1E5IA

Delta-r306 deacetoxycephalosporin c synthase complexed with iron and 2-oxoglutarate.
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
306
structure length
264
Chain Sequence
MDTTVPTFSLAELQQGLHQDEFRRCLRDKGLFYLTDCGLTDTELKSAKDIVIDFFEHGSEAEKRAVTSPVPTMRRGFTGSMCYSMGTADNLFPSGDFERIWTQYFDRQYTASRAVAREVLRATGTEPDGGVEAFLDCEPLLRFRYFPLRMAPHYDLSMVTLIQQTPCFVSLQAEVGGAFTDLPYRPDAVLVFCGAIATLVTGGQVKAPRHHVAASRTSSVFFLRPNADFTFSVPLARECGFDVSLDGETATFQDWIGGNYVNIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Kinetic and Crystallographic Studies on Deacetoxycephalosporin C Synthase (Daocs)
pubmed doi rcsb
source organism Streptomyces clavuligerus
molecule tags Oxidoreductase
molecule keywords DEACETOXYCEPHALOSPORIN C SYNTHASE
total genus 82
structure length 264
sequence length 306
ec nomenclature ec 1.14.20.1: Deacetoxycephalosporin-C synthase.
pdb deposition date 2000-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03171 2OG-FeII_Oxy 2OG-Fe(II) oxygenase superfamily
A PF14226 DIOX_N non-haem dioxygenase in morphine synthesis N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.330 Mainly Beta Sandwich Jelly Rolls B-lactam Antibiotic, Isopenicillin N Synthase; Chain 1e5iA00
4XAEA 2WO7A 1BK0A 1E5SA 2VBBA 1UNBA 2BRTA 1UOBA 1HB2A 1W9YA 1DCSA 2JB8A 1GP4A 1UZWA 1E5RA 1W2OA 1UOFA 1WA6X 1HB1A 1RXFA 2CSGA 1HJFA 2VE1A 2IVIB 1ODNA 1W3XA 3ON7A 1IPSA 1QJFA 1W03A 3OOXA 5C3PA 2VBPA 1W06A 2JB4A 2BJSA 1GP5A 1HB3A 2Y60A 1OBNA 1BLZA 2IVJA 1HJGA 2DBIA 1W28A 2VBDA 1QIQA 1RXGA 2Y6FA 3ZKUA 3ZKYA 3ZOIA 1W2AX 1OC1A 1W3VA 5C3SA 1W2NA 4BB3A 1QJEA 1E5IA 2DBNA 1W04A 1E5HA 1UOGA 5C3RA 1ODMA 2VCMA 1W05A 2BU9A 5C3OA 1HB4A 4RGKA 2VAUA 5APAA 5C3QA 1GP6A 1UO9A
chains in the Genus database with same CATH superfamily
1YQ5A 1ZVFA 2HBTA 3T4HB 2WN3A 3BODA 1JXNA 2PHLA 1X7NA 5H9RA 1W8NA 2AYHA 4R4ZA 3ZYBA 4BPZA 1V0AA 4GH4C 4XXPA 5BY5A 1OD5A 2VOKA 4LK6A 4MUVA 4PF5A 3ZXEA 4AFMA 5HCHA 1O6UA 5FIXA 2QQNA 4XAAA 4QHOA 4E2QA 1O91A 5EXOA 1NCQA 1J1TA 1PVC2 3A21A 1LKNA 3PURA 4I0AA 3HNBM 4EWAA 5LA9A 4MOAA 2EXKA 5BNPA 2W5FA 5DUVA 3OPTA 1ZZ6A 2BW8A 2LS6A 4RQPB 3ACFA 5ACA1 3WP6A 4LULA 4CE8A 2QQUA 1DQ4A 1FAYA 3MW3A 4CUCA 3B01A 1TQ5A 5IVJA 1URXA 3VZNA 3TRSB 1C8M3 3CEWA 3GZTB 2ZA9A 1Z7S1 4XFBA 4C0BA 1VLNA 3ILRA 4F3JA 1VB4A 1YI7A 3ALQA 1W06A 4Q1PA 4AI9A 4AF9A 2RMU3 2D6KA 3KF5A 1JZ4A 1IPKA 4AVBA 1H0BA 1OFSA 4P9GA 3OUJA 3I4IA 4LT5A 1H8TA 4YVWC 3KB5A 5KHIA 5F3GA 4Q29A 5D21A 5FRAA 4ZS2A 3KF3A 1H6XA 4IV1B 5T5LA 1NZIA 3RI8A 1ULCA 4QXHA 3ECQA 2ARBA 2EXHA 1RTVA 3JQWA 2VPVA 5EJZB 1EV11 1OQ1A 2XDVA 2WT1A 1ZBE1 3AKPA 3AYCA 3BGAA 5T50A 4AYUA 3VD9A 2XONA 3L2HA 1VR3A 4QDQA 4UT5A 2Y64A 2BWCA 4ZS3A 2C0ZA 4XBLA 2ES3A 2RDSA 3KHBA 1DGWX 1S0CA 4ITCA 4FSJA 2B4KA 2A3YA 4PJYA 5FY5A 1DZRA 1UWWA 5C8CA 3MIFA 5C9AC 4YGEA 4I2OA 3THTA 4SLIA 5T54A 5A33B 1AYN1 3WNOA 5IUQA 4E9KA 1F8VA 2VULA 2XHKA 4JDMA 1O8SA 2P34A 1DIWA 2RM23 3JU9A 4YVWB 1LOCA 4XE9A 4V2VA 5G05L 1PVC3 5FYUA 1L7QA 1XNTA 1HLCA 1QJU2 5E1RA 2PHRA 3T08A 1LHNA 1NQJA 1HB1A 1NXD1 2GC3A 2W91A 5DUXA 3WUCA 1QGLA 5DQ0A 4PI2A 5BNPC 1UYXA 4B29A 1BK1A 1ZA4A 1XYNA 2PAEA 5IK7A 1GZWB 2WLQA 2WQ4A 5EP9A 5A6XA 5BUVA 1NXMA 4XF1A 2PYTA 3OF1A 3RNSA 3L2YA 4YFZA 1REEA 2O14A 1X9PA 4EQVA 2BGCA 5JSOA 1RVF2 2IUWA 2C24A 5C3OA 1BJQA 2HYKA 4AZZA 5L7OC 4BQXA 4EN7B 1H4GA 2GSYA 3G7DA 2VUJA 1EAH3 2JDPA 3T3YA 5F1RA 4I0BA 3ABZA 1JOJA 1AYN3 1C5IA 1PHMA 3F95A 4ORFA 2X8KA 1WLTA 4JC1A 4SBVA 2ZGPA 2WUHA 4BJ0A 3HPNA 4LKSA 2VH9A 4Q0VA 5CNAA 5L36A 1Y9MA 2K0GA 1Q3EA 2FD8A 4N53C 1SLAA 3QBQA 1UMZA 1IGOA 1S1AA 3AXDA 4R9CA 1JMUB 4Y1VA 2I45A 2WYFA 1YXWA 5CZKA 1QH6A 1C5HA 1AR72 1MS0A 2TBVA 3OPZA 4B4RA 5FYCA 1V9U1 4MG2A 1QJEA 4AAXA 2VCCA 3ACGA 3AXEA 1T6GC 1ND2C 2ZMLA 1SLTA 3C7FA 3KS7A 1L3JA 1R64A 2TEPA 4UFHA 2BWAA 1HXS3 3IBMA 4XW3A 5JIAA 2QQWA 1IPJA 2VMHA 1WW7A 2WJSA 5FQ0B 4XAEA 1C57A 1LRHA 5F5AA 1V00A 4HKOA 4E8CA 2VBBA 1YUDA 2UY9A 2RS33 1NE6A 2ZCWA 5FP3A 2XBO2 3CDZB 4TXWA 2RDQA 4NHKA 3VZKA 1GMMA 5C8CC 3PJQA 4DOUA 3FBMA 3ZYIB 1GQHA 3FUOA 3RZJA 3VD5A 5LK5A 1YLLA 4RQPC 1R092 2ZJCA 2DURA 3RJ2X 4PF1A 4JTNA 5E16A 4YZ5A 1JYNA 3UETA 5CFCB 3KCCA 4XABA 3LAGA 2R072 3NQHA 4FI9A 4RGKA 2IXLA 2NYYA 4FOWA 1CIYA 4YGCA 4XDOA 3H1WA 1DYOA 3GZUC 4CP9A 2QFEA 4E2GA 4WM8B 3V0AB 3VKOA 1DCSA 3AMPA 4QGNA 3USUB 1KJRA 4B3NA 5JSRA 5KR7A 4UAPA 1RMU2 4CDXB 1RVF3 2RJLA 2A71A 2GP5A 2QZ3A 4G4FA 4PLMA 5DABA 1PO12 4WM8A 5FUIA 4GMP0 3WW2A 4CCMA 5BNQA 2R073 3DGTA 1RUC2 2GNDA 4Q0PA 2FZ2A 4AAPA 2P2KA 4K7JA 1M4WA 4BCUA 2Q4SA 1LOFC 2VCBA 2VGDA 4X8NA 1B35B 1CD3G 2HWD1 3GJAA 4A7ZA 5J09A 1SCRA 1YFYA 4EN0A 2X29A 3T30A 2BBAA 4DPNA 4YZ4A 3H42B 2BGOA 1DYKA 1U0AA 1N1VA 4IGOA 2PLV3 3U78A 4AQTA 2HEYF 5CFCC 1VBD1 4ES9A 2CHHA 3O1SA 1F5JA 1NY72 4KU8A 1AUYA 4YM2A 3P6BA 4N53A 1OA4A 5L9BA 5FV3A 2ZX4A 4A45A 2GALA 1CONA 4JGYB 3OGSA 1UKRA 4QXCA 2DU0A 2HH9A 2W1UA 3WHUA 3R4UA 4AHZA 4NHMA 4NPLA 2WNUC 4OVEA 3HBZA 3IDEA 1QIQA 4Q4V1 4Z07A 4NIAA 2ILMA 2DTWA 1VAVA 1W3VA 2CDPA 4JQRA 1RC6A 1YHFA 4KBBA 5IVVA 2VVFA 2HYXA 5C5UA 2ZX3A 2XBO1 4KNCA 5EJ3A 5LBBA 2G9FA 2H0BA 2Q8DA 4BQ4A 1A34A 4EE2A 4XF0A 2XH6A 5FLJA 2EIGA 2VW0A 1HB2A 1SLBA 2E33A 4ASLA 4RQPA 4FAGA 3BOWA 2KM2A 4A7YA 4GB33 1EUUA 2BVVA 2CSGA 1GU3A 2IWGB 3INAA 2VE1A 4RFRB 4QB6A 1VAMA 1IPSA 1Z7S2 4IERA 3WW3A 4GMP1 2BJSA 1HB3A 3F2ZA 3NV1A 1NA1C 2BGPA 1V6JA 2GN3A 4CXWA 4LIUA 3VBFA 3SC7X 1UCXA 4F8AA 1TZOA 3O1PA 4A6OA 2YGLA 1WD4A 1Y43B 2P6HA 3I3BA 1OHFA 3USUA 2VUDA 4OCTA 4G3YC 1CESA 2GMPA 4EV0A 1OSGA 2ZTNA 5KXBA 3IDAA 1ULEA 4LO4B 1PZ8A 3LCPA 1J3QA 1GOGA 2MHFA 3ETPA 3HQUA 4L0PA 1I9RA 2YBKA 4LE4A 1AHSA 2VQAA 2ARXA 4FBFA 2D6MA 3BPZA 1ULPA 1W0NA 1IQDC 1UMIA 1ULGA 3WP5A 2YY1A 4FPKA 2VZOA 1NKGA 4C91A 2QNKA 3E5UA 3WCRA 2JXAA 2ZX1A 4CXYA 4ATFA 4CP2A 1VBE2 2WZ8A 4L92A 5LY2A 2D5HA 1LNSA 2ADEA 3MEPA 3H3ZA 2F17A 2JDYA 2DCKA 3KMHA 4FXGB 4D6QA 1WMEA 1OD3A 3KQRA 2QQIA 5FQ0A 3KSCA 5IK4A 1J3PA 1G9FA 1SPPB 3VKLA 4OQ8A 1C3HA 4CDUA 3FLPA 2D6NA 3H3UA 2R1DA 5FPAA 3E5XA 1W0OA 3WVJA 1REDA 4ZU7A 1BCXA 2OT7A 2A7AA 3P3NA 1GP5A 4XCAA 2VUCA 1UAIA 1UF2C 3O12A 3WP3A 4JVAA 5K0UA 2Y26A 4A4AA 1RUI1 2BFUS 2H6CA 4DQAA 2HBUA 3I2GA 1ZRIA 1IOAA 3TEYA 5FXWA 4FVVA 4C90A 3TEZA 3EB7A 2AACA 2Y8KA 3WOGA 2PELA 2VQUA 4LIVA 1SZBA 1UD1A 1RJ8A 4FAHA 1D2SA 4W50A 3V0BA 4XPVA 1UYPA 3I97A 2OZJA 2ZPXA 3PUSA 4FCAA 5APAA 3T4VA 2YFUA 1ZRFA 4D69A 4CP9B 4OMDA 2G9ZA 2XOMA 4CCCA 2W1WA 2E26A 1WKYA 2VOWA 4E27A 1DQ2A 1OF3A 1Q8VA 3GCWA 3OEAA 4P00B 4D7YA 5FYHA 1C1LA 1KFXL 3QLQA 2DU1A 2F4PA 1OBNA 2NQYA 3LIGA 2BNOA 1N47A 3V64A 4PLOA 2FDKA 1BQPA 2VTFA 1V6MA 3TN92 1COV2 2CU5A 2R7EB 5CKNA 1D0HA 5JDBA 3W9AA 2ZZJA 3LB9A 3BN6A 4FQZA 3VBSA 3GXUA 3LQCA 1DLCA 1FX5A 4QKNA 2XVLA 1OKOA 4PBPA 1FMD3 1W9SA 5IHRA 3T2TA 1HRI2 5FWEA 1DZTA 1O8PA 1RUG3 2RS52 3AZYA 4OUSA 3ZSMA 2R043 2QDNA 3POFA 3PUHA 4D7SA 4CEYC 3PL0A 2Q8EA 2ZGSA 1TNRA 2RJ2A 5JZGA 2VC9A 5FXZA 1MS9A 1QKQA 4GKXA 4E2SA 1ULFA 1GICA 2EA7A 1KDMA 4JGYC 1G9AA 3POYA 1CIWA 4AQ6A 1K12A 2RVAA 3ZFFA 1GZ9A 1JU4A 3OGRA 3VN4A 3RGBA 4AVVA 4ATEA 2QKDA 4AR2A 1DGWA 3MIDA 3PUAA 4LHSA 1VE0A 4KWKA 1MR5A 4Q5OA 1QY4A 2QUOA 3RYKA 4GWIA 1XE7A 4QPGA 4META 4P9IA 4UFMA 4MV2A 5F5IA 2NMNA 3WR0A 1ZRCA 4Q4V3 4NIHA 2B9VA 3B02A 2OVUA 4RL7A 5LRSA 3S5AA 4MGYE 2A6XA 5JWPA 1SFPA 2HWC1 1C4RA 1OA3A 3LOIA 3IWZA 1ZRDA 3EHKA 4WV8A 4QHBA 2X05A 2XKPA 4K1YA 1ODNA 3VBOC 4GWMA 3RPQA 5I0RA 3R4SA 2JD4A 1RMU1 1VP6A 4Z2AA 1NCRA 2GC1A 1KRIA 4COZA 3VDDA 1W8UA 4EN6B 2WSVA 3BIWE 1GZWA 3NO8A 4QB2A 3DCQA 1SACA 1QXJA 5JSPA 4ZHNA 3LD8A 1SQ4A 5FO9B 1OC1A 1QXPA 3POWA 5FUNA 3ZXLA 5F8PA 3DKWA 1XSRA 4CDWC 2ZEZA 1DGRA 2VNVA 5A3UA 2B9UA 4M00A 4U36A 2VD7A 3FL7A 5A70A 3ZYPA 2RV9A 3POJA 4XUOA 4ZU4A 4COVA 4KG8A 2Y38A 4XURA 3I3MA 4FTEA 2JE8A 2VTXJ 4E4ZA 2AREA 2VQ0A 4QGMA 3ZFGA 1COV3 4Q4X1 3WDXA 2AH2A 5I93A 3TN91 1GFF2 2FDGA 4IDZA 4N43B 3KGLA 4YW3A 2I74A 1EP0A 3DN7A 1FMD1 5GLTA 1FV2A 4KWUA 1DHKB 2E51A 2FMDA 4DEVA 1QJY3 1DQ1A 3IZOA 4MVTA 4PLNA 4QGLA 3ZLIA 4EN9B 4QX8A 1H1AA 3KGZA 4BB3A 2WAOA 3A0NA 1OURA 3RI9A 2AC1A 4BIFA 4CDQC 1SPPA 2C4XA 5FZEA 1QOSA 3B3QE 1Q56A 4EZHA 4MYEA 4XBNA 4J6GA 1XNKA 5EWSA 3AFGA 4IE4A 1UW8A 3J7MA 4KG0A 1X50A 3HAGA 4XDPA 4N8MA 1UOFA 1XSQA 2E63A 5T52A 3ON7A 3ZSJA 5FYTA 3E1F1 3AK0A 5FP9A 3ZIWA 4J1WA 4LA3A 4OI2A 1L7LA 2K9ZA 4QM9A 5EPAA 5FCCA 1UIKA 1RUF3 3S57A 4L99A 4R8HA 1I3HA 2VVEA 1MVQA 4QX1A 4BIOA 4DRVA 1VAKA 4LUMA 5A7PA 1OH3A 3N7KA 5HV4A 2W87A 3PUQA 3NW4A 1S4CA 2ZXQA 3HNMA 2RJKA 3PMEA 5I8TA 1RUH2 5CBLA 2WNOA 4XUNA 3SMHA 1W9WA 5JLVA 1BK0A 4NAMA 2UY8A 1YCIA 2OQ6A 4EN8B 3OD4A 2FCVA 3WF4A 3PDQA 5A1FA 2P3YA 5LZ6A 4YW5A 4UW6A 4CDWA 1KQRA 4QPIC 3MLJA 1Z0HA 4LBNA 5EYXA 5FZOA 3MIHA 5AVAA 2ETEA 1D0GA 1H2MA 4FFHA 3OSDA 4PIYA 3BU0A 4Q2FA 1HX6A 1RUF2 3O5SA 2WKKA 2ZAHA 4WVMA 4AL9A 4XBQA 3DYMA 2D6LX 3WV6A 2XQRA 4Q4X2 3VKMA 4WM7A 4ISRA 3VLBB 1XC6A 4LBJA 2H0VA 3GYDA 5AVPA 2FBEA 1SBEA 4XHXA 1XBFA 3D6EA 4ZONA 2W94A 3WNXA 4XZPA 3RZMA 2GH8A 3SEEA 4PDWB 2YBPA 4N9IA 1QHDA 3JB4C 3HQRA 2PA7A 1E57A 4BMBA 4BK4A 1BLZA 5BNOA 3Q9OA 2KR2A 4HPKA 2VJXA 1ZBA1 4UFJA 2P3KA 3O14A 3ZSKA 4QQPA 2E7QA 2X5IC 2VZRA 3D0JA 3IDCB 3IIIA 2EVXA 4Y4RA 2B45X 2BVBA 1AXYA 2W92A 3W5NA 1LENA 1POV0 5FWJA 1ACCA 3FMGA 1VBB3 3LA2A 2NLRA 1G9BA 1QOOA 1PMIA 5J37A 4H7MA 3NAPA 4B1MA 3SH5A 4CUAA 4A42A 4ASMB 4YVSB 2OUJA 3VHPA 5FPXA 4YM1A 4XACA 1ZREA 1RINA 3PU3A 1YIFA 4GKYA 3KT7A 3WQBA 2AGSA 3U10A 4CU9A 1W2TA 3AMHA 1CWPA 5F3CA 1W8WA 1QJFA 1TME3 4IEUA 2SLIA 3NV2A 4IETA 3SLIA 1HW5A 1D4M3 5FP4A 3N9QA 3CLPA 4ARYA 2WQ8A 2XLFA 4DUXA 3KVAA 3E6DA 1JW6A 3LPGA 3EQEA 2ORZA 2LTNA 1COV1 4Q4X3 5GALA 4LBQD 1AXKA 3MO4A 4RA0A 5FAXA 5IK5A 2R063 1LHWA 2IFWA 1G9DA 3O1UA 2H6BA 1AR73 1GOHA 1MEC2 2ZHLA 4U2AA 5FZ1A 2R1BA 1MZFA 5D2AA 5IVEA 4QKDA 4LBLA 4Q4W2 5FMCA 3PUIA 4Z1VA 1ZBE2 4LE3A 4P08A 4QPIA 1SDWA 1JZ2A 1H6YA 3PVEA 3P1IA 4YM3A 1S2BA 4MXWA 5FZ0A 1J3RA 3JD71 4F7ZA 4JZRA 4LUKA 3ZR6A 4QMAA 5JUVA 2XL7A 1JH5A 4UW4A 3CQOA 3NJXA 2A6YA 1EAH2 1WLWA 2VMGA 4OI4A 2WDBA 2ZGLA 3N9NA 1ZZ9A 1POV1 1VBC2 5FMOL 3BTYA 4XEZA 3S30A 4XOGA 3VZLA 1XYOA 4GH4B 1VRBA 1QQP1 2RHPA 4MXVA 4D3WA 2QQVA 4AGGA 4ZXEA 5F3EA 1N1TA 1LODA 3SCHA 3URFA 1GP6A 5K0UB 5LK7B 3WNLA 4HL0A 5L7OB 5FMBA 2D44A 4OMCA 1RUNA 1UZWA 2CWSA 2HWF1 2OIIA 3B69A 1OLRA 1YO8A 2OUHA 2Z69A 3K3OA 4JRLA 1GZCA 3THPA 4FOVA 3NJZA 5CU1A 3BIEA 4YGBA 3VBSC 1AX1A 4CSWA 3THCA 4Y33A 1K3IA 3GM8A 5F3IA 1XXNA 4Q4Y1 2CTVA 4CCNA 1CZSA 4HK8A 2LUWA 4QPGB 4YFWA 4DFSA 4BXSV 2VQTA 3SITA 1UY1A 4J25A 5AC92 4UBGA 4CDXC 1ND2B 5C3RA 4CEYA 4MX3A 5HXVA 4BQ5A 4LO7A 3MBWA 3AP6A 2O8QA 4JDNA 1XE8A 1UO9A 4WM8C 1UU6A 1W39A 2DVFA 4S2DA 1S0GA 2WO2A 1OKQA 2ZHNA 5C5TA 1XPWA 1RXFA 1LOFA 1UL9A 4IV3A 2AENA 2Y6GA 2BYVE 2QBXA 1S0JA 1DZQA 1JN2P 2DCTA 2UYAA 3VUOA 2XPJA 1A3KA 5JXGA 4NN0A 3DXUA 4NAOA 3W21A 1G6NA 2CYFA 2XJTA 4B7EA 2LW8A 4LEJA 4N43A 4AE2A 1AR92 4DY3A 3N3HA 1V9U2 1MEC1 3Q8EA 2QQMA 4NIGA 5CVRA 3NL1A 4OHWA 1SDDB 5F6LB 3PU8A 2AR6A 2WA4A 4R52A 1JUHA 2JWPA 2PN5A 3DF0A 4BQWA 4IQPA 2J22A 4S2FA 2WO1A 2YC2A 1R093 4Y22A 4BYYA 2GDFA 2GH2A 1WZXA 2W46A 2WC2A 2J1VA 2JB8A 4EYUA 3U4XA 2Y0IA 3CJXA 3W5MA 2JDAA 1UY2A 4RS5A 4JX0A 3DUIA 4RR3A 3I2DA 1QJY1 1ASJ3 1OFNA 1W6MA 5F2SA 5BNNB 5JPMB 1PIV3 2ZS6B 3LEKA 5CIRA 2OPKA 4YVWA 5ISLA 3O1RA 2EIBA 3RWNA 2HWE2 1ENXA 4NO4A 1O3QA 1ND3A 3KM5A 5FO7B 3FZ3A 5FZAA 3UJQA 2R0HA 1FYUA 2GU9A 2VCAA 5LA1A 2ZGNA 3DV8A 3LA3A 2VZVA 2ZGRA 2MNGA 3KV4A 3U75A 3WNPA 4M0HA 3ZFGC 5JIUA 3OY8B 3AM2A 4HZFA 3C7GA 4GWJA 2R32A 3BTZA 3VDDB 2MEV1 2CGNA 4YSFA 3GNEA 4BMEA 2J1TA 4XTMA 3KV5A 4XUTA 3QD6A 5GLZA 5JR7B 3LDRA 3H8XA 1ST8A 2E31A 2R30A 1L7RA 1LU2A 4WZCA 4IL7A 4XVHA 5DAQA 4TWTA 4R9BA 3S6PA 4GIQA 3TYJA 5LW9A 4QWNA 3EYPA 3OGVA 1LHUA 5GLUA 2D93A 5FYMA 1BEV3 2VZTA 2HWD2 2I07B 4PQQA 1TNFA 3OJBA 3PVOA 4OLLA 4R4XA 3LEMA 2G9GA 3IPVA 3LDBA 4J1XA 2XG3A 1OQEA 4Y24A 2MPFA 3RZGA 5D8AA 4H14A 5LWBA 4Z92B 4BZ4A 1X9TA 5FZFA 4GMP3 2JICA 1EUTA 4AEMA 3KHCA 1V9U3 3H8UA 4LLFA 1AR93 1JS9A 1D2QA 4OHVA 1TMF3 1U5YA 1B35A 2D6OX 2Y0OA 4P9LA 2ID4A 2W08A 2RM21 5GLWA 4YYOA 2W3JA 2YU2A 4DB5A 3MI8A 1GUIA 4GWNA 4JTOA 5LBCA 5IAXA 4BQYA 3T0DA 3ZN5A 3LKJA 1BVP1 2FZ1A 1ZBA2 4I01A 3X29B 1JBCA 3AVSA 5FZ8A 2K2SA 1A6CA 1UPIA 1SBDA 4XHBA 1I6XA 4Y20A 1MQTB 4IW3A 4PT6A 5FLIA 1RUJ1 4AGVA 1UX6A 5EV7A 2LROA 1NCQB 1RHI2 2RMU1 1TVGA 5BYNA 2BPA2 1QJY2 4NHLA 4L97A 3I59B 2PFWA 4Q0SA 1NOVA 4NPMA 2GZWA 5A3TA 1QJZA 3NKTA 2B5HA 5K9YA 3HOBA 4W6YA 1K5MA 1JYTA 1UY3A 5FY1A 5BNPB 3KT1A 1X36A 4Q0QA 5D1IA 2XJVA 3RZHA 1VPHA 4PIXA 3IAPA 3OTFA 5FK7A 3HNYM 3D4KA 1NT0A 1OA2A 1AYM3 4BDVB 2JIJA 3ITQA 4K3UA 1GNYA 4S2GA 4GXLA 2O8OA 3VD7A 1VALA 1Q8PA 2EALA 2HWB2 5JI9A 4CU6A 4I3PA 1HV0A 3CJIB 3LZZA 4UFLA 1S2EA 4URTA 1DBNA 3POGA 3ES1A 1UY4A 3H8RA 2JKBA 1TME2 3NKGA 3I2OA 2DTYA 5H9SA 3NRUA 5FBJA 1WCUA 1W9TA 4XF3A 5LBEA 3T2PA 4BM8A 2YC0A 2KXLA 2UWBA 2HWD3 1BEV2 2C1FA 2OQ7A 2X5IA 4LBQA 1NQDA 5E6HA 1QNYA 4R9AA 3C2UA 1H8TC 2NPIA 1DG6A 4I30A 4WM7B 4BE3A 3D3AA 5KXEA 2VZQA 3EBRA 2G19A 1UYYA 1W6OA 3ATGA 4XFCA 2ZOEB 3UKNA 3ZKYA 2OPWA 4BISA 1HQNA 4YW2A 2TNFA 4JCKA 1UX7A 3M3OA 3WY6A 3C7OA 2VU9A 2IFRA 3NNGA 3CL1A 1XJAA 3WHTA 2W68A 4CU8A 3UKTA 1ZYBA 2Y34A 1AVBA 4XJAA 5JOYA 4HK9A 4Y22B 4H55A 3JD73 2WFF2 4C1WA 1W6MB 3B5LB 1JYCA 4YWAA 2OZ6A 2ZEXA 3JCIA 4PDWA 4AQ2A 2PXJA 5HV0A 4RHV3 1KD7A 3NJVA 1CAWA 2GNBA 5HI0A 3WW1A 1VB2A 1QQP3 1SHWB 1AR62 4YW6A 4GD4A 4QX7A 4A3XA 2YDEA 1VRH3 4Q4Y2 3WF2A 2WRAA 4AK3A 2ZAAA 5J3UA 1CVNA 1GBGA 3E5QA 3K4ZA 3K77A 3LFMA 4QKBA 4XZUG 2J1AA 4HN1A 4P14A 4QQHA 5A3NA 1CAUA 1NUKA 1MZ6A 3JXSA 3VBFB 5FPBA 2J7MA 3M3CA 2WO7A 4FPJA 2RDNA 4XILA 2W1QA 1PNGA 3PJYA 3NWKA 2ZGOA 3MYXA 1RHI3 4DINB 2WNUA 1YNAA 4FXKB 3MZHA 2B46X 5A3MA 2CY6A 3HEIA 2HLEA 1OLMA 2OA2A 3RVHA 2A70A 1CGPA 3AP7A 2B39A 3W20A 4CEWB 1RIRA 5DUUA 3N9LA 3W59A 2P5BA 3GBWA 4AEJA 4BQ1A 3LF7A 1AR91 4MHRA 4CDUC 3I54A 5DAWA 3ZXJA 1UOGA 5CAZA 4HVOA 1EV12 1HN1A 1HRI1 5T3NA 1BEV1 1YI9A 2VUAA 4HLTA 4BQ2A 1R1A3 3SISA 1U5ZA 2VY0A 1E5SA 1OH4A 5B4XA 3EO6A 4MLOA 4DS0A 2YROA 1GNHA 3T2QA 1PX3A 4A41A 3WP4A 2F4LA 5JAXA 1Q43A 2YMZA 4QKFA 2ADDA 5E8AA 2ZGKA 3N7LA 3AP5A 4LQRA 5DAXA 3ELNA 4HFSA 1QEXA 1W8HA 3FLRA 4NUBA 4YNIA 2WFF1 2E7AA 1RL3A 4PDWC 5LRRA 3IB3A 3T0AA 2X09A 1QJX1 5LASA 5FYYA 5H9PA 3U37A 3LA7A 5BXXA 2R042 1RUI3 1CAWB 3MHZA 5BNNA 4YG3A 3WDUA 1QU0A 1CJDA 4XJ8A 3LE0A 2DF7A 2FHRA 4GJYA 3CJIC 1OXCA 3K3NA 3CNAA 2JG8A 2WWSA 3HBKA 4JHTA 5EIYB 4YW7A 3ME2A 2GAUA 4FTBA 1NCRB 2PHWA 1SFYA 3ZXFA 1S0DA 3LEIA 3V65A 2JDMA 2VMDA 3AYEA 4C1XA 1JYXA 1W8FA 2BDRA 1YRZA 3FC0A 2VVDA 4RR3C 4RS5C 4K1ZA 2EIDA 2WYSA 2GMEA 3ROUA 3VKNA 5FPUA 1O3RA 3ZN6A 1O59A 3J8F1 4LA2A 4P9XA 4IE6A 1A8MA 1APNA 1PMJX 1GZTA 3IPVB 3NVCA 4H2AA 1Y9GA 4OFGA 4QX2A 4AFBA 3PIGA 1T2XA 3ZN4A 1FMD2 1Q8OA 1ZA7A 2JD9A 4TTGA 1Y3TA 5A1LA 2PQQA 4JKMA 3DECA 5JXJA 3ST7A 3FN9A 3HD8B 4XIKA 5ANQA 3N4MA 1F15A 4UW3A 3VBSB 3A23A 4JKLA 1FATA 3ZX7A 5CADA 2WINB 4EJRA 3N36A 1R083 2B42B 5IK8A 5EFUA 4NROA 3ZDSA 4YPJA 4HG6B 1ULOA 3DL3A 2XJSA 3P5BA 1NE4A 4XXAA 3ZXAC 4BHPA 3R05A 3AX4A 2VM9A 2JE7A 3PHMA 4IESA 4AEDB 3CZUA 3M70A 3D82A 1GQPA 3K4AA 4PQ9A 5IATA 4Z8BA 3M4FA 2X53S 4Y5TA 1AYM2 2B8MA 3FJSA 1WMXA 4IEYA 1BKZA 2W9XA 4IUGA 2CNAA 1US2A 3FBYA 1RGSA 2XHNA 4M01A 5FY8A 2CWMA 4LORA 4AFCA 4CPBA 1W6PB 2DBNA 4JKKA 1E5HA 1H1MA 2CDOA 4E4SA 2GP3A 4CXXA 5FZ4A 2NP0A 2RS11 3C7EA 3AYAA 1WGPA 1WBFA 1LGCA 4K40A 3T09A 5FZCA 5CKMA 4UWDA 3SCFA 4AHXA 2XJUA 2UWAA 2YFZA 3CF6E 3DKQA 3MFCA 1IS3A 3NV3A 1W2OA 1RUC1 5SV5A 1QWRA 2Q1ZB 2UU8A 4IXLA 5HCBA 1W3XA 4XFIA 4DY5A 1UU5A 4W6WA 3K51A 4RGAA 3B94A 4YGDA 1W28A 3AMNA 1JZ3A 2Q8CA 4AVCA 2RG4A 1MS5A 2BNMA 1LCLA 2V4AA 3ZFEB 1U5IA 1Q5OA 3POEA 3J8F2 1UKGA 3QCWA 5I0SA 1FPN1 3OEBA 2G1MA 1GOFA 1S0EA 2BZDA 3KCXA 3RJRA 3AKTA 2WO3A 5C6CA 2PHFA 1OI6A 5FZHA 3JUUA 4V2WA 3MLKA 5FMDA 4CZSA 4XFAA 4Y1XA 4B8EA 2VZSA 5EHDA 3FFZA 4AVTA 1F4AA 2XVKA 3K48A 4XYXA 3SKJE 3MIEA 3T1LA 5BV6A 2YYOA 4K6BA 2PHDA 4AQSA 5A3PA 1WUVA 3MUY1 3VD4A 2UURA 3WDTA 1O5LA 4UOJA 5FPVA 3FHAA 1OVPA 1RUD1 2VOXA 2IXIA 1KXGA 4AI1A 1LEDA 5FZIA 3ZMOA 2QQPA 4XUQA 2HEWF 1MS8A 1W6PA 3SHRA 1US3A 3AZWA 4P5HA 2RE9A 1HKDA 1EPWA 4FPLA 2A3WA 1ZBA3 2ZABA 5GM0A 5FOBB 4IEQA 1CZTA 3GHMA 1AYM1 4GJZA 5EZWA 4LO8A 5IYYA 1JYWA 4YRDA 5EYYA 4ET7A 3HN1A 3OOXA 4N90A 2Y6JA 2NMOA 1BZWA 3I2FA 4OHZA 2ZACA 3OB8A 2WZR3 3OPWA 5A3LA 4QQ2A 3B93A 2OX0A 3U14A 3AZVA 2WFPA 1C1FA 2RS12 5F32A 4JGZA 3TB0A 5GZDA 1CR7A 1HV1A 4KI5M 1IQAA 3AFKA 1W04A 1YQ2A 4HONA 4QX5A 5DXDA 5SV8A 3WG1A 4CCDA 3B9IA 2D5FA 1HB4A 3UKVA 4L11A 4O61A 3KWVA 3I2JA 4FOQA 4FPEA 4NOTA 2FQPA 4NVPA 1PIV1 2N7GA 2PHTA 4URAA 1OT5A 4MGSA 2YZ4A 4LBQB 4O9EA 5DG2A 2WQZC 3BTAA 1LU1A 4LBKA 3IIAA 1EYBA 3JD72 1VJ2A 1WCKA 3NNJA 2C26A 2RR11 3VDAA 3H3LA 1BMV1 1LR5A 1IS6A 2BP6A 2Y60A 1GSLA 4QHZA 3DXTA 3RQ0A 4A3ZA 3RMYA 1FPN2 1NAEA 1VBE1 4TLFA 3O1TA 3NAPC 1VBC1 2PTMA 3LFIA 3U11A 2DVGA 3MUZ1 2VZUA 5JZGB 5LBFA 1AR63 1QQP2 2QDRA 1AR82 4N53B 4MGIE 4ZPIA 1IS4A 2Q0AA 1GANA 5T5OA 3AC0A 2L9LA 2J1RA 4CEWC 3OGGA 1QJX2 2IXHA 3RRDA 1RMU3 1PGL2 2ZKLA 3SXWA 2P37A 2CV6A 2HWF2 4I02A 3GDBA 1QJX3 4JGYA 3ZFFC 1KGYA 3PVBB 2D97A 3VBUA 1POV3 5C9AB 1WA6X 1W2UA 4A44A 1O3SA 3O1OA 4AGRA 3IM0A 4NWWA 1W9FA 5FO8B 1NYWA 4NHXA 5JVVA 4COUA 4YW1A 3RSJA 3O0WA 4AI0A 4FPGA 3WXPA 5FZGA 4WM7C 4Q8LA 1WLDA 4BK5A 5AC91 5FOJB 1JHJA 5CFCA 3HJRA 4IEXA 3CU7A 2JDKA 1K5MB 4JGZB 3WQ0A 5FPZA 3TNPB 1YQ8A 1QNWA 3ZO0B 2XKOA 2Q5TA 5A7WA 5IJRA 3OD0A 1LOAA 1NCRC 1BVVA 4QD2A 1X82A 5BNOC 3HWJA 5J36A 3OCPA 1XNAA 1YFWA 1F31A 4RSUA 3TEXA 4DZGA 1IHMA 1QDOA 1VBA2 4DUVA 3AJZA 4MH0E 4MGTA 5DG1A 1U5XA 3FE5A 4M4PA 2YXSA 3JB8A 1UXXX 4IEWA 4FO9A 1JZ6A 1AR83 3PTRB 5FJKA 3ZPYA 1WCQA 3N9PA 3ZOIA 2V72A 5FKCA 4DEQA 1UQXA 1W6OB 2VXRA 2BERA 4LR4A 5DN2A 1B35C 2O0OA 2J1EA 1QJU3 4CCLA 4AEKA 2P6CA 1BMV2 1K5JA 4EWDA 5DPNA 4QQLA 2VZ3A 2P1BA 3DEMA 2W0XA 1E5RA 1ZZBA 2Y6HA 3VBFC 1DGLA 2NM1A 3WNNA 5C9AA 4WVWA 1JYIA 3T0BA 4XDQA 3N9OA 2HWE1 1G7YA 5DMYA 1DU3D 1KS5A 2DDUA 1R081 3POIA 5BNOB 3NNFA 4H3WA 4GH4A 2PMWB 3WT3A 1YC61 5DZEA 3ZFEC 3VBRA 3MPBA 1HIXA 3ZIXA 3AVRA 1PGL1 5FXVA 2YV8A 3T1MA 2A5ZA 2WABA 4D6RA 4CCJA 3ZPOA 3AP4A 2MEV2 1WMFA 1WW5A 5CFDA 4ZKTB 1I5PA 4NRMA 1O3TA 2QTWB 5FPLA 3ZM8A 1AYN2 3K4DA 1UZ0A 4I3GA 1W0PA 4LO6B 2XWJB 1KJLA 3U1XA 1H8VA 1T6BX 1UNBA 3UK9A 1CAUB 1GP4A 2Y6LA 3AL6A 3NNLA 4LK7A 4L2NA 2ZGUA 1QXRA 3V0AA 4EROA 3V56A 5B2GB 2ERFA 1CN1A 1QJU1 3KZ4C 5A7WB 5GZGA 4LTAA 5FYVA 4ZY9A 4Q4W3 4XC9A 4Q0UA 1RUE3 1XOYA 2D7FA 3AYDA 1LB2A 4BH9A 4MHUA 3A22A 4UBHA 2K46A 5DAVA 2P3IA 4JRAA 3WQ7A 4OI0A 2NZ9A 1SG3A 5FYIA 4DXZA 4AFDA 3M3QA 1UZZA 2VAUA 5FP8A 4EWEA 1ALYA 1KITA 2E6VA 2VNRA 2ZX2A 4IEOA 5IAVA 5KXDA 1OPMA 4OQ9A 1RVF1 2YC4A 2EICA 3ILFA 3GCXA 4PBOA 5K7PA 5J48A 3H8OA 2RM22 5C4WA 3HVDA 5LATA 4I09A 3CHXA 1I5ZA 1XNBA 5L73A 3UGFA 4BLIA 3BKZA 4HN0A 1F35A 1FOD1 4FFGA 4IGQA 4XQWA 2OKXA 4K20A 3N7MA 3LOBA 5I91A 4Y5SA 2ZEWA 3RYRA 3AKSA 3JZVA 1P8JA 5FUPA 3ZDVA 1O7FA 4IEVA 3VBRB 1RUJ2 1FT9A 1TMF1 1J58A 1NA1A 3FX3A 1BBT1 1LHOA 1RHI1 2RMU2 3MLLA 3BTXA 3SNMA 5C3QA 1W99A 4ZU5A 2R061 2RR13 1HRI3 3RWKX 3RMXA 5GJ6A 5FZ7A 4CDQA 4AFAA 1R082 2VW2A 2Z4FA 5A6YA 1W6NA 1ENSA 1CAVB 2WZR2 3Q8CA 3LWCA 5I0TA 4GALA 1OUXA 2HJIA 1ND3B 4YVSA 3BUCA 3NMBA 3NAPB 5CG8A 5CFDC 3WF1A 3NSTA 1R1A2 4CA9A 1RUH1 3MV11 3ENRA 4XFGA 4IE5A 4NPRA 1ZBE3 4MGKE 4XIOA 2IXCA 5J98B 1R1ZA 1Y7BA 2FDJA 4M3CE 4CRQA 1PK6A 4LKFA 3AZXA 3VBHA 3KD4A 4QQOA 1CZVA 4LBOA 2UYBA 1VIWB 3WD5A 2XJRA 3I8TA 4UFIA 4DXSA 1PGSA 4OUMA 4QB1A 2A6VA 2WAAA 2QCSB 2YB7A 3APBA 3ZXDA 1PM4A 1CQ9A 2V5YA 4FPCA 4KQ7A 4P5YA 4CUBA 1AL23 2VNGA 5ERLA 2OYZA 2A6WA 4XCBA 1OMIA 5M0TA 1RUG2 2RS53 1PO11 4H7LA 4XJUA 4TZDA 3WDYA 5J1XA 2EXJA 4Y26A 4AWDA 3BB6A 1AR81 4NMIA 1WW6A 2BUKA 1F4HA 3ILNA 5FREA 5FZOB 4HKLA 3MF9A 2NN8A 4CCKA 1LAJA 3I3EA 1OUSA 5GZFA 3MFAA 1AX2A 3PMSA 3VDDC 1WW4A 2VZ1A 1OLME 5K4LA 2ZGTA 4AHYA 1OLQA 4AOCA 2SBAA 4CDQB 1TG7A 1V70A 2C9KA 3WSOA 5I0DA 2PHXA 2V4VA 3O1MA 4P9JA 1VBD2 4X6RB 2BV4A 2R0FA 3PNAA 5IWFA 4AEDA 5F6KA 1MPXA 3WEZA 1S0IA 2DBIA 3ZYHA 3R6SA 1CPNA 1HQLA 1DQ5A 1SMVA 2OW4A 2YBSA 4B7KA 2WS91 2XBO3 3MICA 4NWVA 4XMAA 2XJQA 3GHNA 1H4HA 1W2AX 2HWF3 5BNNC 5IVFA 1POQA 1WCDJ 5DZFA 3A7QA 4FP3A 1D4M2 4D6SA 2A3XA 3TAYA 1WLCA 2D6PA 5FY9A 1NX9A 2JJ6A 3PIJA 2WZR1 3VD3A 5JMOA 2CGPA 5EQUA 1W6QB 5E88A 3K75B 4BLJA 4FPYA 4DMIA 1MEC3 2Y6KA 1MS3A 5JXHA 2D3RA 3OBTA 2GNMA 4FP2A 1LTEA 1JTZX 4TN7A 5FYSA 1AZDA 1VBD3 2Z2SB 4GULA 4AI3A 2ET1A 2QJVA 3VZOA 4CEWA 3JBG2 5G04L 1S0FA 1NZCA 2XUMA 3E6CC 4E4DX 4GA9A 3BI3A 5C70A 1GWLA 1W2NA 1PGW1 4NIIA 4CTEA 5KHGA 2WNUB 1Z7S3 3CZJA 4HT1T 1AXZA 1ODMA 1V6OA 2DCYA 4QPIB 1X8EA 4AHWA 4YG6A 1PO23 3GZAA 3M2MA 4HETA 3WQ1A 4CDWB 3DYPA 4NRQA 2IXKA 2ATFA 4Q27A 4XQDA 3HT2A 1C8NA 2PQSA 2P17A 3B9CA 4M4RA 4N43C 4RN5A 2WZPP 1N1SA 4E8DA 4UYBA 4Y1UA 2VBPA 1FI2A 4AW7A 1CAXA 3AL5A 5JCTA 5KHJA 1J83A 4O65A 2JKXA 1HRV1 1SEFA 2VR4A 4QXKA 3OYWB 4RD7A 5I8SA 4PI0A 3WLUA 2E7TA 3WG3A 5F5QA 2WL1A 3Q8AA 2WNEA 2EF6A 3I7DA 3J7HA 5FLHA 5LEKA 3ZYJB 3I3QA 3WDVA 2HEVF 2WWJA 2Y33A 3PVNA 4OYUA 4COYA 3WG2A 5C8CB 5KXCA 3AKRA 3WINE 2R041 5LA2A 4CP0A 2AZ5A 3ZFFB 5F7UA 3VZMA 4AEDC 1OOPC 3UV9A 2FCUA 1J59A 4LKEA 5K0UC 2DUQA 2R16A 2WZEA 2ZBJA 4HVRA 4XUPA 5IVYA 3RYPA 1ND3C 5HPOA 4CDUB 4A6SA 3OG2A 3I2KA 1LOEA 5L7OA 5FZLA 5JOZA 4FT8A 5C8WA 1DQ6A 2LALA 4KWJA 3C7HA 4TSVA 3B00A 3Q8BA 2ZMNA 4B1LA 4IGPA 3ZVXA 3FHQA 4CEYB 4RFT0 1N3QA 1XQNA 1ZZCA 2Q1FA 2YUEA 1PO22 3CKHA 3H50A 2RS31 5DUWA 1BHGA 5C33A 1RUI2 5LCWL 4HBNA 4HKWA 1VBC3 4FFIA 4UW5A 5ACA2 1LJ7A 1WD3A 5FZ9A 3ZN6B 2JG8B 2FMYA 1ZRRA 1VBE3 4RHV2 4W65A 1YJKA 4HANA 4LHLA 1A8DA 4HMZA 3RDIA 4CDXA 4Z82A 3ETQA 2V09A 1FNZA 2BNNA 3GBFA 5FZDA 4XQ4A 1RUE1 1VBB1 3JBG1 1YFXA 4M3CF 1KFUL 1RUH3 1UMHA 4KH9A 4UFKA 4OULA 3VKFC 5FP7A 3SKVA 4XETA 2ARCA 3HR9A 4PHZA 5K8SA 1FOD2 2R49A 5ABJC 4Q26A 4IV3C 2OS2A 3BCWA 4M3CA 1H2LA 2WWUA 1SLIA 1H2KA 5IVCA 2J42A 4A7KA 1XU2A 4W6XA 1TMF2 4L8QA 5FR3A 1MVEA 3K2OA 4KL1A 3S5QA 1CPMA 4XTPA 4AVSA 2JG9A 3DPRA 2D98A 3RS6A 4X6QB 1AL21 2GNTA 2WFF3 1LEMA 4Y20B 3O7OA 2IVIB 1MS4A 1W03A 2EXIA 2WA3A 1QF3A 2RS51 1J84A 1OF4A 2DVBA 3HIFA 1VBA3 4QAWA 2BBVA 2PAMA 3BYWA 1DLLA 5F37A 1BBT3 3I2HA 4YG0A 4ONUA 5HCFA 2TUNA 4WZFA 3L9JT 4QX0A 2A6ZA 2HWB3 4LXLA 4KU7A 1WCSA 1RJ7A 1IKPA 4OZOA 1W05A 3D5OA 3ZSEA 1MACA 5C4WC 1GWMA 1JZ5A 1JZ7A 5LY1A 1RITA 4PCRA 3VDCA 5CFDB 2DFCA 1JYVA 3WZ1A 4YLZA 5IT6A 4YZ1A 1V6KA 2Q1MA 3JQXA 2YGMA 1H2NA 2XXZA 4JGZC 3ASIA 5AFEA 1GKBA 5I8YA 1PZ7A 2RS13 1SLCA 4XMIA 3AZZA 1PO21 3QH7A 4R9DA 2RS32 2BTVC 1YQ6A 3GF6A 2QZ2A 3A4UA 4NIDA 1ZNPA 2XLGA 3S0MA 1EY2A 5C71A 2VNOA 2XVGA 1ONAA 4XF9A 1K42A 4RHV1 3W58A 2IXJA 4IEZA 5KC5A 2F6BA 2W52A 4AI2A 5AC93 4ZZ8A 4WVVA 1S55A 1UYZA 1RUE2 5KHHA 4COWA 3RG0A 1UU4A 1FOD3 3WF3A 2QQOA 4M0NA 2YG0A 5IW0A 1V6LA 3MGUA 4MXWB 4NR1A 3FLTA 2BOJA 4CCEA 4CVUA 2J1UA 5ABJA 4OUEA 2YU1A 4M3CB 4C8DA 2BOIA 1JOBA 4CCOA 1LGNA 1LGBA 1S0BA 1K45A 2XMLA 3KQ4B 2OXBA 5D8AB 3ACLA 5FTTC 5A3WA 5A6QA 2WNVC 2E53A 4K21A 1JUIA 2AUYA 4QU1A 3UJOA 1MQTA 2W1SA 3AJYA 5J96B 2XQXA 1REFA 2Z79A 2JG9C 3C3VA 3DPRC 5F9TA 3USSA 4AVAA 3VBUB 4DO0A 2EAKA 5CYYA 3EMRA 3ORJA 4Y4YA 4D7TA 5T5JA 1D4M1 3T2OA 1JZ8A 1YWKA 3M8LA 2ZMKA 5A7NA 5EJ1B 3SEPA 1JOPA 4BA6A 1RUOA 2YPDA 3AB0A 1WA4A 3GZEA 3MIGA 3ZYGA 1HDKA 4LPLA 4OZXA 2DFBA 3SH3A 2HWB1 4LJHA 2J1SA 2JEMA 2JB4A 2B7YA 1Y4WA 3ES4A 3J8F3 5C7GA 3WNMA 4ISQA 3WCSA 2EIEA 4K8RB 3S7IA 3QH6A 1XB9A 3OY8A 5FYZA 5T5PA 1K5MC 1TME1 3VBOA 3WDWA 3TN93 4KWLA 4OHXA 1XNDA 1CX4A 3WX5A 3OUIA 1ZZ8A 1M06G 2VCMA 2FDIA 3H7YA 3D0SA 2R071 1HN0A 1N3PA 4BXFA 2ENRA 2VMEA 5KWRA 4JV4A 3WF0A 4CUGA 4HVQA 5T55A 1PO13 2RR12 5HCAA 1QDCA 4F83A 1LECA 2R6QA 2W2IA 2Z42A 2ZHMA 3POSA 2UWCA 1LOGA 3BOPA 4JAAA 2Z5WA 3M3IA 4KMQA 1ENRA 5A3OA 5A7OA 2PLV1 2BEOA 2P3JA 4UF0A 1ULDA 5L9RA 3IAQA 3QACA 3DYOA 4W4ZA 1WBLA 4JDOA 5ABJB 1H1IA 3LSDA 1VMJA 1E5IA 3CIHA 3KCYA 4IE7A 1UXZA 2PHUA 2DCZA 2W47A 3MF6A 4UF0B 4Q8KA 1UZYA 1DQ0A 1D7PM 4B4QA 2QVSB 4TLGA 5FBZA 4WVZA 5FXXA 3S7EA 2YPJA 2WNVA 2XR4A 1J1LA 1NY71 1AR61 1MQTC 2KD7A 3SH4A 3VBRC 2E9QA 1NLQA 5FDBA 3ZYFA 5L9VA 1SBFA 1V6IA 4N7UA 4XFHA 4ES8A 3GJBA 3QOPA 5I0UA 1RUJ3 2ET7A 2LM3A 4GAZA 4K8FA 3VB9A 5JOWA 2IC1A 3IN9A 3P3PA 4Y3OA 5FK8A 1CAVA 2YHJA 3KT4A 3RZKA 4Q4V2 5FZMA 2VG9A 1VMFA 4LLOA 4Y5Z0 3U0ZA 2QQLA 3OBZA 4IV1C 4MGZE 5GKAC 3RZLA 3J9SA 1H30A 1LHVA 1U12A 2DV9A 3J4UH 4INDA 3B7MA 2BQPA 4RGGA 4BU2A 4D94A 1YYNA 1G86A 1IG0A 2JIGA 2ZZQA 3KVBA 1BYHA 5A7QA 1ZM1A 2DUOA 1FPN3 2Q8OA 4ASKA 3ACIA 1VBA1 4MZUA 2CAVA 3KV9A 1GQGA 1IS5A 3TBDA 3NV4A 1XU1A 2VZPA 4IEPA 3VBOB 3BALA 4TYSA 1PX4A 1VBB2 4FPOB 5IFPA 1YJLA 5JOXA 2MEV3 5JPNB 5KC6A 2AEZA 2KA3A 1CX1A 1B09A 5J7MA 1ASJ2 1F5FA 1GNZA 1DFQA 1NLSA 4WBBA 2WLPA 4XJ9A 5FZKA 4X8PA 1D4VB 1HXS1 2ZGQA 4QPYA 2FCTA 5DDJ2 4DXTA 3PTYA 2WIIB 4FTSA 3RZZA 1MZEA 2X5IB 1MZ5A 3FHIB 3LIHA 2VOVA 3NJYA 5A32A 1DDLA 3J7LA 1NCQC 1RUD3 3I2IA 1UOJA 1W8TA 2ZX0A 4CP1A 5FZ6A 1S2KA 4FPFA 3I3DA 3TNQA 2LRPA 4GB32 3UESA 3VGIA 1UOBA 1W9YA 2XUEA 3UYJA 3SCGA 2A73B 4WVMB 4QPGC 1AL22 2ORXA 1AL0G 2WBKA 2V73A 3H0OA 1JODA 4Q4W1 1GYKA 2JG9B 3DPRB 5A80A 1PMHX 1ZX5A 2G4IA 1HJGA 2D40A 4LHKA 5FMOS 1BXHA 5GLVA 1W90A 4KGQA 2ARAA 3M3EA 3ZYRA 3CBNA 2XLAA 1C8M2 2VXJA 1LULA 4QDRA 3UGHA 1X8MA 5A33A 4UXAA 2VECA 1EAH1 1OOPB 1H9WA 2V5DA 5FZ3A 1TEIA 1HQWA 1RUC3 1WWYA 3UL2A 1ENQA 3Q8FA 4DUWA 1NLRA 1XYPA 1G8WA 3CMGA 4ZZ5A 3WG4A 3HMYA 5DZGA 4JQTA 2JECA 1W6NB 4QU2A 1DYPA 1XNCA 3LPFA 5ACA3 2GN7A 3MIBA 4KGGA 4NE9A 2DCJA 1VRH1 2XGXA 1QH7A 2D43A 4LO5B 1RB8G 5FZBA 1VMHA 3VZJA 2JE9A 3OBRA 3H1MA 5D8AC 2ZKNA 4D8MA 1NG0A 2W39A 4HSLA 3TOJA 4B4PA 2C9AA 4XJZA 2QE3A 3OGJA 1XE0A 1W8ZA 5JZGC 3EJKA 4LBMA 3AKQA 3CJIA 3AMQA 4OI1A 3EXUA 4KBZA 3VBUC 2VO5A 3I49A 2C6SA 2BU9A 1Z78A 1FXZA 3BVCA 2IZWA 2Q30A 3VL8A 1PVXA 2PAKA 5JR2A 4DXRA 4MGQA 4P02B 1I1EA 3FUQA 4QXBA 4YW4A 3M1HA 3K46A 4LOTA 5CA6A 4N9HA 5DDJ3 1PM7A 5F2WA 2VOTA 1O5UA 1PZ9A 2VL4A 1KDKA 1O4YA 3ZFEA 3IDBB 5C3PA 1MS1A 4QX3A 4LOSA 4YM0A 5DDJ1 1XRUA 5H9QA 4ARXA 4NHYA 3POBA 1PNFA 1Q8SA 2WSUA 3J7NA 4QDSA 4AXOA 4NJ4A 3ZMNA 3ZKUA 3ZXKA 1GV9A 2QQKA 5GZEA 1YQCA 2VTXA 3O1VA 1BBT2 4ZXKA 4GB31 4S2HA 2WT0A 3TEWA 1Q8QA 3OYWA 3HQXA 3OBAA 4FPHA 5FY0A 2R062 3WW4A 2WN2A 2E32A 2FDHA 3VL9A 1GLHA 3KLSA 4QT6A 3VDBA 1GR3A 3THDA 4P9YA 3D8CA 3PLQA 4Y1ZA 5A6ZA 5AFBA 1AJKA 4V1PA 1GWKA 3I59A 1QMJA 5F39A 1C8M1 3IKWA 5DAPA 3NNMA 3ACHA 1R1A1 5FJHA 5GZCA 1N1YA 1Y9QA 4LKDA 1JHNA 2JDHA 4LITA 1G9CA 4Q1RA 2A75A 2VMFA 2GC0A 2ZGMA 3H1YA 3U07A 3UNPA 3OUHA 4W8JA 5CEHA 1FV3A 1UIJA 3VV1A 1DF0A 2D3SA 1YEWA 1OQDA 3IMMA 1QOTA 4LNVA 3GGLA 2A1XA 5HXMA 3MPPG 3ZSLA 4FOYA 1VRH2 4Q4Y3 2DWRA 4RYDA 1PK6B 3VBHB 5FY7A 3GALA 3VHOA 2HWC2 1ND2A 2ZHKA 2DVAA 1OVSA 4HOOA 4I0WB 1W8OA 3LEGA 2ZEYA 4CPBD 2WS93 3A0KA 1UY0A 3C8XA 3SQOA 4BOWA 1KS4A 4MADA 3G6JB 5A7SA 1UZVA 3H9AA 1JU3A 1RUG1 4XFFA 2VBDA 2CL2A 4MO3M 4Y1YA 1YIPA 5IVBA 1AJOA 2PLV2 5A32B 1IZ3A 2JDUA 2GC2A 1YFUA 4MSVA 1OPOA 1RYYA 2XB6C 2JDZA 3J26N 2D3PA 3E6BA 4XJWA 3UGGA 1DGRN 3ZR5A 2JDNA 1STMA 4CYDA 2VW1A 1CAXB 2WR9A 4YVSC 5BPXA 1H9PA 1SLLA 2BRTA 1AF9A 1LESA 3N35A 2CAUA 1NA1B 3U4SA 1UPSA 2AEYA 5A1AA 5C4WB 5F5CA 3ZFGB 5KHKA 2XWBB 3LSEA 1RUD2 2VMCA 2WNVB 3WNKA 2EAAA 3N9MA 4GZ9A 4FFFA 4P9WA 4E4HA 4EZ4A 4D0QA 5KBFA 5CISA 2VMIA 5TSWA 2WS92 4Z2WA 4YZ2A 5CG9A 2HKXA 3FFQA 4HPKB 4HSJA 1PK6C 3R0RA 3TWIA 3VBHC 5E89A 1AR71 2CGOA 3MV01 1OOPA 3H7JA 3R4DB 5ANNA 5L19A 3LGRA 1IG3A 3JBG3 4QM8A 4RR3B 4RS5B 1PVC1 1LOBA 2C5DA 2DYCA 4HXCA 4C0HA 1F9KA 2GMMA 4BWOA 1CJPA 2W95A 3MW4A 5CB7A 1A78A 5HBAA 4BQ3A 2DVDA 4L9BA 2P4EA 1AX0A 4NRPA 4CU7A 3BU7A 5FFOC 1HJFA 3UT0A 3WUDA 2JX9A 3M7AA 1FNYA 4LMFA 5LA0A 4GQ7A 4N7IA 1WMDA 2IVJA 5LB6A 1O4TA 1SFNA 4UI9L 4YZ3A 1R091 3O0VA 3O0XA 3ZXGA 1DP0A 4FQ4A 5JMCA 3V0BB 1JI6A 3FWEA 3AMMA 5FY4A 1ASJ1 2HWE3 1PGW2 1F2NA 3AP9A 3HN3A 1IKQA 3IT8A 4LHNA 1SCSA 1EV13 5JI7A 1HXS2 4IE0A 1PIV2 4DIQA 1W6QA 3N7JA 3MW2A 2RDRA 3CO2A 3RFRA 4K9SA 4O7XA 2I2SA 4PIZA 5CKQA 5FYBA 4YARA 5IFTA 1V6NA 2FDFA 3VHRA 1TE1B 2WT2A 5B4NA 3E97A 3VHNA 2XL9A 4AI8A 3IMNA 4IV3B 4XF4A 5JXIA 1H8TB 1ZZ7A 3BPSA 2O1QA 4JHZA 2JENA 4OHYA 2QQJA 2DUPA 5FKBA 2XJPA 1HRV2 3LDKA 2BFUL 3GBGA 3MDPA 2HWC3 1EPZA 1UN1A 1O4ZA 3KV6A 4IV1A 1KEXA 4DNYA 4O9GA 1X33A 1RXGA 2Y6FA 4A2UA 4DRRA 4QPWA 5C3SA 4G9SB 3HT1A 1RUF1 2JG8C 4AG4A 1N3OA 2X10A 5LEJA 1HRV3 1C28A
chains in the Genus database with same CATH topology
4XAEA 2WO7A 1BK0A 1E5SA 2VBBA 1UNBA 2BRTA 1UOBA 1HB2A 1W9YA 1DCSA 2JB8A 1GP4A 1UZWA 1E5RA 1W2OA 1UOFA 1WA6X 1HB1A 1RXFA 2CSGA 1HJFA 2VE1A 2IVIB 1ODNA 1W3XA 3ON7A 1IPSA 1QJFA 1W03A 3OOXA 5C3PA 2VBPA 1W06A 2JB4A 2BJSA 1GP5A 1HB3A 2Y60A 1OBNA 1BLZA 2IVJA 1HJGA 2DBIA 1W28A 2VBDA 1QIQA 1RXGA 2Y6FA 3ZKUA 3ZKYA 3ZOIA 1W2AX 1OC1A 1W3VA 5C3SA 1W2NA 4BB3A 1QJEA 1E5IA 2DBNA 1W04A 1E5HA 1UOGA 5C3RA 1ODMA 2VCMA 1W05A 2BU9A 5C3OA 1HB4A 4RGKA 2VAUA 5APAA 5C3QA 1GP6A 1UO9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XAE A;  2WO7 A;  1BK0 A;  1E5S A;  2VBB A;  1UNB A;  2BRT A;  1UOB A;  1HB2 A;  1W9Y A;  1DCS A;  2JB8 A;  1GP4 A;  1UZW A;  1E5R A;  1W2O A;  1UOF A;  1WA6 X;  1HB1 A;  1RXF A;  2CSG A;  1HJF A;  2VE1 A;  2IVI B;  1ODN A;  1W3X A;  3ON7 A;  1IPS A;  1QJF A;  1W03 A;  3OOX A;  5C3P A;  2VBP A;  1W06 A;  2JB4 A;  2BJS A;  1GP5 A;  1HB3 A;  2Y60 A;  1OBN A;  1BLZ A;  2IVJ A;  1HJG A;  2DBI A;  1W28 A;  2VBD A;  1QIQ A;  1RXG A;  2Y6F A;  3ZKU A;  3ZKY A;  3ZOI A;  1W2A X;  1OC1 A;  1W3V A;  5C3S A;  1W2N A;  4BB3 A;  1QJE A;  1E5I A;  2DBN A;  1W04 A;  1E5H A;  1UOG A;  5C3R A;  1ODM A;  2VCM A;  1W05 A;  2BU9 A;  5C3O A;  1HB4 A;  4RGK A;  2VAU A;  5APA A;  5C3Q A;  1GP6 A;  1UO9 A; 
#chains in the Genus database with same CATH topology
 1YQ5 A;  1ZVF A;  2HBT A;  3T4H B;  2WN3 A;  3BOD A;  1JXN A;  2PHL A;  1X7N A;  5H9R A;  1W8N A;  2AYH A;  4R4Z A;  3ZYB A;  4BPZ A;  1V0A A;  4GH4 C;  4XXP A;  5BY5 A;  1OD5 A;  2VOK A;  4LK6 A;  4MUV A;  4PF5 A;  3ZXE A;  4AFM A;  5HCH A;  1O6U A;  5FIX A;  2QQN A;  4XAA A;  4QHO A;  4E2Q A;  1O91 A;  5EXO A;  1NCQ A;  1J1T A;  1PVC 2;  3A21 A;  1LKN A;  3PUR A;  4I0A A;  3HNB M;  4EWA A;  5LA9 A;  4MOA A;  2EXK A;  5BNP A;  2W5F A;  5DUV A;  3OPT A;  1ZZ6 A;  2BW8 A;  2LS6 A;  4RQP B;  3ACF A;  5ACA 1;  3WP6 A;  4LUL A;  4CE8 A;  2QQU A;  1DQ4 A;  1FAY A;  3MW3 A;  4CUC A;  3B01 A;  1TQ5 A;  5IVJ A;  1URX A;  3VZN A;  3TRS B;  1C8M 3;  3CEW A;  3GZT B;  2ZA9 A;  1Z7S 1;  4XFB A;  4C0B A;  1VLN A;  3ILR A;  4F3J A;  1VB4 A;  1YI7 A;  3ALQ A;  1W06 A;  4Q1P A;  4AI9 A;  4AF9 A;  2RMU 3;  2D6K A;  3KF5 A;  1JZ4 A;  1IPK A;  4AVB A;  1H0B A;  1OFS A;  4P9G A;  3OUJ A;  3I4I A;  4LT5 A;  1H8T A;  4YVW C;  3KB5 A;  5KHI A;  5F3G A;  4Q29 A;  5D21 A;  5FRA A;  4ZS2 A;  3KF3 A;  1H6X A;  4IV1 B;  5T5L A;  1NZI A;  3RI8 A;  1ULC A;  4QXH A;  3ECQ A;  2ARB A;  2EXH A;  1RTV A;  3JQW A;  2VPV A;  5EJZ B;  1EV1 1;  1OQ1 A;  2XDV A;  2WT1 A;  1ZBE 1;  3AKP A;  3AYC A;  3BGA A;  5T50 A;  4AYU A;  3VD9 A;  2XON A;  3L2H A;  1VR3 A;  4QDQ A;  4UT5 A;  2Y64 A;  2BWC A;  4ZS3 A;  2C0Z A;  4XBL A;  2ES3 A;  2RDS A;  3KHB A;  1DGW X;  1S0C A;  4ITC A;  4FSJ A;  2B4K A;  2A3Y A;  4PJY A;  5FY5 A;  1DZR A;  1UWW A;  5C8C A;  3MIF A;  5C9A C;  4YGE A;  4I2O A;  3THT A;  4SLI A;  5T54 A;  5A33 B;  1AYN 1;  3WNO A;  5IUQ A;  4E9K A;  1F8V A;  2VUL A;  2XHK A;  4JDM A;  1O8S A;  2P34 A;  1DIW A;  2RM2 3;  3JU9 A;  4YVW B;  1LOC A;  4XE9 A;  4V2V A;  5G05 L;  1PVC 3;  5FYU A;  1L7Q A;  1XNT A;  1HLC A;  1QJU 2;  5E1R A;  2PHR A;  3T08 A;  1LHN A;  1NQJ A;  1HB1 A;  1NXD 1;  2GC3 A;  2W91 A;  5DUX A;  3WUC A;  1QGL A;  5DQ0 A;  4PI2 A;  5BNP C;  1UYX A;  4B29 A;  1BK1 A;  1ZA4 A;  1XYN A;  2PAE A;  5IK7 A;  1GZW B;  2WLQ A;  2WQ4 A;  5EP9 A;  5A6X A;  5BUV A;  1NXM A;  4XF1 A;  2PYT A;  3OF1 A;  3RNS A;  3L2Y A;  4YFZ A;  1REE A;  2O14 A;  1X9P A;  4EQV A;  2BGC A;  5JSO A;  1RVF 2;  2IUW A;  2C24 A;  5C3O A;  1BJQ A;  2HYK A;  4AZZ A;  5L7O C;  4BQX A;  4EN7 B;  1H4G A;  2GSY A;  3G7D A;  2VUJ A;  1EAH 3;  2JDP A;  3T3Y A;  5F1R A;  4I0B A;  3ABZ A;  1JOJ A;  1AYN 3;  1C5I A;  1PHM A;  3F95 A;  4ORF A;  2X8K A;  1WLT A;  4JC1 A;  4SBV A;  2ZGP A;  2WUH A;  4BJ0 A;  3HPN A;  4LKS A;  2VH9 A;  4Q0V A;  5CNA A;  5L36 A;  1Y9M A;  2K0G A;  1Q3E A;  2FD8 A;  4N53 C;  1SLA A;  3QBQ A;  1UMZ A;  1IGO A;  1S1A A;  3AXD A;  4R9C A;  1JMU B;  4Y1V A;  2I45 A;  2WYF A;  1YXW A;  5CZK A;  1QH6 A;  1C5H A;  1AR7 2;  1MS0 A;  2TBV A;  3OPZ A;  4B4R A;  5FYC A;  1V9U 1;  4MG2 A;  1QJE A;  4AAX A;  2VCC A;  3ACG A;  3AXE A;  1T6G C;  1ND2 C;  2ZML A;  1SLT A;  3C7F A;  3KS7 A;  1L3J A;  1R64 A;  2TEP A;  4UFH A;  2BWA A;  1HXS 3;  3IBM A;  4XW3 A;  5JIA A;  2QQW A;  1IPJ A;  2VMH A;  1WW7 A;  2WJS A;  5FQ0 B;  4XAE A;  1C57 A;  1LRH A;  5F5A A;  1V00 A;  4HKO A;  4E8C A;  2VBB A;  1YUD A;  2UY9 A;  2RS3 3;  1NE6 A;  2ZCW A;  5FP3 A;  2XBO 2;  3CDZ B;  4TXW A;  2RDQ A;  4NHK A;  3VZK A;  1GMM A;  5C8C C;  3PJQ A;  4DOU A;  3FBM A;  3ZYI B;  1GQH A;  3FUO A;  3RZJ A;  3VD5 A;  5LK5 A;  1YLL A;  4RQP C;  1R09 2;  2ZJC A;  2DUR A;  3RJ2 X;  4PF1 A;  4JTN A;  5E16 A;  4YZ5 A;  1JYN A;  3UET A;  5CFC B;  3KCC A;  4XAB A;  3LAG A;  2R07 2;  3NQH A;  4FI9 A;  4RGK A;  2IXL A;  2NYY A;  4FOW A;  1CIY A;  4YGC A;  4XDO A;  3H1W A;  1DYO A;  3GZU C;  4CP9 A;  2QFE A;  4E2G A;  4WM8 B;  3V0A B;  3VKO A;  1DCS A;  3AMP A;  4QGN A;  3USU B;  1KJR A;  4B3N A;  5JSR A;  5KR7 A;  4UAP A;  1RMU 2;  4CDX B;  1RVF 3;  2RJL A;  2A71 A;  2GP5 A;  2QZ3 A;  4G4F A;  4PLM A;  5DAB A;  1PO1 2;  4WM8 A;  5FUI A;  4GMP 0;  3WW2 A;  4CCM A;  5BNQ A;  2R07 3;  3DGT A;  1RUC 2;  2GND A;  4Q0P A;  2FZ2 A;  4AAP A;  2P2K A;  4K7J A;  1M4W A;  4BCU A;  2Q4S A;  1LOF C;  2VCB A;  2VGD A;  4X8N A;  1B35 B;  1CD3 G;  2HWD 1;  3GJA A;  4A7Z A;  5J09 A;  1SCR A;  1YFY A;  4EN0 A;  2X29 A;  3T30 A;  2BBA A;  4DPN A;  4YZ4 A;  3H42 B;  2BGO A;  1DYK A;  1U0A A;  1N1V A;  4IGO A;  2PLV 3;  3U78 A;  4AQT A;  2HEY F;  5CFC C;  1VBD 1;  4ES9 A;  2CHH A;  3O1S A;  1F5J A;  1NY7 2;  4KU8 A;  1AUY A;  4YM2 A;  3P6B A;  4N53 A;  1OA4 A;  5L9B A;  5FV3 A;  2ZX4 A;  4A45 A;  2GAL A;  1CON A;  4JGY B;  3OGS A;  1UKR A;  4QXC A;  2DU0 A;  2HH9 A;  2W1U A;  3WHU A;  3R4U A;  4AHZ A;  4NHM A;  4NPL A;  2WNU C;  4OVE A;  3HBZ A;  3IDE A;  1QIQ A;  4Q4V 1;  4Z07 A;  4NIA A;  2ILM A;  2DTW A;  1VAV A;  1W3V A;  2CDP A;  4JQR A;  1RC6 A;  1YHF A;  4KBB A;  5IVV A;  2VVF A;  2HYX A;  5C5U A;  2ZX3 A;  2XBO 1;  4KNC A;  5EJ3 A;  5LBB A;  2G9F A;  2H0B A;  2Q8D A;  4BQ4 A;  1A34 A;  4EE2 A;  4XF0 A;  2XH6 A;  5FLJ A;  2EIG A;  2VW0 A;  1HB2 A;  1SLB A;  2E33 A;  4ASL A;  4RQP A;  4FAG A;  3BOW A;  2KM2 A;  4A7Y A;  4GB3 3;  1EUU A;  2BVV A;  2CSG A;  1GU3 A;  2IWG B;  3INA A;  2VE1 A;  4RFR B;  4QB6 A;  1VAM A;  1IPS A;  1Z7S 2;  4IER A;  3WW3 A;  4GMP 1;  2BJS A;  1HB3 A;  3F2Z A;  3NV1 A;  1NA1 C;  2BGP A;  1V6J A;  2GN3 A;  4CXW A;  4LIU A;  3VBF A;  3SC7 X;  1UCX A;  4F8A A;  1TZO A;  3O1P A;  4A6O A;  2YGL A;  1WD4 A;  1Y43 B;  2P6H A;  3I3B A;  1OHF A;  3USU A;  2VUD A;  4OCT A;  4G3Y C;  1CES A;  2GMP A;  4EV0 A;  1OSG A;  2ZTN A;  5KXB A;  3IDA A;  1ULE A;  4LO4 B;  1PZ8 A;  3LCP A;  1J3Q A;  1GOG A;  2MHF A;  3ETP A;  3HQU A;  4L0P A;  1I9R A;  2YBK A;  4LE4 A;  1AHS A;  2VQA A;  2ARX A;  4FBF A;  2D6M A;  3BPZ A;  1ULP A;  1W0N A;  1IQD C;  1UMI A;  1ULG A;  3WP5 A;  2YY1 A;  4FPK A;  2VZO A;  1NKG A;  4C91 A;  2QNK A;  3E5U A;  3WCR A;  2JXA A;  2ZX1 A;  4CXY A;  4ATF A;  4CP2 A;  1VBE 2;  2WZ8 A;  4L92 A;  5LY2 A;  2D5H A;  1LNS A;  2ADE A;  3MEP A;  3H3Z A;  2F17 A;  2JDY A;  2DCK A;  3KMH A;  4FXG B;  4D6Q A;  1WME A;  1OD3 A;  3KQR A;  2QQI A;  5FQ0 A;  3KSC A;  5IK4 A;  1J3P A;  1G9F A;  1SPP B;  3VKL A;  4OQ8 A;  1C3H A;  4CDU A;  3FLP A;  2D6N A;  3H3U A;  2R1D A;  5FPA A;  3E5X A;  1W0O A;  3WVJ A;  1RED A;  4ZU7 A;  1BCX A;  2OT7 A;  2A7A A;  3P3N A;  1GP5 A;  4XCA A;  2VUC A;  1UAI A;  1UF2 C;  3O12 A;  3WP3 A;  4JVA A;  5K0U A;  2Y26 A;  4A4A A;  1RUI 1;  2BFU S;  2H6C A;  4DQA A;  2HBU A;  3I2G A;  1ZRI A;  1IOA A;  3TEY A;  5FXW A;  4FVV A;  4C90 A;  3TEZ A;  3EB7 A;  2AAC A;  2Y8K A;  3WOG A;  2PEL A;  2VQU A;  4LIV A;  1SZB A;  1UD1 A;  1RJ8 A;  4FAH A;  1D2S A;  4W50 A;  3V0B A;  4XPV A;  1UYP A;  3I97 A;  2OZJ A;  2ZPX A;  3PUS A;  4FCA A;  5APA A;  3T4V A;  2YFU A;  1ZRF A;  4D69 A;  4CP9 B;  4OMD A;  2G9Z A;  2XOM A;  4CCC A;  2W1W A;  2E26 A;  1WKY A;  2VOW A;  4E27 A;  1DQ2 A;  1OF3 A;  1Q8V A;  3GCW A;  3OEA A;  4P00 B;  4D7Y A;  5FYH A;  1C1L A;  1KFX L;  3QLQ A;  2DU1 A;  2F4P A;  1OBN A;  2NQY A;  3LIG A;  2BNO A;  1N47 A;  3V64 A;  4PLO A;  2FDK A;  1BQP A;  2VTF A;  1V6M A;  3TN9 2;  1COV 2;  2CU5 A;  2R7E B;  5CKN A;  1D0H A;  5JDB A;  3W9A A;  2ZZJ A;  3LB9 A;  3BN6 A;  4FQZ A;  3VBS A;  3GXU A;  3LQC A;  1DLC A;  1FX5 A;  4QKN A;  2XVL A;  1OKO A;  4PBP A;  1FMD 3;  1W9S A;  5IHR A;  3T2T A;  1HRI 2;  5FWE A;  1DZT A;  1O8P A;  1RUG 3;  2RS5 2;  3AZY A;  4OUS A;  3ZSM A;  2R04 3;  2QDN A;  3POF A;  3PUH A;  4D7S A;  4CEY C;  3PL0 A;  2Q8E A;  2ZGS A;  1TNR A;  2RJ2 A;  5JZG A;  2VC9 A;  5FXZ A;  1MS9 A;  1QKQ A;  4GKX A;  4E2S A;  1ULF A;  1GIC A;  2EA7 A;  1KDM A;  4JGY C;  1G9A A;  3POY A;  1CIW A;  4AQ6 A;  1K12 A;  2RVA A;  3ZFF A;  1GZ9 A;  1JU4 A;  3OGR A;  3VN4 A;  3RGB A;  4AVV A;  4ATE A;  2QKD A;  4AR2 A;  1DGW A;  3MID A;  3PUA A;  4LHS A;  1VE0 A;  4KWK A;  1MR5 A;  4Q5O A;  1QY4 A;  2QUO A;  3RYK A;  4GWI A;  1XE7 A;  4QPG A;  4MET A;  4P9I A;  4UFM A;  4MV2 A;  5F5I A;  2NMN A;  3WR0 A;  1ZRC A;  4Q4V 3;  4NIH A;  2B9V A;  3B02 A;  2OVU A;  4RL7 A;  5LRS A;  3S5A A;  4MGY E;  2A6X A;  5JWP A;  1SFP A;  2HWC 1;  1C4R A;  1OA3 A;  3LOI A;  3IWZ A;  1ZRD A;  3EHK A;  4WV8 A;  4QHB A;  2X05 A;  2XKP A;  4K1Y A;  1ODN A;  3VBO C;  4GWM A;  3RPQ A;  5I0R A;  3R4S A;  2JD4 A;  1RMU 1;  1VP6 A;  4Z2A A;  1NCR A;  2GC1 A;  1KRI A;  4COZ A;  3VDD A;  1W8U A;  4EN6 B;  2WSV A;  3BIW E;  1GZW A;  3NO8 A;  4QB2 A;  3DCQ A;  1SAC A;  1QXJ A;  5JSP A;  4ZHN A;  3LD8 A;  1SQ4 A;  5FO9 B;  1OC1 A;  1QXP A;  3POW A;  5FUN A;  3ZXL A;  5F8P A;  3DKW A;  1XSR A;  4CDW C;  2ZEZ A;  1DGR A;  2VNV A;  5A3U A;  2B9U A;  4M00 A;  4U36 A;  2VD7 A;  3FL7 A;  5A70 A;  3ZYP A;  2RV9 A;  3POJ A;  4XUO A;  4ZU4 A;  4COV A;  4KG8 A;  2Y38 A;  4XUR A;  3I3M A;  4FTE A;  2JE8 A;  2VTX J;  4E4Z A;  2ARE A;  2VQ0 A;  4QGM A;  3ZFG A;  1COV 3;  4Q4X 1;  3WDX A;  2AH2 A;  5I93 A;  3TN9 1;  1GFF 2;  2FDG A;  4IDZ A;  4N43 B;  3KGL A;  4YW3 A;  2I74 A;  1EP0 A;  3DN7 A;  1FMD 1;  5GLT A;  1FV2 A;  4KWU A;  1DHK B;  2E51 A;  2FMD A;  4DEV A;  1QJY 3;  1DQ1 A;  3IZO A;  4MVT A;  4PLN A;  4QGL A;  3ZLI A;  4EN9 B;  4QX8 A;  1H1A A;  3KGZ A;  4BB3 A;  2WAO A;  3A0N A;  1OUR A;  3RI9 A;  2AC1 A;  4BIF A;  4CDQ C;  1SPP A;  2C4X A;  5FZE A;  1QOS A;  3B3Q E;  1Q56 A;  4EZH A;  4MYE A;  4XBN A;  4J6G A;  1XNK A;  5EWS A;  3AFG A;  4IE4 A;  1UW8 A;  3J7M A;  4KG0 A;  1X50 A;  3HAG A;  4XDP A;  4N8M A;  1UOF A;  1XSQ A;  2E63 A;  5T52 A;  3ON7 A;  3ZSJ A;  5FYT A;  3E1F 1;  3AK0 A;  5FP9 A;  3ZIW A;  4J1W A;  4LA3 A;  4OI2 A;  1L7L A;  2K9Z A;  4QM9 A;  5EPA A;  5FCC A;  1UIK A;  1RUF 3;  3S57 A;  4L99 A;  4R8H A;  1I3H A;  2VVE A;  1MVQ A;  4QX1 A;  4BIO A;  4DRV A;  1VAK A;  4LUM A;  5A7P A;  1OH3 A;  3N7K A;  5HV4 A;  2W87 A;  3PUQ A;  3NW4 A;  1S4C A;  2ZXQ A;  3HNM A;  2RJK A;  3PME A;  5I8T A;  1RUH 2;  5CBL A;  2WNO A;  4XUN A;  3SMH A;  1W9W A;  5JLV A;  1BK0 A;  4NAM A;  2UY8 A;  1YCI A;  2OQ6 A;  4EN8 B;  3OD4 A;  2FCV A;  3WF4 A;  3PDQ A;  5A1F A;  2P3Y A;  5LZ6 A;  4YW5 A;  4UW6 A;  4CDW A;  1KQR A;  4QPI C;  3MLJ A;  1Z0H A;  4LBN A;  5EYX A;  5FZO A;  3MIH A;  5AVA A;  2ETE A;  1D0G A;  1H2M A;  4FFH A;  3OSD A;  4PIY A;  3BU0 A;  4Q2F A;  1HX6 A;  1RUF 2;  3O5S A;  2WKK A;  2ZAH A;  4WVM A;  4AL9 A;  4XBQ A;  3DYM A;  2D6L X;  3WV6 A;  2XQR A;  4Q4X 2;  3VKM A;  4WM7 A;  4ISR A;  3VLB B;  1XC6 A;  4LBJ A;  2H0V A;  3GYD A;  5AVP A;  2FBE A;  1SBE A;  4XHX A;  1XBF A;  3D6E A;  4ZON A;  2W94 A;  3WNX A;  4XZP A;  3RZM A;  2GH8 A;  3SEE A;  4PDW B;  2YBP A;  4N9I A;  1QHD A;  3JB4 C;  3HQR A;  2PA7 A;  1E57 A;  4BMB A;  4BK4 A;  1BLZ A;  5BNO A;  3Q9O A;  2KR2 A;  4HPK A;  2VJX A;  1ZBA 1;  4UFJ A;  2P3K A;  3O14 A;  3ZSK A;  4QQP A;  2E7Q A;  2X5I C;  2VZR A;  3D0J A;  3IDC B;  3III A;  2EVX A;  4Y4R A;  2B45 X;  2BVB A;  1AXY A;  2W92 A;  3W5N A;  1LEN A;  1POV 0;  5FWJ A;  1ACC A;  3FMG A;  1VBB 3;  3LA2 A;  2NLR A;  1G9B A;  1QOO A;  1PMI A;  5J37 A;  4H7M A;  3NAP A;  4B1M A;  3SH5 A;  4CUA A;  4A42 A;  4ASM B;  4YVS B;  2OUJ A;  3VHP A;  5FPX A;  4YM1 A;  4XAC A;  1ZRE A;  1RIN A;  3PU3 A;  1YIF A;  4GKY A;  3KT7 A;  3WQB A;  2AGS A;  3U10 A;  4CU9 A;  1W2T A;  3AMH A;  1CWP A;  5F3C A;  1W8W A;  1QJF A;  1TME 3;  4IEU A;  2SLI A;  3NV2 A;  4IET A;  3SLI A;  1HW5 A;  1D4M 3;  5FP4 A;  3N9Q A;  3CLP A;  4ARY A;  2WQ8 A;  2XLF A;  4DUX A;  3KVA A;  3E6D A;  1JW6 A;  3LPG A;  3EQE A;  2ORZ A;  2LTN A;  1COV 1;  4Q4X 3;  5GAL A;  4LBQ D;  1AXK A;  3MO4 A;  4RA0 A;  5FAX A;  5IK5 A;  2R06 3;  1LHW A;  2IFW A;  1G9D A;  3O1U A;  2H6B A;  1AR7 3;  1GOH A;  1MEC 2;  2ZHL A;  4U2A A;  5FZ1 A;  2R1B A;  1MZF A;  5D2A A;  5IVE A;  4QKD A;  4LBL A;  4Q4W 2;  5FMC A;  3PUI A;  4Z1V A;  1ZBE 2;  4LE3 A;  4P08 A;  4QPI A;  1SDW A;  1JZ2 A;  1H6Y A;  3PVE A;  3P1I A;  4YM3 A;  1S2B A;  4MXW A;  5FZ0 A;  1J3R A;  3JD7 1;  4F7Z A;  4JZR A;  4LUK A;  3ZR6 A;  4QMA A;  5JUV A;  2XL7 A;  1JH5 A;  4UW4 A;  3CQO A;  3NJX A;  2A6Y A;  1EAH 2;  1WLW A;  2VMG A;  4OI4 A;  2WDB A;  2ZGL A;  3N9N A;  1ZZ9 A;  1POV 1;  1VBC 2;  5FMO L;  3BTY A;  4XEZ A;  3S30 A;  4XOG A;  3VZL A;  1XYO A;  4GH4 B;  1VRB A;  1QQP 1;  2RHP A;  4MXV A;  4D3W A;  2QQV A;  4AGG A;  4ZXE A;  5F3E A;  1N1T A;  1LOD A;  3SCH A;  3URF A;  1GP6 A;  5K0U B;  5LK7 B;  3WNL A;  4HL0 A;  5L7O B;  5FMB A;  2D44 A;  4OMC A;  1RUN A;  1UZW A;  2CWS A;  2HWF 1;  2OII A;  3B69 A;  1OLR A;  1YO8 A;  2OUH A;  2Z69 A;  3K3O A;  4JRL A;  1GZC A;  3THP A;  4FOV A;  3NJZ A;  5CU1 A;  3BIE A;  4YGB A;  3VBS C;  1AX1 A;  4CSW A;  3THC A;  4Y33 A;  1K3I A;  3GM8 A;  5F3I A;  1XXN A;  4Q4Y 1;  2CTV A;  4CCN A;  1CZS A;  4HK8 A;  2LUW A;  4QPG B;  4YFW A;  4DFS A;  4BXS V;  2VQT A;  3SIT A;  1UY1 A;  4J25 A;  5AC9 2;  4UBG A;  4CDX C;  1ND2 B;  5C3R A;  4CEY A;  4MX3 A;  5HXV A;  4BQ5 A;  4LO7 A;  3MBW A;  3AP6 A;  2O8Q A;  4JDN A;  1XE8 A;  1UO9 A;  4WM8 C;  1UU6 A;  1W39 A;  2DVF A;  4S2D A;  1S0G A;  2WO2 A;  1OKQ A;  2ZHN A;  5C5T A;  1XPW A;  1RXF A;  1LOF A;  1UL9 A;  4IV3 A;  2AEN A;  2Y6G A;  2BYV E;  2QBX A;  1S0J A;  1DZQ A;  1JN2 P;  2DCT A;  2UYA A;  3VUO A;  2XPJ A;  1A3K A;  5JXG A;  4NN0 A;  3DXU A;  4NAO A;  3W21 A;  1G6N A;  2CYF A;  2XJT A;  4B7E A;  2LW8 A;  4LEJ A;  4N43 A;  4AE2 A;  1AR9 2;  4DY3 A;  3N3H A;  1V9U 2;  1MEC 1;  3Q8E A;  2QQM A;  4NIG A;  5CVR A;  3NL1 A;  4OHW A;  1SDD B;  5F6L B;  3PU8 A;  2AR6 A;  2WA4 A;  4R52 A;  1JUH A;  2JWP A;  2PN5 A;  3DF0 A;  4BQW A;  4IQP A;  2J22 A;  4S2F A;  2WO1 A;  2YC2 A;  1R09 3;  4Y22 A;  4BYY A;  2GDF A;  2GH2 A;  1WZX A;  2W46 A;  2WC2 A;  2J1V A;  2JB8 A;  4EYU A;  3U4X A;  2Y0I A;  3CJX A;  3W5M A;  2JDA A;  1UY2 A;  4RS5 A;  4JX0 A;  3DUI A;  4RR3 A;  3I2D A;  1QJY 1;  1ASJ 3;  1OFN A;  1W6M A;  5F2S A;  5BNN B;  5JPM B;  1PIV 3;  2ZS6 B;  3LEK A;  5CIR A;  2OPK A;  4YVW A;  5ISL A;  3O1R A;  2EIB A;  3RWN A;  2HWE 2;  1ENX A;  4NO4 A;  1O3Q A;  1ND3 A;  3KM5 A;  5FO7 B;  3FZ3 A;  5FZA A;  3UJQ A;  2R0H A;  1FYU A;  2GU9 A;  2VCA A;  5LA1 A;  2ZGN A;  3DV8 A;  3LA3 A;  2VZV A;  2ZGR A;  2MNG A;  3KV4 A;  3U75 A;  3WNP A;  4M0H A;  3ZFG C;  5JIU A;  3OY8 B;  3AM2 A;  4HZF A;  3C7G A;  4GWJ A;  2R32 A;  3BTZ A;  3VDD B;  2MEV 1;  2CGN A;  4YSF A;  3GNE A;  4BME A;  2J1T A;  4XTM A;  3KV5 A;  4XUT A;  3QD6 A;  5GLZ A;  5JR7 B;  3LDR A;  3H8X A;  1ST8 A;  2E31 A;  2R30 A;  1L7R A;  1LU2 A;  4WZC A;  4IL7 A;  4XVH A;  5DAQ A;  4TWT A;  4R9B A;  3S6P A;  4GIQ A;  3TYJ A;  5LW9 A;  4QWN A;  3EYP A;  3OGV A;  1LHU A;  5GLU A;  2D93 A;  5FYM A;  1BEV 3;  2VZT A;  2HWD 2;  2I07 B;  4PQQ A;  1TNF A;  3OJB A;  3PVO A;  4OLL A;  4R4X A;  3LEM A;  2G9G A;  3IPV A;  3LDB A;  4J1X A;  2XG3 A;  1OQE A;  4Y24 A;  2MPF A;  3RZG A;  5D8A A;  4H14 A;  5LWB A;  4Z92 B;  4BZ4 A;  1X9T A;  5FZF A;  4GMP 3;  2JIC A;  1EUT A;  4AEM A;  3KHC A;  1V9U 3;  3H8U A;  4LLF A;  1AR9 3;  1JS9 A;  1D2Q A;  4OHV A;  1TMF 3;  1U5Y A;  1B35 A;  2D6O X;  2Y0O A;  4P9L A;  2ID4 A;  2W08 A;  2RM2 1;  5GLW A;  4YYO A;  2W3J A;  2YU2 A;  4DB5 A;  3MI8 A;  1GUI A;  4GWN A;  4JTO A;  5LBC A;  5IAX A;  4BQY A;  3T0D A;  3ZN5 A;  3LKJ A;  1BVP 1;  2FZ1 A;  1ZBA 2;  4I01 A;  3X29 B;  1JBC A;  3AVS A;  5FZ8 A;  2K2S A;  1A6C A;  1UPI A;  1SBD A;  4XHB A;  1I6X A;  4Y20 A;  1MQT B;  4IW3 A;  4PT6 A;  5FLI A;  1RUJ 1;  4AGV A;  1UX6 A;  5EV7 A;  2LRO A;  1NCQ B;  1RHI 2;  2RMU 1;  1TVG A;  5BYN A;  2BPA 2;  1QJY 2;  4NHL A;  4L97 A;  3I59 B;  2PFW A;  4Q0S A;  1NOV A;  4NPM A;  2GZW A;  5A3T A;  1QJZ A;  3NKT A;  2B5H A;  5K9Y A;  3HOB A;  4W6Y A;  1K5M A;  1JYT A;  1UY3 A;  5FY1 A;  5BNP B;  3KT1 A;  1X36 A;  4Q0Q A;  5D1I A;  2XJV A;  3RZH A;  1VPH A;  4PIX A;  3IAP A;  3OTF A;  5FK7 A;  3HNY M;  3D4K A;  1NT0 A;  1OA2 A;  1AYM 3;  4BDV B;  2JIJ A;  3ITQ A;  4K3U A;  1GNY A;  4S2G A;  4GXL A;  2O8O A;  3VD7 A;  1VAL A;  1Q8P A;  2EAL A;  2HWB 2;  5JI9 A;  4CU6 A;  4I3P A;  1HV0 A;  3CJI B;  3LZZ A;  4UFL A;  1S2E A;  4URT A;  1DBN A;  3POG A;  3ES1 A;  1UY4 A;  3H8R A;  2JKB A;  1TME 2;  3NKG A;  3I2O A;  2DTY A;  5H9S A;  3NRU A;  5FBJ A;  1WCU A;  1W9T A;  4XF3 A;  5LBE A;  3T2P A;  4BM8 A;  2YC0 A;  2KXL A;  2UWB A;  2HWD 3;  1BEV 2;  2C1F A;  2OQ7 A;  2X5I A;  4LBQ A;  1NQD A;  5E6H A;  1QNY A;  4R9A A;  3C2U A;  1H8T C;  2NPI A;  1DG6 A;  4I30 A;  4WM7 B;  4BE3 A;  3D3A A;  5KXE A;  2VZQ A;  3EBR A;  2G19 A;  1UYY A;  1W6O A;  3ATG A;  4XFC A;  2ZOE B;  3UKN A;  3ZKY A;  2OPW A;  4BIS A;  1HQN A;  4YW2 A;  2TNF A;  4JCK A;  1UX7 A;  3M3O A;  3WY6 A;  3C7O A;  2VU9 A;  2IFR A;  3NNG A;  3CL1 A;  1XJA A;  3WHT A;  2W68 A;  4CU8 A;  3UKT A;  1ZYB A;  2Y34 A;  1AVB A;  4XJA A;  5JOY A;  4HK9 A;  4Y22 B;  4H55 A;  3JD7 3;  2WFF 2;  4C1W A;  1W6M B;  3B5L B;  1JYC A;  4YWA A;  2OZ6 A;  2ZEX A;  3JCI A;  4PDW A;  4AQ2 A;  2PXJ A;  5HV0 A;  4RHV 3;  1KD7 A;  3NJV A;  1CAW A;  2GNB A;  5HI0 A;  3WW1 A;  1VB2 A;  1QQP 3;  1SHW B;  1AR6 2;  4YW6 A;  4GD4 A;  4QX7 A;  4A3X A;  2YDE A;  1VRH 3;  4Q4Y 2;  3WF2 A;  2WRA A;  4AK3 A;  2ZAA A;  5J3U A;  1CVN A;  1GBG A;  3E5Q A;  3K4Z A;  3K77 A;  3LFM A;  4QKB A;  4XZU G;  2J1A A;  4HN1 A;  4P14 A;  4QQH A;  5A3N A;  1CAU A;  1NUK A;  1MZ6 A;  3JXS A;  3VBF B;  5FPB A;  2J7M A;  3M3C A;  2WO7 A;  4FPJ A;  2RDN A;  4XIL A;  2W1Q A;  1PNG A;  3PJY A;  3NWK A;  2ZGO A;  3MYX A;  1RHI 3;  4DIN B;  2WNU A;  1YNA A;  4FXK B;  3MZH A;  2B46 X;  5A3M A;  2CY6 A;  3HEI A;  2HLE A;  1OLM A;  2OA2 A;  3RVH A;  2A70 A;  1CGP A;  3AP7 A;  2B39 A;  3W20 A;  4CEW B;  1RIR A;  5DUU A;  3N9L A;  3W59 A;  2P5B A;  3GBW A;  4AEJ A;  4BQ1 A;  3LF7 A;  1AR9 1;  4MHR A;  4CDU C;  3I54 A;  5DAW A;  3ZXJ A;  1UOG A;  5CAZ A;  4HVO A;  1EV1 2;  1HN1 A;  1HRI 1;  5T3N A;  1BEV 1;  1YI9 A;  2VUA A;  4HLT A;  4BQ2 A;  1R1A 3;  3SIS A;  1U5Z A;  2VY0 A;  1E5S A;  1OH4 A;  5B4X A;  3EO6 A;  4MLO A;  4DS0 A;  2YRO A;  1GNH A;  3T2Q A;  1PX3 A;  4A41 A;  3WP4 A;  2F4L A;  5JAX A;  1Q43 A;  2YMZ A;  4QKF A;  2ADD A;  5E8A A;  2ZGK A;  3N7L A;  3AP5 A;  4LQR A;  5DAX A;  3ELN A;  4HFS A;  1QEX A;  1W8H A;  3FLR A;  4NUB A;  4YNI A;  2WFF 1;  2E7A A;  1RL3 A;  4PDW C;  5LRR A;  3IB3 A;  3T0A A;  2X09 A;  1QJX 1;  5LAS A;  5FYY A;  5H9P A;  3U37 A;  3LA7 A;  5BXX A;  2R04 2;  1RUI 3;  1CAW B;  3MHZ A;  5BNN A;  4YG3 A;  3WDU A;  1QU0 A;  1CJD A;  4XJ8 A;  3LE0 A;  2DF7 A;  2FHR A;  4GJY A;  3CJI C;  1OXC A;  3K3N A;  3CNA A;  2JG8 A;  2WWS A;  3HBK A;  4JHT A;  5EIY B;  4YW7 A;  3ME2 A;  2GAU A;  4FTB A;  1NCR B;  2PHW A;  1SFY A;  3ZXF A;  1S0D A;  3LEI A;  3V65 A;  2JDM A;  2VMD A;  3AYE A;  4C1X A;  1JYX A;  1W8F A;  2BDR A;  1YRZ A;  3FC0 A;  2VVD A;  4RR3 C;  4RS5 C;  4K1Z A;  2EID A;  2WYS A;  2GME A;  3ROU A;  3VKN A;  5FPU A;  1O3R A;  3ZN6 A;  1O59 A;  3J8F 1;  4LA2 A;  4P9X A;  4IE6 A;  1A8M A;  1APN A;  1PMJ X;  1GZT A;  3IPV B;  3NVC A;  4H2A A;  1Y9G A;  4OFG A;  4QX2 A;  4AFB A;  3PIG A;  1T2X A;  3ZN4 A;  1FMD 2;  1Q8O A;  1ZA7 A;  2JD9 A;  4TTG A;  1Y3T A;  5A1L A;  2PQQ A;  4JKM A;  3DEC A;  5JXJ A;  3ST7 A;  3FN9 A;  3HD8 B;  4XIK A;  5ANQ A;  3N4M A;  1F15 A;  4UW3 A;  3VBS B;  3A23 A;  4JKL A;  1FAT A;  3ZX7 A;  5CAD A;  2WIN B;  4EJR A;  3N36 A;  1R08 3;  2B42 B;  5IK8 A;  5EFU A;  4NRO A;  3ZDS A;  4YPJ A;  4HG6 B;  1ULO A;  3DL3 A;  2XJS A;  3P5B A;  1NE4 A;  4XXA A;  3ZXA C;  4BHP A;  3R05 A;  3AX4 A;  2VM9 A;  2JE7 A;  3PHM A;  4IES A;  4AED B;  3CZU A;  3M70 A;  3D82 A;  1GQP A;  3K4A A;  4PQ9 A;  5IAT A;  4Z8B A;  3M4F A;  2X53 S;  4Y5T A;  1AYM 2;  2B8M A;  3FJS A;  1WMX A;  4IEY A;  1BKZ A;  2W9X A;  4IUG A;  2CNA A;  1US2 A;  3FBY A;  1RGS A;  2XHN A;  4M01 A;  5FY8 A;  2CWM A;  4LOR A;  4AFC A;  4CPB A;  1W6P B;  2DBN A;  4JKK A;  1E5H A;  1H1M A;  2CDO A;  4E4S A;  2GP3 A;  4CXX A;  5FZ4 A;  2NP0 A;  2RS1 1;  3C7E A;  3AYA A;  1WGP A;  1WBF A;  1LGC A;  4K40 A;  3T09 A;  5FZC A;  5CKM A;  4UWD A;  3SCF A;  4AHX A;  2XJU A;  2UWA A;  2YFZ A;  3CF6 E;  3DKQ A;  3MFC A;  1IS3 A;  3NV3 A;  1W2O A;  1RUC 1;  5SV5 A;  1QWR A;  2Q1Z B;  2UU8 A;  4IXL A;  5HCB A;  1W3X A;  4XFI A;  4DY5 A;  1UU5 A;  4W6W A;  3K51 A;  4RGA A;  3B94 A;  4YGD A;  1W28 A;  3AMN A;  1JZ3 A;  2Q8C A;  4AVC A;  2RG4 A;  1MS5 A;  2BNM A;  1LCL A;  2V4A A;  3ZFE B;  1U5I A;  1Q5O A;  3POE A;  3J8F 2;  1UKG A;  3QCW A;  5I0S A;  1FPN 1;  3OEB A;  2G1M A;  1GOF A;  1S0E A;  2BZD A;  3KCX A;  3RJR A;  3AKT A;  2WO3 A;  5C6C A;  2PHF A;  1OI6 A;  5FZH A;  3JUU A;  4V2W A;  3MLK A;  5FMD A;  4CZS A;  4XFA A;  4Y1X A;  4B8E A;  2VZS A;  5EHD A;  3FFZ A;  4AVT A;  1F4A A;  2XVK A;  3K48 A;  4XYX A;  3SKJ E;  3MIE A;  3T1L A;  5BV6 A;  2YYO A;  4K6B A;  2PHD A;  4AQS A;  5A3P A;  1WUV A;  3MUY 1;  3VD4 A;  2UUR A;  3WDT A;  1O5L A;  4UOJ A;  5FPV A;  3FHA A;  1OVP A;  1RUD 1;  2VOX A;  2IXI A;  1KXG A;  4AI1 A;  1LED A;  5FZI A;  3ZMO A;  2QQP A;  4XUQ A;  2HEW F;  1MS8 A;  1W6P A;  3SHR A;  1US3 A;  3AZW A;  4P5H A;  2RE9 A;  1HKD A;  1EPW A;  4FPL A;  2A3W A;  1ZBA 3;  2ZAB A;  5GM0 A;  5FOB B;  4IEQ A;  1CZT A;  3GHM A;  1AYM 1;  4GJZ A;  5EZW A;  4LO8 A;  5IYY A;  1JYW A;  4YRD A;  5EYY A;  4ET7 A;  3HN1 A;  3OOX A;  4N90 A;  2Y6J A;  2NMO A;  1BZW A;  3I2F A;  4OHZ A;  2ZAC A;  3OB8 A;  2WZR 3;  3OPW A;  5A3L A;  4QQ2 A;  3B93 A;  2OX0 A;  3U14 A;  3AZV A;  2WFP A;  1C1F A;  2RS1 2;  5F32 A;  4JGZ A;  3TB0 A;  5GZD A;  1CR7 A;  1HV1 A;  4KI5 M;  1IQA A;  3AFK A;  1W04 A;  1YQ2 A;  4HON A;  4QX5 A;  5DXD A;  5SV8 A;  3WG1 A;  4CCD A;  3B9I A;  2D5F A;  1HB4 A;  3UKV A;  4L11 A;  4O61 A;  3KWV A;  3I2J A;  4FOQ A;  4FPE A;  4NOT A;  2FQP A;  4NVP A;  1PIV 1;  2N7G A;  2PHT A;  4URA A;  1OT5 A;  4MGS A;  2YZ4 A;  4LBQ B;  4O9E A;  5DG2 A;  2WQZ C;  3BTA A;  1LU1 A;  4LBK A;  3IIA A;  1EYB A;  3JD7 2;  1VJ2 A;  1WCK A;  3NNJ A;  2C26 A;  2RR1 1;  3VDA A;  3H3L A;  1BMV 1;  1LR5 A;  1IS6 A;  2BP6 A;  2Y60 A;  1GSL A;  4QHZ A;  3DXT A;  3RQ0 A;  4A3Z A;  3RMY A;  1FPN 2;  1NAE A;  1VBE 1;  4TLF A;  3O1T A;  3NAP C;  1VBC 1;  2PTM A;  3LFI A;  3U11 A;  2DVG A;  3MUZ 1;  2VZU A;  5JZG B;  5LBF A;  1AR6 3;  1QQP 2;  2QDR A;  1AR8 2;  4N53 B;  4MGI E;  4ZPI A;  1IS4 A;  2Q0A A;  1GAN A;  5T5O A;  3AC0 A;  2L9L A;  2J1R A;  4CEW C;  3OGG A;  1QJX 2;  2IXH A;  3RRD A;  1RMU 3;  1PGL 2;  2ZKL A;  3SXW A;  2P37 A;  2CV6 A;  2HWF 2;  4I02 A;  3GDB A;  1QJX 3;  4JGY A;  3ZFF C;  1KGY A;  3PVB B;  2D97 A;  3VBU A;  1POV 3;  5C9A B;  1WA6 X;  1W2U A;  4A44 A;  1O3S A;  3O1O A;  4AGR A;  3IM0 A;  4NWW A;  1W9F A;  5FO8 B;  1NYW A;  4NHX A;  5JVV A;  4COU A;  4YW1 A;  3RSJ A;  3O0W A;  4AI0 A;  4FPG A;  3WXP A;  5FZG A;  4WM7 C;  4Q8L A;  1WLD A;  4BK5 A;  5AC9 1;  5FOJ B;  1JHJ A;  5CFC A;  3HJR A;  4IEX A;  3CU7 A;  2JDK A;  1K5M B;  4JGZ B;  3WQ0 A;  5FPZ A;  3TNP B;  1YQ8 A;  1QNW A;  3ZO0 B;  2XKO A;  2Q5T A;  5A7W A;  5IJR A;  3OD0 A;  1LOA A;  1NCR C;  1BVV A;  4QD2 A;  1X82 A;  5BNO C;  3HWJ A;  5J36 A;  3OCP A;  1XNA A;  1YFW A;  1F31 A;  4RSU A;  3TEX A;  4DZG A;  1IHM A;  1QDO A;  1VBA 2;  4DUV A;  3AJZ A;  4MH0 E;  4MGT A;  5DG1 A;  1U5X A;  3FE5 A;  4M4P A;  2YXS A;  3JB8 A;  1UXX X;  4IEW A;  4FO9 A;  1JZ6 A;  1AR8 3;  3PTR B;  5FJK A;  3ZPY A;  1WCQ A;  3N9P A;  3ZOI A;  2V72 A;  5FKC A;  4DEQ A;  1UQX A;  1W6O B;  2VXR A;  2BER A;  4LR4 A;  5DN2 A;  1B35 C;  2O0O A;  2J1E A;  1QJU 3;  4CCL A;  4AEK A;  2P6C A;  1BMV 2;  1K5J A;  4EWD A;  5DPN A;  4QQL A;  2VZ3 A;  2P1B A;  3DEM A;  2W0X A;  1E5R A;  1ZZB A;  2Y6H A;  3VBF C;  1DGL A;  2NM1 A;  3WNN A;  5C9A A;  4WVW A;  1JYI A;  3T0B A;  4XDQ A;  3N9O A;  2HWE 1;  1G7Y A;  5DMY A;  1DU3 D;  1KS5 A;  2DDU A;  1R08 1;  3POI A;  5BNO B;  3NNF A;  4H3W A;  4GH4 A;  2PMW B;  3WT3 A;  1YC6 1;  5DZE A;  3ZFE C;  3VBR A;  3MPB A;  1HIX A;  3ZIX A;  3AVR A;  1PGL 1;  5FXV A;  2YV8 A;  3T1M A;  2A5Z A;  2WAB A;  4D6R A;  4CCJ A;  3ZPO A;  3AP4 A;  2MEV 2;  1WMF A;  1WW5 A;  5CFD A;  4ZKT B;  1I5P A;  4NRM A;  1O3T A;  2QTW B;  5FPL A;  3ZM8 A;  1AYN 2;  3K4D A;  1UZ0 A;  4I3G A;  1W0P A;  4LO6 B;  2XWJ B;  1KJL A;  3U1X A;  1H8V A;  1T6B X;  1UNB A;  3UK9 A;  1CAU B;  1GP4 A;  2Y6L A;  3AL6 A;  3NNL A;  4LK7 A;  4L2N A;  2ZGU A;  1QXR A;  3V0A A;  4ERO A;  3V56 A;  5B2G B;  2ERF A;  1CN1 A;  1QJU 1;  3KZ4 C;  5A7W B;  5GZG A;  4LTA A;  5FYV A;  4ZY9 A;  4Q4W 3;  4XC9 A;  4Q0U A;  1RUE 3;  1XOY A;  2D7F A;  3AYD A;  1LB2 A;  4BH9 A;  4MHU A;  3A22 A;  4UBH A;  2K46 A;  5DAV A;  2P3I A;  4JRA A;  3WQ7 A;  4OI0 A;  2NZ9 A;  1SG3 A;  5FYI A;  4DXZ A;  4AFD A;  3M3Q A;  1UZZ A;  2VAU A;  5FP8 A;  4EWE A;  1ALY A;  1KIT A;  2E6V A;  2VNR A;  2ZX2 A;  4IEO A;  5IAV A;  5KXD A;  1OPM A;  4OQ9 A;  1RVF 1;  2YC4 A;  2EIC A;  3ILF A;  3GCX A;  4PBO A;  5K7P A;  5J48 A;  3H8O A;  2RM2 2;  5C4W A;  3HVD A;  5LAT A;  4I09 A;  3CHX A;  1I5Z A;  1XNB A;  5L73 A;  3UGF A;  4BLI A;  3BKZ A;  4HN0 A;  1F35 A;  1FOD 1;  4FFG A;  4IGQ A;  4XQW A;  2OKX A;  4K20 A;  3N7M A;  3LOB A;  5I91 A;  4Y5S A;  2ZEW A;  3RYR A;  3AKS A;  3JZV A;  1P8J A;  5FUP A;  3ZDV A;  1O7F A;  4IEV A;  3VBR B;  1RUJ 2;  1FT9 A;  1TMF 1;  1J58 A;  1NA1 A;  3FX3 A;  1BBT 1;  1LHO A;  1RHI 1;  2RMU 2;  3MLL A;  3BTX A;  3SNM A;  5C3Q A;  1W99 A;  4ZU5 A;  2R06 1;  2RR1 3;  1HRI 3;  3RWK X;  3RMX A;  5GJ6 A;  5FZ7 A;  4CDQ A;  4AFA A;  1R08 2;  2VW2 A;  2Z4F A;  5A6Y A;  1W6N A;  1ENS A;  1CAV B;  2WZR 2;  3Q8C A;  3LWC A;  5I0T A;  4GAL A;  1OUX A;  2HJI A;  1ND3 B;  4YVS A;  3BUC A;  3NMB A;  3NAP B;  5CG8 A;  5CFD C;  3WF1 A;  3NST A;  1R1A 2;  4CA9 A;  1RUH 1;  3MV1 1;  3ENR A;  4XFG A;  4IE5 A;  4NPR A;  1ZBE 3;  4MGK E;  4XIO A;  2IXC A;  5J98 B;  1R1Z A;  1Y7B A;  2FDJ A;  4M3C E;  4CRQ A;  1PK6 A;  4LKF A;  3AZX A;  3VBH A;  3KD4 A;  4QQO A;  1CZV A;  4LBO A;  2UYB A;  1VIW B;  3WD5 A;  2XJR A;  3I8T A;  4UFI A;  4DXS A;  1PGS A;  4OUM A;  4QB1 A;  2A6V A;  2WAA A;  2QCS B;  2YB7 A;  3APB A;  3ZXD A;  1PM4 A;  1CQ9 A;  2V5Y A;  4FPC A;  4KQ7 A;  4P5Y A;  4CUB A;  1AL2 3;  2VNG A;  5ERL A;  2OYZ A;  2A6W A;  4XCB A;  1OMI A;  5M0T A;  1RUG 2;  2RS5 3;  1PO1 1;  4H7L A;  4XJU A;  4TZD A;  3WDY A;  5J1X A;  2EXJ A;  4Y26 A;  4AWD A;  3BB6 A;  1AR8 1;  4NMI A;  1WW6 A;  2BUK A;  1F4H A;  3ILN A;  5FRE A;  5FZO B;  4HKL A;  3MF9 A;  2NN8 A;  4CCK A;  1LAJ A;  3I3E A;  1OUS A;  5GZF A;  3MFA A;  1AX2 A;  3PMS A;  3VDD C;  1WW4 A;  2VZ1 A;  1OLM E;  5K4L A;  2ZGT A;  4AHY A;  1OLQ A;  4AOC A;  2SBA A;  4CDQ B;  1TG7 A;  1V70 A;  2C9K A;  3WSO A;  5I0D A;  2PHX A;  2V4V A;  3O1M A;  4P9J A;  1VBD 2;  4X6R B;  2BV4 A;  2R0F A;  3PNA A;  5IWF A;  4AED A;  5F6K A;  1MPX A;  3WEZ A;  1S0I A;  2DBI A;  3ZYH A;  3R6S A;  1CPN A;  1HQL A;  1DQ5 A;  1SMV A;  2OW4 A;  2YBS A;  4B7K A;  2WS9 1;  2XBO 3;  3MIC A;  4NWV A;  4XMA A;  2XJQ A;  3GHN A;  1H4H A;  1W2A X;  2HWF 3;  5BNN C;  5IVF A;  1POQ A;  1WCD J;  5DZF A;  3A7Q A;  4FP3 A;  1D4M 2;  4D6S A;  2A3X A;  3TAY A;  1WLC A;  2D6P A;  5FY9 A;  1NX9 A;  2JJ6 A;  3PIJ A;  2WZR 1;  3VD3 A;  5JMO A;  2CGP A;  5EQU A;  1W6Q B;  5E88 A;  3K75 B;  4BLJ A;  4FPY A;  4DMI A;  1MEC 3;  2Y6K A;  1MS3 A;  5JXH A;  2D3R A;  3OBT A;  2GNM A;  4FP2 A;  1LTE A;  1JTZ X;  4TN7 A;  5FYS A;  1AZD A;  1VBD 3;  2Z2S B;  4GUL A;  4AI3 A;  2ET1 A;  2QJV A;  3VZO A;  4CEW A;  3JBG 2;  5G04 L;  1S0F A;  1NZC A;  2XUM A;  3E6C C;  4E4D X;  4GA9 A;  3BI3 A;  5C70 A;  1GWL A;  1W2N A;  1PGW 1;  4NII A;  4CTE A;  5KHG A;  2WNU B;  1Z7S 3;  3CZJ A;  4HT1 T;  1AXZ A;  1ODM A;  1V6O A;  2DCY A;  4QPI B;  1X8E A;  4AHW A;  4YG6 A;  1PO2 3;  3GZA A;  3M2M A;  4HET A;  3WQ1 A;  4CDW B;  3DYP A;  4NRQ A;  2IXK A;  2ATF A;  4Q27 A;  4XQD A;  3HT2 A;  1C8N A;  2PQS A;  2P17 A;  3B9C A;  4M4R A;  4N43 C;  4RN5 A;  2WZP P;  1N1S A;  4E8D A;  4UYB A;  4Y1U A;  2VBP A;  1FI2 A;  4AW7 A;  1CAX A;  3AL5 A;  5JCT A;  5KHJ A;  1J83 A;  4O65 A;  2JKX A;  1HRV 1;  1SEF A;  2VR4 A;  4QXK A;  3OYW B;  4RD7 A;  5I8S A;  4PI0 A;  3WLU A;  2E7T A;  3WG3 A;  5F5Q A;  2WL1 A;  3Q8A A;  2WNE A;  2EF6 A;  3I7D A;  3J7H A;  5FLH A;  5LEK A;  3ZYJ B;  3I3Q A;  3WDV A;  2HEV F;  2WWJ A;  2Y33 A;  3PVN A;  4OYU A;  4COY A;  3WG2 A;  5C8C B;  5KXC A;  3AKR A;  3WIN E;  2R04 1;  5LA2 A;  4CP0 A;  2AZ5 A;  3ZFF B;  5F7U A;  3VZM A;  4AED C;  1OOP C;  3UV9 A;  2FCU A;  1J59 A;  4LKE A;  5K0U C;  2DUQ A;  2R16 A;  2WZE A;  2ZBJ A;  4HVR A;  4XUP A;  5IVY A;  3RYP A;  1ND3 C;  5HPO A;  4CDU B;  4A6S A;  3OG2 A;  3I2K A;  1LOE A;  5L7O A;  5FZL A;  5JOZ A;  4FT8 A;  5C8W A;  1DQ6 A;  2LAL A;  4KWJ A;  3C7H A;  4TSV A;  3B00 A;  3Q8B A;  2ZMN A;  4B1L A;  4IGP A;  3ZVX A;  3FHQ A;  4CEY B;  4RFT 0;  1N3Q A;  1XQN A;  1ZZC A;  2Q1F A;  2YUE A;  1PO2 2;  3CKH A;  3H50 A;  2RS3 1;  5DUW A;  1BHG A;  5C33 A;  1RUI 2;  5LCW L;  4HBN A;  4HKW A;  1VBC 3;  4FFI A;  4UW5 A;  5ACA 2;  1LJ7 A;  1WD3 A;  5FZ9 A;  3ZN6 B;  2JG8 B;  2FMY A;  1ZRR A;  1VBE 3;  4RHV 2;  4W65 A;  1YJK A;  4HAN A;  4LHL A;  1A8D A;  4HMZ A;  3RDI A;  4CDX A;  4Z82 A;  3ETQ A;  2V09 A;  1FNZ A;  2BNN A;  3GBF A;  5FZD A;  4XQ4 A;  1RUE 1;  1VBB 1;  3JBG 1;  1YFX A;  4M3C F;  1KFU L;  1RUH 3;  1UMH A;  4KH9 A;  4UFK A;  4OUL A;  3VKF C;  5FP7 A;  3SKV A;  4XET A;  2ARC A;  3HR9 A;  4PHZ A;  5K8S A;  1FOD 2;  2R49 A;  5ABJ C;  4Q26 A;  4IV3 C;  2OS2 A;  3BCW A;  4M3C A;  1H2L A;  2WWU A;  1SLI A;  1H2K A;  5IVC A;  2J42 A;  4A7K A;  1XU2 A;  4W6X A;  1TMF 2;  4L8Q A;  5FR3 A;  1MVE A;  3K2O A;  4KL1 A;  3S5Q A;  1CPM A;  4XTP A;  4AVS A;  2JG9 A;  3DPR A;  2D98 A;  3RS6 A;  4X6Q B;  1AL2 1;  2GNT A;  2WFF 3;  1LEM A;  4Y20 B;  3O7O A;  2IVI B;  1MS4 A;  1W03 A;  2EXI A;  2WA3 A;  1QF3 A;  2RS5 1;  1J84 A;  1OF4 A;  2DVB A;  3HIF A;  1VBA 3;  4QAW A;  2BBV A;  2PAM A;  3BYW A;  1DLL A;  5F37 A;  1BBT 3;  3I2H A;  4YG0 A;  4ONU A;  5HCF A;  2TUN A;  4WZF A;  3L9J T;  4QX0 A;  2A6Z A;  2HWB 3;  4LXL A;  4KU7 A;  1WCS A;  1RJ7 A;  1IKP A;  4OZO A;  1W05 A;  3D5O A;  3ZSE A;  1MAC A;  5C4W C;  1GWM A;  1JZ5 A;  1JZ7 A;  5LY1 A;  1RIT A;  4PCR A;  3VDC A;  5CFD B;  2DFC A;  1JYV A;  3WZ1 A;  4YLZ A;  5IT6 A;  4YZ1 A;  1V6K A;  2Q1M A;  3JQX A;  2YGM A;  1H2N A;  2XXZ A;  4JGZ C;  3ASI A;  5AFE A;  1GKB A;  5I8Y A;  1PZ7 A;  2RS1 3;  1SLC A;  4XMI A;  3AZZ A;  1PO2 1;  3QH7 A;  4R9D A;  2RS3 2;  2BTV C;  1YQ6 A;  3GF6 A;  2QZ2 A;  3A4U A;  4NID A;  1ZNP A;  2XLG A;  3S0M A;  1EY2 A;  5C71 A;  2VNO A;  2XVG A;  1ONA A;  4XF9 A;  1K42 A;  4RHV 1;  3W58 A;  2IXJ A;  4IEZ A;  5KC5 A;  2F6B A;  2W52 A;  4AI2 A;  5AC9 3;  4ZZ8 A;  4WVV A;  1S55 A;  1UYZ A;  1RUE 2;  5KHH A;  4COW A;  3RG0 A;  1UU4 A;  1FOD 3;  3WF3 A;  2QQO A;  4M0N A;  2YG0 A;  5IW0 A;  1V6L A;  3MGU A;  4MXW B;  4NR1 A;  3FLT A;  2BOJ A;  4CCE A;  4CVU A;  2J1U A;  5ABJ A;  4OUE A;  2YU1 A;  4M3C B;  4C8D A;  2BOI A;  1JOB A;  4CCO A;  1LGN A;  1LGB A;  1S0B A;  1K45 A;  2XML A;  3KQ4 B;  2OXB A;  5D8A B;  3ACL A;  5FTT C;  5A3W A;  5A6Q A;  2WNV C;  2E53 A;  4K21 A;  1JUI A;  2AUY A;  4QU1 A;  3UJO A;  1MQT A;  2W1S A;  3AJY A;  5J96 B;  2XQX A;  1REF A;  2Z79 A;  2JG9 C;  3C3V A;  3DPR C;  5F9T A;  3USS A;  4AVA A;  3VBU B;  4DO0 A;  2EAK A;  5CYY A;  3EMR A;  3ORJ A;  4Y4Y A;  4D7T A;  5T5J A;  1D4M 1;  3T2O A;  1JZ8 A;  1YWK A;  3M8L A;  2ZMK A;  5A7N A;  5EJ1 B;  3SEP A;  1JOP A;  4BA6 A;  1RUO A;  2YPD A;  3AB0 A;  1WA4 A;  3GZE A;  3MIG A;  3ZYG A;  1HDK A;  4LPL A;  4OZX A;  2DFB A;  3SH3 A;  2HWB 1;  4LJH A;  2J1S A;  2JEM A;  2JB4 A;  2B7Y A;  1Y4W A;  3ES4 A;  3J8F 3;  5C7G A;  3WNM A;  4ISQ A;  3WCS A;  2EIE A;  4K8R B;  3S7I A;  3QH6 A;  1XB9 A;  3OY8 A;  5FYZ A;  5T5P A;  1K5M C;  1TME 1;  3VBO A;  3WDW A;  3TN9 3;  4KWL A;  4OHX A;  1XND A;  1CX4 A;  3WX5 A;  3OUI A;  1ZZ8 A;  1M06 G;  2VCM A;  2FDI A;  3H7Y A;  3D0S A;  2R07 1;  1HN0 A;  1N3P A;  4BXF A;  2ENR A;  2VME A;  5KWR A;  4JV4 A;  3WF0 A;  4CUG A;  4HVQ A;  5T55 A;  1PO1 3;  2RR1 2;  5HCA A;  1QDC A;  4F83 A;  1LEC A;  2R6Q A;  2W2I A;  2Z42 A;  2ZHM A;  3POS A;  2UWC A;  1LOG A;  3BOP A;  4JAA A;  2Z5W A;  3M3I A;  4KMQ A;  1ENR A;  5A3O A;  5A7O A;  2PLV 1;  2BEO A;  2P3J A;  4UF0 A;  1ULD A;  5L9R A;  3IAQ A;  3QAC A;  3DYO A;  4W4Z A;  1WBL A;  4JDO A;  5ABJ B;  1H1I A;  3LSD A;  1VMJ A;  1E5I A;  3CIH A;  3KCY A;  4IE7 A;  1UXZ A;  2PHU A;  2DCZ A;  2W47 A;  3MF6 A;  4UF0 B;  4Q8K A;  1UZY A;  1DQ0 A;  1D7P M;  4B4Q A;  2QVS B;  4TLG A;  5FBZ A;  4WVZ A;  5FXX A;  3S7E A;  2YPJ A;  2WNV A;  2XR4 A;  1J1L A;  1NY7 1;  1AR6 1;  1MQT C;  2KD7 A;  3SH4 A;  3VBR C;  2E9Q A;  1NLQ A;  5FDB A;  3ZYF A;  5L9V A;  1SBF A;  1V6I A;  4N7U A;  4XFH A;  4ES8 A;  3GJB A;  3QOP A;  5I0U A;  1RUJ 3;  2ET7 A;  2LM3 A;  4GAZ A;  4K8F A;  3VB9 A;  5JOW A;  2IC1 A;  3IN9 A;  3P3P A;  4Y3O A;  5FK8 A;  1CAV A;  2YHJ A;  3KT4 A;  3RZK A;  4Q4V 2;  5FZM A;  2VG9 A;  1VMF A;  4LLO A;  4Y5Z 0;  3U0Z A;  2QQL A;  3OBZ A;  4IV1 C;  4MGZ E;  5GKA C;  3RZL A;  3J9S A;  1H30 A;  1LHV A;  1U12 A;  2DV9 A;  3J4U H;  4IND A;  3B7M A;  2BQP A;  4RGG A;  4BU2 A;  4D94 A;  1YYN A;  1G86 A;  1IG0 A;  2JIG A;  2ZZQ A;  3KVB A;  1BYH A;  5A7Q A;  1ZM1 A;  2DUO A;  1FPN 3;  2Q8O A;  4ASK A;  3ACI A;  1VBA 1;  4MZU A;  2CAV A;  3KV9 A;  1GQG A;  1IS5 A;  3TBD A;  3NV4 A;  1XU1 A;  2VZP A;  4IEP A;  3VBO B;  3BAL A;  4TYS A;  1PX4 A;  1VBB 2;  4FPO B;  5IFP A;  1YJL A;  5JOX A;  2MEV 3;  5JPN B;  5KC6 A;  2AEZ A;  2KA3 A;  1CX1 A;  1B09 A;  5J7M A;  1ASJ 2;  1F5F A;  1GNZ A;  1DFQ A;  1NLS A;  4WBB A;  2WLP A;  4XJ9 A;  5FZK A;  4X8P A;  1D4V B;  1HXS 1;  2ZGQ A;  4QPY A;  2FCT A;  5DDJ 2;  4DXT A;  3PTY A;  2WII B;  4FTS A;  3RZZ A;  1MZE A;  2X5I B;  1MZ5 A;  3FHI B;  3LIH A;  2VOV A;  3NJY A;  5A32 A;  1DDL A;  3J7L A;  1NCQ C;  1RUD 3;  3I2I A;  1UOJ A;  1W8T A;  2ZX0 A;  4CP1 A;  5FZ6 A;  1S2K A;  4FPF A;  3I3D A;  3TNQ A;  2LRP A;  4GB3 2;  3UES A;  3VGI A;  1UOB A;  1W9Y A;  2XUE A;  3UYJ A;  3SCG A;  2A73 B;  4WVM B;  4QPG C;  1AL2 2;  2ORX A;  1AL0 G;  2WBK A;  2V73 A;  3H0O A;  1JOD A;  4Q4W 1;  1GYK A;  2JG9 B;  3DPR B;  5A80 A;  1PMH X;  1ZX5 A;  2G4I A;  1HJG A;  2D40 A;  4LHK A;  5FMO S;  1BXH A;  5GLV A;  1W90 A;  4KGQ A;  2ARA A;  3M3E A;  3ZYR A;  3CBN A;  2XLA A;  1C8M 2;  2VXJ A;  1LUL A;  4QDR A;  3UGH A;  1X8M A;  5A33 A;  4UXA A;  2VEC A;  1EAH 1;  1OOP B;  1H9W A;  2V5D A;  5FZ3 A;  1TEI A;  1HQW A;  1RUC 3;  1WWY A;  3UL2 A;  1ENQ A;  3Q8F A;  4DUW A;  1NLR A;  1XYP A;  1G8W A;  3CMG A;  4ZZ5 A;  3WG4 A;  3HMY A;  5DZG A;  4JQT A;  2JEC A;  1W6N B;  4QU2 A;  1DYP A;  1XNC A;  3LPF A;  5ACA 3;  2GN7 A;  3MIB A;  4KGG A;  4NE9 A;  2DCJ A;  1VRH 1;  2XGX A;  1QH7 A;  2D43 A;  4LO5 B;  1RB8 G;  5FZB A;  1VMH A;  3VZJ A;  2JE9 A;  3OBR A;  3H1M A;  5D8A C;  2ZKN A;  4D8M A;  1NG0 A;  2W39 A;  4HSL A;  3TOJ A;  4B4P A;  2C9A A;  4XJZ A;  2QE3 A;  3OGJ A;  1XE0 A;  1W8Z A;  5JZG C;  3EJK A;  4LBM A;  3AKQ A;  3CJI A;  3AMQ A;  4OI1 A;  3EXU A;  4KBZ A;  3VBU C;  2VO5 A;  3I49 A;  2C6S A;  2BU9 A;  1Z78 A;  1FXZ A;  3BVC A;  2IZW A;  2Q30 A;  3VL8 A;  1PVX A;  2PAK A;  5JR2 A;  4DXR A;  4MGQ A;  4P02 B;  1I1E A;  3FUQ A;  4QXB A;  4YW4 A;  3M1H A;  3K46 A;  4LOT A;  5CA6 A;  4N9H A;  5DDJ 3;  1PM7 A;  5F2W A;  2VOT A;  1O5U A;  1PZ9 A;  2VL4 A;  1KDK A;  1O4Y A;  3ZFE A;  3IDB B;  5C3P A;  1MS1 A;  4QX3 A;  4LOS A;  4YM0 A;  5DDJ 1;  1XRU A;  5H9Q A;  4ARX A;  4NHY A;  3POB A;  1PNF A;  1Q8S A;  2WSU A;  3J7N A;  4QDS A;  4AXO A;  4NJ4 A;  3ZMN A;  3ZKU A;  3ZXK A;  1GV9 A;  2QQK A;  5GZE A;  1YQC A;  2VTX A;  3O1V A;  1BBT 2;  4ZXK A;  4GB3 1;  4S2H A;  2WT0 A;  3TEW A;  1Q8Q A;  3OYW A;  3HQX A;  3OBA A;  4FPH A;  5FY0 A;  2R06 2;  3WW4 A;  2WN2 A;  2E32 A;  2FDH A;  3VL9 A;  1GLH A;  3KLS A;  4QT6 A;  3VDB A;  1GR3 A;  3THD A;  4P9Y A;  3D8C A;  3PLQ A;  4Y1Z A;  5A6Z A;  5AFB A;  1AJK A;  4V1P A;  1GWK A;  3I59 A;  1QMJ A;  5F39 A;  1C8M 1;  3IKW A;  5DAP A;  3NNM A;  3ACH A;  1R1A 1;  5FJH A;  5GZC A;  1N1Y A;  1Y9Q A;  4LKD A;  1JHN A;  2JDH A;  4LIT A;  1G9C A;  4Q1R A;  2A75 A;  2VMF A;  2GC0 A;  2ZGM A;  3H1Y A;  3U07 A;  3UNP A;  3OUH A;  4W8J A;  5CEH A;  1FV3 A;  1UIJ A;  3VV1 A;  1DF0 A;  2D3S A;  1YEW A;  1OQD A;  3IMM A;  1QOT A;  4LNV A;  3GGL A;  2A1X A;  5HXM A;  3MPP G;  3ZSL A;  4FOY A;  1VRH 2;  4Q4Y 3;  2DWR A;  4RYD A;  1PK6 B;  3VBH B;  5FY7 A;  3GAL A;  3VHO A;  2HWC 2;  1ND2 A;  2ZHK A;  2DVA A;  1OVS A;  4HOO A;  4I0W B;  1W8O A;  3LEG A;  2ZEY A;  4CPB D;  2WS9 3;  3A0K A;  1UY0 A;  3C8X A;  3SQO A;  4BOW A;  1KS4 A;  4MAD A;  3G6J B;  5A7S A;  1UZV A;  3H9A A;  1JU3 A;  1RUG 1;  4XFF A;  2VBD A;  2CL2 A;  4MO3 M;  4Y1Y A;  1YIP A;  5IVB A;  1AJO A;  2PLV 2;  5A32 B;  1IZ3 A;  2JDU A;  2GC2 A;  1YFU A;  4MSV A;  1OPO A;  1RYY A;  2XB6 C;  2JDZ A;  3J26 N;  2D3P A;  3E6B A;  4XJW A;  3UGG A;  1DGR N;  3ZR5 A;  2JDN A;  1STM A;  4CYD A;  2VW1 A;  1CAX B;  2WR9 A;  4YVS C;  5BPX A;  1H9P A;  1SLL A;  2BRT A;  1AF9 A;  1LES A;  3N35 A;  2CAU A;  1NA1 B;  3U4S A;  1UPS A;  2AEY A;  5A1A A;  5C4W B;  5F5C A;  3ZFG B;  5KHK A;  2XWB B;  3LSE A;  1RUD 2;  2VMC A;  2WNV B;  3WNK A;  2EAA A;  3N9M A;  4GZ9 A;  4FFF A;  4P9W A;  4E4H A;  4EZ4 A;  4D0Q A;  5KBF A;  5CIS A;  2VMI A;  5TSW A;  2WS9 2;  4Z2W A;  4YZ2 A;  5CG9 A;  2HKX A;  3FFQ A;  4HPK B;  4HSJ A;  1PK6 C;  3R0R A;  3TWI A;  3VBH C;  5E89 A;  1AR7 1;  2CGO A;  3MV0 1;  1OOP A;  3H7J A;  3R4D B;  5ANN A;  5L19 A;  3LGR A;  1IG3 A;  3JBG 3;  4QM8 A;  4RR3 B;  4RS5 B;  1PVC 1;  1LOB A;  2C5D A;  2DYC A;  4HXC A;  4C0H A;  1F9K A;  2GMM A;  4BWO A;  1CJP A;  2W95 A;  3MW4 A;  5CB7 A;  1A78 A;  5HBA A;  4BQ3 A;  2DVD A;  4L9B A;  2P4E A;  1AX0 A;  4NRP A;  4CU7 A;  3BU7 A;  5FFO C;  1HJF A;  3UT0 A;  3WUD A;  2JX9 A;  3M7A A;  1FNY A;  4LMF A;  5LA0 A;  4GQ7 A;  4N7I A;  1WMD A;  2IVJ A;  5LB6 A;  1O4T A;  1SFN A;  4UI9 L;  4YZ3 A;  1R09 1;  3O0V A;  3O0X A;  3ZXG A;  1DP0 A;  4FQ4 A;  5JMC A;  3V0B B;  1JI6 A;  3FWE A;  3AMM A;  5FY4 A;  1ASJ 1;  2HWE 3;  1PGW 2;  1F2N A;  3AP9 A;  3HN3 A;  1IKQ A;  3IT8 A;  4LHN A;  1SCS A;  1EV1 3;  5JI7 A;  1HXS 2;  4IE0 A;  1PIV 2;  4DIQ A;  1W6Q A;  3N7J A;  3MW2 A;  2RDR A;  3CO2 A;  3RFR A;  4K9S A;  4O7X A;  2I2S A;  4PIZ A;  5CKQ A;  5FYB A;  4YAR A;  5IFT A;  1V6N A;  2FDF A;  3VHR A;  1TE1 B;  2WT2 A;  5B4N A;  3E97 A;  3VHN A;  2XL9 A;  4AI8 A;  3IMN A;  4IV3 B;  4XF4 A;  5JXI A;  1H8T B;  1ZZ7 A;  3BPS A;  2O1Q A;  4JHZ A;  2JEN A;  4OHY A;  2QQJ A;  2DUP A;  5FKB A;  2XJP A;  1HRV 2;  3LDK A;  2BFU L;  3GBG A;  3MDP A;  2HWC 3;  1EPZ A;  1UN1 A;  1O4Z A;  3KV6 A;  4IV1 A;  1KEX A;  4DNY A;  4O9G A;  1X33 A;  1RXG A;  2Y6F A;  4A2U A;  4DRR A;  4QPW A;  5C3S A;  4G9S B;  3HT1 A;  1RUF 1;  2JG8 C;  4AG4 A;  1N3O A;  2X10 A;  5LEJ A;  1HRV 3;  1C28 A; 
#chains in the Genus database with same CATH homology
 4XAE A;  2WO7 A;  1BK0 A;  1E5S A;  2VBB A;  1UNB A;  2BRT A;  1UOB A;  1HB2 A;  1W9Y A;  1DCS A;  2JB8 A;  1GP4 A;  1UZW A;  1E5R A;  1W2O A;  1UOF A;  1WA6 X;  1HB1 A;  1RXF A;  2CSG A;  1HJF A;  2VE1 A;  2IVI B;  1ODN A;  1W3X A;  3ON7 A;  1IPS A;  1QJF A;  1W03 A;  3OOX A;  5C3P A;  2VBP A;  1W06 A;  2JB4 A;  2BJS A;  1GP5 A;  1HB3 A;  2Y60 A;  1OBN A;  1BLZ A;  2IVJ A;  1HJG A;  2DBI A;  1W28 A;  2VBD A;  1QIQ A;  1RXG A;  2Y6F A;  3ZKU A;  3ZKY A;  3ZOI A;  1W2A X;  1OC1 A;  1W3V A;  5C3S A;  1W2N A;  4BB3 A;  1QJE A;  1E5I A;  2DBN A;  1W04 A;  1E5H A;  1UOG A;  5C3R A;  1ODM A;  2VCM A;  1W05 A;  2BU9 A;  5C3O A;  1HB4 A;  4RGK A;  2VAU A;  5APA A;  5C3Q A;  1GP6 A;  1UO9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...