA 3LFMA 5BXXA 1OURA 2VNRA 2VVEA 1QNYA 2ZMNA 5LA0A 3HT1A 4AVTA 2WABA 4FFFA 5K4LA 1JI6A 4Z2WA 3J7HA 5FLHA 1V00A 3CJIB 2DCKA 5CAZA 3KV5A 4WM8A 1XRUA 2PXJA 1YNAA 2Y6FA 2GNDA 2ADDA 2WFF3 4LNVA 3ZYPA 1UY0A 4E4HA 5JOXA 1Q5OA 2VE1A 2QCSB 1RXFA 4XETA 1HX6A 2ES3A 3VHNA 3MZHA 1QY4A 1N1VA 2BERA 2RS12 4NN0A 5FPBA 1OVSA 4XVHA 2P3IA 3IDEA 1FATA 4QHOA 4W6XA 5APAA 2Q4SA 3M70A 3RQ0A 4XJUA 1ZRDA 5L19A 2VC9A 3FUOA 3S7EA 5IK4A 5FZDA 2BQPA 4J1XA 2E63A 4P9XA 2YC4A 4QWNA 4AXOA 3FBYA 4IEYA 1O91A 5DXDA 5A32B 5GZFA 5FPVA 4MGIE 3KF3A 3V0AA 2WQ8A 1OBNA 3WZ1A 5FP7A 1E5IA 1S0EA 1AUYA 1QEXA 2XR4A 2YV8A 4RQPC 1ZZ9A 1CAWA 1HRI2 4Y33A 1OFSA 2HWC1 5FYUA 1C57A 2NZ9A 5FZ4A 5FLIA 2AYHA 1WCKA 5SV8A 1RUH2 2VMDA 4HVQA 3VUOA 3H8RA 2I74A 5HV0A 3RZJA 1MPXA 2P6HA 4FPYA 2N7GA 3H50A 3E5QA 3ZXEA 1BEV3 4KNCA 4WZCA 4BJ0A 4ZY9A 4UT5A 2QDRA 1UZWA 1CZTA 4K1ZA 3OGGA 4GMP1 3TN93 1ND3A 2A70A 4LKFA 3WDYA 3HAGA 1H1IA 1WMDA 1W06A 3BTXA 2RDQA 1FOD3 3FHIB 2J1TA 3AM2A 4KU7A 1H2NA 1RUG3 4OUMA 1SZBA 3DGTA 2B8MA 2YBSA 2ZTNA 4GJZA 4XFBA 3OG2A 5FXXA 2VR4A 4UF0A 3I2JA 4IEXA 4LITA 4XFFA 1YXWA 1CIYA 1PM7A 3DCQA 3AYEA 1QJU2 4P9IA 4XDQA 3WF1A 2HWE3 4C0BA 1UY1A 1VE0A 3IIAA 5EWSA 1XB9A 1OOPA 1YRZA 2RDNA 2A73B 1MQTA 4KMQA 2W68A 4YW6A 5EZWA 2FMYA 3N35A 1DG6A 3RMYA 4CEYC 3VZOA 3H9AA 2VVFA 2GDFA 4M3CE 3U1XA 3OJBA 1PMJX 2WQZC 5F6KA 3HQXA 1JOPA 4CSWA 2W1WA 1NCRC 3VDDC 4MH0E 4FTBA 4M3CB 1LULA 1LOAA 1O6UA 4NMIA 1PIV3 1JZ4A 1OOPB 1PMIA 1UY3A 2Y8KA 1BEV1 4WM8C 1D0GA 2P4EA 2DCYA 2WKKA 5EYYA 3ETQA 2FBEA 3SC7X 4CDQC 5L9BA 5FPUA 2ETEA 2VQUA 3OBZA 1H2MA 4MXVA 4RHV1 5E8AA 5HCAA 1SDDB 1X8MA 2R1BA 4O9GA 5DAPA 3VHOA 5D1IA 2VZTA 1KJLA 4QX8A 4B4QA 3OBRA 5L7OB 3JD71 1KGYA 3ELNA 4XMIA 2E7TA 4HSLA 1I9RA 1PO13 5DMYA 4BPZA 4GMP0 2DU0A 2Y38A 2ZEZA 1JU4A 2ZGSA 1TME3 3K75B 2HWB2 4AW7A 2V72A 4QKDA 4Q4Y2 3NRUA 1MS1A 1YI7A 1AR91 3OOXA 4PLMA 2WFPA 2VMIA 5D21A 2Y0IA 4CPBA 4LUMA 3VZLA 3PJQA 4AVSA 1UU4A 2W94A 4IE5A 3AKQA 2DU1A 4LR4A 2W1UA 3KV6A 4O9EA 4OULA 3KQRA 3PVBB 4JDOA 1HB3A 2CGPA 4MGZE 3ZPOA 3SLIA 2ARBA 3LF7A 1RUNA 3SXWA 1CPMA 2EXKA 3I3DA 4JHZA 4PJYA 4AVBA 2PAMA 2BP6A 3PNAA 4B7EA 1H6XA 1R093 5CEHA 2BBVA 4HPKA 2GC2A 4TSVA 1ZRFA 1RUJ3 3OEAA 1RUJ1 3OY8B 2P5BA 4DEQA 5FQ0B 2A7AA 2JB4A 3JB4C 4KBZA 4GULA 4D69A 5IFTA 3VD3A 5ANQA 1LOFC 4ZXEA 4GKYA 1QJU1 1J83A 5B4XA 4X6RB 5FYZA 2PLV3 1AR93 1DYPA 1FXZA 1AZDA 1POV0 2GC3A 3AMPA 1AX0A 1Q8PA 3BPZA 5KXDA 1VP6A 3FE5A 3HQUA 1FNYA 4JGYA 4TXWA 2GC1A 3FHAA 1ULCA 4B4RA 4PDWB 4RSUA 2UU8A 3QOPA 4KH9A 3VHPA 5HXMA 1QOSA 4XJ9A 3POFA 1EPZA 1WW4A 1YJKA 4JGZC 2HWF3 4GIQA 2LW8A 2EF6A 4DXZA 4YARA 3LIGA 5FZKA 4NPRA 1WLWA 1MZ6A 2QZ3A 2WWJA 5FP3A 2BWCA 2FDKA 2OT7A 5HCFA 3ATGA 3LSEA 3O12A 1OSGA 5IK7A 1DF0A 2KXLA 4JGYB 1OH3A 4GA9A 4MUVA 3WNPA 1LU1A 2X5IC 1Y4WA 4LULA 3E6CC 1ZBA2 1JZ3A 2R49A 4WVWA 2JG9C 2VZQA 5F5QA 3LEGA 4K1YA 4UXAA 1Q8OA 1RMU1 3THTA 3AVRA 3WSOA 4ZHNA 3VBSA 1WLCA 4XAAA 1QQP3 2VZVA 2C9AA 3CJIA 4PHZA 2YY1A 4NIIA 1DCSA 4RFT0 1XNCA 2X5IA 4YVWA 1AXYA 2UY8A 3K3NA 3W58A 2WSVA 2G9FA 4B7KA 2ZGTA 2ZPXA 5T5OA 5BNPA 5FYHA 1VRBA 4J1WA 5E88A 3UGHA 1D2SA 4AE2A 4CCOA 5J09A 3BPSA 3ZSJA 5C7GA 3HNBM 2WZR3 1ENRA 4Q8KA 4KBBA 3U75A 4AHYA 1VRH2 2BUKA 4L11A 3RYPA 1PK6A 3RGBA 1OLQA 4A42A 3PL0A 4Y5SA 2XBO2 4OI2A 5FZGA 4W65A 3X29B 1SMVA 3FZ3A 1MACA 2HLEA 2VTFA 3DPRB 4O7XA 3DUIA 5I0DA 5JZGB 4META 3ZFFC 1EYBA 2B5HA 4XACA 5A32A 4PQ9A 3U37A 4AL9A 2DTWA 2P6CA 3AKPA 2WUHA 2XLAA 1WA6X 4Y1VA 1CX1A 4W8JA 3I2DA 3MLKA 1D4M3 1BQPA 4NAOA 1YEWA 5IK5A 2OZ6A 3OCPA 4I2OA 5CG8A 2ZGOA 4ARYA 1O3QA 4CCJA 1NQDA 2IXIA 3WY6A 4CEWC 1UX7A 3ZSEA 1AJKA 2NPIA 3I54A 1VLNA 4AK3A 2XKOA 3T1MA 4IETA 1A78A 1HKDA 1W6QA 4P5YA 3MUY1 4QPYA 3AL6A 3SH4A 3LSDA 2YPDA 3L2HA 3N9NA 4D7TA 5FREA 4Z82A 1J58A 1N47A 4HBNA 2RG4A 2AREA 2AZ5A 3LPFA 1S0IA 1Q3EA 1UY2A 3QBQA 4HG6B 4AFMA 4QPIA 5L9VA 3O1PA 3WDWA 3T2QA 1V6MA 1K12A 3AZVA 3POJA 3I8TA 4LBLA 4PCRA 3KMHA 4R52A 4KG0A 3VBFA 2OS2A 5FKCA 3TAYA 4LO5B 4BQ5A 5CBLA 3VKOA 3E5XA 1YFYA 2FCUA 5FTTC 1VBC2 1P8JA 4LEJA 3BIWE 1DHKB 3OTFA 3VBRB 4A7YA 1RXGA 2WA3A 2ZHNA 2EIGA 1RUC3 3AL5A 3B69A 1JYTA 1H2KA 3VHRA 3WG2A 3EMRA 5C8CA 1KRIA 1JOJA 3M4FA 5JUVA 1NA1A 4SBVA 1V6NA 3OBAA 3PU8A 4OI1A 1S0JA 1VBE3 4UI9L 2JB8A 4N7UA 4E4DX 1JZ2A 3S0MA 2XDVA 4CUGA 2ARAA 1XYNA 3M3QA 5C4WC 3KF5A 3VBRA 5GLVA 1WKYA 1MS5A 2C9KA 2W87A 5F6LB 5JPNB 1T6BX 4NUBA 5FCCA 4AEDB 1O3TA 4A3ZA 4CDUC 3E97A 4ZU7A 5FYYA 4WVZA 5A3TA 3VBOA 5EV7A 4AG4A 4AEDC 2J1UA 1V9U1 3BU7A 3IIIA 2XLGA 4AI1A 4Y24A 2R16A 3ZYRA 2HWD2 4QHZA 1QHDA 1O5UA 1CQ9A 5J36A 2DVBA 1VALA 2WZPP 1VBB2 4AGVA 3S7IA 1HXS2 5JWPA 1B35C 4LHSA 4L99A 5CFDA 1W9WA 4RR3C 3VBHC 2GZWA 2R0HA 2C6SA 4BQYA 3N9OA 3DECA 1XNKA 4FP3A 2D5HA 1EAH2 4F3JA 2HH9A 1AL22 4FTSA 4EV0A 5IATA 5FUIA 2QQKA 4FOWA 4PI0A 4N53B 4GB32 3VKNA 2OX0A 2QBXA 4UFIA 4EQVA 3UNPA 3LPGA 3VV1A 3VZNA 3A7QA 4XZPA 2ZGPA 4YM1A 4GQ7A 2E9QA 2BOJA 5C8CC 1V9U3 3H8OA 4AQTA 1COV2 4G3YC 2B46X 4Y22A 5H9PA 2WINB 1CJPA 1LHOA 3Q8AA 1QDOA 1ULEA 4RFRB 5FY0A 3TEWA 3IN9A 5BY5A 4DUWA 4EWDA 1BK0A 1U5ZA 4OUSA 2FMDA 1CAWB 4XXAA 1SQ4A 4N43A 5FYBA 4Q1RA 5HXVA 2J22A 4HANA 1PVC3 1W9YA 3O1TA 4FPOB 4XHBA 3SITA 4CCCA 1VMJA 1E57A 1ND2A 5ERLA 2ZGNA 5FZMA 2FDFA 4AQ6A 1VBE1 1F5JA 1Z78A 3CLPA 1RUD1 5C33A 2PELA 3N4MA 1AX2A 2BNMA 1G86A 2TNFA 4F8AA 5IK8A 5EJZB 4WM7A 1FMD3 5F3CA 1RMU2 1OD5A 1PO22 1BVVA 1R091 2B45X 2WT0A 4C8DA 4RGKA 3KV4A 3RFRA 4MGTA 2V4VA 4YLZA 4KL1A 1H8TA 1RIRA 2UWAA 3D4KA 5E16A 3T1LA 2MPFA 1N3OA 1YYNA 3ES1A 1W9SA 1YC61 1DQ6A 1V6KA 3JB8A 5FXWA 3T30A 4EN6B 3V0BB 5GZCA 1RHI3 2LALA 3GNEA 2VGDA 2BEOA 3Q9OA 3WOGA 2QVSB 2DTYA 4LO6B 4WVMA 5B4NA 4BMEA 2UY9A 4HXCA 2XLFA 1AXKA 1UZ0A 3AKRA 2O0OA 3WINE 1CAXA 1MQTC 4D8MA 5DUUA 1POV3 2C26A 3IDAA 4XDPA 2YYOA 4XF3A 4FP2A 4GXLA 1LGBA 4EZ4A 2QQUA 4LE3A 4KU8A 4S2GA 4YVSA 2VQTA 2FCVA 3AB0A 4P00B 1N3QA 1GNYA 5KR7A 3J8F3 5FP4A 1XE7A 5FBJA 1LESA 1NQJA 4LOSA 4Y4YA 4DOUA 5KXEA 4QB6A 1S0FA 5FAXA 3FMGA 4AHXA 3I97A 1UYPA 2PHRA 4ATFA 5FO9B 2D6KA 3MFCA 4FPHA 5FV3A 1ASJ3 5C4WA 4E2QA 2FZ2A 2AEYA 1JZ7A 5DDJ1 5IWFA 2VOTA 2VOKA 4XQDA 2CDPA 4XTPA 3HMYA 3OBTA 1NCQC 1WBFA 2AR6A 4W6YA 2HEWF 5GLUA 2IFWA 4HK9A 2BVBA 2W1SA 3J4UH 5JI7A 3ZIXA 5JI9A 5LBCA 3ILRA 3RZHA 1LHVA 3MPPG 4QU2A 5AC92 1SG3A 2Z79A 1G9FA 2GMMA 2P2KA 3H42B 3NWKA 4UFLA 3O1UA 4I3GA 1RINA 1FV2A 3THCA 3JBG2 4GWNA 2VUJA 1TMF3 3MF9A 1A6CA 1QH6A 3ON7A 2O8OA 1VIWB 1X36A 1IHMA 1HQWA 2VECA 3J7LA 1J84A 4A6SA 4MG2A 4V2VA 2ZGQA 3HNYM 2H6BA 1W6QB 5DABA 3A22A 3MIBA 1MZ5A 1TME1 4LUKA 4JKMA 1FAYA 1ASJ1 1QQP1 1IG0A 2YMZA 3HEIA 2XXZA 1PGL1 4AR2A 5KHJA 2GNTA 5J7MA 3AP5A 4LBKA 4NRQA 4TYSA 4IGQA 3NNJA 4Q1PA 1HB1A 4UFHA 2XJQA 5FY4A 5FYSA 3USUB 1O59A 4HL0A 2VQ0A 4YNIA 2GP3A 2G1MA 4XUPA 2SLIA 3DYOA 1AL0G 5LA9A 4DY3A 3E6DA 2WWUA 3O7OA 1NT0A 1X9PA 2DVGA 2GN7A 2BVVA 5CB7A 2P1BA 1LOFA 1HB2A 4C91A 3H7JA 1W0NA 3NV2A 2C4XA 3ZN6A 2XB6C 1ZZBA 4DXTA 5LK7B 3ZYBA 1JYVA 2R043 3LA7A 5LEJA 1RUE2 1SCRA 1HIXA 1AR81 2XKPA 4JKKA 2QE3A 4LA3A 3QLQA 1RL3A 2PYTA 3C7FA 4A7ZA 4XBNA 1GYKA 2CAVA 2Q1MA 1GOGA 4RN5A 5DZGA 4BK4A 1QJY3 2BGPA 5FYMA 1UY4A 1VBD2 1GWLA 1AR72 3EBRA 5F1RA 3POSA 2XUMA 3OGSA 4N9HA 1QIQA 5ACA1 1OXCA 3ZLIA 3I2GA 4XILA 1H9PA 5IVJA 3BODA 4CCDA 1UMIA 1QJX3 3WX5A 4PI2A 1DQ1A 1UPSA 1CD3G 2Y33A 2YZ4A 3MBWA 1GOFA 3O5SA 4UFKA 5DQ0A 4F7ZA 2JDUA 1RUG1 1E5HA 1OQEA 4CUBA 1QJFA 4QM9A 4OQ8A 4C90A 1FOD1 3IPVA 1LCLA 4K21A 3MW2A 1WMEA 2Y6HA 5C9AC 3KHCA 2Y64A 1XNBA 2XGXA 4IEVA 3PUSA 1SFNA 3OPZA 1IS5A 3MYXA 3ZKUA 1L7LA 4FFIA 1MVEA 2JG8B 1VR3A 1W2TA 1WLDA 3AFKA 3GHMA 4H55A 5FZ9A 1VMHA 3C7HA 1YLLA 5A7PA 1AR83 3GHNA 5FZLA 1RITA 2ZGRA 4RQPB 3B94A 3VKFC 5FZHA 2WWSA 4EROA 4LBQB 1U0AA 1WA4A 2JG8A 4TZDA 3BUCA 3MFAA 4Y1ZA 3ZFEA 1JUHA 1STMA 4CP9B 5AFEA 3W9AA 2RJLA 5FYTA 3I49A 3HNMA 3SNMA 5CVRA 1W9TA 2X10A 1WMXA 4RHV3 2Z4FA 1WCDJ 1F2NA 3N7LA 2P37A 3LOIA 1ND3B 2WZ8A 2ARXA 2BZDA 3QCWA 1J1LA 3VBFC 4B4PA 1C5HA 3THDA 1LHUA 1NE6A 2IZWA 2IXHA 3AVSA 1IS4A 3ZYGA 1N3PA 1S0DA 5AFBA 2VXRA 4TWTA 4LKDA 4QXHA 2RS31 2VMEA 5EFUA 1LAJA 2VO5A 5JR7B 5IHRA 2XHNA 2Q8EA 4QX1A 1UXZA 1YQ2A 3PTRB 1C1LA 3E5UA 2OUHA 1YQCA 3AMMA 4DZGA 1J1TA 1U5IA 3FUQA 1IPSA 3N36A 1HRV2 4IEWA 1LJ7A 5A1AA 2WLQA 3JBG3 5I93A 2JDNA 5GKAC 3SKVA 3T0DA 3GBWA 5AC93 2ZEYA 3PJYA 1KDKA 2J1EA 3IB3A 4BCUA 4R4XA 4AI9A 2VZ1A 2K2SA 1YUDA 2VM9A 1WCQA 2BV4A 3RNSA 5KHGA 4JDMA 2XWBB 3Q8BA 4MZUA 4YGCA 5CIRA 1CX4A 1ZBE1 3SMHA 1B35A 5JIAA 1ASJ2 3VBHB 1CPNA 3MICA 1CAXB 2VUCA 1GSLA 3M8LA 3ACHA 4E4ZA 1O3SA 4C0HA 5ACA2 2C1FA 5CKMA 2V5YA 2EAAA 2ZABA 1S55A 4ZONA 1GZTA 3MW3A 4JC1A 1UIJA 5FY5A 1DZTA 3W21A 4IE7A 3APBA 1BLZA 4Q29A 3C3VA 3DXUA 3KT4A 4Z2AA 4P02B 1Y9QA 3OGRA 5F2SA 3ZR5A 5T52A 3ALQA 5F37A 4AEMA 3OB8A 4I0AA 4Y5Z0 3ZXLA 5JZGA 1B35B 1JYNA 4NHLA 2JDPA 1GZ9A 5DG2A 4TN7A 3GBFA 5KC6A 4QPGC 3HN3A 2VNGA 1POV1 1JOBA 1R1A3 3IAPA 5I0TA 3WNOA 1VB2A 4NPMA 3T4VA 3VBOB 1EUTA 5LBFA 1S4CA 4OFGA 4G9SB 2DFCA 2WL1A 4LOTA 1MEC2 4NHXA 4K40A 3WV6A 1RB8G 3I2OA 4Q26A 1AX1A 2YXSA 2W5FA 1ULOA 1GBGA 3EYPA 1IQAA 2D6OX 4NO4A 2FDJA 3MIEA 1CWPA 5T55A 5J3UA 1EV11 1FPN1 2QKDA 1FI2A 1WGPA 1Y3TA 5F5AA 5FZ0A 4CRQA 5CFDB 2IXKA 1VPHA 1UOFA 1PO23 5C9AA 1RUI1 1CIWA 4XUQA 1C28A 1FMD2 1CR7A 2YPJA 5A7WA 4E2GA 4CUCA 4KWUA 4NE9A 3USSA 3I4IA 1IS3A 4GH4C 1QGLA 3ME2A 4FSJA 3WNNA 4IGPA 1VB4A 4LHNA 4C1XA 2XVLA 2QNKA 3KSCA 4M3CA 1DGRA 2Q0AA 4P9LA 2NN8A 4RS5C 3TEZA 2R6QA 2VCBA 3SCGA 2WO1A 4BU2A 1W03A 3N3HA 5FYCA 2B9UA 4IE0A 5E1RA 4PBOA 1XE0A 3M7AA 4BQ1A 3AP6A 3INAA 3AZWA 2QQVA 3FN9A 2DVDA 5CFCA 3FWEA 2JKXA 3UETA 2DDUA 3GZUC 3WF3A 3AZXA 3B02A 2K9ZA 1S0GA 4COWA 1RUF1 4EE2A 3BVCA 3JXSA 4KWKA 4S2HA 3WEZA 4OI0A 2WN2A 4JCKA 4WM7B 2WT2A 3NW4A 4HMZA 2A5ZA 4MVTA 4TLFA 2DVFA 2NM1A 1W8OA 2JDAA 1GMMA 5FZEA 5A3OA 3UJOA 4XFIA 5A7NA 4UW6A 3RMXA 1PX3A 3VBSB 4OMCA 4AGGA 1JYXA 1F15A 1W6NB 2BWAA 4AHZA 1R1A2 1LR5A 1QJX2 2IFRA 3HOBA 1NLRA 5A7SA 1LB2A 4MGQA 4B1LA 1MZFA 2YU2A 3GZAA 1UMHA 4AVVA 3J7MA 3WHUA 2Q1ZB 1PZ8A 2ZAHA 1RC6A 4Q4Y1 4Y1YA 3IT8A 1HDKA 5FMOL 2QDNA 2WNVA 3LDBA 2ZZQA 1LOEA 3CHXA 4HKOA 3SEEA 4OUEA 4QB1A 5FWEA 3FLRA 1W9FA 2A6XA 4HETA 5FQ0A 3DN7A 2XL7A 3HQRA 4N43C 5IVBA 4FAHA 5IVCA 2GMPA 4XCBA 2R042 4S2FA 4AVAA 5ACA3 2WDBA 5IVVA 1OI6A 3VBUA 3MI8A 4XFAA 3R4UA 5L9RA 3I3MA 1ZREA 1HRI1 3PIGA 2VUDA 1JS9A 2ZKLA 5TSWA 5FZOB 2GH2A 1UF2C 5LCWL 3B7MA 4HKWA 2P34A 3AKSA 4RA0A 3VL9A 3WP6A 2VZ3A 1GZWB 4BH9A 1UOJA 1RUD2 4MOAA 3AJZA 5D2AA 3QH6A 2XQRA 4W4ZA 2NMOA 5IAXA 2B39A 2F17A 2G9ZA 5B2GB 4YG0A 1ZRIA 4QQ2A 2PAEA 1LU2A 4RS5B 4LBQA 3ES4A 3SHRA 5FMOS 3W20A 2X05A 2PAKA 4DRVA 1HRV3 3KGZA 3ZFEB 1G9AA 2VW2A 1IKQA 1TQ5A 1ULPA 1JBCA 4JGZA 3JQXA 3POYA 1DDLA 4CVUA 1UKGA 3PIJA 1H2LA 4YVSC 3WNXA 3ZXKA 1W04A 1MS9A 2WJSA 1H9WA 2A1XA 2W52A 1HV0A 1MQTB 4JRAA 4JVAA 4MGYE 3I3QA 5JVVA 4HOOA 1OD3A 5C71A 2ZX1A 4NWWA 2GP5A 1RUD3 5A7QA 4LO7A 4AQSA 4ORFA 1ODMA 2Y0OA 3C7EA 3MV01 1V70A 3H1WA 3LEKA 1G9BA 2VBDA 2D40A 4LTAA 2ZZJA 4QX0A 2ZGMA 3K4DA 4ASLA 4FPGA 1UCXA 3ABZA 4A41A 4B1MA 5IVFA 4NHMA 1KQRA 3ZM8A 1AR82 1V6OA 2EA7A 1K5MA 4PLNA 1NA1B 4Y26A 1W2AX 5FZ6A 2CWSA 3ZSMA 3GZEA 3MIFA 2FDHA 1W6OB 4LLOA 2CTVA 5K0UB 1OF4A 2JIJA 2ARCA 2WQ4A 4LT5A 4IXLA 2VNOA 4UW4A 5FMBA 4GMP3 1LNSA 1HN1A 2XBO3 4IQPA 2YFUA 2NQYA 2ATFA 2ORXA 3KD4A 4K9SA 1K5MB 1JXNA 1UYYA 4KG8A 4LIUA 4HVRA 3WF2A 1Q8SA 2BW8A 1ZA7A 1S2KA 1BJQA 2QQNA 1NXD1 4I01A 4Q0SA 3OUIA 4UWDA 1H6YA 4CU7A 3CDZB 2JG8C 1RHI2 5H9RA 3NV4A 5E6HA 4FFHA 1DP0A 3WDTA 4BWOA 2ZHMA 4JV4A 4V2WA 4Y1UA 3NAPA 1UNBA 1O3RA 3RZMA 1VBD3 1BVP1 3C2UA 3HVDA 4ATEA 4COZA 3OF1A 2PLV1 3NMBA 5JCTA 4NR1A 2JDKA 1W8UA 4XQWA 3CIHA 1YFXA 1V6LA 3U4SA 3CEWA 1RUE3 3WF0A 1ZBA3 2TEPA 1VJ2A 4N90A 2IUWA 1JYWA 2C5DA 1W8WA 4UW3A 1OC1A 3AYDA 4MXWA 5CFDC 4NOTA 3WW1A 1BYHA 4B8EA 4A4AA 4RGGA 3I3BA 4QGMA 2DCJA 4LLFA 1QNWA 3WDUA 3SH5A 3AX4A 4Z1VA 4OHZA 3GDBA 1HJGA 1PVC2 4XPVA 4XW3A 1IPKA 2Q1FA 1Z0HA 3M3CA 5D8AB 4QGLA 5DAWA 4XUOA 1SBFA 3LDKA 2AH2A 1CAUB 5JMOA 1APNA 4LORA 1QU0A 2TBVA 1M06G 2VUAA 3VBOC 2Y26A 1ZYBA 4HZFA 4DINB 4AEJA 3LA3A 5ANNA 2GAUA 3BOWA 1ND3C 2PLV2 4KWJA 5BNPC 3O1VA 5CISA 4I0BA 5I8TA 1QF3A 3SQOA 1ULGA 1XOYA 4YW4A 5LRRA 5D8AA 3K3OA 2E51A 2ZX0A 3CJXA 3PMEA 4GJYA 4U36A 2VZUA 1MEC3 2VCMA 1TMF2 2ENRA 1EAH3 4V1PA 1EUUA 5EQUA 4XUTA 5I8SA 3AMHA 3O1RA 3WQBA 2R071 5FY1A 1HXS3 1FNZA 1VRH1 2AENA 4EN9B 3OGJA 1FX5A 2AEZA 3HWJA 2Y34A 4BB3A 2G4IA 1SLCA 4PDWC 5H9SA 4YM3A 4XBQA 4Q4V1 2B9VA 2DVAA 3LFIA 3ZX7A 1LENA 1ZA4A 2E53A 1W6PA 4H3WA 5F3GA 3VGIA 3O1SA 3MPBA 2H0BA 4GWIA 2JDMA 5A1LA 2YHJA 2HWB3 2FHRA 3MGUA 4DXSA 2WNEA 5CZKA 3J8F2 3JZVA 2KR2A 3ZFEC 3DPRA 2NMNA 1RTVA 1ZZCA 2R061 1TNRA 1VBE2 2RJ2A 4PT6A 2BYVE 5A3LA 2HYKA 2D6NA 4HK8A 5FPAA 1RHI1 2LRPA 2WZEA 3NNMA 5J37A 2OPKA 2VTXJ 2WZR1 1YIFA 5C4WB 1OT5A 5FUPA 1XYOA 1PIV2 4QPGB 5CFCC 1COV1 1VBC3 1W8NA 2BBAA 5FY7A 5FP8A 5JIUA 3WR0A 2R32A 2V09A 4QD2A 5LBBA 2VZOA 1KS5A 2XUEA 4CU8A 1DIWA 4KWLA 4XIKA 3SH3A 3P3NA 4AHWA 1WD4A 3N9LA 5L7OC 4HLTA 4KGGA 4RS5A 4QX3A 1VAKA 2HWE2 3TYJA 1RMU3 4XC9A 1H8TB 2PA7A 3I2HA 1YHFA 4NVPA 1ULDA 4D94A 4I09A 1BHGA 2ORZA 1W28A 1QMJA 1UOGA 3CNAA 4RHV2 1DGLA 4NJ4A 2YUEA 3E1F1 5DUXA 4MADA 2CDOA 2VJXA 1W6MB 4YZ4A 3LB9A 1RUG2 3UKVA 4XYXA 1XSQA 1CJDA 2E33A 2ZXQA 4L9BA 5A6YA 5J48A 2ZHLA 4CYDA 2FDGA 1LHWA 4KGQA 1W0PA 4OLLA 3HR9A 2FDIA 4D7YA 3PUIA 3HIFA 2VOWA 3K48A 5A7WB 3VBSC 1VBA1 4FOQA 3F95A 4EN0A 3WG3A 3RI8A 3T08A 1GUIA 1SLAA 4WBBA 2PHWA 3H7YA 3HBZA 3NNFA 3MO4A 3OGVA 4QQPA 3RYRA 3BKZA 2JX9A 1COV3 1VBC1 3WUCA 2D7FA 4CXXA 3EXUA 1WCSA 5IUQA 5FR3A 1UYXA 2RDRA 2WFF1 2D93A 4CTEA 5JMCA 1FT9A 4YGBA 3ZXJA 4OHYA 3ZSLA 4D7SA 3R6SA 4BE3A 2WNVC 1VRH3 4CCMA 5F5CA 2OXBA 4FVVA 5JOYA 1A8MA 3N7MA 2WZR2 1O8PA 3AP9A 1AL23 2BDRA 2BTVC 3U07A 1EAH1 1G6NA 3GM8A 3ZYJB 3WNLA 5K9YA 3J7NA 5LATA 1FYUA 4ET7A 3CZUA 1JMUB 2QZ2A 2Z69A 1MVQA 3GXUA 5ABJC 4JHTA 3LIHA 3GJAA 4LBMA 1A3KA 3WUDA 1AR73 1F31A 2KD7A 1VAVA 1QJY2 1LOGA 4IW3A 4XMAA 5IVEA 5HV4A 5FZCA 2VAUA 1AXZA 1JN2P 1GFF2 3VLBB 5KXBA 2R041 1OA4A 4F83A 3HT2A 5AVPA 4LBNA 2IVIB 2YC2A 3TEYA 3FFQA 5EYXA 4XE9A 3MUZ1 5BUVA 4AI2A 4LBJA 1XBFA 3KCCA 3OYWA 4Q0PA 2ZEXA 4P9JA 4XUNA 4XF1A 2Y6LA 3WF4A 3TBDA 3NKGA 1IG3A 3ZYIB 5A3PA 1O7FA 1QJEA 2RDSA 2A6YA 2HWF2 1OQ1A 3B5LB 3DYMA 4LA2A 4X8NA 4RQPA 5KBFA 2XL9A 1NKGA 2MNGA 3L2YA 3HPNA 3H8UA 1RUC2 3RZZA 2RS11 1DLCA 2HYXA 4L0PA 4LPLA 5A33A 5KWRA 5EPAA 2YDEA 5FZOA 3KVAA 2LS6A 3LQCA 2NYYA 2P3JA 3AC0A 3OYWB 5FOJB 1GWMA 1O4YA 4YW1A 4JTOA 1NG0A 4QXCA 2AACA 3M1HA 3WP4A 5LA2A 4TTGA 5LEKA 5FJKA 3MDPA 4JAAA 2W0XA 2BOIA 2W08A 4QB2A 5F7UA 3T2PA 4CXYA 3N7JA 1KS4A 2J7MA 3T2TA 5F9TA 4NPLA 4P5HA 1QXRA 2VNVA 4S2DA 4MHRA 2NLRA 3T4HB 5FZ7A 1H8VA 5FZBA 1PM4A 2ERFA 4M0HA 1DLLA 1SDWA 5C8WA 3Q8FA 1OPOA 2R073 4IL7A 4LMFA 3POWA 4JDNA 2Q30A 3KM5A 3MW4A 4INDA 4ONUA 4ZS3A 2J42A 4WVMB 3WW2A 5C5UA 1GQGA 1JTZX 4ISRA 2QQMA 4WV8A 1VAMA 2ZS6B 1AYM1 1XJAA 1PGW1 1GP5A 2OQ6A 2E7AA 2VW0A 4Q0VA 5IAVA 1W6NA 2VMFA 3IPVB 5GALA 1D4M2 2LROA 3KHBA 2RMU3 3U78A 1OOPC 4WM8B 1XQNA 4Y4RA 1TME2 1TEIA 3QACA 4XBLA 3TB0A 4YZ2A 3WT3A 5J1XA 2JE9A 2VMGA 4XF4A 3AXDA 1A34A 1LOBA 1PO12 2IXCA 3H3UA 1GKBA 1GNZA 1JUIA 3WP5A 1UZYA 2WT1A 4DIQA 1W99A 1J59A 3W5NA 1D2QA 1ULFA 3P5BA 4CE8A 3RJRA 3JBG1 1OF3A 2VZSA 4DRRA 4YGEA 4Q0QA 4Z8BA 2WS91 2VW1A 3GYDA 1HQNA 4Q4X1 2DUPA 4IE6A 4Q5OA 1BKZA 2JE7A 3K77A 1ZZ8A 5F3EA 1K5JA 3MLJA 1C3HA 1VBA2 4MYEA 1REFA 2XVKA 5K0UA 1O4ZA 4OI4A 3MV11 2WYFA 4QMAA 1WMFA 4IEZA 5JXIA 5DG1A 1D0HA 1JODA 5F32A 2D6LX 4EWAA 2F6BA 3PMSA 2IVJA 2VY0A 3ZPYA 1H0BA 1PMHX 3FHQA 3AFGA 4H7LA 4XXPA 1O4TA 3R0RA 4YW7A 2Q8OA 3WCSA 3WNMA 1GP4A 1C8NA 2YROA 4JGZB 4NHYA 3FL7A 4XJZA 5FRAA 4E2SA 1KJRA 4IDZA 5ABJA 4X6QB 5C3SA 1BMV2 4CCEA 1IKPA 3P1IA 1NX9A 4TLGA 1RGSA 2H6CA 1LECA 1KFXL 1PK6C 4E27A 3VZJA 4AFCA 4AGRA 1PGW2 5C9AB 1G8WA 3N9MA 4CDUA 1LGNA 1SBEA 2RE9A 4EYUA 1BEV2 4AFBA 2EIEA 2LM3A 4JQRA 1QKQA 3O1OA 1OLMA 4RR3B 5M0TA 2WAAA 2IWGB 4BLJA 1Q8QA 4L2NA 1V9U2 3A0NA 1KFUL 2OW4A 4XQ4A 3ACFA 4AOCA 1SCSA 3PVOA 4URTA 1DGRN 2VD7A 2EXJA 4CDWC 1NXMA 4GB33 2YBKA 2XHKA 1BBT3 3IDBB 3WDVA 2CAUA 1IGOA 1OKOA 4CDWB 3D3AA 1UMZA 2MHFA 1WZXA 3H1YA 4H7MA 3RVHA 3ZVXA 3ZO0B 2RS51 2YGMA 5FZAA 1OLME 1RUJ2 5LK5A 1CESA 4DEVA 4QX7A 2C24A 3CMGA 5D8AC 5CNAA 5H9QA 4BIOA 5EIYB 3UYJA 2HBTA 2VL4A 3ZDVA 3O0XA 1VBB3 3FFZA 2F4LA 4UFMA 5KHKA 4HVOA 3ZFGB 2HWD3 1ENSA 3U11A 3ETPA 1QJZA 1F35A 3S5AA 5JZGC 5FY8A 1ODNA 4XJWA 2RS13 3IDCB 4Q4W1 2GSYA 3DV8A 4HT1T 2JIGA 3RS6A 3WXPA 2VMHA 5BNOC 4Q4Y3 5C70A 5KHIA 5L7OA 1LHNA 1NZCA 1UN1A 1W39A 1WBLA 3BI3A 2LUWA 3BTAA 5F3IA 4H2AA 1XU1A 4CP1A 1BBT1 4MSVA 4IEOA 1F9KA 3EHKA 4U2AA 3ECQA 3EB7A 5F8PA 5FPZA 2DUOA 4CEWA 2W95A 2YGLA 3UV9A 2ZMLA 2XVGA 1JH5A 2FZ1A 3THPA 2DFBA 3OPWA 4R9CA 4XFGA 2AUYA 1C8M1 2KM2A 1AL21 5GJ6A 2BNNA 3VD7A 4R9AA 2HWF1 5LASA 1AYM2 3POBA 4NWVA 1YIPA 1HXS1 1NLSA 3RPQA 3VBUB 1ENQA 3DKQA 4MXWB 4FCAA 3ZFFA 3JUUA 3C7GA 1PVC1 2X29A 5HPOA 3PHMA 1UOBA 4QDQA 1PVXA 5A1FA 1PGL2 3LGRA 2EIBA 4OVEA 3WHTA 3P6BA 4YM2A 2VZRA 3CU7A 4OHXA 3I59A 4CDXA 5A6XA 4FTEA 1O8SA 2RHPA 3B9IA 4QKNA 3VZKA 3POIA 4NIAA 1NYWA 1RUOA 2RM21 1ND2C 1IQDC 3SEPA 4GWJA 2PHFA 3ZMOA 5FJHA 2DURA 3HBKA 3GCXA 4I30A 5DZEA 2R30A 5FXZA 3RDIA 4D6QA 3NL1A 4Y20A 3WNKA 1W2NA 4PDWA 1QDCA 1Y9GA 4UBHA 4BYYA 2PMWB 3D0SA 3RI9A 3TOJA 3I59B 5BNNC 1LTEA 4HONA 5HBAA 1R082 1HQLA 3LA2A 4YGDA 4DUXA 1MZEA 1UZVA 3O0WA 4AI0A 1IZ3A 4FQZA 2QQLA 4IERA 4YG6A 3RJ2X 3PDQA 3UJQA 4ZU5A 5FMCA 2JG9A 4B29A 3LKJA 1WW6A 2CY6A 3A21A 3OUHA 4WZFA 3GJBA 1V6JA 2XQXA 1AJOA 2PQSA 4OZOA 3MHZA 1HLCA 2ZX3A 3FLTA 3U10A 2QJVA 1KDMA 4COUA 1EV12 1FPN2 1DYOA 2DCTA 2G9GA 4YVSB 1G9CA 3IWZA 3PTYA 3KVBA 2HJIA 5AVAA 1C1FA 1WCUA 2WNUB 2WNVB 4LK7A 4DY5A 1AYN3 1RUH1 3ZSKA 3JCIA 4YZ3A 3VBHA 2DV9A 5K7PA 4LHLA 2RM23 3S6PA 1L3JA 4BMBA 1HRI3 4FO9A 1XNAA 4BQWA 2ZOEB 2JDHA 4YVWB 3GBGA 3ENRA 4QPWA 2A6ZA 1ZM1A 5EJ1B 5A6QA 3TWIA 3WW3A 4ISQA 4IV3A 1F5FA 1V0AA 4WVVA 3T2OA 4DFSA 2GU9A 1J3PA 4BZ4A 3I2KA 2IC1A 4NAMA 2PHUA 1GANA 3ZYHA 5GZGA 1PK6B 2HWB1 3AMNA 3DYPA 1AR63 1F4HA 1QQP2 4MV2A 3ZOIA 4DUVA 3MIGA 2BFUL 2JWPA 4URAA 4GKXA 1BMV1 1A8DA 2O14A 4HKLA 4CZSA 4ZS2A 1WUVA 2ZCWA 4AAPA 2RV9A 3KQ4B 2R062 4NIHA 3E6BA 1DU3D 5FZIA 2WFF2 4BQXA 1TG7A 1QOTA 1CAVB 1LRHA 2P3YA 2ZA9A 3J8F1 3WG1A 1XE8A 2PHLA 5FO7B 3SKJE 5AC91 2UWBA 5C3PA 5GLWA 1KD7A 2ADEA 1UIKA 3H1MA 1GZCA 4QQHA 2JXAA 2JE8A 4DS0A 4NROA 2P3KA 2ZBJA 5FK7A 3TNQA 2Y6JA 4QHBA 4YZ1A 2B42B 5T3NA 2XJRA 3VKMA 1EPWA 3PUAA 4B3NA 4BA6A 2QTWB 2HKXA 2OKXA 1MS4A 2Z2SB 4QPIC 2JD9A 4KI5M 3ZXGA 1GU3A 1AR92 2R7EB 5T50A 4MGKE 4QPIB 2D44A 2W9XA 1K45A 5A80A 3UL2A 3LDRA 4CDUB 1C8M2 2SBAA 5J96B 2JKBA 1U12A 4CDQA 2WYSA 3VDAA 2FD8A 2IXJA 4LO4B 3N9QA 1J3QA 1S0BA 5JOZA 3AJYA 1RUC1 1GQPA 1PO21 1R092 2MEV3 3V64A 3BYWA 1RYYA 3G6JB 4Y5TA 4XCAA 2G19A 2Q5TA 4Q4X3 2WS93 3UGGA 3BTZA 5JXJA 4UAPA 2E7QA 1EP0A 4FPLA 3UKTA 4FPFA 2UYAA 2A3WA 1UQXA 1W8FA 2DUQA 2OYZA 3ACIA 4IV3C 1PZ9A 2JD4A 4Q4V3 1DYKA 1CZVA 4E8DA 1SFPA 4NRMA 3ZXDA 1GNHA 3NKTA 3RWKX 3DEMA 5JXGA 3IZOA 1F4AA 5JXHA 3H0OA 4AEDA 3OSDA 4IEQA 4YPJA 2OZJA 3RWNA 4ASMB 1AVBA 3ZKYA 3ZR6A 4D6SA 4N9IA 1W6PB 2RS53 3OEBA 4N53C 2W3JA 4FFGA 4AI3A 1JU3A 1YFWA 2GH8A 4FPJA 4J25A 1ZBA1 4LQRA 4GB31 4BHPA 2V4AA 2D3RA 4NRPA 5J98B 2RR13 4JRLA 4K6BA 2W47A 4BK5A 2GNMA 3KGLA 1OLRA 1H1MA 4ITCA 3BIEA 4XEZA 5KHHA 4O65A 2Q8CA 1VBD1 4O61A 1OUSA 4MHUA 3V0AB 3ZN5A 4ZZ8A 3VBUC 1GQHA 5HCHA 5BNNA 3AK0A 3LCPA 3NVCA 2JEMA 2XJSA 3ILFA 3GALA 2VTXA 1XPWA 4CXWA 3WQ7A 1C5IA 5I8YA 4Y1XA 5ISLA 4QPGA 2EIDA 1UD1A 3KLSA 3RG0A 1QJU3 2ZMKA 3LWCA 5T5PA 4Y22B 4CCNA 1UU6A 4BQ2A 2ZX2A 2Y6GA 1D4M1 3F2ZA 4YFWA 1ZZ6A 1TVGA 4K7JA 3ST7A 4CDXB 2XWJB 4CCLA 4CU6A 2FCTA 2RVAA 3EO6A 4BXSV 3T0BA 4XAEA 5FO8B 1DQ4A 4CPBD 3ZFGC 1FOD2
chains in the Genus database with same CATH topology
2VJXA 4XUPA 3DYOA 2E33A 2ZXQA 2XONA 2XOMA 3CZJA 3PUIA 1W0NA 2C4XA 5LA0A 2WABA 4W50A 3T08A 1GUIA 1JI6A 4DXTA 3J7HA 1JYVA 1CZSA 3MO4A 2DCKA 3OGVA 4JKKA 3C7FA 1UYXA 4RN5A 1GOGA 1UY0A 4BK4A 2BGPA 1UY4A 1OH4A 3OGSA 2BERA 3I2GA 4XVHA 4E8CA 1O8PA 1UMIA 3GM8A 3WNLA 2VC9A 3LEIA 5DQ0A 3MBWA 2E32A 1GOFA 4ET7A 3CZUA 4JX0A 3GXUA 4CUBA 2YC4A 3VD4A 2Y6HA 2Y64A 2KD7A 2WQ8A 2B4KA 2W46A 4PQQA 1XC6A 4LKSA 5G05L 3C7HA 2VMDA 3C7OA 2YC2A 2E31A 1MPXA 3MUZ1 4BJ0A 4XUNA 2ZEXA 4ZY9A 1CZTA 1NAEA 2Y6LA 3WF4A 3DYMA 2J1TA 1NKGA 3HNMA 3HPNA 1W9TA 2X10A 1JZ8A 2Z4FA 1DLCA 2HYXA 4L0PA 4LPLA 2WZ8A 2BZDA 3OG2A 2VR4A 3I2JA 2LS6A 3LQCA 3AC0A 3THDA 1CIYA 2J1SA 3WF1A 1UY1A 4TTGA 5LA2A 1JHJA 2VMEA 4KMQA 2VO5A 5IHRA 2XHNA 4QX1A 2W92A 1UXZA 1YQ2A 4QB2A 5F7UA 3T2PA 2J1RA 2J7MA 1PMJX 2V5DA 5A1AA 1L7RA 2W1WA 3W5MA 3SKVA 3T0DA 1JZ4A 2ZEYA 4PF1A 2J1EA 3IB3A 2Y8KA 1UY3A 2VZ1A 2VM9A 1WCQA 2QQMA 2VQUA 1SDDB 2VMFA 2VZTA 5J1XA 3ACHA 1KGYA 5DMYA 2WBKA 3I2FA 5DN2A 4MO3M 1R64A 2ZEZA 1JU4A 1W99A 3W5NA 3K75B 3UESA 4Z2AA 1OF3A 2VZSA 4P02B 3OGRA 4P08A 2V72A 5IYYA 3NRUA 3OB8A 4M4RA 1JYNA 3K77A 2W94A 2VCCA 2W1UA 3HN3A 3IAPA 3WNOA 1EUTA 3MV11 2X09A 3I3DA 4JHZA 2VZPA 5JXIA 1H6XA 4A45A 2VMCA 4CU9A 2J1VA 3OEAA 1GOHA 4DEQA 2W5FA 1ULOA 3EYPA 1PMHX 2QQIA 5IFTA 3FHQA 3VD3A 2WAOA 5IFPA 4OYUA 3CKHA 4ZXEA 3VD5A 4QDSA 1J83A 3WNMA 4M4PA 5B4XA 4QX2A 3FL7A 4XUQA 4A44A 4CUCA 4KWUA 3P1IA 4TXWA 3FHAA 1UYZA 1NX9A 5G04L 3VDBA 5HXMA 3WNNA 2LW8A 4AAXA 4UOJA 2VCBA 2WO1A 4XZUG 2EIEA 1US3A 2WAAA 3WNPA 4DXRA 4QDRA 1JZ3A 3ACFA 1SHWB 2VZQA 3LEGA 3FN9A 3UETA 2JKXA 3K4ZA 2DDUA 3WSOA 3WF3A 3D3AA 3JXSA 2VZVA 3WEZA 4DEVA 2VCAA 2WN2A 3CMGA 5EIYB 3HJRA 1W8OA 3GGLA 1GMMA 2JDAA 2QQJA 2VL4A 1PX3A 4OMCA 1JYXA 3HOBA 3ETPA 5C7GA 3HNBM 4MGQA 1UMHA 2W1QA 4A42A 5C70A 3SEEA 4OUEA 4QB1A 3K4AA 2HLEA 2VTFA 5I0DA 4JKLA 3ECQA 3EB7A 3U37A 3I3EA 1XNTA 2W95A 2WDBA 2WUHA 4ARXA 1CX1A 4W8JA 2EICA 3VD7A 5LCWL 1JZ6A 2W91A 2VZ3A 5DPNA 4ARYA 3A23A 4MOAA 1UX7A 4W4ZA 1UWWA 4XURA 1K3IA 3C7GA 5HPOA 1NUKA 4P5YA 4QDQA 3MUY1 2EIBA 3BGAA 3P6BA 2VZRA 2X05A 4RYDA 1UXXX 1UY2A 1ULPA 3LPFA 4HG6B 1O8SA 3T2QA 1K12A 4CVUA 4ZZ5A 2J1AA 3SEPA 1IQDC 4GWJA 3WNKA 5IJRA 1P8JA 1L7QA 1OD3A 4FI9A 5C71A 4DUXA 2QQLA 3C7EA 3MV01 2WN3A 5JUVA 3LEKA 3A21A 3OBAA 4OZOA 2XQXA 4QX0A 2PQSA 4UI9L 3K4DA 1JZ2A 3ABZA 4A41A 1DYOA 3ZM8A 3ACGA 1WKYA 2ID4A 2C9KA 2W87A 4A3ZA 1OF4A 3LE0A 4AG4A 1XNAA 1LNSA 2J1UA 1HN1A 3IIIA 2YFUA 4QPWA 5EJ1B 4A6OA 2ORXA 1I5PA 3T2OA 3NJVA 1UYYA 3WF2A 3I2KA 4LHSA 2QQNA 1W9WA 2WO2A 3DECA 1H6YA 4CU7A 3DYPA 3CDZB 1F4HA 4DUVA 1DP0A 5FUIA 2QQKA 4CUAA 2QBXA 2RV9A 3UNPA 3LPGA 3A7QA 1TG7A 3CIHA 4D0QA 3WF0A 2WO3A 3SKJE 3C8XA 1JYWA 4DUWA 4OMDA 3T09A 1JZ5A 2L9LA 4A4AA 4QAWA 3I3BA 4IUGA 2DCJA 2J22A 2JE8A 2Y6JA 3GDBA 3IAQA 4XUOA 3CQOA 2OKXA 5JMOA 3VD9A 2JD9A 4BDVB 4KI5M 1GU3A 2R7EB 5EJZB 3NQHA 3VDCA 2W9XA 1K45A 3K46A 2WYSA 3VDAA 2V4VA 3I2IA 1D7PM 1T2XA 5JR2A 1KEXA 1W9SA 2VZUA 1GQPA 1RYYA 1US2A 5CYYA 1EUUA 4XUTA 3T0AA 5B4NA 3WQBA 1K42A 5JXJA 4UAPA 1UZ0A 4D8MA 2C26A 3ACIA 3IDAA 2B9VA 2YG0A 1CZVA 2VQTA 4E8DA 4P00B 5JXGA 4GWIA 1F4AA 5JXHA 4DXSA 1GNYA 2Y6KA 4YPJA 5CZKA 2YFZA 4QB6A 3OEBA 2W3JA 3I97A 1JU3A 1PX4A 2RJ2A 4PT6A 4LQRA 1JZ7A 2QQOA 2E26A 2VOTA 2YB7A 2CDPA 2WZEA 2W47A 4BK5A 2ZEWA 2W1SA 1OT5A 1SG3A 4GZ9A 5LA1A 4ZZ8A 1W8NA 2BBAA 3THCA 2VZOA 3NNGA 4MGSA 1XPWA 4CU8A 2CDOA 1J84A 2EIDA 3BN6A 3HNYM 2BGOA 3A22A 4QX3A 4JKMA 2Y6GA 3F2ZA 3I2HA 3HEIA 1TVGA 3PUHA 1BHGA 2ORZA 4CU6A 2RVAA 4BXSV 3T0BA 3E1F1 4MADA 3NJXA 1O59A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VJX A;  4XUP A;  3DYO A;  2E33 A;  2ZXQ A;  2XON A;  2XOM A;  3CZJ A;  3PUI A;  1W0N A;  2C4X A;  5LA0 A;  2WAB A;  4W50 A;  3T08 A;  1GUI A;  1JI6 A;  4DXT A;  3J7H A;  1JYV A;  1CZS A;  3MO4 A;  2DCK A;  3OGV A;  4JKK A;  3C7F A;  1UYX A;  4RN5 A;  1GOG A;  1UY0 A;  4BK4 A;  2BGP A;  1UY4 A;  1OH4 A;  3OGS A;  2BER A;  3I2G A;  4XVH A;  4E8C A;  1O8P A;  1UMI A;  3GM8 A;  3WNL A;  2VC9 A;  3LEI A;  5DQ0 A;  3MBW A;  2E32 A;  1GOF A;  4ET7 A;  3CZU A;  4JX0 A;  3GXU A;  4CUB A;  2YC4 A;  3VD4 A;  2Y6H A;  2Y64 A;  2KD7 A;  2WQ8 A;  2B4K A;  2W46 A;  4PQQ A;  1XC6 A;  4LKS A;  5G05 L;  3C7H A;  2VMD A;  3C7O A;  2YC2 A;  2E31 A;  1MPX A;  3MUZ 1;  4BJ0 A;  4XUN A;  2ZEX A;  4ZY9 A;  1CZT A;  1NAE A;  2Y6L A;  3WF4 A;  3DYM A;  2J1T A;  1NKG A;  3HNM A;  3HPN A;  1W9T A;  2X10 A;  1JZ8 A;  2Z4F A;  1DLC A;  2HYX A;  4L0P A;  4LPL A;  2WZ8 A;  2BZD A;  3OG2 A;  2VR4 A;  3I2J A;  2LS6 A;  3LQC A;  3AC0 A;  3THD A;  1CIY A;  2J1S A;  3WF1 A;  1UY1 A;  4TTG A;  5LA2 A;  1JHJ A;  2VME A;  4KMQ A;  2VO5 A;  5IHR A;  2XHN A;  4QX1 A;  2W92 A;  1UXZ A;  1YQ2 A;  4QB2 A;  5F7U A;  3T2P A;  2J1R A;  2J7M A;  1PMJ X;  2V5D A;  5A1A A;  1L7R A;  2W1W A;  3W5M A;  3SKV A;  3T0D A;  1JZ4 A;  2ZEY A;  4PF1 A;  2J1E A;  3IB3 A;  2Y8K A;  1UY3 A;  2VZ1 A;  2VM9 A;  1WCQ A;  2QQM A;  2VQU A;  1SDD B;  2VMF A;  2VZT A;  5J1X A;  3ACH A;  1KGY A;  5DMY A;  2WBK A;  3I2F A;  5DN2 A;  4MO3 M;  1R64 A;  2ZEZ A;  1JU4 A;  1W99 A;  3W5N A;  3K75 B;  3UES A;  4Z2A A;  1OF3 A;  2VZS A;  4P02 B;  3OGR A;  4P08 A;  2V72 A;  5IYY A;  3NRU A;  3OB8 A;  4M4R A;  1JYN A;  3K77 A;  2W94 A;  2VCC A;  2W1U A;  3HN3 A;  3IAP A;  3WNO A;  1EUT A;  3MV1 1;  2X09 A;  3I3D A;  4JHZ A;  2VZP A;  5JXI A;  1H6X A;  4A45 A;  2VMC A;  4CU9 A;  2J1V A;  3OEA A;  1GOH A;  4DEQ A;  2W5F A;  1ULO A;  3EYP A;  1PMH X;  2QQI A;  5IFT A;  3FHQ A;  3VD3 A;  2WAO A;  5IFP A;  4OYU A;  3CKH A;  4ZXE A;  3VD5 A;  4QDS A;  1J83 A;  3WNM A;  4M4P A;  5B4X A;  4QX2 A;  3FL7 A;  4XUQ A;  4A44 A;  4CUC A;  4KWU A;  3P1I A;  4TXW A;  3FHA A;  1UYZ A;  1NX9 A;  5G04 L;  3VDB A;  5HXM A;  3WNN A;  2LW8 A;  4AAX A;  4UOJ A;  2VCB A;  2WO1 A;  4XZU G;  2EIE A;  1US3 A;  2WAA A;  3WNP A;  4DXR A;  4QDR A;  1JZ3 A;  3ACF A;  1SHW B;  2VZQ A;  3LEG A;  3FN9 A;  3UET A;  2JKX A;  3K4Z A;  2DDU A;  3WSO A;  3WF3 A;  3D3A A;  3JXS A;  2VZV A;  3WEZ A;  4DEV A;  2VCA A;  2WN2 A;  3CMG A;  5EIY B;  3HJR A;  1W8O A;  3GGL A;  1GMM A;  2JDA A;  2QQJ A;  2VL4 A;  1PX3 A;  4OMC A;  1JYX A;  3HOB A;  3ETP A;  5C7G A;  3HNB M;  4MGQ A;  1UMH A;  2W1Q A;  4A42 A;  5C70 A;  3SEE A;  4OUE A;  4QB1 A;  3K4A A;  2HLE A;  2VTF A;  5I0D A;  4JKL A;  3ECQ A;  3EB7 A;  3U37 A;  3I3E A;  1XNT A;  2W95 A;  2WDB A;  2WUH A;  4ARX A;  1CX1 A;  4W8J A;  2EIC A;  3VD7 A;  5LCW L;  1JZ6 A;  2W91 A;  2VZ3 A;  5DPN A;  4ARY A;  3A23 A;  4MOA A;  1UX7 A;  4W4Z A;  1UWW A;  4XUR A;  1K3I A;  3C7G A;  5HPO A;  1NUK A;  4P5Y A;  4QDQ A;  3MUY 1;  2EIB A;  3BGA A;  3P6B A;  2VZR A;  2X05 A;  4RYD A;  1UXX X;  1UY2 A;  1ULP A;  3LPF A;  4HG6 B;  1O8S A;  3T2Q A;  1K12 A;  4CVU A;  4ZZ5 A;  2J1A A;  3SEP A;  1IQD C;  4GWJ A;  3WNK A;  5IJR A;  1P8J A;  1L7Q A;  1OD3 A;  4FI9 A;  5C71 A;  4DUX A;  2QQL A;  3C7E A;  3MV0 1;  2WN3 A;  5JUV A;  3LEK A;  3A21 A;  3OBA A;  4OZO A;  2XQX A;  4QX0 A;  2PQS A;  4UI9 L;  3K4D A;  1JZ2 A;  3ABZ A;  4A41 A;  1DYO A;  3ZM8 A;  3ACG A;  1WKY A;  2ID4 A;  2C9K A;  2W87 A;  4A3Z A;  1OF4 A;  3LE0 A;  4AG4 A;  1XNA A;  1LNS A;  2J1U A;  1HN1 A;  3III A;  2YFU A;  4QPW A;  5EJ1 B;  4A6O A;  2ORX A;  1I5P A;  3T2O A;  3NJV A;  1UYY A;  3WF2 A;  3I2K A;  4LHS A;  2QQN A;  1W9W A;  2WO2 A;  3DEC A;  1H6Y A;  4CU7 A;  3DYP A;  3CDZ B;  1F4H A;  4DUV A;  1DP0 A;  5FUI A;  2QQK A;  4CUA A;  2QBX A;  2RV9 A;  3UNP A;  3LPG A;  3A7Q A;  1TG7 A;  3CIH A;  4D0Q A;  3WF0 A;  2WO3 A;  3SKJ E;  3C8X A;  1JYW A;  4DUW A;  4OMD A;  3T09 A;  1JZ5 A;  2L9L A;  4A4A A;  4QAW A;  3I3B A;  4IUG A;  2DCJ A;  2J22 A;  2JE8 A;  2Y6J A;  3GDB A;  3IAQ A;  4XUO A;  3CQO A;  2OKX A;  5JMO A;  3VD9 A;  2JD9 A;  4BDV B;  4KI5 M;  1GU3 A;  2R7E B;  5EJZ B;  3NQH A;  3VDC A;  2W9X A;  1K45 A;  3K46 A;  2WYS A;  3VDA A;  2V4V A;  3I2I A;  1D7P M;  1T2X A;  5JR2 A;  1KEX A;  1W9S A;  2VZU A;  1GQP A;  1RYY A;  1US2 A;  5CYY A;  1EUU A;  4XUT A;  3T0A A;  5B4N A;  3WQB A;  1K42 A;  5JXJ A;  4UAP A;  1UZ0 A;  4D8M A;  2C26 A;  3ACI A;  3IDA A;  2B9V A;  2YG0 A;  1CZV A;  2VQT A;  4E8D A;  4P00 B;  5JXG A;  4GWI A;  1F4A A;  5JXH A;  4DXS A;  1GNY A;  2Y6K A;  4YPJ A;  5CZK A;  2YFZ A;  4QB6 A;  3OEB A;  2W3J A;  3I97 A;  1JU3 A;  1PX4 A;  2RJ2 A;  4PT6 A;  4LQR A;  1JZ7 A;  2QQO A;  2E26 A;  2VOT A;  2YB7 A;  2CDP A;  2WZE A;  2W47 A;  4BK5 A;  2ZEW A;  2W1S A;  1OT5 A;  1SG3 A;  4GZ9 A;  5LA1 A;  4ZZ8 A;  1W8N A;  2BBA A;  3THC A;  2VZO A;  3NNG A;  4MGS A;  1XPW A;  4CU8 A;  2CDO A;  1J84 A;  2EID A;  3BN6 A;  3HNY M;  2BGO A;  3A22 A;  4QX3 A;  4JKM A;  2Y6G A;  3F2Z A;  3I2H A;  3HEI A;  1TVG A;  3PUH A;  1BHG A;  2ORZ A;  4CU6 A;  2RVA A;  4BXS V;  3T0B A;  3E1F 1;  4MAD A;  3NJX A;  1O59 A; 
#chains in the Genus database with same CATH topology
 5E89 A;  3ZDS A;  2BJS A;  1JYI A;  2EXI A;  1G7Y A;  1W0O A;  2XON A;  4QX5 A;  3TN9 2;  3ZXF A;  3CZJ A;  1UKR A;  1W6M A;  3AZY A;  4W50 A;  3UT0 A;  1I3H A;  2D6M A;  1SLT A;  3B9C A;  1CZS A;  1NCQ A;  1AR7 1;  1RUH 3;  1V6I A;  3WG4 A;  3BU0 A;  1JHN A;  4LIV A;  3BCW A;  3PUR A;  5A3N A;  2RS3 2;  4FXK B;  3NJY A;  1ZRC A;  5GLZ A;  3KCY A;  4EJR A;  5DUW A;  4UBG A;  3S30 A;  4NIG A;  2R1D A;  1I6X A;  3V65 A;  2D3S A;  5FKB A;  3KT7 A;  1OH4 A;  4K20 A;  4DNY A;  1N1T A;  1POQ A;  1OPM A;  1BZW A;  4E8C A;  2F4P A;  2X8K A;  4QXB A;  5BNO A;  2GME A;  2WNU A;  4IEU A;  3ROU A;  1DQ5 A;  1NCQ B;  3AXE A;  3H3L A;  1ZBE 2;  3TRS B;  1R1A 1;  1W8H A;  3J9S A;  1ZNP A;  2PHX A;  4L92 A;  1G9D A;  2VBB A;  3DXT A;  4GH4 B;  3W59 A;  4FAG A;  3LEI A;  3TN9 1;  1BCX A;  2XG3 A;  4YYO A;  2E32 A;  2BFU S;  3KCX A;  2RMU 1;  4JX0 A;  5FY9 A;  3EJK A;  3VN4 A;  1UU5 A;  3P3P A;  2LTN A;  3VD4 A;  1ALY A;  3A0K A;  4IE4 A;  1O5L A;  1UAI A;  1ZZ7 A;  5JOW A;  1W3X A;  1N1S A;  2B4K A;  2W46 A;  3N7K A;  3OPT A;  4H14 A;  3UGF A;  2IXL A;  3T3Y A;  3LEM A;  4M01 A;  4PQQ A;  1XC6 A;  3H3Z A;  4LKS A;  2DF7 A;  2HWC 3;  5G05 L;  4PIX A;  5JAX A;  3J26 N;  5L36 A;  2FQP A;  3VBR C;  2YBP A;  3C7O A;  1MS0 A;  4FPC A;  2OII A;  4IGO A;  4YWA A;  4AZZ A;  1H1A A;  2E31 A;  1WW7 A;  2WRA A;  2CL2 A;  5C3O A;  4XJ8 A;  3UK9 A;  2I2S A;  1H8T C;  1OA3 A;  2W39 A;  1URX A;  2D6P A;  4BQ3 A;  2DCZ A;  1CAV A;  1NAE A;  3BTY A;  2PN5 A;  5ABJ B;  2AGS A;  3OD4 A;  4WM7 C;  2GN3 A;  5FYI A;  2P17 A;  4HPK B;  2ZGL A;  3RSJ A;  1CGP A;  2WO7 A;  3URF A;  4BIF A;  3D82 A;  4C1W A;  1JZ8 A;  3S57 A;  3JD7 3;  3WD5 A;  1SBD A;  1RUI 2;  4LBQ D;  5JDB A;  2CWM A;  4XTM A;  2VXJ A;  1MS3 A;  2A3X A;  1CAU A;  1OFN A;  1R1Z A;  2CU5 A;  2J1S A;  4RL7 A;  1CN1 A;  3NNL A;  5FLJ A;  1E5S A;  1JHJ A;  2XJP A;  5A33 B;  2EVX A;  2VPV A;  2W92 A;  4Q4W 2;  4ES8 A;  2QQP A;  2A71 A;  2J1R A;  2ZGK A;  1SLB A;  1NLQ A;  3D0J A;  3VL8 A;  2V5D A;  3O14 A;  4OHW A;  3USU A;  1L7R A;  3W5M A;  4ES9 A;  3EQE A;  2UYB A;  1WWY A;  3ACL A;  3D6E A;  5CKQ A;  5FK8 A;  1RUF 3;  1FV3 A;  4P9W A;  3VKL A;  4Q27 A;  2CV6 A;  4PF1 A;  3TEX A;  4G4F A;  4PF5 A;  1EY2 A;  4FOV A;  5F2W A;  1OKQ A;  3WLU A;  4YSF A;  2GC0 A;  4ZKT B;  2HEY F;  3LAG A;  1W2O A;  3FLP A;  1F8V A;  5A6Z A;  2QFE A;  5T54 A;  1Z7S 1;  2A6W A;  3PVN A;  1WW5 A;  2ZX4 A;  1RVF 2;  3M3E A;  4AVC A;  1HJF A;  1W8Z A;  2PHT A;  4R4Z A;  1U5Y A;  3FBM A;  2WBK A;  2DBN A;  3I2F A;  5DN2 A;  3GCW A;  1QXJ A;  1R64 A;  2GNB A;  3CO2 A;  2K46 A;  4MO3 M;  4Q8L A;  4R9B A;  4XDO A;  2OA2 A;  2DYC A;  4BM8 A;  3UES A;  1Z7S 2;  4DQA A;  1RED A;  4YW2 A;  4P08 A;  5FZ3 A;  1ONA A;  5IYY A;  1UW8 A;  2XML A;  4FPK A;  4M4R A;  2EAK A;  4XJA A;  3IM0 A;  4BQ4 A;  3AKT A;  2VCC A;  1REE A;  1MEC 1;  5FUN A;  4CCK A;  3DF0 A;  1QJX 1;  3OY8 A;  1GZW A;  2CHH A;  2UWC A;  3QH7 A;  4YFZ A;  5FZF A;  3QD6 A;  3TNP B;  2X09 A;  5C3Q A;  1YFU A;  2VZP A;  1ST8 A;  1W8T A;  3Q8C A;  5FFO C;  4A45 A;  3CJI C;  4KQ7 A;  2VMC A;  1NCR A;  1PGS A;  2J1V A;  4QQO A;  5FZ8 A;  3VDD A;  1H30 A;  3RRD A;  4CU9 A;  1GOH A;  1QWR A;  4Q4W 3;  1NOV A;  1KIT A;  5BV6 A;  2QQI A;  4X8P A;  4BIS A;  2O8Q A;  1KXG A;  2WAO A;  3DL3 A;  3CKH A;  4OYU A;  3VD5 A;  5EJ3 A;  5IFP A;  4QDS A;  4M4P A;  3K51 A;  4HN0 A;  4OZX A;  3D8C A;  4QX2 A;  3AYA A;  1C8M 3;  1PO1 1;  2W2I A;  4N43 B;  4AWD A;  3PVE A;  4SLI A;  3JD7 2;  1YI9 A;  4A44 A;  5LY1 A;  1C4R A;  2PHD A;  1AHS A;  1UYZ A;  4K8F A;  5G04 L;  4COY A;  4DO0 A;  3VDB A;  3ZN4 A;  2DWR A;  2VOV A;  5DAV A;  5GLT A;  3U0Z A;  4Y20 B;  4AQ2 A;  3LOB A;  1R08 1;  4CDX C;  2JEC A;  4YRD A;  1I5Z A;  4AAX A;  5GM0 A;  4UOJ A;  3RZG A;  5FIX A;  2OPW A;  4XZU G;  5FPL A;  1K5M C;  2CSG A;  1SLI A;  1N1Y A;  4CP0 A;  2WLP A;  3M3O A;  1US3 A;  2ZAA A;  1OQD A;  2D5F A;  3NV1 A;  1BK1 A;  2OUJ A;  3N9P A;  2VBP A;  4UW5 A;  5GZD A;  4AFA A;  4DXR A;  5DDJ 2;  3RZK A;  4QDR A;  3NST A;  5FWJ A;  1SHW B;  3MLL A;  4OHV A;  2BPA 2;  1RVF 1;  2HWC 2;  3IMN A;  1JW6 A;  3K4Z A;  2QUO A;  5FXV A;  3VBF B;  1PZ7 A;  4YW3 A;  3V0B A;  2Z42 A;  3SIS A;  2R06 3;  5IW0 A;  5BNP B;  2Q8D A;  1GIC A;  2AC1 A;  2XH6 A;  4CP2 A;  3H8X A;  3U14 A;  2VCA A;  3WDX A;  2PQQ A;  1OVP A;  3ZIW A;  4EZH A;  1Y43 B;  1QH7 A;  3POE A;  3PLQ A;  4PIY A;  5HI0 A;  3POG A;  3HJR A;  4L8Q A;  2QQJ A;  3GGL A;  4NHK A;  1X9T A;  1GP6 A;  2JJ6 A;  2KA3 A;  2X53 S;  2OVU A;  4NID A;  2D3P A;  4Z92 B;  4COV A;  1X8E A;  3LD8 A;  4LXL A;  2K0G A;  4IV1 C;  5LRS A;  1ZBE 3;  1UX6 A;  4UYB A;  3K2O A;  3NO8 A;  1HW5 A;  5BNO B;  3ZXA C;  4N8M A;  1PHM A;  2ET1 A;  1GLH A;  2W1Q A;  2I07 B;  4FQ4 A;  4A7K A;  4YM0 A;  2E6V A;  4GH4 A;  2TUN A;  4Q0U A;  4JZR A;  2WSU A;  4PBP A;  4YW5 A;  1ACC A;  2HBU A;  1Z7S 3;  2CNA A;  2D97 A;  1S2B A;  3MEP A;  3NAP B;  3HD8 B;  3K4A A;  3KB5 A;  3ILN A;  3Q8E A;  2RM2 2;  4JKL A;  1RUE 1;  2QQW A;  4A2U A;  3I3E A;  1XNT A;  4ARX A;  1LGC A;  4DB5 A;  4QM8 A;  5CA6 A;  2EIC A;  3R4D B;  4I3P A;  1W90 A;  3KWV A;  1DFQ A;  1TZO A;  3FC0 A;  1U5X A;  5SV5 A;  1YCI A;  4CEY B;  1JZ6 A;  2W91 A;  3KT1 A;  4LBO A;  5DPN A;  1MR5 A;  3A23 A;  2Z5W A;  1H4H A;  3MIH A;  1J3R A;  2PFW A;  5K8S A;  1UWW A;  3V56 A;  5EHD A;  5LBE A;  1S1A A;  5F39 A;  4XUR A;  1K3I A;  4M00 A;  1RUF 2;  2O1Q A;  3O0V A;  1NUK A;  5FYV A;  5CU1 A;  4N53 A;  5BPX A;  2EXH A;  1W2U A;  3A4U A;  1X82 A;  3BGA A;  4N7I A;  2JEN A;  4QKB A;  1I1E A;  2WII B;  1HRV 1;  4RR3 A;  4CEY A;  4JQT A;  4RYD A;  1UXX X;  3LZZ A;  4W6W A;  5I0U A;  5FMD A;  4GAZ A;  1XSR A;  2JDY A;  3IBM A;  5I0S A;  1H4G A;  4FOY A;  4IV1 A;  5FBZ A;  2VQA A;  4ZZ5 A;  4JGY C;  5T5J A;  2J1A A;  4QGN A;  2RJK A;  3M2M A;  4BLI A;  4P14 A;  5IT6 A;  5BNN B;  4FT8 A;  5IJR A;  1ZVF A;  5C8C B;  1L7Q A;  1PNG A;  3RZL A;  4QKF A;  1SFY A;  2C0Z A;  2H0V A;  4HN1 A;  4FI9 A;  1UO9 A;  4K8R B;  2YC0 A;  1Q56 A;  2XJT A;  4UFJ A;  2RR1 2;  3L9J T;  4YG3 A;  3SCF A;  3WP3 A;  4AFD A;  4Y3O A;  3BOP A;  2WN3 A;  4P9Y A;  1Q43 A;  1UL9 A;  2PTM A;  3WW4 A;  1UPI A;  3ZMN A;  4DMI A;  2ET7 A;  1VBB 1;  1PNF A;  1AYM 3;  3WQ0 A;  4FBF A;  1VMF A;  4QT6 A;  4BXF A;  1NE4 A;  4RD7 A;  4JTN A;  5I0R A;  1DBN A;  5FPX A;  3BAL A;  1B09 A;  5CFC B;  3ACG A;  2ID4 A;  3D5O A;  1D4V B;  1ENX A;  1RJ7 A;  2VVD A;  4DPN A;  1OMI A;  4EN7 B;  2CGN A;  1TE1 B;  2B7Y A;  5DAX A;  4HSJ A;  1T6G C;  2VH9 A;  3LE0 A;  1MS8 A;  2X5I B;  1DZQ A;  3KZ4 C;  4LO8 A;  5HCB A;  4AYU A;  1GR3 A;  1YQ8 A;  4OQ9 A;  2BRT A;  1M4W A;  1X33 A;  2ZHK A;  1WD3 A;  4Q4V 2;  1QJY 1;  4XFH A;  4XF0 A;  1SEF A;  4OCT A;  5T5L A;  4A6O A;  1I5P A;  3WCR A;  3MF6 A;  5BYN A;  4PIZ A;  3NJV A;  1ZX5 A;  4XFC A;  1NZI A;  1X7N A;  4GWM A;  1OHF A;  2A75 A;  2WS9 2;  4I0W B;  4LK6 A;  3FJS A;  4M3C F;  2DBI A;  2WO2 A;  3JQW A;  2JIC A;  1IPJ A;  2MEV 2;  3AMQ A;  2HWE 1;  1TMF 1;  3KS7 A;  4ASK A;  2NP0 A;  2I45 A;  4CUA A;  5DZF A;  1SPP A;  2XJV A;  3WVJ A;  1XYP A;  4P9G A;  4R8H A;  4CA9 A;  1SLL A;  2WNO A;  1YWK A;  3JU9 A;  3NJZ A;  5FP9 A;  1XND A;  1BBT 2;  2WR9 A;  4AF9 A;  1AF9 A;  4QXK A;  1QOO A;  1OA2 A;  5IVY A;  3IKW A;  4D0Q A;  5DDJ 3;  2XBO 1;  4XF9 A;  2RS3 3;  1NCR B;  2YU1 A;  3HN1 A;  4K3U A;  3VDD B;  5I91 A;  2WO3 A;  1YO8 A;  1AYN 1;  1PIV 1;  3C8X A;  1ND2 B;  2A3Y A;  3R4S A;  3OD0 A;  5FDB A;  4EWE A;  2ZGU A;  5FOB B;  1SPP B;  5C6C A;  3SCH A;  3CBN A;  4OMD A;  4HFS A;  4LJH A;  2L9L A;  3T09 A;  1JZ5 A;  1UZZ A;  4GD4 A;  4QAW A;  1E5R A;  4IUG A;  4UF0 B;  5A3M A;  5L73 A;  2XPJ A;  1DQ0 A;  3ZYF A;  4MX3 A;  3IAQ A;  1LEM A;  1HB4 A;  3GF6 A;  3OUJ A;  4E4S A;  5BNQ A;  5JPM B;  5LZ6 A;  5CG9 A;  3CL1 A;  3CQO A;  1ZRR A;  1NY7 2;  3WQ1 A;  3VD9 A;  1S0C A;  2ZKN A;  1Q8V A;  2EAL A;  3ASI A;  2JG9 B;  3G7D A;  4BDV B;  4D6R A;  2BGC A;  2BNO A;  2WNU C;  3MID A;  3NQH A;  5GZE A;  1LED A;  2D43 A;  1X50 A;  2V73 A;  1LKN A;  3M3I A;  1CON A;  1DGW A;  5FZ1 A;  5A7O A;  3VDC A;  4AEK A;  1IOA A;  1Y7B A;  3KV9 A;  1YQ5 A;  3K46 A;  2CGO A;  5JSP A;  4RGA A;  3O1M A;  1W3V A;  3I2I A;  1D7P M;  4YVW C;  1T2X A;  1BXH A;  5JR2 A;  5DUV A;  1OUX A;  5F5I A;  1KEX A;  4PLO A;  3NAP C;  1AR6 2;  1NA1 C;  4LHK A;  3UKN A;  4E9K A;  1US2 A;  5CYY A;  5DAQ A;  4CDQ B;  1XXN A;  3T0A A;  3I7D A;  2GAL A;  5LY2 A;  4CDW A;  1RJ8 A;  4A3X A;  1HV1 A;  1K42 A;  3CF6 E;  3R05 A;  3VZM A;  3B3Q E;  4IV3 B;  4ZU4 A;  5A3W A;  5LW9 A;  1AR6 1;  2VG9 A;  4D3W A;  3BB6 A;  2OQ7 A;  1VBA 3;  3AP7 A;  1FMD 1;  2YG0 A;  1IS6 A;  1LOC A;  2ZJC A;  3DPR C;  3ZFG A;  4EN8 B;  1TNF A;  4LKE A;  4FXG B;  1YJL A;  4I02 A;  3U4X A;  2BU9 A;  2RS5 2;  1W6O A;  2ZAC A;  5LWB A;  1AYN 2;  2CYF A;  3B93 A;  2Y6K A;  4FPE A;  5A70 A;  1CVN A;  5CAD A;  2XJU A;  4XHX A;  4AI8 A;  1RVF 3;  2UUR A;  5JSR A;  2YFZ A;  1DQ2 A;  3IMM A;  1YQ6 A;  4L97 A;  1EV1 3;  1FPN 3;  5LB6 A;  4GAL A;  5EP9 A;  4XIO A;  4QU1 A;  1PX4 A;  3S5Q A;  1Y9M A;  2RMU 2;  5C3R A;  4CEW B;  3AYC A;  3B01 A;  2JDZ A;  3FX3 A;  4R9D A;  4XAB A;  4XOG A;  2QQO A;  2E26 A;  2YB7 A;  4IES A;  2RR1 1;  3VB9 A;  4J6G A;  2MEV 1;  2WA4 A;  4BOW A;  3AP4 A;  5KXC A;  5JSO A;  2ZEW A;  3RYK A;  4LE4 A;  1R08 3;  1JYC A;  3GZT B;  2WC2 A;  2R07 2;  4GZ9 A;  4Q4X 2;  5LA1 A;  4IEP A;  2A6V A;  2Y60 A;  2VUL A;  2HEV F;  1HN0 A;  3ZFF B;  5JLV A;  1DZR A;  3DKW A;  2D98 A;  2VOX A;  3NNG A;  3PUQ A;  4MGS A;  5C5T A;  5K0U C;  1S2E A;  3NV3 A;  1WLT A;  3ORJ A;  1W05 A;  3BN6 A;  1LOD A;  1QXP A;  2BGO A;  1DGW X;  4YZ5 A;  1SAC A;  4ZXK A;  4MLO A;  1GWK A;  5KC5 A;  4M0N A;  3PU3 A;  1RUI 3;  2VU9 A;  3PUH A;  5A3U A;  4ZPI A;  4Z07 A;  4CP9 A;  4IV1 B;  3NJX A;  1NY7 1;  1XU2 A;  3ZN6 B;  4QQL A;  1GV9 A;  4Q2F A;  3ITQ A;  2HWD 1;  5EXO A;  2R0F A;  3AZZ A;  2ILM A;  3B00 A;  5CKN A;  2XOM A;  3LFM A;  5BXX A;  1OUR A;  2VNR A;  2VVE A;  1QNY A;  2ZMN A;  5LA0 A;  3HT1 A;  4AVT A;  2WAB A;  4FFF A;  5K4L A;  1JI6 A;  4Z2W A;  3J7H A;  5FLH A;  1V00 A;  3CJI B;  2DCK A;  5CAZ A;  3KV5 A;  4WM8 A;  1XRU A;  2PXJ A;  1YNA A;  2Y6F A;  2GND A;  2ADD A;  2WFF 3;  4LNV A;  3ZYP A;  1UY0 A;  4E4H A;  5JOX A;  1Q5O A;  2VE1 A;  2QCS B;  1RXF A;  4XET A;  1HX6 A;  2ES3 A;  3VHN A;  3MZH A;  1QY4 A;  1N1V A;  2BER A;  2RS1 2;  4NN0 A;  5FPB A;  1OVS A;  4XVH A;  2P3I A;  3IDE A;  1FAT A;  4QHO A;  4W6X A;  5APA A;  2Q4S A;  3M70 A;  3RQ0 A;  4XJU A;  1ZRD A;  5L19 A;  2VC9 A;  3FUO A;  3S7E A;  5IK4 A;  5FZD A;  2BQP A;  4J1X A;  2E63 A;  4P9X A;  2YC4 A;  4QWN A;  4AXO A;  3FBY A;  4IEY A;  1O91 A;  5DXD A;  5A32 B;  5GZF A;  5FPV A;  4MGI E;  3KF3 A;  3V0A A;  2WQ8 A;  1OBN A;  3WZ1 A;  5FP7 A;  1E5I A;  1S0E A;  1AUY A;  1QEX A;  2XR4 A;  2YV8 A;  4RQP C;  1ZZ9 A;  1CAW A;  1HRI 2;  4Y33 A;  1OFS A;  2HWC 1;  5FYU A;  1C57 A;  2NZ9 A;  5FZ4 A;  5FLI A;  2AYH A;  1WCK A;  5SV8 A;  1RUH 2;  2VMD A;  4HVQ A;  3VUO A;  3H8R A;  2I74 A;  5HV0 A;  3RZJ A;  1MPX A;  2P6H A;  4FPY A;  2N7G A;  3H50 A;  3E5Q A;  3ZXE A;  1BEV 3;  4KNC A;  4WZC A;  4BJ0 A;  4ZY9 A;  4UT5 A;  2QDR A;  1UZW A;  1CZT A;  4K1Z A;  3OGG A;  4GMP 1;  3TN9 3;  1ND3 A;  2A70 A;  4LKF A;  3WDY A;  3HAG A;  1H1I A;  1WMD A;  1W06 A;  3BTX A;  2RDQ A;  1FOD 3;  3FHI B;  2J1T A;  3AM2 A;  4KU7 A;  1H2N A;  1RUG 3;  4OUM A;  1SZB A;  3DGT A;  2B8M A;  2YBS A;  2ZTN A;  4GJZ A;  4XFB A;  3OG2 A;  5FXX A;  2VR4 A;  4UF0 A;  3I2J A;  4IEX A;  4LIT A;  4XFF A;  1YXW A;  1CIY A;  1PM7 A;  3DCQ A;  3AYE A;  1QJU 2;  4P9I A;  4XDQ A;  3WF1 A;  2HWE 3;  4C0B A;  1UY1 A;  1VE0 A;  3IIA A;  5EWS A;  1XB9 A;  1OOP A;  1YRZ A;  2RDN A;  2A73 B;  1MQT A;  4KMQ A;  2W68 A;  4YW6 A;  5EZW A;  2FMY A;  3N35 A;  1DG6 A;  3RMY A;  4CEY C;  3VZO A;  3H9A A;  2VVF A;  2GDF A;  4M3C E;  3U1X A;  3OJB A;  1PMJ X;  2WQZ C;  5F6K A;  3HQX A;  1JOP A;  4CSW A;  2W1W A;  1NCR C;  3VDD C;  4MH0 E;  4FTB A;  4M3C B;  1LUL A;  1LOA A;  1O6U A;  4NMI A;  1PIV 3;  1JZ4 A;  1OOP B;  1PMI A;  1UY3 A;  2Y8K A;  1BEV 1;  4WM8 C;  1D0G A;  2P4E A;  2DCY A;  2WKK A;  5EYY A;  3ETQ A;  2FBE A;  3SC7 X;  4CDQ C;  5L9B A;  5FPU A;  2ETE A;  2VQU A;  3OBZ A;  1H2M A;  4MXV A;  4RHV 1;  5E8A A;  5HCA A;  1SDD B;  1X8M A;  2R1B A;  4O9G A;  5DAP A;  3VHO A;  5D1I A;  2VZT A;  1KJL A;  4QX8 A;  4B4Q A;  3OBR A;  5L7O B;  3JD7 1;  1KGY A;  3ELN A;  4XMI A;  2E7T A;  4HSL A;  1I9R A;  1PO1 3;  5DMY A;  4BPZ A;  4GMP 0;  2DU0 A;  2Y38 A;  2ZEZ A;  1JU4 A;  2ZGS A;  1TME 3;  3K75 B;  2HWB 2;  4AW7 A;  2V72 A;  4QKD A;  4Q4Y 2;  3NRU A;  1MS1 A;  1YI7 A;  1AR9 1;  3OOX A;  4PLM A;  2WFP A;  2VMI A;  5D21 A;  2Y0I A;  4CPB A;  4LUM A;  3VZL A;  3PJQ A;  4AVS A;  1UU4 A;  2W94 A;  4IE5 A;  3AKQ A;  2DU1 A;  4LR4 A;  2W1U A;  3KV6 A;  4O9E A;  4OUL A;  3KQR A;  3PVB B;  4JDO A;  1HB3 A;  2CGP A;  4MGZ E;  3ZPO A;  3SLI A;  2ARB A;  3LF7 A;  1RUN A;  3SXW A;  1CPM A;  2EXK A;  3I3D A;  4JHZ A;  4PJY A;  4AVB A;  2PAM A;  2BP6 A;  3PNA A;  4B7E A;  1H6X A;  1R09 3;  5CEH A;  2BBV A;  4HPK A;  2GC2 A;  4TSV A;  1ZRF A;  1RUJ 3;  3OEA A;  1RUJ 1;  3OY8 B;  2P5B A;  4DEQ A;  5FQ0 B;  2A7A A;  2JB4 A;  3JB4 C;  4KBZ A;  4GUL A;  4D69 A;  5IFT A;  3VD3 A;  5ANQ A;  1LOF C;  4ZXE A;  4GKY A;  1QJU 1;  1J83 A;  5B4X A;  4X6R B;  5FYZ A;  2PLV 3;  1AR9 3;  1DYP A;  1FXZ A;  1AZD A;  1POV 0;  2GC3 A;  3AMP A;  1AX0 A;  1Q8P A;  3BPZ A;  5KXD A;  1VP6 A;  3FE5 A;  3HQU A;  1FNY A;  4JGY A;  4TXW A;  2GC1 A;  3FHA A;  1ULC A;  4B4R A;  4PDW B;  4RSU A;  2UU8 A;  3QOP A;  4KH9 A;  3VHP A;  5HXM A;  1QOS A;  4XJ9 A;  3POF A;  1EPZ A;  1WW4 A;  1YJK A;  4JGZ C;  2HWF 3;  4GIQ A;  2LW8 A;  2EF6 A;  4DXZ A;  4YAR A;  3LIG A;  5FZK A;  4NPR A;  1WLW A;  1MZ6 A;  2QZ3 A;  2WWJ A;  5FP3 A;  2BWC A;  2FDK A;  2OT7 A;  5HCF A;  3ATG A;  3LSE A;  3O12 A;  1OSG A;  5IK7 A;  1DF0 A;  2KXL A;  4JGY B;  1OH3 A;  4GA9 A;  4MUV A;  3WNP A;  1LU1 A;  2X5I C;  1Y4W A;  4LUL A;  3E6C C;  1ZBA 2;  1JZ3 A;  2R49 A;  4WVW A;  2JG9 C;  2VZQ A;  5F5Q A;  3LEG A;  4K1Y A;  4UXA A;  1Q8O A;  1RMU 1;  3THT A;  3AVR A;  3WSO A;  4ZHN A;  3VBS A;  1WLC A;  4XAA A;  1QQP 3;  2VZV A;  2C9A A;  3CJI A;  4PHZ A;  2YY1 A;  4NII A;  1DCS A;  4RFT 0;  1XNC A;  2X5I A;  4YVW A;  1AXY A;  2UY8 A;  3K3N A;  3W58 A;  2WSV A;  2G9F A;  4B7K A;  2ZGT A;  2ZPX A;  5T5O A;  5BNP A;  5FYH A;  1VRB A;  4J1W A;  5E88 A;  3UGH A;  1D2S A;  4AE2 A;  4CCO A;  5J09 A;  3BPS A;  3ZSJ A;  5C7G A;  3HNB M;  2WZR 3;  1ENR A;  4Q8K A;  4KBB A;  3U75 A;  4AHY A;  1VRH 2;  2BUK A;  4L11 A;  3RYP A;  1PK6 A;  3RGB A;  1OLQ A;  4A42 A;  3PL0 A;  4Y5S A;  2XBO 2;  4OI2 A;  5FZG A;  4W65 A;  3X29 B;  1SMV A;  3FZ3 A;  1MAC A;  2HLE A;  2VTF A;  3DPR B;  4O7X A;  3DUI A;  5I0D A;  5JZG B;  4MET A;  3ZFF C;  1EYB A;  2B5H A;  4XAC A;  5A32 A;  4PQ9 A;  3U37 A;  4AL9 A;  2DTW A;  2P6C A;  3AKP A;  2WUH A;  2XLA A;  1WA6 X;  4Y1V A;  1CX1 A;  4W8J A;  3I2D A;  3MLK A;  1D4M 3;  1BQP A;  4NAO A;  1YEW A;  5IK5 A;  2OZ6 A;  3OCP A;  4I2O A;  5CG8 A;  2ZGO A;  4ARY A;  1O3Q A;  4CCJ A;  1NQD A;  2IXI A;  3WY6 A;  4CEW C;  1UX7 A;  3ZSE A;  1AJK A;  2NPI A;  3I54 A;  1VLN A;  4AK3 A;  2XKO A;  3T1M A;  4IET A;  1A78 A;  1HKD A;  1W6Q A;  4P5Y A;  3MUY 1;  4QPY A;  3AL6 A;  3SH4 A;  3LSD A;  2YPD A;  3L2H A;  3N9N A;  4D7T A;  5FRE A;  4Z82 A;  1J58 A;  1N47 A;  4HBN A;  2RG4 A;  2ARE A;  2AZ5 A;  3LPF A;  1S0I A;  1Q3E A;  1UY2 A;  3QBQ A;  4HG6 B;  4AFM A;  4QPI A;  5L9V A;  3O1P A;  3WDW A;  3T2Q A;  1V6M A;  1K12 A;  3AZV A;  3POJ A;  3I8T A;  4LBL A;  4PCR A;  3KMH A;  4R52 A;  4KG0 A;  3VBF A;  2OS2 A;  5FKC A;  3TAY A;  4LO5 B;  4BQ5 A;  5CBL A;  3VKO A;  3E5X A;  1YFY A;  2FCU A;  5FTT C;  1VBC 2;  1P8J A;  4LEJ A;  3BIW E;  1DHK B;  3OTF A;  3VBR B;  4A7Y A;  1RXG A;  2WA3 A;  2ZHN A;  2EIG A;  1RUC 3;  3AL5 A;  3B69 A;  1JYT A;  1H2K A;  3VHR A;  3WG2 A;  3EMR A;  5C8C A;  1KRI A;  1JOJ A;  3M4F A;  5JUV A;  1NA1 A;  4SBV A;  1V6N A;  3OBA A;  3PU8 A;  4OI1 A;  1S0J A;  1VBE 3;  4UI9 L;  2JB8 A;  4N7U A;  4E4D X;  1JZ2 A;  3S0M A;  2XDV A;  4CUG A;  2ARA A;  1XYN A;  3M3Q A;  5C4W C;  3KF5 A;  3VBR A;  5GLV A;  1WKY A;  1MS5 A;  2C9K A;  2W87 A;  5F6L B;  5JPN B;  1T6B X;  4NUB A;  5FCC A;  4AED B;  1O3T A;  4A3Z A;  4CDU C;  3E97 A;  4ZU7 A;  5FYY A;  4WVZ A;  5A3T A;  3VBO A;  5EV7 A;  4AG4 A;  4AED C;  2J1U A;  1V9U 1;  3BU7 A;  3III A;  2XLG A;  4AI1 A;  4Y24 A;  2R16 A;  3ZYR A;  2HWD 2;  4QHZ A;  1QHD A;  1O5U A;  1CQ9 A;  5J36 A;  2DVB A;  1VAL A;  2WZP P;  1VBB 2;  4AGV A;  3S7I A;  1HXS 2;  5JWP A;  1B35 C;  4LHS A;  4L99 A;  5CFD A;  1W9W A;  4RR3 C;  3VBH C;  2GZW A;  2R0H A;  2C6S A;  4BQY A;  3N9O A;  3DEC A;  1XNK A;  4FP3 A;  2D5H A;  1EAH 2;  4F3J A;  2HH9 A;  1AL2 2;  4FTS A;  4EV0 A;  5IAT A;  5FUI A;  2QQK A;  4FOW A;  4PI0 A;  4N53 B;  4GB3 2;  3VKN A;  2OX0 A;  2QBX A;  4UFI A;  4EQV A;  3UNP A;  3LPG A;  3VV1 A;  3VZN A;  3A7Q A;  4XZP A;  2ZGP A;  4YM1 A;  4GQ7 A;  2E9Q A;  2BOJ A;  5C8C C;  1V9U 3;  3H8O A;  4AQT A;  1COV 2;  4G3Y C;  2B46 X;  4Y22 A;  5H9P A;  2WIN B;  1CJP A;  1LHO A;  3Q8A A;  1QDO A;  1ULE A;  4RFR B;  5FY0 A;  3TEW A;  3IN9 A;  5BY5 A;  4DUW A;  4EWD A;  1BK0 A;  1U5Z A;  4OUS A;  2FMD A;  1CAW B;  4XXA A;  1SQ4 A;  4N43 A;  5FYB A;  4Q1R A;  5HXV A;  2J22 A;  4HAN A;  1PVC 3;  1W9Y A;  3O1T A;  4FPO B;  4XHB A;  3SIT A;  4CCC A;  1VMJ A;  1E57 A;  1ND2 A;  5ERL A;  2ZGN A;  5FZM A;  2FDF A;  4AQ6 A;  1VBE 1;  1F5J A;  1Z78 A;  3CLP A;  1RUD 1;  5C33 A;  2PEL A;  3N4M A;  1AX2 A;  2BNM A;  1G86 A;  2TNF A;  4F8A A;  5IK8 A;  5EJZ B;  4WM7 A;  1FMD 3;  5F3C A;  1RMU 2;  1OD5 A;  1PO2 2;  1BVV A;  1R09 1;  2B45 X;  2WT0 A;  4C8D A;  4RGK A;  3KV4 A;  3RFR A;  4MGT A;  2V4V A;  4YLZ A;  4KL1 A;  1H8T A;  1RIR A;  2UWA A;  3D4K A;  5E16 A;  3T1L A;  2MPF A;  1N3O A;  1YYN A;  3ES1 A;  1W9S A;  1YC6 1;  1DQ6 A;  1V6K A;  3JB8 A;  5FXW A;  3T30 A;  4EN6 B;  3V0B B;  5GZC A;  1RHI 3;  2LAL A;  3GNE A;  2VGD A;  2BEO A;  3Q9O A;  3WOG A;  2QVS B;  2DTY A;  4LO6 B;  4WVM A;  5B4N A;  4BME A;  2UY9 A;  4HXC A;  2XLF A;  1AXK A;  1UZ0 A;  3AKR A;  2O0O A;  3WIN E;  1CAX A;  1MQT C;  4D8M A;  5DUU A;  1POV 3;  2C26 A;  3IDA A;  4XDP A;  2YYO A;  4XF3 A;  4FP2 A;  4GXL A;  1LGB A;  4EZ4 A;  2QQU A;  4LE3 A;  4KU8 A;  4S2G A;  4YVS A;  2VQT A;  2FCV A;  3AB0 A;  4P00 B;  1N3Q A;  1GNY A;  5KR7 A;  3J8F 3;  5FP4 A;  1XE7 A;  5FBJ A;  1LES A;  1NQJ A;  4LOS A;  4Y4Y A;  4DOU A;  5KXE A;  4QB6 A;  1S0F A;  5FAX A;  3FMG A;  4AHX A;  3I97 A;  1UYP A;  2PHR A;  4ATF A;  5FO9 B;  2D6K A;  3MFC A;  4FPH A;  5FV3 A;  1ASJ 3;  5C4W A;  4E2Q A;  2FZ2 A;  2AEY A;  1JZ7 A;  5DDJ 1;  5IWF A;  2VOT A;  2VOK A;  4XQD A;  2CDP A;  4XTP A;  3HMY A;  3OBT A;  1NCQ C;  1WBF A;  2AR6 A;  4W6Y A;  2HEW F;  5GLU A;  2IFW A;  4HK9 A;  2BVB A;  2W1S A;  3J4U H;  5JI7 A;  3ZIX A;  5JI9 A;  5LBC A;  3ILR A;  3RZH A;  1LHV A;  3MPP G;  4QU2 A;  5AC9 2;  1SG3 A;  2Z79 A;  1G9F A;  2GMM A;  2P2K A;  3H42 B;  3NWK A;  4UFL A;  3O1U A;  4I3G A;  1RIN A;  1FV2 A;  3THC A;  3JBG 2;  4GWN A;  2VUJ A;  1TMF 3;  3MF9 A;  1A6C A;  1QH6 A;  3ON7 A;  2O8O A;  1VIW B;  1X36 A;  1IHM A;  1HQW A;  2VEC A;  3J7L A;  1J84 A;  4A6S A;  4MG2 A;  4V2V A;  2ZGQ A;  3HNY M;  2H6B A;  1W6Q B;  5DAB A;  3A22 A;  3MIB A;  1MZ5 A;  1TME 1;  4LUK A;  4JKM A;  1FAY A;  1ASJ 1;  1QQP 1;  1IG0 A;  2YMZ A;  3HEI A;  2XXZ A;  1PGL 1;  4AR2 A;  5KHJ A;  2GNT A;  5J7M A;  3AP5 A;  4LBK A;  4NRQ A;  4TYS A;  4IGQ A;  3NNJ A;  4Q1P A;  1HB1 A;  4UFH A;  2XJQ A;  5FY4 A;  5FYS A;  3USU B;  1O59 A;  4HL0 A;  2VQ0 A;  4YNI A;  2GP3 A;  2G1M A;  4XUP A;  2SLI A;  3DYO A;  1AL0 G;  5LA9 A;  4DY3 A;  3E6D A;  2WWU A;  3O7O A;  1NT0 A;  1X9P A;  2DVG A;  2GN7 A;  2BVV A;  5CB7 A;  2P1B A;  1LOF A;  1HB2 A;  4C91 A;  3H7J A;  1W0N A;  3NV2 A;  2C4X A;  3ZN6 A;  2XB6 C;  1ZZB A;  4DXT A;  5LK7 B;  3ZYB A;  1JYV A;  2R04 3;  3LA7 A;  5LEJ A;  1RUE 2;  1SCR A;  1HIX A;  1AR8 1;  2XKP A;  4JKK A;  2QE3 A;  4LA3 A;  3QLQ A;  1RL3 A;  2PYT A;  3C7F A;  4A7Z A;  4XBN A;  1GYK A;  2CAV A;  2Q1M A;  1GOG A;  4RN5 A;  5DZG A;  4BK4 A;  1QJY 3;  2BGP A;  5FYM A;  1UY4 A;  1VBD 2;  1GWL A;  1AR7 2;  3EBR A;  5F1R A;  3POS A;  2XUM A;  3OGS A;  4N9H A;  1QIQ A;  5ACA 1;  1OXC A;  3ZLI A;  3I2G A;  4XIL A;  1H9P A;  5IVJ A;  3BOD A;  4CCD A;  1UMI A;  1QJX 3;  3WX5 A;  4PI2 A;  1DQ1 A;  1UPS A;  1CD3 G;  2Y33 A;  2YZ4 A;  3MBW A;  1GOF A;  3O5S A;  4UFK A;  5DQ0 A;  4F7Z A;  2JDU A;  1RUG 1;  1E5H A;  1OQE A;  4CUB A;  1QJF A;  4QM9 A;  4OQ8 A;  4C90 A;  1FOD 1;  3IPV A;  1LCL A;  4K21 A;  3MW2 A;  1WME A;  2Y6H A;  5C9A C;  3KHC A;  2Y64 A;  1XNB A;  2XGX A;  4IEV A;  3PUS A;  1SFN A;  3OPZ A;  1IS5 A;  3MYX A;  3ZKU A;  1L7L A;  4FFI A;  1MVE A;  2JG8 B;  1VR3 A;  1W2T A;  1WLD A;  3AFK A;  3GHM A;  4H55 A;  5FZ9 A;  1VMH A;  3C7H A;  1YLL A;  5A7P A;  1AR8 3;  3GHN A;  5FZL A;  1RIT A;  2ZGR A;  4RQP B;  3B94 A;  3VKF C;  5FZH A;  2WWS A;  4ERO A;  4LBQ B;  1U0A A;  1WA4 A;  2JG8 A;  4TZD A;  3BUC A;  3MFA A;  4Y1Z A;  3ZFE A;  1JUH A;  1STM A;  4CP9 B;  5AFE A;  3W9A A;  2RJL A;  5FYT A;  3I49 A;  3HNM A;  3SNM A;  5CVR A;  1W9T A;  2X10 A;  1WMX A;  4RHV 3;  2Z4F A;  1WCD J;  1F2N A;  3N7L A;  2P37 A;  3LOI A;  1ND3 B;  2WZ8 A;  2ARX A;  2BZD A;  3QCW A;  1J1L A;  3VBF C;  4B4P A;  1C5H A;  3THD A;  1LHU A;  1NE6 A;  2IZW A;  2IXH A;  3AVS A;  1IS4 A;  3ZYG A;  1N3P A;  1S0D A;  5AFB A;  2VXR A;  4TWT A;  4LKD A;  4QXH A;  2RS3 1;  2VME A;  5EFU A;  1LAJ A;  2VO5 A;  5JR7 B;  5IHR A;  2XHN A;  2Q8E A;  4QX1 A;  1UXZ A;  1YQ2 A;  3PTR B;  1C1L A;  3E5U A;  2OUH A;  1YQC A;  3AMM A;  4DZG A;  1J1T A;  1U5I A;  3FUQ A;  1IPS A;  3N36 A;  1HRV 2;  4IEW A;  1LJ7 A;  5A1A A;  2WLQ A;  3JBG 3;  5I93 A;  2JDN A;  5GKA C;  3SKV A;  3T0D A;  3GBW A;  5AC9 3;  2ZEY A;  3PJY A;  1KDK A;  2J1E A;  3IB3 A;  4BCU A;  4R4X A;  4AI9 A;  2VZ1 A;  2K2S A;  1YUD A;  2VM9 A;  1WCQ A;  2BV4 A;  3RNS A;  5KHG A;  4JDM A;  2XWB B;  3Q8B A;  4MZU A;  4YGC A;  5CIR A;  1CX4 A;  1ZBE 1;  3SMH A;  1B35 A;  5JIA A;  1ASJ 2;  3VBH B;  1CPN A;  3MIC A;  1CAX B;  2VUC A;  1GSL A;  3M8L A;  3ACH A;  4E4Z A;  1O3S A;  4C0H A;  5ACA 2;  2C1F A;  5CKM A;  2V5Y A;  2EAA A;  2ZAB A;  1S55 A;  4ZON A;  1GZT A;  3MW3 A;  4JC1 A;  1UIJ A;  5FY5 A;  1DZT A;  3W21 A;  4IE7 A;  3APB A;  1BLZ A;  4Q29 A;  3C3V A;  3DXU A;  3KT4 A;  4Z2A A;  4P02 B;  1Y9Q A;  3OGR A;  5F2S A;  3ZR5 A;  5T52 A;  3ALQ A;  5F37 A;  4AEM A;  3OB8 A;  4I0A A;  4Y5Z 0;  3ZXL A;  5JZG A;  1B35 B;  1JYN A;  4NHL A;  2JDP A;  1GZ9 A;  5DG2 A;  4TN7 A;  3GBF A;  5KC6 A;  4QPG C;  3HN3 A;  2VNG A;  1POV 1;  1JOB A;  1R1A 3;  3IAP A;  5I0T A;  3WNO A;  1VB2 A;  4NPM A;  3T4V A;  3VBO B;  1EUT A;  5LBF A;  1S4C A;  4OFG A;  4G9S B;  2DFC A;  2WL1 A;  4LOT A;  1MEC 2;  4NHX A;  4K40 A;  3WV6 A;  1RB8 G;  3I2O A;  4Q26 A;  1AX1 A;  2YXS A;  2W5F A;  1ULO A;  1GBG A;  3EYP A;  1IQA A;  2D6O X;  4NO4 A;  2FDJ A;  3MIE A;  1CWP A;  5T55 A;  5J3U A;  1EV1 1;  1FPN 1;  2QKD A;  1FI2 A;  1WGP A;  1Y3T A;  5F5A A;  5FZ0 A;  4CRQ A;  5CFD B;  2IXK A;  1VPH A;  1UOF A;  1PO2 3;  5C9A A;  1RUI 1;  1CIW A;  4XUQ A;  1C28 A;  1FMD 2;  1CR7 A;  2YPJ A;  5A7W A;  4E2G A;  4CUC A;  4KWU A;  4NE9 A;  3USS A;  3I4I A;  1IS3 A;  4GH4 C;  1QGL A;  3ME2 A;  4FSJ A;  3WNN A;  4IGP A;  1VB4 A;  4LHN A;  4C1X A;  2XVL A;  2QNK A;  3KSC A;  4M3C A;  1DGR A;  2Q0A A;  4P9L A;  2NN8 A;  4RS5 C;  3TEZ A;  2R6Q A;  2VCB A;  3SCG A;  2WO1 A;  4BU2 A;  1W03 A;  3N3H A;  5FYC A;  2B9U A;  4IE0 A;  5E1R A;  4PBO A;  1XE0 A;  3M7A A;  4BQ1 A;  3AP6 A;  3INA A;  3AZW A;  2QQV A;  3FN9 A;  2DVD A;  5CFC A;  3FWE A;  2JKX A;  3UET A;  2DDU A;  3GZU C;  3WF3 A;  3AZX A;  3B02 A;  2K9Z A;  1S0G A;  4COW A;  1RUF 1;  4EE2 A;  3BVC A;  3JXS A;  4KWK A;  4S2H A;  3WEZ A;  4OI0 A;  2WN2 A;  4JCK A;  4WM7 B;  2WT2 A;  3NW4 A;  4HMZ A;  2A5Z A;  4MVT A;  4TLF A;  2DVF A;  2NM1 A;  1W8O A;  2JDA A;  1GMM A;  5FZE A;  5A3O A;  3UJO A;  4XFI A;  5A7N A;  4UW6 A;  3RMX A;  1PX3 A;  3VBS B;  4OMC A;  4AGG A;  1JYX A;  1F15 A;  1W6N B;  2BWA A;  4AHZ A;  1R1A 2;  1LR5 A;  1QJX 2;  2IFR A;  3HOB A;  1NLR A;  5A7S A;  1LB2 A;  4MGQ A;  4B1L A;  1MZF A;  2YU2 A;  3GZA A;  1UMH A;  4AVV A;  3J7M A;  3WHU A;  2Q1Z B;  1PZ8 A;  2ZAH A;  1RC6 A;  4Q4Y 1;  4Y1Y A;  3IT8 A;  1HDK A;  5FMO L;  2QDN A;  2WNV A;  3LDB A;  2ZZQ A;  1LOE A;  3CHX A;  4HKO A;  3SEE A;  4OUE A;  4QB1 A;  5FWE A;  3FLR A;  1W9F A;  2A6X A;  4HET A;  5FQ0 A;  3DN7 A;  2XL7 A;  3HQR A;  4N43 C;  5IVB A;  4FAH A;  5IVC A;  2GMP A;  4XCB A;  2R04 2;  4S2F A;  4AVA A;  5ACA 3;  2WDB A;  5IVV A;  1OI6 A;  3VBU A;  3MI8 A;  4XFA A;  3R4U A;  5L9R A;  3I3M A;  1ZRE A;  1HRI 1;  3PIG A;  2VUD A;  1JS9 A;  2ZKL A;  5TSW A;  5FZO B;  2GH2 A;  1UF2 C;  5LCW L;  3B7M A;  4HKW A;  2P34 A;  3AKS A;  4RA0 A;  3VL9 A;  3WP6 A;  2VZ3 A;  1GZW B;  4BH9 A;  1UOJ A;  1RUD 2;  4MOA A;  3AJZ A;  5D2A A;  3QH6 A;  2XQR A;  4W4Z A;  2NMO A;  5IAX A;  2B39 A;  2F17 A;  2G9Z A;  5B2G B;  4YG0 A;  1ZRI A;  4QQ2 A;  2PAE A;  1LU2 A;  4RS5 B;  4LBQ A;  3ES4 A;  3SHR A;  5FMO S;  3W20 A;  2X05 A;  2PAK A;  4DRV A;  1HRV 3;  3KGZ A;  3ZFE B;  1G9A A;  2VW2 A;  1IKQ A;  1TQ5 A;  1ULP A;  1JBC A;  4JGZ A;  3JQX A;  3POY A;  1DDL A;  4CVU A;  1UKG A;  3PIJ A;  1H2L A;  4YVS C;  3WNX A;  3ZXK A;  1W04 A;  1MS9 A;  2WJS A;  1H9W A;  2A1X A;  2W52 A;  1HV0 A;  1MQT B;  4JRA A;  4JVA A;  4MGY E;  3I3Q A;  5JVV A;  4HOO A;  1OD3 A;  5C71 A;  2ZX1 A;  4NWW A;  2GP5 A;  1RUD 3;  5A7Q A;  4LO7 A;  4AQS A;  4ORF A;  1ODM A;  2Y0O A;  3C7E A;  3MV0 1;  1V70 A;  3H1W A;  3LEK A;  1G9B A;  2VBD A;  2D40 A;  4LTA A;  2ZZJ A;  4QX0 A;  2ZGM A;  3K4D A;  4ASL A;  4FPG A;  1UCX A;  3ABZ A;  4A41 A;  4B1M A;  5IVF A;  4NHM A;  1KQR A;  3ZM8 A;  1AR8 2;  1V6O A;  2EA7 A;  1K5M A;  4PLN A;  1NA1 B;  4Y26 A;  1W2A X;  5FZ6 A;  2CWS A;  3ZSM A;  3GZE A;  3MIF A;  2FDH A;  1W6O B;  4LLO A;  2CTV A;  5K0U B;  1OF4 A;  2JIJ A;  2ARC A;  2WQ4 A;  4LT5 A;  4IXL A;  2VNO A;  4UW4 A;  5FMB A;  4GMP 3;  1LNS A;  1HN1 A;  2XBO 3;  4IQP A;  2YFU A;  2NQY A;  2ATF A;  2ORX A;  3KD4 A;  4K9S A;  1K5M B;  1JXN A;  1UYY A;  4KG8 A;  4LIU A;  4HVR A;  3WF2 A;  1Q8S A;  2BW8 A;  1ZA7 A;  1S2K A;  1BJQ A;  2QQN A;  1NXD 1;  4I01 A;  4Q0S A;  3OUI A;  4UWD A;  1H6Y A;  4CU7 A;  3CDZ B;  2JG8 C;  1RHI 2;  5H9R A;  3NV4 A;  5E6H A;  4FFH A;  1DP0 A;  3WDT A;  4BWO A;  2ZHM A;  4JV4 A;  4V2W A;  4Y1U A;  3NAP A;  1UNB A;  1O3R A;  3RZM A;  1VBD 3;  1BVP 1;  3C2U A;  3HVD A;  4ATE A;  4COZ A;  3OF1 A;  2PLV 1;  3NMB A;  5JCT A;  4NR1 A;  2JDK A;  1W8U A;  4XQW A;  3CIH A;  1YFX A;  1V6L A;  3U4S A;  3CEW A;  1RUE 3;  3WF0 A;  1ZBA 3;  2TEP A;  1VJ2 A;  4N90 A;  2IUW A;  1JYW A;  2C5D A;  1W8W A;  4UW3 A;  1OC1 A;  3AYD A;  4MXW A;  5CFD C;  4NOT A;  3WW1 A;  1BYH A;  4B8E A;  4A4A A;  4RGG A;  3I3B A;  4QGM A;  2DCJ A;  4LLF A;  1QNW A;  3WDU A;  3SH5 A;  3AX4 A;  4Z1V A;  4OHZ A;  3GDB A;  1HJG A;  1PVC 2;  4XPV A;  4XW3 A;  1IPK A;  2Q1F A;  1Z0H A;  3M3C A;  5D8A B;  4QGL A;  5DAW A;  4XUO A;  1SBF A;  3LDK A;  2AH2 A;  1CAU B;  5JMO A;  1APN A;  4LOR A;  1QU0 A;  2TBV A;  1M06 G;  2VUA A;  3VBO C;  2Y26 A;  1ZYB A;  4HZF A;  4DIN B;  4AEJ A;  3LA3 A;  5ANN A;  2GAU A;  3BOW A;  1ND3 C;  2PLV 2;  4KWJ A;  5BNP C;  3O1V A;  5CIS A;  4I0B A;  5I8T A;  1QF3 A;  3SQO A;  1ULG A;  1XOY A;  4YW4 A;  5LRR A;  5D8A A;  3K3O A;  2E51 A;  2ZX0 A;  3CJX A;  3PME A;  4GJY A;  4U36 A;  2VZU A;  1MEC 3;  2VCM A;  1TMF 2;  2ENR A;  1EAH 3;  4V1P A;  1EUU A;  5EQU A;  4XUT A;  5I8S A;  3AMH A;  3O1R A;  3WQB A;  2R07 1;  5FY1 A;  1HXS 3;  1FNZ A;  1VRH 1;  2AEN A;  4EN9 B;  3OGJ A;  1FX5 A;  2AEZ A;  3HWJ A;  2Y34 A;  4BB3 A;  2G4I A;  1SLC A;  4PDW C;  5H9S A;  4YM3 A;  4XBQ A;  4Q4V 1;  2B9V A;  2DVA A;  3LFI A;  3ZX7 A;  1LEN A;  1ZA4 A;  2E53 A;  1W6P A;  4H3W A;  5F3G A;  3VGI A;  3O1S A;  3MPB A;  2H0B A;  4GWI A;  2JDM A;  5A1L A;  2YHJ A;  2HWB 3;  2FHR A;  3MGU A;  4DXS A;  2WNE A;  5CZK A;  3J8F 2;  3JZV A;  2KR2 A;  3ZFE C;  3DPR A;  2NMN A;  1RTV A;  1ZZC A;  2R06 1;  1TNR A;  1VBE 2;  2RJ2 A;  4PT6 A;  2BYV E;  5A3L A;  2HYK A;  2D6N A;  4HK8 A;  5FPA A;  1RHI 1;  2LRP A;  2WZE A;  3NNM A;  5J37 A;  2OPK A;  2VTX J;  2WZR 1;  1YIF A;  5C4W B;  1OT5 A;  5FUP A;  1XYO A;  1PIV 2;  4QPG B;  5CFC C;  1COV 1;  1VBC 3;  1W8N A;  2BBA A;  5FY7 A;  5FP8 A;  5JIU A;  3WR0 A;  2R32 A;  2V09 A;  4QD2 A;  5LBB A;  2VZO A;  1KS5 A;  2XUE A;  4CU8 A;  1DIW A;  4KWL A;  4XIK A;  3SH3 A;  3P3N A;  4AHW A;  1WD4 A;  3N9L A;  5L7O C;  4HLT A;  4KGG A;  4RS5 A;  4QX3 A;  1VAK A;  2HWE 2;  3TYJ A;  1RMU 3;  4XC9 A;  1H8T B;  2PA7 A;  3I2H A;  1YHF A;  4NVP A;  1ULD A;  4D94 A;  4I09 A;  1BHG A;  2ORZ A;  1W28 A;  1QMJ A;  1UOG A;  3CNA A;  4RHV 2;  1DGL A;  4NJ4 A;  2YUE A;  3E1F 1;  5DUX A;  4MAD A;  2CDO A;  2VJX A;  1W6M B;  4YZ4 A;  3LB9 A;  1RUG 2;  3UKV A;  4XYX A;  1XSQ A;  1CJD A;  2E33 A;  2ZXQ A;  4L9B A;  5A6Y A;  5J48 A;  2ZHL A;  4CYD A;  2FDG A;  1LHW A;  4KGQ A;  1W0P A;  4OLL A;  3HR9 A;  2FDI A;  4D7Y A;  3PUI A;  3HIF A;  2VOW A;  3K48 A;  5A7W B;  3VBS C;  1VBA 1;  4FOQ A;  3F95 A;  4EN0 A;  3WG3 A;  3RI8 A;  3T08 A;  1GUI A;  1SLA A;  4WBB A;  2PHW A;  3H7Y A;  3HBZ A;  3NNF A;  3MO4 A;  3OGV A;  4QQP A;  3RYR A;  3BKZ A;  2JX9 A;  1COV 3;  1VBC 1;  3WUC A;  2D7F A;  4CXX A;  3EXU A;  1WCS A;  5IUQ A;  5FR3 A;  1UYX A;  2RDR A;  2WFF 1;  2D93 A;  4CTE A;  5JMC A;  1FT9 A;  4YGB A;  3ZXJ A;  4OHY A;  3ZSL A;  4D7S A;  3R6S A;  4BE3 A;  2WNV C;  1VRH 3;  4CCM A;  5F5C A;  2OXB A;  4FVV A;  5JOY A;  1A8M A;  3N7M A;  2WZR 2;  1O8P A;  3AP9 A;  1AL2 3;  2BDR A;  2BTV C;  3U07 A;  1EAH 1;  1G6N A;  3GM8 A;  3ZYJ B;  3WNL A;  5K9Y A;  3J7N A;  5LAT A;  1FYU A;  4ET7 A;  3CZU A;  1JMU B;  2QZ2 A;  2Z69 A;  1MVQ A;  3GXU A;  5ABJ C;  4JHT A;  3LIH A;  3GJA A;  4LBM A;  1A3K A;  3WUD A;  1AR7 3;  1F31 A;  2KD7 A;  1VAV A;  1QJY 2;  1LOG A;  4IW3 A;  4XMA A;  5IVE A;  5HV4 A;  5FZC A;  2VAU A;  1AXZ A;  1JN2 P;  1GFF 2;  3VLB B;  5KXB A;  2R04 1;  1OA4 A;  4F83 A;  3HT2 A;  5AVP A;  4LBN A;  2IVI B;  2YC2 A;  3TEY A;  3FFQ A;  5EYX A;  4XE9 A;  3MUZ 1;  5BUV A;  4AI2 A;  4LBJ A;  1XBF A;  3KCC A;  3OYW A;  4Q0P A;  2ZEX A;  4P9J A;  4XUN A;  4XF1 A;  2Y6L A;  3WF4 A;  3TBD A;  3NKG A;  1IG3 A;  3ZYI B;  5A3P A;  1O7F A;  1QJE A;  2RDS A;  2A6Y A;  2HWF 2;  1OQ1 A;  3B5L B;  3DYM A;  4LA2 A;  4X8N A;  4RQP A;  5KBF A;  2XL9 A;  1NKG A;  2MNG A;  3L2Y A;  3HPN A;  3H8U A;  1RUC 2;  3RZZ A;  2RS1 1;  1DLC A;  2HYX A;  4L0P A;  4LPL A;  5A33 A;  5KWR A;  5EPA A;  2YDE A;  5FZO A;  3KVA A;  2LS6 A;  3LQC A;  2NYY A;  2P3J A;  3AC0 A;  3OYW B;  5FOJ B;  1GWM A;  1O4Y A;  4YW1 A;  4JTO A;  1NG0 A;  4QXC A;  2AAC A;  3M1H A;  3WP4 A;  5LA2 A;  4TTG A;  5LEK A;  5FJK A;  3MDP A;  4JAA A;  2W0X A;  2BOI A;  2W08 A;  4QB2 A;  5F7U A;  3T2P A;  4CXY A;  3N7J A;  1KS4 A;  2J7M A;  3T2T A;  5F9T A;  4NPL A;  4P5H A;  1QXR A;  2VNV A;  4S2D A;  4MHR A;  2NLR A;  3T4H B;  5FZ7 A;  1H8V A;  5FZB A;  1PM4 A;  2ERF A;  4M0H A;  1DLL A;  1SDW A;  5C8W A;  3Q8F A;  1OPO A;  2R07 3;  4IL7 A;  4LMF A;  3POW A;  4JDN A;  2Q30 A;  3KM5 A;  3MW4 A;  4IND A;  4ONU A;  4ZS3 A;  2J42 A;  4WVM B;  3WW2 A;  5C5U A;  1GQG A;  1JTZ X;  4ISR A;  2QQM A;  4WV8 A;  1VAM A;  2ZS6 B;  1AYM 1;  1XJA A;  1PGW 1;  1GP5 A;  2OQ6 A;  2E7A A;  2VW0 A;  4Q0V A;  5IAV A;  1W6N A;  2VMF A;  3IPV B;  5GAL A;  1D4M 2;  2LRO A;  3KHB A;  2RMU 3;  3U78 A;  1OOP C;  4WM8 B;  1XQN A;  4Y4R A;  1TME 2;  1TEI A;  3QAC A;  4XBL A;  3TB0 A;  4YZ2 A;  3WT3 A;  5J1X A;  2JE9 A;  2VMG A;  4XF4 A;  3AXD A;  1A34 A;  1LOB A;  1PO1 2;  2IXC A;  3H3U A;  1GKB A;  1GNZ A;  1JUI A;  3WP5 A;  1UZY A;  2WT1 A;  4DIQ A;  1W99 A;  1J59 A;  3W5N A;  1D2Q A;  1ULF A;  3P5B A;  4CE8 A;  3RJR A;  3JBG 1;  1OF3 A;  2VZS A;  4DRR A;  4YGE A;  4Q0Q A;  4Z8B A;  2WS9 1;  2VW1 A;  3GYD A;  1HQN A;  4Q4X 1;  2DUP A;  4IE6 A;  4Q5O A;  1BKZ A;  2JE7 A;  3K77 A;  1ZZ8 A;  5F3E A;  1K5J A;  3MLJ A;  1C3H A;  1VBA 2;  4MYE A;  1REF A;  2XVK A;  5K0U A;  1O4Z A;  4OI4 A;  3MV1 1;  2WYF A;  4QMA A;  1WMF A;  4IEZ A;  5JXI A;  5DG1 A;  1D0H A;  1JOD A;  5F32 A;  2D6L X;  4EWA A;  2F6B A;  3PMS A;  2IVJ A;  2VY0 A;  3ZPY A;  1H0B A;  1PMH X;  3FHQ A;  3AFG A;  4H7L A;  4XXP A;  1O4T A;  3R0R A;  4YW7 A;  2Q8O A;  3WCS A;  3WNM A;  1GP4 A;  1C8N A;  2YRO A;  4JGZ B;  4NHY A;  3FL7 A;  4XJZ A;  5FRA A;  4E2S A;  1KJR A;  4IDZ A;  5ABJ A;  4X6Q B;  5C3S A;  1BMV 2;  4CCE A;  1IKP A;  3P1I A;  1NX9 A;  4TLG A;  1RGS A;  2H6C A;  1LEC A;  1KFX L;  1PK6 C;  4E27 A;  3VZJ A;  4AFC A;  4AGR A;  1PGW 2;  5C9A B;  1G8W A;  3N9M A;  4CDU A;  1LGN A;  1SBE A;  2RE9 A;  4EYU A;  1BEV 2;  4AFB A;  2EIE A;  2LM3 A;  4JQR A;  1QKQ A;  3O1O A;  1OLM A;  4RR3 B;  5M0T A;  2WAA A;  2IWG B;  4BLJ A;  1Q8Q A;  4L2N A;  1V9U 2;  3A0N A;  1KFU L;  2OW4 A;  4XQ4 A;  3ACF A;  4AOC A;  1SCS A;  3PVO A;  4URT A;  1DGR N;  2VD7 A;  2EXJ A;  4CDW C;  1NXM A;  4GB3 3;  2YBK A;  2XHK A;  1BBT 3;  3IDB B;  3WDV A;  2CAU A;  1IGO A;  1OKO A;  4CDW B;  3D3A A;  1UMZ A;  2MHF A;  1WZX A;  3H1Y A;  4H7M A;  3RVH A;  3ZVX A;  3ZO0 B;  2RS5 1;  2YGM A;  5FZA A;  1OLM E;  1RUJ 2;  5LK5 A;  1CES A;  4DEV A;  4QX7 A;  2C24 A;  3CMG A;  5D8A C;  5CNA A;  5H9Q A;  4BIO A;  5EIY B;  3UYJ A;  2HBT A;  2VL4 A;  3ZDV A;  3O0X A;  1VBB 3;  3FFZ A;  2F4L A;  4UFM A;  5KHK A;  4HVO A;  3ZFG B;  2HWD 3;  1ENS A;  3U11 A;  3ETP A;  1QJZ A;  1F35 A;  3S5A A;  5JZG C;  5FY8 A;  1ODN A;  4XJW A;  2RS1 3;  3IDC B;  4Q4W 1;  2GSY A;  3DV8 A;  4HT1 T;  2JIG A;  3RS6 A;  3WXP A;  2VMH A;  5BNO C;  4Q4Y 3;  5C70 A;  5KHI A;  5L7O A;  1LHN A;  1NZC A;  1UN1 A;  1W39 A;  1WBL A;  3BI3 A;  2LUW A;  3BTA A;  5F3I A;  4H2A A;  1XU1 A;  4CP1 A;  1BBT 1;  4MSV A;  4IEO A;  1F9K A;  3EHK A;  4U2A A;  3ECQ A;  3EB7 A;  5F8P A;  5FPZ A;  2DUO A;  4CEW A;  2W95 A;  2YGL A;  3UV9 A;  2ZML A;  2XVG A;  1JH5 A;  2FZ1 A;  3THP A;  2DFB A;  3OPW A;  4R9C A;  4XFG A;  2AUY A;  1C8M 1;  2KM2 A;  1AL2 1;  5GJ6 A;  2BNN A;  3VD7 A;  4R9A A;  2HWF 1;  5LAS A;  1AYM 2;  3POB A;  4NWV A;  1YIP A;  1HXS 1;  1NLS A;  3RPQ A;  3VBU B;  1ENQ A;  3DKQ A;  4MXW B;  4FCA A;  3ZFF A;  3JUU A;  3C7G A;  1PVC 1;  2X29 A;  5HPO A;  3PHM A;  1UOB A;  4QDQ A;  1PVX A;  5A1F A;  1PGL 2;  3LGR A;  2EIB A;  4OVE A;  3WHT A;  3P6B A;  4YM2 A;  2VZR A;  3CU7 A;  4OHX A;  3I59 A;  4CDX A;  5A6X A;  4FTE A;  1O8S A;  2RHP A;  3B9I A;  4QKN A;  3VZK A;  3POI A;  4NIA A;  1NYW A;  1RUO A;  2RM2 1;  1ND2 C;  1IQD C;  3SEP A;  4GWJ A;  2PHF A;  3ZMO A;  5FJH A;  2DUR A;  3HBK A;  3GCX A;  4I30 A;  5DZE A;  2R30 A;  5FXZ A;  3RDI A;  4D6Q A;  3NL1 A;  4Y20 A;  3WNK A;  1W2N A;  4PDW A;  1QDC A;  1Y9G A;  4UBH A;  4BYY A;  2PMW B;  3D0S A;  3RI9 A;  3TOJ A;  3I59 B;  5BNN C;  1LTE A;  4HON A;  5HBA A;  1R08 2;  1HQL A;  3LA2 A;  4YGD A;  4DUX A;  1MZE A;  1UZV A;  3O0W A;  4AI0 A;  1IZ3 A;  4FQZ A;  2QQL A;  4IER A;  4YG6 A;  3RJ2 X;  3PDQ A;  3UJQ A;  4ZU5 A;  5FMC A;  2JG9 A;  4B29 A;  3LKJ A;  1WW6 A;  2CY6 A;  3A21 A;  3OUH A;  4WZF A;  3GJB A;  1V6J A;  2XQX A;  1AJO A;  2PQS A;  4OZO A;  3MHZ A;  1HLC A;  2ZX3 A;  3FLT A;  3U10 A;  2QJV A;  1KDM A;  4COU A;  1EV1 2;  1FPN 2;  1DYO A;  2DCT A;  2G9G A;  4YVS B;  1G9C A;  3IWZ A;  3PTY A;  3KVB A;  2HJI A;  5AVA A;  1C1F A;  1WCU A;  2WNU B;  2WNV B;  4LK7 A;  4DY5 A;  1AYN 3;  1RUH 1;  3ZSK A;  3JCI A;  4YZ3 A;  3VBH A;  2DV9 A;  5K7P A;  4LHL A;  2RM2 3;  3S6P A;  1L3J A;  4BMB A;  1HRI 3;  4FO9 A;  1XNA A;  4BQW A;  2ZOE B;  2JDH A;  4YVW B;  3GBG A;  3ENR A;  4QPW A;  2A6Z A;  1ZM1 A;  5EJ1 B;  5A6Q A;  3TWI A;  3WW3 A;  4ISQ A;  4IV3 A;  1F5F A;  1V0A A;  4WVV A;  3T2O A;  4DFS A;  2GU9 A;  1J3P A;  4BZ4 A;  3I2K A;  2IC1 A;  4NAM A;  2PHU A;  1GAN A;  3ZYH A;  5GZG A;  1PK6 B;  2HWB 1;  3AMN A;  3DYP A;  1AR6 3;  1F4H A;  1QQP 2;  4MV2 A;  3ZOI A;  4DUV A;  3MIG A;  2BFU L;  2JWP A;  4URA A;  4GKX A;  1BMV 1;  1A8D A;  2O14 A;  4HKL A;  4CZS A;  4ZS2 A;  1WUV A;  2ZCW A;  4AAP A;  2RV9 A;  3KQ4 B;  2R06 2;  4NIH A;  3E6B A;  1DU3 D;  5FZI A;  2WFF 2;  4BQX A;  1TG7 A;  1QOT A;  1CAV B;  1LRH A;  2P3Y A;  2ZA9 A;  3J8F 1;  3WG1 A;  1XE8 A;  2PHL A;  5FO7 B;  3SKJ E;  5AC9 1;  2UWB A;  5C3P A;  5GLW A;  1KD7 A;  2ADE A;  1UIK A;  3H1M A;  1GZC A;  4QQH A;  2JXA A;  2JE8 A;  4DS0 A;  4NRO A;  2P3K A;  2ZBJ A;  5FK7 A;  3TNQ A;  2Y6J A;  4QHB A;  4YZ1 A;  2B42 B;  5T3N A;  2XJR A;  3VKM A;  1EPW A;  3PUA A;  4B3N A;  4BA6 A;  2QTW B;  2HKX A;  2OKX A;  1MS4 A;  2Z2S B;  4QPI C;  2JD9 A;  4KI5 M;  3ZXG A;  1GU3 A;  1AR9 2;  2R7E B;  5T50 A;  4MGK E;  4QPI B;  2D44 A;  2W9X A;  1K45 A;  5A80 A;  3UL2 A;  3LDR A;  4CDU B;  1C8M 2;  2SBA A;  5J96 B;  2JKB A;  1U12 A;  4CDQ A;  2WYS A;  3VDA A;  2FD8 A;  2IXJ A;  4LO4 B;  3N9Q A;  1J3Q A;  1S0B A;  5JOZ A;  3AJY A;  1RUC 1;  1GQP A;  1PO2 1;  1R09 2;  2MEV 3;  3V64 A;  3BYW A;  1RYY A;  3G6J B;  4Y5T A;  4XCA A;  2G19 A;  2Q5T A;  4Q4X 3;  2WS9 3;  3UGG A;  3BTZ A;  5JXJ A;  4UAP A;  2E7Q A;  1EP0 A;  4FPL A;  3UKT A;  4FPF A;  2UYA A;  2A3W A;  1UQX A;  1W8F A;  2DUQ A;  2OYZ A;  3ACI A;  4IV3 C;  1PZ9 A;  2JD4 A;  4Q4V 3;  1DYK A;  1CZV A;  4E8D A;  1SFP A;  4NRM A;  3ZXD A;  1GNH A;  3NKT A;  3RWK X;  3DEM A;  5JXG A;  3IZO A;  1F4A A;  5JXH A;  3H0O A;  4AED A;  3OSD A;  4IEQ A;  4YPJ A;  2OZJ A;  3RWN A;  4ASM B;  1AVB A;  3ZKY A;  3ZR6 A;  4D6S A;  4N9I A;  1W6P B;  2RS5 3;  3OEB A;  4N53 C;  2W3J A;  4FFG A;  4AI3 A;  1JU3 A;  1YFW A;  2GH8 A;  4FPJ A;  4J25 A;  1ZBA 1;  4LQR A;  4GB3 1;  4BHP A;  2V4A A;  2D3R A;  4NRP A;  5J98 B;  2RR1 3;  4JRL A;  4K6B A;  2W47 A;  4BK5 A;  2GNM A;  3KGL A;  1OLR A;  1H1M A;  4ITC A;  3BIE A;  4XEZ A;  5KHH A;  4O65 A;  2Q8C A;  1VBD 1;  4O61 A;  1OUS A;  4MHU A;  3V0A B;  3ZN5 A;  4ZZ8 A;  3VBU C;  1GQH A;  5HCH A;  5BNN A;  3AK0 A;  3LCP A;  3NVC A;  2JEM A;  2XJS A;  3ILF A;  3GAL A;  2VTX A;  1XPW A;  4CXW A;  3WQ7 A;  1C5I A;  5I8Y A;  4Y1X A;  5ISL A;  4QPG A;  2EID A;  1UD1 A;  3KLS A;  3RG0 A;  1QJU 3;  2ZMK A;  3LWC A;  5T5P A;  4Y22 B;  4CCN A;  1UU6 A;  4BQ2 A;  2ZX2 A;  2Y6G A;  1D4M 1;  3F2Z A;  4YFW A;  1ZZ6 A;  1TVG A;  4K7J A;  3ST7 A;  4CDX B;  2XWJ B;  4CCL A;  4CU6 A;  2FCT A;  2RVA A;  3EO6 A;  4BXS V;  3T0B A;  4XAE A;  5FO8 B;  1DQ4 A;  4CPB D;  3ZFG C;  1FOD 2; 
#chains in the Genus database with same CATH homology
 2VJX A;  4XUP A;  3DYO A;  2E33 A;  2ZXQ A;  2XON A;  2XOM A;  3CZJ A;  3PUI A;  1W0N A;  2C4X A;  5LA0 A;  2WAB A;  4W50 A;  3T08 A;  1GUI A;  1JI6 A;  4DXT A;  3J7H A;  1JYV A;  1CZS A;  3MO4 A;  2DCK A;  3OGV A;  4JKK A;  3C7F A;  1UYX A;  4RN5 A;  1GOG A;  1UY0 A;  4BK4 A;  2BGP A;  1UY4 A;  1OH4 A;  3OGS A;  2BER A;  3I2G A;  4XVH A;  4E8C A;  1O8P A;  1UMI A;  3GM8 A;  3WNL A;  2VC9 A;  3LEI A;  5DQ0 A;  3MBW A;  2E32 A;  1GOF A;  4ET7 A;  3CZU A;  4JX0 A;  3GXU A;  4CUB A;  2YC4 A;  3VD4 A;  2Y6H A;  2Y64 A;  2KD7 A;  2WQ8 A;  2B4K A;  2W46 A;  4PQQ A;  1XC6 A;  4LKS A;  5G05 L;  3C7H A;  2VMD A;  3C7O A;  2YC2 A;  2E31 A;  1MPX A;  3MUZ 1;  4BJ0 A;  4XUN A;  2ZEX A;  4ZY9 A;  1CZT A;  1NAE A;  2Y6L A;  3WF4 A;  3DYM A;  2J1T A;  1NKG A;  3HNM A;  3HPN A;  1W9T A;  2X10 A;  1JZ8 A;  2Z4F A;  1DLC A;  2HYX A;  4L0P A;  4LPL A;  2WZ8 A;  2BZD A;  3OG2 A;  2VR4 A;  3I2J A;  2LS6 A;  3LQC A;  3AC0 A;  3THD A;  1CIY A;  2J1S A;  3WF1 A;  1UY1 A;  4TTG A;  5LA2 A;  1JHJ A;  2VME A;  4KMQ A;  2VO5 A;  5IHR A;  2XHN A;  4QX1 A;  2W92 A;  1UXZ A;  1YQ2 A;  4QB2 A;  5F7U A;  3T2P A;  2J1R A;  2J7M A;  1PMJ X;  2V5D A;  5A1A A;  1L7R A;  2W1W A;  3W5M A;  3SKV A;  3T0D A;  1JZ4 A;  2ZEY A;  4PF1 A;  2J1E A;  3IB3 A;  2Y8K A;  1UY3 A;  2VZ1 A;  2VM9 A;  1WCQ A;  2QQM A;  2VQU A;  1SDD B;  2VMF A;  2VZT A;  5J1X A;  3ACH A;  1KGY A;  5DMY A;  2WBK A;  3I2F A;  5DN2 A;  4MO3 M;  1R64 A;  2ZEZ A;  1JU4 A;  1W99 A;  3W5N A;  3K75 B;  3UES A;  4Z2A A;  1OF3 A;  2VZS A;  4P02 B;  3OGR A;  4P08 A;  2V72 A;  5IYY A;  3NRU A;  3OB8 A;  4M4R A;  1JYN A;  3K77 A;  2W94 A;  2VCC A;  2W1U A;  3HN3 A;  3IAP A;  3WNO A;  1EUT A;  3MV1 1;  2X09 A;  3I3D A;  4JHZ A;  2VZP A;  5JXI A;  1H6X A;  4A45 A;  2VMC A;  4CU9 A;  2J1V A;  3OEA A;  1GOH A;  4DEQ A;  2W5F A;  1ULO A;  3EYP A;  1PMH X;  2QQI A;  5IFT A;  3FHQ A;  3VD3 A;  2WAO A;  5IFP A;  4OYU A;  3CKH A;  4ZXE A;  3VD5 A;  4QDS A;  1J83 A;  3WNM A;  4M4P A;  5B4X A;  4QX2 A;  3FL7 A;  4XUQ A;  4A44 A;  4CUC A;  4KWU A;  3P1I A;  4TXW A;  3FHA A;  1UYZ A;  1NX9 A;  5G04 L;  3VDB A;  5HXM A;  3WNN A;  2LW8 A;  4AAX A;  4UOJ A;  2VCB A;  2WO1 A;  4XZU G;  2EIE A;  1US3 A;  2WAA A;  3WNP A;  4DXR A;  4QDR A;  1JZ3 A;  3ACF A;  1SHW B;  2VZQ A;  3LEG A;  3FN9 A;  3UET A;  2JKX A;  3K4Z A;  2DDU A;  3WSO A;  3WF3 A;  3D3A A;  3JXS A;  2VZV A;  3WEZ A;  4DEV A;  2VCA A;  2WN2 A;  3CMG A;  5EIY B;  3HJR A;  1W8O A;  3GGL A;  1GMM A;  2JDA A;  2QQJ A;  2VL4 A;  1PX3 A;  4OMC A;  1JYX A;  3HOB A;  3ETP A;  5C7G A;  3HNB M;  4MGQ A;  1UMH A;  2W1Q A;  4A42 A;  5C70 A;  3SEE A;  4OUE A;  4QB1 A;  3K4A A;  2HLE A;  2VTF A;  5I0D A;  4JKL A;  3ECQ A;  3EB7 A;  3U37 A;  3I3E A;  1XNT A;  2W95 A;  2WDB A;  2WUH A;  4ARX A;  1CX1 A;  4W8J A;  2EIC A;  3VD7 A;  5LCW L;  1JZ6 A;  2W91 A;  2VZ3 A;  5DPN A;  4ARY A;  3A23 A;  4MOA A;  1UX7 A;  4W4Z A;  1UWW A;  4XUR A;  1K3I A;  3C7G A;  5HPO A;  1NUK A;  4P5Y A;  4QDQ A;  3MUY 1;  2EIB A;  3BGA A;  3P6B A;  2VZR A;  2X05 A;  4RYD A;  1UXX X;  1UY2 A;  1ULP A;  3LPF A;  4HG6 B;  1O8S A;  3T2Q A;  1K12 A;  4CVU A;  4ZZ5 A;  2J1A A;  3SEP A;  1IQD C;  4GWJ A;  3WNK A;  5IJR A;  1P8J A;  1L7Q A;  1OD3 A;  4FI9 A;  5C71 A;  4DUX A;  2QQL A;  3C7E A;  3MV0 1;  2WN3 A;  5JUV A;  3LEK A;  3A21 A;  3OBA A;  4OZO A;  2XQX A;  4QX0 A;  2PQS A;  4UI9 L;  3K4D A;  1JZ2 A;  3ABZ A;  4A41 A;  1DYO A;  3ZM8 A;  3ACG A;  1WKY A;  2ID4 A;  2C9K A;  2W87 A;  4A3Z A;  1OF4 A;  3LE0 A;  4AG4 A;  1XNA A;  1LNS A;  2J1U A;  1HN1 A;  3III A;  2YFU A;  4QPW A;  5EJ1 B;  4A6O A;  2ORX A;  1I5P A;  3T2O A;  3NJV A;  1UYY A;  3WF2 A;  3I2K A;  4LHS A;  2QQN A;  1W9W A;  2WO2 A;  3DEC A;  1H6Y A;  4CU7 A;  3DYP A;  3CDZ B;  1F4H A;  4DUV A;  1DP0 A;  5FUI A;  2QQK A;  4CUA A;  2QBX A;  2RV9 A;  3UNP A;  3LPG A;  3A7Q A;  1TG7 A;  3CIH A;  4D0Q A;  3WF0 A;  2WO3 A;  3SKJ E;  3C8X A;  1JYW A;  4DUW A;  4OMD A;  3T09 A;  1JZ5 A;  2L9L A;  4A4A A;  4QAW A;  3I3B A;  4IUG A;  2DCJ A;  2J22 A;  2JE8 A;  2Y6J A;  3GDB A;  3IAQ A;  4XUO A;  3CQO A;  2OKX A;  5JMO A;  3VD9 A;  2JD9 A;  4BDV B;  4KI5 M;  1GU3 A;  2R7E B;  5EJZ B;  3NQH A;  3VDC A;  2W9X A;  1K45 A;  3K46 A;  2WYS A;  3VDA A;  2V4V A;  3I2I A;  1D7P M;  1T2X A;  5JR2 A;  1KEX A;  1W9S A;  2VZU A;  1GQP A;  1RYY A;  1US2 A;  5CYY A;  1EUU A;  4XUT A;  3T0A A;  5B4N A;  3WQB A;  1K42 A;  5JXJ A;  4UAP A;  1UZ0 A;  4D8M A;  2C26 A;  3ACI A;  3IDA A;  2B9V A;  2YG0 A;  1CZV A;  2VQT A;  4E8D A;  4P00 B;  5JXG A;  4GWI A;  1F4A A;  5JXH A;  4DXS A;  1GNY A;  2Y6K A;  4YPJ A;  5CZK A;  2YFZ A;  4QB6 A;  3OEB A;  2W3J A;  3I97 A;  1JU3 A;  1PX4 A;  2RJ2 A;  4PT6 A;  4LQR A;  1JZ7 A;  2QQO A;  2E26 A;  2VOT A;  2YB7 A;  2CDP A;  2WZE A;  2W47 A;  4BK5 A;  2ZEW A;  2W1S A;  1OT5 A;  1SG3 A;  4GZ9 A;  5LA1 A;  4ZZ8 A;  1W8N A;  2BBA A;  3THC A;  2VZO A;  3NNG A;  4MGS A;  1XPW A;  4CU8 A;  2CDO A;  1J84 A;  2EID A;  3BN6 A;  3HNY M;  2BGO A;  3A22 A;  4QX3 A;  4JKM A;  2Y6G A;  3F2Z A;  3I2H A;  3HEI A;  1TVG A;  3PUH A;  1BHG A;  2ORZ A;  4CU6 A;  2RVA A;  4BXS V;  3T0B A;  3E1F 1;  4MAD A;  3NJX A;  1O59 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...