2D5FA

Crystal structure of recombinant soybean proglycinin a3b4 subunit, its comparison with mature glycinin a3b4 subunit, responsible for hexamer assembly
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
487
structure length
383
Chain Sequence
NECQLNNLNALEPDHRVESEGGLIETWNSQHPELQCAGVTVSKRTLNRNGLHLPSYSPYPQMIIVVQGKGAIGFAFPGCPETFEKPQLQDSHQKIRHFNEGDVLVIPPGVPYWTYNTGDEPVVAISLLDTSNFNNQLDQNPRVFYLAGNPDIEHPETMQEGGSVLSGFSKHFLAQSFNTNEDTAEKLRSPDDERKQIVTVEGGLSVISPKWGVEENICTMKLHENIARPSRADFYNPKAGRISTLNSLTLPALRQFGLSAQYVVLYRNGIYSPHWNLNANSVIYVTRGKGRVRVVNQGNAVFDGELRRGQLLVVPQNFVVAEQGGEQGLEYVVFKTHHNAVSSYIKDVFRAIPSEVLSNSYNLGQSQVRQLKYQGNSGPLVNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Plant protein
molecule keywords glycinin A3B4 subunit
publication title Conservation and divergence on plant seed 11S globulins based on crystal structures.
pubmed doi rcsb
total genus 95
structure length 383
sequence length 487
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00190 Cupin_1 Cupin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2d5fA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2d5fA01
4XF9A 4XF3A 2B8MA 4HN0A 3D0SA 2IXJA 2CGPA 5KHKA 3OGJA 3E5UA 2IXCA 5I8YA 3NL1A 1LKNA 4IETA 4QGLA 4AQ6A 4N9IA 2Z2SB 2F4PA 5I0TA 2O1QA 4LA2A 1OFNA 1PMIA 1RL3A 4QM9A 5D1IA 2WFPA 3HT2A 1ZZ7A 4P9GA 3B02A 2Y0OA 1UPIA 1XRUA 1NE4A 3KGZA 1J58A 1CAVA 4Z07A 4KWLA 1YFYA 5JSPA 1YFWA 4XF1A 3NW4A 5BY5A 2D40A 3S0MA 1X82A 1FXZA 3CF6E 3QOPA 4IESA 4JV4A 1EY2A 1X8MA 3OCPA 3VHRA 2QCSB 4XFIA 2O8QA 4OLLA 1CAXA 3I54A 2FQPA 4IEOA 1H1IA 3I59B 1J1LA 1NXMA 3BCWA 1CAWB 4HSJA 4EWAA 4WZCA 5FPXA 1XE7A 2PHDA 2BNNA 3SCFA 3D0JA 3OD0A 4MH0E 4B29A 3MYXA 3PLQA 3S7EA 3SHRA 3SCHA 3H50A 5I0UA 3H1YA 3E5QA 4XFFA 1DGRA 4HMZA 3SCGA 3NJZA 2OZJA 2BGCA 1U12A 1OD5A 1ZVFA 3HT1A 5BUVA 2QNKA 4XFBA 5KBFA 3ACLA 3EBRA 3E6BA 5FLIA 2D93A 5FDBA 1YHFA 2I45A 3RYPA 5I8TA 4IEWA 4HVRA 1I6XA 4FT8A 4GULA 1UIJA 2P17A 2D5FA 4YRDA 4I02A 4N9HA 1VR3A 3IBMA 4YYOA 2IXIA 2WC2A 3UKTA 2ET1A 5FQ0B 4EV0A 2EAAA 1ZZ9A 3IDBB 3EHKA 4BHPA 4NVPA 4MGZE 4ORFA 5FCCA 1YLLA 1I5ZA 2OZ6A 4ZU4A 4K8FA 4LEJA 5JSOA 1PM7A 2GZWA 3DKWA 3FJSA 1GQHA 4BIFA 2KXLA 3KGLA 5KHHA 5LRSA 3H3ZA 3R6SA 3NSTA 4WBBA 5HI0A 4O9GA 4AQ2A 3EJKA 1NYWA 5CVRA 2QDRA 2UYBA 3H1MA 2Q0AA 3LZZA 5F1RA 1CAUB 4EWEA 2H0VA 4O9EA 5J3UA 3ELNA 2V09A 2ZCWA 3H8UA 4FAGA 1HW5A 4X6RB 2PA7A 1CX4A 2K9ZA 5JSRA 3UKNA 4E2GA 5KHIA 4IEUA 3N4MA 2H6CA 1UD1A 5E16A 3DV8A 3IWZA 3O14A 3S7IA 2VPVA 5C8WA 4I01A 1O5UA 2BYVE 1O3QA 1RTVA 4JTOA 2N7GA 2VQAA 1V70A 4BH9A 1TQ5A 1ZREA 4D7TA 3LA2A 3NVCA 1CAVB 3IDCB 2ET7A 2ETEA 3CJXA 1ZZCA 3E97A 3WW3A 1JUHA 3ES1A 4KL1A 1ZRCA 3FWEA 2OYZA 3CLPA 1VP6A 1RC6A 4LTAA 2GC1A 4I0BA 4RD7A 3D82A 2PAMA 1ZRFA 2FMYA 1O5LA 2Q4SA 3MDPA 2CV6A 4AVBA 2Q30A 3SXWA 1CAXB 4D7SA 3H9AA 1J3QA 5I0RA 2XLGA 3E6CC 1XE8A 4MZUA 3ROUA 5FLHA 2XL9A 2PAKA 2PQQA 1WGPA 2DCTA 1EYBA 4MX3A 5LEKA 4PIYA 3BU7A 2GU9A 4KU8A 3LAGA 1ZRRA 1J3PA 4YSFA 3FX3A 4KU7A 4Q29A 3H7JA 2IXLA 5I91A 4PJYA 2GAUA 4HVOA 2GH2A 3ES4A 4L2NA 2UY8A 2IC1A 4I0AA 3RYRA 3WW4A 4HN1A 3BALA 4Z82A 4QXKA 2OPKA 2UYAA 4HLTA 3U10A 3LA3A 1ZRDA 2CAUA 2QVSB 3BPZA 3H7YA 5JCTA 1RUNA 3RDIA 1WA4A 4QX5A 1Q3EA 1ZZ8A 3CEWA 4QGNA 3KMHA 4YNIA 1RGSA 4MUVA 1LB2A 2PYTA 1QXJA 5BV6A 3U11A 4BYYA 4E2QA 4XFAA 2IXKA 3MPBA 4QGMA 3LA7A 1UIKA 2QJVA 2HJIA 4LULA 3OF1A 3H1WA 1SQ4A 5I93A 5FLJA 3BB6A 1LRHA 2PTMA 1Y9QA 3H3UA 5JAXA 5E1RA 4DINB 5KHJA 1L3JA 4XETA 1NZCA 2H6BA 4XF0A 2BNMA 3ST7A 4LLOA 1J3RA 3CO2A 1WLTA 2PHLA 1OI6A 3USSA 2C0ZA 2XL7A 3PNAA 4J1XA 3SMHA 3MZHA 5LRRA 3E6DA 4PIXA 2MPFA 2XGXA 5EFUA 3WW2A 5BPXA 2IXHA 2XKPA 3EQEA 5J48A 4I2OA 1LR5A 2BNOA 4MGKE 4IEVA 1CAUA 4XFCA 1UW8A 1QXRA 2XKOA 4FAHA 3TNPB 4IEXA 5EZWA 4HBNA 1X7NA 1YWKA 3LOIA 4Q0PA 3G7DA 1O4TA 1H1MA 4IEZA 4Q0QA 4OFGA 1CGPA 1ZNPA 3FFQA 4F7ZA 4H7LA 1DGWA 3RZZA 1OMIA 3DL3A 2GC2A 4UXAA 4XF4A 4HVQA 4JTNA 2HKXA 4FBFA 1NE6A 3U0ZA 4L11A 5CADA 4IERA 4QM8A 3GBFA 5I8SA 4LUMA 1FI2A 3LWCA 4R52A 1O7FA 1YUDA 5KHGA 1O3TA 2D5HA 2XLFA 1ZZBA 2Q1ZB 2B5HA 1IPKA 4XFGA 2XLAA 3PVBB 4IEQA 2B9UA 2MHFA 3JZVA 1SFNA 4Q0VA 4UBHA 3I59A 1O3RA 4UBGA 4J1WA 1CAWA 4WVZA 2EA7A 4EROA 4YARA 4ZU7A 2E9QA 3IIAA 4KWKA 4LUKA 5FPZA 1EP0A 3QACA 1UCXA 2GC3A 1EPZA 1RUOA 3FHIB 4AXOA 4I3PA 4KWJA 2Z69A 3CL1A 2UY9A 4XEZA 3EO6A 4F8AA 1DZRA 3GYDA 3HQXA 4META 2PAEA 2CAVA 4LA3A 3DN7A 1YFXA 5I0SA 1SEFA 1FT9A 4I09A 1QWRA 3C3VA 1Q5OA 4CYDA 1Y3TA 4A2UA 3I7DA 4HSLA 4XFHA 5CU1A 4AVCA 2PFWA 3ETQA 4PIZA 3NKTA 3RPQA 1GQGA 2BEOA 3WW1A 3M70A 3KCCA 3E5XA 4MGYE 3RYKA 5K8SA 1J59A 4X6QB 5FQ0A 4TLFA 5J7MA 4MV2A 3KSCA 4Q0UA 1Q43A 1DZTA 1ZZ6A 3M3IA 4ZU5A 2MNGA 1ZX5A 5JR7B 1G6NA 2K0GA 2VECA 4AVAA 5BXXA 5T3NA 1X8EA 1VJ2A 4E2SA 3OTFA 2XHKA 4EWDA 4Q0SA 4MGIE 3L2HA 3FE5A 4QMAA 3RNSA 1YFUA 1IPJA 2GC0A 5LEJA 1O3SA 4R8HA 2ZKLA 2ATFA 3TNQA 2EVXA 2OA2A 4JVAA 5C6CA 4HZFA 4IEYA 5AVPA 3HIFA 3UKVA 3FZ3A 4IEPA 4ONUA 1QY4A 3ZDSA
chains in the Genus database with same CATH superfamily
4XF9A 3UGFA 1GNHA 1ND3A 3OEBA 4HN0A 3ILRA 1ENRA 3ILFA 5FZ9A 3IPVB 4CRQA 1WA6X 5FY0A 3LPFA 2WNVB 3ITQA 1GNZA 2J1VA 3E5UA 3ZKUA 3OBRA 2WJSA 4IETA 4CCMA 4Y20B 3UV9A 2VVFA 1V6IA 5JLVA 1ZBA3 1HRV1 4KWUA 1US3A 3ZX7A 4P5YA 4Q8KA 1JW6A 2CNAA 2V5YA 3AFKA 4GMP3 4LA2A 1L7LA 1PMIA 3QD6A 1NA1C 2ZHKA 3JBG3 3O7OA 4CDQC 2ZEZA 5FYMA 4Q5OA 2WT2A 3IM0A 4QX8A 1IPSA 4XMAA 4DUWA 1U5ZA 1ZZ7A 1W3XA 5FY8A 3B02A 4NAMA 1FNZA 1XJAA 1N3QA 3BIWE 1RUC3 2G1MA 5KXEA 4XCAA 5A7OA 3LOBA 1MZFA 2VNOA 1NE4A 4XHBA 3KGZA 3B93A 3VHOA 2D6MA 3VKOA 1VB2A 4NIIA 4Z07A 2V4AA 3VBSC 3ZXJA 3LEGA 4R4XA 4BQ5A 1QQP1 1JHNA 3NW4A 2ZBJA 5FZIA 1Y43B 1NT0A 4JZRA 1FAYA 4DQAA 4AOCA 1W8ZA 3S0MA 1YI7A 3VZJA 5IVEA 3T1MA 2VZPA 3ZSMA 5FKCA 2OX0A 4XBQA 1W8NA 2ZZQA 2CDOA 2QCSB 4XFIA 1NOVA 2O8QA 1AYM3 1HB3A 2VXJA 1CAXA 1PGW1 4Q4W3 3ON7A 3LFMA 5FYYA 1NCQC 2FQPA 1H1IA 3N35A 4K21A 1TG7A 1C8M2 1MEC3 2UU8A 4HSJA 4QX7A 1MZ6A 1DF0A 2LALA 2Q8DA 3SISA 4XQ4A 2FDKA 2E32A 5FPAA 2WNUA 3NAPC 4OMCA 4OMDA 4B29A 1RUG2 3PLQA 4QQ2A 3ZDVA 4Y4RA 2ZAHA 3N7MA 4M4RA 3H50A 3SCHA 4Q27A 1K5MC 3H1YA 3WV6A 4YGEA 2XQXA 3WNNA 4QXBA 3POFA 4HETA 2OUHA 2WKKA 1XNCA 4NHMA 4QXCA 3SCGA 3WF2A 5LY1A 2OZJA 5FJKA 5LWBA 1PO23 4IL7A 1IS4A 1UY0A 2C1FA 2A3YA 1WLWA 4Y22B 2AZ5A 1EV11 2QTWB 3J7LA 5A33B 2K46A 2CWSA 5KBFA 5GM0A 3Q8BA 3FHAA 1ST8A 5GZCA 2ZGTA 4OUEA 1JZ2A 2ZMNA 2D93A 4ATFA 1EAH3 3OG2A 3RZKA 3GALA 3HEIA 3LFIA 2HEWF 5F5QA 1I6XA 2XVGA 3DGTA 4M3CE 5FPVA 2ZJCA 4PI2A 4CDWB 1KFXL 4GULA 4AW7A 1JI6A 2RS53 4CDWC 5C9AC 3RJ2X 1KJLA 4XBNA 4MGTA 2BWAA 1VR3A 1XU1A 4CPBA 2IXIA 2R073 4GD4A 1AR71 1UYYA 2HEYF 4HPKA 5D21A 2GMPA 2XWBB 3U07A 5L7OA 3J8F1 1CIYA 1ZZ9A 3IDBB 4UT5A 4QWNA 3RZMA 2RMU1 1R1A1 4GWIA 4HONA 2PLV1 3MICA 5LK5A 2VZTA 4GMP0 3ZM8A 5IWFA 1PGL1 3MIGA 4CDUB 2XBO2 4HXCA 4AHZA 1BJQA 5EYYA 1PO11 2EALA 1APNA 2GNMA 2VXRA 5A7WB 1UMIA 4K8FA 2Q8OA 4CDUC 1SPPA 4CCJA 1M4WA 2Y34A 4IE5A 1WUVA 1RUF1 1HN0A 5FZAA 3FJSA 1OC1A 1OHFA 2VBPA 4BIFA 3KGLA 2DFCA 4MGQA 5FZMA 1NKGA 2BGOA 3N9LA 1D4VB 5LRSA 4FFIA 2Y6FA 3H3ZA 2ERFA 5CNAA 2WSVA 5DMYA 4RYDA 2B9VA 1LHVA 3POYA 2WZR3 3WNOA 2XJQA 5FOBB 4FOWA 1QDCA 1F5JA 2DWRA 1BCXA 1VRH3 2EXJA 4E8CA 5JMOA 3F95A 4RFRB 4WVMA 4CVUA 1LJ7A 4JKMA 4YM1A 3WF0A 2CYFA 1CWPA 1AR81 2ZOEB 1R093 4B4QA 1ZBE2 2H0VA 1MR5A 4NPLA 1RINA 2WFF3 1LOEA 2V09A 3LQCA 3BUCA 3H8UA 1X50A 5EP9A 3ZFEA 1D2SA 2HWE3 3T3YA 2W39A 5JSRA 3UKNA 3KF3A 4E2GA 3SEPA 2QKDA 3OUIA 4IEUA 3LEKA 4NAOA 4XJAA 1ULDA 1GP5A 4BQ2A 4YVSA 3ZN5A 1CZSA 2TBVA 2UURA 1ODMA 2B42B 3O14A 3MIHA 1JOJA 5IAVA 1U5IA 4I01A 1O5UA 4AWDA 1O3QA 4A3XA 1W6OB 1RUI3 2OPWA 5A3LA 3KM5A 4LBOA 2RVAA 2N7GA 1C5IA 5AC91 2ZX4A 1V70A 5F8PA 4HT1T 3I3EA 1W6QA 1Y9MA 2W1QA 2Q1MA 4LOTA 3AFGA 3OPWA 4AFAA 2JENA 1UZYA 3K3OA 3WF4A 2P6HA 1UU5A 4D7TA 2R041 3KB5A 2VR4A 3CJXA 1GMMA 4QPIB 4M4PA 1ZRCA 4DFSA 4BM8A 4QPIC 3AMPA 4UF0B 5FUPA 2F6BA 3AP6A 3ZIWA 1UY1A 3FMGA 4GB32 4W50A 4HOOA 4XTPA 5FWEA 3POJA 4JGZB 4RD7A 3ZYPA 4D69A 5F3CA 3LKJA 3D82A 3WQ1A 1PK6B 2CGOA 3TB0A 4CCLA 3TN91 1BYHA 2E33A 1PK6C 3MDPA 1GOFA 3JBG2 2DTYA 1JYXA 3JCIA 2WAOA 2EAKA 3LSEA 3ZPOA 2OQ7A 1PZ8A 4Q4V1 2ZX2A 3GM8A 2VULA 2G19A 1QJU3 2ZGUA 1LGCA 2XL9A 3IDEA 2ZXQA 2DURA 1TME3 5BNOB 2PQQA 3ZYIB 5DAVA 5BNOC 1SDDB 2P4EA 2DBIA 4PIYA 5DDJ3 2XONA 1N1VA 3POEA 4FOQA 3FL7A 2TUNA 4IQPA 3I2GA 5K0UA 2QQWA 5ERLA 1YYNA 4SLIA 2JKBA 2BVBA 3LAGA 1ZRRA 3KHCA 1F8VA 2YGLA 4IE0A 4XUPA 1LHNA 3FX3A 4ZS2A 2JDYA 1W28A 2GAUA 2QQMA 4LBQB 1S0BA 3ES4A 4I0AA 1CZTA 3RYRA 4UFHA 4Y1UA 1OQDA 4QXKA 2DFBA 1T6GC 3U10A 1LOAA 1FNYA 2OS2A 3VBHB 3ACIA 5C33A 1WCQA 1MQTC 3RDIA 3VBOA 5F3IA 1JOBA 3VBHC 3ZSEA 4BISA 2UWBA 2PELA 4MHUA 3CEWA 1HLCA 4QGNA 1PVC2 4NR1A 2GMMA 5GZDA 1BEV1 4GJZA 4PBOA 3ZYGA 3B00A 2CWMA 1FPN2 2VMHA 1RGSA 1POV3 4MUVA 3GHMA 1GZ9A 1MACA 1PO22 4YGBA 4WZFA 5FYIA 4L92A 3MPBA 4C91A 1BMV2 4WM8B 4QGMA 4D3WA 4R9BA 3VBRB 1BXHA 4Y5SA 1SHWB 3LA7A 5GZEA 1UIKA 4LXLA 4LULA 2YBPA 3ZSJA 2P2KA 3VBRC 3OF1A 1SQ4A 1LOFC 3MIDA 2HEVF 2XVKA 3BB6A 2PTMA 1C28A 4ZY9A 1Y9QA 3H3UA 1UZWA 4LE4A 5JAXA 3S57A 1GQPA 5DXDA 5FV3A 5C8CC 5KHJA 1L3JA 4XETA 3MO4A 1C1LA 5HPOA 1F2NA 1JU4A 4G4FA 4QPYA 4CP9B 3ST7A 5FBZA 4TTGA 3RZGA 1VPHA 2CY6A 2PHLA 2RS52 3RWKX 3USSA 2C0ZA 1W6MB 2XL7A 2TEPA 4NPRA 5JIUA 4GA9A 4XACA 1NLQA 2R072 5FZDA 2JDPA 2VZSA 3E6DA 1QOOA 3TOJA 4OI2A 1XOYA 2BQPA 1PVXA 1YO8A 3WW2A 3V64A 2IXHA 4V2WA 3FHQA 4M00A 2XKPA 2XR4A 3POIA 3A7QA 4CP0A 5BNQA 5I0DA 4RHV1 4W4ZA 3PJYA 4MXWB 1QJX1 2R6QA 1HV0A 3W59A 1JYTA 3A4UA 2VMCA 1CAUA 3IPVA 4IEVA 4XFCA 4IV3B 4C1XA 1MVEA 5LCWL 2RHPA 2WNVA 5JPMB 1UW8A 1QXRA 2XKOA 4IV3C 4NRPA 2Y6HA 4Y20A 1DCSA 2VNVA 4AG4A 4QAWA 4OI0A 4Q0PA 4FTEA 4OUSA 2I07B 1IHMA 1O4TA 1WBLA 2E26A 4Q26A 1H1MA 1OA3A 4YZ3A 5FZ8A 5IVFA 2W08A 1WMDA 5IVYA 3VDBA 4AQSA 1RUH2 3JU9A 2EXHA 3PUIA 4YW2A 1NG0A 1OD3A 3NNJA 4F7ZA 2W94A 4WM7B 4CCKA 4OHWA 1QIQA 3MV11 2GC2A 5F39A 3AZVA 3H3LA 4NWWA 3O1SA 4XF4A 3EB7A 1UYPA 5FMOL 4AI2A 2C4XA 3IDAA 1T6BX 3I2IA 3NMBA 5A3TA 1OQEA 3K3NA 1D4M2 3P1IA 4AI9A 2ZGQA 4XZUG 1MVQA 4OHYA 3KHBA 4E4DX 3NJXA 1X36A 3GBFA 3GCWA 2YUEA 4K7JA 3QH6A 3NV1A 1FI2A 3LWCA 1H2NA 3SEEA 5ANNA 1O3TA 2R32A 3AZZA 2LS6A 3CU7A 1EV13 4QPGB 2BVVA 3S30A 3VZKA 1GFF2 3UYJA 3ZYHA 2DCJA 1POV0 1COV1 1S2BA 1X9PA 2J22A 2RDRA 5IUQA 4AEDC 1ZYBA 2PQSA 1UF2C 2RR13 4Q0VA 1TVGA 4GAZA 5T54A 4QX3A 1P8JA 1LNSA 3D6EA 1F31A 3O1UA 3CBNA 1UNBA 2D44A 3R4DB 4ZU7A 1OKQA 5DZGA 5F7UA 3MLKA 1CVNA 1VBD2 2QZ2A 1OLME 5FY9A 1EP0A 3QACA 2DVAA 1AR73 1GV9A 4UFMA 2P5BA 3J8F3 2VY0A 1JZ8A 4DMIA 2A6ZA 1V6LA 1R1A3 2RMU3 4QU1A 1WCUA 3USUB 3N7JA 3PUSA 2UY9A 4Y22A 1IQAA 3CKHA 1S4CA 3EXUA 4QKFA 1DZRA 3RSJA 4F8AA 5IVBA 4UW3A 4OVEA 5A33A 1PO13 4K1ZA 2W52A 2RM22 4LA3A 2BDRA 1RUF3 4GQ7A 1QF3A 4I09A 1QWRA 5JIAA 5HBAA 4CYDA 1W03A 1AR61 5FZLA 1GWLA 2VUDA 2YFZA 4FQZA 1YQ6A 2XJRA 4HSLA 3C8XA 4IE6A 4K3UA 3TEYA 1KRIA 2NMOA 4CDWA 5C9AA 1PVC1 3C7GA 3N7LA 4YW3A 3NKTA 1J84A 2J1SA 1T2XA 1XU2A 2XVLA 4GIQA 2HYXA 1UZ0A 3WW1A 3WUDA 4YM0A 4CUCA 5FJHA 5FK7A 3VDAA 4A7KA 1J59A 4X6QB 1AXYA 1AR83 1FMD2 3OY8B 5DG1A 1BMV1 2XJSA 1LESA 1IOAA 4AHWA 1SLCA 1RMU1 2CGNA 4Q0UA 4DXSA 3RZHA 1YQ8A 1AL21 1S55A 4CP1A 1ZX5A 1GKBA 4LLFA 5JR7B 2YU1A 3KV4A 4CDUA 1V6MA 1LHWA 4MSVA 4G9SB 3WG3A 4BQXA 5A7WA 3OYWB 3VD7A 1YC61 4E9KA 1VJ2A 3OTFA 1CX1A 3MFCA 2ZMLA 5CYYA 1PNFA 2TNFA 2Z5WA 2JDMA 4EWDA 5ABJC 3R4SA 4FCAA 1UY2A 2P3KA 5GLVA 4YW7A 3GJAA 5H9RA 2W0XA 2VZOA 3FE5A 4MGIE 2E53A 2A1XA 3RNSA 4WVMB 1YFUA 1IPJA 3SKVA 1WW6A 3WG1A 2WT1A 1ASJ1 4O65A 2ZKLA 5FAXA 5BNPB 2ID4A 5FYHA 4MOAA 5E6HA 3AP5A 4CEYB 1OPMA 2AR6A 4IEYA 5ACA2 2ARBA 3PIGA 1A3KA 3NJYA 2XMLA 4LO5B 4B7KA 3UKVA 4EN0A 1H8VA 4IEPA 4ONUA 1QY4A 1JYIA 2W87A 2R043 4N43C 1Q56A 2FCUA 3DUIA 4FPHA 3D0SA 2IXJA 4AGVA 4NIHA 3HJRA 2BU9A 3KV6A 4FXGB 2DVFA 4KNCA 1G9FA 4N8MA 1MS0A 3ABZA 3AX4A 4FTBA 2IXCA 2JE7A 5DAXA 2VZ3A 1HRV2 2WT0A 3OBZA 5DAWA 3W20A 4D94A 4FOVA 1LGBA 2VG9A 1S0GA 3TN93 1C5HA 2F4PA 3WZ1A 1H2MA 2ES3A 1URXA 2FHRA 3POWA 4Q2FA 1UPSA 1UOFA 1C8M3 2BWCA 4Q4V3 4BLIA 2QQNA 1W6OA 1XNTA 3VKFC 4QM9A 5FP4A 1XSRA 4FPOB 3RJRA 3TAYA 5FZFA 4RGGA 1DDLA 1HQWA 1QOSA 2WL1A 1RUG3 2Y0OA 1Z7S1 4IGOA 1CONA 1QQP2 1J58A 1POQA 3AM2A 5EXOA 4DO0A 4NRMA 2JJ6A 4QPIA 4RA0A 1XE0A 3KF5A 5JSPA 5A70A 1YFWA 3O1PA 2ZKNA 1B35B 3N9PA 3MBWA 4UF0A 1BVVA 1AX0A 1WMFA 4W6WA 5A6YA 3BIEA 5FZBA 4JGZA 5FFOC 3CF6E 3QOPA 4LMFA 2WO1A 3VV1A 1PK6A 4M0HA 1X8MA 1PGW2 1GWKA 5CAZA 3B94A 3VD4A 4PQ9A 2D98A 3KT7A 4NOTA 4QQHA 1SLBA 4IEOA 3I59B 1SLAA 2FBEA 4L97A 3CQOA 1NXMA 3BCWA 2BBAA 1CD3G 4EWAA 2A6VA 2ZEYA 1JU3A 3B69A 5BNOA 1LEMA 4BOWA 2BNNA 1UMHA 3SCFA 1BEV3 3OD0A 3Q8FA 3FLPA 5BNNC 3MYXA 4GWMA 1V6NA 3FBYA 1PGSA 2DUPA 5CKMA 1UZZA 1A34A 3GZUC 3VL8A 2LUWA 3I4IA 1J83A 5FUIA 3ORJA 3NJZA 2Z4FA 2JDKA 5HCBA 3T09A 2XBO3 4A45A 1AJKA 1QMJA 1V00A 1U12A 1OD5A 3HT1A 4FPKA 4R4ZA 1HN1A 1AF9A 1X9TA 2RM21 4LBQA 5EJ1B 5BUVA 1VALA 4DEVA 4JQTA 4QHBA 3LEIA 4XFBA 1LOGA 3ACLA 3EBRA 1EPWA 2VOKA 1LHOA 3ZYFA 1IS5A 4AVTA 2D6OX 1AR91 3VBHA 5FDBA 5GALA 5F6KA 4HVRA 4N90A 3RGBA 3W5MA 2YROA 4NO4A 4FT8A 4V2VA 1UIJA 3BPSA 4C90A 1IZ3A 1NZIA 3PURA 3T0DA 4ZXEA 4YRDA 2G9GA 4N9HA 1OT5A 2Y6GA 2ZTNA 2WWUA 1FMD1 5EJZB 1ZM1A 5A6ZA 3MW4A 1OOPB 3OEAA 1D0GA 2RMU2 4FI9A 5CG9A 5FY7A 2PLV2 1AYN1 1WW7A 1XPWA 3DKQA 5JOWA 1PGL2 4AI0A 3VN4A 4WM8A 2IZWA 4E4SA 3VBRA 3BTXA 4RHV3 1GBGA 1LOFA 1YQCA 4JGYC 1QJX3 4ORFA 1VAMA 5FIXA 1PO12 2AACA 2YDEA 1I5ZA 2ZEWA 3KZ4C 2GMEA 3ZR6A 4CU9A 5FK8A 4A41A 3Q8CA 4AVVA 1PNGA 3F2ZA 5JSOA 3PMSA 1DYPA 3D4KA 4LHNA 2YB7A 3DKWA 5FXVA 4BU2A 4UOJA 3I2OA 1GQHA 1N1YA 4CEWB 2AUYA 1NLRA 2FMDA 3S6PA 4CP9A 1XBFA 3K4AA 4CEWC 1XC6A 4Y1YA 1PIV1 5FY4A 3T2TA 2PHTA 5JMCA 1W6MA 4N53B 3H8XA 3NSTA 3OGSA 4D0QA 4AQ2A 5CIRA 3CJIC 3EJKA 3SH4A 3B01A 1AR82 1NYWA 4BQ4A 3NJVA 2UYBA 4JC1A 1PX3A 1RUD1 4OYUA 1HB4A 4XHXA 2Q0AA 3LZZA 3URFA 1CAUB 2FCTA 4ASMB 2P6CA 1MS8A 1GZTA 4EWEA 1VMJA 2R061 3JQXA 4O9EA 3SH3A 1QXPA 4MXWA 5J3UA 3ELNA 1C1FA 3M3EA 4OCTA 1WLCA 3OUJA 2YV8A 2WO3A 2ZCWA 4IV3A 4Y5Z0 1HQLA 2DBNA 2VMEA 4GB33 2PA7A 4X6RB 5FP8A 2K9ZA 1O91A 2RS31 1GNYA 3LDKA 4DUVA 1NA1B 3BN6A 4CDQB 2UWCA 2H6CA 1UU4A 2DYCA 3WNXA 2D6PA 1GZWA 3VBFC 3O0WA 5A1AA 2XJPA 3CMGA 3IWZA 1COV3 2W5FA 5F3EA 2GH8A 3ZN6B 2EIEA 3DYPA 2A3WA 4WM7A 1N3PA 3I97A 3I3BA 5JOZA 2YC0A 5AC92 2D6NA 1MPXA 1QEXA 1RTVA 3VBSB 4CE8A 5C3SA 2R49A 2VQAA 4HG6B 3OPTA 4PLOA 2R042 1W2UA 2KM2A 1Q8QA 3LA2A 4BMEA 4DXTA 4Q4X1 3NVCA 4FPLA 4BK4A 1GANA 2ET7A 2ETEA 2VZQA 2H0BA 2XHNA 4LHSA 4NMIA 4W6XA 5LATA 2NM1A 2I2SA 4KL1A 3BTYA 3FWEA 5CKQA 2OYZA 2E7TA 1SBDA 3WP3A 2WLPA 4XDQA 1RC6A 2ARAA 2HWB1 4IGPA 2GC1A 3TN92 4B7EA 2R0HA 1LENA 1NCQB 4K9SA 4QPGA 4JDMA 1NX9A 5JZGB 3ATGA 3VDCA 4Q4V2 3RI9A 2FMYA 1O5LA 3LCPA 4RS5B 4UFKA 3O1MA 3JD71 2CV6A 2F17A 5JZGC 3NAPB 5CA6A 4AVBA 5CFCC 4RS5C 1W6NB 3SXWA 5A1FA 4D7SA 3I3MA 2J1AA 3H9AA 2XLGA 3C7OA 2D3PA 4D7YA 1XE8A 3P5BA 3IN9A 3ROUA 1K5MB 2EIBA 3MF9A 1PVC3 3O12A 1TMF1 1ULEA 4CZSA 4RR3B 2RV9A 2WNEA 1FPN3 4RR3C 3W58A 2Y6JA 3N9QA 5IVJA 3CDZB 5LA1A 5HXVA 1OH3A 5DAPA 4LPLA 3VLBB 4A4AA 1IQDC 3VDDB 3AKRA 4KGQA 2ZX1A 2EIDA 2GU9A 2VZRA 4LIUA 3AZWA 2Z79A 3USUA 3VDDC 1J3PA 2VCBA 5D8AC 2NMNA 3H7JA 2E31A 1HB1A 2IXLA 3FN9A 4Y1ZA 1VIWB 3SKJE 1NQDA 4M3CB 2IWGB 2PXJA 3I3QA 3T1LA 3J7NA 4AFDA 4P9IA 3ZFFC 4YZ1A 5K9YA 2UY8A 5T5LA 3RFRA 1BQPA 3N7KA 4BJ0A 4XXAA 2W92A 3M1HA 4CUBA 3T2QA 5C3RA 4FSJA 2NPIA 3J26N 4HLTA 3S5AA 2CAUA 2QVSB 3BPZA 4LKFA 4RN5A 3H7YA 3O1OA 1TEIA 4XAAA 3DXUA 3VKLA 4BIOA 4JQRA 3ACFA 1BEV2 3PU3A 1ASJ3 1Q3EA 1W90A 3IB3A 3MW3A 4FXKB 4AI8A 4YNIA 1CJPA 4PF1A 3OBAA 3Q9OA 5T52A 2ARCA 1REEA 3OY8A 4BK5A 4FPFA 5BV6A 4OUMA 4IUGA 4E2QA 4DY5A 5FZ0A 1KEXA 3ASIA 4COZA 3O1TA 3RG0A 4ASKA 2AEZA 1F9KA 4IV1C 1QJZA 3HVDA 1S0CA 4S2GA 5J98B 3ZR5A 3WF3A 5KWRA 2JWPA 5LW9A 3BI3A 2BUKA 5FLJA 5I93A 1LRHA 3OYWA 2W9XA 2O8OA 1CZVA 3A21A 3N9OA 2O0OA 4OHVA 1D0HA 4YGDA 3FLRA 1QNWA 4NIDA 4ZS3A 4R9CA 2WZEA 1RUH3 1LOCA 1W8TA 3HMYA 1WCSA 2OIIA 3CO2A 1GSLA 5A32A 2VW0A 3AL6A 4MXVA 3T4HB 1ENXA 3MZHA 2QBXA 1G7YA 2ILMA 2WO7A 2YC4A 5A1LA 2VW1A 5BNPA 3IMMA 2V73A 4CEYA 5LRRA 2A6YA 2A6WA 4PIXA 4C1WA 3B7MA 3CZUA 5EFUA 1D4M3 1QJY1 1H2KA 2VCAA 4RHV2 3AMHA 4ARXA 3WLUA 4DY3A 1Z7S3 3PDQA 1QJX2 3I2JA 2B7YA 3K51A 2FD8A 5KXDA 2W1UA 5DAQA 1LR5A 3H8OA 4L8QA 2NLRA 4MGKE 3RQ0A 1TNFA 2IVJA 5E88A 3IT8A 5FY1A 2DUOA 4K8RB 1JTZX 3VZMA 4CXYA 1QOTA 1X7NA 3VBUC 5FWJA 1YQ5A 1SDWA 2YXSA 2R0FA 4IXLA 4QT6A 3VD3A 5JUVA 3UGGA 4XZPA 3I2HA 1ULPA 4Q0QA 1W8UA 4OFGA 1OVPA 3RZJA 3MIFA 2JG8C 4XBLA 4B1LA 3MIBA 4DUXA 1CGPA 1XYNA 1GU3A 1U5XA 1IG3A 5FYVA 3DL3A 1E5IA 2ZEXA 2FDHA 4JDOA 1SBEA 5A7PA 4FTSA 1W2AX 5C9AB 1VBD3 1C8NA 4HKWA 4JTNA 2HKXA 4XE9A 4FBFA 1H0BA 2VQTA 4AF9A 4K40A 3ACHA 5CADA 5M0TA 3UJOA 1OXCA 2QQVA 5HCAA 2B39A 4ZPIA 3HNMA 1B35A 5I8SA 3WCRA 4QU2A 4D6RA 1O7FA 2HH9A 1YUDA 1AJOA 2QZ3A 4COUA 4J25A 5FZKA 5LA2A 2VOTA 2XLFA 5KHGA 4O7XA 1CPMA 1FV2A 3B9CA 4YVWC 3T0BA 3SQOA 1ZZBA 3FBMA 2RM23 5SV5A 1IPKA 1COV2 2WA4A 2XLAA 3PVBB 4IEQA 2Q1FA 4NRQA 4X8NA 1AZDA 3OGRA 1KXGA 3TBDA 1JBCA 4DXRA 2GN3A 2JDNA 4FPGA 2ZGMA 3AMQA 3JZVA 1W9SA 4IDZA 4JCKA 4Y33A 3WINE 5FYCA 2XG3A 3HAGA 3I59A 2J7MA 3K2OA 4J1WA 4E27A 2XJVA 3J7HA 2AH2A 5LBCA 2EA7A 4UAPA 3I8TA 4LO4B 3PU8A 3WNLA 4CDXB 5BNNA 1OF4A 2WSUA 1JHJA 1QJFA 3AXEA 3OOXA 1UY4A 4AHXA 4CDXC 1QH7A 1S0JA 3GF6A 3AZXA 3IIAA 4LUKA 5FPZA 1FMD3 1UCXA 1WKYA 1LECA 1UX7A 1EUTA 2P1BA 3AKQA 4Y4YA 3AKPA 1RUOA 1AYN3 4DS0A 5A7QA 1QDOA 4QKDA 2NN8A 4Y5TA 1VBA1 4I3PA 1ENQA 2HYKA 2XB6C 4MO3M 2YHJA 4KWJA 5CZKA 3ZPYA 3MGUA 4XEZA 4K6BA 1SZBA 5HCFA 3VUOA 1MQTB 1H9PA 3A22A 1UKGA 2PAEA 5FTTC 3IAPA 4OI1A 4D6QA 1AR62 3DN7A 1YFXA 1FYUA 1NLSA 2SLIA 4INDA 1FT9A 4CU6A 2CHHA 4GALA 3C3VA 3BVCA 2WZPP 1JZ3A 2B4KA 5CU1A 1PIV3 3PHMA 4AVCA 2PFWA 1YXWA 4L0PA 2HBUA 5C7GA 2YZ4A 4TZDA 5FZ4A 4PIZA 3WD5A 4FP2A 1DIWA 5JOYA 5ACA3 3POBA 2P3IA 2OT7A 4FFHA 4P9JA 3RYKA 1OOPA 2PMWB 3E5XA 1RMU2 2JICA 5J09A 3ZSLA 1AL22 4WVVA 5DG2A 4HANA 3L9JT 1UYXA 3KSCA 2R063 1Q43A 3W9AA 5JPNB 1W8WA 5C8CB 2PHFA 3M3IA 2FDFA 4HKOA 3DXTA 1ND2C 3VB9A 2XPJA 1G6NA 4LBJA 1GWMA 2VECA 3PL0A 1PM4A 4AYUA 3DPRC 1ODNA 1HRV3 3UJQA 5BXXA 1DQ5A 5T3NA 2RS33 3WNPA 4MLOA 1PMHX 4URAA 5FPUA 4CEWA 2X8KA 3EMRA 1VBC1 4LR4A 1ONAA 1FATA 1K45A 4OI4A 4W65A 1O59A 1WWYA 2P3YA 1ASJ2 3UNPA 3TEZA 1CJDA 2VNRA 4JAAA 5C3OA 3L2HA 1JS9A 4YW1A 1LAJA 4N53A 4Q1PA 1GUIA 4RFT0 5LEJA 1O3SA 4BQ3A 4K1YA 4DPNA 4XJ9A 2ATFA 5JI9A 1OH4A 4ZZ8A 3NRUA 2YPJA 4XQDA 5GLUA 1UWWA 5DUWA 2GNDA 1UZVA 1ULCA 1W2NA 4LKDA 1FX5A 2ADEA 3CZJA 3U1XA 4JHZA 5L19A 2YFUA 1LU2A 1QQP3 1Q8PA 2GALA 2DU0A 4XURA 2BBVA 3ZDSA 4W8JA 3ZMNA 1S0IA 1KJRA 1G86A 4Y3OA 2CGPA 3ZXDA 1H4HA 2P34A 5JXGA 2JB4A 5KHKA 1H8TC 1UOGA 2R7EB 4BQYA 5I8YA 1BVP1 1GZWB 4B4RA 2HWB3 1LKNA 4LITA 3HPNA 1NA1A 4CDQA 1WZXA 3GDBA 3KCYA 4QGLA 1ND3C 4AQ6A 4N9IA 2WYFA 1D2QA 3SH5A 2BPA2 2Z2SB 3T08A 3WDUA 3IIIA 3IKWA 3ZFGB 2YYOA 1SLTA 1OFNA 3ZN6A 3ZFGC 3AVSA 4H3WA 4I0WB 3AYAA 4QKBA 3OSDA 4QB6A 5D1IA 1KGYA 2WFPA 3VBSA 1Z7S2 1TMF3 1W9WA 2VZVA 4CCEA 3HQUA 1YJLA 2IVIB 4RSUA 2CU5A 4H55A 1SG3A 1UPIA 1W3VA 4P9LA 1SFYA 4QX1A 3RZZA 1XRUA 4YM3A 3POGA 1HXS1 2E7AA 4P9XA 2JEMA 4KWLA 1YFYA 1OVSA 3AYEA 2X09A 1Z78A 2BP6A 1RUE1 1FOD1 2X05A 3BTAA 4CCOA 2XUEA 4PQQA 5L9VA 1HX6A 3FUQA 3K4DA 4FPYA 3MLJA 3UK9A 3WDTA 4AEDB 2RDNA 1X82A 1FXZA 1NCQA 2W68A 4GKXA 1RITA 4JRLA 3WOGA 4JV4A 1EY2A 2QQIA 5JZGA 2BGPA 3OCPA 3VHRA 1A78A 1DGLA 3LDRA 4RS5A 4BQWA 2R1BA 3NAPA 1US2A 1G9DA 1W6NA 5FUNA 1ZBA1 5JXIA 4QDSA 5IT6A 4BQ1A 1J1LA 1K5MA 2XWJB 4E8DA 3ECQA 1CAWB 2A7AA 4S2HA 4QKNA 1WBFA 5L36A 1I1EA 4RR3A 4WZCA 4XJ8A 1RJ7A 1XNDA 5FPXA 2PHDA 5T50A 2MEV1 4DIQA 2XJUA 3AL5A 3D0JA 2XUMA 4LQRA 4MH0E 4B3NA 4BDVB 1BBT1 2PLV3 2WQZC 3S7EA 1WD4A 5EHDA 3KS7A 4NIAA 3EYPA 3VDDA 2IFWA 1RUC1 1OLRA 4XFFA 1DGRA 1V9U1 4JRAA 4YG3A 3ZVXA 5HV0A 5GZGA 1H30A 1DYKA 3AVRA 4M3CA 4BE3A 4U36A 2ZGSA 3WP4A 1AR92 2WDBA 1LEDA 1O4YA 3GNEA 1ENSA 2D3SA 1UKRA 1VRBA 3E6BA 3D8CA 1DQ0A 4COYA 5IK5A 2QUOA 3DF0A 5LA0A 3QCWA 3E1F1 5EV7A 3RYPA 2GDFA 3NNLA 5I8TA 2Y64A 4TXWA 2DVBA 1HIXA 3M3OA 4Q4W1 4FP3A 1SBFA 4K20A 2P17A 2D5FA 3H8RA 3VKMA 1AYN2 1MEC1 3OJBA 5A3WA 1O6UA 4YYOA 4ITCA 4BA6A 4DOUA 2VUAA 1G9CA 5FQ0B 2D6KA 1OF3A 1PZ7A 4NVPA 3V0BB 1W2TA 5ABJB 2XOMA 4P00B 2CSGA 1SFPA 2OZ6A 1QNYA 2W46A 1AL0G 4CA9A 5GJ6A 2VUJA 4LJHA 4NROA 5L7OC 2HWC1 2HWF1 5A32B 1DGRN 2GNBA 3THCA 1KFUL 1OFSA 1PIV2 2KXLA 2OXBA 3MF6A 4KG0A 5H9PA 4BPZA 1JZ6A 1OUXA 4CU8A 1K5JA 4YW5A 2A6XA 3R6SA 4PDWC 2QE3A 3ZLIA 1MS4A 5AC93 5HI0A 1IGOA 4O9GA 3K46A 2IFRA 3HN1A 4N43B 4YLZA 4PLMA 1HRI1 1EAH1 5KC6A 4AFMA 1RUD2 4LBMA 2DCKA 2BZDA 2R062 4HL0A 4HK8A 3H1MA 2GP5A 3O1RA 5FOJB 2NYYA 3IAQA 2ZHLA 5H9QA 1PZ9A 1Y4WA 4L99A 4PCRA 2A70A 1W0PA 4AEKA 5B2GB 5J1XA 2WRAA 2ADDA 1K12A 5LASA 2RS32 4TYSA 2XJTA 4RGAA 1YJKA 1HW5A 3KQRA 2WWJA 5J36A 2R16A 5EJ3A 1Q8SA 2WBKA 4QDRA 1JODA 5KHIA 1KITA 2OQ6A 4A6OA 2ZGKA 2JG8A 3M7AA 1S2EA 1UYZA 1VBB1 2Y0IA 3ZFEC 1PMJX 1BHGA 1JN2P 1KS5A 3IMNA 3WF1A 1RJ8A 3RS6A 3WNKA 4XIOA 2BYVE 1LOBA 1JYNA 2V72A 4O61A 3WHTA 1YIFA 2VQ0A 2C24A 4PF5A 1QU0A 5FO8B 3WDWA 2VM9A 3UL2A 3BKZA 2V4VA 4Q4X2 3MW2A 4KGGA 4BH9A 1VRH1 3KD4A 5A6QA 2JX9A 1YIPA 1RHI2 4HKLA 4RL7A 1JZ5A 1CAVB 2RJ2A 3LIHA 4YWAA 2HWB2 5CBLA 4FVVA 4Y24A 1HB2A 1QH6A 3GZAA 4OZXA 2WFF1 4LKEA 4I0BA 4MYEA 4ZZ5A 1KDKA 2VCMA 2RDQA 4AAXA 3JD72 3LB9A 2HWE1 2GNTA 4J6GA 1C3HA 1KD7A 2PAMA 5T5OA 2Q4SA 5L9RA 4B1MA 4QPWA 2LM3A 1W8HA 3OBTA 4Q4Y1 2Y60A 3GHNA 4F3JA 5BNNB 3M4FA 4LIVA 4MADA 4XUQA 1TMF2 3H42B 3L2YA 3NNMA 4PHZA 3T30A 4MZUA 3E6CC 3CHXA 2V5DA 2VOWA 2WN2A 2VGDA 3ZXAC 4L9BA 4XUOA 4CDXA 1NAEA 2DF7A 4QHZA 4NWVA 2VMFA 1CPNA 1RUI1 2DCTA 4TLGA 1UY3A 2AYHA 2J42A 2W1SA 1H6YA 3LDBA 4URTA 3THPA 1W04A 1BK0A 4C0BA 3BU7A 3ZIXA 3TRSB 5ISLA 1N1TA 3A0KA 5FY5A 1Q8OA 1IS3A 3WX5A 4YSFA 1DLLA 4COWA 2ZGRA 4CXWA 4ES8A 5I91A 3NV2A 2WAAA 1MQTA 2P37A 3AP4A 3GBWA 4HVOA 2NZ9A 3MUZ1 4AFCA 2JDUA 1WCKA 3HNYM 4L2NA 4EQVA 1GP6A 5LEKA 3WW4A 4HN1A 5K4LA 4Z82A 1WLDA 1CESA 2VZ1A 3ZO0B 4EZ4A 5CG8A 2OVUA 3OD4A 4TSVA 5FZEA 4EN9B 5IK4A 2A75A 1N47A 2WS91 3LGRA 2JIGA 2G9FA 2JE9A 2JE8A 3N9MA 1RUNA 3HWJA 1W39A 2VTXJ 2E63A 3AB0A 4CPBD 1SCSA 3KMHA 4AVSA 5A3UA 1HJGA 4PLNA 4JGYB 4CCDA 4DNYA 1QJU1 1W06A 4FPJA 2FDIA 4JDNA 1LB2A 1TME1 3VBOC 2PYTA 4H7MA 3LEMA 4CSWA 3U11A 4XTMA 4DZGA 2ZGNA 4KMQA 4OZOA 3AZYA 5T55A 3VL9A 3IZOA 4XQWA 5C8CA 3KV5A 5C4WB 2HJIA 2WR9A 2DU1A 4SBVA 5C4WC 1CQ9A 3LIGA 4EN8B 1N1SA 3D3AA 2ZGOA 3NNFA 4BLJA 5DZFA 3AJZA 4CXXA 5E1RA 4Y1VA 4DINB 2RS11 3Q8EA 4UFLA 1F5FA 3CJIB 5AFEA 4XF0A 2VH9A 5A3NA 2BNMA 2D3RA 1DU3D 1J3RA 4D6SA 1WLTA 4HFSA 1UX6A 3MUY1 1OI6A 4GKYA 5EWSA 4YW6A 1W8OA 3ILNA 3M3CA 2J1UA 2YBSA 4J1XA 3SMHA 2JDAA 2LRPA 1QJY2 5T5JA 3VHNA 1AVBA 4KQ7A 2XGXA 3RRDA 1MS5A 5CFDB 4N7IA 3VGIA 1R081 3PUAA 1IKPA 3RWNA 5CFDC 4ISQA 5IVVA 1VAKA 2WN3A 2HWD2 5J37A 5J48A 1HJFA 3J9SA 5DQ0A 1HXS3 4COVA 3NV3A 5JVVA 1G9AA 3BOWA 1POV1 1SLLA 3V0AB 1RUE3 2C9KA 3VBFB 3WSOA 1WMEA 3FC0A 1H9WA 4AR2A 4A3ZA 5IFTA 3LOIA 2QQPA 3R4UA 4A6SA 3G7DA 4B4PA 1UMZA 5L73A 3ZFGA 4UFJA 1HDKA 2WNVC 4ARYA 1SLIA 2YU2A 1KDMA 5HV4A 1RUJ1 3WHUA 2ZHNA 4UXAA 5LBFA 3WQBA 1JYWA 2EIGA 4JKLA 4UI9L 2VW2A 4S2DA 5CB7A 1LTEA 5FZCA 3ACGA 2MEV3 3ALQA 2BFUL 2RJLA 1NE6A 5DUUA 1RHI1 3U0ZA 1UQXA 1BBT3 4L11A 4FFGA 4IERA 3WDYA 4BXSV 3P3NA 1RB8G 2VL4A 3RZLA 1DGWX 1V9U3 4XAEA 2F4LA 4LUMA 1ALYA 4UYBA 4R52A 3THTA 5FXXA 1W9TA 4AEDA 5CFCB 2D5HA 3AKSA 5JXHA 4MHRA 2VE1A 3M8LA 3OUHA 3MEPA 5HCHA 2Q1ZB 3LF7A 1AR63 3PTYA 1Y9GA 4ZHNA 3B3QE 4XFGA 2PHXA 4FO9A 3KWVA 2ARXA 4CU7A 1OLMA 5IJRA 1WMXA 2VU9A 1OQ1A 3GXUA 1SFNA 5FYSA 4WV8A 3G6JB 2I74A 4AAPA 1S1AA 1W9FA 1CAWA 4NUBA 5F9TA 3AXDA 2ENRA 2VOVA 2ZA9A 4EROA 2UWAA 1R1ZA 2ZHMA 5D8AB 4KWKA 1RMU3 1IS6A 4AEJA 2FCVA 2GC3A 2QDNA 5F2SA 4NPMA 1AL23 1EPZA 1VBA2 4LK6A 2HLEA 5E8AA 3AMMA 5E89A 3ZFFB 1M06G 3FHIB 4MG2A 4ASLA 4AXOA 1UAIA 1PHMA 1VAVA 2R1DA 3R0RA 1XYPA 1F4HA 3CL1A 5KXBA 4FPEA 3GYDA 5FMBA 3ENRA 2WO2A 2LTNA 3N9NA 4NE9A 4UFIA 5FKBA 3TWIA 4TN7A 2HWC3 2HWF3 2XH6A 3T2OA 3BODA 1O4ZA 2WIIB 4BB3A 2VO5A 2ZGLA 5C70A 5I0SA 1SEFA 3UESA 4YZ4A 4H14A 1BLZA 1Q5OA 3HNBM 4A7ZA 4Z2AA 1Y3TA 2ORZA 4A2UA 3WP5A 4XFHA 5CISA 1NXD1 1JMUB 1W0NA 5K7PA 5APAA 3RPQA 2RR11 1GQGA 3PVOA 2BEOA 4QD2A 1GP4A 1HRI3 3I3DA 4IV1B 2Q8EA 4A42A 1H4GA 3KT1A 2VMDA 3M70A 5K8SA 4MGYE 2ZGPA 4XJUA 1S2KA 1PX4A 1ULOA 5FQ0A 4TLFA 1E57A 5J7MA 3FLTA 4MV2A 4EN6B 3V0BA 5JWPA 2DDUA 2KA3A 2MNGA 4N7UA 4XJWA 5ABJA 2VBDA 2EF6A 3M2MA 2RE9A 3HR9A 2AC1A 5DUXA 4AVAA 1IG0A 1X8EA 1VBC2 4FFFA 1UXXX 4E2SA 1VBE2 4U2AA 4XYXA 1DQ4A 1NY71 5IFPA 4JX0A 3A0NA 1B09A 3AK0A 3C7FA 1VBB3 4A44A 4PDWA 2X53S 4KI5M 4MVTA 1NCRB 1JOPA 3ZMOA 5GLTA 4R9AA 5FO7B 3WY6A 5A3PA 4YFWA 1AX2A 4QMAA 5FZ1A 1NCRC 4RQPB 1W6PB 1WCDJ 3U4XA 4IE4A 3TNQA 1DHKB 2CTVA 2EVXA 4N43A 3SLIA 1LHUA 4RQPC 2YPDA 3RI8A 4JVAA 3GGLA 1LU1A 1LCLA 3WNMA 5C6CA 1JZ4A 5FP3A 3HIFA 1OURA 2HWD1 4E4HA 3FZ3A 1UO9A 3VBUB 3PJQA 3W21A 1XB9A 3SITA 1LGNA 2B8MA 4XF3A 3WCSA 3GZTB 3T4VA 4AL9A 2JB8A 4X8PA 1AXZA 1DQ6A 1OPOA 1XQNA 3KCXA 3OGJA 2WINB 4EZHA 5C3PA 1BK1A 2JG8B 5FYZA 2WUHA 3ZXKA 1G8WA 2NQYA 2W2IA 4H2AA 4XJZA 3NL1A 1I9RA 5EIYB 5LZ6A 1CIWA 4RGKA 3U75A 2WYSA 5IK8A 5FPLA 3V56A 5A7NA 5LA9A 3WT3A 5I0TA 2O1QA 3T2PA 4F83A 4XW3A 4GZ9A 2G9ZA 4Q4Y3 1RL3A 5FZOB 2BV4A 4EJRA 2ZPXA 3HT2A 4ES9A 1E5HA 2FZ2A 4LT5A 4P9GA 4C0HA 4R9DA 2A71A 4UW4A 2FDJA 1R64A 1WW4A 1HXS2 2DVDA 4LOSA 2FZ1A 1MS1A 4LBKA 5IVCA 5SV8A 5FMOS 3P6BA 1RUE2 1FOD2 1CAVA 1RVF2 5DN2A 4YVWB 3U37A 1MS3A 4AI3A 1JH5A 2BRTA 2VVEA 4XDPA 1KS4A 5F3GA 1TNRA 5F2WA 1YI9A 4XF1A 5JXJA 5BY5A 5C71A 3BTZA 2D40A 5F5IA 1DZQA 4NHYA 2WA3A 4Z92B 4DB5A 2CL2A 3KV9A 4IESA 4QQOA 1AR93 2ORXA 3MPPG 4OHZA 2Y26A 4S2FA 2ZACA 3C7HA 3TEWA 5FYUA 1ZBA2 4CCCA 1DYOA 2VBBA 5LY2A 5JOXA 4OLLA 4LORA 4ZKTB 2X29A 3I54A 4BXFA 4JGZC 5F32A 2WS93 1F4AA 2MEV2 5A3OA 1Z0HA 1Y7BA 4XXPA 3LPGA 1BBT2 1C8M1 1TE1B 1XE7A 3ZXLA 1J1TA 5FP9A 4CUAA 1AX1A 1RUC2 2GN7A 3U4SA 2AGSA 3ZXGA 3SNMA 1V9U2 3SHRA 1D7PM 5I0UA 2A3XA 1RUG1 2D6LX 4IE7A 3E5QA 2WNOA 3N3HA 3U14A 5H9SA 4HMZA 3VZOA 2GSYA 4AK3A 2BGCA 1A8DA 3B9IA 4YGCA 4Z1VA 5B4NA 1ZVFA 3MIEA 4GH4B 1FV3A 4M0NA 3I2FA 2WABA 2QQOA 3PUQA 1GICA 2QNKA 4JHTA 3RMYA 4DEQA 4GH4C 3J4UH 3MFAA 1W9YA 2VAUA 5T5PA 2RS13 3HQRA 2PHRA 5A80A 2AEYA 3K4ZA 1AYM2 2KD7A 5FLIA 3ZN4A 4Q4W2 1OA2A 5C5UA 1YHFA 2I45A 5DUVA 5HXMA 4IEWA 3KVAA 3AYDA 3JQWA 5GKAC 1MEC2 2QQUA 1RUD3 1ULGA 4JGYA 1CN1A 4I02A 4ZXKA 1MZEA 1OLQA 1ND2B 2JD4A 1UXZA 3IBMA 5FRAA 5JR2A 2C6SA 1E5SA 3WDVA 1TZOA 3DPRB 2WC2A 3UKTA 3ZYRA 3O1VA 1R083 2ET1A 4XMIA 2X5IB 2EAAA 5DABA 3QLQA 1RXGA 3EHKA 3ZOIA 4BHPA 4EV0A 2FDGA 3OB8A 4MGZE 1CR7A 1VMFA 2X5IC 4HK9A 1JZ7A 5C4WA 1V6OA 5FCCA 5G05L 1YLLA 4LO7A 2HWC2 2HWF2 2C26A 4ZU4A 1G9BA 1VBE1 1H2LA 4LEJA 1PM7A 2JG9B 4WM8C 2WQ8A 2GZWA 1NUKA 2XBO1 4LE3A 4AGGA 4EE2A 3VD9A 1W8FA 3CJIA 3RMXA 4QQLA 5AVAA 2JG9C 4YG6A 2WQ4A 5FXZA 5KHHA 4XUNA 1QGLA 2YGMA 1HRI2 1EAH2 4WBBA 1RUJ3 4AGRA 5EYXA 2O14A 5J96B 5FMCA 4XC9A 4Q1RA 2Y8KA 4Y1XA 1ZRIA 3I2DA 5CVRA 2XDVA 5FZ7A 5KC5A 3LE0A 4Q4X3 2QDRA 5FXWA 3TEXA 5CFDA 3FFZA 1H8TB 4BWOA 4QQPA 4GXLA 2RDSA 2OKXA 5F1RA 4LBLA 1RHI3 1XNAA 1UOJA 2XXZA 5IK7A 3BU0A 4B8EA 3WP6A 2YC2A 1ND3B 1VE0A 1ZBE1 4YZ2A 3V0AA 4FAGA 3DYMA 1V0AA 3VBFA 1U0AA 4G3YC 3NNGA 1CX4A 4PT6A 4Z8BA 3OGVA 4QHOA 4XPVA 2G4IA 2D7FA 3M3QA 3JD73 1VBB2 2YY1A 4YFZA 1DLCA 2VVDA 5FP7A 4AQTA 3N4MA 1C57A 5B4XA 3VZNA 4Z2WA 1UD1A 3WDXA 5E16A 2EICA 3DV8A 3K77A 2K2SA 3K48A 3POSA 3S7IA 2Q8CA 2QQKA 2VPVA 5C8WA 3MV01 2JDHA 1IKQA 1K3IA 2VD7A 2WZR2 4JTOA 5KR7A 4QDQA 1I3HA 1VRH2 1L7QA 5IAXA 2A73B 2BOIA 3JB8A 4NJ4A 3VD5A 4ISRA 5F5CA 4E4ZA 1RVF1 2D97A 2PHWA 4WM7C 1TQ5A 1L7RA 2VTFA 3AP9A 1ZREA 1GOHA 4XIKA 1R092 3IDCB 1ZZCA 3E97A 2PN5A 2W3JA 3WW3A 1JUHA 3ES1A 1W0OA 2WFF2 3I2KA 3JXSA 2J1EA 3C7EA 3RVHA 1UU6A 3CLPA 1VP6A 3KVBA 5CFCA 1JYCA 4QB1A 2W95A 1SCRA 2HWE2 4LTAA 4CTEA 1LODA 4LK7A 3ZXEA 5FZGA 1VLNA 4GB31 1O8PA 3WR0A 4Q4Y2 3QH7A 3OPZA 1ZRFA 5IYYA 2LROA 5D2AA 3WUCA 4M3CF 1BKZA 1YNAA 2BW8A 4GMP1 4GWNA 5CEHA 2Q30A 1CAXB 2JECA 1Q8VA 1J3QA 3JBG1 5I0RA 3VKNA 1GLHA 1REFA 3C2UA 4QPGC 5FLHA 2Z42A 1RUI2 2PAKA 2W1WA 4AEMA 1YRZA 2EXIA 5EQUA 2WNUB 1WGPA 4YW4A 5D8AA 4OQ8A 5C3QA 1EYBA 3DEMA 2ZX3A 2WNUC 4GWJA 4MX3A 2C5DA 2W47A 4FOYA 1DG6A 4FPCA 3JUUA 4AHYA 3ZFFA 4KU8A 1YEWA 3D5OA 2QFEA 3KQ4B 3UGHA 2VJXA 2Y6KA 4LBQD 2LW8A 3ZYJB 4KU7A 1DBNA 4Q29A 4PJYA 4BMBA 4KH9A 2JDZA 2GH2A 4GJYA 2IC1A 1ULFA 3BALA 3J7MA 1AYM1 2WS92 4LBNA 2OPKA 2UYAA 1A6CA 3LA3A 1ZRDA 4XDOA 2J1TA 2B46X 1RXFA 3DYOA 1UL9A 2BTVC 4AZZA 1WA4A 5IHRA 4QX5A 5JCTA 3K75B 3APBA 3TYJA 4C8DA 1QJY3 1QJU2 1S0DA 1ZZ8A 2IUWA 1BZWA 1TME2 4IV1A 1MZ5A 1A8MA 1VB4A 1OUSA 2ZS6B 3V65A 4HPKB 4FQ4A 1QXJA 5DDJ2 3FUOA 4A7YA 2HWD3 4BYYA 5L7OB 4XFAA 1FPN1 2IXKA 2OUJA 2B45X 3NKGA 4NHLA 5AFBA 3BGAA 3T0AA 1PO21 2QJVA 4EYUA 1GR3A 5F5AA 3H1WA 1YQ2A 3NV4A 4P5HA 2ZABA 2RS12 1AXKA 2Q5TA 5FZHA 5FYTA 4PDWB 1GZCA 1SPPB 4YPJA 1E5RA 3P3PA 1I5PA 4QXHA 1NZCA 4Q8LA 2H6BA 1NQJA 4OHXA 4PI0A 5L9BA 4MGSA 2Y6LA 1XXNA 2WLQA 3GBGA 4LLOA 1NCRA 2YG0A 3HN3A 2KR2A 5FO9B 3JB4C 3BYWA 3UETA 3PNAA 4RQPA 1W6PA 1DFQA 4P9WA 5LBEA 1DP0A 2VZUA 4AE2A 2BJSA 2RS51 3SC7X 3WQ7A 1R082 3NWKA 4LO6B 2MPFA 3HBKA 1F15A 3WG4A 3I49A 2R071 2VMGA 4ET7A 4DXZA 4QB2A 4KG8A 1LULA 3KT4A 3MHZA 3AJYA 4ZONA 5BPXA 3VBUA 1OA4A 2VUCA 3B5LB 3EQEA 5BNPC 1H1AA 3CIHA 2R30A 4I2OA 2DVGA 4CEYC 2BNOA 1ZA7A 2ZAAA 3HD8B 2W91A 4OQ9A 2Y38A 3O5SA 1VMHA 3ZFEB 4FAHA 2BERA 4V1PA 3TNPB 4IEXA 5EZWA 4HBNA 4XABA 2YMZA 2NP0A 3WG2A 3ZYBA 3R05A 1YWKA 5ANQA 3GJBA 3DECA 3N36A 1DQ2A 4EN7B 4AFBA 3PMEA 2DUQA 5GZFA 4IEZA 4YVSB 2ZZJA 2VC9A 1RUJ2 4YZ5A 4W6YA 3CNAA 2VTXA 4YVSC 4LKSA 1ZNPA 2AENA 5FZOA 3FFQA 1V6JA 4H7LA 1DGWA 4P9YA 5GLZA 1OMIA 2WZR1 3O0XA 4LHLA 3LSDA 2J1RA 1RUH1 1DQ1A 5FBJA 1X33A 3Q8AA 4P08A 4IW3A 2D43A 3A23A 4HVQA 3AC0A 2OW4A 1XYOA 2VCCA 1W6QB 3MLLA 1R091 1S0FA 1VBA3 1SMVA 2DV9A 4JKKA 4LO8A 2E51A 5C5TA 1C4RA 5FPBA 1U5YA 4YVWA 1D4M1 2AREA 1OKOA 3ME2A 4QM8A 3VZLA 1H6XA 1F35A 4CCNA 1QHDA 1REDA 2QQLA 5A7SA 3W5NA 4WVWA 4IGQA 2VMIA 1AUYA 2GP3A 4NHKA 5FREA 3PVNA 4PBPA 2BFUS 4UWDA 5LB6A 1QKQA 2WWSA 5TSWA 2B5HA 2VNGA 5CKNA 2PHUA 1B35C 1W99A 3ETPA 4I30A 4TWTA 2P3JA 2B9UA 1JXNA 2ZX0A 2MHFA 1JYVA 2DCYA 4YM2A 3KLSA 4Y26A 4UBHA 5F6LB 1O3RA 4UBGA 3PTRB 3WVJA 1UN1A 4WVZA 2E7QA 2SBAA 5FZ3A 3WQ0A 4YARA 3AKTA 4NN0A 4XILA 5FMDA 2WZ8A 1HV1A 1WD3A 2E9QA 1XNBA 3GCXA 2EXKA 1O8SA 1MS9A 1STMA 2QQJA 4CUGA 4UW6A 4BCUA 3H0OA 1V6KA 1XNKA 5K0UB 3OGGA 1VBD1 2CDPA 3NQHA 1GYKA 2L9LA 1AHSA 1OBNA 2A5ZA 5BYNA 5K0UC 1OSGA 4NIGA 2BOJA 3VHPA 4P14A 5LK7B 1ZA4A 2Z69A 3AYCA 1S0EA 5G04L 3EO6A 5KXCA 4GH4A 1VBC3 3HQXA 4LHKA 4META 5A6XA 1VBE3 4NHXA 1EV12 2Y33A 3WXPA 2CAVA 4OULA 3INAA 1RIRA 4KBBA 3X29B 5F37A 1JUIA 5IATA 2E6VA 2JD9A 3NO8A 3I7DA 1GOGA 2RR12 3VBOB 3WEZA 2C9AA 4DRRA 3ETQA 3HBZA 3PUHA 4I3GA 1N3OA 2VOXA 1W2OA 4XCBA 5LBBA 1ACCA 1ND2A 3BOPA 1YCIA 5DDJ1 5FYBA 5GLWA 3U78A 3KCCA 3S5QA 3DPRA 3UT0A 4BZ4A 1SACA 1AR72 2X5IA 4AI1A 2RG4A 4P02B 5FZ6A 4XUTA 1KQRA 4XOGA 3GZEA 4QX0A 1DZTA 3J8F2 1ZZ6A 3AMNA 3HOBA 2JIJA 4ZU5A 1R1A2 1ZBE3 3QBQA 2K0GA 3MI8A 4D8MA 1OOPC 1NY72 1EUUA 5IW0A 2HBTA 2JG9A 4XVHA 4LNVA 1XSQA 2XHKA 3ZSKA 1HKDA 3DCQA 3ZXFA 5A3MA 1QJEA 1WW5A 2X10A 4Q0SA 1RUF2 5JI7A 4QX2A 3AP7A 4DRVA 1UOBA 4KBZA 5DPNA 5FR3A 1K42A 5JDBA 1W05A 3ZKYA 4YG0A 2GC0A 4R8HA 4CP2A 2YBKA 2DTWA 2OA2A 5DZEA 3LD8A 2JXAA 3O0VA 2XQRA 1HQNA 4UW5A 4M01A 2RJKA 3PVEA 1H8TA 4HZFA 3THDA 5AVPA 1RYYA 2JKXA 2DCZA 4N53C 4ATEA 2ZMKA 1RVF3 1FOD3 5EPAA 2VQUA 5ACA1 3PIJA
chains in the Genus database with same CATH topology
4XF9A 1GNHA 1ND3A 4HN0A 3ILRA 1ENRA 3ILFA 3IPVB 4CRQA 2WNVB 1GNZA 3E5UA 3OBRA 2WJSA 4IETA 4Y20B 3UV9A 2VVFA 1V6IA 5JLVA 1ZBA3 1HRV1 3ZX7A 4Q8KA 1JW6A 2CNAA 2V5YA 3AFKA 4GMP3 4LA2A 1PMIA 3QD6A 1NA1C 2ZHKA 3JBG3 3O7OA 4CDQC 2WT2A 3IM0A 4XMAA 1U5ZA 1ZZ7A 3B02A 1FNZA 1N3QA 3BIWE 1RUC3 5KXEA 3LOBA 1MZFA 2VNOA 1NE4A 4XHBA 3KGZA 3B93A 3VHOA 2D6MA 3VKOA 1VB2A 3ZXJA 4Z07A 3VBSC 4R4XA 1QQP1 1JHNA 3NW4A 2ZBJA 1Y43B 1FAYA 4DQAA 3S0MA 1YI7A 3VZJA 3T1MA 3ZSMA 4XBQA 2ZZQA 2QCSB 4XFIA 1NOVA 2O8QA 1AYM3 1CAXA 1PGW1 4Q4W3 1NCQC 2FQPA 1H1IA 3N35A 4K21A 1C8M2 1MEC3 2UU8A 4HSJA 1MZ6A 1DF0A 2LALA 3SISA 4XQ4A 2WNUA 3NAPC 4B29A 1RUG2 3PLQA 4QQ2A 2ZAHA 3N7MA 3SCHA 3H50A 3WV6A 4Q27A 1K5MC 3H1YA 4YGEA 4HETA 2OUHA 2WKKA 1XNCA 4NHMA 3SCGA 2OZJA 1PO23 4IL7A 1IS4A 2C1FA 2A3YA 1WLWA 4Y22B 2AZ5A 1EV11 5A33B 2CWSA 5KBFA 5GM0A 5GZCA 2ZGTA 2ZMNA 2D93A 4ATFA 1EAH3 3GALA 2HEWF 5F5QA 1I6XA 2XVGA 3DGTA 4M3CE 4CDWB 2ZJCA 5C9AB 1KFXL 4GULA 4AW7A 2RS53 4CDWC 5C9AC 3RJ2X 1KJLA 4XBNA 2BWAA 1VR3A 1XU1A 2IXIA 2R073 4HPKA 1AR71 2HEYF 2GMPA 2XWBB 3U07A 5L7OA 3J8F1 1ZZ9A 3IDBB 2RMU1 1R1A1 2PLV1 3MICA 5LK5A 4GMP0 1PGL1 3MIGA 4CDUB 2XBO2 4AHZA 1BJQA 5EYYA 1PO11 2EALA 1APNA 2GNMA 2VXRA 4CDUC 4K8FA 2Q8OA 1M4WA 1WUVA 1RUF1 3FJSA 1OHFA 4BIFA 3KGLA 2DFCA 1D4VB 5LRSA 3H3ZA 5CNAA 2ERFA 2WSVA 1LHVA 3POYA 2WZR3 5FOBB 2XJQA 4FOWA 1QDCA 1F5JA 2DWRA 1BCXA 1VRH3 2EXJA 4WVMA 1LJ7A 4YM1A 2CYFA 1AR81 2ZOEB 1R093 4B4QA 1ZBE2 2H0VA 1MR5A 1RINA 2WFF3 1LOEA 2V09A 3H8UA 1X50A 3ZFEA 1D2SA 2HWE3 2W39A 5JSRA 3UKNA 4E2GA 2QKDA 4IEUA 4XJAA 1ULDA 4YVSA 3ZN5A 2TBVA 2UURA 2B42B 3O14A 3MIHA 1JOJA 1U5IA 4I01A 1O5UA 4AWDA 1O3QA 4A3XA 1W6OB 1RUI3 5A3LA 3KM5A 4LBOA 2N7GA 1C5IA 5AC91 2ZX4A 1V70A 4HT1T 1W6QA 2Q1MA 4AFAA 3AFGA 2JENA 1UZYA 1UU5A 4D7TA 2R041 3KB5A 3CJXA 4QPIB 1ZRCA 4DFSA 4BM8A 4QPIC 3AMPA 2F6BA 3AP6A 3ZIWA 3FMGA 4GB32 4XTPA 3ZYPA 4JGZB 4RD7A 4D69A 3LKJA 3D82A 3WQ1A 1PK6B 2CGOA 3TB0A 3TN91 1BYHA 1PK6C 3MDPA 3JBG2 2DTYA 3JCIA 2EAKA 3LSEA 1PZ8A 4Q4V1 2ZX2A 2VULA 1QJU3 2ZGUA 1LGCA 2XL9A 3IDEA 2DURA 1TME3 5BNOB 2PQQA 3ZYIB 5BNOC 4PIYA 5DDJ3 1N1VA 4FOQA 2TUNA 4IQPA 5K0UA 1YYNA 4SLIA 2JKBA 2BVBA 3LAGA 1ZRRA 1F8VA 2YGLA 1LHNA 3FX3A 2GAUA 4LBQB 1S0BA 3ES4A 4I0AA 3RYRA 4Y1UA 1OQDA 4QXKA 2DFBA 1T6GC 3U10A 1LOAA 1FNYA 3VBHB 5C33A 1MQTC 3RDIA 3VBOA 3ZSEA 3VBHC 2UWBA 2PELA 3CEWA 1HLCA 4QGNA 1PVC2 4NR1A 2GMMA 5GZDA 1BEV1 4PBOA 3ZYGA 3B00A 2CWMA 1FPN2 2VMHA 1RGSA 1POV3 4MUVA 3GHMA 1GZ9A 1MACA 1PO22 4YGBA 4WZFA 4L92A 3MPBA 4C91A 1BMV2 4WM8B 4QGMA 4D3WA 4R9BA 3VBRB 1BXHA 3LA7A 5GZEA 1UIKA 4LULA 3ZSJA 2P2KA 3VBRC 3OF1A 1SQ4A 1LOFC 3MIDA 2HEVF 2XVKA 3BB6A 2PTMA 1C28A 1Y9QA 3H3UA 4LE4A 5JAXA 5DXDA 5C8CC 5KHJA 1L3JA 4XETA 1C1LA 1F2NA 4QPYA 4G4FA 3ST7A 5FBZA 2CY6A 2PHLA 2RS52 3USSA 2C0ZA 1W6MB 2XL7A 2TEPA 4NPRA 5JIUA 4GA9A 2R072 3E6DA 1QOOA 3TOJA 4OI2A 2BQPA 1PVXA 1YO8A 3WW2A 3V64A 2IXHA 4M00A 2XKPA 4CP0A 5BNQA 4RHV1 3PJYA 4MXWB 1QJX1 2R6QA 1HV0A 3W59A 3A4UA 3IPVA 1CAUA 4IEVA 4XFCA 4C1XA 4IV3B 1MVEA 2RHPA 2WNVA 5JPMB 1UW8A 1QXRA 2XKOA 4IV3C 4Y20A 4AG4A 4OI0A 4Q0PA 4FTEA 4OUSA 2I07B 1IHMA 1O4TA 1WBLA 4Q26A 4YZ3A 1H1MA 1OA3A 4YW3A 2W08A 1WMDA 4AQSA 1RUH2 3JU9A 2EXHA 4YW2A 1NG0A 4F7ZA 4WM7B 4OHWA 2GC2A 3AZVA 4NWWA 4XF4A 5FMOL 4AI2A 1OQEA 1D4M2 2ZGQA 1MVQA 4OHYA 4E4DX 1X36A 3GBFA 2YUEA 4K7JA 3QH6A 3NV1A 1FI2A 3LWCA 1H2NA 1O3TA 2R32A 3AZZA 3CU7A 1EV13 4QPGB 2BVVA 3S30A 3VZKA 1GFF2 2DCJA 1POV0 1COV1 1S2BA 5IUQA 4AEDC 1ZYBA 4Q0VA 1UF2C 2RR13 5T54A 3D6EA 1F31A 2D44A 3R4DB 4ZU7A 1OKQA 5DZGA 3MLKA 1CVNA 2QZ2A 1VBD2 1EP0A 3QACA 2DVAA 1AR73 1GV9A 3J8F3 2VY0A 4DMIA 2A6ZA 1V6LA 1R1A3 2RMU3 3USUB 3N7JA 2UY9A 4Y22A 1IQAA 3EXUA 3RSJA 4F8AA 1DZRA 4UW3A 4OVEA 5A33A 1PO13 4K1ZA 2W52A 2RM22 4LA3A 4GQ7A 1RUF3 1QF3A 4I09A 1QWRA 5JIAA 5HBAA 4CYDA 1AR61 4FQZA 2XJRA 4HSLA 4K3UA 1KRIA 2NMOA 4CDWA 5C9AA 1PVC1 3N7LA 3NKTA 1XU2A 2XVLA 4GIQA 3WW1A 3WUDA 4YM0A 4A7KA 1J59A 4X6QB 1AXYA 1AR83 1FMD2 3OY8B 5DG1A 1BMV1 2XJSA 1LESA 1IOAA 4AHWA 1SLCA 1RMU1 2CGNA 4Q0UA 1AL21 1S55A 4CP1A 1ZX5A 1GKBA 4LLFA 5JR7B 4CDUA 1V6MA 1LHWA 4MSVA 4G9SB 3WG3A 3OYWB 4E9KA 1VJ2A 3OTFA 3MFCA 2ZMLA 1PNFA 2TNFA 2Z5WA 4EWDA 5ABJC 3R4SA 4FCAA 2P3KA 5GLVA 5H9RA 2W0XA 4MGIE 3FE5A 2E53A 3RNSA 4WVMB 1YFUA 1IPJA 3WG1A 1WW6A 2WT1A 1ASJ1 2ZKLA 5FAXA 5BNPB 4CEYB 3AP5A 1OPMA 2AR6A 4IEYA 5ACA2 2ARBA 1A3KA 4LO5B 4B7KA 3UKVA 4EN0A 1H8VA 4IEPA 4ONUA 1QY4A 1JYIA 2R043 4N43C 1Q56A 3DUIA 4FPHA 3D0SA 2IXJA 4AGVA 4FXGB 2DVFA 4KNCA 1G9FA 1MS0A 3AX4A 4FTBA 2IXCA 2JE7A 1HRV2 2WT0A 4D94A 4FOVA 1LGBA 2VG9A 1S0GA 3TN93 1C5HA 2F4PA 3WZ1A 1H2MA 2ES3A 1URXA 2FHRA 3POWA 4Q2FA 1UPSA 2BWCA 1C8M3 4Q4V3 4BLIA 1W6OA 3VKFC 4QM9A 3RJRA 4FPOB 3TAYA 4RGGA 1DDLA 1HQWA 1QOSA 2WL1A 1RUG3 2Y0OA 1Z7S1 1CONA 1QQP2 1J58A 3AM2A 5EXOA 2JJ6A 4QPIA 4RA0A 5JSPA 1YFWA 2ZKNA 1B35B 1BVVA 1AX0A 1WMFA 4W6WA 4JGZA 5FFOC 3CF6E 3QOPA 3VV1A 1PK6A 4M0HA 1X8MA 1PGW2 5CAZA 3B94A 4PQ9A 2D98A 3KT7A 4NOTA 4QQHA 1SLBA 4IEOA 3I59B 1SLAA 2FBEA 4L97A 1NXMA 3BCWA 1CD3G 4EWAA 2A6VA 3B69A 5BNOA 1LEMA 4BOWA 2BNNA 3SCFA 1BEV3 3OD0A 3FLPA 5BNNC 3MYXA 4GWMA 1V6NA 3FBYA 1PGSA 2DUPA 1UZZA 3GZUC 3VL8A 2LUWA 3I4IA 3NJZA 5HCBA 2XBO3 1AJKA 1QMJA 1V00A 1U12A 1OD5A 3HT1A 4FPKA 4R4ZA 1AF9A 2RM21 4LBQA 5BUVA 1VALA 4QHBA 4XFBA 1LOGA 3ACLA 3EBRA 1EPWA 2VOKA 1LHOA 1IS5A 4AVTA 2D6OX 1AR91 3VBHA 5FDBA 5GALA 5F6KA 4HVRA 4N90A 2YROA 4NO4A 4FT8A 4C90A 1UIJA 1IZ3A 4YRDA 2G9GA 4N9HA 2ZTNA 1FMD1 1ZM1A 3MW4A 1OOPB 1D0GA 2RMU2 5CG9A 2PLV2 1AYN1 1WW7A 5JOWA 1PGL2 4AI0A 3VN4A 4WM8A 2IZWA 4E4SA 3VBRA 4RHV3 1GBGA 1LOFA 4JGYC 1QJX3 4ORFA 1VAMA 1PO12 2YDEA 1I5ZA 3KZ4C 2GMEA 4AVVA 1PNGA 5JSOA 3PMSA 1DYPA 3D4KA 4LHNA 3DKWA 1GQHA 1N1YA 4CEWB 2AUYA 1NLRA 2FMDA 3S6PA 4CEWC 4Y1YA 1PIV1 3T2TA 5JMCA 2PHTA 1W6MA 4N53B 3NSTA 4AQ2A 5CIRA 3CJIC 3EJKA 3SH4A 3B01A 1AR82 1NYWA 2UYBA 4JC1A 1RUD1 3URFA 4XHXA 2Q0AA 3LZZA 1CAUB 4ASMB 1MS8A 4EWEA 2R061 3JQXA 4O9EA 3SH3A 1QXPA 4MXWA 5J3UA 3ELNA 1C1FA 3M3EA 1WLCA 2YV8A 2ZCWA 4IV3A 4Y5Z0 1HQLA 4X6RB 4GB33 2PA7A 2K9ZA 1O91A 2RS31 1NA1B 4CDQB 2UWCA 2H6CA 1UU4A 2DYCA 3WNXA 2D6PA 1GZWA 3VBFC 3O0WA 2XJPA 3IWZA 1COV3 2GH8A 3ZN6B 2A3WA 4WM7A 1N3PA 5JOZA 2YC0A 5AC92 2D6NA 1RTVA 3VBSB 2R49A 2VQAA 4PLOA 2R042 1W2UA 2KM2A 1Q8QA 3LA2A 4BMEA 4Q4X1 3NVCA 4FPLA 1GANA 2ET7A 2ETEA 2H0BA 4W6XA 2NM1A 2I2SA 4KL1A 3FWEA 2OYZA 2E7TA 1SBDA 3WP3A 2WLPA 4XDQA 1RC6A 4B7EA 2HWB1 2GC1A 3TN92 2R0HA 1LENA 1NCQB 4K9SA 4QPGA 4JDMA 5JZGB 3ATGA 4Q4V2 3RI9A 2FMYA 1O5LA 3LCPA 4RS5B 3JD71 2CV6A 5JZGC 3NAPB 5CA6A 4AVBA 5CFCC 4RS5C 1W6NB 3SXWA 4D7SA 3H9AA 2XLGA 4D7YA 2D3PA 1XE8A 3IN9A 3ROUA 1K5MB 3MF9A 1PVC3 3O12A 1TMF1 1ULEA 4CZSA 4RR3B 2WNEA 1FPN3 4RR3C 3W58A 5HXVA 3VLBB 3VDDB 3AKRA 4KGQA 2ZX1A 2GU9A 3AZWA 2Z79A 3USUA 3VDDC 1J3PA 5D8AC 2NMNA 3H7JA 2IXLA 4Y1ZA 1VIWB 1NQDA 4M3CB 2IWGB 4YZ1A 3T1LA 4AFDA 5K9YA 4P9IA 3ZFFC 2UY8A 5T5LA 1BQPA 3N7KA 4XXAA 3M1HA 4FSJA 2NPIA 3J26N 4HLTA 2CAUA 2QVSB 3BPZA 3H7YA 1TEIA 3VKLA 4BIOA 4JQRA 1BEV2 1ASJ3 1Q3EA 3MW3A 4AI8A 4FXKB 4YNIA 1CJPA 3Q9OA 5T52A 1REEA 3OY8A 4FPFA 5BV6A 4OUMA 4E2QA 4DY5A 3ASIA 4COZA 3RG0A 1F9KA 4IV1C 1QJZA 4S2GA 1S0CA 5KWRA 5J98B 2BUKA 5FLJA 5I93A 1LRHA 3OYWA 2O8OA 2O0OA 4OHVA 1D0HA 4YGDA 3FLRA 1QNWA 4R9CA 1RUH3 1LOCA 3HMYA 1WCSA 2OIIA 3CO2A 1GSLA 5A32A 2VW0A 4MXVA 1ENXA 3MZHA 1G7YA 2ILMA 5BNPA 2VW1A 2V73A 4CEYA 5LRRA 2A6YA 2A6WA 4PIXA 4C1WA 3B7MA 5EFUA 1D4M3 1QJY1 1H2KA 4RHV2 3AMHA 3WLUA 4DY3A 1Z7S3 1QJX2 2B7YA 3K51A 5KXDA 1LR5A 4L8QA 2NLRA 4MGKE 3RQ0A 1TNFA 5E88A 3IT8A 2DUOA 1JTZX 3VZMA 1QOTA 1X7NA 3VBUC 2YXSA 1SDWA 4IXLA 2R0FA 4QT6A 4XZPA 4Q0QA 4OFGA 3MIFA 2JG8C 4XBLA 1CGPA 3MIBA 1XYNA 1U5XA 3DL3A 4JDOA 1SBEA 4FTSA 1VBD3 1C8NA 4HKWA 4JTNA 2HKXA 4XE9A 4FBFA 1H0BA 4AF9A 4K40A 5CADA 3UJOA 5HCAA 2B39A 1B35A 5I8SA 3WCRA 4QU2A 1O7FA 4COUA 1YUDA 1AJOA 2QZ3A 5KHGA 2XLFA 1CPMA 1FV2A 3B9CA 4YVWC 1ZZBA 3FBMA 2RM23 5SV5A 1IPKA 1COV2 2WA4A 2XLAA 3PVBB 4IEQA 4X8NA 1AZDA 1KXGA 3TBDA 1JBCA 2GN3A 4FPGA 3WINE 2ZGMA 3AMQA 3JZVA 4JCKA 2XG3A 3HAGA 3I59A 4J1WA 4E27A 2XJVA 2AH2A 2EA7A 3I8TA 4LO4B 4CDXB 5BNNA 2WSUA 3AXEA 4AHXA 4CDXC 1QH7A 1S0JA 3GF6A 3AZXA 3IIAA 4LUKA 5FPZA 1FMD3 1UCXA 1LECA 3AKQA 4Y4YA 3AKPA 1RUOA 1AYN3 4DS0A 1QDOA 2NN8A 1VBA1 4I3PA 1ENQA 2HYKA 2XB6C 2YHJA 4KWJA 3ZPYA 3MGUA 4XEZA 4K6BA 3VUOA 5HCFA 1MQTB 1H9PA 1UKGA 2PAEA 5FTTC 1AR62 4OI1A 3DN7A 1YFXA 1FYUA 1NLSA 2SLIA 4INDA 1FT9A 4GALA 3C3VA 2WZPP 5CU1A 1PIV3 3PHMA 4AVCA 2PFWA 1YXWA 2YZ4A 4TZDA 4PIZA 3WD5A 4FP2A 1DIWA 5JOYA 5ACA3 2P3IA 4P9JA 3RYKA 1OOPA 3E5XA 1RMU2 2JICA 5J09A 3ZSLA 1AL22 4WVVA 5DG2A 4HANA 3L9JT 3KSCA 2R063 1Q43A 3W9AA 5JPNB 5C8CB 2PHFA 3M3IA 4HKOA 1ND2C 2XPJA 1G6NA 4LBJA 2VECA 4AYUA 3DPRC 1HRV3 3UJQA 5BXXA 1DQ5A 5T3NA 2RS33 4MLOA 4CEWA 2X8KA 1VBC1 4LR4A 1ONAA 1FATA 4OI4A 4W65A 1ASJ2 1CJDA 2VNRA 4JAAA 3L2HA 4YW1A 4N53A 4Q1PA 4RFT0 5LEJA 1O3SA 4K1YA 4DPNA 4XJ9A 2ATFA 5JI9A 2YPJA 4XQDA 5GLUA 5DUWA 2GNDA 1ULCA 1FX5A 5L19A 1LU2A 1QQP3 1Q8PA 2GALA 2DU0A 2BBVA 3ZDSA 3ZMNA 1S0IA 1KJRA 1G86A 2CGPA 3ZXDA 1H4HA 2P34A 5KHKA 1H8TC 5I8YA 1BVP1 1GZWB 4B4RA 2HWB3 1LKNA 1NA1A 4CDQA 4QGLA 3KCYA 1ND3C 4AQ6A 4N9IA 1D2QA 3SH5A 2BPA2 2Z2SB 3WDUA 3IKWA 3ZFGB 2YYOA 1SLTA 1OFNA 3ZN6A 3ZFGC 4H3WA 4I0WB 3AYAA 5D1IA 2WFPA 3VBSA 1Z7S2 1TMF3 1YJLA 4RSUA 4H55A 1UPIA 4P9LA 1SFYA 1XRUA 4YM3A 1HXS1 2E7AA 4P9XA 2JEMA 4KWLA 1YFYA 3AYEA 1Z78A 1RUE1 1FOD1 3BTAA 1HX6A 3FUQA 4FPYA 3MLJA 3UK9A 3WDTA 4AEDB 1X82A 1FXZA 1NCQA 2W68A 4GKXA 1RITA 4JRLA 3WOGA 4JV4A 1EY2A 5JZGA 3OCPA 3VHRA 1A78A 1DGLA 4RS5A 2R1BA 3NAPA 1G9DA 1W6NA 1ZBA1 5IT6A 4BQ1A 1J1LA 1K5MA 2XWJB 3ECQA 1CAWB 2A7AA 4S2HA 1WBFA 5L36A 1I1EA 4RR3A 4WZCA 4XJ8A 1RJ7A 1XNDA 5FPXA 2PHDA 5T50A 2MEV1 2XJUA 3D0JA 4MH0E 2XUMA 4B3NA 1BBT1 2PLV3 2WQZC 3S7EA 1WD4A 3KS7A 3VDDA 2IFWA 1RUC1 1OLRA 4XFFA 1DGRA 1V9U1 4JRAA 4YG3A 3ZVXA 5GZGA 1H30A 1DYKA 4M3CA 4BE3A 4U36A 2ZGSA 3WP4A 1AR92 1LEDA 1O4YA 3GNEA 1ENSA 2D3SA 1UKRA 3E6BA 3D8CA 1DQ0A 4COYA 5IK5A 2QUOA 3DF0A 3QCWA 5EV7A 3RYPA 2GDFA 5I8TA 2DVBA 1HIXA 3M3OA 4Q4W1 4FP3A 1SBFA 4K20A 2P17A 2D5FA 3VKMA 1AYN2 1MEC1 3OJBA 4YYOA 4ITCA 4BA6A 4DOUA 2VUAA 1G9CA 5FQ0B 2D6KA 1PZ7A 4NVPA 3V0BB