2B45X

Crystal structure of an engineered uninhibited bacillus subtilis xylanase in free state
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
185
structure length
185
Chain Sequence
ASTDYWQNWTFGGGIVNAVNGSGGNYSVNWSNTGNFVVGKGWTTGSPFRTINYNAGVWAPNGNGYLTLYGWTRSPLIEYYVVDSWGTYRPTGTYKGTVKSDGGTYDIYTTTRYNAPSIDGDDTTFTQYWSVRQSKRPTGSNATITFTNHVNAWKSHGMNLGSNWAYQVMATEGYQSSGSSNVTVW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Endo-1,4-beta-xylanase A
publication title Crystal structure of the Triticum xylanse inhibitor-I in complex with bacillus subtilis xylanase
rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
total genus 49
structure length 185
sequence length 185
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2005-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00457 Glyco_hydro_11 Glycosyl hydrolases family 11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2b45X00
1ENXA 4NPRA 4XQDA 3VGIA 1UU5A 2VUJA 3WT3A 3EXUA 3VHOA 3VZLA 3WP4A 3MF9A 4HKOA 1XNCA 1UKRA 3RI9A 3WQ1A 2DCYA 2BVVA 2F6BA 3WX5A 2JENA 1HV0A 1W2UA 2D98A 3ZSEA 2DCZA 1BVVA 2DFCA 3WP5A 3MF6A 4XQ4A 3WQ7A 4IXLA 2BWAA 2JEMA 2VG9A 4S2FA 3B7MA 1QH6A 3WR0A 1BCXA 4S2HA 1OLRA 4HKWA 3AMQA 3WP6A 1XNDA 1KS5A 1C5HA 2DFBA 2QZ2A 3RI8A 2JICA 3VL9A 3WQ0A 1XNKA 2NQYA 3VL8A 2NLRA 3AKQA 3VHPA 2BW8A 3AKSA 3VZNA 2D97A 1OA4A 1XYOA 1H0BA 2QZ3A 3WXPA 3AKRA 3VZJA 4HK9A 3AMHA 2BWCA 4XQWA 3MFAA 5K9YA 3VZOA 3WP3A 2B45X 3LB9A 4S2GA 4S2DA 1REDA 1M4WA 1REEA 3AKTA 3LGRA 1OA2A 1NLRA 1IGOA 2DCKA 1XXNA 1OA3A 3HD8B 5HXVA 1XYNA 2VULA 3M4FA 1UU6A 1XYPA 1H1AA 2C1FA 3WY6A 1HV1A 4H7MA 1F5JA 1QH7A 3VZMA 2B42B 1XNBA 3MFCA 4HKLA 4XPVA 1HIXA 3AKPA 1H4GA 3AMMA 3B5LB 3VZKA 1UU4A 1KS4A 1BK1A 1H8VA 3O7OA 3VLBB 3AMNA 1C5IA 1T6GC 5EJ3A 2B46X 1REFA 1H4HA 1OLQA 5K7PA 1AXKA 3VHNA 3AMPA 2DCJA 1YNAA 4HK8A 2Z79A 1TE1B 1PVXA 2VGDA
chains in the Genus database with same CATH superfamily
1UYPA 4EN8B 5AFEA 1UY1A 2ZPXA 4QPGA 4UWDA 3MW3A 1AYN1 1GU3A 2ZEYA 5A1FA 3PTYA 2Q8OA 1CX1A 1SBFA 4FFFA 1LOEA 2C4XA 2O1QA 3RZJA 2NN8A 3T2QA 4XMIA 2O0OA 1ULPA 2F6BA 3HQUA 4LE3A 4D6RA 5FO7B 1WMDA 4BQ1A 3MV11 5A6QA 3OYWB 4AOCA 3OGRA 1YIPA 2A3WA 2D43A 1XNTA 2K46A 2ZS6B 3BU7A 1NUKA 4I09A 4Q4V2 1V6OA 2C6SA 4FBFA 2P6CA 2DWRA 1L3JA 1TEIA 3CNAA 1X7NA 5E8AA 1XPWA 5FP3A 1SHWB 2ZOEB 4IDZA 4ATEA 1NA1C 4LLFA 1LKNA 1WKYA 1OPMA 1Q8SA 2OXBA 4HKWA 1JTZX 4AQ2A 1UQXA 4CDUA 1LTEA 2RS32 1C5HA 1W3VA 1RUOA 1JN2P 5FZFA 5BNPB 4ASKA 3C2UA 3CKHA 4CUCA 2DBIA 1PO12 1XU1A 1RUC1 1HN1A 1OA4A 5D8AB 5C5UA 3AZYA 3ATGA 4QM9A 3M1HA 4RN5A 1GQPA 4XF3A 1LR5A 3CO2A 4NRQA 4OMCA 1DZTA 1PX3A 4CCOA 1YQ5A 5H9SA 1CZVA 2WYFA 4AQ6A 1OBNA 2ZEWA 1ZREA 2UY9A 1NZIA 1RUE2 4XAAA 2VZ1A 2WLQA 4IGOA 1UPSA 1WA6X 4XF1A 5IUQA 4CZSA 1PGW1 4RSUA 3AKTA 4XIOA 3BPSA 2EIGA 1TMF2 2VZQA 4I01A 4CDQB 2IXIA 1D4M1 2W46A 4URTA 4DMIA 1PVC3 2NZ9A 1VAMA 3OUJA 1OLME 5L9RA 5FMOL 1BZWA 5T5LA 4AVCA 1UU6A 3GHNA 4MGIE 2FMYA 5F5IA 2RJKA 3WCSA 2FCUA 3O5SA 3LEMA 2VBBA 5I0SA 4QAWA 1GR3A 1OQ1A 4LTAA 1W2TA 1ND3A 4XIKA 3VZMA 2DBNA 1J83A 5T5OA 3UK9A 2J7MA 4N43B 1WBLA 5A33A 5CG8A 2FDIA 2DVBA 5BNOC 2VNGA 4PT6A 1V6JA 4YW2A 1HB1A 4AVAA 5A3UA 4JTNA 4GMP1 3IAQA 4J25A 4LE4A 5GZGA 5JIUA 4XTPA 2R7EB 4W50A 4JGYB 4TLGA 3ECQA 5I0RA 1CIWA 1IQAA 5JLVA 3Q8CA 3LEIA 2TEPA 5FWEA 5IK7A 1REFA 1XE0A 3POWA 5CA6A 4ATFA 1OLQA 3R05A 3ZN4A 3B93A 1DYKA 4AGRA 4IV3C 2WS92 1AXKA 1JUHA 3U10A 4E8CA 1CX4A 1KFXL 1ZBE3 3Q9OA 2PHTA 2YFUA 1RGSA 3GJBA 4Q0UA 3WSOA 3PMSA 3N7MA 4V2WA 5EWSA 1MZFA 1GOFA 4WZFA 3DGTA 3TEZA 3VD7A 1X8MA 5LY2A 5FY9A 4XJUA 2XDVA 3WT3A 3ZXFA 3TNPB 4YPJA 1YQCA 4Q29A 4BCUA 2VECA 5C8CC 1XNCA 4CEWC 1D2QA 3I3QA 2DCYA 2OPWA 3HWJA 1W9TA 2PAMA 3M3IA 4QGNA 1UAIA 1HV0A 5A6ZA 1QJU3 1AYM3 3I2DA 5FYVA 2PLV1 1C8M1 3WDTA 1QJX2 4AE2A 4QKBA 1MS5A 1R091 5K4LA 1WCSA 5IJRA 1UO9A 1I3HA 1RXFA 1VBA3 3R6SA 3KF5A 4OHZA 3AYDA 3C7GA 1VRH3 1UOGA 4A44A 4B3NA 5JOYA 1UYYA 1PO21 1FAYA 2ARCA 5FJKA 4AR2A 1U0AA 1BEV2 3LZZA 4L11A 2VMEA 4OLLA 4TSVA 4XILA 1OQEA 3Q8BA 4FPFA 1N1SA 1VBB3 3A21A 1H1IA 3NNMA 4JDOA 1LOGA 1OT5A 4AFDA 2R071 2FDHA 5KXBA 4KGGA 4OVEA 1KJRA 3ZYFA 4OHVA 3H8UA 4QQPA 5FYHA 4EZ4A 3UKNA 3LFMA 3BTYA 2W1WA 1SCSA 1W6QA 2BGCA 2ZX3A 3RQ0A 5FCCA 5BY5A 5CISA 1LGNA 4JHZA 1IKQA 3SH3A 4FTEA 1RB8G 2XKOA 1UY4A 1R082 3JUUA 5ISLA 1O5UA 4DY3A 1MVEA 2J1EA 1OH3A 4P9WA 4FT8A 3B9IA 4IV1A 5LEJA 3MICA 1LJ7A 3FE5A 3A4UA 5CFCC 1J3PA 3ZM8A 5FXVA 1Z7S3 4OULA 1LOBA 2AENA 2CY6A 2DUPA 5BNNA 3MUZ1 5FPAA 3WDXA 4D7TA 2RMU2 2GP3A 3KCCA 4N53B 4OUMA 3SISA 1EAH3 1U5ZA 1NT0A 2K9ZA 1RJ8A 3H1YA 4I3PA 3WEZA 3L2HA 4CVUA 3FLPA 2C1FA 2DVGA 1FMD3 5FPVA 2JIGA 5FXZA 1KFUL 1R1A3 2YHJA 1XSRA 4OMDA 4RL7A 4LOTA 3VBFC 5FRAA 4MV2A 3LA3A 2VMHA 4B7EA 1LEDA 1W6OB 1AR71 4Y22A 1S0FA 3VZKA 4AVTA 1KS4A 5I91A 2XJUA 1JU4A 3TBDA 1BMV2 1D7PM 3NV1A 3LOIA 1IHMA 2UYAA 1L7LA 3N35A 3POBA 2PQQA 2UYBA 4FTSA 4YVWA 3PL0A 3ZXGA 2QVSB 3VKLA 3RYPA 4JAAA 4TTGA 5FLJA 1H8TA 2H6BA 1ASJ1 2ZX1A 2WO2A 2YGLA 2LALA 5KBFA 3CZUA 1V6MA 1PHMA 5IAVA 1O4TA 4DRRA 2PAKA 2VTXJ 2HKXA 2WAAA 4QHZA 4RFT0 5T54A 2QQNA 1NLSA 4Z2AA 4QU1A 3WDWA 1YO8A 4JRAA 4YYOA 2PHUA 3LOBA 2HWF3 2QQVA 4RS5B 4FFHA 4QPIC 2R6QA 4JC1A 1ND2A 2R0HA 4Q4V1 5C9AB 1HXS3 3C7HA 3UJQA 1IS4A 5C3PA 3ZX7A 4CRQA 1AXZA 5CKNA 3KVAA 3DXTA 5F5QA 3EXUA 5LEKA 1KDKA 3W58A 3PMEA 3WP4A 4KGQA 3NL1A 5EPAA 5JI9A 2A73B 1RUD3 4IW3A 1APNA 4BIFA 3SC7X 2GC3A 3OPWA 5F2WA 3SQOA 3FN9A 4RR3C 2H6CA 2R1BA 2TNFA 4YZ4A 1HQWA 5AVAA 1OXCA 1D2SA 4BLIA 1RUJ1 4IEOA 4JGZC 1BVP1 1FNYA 4C8DA 2A75A 1LHWA 1K3IA 2WNUB 1PO11 4K8FA 2Y64A 3IDCB 1MS4A 5JMCA 1HRI3 1HKDA 2HBUA 2WZ8A 4F3JA 1AR93 3MIEA 3TNQA 4LLOA 4WM8C 3WNNA 3JB4C 3NMBA 1PK6B 4S2HA 3THCA 1ZZ8A 4KG8A 3MUY1 1W8FA 5FPBA 1RUE1 1AR82 1DG6A 3ACGA 3T0AA 3WP6A 5JSOA 2VCMA 2RR13 1MS0A 1XJAA 1W8HA 1HB3A 1XNKA 1CD3G 1SZBA 2XJVA 5FOBB 5IVBA 2IVIB 1PIV3 1K42A 4Q0SA 2XUMA 1E5HA 3N9NA 5FKBA 4OHXA 5C33A 3SKJE 3CBNA 3I3DA 4Y5TA 2QZ3A 2D40A 1X50A 3ZO0B 1C8NA 3AKRA 2WIIB 5DAXA 2Q4SA 1OD3A 3I97A 3L9JT 4QHOA 4WV8A 4YVSB 2VM9A 3SCFA 4DXTA 1RUI2 1DZRA 1OKOA 1F9KA 1CAWA 3THTA 2JG9A 3O0XA 4XFCA 1GLHA 4BQWA 4MXWA 5A7SA 1K5MC 2GMEA 3C7FA 1RUF1 3ZIWA 4S2GA 3FHIB 4LT5A 2W68A 3I3BA 1GNHA 5DUWA 3WF4A 2JE7A 5L7OA 1JI6A 1N1VA 4V2VA 1IGOA 2VTXA 5GKAC 1XXNA 4PBOA 2LM3A 1SBEA 4MX3A 2VULA 2ORZA 3TEXA 1N47A 3LPGA 2X5IC 3KS7A 4ASLA 3W9AA 4QGLA 1PGL1 3EB7A 1G7YA 2ZX4A 3USUA 1NCQB 2WS91 4FCAA 3E5QA 4OI2A 5I8TA 3VDAA 4CYDA 1UPIA 2ZGUA 2LUWA 3H1MA 3KQ4B 4GXLA 2VW0A 5LY1A 1OFSA 2ZGQA 3D3AA 2BGPA 4D7SA 2DV9A 3TYJA 1FNZA 1WW6A 1TNRA 3M3CA 3POSA 1OOPC 4QGMA 3VLBB 1DYOA 2MEV1 1W6NB 1LGCA 3MIDA 1Y7BA 3RMYA 4E4DX 3FBYA 5HCFA 5FZCA 2OT7A 4LIUA 2WINB 2X05A 4LHSA 1GZ9A 1ULFA 1Q8VA 4O9GA 1HJGA 5CBLA 3WG2A 2J22A 5DZFA 2VQAA 5BXXA 2Q1MA 5G05L 1YNAA 1Y9MA 3VBHB 2ZJCA 1PVXA 1GWMA 2VUDA 5JUVA 4NPRA 2G9FA 1US2A 3H3UA 5A7WA 3WNXA 2XHKA 1BBT3 1AVBA 1E57A 4KQ7A 4P08A 4ZXKA 2P5BA 3N9QA 2QFEA 3J7MA 1HRV2 2Y33A 1YEWA 5JAXA 2BU9A 4LO7A 2FBEA 2NM1A 2W39A 3H7YA 3RJ2X 1UKRA 5FKCA 5JPNB 3ES1A 1SLLA 2BQPA 2J1RA 3INAA 1JUIA 2VZRA 4P9XA 3DYPA 4L9BA 4QD2A 5DABA 1N3PA 3UETA 1EYBA 2ADEA 5F3EA 3V0BA 2VZPA 2BZDA 3ZYPA 5JXIA 1DQ1A 3AVRA 4FO9A 4PIYA 3UJOA 3LSDA 5BNPC 4AGVA 4PHZA 4QPGB 1NG0A 3WW3A 3JBG2 2JEMA 5BPXA 5D1IA 1Q5OA 2FQPA 4MH0E 1YFWA 3ACFA 5D8AC 1R081 2RVAA 1E5RA 3WW4A 3AP5A 1HJFA 2VMFA 4O61A 5DXDA 1AR63 2JXAA 3K48A 5E1RA 4BQ4A 2BBVA 5ACA3 4FAHA 4AEJA 4R52A 1ULGA 2JB8A 3CF6E 4K9SA 2J1VA 4EWAA 4MG2A 1QDOA 2D3SA 4JRLA 1LODA 2RJ2A 4IEZA 3ZXKA 2RMU1 1DQ2A 4XDQA 1FPN1 1U12A 5JVVA 5JXHA 3NSTA 1LHVA 3VZNA 1PZ7A 2OW4A 2DUQA 2P1BA 2WT2A 3WUCA 4EWDA 1VPHA 2VOKA 4XXAA 3O0VA 2NPIA 4R9CA 4YW3A 4LXLA 4FXKB 2P17A 1QDCA 5FZDA 1MS8A 4LBQA 3O1RA 4CDUB 4LBOA 4CPBA 2W2IA 3BTXA 3MZHA 2VZTA 1RMU2 5FPZA 2ERFA 2YB7A 4NIGA 2XMLA 5C3SA 1BMV1 1JS9A 4C0HA 3AVSA 1AYN3 2MPFA 3PUIA 4YGDA 5FQ0A 1E5IA 2YU1A 2JJ6A 3O1PA 3SCGA 2GP5A 1OA3A 4NRPA 4NIAA 2X8KA 2I2SA 4AI9A 1COV3 4FPCA 2CHHA 2NMNA 3ZXDA 4UXAA 5F6LB 2D6KA 4JGYC 5FYSA 4A7YA 2ZGRA 5FZ6A 3WLUA 4XACA 4MHRA 3VBSA 5FXXA 1VE0A 4E9KA 2VW1A 2Q0AA 4RFRB 4CP0A 2A7AA 1XE8A 1QJFA 4COZA 1A3KA 3WZ1A 4RHV2 4CP9A 1SG3A 4ONUA 4XVHA 2WNVA 4AQSA 4ZY9A 2D7FA 3ZPOA 2OA2A 1DYPA 2GN7A 1I9RA 3VKOA 1SLTA 5FZBA 5EJ3A 2B46X 4ISQA 3ZSKA 4GWMA 1WLTA 1H4HA 5EZWA 2GU9A 1ND3B 4LEJA 3VDBA 4LHLA 1ZVFA 5K7PA 2P2KA 5DPNA 2BNOA 4WVMA 4FPEA 5A33B 3VUOA 4DO0A 1HQNA 1DGLA 2W94A 1UNBA 3B9CA 1HQLA 2ZGOA 1G9FA 2DTWA 1A34A 2AEYA 3HQRA 4D6SA 2WQ8A 4B4PA 4XAEA 2W1QA 2WBKA 4HN1A 4BPZA 3I59A 2D5HA 4BHPA 5JR7B 3VZLA 1CZTA 1KXGA 2D5FA 2VCCA 2WSUA 2XJQA 2XHNA 4SBVA 3ZYRA 5HCBA 3ZKUA 2XBO3 4X6QB 1YJKA 3JCIA 3WQ1A 1FOD2 5GLZA 5DAPA 2BFUL 4RQPA 3TWIA 5GJ6A 1VB2A 3H3LA 1S2EA 1A8DA 1AJOA 3F2ZA 5FYYA 5HCHA 2CNAA 3WP5A 3T2OA 3GZUC 2A3XA 4PJYA 2OQ6A 3GBFA 1A78A 4M3CB 5DZEA 4A45A 4Q4W2 5FWJA 1U5XA 1IOAA 4P9YA 3HNBM 3ZXLA 5K0UA 4IETA 4CU9A 5FMCA 1RUI1 3LEGA 2HWC3 5F39A 2GC1A 2B9UA 3TEWA 2YFZA 5JOWA 4EYUA 2B7YA 1AL21 1VBE2 3K4DA 2QQMA 1KS5A 3LKJA 4HN0A 2QZ2A 4OFGA 4PLOA 1BLZA 4YM1A 4GMP3 4E2QA 4Y1UA 2KD7A 2W87A 4GWNA 3PVBB 5JDBA 3HPNA 1L7QA 2E51A 3WG1A 3D5OA 3VHPA 3OD0A 2C9AA 2CSGA 3VDDA 5FBZA 1LRHA 3DN7A 4B7KA 4DRVA 1MZ5A 4N53C 5FR3A 2H0VA 2JDAA 3ZMOA 2PTMA 2XKPA 3FWEA 2BWCA 1SEFA 3QBQA 1URXA 4Q0PA 4I0WB 4K20A 2LROA 5F8PA 4XFGA 2BDRA 4EQVA 2BJSA 4EN6B 3RWKX 3C7EA 1KITA 1WW7A 3AYCA 2Q30A 2Y6KA 3DYOA 3M70A 4XF9A 3ZKYA 4FOVA 3ZFFA 2BOJA 3N7KA 3GNEA 4Q27A 4CUBA 2BTVC 4DUWA 1QQP2 4AEDA 2JECA 1NZCA 4KNCA 3K4ZA 2P3YA 2WA3A 4CDWB 3S0MA 1GUIA 1TME1 1W6QB 1RVF2 2QBXA 2Y38A 3CZJA 2XLFA 4JKMA 2FDKA 3BPZA 3V64A 1XOYA 1ZZBA 3X29B 3PVEA 3ZXJA 5A7QA 4IE6A 3CJIA 2HWB2 2YPDA 5JZGA 5LZ6A 1ZRFA 3T08A 1LEMA 1C8M3 2AEZA 2PLV3 2UU8A 4IV1B 3UGFA 3WF3A 1GSLA 2YROA 5FY1A 5SV8A 3RWNA 1V70A 3RS6A 4GB31 3E1F1 3SKVA 3GXUA 2IVJA 5BNNB 4GH4A 3BIWE 3FUQA 3NKTA 5GZFA 1V0AA 3ZYHA 4P02B 4ZPIA 1MEC2 5FP4A 4RS5C 4R4ZA 5LWBA 5LCWL 2WN3A 2MHFA 2WO7A 5C9AC 4Z07A 5F6KA 2O8QA 2PHRA 1GP6A 1UMZA 1SFNA 3NNFA 1I1EA 2EXJA 2QQWA 3KT4A 5J09A 2R073 1SDWA 4Y22B 1NA1A 2BBAA 1YQ8A 4DPNA 1POV0 4Z82A 5JR2A 3KB5A 1EPWA 1QXPA 1GOHA 1E5SA 2QKDA 3ZOIA 3W59A 3RMXA 1RUH2 3JBG1 1CVNA 1RUG3 4BZ4A 5C7GA 3PIJA 1H8TB 2D6LX 2GH8A 3MLKA 4LK7A 4AVBA 4L8QA 1WMEA 3A7QA 1BJQA 3AP4A 2Q1FA 2P3JA 3K75B 2IXCA 1GYKA 1RINA 2IXJA 2XXZA 4DNYA 1PK6C 1S0CA 1DBNA 2ZGKA 5DQ0A 4N9IA 3RZHA 1UMIA 3M3EA 1BK0A 2D98A 4LO5B 3H8XA 2JX9A 1GFF2 1W9SA 4MYEA 4QQOA 4CDXC 1POQA 1JOPA 1LAJA 1ND2B 1HLCA 2D6NA 2RG4A 2WT0A 3PUHA 3LPFA 1WMXA 2XB6C 3N36A 3N9OA 3FMGA 3WD5A 2EVXA 3DEMA 3E6CC 5LRRA 1VAVA 2ZXQA 1ZRCA 4FP3A 3S6PA 1BCXA 1I6XA 1AR73 3E6DA 5EJ1B 1WZXA 1FX5A 2DURA 4JDNA 4YFWA 4YVSC 2OUHA 1X82A 3JU9A 4ZONA 4LBKA 3HR9A 1IG3A 4ZXEA 2BPA2 2A70A 2BEOA 4Y4RA 1UF2C 5DN2A 1G9BA 1A8MA 3EHKA 4W65A 3WUDA 1BYHA 3EJKA 3M2MA 4PF5A 4B1MA 2WA4A 3N3HA 1NQDA 1ASJ3 4PDWB 4BDVB 4DFSA 2D97A 2V72A 3WDVA 2WQ4A 4LR4A 2VBPA 4YARA 1W39A 3ZVXA 5LRSA 3LAGA 3WVJA 4FOWA 3JB8A 5G04L 4COWA 4QT6A 3AFGA 2EXKA 4K3UA 4EWEA 1U5YA 2IXKA 1JU3A 1C3HA 2PN5A 2WO3A 4Q4V3 2WFF3 3CQOA 4UYBA 1F5FA 5BV6A 1NCQC 4QQ2A 1U5IA 2P3KA 4RHV1 2AC1A 1QY4A 5FY0A 3VD4A 2W08A 4HBNA 2KA3A 2XR4A 3KV5A 4KU7A 4E4ZA 5HXVA 1UX6A 2BERA 4IV3A 1PMIA 1XYNA 1LHUA 1ULDA 2Q8EA 2GC2A 4ET7A 4QQLA 4J1XA 1O5LA 1RUJ3 3OCPA 1UL9A 3ZSJA 1J1LA 3ALQA 4XXPA 1ST8A 1CAWB 3O1SA 2JG9B 4NAOA 2W1UA 2WLPA 4MXWB 5F37A 4LKDA 1H2MA 5E89A 5FZOA 1S0DA 2I07B 1YQ6A 2B39A 3RZZA 1JYWA 5IFTA 2A6YA 1YYNA 2EALA 1DIWA 3I4IA 4M4RA 5L7OB 4M4PA 4WVZA 4AHXA 4PI0A 2ZGNA 5J1XA 1D0HA 2ZGSA 4YW4A 3I2FA 3RZMA 4AFAA 4IERA 3VBHC 2X53S 1CQ9A 4LBQD 2XPJA 2VOVA 1RUE3 4BA6A 3E5UA 4CPBD 3AZVA 4JHTA 3ZR6A 1NXMA 3NQHA 1ZRIA 1GNYA 1RC6A 2YPJA 3OGGA 4JKKA 5LATA 2JDZA 4HMZA 1CAVA 1VMJA 4UAPA 1PGSA 1W6PB 3TAYA 3USUB 4KBBA 3S5AA 2RV9A 5KHKA 3ME2A 3WW1A 3QACA 2JKBA 2ZEXA 1X33A 4KWJA 1QJY1 1CONA 2J42A 3W20A 2ZA9A 2VZUA 4M3CE 1ULOA 4XCAA 4GJZA 3ZXAC 4YW6A 3U07A 1ZRDA 4Q4W1 3WCRA 2VOXA 4CP2A 3GJAA 5A7PA 1PVC2 3VHOA 5KR7A 3ITQA 3APBA 4WM7B 1LHOA 1RUF3 4D7YA 1VBE1 1F31A 4META 2A3YA 5KXEA 4CCLA 3EBRA 2RS12 3H3ZA 2JENA 1X36A 4YW7A 2DYCA 2XH6A 2XWBB 5IVJA 4AEMA 3ZSEA 1H6YA 1WLDA 1G9DA 3IPVA 3POYA 3NV4A 2VVFA 1ZZ6A 3W21A 2X29A 1N3QA 3MLJA 5FBJA 4AVVA 2DU1A 4LKSA 4KH9A 2OUJA 1SLAA 3KZ4C 3OGVA 5A7WB 3MEPA 5LK5A 1LENA 1O3RA 4MSVA 1KRIA 4S2FA 2WS93 2ETEA 4FSJA 1AX0A 2XVKA 4NIIA 4YM0A 5LASA 3M7AA 5T55A 2H0BA 1DGWA 3AMQA 3MPBA 5C70A 1XNDA 1SACA 5FP9A 3T1MA 3WW2A 4BQYA 1S0IA 1IPSA 1EUUA 2ORXA 1JODA 1QHDA 2NP0A 2JDUA 1AUYA 3V0BB 2R30A 1QKQA 1ZBE2 1ZBA2 4YW1A 1VBD3 2BOIA 2RDRA 1QQP1 2NMOA 3AP6A 4XHBA 2MEV3 5HV0A 1DQ6A 3VHRA 4W6XA 2YV8A 4W6WA 1OLMA 1V6IA 1RVF1 3M3OA 3LE0A 5A3WA 1O59A 4AGGA 4NJ4A 3GBGA 5F32A 4RD7A 1UOFA 1TNFA 2FDGA 2HWB1 2JDHA 4A42A 4D8MA 4CEYC 5AC91 1WLCA 2Z42A 2XL9A 2WT1A 4OQ8A 4XJZA 3HIFA 3LB9A 4UW5A 2GSYA 1KGYA 1FI2A 4KL1A 1QJU2 2R0FA 1AYM2 3DF0A 4AAPA 1QMJA 1JYNA 5DAQA 1NLRA 1WBFA 4AXOA 3JD73 1MEC1 2D6MA 5ABJB 2A6ZA 2GNTA 4EZHA 2W52A 2WJSA 3H1WA 3S7EA 2E63A 2GNDA 1W90A 1VBA2 2LS6A 4FPJA 1NXD1 2HYXA 2OPKA 1VRH2 2VH9A 3IZOA 3LWCA 4LBQB 4QPIA 2C24A 4WVVA 5F5CA 2GMPA 1RUNA 1GP5A 1OVSA 1PNGA 3JQXA 4HKLA 5LA1A 4UW3A 4UW4A 1ZM1A 2VVDA 1H4GA 1ND3C 4MGTA 2OKXA 1UU4A 3A0KA 4LBMA 2ZHMA 1GKBA 1JXNA 3EMRA 1VBB2 1WW4A 1Z78A 2EIEA 1H2LA 2JG8C 3THPA 3BOWA 4FPKA 4GAZA 1R083 1RUH1 2VQ0A 4J6GA 5I0DA 4RR3A 4QX0A 3SCHA 3OY8A 4JGZA 1GNZA 1F4HA 1JW6A 4Y5SA 2Y26A 4QX2A 4BE3A 5F9TA 4Y26A 1IS6A 1VRBA 2JE9A 3E5XA 3AJZA 3MYXA 2SLIA 2VAUA 3MHZA 4IE0A 5IK8A 1FPN3 4IGPA 4CCCA 2AREA 2ZTNA 4AEKA 4P9JA 2XVLA 5EP9A 1NAEA 1Z7S2 1Z0HA 4WM8A 4HK8A 4CP9B 4R9BA 3NNJA 5DDJ3 4OZXA 1MACA 3OTFA 4BQXA 2WNVB 4YG6A 1SFPA 2BP6A 1VMHA 3HT1A 5FYZA 1LOAA 3VD5A 3QH6A 1EAH2 4OHYA 4OHWA 3PVNA 3BODA 4X8PA 4YGEA 5H9RA 4AYUA 4YG0A 4YRDA 2DF7A 4TN7A 1CR7A 1RITA 3LFIA 4Y20B 5LBCA 3J8F3 3NNGA 4URAA 4XFIA 4RGGA 2VPVA 1JZ7A 4XDPA 3AYEA 3AZXA 1OKQA 1VP6A 1R1A2 4WZCA 3VBUC 1GZWA 2P4EA 2DVFA 4WVMB 4NN0A 3E97A 3AXEA 5FREA 1T2XA 3AYAA 1LNSA 3LDKA 2BFUS 2XQRA 4I2OA 2DFCA 2R063 3OEAA 4JTOA 1K5MA 2AACA 2HEVF 2VD7A 3I59B 3OGSA 4Q0QA 1K12A 5M0TA 5FZ7A 4Y1ZA 4CCNA 5A6YA 3ETQA 3J7NA 4AW7A 1DHKB 3GHMA 2V4AA 2VO5A 1G9AA 3NJXA 5CADA 3MBWA 4LO4B 4K21A 4RQPB 3VB9A 3RI8A 4B4QA 2XQXA 2JICA 4CUGA 5B4NA 4NROA 3WHTA 5JSPA 1W3XA 3PJYA 3ON7A 3WF2A 1AX2A 1UZYA 2VC9A 2HWF2 2RS31 2X5IA 3WV6A 3ZDSA 1I5ZA 3KHCA 4IEPA 2L9LA 4PF1A 2A1XA 1ZRRA 1HXS2 3CU7A 3J4UH 4YW5A 3ZPYA 5IVEA 3FJSA 4OUEA 4XUQA 2P37A 2R042 2QTWB 4LPLA 4CDWC 4A3XA 5K0UB 1POV1 1SBDA 4H3WA 2HWD3 1RUD2 3OGJA 4MGQA 3UGGA 3TN93 4ZZ8A 3POGA 1OOPA 1GICA 4IV1C 3ACHA 2XJSA 4CCDA 1C57A 3IMNA 5ERLA 3SMHA 3WNPA 4BU2A 5A1LA 3LA2A 2GZWA 1DGWX 5FLHA 4ZHNA 3VDDB 2DCKA 2Z5WA 4IEQA 3ZFGC 5JXJA 3U0ZA 4KWUA 1HRI2 3RZKA 5IVFA 2PXJA 1DP0A 1TMF1 4BK5A 1AR92 3RZGA 4DEQA 3AJYA 4JV4A 3LCPA 1KQRA 4LA2A 5F3GA 1Q8QA 3U75A 5IK5A 2QJVA 3HAGA 4AZZA 1G8WA 2PHDA 3KCXA 1O7FA 1YJLA 2ZGTA 3B5LB 2BRTA 2Y0OA 1O3SA 3KD4A 3GCXA 4NPMA 1I5PA 3ZFFB 3D4KA 4AI3A 1PIV2 2Q8DA 3AL6A 2Q8CA 4AK3A 4XHXA 4NOTA 3VBOC 1V9U2 4A7KA 1RUI3 3AMNA 3ZR5A 1PVC1 1AL23 4Y1XA 4R4XA 4QB6A 2ZZJA 5T5PA 2YXSA 3VBRC 4LQRA 5JZGB 4XUOA 2CL2A 2RM22 1H8TC 3K46A 5A7NA 2ADDA 4LKFA 2QQLA 4DXRA 2RS11 4Y5Z0 4AFMA 4CCEA 3W5NA 4I0AA 2HEYF 1H9WA 4DINB 1VBC2 3T2PA 5D8AA 2VBDA 4GH4B 2PHWA 3T0BA 5HPOA 1GP4A 2JWPA 1TE1B 4Z1VA 1SPPA 3NRUA 1PNFA 3WG4A 4LHKA 4Q4X2 2CWMA 1TG7A 1OF3A 4GJYA 1CWPA 1ACCA 2PA7A 4MZUA 4TXWA 4MGKE 4GD4A 1RHI3 3DCQA 5L9VA 4B1LA 1UCXA 3MIGA 3IWZA 5FYMA 1NCRA 1R1ZA 5C6CA 1W0PA 2IFWA 2ZX2A 3IDEA 3KV9A 2WWJA 3C3VA 3BALA 1NA1B 1FV3A 3NJYA 1ZBA1 3H50A 2VMIA 1TME3 5C4WA 3BU0A 4W8JA 1WW5A 4IEYA 3R0RA 2EICA 2GMMA 3KSCA 2DDUA 2XONA 2JKXA 3UGHA 1QJX1 4DOUA 4B29A 2IWGB 4PDWC 5T52A 1JZ3A 4DS0A 2VCAA 4YZ1A 4C0BA 4GULA 4TLFA 3K4AA 4HG6B 4Q8LA 5FP8A 4GB33 5BNQA 1WD3A 5FYCA 1CAXA 1AX1A 4BQ5A 5KWRA 4DY5A 3FC0A 5A3MA 4QDRA 4PCRA 4LOSA 1QJU1 3HEIA 1AYM1 1IQDC 3PTRB 1OC1A 4BISA 5DUXA 1VAKA 1YWKA 1S0EA 2C0ZA 1DQ0A 4QX8A 1BEV1 2F17A 2YG0A 3QOPA 3AKSA 3R4SA 2XL7A 1PMHX 4Y24A 3MPPG 3HBKA 1Q8OA 3TB0A 3RFRA 2WZR3 3GF6A 3O0WA 5JXGA 2O8OA 5FZIA 2YGMA 4EV0A 4JZRA 3VZOA 4MLOA 5F3IA 5HBAA 5FTTC 4M01A 3DKWA 5J48A 4CE8A 3LSEA 2JD4A 2JG9C 3JBG3 4A6OA 2VU9A 3THDA 1VBB1 3B00A 2WWUA 1AF9A 3U14A 2JB4A 4UFLA 5JMOA 5L7OC 4IGQA 1H2KA 1KDMA 1C1FA 3D6EA 1ZA7A 1JOJA 4LMFA 2E33A 2GC0A 3SITA 4NUBA 1UZ0A 2HLEA 3CHXA 4E27A 4NIDA 4H7MA 4AI1A 1ONAA 4R8HA 4IE7A 2AGSA 4CDQC 4LO6B 1DFQA 5ACA2 2EF6A 3FFQA 3FUOA 1CN1A 2W95A 1UIKA 4XW3A 4XFHA 1H2NA 4IE5A 5FUPA 3ZN6A 5FJHA 3H8RA 4QX3A 2WZPP 1EAH1 3SEPA 4IV3B 5J37A 1VALA 5LA2A 4XEZA 4PLMA 4N43C 3OF1A 1OHFA 2HWE2 4MVTA 1WD4A 1Y4WA 4XZPA 1R1A1 2OZJA 5IW0A 4QKDA 4WM7C 4MXVA 1QU0A 1S55A 2PHFA 4XC9A 3IKWA 1W06A 1PM4A 3HBZA 5FMOS 1W6MA 5LA0A 4I02A 2VGDA 3OSDA 4QX5A 1NKGA 5CFDA 4H55A 2V73A 1COV2 1UU5A 3U4SA 4K1ZA 5EJZB 3U1XA 4GMP0 1MQTA 2J1SA 2ZGLA 1CAVB 3NAPA 1YI9A 2W5FA 4CU6A 2VR4A 4NHYA 4HPKA 4YGCA 4ES9A 4HL0A 3P6BA 1W2UA 1W8UA 3WG3A 1QXRA 2HWF1 4AWDA 1KEXA 5KHGA 4ASMB 1LCLA 1OPOA 4XF4A 2RS52 5CB7A 4FP2A 5IFPA 1HXS1 2VZ3A 1RUC3 5GLVA 4COYA 4IXLA 4XE9A 4YWAA 4HOOA 3ROUA 5IYYA 1JZ5A 4AHZA 2R041 1WCDJ 5F5AA 5I8SA 3ES4A 1N3OA 2AYHA 5FY4A 4XFBA 4BLJA 4BMBA 2FD8A 2GDFA 2FDJA 2I74A 3BOPA 1W6OA 3AM2A 5AFBA 4QX1A 5I93A 1OURA 4LJHA 3S30A 1JMUB 3HOBA 3CEWA 4L2NA 5A80A 4UF0A 4AI8A 2IUWA 1SLBA 1DCSA 1AR81 1EV12 3VL8A 3OJBA 4QXKA 4GALA 1OI6A 1OFNA 1XNAA 2E9QA 4MADA 5FDBA 1YLLA 1D4M3 3GDBA 4QB2A 2J1UA 3RVHA 2CU5A 3BN6A 4MGSA 5ABJC 2GH2A 4W4ZA 4QXCA 5F1RA 2LTNA 2VUCA 4FFIA 3GM8A 2ZHLA 4PQ9A 1QJY3 2XBO2 4YZ3A 5D2AA 1WUVA 3O1TA 1N1YA 3KQRA 3WP3A 4P5HA 5CZKA 3ZYJB 1B35A 4CCMA 4FPOB 4Q4W3 1JZ8A 3IN9A 2WRAA 4O7XA 4E2SA 2BNNA 1V9U1 3DPRA 1OUXA 1QOTA 1W03A 1S0GA 3EYPA 3HD8B 3KT1A 4JDMA 3U37A 1QOSA 1VBE3 4BJ0A 3WNKA 1YFYA 4CP1A 2X10A 4XBNA 4ARXA 2RM21 4B8EA 1W8WA 5A1AA 1UOBA 2HWC2 2VXRA 1QIQA 4HVOA 5FY7A 4D69A 1O8PA 2PFWA 2AZ5A 2ZKNA 4NR1A 2B42B 5J3UA 1WLWA 3RNSA 2WDBA 2VZSA 4RGAA 1VBC1 4KWLA 3IDAA 3P3PA 2EA7A 5GLUA 3ZYBA 3OOXA 3AB0A 1MZEA 2AUYA 4Q4X1 1AHSA 3A22A 3QD6A 3H8OA 4YG3A 4C1WA 1YIFA 5C3OA 3ZDVA 2YU2A 3AXDA 2PYTA 4QU2A 3VKNA 1T6GC 2ARAA 5J36A 4ARYA 4QPIB 4CDXA 4XCBA 3V56A 3GZTB 2TUNA 2ZACA 3SXWA 3JXSA 1FXZA 3ZFEA 5T50A 4Q1PA 2VNVA 4CCKA 4DZGA 3ABZA 4H14A 5EQUA 5A3OA 3IIIA 4C91A 4HZFA 1RVF3 1PMJX 2KXLA 4ISRA 1W05A 2Z79A 1GZTA 4NHXA 5LB6A 5T5JA 2D44A 4NRMA 1LGBA 4QDSA 2EAKA 1ENXA 3T0DA 1R093 3NV3A 2PAEA 3SHRA 5LA9A 5C5TA 3C7OA 2VOWA 4JGZB 2VVEA 5AC93 3PU3A 1V6LA 1J59A 3B3QE 1DQ4A 3MF9A 1Y9QA 5IT6A 1BQPA 3V0AA 4BYYA 3G6JB 2PLV2 1C8M2 4QPWA 2BVVA 1IKPA 1PO23 1WGPA 2JD9A 1HRV1 4L99A 4LUMA 4XDOA 1IG0A 4K6BA 3V65A 4CCJA 4CXYA 4PIXA 5EIYB 4Q4Y2 4WM8B 4RQPC 1DGRA 1MZ6A 3E6BA 4HT1T 5IVYA 1BVVA 4NMIA 4XQ4A 2K2SA 1ULEA 3K3NA 4BK4A 3PHMA 4HFSA 3CLPA 1ODNA 4BH9A 1NCQA 4Y1VA 3KVBA 4LBLA 3WR0A 1SCRA 4YVWB 2WNUC 3WNMA 2ATFA 4Y4YA 2A6XA 4DUXA 1HN0A 5K0UC 2BNMA 1GZWB 2HYKA 5KHHA 4BB3A 1QGLA 2PHLA 4PBPA 3O1OA 3IT8A 1IPJA 2R072 3VL9A 2QUOA 2E7TA 2QQOA 2RE9A 5JCTA 3VKMA 5FZHA 5A3PA 5FO8B 1J3QA 1LOFC 1K5JA 1J1TA 2Y60A 2CGNA 3BCWA 4HSJA 1XYOA 4UW6A 3HN3A 5EYXA 3FHAA 4ZU4A 5JIAA 4E2GA 1RUG2 3VDDC 1SLIA 3VD3A 3BKZA 3KT7A 5HI0A 2W92A 3FFZA 5ANNA 5CEHA 3MFAA 1VMFA 4M3CF 3GZAA 3GCWA 2RJLA 1NYWA 4N9HA 4Z92B 2PELA 3GYDA 3UKVA 4UFHA 5TSWA 1NOVA 1H9PA 2HEWF 2UWBA 4N7IA 4H2AA 2G1MA 1M4WA 1REEA 1RMU1 2WN2A 4PLNA 4O65A 1JBCA 2ET7A 3H9AA 3KV6A 4U36A 1G9CA 3PURA 3ASIA 4XUTA 1SQ4A 2HWE1 1LHNA 2VNOA 1LU2A 5JOZA 1CJDA 5BYNA 4ES8A 1AR72 1F5JA 3OUHA 2ET1A 1OQDA 1C28A 1K45A 4ZKTB 2VZOA 1EPZA 1ZX5A 3K51A 5EV7A 2GN3A 3AKPA 4NE9A 2VUAA 5APAA 3ZMNA 5BNOA 1UY2A 3UNPA 5A32A 1UY0A 2GALA 1UXXX 2I45A 1CPNA 4XJAA 4E8DA 1W9WA 1H8VA 1XB9A 3NJZA 4GH4C 1ASJ2 2QCSB 1COV1 4XUPA 5IATA 3MIBA 2XUEA 4LBNA 2VTFA 3HQXA 3RYKA 1WCKA 5E16A 4IQPA 2VCBA 1OMIA 4G4FA 4PI2A 3WDYA 1MS1A 3NO8A 1P8JA 2FDFA 1T6BX 4EN7B 2RS33 5T3NA 1W8TA 2W47A 4JVAA 3U11A 3I2HA 2WFF2 1VIWB 5A7OA 3I54A 3J26N 4X6RB 1UN1A 5FPUA 5I8YA 3LDRA 2RS51 1NLQA 1PO13 1PM7A 2VQTA 4LULA 3VN4A 1JYTA 1POV3 2D3PA 3OEBA 1S2KA 1J84A 4LKEA 3M3QA 5CNAA 3SH4A 4HLTA 4TWTA 4XFFA 4DIQA 5C8CA 3LF7A 1W04A 4CEWA 4LNVA 1ZA4A 3QH7A 2XVGA 1RUJ2 3RI9A 4YGBA 2G9ZA 1M06G 1FATA 1JYCA 4OI4A 4ORFA 1RYYA 1EV11 5IVCA 2AR6A 3I2JA 5A70A 5KXDA 1FOD1 2ARBA 5C71A 2EIDA 3DL3A 2PMWB 1SPPB 1TMF3 3ACIA 3AP9A 3DUIA 3MF6A 4NWVA 4CEYA 1MS9A 3UKTA 4BOWA 4P9IA 1H30A 2BWAA 5FZ8A 3POJA 1TZOA 5FYTA 1JZ4A 3POIA 3QCWA 2G4IA 4XUNA 4BIOA 3LA7A 4EE2A 1JYVA 1OLRA 1W9FA 2CAUA 2CGOA 2ARXA 2XBO1 2SBAA 5FFOC 1NCRB 1W28A 4QPGC 3LQCA 2J1TA 3WNLA 2ZKLA 1DGRN 3WNOA 5A3LA 1W9YA 5C4WB 3LEKA 2NLRA 5FZEA 2C5DA 3AKQA 2VNRA 4GWIA 2ZGPA 3QLQA 3D0SA 4QKFA 4QM8A 2JDYA 1UXZA 2Y34A 2E7AA 2W1SA 1AJKA 1N1TA 4P14A 3A23A 2RS13 4HK9A 3O1MA 4IEUA 4COUA 2D6OX 3BIEA 4XQWA 2HWC1 5IHRA 1RUF2 1CAXB 4G3YC 1O4ZA 2JG8A 5DMYA 3NKGA 4MGYE 4XYXA 5CFCA 5K9YA 1GWLA 3ZLIA 2UWCA 4QWNA 4Z2WA 5D21A 3ILNA 2P34A 2YBPA 3IM0A 1EUTA 2Y6FA 1OA2A 3KM5A 3AP7A 3R4DB 1TQ5A 2OYZA 1GQHA 4CDUC 1OSGA 1SLCA 3AZZA 3ORJA 4YM3A 1PGL2 4H7LA 4OQ9A 4XETA 2A5ZA 1O4YA 1LULA 1XE7A 1WCUA 2IC1A 3VBFA 1C1LA 1UW8A 1ZBA3 4BWOA 2XJTA 3O1VA 1G6NA 5FPXA 2OS2A 2ZMLA 1AXYA 4XPVA 1HDKA 4KBZA 2QNKA 3PJQA 4M0NA 2QQPA 4WBBA 3B69A 4K1YA 3BUCA 4M3CA 3D0JA 4LO8A 5DAWA 1VBD2 1QJX3 1CZSA 1VR3A 2TBVA 2MEV2 2VOTA 1O3TA 4MUVA 4EROA 1F35A 5B4XA 4A4AA 5IAXA 3VBUA 5I0UA 5F2SA 3O7OA 1IS5A 1YCIA 2OVUA 3WQBA 1HB4A 5GZCA 3AZWA 1C5IA 3N9MA 4LIVA 1IZ3A 2ZGMA 4GKXA 2LW8A 2VMCA 1W8OA 2WSVA 3PLQA 4EN9B 5DG1A 2Z4FA 3PUAA 4QXBA 3UL2A 2XJRA 2CWSA 2BV4A 3RGBA 1BEV3 1XSQA 4IEXA 4AHWA 1YQ2A 5A6XA 4HVQA 3PU8A 4Q4Y1 5FY5A 1QNYA 1QXJA 3ZN5A 1PZ8A 3ZN6B 5J96B 5EHDA 2ZMKA 3U4XA 1S0BA 2OZ6A 3BYWA 4FPLA 4RGKA 2B9VA 3JD72 3SEEA 4L92A 3J9SA 2RDQA 5FQ0B 1JHJA 2CTVA 3I2KA 1W2AX 3N7LA 2A6WA 3Q8EA 2VJXA 5GZEA 5K8SA 4R9AA 5FYBA 4BXSV 2XJPA 1LESA 3H42B 4CU8A 1KD7A 2ID4A 4QX7A 3WX5A 3IDBB 3NWKA 4GWJA 2ZAAA 4INDA 4CDWA 1W6MB 1GBGA 4M0HA 1CJPA 4QKNA 3VBSB 2DCZA 3I2OA 1HB2A 3FX3A 5DZGA 2RMU3 5GZDA 1BHGA 5CFDB 4GQ7A 5ANQA 2DVAA 3P3NA 4MOAA 3DECA 4RA0A 1RUG1 1NQJA 5FLIA 3UT0A 3PIGA 4OZOA 2C26A 1MQTB 2W0XA 1QH6A 3KF3A 3LDBA 4JCKA 4XTMA 5FZ9A 4FQ4A 1XBFA 2HH9A 3I3EA 3NAPB 5C8WA 5BUVA 3ZFGA 3UESA 1S1AA 4HPKB 4K40A 3CDZB 4LUKA 4CXXA 4UFMA 5CYYA 1FPN2 3FLRA 2K0GA 3ETPA 5EXOA 2NQYA 3FZ3A 1D4VB 1FMD2 1X9PA 5FZ4A 4QMAA 4G9SB 3T09A 3TRSB 4FQZA 1UIJA 5DDJ2 1VJ2A 2D3RA 4XFAA 4HONA 3OBTA 5FYUA 2YC0A 4FOYA 3WXPA 4DQAA 1JYIA 1WCQA 4AAXA 4XOGA 3J8F2 5GLTA 4QDQA 3BTAA 2WYSA 4FOQA 3RRDA 3KLSA 1DQ5A 3VBOA 4AFCA 1W8ZA 4PQQA 4UF0B 3SH5A 2QDRA 3OBZA 4KI5M 3ZXEA 2QDNA 1FYUA 4YM2A 1GV9A 4OUSA 3VBRA 3DXUA 3LGRA 2EAAA 1QJEA 3VKFC 2PHXA 4BQ3A 1CAUA 4Z8BA 2R062 2YDEA 4P5YA 5FPLA 5A3NA 1O3QA 1RJ7A 2B8MA 3RG0A 1CGPA 1STMA 1UMHA 4FPYA 4N8MA 3NVCA 4F7ZA 3PUQA 1Y43B 3I2IA 2JE8A 3PDQA 4Y33A 4GZ9A 4IEWA 3KCYA 4BQ2A 5FP7A 1HIXA 2UY8A 3D8CA 2WFF1 4MHUA 4BM8A 1B35B 4CXWA 4HSLA 1YRZA 1AZDA 4P9LA 5JOXA 3S5QA 4LBJA 3NV2A 2R043 2YUEA 3BB6A 3DPRB 4XF0A 3POEA 2VMDA 4YFZA 2R32A 4AHYA 4AF9A 3WOGA 2A71A 4K8RB 2JDNA 1Q3EA 5FYIA 1ENRA 1OF4A 3FLTA 5BNNC 1UYXA 2HWD2 1AR83 4I3GA 1Q43A 4MO3M 4I30A 3CJIC 3TN92 2Q5TA 4KG0A 2DUOA 1D0GA 4PDWA 4C90A 3CMGA 4YNIA 1H1MA 4FVVA 3OYWA 1QEXA 1BKZA 5C3RA 2RR12 2W3JA 4J1WA 2V4VA 3VGIA 3S7IA 2Q1ZB 2WAOA 2ZHKA 3T3YA 4AEDB 1SDDB 4XZUG 1YI7A 5L9BA 5FOJB 1X9TA 1UKGA 5GLWA 4CDXB 3RYRA 2YYOA 4HXCA 2YC4A 3OBRA 1J58A 4CUAA 5FK8A 2ENRA 4YVWC 1UOJA 3ZFEB 4KMQA 5FZLA 1SMVA 1V9U3 1Q8PA 2VQUA 3LD8A 3CJIB 3DKQA 1F15A 5BNPA 4XJ9A 4UFIA 2IXHA 5KC5A 3CJXA 2Y6GA 3SNMA 4TZDA 2RM23 5CG9A 1RIRA 2VMGA 4V1PA 4YZ2A 1AL22 2UWAA 1DU3D 2QE3A 5LBEA 3V0AB 1GZCA 1VBC3 1ND2C 2WC2A 1JYXA 2Y0IA 1GOGA 2WZEA 4Q8KA 1NY72 1YUDA 5FUNA 1RL3A 2Z2SB 4N7UA 4UBHA 5FZKA 1W0NA 2WWSA 2CV6A 3IIAA 4Q4X3 2N7GA 5A3TA 1YFXA 5I0TA 1ZZCA 4W6YA 3ILRA 1O8SA 4AFBA 4TYSA 4DEVA 4NAMA 2YY1A 3J7HA 5EFUA 2BW8A 1LOCA 1ZBE1 1ZZ9A 4CDQA 4P00B 2WNEA 3N4MA 2ZBJA 2QQKA 3MDPA 1XU2A 1W6PA 3OB8A 1UZZA 4AG4A 1RHI2 4GIQA 4B4RA 3P5BA 1NE4A 4ZS2A 2E31A 4Q0VA 3BGAA 5E88A 3B02A 2VW2A 2HJIA 2F4PA 2B45X 1JOBA 2UURA 2XG3A 4N43A 3NNLA 5FV3A 4BMEA 1REDA 2YMZA 4XJWA 1VBD1 1TME2 2IZWA 1MVQA 1SFYA 4XBQA 2V09A 2ZEZA 4WM7A 3MO4A 2E53A 5DUVA 3W5MA 1V6NA 4JGYA 4LORA 3ZSLA 4A6SA 3K77A 1XYPA 1HRV3 4LHNA 1H1AA 2QQJA 3GALA 4CU7A 3WY6A 1HV1A 4GB32 2D93A 4UOJA 2ZX0A 2RHPA 1BBT2 1VBA1 1XNBA 2B4KA 1H6XA 1ENQA 3MV01 1VRH1 4FPGA 3ST7A 4UT5A 2W91A 4AVSA 2Z69A 3URFA 4IUGA 2XLGA 2R49A 3T30A 3IBMA 3MI8A 3RDIA 4FTBA 2WKKA 3JD71 1GANA 3GBWA 1BK1A 3KGLA 2E32A 2IFRA 3O1UA 5FK7A 4DB5A 2FZ2A 2P6HA 5L73A 1S4CA 4IESA 3P1IA 2WZR2 3G7DA 1AL0G 4QXHA 3TEYA 1UD1A 2WL1A 5DAVA 5B2GB 4FAGA 3EO6A 2E6VA 1ZYBA 3PNAA 5BNOB 1NX9A 1GQGA 1XC6A 3VHNA 3GZEA 5JZGC 5A32B 5LK7B 4IE4A 4AQTA 1AR62 5FZ1A 4Q1RA 2ZCWA 1ZNPA 3RPQA 1G86A 3FHQA 1W99A 1LB2A 1JZ2A 4IL7A 2EXHA 1WA4A 1Z7S1 4E4HA 4D0QA 4HVRA 2VE1A 2VUJA 1IPKA 2G9GA 2OX0A 1O91A 4Y3OA 4R9DA 3MW4A 3HNYM 5FZMA 2FCTA 2KR2A 1B09A 1BXHA 4Q5OA 1RMU3 1XQNA 3IB3A 3K3OA 3LIHA 1UZVA 1NCRC 5GM0A 1FMD1 5ABJA 3N7JA 3UV9A 3RSJA 3KWVA 3WHUA 3H7JA 4CEWB 5DDJ1 4HANA 2AH2A 3WF0A 2HWE3 4UFJA 5FZOB 2JIJA 4P9GA 3WQ7A 4NHLA 4AL9A 4YLZA 4BXFA 5C4WC 3I3MA 1GWKA 1DF0A 1LECA 2Y6HA 3OPZA 5C8CB 1UZWA 4FPHA 1AYN2 2DU0A 1A6CA 2EXIA 2JDPA 2VG9A 1US3A 4XURA 3J8F1 2EIBA 2WUHA 5LBFA 1UX7A 3SLIA 5CU1A 1F8VA 3MIFA 3HNMA 5KC6A 2Y6JA 3BI3A 5HXMA 2X09A 4JKLA 2RDNA 3T4HB 4U2AA 5FIXA 3USSA 2ILMA 3N9PA 1VB4A 2ZAHA 3Q8FA 2OIIA 4RHV3 3OPTA 1Q56A 2B5HA 2R061 2OQ7A 3MLLA 4CEYB 2MNGA 3WF1A 2BVBA 3I49A 5FZGA 4N53A 5F7UA 3FBMA 2ZZQA 4JX0A 5L19A 2G19A 5C3QA 3KMHA 5GALA 4JQTA 4D3WA 3MGUA 1OVPA 1F4AA 1ZZ7A 3AC0A 4UBGA 5FZ0A 3RJRA 2XGXA 4LITA 3TOJA 1JZ6A 2RS53 4OI1A 3T1LA 3S57A 4ZS3A 1RUD1 2ZHNA 4EN0A 3D82A 2NYYA 4A7ZA 1RXGA 3F95A 3VDCA 4GKYA 1EY2A 4OYUA 3LIGA 4Y20A 3ZYGA 2LRPA 4A41A 1RUC2 2VXJA 1OUSA 3NJVA 3IPVB 3M4FA 2ES3A 4XBLA 1UYZA 4LK6A 1F2NA 1HRI1 2IXLA 5FZAA 1W2OA 3FL7A 2CDOA 1NE6A 1EV13 2HWD1 3UYJA 2JG8B 3WINE 1IS3A 5DUUA 1QH7A 1FOD3 5EYYA 1UWWA 3B94A 1AR91 3TN91 5CFCB 4K7JA 4Q26A 1QOOA 1MPXA 5HV4A 3AMMA 2VY0A 3MW2A 4FXGB 4UFKA 5J98B 1PGW2 2WR9A 4Q2FA 5CKMA 4RS5A 2RR11 1YHFA 1CESA 2O14A 5C9AA 4QPYA 4ZZ5A 1PIV1 1D4M2 5H9QA 4YZ5A 1LU1A 2Y8KA 3AX4A 5IK4A 3C8XA 4D6QA 3ZSMA 2F4LA 1HX6A 2KM2A 3JQWA 1MR5A 3VBFB 3CL1A 4NWWA 4JQRA 5CAZA 5SV5A 3HVDA 4OI0A 3IAPA 1OH4A 1QJY2 1YC61 3BVCA 4F83A 3I8TA 3IMMA 5FAXA 3B01A 4I0BA 2DCJA 2HBTA 3PUSA 2WNUA 3JZVA 3VV1A 1FT9A 4FFGA 3VBSC 2BGOA 3VBUB 2WFPA 4HETA 4XQDA 2R16A 5FO9B 1VLNA 2ZABA 3L2YA 1ODMA 3K2OA 4AI2A 1O6UA 2C9KA 1YXWA 5CFDC 1ALYA 2RDSA 1FV2A 4IEVA 1GMMA 4NHKA 1TVGA 1WWYA 1PK6A 2DTYA 3ACLA 4HKOA 5CKQA 1LOFA 5LBBA 2WNVC 1MQTC 5JWPA 1ULCA 1NY71 3Q8AA 3OBAA 2FHRA 4UI9L 2FMDA 1J3RA 3NAPC 5IWFA 5FXWA 3KGZA 5CVRA 5J7MA 1QQP3 1DDLA 1S2BA 2GNBA 4GA9A 5AVPA 2GAUA 1EP0A 4CSWA 3VD9A 4NIHA 4QB1A 4DUVA 5KHJA 2WNOA 2CGPA 1L7RA 4L0PA 3OG2A 1Y3TA 1C4RA 3B7MA 4L97A 1QNWA 1RHI1 4NVPA 3OUIA 2E7QA 4RR3B 4QHBA 4YVSA 2HWB3 5DG2A 1CIYA 3OY8B 3POFA 3A0NA 4COVA 2DFBA 4X8NA 1QF3A 2VZVA 2WO1A 3WQ0A 3ILFA 3I2GA 4ZU7A 1W8NA 3RZLA 3ZIXA 3OD4A 1QJZA 2CYFA 4EJRA 1MEC3 2DCTA 4FI9A 4O9EA 1R092 4NO4A 2W9XA 1H0BA 2BYVE 3N9LA 4Y1YA 5AC92 3VZJA 5FMDA 4E4SA 2R1DA 3AMHA 2P3IA 2XOMA 1XRUA 3KV4A 2GNMA 2D6PA 3GGLA 4Q4Y3 5FMBA 2DVDA 3ZFGB 1BBT1 2VL4A 1OD5A 2V5DA 4NPLA 4M00A 5KXCA 4RYDA 5LW9A 1PO22 4KWKA 3WDUA 1V6KA 5E6HA 4QQHA 1W0OA 3EQEA 4PIZA 2Y6LA 4S2DA 5JI7A 5JSRA 4ITCA 2V5YA 1RTVA 4A3ZA 4ZU5A 1B35C 3HMYA 3AFKA 2JDKA 3PVOA 4A2UA 3ZYIB 4CTEA 3J7LA 1RUH3 4DXZA 4DXSA 1YFUA 3DPRC 1JHNA 1X8EA 1Y9GA 2E26A 2JDMA 2WABA 1WMFA 3T2TA 2CAVA 2ZMNA 1PZ9A 2PQSA 1W6NA 2WZR1 5IVVA 1ENSA 2QQIA 5JPMB 1HW5A 3O14A 5L36A 2BUKA 5F3CA 1K5MB 1V00A 1R64A 2QQUA 2YC2A 3DV8A 4WVWA 3HT2A 4XABA 5FY8A 3VBOB 3BTZA 4YSFA 2YZ4A 3MFCA 3M8LA 2J1AA 5H9PA 5HCAA 1W2NA 1AR61 4CA9A 3VBRB 4KU8A 5ACA1 1KJLA 1S0JA 1CPMA 1CAUB 2WQZC 4MGZE 3R4UA 3T4VA 3VBHA 4D94A 3KHBA 3ELNA 1UY3A 3CIHA 3ENRA 3U78A 2X5IB 3HJRA 1DLCA 4C1XA 4XMAA 3O12A 4F8AA 5FUIA 3ZFFC 4XJ8A 3H0OA 5FZ3A 4N90A 1PX4A 3DYMA 4AEDC 2FZ1A 2YBSA 2FCVA 2CDPA 2YBKA 1JH5A 5KHIA 1QWRA 3AK0A 5CIRA 3AMPA 4SLIA 1MS3A 1DLLA 3HN1A 3I7DA 4OCTA 2XLAA 3AL5A 3ZFEC 3MIHA 2A6VA 2XWJB 4AI0A 1DZQA 4LA3A 3NW4A 1OOPB 4NHMA
chains in the Genus database with same CATH topology
4EN8B 5AFEA 2ZPXA 4QPGA 3MW3A 1AYN1 3PTYA 2Q8OA 1SBFA 1LOEA 2O1QA 2NN8A 4XMIA 2O0OA 2F6BA 4LE3A 5FO7B 1WMDA 4BQ1A 3OYWB 1YIPA 2A3WA 2D43A 2ZS6B 3BU7A 4I09A 4Q4V2 1V6OA 4FBFA 2DWRA 1L3JA 1TEIA 3CNAA 1X7NA 5E8AA 2ZOEB 4ATEA 1NA1C 4LLFA 1LKNA 1OPMA 1Q8SA 4HKWA 1JTZX 4AQ2A 4CDUA 1LTEA 2RS32 1C5HA 1RUOA 1JN2P 5BNPB 3C2UA 1PO12 1XU1A 1RUC1 1OA4A 5D8AB 3AZYA 3ATGA 4QM9A 3M1HA 4XF3A 1LR5A 3CO2A 1DZTA 5H9SA 4AQ6A 1ZREA 2UY9A 1RUE2 2WLQA 1UPSA 4XF1A 5IUQA 4CZSA 1PGW1 4RSUA 3AKTA 4XIOA 2EIGA 1TMF2 4I01A 4CDQB 2IXIA 1D4M1 4URTA 4DMIA 1PVC3 2NZ9A 1VAMA 5FMOL 1BZWA 5T5LA 4AVCA 1UU6A 3GHNA 4MGIE 2FMYA 2RJKA 3WCSA 3O5SA 5I0SA 1GR3A 1OQ1A 4LTAA 1ND3A 4XIKA 3VZMA 5T5OA 3UK9A 4N43B 1WBLA 5A33A 5CG8A 2DVBA 5BNOC 2VNGA 1V6JA 4YW2A 4AVAA 4JTNA 4GMP1 4LE4A 5GZGA 5JIUA 4XTPA 4JGYB 3ECQA 5I0RA 1CIWA 1IQAA 5JLVA 2TEPA 1REFA 5CA6A 3POWA 4ATFA 1OLQA 3R05A 3ZN4A 3B93A 1DYKA 4AGRA 4IV3C 2WS92 1AXKA 1JUHA 3U10A 1CX4A 1KFXL 1ZBE3 3Q9OA 2PHTA 1RGSA 4Q0UA 3PMSA 3N7MA 5EWSA 1MZFA 4WZFA 3DGTA 1X8MA 3ZXFA 3WT3A 4XJUA 3TNPB 4Q29A 4BCUA 2VECA 5C8CC 1XNCA 4CEWC 1D2QA 2DCYA 3HWJA 2PAMA 3M3IA 4QGNA 1UAIA 1HV0A 1QJU3 1AYM3 3I2DA 2PLV1 1C8M1 3WDTA 1QJX2 1MS5A 1R091 1WCSA 1I3HA 1VBA3 3R6SA 4OHZA 3AYDA 1VRH3 4B3NA 5JOYA 1PO21 1FAYA 1U0AA 1BEV2 3LZZA 4L11A 4OLLA 4TSVA 4XILA 1OQEA 4FPFA 1N1SA 1VBB3 4JDOA 1H1IA 1LOGA 4AFDA 2R071 5KXBA 4KGGA 4OVEA 1KJRA 4OHVA 3H8UA 4QQPA 3UKNA 5BY5A 1SCSA 1W6QA 2BGCA 2ZX3A 3RQ0A 5FCCA 4FTEA 1LGNA 1IKQA 3SH3A 1RB8G 2XKOA 1R082 3JUUA 1O5UA 4DY3A 1MVEA 4P9WA 5LEJA 4FT8A 3B9IA 4IV1A 3MICA 1LJ7A 3FE5A 3A4UA 5CFCC 1J3PA 1Z7S3 4OULA 1LOBA 2AENA 2CY6A 2DUPA 5BNNA 3WDXA 4D7TA 2RMU2 3KCCA 4N53B 4OUMA 3SISA 1EAH3 1U5ZA 2K9ZA 1RJ8A 3H1YA 4I3PA 3L2HA 3FLPA 2C1FA 2DVGA 1FMD3 1KFUL 1R1A3 2YHJA 4RL7A 3VBFC 5FRAA 4MV2A 3LA3A 2VMHA 4B7EA 1LEDA 1W6OB 1AR71 4Y22A 1S0FA 3VZKA 4AVTA 1KS4A 5I91A 2XJUA 1BMV2 3TBDA 3NV1A 3LOIA 1IHMA 2UYAA 3N35A 2PQQA 2UYBA 4YVWA 3ZXGA 2QVSB 3VKLA 3RYPA 4JAAA 5FLJA 1H8TA 2H6BA 1ASJ1 2ZX1A 2YGLA 2LALA 5KBFA 1V6MA 1PHMA 1O4TA 4DRRA 2PAKA 2HKXA 4RFT0 5T54A 1NLSA 3WDWA 1YO8A 4JRAA 4YYOA 2PHUA 3LOBA 2HWF3 4RS5B 4QPIC 2R6QA 4JC1A 1ND2A 2R0HA 4Q4V1 5C9AB 1HXS3 3UJQA 1IS4A 3ZX7A 4CRQA 1AXZA 5F5QA 3EXUA 5LEKA 1KDKA 3WP4A 3PMEA 4KGQA 3NL1A 5JI9A 2A73B 1RUD3 1APNA 4BIFA 2GC3A 4RR3C 2H6CA 2R1BA 2TNFA 4YZ4A 1HQWA 5AVAA 4BLIA 1D2SA 1RUJ1 4IEOA 4JGZC 1BVP1 1FNYA 2A75A 1LHWA 2WNUB 1PO11 4K8FA 3IDCB 1MS4A 5JMCA 1HRI3 1HKDA 4F3JA 1AR93 3MIEA 3TNQA 4LLOA 4WM8C 3JB4C 1PK6B 4S2HA 1ZZ8A 4KG8A 3WP6A 1RUE1 1AR82 1DG6A 5JSOA 2RR13 1MS0A 1XNKA 1CD3G 2XJVA 5FOBB 1PIV3 4Q0SA 2XUMA 5C33A 4OHXA 2QZ3A 2D40A 1X50A 3ZO0B 1C8NA 3AKRA 2WIIB 2Q4SA 3L9JT 4WV8A 4YVSB 3SCFA 1RUI2 1DZRA 1F9KA 1CAWA 3THTA 2JG9A 3O0XA 4XFCA 1GLHA 4MXWA 1K5MC 2GMEA 1RUF1 3ZIWA 4S2GA 3FHIB 4LT5A 2W68A 5DUWA 1GNHA 2JE7A 5L7OA 1N1VA 1IGOA 5GKAC 1XXNA 4PBOA 2LM3A 1SBEA 4MX3A 2VULA 1N47A 2X5IC 3KS7A 4ASLA 3W9AA 4QGLA 1PGL1 1G7YA 2ZX4A 3USUA 1NCQB 2WS91 4FCAA 3E5QA 4OI2A 5I8TA 4CYDA 1UPIA 2ZGUA 2LUWA 3H1MA 4GXLA 2VW0A 1OFSA 2ZGQA 4D7SA 2DV9A 3TYJA 1FNZA 1WW6A 1TNRA 3M3CA 3POSA 1OOPC 4QGMA 3VLBB 2MEV1 1W6NB 1LGCA 3MIDA 1Y7BA 3RMYA 4E4DX 3FBYA 2WINB 1GZ9A 1ULFA 1Q8VA 4O9GA 5CBLA 3WG2A 5DZFA 5BXXA 2VQAA 2Q1MA 1YNAA 3VBHB 2ZJCA 1PVXA 4NPRA 2G9FA 3H3UA 3WNXA 2XHKA 1BBT3 1AVBA 1E57A 4KQ7A 4ZXKA 2QFEA 5JAXA 1HRV2 4LO7A 2W39A 2FBEA 2NM1A 3H7YA 3RJ2X 1UKRA 5JPNB 3ES1A 1SLLA 2BQPA 3INAA 4P9XA 1JUIA 4QD2A 4AE2A 4L9BA 1N3PA 1EYBA 3V0BA 3ZYPA 1DQ1A 4FO9A 4PIYA 3UJOA 3LSDA 5BNPC 4AGVA 4QPGB 1NG0A 3WW3A 3JBG2 2JEMA 5BPXA 5D1IA 1Q5OA 2FQPA 4MH0E 1YFWA 5D8AC 5HCFA 1R081 3WW4A 3AP5A 5DXDA 1AR63 2JXAA 3K48A 5E1RA 2BBVA 5ACA3 4FAHA 4AEJA 4R52A 1ULGA 3CF6E 4K9SA 4EWAA 1QDOA 2D3SA 4JRLA 1LODA 4IEZA 3ZXKA 2RMU1 1DQ2A 4XDQA 1FPN1 1U12A 5JVVA 3NSTA 1LHVA 3VZNA 1PZ7A 2OW4A 2DUQA 3WUCA 2WT2A 4EWDA 4XXAA 2VOKA 3O0VA 2NPIA 4R9CA 4YW3A 4FXKB 2P17A 1QDCA 1MS8A 4LBQA 4CDUB 4LBOA 3MZHA 1RMU2 5FPZA 2ERFA 1BMV1 4C0HA 5FQ0A 1AYN3 2MPFA 4YGDA 2JJ6A 3SCGA 1OA3A 2X8KA 2I2SA 1COV3 4FPCA 2NMNA 3ZXDA 4UXAA 5F6LB 2D6KA 4JGYC 4A7YA 2ZGRA 3WLUA 3VBSA 4E9KA 2VW1A 2Q0AA 4CP0A 2A7AA 1XE8A 4COZA 1A3KA 3WZ1A 4RHV2 4ONUA 2WNVA 4AQSA 2D7FA 2OA2A 1DYPA 2GN7A 1I9RA 3VKOA 1SLTA 5EJ3A 2B46X 4ISQA 3ZSKA 4GWMA 1WLTA 1H4HA 5EZWA 2GU9A 1ND3B 4LEJA 4LHLA 1ZVFA 5K7PA 2P2KA 2BNOA 4WVMA 4FPEA 5A33B 3VUOA 1HQNA 1DGLA 3B9CA 1HQLA 2ZGOA 1G9FA 2DTWA 4B4PA 4HN1A 4BPZA 3I59A 2D5HA 4BHPA 5JR7B 3VZLA 1KXGA 2D5FA 2WSUA 2XJQA 4SBVA 3ZYRA 5HCBA 2XBO3 4X6QB 1YJKA 3JCIA 3WQ1A 1FOD2 5GLZA 2BFUL 4RQPA 3TWIA 5GJ6A 1VB2A 1A8DA 1AJOA 2CNAA 3WP5A 3GZUC 2A3XA 4PJYA 3GBFA 1A78A 4M3CB 5DZEA 4Q4W2 1U5XA 1IOAA 4P9YA 3ZXLA 5K0UA 4IETA 1RUI1 2HWC3 2GC1A 2B9UA 5JOWA 2B7YA 1AL21 1VBE2 3LKJA 1KS5A 4HN0A 2QZ2A 4OFGA 4PLOA 4YM1A 4GMP3 4E2QA 4Y1UA 4GWNA 3PVBB 5JDBA 2E51A 3WG1A 3D5OA 3VHPA 3OD0A 2C9AA 3VDDA 5FBZA 1LRHA 3DN7A 4B7KA 4DRVA 1MZ5A 4N53C 2H0VA 3ZMOA 2PTMA 2XKPA 3FWEA 2BWCA 1SEFA 3QBQA 1URXA 4Q0PA 4I0WB 4K20A 4XFGA 4EN6B 1KITA 1WW7A 3AYCA 2Q30A 3M70A 4XF9A 4FOVA 3ZFFA 3N7KA 3GNEA 4Q27A 2BTVC 1QQP2 4AEDA 2JECA 1NZCA 4KNCA 4CDWB 2WA3A 3S0MA 1TME1 1W6QB 1RVF2 2Y38A 2XLFA 3BPZA 3V64A 3X29B 1ZZBA 3PVEA 3ZXJA 3CJIA 2HWB2 5JZGA 1ZRFA 1LEMA 1C8M3 2PLV3 2UU8A 4IV1B 1GSLA 2YROA 5SV8A 3RWNA 1V70A 3RS6A 4GB31 5BNNB 4GH4A 3BIWE 3FUQA 3NKTA 5GZFA 1MEC2 4RS5C 4R4ZA 2MHFA 5C9AC 4Z07A 5F6KA 2O8QA 2PHRA 1UMZA 1SFNA 1I1EA 2EXJA 3KT4A 5J09A 2R073 1SDWA 4Y22B 1NA1A 4DPNA 1POV0 4Z82A 3KB5A 1EPWA 1QXPA 2QKDA 3W59A 3RMXA 1RUH2 3JBG1 1CVNA 1RUG3 4BZ4A 1H8TB 2D6LX 2GH8A 3MLKA 4AVBA 4L8QA 1WMEA 1BJQA 3AP4A 2P3JA 2IXCA 1GYKA 1RINA 2IXJA 4DNYA 1PK6C 1S0CA 1DBNA 2ZGKA 4N9IA 3M3EA 4LO5B 2D98A 2JX9A 1GFF2 4MYEA 4QQOA 4CDXC 1ND2B 1HLCA 2D6NA 2WT0A 2XB6C 3N36A 3WD5A 3FMGA 2EVXA 3E6CC 5LRRA 1VAVA 1ZRCA 4FP3A 3S6PA 1BCXA 1I6XA 1AR73 3E6DA 1FX5A 2DURA 4JDNA 4YFWA 4YVSC 2OUHA 1X82A 3JU9A 4LBKA 3HR9A 2BPA2 2A70A 2BEOA 1UF2C 1G9BA 1A8MA 3EHKA 4W65A 3WUDA 1BYHA 3EJKA 3M2MA 4PF5A 2WA4A 3N3HA 1NQDA 1ASJ3 4PDWB 4DFSA 2D97A 3WDVA 2WQ4A 4LR4A 4YARA 1W39A 3ZVXA 5LRSA 3LAGA 3WVJA 4FOWA 3JB8A 4COWA 4QT6A 3AFGA 2EXKA 4K3UA 4EWEA 1U5YA 2IXKA 2PN5A 1C3HA 4Q4V3 2WFF3 1F5FA 5BV6A 1NCQC 4QQ2A 1U5IA 2P3KA 4RHV1 1QY4A 2W08A 4HBNA 2KA3A 4KU7A 4E4ZA 5HXVA 1UX6A 4IV3A 1PMIA 1XYNA 1LHUA 1ULDA 2GC2A 4QQLA 4J1XA 1O5LA 1RUJ3 3OCPA 1UL9A 3ZSJA 1J1LA 3ALQA 4XXPA 1CAWB 2JG9B 2WLPA 4MXWB 1H2MA 5E89A 1S0DA 2I07B 2B39A 3RZZA 2A6YA 1YYNA 2EALA 1DIWA 3I4IA 5L7OB 4WVZA 4AHXA 2ZGNA 1D0HA 2ZGSA 4YW4A 4AFAA 4IERA 3VBHC 2X53S 1CQ9A 4LBQD 2XPJA 2VOVA 1RUE3 4BA6A 3E5UA 3AZVA 1NXMA 3OGGA 1RC6A 2YPJA 3USUB 2JDZA 4HMZA 1CAVA 1PGSA 1W6PB 3TAYA 4KBBA 5KHKA 3ME2A 3WW1A 3QACA 2JKBA 1X33A 4KWJA 1QJY1 1CONA 2ZA9A 4M3CE 3ZXAC 3U07A 1ZRDA 4Q4W1 3WCRA 2VOXA 4CP2A 1PVC2 3VHOA 3APBA 4WM7B 1LHOA 1RUF3 4D7YA 1VBE1 1F31A 4META 2A3YA 5KXEA 3EBRA 2RS12 3H3ZA 2JENA 1X36A 2DYCA 2XH6A 2XWBB 4AEMA 3ZSEA 1WLDA 1G9DA 3IPVA 3POYA 3NV4A 2VVFA 1ZZ6A 2X29A 1N3QA 3MLJA 4AVVA 2DU1A 4KH9A 2OUJA 1SLAA 3KZ4C 5LK5A 3MEPA 1LENA 1O3RA 4MSVA 1KRIA 4S2FA 2WS93 2ETEA 4FSJA 1AX0A 2XVKA 4YM0A 3M7AA 5T55A 2H0BA 1DGWA 3AMQA 3MPBA 1XNDA 1SACA 3T1MA 3WW2A 1S0IA 2NP0A 1QHDA 1AUYA 3V0BB 2R30A 1QKQA 1ZBE2 1ZBA2 4YW1A 1VBD3 1QQP1 2NMOA 3AP6A 4XHBA 2MEV3 1DQ6A 4W6XA 2YV8A 4W6WA 1V6IA 1RVF1 3M3OA 4AGGA 3GBGA 4RD7A 1TNFA 2HWB1 4CEYC 5AC91 1WLCA 2Z42A 2XL9A 2WT1A 4XJZA 3HIFA 3LB9A 4UW5A 2GSYA 1FI2A 4KL1A 1QJU2 2R0FA 1AYM2 3DF0A 1QMJA 1NLRA 1WBFA 4AXOA 3JD73 1MEC1 2D6MA 5ABJB 2A6ZA 2GNTA 2W52A 2WJSA 3H1WA 3S7EA 2E63A 2GNDA 4FPJA 1VBA2 1NXD1 2OPKA 2VH9A 1VRH2 3LWCA 4WVVA 4QPIA 4LBQB 3W58A 2GMPA 1RUNA 1PNGA 3JQXA 4HKLA 4UW3A 4UW4A 1ZM1A 2VVDA 1H4GA 1ND3C 1UU4A 3A0KA 4LBMA 2ZHMA 1GKBA 1JXNA 1VBB2 1WW4A 1Z78A 1H2LA 2JG8C 3THPA 3BOWA 4FPKA 4J6GA 1R083 1RUH1 2VQ0A 4RR3A 3SCHA 3OY8A 4JGZA 1GNZA 1JW6A 4BE3A 2Y26A 5F9TA 4Y26A 1IS6A 2JE9A 3E5XA 3AJZA 3MYXA 2SLIA 5IK8A 1FPN3 2AREA 2ZTNA 4AEKA 4P9JA 2XVLA 1Z7S2 1Z0HA 4WM8A 4HK8A 4R9BA 5DDJ3 4OZXA 1MACA 3OTFA 2WNVB 4YG6A 3HT1A 1LOAA 3QH6A 1EAH2 4OHYA 4OHWA 3PVNA 3BODA 4X8PA 4YGEA 5H9RA 4AYUA 4YG0A 4YRDA 2DF7A 4Y20B 1CR7A 1RITA 3J8F3 4XFIA 4RGGA 2VPVA 3AYEA 3AZXA 1OKQA 1VP6A 1R1A2 4WZCA 3VBUC 1GZWA 2DVFA 4WVMB 4NN0A 3E97A 3AXEA 5FREA 3AYAA 2BFUS 4I2OA 2DFCA 2R063 4JTOA 1K5MA 3I59B 2HEVF 4Q0QA 4Y1ZA 3ETQA 4AW7A 1DHKB 3GHMA 1G9AA 5CADA 4RQPB 4LO4B 4K21A 4B4QA 5IK7A 3RI8A 2JICA 3WHTA 5JSPA 3PJYA 1AX2A 2X5IA 1UZYA 2RS31 2HWF2 3WV6A 3ZDSA 1I5ZA 4IEPA 4YW5A 1ZRRA 1HXS2 3CU7A 3J4UH 3ZPYA 3FJSA 2P37A 2R042 4CDWC 4A3XA 5K0UB 1POV1 1SBDA 4H3WA 2HWD3 1RUD2 3OGJA 3TN93 1OOPA 1GICA 4IV1C 2XJSA 1C57A 3IMNA 3SMHA 3LA2A 2GZWA 1DGWX 5FLHA 3VDDB 2DCKA 2Z5WA 4IEQA 3ZFGC 3U0ZA 1HRI2 1TMF1 1AR92 3AJYA 4JV4A 3LCPA 1KQRA 4LA2A 1Q8QA 5IK5A 2QJVA 3HAGA 1G8WA 2PHDA 3KCXA 1O7FA 1YJLA 2ZGTA 3B5LB 2Y0OA 1O3SA 3KD4A 3ZFFB 4AI3A 3D4KA 1PIV2 4AK3A 4XHXA 4NOTA 3VBOC 1V9U2 4A7KA 1RUI3 3AMNA 1PVC1 1AL23 4Y1XA 4R4XA 2ZZJA 5T5PA 2YXSA 3VBRC 5JZGB 2CL2A 2RM22 1H8TC 2RS11 4Y5Z0 4AFMA 4I0AA 2HEYF 1H9WA 4DINB 1VBC2 5D8AA 4GH4B 2PHWA 4Z1VA 1TE1B 1PNFA 3WG4A 4LHKA 4Q4X2 2CWMA 2PA7A 4MZUA 4MGKE 1RHI3 1UCXA 3MIGA 3IWZA 1NCRA 1R1ZA 5C6CA 1W0PA 2IFWA 2ZX2A 3IDEA 3C3VA 3BALA 1NA1B 1FV3A 1ZBA1 3H50A 2VMIA 1TME3 5C4WA 1WW5A 4IEYA 3R0RA 3KSCA 2GMMA 1QJX1 4DOUA 4B29A 2IWGB 4PDWC 5T52A 4DS0A 4YZ1A 4C0BA 4GULA 4TLFA 4Q8LA 4GB33 5BNQA 1WD3A 1CAXA 1AX1A 5KWRA 4DY5A 3FC0A 5A3MA 4PCRA 1QJU1 1AYM1 5DUXA 1VAKA 1YWKA 1S0EA 2C0ZA 1DQ0A 1BEV1 3QOPA 3AKSA 3R4SA 2XL7A 4Y24A 3MPPG 1Q8OA 3TB0A 2WZR3 3GF6A 3O0WA 2O8OA 2YGMA 4EV0A 3VZOA 4MLOA 5HBAA 5FTTC 4M01A 3DKWA 5J48A 3LSEA 2JD4A 2JG9C 3JBG3 2VU9A 1VBB1 3B00A 1AF9A 5L7OC 1H2KA 1KDMA 1C1FA 3D6EA 1JOJA 3SITA 2GC0A 4E27A 4H7MA 4AI1A 1ONAA 4R8HA 2AGSA 4CDQC 4LO6B 1DFQA 5ACA2 2EF6A 3FFQA 3FUOA 1CN1A 1UIKA 4XW3A 4XFHA 1H2NA 3ZN6A 2WZPP 1EAH1 5J37A 4IV3B 1VALA 4XEZA 4PLMA 4N43C 3OF1A 1OHFA 2HWE2 4MVTA 1WD4A 4XZPA 1R1A1 2OZJA 4WM7C 4MXVA 1QU0A 1S55A 2PHFA 3IKWA 3HBZA 5FMOS 1W6MA 4I02A 2VGDA 4QX5A 5CFDA 4H55A 2V73A 1COV2 1UU5A 4K1ZA 4GMP0 1MQTA 2ZGLA 1CAVB 3NAPA 1YI9A 4HPKA 4YGCA 4ES9A 4HL0A 1W2UA 3WG3A 1QXRA 2HWF1 4AWDA 5KHGA 4ASMB 1LCLA 1OPOA 4XF4A 2RS52 5CB7A 4FP2A 1HXS1 5GLVA 1RUC3 4COYA 4IXLA 4XE9A 3ROUA 4AHZA 2R041 1WCDJ 5I8SA 3ES4A 1N3OA 2AYHA 4BLJA 4XFBA 4BMBA 2GDFA 2I74A 3BOPA 1W6OA 3AM2A 5AFBA 5I93A 3S30A 3CEWA 4L2NA 4AI8A 1SLBA 1AR81 1EV12 3VL8A 3OJBA 4QXKA 4GALA 1OI6A 1OFNA 2E9QA 5FDBA 1YLLA 1D4M3 5ABJC 2GH2A 5F1RA 2LTNA 4PQ9A 2ZHLA 1QJY3 2XBO2 4YZ3A 1WUVA 1N1YA 3KQRA 3WP3A 4P5HA 3ZYJB 1B35A 4FPOB 4Q4W3 3IN9A 4E2SA 2BNNA 1V9U1 3DPRA 1QOTA 1S0GA 3HD8B 3KT1A 4JDMA 1QOSA 1VBE3 4CP1A 1YFYA 4XBNA 2RM21 4B8EA 5KHJA 2HWC2 2VXRA 4HVOA 1F8VA 4D69A 2PFWA 2AZ5A 2ZKNA 4NR1A 2B42B 5J3UA 1WLWA 3RNSA 4RGAA 1VBC1 4KWLA 3P3PA 2EA7A 5GLUA 3AB0A 1MZEA 2AUYA 4Q4X1 1AHSA 3QD6A 4YG3A 4C1WA 1YIFA 3AXDA 2PYTA 4QU2A 3VKNA 1T6GC 5J36A 4QPIB 4CDXA 3V56A 3GZTB 2TUNA 2ZACA 3SXWA 1FXZA 3ZFEA 5T50A 4Q1PA 4DZGA 4H14A 4C91A 4HZFA 1RVF3 2KXLA 4ISRA 2Z79A 5T5JA 2D44A 1LGBA 2EAKA 1ENXA 1R093 3NV3A 2PAEA 3SHRA 2VOWA 4JGZB 2VVEA 5AC93 1V6LA 1J59A 3B3QE 1DQ4A 3MF9A 1Y9QA 5IT6A 1BQPA 3V0AA 4BYYA 3G6JB 2PLV2 1C8M2 2BVVA 1IKPA 1PO23 1WGPA 4L99A 1HRV1 4LUMA 3V65A 4K6BA 4PIXA 4Q4Y2 4WM8B 4RQPC 1DGRA 1MZ6A 3E6BA 4HT1T 1BVVA 4XQ4A 2K2SA 1ULEA 3PHMA 4HFSA 3CLPA 4BH9A 1NCQA 4Y1VA 4LBLA 3WR0A 1SCRA 4YVWB 2WNUC 2ATFA 4Y4YA 2A6XA 5K0UC 2BNMA 1GZWB 2HYKA 5KHHA 1QGLA 2PHLA 4PBPA 3IT8A 1IPJA 2R072 3VL9A 2QUOA 2E7TA 2RE9A 5JCTA 3VKMA 5FO8B 1J3QA 1LOFC 1J1TA 4UW6A 2CGNA 3BCWA 4HSJA 1XYOA 5EYXA 5JIAA 3VHRA 4ZU4A 4E2GA 1RUG2 3VDDC 1SLIA 3KT7A 5HI0A 3FFZA 3MFAA 4M3CF 3GZAA 2RJLA 1NYWA 4N9HA 4Z92B 2PELA 3GYDA 3UKVA 5TSWA 1NOVA 1H9PA 2HEWF 2UWBA 4N7IA 1M4WA 1REEA 1RMU1 4PLNA 1JBCA 2ET7A 3H9AA 4U36A 1G9CA 3ASIA 2VNOA 1SQ4A 1LHNA 2HWE1 1LU2A 5JOZA 1CJDA 5BYNA 4ES8A 1AR72 1F5JA 2ET1A 1OQDA 1C28A 4ZKTB 1EPZA 1ZX5A 3K51A 5EV7A 2GN3A 3AKPA 5BNOA 2VUAA 3ZMNA 5A32A 2GALA 2I45A 1CPNA 4XJAA 1H8VA 3NJZA 4GH4C 1ASJ2 2QCSB 1COV1 3MIBA 4LBNA 3HQXA 3RYKA 1WCKA 5E16A 4IQPA 1OMIA 4G4FA 3WDYA 1MS1A 3NO8A 4EN7B 2RS33 5T3NA 4JVAA 3U11A 2WFF2 1VIWB 3I54A 3J26N 4X6RB 1UN1A 5I8YA 2RS51 1PO13 1PM7A 3VN4A 4LULA 1POV3 2D3PA 1S2KA 3M3QA 5CNAA 3SH4A 4HLTA 4TWTA 4XFFA 5C8CA 4CEWA 4LNVA 1ZA4A 3QH7A 2XVGA 1RUJ2 3RI9A 4YGBA 1M06G 1FATA 1JYCA 4OI4A 4ORFA 1EV11 2AR6A 5KXDA 1FOD1 2ARBA 3DL3A 1TMF3 3AP9A 3DUIA 3MF6A 4NWVA 4CEYA 1MS9A 3UKTA 4BOWA 4P9IA 1H30A 2BWAA 3QCWA 2G4IA 4BIOA 3LA7A 1OLRA 2CAUA 2CGOA 2ARXA 2XBO1 2SBAA 5FFOC 1NCRB 4QPGC 2ZKLA 1DGRN 5A3LA 5C4WB 2NLRA 2C5DA 3AKQA 2VNRA 2ZGPA 3QLQA 3D0SA 4QM8A 2E7AA 1AJKA 1N1TA 4P14A 2RS13 4HK9A 4IEUA 4COUA 2D6OX 4XQWA 2HWC1 1RUF2 1CAXB 4G3YC 1O4ZA 2JG8A 3NKGA 4MGYE 4XYXA 5CFCA 5K9YA 2UWCA 4Z2WA 3ILNA 2P34A 3IM0A 1OA2A 3KM5A 3AP7A 3R4DB 1TQ5A 2OYZA 1GQHA 4CDUC 1OSGA 1SLCA 3AZZA 4YM3A 1PGL2 4H7LA 4XETA 2A5ZA 1O4YA 1LULA 1XE7A 2IC1A 3VBFA 1C1LA