1E5IA

Delta-r306 deacetoxycephalosporin c synthase complexed with iron and 2-oxoglutarate.
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
306
structure length
264
Chain Sequence
MDTTVPTFSLAELQQGLHQDEFRRCLRDKGLFYLTDCGLTDTELKSAKDIVIDFFEHGSEAEKRAVTSPVPTMRRGFTGSMCYSMGTADNLFPSGDFERIWTQYFDRQYTASRAVAREVLRATGTEPDGGVEAFLDCEPLLRFRYFPLRMAPHYDLSMVTLIQQTPCFVSLQAEVGGAFTDLPYRPDAVLVFCGAIATLVTGGQVKAPRHHVAASRTSSVFFLRPNADFTFSVPLARECGFDVSLDGETATFQDWIGGNYVNIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DEACETOXYCEPHALOSPORIN C SYNTHASE
publication title Kinetic and Crystallographic Studies on Deacetoxycephalosporin C Synthase (Daocs)
pubmed doi rcsb
source organism Streptomyces clavuligerus
molecule tags Oxidoreductase
total genus 82
structure length 264
sequence length 306
ec nomenclature ec 1.14.20.1: Deacetoxycephalosporin-C synthase.
pdb deposition date 2000-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03171 2OG-FeII_Oxy 2OG-Fe(II) oxygenase superfamily
A PF14226 DIOX_N non-haem dioxygenase in morphine synthesis N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.330 Mainly Beta Sandwich Jelly Rolls B-lactam Antibiotic, Isopenicillin N Synthase; Chain 1e5iA00
5C3QA 2CSGA 1HB2A 3ZKYA 4RGKA 1OC1A 1E5SA 1GP5A 3ON7A 1QIQA 1WA6X 1W03A 1W9YA 2WO7A 5C3OA 5C3PA 1W3XA 2JB4A 1ODMA 2Y60A 1W06A 4BB3A 1UOGA 1E5RA 2IVIB 5C3SA 1QJEA 2DBIA 2VCMA 2IVJA 1W2OA 1E5IA 1W28A 1UOBA 3OOXA 1UZWA 1QJFA 1ODNA 1DCSA 1RXFA 1BK0A 1UNBA 4XAEA 5APAA 2JB8A 2VBPA 1UOFA 2BRTA 2VAUA 1BLZA 1HJFA 2VBBA 1W2AX 1GP4A 2Y6FA 1E5HA 1RXGA 1W05A 1GP6A 1UO9A 1W2NA 2VBDA 1W3VA 1HB4A 3ZOIA 3ZKUA 1W04A 1IPSA 2BJSA 2VE1A 1HB1A 2DBNA 1HJGA 5C3RA 1OBNA 2BU9A 1HB3A
chains in the Genus database with same CATH superfamily
2VUAA 3EYPA 3DYOA 4HN1A 4L8QA 5LEJA 1UU4A 1HKDA 2KM2A 3AP6A 3KCXA 4Q5OA 3M1HA 4XQ4A 3U11A 4BQYA 2GZWA 5CEHA 1QOTA 1BQPA 2D98A 2Y6KA 1V00A 2BNMA 3EBRA 4WM7C 3RMYA 4PBOA 5EJ3A 5FZ0A 1LNSA 5ACA3 5KXCA 3MBWA 5G05L 4ARXA 1TVGA 5IVEA 4GJZA 1FXZA 1HIXA 1OKOA 5D8AA 1QF3A 4XUQA 1NA1C 1O4YA 3MUY1 1AXKA 2EICA 2ZAHA 2MNGA 1WA6X 4QHOA 1RVF3 5D21A 4HVRA 1AL21 1WD4A 1LRHA 1Q8QA 4YRDA 3GJAA 4AEDB 1ZBE1 1XE7A 2BW8A 5FUIA 5C4WC 2R49A 2J1VA 1MPXA 5B2GB 2RDNA 3E1F1 2VZSA 4TN7A 5JI7A 5LRRA 5JOZA 1C5IA 5FZBA 3T0BA 5LA1A 1NQJA 1QOSA 4LLOA 1C1FA 2DFBA 4XDOA 2V09A 1IPKA 4EV0A 2WNUC 1E5RA 1VBC2 2JE9A 1RUJ2 1DGWX 3VDDA 3VHNA 3ZN4A 1XBFA 4AQ2A 3CJIA 4XIKA 3ES4A 4XC9A 1LR5A 1K45A 4GMP3 4V1PA 3NNFA 3V56A 4O9EA 3WSOA 3FLRA 3WG4A 4A7YA 3TEYA 4G9SB 5I0TA 3EMRA 3VBFC 4RD7A 3D0SA 1OA4A 3H8RA 2B8MA 4GB32 5IAXA 1E5IA 4AZZA 3FC0A 4CP2A 2YY1A 2ZHKA 5DAWA 3R4UA 5FCCA 1M06G 2GMEA 5F5IA 1QDCA 5F3CA 1H1MA 4AXOA 3IM0A 1GKBA 2X8KA 3MIGA 1UZ0A 3O7OA 2RS32 4M4RA 4AR2A 2JKXA 5FPAA 5JOWA 1IOAA 2KD7A 4LEJA 1J1LA 3K3NA 1FOD3 3C3VA 1BLZA 3MLKA 2YU1A 5DN2A 3DYMA 4LIVA 3ZPYA 1VBC1 5BNPB 1RUJ1 3I59A 4PIXA 1UYXA 1V6IA 3AK0A 1OOPB 1WD3A 1H1AA 2Y64A 3G6JB 3UV9A 2TEPA 2P3IA 2GALA 5FXXA 2ZGMA 4OI1A 1JW6A 1L7QA 4JTOA 5CIRA 2FQPA 4IQPA 4UF0B 4QPIC 1XOYA 3HOBA 4M3CE 3RGBA 2VUCA 4GB31 4AI8A 4CXYA 2QDRA 1JS9A 4J1WA 5GLVA 4R52A 3QBQA 1MZEA 5F5CA 4HT1T 1C57A 4BA6A 2BP6A 2R063 4YZ4A 5FZIA 1QH6A 2YG0A 2Q4SA 1L7RA 1GZ9A 5BNNB 2TBVA 1IQAA 3R4DB 1UY4A 2RS31 4WV8A 2P4EA 2WS92 2ZMKA 1DF0A 1E57A 5KHKA 5IHRA 1R1A3 3ME2A 4IEWA 4XJ9A 3RDIA 1EV12 1OH4A 1M4WA 3DPRC 4MGYE 5EJ1B 4IE0A 4Z8BA 3MPBA 2ZKNA 3VKLA 1N3OA 3B94A 4B1LA 1RHI3 4Y1XA 4PT6A 2CSGA 2WZEA 1AR72 2DV9A 5LBFA 2BGOA 2WAAA 4GH4A 1QNYA 3WT3A 5FMBA 1S2EA 2IC1A 2OXBA 4FOYA 4YW4A 2E9QA 2CU5A 1NZCA 1OURA 1PO11 1S0GA 2JWPA 4AGGA 4UFHA 3RI8A 3KS7A 2EAAA 2BPA2 1QQP2 3BCWA 1TME3 1OQEA 3BN6A 2MEV3 1X9TA 2R30A 1JZ3A 4U2AA 3S6PA 3RZKA 1DZQA 4P5YA 2WS91 3J4UH 2W2IA 4NRPA 5F3IA 3WP6A 4LHSA 2LTNA 5C7GA 3MYXA 1QY4A 3MUZ1 4TWTA 3C2UA 3EXUA 3SLIA 1EV11 2CV6A 1A8MA 4FFHA 4LO6B 1HRV3 2I2SA 3AP5A 2B45X 4IE7A 4OZXA 4XFHA 4Y1ZA 3WDTA 3DN7A 4IDZA 1ZZCA 2JEMA 5DXDA 3WF1A 4AI0A 2C4XA 5JCTA 4EWDA 3H8OA 2FDFA 4XF3A 3JB4C 3PVBB 4ASLA 4MGQA 1LULA 1NCQB 3ZXGA 3W5MA 2CNAA 2DBIA 1AYM2 3D5OA 1SLTA 4JGYC 2GNDA 3L9JT 1XU2A 3AMQA 4N53B 4KU7A 4P08A 3T3YA 2X10A 1X36A 3J7NA 4WM7A 4Q0UA 2RDSA 4Y1YA 3ZFEB 5LK7B 4N7UA 4Y20A 3WF3A 1I1EA 4AE2A 3KHCA 5E89A 1UZWA 1QJFA 4FOWA 1YEWA 3I3MA 1GNHA 1ZA7A 4XMAA 1AR82 1NA1A 1IQDC 4ZHNA 3PURA 3LB9A 1QXJA 3WNOA 4HK8A 1SCRA 2QZ2A 3SCHA 1ZBA1 4CDUC 2VC9A 3HR9A 1S4CA 1W99A 4ORFA 1DGWA 4RS5B 5FZCA 5E88A 1Y4WA 1BHGA 1AX0A 1UOFA 3M3OA 3FUQA 2DVDA 2X5IC 2LALA 1EAH3 2VBBA 3MDPA 2PAMA 1US3A 2EA7A 5FMOL 5FY8A 4A7KA 1PHMA 2A5ZA 5A3OA 1PMIA 3BUCA 2JXAA 3O14A 4CCLA 3AP9A 5CFDC 1NLRA 1AL23 2LW8A 1N3QA 5FLHA 3KM5A 1ZBE3 3OYWB 1IKQA 1LOFC 3AX4A 4PI0A 4Q29A 1SEFA 5C9AB 1AXYA 1OD3A 5FXWA 2VZQA 3GALA 4XAAA 3VBFA 2XBO2 4YFWA 1CWPA 1SACA 3O1TA 1AR81 3RMXA 2YUEA 4N7IA 2WN3A 5HV4A 3R6SA 1O4TA 1NLSA 2NMOA 5EFUA 4QHBA 4XQDA 4H55A 2BEOA 4FVVA 2DF7A 4Y26A 1OPOA 1H8TC 2ADDA 3WUDA 3AC0A 4CP0A 2IZWA 3AMPA 4HG6B 1AX1A 3WNLA 5BY5A 4DMIA 4JAAA 5DAXA 3S57A 1GOHA 2VNGA 4G3YC 2YC2A 4COZA 2DU1A 2R16A 3M7AA 1O6UA 3MIBA 1MEC2 1NG0A 2DCZA 4F7ZA 4LOTA 1GFF2 3I2DA 4XJWA 5TSWA 1OF4A 3N7LA 3LE0A 4C0BA 1O8PA 2JG8C 4YVSC 4ES9A 1SLCA 5AFBA 1E5SA 1WKYA 2ARCA 2WQZC 4H14A 2VOTA 4WBBA 4V2WA 1LOGA 4OLLA 4DUXA 2XBO1 5FWJA 3HQXA 3N3HA 4I3PA 4HETA 3KQ4B 1VBC3 1TMF2 1RUJ3 4JC1A 4FPGA 5LZ6A 3AZVA 3NNLA 4D6SA 1SDDB 3HN3A 2JDAA 1SZBA 4YGEA 2ZGNA 3E6BA 3T09A 2VD7A 1O3TA 3DUIA 3LEKA 4UFLA 2A3WA 5H9QA 5EQUA 5A3WA 3VBRB 2ZMLA 2VY0A 1UY2A 1D7PM 2PA7A 4FP3A 4GB33 4BPZA 3N36A 4M3CB 4QX7A 5A6QA 2P34A 2R041 4GAZA 1NCRA 1J58A 2OX0A 1UKGA 2E26A 1DBNA 3TOJA 1FATA 3NV1A 1YI7A 1IS4A 4YWAA 2J42A 5GLUA 5I91A 4CDQA 2RS33 3VLBB 3WDXA 4Z1VA 2BBAA 2IXJA 2BERA 3CU7A 3WG3A 3OY8A 4QWNA 5JDBA 1HN0A 2C1FA 2Q1FA 3QH6A 1CESA 2JE7A 5E16A 5IK8A 2ATFA 3WNPA 1DCSA 2Z69A 2Z42A 5AFEA 1X82A 1TMF1 4IUGA 4ZONA 2BVVA 4XACA 3NW4A 2WABA 4QDRA 4OQ9A 4WVWA 2GC3A 4EN7B 3WR0A 5L36A 2IXIA 2PLV2 5J36A 2JB8A 4K6BA 4R9AA 2FHRA 4M00A 5HXVA 5JZGC 5BYNA 4ZS3A 4YZ2A 1KDKA 1ZZBA 4MUVA 1KGYA 2ILMA 3SISA 2ZEWA 1I3HA 3H3LA 2JDPA 3AMNA 3EHKA 2VTFA 3ORJA 5FOBB 1H8VA 3CNAA 3TRSB 4FTEA 1NOVA 1HXS1 3HAGA 5K9YA 2HWB2 3RYRA 4OHYA 1DGRA 2WYSA 4UI9L 1RGSA 4I02A 2W91A 3VL8A 1S1AA 2R0FA 2WS93 1TG7A 2Q30A 4E4ZA 3POYA 1W8NA 1FNZA 2CGOA 4IW3A 1XC6A 2JDKA 4JGYA 3M3IA 3WEZA 2VPVA 1EV13 4RR3C 1ENSA 3RPQA 3P3NA 4AEDC 5A1LA 3THCA 4PF5A 4XF4A 1DDLA 1ND2B 1I6XA 2HYXA 2R1DA 2HBUA 2GN7A 2WL1A 3WDYA 4BK5A 4YZ5A 4AYUA 1K5MB 2PLV1 1ND3C 2A73B 2YPJA 5EP9A 2YHJA 4L2NA 2B39A 3IIIA 4LK7A 5DAVA 2Q8CA 3VZMA 3K2OA 5CVRA 4UFIA 1D4VB 4FBFA 1NXD1 4JRLA 5KXEA 5IK5A 3BIWE 3PIGA 2CAVA 3PVOA 3H0OA 5A7OA 3ZXJA 3PUAA 4C1WA 1JZ6A 2X5IA 2HWB1 2OPKA 4LUMA 1QQP3 1K12A 3KT7A 1WMDA 4MH0E 5DUUA 4LBNA 4LO4B 5B4NA 2XR4A 2XPJA 1IS6A 4RN5A 5CFDA 1RMU1 2K9ZA 5FYZA 3RWKX 5HBAA 3MV01 1CN1A 1QJX1 2BWCA 2WQ8A 3W58A 1EY2A 2D93A 3CHXA 4BWOA 3KD4A 5F39A 3GNEA 5IVCA 5JIAA 4D69A 1W6OA 1F2NA 1GLHA 1H9PA 1VPHA 1YQ2A 3ZSKA 1JUHA 1QJY2 1Q5OA 4IGOA 2BBVA 2XUEA 4DRRA 4IGPA 1O7FA 2ZABA 2Y6GA 2WA3A 1OKQA 4Q8KA 2CGNA 3Q8FA 2GNTA 4XFCA 1H8TA 3VGIA 3WDVA 1SFPA 2YDEA 3ZR5A 5BNPC 1BCXA 1X8MA 2AENA 3POBA 1GZWA 4A6OA 1ACCA 4COYA 1S2BA 2W08A 2WT2A 2O8QA 1AR83 1R1ZA 2LUWA 3THPA 3DXTA 4ITCA 4DS0A 4DZGA 1O3QA 4N9IA 3CMGA 1UZZA 1YI9A 1TE1B 3K4ZA 1JOPA 1CAUA 4HSJA 1UOBA 4YVSA 4JV4A 2OVUA 2VQ0A 4AHXA 5J37A 2QQWA 4B1MA 4FFIA 2CWSA 1YCIA 3AB0A 1RUI2 5A33A 4JQRA 1J59A 1QJY1 1GBGA 4YNIA 2HWD1 4TZDA 3ZO0B 4ZS2A 2J1EA 2WNVC 3WINE 5F1RA 4OUSA 3HWJA 2W3JA 5FKBA 2ETEA 4CZSA 3I4IA 1D0HA 1UW8A 3HJRA 4XJZA 1V6MA 3E5XA 1W2AX 2XG3A 1H30A 1PVC2 3E5UA 1DLLA 1UYPA 1JZ8A 2D40A 1QEXA 3ZSLA 1KQRA 4AI1A 3TEZA 2DWRA 3PU3A 2XBO3 1W8FA 1O3RA 4XFGA 4CUBA 3ZMOA 3IZOA 2FBEA 1POV0 4QKNA 4XUPA 1S55A 4TSVA 5DAPA 2JDMA 2VBDA 5DMYA 4IEOA 1W3VA 2NP0A 2QZ3A 4W6XA 4Y5TA 2UYBA 3ATGA 4IEUA 4Q26A 3KWVA 3VBUB 2NZ9A 1ZVFA 4YW5A 3BTZA 2JG9B 2UU8A 2BJSA 3CEWA 1KDMA 3FHAA 3X29B 1KXGA 1RUH1 2GAUA 2IXLA 3Q8EA 4CSWA 1QU0A 3TYJA 2K0GA 1RUI1 2ZGQA 3LA3A 1HRI2 3DKWA 1MEC3 1QDOA 2C9KA 1JU3A 2XL9A 1WLDA 2QKDA 1IHMA 3NV4A 3J7MA 4MGTA 2XVKA 2IXCA 3N35A 5L9VA 1OQDA 3ZXFA 4GWJA 1CAWB 1RYYA 1DGRN 5D8AC 1PVC1 4NE9A 4XUOA 5H9RA 4FPLA 1QXRA 5FK7A 2HEYF 3L2HA 4X6RB 2C26A 4DUWA 1IS3A 4QMAA 2BOIA 3NL1A 2MPFA 1NCQC 2P2KA 2ZX0A 4N43A 4O7XA 4Q4W2 1LGNA 3MW2A 2BUKA 5KC5A 1YFWA 5F6LB 5JPMB 1YIFA 1TMF3 4NVPA 2EF6A 4GD4A 4AHWA 1EPZA 4FQZA 2V5DA 5FZOB 2JENA 2LM3A 2OQ6A 5T55A 4NO4A 3ZFEC 5CA6A 4FSJA 1OMIA 1U5XA 4BHPA 2H0BA 4D0QA 4AL9A 2ZGRA 4DY5A 4RFRB 3A0NA 2WC2A 1BEV2 3SH4A 4ES8A 3U07A 1MQTB 3CF6E 3BI3A 5FZ8A 3T2OA 1A34A 3CJIC 1AJKA 3B01A 3CKHA 4AEDA 1HRI1 3IAPA 4RS5C 3O1SA 4E27A 2WNOA 3AKSA 5FJHA 4CDWB 2D3SA 1RITA 1DU3D 1N3PA 2BV4A 2IFWA 3VKNA 3LSDA 4XMIA 1LOEA 2RDQA 3UKTA 1R1A2 4FAHA 2PN5A 2Q8DA 3PLQA 1WMXA 2Y6LA 3KCCA 3VBHB 2JD4A 1S0DA 2XLFA 3RZJA 2EALA 4Z07A 3ZFFB 4AVVA 3WNKA 4EE2A 5H9SA 3TWIA 4QGMA 1H2KA 1RJ8A 2VCMA 3BALA 4L0PA 4Y5Z0 5C9AC 5CBLA 4XHBA 1UYZA 3HPNA 1FX5A 2EIEA 3PHMA 4PLNA 4PQ9A 5ERLA 5JMCA 1Y7BA 2PLV3 5FUPA 4B7KA 3KZ4C 4X8PA 1U5IA 3RZGA 1FV2A 3BTYA 1UIKA 4LHKA 3O0XA 1JH5A 4XTMA 4ATEA 1EUTA 3HBKA 1CJPA 3ENRA 4O9GA 3V65A 2OKXA 4C8DA 4WZFA 5FP9A 1YJKA 1WWYA 1F35A 1XSQA 5FZ9A 5IJRA 2RHPA 4XAEA 2F17A 3OGJA 1ZA4A 4AEJA 2HWB3 3WCSA 1VMHA 1G8WA 3LAGA 3C7HA 2RR12 4BISA 5FY1A 1CZTA 1YQCA 1XNTA 5G04L 2VAUA 4AEKA 3V0BB 2E7QA 2WWJA 3O0WA 2QQJA 3MGUA 4MGSA 5F5QA 2A3YA 5FY9A 4CCJA 1IG3A 3AVSA 4D94A 3ETQA 2K2SA 4DEQA 5BNPA 2QQKA 1RL3A 1OOPA 1PK6B 1QJU2 1YFUA 2D97A 4PIYA 4XJAA 3SEPA 5FZ6A 3MIDA 3LIGA 5IVBA 3ACFA 4Q0PA 1F15A 4UF0A 3ZKUA 2VH9A 1OXCA 3KCYA 5ANNA 2AACA 3OBTA 4DQAA 4IEYA 4MV2A 4CCKA 1VMFA 3ITQA 3BU7A 3H42B 4QB2A 4LMFA 4YGBA 2AZ5A 3KV4A 3POGA 3LCPA 4GQ7A 2XVGA 4QX3A 4QX8A 5BNNA 3H50A 2H6BA 3B7MA 2HLEA 3IT8A 4XABA 3POEA 1K5JA 1G6NA 1Q8VA 3VBSB 1JOJA 5F2SA 5A3NA 4BQXA 3VBRC 3CL1A 3KVAA 4I30A 4RA0A 5KWRA 2ET1A 1G9DA 2DTYA 3FLPA 3VBOB 1GWKA 2WNEA 4PHZA 4P9WA 5E8AA 3WY6A 4FFFA 3OCPA 4HONA 1WCKA 3CDZB 1QJU1 2YROA 3OB8A 4GALA 1CD3G 1LEDA 1A78A 1LTEA 2YPDA 3VZLA 1EPWA 2HWC2 2W5FA 3PUQA 4CUGA 2ZEZA 3ZFGB 5LA9A 4BQ3A 4RGGA 5KXBA 1QJY3 1QIQA 4QXHA 3D0JA 3GJBA 3AJYA 2HWD3 1LJ7A 4IE5A 4BXSV 4GJYA 5I0UA 5DUWA 2W46A 3SCGA 4BK4A 1W9YA 3SNMA 1VAVA 3WXPA 2Z79A 3AJZA 1Z7S2 1V6LA 2JDZA 4HXCA 4Y24A 3WQ7A 2VMEA 1FYUA 1QXPA 4XUTA 4AGRA 5CB7A 4IE6A 5C70A 2Y0IA 2WDBA 3MLLA 2Z4FA 3A4UA 5A6ZA 5F32A 1HV1A 1Y3TA 4QHZA 3WUCA 3NV3A 1XNDA 3FUOA 4KG8A 3USSA 4AFMA 2XB6C 1PGL2 5FZLA 3TBDA 1GOGA 1GWMA 1VBA1 4IEQA 4KH9A 4LIUA 3QOPA 1G9CA 4ZZ5A 4HN0A 2VVDA 5F3EA 2HWC1 1NCQA 2ORZA 3NSTA 1RUI3 3WHUA 2FZ1A 2QFEA 4ATFA 1N1TA 2QQPA 5KBFA 3L2YA 3PNAA 5FKCA 4N53A 1PNFA 3Q8CA 3LGRA 3VD5A 1D0GA 1LGCA 3HVDA 1TQ5A 3ZFEA 3AKPA 2AGSA 2W47A 2WZ8A 4LHNA 1ND2C 4UW6A 4K9SA 3NJZA 1PVC3 1JU4A 5IVFA 2JIJA 1Z7S1 3ZR6A 1K5MC 4J1XA 2FDJA 2G9GA 4AQSA 1STMA 4AAXA 3JQWA 5DUXA 5EXOA 1J83A 2EXIA 3B69A 5T3NA 4XE9A 1FV3A 4RS5A 5BNOB 4DUVA 4XF9A 4FPJA 5A1FA 5CG9A 2JDUA 2ZGSA 1W0NA 4FOQA 4LBJA 2A75A 4CCOA 5C8CB 4YG6A 1PGL1 2XDVA 4OMDA 3UJOA 1N1YA 5CFCB 2CAUA 1L7LA 2WZR2 2XQRA 3TNQA 2ZOEB 5A3PA 3V0AB 5FAXA 2WYFA 3WW4A 1F9KA 1W2NA 4QDQA 4QGLA 1HRI3 4E2GA 3S0MA 1P8JA 3OYWA 2WSVA 4AHYA 1PIV2 4P00B 5C9AA 4RGAA 2Y0OA 3IPVB 4PDWB 1J3RA 2P17A 1IPSA 1PX4A 1WUVA 3A21A 3IIAA 4LBMA 3WNXA 4EZHA 4QT6A 3THTA 4D6QA 5JUVA 4LE3A 3RZZA 4FO9A 2X29A 2PQSA 1FMD2 4Q4V1 1UU6A 1HB1A 5GKAC 3ST7A 4BYYA 1LHVA 3JD72 3T4VA 1XXNA 4Q4W3 3OEAA 1SLBA 5JMOA 4IEXA 4FXGB 1BXHA 2RS11 3DXUA 1XRUA 1UOJA 2R1BA 5BUVA 5IK4A 5EV7A 4OHXA 1JHNA 4NIDA 3VUOA 3ZIXA 4IXLA 5GALA 3LA2A 4GWIA 4DNYA 3N9LA 5EPAA 4WVZA 2IXHA 5T50A 3USUB 4EN6B 1AR92 1BEV3 1OF3A 1AXZA 5H9PA 4AGVA 1I5PA 1PO12 2WZR1 5FZGA 3RYPA 2DCJA 1RINA 1WCDJ 1UN1A 5T5OA 3FHQA 1PGSA 3J7HA 1VRBA 3R05A 2C9AA 4S2FA 3WW1A 2G1MA 2ZEXA 1F31A 1PIV1 1VB4A 5D2AA 3NJYA 5FZDA 2NQYA 4ET7A 4F83A 1NE4A 2YV8A 2W52A 1SBEA 4XJUA 2TUNA 1FMD1 1PX3A 1OLMA 5FBZA 2GP3A 2WO7A 1W6QB 2ZKLA 3JD71 1G7YA 2ZCWA 3I97A 4XQWA 1NCRC 1WCUA 2JDHA 4Q0SA 1REDA 5DZEA 3K46A 2GNMA 5JOXA 2Y6JA 1W3XA 3WDWA 5K0UB 3O1MA 4P9XA 4AW7A 5F2WA 4CDQC 3POJA 5I93A 3VDBA 3RI9A 2D7FA 1NXMA 4HLTA 1DIWA 2VW1A 3BPZA 1QH7A 2Y34A 1VBB1 2GH8A 5FZ3A 5FYYA 4XURA 3WP4A 1LAJA 3VBRA 5HI0A 4W8JA 5C3SA 1AR91 3PUSA 1V9U2 1I5ZA 3FLTA 2DCTA 4M3CA 4AOCA 1POV1 3N7KA 2GC1A 2Q0AA 3VDAA 3M8LA 4IERA 3TB0A 4MGIE 5FZHA 1YWKA 3VBUC 1GU3A 1XE0A 3R0RA 2JG9C 1ZBA2 2A70A 2RR13 3C7OA 4Y33A 1LHOA 2HYKA 1VE0A 2ZGPA 4P9LA 3GCXA 2XXZA 2YGLA 4K1ZA 5KHJA 2BQPA 3GHNA 5FXVA 4OVEA 5FPXA 1TZOA 1SBDA 3ZSMA 5ISLA 4K20A 2PAKA 1S0JA 1R64A 3MF9A 1DP0A 4HKLA 1QJU3 4S2GA 2ZMNA 3ZXAC 5LY2A 3HQUA 4R8HA 4W6WA 2D6LX 2VG9A 1J1TA 2ERFA 2ZGLA 2D6KA 4XUNA 3QD6A 4CP1A 3MW3A 3GXUA 5IATA 1YYNA 3QCWA 3S30A 3EQEA 3IKWA 2FD8A 1MVQA 1V9U1 2W87A 3O1PA 4Y4YA 3VKOA 3Q9OA 2C0ZA 1GP6A 1KEXA 3H8UA 2AREA 3KF5A 3PU8A 4J25A 4PIZA 4Q8LA 4LULA 4OYUA 4TYSA 5K4LA 4B7EA 3AYDA 5KHGA 4FPCA 2ZX4A 5FYTA 1CX4A 1JBCA 4QPGB 4R4ZA 2GMPA 4P9GA 2EIGA 4FCAA 1MQTC 4E2SA 4YPJA 2E53A 3WX5A 1Z0HA 4OHWA 1V6KA 4IV1B 2EIDA 3HT2A 4KGGA 3D82A 5A6XA 4CVUA 2ZHMA 3VN4A 4OHVA 3ABZA 4QX1A 1ND2A 2DBNA 3IDBB 3NAPB 5FIXA 3VHOA 4EN9B 3SEEA 1Y43B 5EJZB 1LEMA 5FY5A 4BH9A 1K5MA 4LE4A 2QNKA 2XONA 1HQLA 2EXHA 1ALYA 2HWC3 5AC91 3VBHC 2HH9A 3I54A 1LGBA 3APBA 1W6PB 1ZM1A 3UK9A 3ZFFC 4ASMB 2ZJCA 2QQMA 1H6XA 3RS6A 1ULGA 2E33A 2QQVA 2XHKA 4DFSA 3ASIA 3QLQA 4UAPA 4WM8B 2RV9A 2AEZA 3B93A 3LDRA 2JX9A 5FYBA 2PHWA 3S5AA 1Z7S3 1R092 1GUIA 2W9XA 3VB9A 1UY0A 3PJQA 2ZX2A 3C7GA 1LB2A 3GZAA 4UBHA 1W03A 4OFGA 3ELNA 2CDOA 3KT4A 5FYCA 4AVCA 1NX9A 4EQVA 1ZRIA 3ZYGA 3VL9A 3PUIA 4UW4A 4LITA 3OUIA 3KT1A 4MHRA 1RB8G 1W8UA 1AF9A 4LKSA 1NE6A 4UWDA 3SKJE 2UY8A 4AI9A 1B35B 3K75B 3QH7A 1UZYA 3KLSA 3HNMA 5CU1A 5GZFA 5C5TA 2R042 2QQOA 2VQUA 4CTEA 5A7WB 1LOBA 4D7YA 1X9PA 3H7JA 4P9YA 1U5YA 1CAVB 3IDEA 4LO8A 3FBMA 3POFA 4NRMA 1HX6A 3UETA 2D43A 1O59A 3LPGA 1PK6C 1QJEA 1C8M1 3KGLA 4MHUA 3OBAA 1WW4A 2XH6A 1PM4A 4FPEA 1BBT1 2GN3A 3AKQA 3NQHA 2IVJA 3AMMA 3GM8A 3NKTA 3BTXA 1R091 4KL1A 1D2QA 3BTAA 4HZFA 1I9RA 4IV3B 4QX0A 4FP2A 4LKDA 2WBKA 1QNWA 3IWZA 3RYKA 1CGPA 1ODNA 4N8MA 4I09A 2VXJA 2VR4A 4Z92B 2VCCA 3KQRA 5IVJA 1GQHA 3ZLIA 3K51A 3V64A 5L7OB 1F5JA 4CCCA 1VAMA 4P9JA 4DXZA 1G9FA 1IKPA 3HNBM 3VBSC 3Q8BA 1DHKB 1HXS2 2WZR3 4TLFA 1T6GC 1MS5A 3AL6A 5DUVA 2VUJA 3SMHA 4L99A 3SQOA 5LY1A 3VBOC 3WP3A 3T0AA 3RZHA 2B4KA 1GP4A 4I0WB 4XF0A 4YM1A 1PIV3 3SC7X 5FTTC 2EAKA 3WQBA 5F7UA 2UYAA 4LR4A 4LKEA 3LIHA 3LEGA 1WW7A 2W1SA 4XTPA 2YYOA 2Y6HA 1RUG1 1BK1A 1V6JA 1QGLA 2FDHA 1FMD3 1KRIA 1MS8A 2VULA 1V0AA 3JD73 1DG6A 3H7YA 2V4AA 5EWSA 3GZTB 4DINB 1RUF2 3HD8B 4K1YA 3VV1A 5FP4A 5FBJA 4CU8A 5A7PA 2JE8A 4TXWA 5EYYA 1JYXA 1ZX5A 4CEYC 2ZS6B 1WMEA 1NQDA 1LHWA 2GDFA 4MADA 1GR3A 3N9MA 3VBUA 3TEWA 2A3XA 2R32A 4K8FA 5LASA 2JG9A 2VTXJ 4QQLA 3T2QA 2NM1A 3MPPG 4H7LA 5DQ0A 4F8AA 4N43C 2QUOA 4ASKA 1BMV2 3IAQA 5I8SA 1LOCA 1AR93 4Y3OA 2VZ1A 3AZWA 1LOAA 1PO13 4LBQB 1POV3 1ONAA 3BKZA 1HB3A 3LEIA 1UQXA 4HKOA 1WW6A 1MZ6A 4RYDA 5FY4A 3C7FA 3MI8A 3B02A 4A41A 1PZ7A 1CAWA 2DTWA 3FFZA 5IFPA 3VD9A 1RMU2 2GH2A 5K7PA 4O61A 1QJX2 1C1LA 2RS51 4EWEA 1W90A 1DYPA 1RUF1 2JIGA 5FPZA 3SKVA 4OQ8A 5FZOA 4BCUA 4HK9A 3SH3A 3FZ3A 1H4GA 4NUBA 4NPLA 3DECA 4BOWA 1UKRA 3M3EA 3O0VA 3ZYRA 2VGDA 3I2JA 1MQTA 1BMV1 3T2TA 3N7JA 3SCFA 2TNFA 4MG2A 3P5BA 2FCVA 2D6PA 2Q5TA 4URTA 3WHTA 1H2MA 1V9U3 3WVJA 4XZPA 4I3GA 5FZEA 3ZSEA 5C4WB 4CDWA 4PF1A 2ZZJA 2D5HA 3P1IA 5DABA 4K7JA 1JMUB 1ZZ9A 3U75A 2VMHA 1MVEA 1XJAA 3BOPA 1ZBA3 3DKQA 2P3YA 4Q0QA 3VBHA 4LLFA 2KA3A 3ZFFA 2WNUB 1G86A 3ACIA 1VBD2 4OI2A 4MXWB 4N9HA 2VNRA 3LOBA 3I2OA 2D6MA 3KV6A 3GF6A 4WVVA 3WZ1A 2ZACA 2OS2A 3AZXA 4XZUG 4NN0A 4PDWC 1F5FA 1NAEA 1OD5A 4HSLA 4XCBA 3T08A 1W39A 2D6NA 1RXFA 2NN8A 4D3WA 2FCTA 1JZ5A 3CBNA 2HWD2 3J26N 1LHNA 1HDKA 4I2OA 2VO5A 3KGZA 2QTWB 3HN1A 4DPNA 3CIHA 1H6YA 1OOPC 4NIIA 4JKKA 1JYTA 4YVWB 5GM0A 3RVHA 1OI6A 1ULOA 4RHV2 4B4RA 2VZVA 2VM9A 3JQXA 4NIAA 4IESA 4E2QA 3ZYJB 5JLVA 2Y6FA 3U4SA 3WLUA 4BLIA 4COVA 1X7NA 4ZKTB 3OBZA 4BMBA 1ULCA 3OSDA 2DYCA 2VMDA 3V0BA 2W1UA 3NMBA 1SLLA 2KR2A 3OPZA 3SITA 3UT0A 1VBD1 4DXRA 4H7MA 4YSFA 5JOYA 5AVPA 1ULDA 4G4FA 2PXJA 5K8SA 3LA7A 5LEKA 1PK6A 2BNOA 3FMGA 4IEZA 5BNNC 2WAOA 3LZZA 2ARBA 5FK8A 4UBGA 1RUH2 1OUXA 3FBYA 5JPNB 4QPIB 1QHDA 2OQ7A 1JODA 2OW4A 2HWF2 4IE4A 2VE1A 1DQ1A 2O0OA 5FDBA 1PZ9A 3I7DA 2R0HA 3NRUA 1HN1A 3M3CA 4XHXA 2XVLA 2RMU1 1HJGA 3WF0A 4IGQA 5F8PA 5T5PA 5K0UC 5LA0A 4B29A 1APNA 1KJRA 1MZFA 1JYCA 4RHV1 4C0HA 3SHRA 5C3QA 1ZNPA 3VBSA 1R093 2OT7A 3DYPA 4LT5A 4KI5M 1J3PA 3DPRB 5J1XA 4JDNA 3VBOA 2J1AA 3IBMA 4EWAA 3RZMA 3ACLA 3ACHA 4GKYA 5DDJ2 1W9SA 5IK7A 1QMJA 5F9TA 1DGLA 3SXWA 3RSJA 3C7EA 5FO9B 4UYBA 2ORXA 2VECA 4KGQA 3WW3A 3ZFGA 3WOGA 5FZFA 3W20A 2R043 2HWF1 1VB2A 5E6HA 2PHXA 5A32B 3VZOA 1YFYA 3E5QA 4TLGA 3FN9A 4YG3A 4CEYA 5FPUA 3J8F2 2PHFA 4C1XA 4XDPA 5M0TA 4QX2A 2XJTA 4FPHA 1WA4A 3NO8A 4M01A 4PJYA 4ZU4A 4NHLA 2DUQA 1X8EA 4NRQA 3D3AA 2D3PA 4QB6A 1OLQA 3JUUA 4AK3A 3I49A 5LW9A 1ZRRA 4MX3A 4AVAA 4A6SA 1REFA 4C91A 1ENQA 2IWGB 4N53C 5F5AA 4ZU5A 3VD3A 2E51A 1KJLA 4AAPA 1V70A 5J48A 4PLOA 3N9QA 3MHZA 3ZXEA 3W5NA 2AUYA 2DFCA 1XU1A 5I0SA 4NIHA 5DDJ1 2VOWA 3D4KA 1OH3A 2GMMA 1VRH1 5T5LA 4UW3A 1WLCA 4H3WA 2EVXA 2W1WA 4XILA 5HV0A 2B42B 4NHKA 2YXSA 5D1IA 1FT9A 1HXS3 3D6EA 5GZCA 5JIUA 4UFKA 5FQ0B 5KHHA 4IV1C 3JU9A 4KNCA 2YBSA 4HMZA 3UNPA 1Q8PA 1SPPB 2WJSA 3J8F1 4D8MA 1MZ5A 2YFUA 3NAPC 4KU8A 3LDKA 3AZZA 4QGNA 1Y9MA 4XF1A 4QXBA 2EXJA 3KV5A 2CTVA 5CNAA 4CDUB 4P02B 4DOUA 4QKDA 1PMJX 4FFGA 5IW0A 3UESA 5LB6A 1RUF3 5BNOA 1RUOA 2RJKA 4L11A 2F4PA 3I2FA 3WNMA 4UW5A 2VCAA 1O5LA 2BWAA 4WM8C 2VUDA 5C8CA 4XXPA 3ZSJA 4Y22B 5CFCA 1PMHX 1DLCA 1YQ8A 1Q8OA 3IMMA 3N7MA 3AKRA 2PHRA 4Y4RA 4CYDA 2R7EB 4S2HA 3RWNA 3T30A 3V0AA 3DGTA 4LJHA 3RFRA 3UL2A 2E63A 2WO1A 4YGDA 5FJKA 2ARAA 5CKQA 3K77A 3GZEA 1OSGA 3IPVA 4PDWA 3GZUC 3VZJA 1YXWA 2GNBA 5I8TA 2CWMA 4CDXB 5C33A 2FMDA 3VD7A 1B35C 1RMU3 4QB1A 3LDBA 2YMZA 3AVRA 4U36A 1C5HA 1QJX3 1R082 4CU6A 3AKTA 5FYIA 1F4AA 2JDNA 1AUYA 3AP4A 3H1YA 4MGKE 1D4M2 2R061 2A1XA 1Q3EA 3GDBA 1OA2A 3VDCA 1GWLA 2A6XA 2WLQA 3HBZA 3WDUA 1AHSA 1V6NA 2PHLA 4XJ8A 3ZKYA 5IT6A 1OFSA 2DDUA 1IGOA 3K48A 1AX2A 4ZU7A 1RUE2 3G7DA 2LRPA 1KD7A 2VZ3A 2YBKA 4LA2A 3USUA 5F3GA 3C8XA 2WFPA 4YW3A 5LBBA 4CU9A 1GP5A 4OI0A 2R072 4Q1PA 1DZRA 4W6YA 2E7TA 4GWMA 4QKBA 5HXMA 5BXXA 1PM7A 2JG8B 2NPIA 4BQ4A 3WD5A 2CY6A 1JYNA 2RE9A 3RRDA 3IDAA 1O3SA 3WCRA 1RHI1 5JVVA 5L19A 4QQHA 1XNAA 1MS4A 2F4LA 1AYN2 4CEWB 1CR7A 3POSA 1H2NA 2ZEYA 4HOOA 5J96B 5KHIA 1W6QA 1ODMA 2Y60A 1JYVA 1VBD3 1R081 1UOGA 3U4XA 2O8OA 5FMOS 2E32A 1WMFA 4HKWA 1VBA2 2VOKA 2H6CA 1D4M1 5K0UA 3D8CA 5B4XA 3J9SA 3J7LA 3MFCA 4PI2A 4FPYA 4BLJA 4QDSA 1U0AA 5C5UA 3MF6A 3IMNA 4OMCA 1YUDA 1RUE1 2YB7A 3MIHA 3ZXKA 2K46A 3AP7A 1GV9A 1ZZ7A 1NKGA 2QQLA 2R071 3KVBA 3MFAA 3MW4A 5HCFA 3POIA 1F4HA 5CKMA 2CYFA 4YW7A 3O1OA 1SLAA 1CX1A 4M0HA 4RHV3 1GSLA 2W68A 2XLAA 2W92A 4HPKB 2CDPA 5FYUA 5HCHA 2ZZQA 3ILFA 1UNBA 1DQ4A 4FTSA 1AYN1 1HW5A 3W59A 5APAA 1GNYA 3H3UA 4CP9B 3NV2A 5SV5A 4CUAA 3VZNA 1C28A 4NAOA 5LATA 1YQ6A 4INDA 1HJFA 1RTVA 2O1QA 2ZXQA 2C5DA 3ZN6B 4BIOA 5JZGB 1RUH3 5FZKA 2VZUA 3A23A 4HFSA 3IN9A 3H3ZA 4NR1A 3LD8A 2B46X 2HWF3 3NJXA 3DF0A 4MO3M 2VW2A 1UPSA 4XBNA 5A7SA 1UO9A 1W8TA 1POQA 2YC4A 4DEVA 5EIYB 1VALA 2AH2A 4PCRA 4Q4V2 3UGFA 5FXZA 2WQ4A 3OGGA 4UFMA 4E4HA 5A1AA 1EAH1 2LS6A 1SCSA 2JECA 2VW0A 3PJYA 5GLTA 5JWPA 4AVBA 2WA4A 4JDOA 4QPGA 1PO22 1XB9A 3KB5A 4RFT0 3T2PA 4K8RB 2RS12 4GA9A 3FHIB 4RR3B 5LK5A 4META 4RSUA 3NKGA 4IV1A 1WZXA 4Q27A 1PGW2 2YGMA 4NHMA 3M2MA 4XDQA 1W6MB 5CZKA 2GC2A 2BGPA 1VMJA 2HBTA 4FXKB 4OUMA 3OF1A 3H9AA 5DDJ3 2ZHLA 3NAPA 3NNMA 1ULFA 2NYYA 3BODA 1OUSA 4NIGA 3KMHA 1PZ8A 1VRH3 3MO4A 5JXGA 1ND3B 3U0ZA 2WT1A 2BDRA 1CJDA 1GQPA 3A7QA 5I0DA 4DIQA 3HT1A 3JCIA 3O12A 4D7SA 1N1VA 1W6PA 1H9WA 1X33A 2GP5A 2XJSA 5CAZA 5A80A 4SLIA 4IETA 4KG0A 1VBE2 2BGCA 4RGKA 3I2HA 1HQWA 4E8CA 4AFBA 1G9AA 4BQ2A 2AC1A 2H0VA 3J8F3 4XCAA 3HEIA 4WM8A 4OI4A 1VIWB 4D6RA 3HQRA 2O14A 4NJ4A 2QQIA 4QQPA 5A6YA 3O1UA 2RG4A 1YC61 2OUJA 2P3JA 3AMHA 3NJVA 5J3UA 2DUPA 2VJXA 1SQ4A 1DYKA 3ALQA 4WVMB 5FWEA 1RC6A 1PO21 2XKPA 1UMIA 2I45A 4UFJA 5FLIA 5JAXA 2NMNA 3I3BA 1CAXB 2PMWB 4BJ0A 2HWE2 1BKZA 3KSCA 3LKJA 4DRVA 1PGW1 4YVWC 1SG3A 3S7EA 1MR5A 1VBB2 1W8WA 4FPOB 2P37A 2ET7A 1OLME 4QU2A 1QKQA 1B35A 2G19A 2QQNA 1ZRFA 5FREA 4Z2AA 4JGZB 2PAEA 4HANA 3FL7A 1Q8SA 5A7WA 4CXXA 1CAVA 5LBEA 1S0BA 5C71A 2XQXA 1VBE1 4H2AA 1YJLA 3NWKA 2WFF2 5IUQA 3U78A 3ZX7A 2ZGOA 5BNQA 1NY72 4QPYA 3DL3A 4KWKA 1OVSA 4YW6A 1ULPA 2F6BA 3OOXA 5AVAA 3I2IA 2VOXA 4EJRA 3PMEA 4BQ1A 1UAIA 2I74A 2IFRA 4I0AA 4IV3A 1A6CA 1OPMA 3EJKA 4GWNA 1J84A 5C6CA 2Z2SB 1SMVA 1BK0A 1YLLA 1IS5A 4A42A 2HWE1 5FZ4A 1S0EA 2VL4A 4GIQA 4Z2WA 5L7OA 2XMLA 4YFZA 1JZ7A 2Q1MA 3TEXA 1CZSA 1L3JA 2DU0A 3UGGA 4LO7A 5FPVA 1OQ1A 3RJ2X 3S5QA 2YFZA 2WNVB 3P3PA 1OHFA 1XE8A 4KWJA 2PHTA 2RDRA 3ACGA 4GZ9A 3U1XA 1V6OA 5BV6A 3ZYIB 1W05A 3OPWA 2WFF1 1COV2 2WT0A 3INAA 3OEBA 4YLZA 1NY71 1QWRA 4E4SA 5BPXA 3ZOIA 4Q4X2 5FRAA 2V4VA 2CHHA 3DV8A 2CGPA 2W0XA 5FYVA 5GZEA 2UWCA 4BXFA 4CCDA 4AFAA 2WIIB 4BIFA 1R083 4BMEA 4K21A 5LWBA 1T2XA 1RUD2 4JX0A 4LPLA 4RQPB 5A3LA 4CCNA 1D4M3 1RUC2 4JCKA 1UU5A 3E6CC 2WINB 4AFDA 1W6NB 3TN92 1UF2C 5AC92 5ABJB 3PVEA 2B7YA 5LBCA 4GULA 4YM2A 3N4MA 2PHDA 3B9CA 4NWWA 1RUE3 4BDVB 5CYYA 2BU9A 5HPOA 1XSRA 1HQNA 4Q4Y2 2R073 1S0FA 4LBQA 1CPMA 1IZ3A 2QDNA 4XYXA 4YW1A 1H1IA 1LECA 1LESA 1UXXX 2V5YA 4J6GA 2OZJA 4LKFA 3CJXA 4JDMA 3ZXLA 1WBFA 2AR6A 5D8AB 4A44A 2VMGA 4W4ZA 5FYMA 1COV1 3GHMA 1AR71 2DVGA 2WWSA 1AYN3 2WKKA 1KFUL 4Q4X1 3GGLA 4GMP0 1URXA 3AYEA 4ZXEA 1A3KA 4XFBA 4QD2A 3AM2A 1QJZA 1RUD1 2KXLA 4CDWC 2Q1ZB 1VBA3 3N9NA 5LA2A 1RUC1 1BZWA 2ARXA 3N9PA 1KFXL 1QQP1 3TN91 3MV11 2DUOA 2A71A 5C3OA 3A0KA 4LTAA 5I0RA 5C3PA 4CXWA 3B9IA 2PHUA 4JHTA 3VDDB 3N9OA 4LXLA 2JDYA 2WN2A 4BB3A 3CJIB 1D2SA 4JRAA 1Z78A 1JN2P 2UY9A 1WW5A 1C8M2 3CO2A 4Q4Y1 5DG2A 4OCTA 5C4WA 2ZTNA 1LKNA 4LORA 4RL7A 4XOGA 4CU7A 2OA2A 2FDIA 1BBT2 4UXAA 4WZCA 3H8XA 2G9ZA 2VTXA 1LHUA 4LOSA 4CRQA 4MGZE 4NHXA 1HV0A 3WF4A 5FZ7A 4NHYA 4URAA 4FOVA 5I8YA 5J98B 1W9FA 1OT5A 2WNUA 1W8HA 3A22A 4M3CF 5GZDA 4MXWA 4B8EA 3DEMA 1AYM1 1LODA 5HCAA 1W28A 3NVCA 1DQ0A 2D44A 1SBFA 2QCSB 2ZX3A 3LQCA 4NAMA 2I07B 4CDXC 3AL5A 3K4AA 4NWVA 4LBLA 3O1VA 2VMCA 4A3XA 2J1TA 5FLJA 4LHLA 4N90A 2VBPA 1H0BA 3HMYA 3I59B 4CCMA 1JUIA 2R6QA 5IVVA 3PTYA 3T0DA 1JXNA 3I8TA 2GSYA 3UKVA 2A6WA 3OGRA 2GU9A 3LWCA 4A4AA 3JBG2 1H2LA 3S7IA 1RUG2 4EZ4A 4YVWA 1KITA 4KMQA 4R4XA 1CIWA 4Q4V3 1S2KA 3MZHA 3K4DA 5FPBA 1W0PA 1E5HA 2HJIA 4FTBA 2DCKA 1IG0A 4CPBA 2XHNA 1RXGA 2JD9A 3BYWA 1Q56A 1PO23 1GYKA 2XL7A 2RS13 3UYJA 5FMDA 5JXIA 5JSOA 3MLJA 4BU2A 4W50A 2J1RA 3OG2A 3ROUA 3KF3A 4COUA 3FJSA 2L9LA 4OUEA 2VZOA 3FFQA 3OJBA 4V2VA 1ZYBA 3FWEA 3AZYA 3PDQA 4QPIA 1YNAA 2W1QA 3F95A 5HCBA 4CEWC 3RG0A 5FP7A 5FO7B 2UURA 2XJRA 1GNZA 2JICA 1CQ9A 4AQTA 4E8DA 2RVAA 1LCLA 1Q43A 4JTNA 4B4PA 4YM3A 2XJQA 1VBE3 2YC0A 1RUNA 2W39A 1ZREA 1IPJA 3JBG1 4CE8A 4GH4B 4HBNA 4OHZA 1OVPA 3I3DA 5FP3A 2WR9A 4CA9A 5JXHA 5EZWA 3VD4A 2RS52 2RM22 2X53S 3ZFGC 1EYBA 3TAYA 4YM0A 1REEA 4ZZ8A 1ASJ2 1CPNA 2J7MA 2VNOA 3DPRA 4LO5B 4QXKA 2VOVA 1MEC1 1XNCA 2PTMA 4IEPA 5DZFA 1GQGA 2B5HA 2HWE3 3I3QA 1QOOA 3JXSA 3MEPA 3ON7A 3MICA 5DPNA 3BGAA 5FYSA 4L92A 4ZPIA 1VBB3 4AVTA 5GZGA 3NNGA 1AL0G 3OD4A 2QVSB 1C4RA 1UMZA 4Q0VA 2RJ2A 5IAVA 3RNSA 5FFOC 2GC0A 5JI9A 3CZUA 2ES3A 4R9BA 5A32A 3LFMA 4MZUA 2Z5WA 3VHRA 4XBLA 1YHFA 3WG2A 2BZDA 2WFF3 4MSVA 5FY0A 4M4PA 4XIOA 1RJ7A 5FZ1A 3VHPA 1O5UA 2RM21 1UZVA 2RJLA 4QAWA 3OUJA 4QQ2A 4Q1RA 2WO3A 5F6KA 5FZMA 3AYCA 4WM7B 1B09A 3ZXDA 1XYPA 1ASJ1 3PIJA 4DY3A 4BQWA 4EN8B 2A6YA 4Y20B 4LUKA 3BB6A 5ANQA 5F37A 1YQ5A 1AVBA 4NPRA 4XEZA 3PTRB 2ZBJA 2VZTA 2ZGTA 3ES1A 4Y1UA 5CG8A 4SBVA 1NA1B 5A70A 2BFUS 1DYOA 4P5HA 4B4QA 4Y5SA 1G9BA 1W9WA 2E31A 1LU1A 1UY1A 2PYTA 3SH5A 1NLQA 4BQ5A 4PBPA 5FV3A 5BNOC 2DCYA 2XUMA 3OBRA 4PQQA 4Y1VA 2D6OX 5FQ0A 3I2GA 4AI3A 4FAGA 2J1SA 3AXEA 5FOJB 3UJQA 3PVNA 5C8CC 1SPPA 1CIYA 5T5JA 3VKMA 5JXJA 1Y9QA 2BRTA 1UXZA 1COV3 1UWWA 4HVOA 3WQ0A 5CFCC 1AR62 2DURA 3B5LB 5DG1A 1AR73 4QQOA 3LF7A 4Q4X3 2XOMA 2XWJB 2V73A 2ZX1A 3ZIWA 4CDUA 5J09A 4M0NA 4OULA 4YW2A 3PL0A 2WO2A 1RUD3 2VQTA 3ETPA 3BOWA 4MXVA 5FZAA 3VBFB 1RUC3 1ENXA 1ST8A 5L73A 2QJVA 1DZTA 1N47A 3B00A 3FE5A 4LNVA 4BE3A 3TN93 1HB4A 5AC93 2XWBB 2FDKA 3KHBA 1DQ5A 2WUHA 5J7MA 4Y22A 1WLTA 1W04A 1NYWA 3WW2A 3EO6A 3ZN5A 4QKFA 3TNPB 1UY3A 2FMYA 3LOIA 2RMU2 3ILRA 4I0BA 5E1RA 4DO0A 2XJPA 2Q8OA 4Q4Y3 3BU0A 1ZRDA 4TTGA 1LOFA 4IL7A 4XBQA 1JHJA 4P14A 2FZ2A 1T6BX 1DQ2A 1WGPA 4QXCA 2Y8KA 3FX3A 4QM8A 2G9FA 2PFWA 5DZGA 1UX7A 4EN0A 4CDXA 1YRZA 1AR61 2X05A 1JYIA 4F3JA 4JGZC 2IXKA 3DCQA 2B9UA 3OD0A 1VP6A 2Y38A 3M3QA 1SFNA 4EROA 2E6VA 2P1BA 1AYM3 3P6BA 1FPN2 4KBBA 1HB2A 2A6ZA 5CADA 1O91A 3ZPOA 1EUUA 4OZOA 5IFTA 3ZDVA 2VZRA 4YYOA 5JR2A 2VNVA 2W95A 2XJVA 2YU2A 5JR7B 2BYVE 4CCEA 4AWDA 3QACA 4O65A 4K40A 4D7TA 2PELA 4Q2FA 5FMCA 4AF9A 1N1SA 3MIEA 4W65A 5ACA2 3T4HB 1VLNA 4MLOA 4MVTA 1C8M3 2ENRA 2JG8A 5T52A 2ADEA 1OFNA 5A3UA 3HIFA 2Y26A 1BBT3 3AFGA 1YO8A 1KS5A 3LFIA 4IEVA 3THDA 3VZKA 2HEWF 3ZM8A 1ZRCA 1GMMA 2BNNA 1RVF2 5A3TA 4QX5A 1Y9GA 3JB8A 4CEWA 4KWLA 1NCRB 1LU2A 2IVIB 4E9KA 1CVNA 1BYHA 3OGVA 3U14A 1CONA 2WZPP 1UCXA 1FPN1 2VVEA 3WG1A 1ZZ8A 4CDQB 2SBAA 1VRH2 1SDWA 1ENRA 1FAYA 1JOBA 3GCWA 4FPKA 1GANA 5IWFA 3EB7A 5FR3A 2OYZA 3OY8B 4A45A 1WCSA 4KQ7A 5A3MA 1NZIA 2VMFA 1O4ZA 1W2OA 2HKXA 1WLWA 3GBGA 2J22A 1W2UA 2BOJA 4BM8A 1SHWB 2NLRA 2VCBA 3CLPA 4KBZA 1US2A 3UKNA 5CISA 1O8SA 2DVAA 4K3UA 5ACA1 4RQPC 3GYDA 3H1WA 1BVVA 3GBWA 5EYXA 3JBG3 4QPWA 3AFKA 1RUG3 1UD1A 4JVAA 2EIBA 4XETA 2WRAA 3WNNA 4EYUA 1HLCA 1UYYA 1MS0A 3B3QE 4ONUA 5ABJC 4HPKA 2ZHNA 4AFCA 3IB3A 1RVF1 1UPIA 3POWA 1J3QA 2ZA9A 2WSUA 4UOJA 4XFIA 2J1UA 4A3ZA 3PMSA 4CP9A 3CZJA 1OA3A 4CUCA 1VJ2A 3W9AA 1W8ZA 1TNRA 1VAKA 2YBPA 5IVYA 5CKNA 3ZMNA 2QE3A 3RZLA 4NOTA 1AZDA 1FOD2 2Y33A 2ZGUA 3I3EA 3ZN6A 4ZXKA 4QPGC 5JZGA 4COWA 4JGYB 4KWUA 4YZ3A 4JKMA 4BZ4A 1RIRA 1JZ2A 4YGCA 3AXDA 3H1MA 4X8NA 3T1LA 3ZDSA 2W94A 1K42A 2G4IA 1XQNA 2DVBA 1PVXA 4GMP1 2Q8EA 1X50A 2B9VA 4MYEA 3UGHA 1KS4A 4NPMA 2HEVF 4DXSA 4QU1A 4A2UA 1W0OA 3M4FA 2P6CA 4X6QB 4GKXA 4LBKA 1S0CA 3URFA 4AVSA 2RS53 4LBQD 2RM23 1ZZ6A 2FCUA 2AEYA 3OUHA 3R4SA 2A6VA 5L9RA 1XYOA 3VDDC 5FPLA 2R062 4RR3A 5JSPA 4HL0A 1ASJ3 3OPTA 1K3IA 2X5IB 4FT8A 3ZVXA 4LBOA 2VZPA 5C3RA 1SLIA 1W6MA 2P3KA 3WQ1A 4ISRA 1GZCA 2DVFA 3CQOA 4NMIA 5FO8B 1OLRA 2P6HA 2PQQA 4JHZA 1EP0A 4A7ZA 1C3HA 4I01A 4DB5A 1FOD1 1ND3A 1VR3A 5CFDB 1UIJA 2VVFA 4YARA 3U10A 3LEMA 2AYHA 3HNYM 1OC1A 3JZVA 3Q8AA 3ZYBA 2VMIA 2VQAA 4Q4W1 5JSRA 4E4DX 1XPWA 2V72A 4L9BA 4C90A 2CL2A 2ID4A 5FY7A 1MS1A 1WCQA 2UWBA 1RHI2 1UX6A 4JQTA 4AEMA 5GLZA 1W6OB 2XJUA 3GBFA 4LQRA 2JJ6A 2LROA 4YZ1A 2P5BA 1AJOA 1UL9A 1DQ6A 4JKLA 4JZRA 2D5FA 3OTFA 4XVHA 5LCWL 2XGXA 4FQ4A 1ULEA 4WVMA 1BEV1 1S0IA 4FPFA 4DXTA 2A7AA 2E7AA 1H8TB 2JB4A 3T1MA 4GXLA 5FP8A 1CAXA 1W06A 2QBXA 5FYHA 2VU9A 1TME2 2OIIA 2MEV2 3K3OA 4UT5A 1GZWB 2XKOA 2BTVC 2OPWA 2UWAA 1TNFA 3PUHA 5GJ6A 5A7QA 3W21A 4QM9A 1XYNA 1UMHA 1FNYA 2XLGA 3RJRA 1A8DA 5C8WA 5IYYA 1H4HA 4PLMA 1R1A1 1BJQA 5KC6A 3OGSA 4JGZA 4R9DA 1MACA 4IV3C 3BIEA 3AYAA 1W8OA 4HVQA 1YIPA 4Z82A 1HRV2 3LPFA 3ILNA 2SLIA 5DAQA 4AHZA 4YVSB 1CAUB 3MIFA 1JYWA 5LRSA 3U37A 1BVP1 3WP5A 4YG0A 1TEIA 4ARYA 3LSEA 2ZPXA 5L7OC 4MOAA 5SV8A 2N7GA 5A33B 1AR63 2OZ6A 3F2ZA 4S2DA 4B3NA 1FI2A 1XNBA 2BFUL 2VXRA 1YFXA 3BVCA 3RQ0A 4XFFA 3ECQA 5KXDA 4CPBD 1U5ZA 4XPVA 2FDGA 1TME1 4P9IA 3I2KA 2MEV1 1JTZX 1C8NA 1GICA 3IDCB 4GH4C 1MS3A 1GOFA 2BVBA 2RR11 2C6SA 1U12A 2IUWA 2WWUA 3M70A 4AG4A 1F8VA 4XW3A 1GZTA 1MS9A 4L97A 3ZYPA 5A7NA 2ZAAA 2RMU3 1HRV1 2WNVA 1WBLA 2D3RA 3ZYFA 3NNJA 1EAH2 2JKBA 4AI2A 1JI6A 2OUHA 2ZGKA 4R9CA 3E97A 4FI9A 4XFAA 4AQ6A 1W2TA 4LK6A 3E6DA 1PNGA 1NT0A 1NUKA 2C24A 2YZ4A 4LA3A 1AL22 4NROA 5GLWA 3ZYHA 3VKFC 1XNKA 2EXKA 4XXAA 2X09A 1ZBE2 5FUNA 3WF2A 2QQUA 1CZVA 3O1RA 3WV6A 3BPSA 3O5SA 4RQPA 2WLPA 1FPN3 1W9TA 4CEYB 1SFYA 5T54A 5EHDA 1LENA 1JZ4A 1DFQA 1W6NA 3KV9A 5L9BA 5ABJA 2MHFA 1OBNA 5KR7A 4ZY9A 4N43B 4ISQA
chains in the Genus database with same CATH topology
5C3QA 2CSGA 1HB2A 3ZKYA 4RGKA 1OC1A 1E5SA 1GP5A 3ON7A 1QIQA 1WA6X 1W03A 1W9YA 2WO7A 5C3OA 5C3PA 1W3XA 2JB4A 1ODMA 2Y60A 1W06A 4BB3A 1UOGA 1E5RA 2IVIB 5C3SA 1QJEA 2DBIA 2VCMA 2IVJA 1W2OA 1E5IA 1W28A 1UOBA 3OOXA 1UZWA 1QJFA 1ODNA 1DCSA 1RXFA 1BK0A 1UNBA 4XAEA 5APAA 2JB8A 2VBPA 1UOFA 2BRTA 2VAUA 1BLZA 1HJFA 2VBBA 1W2AX 1GP4A 2Y6FA 1E5HA 1RXGA 1W05A 1GP6A 1UO9A 1W2NA 2VBDA 1W3VA 1HB4A 3ZOIA 3ZKUA 1W04A 1IPSA 2BJSA 2VE1A 1HB1A 2DBNA 1HJGA 5C3RA 1OBNA 2BU9A 1HB3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C3Q A;  2CSG A;  1HB2 A;  3ZKY A;  4RGK A;  1OC1 A;  1E5S A;  1GP5 A;  3ON7 A;  1QIQ A;  1WA6 X;  1W03 A;  1W9Y A;  2WO7 A;  5C3O A;  5C3P A;  1W3X A;  2JB4 A;  1ODM A;  2Y60 A;  1W06 A;  4BB3 A;  1UOG A;  1E5R A;  2IVI B;  5C3S A;  1QJE A;  2DBI A;  2VCM A;  2IVJ A;  1W2O A;  1E5I A;  1W28 A;  1UOB A;  3OOX A;  1UZW A;  1QJF A;  1ODN A;  1DCS A;  1RXF A;  1BK0 A;  1UNB A;  4XAE A;  5APA A;  2JB8 A;  2VBP A;  1UOF A;  2BRT A;  2VAU A;  1BLZ A;  1HJF A;  2VBB A;  1W2A X;  1GP4 A;  2Y6F A;  1E5H A;  1RXG A;  1W05 A;  1GP6 A;  1UO9 A;  1W2N A;  2VBD A;  1W3V A;  1HB4 A;  3ZOI A;  3ZKU A;  1W04 A;  1IPS A;  2BJS A;  2VE1 A;  1HB1 A;  2DBN A;  1HJG A;  5C3R A;  1OBN A;  2BU9 A;  1HB3 A; 
#chains in the Genus database with same CATH topology
 2VUA A;  3EYP A;  3DYO A;  4HN1 A;  4L8Q A;  5LEJ A;  1UU4 A;  1HKD A;  2KM2 A;  3AP6 A;  3KCX A;  4Q5O A;  3M1H A;  4XQ4 A;  3U11 A;  4BQY A;  2GZW A;  5CEH A;  1QOT A;  1BQP A;  2D98 A;  2Y6K A;  1V00 A;  2BNM A;  3EBR A;  4WM7 C;  3RMY A;  4PBO A;  5EJ3 A;  5FZ0 A;  1LNS A;  5ACA 3;  5KXC A;  3MBW A;  5G05 L;  4ARX A;  1TVG A;  5IVE A;  4GJZ A;  1FXZ A;  1HIX A;  1OKO A;  5D8A A;  1QF3 A;  4XUQ A;  1NA1 C;  1O4Y A;  3MUY 1;  1AXK A;  2EIC A;  2ZAH A;  2MNG A;  1WA6 X;  4QHO A;  1RVF 3;  5D21 A;  4HVR A;  1AL2 1;  1WD4 A;  1LRH A;  1Q8Q A;  4YRD A;  3GJA A;  4AED B;  1ZBE 1;  1XE7 A;  2BW8 A;  5FUI A;  5C4W C;  2R49 A;  2J1V A;  1MPX A;  5B2G B;  2RDN A;  3E1F 1;  2VZS A;  4TN7 A;  5JI7 A;  5LRR A;  5JOZ A;  1C5I A;  5FZB A;  3T0B A;  5LA1 A;  1NQJ A;  1QOS A;  4LLO A;  1C1F A;  2DFB A;  4XDO A;  2V09 A;  1IPK A;  4EV0 A;  2WNU C;  1E5R A;  1VBC 2;  2JE9 A;  1RUJ 2;  1DGW X;  3VDD A;  3VHN A;  3ZN4 A;  1XBF A;  4AQ2 A;  3CJI A;  4XIK A;  3ES4 A;  4XC9 A;  1LR5 A;  1K45 A;  4GMP 3;  4V1P A;  3NNF A;  3V56 A;  4O9E A;  3WSO A;  3FLR A;  3WG4 A;  4A7Y A;  3TEY A;  4G9S B;  5I0T A;  3EMR A;  3VBF C;  4RD7 A;  3D0S A;  1OA4 A;  3H8R A;  2B8M A;  4GB3 2;  5IAX A;  1E5I A;  4AZZ A;  3FC0 A;  4CP2 A;  2YY1 A;  2ZHK A;  5DAW A;  3R4U A;  5FCC A;  1M06 G;  2GME A;  5F5I A;  1QDC A;  5F3C A;  1H1M A;  4AXO A;  3IM0 A;  1GKB A;  2X8K A;  3MIG A;  1UZ0 A;  3O7O A;  2RS3 2;  4M4R A;  4AR2 A;  2JKX A;  5FPA A;  5JOW A;  1IOA A;  2KD7 A;  4LEJ A;  1J1L A;  3K3N A;  1FOD 3;  3C3V A;  1BLZ A;  3MLK A;  2YU1 A;  5DN2 A;  3DYM A;  4LIV A;  3ZPY A;  1VBC 1;  5BNP B;  1RUJ 1;  3I59 A;  4PIX A;  1UYX A;  1V6I A;  3AK0 A;  1OOP B;  1WD3 A;  1H1A A;  2Y64 A;  3G6J B;  3UV9 A;  2TEP A;  2P3I A;  2GAL A;  5FXX A;  2ZGM A;  4OI1 A;  1JW6 A;  1L7Q A;  4JTO A;  5CIR A;  2FQP A;  4IQP A;  4UF0 B;  4QPI C;  1XOY A;  3HOB A;  4M3C E;  3RGB A;  2VUC A;  4GB3 1;  4AI8 A;  4CXY A;  2QDR A;  1JS9 A;  4J1W A;  5GLV A;  4R52 A;  3QBQ A;  1MZE A;  5F5C A;  4HT1 T;  1C57 A;  4BA6 A;  2BP6 A;  2R06 3;  4YZ4 A;  5FZI A;  1QH6 A;  2YG0 A;  2Q4S A;  1L7R A;  1GZ9 A;  5BNN B;  2TBV A;  1IQA A;  3R4D B;  1UY4 A;  2RS3 1;  4WV8 A;  2P4E A;  2WS9 2;  2ZMK A;  1DF0 A;  1E57 A;  5KHK A;  5IHR A;  1R1A 3;  3ME2 A;  4IEW A;  4XJ9 A;  3RDI A;  1EV1 2;  1OH4 A;  1M4W A;  3DPR C;  4MGY E;  5EJ1 B;  4IE0 A;  4Z8B A;  3MPB A;  2ZKN A;  3VKL A;  1N3O A;  3B94 A;  4B1L A;  1RHI 3;  4Y1X A;  4PT6 A;  2CSG A;  2WZE A;  1AR7 2;  2DV9 A;  5LBF A;  2BGO A;  2WAA A;  4GH4 A;  1QNY A;  3WT3 A;  5FMB A;  1S2E A;  2IC1 A;  2OXB A;  4FOY A;  4YW4 A;  2E9Q A;  2CU5 A;  1NZC A;  1OUR A;  1PO1 1;  1S0G A;  2JWP A;  4AGG A;  4UFH A;  3RI8 A;  3KS7 A;  2EAA A;  2BPA 2;  1QQP 2;  3BCW A;  1TME 3;  1OQE A;  3BN6 A;  2MEV 3;  1X9T A;  2R30 A;  1JZ3 A;  4U2A A;  3S6P A;  3RZK A;  1DZQ A;  4P5Y A;  2WS9 1;  3J4U H;  2W2I A;  4NRP A;  5F3I A;  3WP6 A;  4LHS A;  2LTN A;  5C7G A;  3MYX A;  1QY4 A;  3MUZ 1;  4TWT A;  3C2U A;  3EXU A;  3SLI A;  1EV1 1;  2CV6 A;  1A8M A;  4FFH A;  4LO6 B;  1HRV 3;  2I2S A;  3AP5 A;  2B45 X;  4IE7 A;  4OZX A;  4XFH A;  4Y1Z A;  3WDT A;  3DN7 A;  4IDZ A;  1ZZC A;  2JEM A;  5DXD A;  3WF1 A;  4AI0 A;  2C4X A;  5JCT A;  4EWD A;  3H8O A;  2FDF A;  4XF3 A;  3JB4 C;  3PVB B;  4ASL A;  4MGQ A;  1LUL A;  1NCQ B;  3ZXG A;  3W5M A;  2CNA A;  2DBI A;  1AYM 2;  3D5O A;  1SLT A;  4JGY C;  2GND A;  3L9J T;  1XU2 A;  3AMQ A;  4N53 B;  4KU7 A;  4P08 A;  3T3Y A;  2X10 A;  1X36 A;  3J7N A;  4WM7 A;  4Q0U A;  2RDS A;  4Y1Y A;  3ZFE B;  5LK7 B;  4N7U A;  4Y20 A;  3WF3 A;  1I1E A;  4AE2 A;  3KHC A;  5E89 A;  1UZW A;  1QJF A;  4FOW A;  1YEW A;  3I3M A;  1GNH A;  1ZA7 A;  4XMA A;  1AR8 2;  1NA1 A;  1IQD C;  4ZHN A;  3PUR A;  3LB9 A;  1QXJ A;  3WNO A;  4HK8 A;  1SCR A;  2QZ2 A;  3SCH A;  1ZBA 1;  4CDU C;  2VC9 A;  3HR9 A;  1S4C A;  1W99 A;  4ORF A;  1DGW A;  4RS5 B;  5FZC A;  5E88 A;  1Y4W A;  1BHG A;  1AX0 A;  1UOF A;  3M3O A;  3FUQ A;  2DVD A;  2X5I C;  2LAL A;  1EAH 3;  2VBB A;  3MDP A;  2PAM A;  1US3 A;  2EA7 A;  5FMO L;  5FY8 A;  4A7K A;  1PHM A;  2A5Z A;  5A3O A;  1PMI A;  3BUC A;  2JXA A;  3O14 A;  4CCL A;  3AP9 A;  5CFD C;  1NLR A;  1AL2 3;  2LW8 A;  1N3Q A;  5FLH A;  3KM5 A;  1ZBE 3;  3OYW B;  1IKQ A;  1LOF C;  3AX4 A;  4PI0 A;  4Q29 A;  1SEF A;  5C9A B;  1AXY A;  1OD3 A;  5FXW A;  2VZQ A;  3GAL A;  4XAA A;  3VBF A;  2XBO 2;  4YFW A;  1CWP A;  1SAC A;  3O1T A;  1AR8 1;  3RMX A;  2YUE A;  4N7I A;  2WN3 A;  5HV4 A;  3R6S A;  1O4T A;  1NLS A;  2NMO A;  5EFU A;  4QHB A;  4XQD A;  4H55 A;  2BEO A;  4FVV A;  2DF7 A;  4Y26 A;  1OPO A;  1H8T C;  2ADD A;  3WUD A;  3AC0 A;  4CP0 A;  2IZW A;  3AMP A;  4HG6 B;  1AX1 A;  3WNL A;  5BY5 A;  4DMI A;  4JAA A;  5DAX A;  3S57 A;  1GOH A;  2VNG A;  4G3Y C;  2YC2 A;  4COZ A;  2DU1 A;  2R16 A;  3M7A A;  1O6U A;  3MIB A;  1MEC 2;  1NG0 A;  2DCZ A;  4F7Z A;  4LOT A;  1GFF 2;  3I2D A;  4XJW A;  5TSW A;  1OF4 A;  3N7L A;  3LE0 A;  4C0B A;  1O8P A;  2JG8 C;  4YVS C;  4ES9 A;  1SLC A;  5AFB A;  1E5S A;  1WKY A;  2ARC A;  2WQZ C;  4H14 A;  2VOT A;  4WBB A;  4V2W A;  1LOG A;  4OLL A;  4DUX A;  2XBO 1;  5FWJ A;  3HQX A;  3N3H A;  4I3P A;  4HET A;  3KQ4 B;  1VBC 3;  1TMF 2;  1RUJ 3;  4JC1 A;  4FPG A;  5LZ6 A;  3AZV A;  3NNL A;  4D6S A;  1SDD B;  3HN3 A;  2JDA A;  1SZB A;  4YGE A;  2ZGN A;  3E6B A;  3T09 A;  2VD7 A;  1O3T A;  3DUI A;  3LEK A;  4UFL A;  2A3W A;  5H9Q A;  5EQU A;  5A3W A;  3VBR B;  2ZML A;  2VY0 A;  1UY2 A;  1D7P M;  2PA7 A;  4FP3 A;  4GB3 3;  4BPZ A;  3N36 A;  4M3C B;  4QX7 A;  5A6Q A;  2P34 A;  2R04 1;  4GAZ A;  1NCR A;  1J58 A;  2OX0 A;  1UKG A;  2E26 A;  1DBN A;  3TOJ A;  1FAT A;  3NV1 A;  1YI7 A;  1IS4 A;  4YWA A;  2J42 A;  5GLU A;  5I91 A;  4CDQ A;  2RS3 3;  3VLB B;  3WDX A;  4Z1V A;  2BBA A;  2IXJ A;  2BER A;  3CU7 A;  3WG3 A;  3OY8 A;  4QWN A;  5JDB A;  1HN0 A;  2C1F A;  2Q1F A;  3QH6 A;  1CES A;  2JE7 A;  5E16 A;  5IK8 A;  2ATF A;  3WNP A;  1DCS A;  2Z69 A;  2Z42 A;  5AFE A;  1X82 A;  1TMF 1;  4IUG A;  4ZON A;  2BVV A;  4XAC A;  3NW4 A;  2WAB A;  4QDR A;  4OQ9 A;  4WVW A;  2GC3 A;  4EN7 B;  3WR0 A;  5L36 A;  2IXI A;  2PLV 2;  5J36 A;  2JB8 A;  4K6B A;  4R9A A;  2FHR A;  4M00 A;  5HXV A;  5JZG C;  5BYN A;  4ZS3 A;  4YZ2 A;  1KDK A;  1ZZB A;  4MUV A;  1KGY A;  2ILM A;  3SIS A;  2ZEW A;  1I3H A;  3H3L A;  2JDP A;  3AMN A;  3EHK A;  2VTF A;  3ORJ A;  5FOB B;  1H8V A;  3CNA A;  3TRS B;  4FTE A;  1NOV A;  1HXS 1;  3HAG A;  5K9Y A;  2HWB 2;  3RYR A;  4OHY A;  1DGR A;  2WYS A;  4UI9 L;  1RGS A;  4I02 A;  2W91 A;  3VL8 A;  1S1A A;  2R0F A;  2WS9 3;  1TG7 A;  2Q30 A;  4E4Z A;  3POY A;  1W8N A;  1FNZ A;  2CGO A;  4IW3 A;  1XC6 A;  2JDK A;  4JGY A;  3M3I A;  3WEZ A;  2VPV A;  1EV1 3;  4RR3 C;  1ENS A;  3RPQ A;  3P3N A;  4AED C;  5A1L A;  3THC A;  4PF5 A;  4XF4 A;  1DDL A;  1ND2 B;  1I6X A;  2HYX A;  2R1D A;  2HBU A;  2GN7 A;  2WL1 A;  3WDY A;  4BK5 A;  4YZ5 A;  4AYU A;  1K5M B;  2PLV 1;  1ND3 C;  2A73 B;  2YPJ A;  5EP9 A;  2YHJ A;  4L2N A;  2B39 A;  3III A;  4LK7 A;  5DAV A;  2Q8C A;  3VZM A;  3K2O A;  5CVR A;  4UFI A;  1D4V B;  4FBF A;  1NXD 1;  4JRL A;  5KXE A;  5IK5 A;  3BIW E;  3PIG A;  2CAV A;  3PVO A;  3H0O A;  5A7O A;  3ZXJ A;  3PUA A;  4C1W A;  1JZ6 A;  2X5I A;  2HWB 1;  2OPK A;  4LUM A;  1QQP 3;  1K12 A;  3KT7 A;  1WMD A;  4MH0 E;  5DUU A;  4LBN A;  4LO4 B;  5B4N A;  2XR4 A;  2XPJ A;  1IS6 A;  4RN5 A;  5CFD A;  1RMU 1;  2K9Z A;  5FYZ A;  3RWK X;  5HBA A;  3MV0 1;  1CN1 A;  1QJX 1;  2BWC A;  2WQ8 A;  3W58 A;  1EY2 A;  2D93 A;  3CHX A;  4BWO A;  3KD4 A;  5F39 A;  3GNE A;  5IVC A;  5JIA A;  4D69 A;  1W6O A;  1F2N A;  1GLH A;  1H9P A;  1VPH A;  1YQ2 A;  3ZSK A;  1JUH A;  1QJY 2;  1Q5O A;  4IGO A;  2BBV A;  2XUE A;  4DRR A;  4IGP A;  1O7F A;  2ZAB A;  2Y6G A;  2WA3 A;  1OKQ A;  4Q8K A;  2CGN A;  3Q8F A;  2GNT A;  4XFC A;  1H8T A;  3VGI A;  3WDV A;  1SFP A;  2YDE A;  3ZR5 A;  5BNP C;  1BCX A;  1X8M A;  2AEN A;  3POB A;  1GZW A;  4A6O A;  1ACC A;  4COY A;  1S2B A;  2W08 A;  2WT2 A;  2O8Q A;  1AR8 3;  1R1Z A;  2LUW A;  3THP A;  3DXT A;  4ITC A;  4DS0 A;  4DZG A;  1O3Q A;  4N9I A;  3CMG A;  1UZZ A;  1YI9 A;  1TE1 B;  3K4Z A;  1JOP A;  1CAU A;  4HSJ A;  1UOB A;  4YVS A;  4JV4 A;  2OVU A;  2VQ0 A;  4AHX A;  5J37 A;  2QQW A;  4B1M A;  4FFI A;  2CWS A;  1YCI A;  3AB0 A;  1RUI 2;  5A33 A;  4JQR A;  1J59 A;  1QJY 1;  1GBG A;  4YNI A;  2HWD 1;  4TZD A;  3ZO0 B;  4ZS2 A;  2J1E A;  2WNV C;  3WIN E;  5F1R A;  4OUS A;  3HWJ A;  2W3J A;  5FKB A;  2ETE A;  4CZS A;  3I4I A;  1D0H A;  1UW8 A;  3HJR A;  4XJZ A;  1V6M A;  3E5X A;  1W2A X;  2XG3 A;  1H30 A;  1PVC 2;  3E5U A;  1DLL A;  1UYP A;  1JZ8 A;  2D40 A;  1QEX A;  3ZSL A;  1KQR A;  4AI1 A;  3TEZ A;  2DWR A;  3PU3 A;  2XBO 3;  1W8F A;  1O3R A;  4XFG A;  4CUB A;  3ZMO A;  3IZO A;  2FBE A;  1POV 0;  4QKN A;  4XUP A;  1S55 A;  4TSV A;  5DAP A;  2JDM A;  2VBD A;  5DMY A;  4IEO A;  1W3V A;  2NP0 A;  2QZ3 A;  4W6X A;  4Y5T A;  2UYB A;  3ATG A;  4IEU A;  4Q26 A;  3KWV A;  3VBU B;  2NZ9 A;  1ZVF A;  4YW5 A;  3BTZ A;  2JG9 B;  2UU8 A;  2BJS A;  3CEW A;  1KDM A;  3FHA A;  3X29 B;  1KXG A;  1RUH 1;  2GAU A;  2IXL A;  3Q8E A;  4CSW A;  1QU0 A;  3TYJ A;  2K0G A;  1RUI 1;  2ZGQ A;  3LA3 A;  1HRI 2;  3DKW A;  1MEC 3;  1QDO A;  2C9K A;  1JU3 A;  2XL9 A;  1WLD A;  2QKD A;  1IHM A;  3NV4 A;  3J7M A;  4MGT A;  2XVK A;  2IXC A;  3N35 A;  5L9V A;  1OQD A;  3ZXF A;  4GWJ A;  1CAW B;  1RYY A;  1DGR N;  5D8A C;  1PVC 1;  4NE9 A;  4XUO A;  5H9R A;  4FPL A;  1QXR A;  5FK7 A;  2HEY F;  3L2H A;  4X6R B;  2C26 A;  4DUW A;  1IS3 A;  4QMA A;  2BOI A;  3NL1 A;  2MPF A;  1NCQ C;  2P2K A;  2ZX0 A;  4N43 A;  4O7X A;  4Q4W 2;  1LGN A;  3MW2 A;  2BUK A;  5KC5 A;  1YFW A;  5F6L B;  5JPM B;  1YIF A;  1TMF 3;  4NVP A;  2EF6 A;  4GD4 A;  4AHW A;  1EPZ A;  4FQZ A;  2V5D A;  5FZO B;  2JEN A;  2LM3 A;  2OQ6 A;  5T55 A;  4NO4 A;  3ZFE C;  5CA6 A;  4FSJ A;  1OMI A;  1U5X A;  4BHP A;  2H0B A;  4D0Q A;  4AL9 A;  2ZGR A;  4DY5 A;  4RFR B;  3A0N A;  2WC2 A;  1BEV 2;  3SH4 A;  4ES8 A;  3U07 A;  1MQT B;  3CF6 E;  3BI3 A;  5FZ8 A;  3T2O A;  1A34 A;  3CJI C;  1AJK A;  3B01 A;  3CKH A;  4AED A;  1HRI 1;  3IAP A;  4RS5 C;  3O1S A;  4E27 A;  2WNO A;  3AKS A;  5FJH A;  4CDW B;  2D3S A;  1RIT A;  1DU3 D;  1N3P A;  2BV4 A;  2IFW A;  3VKN A;  3LSD A;  4XMI A;  1LOE A;  2RDQ A;  3UKT A;  1R1A 2;  4FAH A;  2PN5 A;  2Q8D A;  3PLQ A;  1WMX A;  2Y6L A;  3KCC A;  3VBH B;  2JD4 A;  1S0D A;  2XLF A;  3RZJ A;  2EAL A;  4Z07 A;  3ZFF B;  4AVV A;  3WNK A;  4EE2 A;  5H9S A;  3TWI A;  4QGM A;  1H2K A;  1RJ8 A;  2VCM A;  3BAL A;  4L0P A;  4Y5Z 0;  5C9A C;  5CBL A;  4XHB A;  1UYZ A;  3HPN A;  1FX5 A;  2EIE A;  3PHM A;  4PLN A;  4PQ9 A;  5ERL A;  5JMC A;  1Y7B A;  2PLV 3;  5FUP A;  4B7K A;  3KZ4 C;  4X8P A;  1U5I A;  3RZG A;  1FV2 A;  3BTY A;  1UIK A;  4LHK A;  3O0X A;  1JH5 A;  4XTM A;  4ATE A;  1EUT A;  3HBK A;  1CJP A;  3ENR A;  4O9G A;  3V65 A;  2OKX A;  4C8D A;  4WZF A;  5FP9 A;  1YJK A;  1WWY A;  1F35 A;  1XSQ A;  5FZ9 A;  5IJR A;  2RHP A;  4XAE A;  2F17 A;  3OGJ A;  1ZA4 A;  4AEJ A;  2HWB 3;  3WCS A;  1VMH A;  1G8W A;  3LAG A;  3C7H A;  2RR1 2;  4BIS A;  5FY1 A;  1CZT A;  1YQC A;  1XNT A;  5G04 L;  2VAU A;  4AEK A;  3V0B B;  2E7Q A;  2WWJ A;  3O0W A;  2QQJ A;  3MGU A;  4MGS A;  5F5Q A;  2A3Y A;  5FY9 A;  4CCJ A;  1IG3 A;  3AVS A;  4D94 A;  3ETQ A;  2K2S A;  4DEQ A;  5BNP A;  2QQK A;  1RL3 A;  1OOP A;  1PK6 B;  1QJU 2;  1YFU A;  2D97 A;  4PIY A;  4XJA A;  3SEP A;  5FZ6 A;  3MID A;  3LIG A;  5IVB A;  3ACF A;  4Q0P A;  1F15 A;  4UF0 A;  3ZKU A;  2VH9 A;  1OXC A;  3KCY A;  5ANN A;  2AAC A;  3OBT A;  4DQA A;  4IEY A;  4MV2 A;  4CCK A;  1VMF A;  3ITQ A;  3BU7 A;  3H42 B;  4QB2 A;  4LMF A;  4YGB A;  2AZ5 A;  3KV4 A;  3POG A;  3LCP A;  4GQ7 A;  2XVG A;  4QX3 A;  4QX8 A;  5BNN A;  3H50 A;  2H6B A;  3B7M A;  2HLE A;  3IT8 A;  4XAB A;  3POE A;  1K5J A;  1G6N A;  1Q8V A;  3VBS B;  1JOJ A;  5F2S A;  5A3N A;  4BQX A;  3VBR C;  3CL1 A;  3KVA A;  4I30 A;  4RA0 A;  5KWR A;  2ET1 A;  1G9D A;  2DTY A;  3FLP A;  3VBO B;  1GWK A;  2WNE A;  4PHZ A;  4P9W A;  5E8A A;  3WY6 A;  4FFF A;  3OCP A;  4HON A;  1WCK A;  3CDZ B;  1QJU 1;  2YRO A;  3OB8 A;  4GAL A;  1CD3 G;  1LED A;  1A78 A;  1LTE A;  2YPD A;  3VZL A;  1EPW A;  2HWC 2;  2W5F A;  3PUQ A;  4CUG A;  2ZEZ A;  3ZFG B;  5LA9 A;  4BQ3 A;  4RGG A;  5KXB A;  1QJY 3;  1QIQ A;  4QXH A;  3D0J A;  3GJB A;  3AJY A;  2HWD 3;  1LJ7 A;  4IE5 A;  4BXS V;  4GJY A;  5I0U A;  5DUW A;  2W46 A;  3SCG A;  4BK4 A;  1W9Y A;  3SNM A;  1VAV A;  3WXP A;  2Z79 A;  3AJZ A;  1Z7S 2;  1V6L A;  2JDZ A;  4HXC A;  4Y24 A;  3WQ7 A;  2VME A;  1FYU A;  1QXP A;  4XUT A;  4AGR A;  5CB7 A;  4IE6 A;  5C70 A;  2Y0I A;  2WDB A;  3MLL A;  2Z4F A;  3A4U A;  5A6Z A;  5F32 A;  1HV1 A;  1Y3T A;  4QHZ A;  3WUC A;  3NV3 A;  1XND A;  3FUO A;  4KG8 A;  3USS A;  4AFM A;  2XB6 C;  1PGL 2;  5FZL A;  3TBD A;  1GOG A;  1GWM A;  1VBA 1;  4IEQ A;  4KH9 A;  4LIU A;  3QOP A;  1G9C A;  4ZZ5 A;  4HN0 A;  2VVD A;  5F3E A;  2HWC 1;  1NCQ A;  2ORZ A;  3NST A;  1RUI 3;  3WHU A;  2FZ1 A;  2QFE A;  4ATF A;  1N1T A;  2QQP A;  5KBF A;  3L2Y A;  3PNA A;  5FKC A;  4N53 A;  1PNF A;  3Q8C A;  3LGR A;  3VD5 A;  1D0G A;  1LGC A;  3HVD A;  1TQ5 A;  3ZFE A;  3AKP A;  2AGS A;  2W47 A;  2WZ8 A;  4LHN A;  1ND2 C;  4UW6 A;  4K9S A;  3NJZ A;  1PVC 3;  1JU4 A;  5IVF A;  2JIJ A;  1Z7S 1;  3ZR6 A;  1K5M C;  4J1X A;  2FDJ A;  2G9G A;  4AQS A;  1STM A;  4AAX A;  3JQW A;  5DUX A;  5EXO A;  1J83 A;  2EXI A;  3B69 A;  5T3N A;  4XE9 A;  1FV3 A;  4RS5 A;  5BNO B;  4DUV A;  4XF9 A;  4FPJ A;  5A1F A;  5CG9 A;  2JDU A;  2ZGS A;  1W0N A;  4FOQ A;  4LBJ A;  2A75 A;  4CCO A;  5C8C B;  4YG6 A;  1PGL 1;  2XDV A;  4OMD A;  3UJO A;  1N1Y A;  5CFC B;  2CAU A;  1L7L A;  2WZR 2;  2XQR A;  3TNQ A;  2ZOE B;  5A3P A;  3V0A B;  5FAX A;  2WYF A;  3WW4 A;  1F9K A;  1W2N A;  4QDQ A;  4QGL A;  1HRI 3;  4E2G A;  3S0M A;  1P8J A;  3OYW A;  2WSV A;  4AHY A;  1PIV 2;  4P00 B;  5C9A A;  4RGA A;  2Y0O A;  3IPV B;  4PDW B;  1J3R A;  2P17 A;  1IPS A;  1PX4 A;  1WUV A;  3A21 A;  3IIA A;  4LBM A;  3WNX A;  4EZH A;  4QT6 A;  3THT A;  4D6Q A;  5JUV A;  4LE3 A;  3RZZ A;  4FO9 A;  2X29 A;  2PQS A;  1FMD 2;  4Q4V 1;  1UU6 A;  1HB1 A;  5GKA C;  3ST7 A;  4BYY A;  1LHV A;  3JD7 2;  3T4V A;  1XXN A;  4Q4W 3;  3OEA A;  1SLB A;  5JMO A;  4IEX A;  4FXG B;  1BXH A;  2RS1 1;  3DXU A;  1XRU A;  1UOJ A;  2R1B A;  5BUV A;  5IK4 A;  5EV7 A;  4OHX A;  1JHN A;  4NID A;  3VUO A;  3ZIX A;  4IXL A;  5GAL A;  3LA2 A;  4GWI A;  4DNY A;  3N9L A;  5EPA A;  4WVZ A;  2IXH A;  5T50 A;  3USU B;  4EN6 B;  1AR9 2;  1BEV 3;  1OF3 A;  1AXZ A;  5H9P A;  4AGV A;  1I5P A;  1PO1 2;  2WZR 1;  5FZG A;  3RYP A;  2DCJ A;  1RIN A;  1WCD J;  1UN1 A;  5T5O A;  3FHQ A;  1PGS A;  3J7H A;  1VRB A;  3R05 A;  2C9A A;  4S2F A;  3WW1 A;  2G1M A;  2ZEX A;  1F31 A;  1PIV 1;  1VB4 A;  5D2A A;  3NJY A;  5FZD A;  2NQY A;  4ET7 A;  4F83 A;  1NE4 A;  2YV8 A;  2W52 A;  1SBE A;  4XJU A;  2TUN A;  1FMD 1;  1PX3 A;  1OLM A;  5FBZ A;  2GP3 A;  2WO7 A;  1W6Q B;  2ZKL A;  3JD7 1;  1G7Y A;  2ZCW A;  3I97 A;  4XQW A;  1NCR C;  1WCU A;  2JDH A;  4Q0S A;  1RED A;  5DZE A;  3K46 A;  2GNM A;  5JOX A;  2Y6J A;  1W3X A;  3WDW A;  5K0U B;  3O1M A;  4P9X A;  4AW7 A;  5F2W A;  4CDQ C;  3POJ A;  5I93 A;  3VDB A;  3RI9 A;  2D7F A;  1NXM A;  4HLT A;  1DIW A;  2VW1 A;  3BPZ A;  1QH7 A;  2Y34 A;  1VBB 1;  2GH8 A;  5FZ3 A;  5FYY A;  4XUR A;  3WP4 A;  1LAJ A;  3VBR A;  5HI0 A;  4W8J A;  5C3S A;  1AR9 1;  3PUS A;  1V9U 2;  1I5Z A;  3FLT A;  2DCT A;  4M3C A;  4AOC A;  1POV 1;  3N7K A;  2GC1 A;  2Q0A A;  3VDA A;  3M8L A;  4IER A;  3TB0 A;  4MGI E;  5FZH A;  1YWK A;  3VBU C;  1GU3 A;  1XE0 A;  3R0R A;  2JG9 C;  1ZBA 2;  2A70 A;  2RR1 3;  3C7O A;  4Y33 A;  1LHO A;  2HYK A;  1VE0 A;  2ZGP A;  4P9L A;  3GCX A;  2XXZ A;  2YGL A;  4K1Z A;  5KHJ A;  2BQP A;  3GHN A;  5FXV A;  4OVE A;  5FPX A;  1TZO A;  1SBD A;  3ZSM A;  5ISL A;  4K20 A;  2PAK A;  1S0J A;  1R64 A;  3MF9 A;  1DP0 A;  4HKL A;  1QJU 3;  4S2G A;  2ZMN A;  3ZXA C;  5LY2 A;  3HQU A;  4R8H A;  4W6W A;  2D6L X;  2VG9 A;  1J1T A;  2ERF A;  2ZGL A;  2D6K A;  4XUN A;  3QD6 A;  4CP1 A;  3MW3 A;  3GXU A;  5IAT A;  1YYN A;  3QCW A;  3S30 A;  3EQE A;  3IKW A;  2FD8 A;  1MVQ A;  1V9U 1;  2W87 A;  3O1P A;  4Y4Y A;  3VKO A;  3Q9O A;  2C0Z A;  1GP6 A;  1KEX A;  3H8U A;  2ARE A;  3KF5 A;  3PU8 A;  4J25 A;  4PIZ A;  4Q8L A;  4LUL A;  4OYU A;  4TYS A;  5K4L A;  4B7E A;  3AYD A;  5KHG A;  4FPC A;  2ZX4 A;  5FYT A;  1CX4 A;  1JBC A;  4QPG B;  4R4Z A;  2GMP A;  4P9G A;  2EIG A;  4FCA A;  1MQT C;  4E2S A;  4YPJ A;  2E53 A;  3WX5 A;  1Z0H A;  4OHW A;  1V6K A;  4IV1 B;  2EID A;  3HT2 A;  4KGG A;  3D82 A;  5A6X A;  4CVU A;  2ZHM A;  3VN4 A;  4OHV A;  3ABZ A;  4QX1 A;  1ND2 A;  2DBN A;  3IDB B;  3NAP B;  5FIX A;  3VHO A;  4EN9 B;  3SEE A;  1Y43 B;  5EJZ B;  1LEM A;  5FY5 A;  4BH9 A;  1K5M A;  4LE4 A;  2QNK A;  2XON A;  1HQL A;  2EXH A;  1ALY A;  2HWC 3;  5AC9 1;  3VBH C;  2HH9 A;  3I54 A;  1LGB A;  3APB A;  1W6P B;  1ZM1 A;  3UK9 A;  3ZFF C;  4ASM B;  2ZJC A;  2QQM A;  1H6X A;  3RS6 A;  1ULG A;  2E33 A;  2QQV A;  2XHK A;  4DFS A;  3ASI A;  3QLQ A;  4UAP A;  4WM8 B;  2RV9 A;  2AEZ A;  3B93 A;  3LDR A;  2JX9 A;  5FYB A;  2PHW A;  3S5A A;  1Z7S 3;  1R09 2;  1GUI A;  2W9X A;  3VB9 A;  1UY0 A;  3PJQ A;  2ZX2 A;  3C7G A;  1LB2 A;  3GZA A;  4UBH A;  1W03 A;  4OFG A;  3ELN A;  2CDO A;  3KT4 A;  5FYC A;  4AVC A;  1NX9 A;  4EQV A;  1ZRI A;  3ZYG A;  3VL9 A;  3PUI A;  4UW4 A;  4LIT A;  3OUI A;  3KT1 A;  4MHR A;  1RB8 G;  1W8U A;  1AF9 A;  4LKS A;  1NE6 A;  4UWD A;  3SKJ E;  2UY8 A;  4AI9 A;  1B35 B;  3K75 B;  3QH7 A;  1UZY A;  3KLS A;  3HNM A;  5CU1 A;  5GZF A;  5C5T A;  2R04 2;  2QQO A;  2VQU A;  4CTE A;  5A7W B;  1LOB A;  4D7Y A;  1X9P A;  3H7J A;  4P9Y A;  1U5Y A;  1CAV B;  3IDE A;  4LO8 A;  3FBM A;  3POF A;  4NRM A;  1HX6 A;  3UET A;  2D43 A;  1O59 A;  3LPG A;  1PK6 C;  1QJE A;  1C8M 1;  3KGL A;  4MHU A;  3OBA A;  1WW4 A;  2XH6 A;  1PM4 A;  4FPE A;  1BBT 1;  2GN3 A;  3AKQ A;  3NQH A;  2IVJ A;  3AMM A;  3GM8 A;  3NKT A;  3BTX A;  1R09 1;  4KL1 A;  1D2Q A;  3BTA A;  4HZF A;  1I9R A;  4IV3 B;  4QX0 A;  4FP2 A;  4LKD A;  2WBK A;  1QNW A;  3IWZ A;  3RYK A;  1CGP A;  1ODN A;  4N8M A;  4I09 A;  2VXJ A;  2VR4 A;  4Z92 B;  2VCC A;  3KQR A;  5IVJ A;  1GQH A;  3ZLI A;  3K51 A;  3V64 A;  5L7O B;  1F5J A;  4CCC A;  1VAM A;  4P9J A;  4DXZ A;  1G9F A;  1IKP A;  3HNB M;  3VBS C;  3Q8B A;  1DHK B;  1HXS 2;  2WZR 3;  4TLF A;  1T6G C;  1MS5 A;  3AL6 A;  5DUV A;  2VUJ A;  3SMH A;  4L99 A;  3SQO A;  5LY1 A;  3VBO C;  3WP3 A;  3T0A A;  3RZH A;  2B4K A;  1GP4 A;  4I0W B;  4XF0 A;  4YM1 A;  1PIV 3;  3SC7 X;  5FTT C;  2EAK A;  3WQB A;  5F7U A;  2UYA A;  4LR4 A;  4LKE A;  3LIH A;  3LEG A;  1WW7 A;  2W1S A;  4XTP A;  2YYO A;  2Y6H A;  1RUG 1;  1BK1 A;  1V6J A;  1QGL A;  2FDH A;  1FMD 3;  1KRI A;  1MS8 A;  2VUL A;  1V0A A;  3JD7 3;  1DG6 A;  3H7Y A;  2V4A A;  5EWS A;  3GZT B;  4DIN B;  1RUF 2;  3HD8 B;  4K1Y A;  3VV1 A;  5FP4 A;  5FBJ A;  4CU8 A;  5A7P A;  2JE8 A;  4TXW A;  5EYY A;  1JYX A;  1ZX5 A;  4CEY C;  2ZS6 B;  1WME A;  1NQD A;  1LHW A;  2GDF A;  4MAD A;  1GR3 A;  3N9M A;  3VBU A;  3TEW A;  2A3X A;  2R32 A;  4K8F A;  5LAS A;  2JG9 A;  2VTX J;  4QQL A;  3T2Q A;  2NM1 A;  3MPP G;  4H7L A;  5DQ0 A;  4F8A A;  4N43 C;  2QUO A;  4ASK A;  1BMV 2;  3IAQ A;  5I8S A;  1LOC A;  1AR9 3;  4Y3O A;  2VZ1 A;  3AZW A;  1LOA A;  1PO1 3;  4LBQ B;  1POV 3;  1ONA A;  3BKZ A;  1HB3 A;  3LEI A;  1UQX A;  4HKO A;  1WW6 A;  1MZ6 A;  4RYD A;  5FY4 A;  3C7F A;  3MI8 A;  3B02 A;  4A41 A;  1PZ7 A;  1CAW A;  2DTW A;  3FFZ A;  5IFP A;  3VD9 A;  1RMU 2;  2GH2 A;  5K7P A;  4O61 A;  1QJX 2;  1C1L A;  2RS5 1;  4EWE A;  1W90 A;  1DYP A;  1RUF 1;  2JIG A;  5FPZ A;  3SKV A;  4OQ8 A;  5FZO A;  4BCU A;  4HK9 A;  3SH3 A;  3FZ3 A;  1H4G A;  4NUB A;  4NPL A;  3DEC A;  4BOW A;  1UKR A;  3M3E A;  3O0V A;  3ZYR A;  2VGD A;  3I2J A;  1MQT A;  1BMV 1;  3T2T A;  3N7J A;  3SCF A;  2TNF A;  4MG2 A;  3P5B A;  2FCV A;  2D6P A;  2Q5T A;  4URT A;  3WHT A;  1H2M A;  1V9U 3;  3WVJ A;  4XZP A;  4I3G A;  5FZE A;  3ZSE A;  5C4W B;  4CDW A;  4PF1 A;  2ZZJ A;  2D5H A;  3P1I A;  5DAB A;  4K7J A;  1JMU B;  1ZZ9 A;  3U75 A;  2VMH A;  1MVE A;  1XJA A;  3BOP A;  1ZBA 3;  3DKQ A;  2P3Y A;  4Q0Q A;  3VBH A;  4LLF A;  2KA3 A;  3ZFF A;  2WNU B;  1G86 A;  3ACI A;  1VBD 2;  4OI2 A;  4MXW B;  4N9H A;  2VNR A;  3LOB A;  3I2O A;  2D6M A;  3KV6 A;  3GF6 A;  4WVV A;  3WZ1 A;  2ZAC A;  2OS2 A;  3AZX A;  4XZU G;  4NN0 A;  4PDW C;  1F5F A;  1NAE A;  1OD5 A;  4HSL A;  4XCB A;  3T08 A;  1W39 A;  2D6N A;  1RXF A;  2NN8 A;  4D3W A;  2FCT A;  1JZ5 A;  3CBN A;  2HWD 2;  3J26 N;  1LHN A;  1HDK A;  4I2O A;  2VO5 A;  3KGZ A;  2QTW B;  3HN1 A;  4DPN A;  3CIH A;  1H6Y A;  1OOP C;  4NII A;  4JKK A;  1JYT A;  4YVW B;  5GM0 A;  3RVH A;  1OI6 A;  1ULO A;  4RHV 2;  4B4R A;  2VZV A;  2VM9 A;  3JQX A;  4NIA A;  4IES A;  4E2Q A;  3ZYJ B;  5JLV A;  2Y6F A;  3U4S A;  3WLU A;  4BLI A;  4COV A;  1X7N A;  4ZKT B;  3OBZ A;  4BMB A;  1ULC A;  3OSD A;  2DYC A;  2VMD A;  3V0B A;  2W1U A;  3NMB A;  1SLL A;  2KR2 A;  3OPZ A;  3SIT A;  3UT0 A;  1VBD 1;  4DXR A;  4H7M A;  4YSF A;  5JOY A;  5AVP A;  1ULD A;  4G4F A;  2PXJ A;  5K8S A;  3LA7 A;  5LEK A;  1PK6 A;  2BNO A;  3FMG A;  4IEZ A;  5BNN C;  2WAO A;  3LZZ A;  2ARB A;  5FK8 A;  4UBG A;  1RUH 2;  1OUX A;  3FBY A;  5JPN B;  4QPI B;  1QHD A;  2OQ7 A;  1JOD A;  2OW4 A;  2HWF 2;  4IE4 A;  2VE1 A;  1DQ1 A;  2O0O A;  5FDB A;  1PZ9 A;  3I7D A;  2R0H A;  3NRU A;  1HN1 A;  3M3C A;  4XHX A;  2XVL A;  2RMU 1;  1HJG A;  3WF0 A;  4IGQ A;  5F8P A;  5T5P A;  5K0U C;  5LA0 A;  4B29 A;  1APN A;  1KJR A;  1MZF A;  1JYC A;  4RHV 1;  4C0H A;  3SHR A;  5C3Q A;  1ZNP A;  3VBS A;  1R09 3;  2OT7 A;  3DYP A;  4LT5 A;  4KI5 M;  1J3P A;  3DPR B;  5J1X A;  4JDN A;  3VBO A;  2J1A A;  3IBM A;  4EWA A;  3RZM A;  3ACL A;  3ACH A;  4GKY A;  5DDJ 2;  1W9S A;  5IK7 A;  1QMJ A;  5F9T A;  1DGL A;  3SXW A;  3RSJ A;  3C7E A;  5FO9 B;  4UYB A;  2ORX A;  2VEC A;  4KGQ A;  3WW3 A;  3ZFG A;  3WOG A;  5FZF A;  3W20 A;  2R04 3;  2HWF 1;  1VB2 A;  5E6H A;  2PHX A;  5A32 B;  3VZO A;  1YFY A;  3E5Q A;  4TLG A;  3FN9 A;  4YG3 A;  4CEY A;  5FPU A;  3J8F 2;  2PHF A;  4C1X A;  4XDP A;  5M0T A;  4QX2 A;  2XJT A;  4FPH A;  1WA4 A;  3NO8 A;  4M01 A;  4PJY A;  4ZU4 A;  4NHL A;  2DUQ A;  1X8E A;  4NRQ A;  3D3A A;  2D3P A;  4QB6 A;  1OLQ A;  3JUU A;  4AK3 A;  3I49 A;  5LW9 A;  1ZRR A;  4MX3 A;  4AVA A;  4A6S A;  1REF A;  4C91 A;  1ENQ A;  2IWG B;  4N53 C;  5F5A A;  4ZU5 A;  3VD3 A;  2E51 A;  1KJL A;  4AAP A;  1V70 A;  5J48 A;  4PLO A;  3N9Q A;  3MHZ A;  3ZXE A;  3W5N A;  2AUY A;  2DFC A;  1XU1 A;  5I0S A;  4NIH A;  5DDJ 1;  2VOW A;  3D4K A;  1OH3 A;  2GMM A;  1VRH 1;  5T5L A;  4UW3 A;  1WLC A;  4H3W A;  2EVX A;  2W1W A;  4XIL A;  5HV0 A;  2B42 B;  4NHK A;  2YXS A;  5D1I A;  1FT9 A;  1HXS 3;  3D6E A;  5GZC A;  5JIU A;  4UFK A;  5FQ0 B;  5KHH A;  4IV1 C;  3JU9 A;  4KNC A;  2YBS A;  4HMZ A;  3UNP A;  1Q8P A;  1SPP B;  2WJS A;  3J8F 1;  4D8M A;  1MZ5 A;  2YFU A;  3NAP C;  4KU8 A;  3LDK A;  3AZZ A;  4QGN A;  1Y9M A;  4XF1 A;  4QXB A;  2EXJ A;  3KV5 A;  2CTV A;  5CNA A;  4CDU B;  4P02 B;  4DOU A;  4QKD A;  1PMJ X;  4FFG A;  5IW0 A;  3UES A;  5LB6 A;  1RUF 3;  5BNO A;  1RUO A;  2RJK A;  4L11 A;  2F4P A;  3I2F A;  3WNM A;  4UW5 A;  2VCA A;  1O5L A;  2BWA A;  4WM8 C;  2VUD A;  5C8C A;  4XXP A;  3ZSJ A;  4Y22 B;  5CFC A;  1PMH X;  1DLC A;  1YQ8 A;  1Q8O A;  3IMM A;  3N7M A;  3AKR A;  2PHR A;  4Y4R A;  4CYD A;  2R7E B;  4S2H A;  3RWN A;  3T30 A;  3V0A A;  3DGT A;  4LJH A;  3RFR A;  3UL2 A;  2E63 A;  2WO1 A;  4YGD A;  5FJK A;  2ARA A;  5CKQ A;  3K77 A;  3GZE A;  1OSG A;  3IPV A;  4PDW A;  3GZU C;  3VZJ A;  1YXW A;  2GNB A;  5I8T A;  2CWM A;  4CDX B;  5C33 A;  2FMD A;  3VD7 A;  1B35 C;  1RMU 3;  4QB1 A;  3LDB A;  2YMZ A;  3AVR A;  4U36 A;  1C5H A;  1QJX 3;  1R08 2;  4CU6 A;  3AKT A;  5FYI A;  1F4A A;  2JDN A;  1AUY A;  3AP4 A;  3H1Y A;  4MGK E;  1D4M 2;  2R06 1;  2A1X A;  1Q3E A;  3GDB A;  1OA2 A;  3VDC A;  1GWL A;  2A6X A;  2WLQ A;  3HBZ A;  3WDU A;  1AHS A;  1V6N A;  2PHL A;  4XJ8 A;  3ZKY A;  5IT6 A;  1OFS A;  2DDU A;  1IGO A;  3K48 A;  1AX2 A;  4ZU7 A;  1RUE 2;  3G7D A;  2LRP A;  1KD7 A;  2VZ3 A;  2YBK A;  4LA2 A;  3USU A;  5F3G A;  3C8X A;  2WFP A;  4YW3 A;  5LBB A;  4CU9 A;  1GP5 A;  4OI0 A;  2R07 2;  4Q1P A;  1DZR A;  4W6Y A;  2E7T A;  4GWM A;  4QKB A;  5HXM A;  5BXX A;  1PM7 A;  2JG8 B;  2NPI A;  4BQ4 A;  3WD5 A;  2CY6 A;  1JYN A;  2RE9 A;  3RRD A;  3IDA A;  1O3S A;  3WCR A;  1RHI 1;  5JVV A;  5L19 A;  4QQH A;  1XNA A;  1MS4 A;  2F4L A;  1AYN 2;  4CEW B;  1CR7 A;  3POS A;  1H2N A;  2ZEY A;  4HOO A;  5J96 B;  5KHI A;  1W6Q A;  1ODM A;  2Y60 A;  1JYV A;  1VBD 3;  1R08 1;  1UOG A;  3U4X A;  2O8O A;  5FMO S;  2E32 A;  1WMF A;  4HKW A;  1VBA 2;  2VOK A;  2H6C A;  1D4M 1;  5K0U A;  3D8C A;  5B4X A;  3J9S A;  3J7L A;  3MFC A;  4PI2 A;  4FPY A;  4BLJ A;  4QDS A;  1U0A A;  5C5U A;  3MF6 A;  3IMN A;  4OMC A;  1YUD A;  1RUE 1;  2YB7 A;  3MIH A;  3ZXK A;  2K46 A;  3AP7 A;  1GV9 A;  1ZZ7 A;  1NKG A;  2QQL A;  2R07 1;  3KVB A;  3MFA A;  3MW4 A;  5HCF A;  3POI A;  1F4H A;  5CKM A;  2CYF A;  4YW7 A;  3O1O A;  1SLA A;  1CX1 A;  4M0H A;  4RHV 3;  1GSL A;  2W68 A;  2XLA A;  2W92 A;  4HPK B;  2CDP A;  5FYU A;  5HCH A;  2ZZQ A;  3ILF A;  1UNB A;  1DQ4 A;  4FTS A;  1AYN 1;  1HW5 A;  3W59 A;  5APA A;  1GNY A;  3H3U A;  4CP9 B;  3NV2 A;  5SV5 A;  4CUA A;  3VZN A;  1C28 A;  4NAO A;  5LAT A;  1YQ6 A;  4IND A;  1HJF A;  1RTV A;  2O1Q A;  2ZXQ A;  2C5D A;  3ZN6 B;  4BIO A;  5JZG B;  1RUH 3;  5FZK A;  2VZU A;  3A23 A;  4HFS A;  3IN9 A;  3H3Z A;  4NR1 A;  3LD8 A;  2B46 X;  2HWF 3;  3NJX A;  3DF0 A;  4MO3 M;  2VW2 A;  1UPS A;  4XBN A;  5A7S A;  1UO9 A;  1W8T A;  1POQ A;  2YC4 A;  4DEV A;  5EIY B;  1VAL A;  2AH2 A;  4PCR A;  4Q4V 2;  3UGF A;  5FXZ A;  2WQ4 A;  3OGG A;  4UFM A;  4E4H A;  5A1A A;  1EAH 1;  2LS6 A;  1SCS A;  2JEC A;  2VW0 A;  3PJY A;  5GLT A;  5JWP A;  4AVB A;  2WA4 A;  4JDO A;  4QPG A;  1PO2 2;  1XB9 A;  3KB5 A;  4RFT 0;  3T2P A;  4K8R B;  2RS1 2;  4GA9 A;  3FHI B;  4RR3 B;  5LK5 A;  4MET A;  4RSU A;  3NKG A;  4IV1 A;  1WZX A;  4Q27 A;  1PGW 2;  2YGM A;  4NHM A;  3M2M A;  4XDQ A;  1W6M B;  5CZK A;  2GC2 A;  2BGP A;  1VMJ A;  2HBT A;  4FXK B;  4OUM A;  3OF1 A;  3H9A A;  5DDJ 3;  2ZHL A;  3NAP A;  3NNM A;  1ULF A;  2NYY A;  3BOD A;  1OUS A;  4NIG A;  3KMH A;  1PZ8 A;  1VRH 3;  3MO4 A;  5JXG A;  1ND3 B;  3U0Z A;  2WT1 A;  2BDR A;  1CJD A;  1GQP A;  3A7Q A;  5I0D A;  4DIQ A;  3HT1 A;  3JCI A;  3O12 A;  4D7S A;  1N1V A;  1W6P A;  1H9W A;  1X33 A;  2GP5 A;  2XJS A;  5CAZ A;  5A80 A;  4SLI A;  4IET A;  4KG0 A;  1VBE 2;  2BGC A;  4RGK A;  3I2H A;  1HQW A;  4E8C A;  4AFB A;  1G9A A;  4BQ2 A;  2AC1 A;  2H0V A;  3J8F 3;  4XCA A;  3HEI A;  4WM8 A;  4OI4 A;  1VIW B;  4D6R A;  3HQR A;  2O14 A;  4NJ4 A;  2QQI A;  4QQP A;  5A6Y A;  3O1U A;  2RG4 A;  1YC6 1;  2OUJ A;  2P3J A;  3AMH A;  3NJV A;  5J3U A;  2DUP A;  2VJX A;  1SQ4 A;  1DYK A;  3ALQ A;  4WVM B;  5FWE A;  1RC6 A;  1PO2 1;  2XKP A;  1UMI A;  2I45 A;  4UFJ A;  5FLI A;  5JAX A;  2NMN A;  3I3B A;  1CAX B;  2PMW B;  4BJ0 A;  2HWE 2;  1BKZ A;  3KSC A;  3LKJ A;  4DRV A;  1PGW 1;  4YVW C;  1SG3 A;  3S7E A;  1MR5 A;  1VBB 2;  1W8W A;  4FPO B;  2P37 A;  2ET7 A;  1OLM E;  4QU2 A;  1QKQ A;  1B35 A;  2G19 A;  2QQN A;  1ZRF A;  5FRE A;  4Z2A A;  4JGZ B;  2PAE A;  4HAN A;  3FL7 A;  1Q8S A;  5A7W A;  4CXX A;  1CAV A;  5LBE A;  1S0B A;  5C71 A;  2XQX A;  1VBE 1;  4H2A A;  1YJL A;  3NWK A;  2WFF 2;  5IUQ A;  3U78 A;  3ZX7 A;  2ZGO A;  5BNQ A;  1NY7 2;  4QPY A;  3DL3 A;  4KWK A;  1OVS A;  4YW6 A;  1ULP A;  2F6B A;  3OOX A;  5AVA A;  3I2I A;  2VOX A;  4EJR A;  3PME A;  4BQ1 A;  1UAI A;  2I74 A;  2IFR A;  4I0A A;  4IV3 A;  1A6C A;  1OPM A;  3EJK A;  4GWN A;  1J84 A;  5C6C A;  2Z2S B;  1SMV A;  1BK0 A;  1YLL A;  1IS5 A;  4A42 A;  2HWE 1;  5FZ4 A;  1S0E A;  2VL4 A;  4GIQ A;  4Z2W A;  5L7O A;  2XML A;  4YFZ A;  1JZ7 A;  2Q1M A;  3TEX A;  1CZS A;  1L3J A;  2DU0 A;  3UGG A;  4LO7 A;  5FPV A;  1OQ1 A;  3RJ2 X;  3S5Q A;  2YFZ A;  2WNV B;  3P3P A;  1OHF A;  1XE8 A;  4KWJ A;  2PHT A;  2RDR A;  3ACG A;  4GZ9 A;  3U1X A;  1V6O A;  5BV6 A;  3ZYI B;  1W05 A;  3OPW A;  2WFF 1;  1COV 2;  2WT0 A;  3INA A;  3OEB A;  4YLZ A;  1NY7 1;  1QWR A;  4E4S A;  5BPX A;  3ZOI A;  4Q4X 2;  5FRA A;  2V4V A;  2CHH A;  3DV8 A;  2CGP A;  2W0X A;  5FYV A;  5GZE A;  2UWC A;  4BXF A;  4CCD A;  4AFA A;  2WII B;  4BIF A;  1R08 3;  4BME A;  4K21 A;  5LWB A;  1T2X A;  1RUD 2;  4JX0 A;  4LPL A;  4RQP B;  5A3L A;  4CCN A;  1D4M 3;  1RUC 2;  4JCK A;  1UU5 A;  3E6C C;  2WIN B;  4AFD A;  1W6N B;  3TN9 2;  1UF2 C;  5AC9 2;  5ABJ B;  3PVE A;  2B7Y A;  5LBC A;  4GUL A;  4YM2 A;  3N4M A;  2PHD A;  3B9C A;  4NWW A;  1RUE 3;  4BDV B;  5CYY A;  2BU9 A;  5HPO A;  1XSR A;  1HQN A;  4Q4Y 2;  2R07 3;  1S0F A;  4LBQ A;  1CPM A;  1IZ3 A;  2QDN A;  4XYX A;  4YW1 A;  1H1I A;  1LEC A;  1LES A;  1UXX X;  2V5Y A;  4J6G A;  2OZJ A;  4LKF A;  3CJX A;  4JDM A;  3ZXL A;  1WBF A;  2AR6 A;  5D8A B;  4A44 A;  2VMG A;  4W4Z A;  5FYM A;  1COV 1;  3GHM A;  1AR7 1;  2DVG A;  2WWS A;  1AYN 3;  2WKK A;  1KFU L;  4Q4X 1;  3GGL A;  4GMP 0;  1URX A;  3AYE A;  4ZXE A;  1A3K A;  4XFB A;  4QD2 A;  3AM2 A;  1QJZ A;  1RUD 1;  2KXL A;  4CDW C;  2Q1Z B;  1VBA 3;  3N9N A;  5LA2 A;  1RUC 1;  1BZW A;  2ARX A;  3N9P A;  1KFX L;  1QQP 1;  3TN9 1;  3MV1 1;  2DUO A;  2A71 A;  5C3O A;  3A0K A;  4LTA A;  5I0R A;  5C3P A;  4CXW A;  3B9I A;  2PHU A;  4JHT A;  3VDD B;  3N9O A;  4LXL A;  2JDY A;  2WN2 A;  4BB3 A;  3CJI B;  1D2S A;  4JRA A;  1Z78 A;  1JN2 P;  2UY9 A;  1WW5 A;  1C8M 2;  3CO2 A;  4Q4Y 1;  5DG2 A;  4OCT A;  5C4W A;  2ZTN A;  1LKN A;  4LOR A;  4RL7 A;  4XOG A;  4CU7 A;  2OA2 A;  2FDI A;  1BBT 2;  4UXA A;  4WZC A;  3H8X A;  2G9Z A;  2VTX A;  1LHU A;  4LOS A;  4CRQ A;  4MGZ E;  4NHX A;  1HV0 A;  3WF4 A;  5FZ7 A;  4NHY A;  4URA A;  4FOV A;  5I8Y A;  5J98 B;  1W9F A;  1OT5 A;  2WNU A;  1W8H A;  3A22 A;  4M3C F;  5GZD A;  4MXW A;  4B8E A;  3DEM A;  1AYM 1;  1LOD A;  5HCA A;  1W28 A;  3NVC A;  1DQ0 A;  2D44 A;  1SBF A;  2QCS B;  2ZX3 A;  3LQC A;  4NAM A;  2I07 B;  4CDX C;  3AL5 A;  3K4A A;  4NWV A;  4LBL A;  3O1V A;  2VMC A;  4A3X A;  2J1T A;  5FLJ A;  4LHL A;  4N90 A;  2VBP A;  1H0B A;  3HMY A;  3I59 B;  4CCM A;  1JUI A;  2R6Q A;  5IVV A;  3PTY A;  3T0D A;  1JXN A;  3I8T A;  2GSY A;  3UKV A;  2A6W A;  3OGR A;  2GU9 A;  3LWC A;  4A4A A;  3JBG 2;  1H2L A;  3S7I A;  1RUG 2;  4EZ4 A;  4YVW A;  1KIT A;  4KMQ A;  4R4X A;  1CIW A;  4Q4V 3;  1S2K A;  3MZH A;  3K4D A;  5FPB A;  1W0P A;  1E5H A;  2HJI A;  4FTB A;  2DCK A;  1IG0 A;  4CPB A;  2XHN A;  1RXG A;  2JD9 A;  3BYW A;  1Q56 A;  1PO2 3;  1GYK A;  2XL7 A;  2RS1 3;  3UYJ A;  5FMD A;  5JXI A;  5JSO A;  3MLJ A;  4BU2 A;  4W50 A;  2J1R A;  3OG2 A;  3ROU A;  3KF3 A;  4COU A;  3FJS A;  2L9L A;  4OUE A;  2VZO A;  3FFQ A;  3OJB A;  4V2V A;  1ZYB A;  3FWE A;  3AZY A;  3PDQ A;  4QPI A;  1YNA A;  2W1Q A;  3F95 A;  5HCB A;  4CEW C;  3RG0 A;  5FP7 A;  5FO7 B;  2UUR A;  2XJR A;  1GNZ A;  2JIC A;  1CQ9 A;  4AQT A;  4E8D A;  2RVA A;  1LCL A;  1Q43 A;  4JTN A;  4B4P A;  4YM3 A;  2XJQ A;  1VBE 3;  2YC0 A;  1RUN A;  2W39 A;  1ZRE A;  1IPJ A;  3JBG 1;  4CE8 A;  4GH4 B;  4HBN A;  4OHZ A;  1OVP A;  3I3D A;  5FP3 A;  2WR9 A;  4CA9 A;  5JXH A;  5EZW A;  3VD4 A;  2RS5 2;  2RM2 2;  2X53 S;  3ZFG C;  1EYB A;  3TAY A;  4YM0 A;  1REE A;  4ZZ8 A;  1ASJ 2;  1CPN A;  2J7M A;  2VNO A;  3DPR A;  4LO5 B;  4QXK A;  2VOV A;  1MEC 1;  1XNC A;  2PTM A;  4IEP A;  5DZF A;  1GQG A;  2B5H A;  2HWE 3;  3I3Q A;  1QOO A;  3JXS A;  3MEP A;  3ON7 A;  3MIC A;  5DPN A;  3BGA A;  5FYS A;  4L92 A;  4ZPI A;  1VBB 3;  4AVT A;  5GZG A;  3NNG A;  1AL0 G;  3OD4 A;  2QVS B;  1C4R A;  1UMZ A;  4Q0V A;  2RJ2 A;  5IAV A;  3RNS A;  5FFO C;  2GC0 A;  5JI9 A;  3CZU A;  2ES3 A;  4R9B A;  5A32 A;  3LFM A;  4MZU A;  2Z5W A;  3VHR A;  4XBL A;  1YHF A;  3WG2 A;  2BZD A;  2WFF 3;  4MSV A;  5FY0 A;  4M4P A;  4XIO A;  1RJ7 A;  5FZ1 A;  3VHP A;  1O5U A;  2RM2 1;  1UZV A;  2RJL A;  4QAW A;  3OUJ A;  4QQ2 A;  4Q1R A;  2WO3 A;  5F6K A;  5FZM A;  3AYC A;  4WM7 B;  1B09 A;  3ZXD A;  1XYP A;  1ASJ 1;  3PIJ A;  4DY3 A;  4BQW A;  4EN8 B;  2A6Y A;  4Y20 B;  4LUK A;  3BB6 A;  5ANQ A;  5F37 A;  1YQ5 A;  1AVB A;  4NPR A;  4XEZ A;  3PTR B;  2ZBJ A;  2VZT A;  2ZGT A;  3ES1 A;  4Y1U A;  5CG8 A;  4SBV A;  1NA1 B;  5A70 A;  2BFU S;  1DYO A;  4P5H A;  4B4Q A;  4Y5S A;  1G9B A;  1W9W A;  2E31 A;  1LU1 A;  1UY1 A;  2PYT A;  3SH5 A;  1NLQ A;  4BQ5 A;  4PBP A;  5FV3 A;  5BNO C;  2DCY A;  2XUM A;  3OBR A;  4PQQ A;  4Y1V A;  2D6O X;  5FQ0 A;  3I2G A;  4AI3 A;  4FAG A;  2J1S A;  3AXE A;  5FOJ B;  3UJQ A;  3PVN A;  5C8C C;  1SPP A;  1CIY A;  5T5J A;  3VKM A;  5JXJ A;  1Y9Q A;  2BRT A;  1UXZ A;  1COV 3;  1UWW A;  4HVO A;  3WQ0 A;  5CFC C;  1AR6 2;  2DUR A;  3B5L B;  5DG1 A;  1AR7 3;  4QQO A;  3LF7 A;  4Q4X 3;  2XOM A;  2XWJ B;  2V73 A;  2ZX1 A;  3ZIW A;  4CDU A;  5J09 A;  4M0N A;  4OUL A;  4YW2 A;  3PL0 A;  2WO2 A;  1RUD 3;  2VQT A;  3ETP A;  3BOW A;  4MXV A;  5FZA A;  3VBF B;  1RUC 3;  1ENX A;  1ST8 A;  5L73 A;  2QJV A;  1DZT A;  1N47 A;  3B00 A;  3FE5 A;  4LNV A;  4BE3 A;  3TN9 3;  1HB4 A;  5AC9 3;  2XWB B;  2FDK A;  3KHB A;  1DQ5 A;  2WUH A;  5J7M A;  4Y22 A;  1WLT A;  1W04 A;  1NYW A;  3WW2 A;  3EO6 A;  3ZN5 A;  4QKF A;  3TNP B;  1UY3 A;  2FMY A;  3LOI A;  2RMU 2;  3ILR A;  4I0B A;  5E1R A;  4DO0 A;  2XJP A;  2Q8O A;  4Q4Y 3;  3BU0 A;  1ZRD A;  4TTG A;  1LOF A;  4IL7 A;  4XBQ A;  1JHJ A;  4P14 A;  2FZ2 A;  1T6B X;  1DQ2 A;  1WGP A;  4QXC A;  2Y8K A;  3FX3 A;  4QM8 A;  2G9F A;  2PFW A;  5DZG A;  1UX7 A;  4EN0 A;  4CDX A;  1YRZ A;  1AR6 1;  2X05 A;  1JYI A;  4F3J A;  4JGZ C;  2IXK A;  3DCQ A;  2B9U A;  3OD0 A;  1VP6 A;  2Y38 A;  3M3Q A;  1SFN A;  4ERO A;  2E6V A;  2P1B A;  1AYM 3;  3P6B A;  1FPN 2;  4KBB A;  1HB2 A;  2A6Z A;  5CAD A;  1O91 A;  3ZPO A;  1EUU A;  4OZO A;  5IFT A;  3ZDV A;  2VZR A;  4YYO A;  5JR2 A;  2VNV A;  2W95 A;  2XJV A;  2YU2 A;  5JR7 B;  2BYV E;  4CCE A;  4AWD A;  3QAC A;  4O65 A;  4K40 A;  4D7T A;  2PEL A;  4Q2F A;  5FMC A;  4AF9 A;  1N1S A;  3MIE A;  4W65 A;  5ACA 2;  3T4H B;  1VLN A;  4MLO A;  4MVT A;  1C8M 3;  2ENR A;  2JG8 A;  5T52 A;  2ADE A;  1OFN A;  5A3U A;  3HIF A;  2Y26 A;  1BBT 3;  3AFG A;  1YO8 A;  1KS5 A;  3LFI A;  4IEV A;  3THD A;  3VZK A;  2HEW F;  3ZM8 A;  1ZRC A;  1GMM A;  2BNN A;  1RVF 2;  5A3T A;  4QX5 A;  1Y9G A;  3JB8 A;  4CEW A;  4KWL A;  1NCR B;  1LU2 A;  2IVI B;  4E9K A;  1CVN A;  1BYH A;  3OGV A;  3U14 A;  1CON A;  2WZP P;  1UCX A;  1FPN 1;  2VVE A;  3WG1 A;  1ZZ8 A;  4CDQ B;  2SBA A;  1VRH 2;  1SDW A;  1ENR A;  1FAY A;  1JOB A;  3GCW A;  4FPK A;  1GAN A;  5IWF A;  3EB7 A;  5FR3 A;  2OYZ A;  3OY8 B;  4A45 A;  1WCS A;  4KQ7 A;  5A3M A;  1NZI A;  2VMF A;  1O4Z A;  1W2O A;  2HKX A;  1WLW A;  3GBG A;  2J22 A;  1W2U A;  2BOJ A;  4BM8 A;  1SHW B;  2NLR A;  2VCB A;  3CLP A;  4KBZ A;  1US2 A;  3UKN A;  5CIS A;  1O8S A;  2DVA A;  4K3U A;  5ACA 1;  4RQP C;  3GYD A;  3H1W A;  1BVV A;  3GBW A;  5EYX A;  3JBG 3;  4QPW A;  3AFK A;  1RUG 3;  1UD1 A;  4JVA A;  2EIB A;  4XET A;  2WRA A;  3WNN A;  4EYU A;  1HLC A;  1UYY A;  1MS0 A;  3B3Q E;  4ONU A;  5ABJ C;  4HPK A;  2ZHN A;  4AFC A;  3IB3 A;  1RVF 1;  1UPI A;  3POW A;  1J3Q A;  2ZA9 A;  2WSU A;  4UOJ A;  4XFI A;  2J1U A;  4A3Z A;  3PMS A;  4CP9 A;  3CZJ A;  1OA3 A;  4CUC A;  1VJ2 A;  3W9A A;  1W8Z A;  1TNR A;  1VAK A;  2YBP A;  5IVY A;  5CKN A;  3ZMN A;  2QE3 A;  3RZL A;  4NOT A;  1AZD A;  1FOD 2;  2Y33 A;  2ZGU A;  3I3E A;  3ZN6 A;  4ZXK A;  4QPG C;  5JZG A;  4COW A;  4JGY B;  4KWU A;  4YZ3 A;  4JKM A;  4BZ4 A;  1RIR A;  1JZ2 A;  4YGC A;  3AXD A;  3H1M A;  4X8N A;  3T1L A;  3ZDS A;  2W94 A;  1K42 A;  2G4I A;  1XQN A;  2DVB A;  1PVX A;  4GMP 1;  2Q8E A;  1X50 A;  2B9V A;  4MYE A;  3UGH A;  1KS4 A;  4NPM A;  2HEV F;  4DXS A;  4QU1 A;  4A2U A;  1W0O A;  3M4F A;  2P6C A;  4X6Q B;  4GKX A;  4LBK A;  1S0C A;  3URF A;  4AVS A;  2RS5 3;  4LBQ D;  2RM2 3;  1ZZ6 A;  2FCU A;  2AEY A;  3OUH A;  3R4S A;  2A6V A;  5L9R A;  1XYO A;  3VDD C;  5FPL A;  2R06 2;  4RR3 A;  5JSP A;  4HL0 A;  1ASJ 3;  3OPT A;  1K3I A;  2X5I B;  4FT8 A;  3ZVX A;  4LBO A;  2VZP A;  5C3R A;  1SLI A;  1W6M A;  2P3K A;  3WQ1 A;  4ISR A;  1GZC A;  2DVF A;  3CQO A;  4NMI A;  5FO8 B;  1OLR A;  2P6H A;  2PQQ A;  4JHZ A;  1EP0 A;  4A7Z A;  1C3H A;  4I01 A;  4DB5 A;  1FOD 1;  1ND3 A;  1VR3 A;  5CFD B;  1UIJ A;  2VVF A;  4YAR A;  3U10 A;  3LEM A;  2AYH A;  3HNY M;  1OC1 A;  3JZV A;  3Q8A A;  3ZYB A;  2VMI A;  2VQA A;  4Q4W 1;  5JSR A;  4E4D X;  1XPW A;  2V72 A;  4L9B A;  4C90 A;  2CL2 A;  2ID4 A;  5FY7 A;  1MS1 A;  1WCQ A;  2UWB A;  1RHI 2;  1UX6 A;  4JQT A;  4AEM A;  5GLZ A;  1W6O B;  2XJU A;  3GBF A;  4LQR A;  2JJ6 A;  2LRO A;  4YZ1 A;  2P5B A;  1AJO A;  1UL9 A;  1DQ6 A;  4JKL A;  4JZR A;  2D5F A;  3OTF A;  4XVH A;  5LCW L;  2XGX A;  4FQ4 A;  1ULE A;  4WVM A;  1BEV 1;  1S0I A;  4FPF A;  4DXT A;  2A7A A;  2E7A A;  1H8T B;  2JB4 A;  3T1M A;  4GXL A;  5FP8 A;  1CAX A;  1W06 A;  2QBX A;  5FYH A;  2VU9 A;  1TME 2;  2OII A;  2MEV 2;  3K3O A;  4UT5 A;  1GZW B;  2XKO A;  2BTV C;  2OPW A;  2UWA A;  1TNF A;  3PUH A;  5GJ6 A;  5A7Q A;  3W21 A;  4QM9 A;  1XYN A;  1UMH A;  1FNY A;  2XLG A;  3RJR A;  1A8D A;  5C8W A;  5IYY A;  1H4H A;  4PLM A;  1R1A 1;  1BJQ A;  5KC6 A;  3OGS A;  4JGZ A;  4R9D A;  1MAC A;  4IV3 C;  3BIE A;  3AYA A;  1W8O A;  4HVQ A;  1YIP A;  4Z82 A;  1HRV 2;  3LPF A;  3ILN A;  2SLI A;  5DAQ A;  4AHZ A;  4YVS B;  1CAU B;  3MIF A;  1JYW A;  5LRS A;  3U37 A;  1BVP 1;  3WP5 A;  4YG0 A;  1TEI A;  4ARY A;  3LSE A;  2ZPX A;  5L7O C;  4MOA A;  5SV8 A;  2N7G A;  5A33 B;  1AR6 3;  2OZ6 A;  3F2Z A;  4S2D A;  4B3N A;  1FI2 A;  1XNB A;  2BFU L;  2VXR A;  1YFX A;  3BVC A;  3RQ0 A;  4XFF A;  3ECQ A;  5KXD A;  4CPB D;  1U5Z A;  4XPV A;  2FDG A;  1TME 1;  4P9I A;  3I2K A;  2MEV 1;  1JTZ X;  1C8N A;  1GIC A;  3IDC B;  4GH4 C;  1MS3 A;  1GOF A;  2BVB A;  2RR1 1;  2C6S A;  1U12 A;  2IUW A;  2WWU A;  3M70 A;  4AG4 A;  1F8V A;  4XW3 A;  1GZT A;  1MS9 A;  4L97 A;  3ZYP A;  5A7N A;  2ZAA A;  2RMU 3;  1HRV 1;  2WNV A;  1WBL A;  2D3R A;  3ZYF A;  3NNJ A;  1EAH 2;  2JKB A;  4AI2 A;  1JI6 A;  2OUH A;  2ZGK A;  4R9C A;  3E97 A;  4FI9 A;  4XFA A;  4AQ6 A;  1W2T A;  4LK6 A;  3E6D A;  1PNG A;  1NT0 A;  1NUK A;  2C24 A;  2YZ4 A;  4LA3 A;  1AL2 2;  4NRO A;  5GLW A;  3ZYH A;  3VKF C;  1XNK A;  2EXK A;  4XXA A;  2X09 A;  1ZBE 2;  5FUN A;  3WF2 A;  2QQU A;  1CZV A;  3O1R A;  3WV6 A;  3BPS A;  3O5S A;  4RQP A;  2WLP A;  1FPN 3;  1W9T A;  4CEY B;  1SFY A;  5T54 A;  5EHD A;  1LEN A;  1JZ4 A;  1DFQ A;  1W6N A;  3KV9 A;  5L9B A;  5ABJ A;  2MHF A;  1OBN A;  5KR7 A;  4ZY9 A;  4N43 B;  4ISQ A; 
#chains in the Genus database with same CATH homology
 5C3Q A;  2CSG A;  1HB2 A;  3ZKY A;  4RGK A;  1OC1 A;  1E5S A;  1GP5 A;  3ON7 A;  1QIQ A;  1WA6 X;  1W03 A;  1W9Y A;  2WO7 A;  5C3O A;  5C3P A;  1W3X A;  2JB4 A;  1ODM A;  2Y60 A;  1W06 A;  4BB3 A;  1UOG A;  1E5R A;  2IVI B;  5C3S A;  1QJE A;  2DBI A;  2VCM A;  2IVJ A;  1W2O A;  1E5I A;  1W28 A;  1UOB A;  3OOX A;  1UZW A;  1QJF A;  1ODN A;  1DCS A;  1RXF A;  1BK0 A;  1UNB A;  4XAE A;  5APA A;  2JB8 A;  2VBP A;  1UOF A;  2BRT A;  2VAU A;  1BLZ A;  1HJF A;  2VBB A;  1W2A X;  1GP4 A;  2Y6F A;  1E5H A;  1RXG A;  1W05 A;  1GP6 A;  1UO9 A;  1W2N A;  2VBD A;  1W3V A;  1HB4 A;  3ZOI A;  3ZKU A;  1W04 A;  1IPS A;  2BJS A;  2VE1 A;  1HB1 A;  2DBN A;  1HJG A;  5C3R A;  1OBN A;  2BU9 A;  1HB3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...