1OUSA

Lecb (pa-lii) calcium-free
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
113
structure length
113
Chain Sequence
ATQGVFTLPANTRFGVTAFANSSGTQTVNVLVNNETAATFSGQSTNNAVIGTQVLNSGSSGKVQVQVSVNGRPSDLVSAQVILTNELNFALVGSEDGTDNDYNDAVVVINWPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords hypothetical protein LecB
publication title Structural Basis of Carbohydrate Recognition by the Lectin LecB from Pseudomonas aeruginosa
pubmed doi rcsb
source organism Pseudomonas aeruginosa
total genus 20
structure length 113
sequence length 113
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2003-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07472 PA-IIL Fucose-binding lectin II (PA-IIL)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.400 Mainly Beta Sandwich Jelly Rolls Calcium-mediated lectin 1ousA00
2CHHA 5A3OA 1OURA 1GZTA 1OXCA 1W8HA 2BV4A 3DCQA 5A6QA 2XR4A 4UT5A 3ZDVA 1W8FA 2VNVA 5A6XA 2WRAA 1OVSA 2JDPA 2VUCA 5A6ZA 4CE8A 2BOIA 1UQXA 2JDKA 1OVPA 2JDYA 5HCHA 2JDUA 2JDHA 1UZVA 2BP6A 2VUDA 5A70A 5D2AA 1OUXA 5A6YA 4AOCA 2JDNA 2WR9A 2BOJA 2JDMA 1OUSA
chains in the Genus database with same CATH superfamily
3J7HA 4QX3A 5C33A 2JKBA 4COWA 1JYWA 3KV9A 3BIEA 1OH4A 1O3QA 1W99A 5HXVA 1WCDJ 4WM7B 5BXXA 1UOGA 2JD9A 4Y24A 3KGLA 1F8VA 5LY1A 1J3QA 3OGJA 3A22A 1SBFA 4N43C 1IGOA 2IVIB 1W2AX 4K1ZA 2RS11 1DBNA 4YW1A 4LBLA 4I30A 5GZFA 3RYPA 3A21A 4G9SB 3SXWA 1ZA4A 2P3JA 4M00A 2A6ZA 3LSDA 5EWSA 3OB8A 4DB5A 2J22A 5C5TA 5FZCA 4CDQB 5KBFA 5BNOB 1RYYA 3VBUA 4NVPA 1EYBA 2IXIA 1L7LA 5FZBA 4FPJA 2GNMA 5T54A 5DG1A 4HFSA 1RUG3 2HWC3 1OBNA 4NHYA 1CX4A 3URFA 1WW4A 2B8MA 4CCEA 1SACA 2FMDA 2XH6A 3KT1A 5F32A 5F5IA 4DEVA 2BTVC 5CFCA 3ALQA 5F5AA 3ATGA 3WY6A 5JWPA 3ZXLA 2SLIA 4FFHA 3OEBA 1OOPC 3DPRB 4QHZA 1QIQA 1WMEA 1M06G 4GA9A 4N43A 4PI0A 3AFGA 4QXBA 4N53C 1DZTA 5FUIA 1PO21 4AHZA 3NAPB 3VBOA 2ORZA 1HN0A 2OS2A 3MLLA 3N9QA 2HWE3 2VQUA 3DN7A 3LPFA 2R1BA 4QPGB 4AZZA 2BDRA 1S0IA 2GC2A 3SCGA 2XKOA 5JZGB 4QPIC 3WP5A 4CDXC 4DEQA 2JB4A 3WUDA 1F4AA 3MGUA 1TE1B 2Y33A 2ZHNA 3ZXKA 1QH6A 4ZHNA 1LJ7A 4QU2A 5EYYA 2YBPA 1NUKA 3NW4A 4NIIA 2RS33 2Z42A 1W6PB 2CY6A 2RS32 4D6SA 1D2SA 4AVBA 1EV13 5F2WA 1EV12 5GLTA 2ZGLA 3HQUA 1W8OA 4LUMA 1DGLA 2ILMA 2GC0A 2ZTNA 4ATEA 1UO9A 1I5ZA 3J26N 1OOPA 3NQHA 1REEA 1C8M1 1X8EA 1VALA 1SBEA 4P5HA 2BBAA 4N53A 1H1AA 4QDSA 2ZKLA 2X05A 3ZDSA 4UW3A 5LY2A 4BQ2A 1PGL2 2YU1A 4K40A 1WD4A 3TYJA 2BERA 2YUEA 5C3SA 1W0OA 4CYDA 3NO8A 4UFMA 1UY2A 5IWFA 2JKXA 3WX5A 4LHKA 2Y0IA 5FDBA 2WZR3 1J3RA 1U5ZA 2B5HA 1SEFA 2VGDA 2WSUA 4P9LA 4CDXA 4E2GA 5FY4A 4BMBA 1WW7A 5FYUA 1W2TA 3OD0A 5A7PA 3RZZA 1D0GA 3ZFEC 2W3JA 5K0UB 3I3EA 2VR4A 2WO3A 1JYCA 3R6SA 1YHFA 2VBBA 1UKRA 2D6LX 1IPJA 1Q5OA 3ILNA 1O7FA 5IVBA 2LALA 4WV8A 3CL1A 4DMIA 3O0XA 1LGCA 3DYPA 5F5CA 1GUIA 5IK5A 1D2QA 4AVVA 3WXPA 1E5IA 4YGDA 2LS6A 3GCWA 2X8KA 2VXRA 1D0HA 5DAWA 4ISRA 2BJSA 3OY8B 4LO5B 3LFMA 5BY5A 5APAA 1JHJA 3TEWA 2NMOA 3O1VA 4UYBA 2XJRA 3ZSKA 1AR93 1LESA 4AL9A 1IPSA 1AR92 1C57A 5FPAA 2P34A 1POV1 2FCUA 5FK8A 5LK5A 2D40A 2Q8EA 3WR0A 1HDKA 2JDAA 4XIKA 5J37A 1UIKA 5JOWA 1B35B 3OGSA 1K5MA 4LBQB 4N9HA 4W65A 1GNHA 5FRAA 5G04L 5IAVA 2VULA 1YFXA 3UT0A 2JG8B 4LORA 4HMZA 4JGZA 3FMGA 5JOYA 1GP5A 5FPLA 1UY4A 2RDSA 2ZGOA 1NCRB 4FXGB 2P3IA 1VJ2A 4R4ZA 1V70A 2H6CA 3TN92 3ZFFC 2XUEA 3WHTA 1GSLA 4MVTA 4UW4A 5AFEA 4DFSA 5TSWA 4CEYC 4CEWC 2J1RA 2WWSA 3GJAA 1OD5A 2BNOA 2ID4A 3EO6A 4GWJA 2RDNA 5C7GA 1CGPA 2DVBA 1NQJA 2ENRA 4M4PA 2XWJB 4CEWA 2FQPA 3T0DA 5EJZB 1OD3A 1JU4A 4Q4W1 3LEMA 2VC9A 5JXHA 1G9CA 5FBZA 3H8XA 1RUF3 3R4DB 3MYXA 5J09A 1RUF2 3K4AA 3DYMA 2WAOA 3M70A 3H8UA 4XJUA 5KHHA 2YV8A 5FMBA 1FX5A 3FUOA 4DOUA 3PDQA 3OCPA 3FBMA 1C1LA 3ZYIB 3IN9A 3TB0A 4IE5A 1W2OA 3TEZA 4FFIA 5JI7A 4HN0A 3HN3A 3WVJA 5FWJA 2DTYA 2MEV1 3PTYA 2GP5A 2BGPA 2VZ3A 5LRSA 1XNBA 5FZ6A 1A78A 2WS91 4X8PA 2OT7A 1YO8A 2ARBA 1MS1A 2IXHA 5ERLA 1OVPA 4CVUA 3ZN6A 1UAIA 1H2MA 1MQTB 3INAA 3CJIC 1GR3A 4GIQA 4IEWA 5FREA 3VBHA 1VMJA 5C3RA 1H1IA 1Y43B 1C4RA 4MV2A 5LA0A 4M3CB 4QD2A 5EV7A 4BK5A 2QZ2A 3FL7A 1HX6A 2FDFA 4XUNA 1DP0A 4N8MA 1DYPA 5CKNA 4M3CF 5FYHA 4GJYA 2VO5A 2EXHA 2P37A 2ZBJA 2Y26A 3AVSA 3C2UA 1S0FA 2X29A 1N1VA 4QB1A 4GKYA 1W8FA 4BB3A 3SKVA 1FYUA 2PHUA 1RUC1 4X8NA 4FAHA 2JJ6A 3UGHA 3S7EA 5ACA3 1ZBA1 4XILA 2ADEA 4QHOA 3B9IA 3D8CA 3LGRA 4LIUA 1BMV1 2E7TA 1RMU2 1UZVA 2JG9C 2PQQA 1AXKA 2WAAA 1W05A 3QH6A 2QNKA 2W87A 1X9PA 3PUAA 3O1UA 4PHZA 2W52A 5A7QA 3BTXA 5I0TA 1KS5A 2BNNA 1HRI1 3ZXFA 1YC61 3CJIA 4IEOA 2BZDA 3MW3A 3OD4A 1BJQA 4FP2A 3VZKA 2UU8A 1XE0A 3VBSC 3ZFGC 5J98B 1QOTA 3SLIA 1PX3A 3AKRA 1OXCA 1MEC1 1S1AA 2JENA 2CAVA 5GZDA 3H8OA 5A3UA 3TBDA 1LENA 5FMOS 1A34A 1SLIA 1LULA 4NR1A 3ETQA 2QBXA 2WBKA 3N9PA 5I0DA 4AHXA 2D6MA 1RUH1 1W9SA 3ACGA 3E5XA 1YQCA 3WG3A 3OOXA 4ARYA 3MDPA 2VM9A 3VKOA 5I8YA 1XXNA 4O9EA 4AFDA 5IK8A 4YM0A 5LBFA 2NN8A 1BHGA 1N3PA 4AEDC 5C5UA 2JWPA 2NM1A 1XB9A 3MHZA 1H8TA 3N9LA 4HVOA 3PU3A 4MH0E 3E1F1 4FPOB 3RJRA 2JG9A 2FCVA 2WA3A 5FMDA 3UV9A 1C5HA 4GALA 1XOYA 3AKPA 5A1AA 3UGGA 4R52A 4NHMA 5DABA 2RR13 1H4GA 2RMU2 4IETA 2O1QA 4KI5M 2NLRA 1UYPA 2JE9A 4FT8A 3ZFGA 5FPXA 2P1BA 1BBT3 3OEAA 4MGKE 5JSRA 1AR81 1BBT2 1UOJA 1XNTA 3PMSA 5D1IA 5F3GA 2E6VA 2ZX1A 1C1FA 5FPUA 4V2WA 3KB5A 2BFUL 5ABJC 1Q8QA 3O7OA 2YY1A 3I2DA 4ASKA 2YYOA 5FO7B 2DUPA 2VXJA 1WZXA 4Q4Y3 1PO12 1RHI1 1NCQA 3Q8BA 4HBNA 4Q4Y2 4YG0A 1CAUB 2DBIA 2PAKA 1S0JA 2VTXA 2VZSA 4AEDA 3NJVA 3HMYA 5F3IA 2ETEA 2W08A 1VP6A 2R063 5D8AA 1OI6A 2R062 3KMHA 4JRAA 5CFCB 1POQA 3HIFA 5LA9A 3W59A 1GWKA 1OVSA 2EIBA 5FR3A 4LBKA 4WBBA 1UCXA 1SHWB 2WO2A 4HKOA 5F5QA 2PELA 3GZUC 1ULPA 1CX1A 1S0CA 1FT9A 1VRH1 2VE1A 2D97A 2CGNA 2WFPA 3POFA 5KC5A 5KHIA 5HI0A 3DEMA 4OHYA 4HXCA 5SV5A 3VBOB 3M2MA 2XQRA 2W1UA 2YZ4A 2J1SA 2OPKA 3OF1A 2RS51 4QKDA 4WM7C 5EQUA 4KBZA 1QY4A 4A7ZA 4D3WA 5A33B 4DXRA 4P5YA 1APNA 2XL9A 3J7LA 1URXA 4AI9A 4D6QA 4JTNA 2CDPA 2Q5TA 2FZ2A 2K0GA 5DUWA 4AVCA 2Q4SA 4IV1A 1RUI1 1GQGA 3AP9A 4P00B 2RDQA 5GZGA 1JZ5A 1QQP3 2C9AA 1WLTA 4CDQC 2PHDA 1DYOA 2Q0AA 4XMIA 3UJQA 4AW7A 5BNOC 2Y60A 1HN1A 3VN4A 1KEXA 4XFFA 1I6XA 5BNNB 5GM0A 2ORXA 4AK3A 3O0WA 3ZN4A 1GNZA 4JQRA 1MS8A 2J1AA 3FHQA 3WCRA 3BPSA 3LA7A 1SLCA 1OA2A 2DF7A 1DLCA 5FMCA 4WM7A 3RGBA 4YGEA 4URAA 1JYXA 1WLCA 2PHRA 2QJVA 1RVF3 3DPRC 2PYTA 3ASIA 2WFF1 2WO1A 4EN0A 5BUVA 5JPNB 1NLSA 1WMDA 3RWNA 1LU1A 5FYVA 4CUCA 5B4XA 2G9GA 5IK4A 1ULOA 3KHBA 1XU2A 3NAPC 4GMP0 1GQHA 1UL9A 4IE4A 5A7OA 4EV0A 2ES3A 4QPGC 2BOJA 3O12A 3QACA 4CDQA 3U75A 4LA2A 5JZGC 1PMIA 2WYFA 3R05A 1ASJ3 4QX7A 2VNGA 4ZPIA 1VBA2 1TME1 2J1TA 3S30A 1QDOA 3ZX7A 4AQ6A 3DKWA 4FAGA 3B5LB 4RGGA 4B4RA 5IUQA 4NWVA 2VW0A 2C24A 1D4M1 2WLQA 4PIYA 4PIZA 5ANQA 5FCCA 5JAXA 5L36A 4FVVA 4HSLA 5GJ6A 5F6LB 2Y34A 2IWGB 2O8QA 3WNNA 4XUQA 3T08A 5KHJA 2XBO2 1VBD2 1W3XA 2DFBA 3S5AA 5F2SA 4IESA 4XMAA 2DV9A 2AC1A 4FPYA 2XLAA 1K5MB 4BHPA 4CCLA 1ZRCA 3Q8AA 5HV0A 1YYNA 3VL8A 4CDUC 2R041 1IPKA 4JGZB 4UFHA 3NAPA 1LOAA 3N36A 4OHVA 5E8AA 3K4DA 4ZU4A 5CISA 4LT5A 5HCAA 1NE4A 1RUD3 2ERFA 4W6XA 4HL0A 1K3IA 3SITA 3B9CA 3HNBM 4N90A 5JZGA 4G3YC 2VH9A 1RIRA 1UYZA 2WNVB 5J1XA 2C0ZA 1J83A 2TNFA 2HEWF 3JD71 2VNVA 4NJ4A 4QGLA 2RDRA 4LUKA 1FPN1 4CTEA 4O7XA 1HKDA 4EWAA 1QJZA 3HT2A 1CZSA 2XLGA 1X9TA 2XMLA 2WINB 4MGSA 2JB8A 4MX3A 5F3EA 3VDDB 3VLBB 4BH9A 3BN6A 2QQVA 2XKPA 2O14A 3FN9A 1W6PA 4JQTA 2F4PA 3OPTA 1DZRA 3B3QE 1WA6X 3EBRA 1MACA 4RN5A 4O9GA 4I2OA 4ZS2A 3KF5A 1JU3A 1KFUL 3EJKA 2Y6FA 4GB31 5FLJA 1XPWA 3I7DA 3UKTA 1V6JA 1DZQA 1PVXA 1U5XA 3POBA 4HPKA 1Z78A 1QDCA 3SEPA 2ZGPA 1KRIA 3KV4A 3THTA 5JUVA 4Q0VA 1RUJ2 4QX5A 3POSA 2XR4A 1S2BA 1WWYA 1X82A 1H2NA 1LR5A 3I4IA 5DN2A 4K1YA 4LE3A 1ZVFA 1JYTA 4META 2MNGA 3T0AA 5DUXA 1B35C 3APBA 5FY7A 1JTZX 5H9PA 3VBHB 3VZLA 1JYVA 1LOFC 5FZIA 3U78A 3WG2A 2JG8C 5K0UA 4BU2A 4CCOA 2CGPA 3P3PA 1Q56A 3VBRB 1PHMA 2VTFA 1NAEA 4J1WA 1RUE1 4XXPA 5FK7A 4KQ7A 1NCRC 4XF4A 3CNAA 3KQRA 3ZYPA 3B02A 3NJZA 4GD4A 4E27A 1AYN3 3CEWA 1AYN2 2W95A 3JBG3 4NRPA 3LD8A 1PVC3 3SNMA 3U11A 1PVC2 1E5SA 4LHSA 3UK9A 4HSJA 3W21A 1TNFA 5BNPB 3RYKA 2QVSB 4P14A 1PM7A 3UJOA 4UFLA 2QQUA 5CKQA 1ULCA 4XFHA 5IVCA 1CPMA 2RJ2A 4RL7A 3D5OA 4QX2A 1CPNA 4EN7B 2VMHA 1UNBA 2LUWA 2XL7A 4RS5B 4QDQA 1UZWA 4YVSB 1AX1A 3WF4A 2AZ5A 2JXAA 3NNLA 4CCJA 1NT0A 3LDRA 1US2A 4NIDA 1ACCA 2WLPA 4HZFA 2JDNA 4Q1PA 4NIGA 1DG6A 4YZ3A 5FP3A 1UY0A 2HJIA 3ILRA 3MW4A 4AXOA 3BIWE 4HG6B 4D7YA 2UURA 1ALYA 5BV6A 3IDCB 3WF2A 4R9BA 1UIJA 1BXHA 1OLQA 1WBFA 2EXKA 5A3WA 3MIHA 4HN1A 3IDEA 3IIAA 4URTA 1J3PA 1MQTC 3L2YA 4DRVA 1KJLA 1COV3 2WJSA 3AJYA 4CP2A 3V64A 4ORFA 2CNAA 2FZ1A 3ZXDA 3QLQA 3HWJA 1AXYA 2DURA 2BP6A 2XWBB 1JXNA 2GAUA 2VCCA 1GV9A 4P02B 1H8TB 4JKLA 4FPKA 3O1MA 1ULFA 3EMRA 2WSVA 4GZ9A 4Q4V3 5CBLA 4C91A 3ZXGA 2EAAA 2GDFA 2XOMA 1QJY1 1QXRA 5EIYB 4B4QA 4MXVA 2WQ8A 1TQ5A 4H7LA 2HWD2 1W8HA 4OI0A 1F5FA 2YROA 5T50A 3RRDA 3U14A 1OC1A 2VCBA 4YARA 3OYWA 5A6QA 2W91A 1PZ8A 1UZYA 1OF4A 2XJVA 1SFYA 4AQ2A 1UW8A 1H0BA 2P3KA 5C3PA 5DAPA 5F39A 5LZ6A 4Y1XA 3K4ZA 4IEZA 5FP8A 3AB0A 2QQNA 4XJ9A 3CHXA 3HPNA 1MQTA 2DFCA 4YVWA 3B69A 5EYXA 4CUAA 1W8TA 2FD8A 3NV4A 4YGCA 4BIFA 3P1IA 4GWMA 1UX7A 4JGYB 4M3CA 2OZJA 4C90A 1MPXA 2W5FA 3T2PA 1H30A 4YW3A 3AK0A 5JMOA 2AR6A 2HWF1 4XACA 4XUOA 2B39A 1JS9A 1ZZ7A 2DWRA 3LDBA 4IL7A 1EAH1 1SPPB 3TRSB 4YW6A 2RS31 5D8AB 3WSOA 4I0BA 5J3UA 3T4HB 3SHRA 1EV11 4LBQD 3IMMA 2GH8A 3OUHA 1Q8PA 1D4VB 2W9XA 4CSWA 2VTXJ 5E88A 2IFWA 2VUCA 1AR63 1VBC3 4KNCA 4OHWA 4XJ8A 1VBC2 4YSFA 1UZ0A 3VHPA 1NQDA 3FHIB 4LLOA 1FOD1 5BPXA 1ZREA 2ZMLA 3FE5A 4AVAA 1OKQA 1PGL1 2RM23 3E97A 2RM22 1AR71 1CIWA 1V0AA 2VCMA 1G9BA 3MZHA 5AVAA 1IS5A 1TNRA 3KQ4B 4JZRA 4LHLA 4YGBA 4AAXA 3K3NA 3ZO0B 4ZZ8A 2ARCA 2DVFA 4FQZA 1JODA 1JN2P 3H3LA 1ZRDA 3A0KA 1KD7A 3EHKA 3AYAA 4RHV2 1B09A 3KV6A 4QXKA 1CAVA 3HD8B 3MI8A 5H9SA 4LNVA 3CZUA 4IV1B 3ZN5A 1YWKA 1MZEA 3MF9A 1DQ5A 4J25A 3MUY1 1Q8OA 1XYPA 2D5HA 2WWUA 1L7RA 4PIXA 4ZU5A 2FBEA 4FTSA 2Y8KA 4H7MA 2OQ6A 4NPLA 3VKLA 1NOVA 1OH3A 2JIGA 1TZOA 5T5JA 3WG4A 2GU9A 2V73A 2W1SA 4DS0A 1ZA7A 3I2OA 4XUTA 1AR91 2E51A 4NIHA 2ZXQA 5CFCC 1NYWA 5FYBA 5FZOB 2UYBA 1HQNA 1O6UA 4KL1A 3VZOA 1AL21 4GH4B 1PK6B 4PF5A 3TEYA 4D0QA 1MS3A 1HRV3 1EP0A 1HRV2 3KF3A 2B9VA 1EUTA 4I3PA 2WQZC 3VBOC 3L9JT 5C3OA 1TMF3 3B7MA 5A6YA 5FTTC 1TMF2 3RQ0A 1LHWA 3TN91 2VZPA 4NRQA 3BKZA 1Z7S3 4EYUA 4XXAA 4IE6A 1CAUA 1KGYA 1RJ7A 4LTAA 3OBZA 1V9U1 1US3A 2YC4A 5FY9A 1RUG2 2BV4A 2HWC2 3IBMA 4ES8A 3N35A 1UOFA 4A2UA 3ON7A 1W90A 1ULDA 1F4HA 3OSDA 2BGCA 1Q8SA 2FCTA 2JD4A 2OVUA 4DXSA 3B94A 1ZYBA 3NJXA 4XQDA 3USSA 5BNNC 2JDUA 1UY1A 1XYNA 2ZX3A 4B29A 5CU1A 5CVRA 4XCBA 4JDOA 4DUVA 1EPWA 3LQCA 4Y22B 1R1ZA 3WNKA 2DUOA 3PVNA 1QHDA 2BVVA 3WP6A 2A5ZA 3SH5A 3U10A 2VVDA 1R64A 1YQ5A 3AP4A 3VDCA 4CRQA 5J96B 5J48A 1QOSA 2HWE2 2XJUA 3MIDA 2BYVE 5C8CA 1OURA 4OCTA 2P4EA 5A33A 1VAVA 4CP1A 3CIHA 1AYM3 3ZYGA 3DUIA 2A73B 4YG3A 1ZZBA 5KXDA 2WT1A 4R9AA 2RG4A 1QXJA 2E32A 1H8VA 3AM2A 4OUMA 3U0ZA 4XBQA 1VB4A 5E6HA 4Q27A 1QEXA 3LF7A 1NXD1 3ZYBA 5J7MA 1OUXA 3SMHA 1KS4A 1WUVA 4KWJA 3UKVA 3KCXA 5F1RA 1ENRA 1NX9A 1SQ4A 2GMMA 5BNNA 1RTVA 1WMXA 2J1EA 2DCYA 1AL0G 1PMJX 1Q3EA 1VPHA 2C4XA 3NNFA 4HPKB 4IEQA 5A3OA 1DQ4A 1QJU1 2HYKA 1REFA 3QBQA 1H2LA 5IVFA 2ZEXA 4IE0A 3DCQA 1RMU1 2YU2A 4BLIA 4DY3A 3S5QA 4CP9B 5JMCA 1ZZ8A 2RE9A 4C8DA 1JZ7A 2BBVA 1W39A 4R9CA 3TEXA 1EPZA 1HXS3 1K5MC 2WZR2 5FP4A 1HXS2 3HOBA 2JDZA 3H7JA 4AVSA 3BU0A 1WCKA 2I74A 1SDDB 5A70A 4L8QA 5FZLA 2Q1FA 4JGZC 3T2TA 5KR7A 1N1SA 1F5JA 4DY5A 1R1A1 4Z92B 2NYYA 4S2HA 4CCCA 1LB2A 1JBCA 3VL9A 3THCA 5T5OA 1JUIA 3KLSA 2WNVC 3RDIA 4CUGA 1R093 1VAKA 3AL5A 1EY2A 1R092 4HOOA 1BVP1 3WDXA 3AKSA 1Y9MA 2VZQA 4XFCA 1CAXA 3LEIA 4PI2A 5C70A 1I1EA 1JUHA 3WZ1A 3ZYFA 3IWZA 1SFNA 2KD7A 4R9DA 1LODA 2GP3A 5EFUA 5A6ZA 5JLVA 2GC1A 5CNAA 2LROA 4NAMA 1H4HA 4TWTA 4Y26A 1HB3A 5T55A 5FOJB 3BOPA 2WC2A 5FY1A 3QOPA 4XURA 5LCWL 2XJTA 1DGRN 2PLV1 1YIFA 2RMU1 2W39A 3PHMA 4BQ3A 4L92A 3O1TA 2QQIA 1NLQA 4F3JA 2A6YA 3NKTA 1ZZ6A 3IZOA 4IEXA 3PJYA 2WQ4A 2HYXA 5CA6A 2IC1A 3MPPG 3WQBA 4RSUA 3DYOA 4B3NA 2OA2A 2VZRA 1E5RA 3FLTA 1ZM1A 2HBUA 3GDBA 4FQ4A 1QKQA 4P9IA 2VNRA 1QNWA 1HB2A 2WNVA 3BPZA 5FQ0B 3K46A 1G7YA 5FAXA 4OMDA 4M01A 3VBHC 2BGOA 1PO11 4DZGA 2WNOA 1U12A 2ZGMA 4AI2A 2ZEYA 1RXFA 5LEKA 3VDDA 1JOBA 3U37A 3OGVA 3VBRC 3KT7A 1WMFA 4MUVA 4QQHA 4RFT0 1H6XA 4XYXA 3H3UA 3J4UH 4ZS3A 5DMYA 4WZCA 2HKXA 1WLWA 2DVGA 2VVEA 4FFFA 1JZ8A 3DV8A 4QAWA 5IAXA 1FV3A 5BNPC 5GLVA 5AC93 4Y1ZA 3ZYHA 4WVWA 3FBYA 2A1XA 5AC92 4HK8A 1HV0A 3RZKA 3OYWB 1SBDA 3FC0A 5A3PA 4K7JA 5BNQA 2D5FA 4MGQA 1BEV3 1XQNA 5FJKA 1BEV2 2WRAA 4RS5C 4ZXEA 1GWMA 2R49A 4BYYA 2UWCA 4YVSC 4DRRA 2HEVF 3V0BB 3N7JA 2RV9A 4HT1T 3N3HA 4ZY9A 4P9GA 1N1TA 2V5YA 4X6QB 2DCJA 2MPFA 4Q26A 4YVWB 1UZZA 4K8FA 4AQTA 3FLPA 5C9AA 3CU7A 4WZFA 3WF0A 2JDMA 3VBRA 4IE7A 2PHFA 1QU0A 4EROA 1Q8VA 2D3SA 1PO23 4UBHA 4ATFA 4E4SA 2OPWA 2ZGUA 3SH4A 5JCTA 1K5JA 5K9YA 5L73A 5BNPA 1OLRA 3IKWA 2C26A 1F2NA 4GWNA 1LAJA 1W8UA 3CKHA 2E7QA 5FWEA 5ACA2 4XIOA 3OUJA 5GZEA 1H8TC 3C7OA 4RS5A 5DXDA 3GM8A 1V6MA 4YVSA 2CL2A 3GCXA 3TNPB 1OT5A 1LGNA 5GLWA 5A3MA 1JHNA 3I2JA 2C6SA 3S57A 1HQLA 1VMHA 3FJSA 2Y6LA 3N9OA 1RC6A 2CWSA 3RSJA 3LEGA 1GP4A 4IUGA 5T5PA 2IUWA 1EUUA 3PUSA 4E2SA 1CAVB 3H42B 2GMEA 4JVAA 3M3OA 1C8M3 1CESA 4DQAA 2K2SA 3PUIA 2D93A 1QMJA 5JDBA 5IJRA 4AQSA 2J7MA 3SISA 5CFDB 2DUQA 3AZWA 4MLOA 3ZSJA 4DXZA 2YPJA 5FFOC 4A41A 2R071 4AEKA 3ETPA 1ENSA 2WZ8A 1VBA1 1YFUA 2E7AA 1NCQC 5JI9A 4CCDA 4JGYC 2CV6A 4W4ZA 3PIJA 4M3CE 1ZZ9A 1SMVA 2VZTA 4GQ7A 5FY0A 3KHCA 1DU3D 2K46A 1LGBA 2OUJA 4COUA 3ZR5A 1DF0A 4AWDA 3K2OA 1O3SA 4LBOA 4E4DX 4AI1A 2X5IB 1CZVA 5D8AC 3C7EA 5A7SA 3POGA 4IW3A 4W6YA 2VNOA 1VAMA 1VBD1 2XBO1 3GHMA 3PUQA 4KWLA 4NUBA 3ME2A 2FMYA 4OHXA 2RR12 4I0AA 4R8HA 4UFKA 4BQXA 3HBKA 2ZCWA 3WNOA 3ITQA 4LBNA 2ZGRA 3WDTA 2ZA9A 2R6QA 4PLOA 2PA7A 4B4PA 2VUAA 5FXVA 4Y4YA 2JECA 1W3VA 5FZDA 2BFUS 1PIV1 3W5MA 4XF0A 4MYEA 3VHRA 2DU0A 4JX0A 1O3TA 1POV3 3OPZA 2OW4A 3KSCA 5LB6A 2OX0A 3AP6A 3I2IA 3TNQA 4JGYA 1AJKA 4WM8B 2PHWA 1REDA 2GNTA 1XC6A 3NRUA 2QQOA 2DCZA 4FPEA 4E4HA 5L7OB 4IV1C 5J36A 4PQ9A 4B7EA 4IV3B 4J1XA 1KDKA 2P3YA 1SPPA 5FZGA 2YG0A 4Q0SA 2A3WA 3TOJA 1PZ9A 3JXSA 4PLMA 4A4AA 1JOPA 4CU8A 5A7WB 3BODA 5A1LA 2YPDA 1W0NA 1UY3A 2VBDA 4XETA 1CVNA 2GMPA 4MHUA 2WNUA 3S7IA 4O65A 1WCUA 1YJKA 4BA6A 2FDHA 2CAUA 2DYCA 2W1WA 1ND3B 2EVXA 1LHVA 1ZRIA 3C7HA 3VHNA 3BI3A 1O59A 2A3XA 2D3RA 4NHXA 1RUJ1 1O3RA 1UD1A 4UWDA 3THPA 1PMHX 4Q4W3 4KGGA 4LBMA 4Q4W2 5DUUA 5A3LA 1Y4WA 3HT1A 4GWIA 4Y5Z0 5DAXA 3KVAA 1OFSA 3N4MA 5C8CB 1LOCA 1R081 2A71A 2GC3A 4YFZA 4XTMA 4XUPA 4XABA 2Y6HA 2NQYA 4GH4C 1PK6C 4LE4A 5D21A 2GH2A 2ZHKA 3K75B 5FXZA 1IG3A 1J84A 4FPHA 3LA3A 4UW6A 4I3GA 4F83A 2EIDA 1GYKA 4C0HA 4FTEA 5JSPA 2MEV3 3N9NA 1WBLA 2MEV2 1AYN1 1QQP2 1F15A 1LEDA 4HKWA 4YZ5A 2WS93 2WS92 4PDWB 1T2XA 4INDA 1X36A 3CLPA 4TYSA 2QQLA 5EJ3A 2WT2A 5C4WB 1IS3A 2PXJA 4V2VA 3NV1A 4OQ9A 3GBGA 5K0UC 1OQDA 1N3OA 5H9QA 1NXMA 1QH7A 4NRMA 2PAEA 3D4KA 3GXUA 2G4IA 1YQ2A 4BCUA 2XXZA 1AHSA 5JPMB 4LXLA 5FZOA 3WT3A 3DGTA 2PTMA 4OLLA 2XHKA 3AL6A 2XQXA 2ARAA 3KD4A 2HWB1 3VZJA 3HN1A 4FO9A 4QPYA 4RQPA 4GH4A 4EZ4A 1PK6A 2EIGA 1W8ZA 2EIEA 4CCNA 2GNDA 4XAAA 1C5IA 5FKBA 1RVF2 1XNDA 4OULA 3LA2A 5KXEA 1BQPA 1DQ1A 3IB3A 4MADA 1FMD1 4XFBA 1GMMA 4XDOA 1ZBA3 1P8JA 3I97A 4XQWA 2ZAHA 2D7FA 3D0SA 3RS6A 3LDKA 2WR9A 5L19A 1W8WA 2AREA 1JZ4A 5A80A 1BMV2 4XFIA 4Q4X1 3IDBB 2DBNA 2HBTA 4CXWA 5JOXA 1ASJ2 2J42A 1LCLA 3WUCA 4JDMA 4EN6B 3JB8A 1HRI3 5HCBA 3LZZA 5FIXA 1ND2A 4JC1A 2XVGA 1CAXB 1V6NA 3WW4A 3Q9OA 1GOGA 2RJKA 3Q8FA 2A6XA 4F8AA 1MEC3 4NAOA 5LEJA 4CE8A 3W5NA 5K7PA 2E26A 4RD7A 5LA1A 4Q0QA 2WKKA 5BYNA 1QOOA 1FNYA 1OQEA 1RUH3 2HWD1 1I5PA 2A70A 2V09A 4D94A 4Y22A 3W9AA 3HEIA 1AJOA 3VD4A 1BLZA 2AACA 4NO4A 1KFXL 3SCHA 1O8PA 5JXJA 1NY71 3FX3A 1VBB1 3RMYA 1ZRFA 1RUD2 4YPJA 4MSVA 1RUNA 1OHFA 2A75A 1WW5A 2YGLA 5FLIA 3OGRA 3OG2A 4LA3A 1ZBE1 3AX4A 4GULA 5EPAA 3WNLA 3BYWA 3DF0A 4FOYA 5A1FA 1LKNA 1OF3A 1QF3A 5F8PA 1W6OB 1ODMA 5FZKA 3Q8CA 1QJX1 1AR83 2QFEA 4IDZA 4XEZA 4CXYA 4QQLA 1AR82 5JXIA 1VBE1 4I02A 4P9JA 3T3YA 4PLNA 5LA2A 3LOIA 1C3HA 4ITCA 4XZPA 4A45A 1DGRA 1MS5A 2Y38A 4A7KA 4CCKA 1ULEA 3WQ7A 4Q5OA 4YW7A 4CDWB 4K8RB 1LU2A 5EP9A 2EXJA 4KWKA 2BW8A 4BQWA 3VGIA 2XJQA 3MLJA 1RHI3 2G1MA 2ZABA 2LW8A 3G7DA 3VBFB 5GKAC 2QQKA 2ZX4A 2XG3A 1UOBA 3MIBA 4UT5A 4WVZA 3HJRA 4LMFA 4BE3A 4XFGA 1CJDA 2RM21 2N7GA 1UPSA 4CP9A 3WNMA 4U2AA 3ZXAC 4P9YA 1YLLA 3PTRB 1GBGA 3ZSLA 5FZ0A 5DAQA 3WOGA 3WD5A 2I2SA 1TVGA 1FAYA 1K42A 5JIAA 1W04A 2CWMA 5FOBB 4LKEA 1DIWA 4RHV1 4DO0A 4E8DA 5C9AB 1H9WA 4M0HA 4FXKB 3I3MA 5LWBA 2BUKA 4E9KA 4D7SA 3MV01 3SEEA 3PLQA 4OVEA 3VKMA 3WINE 3FFQA 2CDOA 2V5DA 5FUNA 1IS4A 5F37A 3H7YA 3RFRA 2VAUA 3H50A 3JBG2 4Z1VA 1HW5A 2W46A 2R32A 3L2HA 3LWCA 1YI9A 5C71A 3H8RA 1JYIA 3MO4A 4BPZA 3NV2A 2WN3A 1GWLA 1ZX5A 3H1WA 3I54A 3ZXJA 2A3YA 1JZ2A 4FPFA 4FPLA 2YB7A 4EQVA 1RUI3 1NA1B 2TEPA 3KCYA 1RUI2 2IZWA 1UXXX 3FZ3A 4QXHA 4EWDA 2DVDA 5C8WA 3WW3A 2PAMA 5FO9B 1GOFA 1M4WA 4MXWB 4F7ZA 2W94A 1BK0A 2F17A 2Z4FA 3AKTA 5IVYA 2ZGNA 3EQEA 4YFWA 1A8DA 1MS9A 2KM2A 2VMIA 4QB2A 3H9AA 1DGWA 4Z8BA 4YG6A 4AGRA 1T6BX 2XJPA 2HH9A 2ZEWA 3N7LA 1WKYA 4QMAA 5FBJA 4DUXA 1OPMA 1SLAA 4NWWA 3WDYA 5FQ0A 4FPGA 4QGNA 4NROA 4L99A 2YHJA 4YVWC 5EXOA 3VZMA 3RJ2X 1COV2 1UPIA 1XE8A 3LFIA 3N7KA 1YJLA 4NHLA 3UESA 3RZLA 3PJQA 4AGVA 4LEJA 2H6BA 4KBBA 4XTPA 1W03A 3NJYA 2WFF3 1RUG1 4R4XA 2HWC1 4TLGA 2WFF2 4UAPA 5H9RA 4FOQA 3KWVA 3P5BA 2B9UA 1UKGA 4QT6A 1D7PM 3RYRA 5FZMA 5CYYA 1V6IA 4Q2FA 3UL2A 4Q4V2 2R7EB 4C1WA 3BVCA 3ENRA 1CZTA 2E53A 3ZYRA 1JI6A 2FDIA 3OBRA 1TME3 4QKNA 1CJPA 3HQRA 1H6YA 1TME2 3HAGA 3HR9A 3U07A 1VLNA 4M4RA 1D4M3 4K3UA 4OUEA 3V0BA 1HB4A 1V6OA 1D4M2 1X50A 5ISLA 1SDWA 4HLTA 1E5HA 2JDHA 4XW3A 5FZHA 2HWE1 3BGAA 4Q0UA 4WVMB 2V4AA 3GBFA 2CU5A 4QPWA 4Y5SA 3IDAA 3J9SA 3T0BA 4XZUG 3SQOA 2EXIA 1W0PA 4OUSA 1DLLA 3KT4A 1WCSA 3AJZA 5T5LA 5I91A 3LAGA 1ENQA 3F2ZA 1SLBA 2R043 5CFDC 5IFTA 2R042 1GICA 3H0OA 2GZWA 3MIEA 3AYDA 2P2KA 2WL1A 5FZEA 3W20A 3QCWA 3ZDVA 2NPIA 1WCQA 2XGXA 5F6KA 3JB4C 4YRDA 1F35A 2G19A 3AYEA 2WNUB 5B2GB 1AR62 3RZJA 3JD73 2C5DA 2OIIA 3JD72 3MPBA 1FPN3 4BK4A 2ZX2A 5FZ3A 1X7NA 1GANA 4TTGA 2DCTA 1FI2A 4OFGA 4Z07A 2ZGKA 2FHRA 3T4VA 4Z82A 1KJRA 2X5IC 4XDQA 1Y3TA 5FPZA 3V56A 1I9RA 1F31A 2BWCA 5EZWA 2SBAA 5E1RA 4MO3M 1DGWX 5FLHA 2AEZA 1LHNA 4IEPA 5FZ4A 3AVRA 5L9BA 1XE7A 4JTOA 1W6MA 2WZR1 1HXS1 4HONA 2B7YA 5CG8A 2WIIB 2D6NA 4L2NA 3LPGA 1IQAA 4GB33 4RR3B 5CFDA 3NSTA 4IGOA 3U4XA 5FP9A 1S2KA 3A0NA 3O1SA 3R0RA 3WV6A 2YMZA 4SBVA 4A3ZA 3GZTB 5DAVA 4ZONA 1SLTA 1LHOA 1GZWA 1R091 4WM8C 4COVA 5KWRA 1JZ6A 1DHKB 1W9FA 4ES9A 4MGZE 5L7OC 1WLDA 3H1YA 3D6EA 1UYYA 3IM0A 3NNMA 1YEWA 4YLZA 1QXPA 4IV3C 2OUHA 2X5IA 2YC0A 4YZ2A 3AP5A 1YNAA 1RXGA 1S0BA 5GZCA 2PHTA 3AZZA 2J1UA 2W2IA 4CPBA 4XPVA 4QX8A 4GJZA 1LRHA 4RQPB 2R0HA 4AVTA 2VQAA 4YZ1A 2VW1A 3WQ1A 1ND3C 1UQXA 3KVBA 1N47A 3E5UA 2ARXA 3LB9A 4PBOA 1V6LA 2Q8CA 5IVEA 2D6OX 2YGMA 3B01A 1SG3A 2WZEA 1S0EA 3NNGA 1YQ6A 4RFRB 3FUQA 4BMEA 5C8CC 3BCWA 3AKQA 2XHNA 2J1VA 1Z7S2 4WM8A 2W1QA 4FP3A 1XU1A 4QWNA 1PGW2 4YM1A 1ND2B 2QZ3A 3S0MA 4HANA 5L7OA 2X10A 1A8MA 3IAQA 4IV3A 2P17A 2GNBA 3POEA 3ZKUA 3FFZA 5EJ1B 4NN0A 1AVBA 3K48A 1RUF1 3IIIA 1BYHA 2PMWB 2VJXA 3ZPYA 5A7WA 1W6NB 3K3OA 4CU9A 2VMCA 3RI8A 3T2OA 4PDWC 1VR3A 4P9WA 5C4WC 5I0SA 1O8SA 1U5YA 2JE8A 4MOAA 1ND3A 4ZKTB 5AC91 4LKSA 2C1FA 3H3ZA 4Z2AA 5FP7A 4JDNA 1F9KA 1IG0A 2Q8DA 1BEV1 1YRZA 4AHYA 4XE9A 1AF9A 4UBGA 2IXCA 4XCAA 2BEOA 1W9WA 3RMXA 5FV3A 4UF0B 1ULGA 1AYM2 1QJY3 5DZGA 1QJY2 1BCXA 3UYJA 1C28A 5DZEA 2QQWA 2I07B 4Z2WA 1OA3A 2JICA 2W47A 1GOHA 2YXSA 2ZZQA 3T09A 4AI3A 2LRPA 4CPBD 1UX6A 2VZ1A 3P3NA 3ZPOA 3KM5A 4AG4A 2ZHMA 3KCCA 3P6BA 4FCAA 5K8SA 2Z2SB 1XNAA 4PDWA 4Y1UA 2Z69A 5EHDA 2R1DA 4H2AA 4XF9A 5LRRA 5C4WA 4A7YA 2D98A 2CHHA 2ZKNA 3A7QA 4LBJA 2A7AA 4Y1YA 3DXUA 1VE0A 5ACA1 1SZBA 5CG9A 2VD7A 4LKFA 1JOJA 1UN1A 2HWF3 5FXWA 2HWF2 1K45A 1EAH3 1YIPA 1SCRA 1EAH2 3AZXA 1PNFA 1XRUA 1UU6A 5IK7A 3M3CA 3TAYA 2C9KA 4YM3A 3W58A 3SC7X 4CP0A 4FI9A 1IZ3A 4EZHA 1DQ2A 1FOD3 1WD3A 4TSVA 1FOD2 4RGAA 2JE7A 4CDUB 1XSQA 2ZEZA 1AR73 2ET7A 1VRBA 3RVHA 1STMA 1AR72 3ACIA 3IAPA 4MGIE 2EICA 5JR7B 3WG1A 3ZSMA 3I3BA 5DDJ3 2JEMA 4N7IA 5DDJ2 1CAWB 1HB1A 1OMIA 3LIHA 2DDUA 4PBPA 4QPIA 1FNZA 2DU1A 4IERA 1LNSA 3VDDC 3ZR6A 4CUBA 1GQPA 4XAEA 3HVDA 4BQ5A 2DCKA 1UYXA 2BQPA 2WWJA 2WYSA 3FLRA 5KHKA 1A6CA 4LOSA 3UETA 4DINB 4EE2A 4YWAA 2D43A 1MR5A 4GMP3 4MGTA 1V00A 2EA7A 2UWAA 3O5SA 1X8MA 3M1HA 4LO6B 1O91A 3D0JA 4KH9A 4W50A 4CDWC 1XNCA 2RR11 3ELNA 4RGKA 3I2FA 4LQRA 4XBNA 5HV4A 1HLCA 3T2QA 3VBFC 4QB6A 3R4UA 3AMHA 2BNMA 1BBT1 2UYAA 5ANNA 4QQPA 3PU8A 3CO2A 4GXLA 4C0BA 4IQPA 3J8F3 3T30A 3J8F2 4W8JA 4LJHA 3I49A 1NZCA 4N7UA 4ISQA 3C8XA 3U1XA 4OQ8A 2ZZJA 4GAZA 5I0UA 4JHZA 2WUHA 2VZVA 2ZPXA 2B4KA 5KHGA 4Q4Y1 5C9AC 4B8EA 2FDGA 2D6KA 2JDYA 2VMGA 4CA9A 4JRLA 1AL23 5HPOA 1W6OA 5CAZA 4FSJA 2QQMA 1AL22 1OLMA 1AXZA 5LK7B 5FXXA 2XONA 2QQPA 1VMFA 3ZFEA 2RS13 4D69A 2O8OA 1K12A 4AFAA 2RS12 2YDEA 4AI0A 3CJXA 4LO8A 5FYYA 4ZZ5A 2R061 2LTNA 1H9PA 2WT0A 2WDBA 3M4FA 4CDWA 1N1YA 4PT6A 3HBZA 3MW2A 3TN93 3WF3A 4Q8KA 5L9RA 4Q8LA 4W6WA 3VBFA 2ET1A 1V9U3 4QDRA 1TEIA 1Z0HA 1V9U2 3GGLA 4BM8A 2UWBA 4KGQA 3NVCA 4Y4RA 1NA1C 3VKFC 1AUYA 5CADA 4XF3A 5KXBA 1GP6A 1LOEA 2QDRA 5DUVA 1O5UA 3I2HA 3WDUA 1ZNPA 4FPCA 1CR7A 4NOTA 4IEYA 4LKDA 4H55A 5G05L 3ZLIA 1QWRA 5DG2A 5LATA 3N9MA 3VUOA 4UFIA 4LK7A 4B1LA 1YXWA 3MIFA 1BK1A 4QX0A 2ZS6B 4V1PA 3VZNA 1HJGA 1Q43A 1PO22 1UU5A 3N7MA 2AUYA 2QQJA 3M3EA 4P9XA 1GNYA 1W2NA 1HIXA 3VKNA 1MVEA 2CTVA 3WP4A 3PNAA 1QQP1 3PURA 4B7KA 5A6XA 2F4LA 3ZFFA 2E63A 4LIVA 3F95A 3GNEA 1L7QA 4KG0A 4LULA 4CEYA 1U0AA 3DKQA 4BOWA 3RG0A 3LOBA 1NKGA 1X33A 2ZGQA 1NZIA 3J8F1 1A3KA 5FY8A 1NA1A 3VDBA 1GZ9A 4HK9A 5E89A 3AFKA 1SCSA 1W6QB 4LR4A 4YW2A 3J7NA 2VVFA 4MXWA 1JH5A 3MFCA 4CU6A 2Y0OA 1T6GC 2GN7A 1YFYA 1W6MB 2K9ZA 4XHXA 4PQQA 3ACHA 1RVF1 3JU9A 2Z79A 3D3AA 4E2QA 1C8M2 1XJAA 1YQ8A 1WGPA 3AP7A 3UNPA 1QJU3 1QJU2 4BIOA 3LE0A 1RMU3 4BXFA 3BUCA 3I59B 4YNIA 3RZHA 4RYDA 1ASJ1 1YI7A 4JKMA 1GZWB 3LIGA 4K20A 3NNJA 3Q8EA 4XBLA 3ZSEA 4EN9B 2LM3A 3VD9A 1S55A 2TBVA 5IATA 3V0AA 4AI8A 1DDLA 2B42B 3IPVB 5IFPA 4ONUA 2XB6C 2HLEA 1KDMA 5JIUA 4Y20B 4OI1A 5FJHA 4EWEA 3HNYM 1FV2A 4UW5A 5F7UA 1C8NA 1R1A3 4KU7A 4EJRA 1R1A2 4UXAA 2VZOA 3I2GA 1G86A 3GHNA 2QKDA 4RA0A 3NKGA 3EB7A 4OZOA 5FMOL 4AHWA 3BOWA 4GKXA 4I0WB 4Y1VA 2WNUC 5KC6A 3KS7A 4TZDA 3O1OA 3VV1A 1XSRA 2IXJA 3M7AA 3JUUA 2CSGA 4OYUA 2BOIA 1H1MA 2DVAA 4BWOA 3POWA 2Q8OA 2I45A 4U36A 1S0DA 2VOKA 3LEKA 3KZ4C 1RUD1 3AZVA 4WVMA 5IYYA 2QDNA 1Y9QA 3ES4A 3O1PA 2VL4A 2X53S 4XOGA 4PF1A 1SFPA 4B1MA 3ST7A 1YFWA 2PLV3 2RMU3 2VMDA 3C7FA 4O61A 2A6WA 1CONA 2PLV2 4I09A 3S6PA 2XJSA 2GN3A 4WVVA 4RR3C 3VBSA 4A42A 2VW2A 2Y6GA 3E6DA 4A6SA 3PVEA 3ACFA 3ZMOA 4AR2A 3GZAA 3BTYA 1IOAA 4KWUA 4PCRA 1G9DA 1RITA 3BTAA 4D8MA 4N9IA 3CZJA 4JCKA 2PQSA 2ZHLA 2W68A 3GBWA 1W28A 4X6RB 4LLFA 3RWKX 1PO13 5JXGA 3C3VA 3VBUB 4BXSV 3OGGA 4JHTA 4LHNA 3VHOA 3K77A 3AYCA 4K6BA 5GALA 4DNYA 4ZU7A 1YCIA 1MZFA 1HQWA 5LASA 2RJLA 1U5IA 1MS4A 3QH7A 3USUA 1MS0A 2FDJA 2VU9A 4BJ0A 2YBSA 2NP0A 4AEJA 1IKPA 2O0OA 4RQPC 3BTZA 3OBAA 4D6RA 5HCFA 4ARXA 1ODNA 4KU8A 3R4SA 1IQDC 5FYIA 3ECQA 1AX2A 4COYA 4RR3A 2G9FA 1GKBA 2ADDA 2JDKA 2UY9A 4H3WA 4HETA 2Q1ZB 2GSYA 4QX1A 4N43B 3AMQA 4QU1A 2OQ7A 2AH2A 3MICA 4A3XA 4E8CA 5HCHA 2XVLA 5GLUA 2IXLA 3O14A 2WO7A 3WQ0A 1GFF2 3POIA 3PUHA 3JBG1 2VOXA 5ABJA 1PVC1 1V6KA 4QHBA 3RI9A 4D7TA 1LTEA 3NV3A 1Y7BA 1HV1A 1RINA 1ND2C 1HJFA 4FBFA 4AF9A 1Y9GA 4K21A 4HVQA 2P6HA 4S2FA 5FKCA 4UI9L 3I8TA 3T1MA 4ZXKA 3RZMA 3OBTA 4LITA 5FY5A 1RGSA 4QXCA 2RVAA 2XDVA 2ZJCA 4BQ4A 4L11A 4I01A 5FZ9A 4BZ4A 2R16A 3MLKA 1OKOA 3PL0A 1H2KA 2R30A 1LOGA 5I93A 1NLRA 5IVJA 3C7GA 2DTWA 4HKLA 4TN7A 2OKXA 1RUC3 2Z5WA 1RUC2 3RNSA 1OA4A 4G4FA 1OOPB 2NMNA 4LPLA 4YYOA 3AC0A 5GLZA 1J59A 1ZBA2 1PNGA 2B45X 2ZACA 3B00A 3MV11 1XYOA 1DFQA 4N53B 3MUZ1 5A32B 2OXBA 4TXWA 3OTFA 1IHMA 3A4UA 4ASLA 3WP3A 5FZ1A 2F6BA 3HQXA 2BU9A 3KGZA 4LOTA 1MVQA 2D3PA 4KMQA 1JZ3A 1OFNA 1WW6A 1COV1 5I0RA 4FTBA 1HRI2 2MHFA 2VUJA 3WW1A 2Y64A 4QPIB 4CDXB 3O0VA 3AXEA 1AX0A 4IXLA 2E9QA 1JYNA 4MG2A 1MEC2 1DQ0A 3M3QA 1PX4A 2P5BA 1W6NA 2VOWA 4XJZA 2IVJA 4Q4V1 2VOVA 1MZ5A 4Q29A 2Q1MA 4XFAA 3BU7A 4IEUA 4Y3OA 3AMNA 3JQXA 1LEMA 5IHRA 2R073 3ORJA 5FYZA 5BNOA 3ZMNA 2R072 1RUH2 1VBA3 4H14A 2YFUA 2VY0A 3FWEA 3GF6A 4XF1A 5FPBA 5K4LA 3VD7A 5B4NA 1J1TA 2JX9A 4QM8A 2YBKA 2W0XA 1AZDA 2PN5A 5LBEA 1RJ8A 2QTWB 4QQOA 5DZFA 1UMHA 3MEPA 1OQ1A 1O5LA 3MIGA 5DQ0A 4UF0A 5DPNA 1IS6A 2XBO3 1VBD3 4LO7A 1FXZA 4IGQA 2ZGSA 4XHBA 2AGSA 4QM9A 3O1RA 4XDPA 3DPRA 1UF2C 2E33A 2Y6KA 4JAAA 4AOCA 4YW4A 3ZFEB 5FYSA 2OYZA 5HBAA 1PM4A 1PIV3 2PHXA 2VMEA 4BISA 1PIV2 2CYFA 3ZOIA 1G9FA 2Q30A 1PZ7A 2RHPA 4QPGA 2VBPA 4HVRA 5C3QA 5JR2A 2ZMNA 1AR61 1VBC1 5FYMA 1RHI2 3BB6A 4JV4A 3SKJE 5CZKA 3WNXA 4AFBA 3A23A 1CN1A 5A32A 5IVVA 2JDPA 4QQ2A 2YFZA 4XQ4A 3LKJA 4FOVA 3ES1A 4DIQA 2QCSB 4MGYE 4DXTA 2H0VA 3ZKYA 4BQYA 3WHUA 2D44A 1OSGA 2VOTA 4FOWA 2WN2A 5FPVA 4BLJA 5LW9A 1L3JA 5HXMA 3E6BA 1W8NA 1QGLA 1CD3G 2ZGTA 4L97A 1UMZA 2ZMKA 1VRH3 4OZXA 1KQRA 4CDUA 1VRH2 3MBWA 5I8TA 2VPVA 1RUJ3 1W06A 2KXLA 3NMBA 5IT6A 3RPQA 1PGSA 2RS53 3EYPA 1W2UA 5CB7A 2RS52 4IEVA 3RZGA 1R083 4UFJA 4YM2A 3ZFFB 4XVHA 1R082 1CAWA 4C1XA 4ET7A 5F9TA 3ABZA 4YW5A 1VIWB 3ILFA 3ZN6B 3UGFA 4AYUA 1OLME 4CEWB 4CEYB 1LECA 5D2AA 2VECA 1UXZA 1VB2A 5FZ7A 1GLHA 2UY8A 2ZOEB 2VQ0A 3D82A 5E16A 3LSEA 1LOBA 3SCFA 4BQ1A 3WDWA 1NE6A 4NMIA 4XC9A 4AE2A 2XPJA 1BZWA 4J6GA 3E5QA 3AMPA 3NL1A 1ZRRA 5C6CA 1HRV1 3VD5A 2XVKA 3KV5A 2E31A 2V4VA 2R0FA 3OY8A 3ZIXA 2FDKA 1G6NA 4PJYA 4QKBA 5CKMA 3EXUA 2VQTA 1DQ6A 2CGOA 3MFAA 1J58A 1ZZCA 1TMF1 2BRTA 5JVVA 5LBBA 5KXCA 5T52A 4XJAA 2PFWA 3SH3A 5FZFA 2QUOA 1KXGA 3PVBB 3X29B 3WLUA 1CQ9A 1QJFA 1Z7S1 2IXKA 2HWB3 2VUDA 3H1MA 4L9BA 3ZIWA 2V72A 2HWB2 4AAPA 1JMUB 1B35A 1PGW1 3I2KA 4AFMA 3M3IA 4LBQA 3V0AB 4XJWA 3CJIB 5AVPA 1W9YA 1LOFA 1XNKA 3B93A 2JG8A 2ZAAA 4OI2A 2EF6A 1FMD3 2AEYA 1FMD2 1LHUA 1DCSA 2ZX0A 2EAKA 3TWIA 2BWAA 1CWPA 1DYKA 1NCRA 2VMFA 3BALA 3WEZA 4BDVB 3WW2A 5FYTA 3M8LA 2JIJA 5JSOA 1GU3A 1N3QA 2NZ9A 1XBFA 3AXDA 4Q4X3 4ASMB 5A3TA 3K51A 4Q4X2 1O4ZA 1W9TA 4CU7A 1O4YA 3WCSA 3WDVA 3THDA 3POJA 3VB9A 3G6JB 4LK6A 3OJBA 1O4TA 4A6OA 1S0GA 1RUOA 2X09A 4L0PA 2B46X 4Q1RA 2HEYF 1MZ6A 3VD3A 1BKZA 5SV8A 1KITA 2W92A 4DPNA 5M0TA 2BVBA 3E6CC 4AGGA 4P08A 2JG9B 1TG7A 1ST8A 2WA4A 2OZ6A 2XUMA 3CQOA 5CEHA 3ZYJB 1POV0 1RB8G 4MHRA 1OUSA 2YC2A 2VG9A 3JQWA 3ACLA 5A3NA 1AYM1 3NWKA 5FO8B 4JKKA 3GJBA 4Y5TA 2QE3A 1FATA 4CZSA 2HWD3 3HNMA 1GZTA 1QNYA 3MF6A 2KR2A 3VBSB 3DL3A 3ZFGB 4DUWA 4NE9A 3ROUA 1NG0A 3POYA 5CIRA 4QGMA 3ZM8A 4AEMA 1VBB3 3PVOA 1NY72 5FUPA 1WA4A 4CCMA 1VBB2 3IT8A 1ONAA 1UU4A 3FHAA 3PIGA 3PMEA 1RL3A 2VCAA 1ZBE3 3V65A 4TLFA 4IGPA 1ZBE2 1ENXA 1NCQB 1FPN2 4COZA 4NPMA 5IW0A 5FZ8A 2VZUA 1E57A 2KA3A 2Y6JA 3JCIA 4M0NA 3LCPA 4S2GA 4FFGA 1J1LA 1QJX3 1JW6A 1W6QA 4OI4A 4AEDB 4E4ZA 1QJX2 4EN8B 1VBE3 1VBE2 3USUB 3GZEA 1YUDA 4KG8A 2H0BA 4UOJA 1G9AA 1SLLA 4NHKA 1IKQA 4SLIA 5F3CA 5L9VA 5AFBA 1G8WA 2A6VA 4OMCA 4GB32 5T3NA 2AENA 2PHLA 3T1LA 4S2DA 1UMIA 2BPA2 3DECA 3IMNA 3GYDA 5LBCA 3ZVXA 2EALA 2L9LA 3DXTA 3I59A 5A7NA 3WF1A 1GZCA 2TUNA 3CDZB 3OPWA 3VDAA 1S4CA 2WABA 3OUIA 2WNEA 4NIAA 2G9ZA 5ABJB 4K9SA 5JOZA 3QD6A 4OHZA 1CIYA 3CMGA 3I3QA 3J7MA 5DDJ1 3IPVA 3JZVA 3UKNA 4RHV3 5I8SA 2D6PA 3ZXEA 4Y20A 4YZ4A 2GALA 3U4SA 3AMMA 4CXXA 3CF6E 2P6CA 1RUE3 4A44A 4QKFA 4Y33A 1RUE2 1S2EA 3CBNA 2XLFA 3I3DA 2WZPP 1OPOA 4GMP1 1BVVA 1UWWA 5FZAA 1I3HA 3GALA 4AFCA 2AYHA 3VBUC 4NPRA 4LO4B 2ATFA 2IFRA 4MZUA 4Q0PA 5FYCA 3WNPA 3AZYA 1QJEA
chains in the Genus database with same CATH topology
2CHHA 5A3OA 1OURA 1GZTA 1OXCA 1W8HA 2BV4A 3DCQA 5A6QA 2XR4A 4UT5A 3ZDVA 1W8FA 2VNVA 5A6XA 2WRAA 1OVSA 2JDPA 2VUCA 5A6ZA 4CE8A 2BOIA 1UQXA 2JDKA 1OVPA 2JDYA 5HCHA 2JDUA 2JDHA 1UZVA 2BP6A 2VUDA 5A70A 5D2AA 1OUXA 5A6YA 4AOCA 2JDNA 2WR9A 2BOJA 2JDMA 1OUSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CHH A;  5A3O A;  1OUR A;  1GZT A;  1OXC A;  1W8H A;  2BV4 A;  3DCQ A;  5A6Q A;  2XR4 A;  4UT5 A;  3ZDV A;  1W8F A;  2VNV A;  5A6X A;  2WRA A;  1OVS A;  2JDP A;  2VUC A;  5A6Z A;  4CE8 A;  2BOI A;  1UQX A;  2JDK A;  1OVP A;  2JDY A;  5HCH A;  2JDU A;  2JDH A;  1UZV A;  2BP6 A;  2VUD A;  5A70 A;  5D2A A;  1OUX A;  5A6Y A;  4AOC A;  2JDN A;  2WR9 A;  2BOJ A;  2JDM A;  1OUS A; 
#chains in the Genus database with same CATH topology
 3J7H A;  4QX3 A;  5C33 A;  2JKB A;  4COW A;  1JYW A;  3KV9 A;  3BIE A;  1OH4 A;  1O3Q A;  1W99 A;  5HXV A;  1WCD J;  4WM7 B;  5BXX A;  1UOG A;  2JD9 A;  4Y24 A;  3KGL A;  1F8V A;  5LY1 A;  1J3Q A;  3OGJ A;  3A22 A;  1SBF A;  4N43 C;  1IGO A;  2IVI B;  1W2A X;  4K1Z A;  2RS1 1;  1DBN A;  4YW1 A;  4LBL A;  4I30 A;  5GZF A;  3RYP A;  3A21 A;  4G9S B;  3SXW A;  1ZA4 A;  2P3J A;  4M00 A;  2A6Z A;  3LSD A;  5EWS A;  3OB8 A;  4DB5 A;  2J22 A;  5C5T A;  5FZC A;  4CDQ B;  5KBF A;  5BNO B;  1RYY A;  3VBU A;  4NVP A;  1EYB A;  2IXI A;  1L7L A;  5FZB A;  4FPJ A;  2GNM A;  5T54 A;  5DG1 A;  4HFS A;  1RUG 3;  2HWC 3;  1OBN A;  4NHY A;  1CX4 A;  3URF A;  1WW4 A;  2B8M A;  4CCE A;  1SAC A;  2FMD A;  2XH6 A;  3KT1 A;  5F32 A;  5F5I A;  4DEV A;  2BTV C;  5CFC A;  3ALQ A;  5F5A A;  3ATG A;  3WY6 A;  5JWP A;  3ZXL A;  2SLI A;  4FFH A;  3OEB A;  1OOP C;  3DPR B;  4QHZ A;  1QIQ A;  1WME A;  1M06 G;  4GA9 A;  4N43 A;  4PI0 A;  3AFG A;  4QXB A;  4N53 C;  1DZT A;  5FUI A;  1PO2 1;  4AHZ A;  3NAP B;  3VBO A;  2ORZ A;  1HN0 A;  2OS2 A;  3MLL A;  3N9Q A;  2HWE 3;  2VQU A;  3DN7 A;  3LPF A;  2R1B A;  4QPG B;  4AZZ A;  2BDR A;  1S0I A;  2GC2 A;  3SCG A;  2XKO A;  5JZG B;  4QPI C;  3WP5 A;  4CDX C;  4DEQ A;  2JB4 A;  3WUD A;  1F4A A;  3MGU A;  1TE1 B;  2Y33 A;  2ZHN A;  3ZXK A;  1QH6 A;  4ZHN A;  1LJ7 A;  4QU2 A;  5EYY A;  2YBP A;  1NUK A;  3NW4 A;  4NII A;  2RS3 3;  2Z42 A;  1W6P B;  2CY6 A;  2RS3 2;  4D6S A;  1D2S A;  4AVB A;  1EV1 3;  5F2W A;  1EV1 2;  5GLT A;  2ZGL A;  3HQU A;  1W8O A;  4LUM A;  1DGL A;  2ILM A;  2GC0 A;  2ZTN A;  4ATE A;  1UO9 A;  1I5Z A;  3J26 N;  1OOP A;  3NQH A;  1REE A;  1C8M 1;  1X8E A;  1VAL A;  1SBE A;  4P5H A;  2BBA A;  4N53 A;  1H1A A;  4QDS A;  2ZKL A;  2X05 A;  3ZDS A;  4UW3 A;  5LY2 A;  4BQ2 A;  1PGL 2;  2YU1 A;  4K40 A;  1WD4 A;  3TYJ A;  2BER A;  2YUE A;  5C3S A;  1W0O A;  4CYD A;  3NO8 A;  4UFM A;  1UY2 A;  5IWF A;  2JKX A;  3WX5 A;  4LHK A;  2Y0I A;  5FDB A;  2WZR 3;  1J3R A;  1U5Z A;  2B5H A;  1SEF A;  2VGD A;  2WSU A;  4P9L A;  4CDX A;  4E2G A;  5FY4 A;  4BMB A;  1WW7 A;  5FYU A;  1W2T A;  3OD0 A;  5A7P A;  3RZZ A;  1D0G A;  3ZFE C;  2W3J A;  5K0U B;  3I3E A;  2VR4 A;  2WO3 A;  1JYC A;  3R6S A;  1YHF A;  2VBB A;  1UKR A;  2D6L X;  1IPJ A;  1Q5O A;  3ILN A;  1O7F A;  5IVB A;  2LAL A;  4WV8 A;  3CL1 A;  4DMI A;  3O0X A;  1LGC A;  3DYP A;  5F5C A;  1GUI A;  5IK5 A;  1D2Q A;  4AVV A;  3WXP A;  1E5I A;  4YGD A;  2LS6 A;  3GCW A;  2X8K A;  2VXR A;  1D0H A;  5DAW A;  4ISR A;  2BJS A;  3OY8 B;  4LO5 B;  3LFM A;  5BY5 A;  5APA A;  1JHJ A;  3TEW A;  2NMO A;  3O1V A;  4UYB A;  2XJR A;  3ZSK A;  1AR9 3;  1LES A;  4AL9 A;  1IPS A;  1AR9 2;  1C57 A;  5FPA A;  2P34 A;  1POV 1;  2FCU A;  5FK8 A;  5LK5 A;  2D40 A;  2Q8E A;  3WR0 A;  1HDK A;  2JDA A;  4XIK A;  5J37 A;  1UIK A;  5JOW A;  1B35 B;  3OGS A;  1K5M A;  4LBQ B;  4N9H A;  4W65 A;  1GNH A;  5FRA A;  5G04 L;  5IAV A;  2VUL A;  1YFX A;  3UT0 A;  2JG8 B;  4LOR A;  4HMZ A;  4JGZ A;  3FMG A;  5JOY A;  1GP5 A;  5FPL A;  1UY4 A;  2RDS A;  2ZGO A;  1NCR B;  4FXG B;  2P3I A;  1VJ2 A;  4R4Z A;  1V70 A;  2H6C A;  3TN9 2;  3ZFF C;  2XUE A;  3WHT A;  1GSL A;  4MVT A;  4UW4 A;  5AFE A;  4DFS A;  5TSW A;  4CEY C;  4CEW C;  2J1R A;  2WWS A;  3GJA A;  1OD5 A;  2BNO A;  2ID4 A;  3EO6 A;  4GWJ A;  2RDN A;  5C7G A;  1CGP A;  2DVB A;  1NQJ A;  2ENR A;  4M4P A;  2XWJ B;  4CEW A;  2FQP A;  3T0D A;  5EJZ B;  1OD3 A;  1JU4 A;  4Q4W 1;  3LEM A;  2VC9 A;  5JXH A;  1G9C A;  5FBZ A;  3H8X A;  1RUF 3;  3R4D B;  3MYX A;  5J09 A;  1RUF 2;  3K4A A;  3DYM A;  2WAO A;  3M70 A;  3H8U A;  4XJU A;  5KHH A;  2YV8 A;  5FMB A;  1FX5 A;  3FUO A;  4DOU A;  3PDQ A;  3OCP A;  3FBM A;  1C1L A;  3ZYI B;  3IN9 A;  3TB0 A;  4IE5 A;  1W2O A;  3TEZ A;  4FFI A;  5JI7 A;  4HN0 A;  3HN3 A;  3WVJ A;  5FWJ A;  2DTY A;  2MEV 1;  3PTY A;  2GP5 A;  2BGP A;  2VZ3 A;  5LRS A;  1XNB A;  5FZ6 A;  1A78 A;  2WS9 1;  4X8P A;  2OT7 A;  1YO8 A;  2ARB A;  1MS1 A;  2IXH A;  5ERL A;  1OVP A;  4CVU A;  3ZN6 A;  1UAI A;  1H2M A;  1MQT B;  3INA A;  3CJI C;  1GR3 A;  4GIQ A;  4IEW A;  5FRE A;  3VBH A;  1VMJ A;  5C3R A;  1H1I A;  1Y43 B;  1C4R A;  4MV2 A;  5LA0 A;  4M3C B;  4QD2 A;  5EV7 A;  4BK5 A;  2QZ2 A;  3FL7 A;  1HX6 A;  2FDF A;  4XUN A;  1DP0 A;  4N8M A;  1DYP A;  5CKN A;  4M3C F;  5FYH A;  4GJY A;  2VO5 A;  2EXH A;  2P37 A;  2ZBJ A;  2Y26 A;  3AVS A;  3C2U A;  1S0F A;  2X29 A;  1N1V A;  4QB1 A;  4GKY A;  1W8F A;  4BB3 A;  3SKV A;  1FYU A;  2PHU A;  1RUC 1;  4X8N A;  4FAH A;  2JJ6 A;  3UGH A;  3S7E A;  5ACA 3;  1ZBA 1;  4XIL A;  2ADE A;  4QHO A;  3B9I A;  3D8C A;  3LGR A;  4LIU A;  1BMV 1;  2E7T A;  1RMU 2;  1UZV A;  2JG9 C;  2PQQ A;  1AXK A;  2WAA A;  1W05 A;  3QH6 A;  2QNK A;  2W87 A;  1X9P A;  3PUA A;  3O1U A;  4PHZ A;  2W52 A;  5A7Q A;  3BTX A;  5I0T A;  1KS5 A;  2BNN A;  1HRI 1;  3ZXF A;  1YC6 1;  3CJI A;  4IEO A;  2BZD A;  3MW3 A;  3OD4 A;  1BJQ A;  4FP2 A;  3VZK A;  2UU8 A;  1XE0 A;  3VBS C;  3ZFG C;  5J98 B;  1QOT A;  3SLI A;  1PX3 A;  3AKR A;  1OXC A;  1MEC 1;  1S1A A;  2JEN A;  2CAV A;  5GZD A;  3H8O A;  5A3U A;  3TBD A;  1LEN A;  5FMO S;  1A34 A;  1SLI A;  1LUL A;  4NR1 A;  3ETQ A;  2QBX A;  2WBK A;  3N9P A;  5I0D A;  4AHX A;  2D6M A;  1RUH 1;  1W9S A;  3ACG A;  3E5X A;  1YQC A;  3WG3 A;  3OOX A;  4ARY A;  3MDP A;  2VM9 A;  3VKO A;  5I8Y A;  1XXN A;  4O9E A;  4AFD A;  5IK8 A;  4YM0 A;  5LBF A;  2NN8 A;  1BHG A;  1N3P A;  4AED C;  5C5U A;  2JWP A;  2NM1 A;  1XB9 A;  3MHZ A;  1H8T A;  3N9L A;  4HVO A;  3PU3 A;  4MH0 E;  3E1F 1;  4FPO B;  3RJR A;  2JG9 A;  2FCV A;  2WA3 A;  5FMD A;  3UV9 A;  1C5H A;  4GAL A;  1XOY A;  3AKP A;  5A1A A;  3UGG A;  4R52 A;  4NHM A;  5DAB A;  2RR1 3;  1H4G A;  2RMU 2;  4IET A;  2O1Q A;  4KI5 M;  2NLR A;  1UYP A;  2JE9 A;  4FT8 A;  3ZFG A;  5FPX A;  2P1B A;  1BBT 3;  3OEA A;  4MGK E;  5JSR A;  1AR8 1;  1BBT 2;  1UOJ A;  1XNT A;  3PMS A;  5D1I A;  5F3G A;  2E6V A;  2ZX1 A;  1C1F A;  5FPU A;  4V2W A;  3KB5 A;  2BFU L;  5ABJ C;  1Q8Q A;  3O7O A;  2YY1 A;  3I2D A;  4ASK A;  2YYO A;  5FO7 B;  2DUP A;  2VXJ A;  1WZX A;  4Q4Y 3;  1PO1 2;  1RHI 1;  1NCQ A;  3Q8B A;  4HBN A;  4Q4Y 2;  4YG0 A;  1CAU B;  2DBI A;  2PAK A;  1S0J A;  2VTX A;  2VZS A;  4AED A;  3NJV A;  3HMY A;  5F3I A;  2ETE A;  2W08 A;  1VP6 A;  2R06 3;  5D8A A;  1OI6 A;  2R06 2;  3KMH A;  4JRA A;  5CFC B;  1POQ A;  3HIF A;  5LA9 A;  3W59 A;  1GWK A;  1OVS A;  2EIB A;  5FR3 A;  4LBK A;  4WBB A;  1UCX A;  1SHW B;  2WO2 A;  4HKO A;  5F5Q A;  2PEL A;  3GZU C;  1ULP A;  1CX1 A;  1S0C A;  1FT9 A;  1VRH 1;  2VE1 A;  2D97 A;  2CGN A;  2WFP A;  3POF A;  5KC5 A;  5KHI A;  5HI0 A;  3DEM A;  4OHY A;  4HXC A;  5SV5 A;  3VBO B;  3M2M A;  2XQR A;  2W1U A;  2YZ4 A;  2J1S A;  2OPK A;  3OF1 A;  2RS5 1;  4QKD A;  4WM7 C;  5EQU A;  4KBZ A;  1QY4 A;  4A7Z A;  4D3W A;  5A33 B;  4DXR A;  4P5Y A;  1APN A;  2XL9 A;  3J7L A;  1URX A;  4AI9 A;  4D6Q A;  4JTN A;  2CDP A;  2Q5T A;  2FZ2 A;  2K0G A;  5DUW A;  4AVC A;  2Q4S A;  4IV1 A;  1RUI 1;  1GQG A;  3AP9 A;  4P00 B;  2RDQ A;  5GZG A;  1JZ5 A;  1QQP 3;  2C9A A;  1WLT A;  4CDQ C;  2PHD A;  1DYO A;  2Q0A A;  4XMI A;  3UJQ A;  4AW7 A;  5BNO C;  2Y60 A;  1HN1 A;  3VN4 A;  1KEX A;  4XFF A;  1I6X A;  5BNN B;  5GM0 A;  2ORX A;  4AK3 A;  3O0W A;  3ZN4 A;  1GNZ A;  4JQR A;  1MS8 A;  2J1A A;  3FHQ A;  3WCR A;  3BPS A;  3LA7 A;  1SLC A;  1OA2 A;  2DF7 A;  1DLC A;  5FMC A;  4WM7 A;  3RGB A;  4YGE A;  4URA A;  1JYX A;  1WLC A;  2PHR A;  2QJV A;  1RVF 3;  3DPR C;  2PYT A;  3ASI A;  2WFF 1;  2WO1 A;  4EN0 A;  5BUV A;  5JPN B;  1NLS A;  1WMD A;  3RWN A;  1LU1 A;  5FYV A;  4CUC A;  5B4X A;  2G9G A;  5IK4 A;  1ULO A;  3KHB A;  1XU2 A;  3NAP C;  4GMP 0;  1GQH A;  1UL9 A;  4IE4 A;  5A7O A;  4EV0 A;  2ES3 A;  4QPG C;  2BOJ A;  3O12 A;  3QAC A;  4CDQ A;  3U75 A;  4LA2 A;  5JZG C;  1PMI A;  2WYF A;  3R05 A;  1ASJ 3;  4QX7 A;  2VNG A;  4ZPI A;  1VBA 2;  1TME 1;  2J1T A;  3S30 A;  1QDO A;  3ZX7 A;  4AQ6 A;  3DKW A;  4FAG A;  3B5L B;  4RGG A;  4B4R A;  5IUQ A;  4NWV A;  2VW0 A;  2C24 A;  1D4M 1;  2WLQ A;  4PIY A;  4PIZ A;  5ANQ A;  5FCC A;  5JAX A;  5L36 A;  4FVV A;  4HSL A;  5GJ6 A;  5F6L B;  2Y34 A;  2IWG B;  2O8Q A;  3WNN A;  4XUQ A;  3T08 A;  5KHJ A;  2XBO 2;  1VBD 2;  1W3X A;  2DFB A;  3S5A A;  5F2S A;  4IES A;  4XMA A;  2DV9 A;  2AC1 A;  4FPY A;  2XLA A;  1K5M B;  4BHP A;  4CCL A;  1ZRC A;  3Q8A A;  5HV0 A;  1YYN A;  3VL8 A;  4CDU C;  2R04 1;  1IPK A;  4JGZ B;  4UFH A;  3NAP A;  1LOA A;  3N36 A;  4OHV A;  5E8A A;  3K4D A;  4ZU4 A;  5CIS A;  4LT5 A;  5HCA A;  1NE4 A;  1RUD 3;  2ERF A;  4W6X A;  4HL0 A;  1K3I A;  3SIT A;  3B9C A;  3HNB M;  4N90 A;  5JZG A;  4G3Y C;  2VH9 A;  1RIR A;  1UYZ A;  2WNV B;  5J1X A;  2C0Z A;  1J83 A;  2TNF A;  2HEW F;  3JD7 1;  2VNV A;  4NJ4 A;  4QGL A;  2RDR A;  4LUK A;  1FPN 1;  4CTE A;  4O7X A;  1HKD A;  4EWA A;  1QJZ A;  3HT2 A;  1CZS A;  2XLG A;  1X9T A;  2XML A;  2WIN B;  4MGS A;  2JB8 A;  4MX3 A;  5F3E A;  3VDD B;  3VLB B;  4BH9 A;  3BN6 A;  2QQV A;  2XKP A;  2O14 A;  3FN9 A;  1W6P A;  4JQT A;  2F4P A;  3OPT A;  1DZR A;  3B3Q E;  1WA6 X;  3EBR A;  1MAC A;  4RN5 A;  4O9G A;  4I2O A;  4ZS2 A;  3KF5 A;  1JU3 A;  1KFU L;  3EJK A;  2Y6F A;  4GB3 1;  5FLJ A;  1XPW A;  3I7D A;  3UKT A;  1V6J A;  1DZQ A;  1PVX A;  1U5X A;  3POB A;  4HPK A;  1Z78 A;  1QDC A;  3SEP A;  2ZGP A;  1KRI A;  3KV4 A;  3THT A;  5JUV A;  4Q0V A;  1RUJ 2;  4QX5 A;  3POS A;  2XR4 A;  1S2B A;  1WWY A;  1X82 A;  1H2N A;  1LR5 A;  3I4I A;  5DN2 A;  4K1Y A;  4LE3 A;  1ZVF A;  1JYT A;  4MET A;  2MNG A;  3T0A A;  5DUX A;  1B35 C;  3APB A;  5FY7 A;  1JTZ X;  5H9P A;  3VBH B;  3VZL A;  1JYV A;  1LOF C;  5FZI A;  3U78 A;  3WG2 A;  2JG8 C;  5K0U A;  4BU2 A;  4CCO A;  2CGP A;  3P3P A;  1Q56 A;  3VBR B;  1PHM A;  2VTF A;  1NAE A;  4J1W A;  1RUE 1;  4XXP A;  5FK7 A;  4KQ7 A;  1NCR C;  4XF4 A;  3CNA A;  3KQR A;  3ZYP A;  3B02 A;  3NJZ A;  4GD4 A;  4E27 A;  1AYN 3;  3CEW A;  1AYN 2;  2W95 A;  3JBG 3;  4NRP A;  3LD8 A;  1PVC 3;  3SNM A;  3U11 A;  1PVC 2;  1E5S A;  4LHS A;  3UK9 A;  4HSJ A;  3W21 A;  1TNF A;  5BNP B;  3RYK A;  2QVS B;  4P14 A;  1PM7 A;  3UJO A;  4UFL A;  2QQU A;  5CKQ A;  1ULC A;  4XFH A;  5IVC A;  1CPM A;  2RJ2 A;  4RL7 A;  3D5O A;  4QX2 A;  1CPN A;  4EN7 B;  2VMH A;  1UNB A;  2LUW A;  2XL7 A;  4RS5 B;  4QDQ A;  1UZW A;  4YVS B;  1AX1 A;  3WF4 A;  2AZ5 A;  2JXA A;  3NNL A;  4CCJ A;  1NT0 A;  3LDR A;  1US2 A;  4NID A;  1ACC A;  2WLP A;  4HZF A;  2JDN A;  4Q1P A;  4NIG A;  1DG6 A;  4YZ3 A;  5FP3 A;  1UY0 A;  2HJI A;  3ILR A;  3MW4 A;  4AXO A;  3BIW E;  4HG6 B;  4D7Y A;  2UUR A;  1ALY A;  5BV6 A;  3IDC B;  3WF2 A;  4R9B A;  1UIJ A;  1BXH A;  1OLQ A;  1WBF A;  2EXK A;  5A3W A;  3MIH A;  4HN1 A;  3IDE A;  3IIA A;  4URT A;  1J3P A;  1MQT C;  3L2Y A;  4DRV A;  1KJL A;  1COV 3;  2WJS A;  3AJY A;  4CP2 A;  3V64 A;  4ORF A;  2CNA A;  2FZ1 A;  3ZXD A;  3QLQ A;  3HWJ A;  1AXY A;  2DUR A;  2BP6 A;  2XWB B;  1JXN A;  2GAU A;  2VCC A;  1GV9 A;  4P02 B;  1H8T B;  4JKL A;  4FPK A;  3O1M A;  1ULF A;  3EMR A;  2WSV A;  4GZ9 A;  4Q4V 3;  5CBL A;  4C91 A;  3ZXG A;  2EAA A;  2GDF A;  2XOM A;  1QJY 1;  1QXR A;  5EIY B;  4B4Q A;  4MXV A;  2WQ8 A;  1TQ5 A;  4H7L A;  2HWD 2;  1W8H A;  4OI0 A;  1F5F A;  2YRO A;  5T50 A;  3RRD A;  3U14 A;  1OC1 A;  2VCB A;  4YAR A;  3OYW A;  5A6Q A;  2W91 A;  1PZ8 A;  1UZY A;  1OF4 A;  2XJV A;  1SFY A;  4AQ2 A;  1UW8 A;  1H0B A;  2P3K A;  5C3P A;  5DAP A;  5F39 A;  5LZ6 A;  4Y1X A;  3K4Z A;  4IEZ A;  5FP8 A;  3AB0 A;  2QQN A;  4XJ9 A;  3CHX A;  3HPN A;  1MQT A;  2DFC A;  4YVW A;  3B69 A;  5EYX A;  4CUA A;  1W8T A;  2FD8 A;  3NV4 A;  4YGC A;  4BIF A;  3P1I A;  4GWM A;  1UX7 A;  4JGY B;  4M3C A;  2OZJ A;  4C90 A;  1MPX A;  2W5F A;  3T2P A;  1H30 A;  4YW3 A;  3AK0 A;  5JMO A;  2AR6 A;  2HWF 1;  4XAC A;  4XUO A;  2B39 A;  1JS9 A;  1ZZ7 A;  2DWR A;  3LDB A;  4IL7 A;  1EAH 1;  1SPP B;  3TRS B;  4YW6 A;  2RS3 1;  5D8A B;  3WSO A;  4I0B A;  5J3U A;  3T4H B;  3SHR A;  1EV1 1;  4LBQ D;  3IMM A;  2GH8 A;  3OUH A;  1Q8P A;  1D4V B;  2W9X A;  4CSW A;  2VTX J;  5E88 A;  2IFW A;  2VUC A;  1AR6 3;  1VBC 3;  4KNC A;  4OHW A;  4XJ8 A;  1VBC 2;  4YSF A;  1UZ0 A;  3VHP A;  1NQD A;  3FHI B;  4LLO A;  1FOD 1;  5BPX A;  1ZRE A;  2ZML A;  3FE5 A;  4AVA A;  1OKQ A;  1PGL 1;  2RM2 3;  3E97 A;  2RM2 2;  1AR7 1;  1CIW A;  1V0A A;  2VCM A;  1G9B A;  3MZH A;  5AVA A;  1IS5 A;  1TNR A;  3KQ4 B;  4JZR A;  4LHL A;  4YGB A;  4AAX A;  3K3N A;  3ZO0 B;  4ZZ8 A;  2ARC A;  2DVF A;  4FQZ A;  1JOD A;  1JN2 P;  3H3L A;  1ZRD A;  3A0K A;  1KD7 A;  3EHK A;  3AYA A;  4RHV 2;  1B09 A;  3KV6 A;  4QXK A;  1CAV A;  3HD8 B;  3MI8 A;  5H9S A;  4LNV A;  3CZU A;  4IV1 B;  3ZN5 A;  1YWK A;  1MZE A;  3MF9 A;  1DQ5 A;  4J25 A;  3MUY 1;  1Q8O A;  1XYP A;  2D5H A;  2WWU A;  1L7R A;  4PIX A;  4ZU5 A;  2FBE A;  4FTS A;  2Y8K A;  4H7M A;  2OQ6 A;  4NPL A;  3VKL A;  1NOV A;  1OH3 A;  2JIG A;  1TZO A;  5T5J A;  3WG4 A;  2GU9 A;  2V73 A;  2W1S A;  4DS0 A;  1ZA7 A;  3I2O A;  4XUT A;  1AR9 1;  2E51 A;  4NIH A;  2ZXQ A;  5CFC C;  1NYW A;  5FYB A;  5FZO B;  2UYB A;  1HQN A;  1O6U A;  4KL1 A;  3VZO A;  1AL2 1;  4GH4 B;  1PK6 B;  4PF5 A;  3TEY A;  4D0Q A;  1MS3 A;  1HRV 3;  1EP0 A;  1HRV 2;  3KF3 A;  2B9V A;  1EUT A;  4I3P A;  2WQZ C;  3VBO C;  3L9J T;  5C3O A;  1TMF 3;  3B7M A;  5A6Y A;  5FTT C;  1TMF 2;  3RQ0 A;  1LHW A;  3TN9 1;  2VZP A;  4NRQ A;  3BKZ A;  1Z7S 3;  4EYU A;  4XXA A;  4IE6 A;  1CAU A;  1KGY A;  1RJ7 A;  4LTA A;  3OBZ A;  1V9U 1;  1US3 A;  2YC4 A;  5FY9 A;  1RUG 2;  2BV4 A;  2HWC 2;  3IBM A;  4ES8 A;  3N35 A;  1UOF A;  4A2U A;  3ON7 A;  1W90 A;  1ULD A;  1F4H A;  3OSD A;  2BGC A;  1Q8S A;  2FCT A;  2JD4 A;  2OVU A;  4DXS A;  3B94 A;  1ZYB A;  3NJX A;  4XQD A;  3USS A;  5BNN C;  2JDU A;  1UY1 A;  1XYN A;  2ZX3 A;  4B29 A;  5CU1 A;  5CVR A;  4XCB A;  4JDO A;  4DUV A;  1EPW A;  3LQC A;  4Y22 B;  1R1Z A;  3WNK A;  2DUO A;  3PVN A;  1QHD A;  2BVV A;  3WP6 A;  2A5Z A;  3SH5 A;  3U10 A;  2VVD A;  1R64 A;  1YQ5 A;  3AP4 A;  3VDC A;  4CRQ A;  5J96 B;  5J48 A;  1QOS A;  2HWE 2;  2XJU A;  3MID A;  2BYV E;  5C8C A;  1OUR A;  4OCT A;  2P4E A;  5A33 A;  1VAV A;  4CP1 A;  3CIH A;  1AYM 3;  3ZYG A;  3DUI A;  2A73 B;  4YG3 A;  1ZZB A;  5KXD A;  2WT1 A;  4R9A A;  2RG4 A;  1QXJ A;  2E32 A;  1H8V A;  3AM2 A;  4OUM A;  3U0Z A;  4XBQ A;  1VB4 A;  5E6H A;  4Q27 A;  1QEX A;  3LF7 A;  1NXD 1;  3ZYB A;  5J7M A;  1OUX A;  3SMH A;  1KS4 A;  1WUV A;  4KWJ A;  3UKV A;  3KCX A;  5F1R A;  1ENR A;  1NX9 A;  1SQ4 A;  2GMM A;  5BNN A;  1RTV A;  1WMX A;  2J1E A;  2DCY A;  1AL0 G;  1PMJ X;  1Q3E A;  1VPH A;  2C4X A;  3NNF A;  4HPK B;  4IEQ A;  5A3O A;  1DQ4 A;  1QJU 1;  2HYK A;  1REF A;  3QBQ A;  1H2L A;  5IVF A;  2ZEX A;  4IE0 A;  3DCQ A;  1RMU 1;  2YU2 A;  4BLI A;  4DY3 A;  3S5Q A;  4CP9 B;  5JMC A;  1ZZ8 A;  2RE9 A;  4C8D A;  1JZ7 A;  2BBV A;  1W39 A;  4R9C A;  3TEX A;  1EPZ A;  1HXS 3;  1K5M C;  2WZR 2;  5FP4 A;  1HXS 2;  3HOB A;  2JDZ A;  3H7J A;  4AVS A;  3BU0 A;  1WCK A;  2I74 A;  1SDD B;  5A70 A;  4L8Q A;  5FZL A;  2Q1F A;  4JGZ C;  3T2T A;  5KR7 A;  1N1S A;  1F5J A;  4DY5 A;  1R1A 1;  4Z92 B;  2NYY A;  4S2H A;  4CCC A;  1LB2 A;  1JBC A;  3VL9 A;  3THC A;  5T5O A;  1JUI A;  3KLS A;  2WNV C;  3RDI A;  4CUG A;  1R09 3;  1VAK A;  3AL5 A;  1EY2 A;  1R09 2;  4HOO A;  1BVP 1;  3WDX A;  3AKS A;  1Y9M A;  2VZQ A;  4XFC A;  1CAX A;  3LEI A;  4PI2 A;  5C70 A;  1I1E A;  1JUH A;  3WZ1 A;  3ZYF A;  3IWZ A;  1SFN A;  2KD7 A;  4R9D A;  1LOD A;  2GP3 A;  5EFU A;  5A6Z A;  5JLV A;  2GC1 A;  5CNA A;  2LRO A;  4NAM A;  1H4H A;  4TWT A;  4Y26 A;  1HB3 A;  5T55 A;  5FOJ B;  3BOP A;  2WC2 A;  5FY1 A;  3QOP A;  4XUR A;  5LCW L;  2XJT A;  1DGR N;  2PLV 1;  1YIF A;  2RMU 1;  2W39 A;  3PHM A;  4BQ3 A;  4L92 A;  3O1T A;  2QQI A;  1NLQ A;  4F3J A;  2A6Y A;  3NKT A;  1ZZ6 A;  3IZO A;  4IEX A;  3PJY A;  2WQ4 A;  2HYX A;  5CA6 A;  2IC1 A;  3MPP G;  3WQB A;  4RSU A;  3DYO A;  4B3N A;  2OA2 A;  2VZR A;  1E5R A;  3FLT A;  1ZM1 A;  2HBU A;  3GDB A;  4FQ4 A;  1QKQ A;  4P9I A;  2VNR A;  1QNW A;  1HB2 A;  2WNV A;  3BPZ A;  5FQ0 B;  3K46 A;  1G7Y A;  5FAX A;  4OMD A;  4M01 A;  3VBH C;  2BGO A;  1PO1 1;  4DZG A;  2WNO A;  1U12 A;  2ZGM A;  4AI2 A;  2ZEY A;  1RXF A;  5LEK A;  3VDD A;  1JOB A;  3U37 A;  3OGV A;  3VBR C;  3KT7 A;  1WMF A;  4MUV A;  4QQH A;  4RFT 0;  1H6X A;  4XYX A;  3H3U A;  3J4U H;  4ZS3 A;  5DMY A;  4WZC A;  2HKX A;  1WLW A;  2DVG A;  2VVE A;  4FFF A;  1JZ8 A;  3DV8 A;  4QAW A;  5IAX A;  1FV3 A;  5BNP C;  5GLV A;  5AC9 3;  4Y1Z A;  3ZYH A;  4WVW A;  3FBY A;  2A1X A;  5AC9 2;  4HK8 A;  1HV0 A;  3RZK A;  3OYW B;  1SBD A;  3FC0 A;  5A3P A;  4K7J A;  5BNQ A;  2D5F A;  4MGQ A;  1BEV 3;  1XQN A;  5FJK A;  1BEV 2;  2WRA A;  4RS5 C;  4ZXE A;  1GWM A;  2R49 A;  4BYY A;  2UWC A;  4YVS C;  4DRR A;  2HEV F;  3V0B B;  3N7J A;  2RV9 A;  4HT1 T;  3N3H A;  4ZY9 A;  4P9G A;  1N1T A;  2V5Y A;  4X6Q B;  2DCJ A;  2MPF A;  4Q26 A;  4YVW B;  1UZZ A;  4K8F A;  4AQT A;  3FLP A;  5C9A A;  3CU7 A;  4WZF A;  3WF0 A;  2JDM A;  3VBR A;  4IE7 A;  2PHF A;  1QU0 A;  4ERO A;  1Q8V A;  2D3S A;  1PO2 3;  4UBH A;  4ATF A;  4E4S A;  2OPW A;  2ZGU A;  3SH4 A;  5JCT A;  1K5J A;  5K9Y A;  5L73 A;  5BNP A;  1OLR A;  3IKW A;  2C26 A;  1F2N A;  4GWN A;  1LAJ A;  1W8U A;  3CKH A;  2E7Q A;  5FWE A;  5ACA 2;  4XIO A;  3OUJ A;  5GZE A;  1H8T C;  3C7O A;  4RS5 A;  5DXD A;  3GM8 A;  1V6M A;  4YVS A;  2CL2 A;  3GCX A;  3TNP B;  1OT5 A;  1LGN A;  5GLW A;  5A3M A;  1JHN A;  3I2J A;  2C6S A;  3S57 A;  1HQL A;  1VMH A;  3FJS A;  2Y6L A;  3N9O A;  1RC6 A;  2CWS A;  3RSJ A;  3LEG A;  1GP4 A;  4IUG A;  5T5P A;  2IUW A;  1EUU A;  3PUS A;  4E2S A;  1CAV B;  3H42 B;  2GME A;  4JVA A;  3M3O A;  1C8M 3;  1CES A;  4DQA A;  2K2S A;  3PUI A;  2D93 A;  1QMJ A;  5JDB A;  5IJR A;  4AQS A;  2J7M A;  3SIS A;  5CFD B;  2DUQ A;  3AZW A;  4MLO A;  3ZSJ A;  4DXZ A;  2YPJ A;  5FFO C;  4A41 A;  2R07 1;  4AEK A;  3ETP A;  1ENS A;  2WZ8 A;  1VBA 1;  1YFU A;  2E7A A;  1NCQ C;  5JI9 A;  4CCD A;  4JGY C;  2CV6 A;  4W4Z A;  3PIJ A;  4M3C E;  1ZZ9 A;  1SMV A;  2VZT A;  4GQ7 A;  5FY0 A;  3KHC A;  1DU3 D;  2K46 A;  1LGB A;  2OUJ A;  4COU A;  3ZR5 A;  1DF0 A;  4AWD A;  3K2O A;  1O3S A;  4LBO A;  4E4D X;  4AI1 A;  2X5I B;  1CZV A;  5D8A C;  3C7E A;  5A7S A;  3POG A;  4IW3 A;  4W6Y A;  2VNO A;  1VAM A;  1VBD 1;  2XBO 1;  3GHM A;  3PUQ A;  4KWL A;  4NUB A;  3ME2 A;  2FMY A;  4OHX A;  2RR1 2;  4I0A A;  4R8H A;  4UFK A;  4BQX A;  3HBK A;  2ZCW A;  3WNO A;  3ITQ A;  4LBN A;  2ZGR A;  3WDT A;  2ZA9 A;  2R6Q A;  4PLO A;  2PA7 A;  4B4P A;  2VUA A;  5FXV A;  4Y4Y A;  2JEC A;  1W3V A;  5FZD A;  2BFU S;  1PIV 1;  3W5M A;  4XF0 A;  4MYE A;  3VHR A;  2DU0 A;  4JX0 A;  1O3T A;  1POV 3;  3OPZ A;  2OW4 A;  3KSC A;  5LB6 A;  2OX0 A;  3AP6 A;  3I2I A;  3TNQ A;  4JGY A;  1AJK A;  4WM8 B;  2PHW A;  1RED A;  2GNT A;  1XC6 A;  3NRU A;  2QQO A;  2DCZ A;  4FPE A;  4E4H A;  5L7O B;  4IV1 C;  5J36 A;  4PQ9 A;  4B7E A;  4IV3 B;  4J1X A;  1KDK A;  2P3Y A;  1SPP A;  5FZG A;  2YG0 A;  4Q0S A;  2A3W A;  3TOJ A;  1PZ9 A;  3JXS A;  4PLM A;  4A4A A;  1JOP A;  4CU8 A;  5A7W B;  3BOD A;  5A1L A;  2YPD A;  1W0N A;  1UY3 A;  2VBD A;  4XET A;  1CVN A;  2GMP A;  4MHU A;  2WNU A;  3S7I A;  4O65 A;  1WCU A;  1YJK A;  4BA6 A;  2FDH A;  2CAU A;  2DYC A;  2W1W A;  1ND3 B;  2EVX A;  1LHV A;  1ZRI A;  3C7H A;  3VHN A;  3BI3 A;  1O59 A;  2A3X A;  2D3R A;  4NHX A;  1RUJ 1;  1O3R A;  1UD1 A;  4UWD A;  3THP A;  1PMH X;  4Q4W 3;  4KGG A;  4LBM A;  4Q4W 2;  5DUU A;  5A3L A;  1Y4W A;  3HT1 A;  4GWI A;  4Y5Z 0;  5DAX A;  3KVA A;  1OFS A;  3N4M A;  5C8C B;  1LOC A;  1R08 1;  2A71 A;  2GC3 A;  4YFZ A;  4XTM A;  4XUP A;  4XAB A;  2Y6H A;  2NQY A;  4GH4 C;  1PK6 C;  4LE4 A;  5D21 A;  2GH2 A;  2ZHK A;  3K75 B;  5FXZ A;  1IG3 A;  1J84 A;  4FPH A;  3LA3 A;  4UW6 A;  4I3G A;  4F83 A;  2EID A;  1GYK A;  4C0H A;  4FTE A;  5JSP A;  2MEV 3;  3N9N A;  1WBL A;  2MEV 2;  1AYN 1;  1QQP 2;  1F15 A;  1LED A;  4HKW A;  4YZ5 A;  2WS9 3;  2WS9 2;  4PDW B;  1T2X A;  4IND A;  1X36 A;  3CLP A;  4TYS A;  2QQL A;  5EJ3 A;  2WT2 A;  5C4W B;  1IS3 A;  2PXJ A;  4V2V A;  3NV1 A;  4OQ9 A;  3GBG A;  5K0U C;  1OQD A;  1N3O A;  5H9Q A;  1NXM A;  1QH7 A;  4NRM A;  2PAE A;  3D4K A;  3GXU A;  2G4I A;  1YQ2 A;  4BCU A;  2XXZ A;  1AHS A;  5JPM B;  4LXL A;  5FZO A;  3WT3 A;  3DGT A;  2PTM A;  4OLL A;  2XHK A;  3AL6 A;  2XQX A;  2ARA A;  3KD4 A;  2HWB 1;  3VZJ A;  3HN1 A;  4FO9 A;  4QPY A;  4RQP A;  4GH4 A;  4EZ4 A;  1PK6 A;  2EIG A;  1W8Z A;  2EIE A;  4CCN A;  2GND A;  4XAA A;  1C5I A;  5FKB A;  1RVF 2;  1XND A;  4OUL A;  3LA2 A;  5KXE A;  1BQP A;  1DQ1 A;  3IB3 A;  4MAD A;  1FMD 1;  4XFB A;  1GMM A;  4XDO A;  1ZBA 3;  1P8J A;  3I97 A;  4XQW A;  2ZAH A;  2D7F A;  3D0S A;  3RS6 A;  3LDK A;  2WR9 A;  5L19 A;  1W8W A;  2ARE A;  1JZ4 A;  5A80 A;  1BMV 2;  4XFI A;  4Q4X 1;  3IDB B;  2DBN A;  2HBT A;  4CXW A;  5JOX A;  1ASJ 2;  2J42 A;  1LCL A;  3WUC A;  4JDM A;  4EN6 B;  3JB8 A;  1HRI 3;  5HCB A;  3LZZ A;  5FIX A;  1ND2 A;  4JC1 A;  2XVG A;  1CAX B;  1V6N A;  3WW4 A;  3Q9O A;  1GOG A;  2RJK A;  3Q8F A;  2A6X A;  4F8A A;  1MEC 3;  4NAO A;  5LEJ A;  4CE8 A;  3W5N A;  5K7P A;  2E26 A;  4RD7 A;  5LA1 A;  4Q0Q A;  2WKK A;  5BYN A;  1QOO A;  1FNY A;  1OQE A;  1RUH 3;  2HWD 1;  1I5P A;  2A70 A;  2V09 A;  4D94 A;  4Y22 A;  3W9A A;  3HEI A;  1AJO A;  3VD4 A;  1BLZ A;  2AAC A;  4NO4 A;  1KFX L;  3SCH A;  1O8P A;  5JXJ A;  1NY7 1;  3FX3 A;  1VBB 1;  3RMY A;  1ZRF A;  1RUD 2;  4YPJ A;  4MSV A;  1RUN A;  1OHF A;  2A75 A;  1WW5 A;  2YGL A;  5FLI A;  3OGR A;  3OG2 A;  4LA3 A;  1ZBE 1;  3AX4 A;  4GUL A;  5EPA A;  3WNL A;  3BYW A;  3DF0 A;  4FOY A;  5A1F A;  1LKN A;  1OF3 A;  1QF3 A;  5F8P A;  1W6O B;  1ODM A;  5FZK A;  3Q8C A;  1QJX 1;  1AR8 3;  2QFE A;  4IDZ A;  4XEZ A;  4CXY A;  4QQL A;  1AR8 2;  5JXI A;  1VBE 1;  4I02 A;  4P9J A;  3T3Y A;  4PLN A;  5LA2 A;  3LOI A;  1C3H A;  4ITC A;  4XZP A;  4A45 A;  1DGR A;  1MS5 A;  2Y38 A;  4A7K A;  4CCK A;  1ULE A;  3WQ7 A;  4Q5O A;  4YW7 A;  4CDW B;  4K8R B;  1LU2 A;  5EP9 A;  2EXJ A;  4KWK A;  2BW8 A;  4BQW A;  3VGI A;  2XJQ A;  3MLJ A;  1RHI 3;  2G1M A;  2ZAB A;  2LW8 A;  3G7D A;  3VBF B;  5GKA C;  2QQK A;  2ZX4 A;  2XG3 A;  1UOB A;  3MIB A;  4UT5 A;  4WVZ A;  3HJR A;  4LMF A;  4BE3 A;  4XFG A;  1CJD A;  2RM2 1;  2N7G A;  1UPS A;  4CP9 A;  3WNM A;  4U2A A;  3ZXA C;  4P9Y A;  1YLL A;  3PTR B;  1GBG A;  3ZSL A;  5FZ0 A;  5DAQ A;  3WOG A;  3WD5 A;  2I2S A;  1TVG A;  1FAY A;  1K42 A;  5JIA A;  1W04 A;  2CWM A;  5FOB B;  4LKE A;  1DIW A;  4RHV 1;  4DO0 A;  4E8D A;  5C9A B;  1H9W A;  4M0H A;  4FXK B;  3I3M A;  5LWB A;  2BUK A;  4E9K A;  4D7S A;  3MV0 1;  3SEE A;  3PLQ A;  4OVE A;  3VKM A;  3WIN E;  3FFQ A;  2CDO A;  2V5D A;  5FUN A;  1IS4 A;  5F37 A;  3H7Y A;  3RFR A;  2VAU A;  3H50 A;  3JBG 2;  4Z1V A;  1HW5 A;  2W46 A;  2R32 A;  3L2H A;  3LWC A;  1YI9 A;  5C71 A;  3H8R A;  1JYI A;  3MO4 A;  4BPZ A;  3NV2 A;  2WN3 A;  1GWL A;  1ZX5 A;  3H1W A;  3I54 A;  3ZXJ A;  2A3Y A;  1JZ2 A;  4FPF A;  4FPL A;  2YB7 A;  4EQV A;  1RUI 3;  1NA1 B;  2TEP A;  3KCY A;  1RUI 2;  2IZW A;  1UXX X;  3FZ3 A;  4QXH A;  4EWD A;  2DVD A;  5C8W A;  3WW3 A;  2PAM A;  5FO9 B;  1GOF A;  1M4W A;  4MXW B;  4F7Z A;  2W94 A;  1BK0 A;  2F17 A;  2Z4F A;  3AKT A;  5IVY A;  2ZGN A;  3EQE A;  4YFW A;  1A8D A;  1MS9 A;  2KM2 A;  2VMI A;  4QB2 A;  3H9A A;  1DGW A;  4Z8B A;  4YG6 A;  4AGR A;  1T6B X;  2XJP A;  2HH9 A;  2ZEW A;  3N7L A;  1WKY A;  4QMA A;  5FBJ A;  4DUX A;  1OPM A;  1SLA A;  4NWW A;  3WDY A;  5FQ0 A;  4FPG A;  4QGN A;  4NRO A;  4L99 A;  2YHJ A;  4YVW C;  5EXO A;  3VZM A;  3RJ2 X;  1COV 2;  1UPI A;  1XE8 A;  3LFI A;  3N7K A;  1YJL A;  4NHL A;  3UES A;  3RZL A;  3PJQ A;  4AGV A;  4LEJ A;  2H6B A;  4KBB A;  4XTP A;  1W03 A;  3NJY A;  2WFF 3;  1RUG 1;  4R4X A;  2HWC 1;  4TLG A;  2WFF 2;  4UAP A;  5H9R A;  4FOQ A;  3KWV A;  3P5B A;  2B9U A;  1UKG A;  4QT6 A;  1D7P M;  3RYR A;  5FZM A;  5CYY A;  1V6I A;  4Q2F A;  3UL2 A;  4Q4V 2;  2R7E B;  4C1W A;  3BVC A;  3ENR A;  1CZT A;  2E53 A;  3ZYR A;  1JI6 A;  2FDI A;  3OBR A;  1TME 3;  4QKN A;  1CJP A;  3HQR A;  1H6Y A;  1TME 2;  3HAG A;  3HR9 A;  3U07 A;  1VLN A;  4M4R A;  1D4M 3;  4K3U A;  4OUE A;  3V0B A;  1HB4 A;  1V6O A;  1D4M 2;  1X50 A;  5ISL A;  1SDW A;  4HLT A;  1E5H A;  2JDH A;  4XW3 A;  5FZH A;  2HWE 1;  3BGA A;  4Q0U A;  4WVM B;  2V4A A;  3GBF A;  2CU5 A;  4QPW A;  4Y5S A;  3IDA A;  3J9S A;  3T0B A;  4XZU G;  3SQO A;  2EXI A;  1W0P A;  4OUS A;  1DLL A;  3KT4 A;  1WCS A;  3AJZ A;  5T5L A;  5I91 A;  3LAG A;  1ENQ A;  3F2Z A;  1SLB A;  2R04 3;  5CFD C;  5IFT A;  2R04 2;  1GIC A;  3H0O A;  2GZW A;  3MIE A;  3AYD A;  2P2K A;  2WL1 A;  5FZE A;  3W20 A;  3QCW A;  3ZDV A;  2NPI A;  1WCQ A;  2XGX A;  5F6K A;  3JB4 C;  4YRD A;  1F35 A;  2G19 A;  3AYE A;  2WNU B;  5B2G B;  1AR6 2;  3RZJ A;  3JD7 3;  2C5D A;  2OII A;  3JD7 2;  3MPB A;  1FPN 3;  4BK4 A;  2ZX2 A;  5FZ3 A;  1X7N A;  1GAN A;  4TTG A;  2DCT A;  1FI2 A;  4OFG A;  4Z07 A;  2ZGK A;  2FHR A;  3T4V A;  4Z82 A;  1KJR A;  2X5I C;  4XDQ A;  1Y3T A;  5FPZ A;  3V56 A;  1I9R A;  1F31 A;  2BWC A;  5EZW A;  2SBA A;  5E1R A;  4MO3 M;  1DGW X;  5FLH A;  2AEZ A;  1LHN A;  4IEP A;  5FZ4 A;  3AVR A;  5L9B A;  1XE7 A;  4JTO A;  1W6M A;  2WZR 1;  1HXS 1;  4HON A;  2B7Y A;  5CG8 A;  2WII B;  2D6N A;  4L2N A;  3LPG A;  1IQA A;  4GB3 3;  4RR3 B;  5CFD A;  3NST A;  4IGO A;  3U4X A;  5FP9 A;  1S2K A;  3A0N A;  3O1S A;  3R0R A;  3WV6 A;  2YMZ A;  4SBV A;  4A3Z A;  3GZT B;  5DAV A;  4ZON A;  1SLT A;  1LHO A;  1GZW A;  1R09 1;  4WM8 C;  4COV A;  5KWR A;  1JZ6 A;  1DHK B;  1W9F A;  4ES9 A;  4MGZ E;  5L7O C;  1WLD A;  3H1Y A;  3D6E A;  1UYY A;  3IM0 A;  3NNM A;  1YEW A;  4YLZ A;  1QXP A;  4IV3 C;  2OUH A;  2X5I A;  2YC0 A;  4YZ2 A;  3AP5 A;  1YNA A;  1RXG A;  1S0B A;  5GZC A;  2PHT A;  3AZZ A;  2J1U A;  2W2I A;  4CPB A;  4XPV A;  4QX8 A;  4GJZ A;  1LRH A;  4RQP B;  2R0H A;  4AVT A;  2VQA A;  4YZ1 A;  2VW1 A;  3WQ1 A;  1ND3 C;  1UQX A;  3KVB A;  1N47 A;  3E5U A;  2ARX A;  3LB9 A;  4PBO A;  1V6L A;  2Q8C A;  5IVE A;  2D6O X;  2YGM A;  3B01 A;  1SG3 A;  2WZE A;  1S0E A;  3NNG A;  1YQ6 A;  4RFR B;  3FUQ A;  4BME A;  5C8C C;  3BCW A;  3AKQ A;  2XHN A;  2J1V A;  1Z7S 2;  4WM8 A;  2W1Q A;  4FP3 A;  1XU1 A;  4QWN A;  1PGW 2;  4YM1 A;  1ND2 B;  2QZ3 A;  3S0M A;  4HAN A;  5L7O A;  2X10 A;  1A8M A;  3IAQ A;  4IV3 A;  2P17 A;  2GNB A;  3POE A;  3ZKU A;  3FFZ A;  5EJ1 B;  4NN0 A;  1AVB A;  3K48 A;  1RUF 1;  3III A;  1BYH A;  2PMW B;  2VJX A;  3ZPY A;  5A7W A;  1W6N B;  3K3O A;  4CU9 A;  2VMC A;  3RI8 A;  3T2O A;  4PDW C;  1VR3 A;  4P9W A;  5C4W C;  5I0S A;  1O8S A;  1U5Y A;  2JE8 A;  4MOA A;  1ND3 A;  4ZKT B;  5AC9 1;  4LKS A;  2C1F A;  3H3Z A;  4Z2A A;  5FP7 A;  4JDN A;  1F9K A;  1IG0 A;  2Q8D A;  1BEV 1;  1YRZ A;  4AHY A;  4XE9 A;  1AF9 A;  4UBG A;  2IXC A;  4XCA A;  2BEO A;  1W9W A;  3RMX A;  5FV3 A;  4UF0 B;  1ULG A;  1AYM 2;  1QJY 3;  5DZG A;  1QJY 2;  1BCX A;  3UYJ A;  1C28 A;  5DZE A;  2QQW A;  2I07 B;  4Z2W A;  1OA3 A;  2JIC A;  2W47 A;  1GOH A;  2YXS A;  2ZZQ A;  3T09 A;  4AI3 A;  2LRP A;  4CPB D;  1UX6 A;  2VZ1 A;  3P3N A;  3ZPO A;  3KM5 A;  4AG4 A;  2ZHM A;  3KCC A;  3P6B A;  4FCA A;  5K8S A;  2Z2S B;  1XNA A;  4PDW A;  4Y1U A;  2Z69 A;  5EHD A;  2R1D A;  4H2A A;  4XF9 A;  5LRR A;  5C4W A;  4A7Y A;  2D98 A;  2CHH A;  2ZKN A;  3A7Q A;  4LBJ A;  2A7A A;  4Y1Y A;  3DXU A;  1VE0 A;  5ACA 1;  1SZB A;  5CG9 A;  2VD7 A;  4LKF A;  1JOJ A;  1UN1 A;  2HWF 3;  5FXW A;  2HWF 2;  1K45 A;  1EAH 3;  1YIP A;  1SCR A;  1EAH 2;  3AZX A;  1PNF A;  1XRU A;  1UU6 A;  5IK7 A;  3M3C A;  3TAY A;  2C9K A;  4YM3 A;  3W58 A;  3SC7 X;  4CP0 A;  4FI9 A;  1IZ3 A;  4EZH A;  1DQ2 A;  1FOD 3;  1WD3 A;  4TSV A;  1FOD 2;  4RGA A;  2JE7 A;  4CDU B;  1XSQ A;  2ZEZ A;  1AR7 3;  2ET7 A;  1VRB A;  3RVH A;  1STM A;  1AR7 2;  3ACI A;  3IAP A;  4MGI E;  2EIC A;  5JR7 B;  3WG1 A;  3ZSM A;  3I3B A;  5DDJ 3;  2JEM A;  4N7I A;  5DDJ 2;  1CAW B;  1HB1 A;  1OMI A;  3LIH A;  2DDU A;  4PBP A;  4QPI A;  1FNZ A;  2DU1 A;  4IER A;  1LNS A;  3VDD C;  3ZR6 A;  4CUB A;  1GQP A;  4XAE A;  3HVD A;  4BQ5 A;  2DCK A;  1UYX A;  2BQP A;  2WWJ A;  2WYS A;  3FLR A;  5KHK A;  1A6C A;  4LOS A;  3UET A;  4DIN B;  4EE2 A;  4YWA A;  2D43 A;  1MR5 A;  4GMP 3;  4MGT A;  1V00 A;  2EA7 A;  2UWA A;  3O5S A;  1X8M A;  3M1H A;  4LO6 B;  1O91 A;  3D0J A;  4KH9 A;  4W50 A;  4CDW C;  1XNC A;  2RR1 1;  3ELN A;  4RGK A;  3I2F A;  4LQR A;  4XBN A;  5HV4 A;  1HLC A;  3T2Q A;  3VBF C;  4QB6 A;  3R4U A;  3AMH A;  2BNM A;  1BBT 1;  2UYA A;  5ANN A;  4QQP A;  3PU8 A;  3CO2 A;  4GXL A;  4C0B A;  4IQP A;  3J8F 3;  3T30 A;  3J8F 2;  4W8J A;  4LJH A;  3I49 A;  1NZC A;  4N7U A;  4ISQ A;  3C8X A;  3U1X A;  4OQ8 A;  2ZZJ A;  4GAZ A;  5I0U A;  4JHZ A;  2WUH A;  2VZV A;  2ZPX A;  2B4K A;  5KHG A;  4Q4Y 1;  5C9A C;  4B8E A;  2FDG A;  2D6K A;  2JDY A;  2VMG A;  4CA9 A;  4JRL A;  1AL2 3;  5HPO A;  1W6O A;  5CAZ A;  4FSJ A;  2QQM A;  1AL2 2;  1OLM A;  1AXZ A;  5LK7 B;  5FXX A;  2XON A;  2QQP A;  1VMF A;  3ZFE A;  2RS1 3;  4D69 A;  2O8O A;  1K12 A;  4AFA A;  2RS1 2;  2YDE A;  4AI0 A;  3CJX A;  4LO8 A;  5FYY A;  4ZZ5 A;  2R06 1;  2LTN A;  1H9P A;  2WT0 A;  2WDB A;  3M4F A;  4CDW A;  1N1Y A;  4PT6 A;  3HBZ A;  3MW2 A;  3TN9 3;  3WF3 A;  4Q8K A;  5L9R A;  4Q8L A;  4W6W A;  3VBF A;  2ET1 A;  1V9U 3;  4QDR A;  1TEI A;  1Z0H A;  1V9U 2;  3GGL A;  4BM8 A;  2UWB A;  4KGQ A;  3NVC A;  4Y4R A;  1NA1 C;  3VKF C;  1AUY A;  5CAD A;  4XF3 A;  5KXB A;  1GP6 A;  1LOE A;  2QDR A;  5DUV A;  1O5U A;  3I2H A;  3WDU A;  1ZNP A;  4FPC A;  1CR7 A;  4NOT A;  4IEY A;  4LKD A;  4H55 A;  5G05 L;  3ZLI A;  1QWR A;  5DG2 A;  5LAT A;  3N9M A;  3VUO A;  4UFI A;  4LK7 A;  4B1L A;  1YXW A;  3MIF A;  1BK1 A;  4QX0 A;  2ZS6 B;  4V1P A;  3VZN A;  1HJG A;  1Q43 A;  1PO2 2;  1UU5 A;  3N7M A;  2AUY A;  2QQJ A;  3M3E A;  4P9X A;  1GNY A;  1W2N A;  1HIX A;  3VKN A;  1MVE A;  2CTV A;  3WP4 A;  3PNA A;  1QQP 1;  3PUR A;  4B7K A;  5A6X A;  2F4L A;  3ZFF A;  2E63 A;  4LIV A;  3F95 A;  3GNE A;  1L7Q A;  4KG0 A;  4LUL A;  4CEY A;  1U0A A;  3DKQ A;  4BOW A;  3RG0 A;  3LOB A;  1NKG A;  1X33 A;  2ZGQ A;  1NZI A;  3J8F 1;  1A3K A;  5FY8 A;  1NA1 A;  3VDB A;  1GZ9 A;  4HK9 A;  5E89 A;  3AFK A;  1SCS A;  1W6Q B;  4LR4 A;  4YW2 A;  3J7N A;  2VVF A;  4MXW A;  1JH5 A;  3MFC A;  4CU6 A;  2Y0O A;  1T6G C;  2GN7 A;  1YFY A;  1W6M B;  2K9Z A;  4XHX A;  4PQQ A;  3ACH A;  1RVF 1;  3JU9 A;  2Z79 A;  3D3A A;  4E2Q A;  1C8M 2;  1XJA A;  1YQ8 A;  1WGP A;  3AP7 A;  3UNP A;  1QJU 3;  1QJU 2;  4BIO A;  3LE0 A;  1RMU 3;  4BXF A;  3BUC A;  3I59 B;  4YNI A;  3RZH A;  4RYD A;  1ASJ 1;  1YI7 A;  4JKM A;  1GZW B;  3LIG A;  4K20 A;  3NNJ A;  3Q8E A;  4XBL A;  3ZSE A;  4EN9 B;  2LM3 A;  3VD9 A;  1S55 A;  2TBV A;  5IAT A;  3V0A A;  4AI8 A;  1DDL A;  2B42 B;  3IPV B;  5IFP A;  4ONU A;  2XB6 C;  2HLE A;  1KDM A;  5JIU A;  4Y20 B;  4OI1 A;  5FJH A;  4EWE A;  3HNY M;  1FV2 A;  4UW5 A;  5F7U A;  1C8N A;  1R1A 3;  4KU7 A;  4EJR A;  1R1A 2;  4UXA A;  2VZO A;  3I2G A;  1G86 A;  3GHN A;  2QKD A;  4RA0 A;  3NKG A;  3EB7 A;  4OZO A;  5FMO L;  4AHW A;  3BOW A;  4GKX A;  4I0W B;  4Y1V A;  2WNU C;  5KC6 A;  3KS7 A;  4TZD A;  3O1O A;  3VV1 A;  1XSR A;  2IXJ A;  3M7A A;  3JUU A;  2CSG A;  4OYU A;  2BOI A;  1H1M A;  2DVA A;  4BWO A;  3POW A;  2Q8O A;  2I45 A;  4U36 A;  1S0D A;  2VOK A;  3LEK A;  3KZ4 C;  1RUD 1;  3AZV A;  4WVM A;  5IYY A;  2QDN A;  1Y9Q A;  3ES4 A;  3O1P A;  2VL4 A;  2X53 S;  4XOG A;  4PF1 A;  1SFP A;  4B1M A;  3ST7 A;  1YFW A;  2PLV 3;  2RMU 3;  2VMD A;  3C7F A;  4O61 A;  2A6W A;  1CON A;  2PLV 2;  4I09 A;  3S6P A;  2XJS A;  2GN3 A;  4WVV A;  4RR3 C;  3VBS A;  4A42 A;  2VW2 A;  2Y6G A;  3E6D A;  4A6S A;  3PVE A;  3ACF A;  3ZMO A;  4AR2 A;  3GZA A;  3BTY A;  1IOA A;  4KWU A;  4PCR A;  1G9D A;  1RIT A;  3BTA A;  4D8M A;  4N9I A;  3CZJ A;  4JCK A;  2PQS A;  2ZHL A;  2W68 A;  3GBW A;  1W28 A;  4X6R B;  4LLF A;  3RWK X;  1PO1 3;  5JXG A;  3C3V A;  3VBU B;  4BXS V;  3OGG A;  4JHT A;  4LHN A;  3VHO A;  3K77 A;  3AYC A;  4K6B A;  5GAL A;  4DNY A;  4ZU7 A;  1YCI A;  1MZF A;  1HQW A;  5LAS A;  2RJL A;  1U5I A;  1MS4 A;  3QH7 A;  3USU A;  1MS0 A;  2FDJ A;  2VU9 A;  4BJ0 A;  2YBS A;  2NP0 A;  4AEJ A;  1IKP A;  2O0O A;  4RQP C;  3BTZ A;  3OBA A;  4D6R A;  5HCF A;  4ARX A;  1ODN A;  4KU8 A;  3R4S A;  1IQD C;  5FYI A;  3ECQ A;  1AX2 A;  4COY A;  4RR3 A;  2G9F A;  1GKB A;  2ADD A;  2JDK A;  2UY9 A;  4H3W A;  4HET A;  2Q1Z B;  2GSY A;  4QX1 A;  4N43 B;  3AMQ A;  4QU1 A;  2OQ7 A;  2AH2 A;  3MIC A;  4A3X A;  4E8C A;  5HCH A;  2XVL A;  5GLU A;  2IXL A;  3O14 A;  2WO7 A;  3WQ0 A;  1GFF 2;  3POI A;  3PUH A;  3JBG 1;  2VOX A;  5ABJ A;  1PVC 1;  1V6K A;  4QHB A;  3RI9 A;  4D7T A;  1LTE A;  3NV3 A;  1Y7B A;  1HV1 A;  1RIN A;  1ND2 C;  1HJF A;  4FBF A;  4AF9 A;  1Y9G A;  4K21 A;  4HVQ A;  2P6H A;  4S2F A;  5FKC A;  4UI9 L;  3I8T A;  3T1M A;  4ZXK A;  3RZM A;  3OBT A;  4LIT A;  5FY5 A;  1RGS A;  4QXC A;  2RVA A;  2XDV A;  2ZJC A;  4BQ4 A;  4L11 A;  4I01 A;  5FZ9 A;  4BZ4 A;  2R16 A;  3MLK A;  1OKO A;  3PL0 A;  1H2K A;  2R30 A;  1LOG A;  5I93 A;  1NLR A;  5IVJ A;  3C7G A;  2DTW A;  4HKL A;  4TN7 A;  2OKX A;  1RUC 3;  2Z5W A;  1RUC 2;  3RNS A;  1OA4 A;  4G4F A;  1OOP B;  2NMN A;  4LPL A;  4YYO A;  3AC0 A;  5GLZ A;  1J59 A;  1ZBA 2;  1PNG A;  2B45 X;  2ZAC A;  3B00 A;  3MV1 1;  1XYO A;  1DFQ A;  4N53 B;  3MUZ 1;  5A32 B;  2OXB A;  4TXW A;  3OTF A;  1IHM A;  3A4U A;  4ASL A;  3WP3 A;  5FZ1 A;  2F6B A;  3HQX A;  2BU9 A;  3KGZ A;  4LOT A;  1MVQ A;  2D3P A;  4KMQ A;  1JZ3 A;  1OFN A;  1WW6 A;  1COV 1;  5I0R A;  4FTB A;  1HRI 2;  2MHF A;  2VUJ A;  3WW1 A;  2Y64 A;  4QPI B;  4CDX B;  3O0V A;  3AXE A;  1AX0 A;  4IXL A;  2E9Q A;  1JYN A;  4MG2 A;  1MEC 2;  1DQ0 A;  3M3Q A;  1PX4 A;  2P5B A;  1W6N A;  2VOW A;  4XJZ A;  2IVJ A;  4Q4V 1;  2VOV A;  1MZ5 A;  4Q29 A;  2Q1M A;  4XFA A;  3BU7 A;  4IEU A;  4Y3O A;  3AMN A;  3JQX A;  1LEM A;  5IHR A;  2R07 3;  3ORJ A;  5FYZ A;  5BNO A;  3ZMN A;  2R07 2;  1RUH 2;  1VBA 3;  4H14 A;  2YFU A;  2VY0 A;  3FWE A;  3GF6 A;  4XF1 A;  5FPB A;  5K4L A;  3VD7 A;  5B4N A;  1J1T A;  2JX9 A;  4QM8 A;  2YBK A;  2W0X A;  1AZD A;  2PN5 A;  5LBE A;  1RJ8 A;  2QTW B;  4QQO A;  5DZF A;  1UMH A;  3MEP A;  1OQ1 A;  1O5L A;  3MIG A;  5DQ0 A;  4UF0 A;  5DPN A;  1IS6 A;  2XBO 3;  1VBD 3;  4LO7 A;  1FXZ A;  4IGQ A;  2ZGS A;  4XHB A;  2AGS A;  4QM9 A;  3O1R A;  4XDP A;  3DPR A;  1UF2 C;  2E33 A;  2Y6K A;  4JAA A;  4AOC A;  4YW4 A;  3ZFE B;  5FYS A;  2OYZ A;  5HBA A;  1PM4 A;  1PIV 3;  2PHX A;  2VME A;  4BIS A;  1PIV 2;  2CYF A;  3ZOI A;  1G9F A;  2Q30 A;  1PZ7 A;  2RHP A;  4QPG A;  2VBP A;  4HVR A;  5C3Q A;  5JR2 A;  2ZMN A;  1AR6 1;  1VBC 1;  5FYM A;  1RHI 2;  3BB6 A;  4JV4 A;  3SKJ E;  5CZK A;  3WNX A;  4AFB A;  3A23 A;  1CN1 A;  5A32 A;  5IVV A;  2JDP A;  4QQ2 A;  2YFZ A;  4XQ4 A;  3LKJ A;  4FOV A;  3ES1 A;  4DIQ A;  2QCS B;  4MGY E;  4DXT A;  2H0V A;  3ZKY A;  4BQY A;  3WHU A;  2D44 A;  1OSG A;  2VOT A;  4FOW A;  2WN2 A;  5FPV A;  4BLJ A;  5LW9 A;  1L3J A;  5HXM A;  3E6B A;  1W8N A;  1QGL A;  1CD3 G;  2ZGT A;  4L97 A;  1UMZ A;  2ZMK A;  1VRH 3;  4OZX A;  1KQR A;  4CDU A;  1VRH 2;  3MBW A;  5I8T A;  2VPV A;  1RUJ 3;  1W06 A;  2KXL A;  3NMB A;  5IT6 A;  3RPQ A;  1PGS A;  2RS5 3;  3EYP A;  1W2U A;  5CB7 A;  2RS5 2;  4IEV A;  3RZG A;  1R08 3;  4UFJ A;  4YM2 A;  3ZFF B;  4XVH A;  1R08 2;  1CAW A;  4C1X A;  4ET7 A;  5F9T A;  3ABZ A;  4YW5 A;  1VIW B;  3ILF A;  3ZN6 B;  3UGF A;  4AYU A;  1OLM E;  4CEW B;  4CEY B;  1LEC A;  5D2A A;  2VEC A;  1UXZ A;  1VB2 A;  5FZ7 A;  1GLH A;  2UY8 A;  2ZOE B;  2VQ0 A;  3D82 A;  5E16 A;  3LSE A;  1LOB A;  3SCF A;  4BQ1 A;  3WDW A;  1NE6 A;  4NMI A;  4XC9 A;  4AE2 A;  2XPJ A;  1BZW A;  4J6G A;  3E5Q A;  3AMP A;  3NL1 A;  1ZRR A;  5C6C A;  1HRV 1;  3VD5 A;  2XVK A;  3KV5 A;  2E31 A;  2V4V A;  2R0F A;  3OY8 A;  3ZIX A;  2FDK A;  1G6N A;  4PJY A;  4QKB A;  5CKM A;  3EXU A;  2VQT A;  1DQ6 A;  2CGO A;  3MFA A;  1J58 A;  1ZZC A;  1TMF 1;  2BRT A;  5JVV A;  5LBB A;  5KXC A;  5T52 A;  4XJA A;  2PFW A;  3SH3 A;  5FZF A;  2QUO A;  1KXG A;  3PVB B;  3X29 B;  3WLU A;  1CQ9 A;  1QJF A;  1Z7S 1;  2IXK A;  2HWB 3;  2VUD A;  3H1M A;  4L9B A;  3ZIW A;  2V72 A;  2HWB 2;  4AAP A;  1JMU B;  1B35 A;  1PGW 1;  3I2K A;  4AFM A;  3M3I A;  4LBQ A;  3V0A B;  4XJW A;  3CJI B;  5AVP A;  1W9Y A;  1LOF A;  1XNK A;  3B93 A;  2JG8 A;  2ZAA A;  4OI2 A;  2EF6 A;  1FMD 3;  2AEY A;  1FMD 2;  1LHU A;  1DCS A;  2ZX0 A;  2EAK A;  3TWI A;  2BWA A;  1CWP A;  1DYK A;  1NCR A;  2VMF A;  3BAL A;  3WEZ A;  4BDV B;  3WW2 A;  5FYT A;  3M8L A;  2JIJ A;  5JSO A;  1GU3 A;  1N3Q A;  2NZ9 A;  1XBF A;  3AXD A;  4Q4X 3;  4ASM B;  5A3T A;  3K51 A;  4Q4X 2;  1O4Z A;  1W9T A;  4CU7 A;  1O4Y A;  3WCS A;  3WDV A;  3THD A;  3POJ A;  3VB9 A;  3G6J B;  4LK6 A;  3OJB A;  1O4T A;  4A6O A;  1S0G A;  1RUO A;  2X09 A;  4L0P A;  2B46 X;  4Q1R A;  2HEY F;  1MZ6 A;  3VD3 A;  1BKZ A;  5SV8 A;  1KIT A;  2W92 A;  4DPN A;  5M0T A;  2BVB A;  3E6C C;  4AGG A;  4P08 A;  2JG9 B;  1TG7 A;  1ST8 A;  2WA4 A;  2OZ6 A;  2XUM A;  3CQO A;  5CEH A;  3ZYJ B;  1POV 0;  1RB8 G;  4MHR A;  1OUS A;  2YC2 A;  2VG9 A;  3JQW A;  3ACL A;  5A3N A;  1AYM 1;  3NWK A;  5FO8 B;  4JKK A;  3GJB A;  4Y5T A;  2QE3 A;  1FAT A;  4CZS A;  2HWD 3;  3HNM A;  1GZT A;  1QNY A;  3MF6 A;  2KR2 A;  3VBS B;  3DL3 A;  3ZFG B;  4DUW A;  4NE9 A;  3ROU A;  1NG0 A;  3POY A;  5CIR A;  4QGM A;  3ZM8 A;  4AEM A;  1VBB 3;  3PVO A;  1NY7 2;  5FUP A;  1WA4 A;  4CCM A;  1VBB 2;  3IT8 A;  1ONA A;  1UU4 A;  3FHA A;  3PIG A;  3PME A;  1RL3 A;  2VCA A;  1ZBE 3;  3V65 A;  4TLF A;  4IGP A;  1ZBE 2;  1ENX A;  1NCQ B;  1FPN 2;  4COZ A;  4NPM A;  5IW0 A;  5FZ8 A;  2VZU A;  1E57 A;  2KA3 A;  2Y6J A;  3JCI A;  4M0N A;  3LCP A;  4S2G A;  4FFG A;  1J1L A;  1QJX 3;  1JW6 A;  1W6Q A;  4OI4 A;  4AED B;  4E4Z A;  1QJX 2;  4EN8 B;  1VBE 3;  1VBE 2;  3USU B;  3GZE A;  1YUD A;  4KG8 A;  2H0B A;  4UOJ A;  1G9A A;  1SLL A;  4NHK A;  1IKQ A;  4SLI A;  5F3C A;  5L9V A;  5AFB A;  1G8W A;  2A6V A;  4OMC A;  4GB3 2;  5T3N A;  2AEN A;  2PHL A;  3T1L A;  4S2D A;  1UMI A;  2BPA 2;  3DEC A;  3IMN A;  3GYD A;  5LBC A;  3ZVX A;  2EAL A;  2L9L A;  3DXT A;  3I59 A;  5A7N A;  3WF1 A;  1GZC A;  2TUN A;  3CDZ B;  3OPW A;  3VDA A;  1S4C A;  2WAB A;  3OUI A;  2WNE A;  4NIA A;  2G9Z A;  5ABJ B;  4K9S A;  5JOZ A;  3QD6 A;  4OHZ A;  1CIY A;  3CMG A;  3I3Q A;  3J7M A;  5DDJ 1;  3IPV A;  3JZV A;  3UKN A;  4RHV 3;  5I8S A;  2D6P A;  3ZXE A;  4Y20 A;  4YZ4 A;  2GAL A;  3U4S A;  3AMM A;  4CXX A;  3CF6 E;  2P6C A;  1RUE 3;  4A44 A;  4QKF A;  4Y33 A;  1RUE 2;  1S2E A;  3CBN A;  2XLF A;  3I3D A;  2WZP P;  1OPO A;  4GMP 1;  1BVV A;  1UWW A;  5FZA A;  1I3H A;  3GAL A;  4AFC A;  2AYH A;  3VBU C;  4NPR A;  4LO4 B;  2ATF A;  2IFR A;  4MZU A;  4Q0P A;  5FYC A;  3WNP A;  3AZY A;  1QJE A; 
#chains in the Genus database with same CATH homology
 2CHH A;  5A3O A;  1OUR A;  1GZT A;  1OXC A;  1W8H A;  2BV4 A;  3DCQ A;  5A6Q A;  2XR4 A;  4UT5 A;  3ZDV A;  1W8F A;  2VNV A;  5A6X A;  2WRA A;  1OVS A;  2JDP A;  2VUC A;  5A6Z A;  4CE8 A;  2BOI A;  1UQX A;  2JDK A;  1OVP A;  2JDY A;  5HCH A;  2JDU A;  2JDH A;  1UZV A;  2BP6 A;  2VUD A;  5A70 A;  5D2A A;  1OUX A;  5A6Y A;  4AOC A;  2JDN A;  2WR9 A;  2BOJ A;  2JDM A;  1OUS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...