1OUSA

Lecb (pa-lii) calcium-free
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
113
structure length
113
Chain Sequence
ATQGVFTLPANTRFGVTAFANSSGTQTVNVLVNNETAATFSGQSTNNAVIGTQVLNSGSSGKVQVQVSVNGRPSDLVSAQVILTNELNFALVGSEDGTDNDYNDAVVVINWPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein LecB
publication title Structural Basis of Carbohydrate Recognition by the Lectin LecB from Pseudomonas aeruginosa
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Sugar binding protein
total genus 20
structure length 113
sequence length 113
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2003-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07472 PA-IIL Fucose-binding lectin II (PA-IIL)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.400 Mainly Beta Sandwich Jelly Rolls Calcium-mediated lectin 1ousA00
2VUDA 5A6ZA 2JDYA 1W8HA 4AOCA 5A6YA 2BV4A 2JDPA 2JDKA 5HCHA 2JDHA 1GZTA 5A6XA 1W8FA 3ZDVA 2VUCA 5D2AA 1OXCA 2JDMA 1OUXA 1OVPA 2BOIA 5A70A 2VNVA 2WRAA 2JDUA 2BP6A 4UT5A 1OURA 2JDNA 1OUSA 1OVSA 2CHHA 2WR9A 1UQXA 1UZVA 3DCQA 5A3OA 4CE8A 2XR4A 5A6QA 2BOJA
chains in the Genus database with same CATH superfamily
1DQ6A 2V4AA 5A1AA 2VMIA 2ZGNA 2WLPA 2YBKA 4Y1YA 1HV1A 4KWKA 4H7MA 4P14A 1ZZ7A 4GXLA 5LA9A 3WP5A 1SLCA 1DQ2A 1W8FA 4AI9A 1B35A 2P6HA 2WFPA 4MUVA 5FZMA 4LUKA 4Y1UA 4EWEA 4XMIA 3MGUA 5ACA1 3EBRA 4OHWA 4UWDA 2QQUA 3O5SA 3DPRB 3PVNA 3OD0A 4CEYA 1E57A 5F3GA 1J84A 1AR63 4GULA 2VCMA 1YLLA 5BUVA 2ZMKA 1N3PA 5BNPA 1FMD2 1RUJ3 4A3XA 1US3A 3RI9A 1OOPA 1XPWA 4A6SA 3WD5A 1ASJ2 1H8TA 4AHWA 1K5MC 4BLIA 4UYBA 4AEJA 1XU1A 2ZJCA 1D4M2 3AJZA 3S5AA 2FDJA 1YRZA 3ZFGB 4TTGA 3H8XA 2Z2SB 3S57A 2BUKA 3WW1A 1LGNA 1KFUL 1OH3A 3ZXFA 1FNYA 4E2GA 1KDMA 1PO13 5TSWA 4P5HA 4BQ1A 3RZMA 3EHKA 1AR72 3A0NA 1PMIA 3J7HA 4Q0VA 2Q8DA 1ULDA 1VAVA 1AJKA 2FD8A 3L9JT 3VHPA 3N4MA 1NZIA 2FZ1A 3SH3A 2VVFA 2HWF1 1D0GA 2GZWA 4XF1A 5FJKA 2X09A 3SKJE 4B3NA 3ZSLA 4YFZA 1DGWX 1QQP1 2RM23 3LWCA 3GZTB 5EFUA 1T6GC 3VHRA 5T52A 1ZRDA 4P9YA 1W05A 2UWBA 4YVSC 5FKBA 3ZR6A 1B35B 5LK7B 2YG0A 1VP6A 1W03A 2PFWA 4Q0QA 4LHSA 1GMMA 4PIXA 4QQ2A 2JG8A 4AI1A 3AKQA 1G6NA 1BCXA 4IEOA 4XDPA 4YW4A 3GF6A 3JBG3 1OD5A 4DRRA 4WZFA 5FZIA 3ZMNA 3HBKA 3B93A 4K1ZA 2VCCA 4QU1A 1RTVA 4MGZE 1UN1A 2A7AA 4AGVA 3C7OA 1OOPB 2D6NA 1V9U1 4RD7A 4QQHA 4YG6A 4LLOA 4UFKA 1H8TB 5CU1A 3RGBA 3T0DA 3I4IA 3ZYGA 1GOHA 5JVVA 3WLUA 2XLAA 3VBSA 2VC9A 3K4AA 3ECQA 3ZXEA 3H1YA 4IE6A 1GICA 3H7YA 4JGYA 4FOYA 1W39A 4HBNA 1JOPA 2VZRA 4FPGA 2HWD1 1G86A 5EJ3A 2EVXA 3AP4A 4LE3A 3OPTA 4HT1T 1O5UA 5A7OA 3UJOA 3ZXGA 1J1LA 5FBJA 2K2SA 4IEZA 2W91A 4LA3A 4FPCA 4QQOA 4MXVA 1LJ7A 4W4ZA 1JXNA 5A3PA 3VZOA 5F3CA 4Q4Y3 1RUD1 4PDWA 1XNKA 1W90A 4KGGA 2ZA9A 3ZPOA 2ZHNA 4JHZA 3V0AB 2VMCA 4AVTA 4CUGA 3GNEA 1US2A 2DDUA 2JDPA 3MHZA 2R071 3NL1A 1I6XA 1IS4A 3PUHA 1RHI3 2WYFA 4RYDA 3JU9A 4EN7B 4Q1RA 3HQUA 3VBFA 2XHKA 1PVC1 5FYUA 4XEZA 4XHBA 2XPJA 5KHJA 1BEV3 3HOBA 3OBZA 2AREA 4IW3A 4RGKA 3BUCA 3TEZA 3RZZA 3TRSB 1G8WA 1G9AA 2WR9A 3ZM8A 2W95A 3TEYA 2ID4A 2X10A 3VBOB 1I1EA 4DB5A 2LRPA 4JHTA 2RJLA 3KT7A 4FVVA 4FAGA 1VB2A 5A33A 3TNPB 4FBFA 4KGQA 1U5YA 5CISA 2QQJA 3W20A 1OFNA 2CDPA 2VCBA 4UFLA 1COV1 4YGCA 4FI9A 4QQPA 4U36A 4DPNA 1RJ7A 5JSOA 5FIXA 5C3SA 3NMBA 5FY0A 1SBEA 4B8EA 2XJPA 5FP7A 3B9CA 2R49A 4Q29A 1NA1C 3VBSB 2XUMA 4GH4A 1LEDA 1NXMA 1VBC1 5FY4A 5FYTA 1ZRFA 2EXJA 3WQBA 5JZGC 1CJPA 4JGYB 4N43A 5L7OC 1WW5A 3AYAA 3PVBB 3LA3A 1V6MA 1S0EA 2VR4A 3KZ4C 4C8DA 2VL4A 1VRH1 1QJEA 4MHUA 4P9XA 4XCBA 4Z8BA 2RS52 3OSDA 1MEC3 2ZGPA 2ZOEB 4CU9A 4COZA 1GANA 4PDWB 1JYWA 4WVMB 1RUG1 4GKXA 3WVJA 4C0HA 2IC1A 3PVOA 4I01A 2IVIB 4M00A 2VNGA 1WD4A 3MO4A 1ZZ8A 4KU8A 5FP8A 1RC6A 5I0UA 1NCRA 1RVF2 1XBFA 2A6XA 4MLOA 4NIIA 4Q0SA 1VLNA 5IW0A 4CXWA 1G9FA 1ZYBA 4WZCA 1WGPA 5EQUA 4AVBA 3VBFB 5DG1A 2RR13 2LTNA 1D2SA 2FBEA 3A4UA 4TXWA 1K5MA 5FZ4A 1FI2A 4XJ9A 2D6PA 2D6LX 4XIKA 3SXWA 3C2UA 4K6BA 1H1AA 1U5XA 4NOTA 4XJUA 2NPIA 3SQOA 4QGNA 4HG6B 2MNGA 4IE4A 1AR82 3RSJA 4LUMA 1MS3A 4LR4A 2NLRA 1XNBA 3PUSA 1EUUA 1S2BA 4CCEA 1GNYA 5FZ7A 3SITA 4AEDC 5JXIA 2QQWA 2PHRA 3W9AA 1RUF3 1R1A1 1Z0HA 3EQEA 1YI9A 4MGTA 3CMGA 1C5HA 2UY8A 2VU9A 4MADA 4BM8A 4ZZ5A 4JGZC 3AL5A 4DQAA 4FP3A 3RMXA 1DU3D 2D3PA 2QJVA 2ZGSA 4GWIA 3ZXJA 4DY3A 4NIGA 4ZPIA 2HBUA 5E89A 3CJIC 4LMFA 4NWWA 1EPZA 3FMGA 4H2AA 3FC0A 1IPSA 4GH4B 5CFCA 2F6BA 2NQYA 5GM0A 4YM0A 1HB3A 4KWJA 1SZBA 2D7FA 2WQZC 3I3EA 5E1RA 2WZR2 4CZSA 2J1RA 5C5UA 1NX9A 3ALQA 4IV3A 3RJ2X 4AVCA 1HRI3 2RG4A 2ZGOA 5F3EA 4YVSA 2EIBA 4PBOA 1NT0A 2DUPA 1CAXA 3T0AA 4XUNA 4CP2A 4AI0A 1ENXA 2ZAHA 1D4VB 3M2MA 4AAXA 4Q27A 2OYZA 3ZDVA 3BALA 2ZHMA 4CDWC 1V6NA 2MPFA 1NCRB 2W94A 1BZWA 4PIZA 1CAVB 4V2VA 2ZEWA 2J1EA 4OI0A 3OCPA 1VBA3 3LAGA 3WG4A 5CKQA 1UZZA 2EXIA 3WV6A 5AFBA 3JB8A 2D6OX 2IXHA 4PQ9A 3OPZA 1W6NB 2WO3A 2RMU3 2VBDA 4GJYA 5FP9A 2CGPA 2P3IA 3IMMA 2YXSA 4B4RA 5C9AC 4LORA 2G9FA 5T54A 5F9TA 4RFRB 3KVBA 3D82A 4F3JA 5JSPA 5FY1A 1JZ8A 1W28A 2W9XA 3TOJA 4LOSA 1QU0A 2ARCA 4B7KA 5I8YA 1AUYA 1AYM1 1VAKA 3HPNA 2QNKA 1DHKB 2AEZA 4QQLA 5KR7A 2GMMA 3W21A 2O1QA 4AQ2A 4SLIA 4B4QA 5ABJA 4IEVA 3DUIA 4XVHA 3SH4A 2VQTA 4TZDA 1O8PA 1W0NA 3IMNA 5IVFA 5CFCB 2XLFA 3ZPYA 5LY1A 1AL22 1ZVFA 2WNVB 3BU7A 1WW4A 3OGGA 4ZXEA 3ZIWA 2MEV3 1UD1A 5C4WC 4IV3B 4KI5M 4K8RB 4BZ4A 1O59A 1AYN1 4CCNA 1SBFA 1EP0A 5C70A 4Y3OA 4YFWA 1MVQA 2WSUA 3WG3A 2OS2A 1R093 1JZ3A 3T0BA 2Y6HA 1GP5A 5KC5A 2V4VA 3E5QA 2BVBA 3TEXA 3T09A 3VL8A 4BQ2A 4R4XA 4K9SA 2P37A 4LBOA 4LBLA 2QQOA 3RZHA 1S1AA 3DECA 3FLTA 4GB32 3VDDB 3O1UA 4A3ZA 1K45A 2VW1A 1WCUA 2Z42A 4Y24A 2XBO3 1UMHA 2BNNA 2BYVE 2OPKA 2XJSA 3ZOIA 1KRIA 4HVRA 2H6BA 2CU5A 2JD4A 1D7PM 2ZHLA 4GAZA 2W46A 4DS0A 2DCKA 1F5FA 3N7KA 3WEZA 3NW4A 5JPMB 1WA4A 1I3HA 5I0SA 4Y5TA 2VUDA 1UNBA 1ZBE2 1NA1A 1RXGA 2OQ6A 1APNA 3DF0A 2D44A 5FAXA 1ZRIA 2PXJA 1Q8VA 4P9LA 2OXBA 4XZUG 5F6LB 2I2SA 5C3OA 1AJOA 4D94A 2PAKA 1CPNA 2RJ2A 4FFHA 1CIWA 1KQRA 4Q4V2 4P9WA 4NIAA 4MH0E 3NNJA 5DAPA 4CTEA 4CCLA 5ACA3 2HEVF 1MZFA 1FOD3 2RS11 3JQWA 5JMCA 1YFWA 4WM8A 4QX2A 3DYPA 2XG3A 1VR3A 3IIAA 2YC0A 1PMHX 4XXAA 4CXYA 1PX3A 4BK4A 1HQNA 1VAMA 1YIFA 1WMXA 1NG0A 3OB8A 1W9YA 3WY6A 3BN6A 3H42B 2XGXA 4BDVB 4L8QA 3AP6A 1LEMA 2GN3A 5JSRA 4DUXA 3ITQA 1B09A 3LF7A 4XF3A 3BTZA 4QKNA 3AYDA 3RG0A 1SACA 3SISA 3T2QA 2WZPP 3VKNA 3U75A 3KSCA 4AZZA 4AQSA 1TMF1 1XOYA 2UYAA 2Y8KA 3ZKYA 2DU0A 4AGGA 1GFF2 1PGSA 4M3CA 4AGRA 1ZZCA 4FTSA 4AEDA 5KXBA 1KITA 2VZ1A 3J4UH 2B39A 1UQXA 3JBG1 3O14A 3N7LA 1RINA 4INDA 2NZ9A 3FUQA 3NNFA 3NVCA 3ROUA 4XQ4A 1HV0A 2BW8A 2IXLA 4UW3A 2JE9A 3AP5A 1PMJX 4XE9A 2XWBB 3BPZA 3DL3A 3ES1A 1DZRA 4PLOA 4ITCA 5JXHA 1LOFA 1LULA 5L19A 3VD7A 1QQP3 1T6BX 4CDXC 3HAGA 5D2AA 5FYVA 3BTAA 1PIV2 2KA3A 2WN3A 4P08A 3AZZA 1G9CA 4FTEA 3WUDA 1UW8A 3WF2A 2VG9A 1LHOA 4DFSA 3MIBA 3ZXDA 3M3QA 1RMU3 1RUI2 3LZZA 1C8M3 4XJZA 3VB9A 4URAA 1VBE1 1FATA 4L11A 2YC4A 3GJBA 1UYYA 3U78A 3J8F1 3IDAA 3MW3A 4W6XA 3ZVXA 2RS33 3KHCA 3H8UA 1UY2A 1X8EA 4WM8B 2BNMA 2BRTA 2OX0A 1V9U3 1KDKA 4PLMA 2A1XA 3JD71 2BBVA 1DQ4A 3WX5A 5FRAA 2PA7A 4XW3A 3VKLA 4D6QA 3FHQA 5ANNA 4QPIC 4CCJA 1EV12 1QDOA 3HIFA 2R16A 3KV6A 2V5YA 3O7OA 1MVEA 4QHZA 4CXXA 5JOYA 1UPIA 1UXXX 3D8CA 4ASLA 4YM1A 2RDSA 2WABA 4GWMA 2VULA 5L36A 1QH7A 4RGGA 2HWD3 3RFRA 1MQTA 2KXLA 4IESA 4UFJA 3U4SA 5KXEA 1JYCA 1O7FA 4W8JA 5FPLA 3SEEA 3GM8A 1DGRN 4JC1A 4M3CB 5IWFA 1F8VA 2UY9A 2B7YA 5T5OA 5CZKA 4JZRA 3VKOA 4HZFA 4GJZA 2JD9A 1RUD3 5L9VA 5FV3A 1LENA 2C24A 4RR3A 5CB7A 3WNXA 2YU1A 1NE6A 4LHNA 3EXUA 3ZLIA 3H9AA 4NRMA 1N47A 1LHWA 3WOGA 2HWB2 4B1MA 2R073 5DXDA 1OMIA 1UPSA 3N9LA 4BQ3A 3M3CA 3CJXA 4BXSV 2JDMA 2HEWF 2DVGA 4BWOA 5C3QA 4BA6A 1IQAA 1JODA 2DV9A 1PVC3 3B5LB 1UIKA 4XABA 1CZVA 5C4WA 4IGOA 4WVVA 3AXDA 2EIGA 4LIVA 3PMSA 4WVWA 4K8FA 4DMIA 3VBHC 5A3UA 2AYHA 2WN2A 3HEIA 4OI1A 5FBZA 2AH2A 3AVSA 2ES3A 1F31A 5H9RA 4IEUA 4QX1A 1VMJA 5JPNB 3FJSA 2FCVA 4N9IA 1NKGA 3BTXA 3C7FA 1GNZA 1SG3A 1COV3 4LKFA 4QXCA 5A3WA 3ZYHA 4A7ZA 4JTNA 4XPVA 1QNWA 4RHV1 3RZJA 2OQ7A 1ZNPA 4PI0A 4XHXA 4E4SA 5A3MA 1PGW1 2ZZJA 4DXSA 5A7SA 1AR73 2PHXA 1VBC3 2RR11 5IUQA 4NE9A 2SBAA 3AZVA 3JXSA 1IGOA 5FMOL 1BBT2 3GHNA 2D5HA 3L2YA 3WHTA 1MQTB 3K4ZA 4JVAA 1VRH3 3SCGA 1XE8A 4Q2FA 3WDWA 2QE3A 1V00A 2LM3A 5A80A 3SMHA 3P3PA 1WW7A 2BDRA 2W1SA 1X50A 1RUG3 2J22A 1LU1A 4RR3B 3TWIA 1ZA7A 2OVUA 1RUE2 2JDKA 2BBAA 2OUJA 1QGLA 2VTXJ 2B45X 1FT9A 3ZYBA 2V73A 3ZYJB 2WFF1 2VE1A 4K20A 4XF0A 5DUVA 3MV11 2O8OA 1W3VA 4MVTA 3POBA 4CRQA 4G9SB 3FLRA 2VZSA 1JYNA 1QDCA 5F1RA 2NM1A 5GKAC 4UFIA 3POFA 2YFZA 4D6RA 2E53A 4I0AA 2QCSB 5B2GB 3VUOA 3V64A 3S6PA 1AX2A 4JTOA 4B1LA 2ZKLA 2HBTA 3PUAA 5IVJA 3FE5A 3Q8BA 1PK6C 1IG0A 5DQ0A 4URTA 3VZMA 4CDQC 3I2KA 1AZDA 1GYKA 3OBTA 4QXBA 5FO7B 2EF6A 4KH9A 3RYKA 1R1A3 2BPA2 1TG7A 1QJFA 2O0OA 4FPEA 4FXGB 4IEPA 4LHKA 3FN9A 3NO8A 1XQNA 4CYDA 1TQ5A 1RB8G 2MHFA 3P1IA 2K0GA 2EICA 3JUUA 3WHUA 3WR0A 3SKVA 4QDQA 4HANA 2YMZA 1BMV2 4ZS3A 3URFA 1YJKA 5EP9A 4CSWA 3N7MA 4MGKE 5FZKA 1LESA 3VDBA 1DYOA 2YFUA 2GSYA 1YFUA 1QJY2 4CDXA 3ZFFB 2C26A 5BNOC 2XONA 3MIFA 3NJVA 1HXS2 1O6UA 5J3UA 3U14A 3FFZA 2VQ0A 4GMP0 3FLPA 3ZMOA 2A6VA 4D7YA 1QNYA 5K7PA 5BNNA 4BOWA 5IVBA 3MFCA 1PGL1 1VBB2 4QX7A 4GMP1 1JMUB 3ETQA 1W2TA 4NJ4A 4KMQA 1HQWA 3C8XA 1ZREA 1HRV2 4M4PA 4ET7A 3IKWA 2PHTA 1W9SA 4H7LA 5FK8A 2PN5A 4MGYE 2Z5WA 3N9NA 5L73A 1UX7A 5D8AC 5T5PA 1IG3A 4OLLA 4LO8A 1YCIA 1GR3A 1ACCA 4D8MA 3WCSA 3LGRA 2VJXA 1VB4A 2W0XA 1H1MA 2J1AA 1NCQA 1GZCA 4AHXA 3QBQA 4CU6A 1LHNA 1DGWA 3OGVA 2CSGA 2J1TA 1OA2A 2WWJA 4NIDA 1H4GA 2Q4SA 3WNMA 1ULPA 3HT2A 5A1FA 4YVWB 1VPHA 4MYEA 3B01A 3M3OA 1IS5A 1AYM3 1SBDA 3NKTA 1NY71 4FPKA 3EMRA 1KXGA 1F4AA 5IAVA 1W6PA 2DTWA 5FDBA 3ENRA 1HB4A 1LHVA 2VTXA 5FZ0A 4QT6A 4COVA 5FUPA 1RUC2 2Q0AA 3Q8CA 4M0NA 1UCXA 3H1MA 5FPAA 1DLLA 4OUMA 4O65A 5GLVA 4EN0A 1ULOA 1DG6A 3FWEA 1CAWA 4MSVA 4DINB 5FPBA 5CNAA 5F8PA 4HL0A 1RUH2 2G9ZA 2JDZA 2LROA 2RE9A 2V72A 3PTRB 5AC92 1AHSA 4K3UA 1OC1A 1AYN3 2WBKA 5IVCA 4AE2A 5DDJ2 2L9LA 1H2KA 1VBD2 3D0SA 3NJXA 3R4UA 1CZSA 3R4DB 3THPA 3MI8A 5H9SA 4Q4W1 4Y5Z0 1FAYA 3KCCA 1YEWA 4XUPA 2QFEA 5BNNB 3GZAA 5LWBA 1DLCA 2HWC2 3TN92 4LEJA 5JXGA 2ENRA 3LOBA 2A73B 4C1WA 4BYYA 1ONAA 1RL3A 2WWSA 2BQPA 2HYXA 1WBFA 1JHJA 3CBNA 2G4IA 2GNBA 4H3WA 4L92A 4P00B 1PM4A 3RJRA 1FOD1 5HCBA 1FPN2 1H2NA 1F9KA 5JLVA 4UI9L 2VAUA 1BK1A 3B3QE 2R041 1J3PA 1SCRA 2VBBA 2VECA 3CZJA 2WLQA 1AXZA 1E5SA 2GC3A 2XJQA 4OZXA 1RXFA 4AFBA 1NCQB 3E6CC 2GDFA 3U07A 3ZFEC 1UMZA 2BFUL 2ET7A 3I59A 4R9DA 5LRRA 1YWKA 4XJ8A 2N7GA 5FUIA 5IYYA 1F35A 1D0HA 2E6VA 1OT5A 2QDNA 4E9KA 1MS4A 2Y6KA 5I0TA 2YV8A 3VHNA 4ZXKA 1TME1 2R061 3T30A 5LASA 1ZX5A 4LO4B 4RQPB 3N9OA 1EAH2 4ZZ8A 1W6PB 1UMIA 1Z78A 3I3BA 1SFNA 1VALA 5DUWA 4D69A 2YC2A 2W52A 1XNTA 4KBBA 2RS13 1UY0A 1C4RA 1JZ6A 2BGPA 2WNUB 2Y0IA 3IWZA 1QJX1 5APAA 5LA2A 1N3QA 4LBQA 4LNVA 3U1XA 1BQPA 3B7MA 2DUQA 1LODA 1OLME 3ASIA 5FMCA 2E7AA 4S2DA 3HJRA 2D3SA 1X7NA 1ENQA 1DQ5A 1WCQA 2HH9A 2Q5TA 2ZAAA 3MIDA 4FPHA 5E16A 3S5QA 1SFPA 4R8HA 5I91A 4MGSA 3SEPA 4Q4X1 5FYSA 5IHRA 2FHRA 2SLIA 2VTFA 4O7XA 3K4DA 3DN7A 4WM7C 2OW4A 3WP6A 4AVSA 5I93A 2EIEA 1ZM1A 1GZWA 2F17A 3CIHA 5JWPA 2XH6A 4NR1A 1TMF3 2VVEA 1RMU1 3FHIB 3PNAA 1C8M1 4OHVA 3J26N 2P4EA 1V6KA 1QJU1 3LEIA 3GCXA 2JB4A 4CEYB 4HXCA 5GALA 3WNPA 2RS31 2KD7A 4XQDA 3ACIA 1CPMA 3FFQA 5FZ6A 3USUA 5BNPB 5A6ZA 1Y9GA 1RJ8A 4EYUA 2KR2A 2ERFA 4HSLA 2A6WA 4PLNA 3I59B 4MOAA 1GP4A 5FPXA 1E5IA 3X29B 5JI9A 3TB0A 1GQGA 1CQ9A 2WA4A 5LATA 4O9GA 2VW2A 1E5HA 1R082 2ZGUA 1XNCA 2CWSA 5CKNA 4JV4A 4LBJA 1QHDA 2QQLA 1OSGA 3ILRA 4GWJA 1MS9A 4HKOA 1H2MA 2D93A 1MS0A 4ZU4A 1ULEA 1CVNA 4QDSA 2GNTA 4NUBA 2BEOA 1C1FA 4RGAA 1Q8PA 1VBE3 5IVEA 4LBMA 2YU2A 1X82A 1SQ4A 3FL7A 3UT0A 5F5IA 3J8F3 2YROA 3JCIA 5C71A 1OD3A 4D7SA 2UWAA 2W87A 4PI2A 2FCUA 4AL9A 4NN0A 5FZ1A 2WUHA 3OJBA 3JD73 4ZONA 2ETEA 3POIA 5FKCA 2C9KA 3WZ1A 4ZU5A 2AUYA 2VZUA 1WCSA 2ZCWA 2Y64A 4QD2A 4L0PA 4M3CE 4COWA 4E8DA 2YBSA 3K75B 3UK9A 1FV2A 5FOJB 1FYUA 1NQDA 1PHMA 3DYMA 4XETA 5C7GA 3RPQA 5CFDA 1SMVA 1GZWB 2IXIA 5JOXA 2PLV2 1FMD1 3N36A 5KHGA 1PNGA 4I02A 2GAUA 1VMHA 1XC6A 5ISLA 2CWMA 1ASJ1 3DCQA 2JG8B 3ETPA 3P3NA 2YGMA 3B9IA 4J1WA 4QAWA 1UYXA 2JKXA 3M70A 4B29A 2WIIB 5FZBA 3RYPA 4NIHA 5F6KA 1D4M1 4AI3A 5FO8B 1JZ7A 4V2WA 3USUB 1MS8A 1NXD1 2TUNA 2VCAA 5LA0A 3RZLA 1S0DA 3KGZA 3WNOA 3RZGA 5B4NA 1O4YA 2JDHA 5G04L 3T1LA 5DAVA 1H6XA 3LPFA 1ND3C 4Q4V3 4YW7A 5CAZA 4ASKA 4AK3A 2ZX4A 1LOAA 4L97A 2Q8OA 4R9AA 3AYCA 1AR71 3FBYA 1K42A 3GJAA 5K8SA 2A70A 1OKQA 1C28A 3JZVA 2TBVA 2WS92 3AZWA 4AF9A 4AG4A 1CWPA 2CDOA 1DCSA 3MF9A 3T2PA 1OFSA 4MO3M 3KGLA 3KT4A 1YJLA 2B46X 2QDRA 2GALA 1ZBA2 1JU4A 2QVSB 5LBCA 3VBRC 2FCTA 2A3WA 1JBCA 5BYNA 5K0UC 1UU4A 2W92A 4K21A 3HR9A 1OLQA 3QOPA 5HBAA 1X9PA 1YC61 3LDBA 2XMLA 4E8CA 4RHV3 1OVPA 5DG2A 5EYXA 2HYKA 5K4LA 1FV3A 3RVHA 4YW1A 3B69A 4BPZA 1DGRA 4IERA 1ENRA 4JKKA 1ZZBA 4JDOA 5FZ8A 1YO8A 1N1TA 5CFDB 3ZFEA 4HPKA 3ZXAC 4Z92B 4Q5OA 5C8CC 3NQHA 4A45A 4BQ5A 1BHGA 4AW7A 2ARXA 3ZR5A 1RUOA 4LK6A 5JCTA 2PAMA 2AR6A 2HKXA 3DGTA 1OQ1A 3KVAA 1X33A 2ZEXA 4JRLA 4XJAA 4E4DX 1XSQA 4OULA 5A33B 2P34A 4HOOA 1PIV3 4XACA 3I2FA 4GIQA 3GZEA 1GLHA 5FLHA 2WFF3 2BERA 3B94A 2PELA 2QQVA 3I2GA 3ME2A 3WUCA 4AYUA 1UOFA 2W3JA 5E8AA 5F5CA 1V6LA 1ODMA 4QB1A 4N43B 4PF1A 1WWYA 3NAPC 5DABA 4XUTA 3U37A 2NYYA 1AR62 4CPBA 2WDBA 2VMHA 4OI4A 3MZHA 3RZKA 2LS6A 1X8MA 1LU2A 1RUJ2 3H50A 4Q0PA 4BISA 2FDIA 3RWKX 1F15A 4WM7A 3IAQA 1W8HA 4DRVA 1OLRA 3O1RA 4OHZA 4IV1C 3IDEA 4ISRA 2YPJA 4IUGA 3VV1A 5KXCA 4RSUA 5FZ9A 4QPGC 4CDUC 2EIDA 1AX1A 2VNOA 2J7MA 2D6MA 5DPNA 5LZ6A 1OUXA 4AFAA 3ACHA 5GLZA 1PNFA 4CEWC 3AJYA 4CUAA 2WAOA 4UFHA 5F2SA 4LKSA 1OPMA 4YM2A 1OVSA 1PO12 1H9WA 2NMOA 3I49A 4LBQD 3BIEA 1K5MB 5C8WA 4XF4A 4QX5A 4ISQA 5GLWA 1NOVA 1WCDJ 1C5IA 1X9TA 2X53S 1YYNA 4P9JA 2PHUA 4R9BA 5FZOA 2C1FA 4PQQA 1IPJA 4OUSA 3IDCB 3NV3A 1Q43A 4YZ4A 3MLKA 2PHWA 2DVFA 4ZU7A 1I5PA 1G9BA 4Y4RA 3OGSA 4E2SA 2RM22 4GMP3 2QZ2A 3S7EA 1F2NA 3AMMA 3N3HA 3IT8A 4YARA 2JG9C 2IXJA 1BLZA 4N53C 4ZS2A 4ASMB 1S0GA 3VD9A 4AFCA 2RS51 2X5IC 3MYXA 1SLLA 4IE7A 5IAXA 2TNFA 3H1WA 4ARXA 3HD8B 3IPVA 3SLIA 1SLAA 1GP6A 3OEAA 1LNSA 5J1XA 3MUY1 2IFRA 2XR4A 4YRDA 5A3NA 4AHYA 2VW0A 4OQ9A 3VL9A 3IN9A 1JI6A 5J37A 5T50A 2DYCA 2HLEA 1DZQA 1REFA 4YVSB 1RVF1 3AKRA 5KWRA 1TZOA 1CAXB 2VUAA 1SLIA 1POQA 3VHOA 5C5TA 3K46A 5HXVA 1SFYA 4ZHNA 1YQ8A 1DP0A 2HJIA 2WZEA 1JYTA 3ACFA 2IVJA 3A0KA 5CG8A 1GZ9A 5FYBA 1AR81 2A3YA 2D5FA 1PZ7A 3R05A 4IEYA 1UZVA 3H7JA 4CU8A 2DURA 3K51A 4YGBA 3RWNA 1QXJA 2OIIA 3T3YA 2LALA 2XVGA 3MICA 4JKLA 1DZTA 1H0BA 2AENA 3KS7A 1XYOA 1HB1A 4Q4Y2 2XLGA 5J09A 1L7RA 3NRUA 1W6MA 5G05L 2UURA 2JX9A 3VBUC 5JZGA 1HJFA 3E6BA 4I0WB 5L7OA 4MV2A 4Q4W3 5FYMA 2QZ3A 1JZ4A 3K3OA 3OBRA 1E5RA 1QOOA 1RHI2 3INAA 2EXHA 3AFGA 4A6OA 3MIEA 3BVCA 3PIGA 2ZX0A 2WZR1 4UT5A 1YFXA 3ZO0B 4OUEA 5BPXA 5ABJB 4UAPA 3ZN4A 2Q1ZB 1BEV2 1EPWA 3IM0A 3O1VA 3ZSEA 4XQWA 3M4FA 1NYWA 3UJQA 2R043 3IPVB 5L9RA 5FXXA 4TN7A 5JI7A 1OF3A 4XFFA 3MLJA 1W9FA 2WJSA 4YW5A 3ZFFC 1W3XA 4ATFA 4FTBA 4Q1PA 2BWAA 2H0VA 1DBNA 2P3YA 1UF2C 3WNNA 3V56A 4F8AA 2OT7A 1WMFA 2J42A 2G9GA 3O0VA 1TME3 2R063 2XDVA 5BY5A 4RS5C 3CL1A 5SV8A 3MFAA 4C90A 4YZ5A 3MLLA 3PURA 4NPRA 5IATA 4A42A 2HWE2 4TLFA 1MS5A 2CHHA 4R9CA 4Q8KA 1ND2C 1QJY3 3E5XA 3CQOA 4P5YA 2RV9A 3WW3A 5FMOS 4QX8A 5FZFA 4LO5B 5LCWL 2JECA 1QJX3 3C7GA 3KM5A 4JGZA 1MEC2 1Z7S2 2WT0A 3WP4A 3AFKA 4AI2A 3DEMA 5IK4A 4CCCA 5CYYA 1JZ5A 3CJIA 4R4ZA 1NA1B 2XL9A 1W6MB 3WDUA 3LIHA 3P5BA 4YG3A 5JZGB 1GWMA 3DYOA 4Q4X3 3ZIXA 5M0TA 3WINE 2DUOA 3MEPA 5L7OB 4Y1VA 1YHFA 1LCLA 4S2HA 1AL21 2E31A 1NUKA 2P5BA 4D3WA 1YQCA 1H2LA 4IV1A 1QJU3 1R64A 1DQ1A 2X8KA 2X05A 4DZGA 1UAIA 3Q8FA 3QH6A 5A3OA 3I8TA 4CDUA 3ZX7A 3UESA 3K48A 3WDYA 5K9YA 4CDWA 5D1IA 2DTYA 3FBMA 3U4XA 5LY2A 2I45A 4XMAA 3K77A 5DZFA 1REEA 1XU2A 3AMQA 3IIIA 1JS9A 1CR7A 1LOBA 3KF5A 2XJRA 5FLJA 3BCWA 5A6XA 3NNGA 2BWCA 1QIQA 1RUF2 4GB31 1URXA 4M3CF 4BXFA 5J7MA 1RUC3 1JW6A 1WMEA 4FAHA 5IK8A 1W8NA 4HK8A 4P02B 1GKBA 2JEMA 5FZAA 2IXCA 4N9HA 4A41A 5CBLA 1CESA 4XFHA 3FZ3A 4CPBD 1P8JA 4LLFA 1OA3A 1Q8SA 2E7QA 1UY3A 5C9AA 5JMOA 3MW2A 1Y4WA 2XVKA 5J48A 1S0JA 1ZRCA 5ANQA 4BQ4A 2QTWB 1ZBE1 4O9EA 3DPRC 4AEDB 1WMDA 4CE8A 5DDJ3 4BE3A 1PO22 4CUBA 1DF0A 4KU7A 2KM2A 1HRI2 2JDYA 5FOBB 4X8NA 5FWEA 4JGZB 1V6JA 1KS5A 4R52A 1QXRA 2IZWA 4B7EA 4LO7A 4JAAA 3W5MA 1UYZA 4PCRA 1DIWA 3ORJA 3CJIB 3UKNA 3H3LA 4BIFA 1OH4A 1UKGA 1A8MA 1HB2A 1LOGA 2ZXQA 4Q4V1 1D2QA 1IHMA 1MZ6A 1K3IA 3IAPA 1W6OA 3ZFGC 1FPN3 3VKMA 1AR92 5T5LA 3UL2A 5EZWA 5FZLA 1FMD3 3CZUA 3VDCA 1VBA2 2QQIA 4NPMA 2DCJA 4QKFA 3VZNA 3ZKUA 4UW5A 1ASJ3 2PAEA 4QX0A 5H9QA 3KMHA 3A7QA 1W0PA 4KL1A 4XXPA 2NMNA 4FSJA 2RMU2 2VY0A 3F2ZA 4EN6B 1D4M3 5FZGA 3OOXA 4COUA 1OPOA 1POV0 4CDWB 3TNQA 3T2OA 1J3QA 1Y9QA 4N7UA 3M1HA 2C9AA 3P6BA 4O61A 5EHDA 1ULFA 2VQUA 4AQ6A 4LXLA 5FXZA 1POV1 4A7YA 2ARBA 2BTVC 3LA7A 3AB0A 3E5UA 1Q3EA 4KQ7A 4V1PA 2XHNA 1W8TA 4KG8A 3NV4A 4RN5A 2P6CA 3RDIA 4I09A 1CN1A 1OQEA 1B35C 2LUWA 1GV9A 1W8WA 5I0DA 3CU7A 4YW6A 2VZ3A 2AGSA 3CNAA 2C5DA 4X6RB 5C9AB 4IE0A 3EYPA 1S4CA 2VVDA 3HMYA 2G1MA 2D3RA 5JIAA 3A23A 4CEYC 1JH5A 2MEV2 4HLTA 2EA7A 2ZHKA 3T4HB 2TEPA 5A3LA 1QJZA 4YW3A 1PIV1 1OOPC 2ZBJA 4LBNA 4QKDA 2VMGA 3WF3A 2DCTA 2WO7A 5CA6A 2GH2A 1H8TC 1H30A 2ZX1A 3KCYA 1R092 3DXUA 2RDRA 3OPWA 5FP4A 4BQXA 3A21A 3THTA 5A7WA 3S30A 1RUI1 2X29A 2ZGRA 3GBWA 3WNKA 4Q8LA 4DOUA 2A71A 3MDPA 1LECA 1W2NA 4JRAA 1W6OB 3KF3A 4XTMA 2W1WA 2XBO2 5C4WB 4XUOA 3KD4A 1W2OA 4H14A 1GSLA 2JXAA 1GNHA 2R0HA 2YYOA 5FUNA 3F95A 1ZZ6A 3TBDA 1EV11 4RS5A 2WWUA 3ZN5A 2XWJB 4OYUA 3T1MA 2BFUS 1IOAA 1HLCA 1FNZA 3DKWA 2FDGA 2W68A 5LA1A 2WT2A 1O91A 2QQPA 4I30A 4XFGA 1IS3A 2JDUA 2BP6A 1NLRA 2XVLA 3D5OA 5GZEA 1CZTA 5KHKA 3PTYA 2C6SA 3HQRA 4EN8B 4OHXA 5ACA2 1SDWA 2CL2A 2J1VA 3WQ1A 2ZGLA 4LITA 3LQCA 2A5ZA 2Y33A 2JG8C 3HWJA 5FREA 3RQ0A 2HWB1 1WLWA 4LKDA 4BJ0A 5AFEA 4A2UA 3VBOC 2BZDA 1V0AA 4YLZA 3CO2A 1KS4A 1OBNA 3LOIA 4EZHA 4BQYA 2PYTA 1A8DA 3D6EA 3LSEA 4HFSA 3HN3A 3O1MA 4E4HA 4NRQA 2Q30A 5T3NA 2H0BA 3W5NA 1V70A 4XFCA 5A7WB 1AL0G 1H4HA 4Q0UA 3WF1A 3BTYA 1YI7A 2VZPA 4HN1A 4TSVA 3M3EA 5JR2A 2FZ2A 3VBSC 5EJZB 1JUIA 4BMBA 1GUIA 3IB3A 5EYYA 4F83A 1FXZA 4JGYC 1YFYA 4QPIA 4W6YA 4XURA 5FXWA 3AMHA 4OFGA 4KG0A 3UGHA 1U0AA 4NWVA 1ENSA 3PUQA 4OCTA 1SEFA 3V65A 2W39A 5A6YA 4FFIA 2YDEA 2HWF2 4AEKA 1PZ8A 1Q8OA 2ZGQA 1C8NA 4PDWC 4DY5A 2FDKA 2CAUA 1W2UA 4LQRA 4Z1VA 1M06G 2VQAA 1QQP2 4WBBA 4AFMA 4C91A 1BBT1 1S0BA 1HX6A 1Y3TA 2Y60A 1YQ6A 2J1SA 4DXTA 2RHPA 4CCDA 1IPKA 2RS53 4DEVA 1GWLA 4RFT0 5F39A 3VBFC 1VE0A 2UYBA 4JQTA 1K5JA 1KEXA 4UW4A 2XQRA 4XC9A 3KLSA 3OEBA 1RUE1 3T08A 4CDXB 2XJTA 1J58A 1QH6A 1V9U2 1W8UA 2VH9A 2WO2A 1RVF3 5DZEA 4J6GA 2ORXA 1AXYA 3A22A 4RL7A 2QUOA 4CCOA 5HI0A 1W0OA 4Y1ZA 3VBHA 3ON7A 5LW9A 3UGGA 1WZXA 2PHDA 4NROA 3NWKA 3TAYA 3D0JA 1C3HA 2JWPA 2PHLA 2W08A 3TYJA 1UY4A 1DDLA 3AX4A 3Q8AA 4QB2A 5ERLA 4E2QA 1Y9MA 3OG2A 2HWD2 1AR83 4NPLA 1VRBA 4UFMA 2B4KA 3AP7A 3N9MA 4GH4C 5CVRA 3SC7X 2R0FA 4CU7A 3EJKA 3V0BA 3CKHA 4N43C 4JDMA 4MG2A 1OKOA 1XYPA 2ZPXA 1S0FA 3MF6A 2RJKA 4QPIB 2BGOA 1RUD2 4H55A 3R6SA 5KHHA 1XE0A 4NHXA 1UWWA 1IKQA 4GKYA 3KWVA 5FO9B 1JOBA 2I74A 4D0QA 1TNFA 5FQ0A 2R072 2CYFA 4LBKA 2ZEYA 3GGLA 1JU3A 5CEHA 1BMV1 2XOMA 3HBZA 4XUQA 3I54A 1HN1A 3LA2A 4E4ZA 2WSVA 4MGQA 2WZR3 3WCRA 1NCRC 1DGLA 1PVC2 2WA3A 4UBGA 1H9PA 4HK9A 1QJY1 5GLTA 2P17A 4F7ZA 2D43A 1O3TA 1MS1A 5GJ6A 1HXS1 5HV0A 2XKOA 3I2JA 1T2XA 1AF9A 4GZ9A 4HVOA 3E6DA 3BU0A 2VOTA 4S2FA 5LB6A 1CAWB 2A6YA 5DAXA 3J7NA 2QKDA 4TWTA 4XDQA 1VBB1 1VJ2A 1WBLA 1YXWA 1N3OA 1U5IA 4IL7A 1XNAA 3LEKA 2VOWA 4AVAA 4CP1A 2YY1A 1GOGA 5C33A 1COV2 1HRV1 2P2KA 2BJSA 3MV01 1L7QA 1CD3G 3H3UA 5JOZA 4JKMA 3VBHB 3BOWA 2EALA 2VZOA 4FPYA 3I97A 3NKGA 3SCFA 1PK6A 1VBC2 3LE0A 3NJYA 4FT8A 4CDQA 1J1TA 1NQJA 1YIPA 5DAQA 4QKBA 2FQPA 3D4KA 3CDZB 3GXUA 4X8PA 5FLIA 4CCKA 2ZGTA 4FOVA 3V0AA 1VRH2 5CFCC 1CGPA 2GNDA 1UZ0A 2WNVC 3VZJA 2Y6LA 3V0BB 3WF4A 4S2GA 1HN0A 3APBA 3GBFA 2XJVA 3C3VA 4DNYA 1GWKA 4EWDA 4IV3C 1RUG2 4YWAA 5HCHA 4A4AA 3WG1A 1JZ2A 2GMEA 1RUNA 2GC1A 2V09A 4Y20A 1RUC1 2WKKA 4NAOA 5FQ0B 2VNVA 3RRDA 1ZZ9A 4NHLA 4AI8A 1UO9A 4L99A 2ZGKA 5EIYB 1BXHA 2VOXA 3AZYA 3W58A 4DUVA 5BNOA 1AL23 2CY6A 3BB6A 3VBOA 3VDDC 2YHJA 2OA2A 1MZEA 1RUH1 4DEQA 4HETA 1YUDA 1Q5OA 2R32A 3OY8A 4I0BA 5AC91 3AKSA 5JR7B 3ZYIB 4YW2A 5DDJ1 3M3IA 5F7UA 1VBD1 5FZCA 3R0RA 4XJWA 1REDA 1LGCA 3LB9A 2VXJA 3QCWA 4LBQB 3PU8A 3ABZA 3ZSKA 2HWC1 3TN91 2W47A 2CGOA 3MW4A 3HN1A 4XOGA 4AQTA 3ZYFA 1SLBA 1OXCA 1L7LA 4GB33 1R1A2 2JE8A 5D8AA 2GN7A 3PDQA 4BCUA 4QHOA 5HCFA 3RYRA 1FPN1 3JB4C 3FUOA 3ACGA 4CUCA 2JICA 1DYPA 1TEIA 1IKPA 1ST8A 4LT5A 1PK6B 3BODA 4CDQB 4YSFA 5ABJC 4BH9A 4WVMA 1ZBE3 3SHRA 5GZCA 3AMNA 2D6KA 3AP9A 2QBXA 2CAVA 5BNQA 4FP2A 3LEGA 3IDBB 4XBQA 3VD4A 2B9UA 1S0IA 4NVPA 3WDXA 1UOBA 2GP5A 3S7IA 2RVAA 3SCHA 1EAH1 3UKTA 2ZMLA 4AAPA 4QM8A 4DO0A 1YQ5A 1XNDA 4Y20B 2XJUA 4PJYA 5C3RA 3GBGA 3AM2A 3Q8EA 4IGPA 1OURA 1Q8QA 2WNEA 5I8TA 5BNOB 3CEWA 2UU8A 2ATFA 2DVAA 4XBNA 2E51A 4BK5A 5KC6A 1O3SA 3M8LA 4LTAA 2Y38A 1SPPA 3QD6A 5FYCA 5JIUA 1F4HA 2QQNA 3I3QA 3OY8B 4Z2AA 3OUJA 2IXKA 1KFXL 1MZ5A 1UOJA 4AHZA 4LIUA 4YNIA 1S2EA 3G7DA 3C7HA 3HNMA 3VGIA 5IK5A 3KT1A 2DFCA 4HONA 4Z07A 5F37A 1CJDA 5E6HA 5LEKA 4FPOB 4FFGA 2ZTNA 5LBBA 4XFBA 4B4PA 5DMYA 4QB6A 1POV3 2DWRA 4UW6A 2HWE3 3O1SA 1AYM2 5FZHA 4CA9A 4QGMA 4GWNA 5D8AB 1I5ZA 4FOWA 3EB7A 3UV9A 1H8VA 3I3DA 3PVEA 3ZN6A 5GLUA 4YZ1A 5FMBA 5JDBA 2AC1A 3MPBA 5FCCA 4P9GA 2BU9A 2E33A 1O3QA 1Z7S3 4OVEA 1JTZX 3AVRA 4IEXA 3KB5A 4I2OA 3BGAA 5LEJA 5DUXA 5I8SA 4XBLA 3WSOA 3AKPA 2DVDA 2BNOA 2B42B 1UU6A 1W06A 1JYIA 1R081 4Z82A 1MPXA 3MUZ1 1AYN2 4WM8C 4XILA 1AVBA 4IGQA 5FFOC 4XCAA 1CAVA 1DYKA 4QX3A 3KQ4B 3RS6A 5L9BA 3I3MA 4UXAA 1RUI3 1ULGA 3H3ZA 4XYXA 3ELNA 3UKVA 4I3GA 1VIWB 1O5LA 1NLSA 3LKJA 4CP0A 3W59A 2P3KA 3POJA 1W6NA 1CAUA 3H0OA 3POYA 5BV6A 1W9WA 2FDHA 2VPVA 4HMZA 3WQ7A 1JYXA 3AL6A 1SPPB 2NP0A 3BOPA 2BOIA 2BOJA 4OMCA 3ILNA 2OKXA 4AXOA 1QXPA 4DXRA 2AACA 4TYSA 4EZ4A 1EV13 1IS6A 3KHBA 3PLQA 4A7KA 5IFTA 1KJRA 4PT6A 3IZOA 3UETA 4DXZA 1HQLA 2PLV1 2WQ8A 5EWSA 2GMPA 4OZOA 1UIJA 3GDBA 1LOFC 1XRUA 2JJ6A 2YBPA 2ZX2A 4AR2A 3UYJA 4ES9A 4EE2A 2WNVA 4NHKA 3FX3A 1OA4A 5F2WA 4BB3A 5LBFA 3NJZA 4XAEA 1PO23 1PZ9A 3HNBM 1S55A 5DUUA 4YZ3A 5LK5A 3ZFEB 2RS12 4HPKB 4PIYA 4YG0A 4ATEA 5F5QA 3GALA 2Q1FA 3AK0A 5FTTC 3H8OA 1MR5A 1WW6A 2HWB3 3AYEA 5DN2A 3K3NA 4BLJA 1EUTA 3LIGA 4YM3A 3PUIA 2HEYF 1XE7A 3EO6A 4YGEA 3ZYPA 1N1VA 2EAAA 4EV0A 3ZXKA 3VDDA 3BI3A 2PQQA 1AR93 5EPAA 2DBIA 4Y33A 1TE1B 5CIRA 1N1YA 1O4ZA 2EXKA 2WS91 2BVVA 3BYWA 4I3PA 3GCWA 3N9QA 5J98B 3PHMA 1OF4A 5A32A 1NZCA 4DUWA 5CADA 1ZBA1 1TMF2 2GC0A 1ALYA 2AZ5A 5BXXA 2VZQA 1CAUB 3N9PA 1QWRA 2Q8EA 3JBG2 1MQTC 2XQXA 3HNYM 4QMAA 3CLPA 1R1ZA 2R30A 4XAAA 4HVQA 4HKWA 3LSDA 1WA6X 4WM7B 4DIQA 2GP3A 3ZDSA 1W6QA 4FFFA 3T2TA 4M0HA 4AFDA 4RR3C 2WZ8A 3HVDA 3VZLA 5FMDA 5AVPA 3MIGA 1A6CA 1BBT3 2DCYA 4L9BA 2ZS6B 5T5JA 4BIOA 1UXZA 2F4PA 2JDAA 1UKRA 4FPJA 5FY8A 1UZWA 2Y0OA 5GZFA 3J9SA 1VBE2 5A6QA 3J8F2 1ND3A 4L2NA 4N8MA 1RUE3 1SCSA 2PMWB 2CNAA 3NNMA 2C4XA 4QDRA 1QOTA 2UWCA 5FZOB 3GZUC 5HCAA 4FXKB 3USSA 1GQHA 5FZDA 1AXKA 3POWA 3WF0A 3I2HA 3JD72 4QGLA 1OLMA 5LBEA 3OUHA 4YZ2A 2W1UA 2VGDA 5KBFA 4YGDA 4GALA 3UGFA 5FY7A 5DAWA 4NMIA 3VBRA 4MHRA 3VDAA 2ZZQA 5K0UA 2JDNA 1AR61 5EXOA 3WW2A 4ONUA 1PX4A 1CX4A 1CONA 3D3AA 2Q1MA 5A32B 1RUJ1 4Q26A 3L2HA 3PU3A 1QMJA 1WD3A 4C0BA 1K12A 2JB8A 2O14A 3VZKA 4LHLA 2B9VA 4XZPA 1SLTA 4XDOA 4XF9A 3MIHA 4U2AA 3RNSA 2XKPA 4LA2A 5D21A 1LB2A 3DKQA 3B02A 4KBZA 5EV7A 4LKEA 1O4TA 1LHUA 2VZVA 5JAXA 1LR5A 1W6QB 5C8CA 3E1F1 5I0RA 5A70A 1TVGA 1O8SA 5KHIA 3HT1A 2ZEZA 1PO11 1WLTA 2GNMA 5FJHA 3UNPA 1KGYA 3G6JB 5DZGA 2WT1A 4Y22A 2VBPA 1UU5A 2DF7A 1HXS3 2YUEA 4UF0A 1ZA4A 2CGNA 2DFBA 5IT6A 5J96B 2A6ZA 2ZABA 4C1XA 2A3XA 3ZN6B 2VMEA 3M7AA 3K2OA 1ND3B 3ATGA 4X6QB 3WDVA 1VBB3 2RM21 2GH8A 3LDRA 3NNLA 4FCAA 3U11A 1GZTA 4PBPA 4ZKTB 2WC2A 1UOGA 3OGRA 4NHMA 3RI8A 4MXWA 3VKFC 1GBGA 1HRV3 2VXRA 3NAPA 3OBAA 4LOTA 3GHMA 4YVWC 1ZRRA 4RHV2 1RYYA 1YNAA 2D40A 3OGJA 4QXHA 3T4VA 3POSA 1V6IA 1PGW2 4Y4YA 1NE4A 3VBRB 5JUVA 4E27A 3NV2A 1EY2A 5K0UB 2RR12 2E9QA 4CVUA 1I9RA 1LRHA 4G4FA 4NRPA 4QPGA 4M4RA 4QM9A 4A44A 2HWF3 2ZACA 3ILFA 4XIOA 4PF5A 4Y1XA 5CG9A 5SV5A 2ADDA 3KV5A 4IEWA 5FZEA 4CEWA 1QEXA 1F5JA 3WDTA 4OQ8A 4EROA 1EYBA 3MPPG 4MZUA 2VUCA 4HN0A 2RDQA 4Y26A 4JX0A 4BMEA 1HW5A 3AKTA 1SDDB 3KV9A 2XB6C 3VD5A 2H6CA 5C8CB 2WFF2 5C6CA 5BNNC 3I7DA 4HKLA 3H8RA 2W5FA 1SHWB 2VMFA 1UX6A 4Y22B 2FMYA 1RUH3 2CTVA 5AC93 4Q4Y1 3RMYA 1LOEA 2R1DA 4UF0B 4Z2WA 1CX1A 2OPWA 2Z4FA 1BYHA 2YGLA 1VBD3 2R6QA 3I2IA 3VLBB 4BU2A 3OYWA 3VN4A 4W6WA 3PL0A 1Q56A 3NSTA 2JG9A 4FOQA 1JYVA 1HIXA 4LK7A 4N53A 1LOCA 3LCPA 1NCQC 2HWC3 3AZXA 3TN93 3ES4A 4BQWA 4XFAA 1RHI1 2X5IA 4CP9A 1WCKA 4W65A 2I07B 4MXWB 5FYHA 1DFQA 3O1OA 4HSJA 1XYNA 1YQ2A 3NAPB 4RA0A 4AVVA 3O1TA 1BEV1 1KD7A 1WUVA 2Y34A 1V6OA 4IEQA 1LTEA 4KNCA 1CIYA 4RQPC 3LPGA 1J3RA 1GQPA 2G19A 3LD8A 1JUHA 2K46A 1RGSA 3KQRA 4EWAA 4IV1B 3FHAA 4LPLA 5JOWA 1WLCA 4K7JA 5FR3A 2OZ6A 4QPGB 4FQZA 1W9TA 3N7JA 4IETA 4CDUB 4LO6B 4WVZA 3ZSMA 3O12A 3LFIA 2WNUC 1PVXA 2BGCA 4NO4A 2IFWA 4YPJA 4EJRA 1LAJA 2WO1A 1U12A 2WQ4A 2F4LA 3HQXA 1A3KA 3LEMA 4CEWB 4FPFA 4LE4A 3THCA 4UBHA 2ORZA 4BHPA 1EAH3 5KXDA 3PJYA 1PGL2 2GU9A 2HWE1 4XTPA 3C7EA 2DCZA 3MBWA 5FY5A 5GZDA 1A78A 5J36A 1NAEA 1BJQA 1AX0A 2YB7A 3VBUA 5FYIA 1RITA 3BPSA 1MEC1 1WKYA 1Z7S1 4J1XA 2R7EB 2OUHA 4IE5A 4LJHA 3J7MA 2ET1A 1H6YA 1JOJA 3DV8A 4PHZA 3OYWB 2CV6A 3QACA 5EJ1B 1XJAA 4K1YA 4AEMA 5BNPC 5FP3A 2J1UA 5CKMA 3O0XA 2JG9B 4EQVA 1S2KA 1RIRA 1QOSA 2JENA 4N53B 1IZ3A 3WT3A 4OI2A 4GQ7A 1IQDC 2X5IB 4CP9B 2ILMA 5FPUA 1MACA 3J7LA 2WRAA 4META 1NY72 2Y6JA 2NN8A 2ZX3A 1UY1A 1Y7BA 3OD4A 1VMFA 4N90A 5F5AA 4QU2A 2Q8CA 1OUSA 4CCMA 2E63A 1HDKA 4UOJA 1TNRA 5IJRA 3WQ0A 3ZFFA 3THDA 4JCKA 4M01A 5A3TA 5JXJA 3LDKA 2AEYA 5FXVA 2RDNA 5IVYA 2FDFA 3OUIA 3PIJA 2VZTA 1W2AX 4EN9B 5FK7A 2QQKA 1RUF1 1R083 4QWNA 4YYOA 1GU3A 2WNOA 2XUEA 2P3JA 5A1LA 4OMDA 4KWLA 2VOKA 3PMEA 3CF6E 2Y6GA 1ND2A 3OF1A 4Q4W2 5A7NA 5B4XA 1UL9A 2YPDA 5C3PA 1J83A 4SBVA 2QQMA 5T55A 3KCXA 1OQDA 1A34A 1QY4A 4IDZA 3WW4A 4QPYA 1BK0A 1L3JA 5HXMA 2ADEA 3AMPA 2Y26A 5A7PA 1OHFA 1PO21 4FPLA 3B00A 3WNLA 1FOD2 1HRI1 1HJGA 2Z69A 3VBUB 3I2OA 2A75A 2E7TA 1WLDA 3WP3A 1QF3A 5FYZA 4G3YC 4LULA 5IK7A 2PTMA 3PJQA 4YVWA 2R042 1C1LA 3S0MA 4OHYA 2ZKNA 2JKBA 4J25A 3CHXA 1G7YA 4JQRA 1XB9A 3POGA 1M4WA 3SH5A 2B8MA 3O0WA 2VMDA 3ZXLA 2C0ZA 5F32A 1U5ZA 2XL7A 5A7QA 1AR91 1W8ZA 2ZGMA 3BIWE 2EAKA 3R4SA 4NHYA 2E26A 2PLV3 2YZ4A 4FO9A 4COYA 1N1SA 1TME2 1VBA1 1XXNA 2R062 3POEA 5FWJA 3WXPA 1J59A 2IUWA 2ZMNA 1OI6A 2JIJA 2R1BA 4W50A 1LKNA 1ULCA 1S0CA 1W8OA 2ARAA 4MGIE 3E97A 4JDNA 1NLQA 5LRSA 3O1PA 4Y5SA 2RMU1 2XXZA 5FPZA 4QPWA 3I2DA 2WL1A 2Z79A 4FQ4A 3JQXA 1QJX2 2W2IA 3DXTA 3AC0A 2B5HA 5IVVA 1BVP1 3TEWA 3AXEA 2JE7A 4RS5B 1BVVA 4QXKA 2PHFA 1G9DA 5H9PA 2FMDA 3ZYRA 1X36A 1ND2B 4Q4X2 2VUJA 1FX5A 3DPRA 2WS93 1XSRA 4K40A 4MX3A 4TLGA 2VO5A 4QHBA 1PM7A 1LGBA 5HPOA 4ZY9A 5FPVA 3ST7A 4WV8A 3BKZA 1UZYA 1ZBA3 1BKZA 2O8QA 4ORFA 1RMU2 1C8M2 2DVBA 2MEV1 5FY9A 4D6SA 1QJU2 2D97A 4IXLA 5CFDC 1H1IA 4ARYA 3U0ZA 2WINB 1W99A 2VNRA 2VM9A 3N35A 3QH7A 5FZ3A 5GZGA 2RS32 2OZJA 4AOCA 2BV4A 3ACLA 5E88A 1R091 3OTFA 1QKQA 2WAAA 4GD4A 2VOVA 4IQPA 1KJLA 2D98A 3ZFGA 5IFPA 5HV4A 3KV4A 1HKDA 1O3RA 3NV1A 2JIGA 4RQPA 5AVAA 2W1QA 5FYYA 3U10A 4D7TA 2VD7A 2Y6FA 4N7IA 4NAMA 2XBO1 4ES8A 4XFIA 2V5DA 3GYDA 2DU1A 4GA9A 1STMA 1UYPA 2P1BA 3Q9OA 1DQ0A 2WNUA 2K9ZA 1C57A 3IBMA 1W04A 3QLQA 4AWDA 2LW8A 1ODNA 2E32A 3WG2A 3ZSJA 1JHNA 1GOFA 5F3IA 3VD3A 2DBNA 2IWGB 2WYSA 1JN2P 1Y43B 3LFMA 4KWUA 3SNMA 2PQSA 2GC2A 4P9IA
chains in the Genus database with same CATH topology
2VUDA 5A6ZA 2JDYA 1W8HA 4AOCA 5A6YA 2BV4A 2JDPA 2JDKA 5HCHA 2JDHA 1GZTA 5A6XA 1W8FA 3ZDVA 2VUCA 5D2AA 1OXCA 2JDMA 1OUXA 1OVPA 2BOIA 5A70A 2VNVA 2WRAA 2JDUA 2BP6A 4UT5A 1OURA 2JDNA 1OUSA 1OVSA 2CHHA 2WR9A 1UQXA 1UZVA 3DCQA 5A3OA 4CE8A 2XR4A 5A6QA 2BOJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VUD A;  5A6Z A;  2JDY A;  1W8H A;  4AOC A;  5A6Y A;  2BV4 A;  2JDP A;  2JDK A;  5HCH A;  2JDH A;  1GZT A;  5A6X A;  1W8F A;  3ZDV A;  2VUC A;  5D2A A;  1OXC A;  2JDM A;  1OUX A;  1OVP A;  2BOI A;  5A70 A;  2VNV A;  2WRA A;  2JDU A;  2BP6 A;  4UT5 A;  1OUR A;  2JDN A;  1OUS A;  1OVS A;  2CHH A;  2WR9 A;  1UQX A;  1UZV A;  3DCQ A;  5A3O A;  4CE8 A;  2XR4 A;  5A6Q A;  2BOJ A; 
#chains in the Genus database with same CATH topology
 1DQ6 A;  2V4A A;  5A1A A;  2VMI A;  2ZGN A;  2WLP A;  2YBK A;  4Y1Y A;  1HV1 A;  4KWK A;  4H7M A;  4P14 A;  1ZZ7 A;  4GXL A;  5LA9 A;  3WP5 A;  1SLC A;  1DQ2 A;  1W8F A;  4AI9 A;  1B35 A;  2P6H A;  2WFP A;  4MUV A;  5FZM A;  4LUK A;  4Y1U A;  4EWE A;  4XMI A;  3MGU A;  5ACA 1;  3EBR A;  4OHW A;  4UWD A;  2QQU A;  3O5S A;  3DPR B;  3PVN A;  3OD0 A;  4CEY A;  1E57 A;  5F3G A;  1J84 A;  1AR6 3;  4GUL A;  2VCM A;  1YLL A;  5BUV A;  2ZMK A;  1N3P A;  5BNP A;  1FMD 2;  1RUJ 3;  4A3X A;  1US3 A;  3RI9 A;  1OOP A;  1XPW A;  4A6S A;  3WD5 A;  1ASJ 2;  1H8T A;  4AHW A;  1K5M C;  4BLI A;  4UYB A;  4AEJ A;  1XU1 A;  2ZJC A;  1D4M 2;  3AJZ A;  3S5A A;  2FDJ A;  1YRZ A;  3ZFG B;  4TTG A;  3H8X A;  2Z2S B;  3S57 A;  2BUK A;  3WW1 A;  1LGN A;  1KFU L;  1OH3 A;  3ZXF A;  1FNY A;  4E2G A;  1KDM A;  1PO1 3;  5TSW A;  4P5H A;  4BQ1 A;  3RZM A;  3EHK A;  1AR7 2;  3A0N A;  1PMI A;  3J7H A;  4Q0V A;  2Q8D A;  1ULD A;  1VAV A;  1AJK A;  2FD8 A;  3L9J T;  3VHP A;  3N4M A;  1NZI A;  2FZ1 A;  3SH3 A;  2VVF A;  2HWF 1;  1D0G A;  2GZW A;  4XF1 A;  5FJK A;  2X09 A;  3SKJ E;  4B3N A;  3ZSL A;  4YFZ A;  1DGW X;  1QQP 1;  2RM2 3;  3LWC A;  3GZT B;  5EFU A;  1T6G C;  3VHR A;  5T52 A;  1ZRD A;  4P9Y A;  1W05 A;  2UWB A;  4YVS C;  5FKB A;  3ZR6 A;  1B35 B;  5LK7 B;  2YG0 A;  1VP6 A;  1W03 A;  2PFW A;  4Q0Q A;  4LHS A;  1GMM A;  4PIX A;  4QQ2 A;  2JG8 A;  4AI1 A;  3AKQ A;  1G6N A;  1BCX A;  4IEO A;  4XDP A;  4YW4 A;  3GF6 A;  3JBG 3;  1OD5 A;  4DRR A;  4WZF A;  5FZI A;  3ZMN A;  3HBK A;  3B93 A;  4K1Z A;  2VCC A;  4QU1 A;  1RTV A;  4MGZ E;  1UN1 A;  2A7A A;  4AGV A;  3C7O A;  1OOP B;  2D6N A;  1V9U 1;  4RD7 A;  4QQH A;  4YG6 A;  4LLO A;  4UFK A;  1H8T B;  5CU1 A;  3RGB A;  3T0D A;  3I4I A;  3ZYG A;  1GOH A;  5JVV A;  3WLU A;  2XLA A;  3VBS A;  2VC9 A;  3K4A A;  3ECQ A;  3ZXE A;  3H1Y A;  4IE6 A;  1GIC A;  3H7Y A;  4JGY A;  4FOY A;  1W39 A;  4HBN A;  1JOP A;  2VZR A;  4FPG A;  2HWD 1;  1G86 A;  5EJ3 A;  2EVX A;  3AP4 A;  4LE3 A;  3OPT A;  4HT1 T;  1O5U A;  5A7O A;  3UJO A;  3ZXG A;  1J1L A;  5FBJ A;  2K2S A;  4IEZ A;  2W91 A;  4LA3 A;  4FPC A;  4QQO A;  4MXV A;  1LJ7 A;  4W4Z A;  1JXN A;  5A3P A;  3VZO A;  5F3C A;  4Q4Y 3;  1RUD 1;  4PDW A;  1XNK A;  1W90 A;  4KGG A;  2ZA9 A;  3ZPO A;  2ZHN A;  4JHZ A;  3V0A B;  2VMC A;  4AVT A;  4CUG A;  3GNE A;  1US2 A;  2DDU A;  2JDP A;  3MHZ A;  2R07 1;  3NL1 A;  1I6X A;  1IS4 A;  3PUH A;  1RHI 3;  2WYF A;  4RYD A;  3JU9 A;  4EN7 B;  4Q1R A;  3HQU A;  3VBF A;  2XHK A;  1PVC 1;  5FYU A;  4XEZ A;  4XHB A;  2XPJ A;  5KHJ A;  1BEV 3;  3HOB A;  3OBZ A;  2ARE A;  4IW3 A;  4RGK A;  3BUC A;  3TEZ A;  3RZZ A;  3TRS B;  1G8W A;  1G9A A;  2WR9 A;  3ZM8 A;  2W95 A;  3TEY A;  2ID4 A;  2X10 A;  3VBO B;  1I1E A;  4DB5 A;  2LRP A;  4JHT A;  2RJL A;  3KT7 A;  4FVV A;  4FAG A;  1VB2 A;  5A33 A;  3TNP B;  4FBF A;  4KGQ A;  1U5Y A;  5CIS A;  2QQJ A;  3W20 A;  1OFN A;  2CDP A;  2VCB A;  4UFL A;  1COV 1;  4YGC A;  4FI9 A;  4QQP A;  4U36 A;  4DPN A;  1RJ7 A;  5JSO A;  5FIX A;  5C3S A;  3NMB A;  5FY0 A;  1SBE A;  4B8E A;  2XJP A;  5FP7 A;  3B9C A;  2R49 A;  4Q29 A;  1NA1 C;  3VBS B;  2XUM A;  4GH4 A;  1LED A;  1NXM A;  1VBC 1;  5FY4 A;  5FYT A;  1ZRF A;  2EXJ A;  3WQB A;  5JZG C;  1CJP A;  4JGY B;  4N43 A;  5L7O C;  1WW5 A;  3AYA A;  3PVB B;  3LA3 A;  1V6M A;  1S0E A;  2VR4 A;  3KZ4 C;  4C8D A;  2VL4 A;  1VRH 1;  1QJE A;  4MHU A;  4P9X A;  4XCB A;  4Z8B A;  2RS5 2;  3OSD A;  1MEC 3;  2ZGP A;  2ZOE B;  4CU9 A;  4COZ A;  1GAN A;  4PDW B;  1JYW A;  4WVM B;  1RUG 1;  4GKX A;  3WVJ A;  4C0H A;  2IC1 A;  3PVO A;  4I01 A;  2IVI B;  4M00 A;  2VNG A;  1WD4 A;  3MO4 A;  1ZZ8 A;  4KU8 A;  5FP8 A;  1RC6 A;  5I0U A;  1NCR A;  1RVF 2;  1XBF A;  2A6X A;  4MLO A;  4NII A;  4Q0S A;  1VLN A;  5IW0 A;  4CXW A;  1G9F A;  1ZYB A;  4WZC A;  1WGP A;  5EQU A;  4AVB A;  3VBF B;  5DG1 A;  2RR1 3;  2LTN A;  1D2S A;  2FBE A;  3A4U A;  4TXW A;  1K5M A;  5FZ4 A;  1FI2 A;  4XJ9 A;  2D6P A;  2D6L X;  4XIK A;  3SXW A;  3C2U A;  4K6B A;  1H1A A;  1U5X A;  4NOT A;  4XJU A;  2NPI A;  3SQO A;  4QGN A;  4HG6 B;  2MNG A;  4IE4 A;  1AR8 2;  3RSJ A;  4LUM A;  1MS3 A;  4LR4 A;  2NLR A;  1XNB A;  3PUS A;  1EUU A;  1S2B A;  4CCE A;  1GNY A;  5FZ7 A;  3SIT A;  4AED C;  5JXI A;  2QQW A;  2PHR A;  3W9A A;  1RUF 3;  1R1A 1;  1Z0H A;  3EQE A;  1YI9 A;  4MGT A;  3CMG A;  1C5H A;  2UY8 A;  2VU9 A;  4MAD A;  4BM8 A;  4ZZ5 A;  4JGZ C;  3AL5 A;  4DQA A;  4FP3 A;  3RMX A;  1DU3 D;  2D3P A;  2QJV A;  2ZGS A;  4GWI A;  3ZXJ A;  4DY3 A;  4NIG A;  4ZPI A;  2HBU A;  5E89 A;  3CJI C;  4LMF A;  4NWW A;  1EPZ A;  3FMG A;  4H2A A;  3FC0 A;  1IPS A;  4GH4 B;  5CFC A;  2F6B A;  2NQY A;  5GM0 A;  4YM0 A;  1HB3 A;  4KWJ A;  1SZB A;  2D7F A;  2WQZ C;  3I3E A;  5E1R A;  2WZR 2;  4CZS A;  2J1R A;  5C5U A;  1NX9 A;  3ALQ A;  4IV3 A;  3RJ2 X;  4AVC A;  1HRI 3;  2RG4 A;  2ZGO A;  5F3E A;  4YVS A;  2EIB A;  4PBO A;  1NT0 A;  2DUP A;  1CAX A;  3T0A A;  4XUN A;  4CP2 A;  4AI0 A;  1ENX A;  2ZAH A;  1D4V B;  3M2M A;  4AAX A;  4Q27 A;  2OYZ A;  3ZDV A;  3BAL A;  2ZHM A;  4CDW C;  1V6N A;  2MPF A;  1NCR B;  2W94 A;  1BZW A;  4PIZ A;  1CAV B;  4V2V A;  2ZEW A;  2J1E A;  4OI0 A;  3OCP A;  1VBA 3;  3LAG A;  3WG4 A;  5CKQ A;  1UZZ A;  2EXI A;  3WV6 A;  5AFB A;  3JB8 A;  2D6O X;  2IXH A;  4PQ9 A;  3OPZ A;  1W6N B;  2WO3 A;  2RMU 3;  2VBD A;  4GJY A;  5FP9 A;  2CGP A;  2P3I A;  3IMM A;  2YXS A;  4B4R A;  5C9A C;  4LOR A;  2G9F A;  5T54 A;  5F9T A;  4RFR B;  3KVB A;  3D82 A;  4F3J A;  5JSP A;  5FY1 A;  1JZ8 A;  1W28 A;  2W9X A;  3TOJ A;  4LOS A;  1QU0 A;  2ARC A;  4B7K A;  5I8Y A;  1AUY A;  1AYM 1;  1VAK A;  3HPN A;  2QNK A;  1DHK B;  2AEZ A;  4QQL A;  5KR7 A;  2GMM A;  3W21 A;  2O1Q A;  4AQ2 A;  4SLI A;  4B4Q A;  5ABJ A;  4IEV A;  3DUI A;  4XVH A;  3SH4 A;  2VQT A;  4TZD A;  1O8P A;  1W0N A;  3IMN A;  5IVF A;  5CFC B;  2XLF A;  3ZPY A;  5LY1 A;  1AL2 2;  1ZVF A;  2WNV B;  3BU7 A;  1WW4 A;  3OGG A;  4ZXE A;  3ZIW A;  2MEV 3;  1UD1 A;  5C4W C;  4IV3 B;  4KI5 M;  4K8R B;  4BZ4 A;  1O59 A;  1AYN 1;  4CCN A;  1SBF A;  1EP0 A;  5C70 A;  4Y3O A;  4YFW A;  1MVQ A;  2WSU A;  3WG3 A;  2OS2 A;  1R09 3;  1JZ3 A;  3T0B A;  2Y6H A;  1GP5 A;  5KC5 A;  2V4V A;  3E5Q A;  2BVB A;  3TEX A;  3T09 A;  3VL8 A;  4BQ2 A;  4R4X A;  4K9S A;  2P37 A;  4LBO A;  4LBL A;  2QQO A;  3RZH A;  1S1A A;  3DEC A;  3FLT A;  4GB3 2;  3VDD B;  3O1U A;  4A3Z A;  1K45 A;  2VW1 A;  1WCU A;  2Z42 A;  4Y24 A;  2XBO 3;  1UMH A;  2BNN A;  2BYV E;  2OPK A;  2XJS A;  3ZOI A;  1KRI A;  4HVR A;  2H6B A;  2CU5 A;  2JD4 A;  1D7P M;  2ZHL A;  4GAZ A;  2W46 A;  4DS0 A;  2DCK A;  1F5F A;  3N7K A;  3WEZ A;  3NW4 A;  5JPM B;  1WA4 A;  1I3H A;  5I0S A;  4Y5T A;  2VUD A;  1UNB A;  1ZBE 2;  1NA1 A;  1RXG A;  2OQ6 A;  1APN A;  3DF0 A;  2D44 A;  5FAX A;  1ZRI A;  2PXJ A;  1Q8V A;  4P9L A;  2OXB A;  4XZU G;  5F6L B;  2I2S A;  5C3O A;  1AJO A;  4D94 A;  2PAK A;  1CPN A;  2RJ2 A;  4FFH A;  1CIW A;  1KQR A;  4Q4V 2;  4P9W A;  4NIA A;  4MH0 E;  3NNJ A;  5DAP A;  4CTE A;  4CCL A;  5ACA 3;  2HEV F;  1MZF A;  1FOD 3;  2RS1 1;  3JQW A;  5JMC A;  1YFW A;  4WM8 A;  4QX2 A;  3DYP A;  2XG3 A;  1VR3 A;  3IIA A;  2YC0 A;  1PMH X;  4XXA A;  4CXY A;  1PX3 A;  4BK4 A;  1HQN A;  1VAM A;  1YIF A;  1WMX A;  1NG0 A;  3OB8 A;  1W9Y A;  3WY6 A;  3BN6 A;  3H42 B;  2XGX A;  4BDV B;  4L8Q A;  3AP6 A;  1LEM A;  2GN3 A;  5JSR A;  4DUX A;  3ITQ A;  1B09 A;  3LF7 A;  4XF3 A;  3BTZ A;  4QKN A;  3AYD A;  3RG0 A;  1SAC A;  3SIS A;  3T2Q A;  2WZP P;  3VKN A;  3U75 A;  3KSC A;  4AZZ A;  4AQS A;  1TMF 1;  1XOY A;  2UYA A;  2Y8K A;  3ZKY A;  2DU0 A;  4AGG A;  1GFF 2;  1PGS A;  4M3C A;  4AGR A;  1ZZC A;  4FTS A;  4AED A;  5KXB A;  1KIT A;  2VZ1 A;  3J4U H;  2B39 A;  1UQX A;  3JBG 1;  3O14 A;  3N7L A;  1RIN A;  4IND A;  2NZ9 A;  3FUQ A;  3NNF A;  3NVC A;  3ROU A;  4XQ4 A;  1HV0 A;  2BW8 A;  2IXL A;  4UW3 A;  2JE9 A;  3AP5 A;  1PMJ X;  4XE9 A;  2XWB B;  3BPZ A;  3DL3 A;  3ES1 A;  1DZR A;  4PLO A;  4ITC A;  5JXH A;  1LOF A;  1LUL A;  5L19 A;  3VD7 A;  1QQP 3;  1T6B X;  4CDX C;  3HAG A;  5D2A A;  5FYV A;  3BTA A;  1PIV 2;  2KA3 A;  2WN3 A;  4P08 A;  3AZZ A;  1G9C A;  4FTE A;  3WUD A;  1UW8 A;  3WF2 A;  2VG9 A;  1LHO A;  4DFS A;  3MIB A;  3ZXD A;  3M3Q A;  1RMU 3;  1RUI 2;  3LZZ A;  1C8M 3;  4XJZ A;  3VB9 A;  4URA A;  1VBE 1;  1FAT A;  4L11 A;  2YC4 A;  3GJB A;  1UYY A;  3U78 A;  3J8F 1;  3IDA A;  3MW3 A;  4W6X A;  3ZVX A;  2RS3 3;  3KHC A;  3H8U A;  1UY2 A;  1X8E A;  4WM8 B;  2BNM A;  2BRT A;  2OX0 A;  1V9U 3;  1KDK A;  4PLM A;  2A1X A;  3JD7 1;  2BBV A;  1DQ4 A;  3WX5 A;  5FRA A;  2PA7 A;  4XW3 A;  3VKL A;  4D6Q A;  3FHQ A;  5ANN A;  4QPI C;  4CCJ A;  1EV1 2;  1QDO A;  3HIF A;  2R16 A;  3KV6 A;  2V5Y A;  3O7O A;  1MVE A;  4QHZ A;  4CXX A;  5JOY A;  1UPI A;  1UXX X;  3D8C A;  4ASL A;  4YM1 A;  2RDS A;  2WAB A;  4GWM A;  2VUL A;  5L36 A;  1QH7 A;  4RGG A;  2HWD 3;  3RFR A;  1MQT A;  2KXL A;  4IES A;  4UFJ A;  3U4S A;  5KXE A;  1JYC A;  1O7F A;  4W8J A;  5FPL A;  3SEE A;  3GM8 A;  1DGR N;  4JC1 A;  4M3C B;  5IWF A;  1F8V A;  2UY9 A;  2B7Y A;  5T5O A;  5CZK A;  4JZR A;  3VKO A;  4HZF A;  4GJZ A;  2JD9 A;  1RUD 3;  5L9V A;  5FV3 A;  1LEN A;  2C24 A;  4RR3 A;  5CB7 A;  3WNX A;  2YU1 A;  1NE6 A;  4LHN A;  3EXU A;  3ZLI A;  3H9A A;  4NRM A;  1N47 A;  1LHW A;  3WOG A;  2HWB 2;  4B1M A;  2R07 3;  5DXD A;  1OMI A;  1UPS A;  3N9L A;  4BQ3 A;  3M3C A;  3CJX A;  4BXS V;  2JDM A;  2HEW F;  2DVG A;  4BWO A;  5C3Q A;  4BA6 A;  1IQA A;  1JOD A;  2DV9 A;  1PVC 3;  3B5L B;  1UIK A;  4XAB A;  1CZV A;  5C4W A;  4IGO A;  4WVV A;  3AXD A;  2EIG A;  4LIV A;  3PMS A;  4WVW A;  4K8F A;  4DMI A;  3VBH C;  5A3U A;  2AYH A;  2WN2 A;  3HEI A;  4OI1 A;  5FBZ A;  2AH2 A;  3AVS A;  2ES3 A;  1F31 A;  5H9R A;  4IEU A;  4QX1 A;  1VMJ A;  5JPN B;  3FJS A;  2FCV A;  4N9I A;  1NKG A;  3BTX A;  3C7F A;  1GNZ A;  1SG3 A;  1COV 3;  4LKF A;  4QXC A;  5A3W A;  3ZYH A;  4A7Z A;  4JTN A;  4XPV A;  1QNW A;  4RHV 1;  3RZJ A;  2OQ7 A;  1ZNP A;  4PI0 A;  4XHX A;  4E4S A;  5A3M A;  1PGW 1;  2ZZJ A;  4DXS A;  5A7S A;  1AR7 3;  2PHX A;  1VBC 3;  2RR1 1;  5IUQ A;  4NE9 A;  2SBA A;  3AZV A;  3JXS A;  1IGO A;  5FMO L;  1BBT 2;  3GHN A;  2D5H A;  3L2Y A;  3WHT A;  1MQT B;  3K4Z A;  4JVA A;  1VRH 3;  3SCG A;  1XE8 A;  4Q2F A;  3WDW A;  2QE3 A;  1V00 A;  2LM3 A;  5A80 A;  3SMH A;  3P3P A;  1WW7 A;  2BDR A;  2W1S A;  1X50 A;  1RUG 3;  2J22 A;  1LU1 A;  4RR3 B;  3TWI A;  1ZA7 A;  2OVU A;  1RUE 2;  2JDK A;  2BBA A;  2OUJ A;  1QGL A;  2VTX J;  2B45 X;  1FT9 A;  3ZYB A;  2V73 A;  3ZYJ B;  2WFF 1;  2VE1 A;  4K20 A;  4XF0 A;  5DUV A;  3MV1 1;  2O8O A;  1W3V A;  4MVT A;  3POB A;  4CRQ A;  4G9S B;  3FLR A;  2VZS A;  1JYN A;  1QDC A;  5F1R A;  2NM1 A;  5GKA C;  4UFI A;  3POF A;  2YFZ A;  4D6R A;  2E53 A;  4I0A A;  2QCS B;  5B2G B;  3VUO A;  3V64 A;  3S6P A;  1AX2 A;  4JTO A;  4B1L A;  2ZKL A;  2HBT A;  3PUA A;  5IVJ A;  3FE5 A;  3Q8B A;  1PK6 C;  1IG0 A;  5DQ0 A;  4URT A;  3VZM A;  4CDQ C;  3I2K A;  1AZD A;  1GYK A;  3OBT A;  4QXB A;  5FO7 B;  2EF6 A;  4KH9 A;  3RYK A;  1R1A 3;  2BPA 2;  1TG7 A;  1QJF A;  2O0O A;  4FPE A;  4FXG B;  4IEP A;  4LHK A;  3FN9 A;  3NO8 A;  1XQN A;  4CYD A;  1TQ5 A;  1RB8 G;  2MHF A;  3P1I A;  2K0G A;  2EIC A;  3JUU A;  3WHU A;  3WR0 A;  3SKV A;  4QDQ A;  4HAN A;  2YMZ A;  1BMV 2;  4ZS3 A;  3URF A;  1YJK A;  5EP9 A;  4CSW A;  3N7M A;  4MGK E;  5FZK A;  1LES A;  3VDB A;  1DYO A;  2YFU A;  2GSY A;  1YFU A;  1QJY 2;  4CDX A;  3ZFF B;  2C26 A;  5BNO C;  2XON A;  3MIF A;  3NJV A;  1HXS 2;  1O6U A;  5J3U A;  3U14 A;  3FFZ A;  2VQ0 A;  4GMP 0;  3FLP A;  3ZMO A;  2A6V A;  4D7Y A;  1QNY A;  5K7P A;  5BNN A;  4BOW A;  5IVB A;  3MFC A;  1PGL 1;  1VBB 2;  4QX7 A;  4GMP 1;  1JMU B;  3ETQ A;  1W2T A;  4NJ4 A;  4KMQ A;  1HQW A;  3C8X A;  1ZRE A;  1HRV 2;  4M4P A;  4ET7 A;  3IKW A;  2PHT A;  1W9S A;  4H7L A;  5FK8 A;  2PN5 A;  4MGY E;  2Z5W A;  3N9N A;  5L73 A;  1UX7 A;  5D8A C;  5T5P A;  1IG3 A;  4OLL A;  4LO8 A;  1YCI A;  1GR3 A;  1ACC A;  4D8M A;  3WCS A;  3LGR A;  2VJX A;  1VB4 A;  2W0X A;  1H1M A;  2J1A A;  1NCQ A;  1GZC A;  4AHX A;  3QBQ A;  4CU6 A;  1LHN A;  1DGW A;  3OGV A;  2CSG A;  2J1T A;  1OA2 A;  2WWJ A;  4NID A;  1H4G A;  2Q4S A;  3WNM A;  1ULP A;  3HT2 A;  5A1F A;  4YVW B;  1VPH A;  4MYE A;  3B01 A;  3M3O A;  1IS5 A;  1AYM 3;  1SBD A;  3NKT A;  1NY7 1;  4FPK A;  3EMR A;  1KXG A;  1F4A A;  5IAV A;  1W6P A;  2DTW A;  5FDB A;  3ENR A;  1HB4 A;  1LHV A;  2VTX A;  5FZ0 A;  4QT6 A;  4COV A;  5FUP A;  1RUC 2;  2Q0A A;  3Q8C A;  4M0N A;  1UCX A;  3H1M A;  5FPA A;  1DLL A;  4OUM A;  4O65 A;  5GLV A;  4EN0 A;  1ULO A;  1DG6 A;  3FWE A;  1CAW A;  4MSV A;  4DIN B;  5FPB A;  5CNA A;  5F8P A;  4HL0 A;  1RUH 2;  2G9Z A;  2JDZ A;  2LRO A;  2RE9 A;  2V72 A;  3PTR B;  5AC9 2;  1AHS A;  4K3U A;  1OC1 A;  1AYN 3;  2WBK A;  5IVC A;  4AE2 A;  5DDJ 2;  2L9L A;  1H2K A;  1VBD 2;  3D0S A;  3NJX A;  3R4U A;  1CZS A;  3R4D B;  3THP A;  3MI8 A;  5H9S A;  4Q4W 1;  4Y5Z 0;  1FAY A;  3KCC A;  1YEW A;  4XUP A;  2QFE A;  5BNN B;  3GZA A;  5LWB A;  1DLC A;  2HWC 2;  3TN9 2;  4LEJ A;  5JXG A;  2ENR A;  3LOB A;  2A73 B;  4C1W A;  4BYY A;  1ONA A;  1RL3 A;  2WWS A;  2BQP A;  2HYX A;  1WBF A;  1JHJ A;  3CBN A;  2G4I A;  2GNB A;  4H3W A;  4L92 A;  4P00 B;  1PM4 A;  3RJR A;  1FOD 1;  5HCB A;  1FPN 2;  1H2N A;  1F9K A;  5JLV A;  4UI9 L;  2VAU A;  1BK1 A;  3B3Q E;  2R04 1;  1J3P A;  1SCR A;  2VBB A;  2VEC A;  3CZJ A;  2WLQ A;  1AXZ A;  1E5S A;  2GC3 A;  2XJQ A;  4OZX A;  1RXF A;  4AFB A;  1NCQ B;  3E6C C;  2GDF A;  3U07 A;  3ZFE C;  1UMZ A;  2BFU L;  2ET7 A;  3I59 A;  4R9D A;  5LRR A;  1YWK A;  4XJ8 A;  2N7G A;  5FUI A;  5IYY A;  1F35 A;  1D0H A;  2E6V A;  1OT5 A;  2QDN A;  4E9K A;  1MS4 A;  2Y6K A;  5I0T A;  2YV8 A;  3VHN A;  4ZXK A;  1TME 1;  2R06 1;  3T30 A;  5LAS A;  1ZX5 A;  4LO4 B;  4RQP B;  3N9O A;  1EAH 2;  4ZZ8 A;  1W6P B;  1UMI A;  1Z78 A;  3I3B A;  1SFN A;  1VAL A;  5DUW A;  4D69 A;  2YC2 A;  2W52 A;  1XNT A;  4KBB A;  2RS1 3;  1UY0 A;  1C4R A;  1JZ6 A;  2BGP A;  2WNU B;  2Y0I A;  3IWZ A;  1QJX 1;  5APA A;  5LA2 A;  1N3Q A;  4LBQ A;  4LNV A;  3U1X A;  1BQP A;  3B7M A;  2DUQ A;  1LOD A;  1OLM E;  3ASI A;  5FMC A;  2E7A A;  4S2D A;  3HJR A;  2D3S A;  1X7N A;  1ENQ A;  1DQ5 A;  1WCQ A;  2HH9 A;  2Q5T A;  2ZAA A;  3MID A;  4FPH A;  5E16 A;  3S5Q A;  1SFP A;  4R8H A;  5I91 A;  4MGS A;  3SEP A;  4Q4X 1;  5FYS A;  5IHR A;  2FHR A;  2SLI A;  2VTF A;  4O7X A;  3K4D A;  3DN7 A;  4WM7 C;  2OW4 A;  3WP6 A;  4AVS A;  5I93 A;  2EIE A;  1ZM1 A;  1GZW A;  2F17 A;  3CIH A;  5JWP A;  2XH6 A;  4NR1 A;  1TMF 3;  2VVE A;  1RMU 1;  3FHI B;  3PNA A;  1C8M 1;  4OHV A;  3J26 N;  2P4E A;  1V6K A;  1QJU 1;  3LEI A;  3GCX A;  2JB4 A;  4CEY B;  4HXC A;  5GAL A;  3WNP A;  2RS3 1;  2KD7 A;  4XQD A;  3ACI A;  1CPM A;  3FFQ A;  5FZ6 A;  3USU A;  5BNP B;  5A6Z A;  1Y9G A;  1RJ8 A;  4EYU A;  2KR2 A;  2ERF A;  4HSL A;  2A6W A;  4PLN A;  3I59 B;  4MOA A;  1GP4 A;  5FPX A;  1E5I A;  3X29 B;  5JI9 A;  3TB0 A;  1GQG A;  1CQ9 A;  2WA4 A;  5LAT A;  4O9G A;  2VW2 A;  1E5H A;  1R08 2;  2ZGU A;  1XNC A;  2CWS A;  5CKN A;  4JV4 A;  4LBJ A;  1QHD A;  2QQL A;  1OSG A;  3ILR A;  4GWJ A;  1MS9 A;  4HKO A;  1H2M A;  2D93 A;  1MS0 A;  4ZU4 A;  1ULE A;  1CVN A;  4QDS A;  2GNT A;  4NUB A;  2BEO A;  1C1F A;  4RGA A;  1Q8P A;  1VBE 3;  5IVE A;  4LBM A;  2YU2 A;  1X82 A;  1SQ4 A;  3FL7 A;  3UT0 A;  5F5I A;  3J8F 3;  2YRO A;  3JCI A;  5C71 A;  1OD3 A;  4D7S A;  2UWA A;  2W87 A;  4PI2 A;  2FCU A;  4AL9 A;  4NN0 A;  5FZ1 A;  2WUH A;  3OJB A;  3JD7 3;  4ZON A;  2ETE A;  3POI A;  5FKC A;  2C9K A;  3WZ1 A;  4ZU5 A;  2AUY A;  2VZU A;  1WCS A;  2ZCW A;  2Y64 A;  4QD2 A;  4L0P A;  4M3C E;  4COW A;  4E8D A;  2YBS A;  3K75 B;  3UK9 A;  1FV2 A;  5FOJ B;  1FYU A;  1NQD A;  1PHM A;  3DYM A;  4XET A;  5C7G A;  3RPQ A;  5CFD A;  1SMV A;  1GZW B;  2IXI A;  5JOX A;  2PLV 2;  1FMD 1;  3N36 A;  5KHG A;  1PNG A;  4I02 A;  2GAU A;  1VMH A;  1XC6 A;  5ISL A;  2CWM A;  1ASJ 1;  3DCQ A;  2JG8 B;  3ETP A;  3P3N A;  2YGM A;  3B9I A;  4J1W A;  4QAW A;  1UYX A;  2JKX A;  3M70 A;  4B29 A;  2WII B;  5FZB A;  3RYP A;  4NIH A;  5F6K A;  1D4M 1;  4AI3 A;  5FO8 B;  1JZ7 A;  4V2W A;  3USU B;  1MS8 A;  1NXD 1;  2TUN A;  2VCA A;  5LA0 A;  3RZL A;  1S0D A;  3KGZ A;  3WNO A;  3RZG A;  5B4N A;  1O4Y A;  2JDH A;  5G04 L;  3T1L A;  5DAV A;  1H6X A;  3LPF A;  1ND3 C;  4Q4V 3;  4YW7 A;  5CAZ A;  4ASK A;  4AK3 A;  2ZX4 A;  1LOA A;  4L97 A;  2Q8O A;  4R9A A;  3AYC A;  1AR7 1;  3FBY A;  1K42 A;  3GJA A;  5K8S A;  2A70 A;  1OKQ A;  1C28 A;  3JZV A;  2TBV A;  2WS9 2;  3AZW A;  4AF9 A;  4AG4 A;  1CWP A;  2CDO A;  1DCS A;  3MF9 A;  3T2P A;  1OFS A;  4MO3 M;  3KGL A;  3KT4 A;  1YJL A;  2B46 X;  2QDR A;  2GAL A;  1ZBA 2;  1JU4 A;  2QVS B;  5LBC A;  3VBR C;  2FCT A;  2A3W A;  1JBC A;  5BYN A;  5K0U C;  1UU4 A;  2W92 A;  4K21 A;  3HR9 A;  1OLQ A;  3QOP A;  5HBA A;  1X9P A;  1YC6 1;  3LDB A;  2XML A;  4E8C A;  4RHV 3;  1OVP A;  5DG2 A;  5EYX A;  2HYK A;  5K4L A;  1FV3 A;  3RVH A;  4YW1 A;  3B69 A;  4BPZ A;  1DGR A;  4IER A;  1ENR A;  4JKK A;  1ZZB A;  4JDO A;  5FZ8 A;  1YO8 A;  1N1T A;  5CFD B;  3ZFE A;  4HPK A;  3ZXA C;  4Z92 B;  4Q5O A;  5C8C C;  3NQH A;  4A45 A;  4BQ5 A;  1BHG A;  4AW7 A;  2ARX A;  3ZR5 A;  1RUO A;  4LK6 A;  5JCT A;  2PAM A;  2AR6 A;  2HKX A;  3DGT A;  1OQ1 A;  3KVA A;  1X33 A;  2ZEX A;  4JRL A;  4XJA A;  4E4D X;  1XSQ A;  4OUL A;  5A33 B;  2P34 A;  4HOO A;  1PIV 3;  4XAC A;  3I2F A;  4GIQ A;  3GZE A;  1GLH A;  5FLH A;  2WFF 3;  2BER A;  3B94 A;  2PEL A;  2QQV A;  3I2G A;  3ME2 A;  3WUC A;  4AYU A;  1UOF A;  2W3J A;  5E8A A;  5F5C A;  1V6L A;  1ODM A;  4QB1 A;  4N43 B;  4PF1 A;  1WWY A;  3NAP C;  5DAB A;  4XUT A;  3U37 A;  2NYY A;  1AR6 2;  4CPB A;  2WDB A;  2VMH A;  4OI4 A;  3MZH A;  3RZK A;  2LS6 A;  1X8M A;  1LU2 A;  1RUJ 2;  3H50 A;  4Q0P A;  4BIS A;  2FDI A;  3RWK X;  1F15 A;  4WM7 A;  3IAQ A;  1W8H A;  4DRV A;  1OLR A;  3O1R A;  4OHZ A;  4IV1 C;  3IDE A;  4ISR A;  2YPJ A;  4IUG A;  3VV1 A;  5KXC A;  4RSU A;  5FZ9 A;  4QPG C;  4CDU C;  2EID A;  1AX1 A;  2VNO A;  2J7M A;  2D6M A;  5DPN A;  5LZ6 A;  1OUX A;  4AFA A;  3ACH A;  5GLZ A;  1PNF A;  4CEW C;  3AJY A;  4CUA A;  2WAO A;  4UFH A;  5F2S A;  4LKS A;  1OPM A;  4YM2 A;  1OVS A;  1PO1 2;  1H9W A;  2NMO A;  3I49 A;  4LBQ D;  3BIE A;  1K5M B;  5C8W A;  4XF4 A;  4QX5 A;  4ISQ A;  5GLW A;  1NOV A;  1WCD J;  1C5I A;  1X9T A;  2X53 S;  1YYN A;  4P9J A;  2PHU A;  4R9B A;  5FZO A;  2C1F A;  4PQQ A;  1IPJ A;  4OUS A;  3IDC B;  3NV3 A;  1Q43 A;  4YZ4 A;  3MLK A;  2PHW A;  2DVF A;  4ZU7 A;  1I5P A;  1G9B A;  4Y4R A;  3OGS A;  4E2S A;  2RM2 2;  4GMP 3;  2QZ2 A;  3S7E A;  1F2N A;  3AMM A;  3N3H A;  3IT8 A;  4YAR A;  2JG9 C;  2IXJ A;  1BLZ A;  4N53 C;  4ZS2 A;  4ASM B;  1S0G A;  3VD9 A;  4AFC A;  2RS5 1;  2X5I C;  3MYX A;  1SLL A;  4IE7 A;  5IAX A;  2TNF A;  3H1W A;  4ARX A;  3HD8 B;  3IPV A;  3SLI A;  1SLA A;  1GP6 A;  3OEA A;  1LNS A;  5J1X A;  3MUY 1;  2IFR A;  2XR4 A;  4YRD A;  5A3N A;  4AHY A;  2VW0 A;  4OQ9 A;  3VL9 A;  3IN9 A;  1JI6 A;  5J37 A;  5T50 A;  2DYC A;  2HLE A;  1DZQ A;  1REF A;  4YVS B;  1RVF 1;  3AKR A;  5KWR A;  1TZO A;  1CAX B;  2VUA A;  1SLI A;  1POQ A;  3VHO A;  5C5T A;  3K46 A;  5HXV A;  1SFY A;  4ZHN A;  1YQ8 A;  1DP0 A;  2HJI A;  2WZE A;  1JYT A;  3ACF A;  2IVJ A;  3A0K A;  5CG8 A;  1GZ9 A;  5FYB A;  1AR8 1;  2A3Y A;  2D5F A;  1PZ7 A;  3R05 A;  4IEY A;  1UZV A;  3H7J A;  4CU8 A;  2DUR A;  3K51 A;  4YGB A;  3RWN A;  1QXJ A;  2OII A;  3T3Y A;  2LAL A;  2XVG A;  3MIC A;  4JKL A;  1DZT A;  1H0B A;  2AEN A;  3KS7 A;  1XYO A;  1HB1 A;  4Q4Y 2;  2XLG A;  5J09 A;  1L7R A;  3NRU A;  1W6M A;  5G05 L;  2UUR A;  2JX9 A;  3VBU C;  5JZG A;  1HJF A;  3E6B A;  4I0W B;  5L7O A;  4MV2 A;  4Q4W 3;  5FYM A;  2QZ3 A;  1JZ4 A;  3K3O A;  3OBR A;  1E5R A;  1QOO A;  1RHI 2;  3INA A;  2EXH A;  3AFG A;  4A6O A;  3MIE A;  3BVC A;  3PIG A;  2ZX0 A;  2WZR 1;  4UT5 A;  1YFX A;  3ZO0 B;  4OUE A;  5BPX A;  5ABJ B;  4UAP A;  3ZN4 A;  2Q1Z B;  1BEV 2;  1EPW A;  3IM0 A;  3O1V A;  3ZSE A;  4XQW A;  3M4F A;  1NYW A;  3UJQ A;  2R04 3;  3IPV B;  5L9R A;  5FXX A;  4TN7 A;  5JI7 A;  1OF3 A;  4XFF A;  3MLJ A;  1W9F A;  2WJS A;  4YW5 A;  3ZFF C;  1W3X A;  4ATF A;  4FTB A;  4Q1P A;  2BWA A;  2H0V A;  1DBN A;  2P3Y A;  1UF2 C;  3WNN A;  3V56 A;  4F8A A;  2OT7 A;  1WMF A;  2J42 A;  2G9G A;  3O0V A;  1TME 3;  2R06 3;  2XDV A;  5BY5 A;  4RS5 C;  3CL1 A;  5SV8 A;  3MFA A;  4C90 A;  4YZ5 A;  3MLL A;  3PUR A;  4NPR A;  5IAT A;  4A42 A;  2HWE 2;  4TLF A;  1MS5 A;  2CHH A;  4R9C A;  4Q8K A;  1ND2 C;  1QJY 3;  3E5X A;  3CQO A;  4P5Y A;  2RV9 A;  3WW3 A;  5FMO S;  4QX8 A;  5FZF A;  4LO5 B;  5LCW L;  2JEC A;  1QJX 3;  3C7G A;  3KM5 A;  4JGZ A;  1MEC 2;  1Z7S 2;  2WT0 A;  3WP4 A;  3AFK A;  4AI2 A;  3DEM A;  5IK4 A;  4CCC A;  5CYY A;  1JZ5 A;  3CJI A;  4R4Z A;  1NA1 B;  2XL9 A;  1W6M B;  3WDU A;  3LIH A;  3P5B A;  4YG3 A;  5JZG B;  1GWM A;  3DYO A;  4Q4X 3;  3ZIX A;  5M0T A;  3WIN E;  2DUO A;  3MEP A;  5L7O B;  4Y1V A;  1YHF A;  1LCL A;  4S2H A;  1AL2 1;  2E31 A;  1NUK A;  2P5B A;  4D3W A;  1YQC A;  1H2L A;  4IV1 A;  1QJU 3;  1R64 A;  1DQ1 A;  2X8K A;  2X05 A;  4DZG A;  1UAI A;  3Q8F A;  3QH6 A;  5A3O A;  3I8T A;  4CDU A;  3ZX7 A;  3UES A;  3K48 A;  3WDY A;  5K9Y A;  4CDW A;  5D1I A;  2DTY A;  3FBM A;  3U4X A;  5LY2 A;  2I45 A;  4XMA A;  3K77 A;  5DZF A;  1REE A;  1XU2 A;  3AMQ A;  3III A;  1JS9 A;  1CR7 A;  1LOB A;  3KF5 A;  2XJR A;  5FLJ A;  3BCW A;  5A6X A;  3NNG A;  2BWC A;  1QIQ A;  1RUF 2;  4GB3 1;  1URX A;  4M3C F;  4BXF A;  5J7M A;  1RUC 3;  1JW6 A;  1WME A;  4FAH A;  5IK8 A;  1W8N A;  4HK8 A;  4P02 B;  1GKB A;  2JEM A;  5FZA A;  2IXC A;  4N9H A;  4A41 A;  5CBL A;  1CES A;  4XFH A;  3FZ3 A;  4CPB D;  1P8J A;  4LLF A;  1OA3 A;  1Q8S A;  2E7Q A;  1UY3 A;  5C9A A;  5JMO A;  3MW2 A;  1Y4W A;  2XVK A;  5J48 A;  1S0J A;  1ZRC A;  5ANQ A;  4BQ4 A;  2QTW B;  1ZBE 1;  4O9E A;  3DPR C;  4AED B;  1WMD A;  4CE8 A;  5DDJ 3;  4BE3 A;  1PO2 2;  4CUB A;  1DF0 A;  4KU7 A;  2KM2 A;  1HRI 2;  2JDY A;  5FOB B;  4X8N A;  5FWE A;  4JGZ B;  1V6J A;  1KS5 A;  4R52 A;  1QXR A;  2IZW A;  4B7E A;  4LO7 A;  4JAA A;  3W5M A;  1UYZ A;  4PCR A;  1DIW A;  3ORJ A;  3CJI B;  3UKN A;  3H3L A;  4BIF A;  1OH4 A;  1UKG A;  1A8M A;  1HB2 A;  1LOG A;  2ZXQ A;  4Q4V 1;  1D2Q A;  1IHM A;  1MZ6 A;  1K3I A;  3IAP A;  1W6O A;  3ZFG C;  1FPN 3;  3VKM A;  1AR9 2;  5T5L A;  3UL2 A;  5EZW A;  5FZL A;  1FMD 3;  3CZU A;  3VDC A;  1VBA 2;  2QQI A;  4NPM A;  2DCJ A;  4QKF A;  3VZN A;  3ZKU A;  4UW5 A;  1ASJ 3;  2PAE A;  4QX0 A;  5H9Q A;  3KMH A;  3A7Q A;  1W0P A;  4KL1 A;  4XXP A;  2NMN A;  4FSJ A;  2RMU 2;  2VY0 A;  3F2Z A;  4EN6 B;  1D4M 3;  5FZG A;  3OOX A;  4COU A;  1OPO A;  1POV 0;  4CDW B;  3TNQ A;  3T2O A;  1J3Q A;  1Y9Q A;  4N7U A;  3M1H A;  2C9A A;  3P6B A;  4O61 A;  5EHD A;  1ULF A;  2VQU A;  4AQ6 A;  4LXL A;  5FXZ A;  1POV 1;  4A7Y A;  2ARB A;  2BTV C;  3LA7 A;  3AB0 A;  3E5U A;  1Q3E A;  4KQ7 A;  4V1P A;  2XHN A;  1W8T A;  4KG8 A;  3NV4 A;  4RN5 A;  2P6C A;  3RDI A;  4I09 A;  1CN1 A;  1OQE A;  1B35 C;  2LUW A;  1GV9 A;  1W8W A;  5I0D A;  3CU7 A;  4YW6 A;  2VZ3 A;  2AGS A;  3CNA A;  2C5D A;  4X6R B;  5C9A B;  4IE0 A;  3EYP A;  1S4C A;  2VVD A;  3HMY A;  2G1M A;  2D3R A;  5JIA A;  3A23 A;  4CEY C;  1JH5 A;  2MEV 2;  4HLT A;  2EA7 A;  2ZHK A;  3T4H B;  2TEP A;  5A3L A;  1QJZ A;  4YW3 A;  1PIV 1;  1OOP C;  2ZBJ A;  4LBN A;  4QKD A;  2VMG A;  3WF3 A;  2DCT A;  2WO7 A;  5CA6 A;  2GH2 A;  1H8T C;  1H30 A;  2ZX1 A;  3KCY A;  1R09 2;  3DXU A;  2RDR A;  3OPW A;  5FP4 A;  4BQX A;  3A21 A;  3THT A;  5A7W A;  3S30 A;  1RUI 1;  2X29 A;  2ZGR A;  3GBW A;  3WNK A;  4Q8L A;  4DOU A;  2A71 A;  3MDP A;  1LEC A;  1W2N A;  4JRA A;  1W6O B;  3KF3 A;  4XTM A;  2W1W A;  2XBO 2;  5C4W B;  4XUO A;  3KD4 A;  1W2O A;  4H14 A;  1GSL A;  2JXA A;  1GNH A;  2R0H A;  2YYO A;  5FUN A;  3F95 A;  1ZZ6 A;  3TBD A;  1EV1 1;  4RS5 A;  2WWU A;  3ZN5 A;  2XWJ B;  4OYU A;  3T1M A;  2BFU S;  1IOA A;  1HLC A;  1FNZ A;  3DKW A;  2FDG A;  2W68 A;  5LA1 A;  2WT2 A;  1O91 A;  2QQP A;  4I30 A;  4XFG A;  1IS3 A;  2JDU A;  2BP6 A;  1NLR A;  2XVL A;  3D5O A;  5GZE A;  1CZT A;  5KHK A;  3PTY A;  2C6S A;  3HQR A;  4EN8 B;  4OHX A;  5ACA 2;  1SDW A;  2CL2 A;  2J1V A;  3WQ1 A;  2ZGL A;  4LIT A;  3LQC A;  2A5Z A;  2Y33 A;  2JG8 C;  3HWJ A;  5FRE A;  3RQ0 A;  2HWB 1;  1WLW A;  4LKD A;  4BJ0 A;  5AFE A;  4A2U A;  3VBO C;  2BZD A;  1V0A A;  4YLZ A;  3CO2 A;  1KS4 A;  1OBN A;  3LOI A;  4EZH A;  4BQY A;  2PYT A;  1A8D A;  3D6E A;  3LSE A;  4HFS A;  3HN3 A;  3O1M A;  4E4H A;  4NRQ A;  2Q30 A;  5T3N A;  2H0B A;  3W5N A;  1V70 A;  4XFC A;  5A7W B;  1AL0 G;  1H4H A;  4Q0U A;  3WF1 A;  3BTY A;  1YI7 A;  2VZP A;  4HN1 A;  4TSV A;  3M3E A;  5JR2 A;  2FZ2 A;  3VBS C;  5EJZ B;  1JUI A;  4BMB A;  1GUI A;  3IB3 A;  5EYY A;  4F83 A;  1FXZ A;  4JGY C;  1YFY A;  4QPI A;  4W6Y A;  4XUR A;  5FXW A;  3AMH A;  4OFG A;  4KG0 A;  3UGH A;  1U0A A;  4NWV A;  1ENS A;  3PUQ A;  4OCT A;  1SEF A;  3V65 A;  2W39 A;  5A6Y A;  4FFI A;  2YDE A;  2HWF 2;  4AEK A;  1PZ8 A;  1Q8O A;  2ZGQ A;  1C8N A;  4PDW C;  4DY5 A;  2FDK A;  2CAU A;  1W2U A;  4LQR A;  4Z1V A;  1M06 G;  2VQA A;  1QQP 2;  4WBB A;  4AFM A;  4C91 A;  1BBT 1;  1S0B A;  1HX6 A;  1Y3T A;  2Y60 A;  1YQ6 A;  2J1S A;  4DXT A;  2RHP A;  4CCD A;  1IPK A;  2RS5 3;  4DEV A;  1GWL A;  4RFT 0;  5F39 A;  3VBF C;  1VE0 A;  2UYB A;  4JQT A;  1K5J A;  1KEX A;  4UW4 A;  2XQR A;  4XC9 A;  3KLS A;  3OEB A;  1RUE 1;  3T08 A;  4CDX B;  2XJT A;  1J58 A;  1QH6 A;  1V9U 2;  1W8U A;  2VH9 A;  2WO2 A;  1RVF 3;  5DZE A;  4J6G A;  2ORX A;  1AXY A;  3A22 A;  4RL7 A;  2QUO A;  4CCO A;  5HI0 A;  1W0O A;  4Y1Z A;  3VBH A;  3ON7 A;  5LW9 A;  3UGG A;  1WZX A;  2PHD A;  4NRO A;  3NWK A;  3TAY A;  3D0J A;  1C3H A;  2JWP A;  2PHL A;  2W08 A;  3TYJ A;  1UY4 A;  1DDL A;  3AX4 A;  3Q8A A;  4QB2 A;  5ERL A;  4E2Q A;  1Y9M A;  3OG2 A;  2HWD 2;  1AR8 3;  4NPL A;  1VRB A;  4UFM A;  2B4K A;  3AP7 A;  3N9M A;  4GH4 C;  5CVR A;  3SC7 X;  2R0F A;  4CU7 A;  3EJK A;  3V0B A;  3CKH A;  4N43 C;  4JDM A;  4MG2 A;  1OKO A;  1XYP A;  2ZPX A;  1S0F A;  3MF6 A;  2RJK A;  4QPI B;  2BGO A;  1RUD 2;  4H55 A;  3R6S A;  5KHH A;  1XE0 A;  4NHX A;  1UWW A;  1IKQ A;  4GKY A;  3KWV A;  5FO9 B;  1JOB A;  2I74 A;  4D0Q A;  1TNF A;  5FQ0 A;  2R07 2;  2CYF A;  4LBK A;  2ZEY A;  3GGL A;  1JU3 A;  5CEH A;  1BMV 1;  2XOM A;  3HBZ A;  4XUQ A;  3I54 A;  1HN1 A;  3LA2 A;  4E4Z A;  2WSV A;  4MGQ A;  2WZR 3;  3WCR A;  1NCR C;  1DGL A;  1PVC 2;  2WA3 A;  4UBG A;  1H9P A;  4HK9 A;  1QJY 1;  5GLT A;  2P17 A;  4F7Z A;  2D43 A;  1O3T A;  1MS1 A;  5GJ6 A;  1HXS 1;  5HV0 A;  2XKO A;  3I2J A;  1T2X A;  1AF9 A;  4GZ9 A;  4HVO A;  3E6D A;  3BU0 A;  2VOT A;  4S2F A;  5LB6 A;  1CAW B;  2A6Y A;  5DAX A;  3J7N A;  2QKD A;  4TWT A;  4XDQ A;  1VBB 1;  1VJ2 A;  1WBL A;  1YXW A;  1N3O A;  1U5I A;  4IL7 A;  1XNA A;  3LEK A;  2VOW A;  4AVA A;  4CP1 A;  2YY1 A;  1GOG A;  5C33 A;  1COV 2;  1HRV 1;  2P2K A;  2BJS A;  3MV0 1;  1L7Q A;  1CD3 G;  3H3U A;  5JOZ A;  4JKM A;  3VBH B;  3BOW A;  2EAL A;  2VZO A;  4FPY A;  3I97 A;  3NKG A;  3SCF A;  1PK6 A;  1VBC 2;  3LE0 A;  3NJY A;  4FT8 A;  4CDQ A;  1J1T A;  1NQJ A;  1YIP A;  5DAQ A;  4QKB A;  2FQP A;  3D4K A;  3CDZ B;  3GXU A;  4X8P A;  5FLI A;  4CCK A;  2ZGT A;  4FOV A;  3V0A A;  1VRH 2;  5CFC C;  1CGP A;  2GND A;  1UZ0 A;  2WNV C;  3VZJ A;  2Y6L A;  3V0B B;  3WF4 A;  4S2G A;  1HN0 A;  3APB A;  3GBF A;  2XJV A;  3C3V A;  4DNY A;  1GWK A;  4EWD A;  4IV3 C;  1RUG 2;  4YWA A;  5HCH A;  4A4A A;  3WG1 A;  1JZ2 A;  2GME A;  1RUN A;  2GC1 A;  2V09 A;  4Y20 A;  1RUC 1;  2WKK A;  4NAO A;  5FQ0 B;  2VNV A;  3RRD A;  1ZZ9 A;  4NHL A;  4AI8 A;  1UO9 A;  4L99 A;  2ZGK A;  5EIY B;  1BXH A;  2VOX A;  3AZY A;  3W58 A;  4DUV A;  5BNO A;  1AL2 3;  2CY6 A;  3BB6 A;  3VBO A;  3VDD C;  2YHJ A;  2OA2 A;  1MZE A;  1RUH 1;  4DEQ A;  4HET A;  1YUD A;  1Q5O A;  2R32 A;  3OY8 A;  4I0B A;  5AC9 1;  3AKS A;  5JR7 B;  3ZYI B;  4YW2 A;  5DDJ 1;  3M3I A;  5F7U A;  1VBD 1;  5FZC A;  3R0R A;  4XJW A;  1RED A;  1LGC A;  3LB9 A;  2VXJ A;  3QCW A;  4LBQ B;  3PU8 A;  3ABZ A;  3ZSK A;  2HWC 1;  3TN9 1;  2W47 A;  2CGO A;  3MW4 A;  3HN1 A;  4XOG A;  4AQT A;  3ZYF A;  1SLB A;  1OXC A;  1L7L A;  4GB3 3;  1R1A 2;  2JE8 A;  5D8A A;  2GN7 A;  3PDQ A;  4BCU A;  4QHO A;  5HCF A;  3RYR A;  1FPN 1;  3JB4 C;  3FUO A;  3ACG A;  4CUC A;  2JIC A;  1DYP A;  1TEI A;  1IKP A;  1ST8 A;  4LT5 A;  1PK6 B;  3BOD A;  4CDQ B;  4YSF A;  5ABJ C;  4BH9 A;  4WVM A;  1ZBE 3;  3SHR A;  5GZC A;  3AMN A;  2D6K A;  3AP9 A;  2QBX A;  2CAV A;  5BNQ A;  4FP2 A;  3LEG A;  3IDB B;  4XBQ A;  3VD4 A;  2B9U A;  1S0I A;  4NVP A;  3WDX A;  1UOB A;  2GP5 A;  3S7I A;  2RVA A;  3SCH A;  1EAH 1;  3UKT A;  2ZML A;  4AAP A;  4QM8 A;  4DO0 A;  1YQ5 A;  1XND A;  4Y20 B;  2XJU A;  4PJY A;  5C3R A;  3GBG A;  3AM2 A;  3Q8E A;  4IGP A;  1OUR A;  1Q8Q A;  2WNE A;  5I8T A;  5BNO B;  3CEW A;  2UU8 A;  2ATF A;  2DVA A;  4XBN A;  2E51 A;  4BK5 A;  5KC6 A;  1O3S A;  3M8L A;  4LTA A;  2Y38 A;  1SPP A;  3QD6 A;  5FYC A;  5JIU A;  1F4H A;  2QQN A;  3I3Q A;  3OY8 B;  4Z2A A;  3OUJ A;  2IXK A;  1KFX L;  1MZ5 A;  1UOJ A;  4AHZ A;  4LIU A;  4YNI A;  1S2E A;  3G7D A;  3C7H A;  3HNM A;  3VGI A;  5IK5 A;  3KT1 A;  2DFC A;  4HON A;  4Z07 A;  5F37 A;  1CJD A;  5E6H A;  5LEK A;  4FPO B;  4FFG A;  2ZTN A;  5LBB A;  4XFB A;  4B4P A;  5DMY A;  4QB6 A;  1POV 3;  2DWR A;  4UW6 A;  2HWE 3;  3O1S A;  1AYM 2;  5FZH A;  4CA9 A;  4QGM A;  4GWN A;  5D8A B;  1I5Z A;  4FOW A;  3EB7 A;  3UV9 A;  1H8V A;  3I3D A;  3PVE A;  3ZN6 A;  5GLU A;  4YZ1 A;  5FMB A;  5JDB A;  2AC1 A;  3MPB A;  5FCC A;  4P9G A;  2BU9 A;  2E33 A;  1O3Q A;  1Z7S 3;  4OVE A;  1JTZ X;  3AVR A;  4IEX A;  3KB5 A;  4I2O A;  3BGA A;  5LEJ A;  5DUX A;  5I8S A;  4XBL A;  3WSO A;  3AKP A;  2DVD A;  2BNO A;  2B42 B;  1UU6 A;  1W06 A;  1JYI A;  1R08 1;  4Z82 A;  1MPX A;  3MUZ 1;  1AYN 2;  4WM8 C;  4XIL A;  1AVB A;  4IGQ A;  5FFO C;  4XCA A;  1CAV A;  1DYK A;  4QX3 A;  3KQ4 B;  3RS6 A;  5L9B A;  3I3M A;  4UXA A;  1RUI 3;  1ULG A;  3H3Z A;  4XYX A;  3ELN A;  3UKV A;  4I3G A;  1VIW B;  1O5L A;  1NLS A;  3LKJ A;  4CP0 A;  3W59 A;  2P3K A;  3POJ A;  1W6N A;  1CAU A;  3H0O A;  3POY A;  5BV6 A;  1W9W A;  2FDH A;  2VPV A;  4HMZ A;  3WQ7 A;  1JYX A;  3AL6 A;  1SPP B;  2NP0 A;  3BOP A;  2BOI A;  2BOJ A;  4OMC A;  3ILN A;  2OKX A;  4AXO A;  1QXP A;  4DXR A;  2AAC A;  4TYS A;  4EZ4 A;  1EV1 3;  1IS6 A;  3KHB A;  3PLQ A;  4A7K A;  5IFT A;  1KJR A;  4PT6 A;  3IZO A;  3UET A;  4DXZ A;  1HQL A;  2PLV 1;  2WQ8 A;  5EWS A;  2GMP A;  4OZO A;  1UIJ A;  3GDB A;  1LOF C;  1XRU A;  2JJ6 A;  2YBP A;  2ZX2 A;  4AR2 A;  3UYJ A;  4ES9 A;  4EE2 A;  2WNV A;  4NHK A;  3FX3 A;  1OA4 A;  5F2W A;  4BB3 A;  5LBF A;  3NJZ A;  4XAE A;  1PO2 3;  1PZ9 A;  3HNB M;  1S55 A;  5DUU A;  4YZ3 A;  5LK5 A;  3ZFE B;  2RS1 2;  4HPK B;  4PIY A;  4YG0 A;  4ATE A;  5F5Q A;  3GAL A;  2Q1F A;  3AK0 A;  5FTT C;  3H8O A;  1MR5 A;  1WW6 A;  2HWB 3;  3AYE A;  5DN2 A;  3K3N A;  4BLJ A;  1EUT A;  3LIG A;  4YM3 A;  3PUI A;  2HEY F;  1XE7 A;  3EO6 A;  4YGE A;  3ZYP A;  1N1V A;  2EAA A;  4EV0 A;  3ZXK A;  3VDD A;  3BI3 A;  2PQQ A;  1AR9 3;  5EPA A;  2DBI A;  4Y33 A;  1TE1 B;  5CIR A;  1N1Y A;  1O4Z A;  2EXK A;  2WS9 1;  2BVV A;  3BYW A;  4I3P A;  3GCW A;  3N9Q A;  5J98 B;  3PHM A;  1OF4 A;  5A32 A;  1NZC A;  4DUW A;  5CAD A;  1ZBA 1;  1TMF 2;  2GC0 A;  1ALY A;  2AZ5 A;  5BXX A;  2VZQ A;  1CAU B;  3N9P A;  1QWR A;  2Q8E A;  3JBG 2;  1MQT C;  2XQX A;  3HNY M;  4QMA A;  3CLP A;  1R1Z A;  2R30 A;  4XAA A;  4HVQ A;  4HKW A;  3LSD A;  1WA6 X;  4WM7 B;  4DIQ A;  2GP3 A;  3ZDS A;  1W6Q A;  4FFF A;  3T2T A;  4M0H A;  4AFD A;  4RR3 C;  2WZ8 A;  3HVD A;  3VZL A;  5FMD A;  5AVP A;  3MIG A;  1A6C A;  1BBT 3;  2DCY A;  4L9B A;  2ZS6 B;  5T5J A;  4BIO A;  1UXZ A;  2F4P A;  2JDA A;  1UKR A;  4FPJ A;  5FY8 A;  1UZW A;  2Y0O A;  5GZF A;  3J9S A;  1VBE 2;  5A6Q A;  3J8F 2;  1ND3 A;  4L2N A;  4N8M A;  1RUE 3;  1SCS A;  2PMW B;  2CNA A;  3NNM A;  2C4X A;  4QDR A;  1QOT A;  2UWC A;  5FZO B;  3GZU C;  5HCA A;  4FXK B;  3USS A;  1GQH A;  5FZD A;  1AXK A;  3POW A;  3WF0 A;  3I2H A;  3JD7 2;  4QGL A;  1OLM A;  5LBE A;  3OUH A;  4YZ2 A;  2W1U A;  2VGD A;  5KBF A;  4YGD A;  4GAL A;  3UGF A;  5FY7 A;  5DAW A;  4NMI A;  3VBR A;  4MHR A;  3VDA A;  2ZZQ A;  5K0U A;  2JDN A;  1AR6 1;  5EXO A;  3WW2 A;  4ONU A;  1PX4 A;  1CX4 A;  1CON A;  3D3A A;  2Q1M A;  5A32 B;  1RUJ 1;  4Q26 A;  3L2H A;  3PU3 A;  1QMJ A;  1WD3 A;  4C0B A;  1K12 A;  2JB8 A;  2O14 A;  3VZK A;  4LHL A;  2B9V A;  4XZP A;  1SLT A;  4XDO A;  4XF9 A;  3MIH A;  4U2A A;  3RNS A;  2XKP A;  4LA2 A;  5D21 A;  1LB2 A;  3DKQ A;  3B02 A;  4KBZ A;  5EV7 A;  4LKE A;  1O4T A;  1LHU A;  2VZV A;  5JAX A;  1LR5 A;  1W6Q B;  5C8C A;  3E1F 1;  5I0R A;  5A70 A;  1TVG A;  1O8S A;  5KHI A;  3HT1 A;  2ZEZ A;  1PO1 1;  1WLT A;  2GNM A;  5FJH A;  3UNP A;  1KGY A;  3G6J B;  5DZG A;  2WT1 A;  4Y22 A;  2VBP A;  1UU5 A;  2DF7 A;  1HXS 3;  2YUE A;  4UF0 A;  1ZA4 A;  2CGN A;  2DFB A;  5IT6 A;  5J96 B;  2A6Z A;  2ZAB A;  4C1X A;  2A3X A;  3ZN6 B;  2VME A;  3M7A A;  3K2O A;  1ND3 B;  3ATG A;  4X6Q B;  3WDV A;  1VBB 3;  2RM2 1;  2GH8 A;  3LDR A;  3NNL A;  4FCA A;  3U11 A;  1GZT A;  4PBP A;  4ZKT B;  2WC2 A;  1UOG A;  3OGR A;  4NHM A;  3RI8 A;  4MXW A;  3VKF C;  1GBG A;  1HRV 3;  2VXR A;  3NAP A;  3OBA A;  4LOT A;  3GHM A;  4YVW C;  1ZRR A;  4RHV 2;  1RYY A;  1YNA A;  2D40 A;  3OGJ A;  4QXH A;  3T4V A;  3POS A;  1V6I A;  1PGW 2;  4Y4Y A;  1NE4 A;  3VBR B;  5JUV A;  4E27 A;  3NV2 A;  1EY2 A;  5K0U B;  2RR1 2;  2E9Q A;  4CVU A;  1I9R A;  1LRH A;  4G4F A;  4NRP A;  4QPG A;  4M4R A;  4QM9 A;  4A44 A;  2HWF 3;  2ZAC A;  3ILF A;  4XIO A;  4PF5 A;  4Y1X A;  5CG9 A;  5SV5 A;  2ADD A;  3KV5 A;  4IEW A;  5FZE A;  4CEW A;  1QEX A;  1F5J A;  3WDT A;  4OQ8 A;  4ERO A;  1EYB A;  3MPP G;  4MZU A;  2VUC A;  4HN0 A;  2RDQ A;  4Y26 A;  4JX0 A;  4BME A;  1HW5 A;  3AKT A;  1SDD B;  3KV9 A;  2XB6 C;  3VD5 A;  2H6C A;  5C8C B;  2WFF 2;  5C6C A;  5BNN C;  3I7D A;  4HKL A;  3H8R A;  2W5F A;  1SHW B;  2VMF A;  1UX6 A;  4Y22 B;  2FMY A;  1RUH 3;  2CTV A;  5AC9 3;  4Q4Y 1;  3RMY A;  1LOE A;  2R1D A;  4UF0 B;  4Z2W A;  1CX1 A;  2OPW A;  2Z4F A;  1BYH A;  2YGL A;  1VBD 3;  2R6Q A;  3I2I A;  3VLB B;  4BU2 A;  3OYW A;  3VN4 A;  4W6W A;  3PL0 A;  1Q56 A;  3NST A;  2JG9 A;  4FOQ A;  1JYV A;  1HIX A;  4LK7 A;  4N53 A;  1LOC A;  3LCP A;  1NCQ C;  2HWC 3;  3AZX A;  3TN9 3;  3ES4 A;  4BQW A;  4XFA A;  1RHI 1;  2X5I A;  4CP9 A;  1WCK A;  4W65 A;  2I07 B;  4MXW B;  5FYH A;  1DFQ A;  3O1O A;  4HSJ A;  1XYN A;  1YQ2 A;  3NAP B;  4RA0 A;  4AVV A;  3O1T A;  1BEV 1;  1KD7 A;  1WUV A;  2Y34 A;  1V6O A;  4IEQ A;  1LTE A;  4KNC A;  1CIY A;  4RQP C;  3LPG A;  1J3R A;  1GQP A;  2G19 A;  3LD8 A;  1JUH A;  2K46 A;  1RGS A;  3KQR A;  4EWA A;  4IV1 B;  3FHA A;  4LPL A;  5JOW A;  1WLC A;  4K7J A;  5FR3 A;  2OZ6 A;  4QPG B;  4FQZ A;  1W9T A;  3N7J A;  4IET A;  4CDU B;  4LO6 B;  4WVZ A;  3ZSM A;  3O12 A;  3LFI A;  2WNU C;  1PVX A;  2BGC A;  4NO4 A;  2IFW A;  4YPJ A;  4EJR A;  1LAJ A;  2WO1 A;  1U12 A;  2WQ4 A;  2F4L A;  3HQX A;  1A3K A;  3LEM A;  4CEW B;  4FPF A;  4LE4 A;  3THC A;  4UBH A;  2ORZ A;  4BHP A;  1EAH 3;  5KXD A;  3PJY A;  1PGL 2;  2GU9 A;  2HWE 1;  4XTP A;  3C7E A;  2DCZ A;  3MBW A;  5FY5 A;  5GZD A;  1A78 A;  5J36 A;  1NAE A;  1BJQ A;  1AX0 A;  2YB7 A;  3VBU A;  5FYI A;  1RIT A;  3BPS A;  1MEC 1;  1WKY A;  1Z7S 1;  4J1X A;  2R7E B;  2OUH A;  4IE5 A;  4LJH A;  3J7M A;  2ET1 A;  1H6Y A;  1JOJ A;  3DV8 A;  4PHZ A;  3OYW B;  2CV6 A;  3QAC A;  5EJ1 B;  1XJA A;  4K1Y A;  4AEM A;  5BNP C;  5FP3 A;  2J1U A;  5CKM A;  3O0X A;  2JG9 B;  4EQV A;  1S2K A;  1RIR A;  1QOS A;  2JEN A;  4N53 B;  1IZ3 A;  3WT3 A;  4OI2 A;  4GQ7 A;  1IQD C;  2X5I B;  4CP9 B;  2ILM A;  5FPU A;  1MAC A;  3J7L A;  2WRA A;  4MET A;  1NY7 2;  2Y6J A;  2NN8 A;  2ZX3 A;  1UY1 A;  1Y7B A;  3OD4 A;  1VMF A;  4N90 A;  5F5A A;  4QU2 A;  2Q8C A;  1OUS A;  4CCM A;  2E63 A;  1HDK A;  4UOJ A;  1TNR A;  5IJR A;  3WQ0 A;  3ZFF A;  3THD A;  4JCK A;  4M01 A;  5A3T A;  5JXJ A;  3LDK A;  2AEY A;  5FXV A;  2RDN A;  5IVY A;  2FDF A;  3OUI A;  3PIJ A;  2VZT A;  1W2A X;  4EN9 B;  5FK7 A;  2QQK A;  1RUF 1;  1R08 3;  4QWN A;  4YYO A;  1GU3 A;  2WNO A;  2XUE A;  2P3J A;  5A1L A;  4OMD A;  4KWL A;  2VOK A;  3PME A;  3CF6 E;  2Y6G A;  1ND2 A;  3OF1 A;  4Q4W 2;  5A7N A;  5B4X A;  1UL9 A;  2YPD A;  5C3P A;  1J83 A;  4SBV A;  2QQM A;  5T55 A;  3KCX A;  1OQD A;  1A34 A;  1QY4 A;  4IDZ A;  3WW4 A;  4QPY A;  1BK0 A;  1L3J A;  5HXM A;  2ADE A;  3AMP A;  2Y26 A;  5A7P A;  1OHF A;  1PO2 1;  4FPL A;  3B00 A;  3WNL A;  1FOD 2;  1HRI 1;  1HJG A;  2Z69 A;  3VBU B;  3I2O A;  2A75 A;  2E7T A;  1WLD A;  3WP3 A;  1QF3 A;  5FYZ A;  4G3Y C;  4LUL A;  5IK7 A;  2PTM A;  3PJQ A;  4YVW A;  2R04 2;  1C1L A;  3S0M A;  4OHY A;  2ZKN A;  2JKB A;  4J25 A;  3CHX A;  1G7Y A;  4JQR A;  1XB9 A;  3POG A;  1M4W A;  3SH5 A;  2B8M A;  3O0W A;  2VMD A;  3ZXL A;  2C0Z A;  5F32 A;  1U5Z A;  2XL7 A;  5A7Q A;  1AR9 1;  1W8Z A;  2ZGM A;  3BIW E;  2EAK A;  3R4S A;  4NHY A;  2E26 A;  2PLV 3;  2YZ4 A;  4FO9 A;  4COY A;  1N1S A;  1TME 2;  1VBA 1;  1XXN A;  2R06 2;  3POE A;  5FWJ A;  3WXP A;  1J59 A;  2IUW A;  2ZMN A;  1OI6 A;  2JIJ A;  2R1B A;  4W50 A;  1LKN A;  1ULC A;  1S0C A;  1W8O A;  2ARA A;  4MGI E;  3E97 A;  4JDN A;  1NLQ A;  5LRS A;  3O1P A;  4Y5S A;  2RMU 1;  2XXZ A;  5FPZ A;  4QPW A;  3I2D A;  2WL1 A;  2Z79 A;  4FQ4 A;  3JQX A;  1QJX 2;  2W2I A;  3DXT A;  3AC0 A;  2B5H A;  5IVV A;  1BVP 1;  3TEW A;  3AXE A;  2JE7 A;  4RS5 B;  1BVV A;  4QXK A;  2PHF A;  1G9D A;  5H9P A;  2FMD A;  3ZYR A;  1X36 A;  1ND2 B;  4Q4X 2;  2VUJ A;  1FX5 A;  3DPR A;  2WS9 3;  1XSR A;  4K40 A;  4MX3 A;  4TLG A;  2VO5 A;  4QHB A;  1PM7 A;  1LGB A;  5HPO A;  4ZY9 A;  5FPV A;  3ST7 A;  4WV8 A;  3BKZ A;  1UZY A;  1ZBA 3;  1BKZ A;  2O8Q A;  4ORF A;  1RMU 2;  1C8M 2;  2DVB A;  2MEV 1;  5FY9 A;  4D6S A;  1QJU 2;  2D97 A;  4IXL A;  5CFD C;  1H1I A;  4ARY A;  3U0Z A;  2WIN B;  1W99 A;  2VNR A;  2VM9 A;  3N35 A;  3QH7 A;  5FZ3 A;  5GZG A;  2RS3 2;  2OZJ A;  4AOC A;  2BV4 A;  3ACL A;  5E88 A;  1R09 1;  3OTF A;  1QKQ A;  2WAA A;  4GD4 A;  2VOV A;  4IQP A;  1KJL A;  2D98 A;  3ZFG A;  5IFP A;  5HV4 A;  3KV4 A;  1HKD A;  1O3R A;  3NV1 A;  2JIG A;  4RQP A;  5AVA A;  2W1Q A;  5FYY A;  3U10 A;  4D7T A;  2VD7 A;  2Y6F A;  4N7I A;  4NAM A;  2XBO 1;  4ES8 A;  4XFI A;  2V5D A;  3GYD A;  2DU1 A;  4GA9 A;  1STM A;  1UYP A;  2P1B A;  3Q9O A;  1DQ0 A;  2WNU A;  2K9Z A;  1C57 A;  3IBM A;  1W04 A;  3QLQ A;  4AWD A;  2LW8 A;  1ODN A;  2E32 A;  3WG2 A;  3ZSJ A;  1JHN A;  1GOF A;  5F3I A;  3VD3 A;  2DBN A;  2IWG B;  2WYS A;  1JN2 P;  1Y43 B;  3LFM A;  4KWU A;  3SNM A;  2PQS A;  2GC2 A;  4P9I A; 
#chains in the Genus database with same CATH homology
 2VUD A;  5A6Z A;  2JDY A;  1W8H A;  4AOC A;  5A6Y A;  2BV4 A;  2JDP A;  2JDK A;  5HCH A;  2JDH A;  1GZT A;  5A6X A;  1W8F A;  3ZDV A;  2VUC A;  5D2A A;  1OXC A;  2JDM A;  1OUX A;  1OVP A;  2BOI A;  5A70 A;  2VNV A;  2WRA A;  2JDU A;  2BP6 A;  4UT5 A;  1OUR A;  2JDN A;  1OUS A;  1OVS A;  2CHH A;  2WR9 A;  1UQX A;  1UZV A;  3DCQ A;  5A3O A;  4CE8 A;  2XR4 A;  5A6Q A;  2BOJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...