2D5FA

Crystal structure of recombinant soybean proglycinin a3b4 subunit, its comparison with mature glycinin a3b4 subunit, responsible for hexamer assembly
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
487
structure length
383
Chain Sequence
NECQLNNLNALEPDHRVESEGGLIETWNSQHPELQCAGVTVSKRTLNRNGLHLPSYSPYPQMIIVVQGKGAIGFAFPGCPETFEKPQLQDSHQKIRHFNEGDVLVIPPGVPYWTYNTGDEPVVAISLLDTSNFNNQLDQNPRVFYLAGNPDIEHPETMQEGGSVLSGFSKHFLAQSFNTNEDTAEKLRSPDDERKQIVTVEGGLSVISPKWGVEENICTMKLHENIARPSRADFYNPKAGRISTLNSLTLPALRQFGLSAQYVVLYRNGIYSPHWNLNANSVIYVTRGKGRVRVVNQGNAVFDGELRRGQLLVVPQNFVVAEQGGEQGLEYVVFKTHHNAVSSYIKDVFRAIPSEVLSNSYNLGQSQVRQLKYQGNSGPLVNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords glycinin A3B4 subunit
publication title Conservation and divergence on plant seed 11S globulins based on crystal structures.
pubmed doi rcsb
molecule tags Plant protein
total genus 95
structure length 383
sequence length 487
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00190 Cupin_1 Cupin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2d5fA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2d5fA01
4CYDA 1YFXA 2PHLA 4MH0E 3E5QA 1J3RA 3TNPB 4J1XA 5T3NA 1LB2A 2KXLA 2BYVE 1YWKA 2N7GA 4O9GA 4Z07A 4ZU4A 2EAAA 5I8SA 1O4TA 4EV0A 1DGRA 1UW8A 4XF4A 3ST7A 2Q4SA 3RZZA 2PYTA 5F1RA 3DKWA 3CLPA 4R8HA 1CAXB 2UY8A 1DZRA 1ZZ8A 5K8SA 4D7TA 4N9HA 1SEFA 2HJIA 3BALA 5I0TA 3QACA 2VPVA 5BY5A 2D40A 2CAVA 5BUVA 1SFNA 2IXCA 2Z69A 4AVAA 3IWZA 4IEVA 3CL1A 4JV4A 2ET1A 2K9ZA 1WGPA 4O9EA 1OMIA 1CAXA 3ROUA 4L11A 4UBGA 4PIZA 2I45A 4RD7A 3DV8A 3HT1A 3E5UA 3NKTA 1OD5A 1X8EA 1ZRRA 1OI6A 1FXZA 5D1IA 1X8MA 1Q5OA 4LA3A 3RNSA 3E6BA 3H1MA 1IPKA 3B02A 3EBRA 1UPIA 2Q30A 4XFAA 3KGLA 4IEZA 4MX3A 3D0JA 4FAHA 4KWJA 1ZZ9A 4EROA 3L2HA 3SCGA 3D0SA 5FPZA 1GQHA 4LLOA 2XL7A 5BPXA 2GU9A 4Q0SA 1YFUA 4MGKE 1G6NA 2Z2SB 3O14A 1ZRDA 4QMAA 3LA2A 3EQEA 2IC1A 2UYBA 1XE8A 3BCWA 4AVCA 1NYWA 1O3SA 5LRSA 3LA3A 4QGLA 4KWKA 2V09A 4X6RB 1RUOA 4HZFA 5BXXA 2P17A 3KMHA 2ETEA 4MV2A 3OF1A 3WW3A 3OCPA 4GULA 3WW4A 2QJVA 4UXAA 4OFGA 4IEUA 4Q0UA 5FQ0B 1O5LA 4MGZE 4KU7A 5FLJA 1J58A 4I3PA 4KL1A 3DN7A 3E5XA 3U10A 3ACLA 5FPXA 1VJ2A 2GC1A 3S7EA 3SMHA 4QM9A 4XETA 4XEZA 1GQGA 1HW5A 4P9GA 1LRHA 3MYXA 3LZZA 4ZU7A 2O1QA 2H6CA 1O3TA 5FQ0A 4AXOA 3H7YA 1DGWA 2MPFA 1J59A 4HBNA 4MUVA 2PAEA 3OTFA 4XFGA 2C0ZA 2XKOA 3E6DA 3U0ZA 3HT2A 2IXJA 3BB6A 5JCTA 4KU8A 3IBMA 2FMYA 5JSPA 3KCCA 1UCXA 4PIXA 3KGZA 2B5HA 4I0BA 1RC6A 1YFYA 2MNGA 3PNAA 3UKVA 5C8WA 1VR3A 3SXWA 3WW1A 4XFCA 4IETA 3N4MA 4META 2BNNA 1WA4A 3M70A 5EZWA 4NVPA 3USSA 3IIAA 1CGPA 4I2OA 3D82A 5I8YA 3MDPA 2OYZA 5CADA 1LKNA 5LEJA 3BU7A 3UKTA 1ZREA 2XHKA 1UIJA 4LUKA 4XF9A 4YRDA 3OGJA 2B9UA 2H0VA 4F8AA 3C3VA 1PMIA 1X7NA 4HN1A 2GZWA 3U11A 2BNOA 2WC2A 4TLFA 2CV6A 4Q29A 4PJYA 4E2QA 4YARA 3FZ3A 4MZUA 2XKPA 1O7FA 3KSCA 3FJSA 2EVXA 4XFFA 3SCHA 3LWCA 1ZZCA 4XFIA 1NXMA 1H1MA 3S0MA 2IXLA 3ZDSA 2IXHA 5FLHA 5I8TA 3FX3A 4WBBA 2XLAA 1XE7A 4HVQA 1H1IA 3CF6E 4PIYA 5I0SA 3MPBA 4LA2A 5JAXA 4MGIE 3DL3A 5FDBA 1V70A 3EHKA 3I7DA 4QX5A 5J7MA 1QY4A 3LAGA 3I54A 5I91A 1YLLA 4IERA 1EPZA 4XF0A 4D7SA 1ZZBA 2GH2A 3HIFA 1LR5A 3RDIA 1TQ5A 1X82A 3IDCB 4J1WA 5CU1A 4QGNA 2Q0AA 1IPJA 3ETQA 4FBFA 4OLLA 4UBHA 1PM7A 3FHIB 1ZZ7A 4R52A 2PA7A 4HVRA 3WW2A 4HLTA 2GAUA 4I02A 2PAKA 3GBFA 5J3UA 1O5UA 1O3RA 2BNMA 2XLGA 1ZRFA 3EO6A 3RPQA 3E6CC 2XGXA 1NZCA 4LUMA 4AVBA 2PFWA 2XL9A 2CGPA 3H7JA 1CAVB 2VECA 3TNQA 3QOPA 3LOIA 2F4PA 4JVAA 2ATFA 4YNIA 5E1RA 1ZX5A 2IXIA 4E2SA 4A2UA 3MZHA 4QGMA 4ONUA 1CAUB 3PVBB 4XFBA 4FT8A 4QM8A 1CAVA 4X6QB 2QVSB 5KHHA 4BH9A 2QNKA 3PLQA 1I5ZA 2OA2A 1DZTA 5BV6A 5JSOA 3RYKA 4IEXA 3ELNA 3FFQA 2Y0OA 5AVPA 1ZVFA 4HN0A 3NL1A 1CAUA 1QXRA 5JSRA 5FCCA 1J3QA 5KHKA 1VP6A 2O8QA 3CEWA 3H50A 2OZ6A 4HSJA 4K8FA 4Z82A 1CX4A 2GC0A 4XF3A 1L3JA 4AQ2A 1NE4A 2OZJA 4BYYA 1EYBA 4IEOA 3FWEA 4IEWA 1ZRCA 2QDRA 2VQAA 1QXJA 2K0GA 4AQ6A 1YUDA 3CO2A 2H6BA 4LTAA 3NJZA 1SQ4A 3R6SA 1NE6A 4WZCA 2ET7A 3NSTA 2D5HA 3RYRA 3FE5A 5KBFA 4MGYE 4EWEA 4ZU5A 5E16A 3NVCA 1UIKA 1Q3EA 4EWDA 1RL3A 5I0UA 1OFNA 2OPKA 2UY9A 3CJXA 4XFHA 4Q0VA 3UKNA 5KHGA 4I0AA 3S7IA 5I0RA 4JTOA 3E97A 1YHFA 3H3UA 2D5FA 4FAGA 3IDBB 1I6XA 2HKXA 4BIFA 2MHFA 1RGSA 1WLTA 5KHJA 4Q0PA 5CVRA 3SCFA 4IEPA 3ES1A 1U12A 4HMZA 2Q1ZB 3LA7A 3M3IA 2XLFA 1JUHA 2GC2A 5C6CA 5HI0A 4ORFA 2ZCWA 2GC3A 1CAWB 4HVOA 4DINB 1XRUA 2PQQA 1Y3TA 4F7ZA 3I59B 3SHRA 4KWLA 2BEOA 3RYPA 3OD0A 1YFWA 1RUNA 5LEKA 1FT9A 4H7LA 5LRRA 1UD1A 2FQPA 3H9AA 2BGCA 4B29A 4WVZA 2WFPA 4BHPA 1CAWA 1EY2A 4YYOA 1Q43A 5J48A 3I59A 4IEQA 4N9IA 4EWAA 2UYAA 3JZVA 2PAMA 3H8UA 3VHRA 2PTMA 4HSLA 2CAUA 3EJKA 4QXKA 2D93A 4YSFA 1J1LA 1FI2A 1ZZ6A 5FLIA 5KHIA 2IXKA 4JTNA 1J3PA 1QWRA 2E9QA 4LULA 1ZNPA 3H1YA 4E2GA 2PHDA 3GYDA 1EP0A 4Q0QA 2DCTA 4I09A 2EA7A 4XF1A 5EFUA 3NW4A 3H3ZA 2QCSB 3HQXA 3ES4A 4IEYA 4L2NA 1Y9QA 4LEJA 5I93A 4IESA 2B8MA 4I01A 1O3QA 3H1WA 1RTVA 2ZKLA 3BPZA 5JR7B 3G7DA
chains in the Genus database with same CATH superfamily
4NOTA 4IV1B 3I3DA 1AVBA 1NQJA 4E4SA 2BQPA 1YFXA 2PHRA 4IQPA 4MH0E 5KXDA 1J3RA 1TG7A 4I30A 5F2WA 5C4WC 1VRH3 2KXLA 1V6JA 4FSJA 5LA9A 1OUSA 4O9GA 5DG2A 2FDFA 3BUCA 2HWE1 4JZRA 3JBG3 3WNNA 5I8SA 5CAZA 1DGRA 4XF4A 1MS1A 1PIV3 1PO12 1MQTB 2PYTA 2Z42A 3RMYA 3CLPA 3ITQA 4A44A 4IV1A 2XJUA 3U4XA 3GHMA 1BMV2 5E89A 4Y24A 3ZPYA 1C1FA 4QB6A 2FCTA 3M3QA 3ZMOA 1GQPA 4K6BA 4N9HA 1YQCA 4NHXA 1JS9A 2HBTA 3NMBA 1LU2A 4EN9B 5LBEA 3OY8B 2EAKA 3VD3A 4CUBA 3QACA 4Y22B 1HJFA 5LB6A 2X05A 1SDWA 1MQTA 3W20A 1MZ6A 2D40A 4Z8BA 2CAVA 1POV3 1SFNA 5KXBA 1IS3A 2GN7A 4OULA 4Q8KA 2BBAA 3CL1A 4OMDA 4JV4A 2ET1A 4N7UA 4ATFA 3ZN4A 4QHOA 4NAMA 3PL0A 1E5HA 2O14A 1GSLA 2I45A 3QBQA 1QQP2 4EQVA 1GWMA 1KGYA 4C90A 3NKTA 1C4RA 4XYXA 4XJWA 3OY8A 1JYNA 4Y22A 3GCWA 4IV3C 1XE0A 5HV0A 3POIA 3RNSA 1CWPA 1STMA 3E6BA 1IPKA 2A73B 5FK7A 2AR6A 1GWLA 1V6MA 1UPIA 2RR13 3EBRA 1CN1A 5DDJ1 1ENQA 4W4ZA 4CU9A 1TVGA 4CP1A 1CESA 1ULOA 2JG9B 1VAKA 3O1SA 5IW0A 2EXJA 1CONA 3D0JA 4AI2A 3PUSA 4KWJA 2MEV3 1GZTA 2ZBJA 2JE8A 3MW2A 1CX1A 2XUMA 5CKNA 5JXHA 2AENA 2BWAA 1E57A 5AC93 3N7LA 1RYYA 2XXZA 2VOVA 3B00A 1H6XA 4FCAA 4F3JA 4XBLA 1YFUA 1O59A 4EN0A 2HWF2 4WVWA 2E63A 5DAQA 2JG9A 4AFCA 5A6YA 4QMAA 4P5YA 5B4XA 1M06G 3S6PA 2UYBA 4MADA 2TUNA 3MIHA 5IYYA 2D97A 4ATEA 1RUJ3 3KZ4C 2PN5A 2ZGOA 3HMYA 4XVHA 5J37A 3LEGA 1TME1 5L36A 2XJTA 3LA3A 3S57A 1UZYA 1RHI1 2I2SA 4KWKA 5APAA 1VBB1 4IGPA 1WMDA 3WXPA 1Y7BA 3AJYA 1C3HA 2VOXA 2ETEA 1BEV2 1LOCA 3WW3A 3IM0A 2ZMLA 1RIRA 2Z79A 4CEYC 5EIYB 4XAAA 4YW1A 4G9SB 4KGGA 3ZYFA 3WW4A 4AEDC 4UXAA 2VBPA 3O12A 2WZR2 4XJZA 5FQ0B 1QH7A 3RZKA 5F3EA 3R4UA 3WDUA 3PTRB 2QQWA 4Z2AA 3C7EA 2XJRA 4CEWC 1YJLA 1VJ2A 5TSWA 3S7EA 3KVAA 1OA3A 3DYMA 1Y4WA 2GNMA 4Y1VA 2FDGA 2ZGQA 1SBEA 1LRHA 3EXUA 1AX0A 4XBQA 2EIGA 4JHTA 3MV01 2ARAA 4FPHA 5FY7A 3ZX7A 5FBZA 1RMU1 1W8UA 2UURA 3MYXA 4CUAA 4D69A 1CPMA 2H6CA 3ACIA 1QJZA 1O3TA 4Q4V1 5FQ0A 5FWEA 3TEXA 4XJUA 1QKQA 1PM4A 2RS13 1DGWA 1LHWA 2ID4A 3LEIA 4JDNA 4HBNA 3T4HB 5GLZA 4U2AA 3AZWA 3ZYIB 1UNBA 4XFGA 1FMD3 1F4HA 2C0ZA 2XKOA 3E6DA 1JZ6A 1KD7A 5FPBA 4UYBA 4A41A 3HT2A 4GKXA 2IXJA 3BB6A 3CHXA 4RGKA 1HRV1 4J6GA 4KI5M 2VXJA 4GA9A 3ZFEB 4EE2A 5JDBA 3H8OA 2YBPA 1UCXA 4LBJA 5A7OA 2P6HA 3KF3A 3HQRA 4Y26A 1YFYA 3PNAA 5C8WA 2X8KA 3I8TA 3C2UA 2X53S 2JIGA 1N3OA 3KV6A 4PBOA 4R4ZA 3SXWA 2WLQA 3MPPG 5CB7A 1SHWB 2WN2A 4META 2DVFA 1WA4A 3H8XA 3M70A 2O8OA 5EZWA 5LBFA 3QH6A 2NMNA 3BU0A 1XNTA 1YQ6A 4KG0A 3CMGA 3AP7A 2QQOA 1WW5A 3AXDA 3IIAA 4LITA 5C3OA 5HCFA 3ZFEA 2WSUA 3D82A 1IGOA 4LR4A 2W0XA 5FP8A 5IVFA 5G04L 1RJ8A 3MF6A 4EN8B 5DABA 3N9OA 4BQ5A 5CADA 3AMHA 3WG2A 2E26A 3BU7A 5DPNA 1AYM3 1ZREA 2ZHMA 4GH4C 1UIJA 3AVSA 3MGUA 1WLWA 3NNJA 4OZXA 3OGJA 4XF9A 4NIHA 4AGGA 4YFZA 5FZEA 5CFDC 4KBBA 3WEZA 3AKRA 5EV7A 1S55A 1HJGA 1W3VA 3C3VA 4FP3A 2KM2A 1X7NA 3OD4A 4QB2A 2IWGB 5GLWA 4K40A 4AGRA 4CPBA 1RVF1 5FKCA 1UU5A 3OBZA 4Y5SA 4PJYA 4AE2A 5L73A 5B4NA 1YRZA 1KDMA 1RUD2 3OPZA 3RGBA 3WINE 5B2GB 1OVSA 3LDRA 5EXOA 2WBKA 2ZMNA 4Q4X1 3LB9A 1GNHA 3KD4A 2LM3A 2UWBA 5JVVA 3DXTA 3KSCA 4FVVA 5CG9A 2EVXA 2V4VA 3POJA 4XFFA 1AYN3 1DCSA 1UWWA 2XONA 2WNVC 2ZEWA 1ZZCA 2ZEZA 3B69A 3NV3A 3SH5A 1OHFA 1UY4A 5IFTA 4LBKA 2VW0A 2IXLA 4ZPIA 4NE9A 3IKWA 4YW2A 1M4WA 5I8TA 4HONA 2JJ6A 2WRAA 4L97A 3WNOA 4BJ0A 4YFWA 1LHVA 3DCQA 4LBLA 3MBWA 4WBBA 3WZ1A 2WWUA 3KVBA 4OUMA 3CF6E 5FZIA 4AQSA 5JAXA 4CP9B 2XH6A 4MGIE 1JTZX 4IXLA 1QJY2 2VNRA 3I2FA 5FDBA 1BQPA 4ZY9A 1LAJA 1QJFA 2BW8A 5T5PA 1JYXA 1IZ3A 1EV11 1QY4A 3LAGA 2JD4A 4RA0A 5H9RA 5JXGA 4CUGA 3I54A 1KEXA 1RUF3 1YLLA 4QU1A 1AZDA 4D6QA 1EPZA 4D7SA 2VW2A 1ZZBA 2GH2A 4DEQA 1GP4A 2ZX3A 3VZJA 5BNPB 1PGL2 2Q0AA 4V2WA 1E5IA 2YC4A 3ETQA 5FP4A 4CP9A 2I74A 2VUDA 4AVTA 1PM7A 2RMU1 2VZ1A 2Q5TA 1ZA4A 2PHFA 5GALA 1OA2A 4AFAA 1IPSA 2DFCA 2PA7A 4HVRA 3I49A 2FDIA 1LEMA 1S0DA 2PXJA 4I02A 1XYPA 2X5IB 3GBFA 3JCIA 1O5UA 3O0WA 4JRLA 3WOGA 4DUVA 3AJZA 5BNPA 1HXS2 1UY3A 4LUMA 1MEC2 2PFWA 2XL9A 3ACGA 3AVRA 2XWBB 3K2OA 2J1UA 3N9QA 1JU4A 5FZ1A 2Y6HA 3ZFGB 2QQMA 1UL9A 5H9SA 3PMSA 4NWWA 3ZXFA 4QPIC 4HANA 2XVLA 2JB8A 2OIIA 5FY1A 1GMMA 3V64A 4IE4A 2ATFA 2CWMA 3CDZB 4LO7A 4P08A 3TEWA 2Y8KA 3KQRA 5L9RA 4FTBA 2Y64A 2IXIA 5E1RA 2HWE2 2X5IA 3UNPA 1H0BA 3O0XA 5FKBA 3INAA 2A70A 2TNFA 4N7IA 2RDRA 3T2TA 2QQLA 3ZFGA 3IIIA 4BH9A 4XUTA 2QVSB 3J8F3 2BZDA 1VBE3 2QNKA 2RS51 5T5LA 1S0CA 1IS5A 1S2KA 3WNPA 1E5RA 5BV6A 2ZXQA 4HPKB 3DEMA 3RYKA 1R083 4WM7B 3GJBA 1NUKA 4FQZA 5JIAA 4LORA 2KD7A 3MLLA 2ZEXA 1YCIA 5AVPA 1JOBA 3IDEA 1YI9A 3NL1A 4FTEA 1B35C 4JKMA 4DXTA 5JSRA 1F2NA 5FCCA 5KHKA 3J7NA 4HSJA 2O8QA 3CEWA 3H50A 1G86A 4RFRB 5H9PA 1VAMA 3RMXA 1S0IA 4Z82A 1CX4A 4R9CA 1AR93 5FYMA 4HPKA 4YVWC 3VL8A 1JN2P 4OZOA 4WM7A 5IVYA 5C9AC 4AOCA 2YG0A 2GP5A 4N53C 5F3IA 1APNA 1VRH1 3A23A 3FWEA 5F9TA 3NV1A 1D7PM 2BERA 2HBUA 5DZGA 1ZRCA 3JQXA 4XE9A 1LHNA 3JBG1 2XB6C 4LKSA 2VQAA 4CCCA 1QXJA 2K0GA 4N53B 1JBCA 4Y1UA 5DAXA 1PIV1 1UXXX 1D2SA 1S0FA 1DQ1A 3OUJA 3I2DA 3BIWE 2VNGA 5A6QA 2PHUA 5FV3A 1DYPA 1JZ2A 1SQ4A 3RSJA 1DLLA 3R05A 4WZCA 2P3JA 2ET7A 1BXHA 4KMQA 5FWJA 3CU7A 5FK8A 1MACA 2WINB 3AC0A 4P5HA 2OT7A 3BVCA 2V72A 2ILMA 3OGSA 4EWEA 4ZU5A 3I2IA 3MICA 1POV1 4GAZA 2VZUA 3WF1A 1W8NA 1C1LA 5LA2A 1OFNA 2OPKA 1US3A 2R073 4XFHA 3VKNA 1R64A 2WZ8A 2TBVA 4FPFA 3ZOIA 5FPUA 4P9YA 4Q0VA 1V6KA 1TME2 1XPWA 4DNYA 1D0GA 1RHI2 1W6OB 3F2ZA 3LIHA 4NR1A 4I0AA 2VZVA 3S7IA 1VBB2 1PVXA 4Y1ZA 4JTOA 4Y5Z0 3TN93 1XB9A 3ZXAC 5JUVA 3WDWA 1ND3C 1U0AA 1LEDA 3IDBB 4FXGB 2G19A 5FYCA 4BQWA 3IN9A 5FYVA 2RR11 5BNOB 1ZRIA 1WLTA 5KHJA 2VTFA 3ZYJB 4JKLA 4RS5B 3AMQA 1DQ2A 3SCFA 1R093 2MEV1 3ZVXA 5FYHA 3VBRC 5LWBA 4TSVA 1POQA 4BOWA 1W6OA 4U36A 1MS9A 2VGDA 2DTWA 2I07B 4H3WA 4K9SA 4QQLA 1COV3 2C6SA 3SLIA 5AC91 4CCEA 3MIFA 1E5SA 5FMCA 3KF5A 2PMWB 1K42A 2X29A 1UYYA 3DF0A 5BNOA 2ZCWA 1LOBA 1S2EA 1SLCA 2CL2A 2JG8B 5EQUA 4RS5A 1Y43B 4F7ZA 3ZR5A 3I59B 4A6SA 4RR3C 1JYVA 1RUJ1 2VC9A 1H8TB 2WAOA 3B9IA 1ZBA3 3VDAA 5LEKA 4CPBD 4H7LA 3ZSJA 4TN7A 1CIYA 3AYCA 5LRRA 2EIBA 1JU3A 1HRV2 4R9AA 3WF0A 1ND2B 2WFPA 4RQPB 1NCRC 2VL4A 1JODA 1EY2A 1UPSA 4YYOA 2JG8A 1CJPA 1G9AA 4GD4A 1OPOA 3JQWA 4Q27A 3I59A 5CBLA 4LXLA 1F35A 2PHTA 1SFYA 4JGYC 1H8VA 2W52A 5IATA 1H8TA 1JOJA 4UW5A 2ADDA 1IS4A 4XQ4A 3THDA 1CPNA 4Z92B 2CNAA 1JZ3A 3R4SA 1ND2A 2CAUA 3EJKA 3SH4A 4B1LA 3NQHA 2D93A 4RQPA 4Y4YA 5A7NA 5AFEA 4LOSA 4UOJA 3I97A 5FLIA 1QEXA 4R4XA 5KHIA 1UKGA 2XUEA 5H9QA 5D8AB 2WYFA 1SLAA 1AXZA 2D3PA 2JDUA 2CWSA 5F5AA 4COWA 2RS11 3POGA 3WT3A 1K5JA 1NCQC 2VCMA 5DAPA 3JD73 1WA6X 5K0UC 1EAH3 4MHRA 3P3PA 4DEVA 3GYDA 1W0NA 1VMFA 3HR9A 1EP0A 4B4QA 1FMD1 1HN0A 4BISA 4OI2A 4BLJA 3W21A 4YZ2A 4GJZA 2XQRA 2Q8DA 4AI0A 4BLIA 2LUWA 2YUEA 4IEYA 1GFF2 4L2NA 3NAPC 3WG1A 5D8AA 2B8MA 4NHKA 3U4SA 4Q4X2 5F8PA 2ZKLA 3A4UA 3BPZA 3UGFA 4ASKA 2FZ2A 1NA1B 2QUOA 4CYDA 2QKDA 3TNPB 1SBFA 1UU6A 2CYFA 3HD8B 4J1XA 2BYVE 4DXZA 1AR73 1UN1A 4KQ7A 2N7GA 1Q8PA 3ZSMA 2C26A 2EAAA 2E32A 4EV0A 3ST7A 4CXWA 3ALQA 3TAYA 2E6VA 1W9TA 2R1BA 4JC1A 1KS4A 3KHBA 2P3YA 1AYM1 4EJRA 3H0OA 5IK4A 3UL2A 2W94A 1GOHA 1AX2A 2VMFA 1NA1A 3Q8BA 2ZHKA 5F5IA 2RDQA 3WP5A 5JXIA 4AFMA 4BQ2A 4AL9A 2UY8A 4XW3A 4D7TA 5C8CC 4YW6A 4XJAA 5FP7A 1EV12 2VY0A 1SEFA 1W9YA 2HJIA 3Q9OA 4MG2A 4M0HA 5I0TA 1FNZA 2WO1A 2VPVA 2OUHA 3U37A 1I1EA 2YYOA 2VZ3A 1QGLA 2YXSA 3WV6A 1FOD3 1UMIA 4CP2A 5A32A 1GICA 3AZZA 3VBOC 4AVAA 4YG3A 4QD2A 2VR4A 4NRQA 3NJVA 2BVBA 2FDJA 2K9ZA 1WGPA 2YB7A 3VBFB 3ZM8A 1AYN1 4L11A 4QQHA 3MW4A 2JDNA 2WJSA 1QJEA 2RMU2 3A21A 1I9RA 2WR9A 4RD7A 3HT1A 1AXYA 3E5UA 1H2MA 1TMF2 3PJQA 2XDVA 1PZ7A 1OD5A 3KLSA 5L7OA 1ZRRA 1FXZA 3V56A 4CCDA 1Q5OA 1FX5A 2DBIA 3O1OA 1DGRN 1ENSA 3THTA 3BIEA 1K5MC 4NPRA 2CTVA 4DXSA 4XFAA 1JYIA 3VBFA 4MX3A 4IEZA 1FYUA 4C1WA 1QDOA 5FZ7A 3SCGA 1AR63 4TWTA 1VIWB 4JDOA 4PBPA 1SCRA 3BKZA 2BGOA 1OA4A 1XU1A 2GMMA 2XL7A 1RUF1 3RQ0A 1WMFA 5F6LB 2A3XA 2CGOA 2X10A 3MLKA 3PURA 1G6NA 1YIFA 2Z2SB 3JB8A 3EB7A 2YGMA 1POV0 1VRBA 1B09A 4FPCA 3OBRA 1H4GA 3WDXA 3EQEA 2IC1A 4CXXA 2W39A 3WDTA 2R1DA 1FNYA 2RS52 5IUQA 1MVQA 4CU7A 4DIQA 1PNFA 1C5HA 3V65A 3I3EA 5T54A 4AVCA 1NYWA 1O3SA 2KR2A 2ZGKA 3CJIC 3WD5A 2ORXA 4ET7A 5LRSA 1VBA1 4KBZA 5ACA3 3ILFA 3N9NA 4X6RB 1RUOA 4LIUA 1WD4A 5BYNA 5IK5A 4MV2A 3OF1A 3AZXA 3LPGA 1LENA 4ARXA 4Z1VA 1ZM1A 2ZHNA 4QDQA 5JZGB 3AZYA 1VLNA 2WFF3 4ZXEA 5C33A 2IVIB 4CUCA 4Y5TA 5GLVA 5T5JA 1RUG3 1PO23 4Q0UA 2WNEA 4LBMA 1O5LA 1H4HA 1QJU3 5FIXA 3AL5A 2QQJA 5FLJA 4HKLA 1W03A 2XBO2 4JRAA 1J58A 3OEBA 4KL1A 3DN7A 1VBD3 2DVGA 1VRH2 5F5QA 2GC1A 1QOSA 4XETA 3A0KA 4CU6A 3LGRA 5FXWA 1JYTA 2YU1A 5A6XA 4P9GA 3JBG2 1OLMA 2R16A 1AJOA 3JXSA 4M3CF 4FFGA 1TNFA 3D8CA 5JZGA 1Z7S3 2HEVF 3R0RA 1A34A 1UU4A 3DECA 1JZ5A 2O1QA 4LT5A 1VMJA 3VBHC 4MVTA 3PDQA 4AHWA 3J8F1 1VBE1 2MPFA 3FHAA 1AR83 1PGW1 3VHPA 3VKOA 2GNTA 1Q8QA 1WW6A 2YPJA 4MUVA 4YVSB 1R081 2EF6A 2PAEA 3OTFA 4EZ4A 1NX9A 4QX1A 3NJYA 3U0ZA 1HN1A 4BIOA 2WS93 3GGLA 3UJQA 2W87A 4N43C 4YM2A 4KU8A 1X33A 3PU3A 3OBAA 3VDCA 5JSPA 2C1FA 4M3CE 3KCCA 4GALA 3EYPA 1BZWA 4K1ZA 3GNEA 3BTYA 4I0BA 4G3YC 4MGTA 2C4XA 2MNGA 4NMIA 2VUCA 5C5UA 2ZZQA 3AYEA 3WW1A 1AR91 4XFCA 3M4FA 1JHJA 4IETA 4YVSA 4AAXA 4S2HA 5GLUA 2C5DA 1CZSA 4UW4A 3BTZA 3ON7A 5JR2A 4AHXA 4GB33 2VNOA 4NVPA 4XACA 1YO8A 5C4WB 5LZ6A 4QKNA 5JI7A 2W92A 3SITA 3AZVA 4FPYA 4O61A 1CGPA 1XJAA 1UY1A 5JOZA 4QKDA 3OGVA 1QJX3 3MDPA 4QKFA 1W6QB 5A80A 4BZ4A 3WNXA 2OYZA 4HK9A 3LD8A 3PU8A 2RR12 1H2LA 4Z2WA 3UKTA 3EMRA 5FY8A 4HOOA 4NIGA 4YRDA 2QQKA 4CRQA 3UGHA 2B9UA 2WLPA 3GXUA 3KV9A 3ZPOA 1PVC3 4HT1T 2VD7A 5C4WA 4F8AA 1PMIA 3UGGA 2OXBA 3DXUA 4HN1A 2GZWA 3D4KA 3T08A 4AHZA 1N1VA 5AC92 5LA0A 1JYCA 2ERFA 4E4HA 2VM9A 1SFPA 2WC2A 3FUQA 1W6QA 4LKEA 4E2QA 4XMAA 1REEA 2A6ZA 1TZOA 4YW7A 4MZUA 3VL9A 2W2IA 2XKPA 3ZIWA 2FHRA 1S0BA 2VOKA 4LHNA 5CA6A 3HPNA 5A3LA 1YJKA 2VBDA 2R071 3AK0A 4QX3A 3SKJE 4YWAA 4GIQA 2FCUA 1RUJ2 1BK1A 5FTTC 4PI2A 3PIJA 5SV5A 5EHDA 5FZHA 3UESA 2PHXA 4XCBA 4AAPA 3ZFFC 5E6HA 2W3JA 4FOVA 3ZDSA 5J09A 2YHJA 5FLHA 5GM0A 3SKVA 3KT4A 2WSVA 3N3HA 3IB3A 4IV3B 3TN91 4GZ9A 4EZHA 2HWD3 1GUIA 2YFUA 4ARYA 4HVQA 1I3HA 3V0BB 4BMBA 3GZEA 1S0EA 5DUUA 1DZQA 1HQNA 1R091 3MPBA 4UW3A 3LDKA 1W8HA 1W2UA 2CHHA 5FPVA 3DL3A 4QDSA 1V9U3 1ST8A 2WA4A 3EHKA 1COV1 2DBNA 4QX5A 1PK6C 3WVJA 4IV3A 5FUNA 4QXBA 5I91A 3AP5A 1WKYA 1NG0A 3NWKA 4L9BA 1JXNA 4XUOA 1LR5A 1O8PA 3V0BA 2WO2A 3ILNA 1H2NA 4M0NA 2GMPA 5C70A 1N3QA 1IPJA 3DPRC 4FBFA 2RS12 1OD3A 1UO9A 4OLLA 4A42A 4Q5OA 3LEKA 5GZFA 5C5TA 4I0WB 5HXVA 4FP2A 1JI6A 1U5ZA 1FMD2 1DGLA 1VE0A 1ZBA1 4JQTA 4CDWC 4IW3A 5JPNB 1UXZA 1ZZ7A 2JECA 4DB5A 3WF2A 3ZKUA 1YXWA 3MF9A 3QLQA 4L0PA 3KHCA 4HLTA 2GAUA 3OBTA 4HXCA 3ZYPA 1SPPB 2DUQA 3FBMA 1BLZA 2GNDA 1XBFA 2RJ2A 5FUIA 1G9BA 3EO6A 4KG8A 4BQ3A 2VMHA 3RPQA 4CEYB 1Y9MA 2XGXA 3ZYRA 3ZO0B 4AEDB 2LS6A 4DQAA 2CGPA 2JEMA 2XVGA 4MGSA 1ULPA 4ZKTB 2DURA 4DUXA 4GQ7A 1NLQA 1KJLA 2F4PA 3HEIA 4JVAA 4NWVA 4CEWB 1K3IA 2OUJA 4YNIA 1PGSA 2O0OA 2YDEA 5FZAA 1SPPA 4FPLA 3VV1A 1OF3A 1RUE2 4NHMA 2JXAA 5CG8A 2DVBA 3WX5A 3AFKA 4CEYA 3MZHA 4ONUA 3POSA 4AEDA 1AYM2 4FT8A 3B93A 4QM8A 5FO8B 5KHHA 3P6BA 5J98B 3IAPA 3PLQA 5FYBA 3JD71 1EAH1 1HQLA 1O91A 5A3NA 4CEWA 1KFXL 4JQRA 2WAAA 3WCSA 3RVHA 3OB8A 2EIEA 1YQ5A 1OXCA 5FZGA 5C7GA 2B9VA 4K8RB 5T55A 1UZZA 4C0BA 5A3UA 2OZ6A 1S0JA 3R4DB 3BGAA 4ISRA 4UF0B 5EYXA 5FO7B 3U75A 3PJYA 2GC0A 4AI1A 2BJSA 5F6KA 1BEV3 4XMIA 1ZA7A 3ZN6B 2GDFA 1AYN2 2AEZA 3C7GA 3W9AA 2OZJA 4CCKA 2VMGA 1FV2A 1KXGA 2AREA 4DY5A 1AR71 3FL7A 1W6PB 2BWCA 5GZCA 1XNDA 3ZXGA 3ZYGA 4FQ4A 1DF0A 1ENRA 3I2JA 2RM22 2B4KA 4UF0A 2W1WA 1X50A 1YUDA 2F17A 1DHKB 4XUNA 2H6BA 1W3XA 1QF3A 3M3CA 4LTAA 3FMGA 4GH4B 3ZN6A 3RJ2X 5JPMB 2YMZA 5CFDB 1CIWA 3VKLA 1DQ5A 1NE6A 3ZDVA 5DMYA 4OQ8A 1NLRA 2WWSA 1MR5A 1W6PA 2ZAAA 3NNFA 4CZSA 3WG3A 1OOPC 4TYSA 5A70A 1UZVA 1IHMA 4MOAA 2ZZJA 3JU9A 2XJQA 1F5FA 2BFUL 5HCAA 4XOGA 3NVCA 1FOD1 1Q3EA 3K77A 4GH4A 1RL3A 2WO3A 4YGBA 5I0UA 4EWDA 2UY9A 4QKBA 5CFDA 3FUOA 4RYDA 2IVJA 1OH3A 1PHMA 2XMLA 2ZABA 3N7JA 4H14A 4XABA 5FZOB 5LK5A 2D43A 5FP9A 2J42A 4P9JA 1V6IA 2DCZA 1LTEA 2WNVB 3UKNA 1Z0HA 4HL0A 4C0HA 4V1PA 4NJ4A 4LBOA 1DYOA 1VBA2 2J1EA 1HB1A 3AB0A 5I0RA 4JGZC 2ZX4A 4B4RA 1OVPA 1YHFA 2VZPA 4HKOA 5KC6A 2QBXA 1MZFA 2XG3A 4DY3A 4LKDA 1ENXA 4BIFA 1RGSA 4NN0A 1LECA 5FZOA 2A3YA 5BNNC 2WNUC 5KXEA 3WG4A 1SG3A 2W1SA 2WNVA 4QWNA 4CCLA 3ZXEA 3IT8A 4HMZA 4JX0A 4RL7A 2DU0A 2Q1ZB 1QXPA 1MS8A 2NZ9A 1AR61 3J4UH 1IQDC 3AKQA 3KQ4B 4W6XA 4XTPA 1JUIA 1T2XA 1UOFA 4V2VA 1GKBA 4E4ZA 2BFUS 2D6PA 3BPSA 4E8DA 5C6CA 4ORFA 5HI0A 2DYCA 3G6JB 4UFJA 4IGQA 2GC3A 4P9LA 1LOGA 4AQTA 2G4IA 1XRUA 3ZXDA 2QE3A 2HYXA 2JX9A 3AKPA 3J8F2 3C7HA 1W8ZA 2VW1A 1VBE2 5FZFA 1C8M3 1HV0A 4TLGA 4TTGA 1TE1B 2J1SA 2KA3A 1F31A 1R082 2SBAA 2ADEA 1OURA 4P00B 4D0QA 2DWRA 4IE5A 2OW4A 3VZOA 3L2YA 1OQEA 1IKQA 4PLNA 4B4PA 5ACA1 2Q8OA 1UD1A 3H9AA 2BGCA 3PVEA 4B29A 3KV5A 2ZACA 4M01A 3J7MA 3WQBA 2VO5A 5F3GA 4DZGA 2WFF1 2YFZA 5FAXA 5FZ3A 5LASA 1Q43A 5F39A 1CJDA 1RUG1 3CKHA 2V73A 3POWA 1R1A3 2CY6A 3X29B 1QJU1 4M4RA 4LIVA 1IS6A 3O7OA 1H9PA 2UYAA 4QPIB 4BXSV 1JZ8A 4XUQA 4Y3OA 1C5IA 1VBD1 4YZ5A 3V0AB 3JZVA 4FFIA 2PAMA 2B42B 3VHRA 1MPXA 4WVVA 4HSLA 1EUTA 4YZ4A 4IUGA 2GP3A 1FI2A 1Z7S1 1ZZ6A 2BV4A 4ASLA 3VDDC 2GNBA 3QCWA 3AFGA 4CCOA 4FFHA 1QWRA 2E9QA 1LGNA 1O4ZA 3H1YA 1AR81 2DTYA 1JOPA 4CDXC 3K3NA 2D6LX 1QOTA 3V0AA 2VZTA 3HVDA 1CVNA 1W8WA 4LO8A 2R063 3M1HA 2WS91 2HWB3 3VBUC 3H3ZA 2QCSB 3K4ZA 4UAPA 2JDAA 1V6OA 1X9PA 2YZ4A 3ES4A 1B35B 1LOFC 5I93A 3LFMA 5FMOL 5LY2A 2QQIA 2LALA 3H1WA 2AZ5A 4A7ZA 1LU1A 1RTVA 5IHRA 2LROA 3G7DA 3HBZA 2Y0IA 2R072 5JR7B 4CCJA 2D6KA 4A45A 4ZHNA 4YVWB 2PLV3 5C9AB 2NLRA 2PHLA 3E5QA 1HXS3 4GB31 1LB2A 5IT6A 4FO9A 4XDPA 1H1AA 1LGCA 2PQSA 4TXWA 1SLLA 4Z07A 5DDJ2 1B35A 1QJX1 1WWYA 5LY1A 2LW8A 1O4TA 1O4YA 3TN92 1H30A 2VAUA 4M4PA 1D4M3 1AF9A 1W2OA 3RZZA 1MZEA 5FZCA 1NOVA 3ZKYA 4DFSA 4QPGC 5A33B 2ZGUA 3DKWA 2XPJA 5D21A 3RG0A 3F95A 3AMMA 1HRI3 3SNMA 4PDWC 4NRPA 4YVWA 4WVMB 5C9AA 1R092 3LSDA 1PVC1 2VOWA 3N7MA 4R8HA 4LO4B 4N53A 4ZS2A 1DZRA 5FYIA 2EICA 5FPLA 4YGEA 2E7QA 5ANNA 5JIUA 2Y33A 2QDNA 4DOUA 3BALA 4YW3A 1LESA 1DFQA 2WL1A 4B7KA 4AFBA 5JOYA 1W90A 2WQZC 1KFUL 2R49A 4L99A 5A33A 5BY5A 1HB4A 3C8XA 4FPEA 2IUWA 5BUVA 1SBDA 2A5ZA 2IXCA 2Z69A 4Q1PA 4UFKA 3IWZA 4WVMA 4IEVA 3I4IA 1UX6A 5ANQA 1XC6A 1DP0A 4O9EA 4AGVA 5ABJC 1OMIA 1RUI3 3ROUA 4AW7A 1FATA 1VBC3 2VZSA 4PIZA 5D2AA 1ZBA2 1KS5A 3CIHA 3AYDA 2VULA 3DV8A 3OSDA 1WD3A 2DV9A 3D6EA 1YNAA 4ZONA 2G9FA 2ZHLA 4IL7A 3OOXA 1XXNA 3THPA 2ZTNA 5D1IA 5FXXA 1X8MA 1SCSA 2HWD1 1WBLA 5KXCA 4E8CA 1ND3B 3H1MA 1N47A 1Y9GA 1JHNA 4GMP3 5FYZA 3RZLA 4NPMA 1PMJX 3AX4A 3LDBA 2ZAHA 3Q8EA 2GALA 4FAHA 1Z78A 2WABA 1FPN3 4EROA 3VD9A 2VOTA 1ULDA 3D0SA 1V9U1 3VBRB 3T30A 1WMXA 5EJ3A 1RMU2 2RS33 1A78A 3FFZA 1BJQA 2Y60A 4MXVA 3ZSLA 2UU8A 2XWJB 4D94A 1GQHA 4LLOA 4Q4V2 4YW5A 5BPXA 4A7KA 2GU9A 1JMUB 1ND3A 2BRTA 2RHPA 5CFCC 3VUOA 4NRMA 4LLFA 1UAIA 1UMZA 2E31A 3ZXLA 3VHOA 3GHNA 1EAH2 4GWNA 5JMCA 2DF7A 4LOTA 2W5FA 4RR3B 4WV8A 3VBRA 4Y1XA 1W99A 3BCWA 1UZWA 2X09A 5FRAA 3T09A 3U1XA 1XYNA 4QGLA 1PZ9A 1QH6A 2ARBA 4UI9L 2V09A 2NQYA 5BXXA 2EALA 1ASJ3 2G9ZA 2R6QA 3KMHA 3SQOA 5F37A 1C57A 5LATA 3MIDA 1NCRB 1NT0A 4FPOB 4LK6A 2Y6LA 3WHTA 5SV8A 4D8MA 2W1UA 3TYJA 1UQXA 5AVAA 4HKWA 4RR3A 4JGYB 3PVNA 2D98A 4MGZE 1LHOA 1WCQA 4KU7A 1DQ0A 2D3SA 3E5XA 3U10A 4D3WA 4CDUC 1FAYA 1AR72 3TB0A 1N3PA 2JDYA 4H2AA 1J1TA 1GQGA 1NZIA 2CDPA 1QNWA 2V5YA 4UW6A 4XEZA 4CP0A 2D44A 1OF4A 1NCRA 1Q8SA 2BU9A 2E51A 2WN3A 2JB4A 4Y4RA 3LZZA 4LO6B 4LK7A 4RFT0 1CZVA 1DBNA 2R32A 3H7YA 4JGYA 1WCDJ 4LQRA 4AXOA 2CDOA 3IDAA 4BM8A 1RVF2 4Q26A 3WUCA 1NCQB 5HPOA 5K0UB 2P3IA 2C9KA 3C7FA 1ULEA 4IE6A 2ZGLA 3APBA 2ZPXA 5DN2A 3NNMA 4WM8C 4UFMA 3VKFC 3VKMA 4AVVA 3I2KA 5JCTA 4XJ8A 2VBBA 3WHUA 3IBMA 4RHV3 2FMYA 4CVUA 1J84A 4CDQC 4OHZA 1SMVA 3PIGA 3WY6A 4AEJA 2VVEA 3NAPB 1W8OA 1ZBE3 1FOD2 3UKVA 5LCWL 1VR3A 2BP6A 2W47A 4HETA 1NCQA 1REDA 4IE7A 3K75B 5K0UA 1LOEA 3N4MA 3LEMA 1HKDA 2BNNA 5IVCA 1X36A 2WNOA 3Q8CA 4XQDA 3USSA 1PMHX 2HEYF 4LPLA 4H7MA 2DDUA 5GKAC 1IG3A 3NAPA 4FI9A 4UFLA 1N1YA 1F15A 5FBJA 5HBAA 5C3PA 4QXHA 4QQPA 2WUHA 3HQUA 4YG6A 1F9KA 5FFOC 1DU3D 1A3KA 2D6NA 1DG6A 1W39A 3L9JT 2A1XA 3N35A 4IE0A 5FY5A 1RUC3 5IVBA 5FJHA 3WR0A 3VB9A 2Y34A 5C8CB 4CA9A 3AM2A 1AR62 4PT6A 3AMPA 1YQ2A 2JKXA 3J9SA 4XURA 4TLFA 4IDZA 5ERLA 2WT2A 5HCHA 2CV6A 5E8AA 5FZLA 2XQXA 4FOWA 5IJRA 1NY71 1TEIA 1D4VB 4C91A 5J36A 3WF3A 3MIEA 2HH9A 4DMIA 4PLOA 1O7FA 4W50A 1UOGA 5EPAA 3VBOB 3TEZA 3NNGA 5J96B 1WCKA 5FZ0A 1GR3A 5GZEA 4S2FA 5CKMA 5A7QA 3SCHA 1WLCA 3LWCA 2WQ4A 5C8CA 2UWCA 2YC0A 4XFIA 1NXMA 1H1MA 2JE9A 3S0MA 1O6UA 3B3QE 2IXHA 2HLEA 4XHBA 4MYEA 5ISLA 3ZMNA 3A7QA 4AVSA 3OYWB 3FX3A 4Q4W3 5LBBA 5F32A 1GNZA 2WFF2 3VD7A 2R7EB 3O1RA 3VBOA 4EN7B 1K5MB 5IK8A 1RUG2 3RWKX 1QJU2 2AGSA 2F6BA 2VTXA 2DUPA 2ORZA 3WLUA 3O1UA 4PF5A 1VBD2 5C71A 2XJVA 3N7KA 4EN6B 2VZOA 3FBYA 3USUB 5J7MA 1HIXA 2EXKA 2DFBA 4IERA 4A3XA 2ZGTA 1Z7S2 1VMHA 4YGDA 1A8MA 4PQ9A 4UFIA 1K5MA 3CZUA 3HIFA 3MFCA 3RDIA 1X82A 5CU1A 1T6BX 1RUH3 3K46A 2VMIA 5J1XA 1W6MB 3HBKA 3WF4A 1AR82 1C8M1 2B45X 3CNAA 5DQ0A 5FY9A 1QOOA 5CKQA 3RI8A 3M3EA 1DGWX 4X8PA 2OQ7A 2CU5A 3FHIB 4FPJA 1YQ8A 1VB4A 2WS92 3CJIB 3ZXKA 3LF7A 1KDKA 2OPWA 5IFPA 3ZYBA 3J26N 2HWC3 2R0HA 3U78A 2E33A 1KRIA 5J3UA 1W05A 1W8FA 1GANA 2FDHA 1O3RA 2BNMA 1ZRFA 2RV9A 1TMF3 2DVAA 3E6CC 4LBQB 1ODNA 3Q8AA 1NZCA 4IGOA 1W6MA 5DXDA 3ZSEA 1R1A1 4CCMA 1AL23 1CAVB 2NN8A 2OS2A 5FPAA 1LODA 2WT0A 3LOIA 3CJIA 2ARXA 4AI3A 1PIV2 2P34A 1W0OA 3VBSC 2CGNA 3T1MA 1AHSA 3URFA 1OC1A 1UZ0A 1QJX2 2R0FA 1V0AA 4A2UA 3PVOA 4LBQA 4QGMA 1CAUB 4SLIA 4YG0A 4K20A 4XTMA 4XFBA 3VBHB 1CAVA 4Q4Y3 4X6QB 1BK0A 2Z4FA 2ZGMA 3MLJA 4K7JA 4Q2FA 1PVC2 1SACA 1LOAA 1NAEA 4QDRA 4IEXA 3I3BA 3ELNA 2W9XA 2R061 3PMEA 1L7LA 1WZXA 3N9LA 2VMDA 2HWB1 4QX8A 4N43B 3WUDA 4HN0A 4KWUA 2D6OX 1CAUA 2QQPA 1YYNA 5IK7A 1J3QA 2R043 3ZYHA 4K8FA 1JZ4A 1GWKA 3T0BA 4NROA 2E7AA 1L7QA 3HN1A 3VBHA 1MS3A 1NQDA 4XXAA 2ZEYA 4BMEA 1BBT3 4IV1C 1L3JA 4QHBA 4M3CB 2PLV1 4BYYA 1GP5A 1HXS1 3TWIA 2JDKA 2ES3A 3WQ0A 2E7TA 1TNRA 4N43A 4DXRA 1UY0A 1ALYA 2XBO3 3VN4A 3LKJA 4AHYA 4C1XA 2QDRA 1W6NB 3GZTB 3ACFA 3DYOA 5GZDA 1D4M1 1RJ7A 2HWD2 4AQ6A 2MEV2 1MQTC 3CO2A 2C9AA 3LIGA 3T1LA 1UF2C 4XZPA 4BWOA 3ZXJA 3TOJA 1HRI1 4BQYA 4M3CA 1EUUA 5LW9A 4MSVA 3NSTA 3KB5A 2TEPA 1GP6A 1V9U2 4W6YA 2VNVA 3RYRA 1UYXA 3HNBM 5HV4A 1NKGA 3MV11 3FE5A 1W6NA 3PHMA 3RFRA 5KBFA 2Z5WA 4BDVB 4P02B 5A1FA 4RN5A 2VMEA 3M8LA 5LK7B 1ACCA 2YC2A 1BYHA 1UIKA 4S2GA 4CCNA 2FMDA 1KJRA 3H42B 5K4LA 3CJXA 1OQDA 5A7PA 4DRRA 1RUI1 4INDA 4PLMA 4COZA 2WIIB 1DDLA 1AX1A 1VBC1 4KNCA 3THCA 5K9YA 3I3QA 2DCJA 5DAWA 5HXMA 3FHQA 3ZFFB 5LBCA 2JICA 2VU9A 1VAVA 3J7LA 2VCCA 2Y6JA 3ZIXA 5FOBB 3OJBA 4BK4A 4GMP1 2J7MA 1PO13 4OMCA 4Q1RA 3NKGA 1GBGA 2JG9C 3ABZA 1AUYA 4Q0PA 5F2SA 2DCKA 5FZ4A 3MIGA 1OQ1A 2FCVA 3IPVB 3O1PA 3MUY1 3PUQA 1FPN1 2P2KA 4XHXA 3AYAA 1GOGA 3ES1A 1U12A 2P5BA 4NUBA 2A6VA 3GJAA 3ZFFA 2RS31 2AYHA 3M3IA 5FZ6A 3NRUA 4BQXA 2XLFA 1VALA 3ATGA 3BTAA 5A3OA 4D7YA 4A3ZA 1PK6B 3I2OA 1QDCA 4W65A 2AEYA 3IZOA 3VZKA 2VQUA 3RZJA 2VVDA 4DINB 1CAWB 4HVOA 4FPGA 2VE1A 1PZ8A 2ZGPA 1HDKA 1Y3TA 4BPZA 3DPRB 3IPVA 4JKKA 1K12A 5FUPA 3N36A 2JIJA 4BK5A 1G9CA 3SHRA 2IFRA 5CNAA 4BQ4A 3TEYA 2RE9A 1QQP3 3OD0A 3RYPA 1OH4A 3D3AA 1W28A 1FT9A 4CDWB 1BVP1 2DCYA 4LMFA 5FZBA 3VLBB 1UOJA 1LHUA 1PK6A 3TBDA 3WP3A 3OGGA 4LBNA 3WP4A 1ASJ1 2Q1MA 3MO4A 4WVZA 2WZPP 1CAWA 3FLPA 2K2SA 4COYA 1SLIA 5F3CA 3DPRA 5GLTA 5J48A 4QXCA 5GJ6A 4OCTA 2RVAA 2VJXA 4CDWA 2Q8CA 1W2AX 4ITCA 4XC9A 4RSUA 3OGRA 3H8UA 2PTMA 1AXKA 3RZHA 5L9VA 3O5SA 5FZ9A 4NHYA 4A6OA 4GWIA 1J1LA 2BVVA 4GXLA 1T6GC 2LTNA 2P6CA 2QFEA 4JTNA 3E1F1 2HWF3 3UV9A 5IVJA 2V4AA 1ZNPA 4BB3A 1QIQA 3DUIA 4AK3A 5DZFA 1OBNA 2VQ0A 3BYWA 4I09A 3B01A 4YW4A 4XJ9A 3T0AA 3NW4A 3ME2A 5C3QA 3HQXA 4RHV1 3AP4A 3ZFEC 1XSQA 1HQWA 1NY72 4LEJA 2XOMA 4HFSA 1ZBE1 4I01A 1O3QA 4O65A 1BKZA 3IMNA 2A3WA 3LCPA 3SEPA 2WZR3 2Y6FA 2W08A 2XHNA 2A7AA 1GYKA 2DVDA 2BDRA 2VMCA 2RJLA 2ZGRA 4I3GA 1HB2A 1VPHA 1OPMA 2OX0A 1L7RA 1XNCA 1OKOA 3NV2A 2YGLA 1LNSA 5T3NA 4YM3A 1IG0A 3DGTA 3CQOA 2XVKA 3LSEA 3N9MA 1YWKA 4ZU4A 2WA3A 4LHSA 4HK8A 1W2NA 1F5JA 1YI7A 1UW8A 3O1MA 1G7YA 2Q4SA 4ZS3A 3M2MA 5DG1A 2YU2A 5F1RA 4QPYA 1FV3A 2RDSA 2IFWA 1IQAA 4XUPA 1RUE3 4Q8LA 3M7AA 3NJXA 1BCXA 1BHGA 3POFA 1CAXB 1RUC1 1RUF2 1WW7A 1ZZ8A 5DUVA 5L9BA 5K8SA 2RJKA 5FXVA 3ZN5A 1OOPB 3AKSA 1UMHA 1W8TA 1JYWA 3I3MA 5T5OA 4LBQD 4FFFA 3MIBA 3GF6A 3S30A 1RB8G 1RITA 2ZA9A 4QX7A 1S0GA 5IVVA 1OKQA 3POBA 3VD4A 1C8M2 1WLDA 5FZKA 2PELA 1G9FA 2A71A 1CAXA 3CBNA 4UBGA 4DO0A 2BOIA 1OOPA 3A0NA 2A6XA 3TRSB 2L9LA 2NPIA 1J83A 5IAVA 4JGZB 1X8EA 1N1TA 5FYUA 2ZKNA 1OI6A 4AWDA 4LA3A 4H55A 4Q4W1 3DKQA 1X9TA 3B02A 4XPVA 2YROA 4ISQA 2Q30A 4W8JA 5KWRA 1R1A2 3KGLA 2RM23 4YM1A 3RRDA 5BNNB 2WNUB 5FZDA 1ZZ9A 4UFHA 2YV8A 3L2HA 2VQTA 4P9WA 1QU0A 4YPJA 4ZXKA 4N90A 5A1AA 3CZJA 4JGZA 1GZWB 1WBFA 4PHZA 2VUJA 5FPZA 1QNYA 1GZCA 2W91A 3H3LA 3MEPA 3P1IA 4OI4A 2QQUA 1RUD3 1PGW2 4MGKE 4Q0SA 1HB3A 5FZMA 5JMOA 3O1VA 3O14A 4TZDA 5BNPC 1ZRDA 1RUH1 1ZYBA 2ZX2A 2JENA 3LA2A 5BNQA 5BNNA 3HAGA 5C3SA 2WNUA 5KC5A 1XE8A 4P9XA 2XJPA 3W59A 1AJKA 2J1RA 4COUA 1UYZA 2R062 2ARCA 5DZEA 3AXEA 5F7UA 4AYUA 1P8JA 3UK9A 2HWB2 1S1AA 4R9BA 1GZWA 1RXFA 1C28A 3B5LB 2D6MA 4HZFA 1H9WA 2P17A 1PO21 2HWC1 2X5IC 1AR92 4EYUA 2QTWB 4XIOA 4AEMA 3OCPA 1TMF1 1VBA3 2ZJCA 3AKTA 3D5OA 4GMP0 4GULA 4PQQA 1MVEA 2QJVA 3ZFGC 4OFGA 4IEUA 3BTXA 3BOWA 1AL21 2VCAA 4C8DA 3K4AA 2BOJA 3NO8A 2PLV2 2QZ2A 4I3PA 1MZ5A 1QJY3 1LCLA 3ACLA 3B9CA 5FPXA 3W5MA 3SMHA 4QM9A 1AL0G 5M0TA 2EXHA 1HW5A 2VG9A 3MW3A 5FREA 4OHXA 4CU8A 4NHLA 3RJRA 4YM0A 3RS6A 4MXWB 1D4M2 4QPIA 1YEWA 3VDDB 2VVFA 4ZU7A 3P5BA 2W46A 4LKFA 4L92A 2W1QA 4AR2A 4Q4Y1 1HRI2 1W0PA 1D0HA 4URAA 2Y6KA 1J59A 4CDXB 1PX3A 4WM7C 5FZ8A 1N1SA 2FD8A 3VBUB 1Q56A 4YZ3A 4MXWA 2XR4A 3HJRA 5JI9A 1U5IA 3VDDA 4PIXA 3KGZA 2R041 2B5HA 3WNLA 3KV4A 1RC6A 2CSGA 1G9DA 1MEC3 4ZZ8A 2VTXJ 5A3MA 1BBT1 4CDXA 4CTEA 1RUI2 3N9PA 1VBC2 1C8NA 1CZTA 3VBUA 1D2QA 1UKRA 2BPA2 4DUWA 1XU2A 3UJOA 3VZLA 2HWE3 2LRPA 2XBO1 5CISA 4I2OA 2NM1A 5I8YA 1UYPA 1KQRA 5FMDA 5A3WA 1LOFA 3B7MA 4PF1A 3QH7A 3WP6A 4E4DX 4OUSA 1LKNA 3KT7A 5LEJA 4QPGB 2XHKA 2NP0A 2GH8A 1UOBA 4LUKA 5DUXA 3ENRA 1COV2 3MHZA 5JOXA 4PDWB 2H0VA 3OPTA 5FR3A 1FPN2 3K48A 1REFA 1XNBA 2G9GA 5JWPA 4G4FA 3BODA 3POYA 2AACA 2RS32 2J1TA 4LJHA 5FMOS 3U11A 2E53A 4XQWA 1QHDA 3LOBA 1XSRA 2BNOA 4SBVA 4Y33A 4XDOA 4RGAA 2JDPA 4Q29A 3VZMA 4B3NA 4YARA 3FZ3A 1JH5A 2XJSA 4QPGA 4LE3A 3DYPA 5K7PA 1CD3G 3OPWA 2GMEA 5FYYA 3VGIA 3WDVA 2B46X 4PDWA 5FP3A 3FJSA 1S2BA 3HWJA 5ABJB 3T3YA 4YLZA 3WSOA 4F83A 2Q1FA 3GBGA 3T2QA 4QB1A 4LHLA 3C7OA 3PUHA 4MGQA 4QQOA 5JOWA 1H6YA 1JZ7A 4XBNA 1US2A 5AFBA 1ASJ2 3SISA 2H0BA 2BGPA 4NIDA 1G8WA 4MO3M 3VZNA 1IOAA 5BNOC 4E27A 4UT5A 4LE4A 1PO11 4O7XA 2XLAA 1WW4A 1XE7A 5DDJ3 2Q8EA 4RS5C 1H1IA 2VZRA 3P3NA 4PIYA 2QQVA 4URTA 4YGCA 4XAEA 4CE8A 5ABJA 4D6SA 5I0SA 4LA2A 3A22A 2FBEA 2OVUA 2OQ6A 1BMV1 5IAXA 1UY2A 5G05L 1HX6A 4YZ1A 3GDBA 3MUZ1 4DPNA 1V70A 2VCBA 4L8QA 4QX2A 3I7DA 4AZZA 1WMEA 5A3PA 4XIKA 4AI8A 3AP6A 4B7EA 1W9WA 3BI3A 1RINA 3ASIA 4N8MA 3JD72 4AFDA 5CFCB 4XF0A 4XILA 5IWFA 5T52A 1KITA 2FDKA 2JG8C 4XCAA 5CIRA 4OHYA 1TQ5A 3IDCB 4J1WA 4XZUG 2SLIA 4QGNA 4PCRA 3KM5A 1U5XA 4UBHA 3GBWA 5T50A 1H8TC 2QQNA 4DS0A 2K46A 5A1LA 1DQ4A 1QQP1 3BN6A 3GZAA 1TME3 2JWPA 1GV9A 2GSYA 4R52A 1PX4A 2HYKA 1RHI3 2ZOEB 2WT1A 3WW2A 2ZGNA 3AP9A 2WO7A 1VBB3 1ND2C 4RHV2 3WQ1A 2PAKA 4RQPC 4ZZ5A 5CFCA 1URXA 4AG4A 2XLGA 4JDMA 2J22A 2UWAA 1GU3A 1ODMA 1LGBA 1ZBE2 4D6RA 5JLVA 4FTSA 5A7SA 3LE0A 2YY1A 4AVBA 3T4VA 3ECQA 2QZ3A 3H7JA 2R30A 3RZGA 2VECA 1ONAA 1W06A 3TNQA 3QOPA 2W95A 5EP9A 3HNMA 4ES9A 4CDUB 4NIIA 2RDNA 2IZWA 1ZX5A 3MFAA 4E2SA 3OEAA 2B7YA 3JUUA 3W5NA 1RMU3 3PVBB 4WZFA 2HWF1 5D8AC 4JHZA 3O1TA 3ZLIA 1OUXA 3FC0A 4NPLA 4Q4V3 1ULCA 2AH2A 3HN3A 2WKKA 2JDMA 1I5ZA 4AEKA 2OA2A 3NNLA 1HV1A 3KCXA 5JXJA 1DZTA 5JSOA 4FOQA 1RUC2 3GZUC 4QX0A 5DUWA 1MS5A 2W68A 1S4CA 3ETPA 5CYYA 3SEEA 4CDUA 3FFQA 2ENRA 4BU2A 2Y0OA 4X8NA 1BVVA 1W04A 1DIWA 4WM8B 4S2DA 4B8EA 1ZVFA 3VDBA 1HRV3 4BE3A 1XNAA 1BEV1 1QXRA 4CDQB 5I0DA 3LFIA 1W2TA 5IVEA 1VP6A 2VZQA 2D7FA 3RI9A 2JDZA 3I2GA 2WZR1 3K3OA 3GCXA 1OSGA 4XF3A 4AQ2A 1NA1C 4OHWA 5FYTA 1NE4A 2WZEA 3T2PA 1DQ6A 1EYBA 3IAQA 1K45A 4IEOA 4ES8A 4WM8A 4IEWA 3SH3A 1GOFA 3ZSKA 3U07A 1H2KA 4K1YA 4GWJA 5EJZB 5FMBA 5FYSA 4AI9A 5FY4A 1SLTA 4CDQA 1HLCA 1LULA 1O8SA 2P4EA 1XYOA 4Q4W2 1QMJA 2C24A 4Y1YA 1YIPA 3KWVA 1XQNA 2BUKA 3VD5A 1U5YA 1RUE1 3K51A 3T0DA 1A8DA 1GLHA 3NJZA 2AUYA 3S5AA 4ASMB 3R6SA 3LQCA 4OI0A 5F5CA 4NIAA 2D3RA 3T2OA 5A3TA 2D5HA 3POEA 5E88A 4W6WA 2AC1A 5A32B 3Q8FA 3WNKA 1RVF3 2WWJA 5EYYA 3PTYA 3PUAA 4MGYE 5FY0A 1W9SA 5L7OC 1IKPA 3GALA 4QQ2A 4P14A 5E16A 3RZMA 4QT6A 1R1ZA 4Q4X3 2PHWA 1RUH2 1Q8VA 3UETA 4E9KA 3OUHA 3VBFC 4OQ9A 4JAAA 5L7OB 3AL6A 5ACA2 4OYUA 5DAVA 3WQ7A 2GN3A 2WQ8A 3UT0A 5FXZA 1ULFA 4NO4A 5KHGA 4OI1A 1F4AA 2WDBA 5EJ1B 3ZR6A 3OG2A 5CZKA 4UWDA 1PO22 2HWC2 3E97A 3WNMA 4QU2A 1I5PA 3H3UA 2D5FA 2YBSA 3GM8A 3ILRA 1W9FA 3ORJA 3RWNA 4FAGA 5FO9B 4LHKA 1I6XA 2HKXA 4MLOA 1SLBA 2MHFA 2NYYA 4LNVA 1DYKA 1JW6A 4QPWA 4DRVA 2RM21 3H8RA 4CXYA 1AL22 5LA1A 4MHUA 5CVRA 4GJYA 4HG6B 1GZ9A 4IEPA 1VB2A 1V6LA 4BA6A 2A6YA 2ZX0A 2HEWF 3OYWA 3LA7A 2ZMKA 2YPDA 1F8VA 4XDQA 1EV13 2F4LA 1JUHA 1V6NA 3O0VA 4GKYA 2GC2A 1RUD1 1Q8OA 1OFSA 1XOYA 1EPWA 4K21A 5FJKA 2A6WA 4KH9A 3U14A 1PNGA 4COVA 2JD9A 2PQQA 4Q4Y2 3USUA 5L19A 1OLRA 1UX7A 3KCYA 3LPFA 3S5QA 4KWLA 2BBVA 1OLME 2BEOA 2P3KA 2RMU3 5A7WB 4OVEA 1YFWA 1RUNA 2G1MA 1LJ7A 2EXIA 3PUIA 4P9IA 3KT1A 4NAOA 2FQPA 4J25A 3AMNA 2P37A 2Y26A 3M3OA 4BHPA 1SZBA 5JZGC 2R042 4R9DA 4CSWA 1MS0A 4M00A 4GB32 4OHVA 3BOPA 1CR7A 4IEQA 4KGQA 1XNKA 1BBT2 2ZS6B 3WCRA 3FN9A 4N9IA 1WCSA 3ACHA 4BXFA 1YC61 4XXPA 3WDYA 4EWAA 1SDDB 4FPKA 5A7WA 3J7HA 1QJY1 4PI0A 5EWSA 1OT5A 4QHZA 2JE7A 1CQ9A 2DUOA 2Y38A 4Y20B 5GZGA 2B39A 2Y6GA 3FLTA 2A75A 2WYSA 1DLCA 3IMMA 3VBSB 3HNYM 2P1BA 4QXKA 2VH9A 3SC7X 5A6ZA 1WUVA 1OLQA 3NV4A 4YSFA 3FLRA 4RGGA 1ULGA 2RG4A 4AF9A 4FOYA 2YBKA 2BTVC 2EIDA 2IXKA 3HOBA 3MI8A 4FXKB 1NXD1 1J3PA 4LULA 1PGL1 2JKBA 2J1VA 4B1MA 2ZGSA 2JDHA 3QD6A 1A6CA 1MS4A 2RS53 4JCKA 3UYJA 4E2GA 2V5DA 3JB4C 2PHDA 2DU1A 2NMOA 3KS7A 4YVSC 5C3RA 5CEHA 2J1AA 4Y20A 5KR7A 4BQ1A 4Q0QA 2DCTA 4A7YA 3I2HA 3VBSA 2VUAA 2VXRA 2ZX1A 2FZ1A 2EA7A 4LO5B 4XF1A 5EFUA 4K3UA 5HCBA 4QAWA 4GWMA 1RXGA 1WCUA 5FOJB 1Y9QA 4IESA 2OKXA 4OUEA 1GNYA 3OUIA 1V00A 1NLSA 3B94A 3VHNA 1MEC1 3W58A 4A4AA 3K4DA 4BCUA
chains in the Genus database with same CATH topology
4NOTA 4IV1B 1AVBA 1NQJA 4E4SA 2BQPA 1YFXA 2PHRA 4IQPA 4MH0E 5KXDA 1J3RA 4I30A 5C4WC 4FSJA 1VRH3 2KXLA 1V6JA 4O9GA 5DG2A 2HWE1 3JBG3 5I8SA 5CAZA 1DGRA 4XF4A 1MS1A 1PIV3 1PO12 1MQTB 2PYTA 2Z42A 3RMYA 3CLPA 4IV1A 2XJUA 3U4XA 3GHMA 1BMV2 5E89A 4Y24A 3ZPYA 1C1FA 3M3QA 3ZMOA 4K6BA 4N9HA 1LU2A 4EN9B 3OY8B 2EAKA 3QACA 4Y22B 1SDWA 1MQTA 1MZ6A 2D40A 4Z8BA 2CAVA 1POV3 1SFNA 5KXBA 1IS3A 2GN7A 4OULA 4Q8KA 3CL1A 4JV4A 2ET1A 4N7UA 4ATFA 3ZN4A 1GSLA 2I45A 3QBQA 1QQP2 4C90A 3NKTA 1C4RA 4XYXA 4XJWA 3OY8A 4Y22A 4IV3C 3RNSA 3E6BA 1IPKA 2A73B 2AR6A 1V6MA 1UPIA 2RR13 3EBRA 1CN1A 5DDJ1 1ENQA 4CP1A 1CESA 2JG9B 1VAKA 2EXJA 1CONA 3D0JA 4AI2A 4KWJA 2MEV3 2ZBJA 3MW2A 2XUMA 2AENA 2BWAA 1E57A 5AC93 3N7LA 3B00A 2VOVA 4FCAA 4F3JA 4XBLA 1YFUA 4EN0A 2HWF2 4WVWA 2E63A 4AFCA 2JG9A 4QMAA 1M06G 3S6PA 2UYBA 2TUNA 3MIHA 2D97A 4ATEA 1RUJ3 3KZ4C 2PN5A 2ZGOA 3HMYA 5J37A 1TME1 5L36A 2XJTA 3LA3A 1UZYA 1RHI1 2I2SA 4KWKA 1VBB1 1WMDA 3WXPA 1Y7BA 3AJYA 1C3HA 2VOXA 2ETEA 1BEV2 1LOCA 3WW3A 3IM0A 2ZMLA 1RIRA 2Z79A 4CEYC 4YW1A 4G9SB 4KGGA 3WW4A 4AEDC 4UXAA 3O12A 2WZR2 4XJZA 5FQ0B 1QH7A 3R4UA 3WDUA 2XJRA 4CEWC 1YJLA 1VJ2A 5TSWA 3S7EA 1OA3A 2GNMA 4Y1VA 2ZGQA 1SBEA 1LRHA 3EXUA 1AX0A 4XBQA 2EIGA 4FPHA 3ZX7A 5FBZA 1RMU1 2UURA 3MYXA 4D69A 1CPMA 2H6CA 1O3TA 1QJZA 4Q4V1 5FQ0A 4XJUA 1QKQA 2RS13 1DGWA 1LHWA 4JDNA 4HBNA 5GLZA 4U2AA 3AZWA 4XFGA 1FMD3 2C0ZA 2XKOA 3E6DA 1KD7A 3HT2A 4GKXA 2IXJA 3BB6A 1HRV1 4J6GA 3ZFEB 4GA9A 5JDBA 1UCXA 4LBJA 4Y26A 1YFYA 3PNAA 5C8WA 2X8KA 3I8TA 3C2UA 2X53S 1N3OA 4PBOA 4R4ZA 3SXWA 2WLQA 3MPPG 5CB7A 4META 2DVFA 1WA4A 3M70A 2O8OA 5EZWA 3QH6A 2NMNA 4KG0A 3AP7A 1WW5A 3AXDA 3IIAA 5HCFA 3ZFEA 2WSUA 3D82A 1IGOA 4LR4A 2W0XA 1RJ8A 3MF6A 4EN8B 5CADA 3AMHA 3WG2A 3BU7A 1AYM3 1ZREA 2ZHMA 4GH4C 1UIJA 3MGUA 1WLWA 4OZXA 4XF9A 3OGJA 4AGGA 4YFZA 5CFDC 4KBBA 3AKRA 5EV7A 1S55A 3C3VA 4FP3A 2KM2A 1X7NA 3OD4A 2IWGB 5GLWA 4K40A 4AGRA 1RVF1 1UU5A 4PJYA 4AE2A 5L73A 1YRZA 1KDMA 1RUD2 3OPZA 3WINE 5B2GB 5EXOA 2ZMNA 4Q4X1 3LB9A 1GNHA 3KD4A 2LM3A 2UWBA 5JVVA 3KSCA 4FVVA 5CG9A 2EVXA 4XFFA 1AYN3 2WNVC 1ZZCA 3B69A 3NV3A 3SH5A 1OHFA 4LBKA 2VW0A 2IXLA 4YW2A 3IKWA 1M4WA 5I8TA 2JJ6A 4L97A 4YFWA 1LHVA 4LBLA 4WBBA 3WZ1A 4OUMA 3CF6E 4AQSA 5JAXA 2XH6A 4MGIE 1JTZX 4IXLA 1QJY2 2VNRA 5FDBA 1BQPA 2BW8A 5T5PA 1IZ3A 1EV11 1QY4A 3LAGA 2JD4A 4RA0A 5H9RA 3I54A 1RUF3 1YLLA 1AZDA 1EPZA 4D7SA 2VW2A 1ZZBA 2GH2A 2ZX3A 1PGL2 3VZJA 5BNPB 2Q0AA 3ETQA 2I74A 4AVTA 1PM7A 2RMU1 2Q5TA 1ZA4A 2PHFA 5GALA 1OA2A 4AFAA 2DFCA 2PA7A 4HVRA 1LEMA 1S0DA 4I02A 1XYPA 2X5IB 3GBFA 3JCIA 1O5UA 3O0WA 4JRLA 3WOGA 3AJZA 5BNPA 1HXS2 4LUMA 1MEC2 2PFWA 2XL9A 2XWBB 3ZFGB 1UL9A 5H9SA 3PMSA 4NWWA 3ZXFA 4QPIC 4HANA 2XVLA 2OIIA 3V64A 4LO7A 2ATFA 2CWMA 3KQRA 4FTBA 5E1RA 2IXIA 2HWE2 2X5IA 1H0BA 3O0XA 3INAA 2A70A 2TNFA 4N7IA 3T2TA 3ZFGA 4BH9A 2QVSB 3J8F3 2QNKA 1VBE3 5T5LA 2RS51 1S0CA 1IS5A 1S2KA 5BV6A 4HPKB 3RYKA 1R083 4WM7B 4FQZA 5JIAA 3MLLA 1YCIA 5AVPA 3IDEA 1YI9A 3NL1A 4FTEA 1B35C 5JSRA 1F2NA 5FCCA 5KHKA 4HSJA 2O8QA 3CEWA 3H50A 1G86A 3RMXA 5H9PA 1VAMA 1S0IA 4Z82A 1CX4A 4R9CA 1AR93 4HPKA 4YVWC 3VL8A 1JN2P 5C9AC 4WM7A 4N53C 1APNA 1VRH1 5F9TA 3FWEA 3NV1A 5DZGA 1ZRCA 3JQXA 4XE9A 1LHNA 3JBG1 2XB6C 2VQAA 1QXJA 2K0GA 4N53B 1JBCA 4Y1UA 1PIV1 1D2SA 1S0FA 1DQ1A 3I2DA 3BIWE 2VNGA 2PHUA 1DYPA 1SQ4A 3RSJA 1DLLA 3R05A 4WZCA 2P3JA 2ET7A 1BXHA 3CU7A 1MACA 2WINB 4P5HA 2ILMA 4EWEA 4ZU5A 3MICA 1POV1 1C1LA 1OFNA 2OPKA 2R073 4XFHA 3VKNA 4FPFA 2TBVA 4P9YA 4Q0VA 1V6KA 1TME2 4DNYA 1D0GA 1RHI2 1W6OB 4NR1A 4I0AA 3S7IA 1VBB2 1PVXA 4Y1ZA 4JTOA 4Y5Z0 3TN93 3ZXAC 3WDWA 1ND3C 1U0AA 1LEDA 3IDBB 4FXGB 3IN9A 5BNOB 2RR11 1WLTA 5KHJA 3ZYJB 4RS5B 3AMQA 1DQ2A 3SCFA 1R093 2MEV1 3ZVXA 3VBRC 4TSVA 4BOWA 1W6OA 4U36A 1MS9A 2VGDA 2DTWA 2I07B 4H3WA 4K9SA 4QQLA 1COV3 3SLIA 5AC91 3MIFA 2X29A 3DF0A 5BNOA 2ZCWA 1LOBA 1SLCA 2CL2A 2JG8B 4RS5A 1Y43B 4F7ZA 3I59B 4RR3C 1RUJ1 1H8TB 3B9IA 1ZBA3 5LEKA 4H7LA 3ZSJA 3AYCA 5LRRA 1HRV2 4R9AA 1ND2B 2WFPA 4RQPB 1NCRC 1EY2A 1UPSA 4YYOA 2JG8A 1CJPA 1G9AA 1OPOA 3JQWA 4Q27A 3I59A 5CBLA 2PHTA 1SFYA 4JGYC 1H8VA 2W52A 1H8TA 1JOJA 4UW5A 4XQ4A 1IS4A 1CPNA 4Z92B 2CNAA 3R4SA 1ND2A 2CAUA 3EJKA 3SH4A 2D93A 4RQPA 4Y4YA 5AFEA 5FLIA 4R4XA 5KHIA 1UKGA 5H9QA 5D8AB 1SLAA 1AXZA 2D3PA 4COWA 2CWSA 2RS11 3WT3A 1NCQC 3JD73 5K0UC 1EAH3 3P3PA 3GYDA 3HR9A 1EP0A 4B4QA 1FMD1 4OI2A 4BLJA 4YZ2A 4BLIA 4AI0A 2LUWA 2YUEA 4IEYA 1GFF2 4L2NA 3NAPC 3WG1A 5D8AA 2B8MA 4NHKA 4Q4X2 2ZKLA 3A4UA 3BPZA 2FZ2A 1NA1B 2QUOA 4CYDA 2QKDA 3TNPB 1SBFA 1UU6A 2CYFA 3HD8B 4J1XA 2BYVE 4DXZA 1AR73 1UN1A 4KQ7A 2N7GA 1Q8PA 3ZSMA 2EAAA 4EV0A 3ST7A 3ALQA 3TAYA 2E6VA 4JC1A 2R1BA 1KS4A 1AYM1 4EJRA 3H0OA 5IK4A 3UL2A 1AX2A 1NA1A 2ZHKA 3WP5A 4AFMA 2UY8A 4XW3A 4D7TA 5C8CC 4XJAA 1EV12 2VY0A 1SEFA 2HJIA 3Q9OA 4M0HA 5I0TA 1FNZA 2VPVA 2OUHA 1I1EA 2YYOA 3WV6A 1QGLA 2YXSA 4CP2A 1FOD3 5A32A 1GICA 3AZZA 3VBOC 4AVAA 4YG3A 4QD2A 2BVBA 2K9ZA 1WGPA 3VBFB 1AYN1 4L11A 4QQHA 3MW4A 2WJSA 2RMU2 1I9RA 4RD7A 3HT1A 1AXYA 3E5UA 1H2MA 1TMF2 3PJQA 1PZ7A 1OD5A 3KLSA 5L7OA 1ZRRA 1FXZA 3V56A 1Q5OA 1FX5A 1DGRN 1ENSA 3THTA 1K5MC 4NPRA 2CTVA 4XFAA 1JYIA 3VBFA 4MX3A 4IEZA 1FYUA 4C1WA 1QDOA 3SCGA 1AR63 4TWTA 1VIWB 4JDOA 4PBPA 1SCRA 1OA4A 1XU1A 2GMMA 2XL7A 1RUF1 3RQ0A 1WMFA 5F6LB 2A3XA 2CGOA 3MLKA 1G6NA 1YIFA 2Z2SB 3JB8A 2YGMA 1POV0 4FPCA 1B09A 3OBRA 1H4GA 3WDXA 3EQEA 2IC1A 2W39A 3WDTA 2R1DA 1FNYA 2RS52 5IUQA 1MVQA 1PNFA 1C5HA 3V65A 5T54A 4AVCA 1NYWA 1O3SA 2ZGKA 3CJIC 3WD5A 5LRSA 1VBA1 5ACA3 3ILFA 4X6RB 1RUOA 1WD4A 5BYNA 5IK5A 4MV2A 3OF1A 3AZXA 1LENA 4Z1VA 1ZM1A 2ZHNA 5JZGB 3AZYA 1VLNA 2WFF3 5C33A 5GLVA 5T5JA 1RUG3 1PO23 4Q0UA 2WNEA 4LBMA 1O5LA 1H4HA 1QJU3 5FLJA 4HKLA 2XBO2 4JRAA 1J58A 4KL1A 3DN7A 1VBD3 2DVGA 1VRH2 5F5QA 2GC1A 1QOSA 4XETA 3A0KA 3LGRA 4P9GA 3JBG2 2R16A 1AJOA 4M3CF 1TNFA 3D8CA 5JZGA 1Z7S3 2HEVF 3R0RA 1UU4A 2O1QA 4LT5A 3VBHC 4MVTA 4AHWA 3J8F1 1VBE1 2MPFA 3VKOA 1AR83 1PGW1 3VHPA 2GNTA 1Q8QA 1WW6A 2YPJA 4MUVA 4YVSB 1R081 2EF6A 2PAEA 3OTFA 3U0ZA 4BIOA 2WS93 3UJQA 4N43C 4YM2A 4KU8A 1X33A 5JSPA 2C1FA 4M3CE 3KCCA 4GALA 1BZWA 4K1ZA 3GNEA 4I0BA 4G3YC 2MNGA 2ZZQA 3AYEA 3WW1A 1AR91 4XFCA 3M4FA 4IETA 4YVSA 4S2HA 5GLUA 2C5DA 4UW4A 4AHXA 4GB33 2VNOA 4NVPA 1YO8A 5C4WB 5JI7A 3SITA 3AZVA 4FPYA 1CGPA 5JOZA 1QJX3 3MDPA 1W6QB 4BZ4A 3WNXA 2OYZA 4HK9A 4Z2WA 2RR12 1H2LA 3UKTA 4YRDA 4CRQA 2B9UA 2WLPA 1PVC3 4HT1T 5C4WA 4F8AA 1PMIA 4HN1A 2GZWA 3D4KA 4AHZA 1N1VA 5AC92 1JYCA 2ERFA 2WC2A 3FUQA 1W6QA 4E2QA 4XMAA 1REEA 2A6ZA 4MZUA 3VL9A 2XKPA 3ZIWA 2FHRA 1S0BA 2VOKA 4LHNA 5CA6A 5A3LA 1YJKA 2R071 3AK0A 4GIQA 1RUJ2 1BK1A 5FTTC 5SV5A 2PHXA 3ZFFC 4FOVA 3ZDSA 5J09A 2YHJA 5FLHA 5GM0A 3KT4A 2WSVA 3N3HA 4IV3B 3TN91 2HWD3 4HVQA 1I3HA 3V0BB 4BMBA 1S0EA 5DUUA 1DZQA 1HQNA 1R091 3MPBA 4UW3A 1W2UA 3DL3A 1V9U3 2WA4A 3EHKA 1COV1 4QX5A 1PK6C 3WVJA 4IV3A 5I91A 3AP5A 1NG0A 3NWKA 4L9BA 1JXNA 1LR5A 3V0BA 3ILNA 1H2NA 4M0NA 2GMPA 1N3QA 1IPJA 3DPRC 4FBFA 2RS12 4OLLA 5GZFA 4I0WB 5HXVA 4FP2A 1U5ZA 1FMD2 1DGLA 1ZBA1 4CDWC 5JPNB 1ZZ7A 2JECA 4DB5A 1YXWA 3MF9A 3QLQA 4HLTA 2GAUA 3OBTA 3ZYPA 2DUQA 3FBMA 2GNDA 1G9BA 3EO6A 4KG8A 2VMHA 3RPQA 4CEYB 2XGXA 3ZYRA 3ZO0B 4AEDB 4DQAA 2CGPA 2JEMA 2XVGA 4ZKTB 2DURA 4GQ7A 1KJLA 2F4PA 4JVAA 4NWVA 4CEWB 2OUJA 4YNIA 1PGSA 2O0OA 2YDEA 4FPLA 3VV1A 1RUE2 4NHMA 2JXAA 5CG8A 2DVBA 3WX5A 3AFKA 4CEYA 3MZHA 4ONUA 3POSA 4AEDA 1AYM2 4FT8A 3B93A 4QM8A 5FO8B 5KHHA 5J98B 3PLQA 3JD71 1EAH1 1HQLA 1O91A 4CEWA 1KFXL 4JQRA 3WCSA 5T55A 1UZZA 4C0BA 2OZ6A 1S0JA 3R4DB 4ISRA 5EYXA 5FO7B 3PJYA 2GC0A 4AI1A 5F6KA 1BEV3 4XMIA 3ZN6B 2GDFA 1AYN2 3W9AA 2OZJA 2VMGA 1FV2A 1KXGA 2AREA 4DY5A 1AR71 1W6PB 2BWCA 5GZCA 1XNDA 3ZXGA 3ZYGA 4FQ4A 1DF0A 1ENRA 2RM22 1X50A 1YUDA 1DHKB 2H6BA 3M3CA 1QF3A 4LTAA 3FMGA 4GH4B 3ZN6A 3RJ2X 5JPMB 2YMZA 5CFDB 1CIWA 3VKLA 1DQ5A 1NE6A 1NLRA 2WWSA 1MR5A 1W6PA 2ZAAA 4CZSA 3WG3A 1OOPC 4TYSA 1IHMA 2ZZJA 3JU9A 2XJQA 1F5FA 2BFUL 5HCAA 4XOGA 3NVCA 1FOD1 1Q3EA 4GH4A 4YGBA 1RL3A 5I0UA 4EWDA 2UY9A 5CFDA 3FUOA 2ZABA 1PHMA 3N7JA 4H14A 5LK5A 2D43A 4P9JA 1V6IA 2DCZA 1LTEA 2WNVB 3UKNA 1Z0HA 4HL0A 4C0HA 4V1PA 4LBOA 1VBA2 3AB0A 5I0RA 4JGZC 2ZX4A 4B4RA 1YHFA 4HKOA 5KC6A 2XG3A 1MZFA 4DY3A 1ENXA 4BIFA 1RGSA 4NN0A 1LECA 5BNNC 2A3YA 2WNUC 5KXEA 3WG4A 2WNVA 3ZXEA 3IT8A 4HMZA 4RL7A 2Q1ZB 2DU0A 1QXPA 1MS8A 2NZ9A 1AR61 3J4UH 3AKQA 4W6XA 4XTPA 3ZYIB 1JUIA 1GKBA 4E4ZA 2BFUS 2D6PA 5C6CA 5HI0A 4ORFA 2DYCA 3G6JB 2GC3A 4P9LA 1LOGA 4AQTA 2G4IA 1XRUA 3ZXDA 2QE3A 3AKPA 2JX9A 3J8F2 2VW1A 1VBE2 1C8M3 1HV0A 1TE1B 2KA3A 1F31A 2SBAA 1R082 2DWRA 2OW4A 3VZOA 3L2YA 1OQEA 1IKQA 4PLNA 4B4PA 5ACA1 2Q8OA 1UD1A 3H9AA 2BGCA 3PVEA 4B29A 2ZACA 4M01A 4DZGA 2WFF1 5FAXA 1Q43A 1CJDA 1RUG1 2V73A 3POWA 1R1A3 2CY6A 3X29B 1QJU1 1IS6A 3O7OA 1H9PA 2UYAA 4QPIB 1C5IA 1VBD1 4YZ5A 3V0AB 3JZVA 2PAMA 2B42B 3VHRA 4WVVA 4HSLA 4YZ4A 1FI2A 1Z7S1 1ZZ6A 4ASLA 3VDDC 2GNBA 3QCWA 3AFGA 1QWRA 2E9QA 1LGNA 1O4ZA 3H1YA 1AR81 2DTYA 4CDXC 3V0AA 2D6LX 1QOTA 1CVNA 4LO8A 2R063 3M1HA 2WS91 2HWB3 3VBUC 3H3ZA 2QCSB 1V6OA 2YZ4A 3ES4A 1B35B 1LOFC 5I93A 5FMOL 2LALA 3H1WA 2AZ5A 4A7ZA 1LU1A 1RTVA 5JR7B 3G7DA 3HBZA 2Y0IA 2R072 2D6KA 4YVWB 2PLV3 5C9AB 2NLRA 2PHLA 3E5QA 1HXS3 4GB31 1LB2A 5IT6A 4FO9A 1H1AA 1LGCA 4Z07A 1SLLA 5DDJ2 1B35A 1QJX1 3TN92 1O4TA 1O4YA 1H30A 1D4M3 1AF9A 3RZZA 4DFSA 1MZEA 1NOVA 4QPGC 5A33B 2ZGUA 3DKWA 2XPJA 3RG0A 3AMMA 1HRI3 3SNMA 4PDWC 4YVWA 4WVMB 5C9AA 1R092 3LSDA 1PVC1 2VOWA 3N7MA 4R8HA 4LO4B 4N53A 1DZRA 4YGEA 2E7QA 5JIUA 2QDNA 4DOUA 3BALA 4YW3A 1LESA 1DFQA 2WL1A 4B7KA 4AFBA 5JOYA 2WQZC 1KFUL 2R49A 4L99A 5A33A 5BY5A 4FPEA 5BUVA 1SBDA 2A5ZA 2IXCA 2Z69A 4Q1PA 3IWZA 4WVMA 4IEVA 3I4IA 1UX6A 4AGVA 4O9EA 5ABJC 1OMIA 1RUI3 3ROUA 4AW7A 1FATA 1VBC3 4PIZA 1ZBA2 1KS5A 3AYDA 2VULA 3DV8A 1WD3A 2DV9A 3D6EA 1YNAA 2G9FA 2ZHLA 4IL7A 1XXNA 3THPA 2ZTNA 5D1IA 1X8MA 1SCSA 2HWD1 1WBLA 5KXCA 1ND3B 3H1MA 1N47A 4GMP3 1JHNA 3AX4A 2ZAHA 2GALA 4FAHA 1Z78A 1FPN3 4EROA 3D0SA 1ULDA 3VBRB 1V9U1 5EJ3A 1RMU2 2RS33 1A78A 3FFZA 1BJQA 4MXVA 3ZSLA 2UU8A 2XWJB 4D94A 1GQHA 4LLOA 4Q4V2 4YW5A 5BPXA 4A7KA 2GU9A 2RHPA 1ND3A 5CFCC 3VUOA 4LLFA 1UAIA 1UMZA 3ZXLA 3VHOA 3GHNA 1EAH2 4GWNA 5JMCA 2DF7A 4RR3B 4WV8A 3VBRA 4Y1XA 3BCWA 5FRAA 1XYNA 4QGLA 1PZ9A 1QH6A