1E5IA

Delta-r306 deacetoxycephalosporin c synthase complexed with iron and 2-oxoglutarate.
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
306
structure length
264
Chain Sequence
MDTTVPTFSLAELQQGLHQDEFRRCLRDKGLFYLTDCGLTDTELKSAKDIVIDFFEHGSEAEKRAVTSPVPTMRRGFTGSMCYSMGTADNLFPSGDFERIWTQYFDRQYTASRAVAREVLRATGTEPDGGVEAFLDCEPLLRFRYFPLRMAPHYDLSMVTLIQQTPCFVSLQAEVGGAFTDLPYRPDAVLVFCGAIATLVTGGQVKAPRHHVAASRTSSVFFLRPNADFTFSVPLARECGFDVSLDGETATFQDWIGGNYVNIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords DEACETOXYCEPHALOSPORIN C SYNTHASE
publication title Kinetic and Crystallographic Studies on Deacetoxycephalosporin C Synthase (Daocs)
pubmed doi rcsb
source organism Streptomyces clavuligerus
total genus 82
structure length 264
sequence length 306
ec nomenclature ec 1.14.20.1: Deacetoxycephalosporin-C synthase.
pdb deposition date 2000-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03171 2OG-FeII_Oxy 2OG-Fe(II) oxygenase superfamily
A PF14226 DIOX_N non-haem dioxygenase in morphine synthesis N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.330 Mainly Beta Sandwich Jelly Rolls B-lactam Antibiotic, Isopenicillin N Synthase; Chain 1e5iA00
1W3VA 2VBBA 1E5IA 1OBNA 1RXGA 2VE1A 1UO9A 1W3XA 1BK0A 5C3SA 1W05A 1HB2A 1UZWA 5C3PA 1E5RA 1W2AX 5C3RA 2JB8A 2CSGA 2Y6FA 4XAEA 1W06A 1QJEA 1QIQA 1ODMA 1ODNA 3ZKUA 1W9YA 2IVIB 2WO7A 3OOXA 2VBDA 1W03A 1HJGA 1OC1A 1IPSA 3ON7A 5C3QA 1BLZA 4RGKA 1HB4A 2IVJA 2VCMA 2DBIA 1GP5A 1W28A 1RXFA 1HB1A 2BJSA 1HB3A 1W04A 1GP6A 1E5SA 1QJFA 1W2NA 1UOBA 1UOGA 1GP4A 3ZOIA 2BU9A 1E5HA 1UOFA 2VBPA 1DCSA 2BRTA 4BB3A 5C3OA 1UNBA 2VAUA 5APAA 3ZKYA 2DBNA 1HJFA 1WA6X 2JB4A 1W2OA 2Y60A
chains in the Genus database with same CATH superfamily
1QQP2 4HBNA 1O3SA 5A7PA 2JWPA 3VZMA 5ANNA 3KF5A 2V4VA 4V2WA 4JTNA 1GWKA 1LRHA 2ZX1A 2J1VA 5F37A 4RQPB 2MEV2 4JGYC 2ZX4A 4ZS3A 5I0UA 5IATA 3S57A 3PVNA 1W8HA 5J36A 3S30A 3ZPOA 5JPMB 2VCAA 1Y3TA 2OZJA 3ZMNA 1RMU2 5DAXA 3EJKA 3H3LA 4XZPA 1RB8G 4YARA 5LASA 5EHDA 1RUF3 2WA4A 2AYHA 2W95A 1C8NA 4HONA 1JS9A 2X10A 4MGKE 2RM23 1D4M1 4ZONA 4WM8B 5K7PA 4FP3A 5I8SA 1RUE3 2W1SA 3MLJA 4LBQD 5K4LA 3AZXA 4NRMA 4CP1A 5I0RA 2JEMA 4RN5A 4F83A 1V6NA 2ZOEB 5GM0A 1DIWA 3VBOC 2KD7A 1GBGA 3A23A 4QU2A 1B35B 3PIGA 3FL7A 2EAAA 1AR62 2WSUA 1V6OA 3D6EA 2R041 1DLCA 1Z78A 1ZYBA 5CFCA 4RHV1 1KRIA 3T08A 4NIIA 3VZLA 2EXKA 4CUBA 4M0NA 2D43A 3SHRA 4IEVA 2Z79A 1ULCA 3KV4A 1QKQA 4QQHA 4FXGB 4RSUA 3TWIA 2VZSA 4XUTA 4OULA 2YC0A 5FZOB 4CDWA 3NAPC 2E6VA 3ES1A 3AVRA 4QX7A 3AL5A 5ANQA 1PO13 5ABJA 1HN0A 1VBC3 5AVPA 3MIGA 4GH4A 4A3ZA 3RYKA 4SBVA 4TWTA 3M3EA 4MH0E 5FZCA 5GZGA 4XBNA 2IXCA 4JX0A 4CU9A 1GOFA 1W04A 2UY9A 5F1RA 1RUNA 2BNMA 4AI9A 1RUD1 4B1LA 1G9FA 3SLIA 3Q8AA 3OBRA 1H30A 4CEYC 1XXNA 2R6QA 2WWUA 2VQ0A 1W8WA 1ZBE2 1KFUL 4Z8BA 4C8DA 1IG3A 2CWSA 1BZWA 3G6JB 4KMQA 1C5IA 1ZBA1 2VBPA 1BBT2 3VBOB 2DFCA 2D6LX 1XYNA 4FTSA 3AP7A 4OQ9A 4XTMA 3T30A 5M0TA 1HIXA 5C8CC 3VUOA 2HEWF 4MGTA 1OUSA 3DGTA 1CVNA 2AC1A 1OQDA 1Y4WA 2F17A 4R4ZA 5A7OA 4KNCA 3TEWA 3PTYA 2RMU1 1VBB1 1W9WA 3MHZA 3NV1A 2OZ6A 4DS0A 1U5ZA 4TZDA 4MGZE 5DXDA 4N43C 1J58A 3OGGA 1J3PA 1SLLA 3RI9A 2WQ4A 2LRPA 1YFUA 2BVVA 2A6WA 4OI4A 1HJFA 5EZWA 3N9LA 3KV9A 3NAPB 4XCAA 2BEOA 4HANA 5FP7A 3VDDC 5FDBA 5EQUA 3GALA 1QHDA 1J3QA 1WCKA 2VULA 4BJ0A 4CCEA 1PVC3 3LDKA 3VBHC 2XDVA 2ZKNA 1CD3G 4G3YC 2WLPA 1LENA 5J7MA 1SPPA 1SHWB 2RE9A 3OBTA 4AI3A 1VPHA 4AHYA 4E2QA 3OD0A 1QJY3 5A3MA 5B4NA 1LEDA 2E51A 4CEYB 1JYTA 3VD4A 5JCTA 2E53A 3C7HA 4META 3BU0A 1W39A 1KDKA 4HT1T 4UW6A 1LOFA 4IEYA 1NLRA 1W99A 5FPUA 4K20A 2FDKA 2VXRA 3ZFEA 2ZGNA 1NLQA 1XSRA 4I0BA 5FYMA 1YHFA 3USUA 5KC5A 1UN1A 3O1VA 2JG9B 3IKWA 4MGSA 4FVVA 4XUOA 1LEMA 1H8VA 1QJX3 4XDPA 3O0WA 2R30A 2AEZA 3B93A 4YM2A 2PYTA 2F4PA 2A3YA 1BXHA 1S0EA 1WD4A 3DYOA 2WR9A 4ZZ5A 1BKZA 2CSGA 1N3PA 3ECQA 4CDUA 3C7EA 1GU3A 5GZFA 4XQWA 4Y5Z0 2VOWA 4AR2A 5JPNB 1EAH3 3ZFFA 3Q8BA 2RS31 3ZKUA 1RUJ2 5EYXA 4LO5B 4UFJA 1FYUA 4Q8LA 1TME1 4YVWC 3SC7X 3RRDA 3WW4A 5A6QA 1ZREA 2A5ZA 4WVMB 4D7SA 2P17A 4NJ4A 3U37A 3B94A 1HJGA 2YZ4A 1TQ5A 1J59A 2AENA 2QQLA 5DAWA 4EZ4A 1ZZ6A 1TZOA 4AZZA 1W8OA 1W9FA 2P3JA 1LU2A 1GYKA 1RITA 1W8FA 2JJ6A 5FKCA 3DUIA 3HOBA 5EJ1B 2Y26A 5C4WC 4S2GA 4CEWA 2D6OX 4D94A 4XFFA 4A7ZA 2XLAA 4IEZA 5DDJ2 4UAPA 3DEMA 2CHHA 2W5FA 4Y3OA 4AVCA 5CAZA 5A33B 1ZX5A 1UY4A 1T2XA 1CPMA 4L97A 3I3DA 1HB1A 2CDOA 2WO3A 2P3IA 3J8F1 4XETA 1D2QA 4QXKA 3RYRA 2ZHNA 5SV8A 4M3CA 4YVSC 4Q4X1 4NWVA 1PIV1 2DDUA 2IXIA 2CGOA 5JAXA 4YZ5A 4K21A 1QNWA 4LO4B 5LBFA 5HBAA 2FD8A 1KXGA 2VH9A 1UOGA 3PDQA 2DUQA 4UYBA 2YMZA 2W2IA 1UY1A 2YC2A 2IZWA 2ZABA 3WHTA 1RIRA 1DGLA 1FAYA 1MVEA 1NY72 4KWKA 3WG1A 2DCJA 2F6BA 1ST8A 2X5IC 2D7FA 4KBZA 1E57A 1UY0A 5FYSA 5H9QA 2ZMNA 5FZ0A 2FDFA 5L7OC 5DZGA 1W6PB 4GD4A 3MW2A 4TYSA 2Y0IA 3CQOA 4MUVA 3VKMA 2VMEA 1LNSA 4AQSA 4XIKA 5FMCA 3BB6A 1R1A3 4KGQA 3ZYJB 3ZXEA 1SFYA 1XYPA 1PGW2 1O5LA 3TBDA 4LO7A 4AAPA 5FYHA 2IWGB 2D3PA 3PVBB 1AXKA 3UV9A 1OVPA 4Q4Y3 3S7EA 4AFCA 2JKXA 1FOD3 4RQPA 4N9IA 2PAMA 2VQAA 3NV2A 4IXLA 4XHXA 5IK4A 2E26A 4YVSB 4NVPA 4EV0A 4C1XA 4HMZA 1UMIA 3SCGA 1NG0A 2J42A 2PMWB 1VR3A 2W39A 4LE4A 3CZJA 2ZEXA 5G04L 1RXGA 1G9CA 2RS53 2XPJA 5ACA3 1V9U1 3B9IA 4Q4V2 1JYVA 1UZZA 2ZEZA 2HJIA 3JD71 3RZLA 2VG9A 3WNMA 1XNCA 1WW7A 4JVAA 2ZX3A 4B4PA 1DDLA 1COV1 4WM8A 3CJIC 2VOVA 3NWKA 2PHTA 1KGYA 3K3NA 1SFNA 2YUEA 3D82A 1OLRA 1JYXA 1YJKA 2VPVA 3B02A 2WZR1 3UT0A 3WQBA 2QZ2A 5HXMA 1JMUB 2BUKA 2ZPXA 4AFAA 3ME2A 1B35A 3BOWA 2OS2A 1W06A 2C5DA 2EA7A 3JBG1 4I01A 5FPBA 2I45A 1UMZA 5JR2A 2O1QA 3IMNA 5FZDA 4YW7A 1UCXA 2DCYA 1ACCA 4FPFA 3SITA 4CCDA 4D6RA 4Q1RA 2J1TA 3RG0A 2N7GA 4P9JA 4QXCA 2WINB 3AP4A 5A3UA 3ZXGA 3ZO0B 1OQ1A 1UYYA 1YCIA 3FZ3A 3T2PA 3ZXDA 2XMLA 2HWC3 5FZOA 1D0HA 2YPJA 4P9LA 1S2BA 5JIAA 1Z7S1 4H2AA 5C70A 4Q27A 3TNQA 4Y1ZA 1ZRDA 4IGOA 1XNDA 3ZYIB 1LTEA 4XW3A 4E8CA 2IVJA 1RUF2 4XPVA 2QE3A 4CCMA 2W68A 1DYOA 5FJHA 2RM22 3SCHA 1DYKA 5JDBA 3V0BB 1RUE2 1UXZA 3GHNA 1GP6A 4HLTA 1C1LA 4XUQA 2RDSA 4AEMA 4CP9B 3BTZA 1YLLA 4LBLA 2W52A 2QQIA 2ZACA 2AZ5A 1XNAA 3VBOA 4LR4A 2ES3A 1S2KA 1KDMA 1ULGA 2ZEWA 3OPWA 4BQ4A 1NLSA 1O8PA 4UFLA 1GOGA 1R091 1UOFA 5FY1A 1LOBA 1SBEA 2HWB1 5GALA 3VKNA 5A3LA 5IT6A 1GWLA 2XH6A 2VVDA 2LUWA 3RMYA 1QOTA 4WM7C 1H4HA 3WF2A 4FPKA 1C8M2 3U07A 4LT5A 5FPXA 1PO12 1NYWA 1JTZX 1VBC2 2TEPA 1WA4A 2Z69A 3LSDA 3LZZA 3NAPA 4NRPA 5DZEA 1LCLA 3AZYA 5DAVA 1D4M3 5A3NA 2GC1A 2JDNA 1PO22 4Y1YA 1L7LA 1LHOA 2D6KA 2WBKA 1XNTA 4CCLA 5LZ6A 2K0GA 2VNRA 5KBFA 1B09A 2UWAA 4IETA 3ALQA 3R4SA 3J7HA 3AKTA 1AJKA 2Y60A 4CEYA 2QKDA 1PHMA 3CU7A 2WNVB 4ATEA 3JZVA 2EIBA 2R043 1VBA1 3LF7A 4RHV3 4W6YA 2HWE1 3GZUC 4LHLA 4HFSA 5T5LA 3UESA 3WUDA 1RGSA 1TG7A 4Y22B 2JG9A 1ULEA 1MEC1 5BY5A 3VHPA 3EHKA 4RFT0 3M1HA 3OB8A 4KWLA 2VM9A 2ZZQA 4IEUA 1RUI1 2FZ2A 4Z2WA 1CZVA 4L9BA 4DINB 1BEV1 4ZXKA 4B4RA 2UY8A 2VZRA 4A6OA 4BQ5A 2DURA 3C7OA 1QH6A 2BGOA 4MSVA 4A4AA 2VOXA 3CHXA 1OD5A 1ZZ7A 3BIWE 4Q1PA 3TAYA 3O1TA 2Q4SA 2QQUA 2XJQA 4LIVA 1T6BX 1APNA 1RUD3 1XE7A 2ZGOA 1VAVA 3HJRA 1PVC2 3JXSA 4WVMA 5DUXA 3URFA 4DRVA 1RUG2 1KJRA 1W9SA 4GJYA 4YFZA 4OQ8A 3D8CA 5HI0A 4ASMB 3HQRA 1QJY2 4URAA 4XYXA 4XEZA 4L8QA 4DXRA 2JECA 3TRSB 1ZM1A 3PMSA 1ZBA3 4CCJA 4BK5A 3PJYA 1RHI1 5I0SA 2XVGA 3ZYGA 2P6HA 4Y33A 4F7ZA 2VVEA 1D0GA 1H9PA 1Q8VA 1UPIA 1W8NA 1OC1A 3ZN6B 1AX2A 2C4XA 1K3IA 4XCBA 2QTWB 1MZ5A 3ON7A 5I91A 1C5HA 2VMCA 4GH4C 4Y1XA 5A80A 2C9KA 3HIFA 2XHKA 5CZKA 5A33A 3R0RA 2DBIA 2RMU3 1QJX2 1RUH2 1VBB3 3FN9A 4XAAA 5LATA 3V64A 1O3RA 4DEVA 3LA7A 4Z92B 4HKLA 4BXSV 5C7GA 4H55A 4CU8A 1WBLA 1I1EA 4CTEA 3NRUA 1PZ9A 2B5HA 1ULOA 1AHSA 3EMRA 3VZJA 2QQWA 3WP5A 2E7QA 3OCPA 4XF9A 1WLDA 5E16A 3NNJA 1DGRA 3FBYA 3DV8A 5FO7B 4OLLA 1EAH2 2ZGUA 3ITQA 2ZGRA 4R9DA 5T5OA 5FZIA 5FMOS 5A7WB 5CBLA 1AJOA 3WF1A 2WQZC 2EICA 2Y64A 4IV1B 4M00A 1IGOA 3HAGA 5KHHA 1ZA7A 3HT1A 4B7EA 4IESA 1W6PA 1JW6A 4BYYA 4LUMA 3ELNA 3WF0A 1CAWB 1F9KA 5FZ1A 5C3OA 4I0WB 4DEQA 5DUUA 2TUNA 4N7UA 2ETEA 1P8JA 3T1MA 1V6LA 3O7OA 3NVCA 4N7IA 1RJ7A 3KT4A 3MPBA 4BE3A 4D69A 3PUHA 2OPWA 5I0DA 1OHFA 4PI2A 1XB9A 2GN3A 4JQTA 5FXXA 4QPIB 1RTVA 1VMHA 1WA6X 4BZ4A 2OXBA 4HN0A 5FZLA 4BQ2A 4YVSA 5EJZB 4TLGA 1FX5A 4UOJA 4GZ9A 2ARXA 4PQQA 4YM0A 2RS33 2D40A 4BM8A 1OF4A 2GNTA 3D3AA 3NW4A 2XJSA 1JYNA 1TME3 5FZFA 3BPZA 3D0JA 3VN4A 4O9EA 5CYYA 4MXVA 4DO0A 1G8WA 1LOFC 1YUDA 3BTAA 4XFAA 1AL21 1OH4A 3NJYA 1TMF1 1NQDA 2WNUB 5F8PA 3JU9A 5GLWA 2WYFA 4M4RA 2Q8DA 4P5YA 2WFPA 2J22A 3ASIA 1YEWA 4R9AA 4Y20B 5IK7A 4QX3A 1OA3A 1IS5A 3NNMA 4MGIE 1LHUA 2BOIA 4I0AA 3FHQA 1LU1A 4NMIA 4S2FA 1XPWA 4AFDA 4QHBA 4CDQB 3ZSKA 4E4ZA 2ADDA 2W1UA 1ZRCA 2XJPA 1A8MA 1K5MC 1R1A2 1HQNA 1HB2A 3D5OA 3OY8B 1ZRFA 3HT2A 3JQWA 1E5RA 3DECA 3J8F3 4IEPA 2CNAA 2FQPA 3SEEA 4EWAA 4JDNA 3GZAA 3HNYM 4Q4X3 1PIV3 4Q4Y2 2JDHA 3I2IA 1FOD2 4JHTA 4YZ3A 4PBOA 5FOJB 3DXUA 3GHMA 2IXHA 4L2NA 2VUAA 3CIHA 1QDOA 5DQ0A 5L9VA 4CU7A 2PFWA 3MF9A 2W08A 2VUCA 2RS52 2FCVA 5LBCA 5G05L 4A42A 1EP0A 3EXUA 4C1WA 2OIIA 4R4XA 1UIJA 3AFKA 4CEWC 3MF6A 3KMHA 1UOJA 4DMIA 4MZUA 1PGL2 5CKNA 4Q0SA 4MGQA 4P9GA 3V0BA 3LDRA 4M01A 1DBNA 3WF3A 1AYN1 3MO4A 2CYFA 2JICA 1HKDA 4CP9A 1OF3A 4XTPA 3UETA 1QXRA 2ORXA 5FY5A 3HNMA 2O0OA 2W87A 4IL7A 1ND3C 1K5MB 2R1BA 4D6QA 3BUCA 3U1XA 1CIWA 1UOBA 1MVQA 3POJA 4PCRA 5F2SA 4DUWA 1YC61 1SLTA 1O3QA 1WBFA 4QDRA 4AK3A 4A3XA 5LBEA 1VJ2A 1YNAA 3WP6A 3ZN4A 1XYOA 4E4SA 3I7DA 3BVCA 2B8MA 1Q3EA 2HWC2 2ZGQA 3GBGA 3AM2A 3IPVB 3DYMA 1V9U3 5J37A 4HKOA 3N9MA 5FUPA 3JD73 5CU1A 5FP8A 4JAAA 3HMYA 5HPOA 1X50A 4ASKA 1GWMA 4NIGA 2V5YA 1COV3 3CZUA 2YGLA 4GWMA 3H7JA 4X8PA 4AEDC 4JGZC 1RC6A 1OMIA 3WQ0A 1SDWA 2WUHA 4BMBA 1UXXX 4HSLA 5FZ7A 4ZS2A 4P9XA 1ZRRA 2FCUA 2WZR3 3PL0A 4AQ2A 1KS4A 2V72A 2WIIB 2WNVA 3ENRA 4QHOA 4WVVA 3MFAA 2H6BA 2VW1A 4KL1A 1SBDA 3JBG3 3I97A 4FO9A 4XOGA 4WZCA 4D7YA 1JODA 2Z42A 1WLWA 3KCCA 4CU6A 2EAKA 1SLIA 2G9GA 3M3IA 1O4TA 3PJQA 1OKOA 3OGVA 3ZVXA 1ND3B 1CESA 1UYPA 2K46A 4WZFA 2GP5A 4N9HA 2ZGSA 3IDEA 3H42B 1VBE1 2DVFA 5FY7A 3RVHA 4A6SA 4E27A 5FYCA 3WCRA 3HEIA 3T1LA 1ULFA 3GZEA 3NKTA 1DGWX 5JSRA 3HPNA 1Z7S3 3NNGA 5FY4A 5JOWA 3U75A 1BK0A 1IS4A 1MQTB 1O7FA 1PNGA 3WOGA 1UQXA 2YGMA 3DF0A 2B45X 4LOSA 4AE2A 4CUGA 1QJU1 1B35C 1D4M2 1BQPA 4ONUA 4QKFA 3NSTA 2VZ3A 1XSQA 3KCXA 5FBJA 4AI1A 2OKXA 2B39A 4DY3A 3BYWA 1PK6C 5IAXA 2ZBJA 4JGZB 3ST7A 4AEDB 4OCTA 4I2OA 5C3RA 5LRSA 2L9LA 2AH2A 4Z2AA 1Y9QA 2DTYA 4K1YA 3GCXA 1URXA 4GWJA 1QJEA 4LULA 3ATGA 4Q2FA 1W6MB 4RR3B 3KM5A 1IPJA 1W9TA 5E6HA 3DKQA 3RFRA 3I2OA 5A3PA 3VD5A 3WF4A 3ZN6A 1IS6A 2YY1A 2R042 5D21A 4HETA 2WS91 5A3WA 4RHV2 2GU9A 3MLLA 5CA6A 1R093 2PHFA 4TTGA 5F7UA 2HWB3 5IVVA 4MADA 1KITA 2C0ZA 5LA2A 2SLIA 2LTNA 5EWSA 4ET7A 4QGMA 3WNXA 1OQEA 3ACIA 3ES4A 3PIJA 2XJTA 3WDXA 1O3TA 5EYYA 4I3PA 5C5UA 1Y9MA 4QKDA 1UD1A 3AYDA 1AR71 5IJRA 2CGPA 3U11A 1N3OA 1NQJA 3M3OA 5KXDA 2FDJA 2JE7A 4YGCA 4LBNA 3VLBB 4XBLA 3ACGA 1OKQA 1CPNA 2E63A 2GC0A 4XURA 4QD2A 5IWFA 3HWJA 1GQGA 1H6YA 1PVXA 3N9NA 5BNOC 1WWYA 1ZZBA 5A7WA 1HDKA 1V70A 2YYOA 3FHIB 2E33A 4IV1A 1YIFA 3I3EA 1H8TB 1JXNA 4HK8A 4QU1A 5FLHA 1OPOA 3WQ1A 3MV11 4UW5A 4M0HA 2QUOA 1PK6B 5FBZA 4OUMA 3ILFA 2WC2A 1CAWA 2O8OA 4XBQA 4B3NA 1ZBA2 1VBA3 1DZRA 3LEGA 1HXS1 2HWE3 1WW5A 1H1MA 1H2MA 1LOAA 1V6JA 2DV9A 3D4KA 3NJVA 1MEC3 1QQP1 5T52A 1HQWA 3ACHA 4JV4A 5HCBA 2B42B 3VBSC 3K75B 2Z5WA 1UYZA 5IVCA 1RUI3 3HBKA 3AMNA 4JTOA 1DQ1A 2DUPA 2VNOA 4XFIA 2C9AA 1BEV3 2RMU2 1VBB2 2NPIA 2XWBB 4QPIA 4OHYA 3LWCA 2VY0A 3RGBA 3WDWA 1OPMA 3AP9A 5APAA 4AW7A 5F2WA 1A34A 1RMU1 3E97A 4RGAA 3LIGA 2Q1ZB 3PURA 4GB31 5BNOB 5T55A 1SMVA 4Y5TA 5FLJA 2JG9C 1ZZ8A 3LEKA 3O1RA 1LODA 2UWCA 2YU2A 3KB5A 1V6MA 4DQAA 2ET7A 2VBBA 3AKPA 4Y20A 1RHI3 1VAKA 3T0DA 3M7AA 2PHWA 5H9RA 2VVFA 4CDQA 1WW4A 5IK5A 1U5YA 4GA9A 3J26N 4P08A 4AHWA 4FPCA 3WSOA 2HWD1 4E8DA 4ZU4A 3OY8A 1PMHX 1R081 4OFGA 4C91A 2Y8KA 3AP5A 5FZKA 5K9YA 3VBSB 3B69A 4OI0A 2BZDA 1JZ5A 4HSJA 3V0AB 3TEZA 3I49A 1U12A 3MIEA 5E88A 3M2MA 2RJ2A 3WW2A 3LEMA 4FOYA 4DXTA 5ERLA 4OVEA 3P6BA 2NM1A 4XF1A 2RS32 4LOTA 5BUVA 4K8RB 3F95A 2OUHA 2WZ8A 4J25A 5EPAA 2BBVA 1TME2 4FPEA 1SLCA 2BPA2 1OI6A 5A1AA 1W9YA 3OBZA 4QPGC 4Q29A 3F2ZA 3VD3A 5AC91 3VZOA 5C5TA 5C9AC 2JDZA 2VL4A 3IN9A 2PXJA 3OOXA 4BOWA 1M06G 5GZDA 1VBD1 2XVLA 1MZEA 4OHWA 3J7LA 4MGYE 1JZ2A 4IGPA 3OEAA 2YDEA 5A3OA 4AVBA 4IEXA 3UJOA 1GFF2 2C1FA 1WGPA 1BBT1 2A7AA 4PHZA 3BU7A 2XJUA 1OT5A 4Q0UA 2J7MA 4QQLA 3VDCA 1LHNA 1NCRB 5FZAA 1CR7A 3AZWA 1GV9A 2HEYF 1AZDA 1EUTA 3KT1A 4YW2A 1K5MA 1ZNPA 1UZYA 1RXFA 3FLRA 3J8F2 3LD8A 3PVEA 3QCWA 4FPYA 3WG2A 4GJZA 4IEOA 5IK8A 1D7PM 2OPKA 4NWWA 1PIV2 3G7DA 3IIAA 1W2TA 1LECA 1VMFA 5F3GA 3CF6E 3T09A 2PA7A 3NL1A 4GALA 1IKQA 1CGPA 1AF9A 1TNFA 4G4FA 4FSJA 2J1AA 5JUVA 3M70A 4YW1A 3K4DA 3IAPA 4OMCA 1C4RA 4HKWA 1F35A 3IPVA 4JRLA 1JUIA 4ZXEA 2DWRA 1IPKA 3LA2A 1E5HA 1AL23 5D1IA 4XDQA 3THTA 1TMF3 2VOKA 1SQ4A 2Q8EA 4QPGB 4Y26A 4AYUA 4BB3A 5C9AB 3T2TA 4FOQA 4LXLA 1NX9A 3CLPA 3GJBA 1IHMA 3B9CA 3EBRA 2QBXA 4X6QB 2GMEA 2P6CA 4CCOA 3I3BA 5JR7B 3VBUB 3FMGA 1UNBA 4SLIA 3MIFA 3UL2A 3AZVA 1Q5OA 2VOTA 4WVWA 2P3KA 3VDBA 1FMD1 4QDSA 4QKNA 5FZBA 4CP0A 2ZGTA 2WNEA 3W20A 3M3QA 1C1FA 4BMEA 3Q9OA 3H8XA 1V6KA 5I93A 4N53C 1ND3A 1N47A 1R1ZA 1RUC1 4ATFA 2EF6A 1OFNA 1OLMA 2EALA 4YG6A 1UU6A 2XBO1 3USSA 1XU2A 5LA9A 5FZMA 3H0OA 3KVBA 1FATA 4CCKA 5T54A 2WDBA 3T4VA 1JUHA 2FBEA 1GICA 4OI2A 4UI9L 5H9SA 4A41A 1HRV2 3AC0A 4NN0A 1WUVA 1V9U2 2YPDA 3RZHA 4UW3A 5T50A 1U5IA 1MQTA 4LKDA 1SLBA 2PHUA 3JD72 5CISA 1W6QB 1K5JA 4LNVA 1GQHA 1CN1A 4XFGA 5HV4A 1K45A 1PM4A 4K9SA 3NJZA 1HLCA 1OA2A 4Y4RA 1UKRA 1W0OA 2BNNA 2GNBA 2OUJA 3W9AA 4AEDA 3K4ZA 3ACFA 4JGZA 1AYN3 4AEJA 5JMOA 4ISRA 2GZWA 1DQ6A 2CTVA 3BPSA 2X09A 5FYIA 4FP2A 1WLCA 4RR3A 1F5FA 3B00A 1H2KA 2GH2A 1IKPA 4K40A 1JZ6A 3N7MA 4XAEA 3RJ2X 3RZJA 4OI1A 3PUSA 4LA2A 3O5SA 5A7QA 4UF0B 3WW1A 3VL9A 4NHXA 4MV2A 1AX1A 3MIBA 4WBBA 1PZ8A 5FK8A 2HYKA 3N7KA 5JI7A 4N53B 3ETPA 2IVIB 1W6OB 1G86A 3O1OA 3SKJE 1GZWB 1Y43B 1A78A 1YFWA 5A7NA 2R062 2DVBA 3RWKX 2PLV1 3VHOA 3O14A 5KXBA 2ZZJA 4DNYA 5HCAA 1Z7S2 3N35A 2D6PA 4KG0A 2EXHA 1CZTA 5DPNA 1NZIA 5FTTC 3AKSA 2HYXA 3RZZA 2RDNA 2CAVA 1WZXA 4LUKA 4DPNA 2I74A 2VCMA 2DVGA 1UKGA 4AFBA 3ZYBA 3N9QA 2XVKA 3WXPA 4O9GA 4W8JA 2AR6A 4AL9A 3U0ZA 2BJSA 2UU8A 1STMA 2W91A 4KI5M 1DQ5A 1PK6A 3KF3A 1OD3A 1XNBA 2BFUL 3PNAA 2RVAA 2DVDA 3VKFC 4B7KA 5JIUA 4TXWA 1UZ0A 2IC1A 4XJUA 4A2UA 4QB1A 2WKKA 3JB8A 4UBHA 2R0HA 1RUOA 1LGNA 1I6XA 4PLMA 2ORZA 1ND2C 3N7JA 3HQXA 1R092 4LBOA 5CKQA 1VBE3 4YW5A 2HWB2 3GBWA 1UL9A 2ZEYA 5FZHA 3RS6A 1JYWA 4MOAA 3PLQA 3AX4A 1PMJX 1QWRA 4JHZA 2DTWA 1IZ3A 3EYPA 1HRI1 1JYIA 1O4YA 4YW4A 1O8SA 1QGLA 2VR4A 3HN1A 5FWEA 5C6CA 3J7MA 4QB2A 3A0KA 4AVTA 2WNVC 1QJU3 2HLEA 3H1WA 4QM9A 3ZSJA 5A70A 2XONA 3PUAA 4K6BA 5LK7B 5CKMA 4A7YA 2ZHKA 3IWZA 3H8OA 1QOOA 1I3HA 4UFHA 3KV6A 5BNOA 1JHNA 2DUOA 4N90A 4LKFA 5IFPA 1UAIA 1LKNA 4FPJA 2YHJA 3AP6A 1EY2A 3FWEA 1LJ7A 4AGVA 1WW6A 1UZVA 1VBA2 2WS93 2HWE2 5C3PA 2UURA 1MS3A 2YFUA 2P3YA 4LHNA 3C7FA 1MEC2 2XLFA 2VE1A 4HL0A 1EV11 2OW4A 2Q1FA 5JZGC 1MS0A 4HPKB 3AXDA 4CPBA 1ND2B 3WNPA 1JHJA 3VBSA 1RUI2 5FAXA 1AR73 1D2SA 3T3YA 4AVSA 3V0AA 1RYYA 2VC9A 3JQXA 5L36A 5FREA 4AEKA 1H4GA 1OLQA 2OA2A 3M3CA 4L0PA 1HV0A 5IAVA 5TSWA 1YQCA 2Q8OA 4M4PA 5CADA 3OTFA 4CCNA 1L7QA 1NXD1 2NMNA 4IGQA 3ACLA 2D98A 4HK9A 1UZWA 2IXLA 5I8YA 3L9JT 3AZZA 4YGBA 3I2KA 2LS6A 3NNFA 1A3KA 1CAXB 1W2AX 4QQOA 2PELA 2BTVC 2A6ZA 1L7RA 3LAGA 4B4QA 2BERA 5A32B 3I2FA 2V73A 4HZFA 2A1XA 3L2HA 1JU3A 4MYEA 2VTFA 2YXSA 3KZ4C 1HXS3 1RHI2 4LK6A 2A3XA 3VKLA 4UBGA 3M4FA 2WFF1 1XNKA 4EN6B 1UW8A 1QQP3 2DF7A 2WO1A 3H9AA 1PGSA 3OYWB 4ES8A 2VO5A 2BQPA 2XJVA 4XJWA 3THCA 1NCRA 1ZZCA 3LCPA 3I59B 4FQ4A 3RPQA 2H0BA 4AHXA 4AVAA 2VCBA 3IDBB 1H1AA 4LKEA 3IAQA 5JZGB 3QOPA 4LQRA 4IV1C 3DL3A 4K8FA 1YFXA 2LROA 1GMMA 1OOPC 2I07B 1DQ2A 1HQLA 2JDYA 1RMU3 2QQKA 1C8M1 1HB3A 3AMHA 1EYBA 1VLNA 4XF4A 5FZEA 2Y0OA 5FPLA 4GB33 3ZMOA 1W2NA 5GZCA 2ZGKA 2E32A 1XQNA 3POIA 4GWNA 1GANA 2FZ1A 3NNLA 1PO21 2OQ6A 4K1ZA 4QPGA 3RMXA 1U0AA 5C9AA 4HVOA 4Q0QA 5K0UC 4A44A 2PTMA 2A73B 2G9ZA 1RVF1 3EQEA 5FCCA 3MEPA 5LA0A 1X8EA 1UWWA 4QPIC 4K7JA 2HBTA 4XMAA 3UGFA 3ORJA 1VRH1 1REFA 1IOAA 2HWD3 3MIDA 3VBUA 3FUOA 5BV6A 2BW8A 4MG2A 2VZ1A 4PI0A 3SISA 2LM3A 2QDRA 2XG3A 4MLOA 1R083 1WD3A 4NHLA 1GZ9A 1WLTA 4PF5A 3KS7A 5LK5A 5FY0A 1F8VA 5FWJA 1X33A 1X82A 5D2AA 4LO6B 1CZSA 2W46A 2FMDA 2WL1A 1N3QA 4AFMA 3H50A 4IE5A 4PDWB 3ZX7A 2EIGA 5F9TA 4CUCA 5FPVA 5FZ6A 2ZJCA 4JDMA 4LO8A 1JU4A 2GAUA 3RI8A 4W6XA 2QQOA 2WNUC 1AX0A 4CPBD 4DRRA 3O1PA 3H8UA 3UGHA 3VL8A 1SCRA 4BU2A 1UX7A 4FOWA 4GWIA 2BBAA 2VTXJ 3P3PA 3TN91 4WVZA 4AVVA 4QX0A 1OOPB 3I2GA 4GKXA 1JOPA 1UMHA 2ADEA 1QJZA 4CDQC 4A45A 3VHNA 5AC93 3K4AA 1TMF2 1E5IA 3L2YA 2VZQA 5JI9A 3DCQA 1VBD3 1OUXA 2IUWA 5FZ9A 4B8EA 1RUG1 3IB3A 1PM7A 2VMGA 3S6PA 2ZKLA 3FLTA 4I3GA 4P9YA 5K0UB 2J1RA 3RZKA 1BBT3 2OQ7A 1CQ9A 3AKQA 3UJQA 4NPMA 1Q8PA 1UY2A 4R9BA 4Y4YA 3IZOA 3ROUA 1QNYA 5T5PA 5GLVA 4ZU7A 1Y7BA 4YPJA 4BCUA 2X05A 2Y38A 3MIHA 1ZRIA 3K46A 4IEWA 4UF0A 4Y1VA 5GLUA 2X8KA 1W8UA 2PAKA 4FOVA 1RUH1 4N53A 1W6OA 3QH6A 4X8NA 1FPN1 1GZWA 3ZDVA 3LQCA 4XE9A 4N8MA 3BGAA 4DUVA 2VU9A 1BJQA 1SZBA 1M4WA 4B1MA 3WG4A 3SQOA 2GSYA 1DFQA 3CKHA 3MW3A 4LE3A 4CYDA 2VCCA 2FDGA 2JKBA 1XC6A 1BMV1 4EWEA 4EZHA 3J4UH 5LRRA 4AI2A 3P5BA 4ASLA 4FT8A 1HB4A 1AYN2 4LORA 1WCUA 4Q0PA 1AYM1 2QDNA 3B5LB 5C8WA 3TYJA 4KG8A 3VGIA 1W28A 2NMOA 1VB4A 2XKPA 3POGA 1FMD3 1L3JA 3N3HA 3LFIA 3FHAA 4RS5C 5FZ3A 5HCHA 2JG8C 2WAAA 3M8LA 3VBRC 1Q8SA 5FMDA 2VTXA 3GM8A 4YZ2A 1LHWA 1E5SA 1RUC3 2WA3A 1Q43A 5JVVA 2XBO3 1SCSA 4IQPA 3UNPA 2FDIA 3RZMA 2WQ8A 3AYCA 5J3UA 5FZ8A 5ACA2 2Q30A 3SH4A 3WV6A 3U4XA 1AR91 4NE9A 2WYSA 2GNMA 3MW4A 4QDQA 3I3MA 5BNPB 5JXHA 4ES9A 4HVQA 1W2UA 2KR2A 1CIYA 5IVFA 4A7KA 3FX3A 4BIFA 1DCSA 1N1TA 1N1YA 1FNZA 3E6DA 4IW3A 3SNMA 4XF0A 5LY2A 5HV0A 3ZM8A 4ORFA 4AI8A 3KSCA 2B4KA 4NOTA 3AMMA 3GNEA 1GLHA 1PX4A 4H7LA 1BK1A 5CG9A 3QACA 3GF6A 1NZCA 2RG4A 3ZSMA 1GKBA 2WO2A 2XXZA 4YG3A 1JZ4A 4LK7A 4BWOA 1S2EA 2P5BA 2RDRA 4DIQA 4IE0A 5GJ6A 2Y6LA 4XZUG 5DUVA 4QM8A 2OYZA 2W1WA 2BDRA 3WP3A 1HX6A 2VZUA 5EIYB 4RS5B 2ZMKA 4O61A 2JG8B 3VBRB 1NT0A 3MGUA 2AACA 1DZTA 3ILNA 1MQTC 1VBE2 4HPKA 1D4VB 1ND2A 2W94A 5C71A 3DPRB 3K77A 4XQDA 3U10A 1IQDC 2RR11 3WINE 3RYPA 1OBNA 2PLV3 1X9TA 3GBFA 2VMFA 1JZ8A 3HQUA 3H8RA 2HWF1 1W3XA 2R071 3SCFA 4NIAA 2RS11 2EIDA 3O1UA 5BNNC 4YSFA 5LEKA 3K51A 4RR3C 4OZOA 2CDPA 3WCSA 1QJU2 2KM2A 2YG0A 1T6GC 4H7MA 5BPXA 5J96B 2ZX2A 1IG0A 3OF1A 4BDVB 3MDPA 2OVUA 4E2GA 3ZYPA 2VJXA 4Q4W1 5DUWA 4COVA 1MS9A 5FXZA 1PGL1 4JDOA 5A32A 2CGNA 3WVJA 1GZTA 1KFXL 4Y22A 4FTEA 2PHLA 4LBJA 4LJHA 2P1BA 2J1SA 1VB2A 5JOXA 4ZKTB 2YBSA 3N9PA 1J1TA 2WS92 3E6BA 5FIXA 3ZXKA 3IDAA 2E7AA 3KHCA 4P9IA 1ASJ1 3OYWA 3WY6A 1ENRA 2NQYA 1ULPA 3VBFC 1I5ZA 2C26A 4IERA 3I59A 3T2OA 4IUGA 3FJSA 2A6YA 4J1WA 4COUA 2J1UA 4MVTA 2DFBA 5JZGA 4RD7A 4FFIA 1H1IA 1MPXA 1AR72 2AGSA 1HRI3 1Q8OA 1H8TC 3H7YA 2K2SA 1XJAA 1AR81 1F4AA 4QQPA 5BYNA 1LR5A 1BLZA 1POV0 3LOBA 3AYAA 3Q8FA 1VMJA 5FJKA 4AWDA 3E5XA 4C0HA 1TNRA 4X6RB 1RL3A 2MHFA 1O59A 2C24A 5F5AA 2TNFA 5BNNB 2D3RA 3POFA 1DF0A 5FZGA 2G9FA 2X53S 3WDTA 5IHRA 4YG0A 5FY8A 2ZAHA 4XC9A 4YGDA 1R64A 3PMEA 2NN8A 3FUQA 3I4IA 2IFRA 3BTYA 1VE0A 3LDBA 1VRBA 2B46X 2GP3A 3AB0A 2ARAA 4LHKA 3KCYA 2XB6C 4FPGA 3PUIA 1CJDA 4PIZA 1H2NA 5EP9A 4CDXC 1EV13 5DMYA 2A3WA 4OUEA 2Y33A 1LOEA 4Q8KA 2XUMA 4LA3A 3J7NA 4YNIA 5SV5A 5T5JA 3VBFB 1OA4A 1ULDA 4PDWA 5J48A 2ERFA 3ZYFA 4FFGA 2JE9A 1RUD2 1SBFA 3DKWA 4FXKB 5A6ZA 5FOBB 1OURA 5FP4A 3C2UA 4P02B 5CFDB 5KHGA 3A21A 3SXWA 4GQ7A 1OOPA 1JOJA 5FP9A 4CXXA 3BKZA 2NP0A 2YB7A 2FCTA 4L99A 4GB32 4CUAA 1W0PA 1YI7A 3UYJA 4FBFA 2VECA 3RWNA 3JB4C 5L19A 1G7YA 3WNOA 2PQQA 2R16A 3LA3A 5L9BA 5JSPA 2I2SA 1ZVFA 1W3VA 5KWRA 4NPLA 4RGGA 4Y1UA 1S0GA 2JDAA 3JUUA 1N1SA 4QAWA 4AG4A 4CCCA 2XOMA 4DOUA 2WFF3 1LOGA 5K0UA 4ZZ8A 4DUXA 3B7MA 1JOBA 5AVAA 5FYBA 2HWD2 3VKOA 1GR3A 2MEV1 4HXCA 4M3CE 4UW4A 3LB9A 3H3ZA 5FR3A 2CWMA 1YJLA 4J1XA 5DABA 3ZSLA 1R082 1NE6A 2CAUA 2R49A 3SH5A 3KVAA 4CDXB 5AFBA 4LIUA 1YQ5A 2HKXA 2VD7A 3A4UA 3VHRA 3H3UA 4DB5A 1AXYA 3POWA 3MLKA 3NQHA 2JIGA 1SFPA 3OG2A 1OLME 1FT9A 4E4HA 4LLFA 2RJLA 4UWDA 4LKSA 2YFZA 2WWSA 4JGYB 1FV3A 4D0QA 3HD8B 1C8M3 4BLJA 1FXZA 2P37A 4XILA 3UGGA 3POSA 2WNUA 1RJ8A 3VD7A 1DHKB 2JD9A 2MNGA 5LWBA 4XABA 5JOZA 5JXIA 1MS1A 2HBUA 3Q8CA 3H1MA 1GSLA 1PO23 4OHVA 3AKRA 2E7TA 1XOYA 5AC92 3AK0A 3U14A 5J1XA 4JKLA 2RHPA 2Q0AA 4LHSA 3THDA 1CONA 1NCRC 1W6NB 1VBD2 2Z2SB 3LGRA 1AR61 4E9KA 1RVF3 1YXWA 2XKOA 4LEJA 1VIWB 2B7YA 1W03A 5FMBA 1VRH3 2GN7A 3ZIWA 1MS8A 4M3CF 4QWNA 2WT0A 1REDA 4UFIA 5FQ0B 4Z1VA 3QH7A 1CAUB 5F6LB 1WMFA 3PTRB 4UFMA 3HN3A 4D6SA 4QX5A 2A75A 5KR7A 1C57A 4CVUA 3PVOA 4MX3A 4F3JA 2BP6A 1DGWA 4XXAA 5JWPA 4V2VA 4XMIA 1UU4A 4P5HA 3ZN5A 4IV3C 4OMDA 2DCTA 3WLUA 3VV1A 1WMDA 5IVBA 3BN6A 3LE0A 2Y6JA 3CBNA 2GDFA 2NYYA 5T3NA 3TN93 1XE0A 5BNPA 3AJZA 1DQ4A 1I5PA 4MXWB 1QMJA 3CDZB 4ISQA 4P00B 1IQAA 2VQTA 4LPLA 3ZPYA 1S1AA 1MS4A 2ARCA 3JCIA 3VBUC 3MUY1 3T4HB 1F15A 1ZBE1 4GMP1 5K8SA 3OPTA 4BQ1A 1CAVB 5KHKA 5F32A 4EN7B 3H1YA 1RUG3 3E1F1 4TLFA 3FE5A 3KLSA 2A6VA 3ZXAC 2Z4FA 2JD4A 2YBPA 3PU8A 4NHKA 5FY9A 3GJAA 4GIQA 4BLIA 4BPZA 2VMIA 3RJRA 2WWJA 3PHMA 2XR4A 3WHUA 4XJAA 4FPOB 5LY1A 2D5HA 1WCSA 2XLGA 4Q4X2 2GALA 3ZDSA 5FUNA 5JLVA 1QXJA 1FMD2 3TEXA 4COZA 3PUQA 4PQ9A 4C90A 5DAQA 3RQ0A 3TEYA 4RS5A 1DYPA 2JDKA 4NHMA 2JG8A 2GMPA 1RUC2 3VBRA 5C8CB 1DZQA 1AVBA 1RUH3 2XBO2 5L9RA 5JXJA 1FPN3 3DPRA 4KBBA 1VP6A 5F3IA 4EWDA 4NHYA 5EFUA 3INAA 4IV3B 2W9XA 3ZYRA 3I2JA 1GUIA 1W8ZA 2EXJA 4OHXA 3TNPB 1POQA 2CY6A 4PT6A 3VDAA 4EYUA 1YI9A 1X8MA 3LIHA 4IEQA 4N43B 4AQTA 5FXVA 3KQRA 4DZGA 3MICA 1MS5A 3WNNA 3C8XA 3OEBA 3PU3A 3VDDB 3W5MA 2QQNA 2FDHA 5A6XA 4KWJA 1F5JA 4K3UA 4YZ1A 3VBHB 1QF3A 2XL7A 3I8TA 3O0XA 1C28A 2D5FA 2A6XA 1AYM3 1MZFA 5F3CA 4J6GA 3ILRA 4Z82A 3AMQA 3N36A 4IE7A 4BIOA 2K9ZA 2PHRA 1WMXA 2WLQA 4GULA 4W6WA 3S0MA 3W21A 1MZ6A 3POYA 1XRUA 3HBZA 2ZXQA 5D8AC 4DXZA 2BWCA 2VUJA 2XL9A 3LSEA 3S5AA 1AR93 1TE1B 1NUKA 1ODNA 3WDUA 1TVGA 1RUJ1 2EIEA 1HV1A 2PLV2 3C7GA 2W0XA 2OX0A 1YYNA 2VBDA 5CIRA 1COV2 5F3EA 1HW5A 1ENSA 4FCAA 4EJRA 3OGJA 4JZRA 2ZGMA 5DG2A 2WN3A 5FXWA 1JH5A 1XE8A 1YIPA 2IXKA 4FPLA 4BK4A 2VZOA 2R0FA 5BNNA 2WZR2 4YVWB 3T2QA 1W6MA 1VAMA 3THPA 1UIKA 3FFZA 5F5IA 2BGPA 3JBG2 2W3JA 4JKKA 1N1VA 5DDJ1 4ZU5A 3LKJA 4BQWA 4AQ6A 5H9PA 4AGGA 1WCDJ 5F5CA 4BHPA 3VB9A 2P4EA 2D6NA 2VW0A 3X29B 5KC6A 4ZHNA 4I30A 1QJFA 3ZXLA 1XU1A 4NRQA 1WMEA 4P9WA 2ZGLA 5C4WB 4LMFA 3ABZA 2GH8A 5FO8B 3TB0A 4QB6A 2QFEA 2CV6A 1S0JA 5J98B 1KD7A 3T0AA 2JDMA 1H2LA 1NCQC 1S4CA 2BFUS 2IFWA 2RR13 2WABA 4Q0VA 4HN1A 3I54A 4OYUA 5D8AB 2X29A 5BXXA 3T0BA 3VBFA 1ZZ9A 4CZSA 4G9SB 2NZ9A 3MYXA 1NY71 2ENRA 2HWF3 1BYHA 1HRI2 2R073 5IVYA 4D3WA 2ATFA 5IVEA 2RS13 4R8HA 4AXOA 2QNKA 1H8TA 5CFDA 4XVHA 1WCQA 1PNFA 1HRV1 1UYXA 2UYBA 1CX4A 4JRAA 1QXPA 2KXLA 4GKYA 2BV4A 2ZMLA 4NROA 4O7XA 4YWAA 3R6SA 1YWKA 2X5IB 4Q4W3 3SEPA 3HR9A 2V09A 1JZ7A 2A70A 3LFMA 4QGLA 2DBNA 4W4ZA 3ZIXA 3POEA 4XXPA 1OVSA 4FQZA 5FYTA 1K12A 1RINA 4GAZA 1PGW1 1Y9GA 3RDIA 1S55A 5L7OB 4LBMA 1W2OA 5LCWL 3MV01 5IYYA 2VMHA 4LLOA 3VD9A 3QBQA 4XIOA 3OUIA 1LHVA 4AOCA 4QT6A 1ASJ3 1AXZA 4YRDA 2XQRA 1UF2C 5GKAC 1UU5A 2HH9A 1EV12 3RNSA 4DXSA 2D6MA 1U5XA 2VMDA 4XFHA 3ZFGC 4NO4A 1QOSA 3MFCA 4FFHA 3DXTA 3U78A 4CDXA 2D93A 2GNDA 4YW6A 2Q1MA 4EQVA 3AFGA 2JENA 4RYDA 4XACA 3W59A 3NJXA 1NCQB 5ISLA 5LEJA 4EN9B 5B4XA 4UFKA 2CU5A 1AR83 1QU0A 4Q4V1 2BVBA 2W1QA 3IBMA 1DGRN 1UY3A 2R061 4JC1A 4JGYA 4QPWA 2SBAA 3WP4A 5A3TA 2R32A 5BNQA 4CRQA 3KGZA 1NE4A 4O65A 5EJ3A 1ALYA 1YQ8A 1O91A 2ZCWA 4CXYA 2XWJB 2UWBA 1XBFA 4QMAA 4W65A 5CB7A 3ZYHA 4Y24A 1G9AA 1GNYA 2PHXA 4Z07A 1QEXA 4HOOA 4S2DA 4XFCA 3KT7A 2HEVF 4RA0A 1W6NA 2QVSB 3E6CC 5LW9A 1POV1 3CNAA 5FLIA 3CJIB 1ODMA 3KQ4B 4QX1A 4PBPA 2DU1A 1A6CA 5B2GB 3OUJA 4WV8A 2WFF2 2QJVA 3AL6A 1OSGA 1PZ7A 3EB7A 3GGLA 4AHZA 5FQ0A 5FZ4A 2QQPA 1CAUA 4ARYA 5FO9B 4BH9A 1W8TA 1BEV2 5I8TA 1PX3A 5FRAA 1SACA 2XHNA 2WRAA 1O4ZA 2QQMA 3ETQA 1DG6A 3AXEA 1LOCA 2EXIA 4NAMA 4NAOA 4ARXA 5C3QA 3O1MA 2JX9A 3ZFGB 2VZTA 1JN2P 4AF9A 4KQ7A 4I02A 4LBQB 3WEZA 1FI2A 4KU7A 4YFWA 3CO2A 1MR5A 1RUF1 3I2DA 1ONAA 5IW0A 1DP0A 3N4MA 3GYDA 2RM21 4I09A 2WSVA 3N9OA 4MXWA 3S7IA 5DG1A 3AVSA 4EN0A 4PF1A 3RZGA 1O6UA 1RUE1 2D44A 5F5QA 1NA1C 1X9PA 2JDUA 5IUQA 3WUCA 3CEWA 1H6XA 1YFYA 1YO8A 3ZXFA 3CMGA 2DCZA 1CAVA 1WKYA 1Z0HA 2MPFA 2Y6KA 3ZLIA 3NKGA 3LPGA 4D7TA 1GP4A 1I9RA 4XQ4A 2VGDA 1X36A 1J83A 2BU9A 1RVF2 1S0CA 2FMYA 1JBCA 1S0DA 4L11A 2NLRA 4PJYA 4PDWC 2R1DA 2WAOA 1VRH2 5FPZA 4NUBA 4QQ2A 2MEV3 5DZFA 4AI0A 4XUPA 1NOVA 4CA9A 5HCFA 4KWUA 1LESA 3KGLA 2J1EA 2YV8A 1SG3A 2DVAA 3LPFA 4S2HA 1CWPA 5FKBA 4UXAA 3BTXA 2JDPA 2R7EB 5GLTA 4U36A 4CP2A 4XF3A 1ENQA 5C8CA 4URTA 3K2OA 5A1LA 5FK7A 2BNOA 1PO11 1VBC1 2ZAAA 4KH9A 2ID4A 3WR0A 3R05A 4P14A 4H3WA 2JXAA 4IV3A 3ZKYA 2DCKA 4E2SA 4WM7B 2VZVA 1OH3A 3FFQA 3AYEA 1EUUA 2E9QA 2H6CA 5E1RA 3TN92 5CEHA 4N43A 4JCKA 3HVDA 2WT2A 2UYAA 1H9WA 1LB2A 2LALA 4YZ4A 3V56A 1NXMA 2DYCA 2ILMA 3VDDA 1YRZA 3KV5A 1X7NA 3O0VA 5A7SA 1NA1B 1NAEA 2YC4A 4TN7A 2C6SA 5CFCC 4IDZA 4XJZA 1AR63 3AMPA 3OJBA 3S5QA 2PAEA 3VBHA 1GNZA 1UO9A 4EN8B 4BXFA 4XFBA 1S0FA 3MPPG 3W5NA 1BVVA 4AGRA 1S0BA 3CL1A 4FAGA 2D97A 4GMP0 1DU3D 2QZ3A 2GMMA 4PLOA 4HVRA 1W05A 5F6KA 1SEFA 3LOIA 3BALA 1F31A 4CDWC 3IT8A 5ABJC 3WNLA 4EE2A 1W0NA 3OGSA 3R4DB 2W92A 5IVJA 4F8AA 5KXCA 3N7LA 2WZPP 5FFOC 3GZTB 3MBWA 5E89A 3NV4A 3B3QE 1DLLA 1BCXA 1FPN2 3OSDA 4OZXA 5J09A 2JB8A 2Y6FA 1A8DA 1AL22 1EPZA 3HNBM 2YU1A 2RDQA 1W6QA 2ARBA 3P1IA 4INDA 2AEYA 3EO6A 1PVC1 1QH7A 1J3RA 3POBA 4MHRA 4NPRA 1W90A 4H14A 5HXVA 5E8AA 1HN1A 3WDYA 2E31A 2W47A 1PMIA 1ZBE3 4GMP3 3WNKA 5C33A 1QJY1 2BYVE 1MACA 2WT1A 4HG6B 3NMBA 4XHBA 2Q5TA 3I3QA 3LEIA 1BMV2 1V00A 4YVWA 5FYVA 2WNOA 1IPSA 2VNVA 3E5UA 3GXUA 3Q8EA 5CFCB 1K42A 4DY5A 2ET1A 5FUIA 4RGKA 4TSVA 3IDCB 1AYM2 3OBAA 1IS3A 2XQXA 1QJX1 4KU8A 3R4UA 1NKGA 2GC3A 5FMOL 5BNPC 3MZHA 5KHIA 4Y5SA 5C4WA 3B01A 2WJSA 4CDWB 5LA1A 3IM0A 1YQ6A 5ABJB 4QHZA 4GH4B 1REEA 5EV7A 4U2AA 2AREA 2DU0A 5D8AA 1AR92 1EAH1 4QX2A 2A71A 3ZR6A 5EXOA 3GCWA 1ZA4A 3MI8A 3ZOIA 1J1LA 1G9DA 4D8MA 3KWVA 1SDDB 1SLAA 5KHJA 3A0NA 4QX8A 3TOJA 2Y6HA 2Y34A 4NR1A 3J9SA 4C0BA 3AJYA 3WDVA 3I2HA 3FC0A 4XDOA 3ZFEC 1BHGA 2X5IA 1G9BA 1C3HA 1JYCA 2B9VA 2JE8A 4L92A 5C3SA 4Q5OA 2FHRA 2Q8CA 4AAXA 4KGGA 4UT5A 1F4HA 5AFEA 2QCSB 2QQJA 4OHZA 3SMHA 4BA6A 3NO8A 5L7OA 4MO3M 2PHDA 3BIEA 1YQ2A 3DPRC 3VZNA 3WG3A 3OD4A 1CX1A 2VZPA 3A22A 2G19A 4R52A 1OFSA 4FFFA 4FPHA 4LTAA 3O1SA 2D3SA 3OUHA 2JB4A 4NIDA 2TBVA 5L73A 4CDUC 4EROA 2AUYA 2OT7A 4QPYA 1ENXA 3SH3A 5FV3A 5GZEA 3DN7A 3ZFFC 4B29A 3UKNA 1FNYA 2B9UA 2G4IA 1V6IA 2BOJA 2Y6GA 1DQ0A 2RR12 1RUJ3 1LGCA 1NCQA 2F4LA 1JI6A 3A7QA 3ZXJA 5DN2A 1TEIA 1Q56A 3WT3A 1Q8QA 2HWF2 4QGNA 2R072 2RV9A 5FYYA 2V5DA 4ZY9A 4BQ3A 5LB6A 3FLPA 1KQRA 1SPPB 5GLZA 3V65A 2RS12 3NV3A 4E4DX 3UKVA 5A1FA 1EPWA 4PLNA 4PIXA 1UX6A 2ZS6B 1QDCA 4MHUA 1CJPA 3KHBA 4XJ9A 2ZX0A 4YGEA 4CSWA 3QD6A 2VQUA 2ZA9A 4Q4W2 5FYUA 3ZFEB 5DDJ3 4COYA 1AL0G 1G6NA 1GZCA 3USUB 4Q26A 4RFRB 2P34A 1R1A1 4CXWA 3W58A 3K48A 3CJIA 1US2A 5JOYA 4R9CA 5I0TA 1J84A 2PN5A 3D0SA 4YM1A 5CG8A 2VW2A 3WW3A 1GNHA 2VUDA 4Q4Y1 1QIQA 1FOD1 1ASJ2 4YLZA 5FYZA 4COWA 5FP3A 3RSJA 2WO7A 2V4AA 2O14A 3BCWA 4CDUB 3ZR5A 3C3VA 4BISA 2WN2A 4V1PA 3ZFFB 2VXJA 3ZFGA 2RS51 1KS5A 2G1MA 3WZ1A 5ACA1 1LAJA 4LBQA 2XUEA 1AR82 1CAXA 3BODA 3MUZ1 3P3NA 1US3A 2WZEA 2YBKA 3BI3A 2XJRA 2P2KA 3E5QA 1HRV3 3KD4A 5FPAA 3U4SA 4XJ8A 5JSOA 5JXGA 3CJXA 4FI9A 1GP5A 4JQRA 3ZSEA 3GDBA 4ITCA 1JZ3A 2IXJA 2RJKA 1FV2A 2ZGPA 2ZTNA 1QY4A 4RL7A 3BOPA 4CEWB 5CVRA 4DFSA 1V0AA 2CL2A 1KEXA 1GQPA 3O12A 1VALA 3K3OA 3UK9A 2XGXA 1LULA 4CE8A 2KA3A 3QLQA 4LITA 3DYPA 4FAHA 4YM3A 4JKMA 4RQPC 1KJLA 3APBA 1F2NA 5A6YA 2BWAA 2ZHLA 4M3CB 3IMMA 4PIYA 5DAPA 1AUYA 1S0IA 1H0BA 4YYOA 3VZKA 2BGCA 5CNAA 2GC2A 5CFDC 2EVXA 3WQ7A 3OPZA 4QKBA 5JMCA 2BRTA 2PQSA 2HWC1 1BVP1 4ZPIA 4OUSA 5LBBA 4Q4V3 1O5UA 2R063 5F39A 2YROA 4WM8C 3SKVA 4GXLA 2LW8A 4QXHA 4WM7A 4BQXA 5KXEA 4YW3A 2QQVA 3UKTA 4FTBA 3IIIA 2VAUA 4IE4A 4XUNA 3WX5A 4IE6A 3OGRA 1OXCA 1GOHA 2JIJA 4NIHA 5IFTA 2O8QA 4LBKA 1HXS2 2ZHMA 3FBMA 2VNGA 1NA1A 1LGBA 2H0VA 4W50A 1UPSA 4QXBA 4BQYA 1POV3 3WD5A
chains in the Genus database with same CATH topology
1W3VA 2VBBA 1E5IA 1OBNA 1RXGA 2VE1A 1UO9A 1W3XA 1BK0A 5C3SA 1W05A 1HB2A 1UZWA 5C3PA 1E5RA 1W2AX 5C3RA 2JB8A 2CSGA 2Y6FA 4XAEA 1W06A 1QJEA 1QIQA 1ODMA 1ODNA 3ZKUA 1W9YA 2IVIB 2WO7A 3OOXA 2VBDA 1W03A 1HJGA 1OC1A 1IPSA 3ON7A 5C3QA 1BLZA 4RGKA 1HB4A 2IVJA 2VCMA 2DBIA 1GP5A 1W28A 1RXFA 1HB1A 2BJSA 1HB3A 1W04A 1GP6A 1E5SA 1QJFA 1W2NA 1UOBA 1UOGA 1GP4A 3ZOIA 2BU9A 1E5HA 1UOFA 2VBPA 1DCSA 2BRTA 4BB3A 5C3OA 1UNBA 2VAUA 5APAA 3ZKYA 2DBNA 1HJFA 1WA6X 2JB4A 1W2OA 2Y60A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W3V A;  2VBB A;  1E5I A;  1OBN A;  1RXG A;  2VE1 A;  1UO9 A;  1W3X A;  1BK0 A;  5C3S A;  1W05 A;  1HB2 A;  1UZW A;  5C3P A;  1E5R A;  1W2A X;  5C3R A;  2JB8 A;  2CSG A;  2Y6F A;  4XAE A;  1W06 A;  1QJE A;  1QIQ A;  1ODM A;  1ODN A;  3ZKU A;  1W9Y A;  2IVI B;  2WO7 A;  3OOX A;  2VBD A;  1W03 A;  1HJG A;  1OC1 A;  1IPS A;  3ON7 A;  5C3Q A;  1BLZ A;  4RGK A;  1HB4 A;  2IVJ A;  2VCM A;  2DBI A;  1GP5 A;  1W28 A;  1RXF A;  1HB1 A;  2BJS A;  1HB3 A;  1W04 A;  1GP6 A;  1E5S A;  1QJF A;  1W2N A;  1UOB A;  1UOG A;  1GP4 A;  3ZOI A;  2BU9 A;  1E5H A;  1UOF A;  2VBP A;  1DCS A;  2BRT A;  4BB3 A;  5C3O A;  1UNB A;  2VAU A;  5APA A;  3ZKY A;  2DBN A;  1HJF A;  1WA6 X;  2JB4 A;  1W2O A;  2Y60 A; 
#chains in the Genus database with same CATH topology
 1QQP 2;  4HBN A;  1O3S A;  5A7P A;  2JWP A;  3VZM A;  5ANN A;  3KF5 A;  2V4V A;  4V2W A;  4JTN A;  1GWK A;  1LRH A;  2ZX1 A;  2J1V A;  5F37 A;  4RQP B;  2MEV 2;  4JGY C;  2ZX4 A;  4ZS3 A;  5I0U A;  5IAT A;  3S57 A;  3PVN A;  1W8H A;  5J36 A;  3S30 A;  3ZPO A;  5JPM B;  2VCA A;  1Y3T A;  2OZJ A;  3ZMN A;  1RMU 2;  5DAX A;  3EJK A;  3H3L A;  4XZP A;  1RB8 G;  4YAR A;  5LAS A;  5EHD A;  1RUF 3;  2WA4 A;  2AYH A;  2W95 A;  1C8N A;  4HON A;  1JS9 A;  2X10 A;  4MGK E;  2RM2 3;  1D4M 1;  4ZON A;  4WM8 B;  5K7P A;  4FP3 A;  5I8S A;  1RUE 3;  2W1S A;  3MLJ A;  4LBQ D;  5K4L A;  3AZX A;  4NRM A;  4CP1 A;  5I0R A;  2JEM A;  4RN5 A;  4F83 A;  1V6N A;  2ZOE B;  5GM0 A;  1DIW A;  3VBO C;  2KD7 A;  1GBG A;  3A23 A;  4QU2 A;  1B35 B;  3PIG A;  3FL7 A;  2EAA A;  1AR6 2;  2WSU A;  1V6O A;  3D6E A;  2R04 1;  1DLC A;  1Z78 A;  1ZYB A;  5CFC A;  4RHV 1;  1KRI A;  3T08 A;  4NII A;  3VZL A;  2EXK A;  4CUB A;  4M0N A;  2D43 A;  3SHR A;  4IEV A;  2Z79 A;  1ULC A;  3KV4 A;  1QKQ A;  4QQH A;  4FXG B;  4RSU A;  3TWI A;  2VZS A;  4XUT A;  4OUL A;  2YC0 A;  5FZO B;  4CDW A;  3NAP C;  2E6V A;  3ES1 A;  3AVR A;  4QX7 A;  3AL5 A;  5ANQ A;  1PO1 3;  5ABJ A;  1HN0 A;  1VBC 3;  5AVP A;  3MIG A;  4GH4 A;  4A3Z A;  3RYK A;  4SBV A;  4TWT A;  3M3E A;  4MH0 E;  5FZC A;  5GZG A;  4XBN A;  2IXC A;  4JX0 A;  4CU9 A;  1GOF A;  1W04 A;  2UY9 A;  5F1R A;  1RUN A;  2BNM A;  4AI9 A;  1RUD 1;  4B1L A;  1G9F A;  3SLI A;  3Q8A A;  3OBR A;  1H30 A;  4CEY C;  1XXN A;  2R6Q A;  2WWU A;  2VQ0 A;  1W8W A;  1ZBE 2;  1KFU L;  4Z8B A;  4C8D A;  1IG3 A;  2CWS A;  1BZW A;  3G6J B;  4KMQ A;  1C5I A;  1ZBA 1;  2VBP A;  1BBT 2;  3VBO B;  2DFC A;  2D6L X;  1XYN A;  4FTS A;  3AP7 A;  4OQ9 A;  4XTM A;  3T30 A;  5M0T A;  1HIX A;  5C8C C;  3VUO A;  2HEW F;  4MGT A;  1OUS A;  3DGT A;  1CVN A;  2AC1 A;  1OQD A;  1Y4W A;  2F17 A;  4R4Z A;  5A7O A;  4KNC A;  3TEW A;  3PTY A;  2RMU 1;  1VBB 1;  1W9W A;  3MHZ A;  3NV1 A;  2OZ6 A;  4DS0 A;  1U5Z A;  4TZD A;  4MGZ E;  5DXD A;  4N43 C;  1J58 A;  3OGG A;  1J3P A;  1SLL A;  3RI9 A;  2WQ4 A;  2LRP A;  1YFU A;  2BVV A;  2A6W A;  4OI4 A;  1HJF A;  5EZW A;  3N9L A;  3KV9 A;  3NAP B;  4XCA A;  2BEO A;  4HAN A;  5FP7 A;  3VDD C;  5FDB A;  5EQU A;  3GAL A;  1QHD A;  1J3Q A;  1WCK A;  2VUL A;  4BJ0 A;  4CCE A;  1PVC 3;  3LDK A;  3VBH C;  2XDV A;  2ZKN A;  1CD3 G;  4G3Y C;  2WLP A;  1LEN A;  5J7M A;  1SPP A;  1SHW B;  2RE9 A;  3OBT A;  4AI3 A;  1VPH A;  4AHY A;  4E2Q A;  3OD0 A;  1QJY 3;  5A3M A;  5B4N A;  1LED A;  2E51 A;  4CEY B;  1JYT A;  3VD4 A;  5JCT A;  2E53 A;  3C7H A;  4MET A;  3BU0 A;  1W39 A;  1KDK A;  4HT1 T;  4UW6 A;  1LOF A;  4IEY A;  1NLR A;  1W99 A;  5FPU A;  4K20 A;  2FDK A;  2VXR A;  3ZFE A;  2ZGN A;  1NLQ A;  1XSR A;  4I0B A;  5FYM A;  1YHF A;  3USU A;  5KC5 A;  1UN1 A;  3O1V A;  2JG9 B;  3IKW A;  4MGS A;  4FVV A;  4XUO A;  1LEM A;  1H8V A;  1QJX 3;  4XDP A;  3O0W A;  2R30 A;  2AEZ A;  3B93 A;  4YM2 A;  2PYT A;  2F4P A;  2A3Y A;  1BXH A;  1S0E A;  1WD4 A;  3DYO A;  2WR9 A;  4ZZ5 A;  1BKZ A;  2CSG A;  1N3P A;  3ECQ A;  4CDU A;  3C7E A;  1GU3 A;  5GZF A;  4XQW A;  4Y5Z 0;  2VOW A;  4AR2 A;  5JPN B;  1EAH 3;  3ZFF A;  3Q8B A;  2RS3 1;  3ZKU A;  1RUJ 2;  5EYX A;  4LO5 B;  4UFJ A;  1FYU A;  4Q8L A;  1TME 1;  4YVW C;  3SC7 X;  3RRD A;  3WW4 A;  5A6Q A;  1ZRE A;  2A5Z A;  4WVM B;  4D7S A;  2P17 A;  4NJ4 A;  3U37 A;  3B94 A;  1HJG A;  2YZ4 A;  1TQ5 A;  1J59 A;  2AEN A;  2QQL A;  5DAW A;  4EZ4 A;  1ZZ6 A;  1TZO A;  4AZZ A;  1W8O A;  1W9F A;  2P3J A;  1LU2 A;  1GYK A;  1RIT A;  1W8F A;  2JJ6 A;  5FKC A;  3DUI A;  3HOB A;  5EJ1 B;  2Y26 A;  5C4W C;  4S2G A;  4CEW A;  2D6O X;  4D94 A;  4XFF A;  4A7Z A;  2XLA A;  4IEZ A;  5DDJ 2;  4UAP A;  3DEM A;  2CHH A;  2W5F A;  4Y3O A;  4AVC A;  5CAZ A;  5A33 B;  1ZX5 A;  1UY4 A;  1T2X A;  1CPM A;  4L97 A;  3I3D A;  1HB1 A;  2CDO A;  2WO3 A;  2P3I A;  3J8F 1;  4XET A;  1D2Q A;  4QXK A;  3RYR A;  2ZHN A;  5SV8 A;  4M3C A;  4YVS C;  4Q4X 1;  4NWV A;  1PIV 1;  2DDU A;  2IXI A;  2CGO A;  5JAX A;  4YZ5 A;  4K21 A;  1QNW A;  4LO4 B;  5LBF A;  5HBA A;  2FD8 A;  1KXG A;  2VH9 A;  1UOG A;  3PDQ A;  2DUQ A;  4UYB A;  2YMZ A;  2W2I A;  1UY1 A;  2YC2 A;  2IZW A;  2ZAB A;  3WHT A;  1RIR A;  1DGL A;  1FAY A;  1MVE A;  1NY7 2;  4KWK A;  3WG1 A;  2DCJ A;  2F6B A;  1ST8 A;  2X5I C;  2D7F A;  4KBZ A;  1E57 A;  1UY0 A;  5FYS A;  5H9Q A;  2ZMN A;  5FZ0 A;  2FDF A;  5L7O C;  5DZG A;  1W6P B;  4GD4 A;  3MW2 A;  4TYS A;  2Y0I A;  3CQO A;  4MUV A;  3VKM A;  2VME A;  1LNS A;  4AQS A;  4XIK A;  5FMC A;  3BB6 A;  1R1A 3;  4KGQ A;  3ZYJ B;  3ZXE A;  1SFY A;  1XYP A;  1PGW 2;  1O5L A;  3TBD A;  4LO7 A;  4AAP A;  5FYH A;  2IWG B;  2D3P A;  3PVB B;  1AXK A;  3UV9 A;  1OVP A;  4Q4Y 3;  3S7E A;  4AFC A;  2JKX A;  1FOD 3;  4RQP A;  4N9I A;  2PAM A;  2VQA A;  3NV2 A;  4IXL A;  4XHX A;  5IK4 A;  2E26 A;  4YVS B;  4NVP A;  4EV0 A;  4C1X A;  4HMZ A;  1UMI A;  3SCG A;  1NG0 A;  2J42 A;  2PMW B;  1VR3 A;  2W39 A;  4LE4 A;  3CZJ A;  2ZEX A;  5G04 L;  1RXG A;  1G9C A;  2RS5 3;  2XPJ A;  5ACA 3;  1V9U 1;  3B9I A;  4Q4V 2;  1JYV A;  1UZZ A;  2ZEZ A;  2HJI A;  3JD7 1;  3RZL A;  2VG9 A;  3WNM A;  1XNC A;  1WW7 A;  4JVA A;  2ZX3 A;  4B4P A;  1DDL A;  1COV 1;  4WM8 A;  3CJI C;  2VOV A;  3NWK A;  2PHT A;  1KGY A;  3K3N A;  1SFN A;  2YUE A;  3D82 A;  1OLR A;  1JYX A;  1YJK A;  2VPV A;  3B02 A;  2WZR 1;  3UT0 A;  3WQB A;  2QZ2 A;  5HXM A;  1JMU B;  2BUK A;  2ZPX A;  4AFA A;  3ME2 A;  1B35 A;  3BOW A;  2OS2 A;  1W06 A;  2C5D A;  2EA7 A;  3JBG 1;  4I01 A;  5FPB A;  2I45 A;  1UMZ A;  5JR2 A;  2O1Q A;  3IMN A;  5FZD A;  4YW7 A;  1UCX A;  2DCY A;  1ACC A;  4FPF A;  3SIT A;  4CCD A;  4D6R A;  4Q1R A;  2J1T A;  3RG0 A;  2N7G A;  4P9J A;  4QXC A;  2WIN B;  3AP4 A;  5A3U A;  3ZXG A;  3ZO0 B;  1OQ1 A;  1UYY A;  1YCI A;  3FZ3 A;  3T2P A;  3ZXD A;  2XML A;  2HWC 3;  5FZO A;  1D0H A;  2YPJ A;  4P9L A;  1S2B A;  5JIA A;  1Z7S 1;  4H2A A;  5C70 A;  4Q27 A;  3TNQ A;  4Y1Z A;  1ZRD A;  4IGO A;  1XND A;  3ZYI B;  1LTE A;  4XW3 A;  4E8C A;  2IVJ A;  1RUF 2;  4XPV A;  2QE3 A;  4CCM A;  2W68 A;  1DYO A;  5FJH A;  2RM2 2;  3SCH A;  1DYK A;  5JDB A;  3V0B B;  1RUE 2;  1UXZ A;  3GHN A;  1GP6 A;  4HLT A;  1C1L A;  4XUQ A;  2RDS A;  4AEM A;  4CP9 B;  3BTZ A;  1YLL A;  4LBL A;  2W52 A;  2QQI A;  2ZAC A;  2AZ5 A;  1XNA A;  3VBO A;  4LR4 A;  2ES3 A;  1S2K A;  1KDM A;  1ULG A;  2ZEW A;  3OPW A;  4BQ4 A;  1NLS A;  1O8P A;  4UFL A;  1GOG A;  1R09 1;  1UOF A;  5FY1 A;  1LOB A;  1SBE A;  2HWB 1;  5GAL A;  3VKN A;  5A3L A;  5IT6 A;  1GWL A;  2XH6 A;  2VVD A;  2LUW A;  3RMY A;  1QOT A;  4WM7 C;  1H4H A;  3WF2 A;  4FPK A;  1C8M 2;  3U07 A;  4LT5 A;  5FPX A;  1PO1 2;  1NYW A;  1JTZ X;  1VBC 2;  2TEP A;  1WA4 A;  2Z69 A;  3LSD A;  3LZZ A;  3NAP A;  4NRP A;  5DZE A;  1LCL A;  3AZY A;  5DAV A;  1D4M 3;  5A3N A;  2GC1 A;  2JDN A;  1PO2 2;  4Y1Y A;  1L7L A;  1LHO A;  2D6K A;  2WBK A;  1XNT A;  4CCL A;  5LZ6 A;  2K0G A;  2VNR A;  5KBF A;  1B09 A;  2UWA A;  4IET A;  3ALQ A;  3R4S A;  3J7H A;  3AKT A;  1AJK A;  2Y60 A;  4CEY A;  2QKD A;  1PHM A;  3CU7 A;  2WNV B;  4ATE A;  3JZV A;  2EIB A;  2R04 3;  1VBA 1;  3LF7 A;  4RHV 3;  4W6Y A;  2HWE 1;  3GZU C;  4LHL A;  4HFS A;  5T5L A;  3UES A;  3WUD A;  1RGS A;  1TG7 A;  4Y22 B;  2JG9 A;  1ULE A;  1MEC 1;  5BY5 A;  3VHP A;  3EHK A;  4RFT 0;  3M1H A;  3OB8 A;  4KWL A;  2VM9 A;  2ZZQ A;  4IEU A;  1RUI 1;  2FZ2 A;  4Z2W A;  1CZV A;  4L9B A;  4DIN B;  1BEV 1;  4ZXK A;  4B4R A;  2UY8 A;  2VZR A;  4A6O A;  4BQ5 A;  2DUR A;  3C7O A;  1QH6 A;  2BGO A;  4MSV A;  4A4A A;  2VOX A;  3CHX A;  1OD5 A;  1ZZ7 A;  3BIW E;  4Q1P A;  3TAY A;  3O1T A;  2Q4S A;  2QQU A;  2XJQ A;  4LIV A;  1T6B X;  1APN A;  1RUD 3;  1XE7 A;  2ZGO A;  1VAV A;  3HJR A;  1PVC 2;  3JXS A;  4WVM A;  5DUX A;  3URF A;  4DRV A;  1RUG 2;  1KJR A;  1W9S A;  4GJY A;  4YFZ A;  4OQ8 A;  3D8C A;  5HI0 A;  4ASM B;  3HQR A;  1QJY 2;  4URA A;  4XYX A;  4XEZ A;  4L8Q A;  4DXR A;  2JEC A;  3TRS B;  1ZM1 A;  3PMS A;  1ZBA 3;  4CCJ A;  4BK5 A;  3PJY A;  1RHI 1;  5I0S A;  2XVG A;  3ZYG A;  2P6H A;  4Y33 A;  4F7Z A;  2VVE A;  1D0G A;  1H9P A;  1Q8V A;  1UPI A;  1W8N A;  1OC1 A;  3ZN6 B;  1AX2 A;  2C4X A;  1K3I A;  4XCB A;  2QTW B;  1MZ5 A;  3ON7 A;  5I91 A;  1C5H A;  2VMC A;  4GH4 C;  4Y1X A;  5A80 A;  2C9K A;  3HIF A;  2XHK A;  5CZK A;  5A33 A;  3R0R A;  2DBI A;  2RMU 3;  1QJX 2;  1RUH 2;  1VBB 3;  3FN9 A;  4XAA A;  5LAT A;  3V64 A;  1O3R A;  4DEV A;  3LA7 A;  4Z92 B;  4HKL A;  4BXS V;  5C7G A;  4H55 A;  4CU8 A;  1WBL A;  1I1E A;  4CTE A;  3NRU A;  1PZ9 A;  2B5H A;  1ULO A;  1AHS A;  3EMR A;  3VZJ A;  2QQW A;  3WP5 A;  2E7Q A;  3OCP A;  4XF9 A;  1WLD A;  5E16 A;  3NNJ A;  1DGR A;  3FBY A;  3DV8 A;  5FO7 B;  4OLL A;  1EAH 2;  2ZGU A;  3ITQ A;  2ZGR A;  4R9D A;  5T5O A;  5FZI A;  5FMO S;  5A7W B;  5CBL A;  1AJO A;  3WF1 A;  2WQZ C;  2EIC A;  2Y64 A;  4IV1 B;  4M00 A;  1IGO A;  3HAG A;  5KHH A;  1ZA7 A;  3HT1 A;  4B7E A;  4IES A;  1W6P A;  1JW6 A;  4BYY A;  4LUM A;  3ELN A;  3WF0 A;  1CAW B;  1F9K A;  5FZ1 A;  5C3O A;  4I0W B;  4DEQ A;  5DUU A;  2TUN A;  4N7U A;  2ETE A;  1P8J A;  3T1M A;  1V6L A;  3O7O A;  3NVC A;  4N7I A;  1RJ7 A;  3KT4 A;  3MPB A;  4BE3 A;  4D69 A;  3PUH A;  2OPW A;  5I0D A;  1OHF A;  4PI2 A;  1XB9 A;  2GN3 A;  4JQT A;  5FXX A;  4QPI B;  1RTV A;  1VMH A;  1WA6 X;  4BZ4 A;  2OXB A;  4HN0 A;  5FZL A;  4BQ2 A;  4YVS A;  5EJZ B;  4TLG A;  1FX5 A;  4UOJ A;  4GZ9 A;  2ARX A;  4PQQ A;  4YM0 A;  2RS3 3;  2D40 A;  4BM8 A;  1OF4 A;  2GNT A;  3D3A A;  3NW4 A;  2XJS A;  1JYN A;  1TME 3;  5FZF A;  3BPZ A;  3D0J A;  3VN4 A;  4O9E A;  5CYY A;  4MXV A;  4DO0 A;  1G8W A;  1LOF C;  1YUD A;  3BTA A;  4XFA A;  1AL2 1;  1OH4 A;  3NJY A;  1TMF 1;  1NQD A;  2WNU B;  5F8P A;  3JU9 A;  5GLW A;  2WYF A;  4M4R A;  2Q8D A;  4P5Y A;  2WFP A;  2J22 A;  3ASI A;  1YEW A;  4R9A A;  4Y20 B;  5IK7 A;  4QX3 A;  1OA3 A;  1IS5 A;  3NNM A;  4MGI E;  1LHU A;  2BOI A;  4I0A A;  3FHQ A;  1LU1 A;  4NMI A;  4S2F A;  1XPW A;  4AFD A;  4QHB A;  4CDQ B;  3ZSK A;  4E4Z A;  2ADD A;  2W1U A;  1ZRC A;  2XJP A;  1A8M A;  1K5M C;  1R1A 2;  1HQN A;  1HB2 A;  3D5O A;  3OY8 B;  1ZRF A;  3HT2 A;  3JQW A;  1E5R A;  3DEC A;  3J8F 3;  4IEP A;  2CNA A;  2FQP A;  3SEE A;  4EWA A;  4JDN A;  3GZA A;  3HNY M;  4Q4X 3;  1PIV 3;  4Q4Y 2;  2JDH A;  3I2I A;  1FOD 2;  4JHT A;  4YZ3 A;  4PBO A;  5FOJ B;  3DXU A;  3GHM A;  2IXH A;  4L2N A;  2VUA A;  3CIH A;  1QDO A;  5DQ0 A;  5L9V A;  4CU7 A;  2PFW A;  3MF9 A;  2W08 A;  2VUC A;  2RS5 2;  2FCV A;  5LBC A;  5G05 L;  4A42 A;  1EP0 A;  3EXU A;  4C1W A;  2OII A;  4R4X A;  1UIJ A;  3AFK A;  4CEW C;  3MF6 A;  3KMH A;  1UOJ A;  4DMI A;  4MZU A;  1PGL 2;  5CKN A;  4Q0S A;  4MGQ A;  4P9G A;  3V0B A;  3LDR A;  4M01 A;  1DBN A;  3WF3 A;  1AYN 1;  3MO4 A;  2CYF A;  2JIC A;  1HKD A;  4CP9 A;  1OF3 A;  4XTP A;  3UET A;  1QXR A;  2ORX A;  5FY5 A;  3HNM A;  2O0O A;  2W87 A;  4IL7 A;  1ND3 C;  1K5M B;  2R1B A;  4D6Q A;  3BUC A;  3U1X A;  1CIW A;  1UOB A;  1MVQ A;  3POJ A;  4PCR A;  5F2S A;  4DUW A;  1YC6 1;  1SLT A;  1O3Q A;  1WBF A;  4QDR A;  4AK3 A;  4A3X A;  5LBE A;  1VJ2 A;  1YNA A;  3WP6 A;  3ZN4 A;  1XYO A;  4E4S A;  3I7D A;  3BVC A;  2B8M A;  1Q3E A;  2HWC 2;  2ZGQ A;  3GBG A;  3AM2 A;  3IPV B;  3DYM A;  1V9U 3;  5J37 A;  4HKO A;  3N9M A;  5FUP A;  3JD7 3;  5CU1 A;  5FP8 A;  4JAA A;  3HMY A;  5HPO A;  1X50 A;  4ASK A;  1GWM A;  4NIG A;  2V5Y A;  1COV 3;  3CZU A;  2YGL A;  4GWM A;  3H7J A;  4X8P A;  4AED C;  4JGZ C;  1RC6 A;  1OMI A;  3WQ0 A;  1SDW A;  2WUH A;  4BMB A;  1UXX X;  4HSL A;  5FZ7 A;  4ZS2 A;  4P9X A;  1ZRR A;  2FCU A;  2WZR 3;  3PL0 A;  4AQ2 A;  1KS4 A;  2V72 A;  2WII B;  2WNV A;  3ENR A;  4QHO A;  4WVV A;  3MFA A;  2H6B A;  2VW1 A;  4KL1 A;  1SBD A;  3JBG 3;  3I97 A;  4FO9 A;  4XOG A;  4WZC A;  4D7Y A;  1JOD A;  2Z42 A;  1WLW A;  3KCC A;  4CU6 A;  2EAK A;  1SLI A;  2G9G A;  3M3I A;  1O4T A;  3PJQ A;  1OKO A;  3OGV A;  3ZVX A;  1ND3 B;  1CES A;  1UYP A;  2K46 A;  4WZF A;  2GP5 A;  4N9H A;  2ZGS A;  3IDE A;  3H42 B;  1VBE 1;  2DVF A;  5FY7 A;  3RVH A;  4A6S A;  4E27 A;  5FYC A;  3WCR A;  3HEI A;  3T1L A;  1ULF A;  3GZE A;  3NKT A;  1DGW X;  5JSR A;  3HPN A;  1Z7S 3;  3NNG A;  5FY4 A;  5JOW A;  3U75 A;  1BK0 A;  1IS4 A;  1MQT B;  1O7F A;  1PNG A;  3WOG A;  1UQX A;  2YGM A;  3DF0 A;  2B45 X;  4LOS A;  4AE2 A;  4CUG A;  1QJU 1;  1B35 C;  1D4M 2;  1BQP A;  4ONU A;  4QKF A;  3NST A;  2VZ3 A;  1XSQ A;  3KCX A;  5FBJ A;  4AI1 A;  2OKX A;  2B39 A;  4DY3 A;  3BYW A;  1PK6 C;  5IAX A;  2ZBJ A;  4JGZ B;  3ST7 A;  4AED B;  4OCT A;  4I2O A;  5C3R A;  5LRS A;  2L9L A;  2AH2 A;  4Z2A A;  1Y9Q A;  2DTY A;  4K1Y A;  3GCX A;  1URX A;  4GWJ A;  1QJE A;  4LUL A;  3ATG A;  4Q2F A;  1W6M B;  4RR3 B;  3KM5 A;  1IPJ A;  1W9T A;  5E6H A;  3DKQ A;  3RFR A;  3I2O A;  5A3P A;  3VD5 A;  3WF4 A;  3ZN6 A;  1IS6 A;  2YY1 A;  2R04 2;  5D21 A;  4HET A;  2WS9 1;  5A3W A;  4RHV 2;  2GU9 A;  3MLL A;  5CA6 A;  1R09 3;  2PHF A;  4TTG A;  5F7U A;  2HWB 3;  5IVV A;  4MAD A;  1KIT A;  2C0Z A;  5LA2 A;  2SLI A;  2LTN A;  5EWS A;  4ET7 A;  4QGM A;  3WNX A;  1OQE A;  3ACI A;  3ES4 A;  3PIJ A;  2XJT A;  3WDX A;  1O3T A;  5EYY A;  4I3P A;  5C5U A;  1Y9M A;  4QKD A;  1UD1 A;  3AYD A;  1AR7 1;  5IJR A;  2CGP A;  3U11 A;  1N3O A;  1NQJ A;  3M3O A;  5KXD A;  2FDJ A;  2JE7 A;  4YGC A;  4LBN A;  3VLB B;  4XBL A;  3ACG A;  1OKQ A;  1CPN A;  2E63 A;  2GC0 A;  4XUR A;  4QD2 A;  5IWF A;  3HWJ A;  1GQG A;  1H6Y A;  1PVX A;  3N9N A;  5BNO C;  1WWY A;  1ZZB A;  5A7W A;  1HDK A;  1V70 A;  2YYO A;  3FHI B;  2E33 A;  4IV1 A;  1YIF A;  3I3E A;  1H8T B;  1JXN A;  4HK8 A;  4QU1 A;  5FLH A;  1OPO A;  3WQ1 A;  3MV1 1;  4UW5 A;  4M0H A;  2QUO A;  1PK6 B;  5FBZ A;  4OUM A;  3ILF A;  2WC2 A;  1CAW A;  2O8O A;  4XBQ A;  4B3N A;  1ZBA 2;  1VBA 3;  1DZR A;  3LEG A;  1HXS 1;  2HWE 3;  1WW5 A;  1H1M A;  1H2M A;  1LOA A;  1V6J A;  2DV9 A;  3D4K A;  3NJV A;  1MEC 3;  1QQP 1;  5T52 A;  1HQW A;  3ACH A;  4JV4 A;  5HCB A;  2B42 B;  3VBS C;  3K75 B;  2Z5W A;  1UYZ A;  5IVC A;  1RUI 3;  3HBK A;  3AMN A;  4JTO A;  1DQ1 A;  2DUP A;  2VNO A;  4XFI A;  2C9A A;  1BEV 3;  2RMU 2;  1VBB 2;  2NPI A;  2XWB B;  4QPI A;  4OHY A;  3LWC A;  2VY0 A;  3RGB A;  3WDW A;  1OPM A;  3AP9 A;  5APA A;  4AW7 A;  5F2W A;  1A34 A;  1RMU 1;  3E97 A;  4RGA A;  3LIG A;  2Q1Z B;  3PUR A;  4GB3 1;  5BNO B;  5T55 A;  1SMV A;  4Y5T A;  5FLJ A;  2JG9 C;  1ZZ8 A;  3LEK A;  3O1R A;  1LOD A;  2UWC A;  2YU2 A;  3KB5 A;  1V6M A;  4DQA A;  2ET7 A;  2VBB A;  3AKP A;  4Y20 A;  1RHI 3;  1VAK A;  3T0D A;  3M7A A;  2PHW A;  5H9R A;  2VVF A;  4CDQ A;  1WW4 A;  5IK5 A;  1U5Y A;  4GA9 A;  3J26 N;  4P08 A;  4AHW A;  4FPC A;  3WSO A;  2HWD 1;  4E8D A;  4ZU4 A;  3OY8 A;  1PMH X;  1R08 1;  4OFG A;  4C91 A;  2Y8K A;  3AP5 A;  5FZK A;  5K9Y A;  3VBS B;  3B69 A;  4OI0 A;  2BZD A;  1JZ5 A;  4HSJ A;  3V0A B;  3TEZ A;  3I49 A;  1U12 A;  3MIE A;  5E88 A;  3M2M A;  2RJ2 A;  3WW2 A;  3LEM A;  4FOY A;  4DXT A;  5ERL A;  4OVE A;  3P6B A;  2NM1 A;  4XF1 A;  2RS3 2;  4LOT A;  5BUV A;  4K8R B;  3F95 A;  2OUH A;  2WZ8 A;  4J25 A;  5EPA A;  2BBV A;  1TME 2;  4FPE A;  1SLC A;  2BPA 2;  1OI6 A;  5A1A A;  1W9Y A;  3OBZ A;  4QPG C;  4Q29 A;  3F2Z A;  3VD3 A;  5AC9 1;  3VZO A;  5C5T A;  5C9A C;  2JDZ A;  2VL4 A;  3IN9 A;  2PXJ A;  3OOX A;  4BOW A;  1M06 G;  5GZD A;  1VBD 1;  2XVL A;  1MZE A;  4OHW A;  3J7L A;  4MGY E;  1JZ2 A;  4IGP A;  3OEA A;  2YDE A;  5A3O A;  4AVB A;  4IEX A;  3UJO A;  1GFF 2;  2C1F A;  1WGP A;  1BBT 1;  2A7A A;  4PHZ A;  3BU7 A;  2XJU A;  1OT5 A;  4Q0U A;  2J7M A;  4QQL A;  3VDC A;  1LHN A;  1NCR B;  5FZA A;  1CR7 A;  3AZW A;  1GV9 A;  2HEY F;  1AZD A;  1EUT A;  3KT1 A;  4YW2 A;  1K5M A;  1ZNP A;  1UZY A;  1RXF A;  3FLR A;  3J8F 2;  3LD8 A;  3PVE A;  3QCW A;  4FPY A;  3WG2 A;  4GJZ A;  4IEO A;  5IK8 A;  1D7P M;  2OPK A;  4NWW A;  1PIV 2;  3G7D A;  3IIA A;  1W2T A;  1LEC A;  1VMF A;  5F3G A;  3CF6 E;  3T09 A;  2PA7 A;  3NL1 A;  4GAL A;  1IKQ A;  1CGP A;  1AF9 A;  1TNF A;  4G4F A;  4FSJ A;  2J1A A;  5JUV A;  3M70 A;  4YW1 A;  3K4D A;  3IAP A;  4OMC A;  1C4R A;  4HKW A;  1F35 A;  3IPV A;  4JRL A;  1JUI A;  4ZXE A;  2DWR A;  1IPK A;  3LA2 A;  1E5H A;  1AL2 3;  5D1I A;  4XDQ A;  3THT A;  1TMF 3;  2VOK A;  1SQ4 A;  2Q8E A;  4QPG B;  4Y26 A;  4AYU A;  4BB3 A;  5C9A B;  3T2T A;  4FOQ A;  4LXL A;  1NX9 A;  3CLP A;  3GJB A;  1IHM A;  3B9C A;  3EBR A;  2QBX A;  4X6Q B;  2GME A;  2P6C A;  4CCO A;  3I3B A;  5JR7 B;  3VBU B;  3FMG A;  1UNB A;  4SLI A;  3MIF A;  3UL2 A;  3AZV A;  1Q5O A;  2VOT A;  4WVW A;  2P3K A;  3VDB A;  1FMD 1;  4QDS A;  4QKN A;  5FZB A;  4CP0 A;  2ZGT A;  2WNE A;  3W20 A;  3M3Q A;  1C1F A;  4BME A;  3Q9O A;  3H8X A;  1V6K A;  5I93 A;  4N53 C;  1ND3 A;  1N47 A;  1R1Z A;  1RUC 1;  4ATF A;  2EF6 A;  1OFN A;  1OLM A;  2EAL A;  4YG6 A;  1UU6 A;  2XBO 1;  3USS A;  1XU2 A;  5LA9 A;  5FZM A;  3H0O A;  3KVB A;  1FAT A;  4CCK A;  5T54 A;  2WDB A;  3T4V A;  1JUH A;  2FBE A;  1GIC A;  4OI2 A;  4UI9 L;  5H9S A;  4A41 A;  1HRV 2;  3AC0 A;  4NN0 A;  1WUV A;  1V9U 2;  2YPD A;  3RZH A;  4UW3 A;  5T50 A;  1U5I A;  1MQT A;  4LKD A;  1SLB A;  2PHU A;  3JD7 2;  5CIS A;  1W6Q B;  1K5J A;  4LNV A;  1GQH A;  1CN1 A;  4XFG A;  5HV4 A;  1K45 A;  1PM4 A;  4K9S A;  3NJZ A;  1HLC A;  1OA2 A;  4Y4R A;  1UKR A;  1W0O A;  2BNN A;  2GNB A;  2OUJ A;  3W9A A;  4AED A;  3K4Z A;  3ACF A;  4JGZ A;  1AYN 3;  4AEJ A;  5JMO A;  4ISR A;  2GZW A;  1DQ6 A;  2CTV A;  3BPS A;  2X09 A;  5FYI A;  4FP2 A;  1WLC A;  4RR3 A;  1F5F A;  3B00 A;  1H2K A;  2GH2 A;  1IKP A;  4K40 A;  1JZ6 A;  3N7M A;  4XAE A;  3RJ2 X;  3RZJ A;  4OI1 A;  3PUS A;  4LA2 A;  3O5S A;  5A7Q A;  4UF0 B;  3WW1 A;  3VL9 A;  4NHX A;  4MV2 A;  1AX1 A;  3MIB A;  4WBB A;  1PZ8 A;  5FK8 A;  2HYK A;  3N7K A;  5JI7 A;  4N53 B;  3ETP A;  2IVI B;  1W6O B;  1G86 A;  3O1O A;  3SKJ E;  1GZW B;  1Y43 B;  1A78 A;  1YFW A;  5A7N A;  2R06 2;  2DVB A;  3RWK X;  2PLV 1;  3VHO A;  3O14 A;  5KXB A;  2ZZJ A;  4DNY A;  5HCA A;  1Z7S 2;  3N35 A;  2D6P A;  4KG0 A;  2EXH A;  1CZT A;  5DPN A;  1NZI A;  5FTT C;  3AKS A;  2HYX A;  3RZZ A;  2RDN A;  2CAV A;  1WZX A;  4LUK A;  4DPN A;  2I74 A;  2VCM A;  2DVG A;  1UKG A;  4AFB A;  3ZYB A;  3N9Q A;  2XVK A;  3WXP A;  4O9G A;  4W8J A;  2AR6 A;  4AL9 A;  3U0Z A;  2BJS A;  2UU8 A;  1STM A;  2W91 A;  4KI5 M;  1DQ5 A;  1PK6 A;  3KF3 A;  1OD3 A;  1XNB A;  2BFU L;  3PNA A;  2RVA A;  2DVD A;  3VKF C;  4B7K A;  5JIU A;  4TXW A;  1UZ0 A;  2IC1 A;  4XJU A;  4A2U A;  4QB1 A;  2WKK A;  3JB8 A;  4UBH A;  2R0H A;  1RUO A;  1LGN A;  1I6X A;  4PLM A;  2ORZ A;  1ND2 C;  3N7J A;  3HQX A;  1R09 2;  4LBO A;  5CKQ A;  1VBE 3;  4YW5 A;  2HWB 2;  3GBW A;  1UL9 A;  2ZEY A;  5FZH A;  3RS6 A;  1JYW A;  4MOA A;  3PLQ A;  3AX4 A;  1PMJ X;  1QWR A;  4JHZ A;  2DTW A;  1IZ3 A;  3EYP A;  1HRI 1;  1JYI A;  1O4Y A;  4YW4 A;  1O8S A;  1QGL A;  2VR4 A;  3HN1 A;  5FWE A;  5C6C A;  3J7M A;  4QB2 A;  3A0K A;  4AVT A;  2WNV C;  1QJU 3;  2HLE A;  3H1W A;  4QM9 A;  3ZSJ A;  5A70 A;  2XON A;  3PUA A;  4K6B A;  5LK7 B;  5CKM A;  4A7Y A;  2ZHK A;  3IWZ A;  3H8O A;  1QOO A;  1I3H A;  4UFH A;  3KV6 A;  5BNO A;  1JHN A;  2DUO A;  4N90 A;  4LKF A;  5IFP A;  1UAI A;  1LKN A;  4FPJ A;  2YHJ A;  3AP6 A;  1EY2 A;  3FWE A;  1LJ7 A;  4AGV A;  1WW6 A;  1UZV A;  1VBA 2;  2WS9 3;  2HWE 2;  5C3P A;  2UUR A;  1MS3 A;  2YFU A;  2P3Y A;  4LHN A;  3C7F A;  1MEC 2;  2XLF A;  2VE1 A;  4HL0 A;  1EV1 1;  2OW4 A;  2Q1F A;  5JZG C;  1MS0 A;  4HPK B;  3AXD A;  4CPB A;  1ND2 B;  3WNP A;  1JHJ A;  3VBS A;  1RUI 2;  5FAX A;  1AR7 3;  1D2S A;  3T3Y A;  4AVS A;  3V0A A;  1RYY A;  2VC9 A;  3JQX A;  5L36 A;  5FRE A;  4AEK A;  1H4G A;  1OLQ A;  2OA2 A;  3M3C A;  4L0P A;  1HV0 A;  5IAV A;  5TSW A;  1YQC A;  2Q8O A;  4M4P A;  5CAD A;  3OTF A;  4CCN A;  1L7Q A;  1NXD 1;  2NMN A;  4IGQ A;  3ACL A;  2D98 A;  4HK9 A;  1UZW A;  2IXL A;  5I8Y A;  3L9J T;  3AZZ A;  4YGB A;  3I2K A;  2LS6 A;  3NNF A;  1A3K A;  1CAX B;  1W2A X;  4QQO A;  2PEL A;  2BTV C;  2A6Z A;  1L7R A;  3LAG A;  4B4Q A;  2BER A;  5A32 B;  3I2F A;  2V73 A;  4HZF A;  2A1X A;  3L2H A;  1JU3 A;  4MYE A;  2VTF A;  2YXS A;  3KZ4 C;  1HXS 3;  1RHI 2;  4LK6 A;  2A3X A;  3VKL A;  4UBG A;  3M4F A;  2WFF 1;  1XNK A;  4EN6 B;  1UW8 A;  1QQP 3;  2DF7 A;  2WO1 A;  3H9A A;  1PGS A;  3OYW B;  4ES8 A;  2VO5 A;  2BQP A;  2XJV A;  4XJW A;  3THC A;  1NCR A;  1ZZC A;  3LCP A;  3I59 B;  4FQ4 A;  3RPQ A;  2H0B A;  4AHX A;  4AVA A;  2VCB A;  3IDB B;  1H1A A;  4LKE A;  3IAQ A;  5JZG B;  3QOP A;  4LQR A;  4IV1 C;  3DL3 A;  4K8F A;  1YFX A;  2LRO A;  1GMM A;  1OOP C;  2I07 B;  1DQ2 A;  1HQL A;  2JDY A;  1RMU 3;  2QQK A;  1C8M 1;  1HB3 A;  3AMH A;  1EYB A;  1VLN A;  4XF4 A;  5FZE A;  2Y0O A;  5FPL A;  4GB3 3;  3ZMO A;  1W2N A;  5GZC A;  2ZGK A;  2E32 A;  1XQN A;  3POI A;  4GWN A;  1GAN A;  2FZ1 A;  3NNL A;  1PO2 1;  2OQ6 A;  4K1Z A;  4QPG A;  3RMX A;  1U0A A;  5C9A A;  4HVO A;  4Q0Q A;  5K0U C;  4A44 A;  2PTM A;  2A73 B;  2G9Z A;  1RVF 1;  3EQE A;  5FCC A;  3MEP A;  5LA0 A;  1X8E A;  1UWW A;  4QPI C;  4K7J A;  2HBT A;  4XMA A;  3UGF A;  3ORJ A;  1VRH 1;  1REF A;  1IOA A;  2HWD 3;  3MID A;  3VBU A;  3FUO A;  5BV6 A;  2BW8 A;  4MG2 A;  2VZ1 A;  4PI0 A;  3SIS A;  2LM3 A;  2QDR A;  2XG3 A;  4MLO A;  1R08 3;  1WD3 A;  4NHL A;  1GZ9 A;  1WLT A;  4PF5 A;  3KS7 A;  5LK5 A;  5FY0 A;  1F8V A;  5FWJ A;  1X33 A;  1X82 A;  5D2A A;  4LO6 B;  1CZS A;  2W46 A;  2FMD A;  2WL1 A;  1N3Q A;  4AFM A;  3H50 A;  4IE5 A;  4PDW B;  3ZX7 A;  2EIG A;  5F9T A;  4CUC A;  5FPV A;  5FZ6 A;  2ZJC A;  4JDM A;  4LO8 A;  1JU4 A;  2GAU A;  3RI8 A;  4W6X A;  2QQO A;  2WNU C;  1AX0 A;  4CPB D;  4DRR A;  3O1P A;  3H8U A;  3UGH A;  3VL8 A;  1SCR A;  4BU2 A;  1UX7 A;  4FOW A;  4GWI A;  2BBA A;  2VTX J;  3P3P A;  3TN9 1;  4WVZ A;  4AVV A;  4QX0 A;  1OOP B;  3I2G A;  4GKX A;  1JOP A;  1UMH A;  2ADE A;  1QJZ A;  4CDQ C;  4A45 A;  3VHN A;  5AC9 3;  3K4A A;  1TMF 2;  1E5I A;  3L2Y A;  2VZQ A;  5JI9 A;  3DCQ A;  1VBD 3;  1OUX A;  2IUW A;  5FZ9 A;  4B8E A;  1RUG 1;  3IB3 A;  1PM7 A;  2VMG A;  3S6P A;  2ZKL A;  3FLT A;  4I3G A;  4P9Y A;  5K0U B;  2J1R A;  3RZK A;  1BBT 3;  2OQ7 A;  1CQ9 A;  3AKQ A;  3UJQ A;  4NPM A;  1Q8P A;  1UY2 A;  4R9B A;  4Y4Y A;  3IZO A;  3ROU A;  1QNY A;  5T5P A;  5GLV A;  4ZU7 A;  1Y7B A;  4YPJ A;  4BCU A;  2X05 A;  2Y38 A;  3MIH A;  1ZRI A;  3K46 A;  4IEW A;  4UF0 A;  4Y1V A;  5GLU A;  2X8K A;  1W8U A;  2PAK A;  4FOV A;  1RUH 1;  4N53 A;  1W6O A;  3QH6 A;  4X8N A;  1FPN 1;  1GZW A;  3ZDV A;  3LQC A;  4XE9 A;  4N8M A;  3BGA A;  4DUV A;  2VU9 A;  1BJQ A;  1SZB A;  1M4W A;  4B1M A;  3WG4 A;  3SQO A;  2GSY A;  1DFQ A;  3CKH A;  3MW3 A;  4LE3 A;  4CYD A;  2VCC A;  2FDG A;  2JKB A;  1XC6 A;  1BMV 1;  4EWE A;  4EZH A;  3J4U H;  5LRR A;  4AI2 A;  3P5B A;  4ASL A;  4FT8 A;  1HB4 A;  1AYN 2;  4LOR A;  1WCU A;  4Q0P A;  1AYM 1;  2QDN A;  3B5L B;  5C8W A;  3TYJ A;  4KG8 A;  3VGI A;  1W28 A;  2NMO A;  1VB4 A;  2XKP A;  3POG A;  1FMD 3;  1L3J A;  3N3H A;  3LFI A;  3FHA A;  4RS5 C;  5FZ3 A;  5HCH A;  2JG8 C;  2WAA A;  3M8L A;  3VBR C;  1Q8S A;  5FMD A;  2VTX A;  3GM8 A;  4YZ2 A;  1LHW A;  1E5S A;  1RUC 3;  2WA3 A;  1Q43 A;  5JVV A;  2XBO 3;  1SCS A;  4IQP A;  3UNP A;  2FDI A;  3RZM A;  2WQ8 A;  3AYC A;  5J3U A;  5FZ8 A;  5ACA 2;  2Q30 A;  3SH4 A;  3WV6 A;  3U4X A;  1AR9 1;  4NE9 A;  2WYS A;  2GNM A;  3MW4 A;  4QDQ A;  3I3M A;  5BNP B;  5JXH A;  4ES9 A;  4HVQ A;  1W2U A;  2KR2 A;  1CIY A;  5IVF A;  4A7K A;  3FX3 A;  4BIF A;  1DCS A;  1N1T A;  1N1Y A;  1FNZ A;  3E6D A;  4IW3 A;  3SNM A;  4XF0 A;  5LY2 A;  5HV0 A;  3ZM8 A;  4ORF A;  4AI8 A;  3KSC A;  2B4K A;  4NOT A;  3AMM A;  3GNE A;  1GLH A;  1PX4 A;  4H7L A;  1BK1 A;  5CG9 A;  3QAC A;  3GF6 A;  1NZC A;  2RG4 A;  3ZSM A;  1GKB A;  2WO2 A;  2XXZ A;  4YG3 A;  1JZ4 A;  4LK7 A;  4BWO A;  1S2E A;  2P5B A;  2RDR A;  4DIQ A;  4IE0 A;  5GJ6 A;  2Y6L A;  4XZU G;  5DUV A;  4QM8 A;  2OYZ A;  2W1W A;  2BDR A;  3WP3 A;  1HX6 A;  2VZU A;  5EIY B;  4RS5 B;  2ZMK A;  4O61 A;  2JG8 B;  3VBR B;  1NT0 A;  3MGU A;  2AAC A;  1DZT A;  3ILN A;  1MQT C;  1VBE 2;  4HPK A;  1D4V B;  1ND2 A;  2W94 A;  5C71 A;  3DPR B;  3K77 A;  4XQD A;  3U10 A;  1IQD C;  2RR1 1;  3WIN E;  3RYP A;  1OBN A;  2PLV 3;  1X9T A;  3GBF A;  2VMF A;  1JZ8 A;  3HQU A;  3H8R A;  2HWF 1;  1W3X A;  2R07 1;  3SCF A;  4NIA A;  2RS1 1;  2EID A;  3O1U A;  5BNN C;  4YSF A;  5LEK A;  3K51 A;  4RR3 C;  4OZO A;  2CDP A;  3WCS A;  1QJU 2;  2KM2 A;  2YG0 A;  1T6G C;  4H7M A;  5BPX A;  5J96 B;  2ZX2 A;  1IG0 A;  3OF1 A;  4BDV B;  3MDP A;  2OVU A;  4E2G A;  3ZYP A;  2VJX A;  4Q4W 1;  5DUW A;  4COV A;  1MS9 A;  5FXZ A;  1PGL 1;  4JDO A;  5A32 A;  2CGN A;  3WVJ A;  1GZT A;  1KFX L;  4Y22 A;  4FTE A;  2PHL A;  4LBJ A;  4LJH A;  2P1B A;  2J1S A;  1VB2 A;  5JOX A;  4ZKT B;  2YBS A;  3N9P A;  1J1T A;  2WS9 2;  3E6B A;  5FIX A;  3ZXK A;  3IDA A;  2E7A A;  3KHC A;  4P9I A;  1ASJ 1;  3OYW A;  3WY6 A;  1ENR A;  2NQY A;  1ULP A;  3VBF C;  1I5Z A;  2C26 A;  4IER A;  3I59 A;  3T2O A;  4IUG A;  3FJS A;  2A6Y A;  4J1W A;  4COU A;  2J1U A;  4MVT A;  2DFB A;  5JZG A;  4RD7 A;  4FFI A;  1H1I A;  1MPX A;  1AR7 2;  2AGS A;  1HRI 3;  1Q8O A;  1H8T C;  3H7Y A;  2K2S A;  1XJA A;  1AR8 1;  1F4A A;  4QQP A;  5BYN A;  1LR5 A;  1BLZ A;  1POV 0;  3LOB A;  3AYA A;  3Q8F A;  1VMJ A;  5FJK A;  4AWD A;  3E5X A;  4C0H A;  1TNR A;  4X6R B;  1RL3 A;  2MHF A;  1O59 A;  2C24 A;  5F5A A;  2TNF A;  5BNN B;  2D3R A;  3POF A;  1DF0 A;  5FZG A;  2G9F A;  2X53 S;  3WDT A;  5IHR A;  4YG0 A;  5FY8 A;  2ZAH A;  4XC9 A;  4YGD A;  1R64 A;  3PME A;  2NN8 A;  3FUQ A;  3I4I A;  2IFR A;  3BTY A;  1VE0 A;  3LDB A;  1VRB A;  2B46 X;  2GP3 A;  3AB0 A;  2ARA A;  4LHK A;  3KCY A;  2XB6 C;  4FPG A;  3PUI A;  1CJD A;  4PIZ A;  1H2N A;  5EP9 A;  4CDX C;  1EV1 3;  5DMY A;  2A3W A;  4OUE A;  2Y33 A;  1LOE A;  4Q8K A;  2XUM A;  4LA3 A;  3J7N A;  4YNI A;  5SV5 A;  5T5J A;  3VBF B;  1OA4 A;  1ULD A;  4PDW A;  5J48 A;  2ERF A;  3ZYF A;  4FFG A;  2JE9 A;  1RUD 2;  1SBF A;  3DKW A;  4FXK B;  5A6Z A;  5FOB B;  1OUR A;  5FP4 A;  3C2U A;  4P02 B;  5CFD B;  5KHG A;  3A21 A;  3SXW A;  4GQ7 A;  1OOP A;  1JOJ A;  5FP9 A;  4CXX A;  3BKZ A;  2NP0 A;  2YB7 A;  2FCT A;  4L99 A;  4GB3 2;  4CUA A;  1W0P A;  1YI7 A;  3UYJ A;  4FBF A;  2VEC A;  3RWN A;  3JB4 C;  5L19 A;  1G7Y A;  3WNO A;  2PQQ A;  2R16 A;  3LA3 A;  5L9B A;  5JSP A;  2I2S A;  1ZVF A;  1W3V A;  5KWR A;  4NPL A;  4RGG A;  4Y1U A;  1S0G A;  2JDA A;  3JUU A;  1N1S A;  4QAW A;  4AG4 A;  4CCC A;  2XOM A;  4DOU A;  2WFF 3;  1LOG A;  5K0U A;  4ZZ8 A;  4DUX A;  3B7M A;  1JOB A;  5AVA A;  5FYB A;  2HWD 2;  3VKO A;  1GR3 A;  2MEV 1;  4HXC A;  4M3C E;  4UW4 A;  3LB9 A;  3H3Z A;  5FR3 A;  2CWM A;  1YJL A;  4J1X A;  5DAB A;  3ZSL A;  1R08 2;  1NE6 A;  2CAU A;  2R49 A;  3SH5 A;  3KVA A;  4CDX B;  5AFB A;  4LIU A;  1YQ5 A;  2HKX A;  2VD7 A;  3A4U A;  3VHR A;  3H3U A;  4DB5 A;  1AXY A;  3POW A;  3MLK A;  3NQH A;  2JIG A;  1SFP A;  3OG2 A;  1OLM E;  1FT9 A;  4E4H A;  4LLF A;  2RJL A;  4UWD A;  4LKS A;  2YFZ A;  2WWS A;  4JGY B;  1FV3 A;  4D0Q A;  3HD8 B;  1C8M 3;  4BLJ A;  1FXZ A;  2P37 A;  4XIL A;  3UGG A;  3POS A;  2WNU A;  1RJ8 A;  3VD7 A;  1DHK B;  2JD9 A;  2MNG A;  5LWB A;  4XAB A;  5JOZ A;  5JXI A;  1MS1 A;  2HBU A;  3Q8C A;  3H1M A;  1GSL A;  1PO2 3;  4OHV A;  3AKR A;  2E7T A;  1XOY A;  5AC9 2;  3AK0 A;  3U14 A;  5J1X A;  4JKL A;  2RHP A;  2Q0A A;  4LHS A;  3THD A;  1CON A;  1NCR C;  1W6N B;  1VBD 2;  2Z2S B;  3LGR A;  1AR6 1;  4E9K A;  1RVF 3;  1YXW A;  2XKO A;  4LEJ A;  1VIW B;  2B7Y A;  1W03 A;  5FMB A;  1VRH 3;  2GN7 A;  3ZIW A;  1MS8 A;  4M3C F;  4QWN A;  2WT0 A;  1RED A;  4UFI A;  5FQ0 B;  4Z1V A;  3QH7 A;  1CAU B;  5F6L B;  1WMF A;  3PTR B;  4UFM A;  3HN3 A;  4D6S A;  4QX5 A;  2A75 A;  5KR7 A;  1C57 A;  4CVU A;  3PVO A;  4MX3 A;  4F3J A;  2BP6 A;  1DGW A;  4XXA A;  5JWP A;  4V2V A;  4XMI A;  1UU4 A;  4P5H A;  3ZN5 A;  4IV3 C;  4OMD A;  2DCT A;  3WLU A;  3VV1 A;  1WMD A;  5IVB A;  3BN6 A;  3LE0 A;  2Y6J A;  3CBN A;  2GDF A;  2NYY A;  5T3N A;  3TN9 3;  1XE0 A;  5BNP A;  3AJZ A;  1DQ4 A;  1I5P A;  4MXW B;  1QMJ A;  3CDZ B;  4ISQ A;  4P00 B;  1IQA A;  2VQT A;  4LPL A;  3ZPY A;  1S1A A;  1MS4 A;  2ARC A;  3JCI A;  3VBU C;  3MUY 1;  3T4H B;  1F15 A;  1ZBE 1;  4GMP 1;  5K8S A;  3OPT A;  4BQ1 A;  1CAV B;  5KHK A;  5F32 A;  4EN7 B;  3H1Y A;  1RUG 3;  3E1F 1;  4TLF A;  3FE5 A;  3KLS A;  2A6V A;  3ZXA C;  2Z4F A;  2JD4 A;  2YBP A;  3PU8 A;  4NHK A;  5FY9 A;  3GJA A;  4GIQ A;  4BLI A;  4BPZ A;  2VMI A;  3RJR A;  2WWJ A;  3PHM A;  2XR4 A;  3WHU A;  4XJA A;  4FPO B;  5LY1 A;  2D5H A;  1WCS A;  2XLG A;  4Q4X 2;  2GAL A;  3ZDS A;  5FUN A;  5JLV A;  1QXJ A;  1FMD 2;  3TEX A;  4COZ A;  3PUQ A;  4PQ9 A;  4C90 A;  5DAQ A;  3RQ0 A;  3TEY A;  4RS5 A;  1DYP A;  2JDK A;  4NHM A;  2JG8 A;  2GMP A;  1RUC 2;  3VBR A;  5C8C B;  1DZQ A;  1AVB A;  1RUH 3;  2XBO 2;  5L9R A;  5JXJ A;  1FPN 3;  3DPR A;  4KBB A;  1VP6 A;  5F3I A;  4EWD A;  4NHY A;  5EFU A;  3INA A;  4IV3 B;  2W9X A;  3ZYR A;  3I2J A;  1GUI A;  1W8Z A;  2EXJ A;  4OHX A;  3TNP B;  1POQ A;  2CY6 A;  4PT6 A;  3VDA A;  4EYU A;  1YI9 A;  1X8M A;  3LIH A;  4IEQ A;  4N43 B;  4AQT A;  5FXV A;  3KQR A;  4DZG A;  3MIC A;  1MS5 A;  3WNN A;  3C8X A;  3OEB A;  3PU3 A;  3VDD B;  3W5M A;  2QQN A;  2FDH A;  5A6X A;  4KWJ A;  1F5J A;  4K3U A;  4YZ1 A;  3VBH B;  1QF3 A;  2XL7 A;  3I8T A;  3O0X A;  1C28 A;  2D5F A;  2A6X A;  1AYM 3;  1MZF A;  5F3C A;  4J6G A;  3ILR A;  4Z82 A;  3AMQ A;  3N36 A;  4IE7 A;  4BIO A;  2K9Z A;  2PHR A;  1WMX A;  2WLQ A;  4GUL A;  4W6W A;  3S0M A;  3W21 A;  1MZ6 A;  3POY A;  1XRU A;  3HBZ A;  2ZXQ A;  5D8A C;  4DXZ A;  2BWC A;  2VUJ A;  2XL9 A;  3LSE A;  3S5A A;  1AR9 3;  1TE1 B;  1NUK A;  1ODN A;  3WDU A;  1TVG A;  1RUJ 1;  2EIE A;  1HV1 A;  2PLV 2;  3C7G A;  2W0X A;  2OX0 A;  1YYN A;  2VBD A;  5CIR A;  1COV 2;  5F3E A;  1HW5 A;  1ENS A;  4FCA A;  4EJR A;  3OGJ A;  4JZR A;  2ZGM A;  5DG2 A;  2WN3 A;  5FXW A;  1JH5 A;  1XE8 A;  1YIP A;  2IXK A;  4FPL A;  4BK4 A;  2VZO A;  2R0F A;  5BNN A;  2WZR 2;  4YVW B;  3T2Q A;  1W6M A;  1VAM A;  3THP A;  1UIK A;  3FFZ A;  5F5I A;  2BGP A;  3JBG 2;  2W3J A;  4JKK A;  1N1V A;  5DDJ 1;  4ZU5 A;  3LKJ A;  4BQW A;  4AQ6 A;  5H9P A;  4AGG A;  1WCD J;  5F5C A;  4BHP A;  3VB9 A;  2P4E A;  2D6N A;  2VW0 A;  3X29 B;  5KC6 A;  4ZHN A;  4I30 A;  1QJF A;  3ZXL A;  1XU1 A;  4NRQ A;  1WME A;  4P9W A;  2ZGL A;  5C4W B;  4LMF A;  3ABZ A;  2GH8 A;  5FO8 B;  3TB0 A;  4QB6 A;  2QFE A;  2CV6 A;  1S0J A;  5J98 B;  1KD7 A;  3T0A A;  2JDM A;  1H2L A;  1NCQ C;  1S4C A;  2BFU S;  2IFW A;  2RR1 3;  2WAB A;  4Q0V A;  4HN1 A;  3I54 A;  4OYU A;  5D8A B;  2X29 A;  5BXX A;  3T0B A;  3VBF A;  1ZZ9 A;  4CZS A;  4G9S B;  2NZ9 A;  3MYX A;  1NY7 1;  2ENR A;  2HWF 3;  1BYH A;  1HRI 2;  2R07 3;  5IVY A;  4D3W A;  2ATF A;  5IVE A;  2RS1 3;  4R8H A;  4AXO A;  2QNK A;  1H8T A;  5CFD A;  4XVH A;  1WCQ A;  1PNF A;  1HRV 1;  1UYX A;  2UYB A;  1CX4 A;  4JRA A;  1QXP A;  2KXL A;  4GKY A;  2BV4 A;  2ZML A;  4NRO A;  4O7X A;  4YWA A;  3R6S A;  1YWK A;  2X5I B;  4Q4W 3;  3SEP A;  3HR9 A;  2V09 A;  1JZ7 A;  2A70 A;  3LFM A;  4QGL A;  2DBN A;  4W4Z A;  3ZIX A;  3POE A;  4XXP A;  1OVS A;  4FQZ A;  5FYT A;  1K12 A;  1RIN A;  4GAZ A;  1PGW 1;  1Y9G A;  3RDI A;  1S55 A;  5L7O B;  4LBM A;  1W2O A;  5LCW L;  3MV0 1;  5IYY A;  2VMH A;  4LLO A;  3VD9 A;  3QBQ A;  4XIO A;  3OUI A;  1LHV A;  4AOC A;  4QT6 A;  1ASJ 3;  1AXZ A;  4YRD A;  2XQR A;  1UF2 C;  5GKA C;  1UU5 A;  2HH9 A;  1EV1 2;  3RNS A;  4DXS A;  2D6M A;  1U5X A;  2VMD A;  4XFH A;  3ZFG C;  4NO4 A;  1QOS A;  3MFC A;  4FFH A;  3DXT A;  3U78 A;  4CDX A;  2D93 A;  2GND A;  4YW6 A;  2Q1M A;  4EQV A;  3AFG A;  2JEN A;  4RYD A;  4XAC A;  3W59 A;  3NJX A;  1NCQ B;  5ISL A;  5LEJ A;  4EN9 B;  5B4X A;  4UFK A;  2CU5 A;  1AR8 3;  1QU0 A;  4Q4V 1;  2BVB A;  2W1Q A;  3IBM A;  1DGR N;  1UY3 A;  2R06 1;  4JC1 A;  4JGY A;  4QPW A;  2SBA A;  3WP4 A;  5A3T A;  2R32 A;  5BNQ A;  4CRQ A;  3KGZ A;  1NE4 A;  4O65 A;  5EJ3 A;  1ALY A;  1YQ8 A;  1O91 A;  2ZCW A;  4CXY A;  2XWJ B;  2UWB A;  1XBF A;  4QMA A;  4W65 A;  5CB7 A;  3ZYH A;  4Y24 A;  1G9A A;  1GNY A;  2PHX A;  4Z07 A;  1QEX A;  4HOO A;  4S2D A;  4XFC A;  3KT7 A;  2HEV F;  4RA0 A;  1W6N A;  2QVS B;  3E6C C;  5LW9 A;  1POV 1;  3CNA A;  5FLI A;  3CJI B;  1ODM A;  3KQ4 B;  4QX1 A;  4PBP A;  2DU1 A;  1A6C A;  5B2G B;  3OUJ A;  4WV8 A;  2WFF 2;  2QJV A;  3AL6 A;  1OSG A;  1PZ7 A;  3EB7 A;  3GGL A;  4AHZ A;  5FQ0 A;  5FZ4 A;  2QQP A;  1CAU A;  4ARY A;  5FO9 B;  4BH9 A;  1W8T A;  1BEV 2;  5I8T A;  1PX3 A;  5FRA A;  1SAC A;  2XHN A;  2WRA A;  1O4Z A;  2QQM A;  3ETQ A;  1DG6 A;  3AXE A;  1LOC A;  2EXI A;  4NAM A;  4NAO A;  4ARX A;  5C3Q A;  3O1M A;  2JX9 A;  3ZFG B;  2VZT A;  1JN2 P;  4AF9 A;  4KQ7 A;  4I02 A;  4LBQ B;  3WEZ A;  1FI2 A;  4KU7 A;  4YFW A;  3CO2 A;  1MR5 A;  1RUF 1;  3I2D A;  1ONA A;  5IW0 A;  1DP0 A;  3N4M A;  3GYD A;  2RM2 1;  4I09 A;  2WSV A;  3N9O A;  4MXW A;  3S7I A;  5DG1 A;  3AVS A;  4EN0 A;  4PF1 A;  3RZG A;  1O6U A;  1RUE 1;  2D44 A;  5F5Q A;  1NA1 C;  1X9P A;  2JDU A;  5IUQ A;  3WUC A;  3CEW A;  1H6X A;  1YFY A;  1YO8 A;  3ZXF A;  3CMG A;  2DCZ A;  1CAV A;  1WKY A;  1Z0H A;  2MPF A;  2Y6K A;  3ZLI A;  3NKG A;  3LPG A;  4D7T A;  1GP4 A;  1I9R A;  4XQ4 A;  2VGD A;  1X36 A;  1J83 A;  2BU9 A;  1RVF 2;  1S0C A;  2FMY A;  1JBC A;  1S0D A;  4L11 A;  2NLR A;  4PJY A;  4PDW C;  2R1D A;  2WAO A;  1VRH 2;  5FPZ A;  4NUB A;  4QQ2 A;  2MEV 3;  5DZF A;  4AI0 A;  4XUP A;  1NOV A;  4CA9 A;  5HCF A;  4KWU A;  1LES A;  3KGL A;  2J1E A;  2YV8 A;  1SG3 A;  2DVA A;  3LPF A;  4S2H A;  1CWP A;  5FKB A;  4UXA A;  3BTX A;  2JDP A;  2R7E B;  5GLT A;  4U36 A;  4CP2 A;  4XF3 A;  1ENQ A;  5C8C A;  4URT A;  3K2O A;  5A1L A;  5FK7 A;  2BNO A;  1PO1 1;  1VBC 1;  2ZAA A;  4KH9 A;  2ID4 A;  3WR0 A;  3R05 A;  4P14 A;  4H3W A;  2JXA A;  4IV3 A;  3ZKY A;  2DCK A;  4E2S A;  4WM7 B;  2VZV A;  1OH3 A;  3FFQ A;  3AYE A;  1EUU A;  2E9Q A;  2H6C A;  5E1R A;  3TN9 2;  5CEH A;  4N43 A;  4JCK A;  3HVD A;  2WT2 A;  2UYA A;  1H9W A;  1LB2 A;  2LAL A;  4YZ4 A;  3V56 A;  1NXM A;  2DYC A;  2ILM A;  3VDD A;  1YRZ A;  3KV5 A;  1X7N A;  3O0V A;  5A7S A;  1NA1 B;  1NAE A;  2YC4 A;  4TN7 A;  2C6S A;  5CFC C;  4IDZ A;  4XJZ A;  1AR6 3;  3AMP A;  3OJB A;  3S5Q A;  2PAE A;  3VBH A;  1GNZ A;  1UO9 A;  4EN8 B;  4BXF A;  4XFB A;  1S0F A;  3MPP G;  3W5N A;  1BVV A;  4AGR A;  1S0B A;  3CL1 A;  4FAG A;  2D97 A;  4GMP 0;  1DU3 D;  2QZ3 A;  2GMM A;  4PLO A;  4HVR A;  1W05 A;  5F6K A;  1SEF A;  3LOI A;  3BAL A;  1F31 A;  4CDW C;  3IT8 A;  5ABJ C;  3WNL A;  4EE2 A;  1W0N A;  3OGS A;  3R4D B;  2W92 A;  5IVJ A;  4F8A A;  5KXC A;  3N7L A;  2WZP P;  5FFO C;  3GZT B;  3MBW A;  5E89 A;  3NV4 A;  3B3Q E;  1DLL A;  1BCX A;  1FPN 2;  3OSD A;  4OZX A;  5J09 A;  2JB8 A;  2Y6F A;  1A8D A;  1AL2 2;  1EPZ A;  3HNB M;  2YU1 A;  2RDQ A;  1W6Q A;  2ARB A;  3P1I A;  4IND A;  2AEY A;  3EO6 A;  1PVC 1;  1QH7 A;  1J3R A;  3POB A;  4MHR A;  4NPR A;  1W90 A;  4H14 A;  5HXV A;  5E8A A;  1HN1 A;  3WDY A;  2E31 A;  2W47 A;  1PMI A;  1ZBE 3;  4GMP 3;  3WNK A;  5C33 A;  1QJY 1;  2BYV E;  1MAC A;  2WT1 A;  4HG6 B;  3NMB A;  4XHB A;  2Q5T A;  3I3Q A;  3LEI A;  1BMV 2;  1V00 A;  4YVW A;  5FYV A;  2WNO A;  1IPS A;  2VNV A;  3E5U A;  3GXU A;  3Q8E A;  5CFC B;  1K42 A;  4DY5 A;  2ET1 A;  5FUI A;  4RGK A;  4TSV A;  3IDC B;  1AYM 2;  3OBA A;  1IS3 A;  2XQX A;  1QJX 1;  4KU8 A;  3R4U A;  1NKG A;  2GC3 A;  5FMO L;  5BNP C;  3MZH A;  5KHI A;  4Y5S A;  5C4W A;  3B01 A;  2WJS A;  4CDW B;  5LA1 A;  3IM0 A;  1YQ6 A;  5ABJ B;  4QHZ A;  4GH4 B;  1REE A;  5EV7 A;  4U2A A;  2ARE A;  2DU0 A;  5D8A A;  1AR9 2;  1EAH 1;  4QX2 A;  2A71 A;  3ZR6 A;  5EXO A;  3GCW A;  1ZA4 A;  3MI8 A;  3ZOI A;  1J1L A;  1G9D A;  4D8M A;  3KWV A;  1SDD B;  1SLA A;  5KHJ A;  3A0N A;  4QX8 A;  3TOJ A;  2Y6H A;  2Y34 A;  4NR1 A;  3J9S A;  4C0B A;  3AJY A;  3WDV A;  3I2H A;  3FC0 A;  4XDO A;  3ZFE C;  1BHG A;  2X5I A;  1G9B A;  1C3H A;  1JYC A;  2B9V A;  2JE8 A;  4L92 A;  5C3S A;  4Q5O A;  2FHR A;  2Q8C A;  4AAX A;  4KGG A;  4UT5 A;  1F4H A;  5AFE A;  2QCS B;  2QQJ A;  4OHZ A;  3SMH A;  4BA6 A;  3NO8 A;  5L7O A;  4MO3 M;  2PHD A;  3BIE A;  1YQ2 A;  3DPR C;  3VZN A;  3WG3 A;  3OD4 A;  1CX1 A;  2VZP A;  3A22 A;  2G19 A;  4R52 A;  1OFS A;  4FFF A;  4FPH A;  4LTA A;  3O1S A;  2D3S A;  3OUH A;  2JB4 A;  4NID A;  2TBV A;  5L73 A;  4CDU C;  4ERO A;  2AUY A;  2OT7 A;  4QPY A;  1ENX A;  3SH3 A;  5FV3 A;  5GZE A;  3DN7 A;  3ZFF C;  4B29 A;  3UKN A;  1FNY A;  2B9U A;  2G4I A;  1V6I A;  2BOJ A;  2Y6G A;  1DQ0 A;  2RR1 2;  1RUJ 3;  1LGC A;  1NCQ A;  2F4L A;  1JI6 A;  3A7Q A;  3ZXJ A;  5DN2 A;  1TEI A;  1Q56 A;  3WT3 A;  1Q8Q A;  2HWF 2;  4QGN A;  2R07 2;  2RV9 A;  5FYY A;  2V5D A;  4ZY9 A;  4BQ3 A;  5LB6 A;  3FLP A;  1KQR A;  1SPP B;  5GLZ A;  3V65 A;  2RS1 2;  3NV3 A;  4E4D X;  3UKV A;  5A1F A;  1EPW A;  4PLN A;  4PIX A;  1UX6 A;  2ZS6 B;  1QDC A;  4MHU A;  1CJP A;  3KHB A;  4XJ9 A;  2ZX0 A;  4YGE A;  4CSW A;  3QD6 A;  2VQU A;  2ZA9 A;  4Q4W 2;  5FYU A;  3ZFE B;  5DDJ 3;  4COY A;  1AL0 G;  1G6N A;  1GZC A;  3USU B;  4Q26 A;  4RFR B;  2P34 A;  1R1A 1;  4CXW A;  3W58 A;  3K48 A;  3CJI A;  1US2 A;  5JOY A;  4R9C A;  5I0T A;  1J84 A;  2PN5 A;  3D0S A;  4YM1 A;  5CG8 A;  2VW2 A;  3WW3 A;  1GNH A;  2VUD A;  4Q4Y 1;  1QIQ A;  1FOD 1;  1ASJ 2;  4YLZ A;  5FYZ A;  4COW A;  5FP3 A;  3RSJ A;  2WO7 A;  2V4A A;  2O14 A;  3BCW A;  4CDU B;  3ZR5 A;  3C3V A;  4BIS A;  2WN2 A;  4V1P A;  3ZFF B;  2VXJ A;  3ZFG A;  2RS5 1;  1KS5 A;  2G1M A;  3WZ1 A;  5ACA 1;  1LAJ A;  4LBQ A;  2XUE A;  1AR8 2;  1CAX A;  3BOD A;  3MUZ 1;  3P3N A;  1US3 A;  2WZE A;  2YBK A;  3BI3 A;  2XJR A;  2P2K A;  3E5Q A;  1HRV 3;  3KD4 A;  5FPA A;  3U4S A;  4XJ8 A;  5JSO A;  5JXG A;  3CJX A;  4FI9 A;  1GP5 A;  4JQR A;  3ZSE A;  3GDB A;  4ITC A;  1JZ3 A;  2IXJ A;  2RJK A;  1FV2 A;  2ZGP A;  2ZTN A;  1QY4 A;  4RL7 A;  3BOP A;  4CEW B;  5CVR A;  4DFS A;  1V0A A;  2CL2 A;  1KEX A;  1GQP A;  3O12 A;  1VAL A;  3K3O A;  3UK9 A;  2XGX A;  1LUL A;  4CE8 A;  2KA3 A;  3QLQ A;  4LIT A;  3DYP A;  4FAH A;  4YM3 A;  4JKM A;  4RQP C;  1KJL A;  3APB A;  1F2N A;  5A6Y A;  2BWA A;  2ZHL A;  4M3C B;  3IMM A;  4PIY A;  5DAP A;  1AUY A;  1S0I A;  1H0B A;  4YYO A;  3VZK A;  2BGC A;  5CNA A;  2GC2 A;  5CFD C;  2EVX A;  3WQ7 A;  3OPZ A;  4QKB A;  5JMC A;  2BRT A;  2PQS A;  2HWC 1;  1BVP 1;  4ZPI A;  4OUS A;  5LBB A;  4Q4V 3;  1O5U A;  2R06 3;  5F39 A;  2YRO A;  4WM8 C;  3SKV A;  4GXL A;  2LW8 A;  4QXH A;  4WM7 A;  4BQX A;  5KXE A;  4YW3 A;  2QQV A;  3UKT A;  4FTB A;  3III A;  2VAU A;  4IE4 A;  4XUN A;  3WX5 A;  4IE6 A;  3OGR A;  1OXC A;  1GOH A;  2JIJ A;  4NIH A;  5IFT A;  2O8Q A;  4LBK A;  1HXS 2;  2ZHM A;  3FBM A;  2VNG A;  1NA1 A;  1LGB A;  2H0V A;  4W50 A;  1UPS A;  4QXB A;  4BQY A;  1POV 3;  3WD5 A; 
#chains in the Genus database with same CATH homology
 1W3V A;  2VBB A;  1E5I A;  1OBN A;  1RXG A;  2VE1 A;  1UO9 A;  1W3X A;  1BK0 A;  5C3S A;  1W05 A;  1HB2 A;  1UZW A;  5C3P A;  1E5R A;  1W2A X;  5C3R A;  2JB8 A;  2CSG A;  2Y6F A;  4XAE A;  1W06 A;  1QJE A;  1QIQ A;  1ODM A;  1ODN A;  3ZKU A;  1W9Y A;  2IVI B;  2WO7 A;  3OOX A;  2VBD A;  1W03 A;  1HJG A;  1OC1 A;  1IPS A;  3ON7 A;  5C3Q A;  1BLZ A;  4RGK A;  1HB4 A;  2IVJ A;  2VCM A;  2DBI A;  1GP5 A;  1W28 A;  1RXF A;  1HB1 A;  2BJS A;  1HB3 A;  1W04 A;  1GP6 A;  1E5S A;  1QJF A;  1W2N A;  1UOB A;  1UOG A;  1GP4 A;  3ZOI A;  2BU9 A;  1E5H A;  1UOF A;  2VBP A;  1DCS A;  2BRT A;  4BB3 A;  5C3O A;  1UNB A;  2VAU A;  5APA A;  3ZKY A;  2DBN A;  1HJF A;  1WA6 X;  2JB4 A;  1W2O A;  2Y60 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...