2B45X

Crystal structure of an engineered uninhibited bacillus subtilis xylanase in free state
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
185
structure length
185
Chain Sequence
ASTDYWQNWTFGGGIVNAVNGSGGNYSVNWSNTGNFVVGKGWTTGSPFRTINYNAGVWAPNGNGYLTLYGWTRSPLIEYYVVDSWGTYRPTGTYKGTVKSDGGTYDIYTTTRYNAPSIDGDDTTFTQYWSVRQSKRPTGSNATITFTNHVNAWKSHGMNLGSNWAYQVMATEGYQSSGSSNVTVW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Endo-1,4-beta-xylanase A
publication title Crystal structure of the Triticum xylanse inhibitor-I in complex with bacillus subtilis xylanase
rcsb
source organism Bacillus subtilis
total genus 49
structure length 185
sequence length 185
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2005-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00457 Glyco_hydro_11 Glycosyl hydrolases family 11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2b45X00
2QZ3A 1AXKA 2Z79A 3RI8A 3WY6A 1PVXA 3WQ7A 1OLQA 3VZJA 2BWAA 4XPVA 1OA2A 3VZNA 4S2GA 2NLRA 3VHNA 1UKRA 1QH6A 3AKTA 4S2FA 3WP6A 3LB9A 1KS5A 1H4HA 3ZSEA 3AMQA 3WT3A 3WP4A 2DCJA 3MFAA 1REEA 2DCYA 3RI9A 1REDA 3VHPA 5EJ3A 3WP5A 2B46X 3MF9A 1XYPA 2C1FA 2VUJA 2VULA 3AKPA 3O7OA 4NPRA 1H0BA 2DCZA 1C5HA 1M4WA 1REFA 4S2DA 3VZMA 3HD8B 2QZ2A 1BVVA 3VLBB 1UU4A 3MFCA 4HK9A 1NLRA 1C5IA 1F5JA 3AKSA 2BW8A 3LGRA 3AMMA 4H7MA 1XNDA 3VHOA 1XNBA 3WP3A 3M4FA 1OLRA 4S2HA 1TE1B 3AMHA 2VG9A 3VZLA 1HIXA 2BWCA 1HV1A 1OA4A 3AKRA 1XNCA 3B7MA 4XQWA 2BVVA 2B42B 3WXPA 1BK1A 1QH7A 5HXVA 2DFBA 1ENXA 3AMNA 2JICA 3EXUA 4XQ4A 2D97A 2B45X 2DFCA 1BCXA 3VL8A 4HKLA 1UU6A 2JEMA 5K9YA 1XYNA 2DCKA 3WX5A 1XYOA 1H1AA 2F6BA 3VGIA 3WQ0A 5K7PA 1YNAA 3WR0A 3AKQA 1XXNA 1KS4A 3VZKA 3VL9A 2NQYA 3AMPA 1XNKA 1UU5A 1H4GA 3MF6A 1W2UA 4HK8A 1T6GC 2JENA 3WQ1A 1H8VA 3B5LB 2D98A 4XQDA 2VGDA 1IGOA 1OA3A 3VZOA 4IXLA 4HKWA 1HV0A 4HKOA
chains in the Genus database with same CATH superfamily
3IAPA 1VRH2 1O91A 2O1QA 1JODA 4JZRA 5CU1A 1LGNA 4CP9B 3FHAA 2WN3A 1UL9A 1WW7A 5ABJC 2BWAA 4CDWC 3J7LA 4M4RA 3WNLA 1I1EA 3DYOA 3J8F1 2LS6A 2NLRA 1PGW1 2RJKA 4IV1C 1UIKA 1QH6A 2ZXQA 5CFDC 3TEXA 1JBCA 3LIHA 5JPMB 4A7YA 2ZS6B 5AFBA 1DYKA 2XLGA 4J6GA 4N53B 4EWDA 1JYNA 4UF0B 2VVDA 5A3OA 3T1MA 3AFKA 4LMFA 2FZ2A 2QQUA 5D21A 1TMF1 2GC3A 4AOCA 3AKPA 5BV6A 3RJ2X 2BGPA 2WL1A 3IN9A 2HWF2 3Q9OA 4JX0A 3S5QA 1M4WA 2P37A 4FPFA 4BQXA 4XHXA 3VZLA 1PZ7A 1ZZ9A 3HD8B 5FREA 2Y6KA 2RDNA 2YBKA 4ZZ8A 2D3RA 2TUNA 3SEPA 4AYUA 3I8TA 2OPWA 1G7YA 4XJZA 3W20A 1ODMA 5A7WB 4Q4V3 1AL21 1XNDA 3T4VA 5GZCA 2JG9C 1O8SA 5F32A 2GH2A 3VBFC 3ZYIB 4IE5A 5F6LB 5EIYB 1E5RA 1DU3D 1VBA3 2OPKA 1NCQA 2YC0A 4YSFA 4RGGA 4A42A 2JDKA 1SG3A 4PBOA 3MEPA 3C8XA 1GZWA 3WNKA 5IYYA 1ND2C 4RHV1 2JE8A 3KWVA 1TG7A 4QU2A 4XFGA 1VBD1 2CU5A 1Q43A 2JDPA 5FYMA 3TAYA 1W9WA 1OA4A 2VMHA 4QM9A 3R4SA 1GU3A 4Y1YA 4Z2AA 2ZGLA 5GZEA 4Y24A 1H2KA 3WG2A 2BEOA 4F8AA 1SLCA 4AL9A 4FAHA 2H0VA 3ZXJA 2O8OA 1O6UA 5F5CA 1WMFA 1O7FA 2BYVE 4QXCA 2GZWA 1W90A 3GCWA 4XAAA 2ZACA 4YZ3A 1IKPA 2IXJA 3SITA 4EWEA 1Q5OA 1CX4A 4JCKA 4ARYA 4PT6A 4YG3A 1E5HA 2GN7A 2EXIA 3OBTA 4XTPA 5SV5A 1L7QA 2GC1A 3M3EA 2XUEA 4PIZA 1DLCA 2ETEA 1QY4A 4K3UA 3T09A 4B1MA 4X6QB 5JWPA 4QPGC 5ANQA 3O1TA 2DBNA 1RYYA 4A7KA 1PO13 2PYTA 1QJFA 1S0CA 4LHSA 4W65A 4EQVA 1XNKA 4HL0A 5FR3A 4AHXA 2PHXA 1JXNA 2W39A 3PLQA 5LY2A 5AVPA 1R081 4PHZA 1GZWB 1DHKB 1WA6X 2WS93 3KT1A 4GMP1 4XUNA 5IHRA 5LCWL 1DYPA 2D3PA 1CJPA 2C26A 2Y6FA 3PVEA 4ZXEA 5FP9A 1D0HA 5A33A 4XFBA 3U10A 3GHNA 4XACA 4B4PA 4EZHA 4JKLA 4GH4A 3JBG2 2EA7A 1LHVA 2OQ7A 2PHWA 5JR7B 2WNUA 5GZFA 3IDEA 4HG6B 1UNBA 2Q0AA 4BOWA 3QLQA 4HVRA 1OLQA 2BOIA 4JKMA 3NV4A 1Q3EA 5A7OA 3VBSB 2GC0A 5FY8A 5GLZA 3MIHA 3T2PA 3FE5A 4C8DA 4RR3A 1W6PA 3H3ZA 1YYNA 3DV8A 3ZSEA 1RUG1 5DPNA 4L11A 1NCRA 2BQPA 3AM2A 2RR11 4XHBA 5A3NA 3RI9A 4DFSA 1VAVA 2A73B 1EAH3 1SCRA 1XNAA 2OQ6A 4Y1ZA 3TNQA 4Z07A 2ZGKA 4HANA 4QDRA 1QOOA 3PVNA 4YLZA 2PHUA 1HRV2 4Z2WA 3O7OA 5KHHA 1PVC1 1OUSA 1QNWA 4YZ2A 3A23A 3BVCA 2JDYA 3MLKA 5C3OA 3H0OA 5T55A 1GZ9A 1RUJ2 3KMHA 4KBZA 4JTOA 5A33B 3MPPG 1AR63 4LO4B 4UW4A 3ORJA 1ASJ2 1GZCA 3AX4A 4MGIE 3U11A 2WNUB 1QGLA 2IFRA 1X50A 3WF0A 1IS6A 1O3RA 4X8NA 4AFAA 2QQLA 2QQOA 4NIDA 1CIWA 1AX0A 4R52A 3KHCA 2WQ8A 3HBZA 2CWMA 1UCXA 1FI2A 1RL3A 1KFUL 4RR3B 1HV1A 3AKRA 5CIRA 1JH5A 1W6PB 2VTXA 3CZJA 2R063 4K6BA 1SBEA 2HH9A 5H9RA 5E1RA 4BM8A 1NCRB 1QKQA 3IIIA 4MO3M 4TWTA 5JZGC 3SCHA 2OA2A 2DFBA 3MBWA 5FPBA 1UZYA 3CQOA 4CUBA 4K8RB 4KH9A 4I09A 3VBUB 1QWRA 4LITA 4EN7B 3D0JA 3NNLA 1QJU3 4P9JA 1NKGA 3FLPA 2XBO3 2FCTA 1CJDA 2RS33 3C2UA 2IVJA 3BPSA 2W1WA 1IPJA 1ENRA 5I93A 2RMU2 3GGLA 3VD4A 2HWE3 5F5IA 3KCYA 3OGGA 4AEKA 1XYOA 4LEJA 5DAPA 5J36A 4FP2A 1MZEA 1Z7S1 1JYIA 3TN92 1YEWA 4RFT0 2WR9A 2W68A 1BMV1 4CVUA 1Y7BA 1C8M1 3ZVXA 3TYJA 4FP3A 2ZEXA 3WNPA 3AMPA 2B39A 4D7YA 4LULA 5BNNA 5C9AA 4FTBA 3K75B 1ULEA 3MF6A 1J58A 1W2UA 2MEV3 3FJSA 4YW3A 4H7LA 3WW2A 1OVSA 4EWAA 1IPKA 5AC91 1S1AA 2JENA 2W2IA 3S6PA 2AH2A 3D82A 3GCXA 2ZBJA 3PMSA 1V0AA 5KXCA 4LK6A 4LHKA 5IK7A 4KQ7A 1IZ3A 4DUVA 1WLCA 2ZAAA 4A4AA 1RMU2 1LGBA 2ZMKA 4AQTA 1RUE1 4AE2A 4XQDA 4YRDA 3IIAA 1NE4A 2QNKA 2MPFA 4QHBA 3ILNA 3ZFFB 1R093 1EYBA 2DTWA 3EBRA 2GNMA 3PJYA 1PGW2 3W21A 5CNAA 1G86A 2UYAA 1F5FA 4DZGA 5FJKA 1CN1A 1OVPA 2ZPXA 4YGEA 5LB6A 3AKTA 1EV11 3M3OA 4XETA 3VBRA 2ZHLA 4JGYA 5F3CA 4KGQA 2D5HA 2VXJA 3CHXA 3WP4A 3HN3A 4R8HA 1KEXA 2WZR1 1TMF2 4PDWA 2YROA 4YVSC 3USUA 3ZLIA 4BQ5A 1FNYA 4BQWA 4M0NA 5C9AB 1XB9A 5BNNB 4OHZA 4INDA 3DEMA 4DQAA 3MV01 5FMDA 2WO1A 5FZMA 4CDQA 1ULGA 2DCZA 4JGZA 3PUAA 3BTZA 1U5XA 2ERFA 3WV6A 3O1OA 4XDPA 2KA3A 2RS52 1PX3A 2DVGA 2AZ5A 1HXS1 2AENA 2A1XA 2EVXA 2HWC1 3ENRA 5GM0A 4BK5A 1AL22 5LBEA 4Q27A 4Y5Z0 1DGWA 4M3CF 3VKNA 2QQVA 4N7UA 3DN7A 4COZA 4E8DA 2BW8A 5B4NA 3C7FA 4GWNA 1PGL1 1IPSA 5LBCA 4Z1VA 4MXWA 3U07A 5JOYA 1NY71 4QXBA 2R071 4RHV2 1FYUA 3OY8A 1VBD2 2G1MA 4O9EA 2CSGA 2W47A 2EIDA 1WCUA 3CNAA 4GJZA 4XZPA 2R30A 2ZAHA 3A0KA 5IVEA 2YBSA 1AJKA 3VBRB 4GIQA 4TTGA 1DCSA 4RA0A 3WG4A 4GZ9A 3MIEA 2BERA 4PDWB 3AZZA 2NYYA 3USUB 1EUTA 2KXLA 3ACFA 4XUQA 2C24A 3UKNA 3UT0A 3MICA 3H1YA 3H7JA 5G04L 3N9MA 4RQPC 1V6NA 2WYSA 4LO6B 2Y33A 2WLQA 2YV8A 5FZBA 5BY5A 3PMEA 2PLV1 2RS13 3QD6A 5F6KA 3SH4A 4CDQB 1PIV3 2V5DA 2ZCWA 2VVFA 4JGZB 4NWVA 4XCAA 4BQYA 1SLAA 2K46A 5FTTC 2CHHA 4FT8A 1YQ2A 5KXEA 5CFCA 4XTMA 2NZ9A 5A1FA 2Q1MA 3USSA 4QX2A 1DQ4A 1W2TA 4GULA 4GWJA 1TEIA 1R082 2HBTA 3KV6A 3CBNA 4F3JA 4MGKE 4MXWB 5FYHA 4META 3ACHA 2VBBA 1FMD3 4WM7C 3UJQA 2I07B 5F7UA 5T3NA 3OY8B 2B9VA 2MNGA 2WFF3 1SLBA 5FMBA 4BDVB 4BZ4A 5HCAA 5CG8A 2WABA 4IEVA 1QJY3 2DUPA 2WSVA 3JCIA 3L9JT 5FYTA 1QIQA 4E4ZA 1LJ7A 5IVFA 1H8TA 4OI0A 1W8HA 5DABA 2LW8A 1POV3 3LEIA 4OUEA 2GC2A 3AZXA 5DXDA 4DRRA 4NIHA 4MHUA 1ZBA2 3SCFA 1OQDA 1RHI1 2HEWF 4JQTA 2JX9A 5FYVA 1LECA 1QNYA 1OA3A 5JR2A 1YFXA 3B01A 2F4PA 1HV0A 2PHDA 3QH7A 1AXKA 1DFQA 1H6XA 2W95A 2D5FA 1GP5A 2W94A 2XUMA 5FLIA 1OI6A 1G9FA 2QKDA 4CEWC 3RDIA 4I02A 1JYTA 2JWPA 2QDNA 5FIXA 3SC7X 1RUG2 2RVAA 3AYAA 4FBFA 5JXHA 1MS4A 1CQ9A 1O4YA 1US3A 2RR12 2XJTA 4XF1A 4Y22A 1U12A 3ZSLA 5CFCB 2PA7A 5JPNB 5FZGA 2DCJA 1HB4A 2B5HA 3RZMA 1UZ0A 3ZR6A 5JUVA 4NE9A 1RUD1 2W3JA 2B46X 1ND3A 4PLMA 1PVC2 2BNOA 2ZGRA 3O1PA 4V2WA 3B9CA 1H2MA 3J7NA 4BA6A 5C71A 1YI9A 3SHRA 4D7TA 1C5HA 5FPXA 4HLTA 1NQDA 4WM8C 4A6SA 1UMIA 4CCCA 3K3NA 3KCXA 4NVPA 4TLGA 4UW3A 1H8TB 2YY1A 4ASMB 2D6OX 2QCSB 1HQNA 1UOJA 4MUVA 2VE1A 2A6WA 1FNZA 1J3RA 3AKSA 4UFLA 1VIWB 5H9QA 4H3WA 5IFPA 4ATEA 1K3IA 4EN0A 4CCKA 2WQZC 2I74A 4GQ7A 3H3LA 2JIGA 1CZTA 3GNEA 3K2OA 3LSEA 2DVAA 1FPN3 4PF1A 1RVF3 3H1WA 3RYPA 3R4UA 4QPWA 1O3SA 5L7OC 2NN8A 1IG3A 2VG9A 4LBLA 4Q4V1 4BLIA 4C0HA 5FZLA 1PX4A 2WNEA 3KV4A 4HXCA 5A3LA 2VL4A 4Y22B 2X10A 3B7MA 1XNCA 1VBA1 2H6BA 3ZSJA 3PJQA 5CG9A 3U14A 4DY3A 5H9PA 5JDBA 5FMCA 3RJRA 4YVWC 1N3PA 3A0NA 4UBGA 3UGFA 2J22A 1ZZCA 2ILMA 4GB31 2EAKA 2Y6HA 1ND3B 4P08A 3WCSA 4R9DA 4RFRB 3R4DB 4FPKA 2LTNA 1ZA4A 3I3QA 3POJA 5A1AA 2R0HA 2GMMA 2ZHMA 1XE0A 4ISQA 1Z7S2 2EIGA 4QPYA 4ZHNA 2VZPA 4HKLA 3RMXA 1Q8SA 4Q8LA 1YJLA 1XYNA 4R9AA 3FBYA 4DMIA 1YC61 3EHKA 3WQ0A 5J96B 1BMV2 4YW1A 1R1A3 1C8M2 4XABA 1U5IA 4OQ8A 3RQ0A 2VNGA 2Z42A 2WA4A 3AP9A 3HPNA 2WT0A 1WCKA 2E31A 3CEWA 3B69A 1PNGA 3Q8EA 4YG0A 2PMWB 2HWB1 3O12A 5F2SA 4AEMA 1OLME 1PZ9A 4CCMA 1AR73 1XJAA 2BU9A 5JMCA 4RSUA 5J3UA 4IEYA 5C3RA 1VMFA 1JOJA 2XMLA 1RUE2 1UD1A 1JZ6A 4G4FA 3HIFA 3VDDC 1NE6A 4IEWA 1NAEA 3WW4A 3OEBA 3QBQA 4AEDA 1IGOA 3BCWA 2XL7A 1W8ZA 4BQ2A 2PAMA 1EUUA 2YHJA 2Z79A 3WNOA 5DUWA 3VHRA 3T2QA 1NX9A 4JRAA 1QDOA 4K21A 2IZWA 3NW4A 1EV12 4Q4X3 4QKBA 1G9AA 4XFFA 1RUF3 1YIFA 3HNYM 4UXAA 4N9IA 1CAWB 1DGRN 3ZX7A 3S7EA 4LXLA 3TNPB 2WZR2 3K46A 5HXMA 5FYBA 5HV0A 2JDAA 4LE3A 3JQXA 2WYFA 5KHJA 5DUUA 3DPRA 3AP5A 2SLIA 4IV3B 2RE9A 1CAVA 2E7TA 1W9FA 5F9TA 5D1IA 3UJOA 3VBOC 1SDDB 2CWSA 3ACIA 2WRAA 1W05A 3ACLA 1F31A 2Y26A 4PLNA 1HXS2 1FX5A 2JDHA 2HWC2 1CZSA 4NAMA 2EICA 2YYOA 5ISLA 1YFYA 3NWKA 1QJZA 4Q1RA 5F5AA 1PGL2 4LORA 1GICA 1F4HA 4LO5B 1HQWA 2W5FA 4HK9A 2YU1A 2P6CA 3CIHA 2OUJA 1NY72 1F2NA 4LBKA 4NUBA 2R072 4AEDB 2A3WA 2ZA9A 1JW6A 1TME1 4W4ZA 3UGHA 5I0DA 2FDGA 4MV2A 2VW1A 5DG1A 3CJXA 4N53C 2YC2A 1HRI3 4LLOA 2FBEA 4EN9B 5LZ6A 4OZOA 1IKQA 1HDKA 3T3YA 5FLJA 2DWRA 4QT6A 4IEOA 4ASLA 3WF1A 1DG6A 2VCAA 1AR61 2TNFA 4QQLA 3KT4A 5FP7A 4WVMA 1V6IA 3I49A 1RINA 2ID4A 4DRVA 5I0RA 4R4XA 3WOGA 2E7QA 4B4QA 4ZPIA 2WDBA 4C91A 4LPLA 3NVCA 4DO0A 2VM9A 2Y38A 1QH7A 2PHTA 2O14A 2VOWA 1LHWA 1PMHX 2XLFA 4FOWA 3X29B 3WZ1A 2AR6A 1ZBE3 3BU7A 2PLV2 1B09A 5A70A 4GAZA 4BE3A 2HKXA 4CEYC 4CDUA 2DFCA 3K48A 5FY1A 4R4ZA 1RUJ1 1SFNA 2OIIA 4KBBA 4MYEA 4RGAA 4BQ4A 1JUHA 5FZDA 1GFF2 4I30A 4GD4A 1UU6A 1AR81 2VW0A 2LM3A 5A7PA 4DINB 2F17A 2A6VA 1WCQA 2YG0A 2ARBA 3M2MA 3KM5A 4ZU7A 2XXZA 5BNPA 1K45A 2D93A 2XBO1 4GMP0 1JMUB 1HKDA 5BPXA 4JTNA 1FV3A 5GLWA 1CAXA 3N7LA 2NMNA 1D4M2 1QXRA 4FOYA 1WMXA 2YUEA 1W6OA 3D5OA 3HAGA 5FRAA 3PIGA 4I3GA 1DLLA 1COV3 2XWJB 3M7AA 3GBFA 2A5ZA 2VCMA 1ACCA 1RHI2 1E57A 1KJRA 3B5LB 4N9HA 2VVEA 4O61A 5F39A 4CE8A 3N9OA 2RM23 4E4HA 3LF7A 1LRHA 5FXZA 2G4IA 3FHQA 1NXD1 3LDKA 4IE7A 3P6BA 4QQOA 1AYM1 1KQRA 4HKOA 1IS3A 4L99A 5IK4A 4CDUB 2OXBA 5DDJ1 5HCHA 2CDPA 4Y26A 1VB4A 5CKQA 1WZXA 4Q0SA 4XJWA 1O3TA 2Y6JA 1Q8OA 3EJKA 4IE4A 3KF5A 3AFGA 3LB9A 1H4HA 4LNVA 3TOJA 4UFKA 5E88A 2VUDA 1F35A 5KHKA 4YM1A 3SKJE 2ZHNA 1REEA 4P9LA 5BNPB 2YU2A 2R7EB 3GZTB 4AVBA 3MHZA 1FT9A 1PM7A 3AP6A 1OFNA 1CAXB 4AGRA 3ITQA 1VP6A 1C4RA 4LKEA 4LQRA 3RS6A 1W6OB 1QEXA 5CYYA 1RTVA 4K20A 4L92A 2ARCA 2QQKA 5T54A 4W6XA 2CL2A 3BIEA 1NZCA 3E1F1 4XEZA 4HETA 2AREA 2IVIB 3ZFGA 3VBSC 4OHWA 5BNOA 1X82A 5D8AA 1NLRA 3RNSA 3IM0A 3ACGA 2VCBA 4Z82A 1LAJA 3O14A 2VBDA 3POSA 1B35A 2WAOA 3QH6A 3M3QA 4RS5A 3NKTA 3H8UA 1ZZBA 2VZSA 5EQUA 1V9U3 1CPNA 3JB4C 4AFCA 4Q4V2 1Z0HA 1SMVA 2JB4A 2VXRA 2VZOA 2ZGNA 3POIA 1WD4A 3SH5A 2LRPA 4V2VA 4I0AA 1GP6A 3T0BA 1VBA2 4PLOA 4AF9A 4OCTA 4BIOA 3PUHA 4Q26A 2XJQA 2IXKA 2WWUA 5A3WA 5EWSA 3S0MA 4GB32 2BFUL 1PO21 2ZZJA 4DUWA 2J1TA 2KR2A 5IVYA 3IMMA 2EXKA 4FI9A 3Q8FA 3VDBA 4AXOA 3WNMA 4XBLA 2D97A 2RS51 3B9IA 4FTEA 3NMBA 3T08A 4YM0A 1OH3A 4TSVA 3ZN6A 1GNHA 4ZU5A 1MVQA 3LPFA 1UQXA 2WNVA 3ME2A 3NKGA 1CIYA 3VL8A 5C8CA 4LKDA 2VMCA 5E89A 3NV1A 2E7AA 1PGSA 2XOMA 1MVEA 2KM2A 2PHRA 2Q4SA 4N43A 3ZFGB 4E4DX 5BNOB 2VZUA 2RS11 4RR3C 5FZ3A 3EQEA 5FKCA 2HWB2 4URAA 3GBWA 3NV2A 3K4ZA 2RG4A 3KV5A 4A2UA 2CYFA 4RS5B 1B35B 4OI4A 3URFA 4WVWA 5FP4A 1J1LA 2NQYA 4MOAA 3RZZA 1LEDA 4A3ZA 3PVBB 2DURA 2GSYA 5L36A 1H30A 1PO12 2VQUA 3VBUC 1W3VA 3V56A 1JZ8A 4YNIA 2W92A 3DKWA 2EIEA 1FMD1 2VMDA 3ZIXA 1GWKA 5IW0A 2HWF3 5B4XA 4HFSA 4YM3A 3E6CC 2VGDA 1UY2A 4K7JA 3POFA 3OJBA 4ASKA 4HKWA 1WW5A 5JI9A 4ES8A 2ZGUA 3B93A 3RI8A 4L97A 3THDA 4LKFA 2VOVA 2P17A 1VBE1 1W8NA 1STMA 3C7HA 4HBNA 3N35A 5F3GA 3O0WA 3RWKX 1Y43B 4AR2A 5JSOA 1ZA7A 5C8CB 1UX6A 4AZZA 3TB0A 1NZIA 3VKMA 1NCQB 1RC6A 5EP9A 3BTXA 4QDSA 2VOXA 1GOHA 2P5BA 5L9BA 4CDWA 1K12A 2ARXA 2DCYA 3MW2A 1NXMA 4Z8BA 5KC5A 3Q8AA 4IV1A 4MSVA 1HJFA 2WZEA 2JDNA 5JIAA 5CFDA 5CKNA 1JZ2A 1CPMA 5HV4A 2E6VA 4OHXA 3ZFFC 5JCTA 1NYWA 4EJRA 2D44A 3O1VA 2BDRA 4NWWA 1ZBA1 4V1PA 1W9TA 3OPWA 1N1TA 5GJ6A 5CA6A 4B4RA 5FZAA 3IKWA 5CBLA 3A7QA 2D6MA 3SQOA 1BVVA 4QX3A 2R49A 1CR7A 1TME2 2XL9A 3ZYGA 1W99A 3ZSKA 4AQ2A 5C4WA 3QOPA 4BHPA 1C5IA 1PHMA 2WBKA 3POBA 1HQLA 4ZU4A 4A3XA 2A3XA 4HOOA 3TRSB 1RUNA 1OPOA 2A6ZA 3HJRA 3WP3A 2XG3A 3BPZA 1AR62 4CTEA 1SFYA 4CCEA 2LUWA 4WV8A 4AWDA 3ILRA 5A3UA 4HPKA 5FBZA 1URXA 3OBAA 3OD4A 4JQRA 4CCOA 5E8AA 2XQXA 1BVP1 1XU1A 1KRIA 2DU1A 1CD3G 3I2FA 3OCPA 1HIXA 1O5UA 1LOFC 1S2KA 2WT1A 5BUVA 4Y4YA 1QQP3 4COVA 5FQ0A 3HR9A 4CRQA 4CUGA 2R041 5FMOL 1RVF1 3ZDSA 2WSUA 2JD4A 4M4PA 4CDWB 1IOAA 3SMHA 1FOD1 2JG8A 2VR4A 1JZ3A 2VPVA 4NROA 1Y4WA 4UWDA 1CAUA 3IZOA 4URTA 5JSPA 3LD8A 5GZGA 2GMEA 5JOWA 1AR82 2Y0IA 4GH4B 3OUHA 3ZN5A 4D6RA 3SNMA 4AI3A 4LBOA 2R1DA 3JBG3 2OYZA 5KWRA 5EV7A 1YIPA 3NJXA 2XBO2 4L0PA 5FZ1A 2VD7A 1LB2A 3HOBA 4IEZA 3TEYA 4I3PA 5FPUA 2HWE2 3ZXDA 2JDMA 4QWNA 5C4WB 2ZEZA 4ZS3A 3HQRA 3VBRC 2D6KA 3DGTA 4CZSA 2BJSA 1AXYA 1KGYA 1MEC3 1NG0A 3WQ1A 1JYWA 3OEAA 2WQ4A 2DUOA 4W8JA 5F37A 4PDWC 2P3IA 2XVGA 1ONAA 1R1A1 1W04A 4HPKB 3V0AA 2DU0A 2XJUA 4KL1A 1RUC3 1OFSA 3I2OA 4LKSA 4QPGA 1RXFA 3SXWA 2UU8A 4CDQC 2HWD1 3J4UH 4JGZC 1OKQA 1HB1A 3CU7A 1HRV3 3I2IA 4FFGA 4IUGA 4XJ9A 5FAXA 5FQ0B 3ZKUA 3VD9A 1AYM2 1AR71 2N7GA 4ITCA 5FZ8A 5JSRA 1V6LA 2GP5A 4H14A 1G8WA 4B7KA 1A78A 5DDJ2 4LJHA 3E5UA 3LDBA 3KVAA 5EPAA 3U78A 2JG8B 2FMDA 3POGA 3AZVA 4XILA 1OPMA 3H9AA 1CAUB 3ZYFA 1NOVA 4A41A 3IT8A 1GOGA 3R0RA 4G9SB 1R64A 1O8PA 3M3CA 4AAXA 4XPVA 1BBT1 5EYYA 1ASJ3 5KHIA 3HMYA 3SEEA 1H2NA 4FOQA 2W0XA 2E9QA 4S2FA 1GLHA 1I3HA 3JD73 4E2GA 4LIVA 4QX5A 4KGGA 1AX1A 2C5DA 3AMQA 1W8TA 4A45A 5J37A 1RUF1 2CY6A 2FDKA 2D40A 4FPGA 3PTRB 4KWUA 4XDQA 3W59A 5FZ6A 2BNNA 2E33A 2VECA 3V0AB 4KWKA 1OD5A 1DF0A 1D2SA 4QPGB 1ZNPA 3KGLA 4PI0A 2ZKNA 2ZMNA 2BBAA 1MZFA 1SLTA 1I9RA 2H6CA 2WWJA 2BP6A 1JOPA 2JE7A 2PTMA 2WINB 3O0VA 4H7MA 3N9QA 5A7QA 5FP8A 5CFCC 5FPAA 2RMU3 2Z5WA 1C28A 2ZEWA 3M4FA 4Y3OA 4KNCA 2VQTA 1ENSA 4I2OA 4HSLA 4CYDA 3WDXA 2XJRA 4FFHA 4IEPA 2HJIA 5SV8A 1LGCA 1PNFA 4P02B 4XVHA 3VDCA 2QQPA 4CPBA 5FBJA 2VMEA 5FZ0A 1PO22 1OD3A 2ENRA 4QXHA 3T30A 2ZGOA 4Y20A 1LOEA 2QQJA 2FMYA 4JDMA 3I2DA 1HRI1 2OZJA 5IT6A 1D0GA 1S0GA 1W2NA 2B42B 2UWCA 3GZUC 1ZREA 1J84A 3N4MA 1UYXA 1H8TC 2CAUA 2BZDA 3BTYA 2K9ZA 3VV1A 5T5LA 4M0HA 4MGQA 1H6YA 1RMU3 3OGRA 1BYHA 2AUYA 4XYXA 3IPVA 4YM2A 1ZBE1 5A6XA 2JEMA 2RS12 4FAGA 4NR1A 4ZXKA 2J1RA 2GDFA 3J8F3 2CV6A 2F6BA 3LZZA 3BALA 3IWZA 2UY9A 3T2OA 4FPYA 4FSJA 4W6WA 1UW8A 3N7KA 5FMOS 2X5IA 1Q8PA 5FKBA 5FCCA 3H8XA 1W28A 3VZKA 4LA2A 4CPBD 3NNJA 4JGYB 4CUAA 4P5YA 3MO4A 1NLSA 2IXCA 3PUQA 4M00A 1ND3C 4D8MA 1HN0A 1FMD2 3AZYA 2DVDA 4ZS2A 1WW4A 1O3QA 2ES3A 1MQTA 3L2YA 3E5QA 4Y20B 1RJ8A 3I7DA 4E2QA 1LHNA 1GUIA 4NIIA 5ABJB 2B4KA 1ZZ8A 2KD7A 3ZR5A 1KJLA 4XUTA 1VBE2 4B3NA 2ZX2A 3AJYA 3AYDA 1VBC1 3ZMNA 3O1SA 2WWSA 1QOTA 2FDHA 2K0GA 3HNBM 1AL23 3O0XA 4QD2A 2Y8KA 4KWJA 4LIUA 1A8MA 2RM21 1UZZA 3AK0A 3WG1A 4B29A 3KQ4B 1DQ0A 3IPVB 2AYHA 1EPZA 2Y60A 4CDXA 4KWLA 3HN1A 5FYUA 2ZMLA 2VAUA 3ELNA 1D4M1 4Q4Y1 4KU8A 1WLWA 2A70A 3F2ZA 3WT3A 4BXFA 3ZSMA 2ADDA 1REDA 2X5IB 4LBJA 4NJ4A 2DF7A 1SLLA 3OUJA 3W5MA 2XDVA 1SACA 2NMOA 3M8LA 3C7EA 4CU8A 2WN2A 5J09A 4K40A 2VULA 2VTFA 1YFUA 1DGLA 4NPRA 4FVVA 4YVSA 4I01A 1DQ1A 1VR3A 1RUH3 5FZ9A 2B8MA 3LEGA 4Q1PA 3ZPOA 3PTYA 5FXWA 4ZZ5A 2CGPA 1MQTB 5G05L 4NHLA 5C3PA 4NIGA 4RD7A 4XXAA 3FC0A 2VZVA 4OMDA 2Y6LA 1C3HA 3LGRA 2OS2A 3AMMA 4XDOA 2YXSA 1SQ4A 1K5MA 2XR4A 1KITA 4QPIA 4ARXA 1RXGA 4IV3C 1PK6A 3FZ3A 3JUUA 5FY0A 5JAXA 3NJVA 2P3YA 3H50A 3MIBA 2UURA 1OC1A 4MZUA 3WG3A 5JXJA 3UNPA 1GNYA 2B7YA 1JUIA 1FPN2 3RMYA 2R042 2VMFA 1RVF2 3LAGA 4CDXB 5A32A 4LTAA 1LTEA 2WZPP 4XQWA 1FOD2 1J83A 4Q0QA 3N9LA 1K5JA 2BVVA 1V70A 2WO3A 1ENQA 1MZ6A 4NHKA 4GMP3 3OTFA 1YLLA 4QX0A 3ZXLA 1ENXA 3MUY1 3U75A 2XHKA 4PBPA 2JICA 2ZKLA 4QX7A 4O7XA 4ZONA 4YZ1A 4LBQA 5J1XA 3HT2A 5FZFA 3DF0A 3IDCB 4AEDC 1GV9A 5C3QA 2ZEYA 3H8RA 2J1UA 3GDBA 3K4AA 3I2GA 5FPLA 1X9PA 4P9GA 1XOYA 3W5NA 5HI0A 4IGOA 2DTYA 2Q30A 3FFQA 3WDVA 1DYOA 5FZ7A 1JYXA 5LY1A 1G9DA 1WCSA 5FYSA 2CAVA 4YW2A 4OZXA 5DZEA 3HNMA 1XBFA 4PCRA 1H1IA 3WDUA 1PZ8A 3EYPA 3ZO0B 1XXNA 1R1A2 2ZGTA 2RR13 3J9SA 1K5MB 1W6MA 4BMBA 2K2SA 2ZX4A 3VBHC 3LA2A 4QPIB 3I2HA 1PK6B 3KD4A 4D3WA 2HWD2 3BTAA 4YPJA 3OPZA 1WMDA 1AR72 3P3NA 1HJGA 3Q8BA 4X6RB 1PVC3 3AYCA 3W58A 1UPIA 1V6OA 3AP4A 3GM8A 4WM7A 4HSJA 4LBQD 1H8VA 4HMZA 5I0SA 3S5AA 1YQCA 5FDBA 3ZMOA 3BUCA 5FK8A 5K4LA 3E5XA 3M70A 2QUOA 4Y1VA 5ANNA 4XC9A 3AL5A 2QZ3A 4LBQB 1BBT2 3WVJA 3ZOIA 4CU9A 4SBVA 1CONA 1I5PA 3U4SA 3OG2A 1OQEA 5LA9A 2W46A 1DZTA 4K8FA 4L2NA 5FY4A 1G6NA 2D6PA 3RZLA 4S2GA 4COYA 4Q4X2 3ZFEA 2YFUA 4KI5M 1HLCA 1RUF2 4XXPA 2JD9A 1OF4A 5FZKA 3WINE 4FPCA 4E9KA 5HBAA 1PO11 3WUCA 4TXWA 1SCSA 2GU9A 3CMGA 3MPBA 4B7EA 5CEHA 1XYPA 4UOJA 4UFHA 4BB3A 1W6MB 1UYYA 3D4KA 2G9GA 4Q4W3 5FY5A 5I0UA 3VN4A 3WQBA 3OD0A 2PQSA 4Y33A 4AVCA 4Q2FA 4XF9A 3HEIA 1SEFA 2WS91 4EV0A 1S2EA 3FWEA 3CJIA 5E6HA 1XNTA 2AEYA 3PURA 4CDUC 1GWMA 4S2DA 5FOBB 4WM7B 1JHJA 3WEZA 1VLNA 4AQ6A 1LR5A 1QDCA 3ZXAC 1LCLA 1YCIA 4WM8A 1UMZA 2C9AA 5IUQA 1NA1A 5BNPC 3THCA 1ZX5A 3UKVA 3AJZA 1OLRA 3CO2A 3OGJA 4S2HA 3OUIA 3U37A 1AVBA 5IVVA 4QKDA 3J7MA 3AMHA 3LKJA 5FY9A 1HRI2 3WF4A 4BPZA 5FO9B 1BKZA 1WUVA 4LR4A 2PAEA 1LHOA 1RJ7A 1XSQA 3POYA 5CVRA 5JMOA 3LEKA 3WNXA 1AHSA 2BWCA 4IEXA 1GOFA 3ZFEB 5AC93 2HLEA 2E32A 4R9CA 1EAH1 3CL1A 4UBHA 2X29A 5C5UA 4FO9A 1WBLA 4E27A 4CP2A 4CCDA 1YXWA 2O0OA 3ZXGA 4SLIA 5A7NA 2BVBA 5DAXA 2YC4A 5I8SA 5ACA3 1WLTA 2YPDA 5TSWA 2OW4A 1QQP1 5JIUA 1ZBE2 5JI7A 3C3VA 3LWCA 2JKBA 2W91A 3UETA 4C1XA 4YVWA 3CJIB 5KBFA 1UYPA 2A71A 4IEQA 1CVNA 5K9YA 2DCKA 4D69A 2C4XA 1LENA 3GJBA 5FUIA 3GXUA 1LHUA 2VNOA 5CZKA 1P8JA 1W0PA 3PU8A 5K7PA 3RVHA 1Q8VA 2UWBA 2BGCA 1EV13 4PIYA 1HB3A 2P6HA 5A6ZA 1S0FA 4AI8A 2CDOA 2J7MA 3B3QE 3OPTA 4KG8A 1NA1B 2ET1A 4WM8B 4QQPA 3VL9A 3CDZB 2P2KA 5FOJB 2PFWA 2WO7A 2WZR3 2Y64A 4NMIA 5LRRA 1F4AA 1DQ2A 5FZOA 3WLUA 4QB6A 5A80A 3DPRB 4DEQA 1MS9A 2ORXA 5IVJA 4CXYA 1XQNA 1CAVB 2V5YA 3FHIB 1ZZ6A 3H42B 3WUDA 4AVSA 1A8DA 1MEC1 2R061 2GMPA 2R16A 3OF1A 5KC6A 4BLJA 2J1EA 1QJX3 1UWWA 3HT1A 1TQ5A 1ZRRA 4E8CA 1VBC2 2ZGQA 1BZWA 2HWC3 3UK9A 3KF3A 1LOCA 3ZFGC 5BNOC 4MH0E 4QKNA 2A6YA 2JKXA 1QJU1 4Y5SA 4LE4A 5LASA 1OT5A 5CISA 5LEJA 2RM22 1N1SA 1K42A 2RS31 4RS5C 1B35C 3T0DA 2Q8OA 4UFIA 4AGGA 3VZJA 2HWE1 2R073 4Q4Y2 3KSCA 1ZYBA 3KB5A 2LROA 3NAPA 4YG6A 4EE2A 1Y9GA 5M0TA 2D3SA 3GHMA 3ZYJB 1D4VB 1AZDA 4WVMB 4Y4RA 5I8TA 3ILFA 4NHYA 5GKAC 4LHLA 2RDRA 3RG0A 4CCNA 4MX3A 2FHRA 2Z69A 2H0BA 2MEV1 1DQ5A 3JD71 4FXGB 5C5TA 2I2SA 3VKOA 5LA0A 3K51A 5T5PA 1W39A 2CGOA 1RGSA 2VNRA 2WO2A 5FZOB 1AR93 3E6BA 5DUVA 1ZRIA 2I45A 3ST7A 4YARA 2RJLA 5C6CA 1GQGA 3VBOA 2AEZA 4XCBA 3OBRA 3GALA 1FATA 3T0AA 4XMIA 5C8CC 1W8FA 4MVTA 3U1XA 1R091 4JRLA 1NCQC 1F5JA 4D6SA 4Q0VA 2Q1FA 1C8NA 1N3QA 3N3HA 4MGYE 4Y5TA 3SISA 2QQMA 4R9BA 1YQ6A 5DAWA 4G3YC 1TVGA 1MPXA 2IWGB 5DN2A 4AW7A 4C90A 4FPHA 4M3CA 3SKVA 1N3OA 4Q29A 1AYN3 4DXRA 3ALQA 5EJZB 2V4VA 4XFAA 5IJRA 1NUKA 4P5HA 5LA1A 2C6SA 3GJAA 3RFRA 4P14A 4Q0UA 2D6LX 4XIOA 3ZIWA 1ULOA 2YB7A 1HN1A 1ZRCA 5A3PA 1ALYA 3NAPB 1EP0A 4NRMA 1F15A 2JECA 2FD8A 4XUOA 3S30A 2TBVA 3FMGA 4BYYA 4AQSA 1JTZX 3KT7A 2EALA 4WZCA 1LNSA 4AI0A 1UY4A 1BEV3 5A7SA 5FP3A 4ORFA 3P3PA 4YFWA 3LPGA 4AI9A 4QX8A 4BH9A 4FFIA 3G6JB 3OSDA 4AAPA 3TBDA 1VBB3 1RUI3 3MZHA 1LOAA 4FTSA 4CEYA 2F4LA 3VBOB 1H1AA 1WWYA 2VQ0A 3I54A 5FZHA 4CA9A 1XRUA 3V0BA 2Y34A 5FXVA 2V73A 2V09A 5LBFA 1OH4A 1AXZA 4IE0A 2Y6GA 1S55A 2GALA 4NAOA 3MIGA 4PJYA 1VALA 4M3CB 5DZFA 1RUD3 1ZZ7A 1U5YA 3Q8CA 1L3JA 4ES9A 4AVTA 4KMQA 3TEWA 3M1HA 3BN6A 1VAMA 5GALA 4GH4C 2ZX3A 2Y0OA 5DAVA 1OOPA 4OMCA 1JS9A 2WNUC 3LA3A 4GALA 3AZWA 3LCPA 5IATA 4FOVA 3O1RA 4M01A 1VRH3 2WT2A 2OUHA 4I0BA 5C4WC 2RDQA 5D8AB 4BWOA 4EZ4A 1PIV1 2AACA 4HVOA 4QAWA 1PVXA 5F3IA 5B2GB 4YZ4A 4QDQA 5GLUA 5DZGA 1NCRC 2NM1A 2G9FA 3NL1A 4XIKA 3IAQA 3PUIA 5A6YA 3APBA 2X05A 3MGUA 3FLRA 5K0UA 1OLMA 1QU0A 4OI2A 4MXVA 4CEYB 1Y9QA 2JDZA 1S0EA 1GBGA 3FUQA 5C8WA 3V0BB 2TEPA 1W8OA 2PHLA 2DUQA 3VHPA 2VZ3A 2W1SA 4U2AA 5EJ3A 3DXUA 2PN5A 2WS92 1S0IA 1H9PA 2WFF1 3NNGA 1ULCA 3NQHA 2IUWA 4DIQA 4GB33 2JG8C 3IDAA 4GKYA 1QJY1 4IETA 4D0QA 1OXCA 2DDUA 1OSGA 2Q5TA 1REFA 1POV1 3FUOA 3TEZA 4CUCA 3VB9A 2QZ2A 4DY5A 1OOPB 3ZN6B 2X53S 2J1SA 3GYDA 4AFMA 1W6QA 3ZXEA 2WNVB 4QMAA 4WVZA 3ZXFA 1G9CA 2HEVF 3HQUA 5DUXA 3VD7A 1RUH1 1DQ6A 4N43B 2J1AA 3S57A 1J59A 4F83A 3O5SA 3VBSA 5ABJA 3GZAA 5LA2A 2B9UA 2VBPA 5IFTA 1FXZA 4XF4A 2UYBA 2BNMA 4IESA 2HWB3 4XAEA 4CCJA 3DCQA 4OHVA 3KHBA 1UOGA 3EMRA 1EAH2 2RHPA 4YYOA 5CAZA 1POQA 3ASIA 5K0UB 5LEKA 3H7YA 1UIJA 2VZRA 3N7MA 3RPQA 2D7FA 5K8SA 4AEJA 5LWBA 2LALA 5BNQA 5FYYA 2CNAA 4QKFA 1QQP2 3MLJA 2DVFA 3B02A 2XB6C 4CU6A 1DP0A 1BLZA 3ECQA 4LOTA 2R6QA 5L73A 3K3OA 3K4DA 5D2AA 4YZ5A 2B45X 2BPA2 1BCXA 4YGDA 1V00A 1T2XA 4BQ3A 1UOFA 4PI2A 5L9VA 1E5IA 3HQXA 1M06G 4EN6B 1DZRA 5C9AC 2C9KA 4CP1A 5BNNC 2XJPA 2JIJA 4AVAA 4PIXA 1W6QB 2JG9A 3OGSA 1W06A 3VBFA 3FBMA 3NNFA 4QQ2A 4BIFA 3I3DA 3ROUA 4ET7A 2BOJA 2HBUA 1ZVFA 5A6QA 3AP7A 5FZCA 3RYKA 1FPN1 5BYNA 3BOWA 2XKOA 2QJVA 1US2A 3JU9A 1MEC2 3MV11 5GLTA 2R062 3POWA 1N47A 1JZ7A 1ND2A 1WGPA 1UMHA 1H4GA 5FYCA 4IV1B 4BMEA 2VZ1A 2ZTNA 1T6GC 5IK5A 4QXKA 5CFDB 2R0FA 1RUC2 3MI8A 2W87A 1QJU2 2W08A 3VBUA 4C0BA 2AC1A 4J1WA 2VTXJ 4FQZA 2D98A 2RS32 1O5LA 4U36A 4UYBA 3ZPYA 5C70A 1UZWA 2ORZA 3J7HA 1N1YA 3NNMA 2YGMA 4P9XA 3T4HB 3UESA 1IS5A 1GP4A 2BFUS 1TME3 1XU2A 3WQ7A 3BGAA 1X33A 3HWJA 2VC9A 3KGZA 1VPHA 2IXIA 4JGYC 5FV3A 3THPA 3AVSA 5FUNA 5IWFA 5FK7A 1C57A 3JQWA 5A3TA 3PNAA 3RSJA 5FUPA 1X8MA 2GAUA 3WP6A 1KS5A 4NPLA 5F1RA 4QB1A 2IC1A 1CGPA 3UL2A 1PMIA 4IQPA 3T2TA 3MFAA 2JG9B 2MEV2 3JD72 5FPVA 1IQAA 3VBFB 1IG0A 1ULPA 1V6KA 5FZIA 3V65A 1A3KA 4OHYA 1QMJA 5FO7B 2QE3A 3CLPA 4HZFA 1S2BA 4RYDA 1LULA 1UY1A 2EXHA 3BOPA 1ND2B 4CCLA 1H0BA 4YW7A 3U4XA 1RUJ3 5J7MA 3ZKYA 2D6NA 5A1LA 1R092 1UXZA 3N7JA 4Q4W1 1DGRA 4Z92B 1XC6A 2J1VA 2J42A 3JB8A 4JDOA 3VLBB 3IB3A 3ZFFA 5KHGA 1AR83 2HYXA 2PQQA 1UF2C 3LFMA 4D94A 5FO8B 4YFZA 2XKPA 5KXBA 1JN2P 1MS1A 3LSDA 2PAKA 1MZ5A 4UT5A 4XUPA 5LK5A 2NPIA 2Z4FA 3R6SA 3OGVA 4DNYA 3B00A 2X5IC 4AG4A 4Q4X1 1QOSA 2Q8EA 1X7NA 2EAAA 2VOTA 3MUZ1 3MW4A 3MLLA 4XFIA 5F5QA 2XVKA 1ZM1A 2EXJA 3WW1A 4IL7A 2P1BA 2G9ZA 1BXHA 2IXHA 2WC2A 2YZ4A 1W3XA 2BGOA 3D8CA 5EHDA 5HCBA 3RWNA 1BJQA 1CESA 1DDLA 5EJ1B 2R32A 5AFEA 1TNFA 3UV9A 4NOTA 1UZVA 2PXJA 1MQTC 5H9SA 4N8MA 2XGXA 1Z78A 4C1WA 2BBVA 1V6MA 3KCCA 1A6CA 4BJ0A 4HN1A 2WAAA 1LOFA 3MIFA 5C3SA 4XQ4A 1AF9A 4FFFA 2XJSA 1VMHA 4B8EA 1CX1A 5F2WA 2WUHA 1AYM3 1QF3A 5JXGA 2HYKA 4UAPA 1WLDA 2VMIA 2VQAA 5DDJ3 4MHRA 4JAAA 4X8PA 3ZYRA 3ZYBA 5FJHA 4ZKTB 5ACA1 4PF5A 3TN93 3VGIA 4ONUA 2G19A 5JOXA 1GWLA 2WJSA 3DL3A 1QJEA 4NIAA 1UAIA 2AGSA 4CDXC 1VAKA 4OYUA 3J8F2 2VZQA 3H3UA 4OFGA 5E16A 2PELA 4FPLA 4IDZA 4MADA 2WIIB 1FV2A 3LOBA 4XJUA 3IMNA 1J1TA 1FAYA 2WFPA 1WA4A 2DCTA 2L9LA 2YBPA 3DUIA 1L7RA 3MDPA 3M3IA 3BKZA 1KFXL 3PU3A 5I0TA 3ZYHA 5HPOA 3WNNA 2V4AA 5JZGA 1O4ZA 4Q0PA 4JKKA 2OT7A 3D0SA 2RV9A 3CZUA 4IEUA 3VKLA 3FFZA 3ZDVA 3AVRA 1PIV2 2VH9A 1LOGA 2VOKA 3BIWE 1UKGA 1SBFA 3AXEA 1QJX1 1ULDA 4L9BA 3LIGA 5IK8A 1IQDC 3DKQA 3WY6A 3KQRA 5GZDA 2OZ6A 3KV9A 1K5MC 3RRDA 3ZYPA 4AGVA 1LKNA 3ABZA 2IFWA 4MGZE 4QPIC 5JLVA 3NSTA 4QU1A 1PK6C 3NO8A 1UXXX 2A3YA 1OBNA 1QXPA 3PIJA 4L8QA 1LOBA 4XZUG 1MACA 1Y3TA 4PQ9A 1W9YA 4XE9A 4UFJA 1S0JA 1TMF3 2XJVA 2C0ZA 4O65A 5EFUA 1OUXA 2WFF2 3WSOA 4A44A 4GXLA 3WCRA 1SFPA 3LQCA 1PO23 2VO5A 1W0OA 1QJY2 5F3EA 2ZABA 2JJ6A 5T5JA 4DS0A 3MF9A 4AK3A 4DEVA 3LFIA 1D2QA 1EY2A 4H2AA 2VZTA 5APAA 1WCDJ 1COV1 4A7ZA 2RS53 1AL0G 4B1LA 4XFCA 4AI1A 1W6NA 2D43A 2P34A 4N7IA 3V64A 3KS7A 4AFBA 1AUYA 4E2SA 1W2AX 1RUH2 5JZGB 4YWAA 3H8OA 1JU3A 4UFMA 3CKHA 1WBFA 2XPJA 1W8UA 3L2HA 4ATFA 1AR91 3RZHA 4XF3A 3GF6A 2ARAA 3VHOA 1NQJA 4RHV3 1A34A 3C7GA 2VW2A 1VBD3 1UX7A 1YFWA 3LOIA 4CU7A 1F8VA 1Q56A 2ET7A 2E63A 3PHMA 1EPWA 4XBNA 4EYUA 5T52A 3F95A 5FWEA 4W50A 4P9YA 1QXJA 2ZHKA 1AYN1 2WA3A 3BB6A 4ISRA 4LA3A 1OKOA 4YW6A 5LK7B 1KDKA 1YI7A 1W2OA 1W8WA 4TYSA 2FCVA 4LO7A 5CKMA 4FPOB 1XPWA 3WXPA 1SDWA 5FFOC 4JV4A 4QX1A 3EXUA 2VMGA 2PHFA 3ZN4A 1JI6A 2GNBA 2OKXA 3RYRA 4LBNA 4Y1XA 2ZZQA 2ZOEB 4K1YA 4LOSA 1OHFA 1W6NB 1XE7A 1VBE3 3I59A 3LEMA 4JVAA 4COWA 4J1XA 3WX5A 3FL7A 1BEV1 3AL6A 2E53A 3GZEA 4DPNA 1APNA 4DXTA 2ZJCA 3ZFEC 1R083 1R1ZA 4NO4A 5I91A 1E5SA 1V9U1 3WF3A 1ZRDA 4HT1T 1N1VA 2VY0A 3I97A 3MW3A 1VBB1 1KS4A 1RUI1 1UOBA 1X8EA 2SBAA 1IS4A 1OF3A 2BRTA 1G9BA 3OOXA 3G7DA 4JC1A 1J3QA 2P4EA 4LBMA 3RGBA 4UW6A 3J26N 4MG2A 2QDRA 3ATGA 1VMJA 1V6JA 1SLIA 4M3CE 1PM4A 5GLVA 2YFZA 3VD3A 1YUDA 2DVBA 1JYVA 3CJIC 1ZBA3 1ST8A 2RDSA 2X8KA 4YVSB 4Q8KA 4H55A 2VU9A 2EF6A 5LW9A 1OURA 4RQPA 4LO8A 3W9AA 4GA9A 5JOZA 3VZOA 5L19A 2VNVA 5KXDA 2Z2SB 3O1UA 3KLSA 2ADEA 1NA1C 3N9NA 1RUG3 5FYZA 3UGGA 5FXXA 3PUSA 2YMZA 5LATA 1XSRA 2W1UA 3R05A 2XLAA 1OA2A 1VRH1 2GN3A 3GBGA 3IBMA 3NRUA 4XBQA 3DPRC 3I59B 4QB2A 4CXWA 4FPJA 1SPPA 1JHNA 1UKRA 4I0WB 3FX3A 3VD5A 1D7PM 2XVLA 3H1MA 4DXZA 4WBBA 1WKYA 1U0AA 4LK7A 1VE0A 4CXXA 3DYMA 1MR5A 5A32B 1KXGA 2W1QA 2DBIA 1S0DA 4QHZA 1L7LA 5EYXA 1ODNA 4OI1A 2BUKA 1QHDA 2R043 3WP5A 1YQ5A 3AXDA 1CWPA 3BYWA 1FOD3 4MLOA 3NV3A 4MGSA 4NRPA 4Q4W2 4GJYA 2FCUA 4AVVA 1GQHA 4D6QA 5A3MA 4OUMA 5J48A 3OB8A 1UYZA 4FXKB 2E26A 2ZX1A 3S7IA 4AHZA 2JDUA 2HWF1 1UN1A 3MFCA 1W03A 1KDMA 1NLQA 3K77A 3RZKA 3I3MA 4Y1UA 4RQPB 2RJ2A 4CEWA 2UWAA 5C7GA 1LODA 4RN5A 1WMEA 3WD5A 4HONA 1UY0A 1CAWA 4AHWA 3QCWA 4JHZA 5CB7A 4P00B 3B94A 5HCFA 2W52A 2FDFA 3QACA 2JE9A 2R1BA 3JXSA 4QGMA 4O9GA 1T6BX 4YW5A 1SPPB 3TWIA 4TZDA 4P9WA 4IV3A 1YJKA 4LLFA 1ULFA 4BXSV 3AC0A 4DXSA 4OLLA 2QFEA 4E4SA 4W6YA 2HWD3 2O8QA 1DIWA 4QGNA 3ETPA 3WDTA 2V72A 5HXVA 5AC92 1H1MA 3AMNA 4N90A 3RZJA 5FYIA 2GH8A 1DBNA 4NRQA 1AJOA 3SCGA 5DG2A 4BU2A 1O4TA 3WDWA 4HN0A 2WKKA 3OYWA 1Z7S3 3WHTA 5ACA2 1BHGA 3I2JA 3WDYA 3O1MA 5EZWA 5C33A 1C1LA 3LE0A 2ZGPA 4P9IA 5FZEA 5JXIA 3EO6A 1C8M3 1SBDA 1BBT3 1Y9MA 2YGLA 1MS5A 3ES4A 2P3JA 4Q5OA 4EROA 1YRZA 2VCCA 3WR0A 5L9RA 3NAPC 1S0BA 1HW5A 1NT0A 5F8PA 5FPZA 1Q8QA 1H9WA 2ZX0A 3AYEA 1DGWX 1HB2A 4CEWB 1GYKA 4YW4A 4FPEA 2QQIA 3JZVA 2FZ1A 1YO8A 3ETQA 5L7OA 1X36A 4GKXA 1F9KA 1UU5A 3I3EA 3CF6E 1LEMA 1YQ8A 1J3PA 1RUE3 2GNDA 2XONA 1YWKA 1GMMA 4WZFA 3VUOA 4HVQA 3E6DA 1VRBA 3BU0A 1LU1A 1C1FA 2GNTA 3LA7A 3VBHA 1JU4A 4KU7A 1RIRA 3HVDA 1O59A 5T50A 1OQ1A 4YGBA 1W9SA 3A22A 1DZQA 3MIDA 1QJX2 4GWMA 1GNZA 4XW3A 4BQ1A 3OBZA 2DYCA 2ZGSA 4NPMA 2E51A 2EIBA 3PVOA 3ZXKA 1MS3A 5DAQA 2Q8DA 2ATFA 3AB0A 2GP3A 3N36A 3JBG1 3OYWB 2FDIA 4AHYA 2BV4A 2QQWA 3VZNA 5JVVA 3DECA 3VHNA 4BISA 1BK0A 4XJAA 3N9PA 4IW3A 5FY7A 1WD3A 4XURA 1POV0 2XQRA 5EXOA 3VKFC 3PDQA 4UW5A 1VB2A 1GR3A 4IERA 4LUMA 3UKTA 4DUXA 2XH6A 4OVEA 1COV2 1I6XA 3INAA 3BI3A 1GANA 2Q1ZB 1GZTA 2YDEA 3POEA 3SLIA 2CTVA 3WHUA 3A4UA 1HXS3 3A21A 2C1FA 1RUC1 5DQ0A 1UPSA 2FQPA 4XJ8A 5L7OB 1KD7A 2VUJA 4XF0A 5D8AC 1JOBA 4CP0A 1W0NA 4GWIA 4D7SA 1XE8A 5FZ4A 3VDDA 1HRV1 1AR92 4XFHA 2Q8CA 3VZMA 1CZVA 5AVAA 2A6XA 2QTWB 3VBHB 3SH3A 1U5ZA 4CSWA 5FLHA 1UU4A 4YVWB 1LU2A 3C7OA 2OVUA 1GSLA 4RGKA 5ERLA 2HEYF 1UO9A 3I4IA 1ZRFA 1XNBA 2BTVC 3WW3A 2QVSB 4FCAA 4XOGA 2FDJA 2IXLA 2VJXA 1TE1B 1TNRA 1ASJ1 3VDAA 4NN0A 4AFDA 2X09A 4DB5A 3EB7A 1RUOA 1AYN2 4FQ4A 4F7ZA 5IVBA 3UYJA 5LRSA 4QGLA 1TZOA 1JZ4A 3P1IA 3BODA 1JYCA 4IGQA 1I5ZA 1LESA 3NJZA 3ES1A 3D6EA 1OOPC 2PLV3 4OUSA 2JB8A 1BK1A 4DOUA 2DV9A 1YHFA 2WLPA 2WNVC 1GQPA 2NP0A 4KG0A 2UY8A 3T1LA 1UY3A 3KZ4C 5IAXA 2VUAA 4NHMA 3ZM8A 1RITA 1HX6A 4N43C 4CP9A 4QHOA 4WVVA 1VBC3 2QQNA 4RL7A 3MYXA 4ZY9A 1MS0A 1SZBA 1BEV2 3HBKA 5BXXA 1JZ5A 4QQHA 2W9XA 2A75A 3FLTA 3DXTA 1AX2A 2ZGMA 3ON7A 3VDDB 2OX0A 5DMYA 1V9U2 4EN8B 1GKBA 4K1ZA 1OMIA 3P5BA 4TLFA 1VBB2 1RUI2 5FWJA 4A6OA 5K0UC 1YNAA 4TN7A 1VJ2A 4XMAA 2RMU1 3PL0A 4K9SA 4IGPA 3AKQA 1BQPA 4N53A 1D4M3 4UF0A 3I3BA 4JHTA 4Q4Y3 5T5OA 5IAVA 3FN9A 3RZGA 2WZ8A 4J25A 2VUCA 3TN91 2XWBB 1PMJX 4OQ9A 1S4CA 3LDRA 5IVCA 5J98B 1RB8G 4PQQA 3DYPA 4LT5A 1RHI3 1RUD2 2P3KA 4HK8A 4MGTA 3KVBA 2QBXA 4QM8A 3THTA 2A7AA 3IDBB 4UI9L 2XHNA 4AI2A 4OULA 3U0ZA 3NJYA 4IE6A 5KR7A 5LBBA 1SHWB 4COUA 1IHMA 3WF2A 3I2KA 4LHNA 5CADA 2JXAA 1MS8A 2YPJA 4LUKA 2MHFA 5A7WA 4BK4A 2WNOA 4JDNA 4YGCA 3D3AA 5I8YA 4NHXA 2CGNA 4BCUA 4IXLA 1WW6A 1X9TA 1RMU1 1H2LA 3E97A
chains in the Genus database with same CATH topology
1VRH2 1O91A 2O1QA 5CU1A 1LGNA 1UL9A 1WW7A 5ABJC 2BWAA 4CDWC 1I1EA 3J8F1 2NLRA 1PGW1 2RJKA 4IV1C 1UIKA 1QH6A 5CFDC 1JBCA 5JPMB 4A7YA 2ZS6B 5AFBA 1DYKA 2XLGA 4J6GA 4N53B 4EWDA 2VVDA 3T1MA 3AFKA 2FZ2A 1TMF1 2GC3A 3AKPA 5BV6A 3RJ2X 2WL1A 3IN9A 3Q9OA 2HWF2 1M4WA 2P37A 4FPFA 4XHXA 1PZ7A 1ZZ9A 3HD8B 5FREA 2D3RA 2TUNA 4AYUA 3I8TA 4XJZA 1G7YA 4Q4V3 1AL21 1XNDA 5GZCA 2JG9C 2GH2A 3VBFC 3ZYIB 5F6LB 1DU3D 1VBA3 2OPKA 1NCQA 2YC0A 4YSFA 4RGGA 4PBOA 3MEPA 1GZWA 1ND2C 4RHV1 4XFGA 4QU2A 1VBD1 3TAYA 1Q43A 4QM9A 1OA4A 2VMHA 3R4SA 4Y1YA 2ZGLA 5GZEA 4Y24A 1H2KA 3WG2A 2BEOA 4F8AA 1SLCA 4FAHA 2H0VA 3ZXJA 2O8OA 1WMFA 1O7FA 2BYVE 2GZWA 2ZACA 4YZ3A 1IKPA 2IXJA 3SITA 4EWEA 1Q5OA 1CX4A 4JCKA 4YG3A 2GN7A 2EXIA 3OBTA 4XTPA 5SV5A 2GC1A 3M3EA 4PIZA 2ETEA 4K3UA 1QY4A 4X6QB 5JWPA 4QPGC 4A7KA 1PO13 2PYTA 1S0CA 4W65A 1XNKA 4HL0A 4AHXA 2PHXA 1JXNA 2W39A 3PLQA 5AVPA 1R081 1GZWB 1DHKB 2WS93 3KT1A 4GMP1 1DYPA 2D3PA 1CJPA 3PVEA 3U10A 3WHUA 5A33A 1D0HA 4XFBA 4B4PA 3GHNA 4GH4A 3JBG2 2EA7A 1LHVA 2PHWA 5JR7B 2WNUA 5GZFA 3IDEA 2Q0AA 4BOWA 3QLQA 4HVRA 1OLQA 3NV4A 1Q3EA 3VBSB 2GC0A 5GLZA 3MIHA 3FE5A 4RR3A 1W6PA 3H3ZA 1YYNA 3DV8A 3ZSEA 1RUG1 4L11A 1NCRA 2BQPA 3AM2A 2RR11 4XHBA 3RI9A 4DFSA 1VAVA 2A73B 1EAH3 1SCRA 4Y1ZA 3TNQA 4Z07A 2ZGKA 4HANA 1QOOA 3PVNA 4YLZA 2PHUA 1HRV2 4Z2WA 3O7OA 5KHHA 1PVC1 1QNWA 4YZ2A 3MLKA 3H0OA 5T55A 1GZ9A 1RUJ2 3KMHA 4JTOA 5A33B 3MPPG 1AR63 4LO4B 4UW4A 1ASJ2 1GZCA 3AX4A 4MGIE 2WNUB 1QGLA 2IFRA 1X50A 1IS6A 1O3RA 4X8NA 4AFAA 1CIWA 1AX0A 4R52A 3HBZA 2CWMA 1UCXA 1FI2A 1RL3A 1KFUL 4RR3B 1HV1A 3AKRA 5CIRA 1JH5A 1W6PB 2R063 4K6BA 1SBEA 5H9RA 5E1RA 4BM8A 1NCRB 1QKQA 4TWTA 5JZGC 3SCHA 2OA2A 2DFBA 1UZYA 4KH9A 4I09A 3VBUB 1QWRA 4EN7B 3D0JA 1QJU3 4P9JA 3FLPA 2XBO3 3C2UA 1CJDA 2RS33 1IPJA 1ENRA 5I93A 2RMU2 2HWE3 3KCYA 3OGGA 4AEKA 1XYOA 4LEJA 5J36A 4FP2A 1MZEA 1Z7S1 1JYIA 3TN92 4RFT0 2W68A 1BMV1 1Y7BA 1C8M1 3ZVXA 3TYJA 4FP3A 4D7YA 5BNNA 3AMPA 2B39A 5C9AA 4LULA 4FTBA 1ULEA 3MF6A 1J58A 1W2UA 2MEV3 3FJSA 4YW3A 4H7LA 3WW2A 4EWAA 1IPKA 5AC91 1S1AA 2JENA 3S6PA 2AH2A 3D82A 2ZBJA 3PMSA 5KXCA 4LHKA 5IK7A 4KQ7A 1IZ3A 1WLCA 2ZAAA 1RMU2 1LGBA 2ZMKA 4AQTA 1RUE1 4AE2A 4XQDA 4YRDA 3IIAA 1NE4A 2QNKA 2MPFA 4QHBA 3ILNA 3ZFFB 1R093 1EYBA 2DTWA 3EBRA 2GNMA 3PJYA 1PGW2 5CNAA 1G86A 2UYAA 1F5FA 4DZGA 1CN1A 2ZPXA 4YGEA 3AKTA 1EV11 3M3OA 4XETA 3VBRA 2ZHLA 4JGYA 4KGQA 2D5HA 3WP4A 4R8HA 2WZR1 1TMF2 4PDWA 2YROA 4YVSC 3USUA 1FNYA 4M0NA 5C9AB 5BNNB 4OHZA 4INDA 4DQAA 4CDQA 1ULGA 2DCZA 4JGZA 1U5XA 2ERFA 3WV6A 2KA3A 2RS52 2DVGA 2AZ5A 1HXS1 2AENA 2EVXA 2HWC1 3ENRA 5GM0A 1AL22 4Q27A 4Y5Z0 1DGWA 4M3CF 3VKNA 4N7UA 3DN7A 4COZA 2BW8A 1PGL1 4GWNA 4Z1VA 4MXWA 3U07A 5JOYA 1NY71 2R071 4RHV2 1FYUA 3OY8A 1VBD2 4O9EA 3CNAA 4XZPA 2R30A 2ZAHA 3A0KA 1AJKA 3VBRB 4GIQA 4RA0A 3WG4A 3MIEA 4PDWB 3AZZA 2NYYA 3USUB 2KXLA 3UKNA 3MICA 3H1YA 3H7JA 4RQPC 1V6NA 4LO6B 2WLQA 2YV8A 5BY5A 3PMEA 2PLV1 2RS13 3QD6A 5F6KA 3SH4A 4CDQB 1PIV3 2ZCWA 2VVFA 4JGZB 4NWVA 1SLAA 5FTTC 4FT8A 5KXEA 5CFCA 4XTMA 2NZ9A 2Q1MA 3USSA 1DQ4A 4GULA 1TEIA 1R082 4F3JA 4MGKE 4MXWB 4META 4WM7C 1FMD3 3UJQA 2I07B 5T3NA 3OY8B 4BZ4A 2MNGA 2WFF3 1SLBA 5HCAA 5CG8A 4IEVA 1QJY3 2DUPA 2WSVA 3JCIA 3L9JT 4E4ZA 1LJ7A 1H8TA 4OI0A 5DXDA 1POV3 4DRRA 2GC2A 3AZXA 1ZBA2 3SCFA 1OQDA 1RHI1 2HEWF 2JX9A 1LECA 1QNYA 1OA3A 1YFXA 3B01A 2F4PA 1HV0A 2PHDA 3QH7A 1AXKA 1DFQA 2D5FA 5FLIA 2XUMA 1OI6A 1G9FA 2QKDA 4CEWC 3RDIA 4I02A 2QDNA 1RUG2 4FBFA 3AYAA 1ZRCA 1MS4A 1CQ9A 1O4YA 2RR12 2XJTA 4XF1A 4Y22A 3ZSLA 1U12A 5CFCB 2PA7A 5JPNB 2DCJA 2B5HA 1RUD1 2B46X 1ND3A 4PLMA 1PVC2 2BNOA 2ZGRA 3B9CA 1H2MA 4BA6A 1YI9A 3SHRA 4D7TA 1C5HA 5FPXA 4HLTA 1NQDA 4WM8C 3KCXA 4NVPA 4UW3A 2YY1A 1H8TB 4ASMB 2D6OX 2QCSB 1HQNA 4MUVA 2A6WA 1FNZA 1J3RA 3AKSA 1VIWB 5H9QA 4H3WA 4ATEA 4EN0A 2WQZC 2I74A 4GQ7A 3GNEA 3LSEA 2DVAA 1FPN3 1RVF3 3H1WA 3RYPA 3R4UA 1O3SA 5L7OC 2NN8A 2VG9A 4LBLA 4Q4V1 4BLIA 4C0HA 2WNEA 5A3LA 4Y22B 3B7MA 1XNCA 1VBA1 2H6BA 3ZSJA 3PJQA 5CG9A 4DY3A 5H9PA 5JDBA 3RJRA 4YVWC 1N3PA 3A0NA 4UBGA 4GB31 1ZZCA 2ILMA 2EAKA 1ND3B 3WCSA 4R9DA 3R4DB 4FPKA 2LTNA 1ZA4A 2R0HA 2GMMA 2ZHMA 4ISQA 4QPYA 1Z7S2 2EIGA 3RMXA 4HKLA 1Q8SA 4Q8LA 1YJLA 1XYNA 4R9AA 3FBYA 4DMIA 3WQ0A 3EHKA 5J96B 1BMV2 4YW1A 1R1A3 1C8M2 1U5IA 3RQ0A 2VNGA 2Z42A 2WA4A 3AP9A 2WT0A 1WCKA 3CEWA 3B69A 1PNGA 4YG0A 2HWB1 3O12A 4AEMA 1PZ9A 1AR73 5JMCA 4RSUA 5J3UA 4IEYA 1JOJA 1RUE2 1UD1A 4G4FA 3HIFA 3VDDC 1NE6A 4IEWA 3WW4A 4AEDA 1IGOA 3BCWA 2XL7A 2PAMA 2YHJA 2Z79A 5DUWA 3VHRA 4JRAA 1QDOA 4K21A 2IZWA 3NW4A 1EV12 4Q4X3 1G9AA 4XFFA 1RUF3 1YIFA 4UXAA 4N9IA 1CAWB 1DGRN 3ZX7A 3S7EA 3TNPB 2WZR2 4LE3A 3JQXA 5KHJA 5DUUA 3DPRA 3AP5A 2SLIA 4IV3B 2RE9A 1CAVA 2E7TA 5F9TA 5D1IA 3UJOA 3VBOC 3ACLA 2CWSA 4PLNA 1F31A 2Y26A 1HXS2 1FX5A 2HWC2 2YYOA 1YFYA 3NWKA 1QJZA 4Q1RA 1PGL2 1GICA 4LO5B 1HQWA 4HK9A 2OUJA 1NY72 1F2NA 4LBKA 2R072 4AEDB 2A3WA 2ZA9A 1JW6A 1TME1 4MV2A 2VW1A 5DG1A 3CJXA 4N53C 1HRI3 4LLOA 2FBEA 4EN9B 1IKQA 1HDKA 4ASLA 5FLJA 2DWRA 4QT6A 4IEOA 1DG6A 1AR61 2TNFA 4QQLA 3KT4A 4WVMA 1V6IA 1RINA 4DRVA 5I0RA 4R4XA 3WOGA 2E7QA 4B4QA 4C91A 3NVCA 2Y38A 1QH7A 2PHTA 2VOWA 1LHWA 4FOWA 2XLFA 3X29B 3WZ1A 2AR6A 1ZBE3 3BU7A 2PLV2 1B09A 4BE3A 2HKXA 4CEYC 4CDUA 2DFCA 3K48A 4R4ZA 1RUJ1 1SFNA 2OIIA 4KBBA 4MYEA 4RGAA 1JUHA 1GFF2 4I30A 1UU6A 1AR81 2VW0A 2LM3A 4DINB 2A6VA 2ARBA 3M2MA 3KM5A 4ZU7A 5BNPA 2D93A 2XBO1 4GMP0 1HKDA 5BPXA 4JTNA 1FV3A 5GLWA 1CAXA 3N7LA 2NMNA 1D4M2 1QXRA 4FOYA 2YUEA 1W6OA 3D5OA 3HAGA 5FRAA 4I3GA 1DLLA 1COV3 2XWJB 3M7AA 3GBFA 2A5ZA 1RHI2 1E57A 1KJRA 3B5LB 4N9HA 2VVEA 2RM23 1LRHA 2G4IA 1NXD1 4QQOA 1KQRA 1AYM1 4HKOA 1IS3A 4L99A 5IK4A 4CDUB 5DDJ1 4Y26A 1VB4A 4Q0SA 4XJWA 1O3TA 1Q8OA 3EJKA 3AFGA 3LB9A 1H4HA 4LNVA 3TOJA 5E88A 5KHKA 4YM1A 5BNPB 2ZHNA 1REEA 4P9LA 3GZTB 4AVBA 1FT9A 1PM7A 3AP6A 1OFNA 1CAXB 4AGRA 1VP6A 1C4RA 3RS6A 1W6OB 1RTVA 4K20A 4L92A 5T54A 4W6XA 2CL2A 1NZCA 4XEZA 4HETA 2AREA 3ZFGA 3VBSC 4OHWA 5BNOA 1X82A 5D8AA 1NLRA 3RNSA 3IM0A 4Z82A 3O14A 3POSA 1B35A 3QH6A 4RS5A 3M3QA 3NKTA 3H8UA 1ZZBA 1V9U3 1CPNA 3JB4C 4AFCA 4Q4V2 1Z0HA 1SMVA 2VXRA 2ZGNA 1WD4A 3SH5A 4I0AA 1VBA2 4PLOA 4AF9A 4BIOA 4Q26A 2XJQA 2IXKA 5EWSA 3S0MA 4GB32 2BFUL 1PO21 2ZZJA 2EXKA 4AXOA 4XBLA 2D97A 2RS51 3B9IA 4FTEA 4YM0A 4TSVA 3ZN6A 1GNHA 4ZU5A 1MVQA 3ME2A 2WNVA 3NKGA 3VL8A 5C8CA 5E89A 3NV1A 2E7AA 1PGSA 4N43A 1MVEA 2KM2A 2PHRA 2Q4SA 3ZFGB 4E4DX 5BNOB 2RS11 4RR3C 3EQEA 2HWB2 3GBWA 3NV2A 4A2UA 2CYFA 4RS5B 1B35B 4OI4A 3URFA 4WVWA 1J1LA 2NQYA 3RZZA 1LEDA 3PVBB 2DURA 2GSYA 5L36A 1H30A 1PO12 3VBUC 3V56A 4YNIA 3DKWA 1FMD1 3ZIXA 3E6CC 2HWF3 4HFSA 4YM3A 2VGDA 4K7JA 3OJBA 4HKWA 1WW5A 5JI9A 4ES8A 2ZGUA 3B93A 3RI8A 4L97A 2VOVA 2P17A 1VBE1 4HBNA 3N35A 3O0WA 1Y43B 5JSOA 5C8CB 1UX6A 3TB0A 3VKMA 1NCQB 1RC6A 2VOXA 4CDWA 2ARXA 2DCYA 3MW2A 1NXMA 4Z8BA 5KC5A 4IV1A 4MSVA 5JIAA 5CFDA 1CPMA 2E6VA 4OHXA 3ZFFC 5JCTA 1NYWA 4EJRA 2D44A 4NWWA 1ZBA1 4V1PA 5GJ6A 5CA6A 1N1TA 4B4RA 3IKWA 5CBLA 2D6MA 1BVVA 2R49A 1CR7A 1TME2 2XL9A 3ZYGA 3ZSKA 4AQ2A 5C4WA 3QOPA 4BHPA 1C5IA 1PHMA 4ZU4A 1HQLA 4A3XA 2A3XA 3TRSB 1RUNA 1OPOA 2A6ZA 3WP3A 2XG3A 3BPZA 1AR62 4CTEA 1SFYA 2LUWA 4WV8A 4AWDA 3ILRA 4HPKA 5FBZA 1URXA 3OD4A 4JQRA 5E8AA 1BVP1 1XU1A 1KRIA 2DU1A 1CD3G 3OCPA 1HIXA 1O5UA 1LOFC 1S2KA 2WT1A 5BUVA 4Y4YA 1QQP3 4COVA 5FQ0A 3HR9A 4CRQA 2R041 5FMOL 1RVF1 3ZDSA 2WSUA 2JD4A 4CDWB 1IOAA 3SMHA 1FOD1 2JG8A 2VPVA 1CAUA 4URTA 5JSPA 5GZGA 2GMEA 5JOWA 1AR82 2Y0IA 4GH4B 3ZN5A 3SNMA 4AI3A 4LBOA 2R1DA 3JBG3 2OYZA 5KWRA 5EV7A 1YIPA 2XBO2 1LB2A 4IEZA 4I3PA 2HWE2 5C4WB 3VBRC 2D6KA 3DGTA 4CZSA 1AXYA 1MEC3 1NG0A 2WQ4A 2DUOA 4PDWC 2P3IA 2XVGA 1ONAA 1R1A1 4HPKB 3V0AA 2DU0A 2XJUA 4KL1A 1RUC3 1OFSA 4QPGA 3SXWA 2UU8A 4CDQC 2HWD1 3J4UH 4JGZC 1OKQA 3CU7A 4XJ9A 1HRV3 5FAXA 3WQ1A 5FQ0B 1AYM2 1AR71 2N7GA 4ITCA 5JSRA 1V6LA 4H14A 1G8WA 4B7KA 1A78A 5DDJ2 3E5UA 2JG8B 2FMDA 3AZVA 4XILA 1OPMA 3H9AA 1CAUB 1NOVA 3IT8A 3R0RA 4G9SB 3M3CA 4XPVA 1BBT1 5EYYA 1ASJ3 5KHIA 3HMYA 1H2NA 4FOQA 2W0XA 2E9QA 4S2FA 1GLHA 1I3HA 3JD73 4E2GA 4QX5A 4KGGA 1AX1A 2C5DA 3AMQA 5J37A 1RUF1 2CY6A 2D40A 4FPGA 4XDQA 3W59A 2BNNA 2VECA 3V0AB 4KWKA 1OD5A 1DF0A 1D2SA 4QPGB 1ZNPA 3KGLA 2ZKNA 2ZMNA 1MZFA 1SLTA 1I9RA 2H6CA 2JE7A 2PTMA 2WINB 3O0VA 4H7MA 5CFCC 2RMU3 2Z5WA 1C28A 4I2OA 3M4FA 4KNCA 1ENSA 4HSLA 4CYDA 3WDXA 2XJRA 4IEPA 2HJIA 5SV8A 1LGCA 1PNFA 2QQPA 1PO22 2ENRA 2ZGOA 4Y20A 1LOEA 4JDMA 2FMYA 3I2DA 1HRI1 2OZJA 5IT6A 1D0GA 1S0GA 2B42B 2UWCA 3GZUC 1ZREA 3N4MA 1H8TC 2CAUA 2K9ZA 3VV1A 5T5LA 4M0HA 1RMU3 1BYHA 2AUYA 4XYXA 3IPVA 4YM2A 1ZBE1 2JEMA 2RS12 4FAGA 4NR1A 4ZXKA 2GDFA 3J8F3 2CV6A 2F6BA 3LZZA 3BALA 3IWZA 2UY9A 4FPYA 4FSJA 4W6WA 1UW8A 3N7KA 5FMOS 2X5IA 1Q8PA 5FCCA 3VZKA 4LA2A 4JGYB 1NLSA 2IXCA 4M00A 1ND3C 1FMD2 3AZYA 2DVDA 1WW4A 1O3QA 2ES3A 1MQTA 3L2YA 3E5QA 4Y20B 1RJ8A 3I7DA 4E2QA 1LHNA 1ZZ8A 1KJLA 1VBE2 4B3NA 2ZX2A 3AJYA 3AYDA 1VBC1 3ZMNA 2WWSA 1QOTA 2K0GA 3O0XA 1AL23 4QD2A 4KWJA 1A8MA 2RM21 1UZZA 3AK0A 3WG1A 4B29A 1DQ0A 3IPVB 2AYHA 1EPZA 4CDXA 4KWLA 3HN1A 2ZMLA 3ELNA 1D4M1 4Q4Y1 4KU8A 1WLWA 2A70A 3WT3A 3ZSMA 1REDA 2X5IB 4LBJA 2DF7A 1SLLA 1SACA 2NMOA 3M8LA 5J09A 4K40A 2VULA 1YFUA 1DGLA 4NPRA 4FVVA 4YVSA 4I01A 1DQ1A 1VR3A 1RUH3 2B8MA 4Q1PA 3PTYA 2CGPA 1MQTB 4NHLA 4RD7A 4XXAA 3FC0A 1C3HA 3LGRA 3AMMA 2YXSA 1SQ4A 1K5MA 1KITA 4QPIA 4IV3C 1PK6A 3FZ3A 3JUUA 5JAXA 3H50A 3MIBA 2UURA 4MZUA 3WG3A 2B7YA 1JUIA 1FPN2 3RMYA 2R042 3LAGA 1RVF2 4CDXB 5A32A 4LTAA 1LTEA 2WZPP 4XQWA 1FOD2 4Q0QA 2BVVA 1V70A 1ENQA 1MZ6A 4NHKA 4GMP3 3OTFA 1YLLA 3ZXLA 1ENXA 2XHKA 4PBPA 2JICA 2ZKLA 4YZ1A 4LBQA 3HT2A 3DF0A 3IDCB 4AEDC 1GV9A 4P9GA 5HI0A 2DTYA 2Q30A 3FFQA 3WDVA 1G9DA 1WCSA 2CAVA 4YW2A 4OZXA 5DZEA 4PCRA 1H1IA 3WDUA 1PZ8A 3ZO0B 1XXNA 1R1A2 2ZGTA 2RR13 3J9SA 1K5MB 1W6MA 4BMBA 2K2SA 2ZX4A 3VBHC 3LA2A 4QPIB 1PK6B 3KD4A 4D3WA 2HWD2 3BTAA 3OPZA 1WMDA 1AR72 3P3NA 4X6RB 1PVC3 3AYCA 3W58A 1UPIA 1V6OA 3AP4A 4WM7A 4HSJA 4LBQD 1H8VA 4HMZA 5I0SA 5FDBA 3ZMOA 3E5XA 3M70A 2QUOA 4Y1VA 3WVJA 2QZ3A 4LBQB 1BBT2 4SBVA 1CONA 1OQEA 1DZTA 4K8FA 4L2NA 1G6NA 2D6PA 4S2GA 4COYA 4Q4X2 3ZFEA 1HLCA 1RUF2 4XXPA 3WINE 4FPCA 4E9KA 5HBAA 1PO11 3WUCA 1SCSA 2GU9A 3MPBA 4B7EA 1XYPA 1W6MB 3D4KA 4Q4W3 2G9GA 5I0UA 3VN4A 4AVCA 3OD0A 4Q2FA 4XF9A 1SEFA 2WS91 4EV0A 3FWEA 3CJIA 4CDUC 4S2DA 5FOBB 4WM7B 1VLNA 4AQ6A 1LR5A 1QDCA 3ZXAC 1LCLA 1YCIA 4WM8A 1UMZA 2C9AA 5IUQA 1NA1A 5BNPC 3UKVA 1ZX5A 3AJZA 1OLRA 3CO2A 3OGJA 4S2HA 1AVBA 3AMHA 3LKJA 4BPZA 1HRI2 5FO9B 1BKZA 1WUVA 4LR4A 2PAEA 1LHOA 1RJ7A 3POYA 5CVRA 3WNXA 1AHSA 2BWCA 4IEXA 3ZFEB 5AC93 4R9CA 1EAH1 3CL1A 4UBHA 2X29A 4FO9A 1WBLA 4E27A 4CP2A 1YXWA 2O0OA 3ZXGA 4SLIA 2BVBA 5I8SA 5ACA3 1WLTA 5TSWA 2OW4A 1QQP1 5JIUA 1ZBE2 5JI7A 3C3VA 3LWCA 2JKBA 4C1XA 4YVWA 3CJIB 5KBFA 2A71A 4IEQA 1CVNA 5K9YA 2DCKA 4D69A 1LENA 1LHUA 2VNOA 1W0PA 5K7PA 1Q8VA 2UWBA 2BGCA 1EV13 4PIYA 1S0FA 4AI8A 3B3QE 4KG8A 4WM8B 1NA1B 2ET1A 4QQPA 3VL9A 2P2KA 5FOJB 2PFWA 2WZR3 5LRRA 1DQ2A 3WLUA 3DPRB 1MS9A 1XQNA 1CAVB 2V5YA 3FHIB 1ZZ6A 3WUDA 4AVSA 1A8DA 1MEC1 2R061 2GMPA 2R16A 3OF1A 5KC6A 4BLJA 3HT1A 1QJX3 1TQ5A 1ZRRA 1VBC2 2ZGQA 1BZWA 2HWC3 3UK9A 3ZFGC 1LOCA 5BNOC 4MH0E 2A6YA 1QJU1 4LE4A 5LEJA 2RM22 1N1SA 2RS31 4RS5C 1B35C 2Q8OA 4AGGA 3VZJA 2HWE1 2R073 4Q4Y2 3KSCA 1ZYBA 3KB5A 3NAPA 4YG6A 2D3SA 3GHMA 3ZYJB 1D4VB 1AZDA 4WVMB 5I8TA 3ILFA 5GKAC 4LHLA 3RG0A 4MX3A 2FHRA 2Z69A 2H0BA 2MEV1 1DQ5A 3JD71 4FXGB 2I2SA 3VKOA 3K51A 5T5PA 1W39A 2CGOA 1RGSA 2VNRA 1AR93 3E6BA 5DUVA 2I45A 3ST7A 4YARA 2RJLA 5C6CA 1GQGA 3VBOA 3OBRA 3GALA 1FATA 4XMIA 5C8CC 4MVTA 1R091 4JRLA 1NCQC 1F5JA 4Q0VA 1C8NA 1N3QA 3N3HA 4MGYE 3SISA 4R9BA 4G3YC 2IWGB 4AW7A 4C90A 4FPHA 4M3CA 1N3OA 4Q29A 1AYN3 3ALQA 4XFAA 4P5HA 4P14A 4Q0UA 2D6LX 4XIOA 3ZIWA 1ALYA 3NAPB 1EP0A 2JECA 3S30A 2TBVA 3FMGA 4BYYA 4AQSA 1JTZX 3KT7A 2EALA 4WZCA 4AI0A 1BEV3 4ORFA 3P3PA 4YFWA 4BH9A 3G6JB 3TBDA 1VBB3 1RUI3 3MZHA 1LOAA 4FTSA 4CEYA 3VBOB 1H1AA 2VQ0A 3I54A 1XRUA 3V0BA 2V73A 2V09A 1AXZA 1S55A 2GALA 3MIGA 4PJYA 1VALA 4M3CB 5DZFA 1RUD3 1ZZ7A 1U5YA 1L3JA 4ES9A 4AVTA 3M1HA 1VAMA 5GALA 4GH4C 2ZX3A 2Y0OA 1OOPA 2WNUC 3LA3A 4GALA 3AZWA 3LCPA 4FOVA 4M01A 1VRH3 2WT2A 2OUHA 4I0BA 5C4WC 5D8AB 4BWOA 1PIV1 4HVOA 1PVXA 5B2GB 4YZ4A 5GLUA 5DZGA 1NCRC 2NM1A 2G9FA 3NL1A 4XIKA 3APBA 3MGUA 3FLRA 5K0UA 1QU0A 4OI2A 4MXVA 4CEYB 1Y9QA 2JDZA 1S0EA 1GBGA 3FUQA 5C8WA 3V0BB 2TEPA 2PHLA 2DUQA 3VHPA 4U2AA 5EJ3A 2PN5A 2WS92 1S0IA 1H9PA 2WFF1 1ULCA 4GB33 2JG8C 4GKYA 4IETA 1QJY1 1OSGA 2Q5TA 1REFA 1POV1 3FUOA 2QZ2A 4DY5A 1OOPB 3ZN6B 2X53S 3GYDA 4AFMA 1W6QA 3ZXEA 2WNVB 4QMAA 4WVZA 3ZXFA 1G9CA 2HEVF 5DUXA 1RUH1 1DQ6A 4N43B 1J59A 4F83A 3O5SA 3VBSA 5ABJA 3GZAA 2B9UA 1FXZA 4XF4A 2UYBA 2BNMA 4IESA 2HWB3 4OHVA 4YYOA 1EAH2 2RHPA 5CAZA 3ASIA 5K0UB 5LEKA 3H7YA 1UIJA 3N7MA 3RPQA 2D7FA 5K8SA 4AEJA 2LALA 5BNQA 2CNAA 1QQP2 3MLJA 2DVFA 3B02A 2XB6C 5L73A 3ECQA 2R6QA 4YZ5A 2B45X 2BPA2 1BCXA 4YGDA 1V00A 3HQXA 1M06G 4EN6B 1DZRA 5C9AC 5BNNC 4CP1A 2XJPA 4AVAA 4PIXA 1W6QB 2JG9A 3VBFA 3FBMA 4QQ2A 4BIFA 3ROUA 1ZVFA 3AP7A 3RYKA 1FPN1 5BYNA 3BOWA 2XKOA 2QJVA 3JU9A 3U11A 1MEC2 5GLTA 5ABJB 2R062 3POWA