2B45X

Crystal structure of an engineered uninhibited bacillus subtilis xylanase in free state
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
185
structure length
185
Chain Sequence
ASTDYWQNWTFGGGIVNAVNGSGGNYSVNWSNTGNFVVGKGWTTGSPFRTINYNAGVWAPNGNGYLTLYGWTRSPLIEYYVVDSWGTYRPTGTYKGTVKSDGGTYDIYTTTRYNAPSIDGDDTTFTQYWSVRQSKRPTGSNATITFTNHVNAWKSHGMNLGSNWAYQVMATEGYQSSGSSNVTVW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Endo-1,4-beta-xylanase A
publication title Crystal structure of the Triticum xylanse inhibitor-I in complex with bacillus subtilis xylanase
rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
total genus 49
structure length 185
sequence length 185
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2005-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00457 Glyco_hydro_11 Glycosyl hydrolases family 11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2b45X00
1XNDA 4HKWA 4XPVA 1OA2A 3MFCA 4S2HA 2F6BA 2C1FA 3LGRA 2BWAA 2DFCA 1REEA 3AKQA 3WQ0A 2DCKA 1H8VA 3VL9A 1UU5A 4S2DA 3WY6A 3VZOA 3AKSA 5K9YA 1KS5A 3VHNA 1PVXA 2VULA 3AMMA 3WQ7A 1AXKA 4XQWA 3WT3A 3MF6A 3MFAA 3VL8A 3HD8B 3WQ1A 3VGIA 1YNAA 3MF9A 3AKTA 2JICA 3AMHA 4HK9A 1KS4A 1C5HA 5HXVA 2JENA 5K7PA 1M4WA 1XYOA 2BW8A 3RI8A 1HIXA 3B7MA 2B42B 2DCYA 5EJ3A 1UU4A 2D97A 4IXLA 4S2GA 3VZMA 3EXUA 3WP4A 2Z79A 4XQDA 2NLRA 1IGOA 1XNKA 1BCXA 4HKLA 2VUJA 2DFBA 2BVVA 2QZ2A 1XYPA 2DCJA 3WP5A 2D98A 1XNBA 3AMQA 3ZSEA 3AMPA 2JEMA 1H4HA 1HV0A 1REDA 1T6GC 2B46X 1BVVA 2VG9A 3WX5A 3WXPA 1H0BA 3B5LB 1XNCA 3WR0A 1XYNA 1W2UA 3LB9A 3RI9A 3WP3A 3VZNA 1UKRA 3VHOA 1ENXA 4H7MA 1C5IA 3AKPA 2B45X 1QH6A 3O7OA 2VGDA 4HK8A 1H4GA 3M4FA 1F5JA 1NLRA 2QZ3A 3VHPA 3WP6A 3AMNA 1UU6A 1REFA 3VZLA 3VLBB 1HV1A 1H1AA 4S2FA 1QH7A 2NQYA 2DCZA 1XXNA 1OLQA 3VZJA 2BWCA 4HKOA 1OLRA 4XQ4A 1OA4A 1OA3A 3AKRA 4NPRA 1TE1B 3VZKA 1BK1A
chains in the Genus database with same CATH superfamily
1FT9A 1SBEA 2C5DA 5K4LA 3ZXJA 3ZFFA 1W8HA 5GZGA 2RG4A 2H0BA 3WCSA 1CWPA 4Y24A 1YIPA 4FP3A 2WWUA 2IVJA 4KWKA 4LOSA 4MGSA 4FOYA 4RGGA 1X50A 3V65A 2VZ1A 1CAUB 3C7EA 4HVOA 4J25A 1ODMA 4NVPA 4CTEA 1X36A 4C1WA 4QDSA 1JYVA 1CJPA 1CVNA 3FC0A 3AP6A 5C33A 1AXZA 2L9LA 3FLTA 2ORZA 1HXS3 1VMJA 1O5UA 2VMCA 3D82A 4GWNA 4LBQA 2QFEA 5D8AC 1BEV3 1UY1A 1LJ7A 1PO11 3O1VA 2DUOA 2R072 4P9GA 1F2NA 3PHMA 5D2AA 4NMIA 5BNPC 3T2QA 4QPGA 1RUD1 3F2ZA 4CA9A 4Y20A 5C3QA 2CDOA 4YVSB 4AEDC 3VBHC 4ZS3A 3H7JA 1GOHA 1C5HA 2VZUA 1JHJA 1MS1A 1UMIA 5EJ1B 1CZVA 1VRBA 2G4IA 2RDSA 2W94A 5HXVA 3WF0A 1MEC2 1AR63 3PIGA 5GLWA 4HL0A 3ORJA 1FPN3 1QJY2 3WDYA 4JQTA 2ZTNA 1JZ6A 1YLLA 1MS0A 1PVC3 1OI6A 2BFUL 4JDMA 1EAH2 4ATFA 4ZKTB 2AREA 1QIQA 4XXPA 3UKVA 2ET7A 4CRQA 2D97A 2HWF1 4GKYA 4HT1T 1WZXA 3LDKA 3JD72 4JAAA 1FOD3 1PMIA 1SZBA 4QGLA 3UESA 1C8M1 1GP4A 1W8NA 3C2UA 3CL1A 3H1MA 5KHKA 1ST8A 3WNKA 2XL9A 4Z07A 3TRSB 4YZ5A 1EPWA 3TEYA 4QPWA 1O5LA 1GOGA 2GMMA 2MPFA 2VQ0A 4HKLA 5LATA 5T5JA 2QZ2A 1BQPA 4LNVA 5D8AA 4L97A 1VRH1 5BUVA 5FY8A 2YMZA 1W90A 2PA7A 2A6WA 3C8XA 2PLV3 5BNPA 2BGCA 2A1XA 2OZ6A 4RS5C 3FHIB 4JQRA 4YW2A 3MPBA 5LA0A 4JC1A 4QWNA 1R093 4HSLA 4AEDA 3VBHA 3RPQA 3ZFEC 3NJXA 3QLQA 1UY3A 2A70A 2B45X 2WS91 4DXRA 3I2FA 5CADA 1A78A 4Y1ZA 5FLJA 1LAJA 4AI8A 1IZ3A 4AEJA 5LCWL 1QXJA 4LT5A 3KCXA 3M3OA 5FAXA 3IBMA 1UD1A 1IS4A 4BHPA 1G9FA 2DU0A 4W6WA 4QQPA 2W91A 1E57A 4YPJA 1K3IA 4FBFA 5KHGA 3J7NA 1NE4A 3ZM8A 2VNRA 3UYJA 4XW3A 2ZZQA 1REFA 1IS6A 4XTMA 1S4CA 3T2TA 2UYBA 2UWCA 4ORFA 4E9KA 1YFXA 2C9KA 2VZ3A 5FZLA 1UWWA 3A23A 1JH5A 3GM8A 5KR7A 2EIEA 2Q1ZB 3LD8A 4DXTA 5FUNA 1W9WA 4E2GA 3AFGA 2Y6FA 2ZZJA 4BQ2A 4WVMB 1QQP3 4WM8C 5JSPA 1V0AA 5E1RA 4RS5A 3PU3A 4W8JA 3ZN6A 4X8PA 1YFUA 5GLZA 3GCWA 4AGRA 4OUMA 1DGWA 3ZFEA 1BVP1 4Q1RA 2YPJA 4WVVA 4YM2A 4BXFA 1N47A 1RHI1 1RUC3 4DZGA 5JPNB 3KD4A 4QPYA 1QKQA 1UOBA 1CAVB 1W8TA 1CD3G 1H8TC 2BOIA 4YLZA 3CMGA 3KQ4B 4PF1A 2IXJA 3KHBA 4JVAA 2HJIA 3LAGA 2H0VA 2DYCA 2Y8KA 4NWVA 1ULFA 1WA4A 2A75A 3I59A 3WW2A 2VECA 1F5FA 4GALA 3JUUA 1S0FA 4YVWB 1KD7A 1I6XA 3VD4A 1GNHA 1QJU1 5JIAA 4TYSA 4CCNA 3GHNA 1W8OA 4XJ8A 2Z5WA 5HV4A 2VPVA 1VBB1 4K20A 4JTOA 2HEVF 3NW4A 2PAMA 2BW8A 3ACLA 5A1FA 5AFEA 2P17A 2WO3A 1HB2A 1XJAA 4IERA 1PK6B 3E5QA 3HN3A 1NXD1 4CDQC 4CDWB 1BMV2 2V72A 3UK9A 4XUNA 3ZX7A 2E7AA 2JD9A 1W99A 3GNEA 4PF5A 5EJ3A 5LBCA 2ZGLA 3MW4A 4HVQA 2IFWA 1V9U2 3VZKA 4ITCA 4KNCA 5A7PA 3VZMA 1V6LA 4A45A 1NZCA 5BNOA 5E16A 1JYIA 3AP9A 4WZCA 3RWKX 2R1BA 3APBA 4NHLA 5LB6A 2ZX1A 5JVVA 2ZGRA 5FJKA 3PIJA 1RUF1 1TZOA 3W59A 4PHZA 1UIJA 2W1QA 1ZVFA 1QF3A 2Q5TA 3WQBA 5KWRA 5FLIA 5FCCA 3ZSEA 2X29A 2YU2A 1VBA1 2GNDA 2JDMA 2Y6GA 3HIFA 4IL7A 3SISA 4AXOA 5IT6A 4FTBA 5EIYB 2VTXJ 3ZXLA 3B5LB 1IG3A 3FX3A 2PTMA 3VZNA 3VHOA 2A6VA 3B02A 3J9SA 3UL2A 3VKOA 4LBQB 4BLIA 2FZ2A 1VBE1 2O1QA 2FMDA 4CZSA 1WMEA 3ZYRA 1JU4A 2J1VA 3LPGA 5LWBA 4U36A 2LRPA 1GWMA 4AVSA 4YNIA 5L7OC 4CDQA 2AUYA 3PDQA 4AL9A 3VKNA 2QDRA 4LBKA 5FYUA 4O9EA 1R1A3 2HYKA 1RMU1 1D2SA 1GSLA 3L2HA 4YRDA 5CAZA 5BXXA 3JU9A 5F5CA 4LHSA 4AVAA 1JI6A 2W47A 2D6OX 2HWD1 1DYPA 1S0GA 2X05A 3H42B 4AG4A 1ZBE2 2VW0A 4FFFA 4GKXA 3OBAA 3R4SA 4HSJA 5FO8B 2C6SA 3AVSA 5T50A 2O8QA 1O3SA 4JGZC 1TMF3 1VAKA 2UWAA 1BHGA 3D0SA 4XC9A 2K0GA 1XU1A 3EQEA 1UY4A 3KV6A 4S2HA 2IVIB 4R9CA 1ZBA3 3M3IA 1SFNA 4Y5SA 5IAXA 3U78A 5LBEA 1Q8QA 4BDVB 4Z2AA 2B8MA 2YV8A 4LHNA 3NRUA 1AR71 1ULEA 5LEJA 1H8VA 1Y4WA 3NAPC 2C26A 4DMIA 3AZZA 5FK8A 3TEXA 1JZ8A 4YZ3A 2XBO2 2XQRA 2YB7A 1VBD1 4Y26A 1SG3A 4WVZA 2R49A 5L7OA 3VHNA 3PLQA 1ZZ7A 1QY4A 2HWC1 2WT0A 2WYSA 5FREA 3E1F1 1BK0A 1AXKA 2A3XA 2OXBA 4JDNA 4GMP1 1R082 2Q30A 5AC91 1ENSA 4NE9A 1XE0A 1LULA 4XUPA 5CKQA 4AYUA 4CDXC 4NPMA 1OQDA 1MZFA 4UFJA 5FZBA 5CFDB 3AMHA 5A33B 3O1PA 3D0JA 4OULA 3UETA 1OVSA 4XJZA 4AVCA 3WSOA 4FFIA 3FHAA 1UPSA 1PGL1 2ZAHA 4K1ZA 3A22A 3W5MA 2VXRA 3NNLA 5I0SA 3ETPA 4JGZA 1TME1 1ASJ3 3NKTA 4XAEA 5FXZA 2ZGTA 4W6XA 4CP9A 3ZFGB 5FY5A 5FOBB 1Z7S1 3CLPA 3T0DA 2YC0A 2QQUA 1W9YA 2FDJA 4QPIB 1IKPA 1PGW1 4XBLA 4FTEA 5FR3A 1IPJA 4M0NA 3BN6A 3ZKUA 1YJKA 3NAPA 3J4UH 5DUUA 5JDBA 3WNOA 4JGYC 2WL1A 1QOTA 2DCJA 2I74A 3H8OA 4IV1B 3WDVA 2QNKA 1UW8A 2P2KA 2XJSA 4RA0A 5FZEA 3RMYA 2XOMA 4P9YA 3I2DA 4AFMA 5CBLA 2J22A 1V6IA 4XOGA 1QJX3 2B7YA 4QXCA 2ZX2A 3MPPG 1AL22 4XE9A 3WF3A 3O0WA 2D6LX 5HPOA 4HZFA 3VDDC 3SEPA 1Q8VA 4IGOA 1RC6A 3I59B 4Q4W2 2CL2A 2R6QA 4JKLA 4K7JA 1VALA 4META 4XJ9A 4LHLA 3GBGA 3W9AA 3POJA 5AVPA 5CZKA 4BQWA 1OXCA 1Q3EA 3R4UA 2D3PA 4LIVA 1V6JA 1F8VA 1FXZA 1LEMA 2XQXA 1LU2A 3H3UA 5CNAA 3AMNA 5E89A 1UU6A 2A3YA 1UOFA 2AENA 3IM0A 1K12A 1VLNA 5FYZA 5LBBA 3WEZA 1F31A 1O3TA 1ZYBA 2OS2A 1G8WA 2ZACA 3B9CA 3MUY1 4LIUA 4UFHA 3RS6A 4AI0A 4HETA 3I97A 4YM1A 1TNFA 4ZS2A 2X5IB 5GZDA 3GALA 4NIIA 5C8WA 3MBWA 3POFA 4JX0A 4BM8A 1SMVA 5LW9A 5ACA2 1RYYA 2GALA 1KEXA 3M3CA 5CFCA 4NPRA 1HXS2 4QX3A 3LE0A 4K8FA 2ZEZA 2IUWA 1GBGA 5BNOB 1U5ZA 3I2KA 1VBC2 2VNGA 1OF3A 1OMIA 2VQAA 1GZ9A 2YG0A 2ZMNA 2WLPA 2XJVA 2EXKA 5EV7A 2ZGMA 4HLTA 2VJXA 3EO6A 3VBFA 5EHDA 1ENQA 1NY72 3RG0A 2J1TA 2LROA 3VDDA 3P3NA 4PCRA 4MXVA 1LOGA 4QXBA 1AR62 3VZOA 1IS3A 2PQQA 5K0UC 4H14A 4ZY9A 3SITA 1FPN2 5FZ8A 2GH8A 2VCBA 5IVBA 1WCKA 2IXLA 1O3RA 1EV11 3MFAA 2Q8OA 2FBEA 1HJGA 4GXLA 3FWEA 3SMHA 4PDWC 1O3QA 3B69A 1FOD2 3GZUC 3JCIA 5T54A 4HK9A 2P3YA 2CHHA 3EB7A 4BQ1A 4Q2FA 4COWA 2R063 1YXWA 1WLCA 4AGGA 4R4ZA 2BUKA 5FLHA 3WF2A 4CUGA 4AFBA 1W6NA 3DYOA 1OLME 2QQKA 4YZ2A 1QHDA 2E7TA 4YW5A 4DEVA 4MV2A 3SCFA 5FYHA 3R0RA 3W20A 2PLV2 4EV0A 1COV1 1ND3B 1TQ5A 3VHRA 1B09A 3F95A 3S30A 3MDPA 2PHLA 3I3EA 1R092 1OD3A 4CDUB 3HOBA 5A6YA 2R041 2RM22 5FPXA 5J3UA 4IE5A 4QB6A 1W8FA 4PLMA 1PO13 5K0UA 1DQ2A 2QQOA 1N3PA 3RYRA 2BOJA 4UBHA 1LOEA 2VZSA 3LA7A 3JQXA 3I3BA 5FY1A 1H4HA 1HV0A 5DXDA 2JDHA 4AVVA 4CCDA 1RUI2 4YVSC 1W6OA 1NQDA 4P5HA 1J1TA 4PDWA 4YFZA 4CVUA 4JKKA 4LEJA 3I2OA 1DFQA 1ULDA 1RUJ2 1WW4A 2DWRA 4NAMA 3I49A 1G9AA 2BVBA 3ZXFA 3P5BA 4I09A 2WQZC 1STMA 1UZVA 3ZR5A 1LOBA 1SCSA 1UF2C 1KJRA 5LRRA 4KWLA 1US3A 3NKGA 2NN8A 3HQXA 1JYXA 5CKMA 2HWF3 5A32B 4E4HA 3OSDA 2WFF1 5A7OA 1C8M3 2QUOA 1AYN3 3AYDA 1QQP2 3IIAA 3KWVA 1RUH1 3LA3A 3SXWA 3VD3A 4ARXA 2CDPA 3DF0A 3KM5A 1HB1A 1U5XA 2WT2A 5T3NA 3UKNA 1XNAA 1MS5A 3K3NA 3LDBA 2XLFA 2RS11 1ND2B 4S2FA 2VU9A 5FUIA 2NQYA 3JZVA 4Y4RA 1HN0A 3WF4A 1IPKA 5JR2A 3U0ZA 2XLGA 3MICA 4DPNA 4XVHA 2YUEA 4XUQA 5IFPA 1VRH3 1HRV1 4FPEA 2AYHA 5GLVA 5A3UA 1LOFC 2UWBA 3SKJE 2DDUA 4HVRA 4FPCA 4ZU5A 5JPMB 1DGRN 2QJVA 3THTA 2E9QA 3RZZA 2JB8A 2W39A 4Q0UA 2WS93 3ZSMA 3TN92 2DV9A 1DCSA 3IMMA 4FT8A 3LEIA 5KXCA 1HW5A 5C9AA 4Z1VA 4QQHA 2JG8B 2JDUA 3PVEA 5LA1A 1LKNA 2VBDA 1EUUA 1UU5A 2E33A 4LO5B 3KB5A 4X6QB 1UZ0A 3ALQA 4A44A 1H9PA 1H9WA 3HBKA 3A0NA 1KFXL 4IEVA 5F37A 1PVXA 2VULA 3WQ7A 2EXHA 2VCMA 3OCPA 4OMDA 5DMYA 4I0AA 1W05A 4QQ2A 3ZN5A 2CV6A 4KH9A 2WZEA 3LA2A 5D21A 5HCBA 2VMDA 2WZR1 4D7TA 3TYJA 4N8MA 4FVVA 2QVSB 4F8AA 4LBOA 2FQPA 4FPYA 1W6MB 3BGAA 1SBFA 1VMHA 3VDBA 1SPPA 4KG8A 4LK7A 1BZWA 1ZM1A 5FMDA 4Q4X3 5F6LB 3S5AA 3AVRA 2JE9A 2VH9A 1LOFA 1GUIA 2VM9A 2Y34A 1JYTA 4KU8A 4HONA 2J7MA 5FTTC 4AHYA 1UY2A 1V6OA 1D4M1 1W03A 3MV11 4ZPIA 4NIAA 4CCJA 5A3TA 3O1SA 5I0DA 3FBMA 4A7KA 4QQOA 2H6CA 2CTVA 1VAMA 5KC5A 3BPSA 1W8ZA 1C57A 3ZYHA 1PZ9A 5CFCB 2NLRA 1IGOA 4Q0QA 1XNKA 1OLMA 4Q4Y1 2C24A 2UY9A 5JXGA 1PMHX 1QXRA 1PHMA 3NO8A 1ZA4A 3UNPA 2JG9B 5FZAA 2QBXA 4M00A 3WLUA 3ZYIB 1QNYA 3BOWA 1LHOA 3PU8A 4YVWC 3VBFB 4WBBA 4GMP0 3LF7A 5FFOC 1QJU3 1OF4A 3ECQA 1R1A2 4OCTA 2BBVA 1D4VB 3RNSA 3WP3A 2ZAAA 2QQMA 3W21A 1VBB3 1DF0A 3IDEA 3IWZA 1W0NA 4D7SA 4AQ2A 5KHHA 5EZWA 1CX1A 3O7OA 5FZFA 1CPMA 1PK6C 4CDWC 4WVMA 4N53A 4LR4A 3LZZA 2EIDA 4QXHA 2XJTA 3B01A 4M0HA 5C3SA 3H8RA 1FYUA 2R071 2EAAA 2W68A 4O61A 4QX0A 5CEHA 5GZCA 2A7AA 3AB0A 4M01A 5I8SA 2MEV2 1TG7A 1OUSA 3RDIA 3WP6A 4IE7A 5FYYA 4EZHA 3D3AA 2VVEA 3GJAA 5FZHA 5FOJB 4CUCA 4B4PA 4D6RA 1RUF3 1H1AA 1CAVA 1F9KA 2HBTA 2K9ZA 1MEC1 3P1IA 4JRLA 2D6MA 1LODA 1WMDA 4LMFA 4Q26A 4D0QA 5SV5A 3A4UA 5BV6A 4A6OA 4BIOA 1QJY1 2BWCA 2XKPA 4ET7A 4LOTA 5IK7A 2XXZA 4XFBA 3T1MA 1DYKA 2V09A 3HAGA 3KGZA 1GMMA 1EAH1 2JDAA 1Q8SA 4BYYA 4PI2A 1TE1B 4YVWA 1BBT3 3NJZA 4IE0A 3AYCA 1JYCA 3JB8A 2XGXA 2PAEA 4P02B 2VNOA 2WWJA 3JD71 1UZZA 3UT0A 1YWKA 4GA9A 5C3OA 5JZGB 3WVJA 2YGLA 4CXYA 2PQSA 5J48A 4TLGA 4EQVA 1QOSA 4BE3A 1VBE3 2DU1A 3BODA 1V6MA 3LQCA 5FMOL 1YHFA 1VAVA 3VBSB 1FATA 4XUTA 3UGFA 2Y6KA 3IDCB 3ZLIA 1JZ7A 2VCAA 4M4PA 1QDCA 1PK6A 2FCUA 2ET1A 1CPNA 1YEWA 2YBPA 4CEYB 3BTYA 3BYWA 3WG4A 2P3KA 5EXOA 3INAA 4NN0A 2D40A 1RMU3 4KWUA 1PZ7A 5L36A 2Y60A 3H50A 3BTAA 1ZRFA 4GJZA 4RSUA 4SLIA 3MI8A 4W65A 1YNAA 3I2HA 2EVXA 2HWD3 4P08A 4YGEA 3ZXKA 2VZRA 4IUGA 3U4SA 4CP0A 1AX1A 4UYBA 2D5FA 4FPLA 1YI7A 4FQZA 1XBFA 2RVAA 4J1XA 5FP8A 4IEZA 1IHMA 3M2MA 2BQPA 3HN1A 1NCQB 5F5IA 2B4KA 3GZEA 2J1RA 4IEUA 1OUXA 4EWDA 3RI8A 2HWE1 3M1HA 1HIXA 1JOPA 3U1XA 1YJLA 4JCKA 1WLWA 2DVAA 5FPUA 4PQ9A 1RUOA 3SKVA 1SBDA 1YO8A 3LIGA 3SEEA 4HPKB 4NRPA 1BKZA 5ANNA 1CR7A 2YHJA 4NHKA 4INDA 3RVHA 2WUHA 4AI1A 4BIFA 2ZX0A 4MOAA 4E2SA 4Y1YA 3CIHA 4UF0B 3N4MA 1RXFA 2WAAA 2A5ZA 1AR73 3S57A 1OC1A 5CIRA 3NQHA 5IWFA 4V2WA 2WO7A 3CNAA 4OZXA 4TSVA 3B00A 2HWC3 2WR9A 4PI0A 1OOPA 2UY8A 2QKDA 3HR9A 2ZS6B 4GMP3 1SQ4A 4PIXA 5A80A 2NM1A 3KT4A 3ACGA 3D6EA 5C9AB 1W8UA 4IEWA 4H2AA 1GWLA 5LY2A 5CFDC 4MG2A 2ZPXA 1KGYA 3OPWA 3FFQA 5FZIA 1ZRRA 4OI1A 4LLFA 2ZGPA 5FYCA 3ES1A 2ZABA 1I5ZA 4H7MA 2X8KA 1C5IA 2VMHA 3CF6E 4PBOA 3VDAA 1PO23 1JYNA 3OYWA 5FXVA 4P9LA 2HBUA 1TME3 4D3WA 2PHDA 1V70A 4P9XA 4PLOA 4F83A 2R0FA 1HRI2 2E26A 3ETQA 1HDKA 1POV0 3ZFGC 3JB4C 1GOFA 1Z7S3 2WQ4A 2B9VA 5FPAA 5TSWA 4BQ4A 5C5UA 1PX4A 1OKQA 2A6XA 2MNGA 3J8F3 4L9BA 1U12A 2ZEXA 4QPIC 5F3CA 1D0HA 3NV4A 5FZ0A 1SPPB 2FD8A 1W2OA 1W28A 4YG3A 3SC7X 2RJ2A 4XMIA 3ZSLA 3VLBB 3PUQA 4UFKA 4A42A 2W95A 4MVTA 4DXZA 3N35A 1NT0A 3KLSA 2WC2A 1US2A 4IV1C 1XXNA 1UX7A 4E27A 2W3JA 2Y26A 4EN7B 1G7YA 3CKHA 4RHV1 1BMV1 2QQJA 2RS33 1OA4A 3VKMA 4LBMA 3FE5A 3VBRB 3ZDSA 1TNRA 4PT6A 2I07B 3NNGA 1YC61 5FYSA 5CFDA 5J7MA 1V9U1 2Y38A 5IATA 5FY7A 5A33A 1RUG1 4DRRA 3WDTA 3THPA 1YQ2A 4COYA 5DAPA 4PJYA 1P8JA 4FPFA 5JI9A 1L3JA 2W0XA 4GWIA 2W1SA 4MX3A 1GZWB 1K42A 1LHVA 2DCKA 4MHRA 2QQWA 1OKOA 3HPNA 4UI9L 4LTAA 3U11A 3ZXGA 2XWBB 1DLLA 2IXKA 4C0HA 2LTNA 1GWKA 1PIV2 2RJKA 2Z42A 3IAPA 2G9GA 2VD7A 3ZFGA 3LDRA 1Q43A 1UZWA 3BU7A 1CAXB 5BPXA 2Y33A 3T0BA 4BK5A 1PM4A 2CWSA 2Z2SB 4FPOB 4QPIA 5FZ4A 5L9RA 3PVNA 3N7LA 2RV9A 4NHMA 4EN8B 4N53B 4K9SA 2X5IC 3K4ZA 5A3LA 1ZNPA 1QJEA 3OOXA 4OZOA 4XZPA 3NNMA 4IV1A 4IV3B 4COVA 5A1AA 2QQLA 2FDHA 1U0AA 5BNOC 1XYOA 4A7YA 3J26N 4FFGA 5IFTA 4R9AA 1Q5OA 4BCUA 5FY4A 3IKWA 2OIIA 3NWKA 5FMOS 2AEZA 2QTWB 2YPDA 4CXWA 1H1MA 1ONAA 4IXLA 5BYNA 1DZQA 2GC3A 2ID4A 4BJ0A 1FX5A 1KQRA 4BMEA 1G9DA 2ZX4A 1B35B 4ISQA 2RS52 4KL1A 3OF1A 1BYHA 2C0ZA 1ZBE1 1YIFA 2XLAA 4QX2A 3AJZA 2GP3A 3AJYA 5EWSA 3VKLA 2CGNA 4IDZA 4XFIA 1KDKA 4Y4YA 3ZXEA 2ZEYA 4HG6B 1S0DA 2IXIA 1H6XA 2YBKA 2Q8CA 4B1MA 1I3HA 4XILA 4QX8A 1XYPA 4D94A 5FY9A 1ZREA 4XHBA 1O6UA 4ZZ5A 4HN1A 1EV13 5F9TA 4Q0VA 2EXJA 4WZFA 5DDJ1 1TEIA 1T6GC 1POQA 1MZEA 1Y9GA 1C8M2 1AYN2 3KT1A 4FOWA 2XKOA 4G3YC 2PAKA 1UKRA 3OGJA 2X5IA 3E97A 3NJYA 4GWJA 2ZGKA 2XR4A 1KJLA 3V56A 1S2EA 3LFMA 4YYOA 4E4DX 2XBO1 2D5HA 1GV9A 1XE8A 3POYA 4X8NA 1VR3A 4CUAA 5IYYA 5IVVA 1NLRA 4WM7B 1M06G 4H3WA 4IEXA 1COV3 1ND3C 4I3PA 4QMAA 3SH5A 3E6BA 1LGBA 4AQTA 1D2QA 3PTYA 1F15A 3RZMA 1W6PB 2D93A 1H30A 2TUNA 3H1WA 4JHTA 4O9GA 4XUOA 3VHPA 3WNPA 4CDUC 2R043 4XF4A 1GLHA 3OBTA 3KSCA 1J59A 2XUEA 5IK4A 1NE6A 2QQVA 2GZWA 4FP2A 4EN9B 1QH7A 2F17A 2K46A 3DEMA 2RDRA 1DU3D 1U5YA 3EJKA 1LEDA 1RIRA 2JX9A 1RVF2 2TNFA 2VZOA 4C0BA 1WUVA 3G6JB 3OBZA 4K3UA 3FFZA 2CAVA 3AKRA 1DIWA 5FP3A 2BPA2 5A7QA 2BFUS 4A7ZA 4CCKA 3TEWA 5T5PA 1QJFA 1NG0A 1QNWA 3AP5A 2F6BA 1YFWA 2GSYA 3IIIA 2BWAA 3C7FA 2YROA 1OOPB 3R05A 1UOJA 5H9QA 1FMD2 2P4EA 5DQ0A 4GAZA 4OI4A 4XMAA 1FNZA 1GYKA 4XF3A 5J96B 3BTXA 2CU5A 4QHBA 4OQ9A 3M7AA 2XB6C 4DUXA 2JDPA 2D3SA 3RGBA 3N3HA 4LJHA 3AKSA 4R9DA 2WFF3 2GNTA 1X8MA 3V0BA 3C7HA 1RUH3 4Q4X2 5FO9B 2LS6A 5FXWA 1ND3A 3RZLA 1JXNA 1H2MA 2WO1A 4XQWA 2RS13 3ZIXA 1ND2C 3TOJA 4CDUA 3ACHA 1ZZ6A 1AL21 3OYWB 3KCYA 1N1SA 4IESA 4LKDA 4RD7A 1ZRCA 3M3EA 5JUVA 4Q4W1 3ZYGA 5L19A 3OGGA 3TNPB 1HRV3 2ES3A 4QDRA 2JENA 2BGPA 4TLFA 3DCQA 2DVBA 1RITA 5DG2A 1A6CA 4GZ9A 5FQ0B 3E6CC 5LK5A 5GALA 4P9JA 1KDMA 3ENRA 1YI9A 1FV2A 1Y9QA 1GNYA 2VMGA 3GZTB 4N9HA 3A0KA 3O1UA 1GKBA 1UU4A 3FJSA 1QJU2 2TBVA 3ZOIA 2AH2A 2JG8C 3KHCA 3ACFA 3WP4A 4XQDA 3KV5A 4UFIA 1NAEA 3OUHA 2BRTA 2EA7A 1FI2A 3THDA 3WF1A 4J6GA 5DAQA 5A32A 5ACA1 2O8OA 4KG0A 3D5OA 1HXS1 2E31A 3WW3A 4LULA 3AMPA 3ZXDA 3URFA 5C3RA 1VBC1 1NZIA 2LM3A 3LIHA 1C8NA 1BVVA 2WZR3 4K6BA 1ND2A 4Y5TA 1MACA 1CQ9A 4LITA 5A6XA 1NY71 3POSA 3GCXA 4HN0A 4XCAA 4N7UA 3DXUA 3U10A 3K46A 2P37A 3C7GA 1RUF2 3K3OA 4QKBA 1ZZ8A 1AR61 1DP0A 1PZ8A 1RUE2 1AX2A 1FPN1 5I0UA 1DQ5A 2VGDA 4NRQA 1VIWB 5I8TA 4LUMA 2JWPA 4EE2A 2WNVA 3ILFA 1D4M3 1W2AX 2IWGB 4KI5M 4QKNA 4PIZA 1BBT2 2ZKNA 3AX4A 3OTFA 3QACA 3SCHA 4BLJA 3PTRB 4BISA 4AE2A 1Q8PA 1BXHA 2JDNA 2N7GA 4RR3B 5CFCC 1AR93 1EP0A 2JG8A 3JBG2 1NQJA 4Q4Y3 3HBZA 3HNBM 1HV1A 2JE7A 2PELA 4OUEA 4B7EA 5DAVA 2R32A 4Z2WA 4RYDA 1LOCA 1YCIA 1C4RA 1MR5A 2DCZA 2JG9C 1LB2A 2PHRA 4AOCA 4I3GA 1Y3TA 3KF5A 1UYXA 4LORA 2VVDA 4QXKA 3T2OA 3VBFC 4E8CA 5I0TA 5FZOB 3ZPOA 1EY2A 5A3OA 1J83A 2ORXA 2VOWA 3LPFA 3IPVB 5ANQA 2PLV1 3OPZA 1JU3A 4CU8A 5LRSA 1JYWA 5F39A 2XVGA 4LHKA 1R091 1W6MA 4UW4A 1CX4A 2RM21 4F3JA 1XE7A 3O1MA 2VO5A 3I7DA 2RR11 1VMFA 3WQ0A 1OD5A 2WLQA 3PVBB 5A3WA 1A3KA 1JHNA 3O1OA 5FZ3A 2HWB1 2R0HA 1IS5A 4S2DA 1WWYA 2R7EB 4Y3OA 4FFHA 5IAVA 3AZXA 1E5SA 1YQCA 1RUI1 1APNA 3RRDA 3Q8AA 1A34A 1NLQA 2B9UA 2P5BA 4YWAA 4A3ZA 3ELNA 5G04L 1PGSA 3HD8B 5GKAC 5IVYA 1MEC3 4AAXA 3N9LA 2BJSA 1AJOA 1DQ0A 1JUIA 1DHKB 1BEV2 1JBCA 1RUJ1 1SACA 1VE0A 3OG2A 3PUIA 1QXPA 1QJY3 4FPKA 1AR72 1AUYA 5C7GA 1D7PM 2JG9A 4N43A 1MVEA 1NLSA 3VUOA 3MIBA 5FP7A 3T2PA 1EAH3 1AYM3 2JD4A 4A4AA 2HWC2 4GB31 2BZDA 2XVKA 4P5YA 3JD73 1CZTA 4DQAA 3OJBA 2J1AA 4DY5A 2NZ9A 4AFCA 1QQP1 2WNUB 2B39A 4WVWA 4URAA 1G9BA 4DUWA 4XABA 2FDGA 4UOJA 4YZ1A 4EWEA 2V5YA 4J1WA 5I91A 3PVOA 3VBSC 1PVC2 3EXUA 3LSDA 2Z79A 5FY0A 1J84A 3CQOA 2R1DA 1MS9A 2WO2A 4CEYC 4DIQA 2J1EA 4G4FA 4ES9A 1JN2P 5APAA 1PO22 1O4ZA 4Q0PA 1TME2 2WWSA 3O14A 3AK0A 1SLIA 1XSRA 4NWWA 1V6KA 5JIUA 1AR83 2VG9A 2FHRA 3J8F2 4I01A 3TN91 4B8EA 5FXXA 1POV1 3KGLA 3LB9A 2GU9A 5IVEA 1C1FA 3V0BB 1NCQC 4R52A 5GLTA 1PMJX 1OFSA 5HXMA 4KGQA 2HWE3 2V73A 2NYYA 5JR7B 2WZ8A 4CXXA 3BUCA 4AVBA 1LENA 4YGDA 1AZDA 2HEYF 4AR2A 4YFWA 2BNMA 1HJFA 4P14A 5JZGA 3SCGA 3FUOA 1SFPA 2RS32 3JQWA 1GR3A 4QU2A 3ZYPA 4DUVA 1QMJA 3BALA 4XYXA 2XHNA 2ZJCA 4IE4A 3H0OA 2JKXA 2CY6A 3VBSA 3VZLA 4L92A 2RE9A 1RUD3 5EJZB 1UPIA 2ZBJA 4EWAA 3UJQA 3K51A 3O1RA 4K40A 2KR2A 2PHTA 4CEYA 2WT1A 1RB8G 3KS7A 2BNOA 3ZYFA 2P6HA 2HYXA 4SBVA 5C9AC 3QOPA 1LTEA 1IQAA 5C3PA 2ILMA 1NYWA 4QGMA 4MGKE 4OI2A 2X53S 1NCRB 3VBOB 1CONA 4IW3A 3PMSA 2XJQA 1URXA 4CYDA 2JXAA 3VDCA 2NP0A 4AFDA 2OA2A 1W6QB 2W1UA 4MXWB 4KGGA 3DV8A 1WCUA 2GMPA 4Q0SA 1WW7A 5FBJA 2ZHNA 4AW7A 4EJRA 1Y7BA 1NCQA 1REEA 2G9ZA 2WABA 4NR1A 3WNNA 3WNXA 2ARBA 1F4AA 1QU0A 4RFRB 4HPKA 4LBNA 3TB0A 2I45A 2VZPA 4CU7A 3MW2A 3DXTA 1OT5A 2IXHA 2E32A 1RUC2 2OX0A 4OHXA 4NPLA 4XAAA 4K21A 1YQ6A 4UF0A 2PHUA 1EUTA 4CE8A 1DGWX 1UMHA 1WBFA 2LALA 3CU7A 4OLLA 3N9MA 5IVFA 1RUNA 1HB3A 1H2LA 2RJLA 5JI7A 3Q8BA 4OHZA 1MS4A 1W9FA 1DBNA 1UN1A 2JICA 2JKBA 2XMLA 3AKTA 4RQPA 3ZVXA 1JZ3A 2CYFA 1CAWB 2WNVB 1LGCA 1KS4A 2RMU1 2YY1A 1SLCA 2OPKA 3S5QA 4AQ6A 5KXBA 4RHV3 3I2JA 4L11A 4ES8A 2VC9A 1NOVA 3VBRC 4D6QA 1WMFA 1XB9A 3KVAA 4Q4V1 4DXSA 5FP4A 2E6VA 5KC6A 1V9U3 1LRHA 1RUG3 4X6RB 5FZ6A 2MEV1 3AFKA 4L99A 3RSJA 4B3NA 4CCCA 2ATFA 4LE3A 3B3QE 1IQDC 4Z92B 2VUDA 1QEXA 2DCYA 2WKKA 1W8WA 4XJAA 1K5MB 2ZXQA 4S2GA 4CEWA 4UW5A 1W0PA 4NOTA 4AEKA 5FPBA 1Z0HA 3QH7A 1S2KA 4GH4A 3ZPYA 2VBBA 2KM2A 4V1PA 5DZEA 5FV3A 3VN4A 2PHWA 4K1YA 4AEMA 3GGLA 1O8PA 3WUCA 4FAHA 2W9XA 5EP9A 3LOIA 2D3RA 5T52A 2A73B 2VW2A 4N53C 3WNMA 1YUDA 2WA3A 1DDLA 5FWEA 3K77A 4F7ZA 5FZKA 4NHYA 1ENXA 3DPRB 4IV3C 1GZCA 4UFLA 5F32A 5FP9A 4W6YA 2B5HA 2BP6A 3WG3A 2I2SA 4AI2A 5JLVA 2RHPA 1WCSA 3CZUA 4O65A 1RHI3 2SBAA 3IMNA 2WZPP 4IEQA 1OQEA 3VBRA 4NUBA 4XF0A 1H4GA 4XIKA 3O0VA 4GD4A 2ZMLA 3ROUA 1UZYA 3GXUA 1LECA 1H2KA 2D43A 3AZYA 3UGGA 2E51A 5FZMA 3LEMA 1W04A 1B35C 4N43B 1HQLA 1GZWA 3AP4A 1ULPA 4P9WA 2XPJA 1BLZA 2P6CA 3SQOA 4TTGA 4E4SA 1QGLA 2GNMA 5B2GB 5FZ1A 4GIQA 5FZ7A 1F35A 1XOYA 3WOGA 2EALA 4QQLA 4XACA 4B4RA 5DDJ3 2HKXA 3LEKA 4DOUA 1CAXA 2NMNA 4AHZA 3BCWA 5HCHA 1KFUL 1PX3A 1WBLA 5A6ZA 1BK1A 3C3VA 1ZZCA 2JDZA 3MGUA 4CCMA 5EPAA 2WINB 3CEWA 5F3GA 1J3RA 4FSJA 2OW4A 1ALYA 4XF9A 1OH3A 4IV3A 2XBO3 5FKBA 3TWIA 5ERLA 5IVCA 5JMCA 4ZHNA 3M8LA 1TMF2 4KBZA 5FPVA 4AI9A 1N3QA 4FI9A 1O91A 5F1RA 2DCTA 4UXAA 3EHKA 1ZBA2 3HNMA 5GZFA 3QD6A 4WM7C 4DO0A 2QQPA 1G86A 3KZ4C 4LA2A 4TXWA 2A6YA 2VR4A 2ZKLA 3N7JA 4Q29A 4QKDA 2OKXA 2ZGNA 1DLCA 1CZSA 4DB5A 4YGBA 1VBA3 1W3VA 4FTSA 1MPXA 1B35A 1OVPA 2FCVA 4MGIE 4BMBA 4QHOA 4CU9A 3WQ1A 3VGIA 5GJ6A 4PBPA 5EFUA 4ATEA 1UO9A 3IDBB 3BIWE 4JKMA 3T0AA 4XZUG 1N1TA 5F3IA 2O0OA 3WG2A 4I0BA 3AXDA 5GM0A 2GAUA 2JJ6A 1HRI1 5F3EA 4YZ4A 5K7PA 4A41A 3AL5A 3AYEA 4L8QA 4N9IA 4XBQA 1RL3A 5KBFA 1C1LA 1FAYA 1WCDJ 3X29B 2PHFA 1HLCA 3FBYA 4MHUA 2HH9A 1JOJA 1OOPC 2WZR2 4ZZ8A 1UYYA 4MYEA 4MGQA 1A8MA 1X33A 4YW1A 1O59A 4MH0E 2VMIA 1JODA 1ASJ2 3QH6A 4COUA 2GN3A 3N7MA 5DN2A 3K48A 4LO4B 4B7KA 2YDEA 5DZGA 1ACCA 1WD4A 4BH9A 4WM7A 2VUJA 1AF9A 3KV9A 1OHFA 1W6PA 1UKGA 1S1AA 4K8RB 1AL23 1D4M2 1REDA 2ZHKA 1XU2A 4OQ8A 4M3CF 1FV3A 3WXPA 2VVFA 2ZHMA 4N90A 2FMYA 1XNCA 3E5UA 3LSEA 4Z82A 3VKFC 1LNSA 3VV1A 5B4NA 1NA1B 5LK7B 4Q4W3 2VOTA 1AR92 1W2TA 2BTVC 3O5SA 4Q4Y2 4QM8A 1KXGA 1N1YA 3FHQA 3NVCA 4BK4A 2DTWA 2GC1A 4LXLA 3H8XA 3ZIWA 4NAOA 4RGKA 2WRAA 1QJX2 4N7IA 4C91A 4QM9A 1PIV1 5A1LA 2DTYA 4I0WB 3WW4A 3DYPA 1VBD3 1ZRDA 3AZWA 2WQ8A 2JE8A 4HMZA 4IEPA 3NNFA 4RQPB 1GANA 5HCFA 3OBRA 3RYKA 3T09A 1GQGA 4KMQA 2W5FA 3ME2A 3WCRA 2DBNA 4CCLA 4BXSV 2YC4A 4D6SA 5FMBA 1G6NA 2Q4SA 4A3XA 2XUMA 5AC93 2VXJA 1Z78A 2GC2A 2ARAA 3LWCA 4XEZA 3WUDA 5GLUA 2JDYA 3MZHA 5ACA3 5DUXA 1SLAA 3AXEA 1H6YA 2CSGA 3TNQA 4MADA 3MLJA 4NHXA 5BNNB 4LO8A 2GMEA 5I0RA 1VBC3 5E6HA 1MQTA 1SLTA 2PN5A 3OY8A 3WNLA 4COZA 4CEWB 4E8DA 3OB8A 2XVLA 2WBKA 3NSTA 5HBAA 4YG0A 2DVFA 3ATGA 2J42A 1GICA 5ABJB 4GH4B 1UYPA 2C1FA 2RS51 4AHXA 5CISA 5KXEA 4TZDA 2D44A 4FAGA 5EYYA 5FO7B 3PJYA 3AKQA 2VMEA 3QCWA 4XDPA 4QKFA 5FQ0A 1W9TA 3WY6A 2E7QA 2VCCA 1AYM2 2VZQA 2VBPA 5G05L 3A7QA 4A2UA 5J1XA 4RR3C 2XONA 1AYN1 5H9SA 1L7RA 3WHUA 3FZ3A 3OEAA 3CJIB 4XURA 4LO7A 2QQNA 2G1MA 5T55A 2G19A 5F2WA 3L9JT 1D0GA 3HQRA 1ZX5A 3VBUB 2BYVE 5DABA 5C6CA 1W06A 1WLDA 4YM3A 1AVBA 4NROA 4ZONA 3USUB 2OZJA 1S0JA 2AEYA 3IB3A 3GZAA 5F8PA 3ZKYA 1OPMA 4LKFA 3CO2A 3MUZ1 2ADEA 4FO9A 2GP5A 3MHZA 3GF6A 2C9AA 3BU0A 3D4KA 4CSWA 3H7YA 3VD9A 3CZJA 4CP2A 1UL9A 2R062 2RM23 2VQUA 1AR82 4NIDA 3NJVA 5L9VA 3AP7A 3MV01 1T6BX 2JDKA 4RN5A 2RR13 3DN7A 3MIHA 3UV9A 1OURA 2HWB3 2P3JA 5FZGA 5FUPA 4XFCA 3BIEA 1CIYA 2CWMA 3DECA 4KWJA 1RVF1 1QJZA 2HWE2 1RUI3 1XSQA 2BVVA 1ZZBA 2LUWA 4M3CB 4BU2A 4UW6A 4RR3A 4ISRA 3POIA 2B46X 3ZDVA 2GNBA 3ST7A 1RUJ3 4QDQA 1H0BA 2ZMKA 1PO12 1GZTA 3LEGA 3HJRA 5FYBA 1DQ4A 2KXLA 1FMD1 2WAOA 2WDBA 1RUD2 2BDRA 4AZZA 4XJWA 1ULGA 5M0TA 1C3HA 5C5TA 4GB33 3SHRA 3O12A 1SLLA 4DINB 5FZOA 2DVDA 3S0MA 1QWRA 4JDOA 2ETEA 2WNUC 4Q4X1 3IPVA 5K8SA 1S0IA 4NO4A 4EZ4A 1E5RA 3IN9A 5DUWA 4UFMA 1WMXA 1LU1A 4MLOA 2BBAA 4YG6A 4OHWA 2KD7A 2JIGA 2VUCA 3C7OA 2HWF2 4JTNA 4QX5A 3Q8EA 5DAWA 1T2XA 4QX1A 3U07A 2KA3A 1I1EA 3TEZA 2EAKA 3I8TA 5CKNA 2E63A 1S0BA 5FZ9A 3POBA 5C8CB 1GU3A 1X82A 2IFRA 4NJ4A 3O1TA 5IK8A 4HKOA 1SEFA 1SDWA 4O7XA 1VJ2A 2QE3A 2BGOA 2ADDA 4OFGA 4LO6B 3TN93 1NXMA 1OA3A 2D6NA 3B93A 5DAXA 1POV3 2EIBA 2A71A 5F2SA 4ZU7A 5BY5A 5DG1A 3NV1A 3M3QA 1VRH2 1DYOA 2G9FA 2K2SA 3MFCA 3MLLA 1UOGA 3MW3A 4LPLA 4TN7A 1R081 3MIEA 3DL3A 5JOWA 3FMGA 2NMOA 3ABZA 4DFSA 3M70A 4JZRA 5C4WB 5JAXA 5JXJA 3BTZA 2WS92 4RHV2 1QDOA 2WNUA 3NMBA 4WM8A 4I02A 4Y1XA 5LBFA 4D69A 1VP6A 3VD5A 4AQSA 1X7NA 1UYZA 2VQTA 4ASKA 2DURA 2IXCA 3ILNA 2OVUA 1RUG2 2OUJA 2BU9A 2JECA 2VE1A 5L9BA 3WD5A 3HMYA 4H55A 3PUHA 4ZXKA 3V64A 3RZKA 1Y43B 1CGPA 1SDDB 1XRUA 1VPHA 3MF9A 1XQNA 1CIWA 2CGOA 1GP6A 3ZFFB 1H8TA 1UMZA 1RUE1 1V6NA 2BERA 3ZN4A 3EYPA 2CNAA 2DUPA 2DF7A 3N9PA 1NCRC 2OPWA 3VBOC 4AF9A 3CJXA 5JWPA 2Y6JA 1BBT1 4OI0A 1UXXX 2YGMA 2ZOEB 1GFF2 1J3PA 2B42B 2VAUA 4G9SB 4CP1A 3JBG1 1GP5A 2XJRA 3KF3A 4UAPA 3WV6A 1DGRA 4P00B 3AZVA 1MQTB 3OY8B 4DY3A 1N3OA 2W2IA 3KV4A 4GJYA 4QPGB 2Q1MA 5H9RA 3SLIA 4Y20B 4C8DA 1Q8OA 3UGHA 1RHI2 4LKSA 2AGSA 3J7MA 4URTA 5DPNA 5E88A 2J1UA 4Q1PA 2P34A 1O8SA 2OT7A 3LCPA 3OPTA 1WGPA 4L0PA 2PFWA 4E2QA 3OEBA 4EN0A 2WNVC 4Q8KA 3NL1A 3WW1A 2RMU3 3RJRA 2VTXA 2JIJA 3RI9A 2V4VA 2VMFA 2ZCWA 1G9CA 1VB2A 2W52A 3ON7A 3GJBA 3S6PA 4Q4V3 4QAWA 4FCAA 3T1LA 4YW3A 2AACA 4GQ7A 4JV4A 1Y9MA 2MEV3 1NCRA 3VBOA 5F5AA 1H1IA 1JTZX 5DDJ2 1VBB2 1MVQA 2EXIA 1AXYA 3H1YA 4RFT0 1W6QA 4B29A 4MXWA 4XETA 3WZ1A 4YM0A 4D8MA 4YSFA 1K5MC 4HBNA 3FUQA 1CESA 5LA2A 3T30A 3H9AA 1WD3A 1WCQA 4B1LA 1VB4A 3AYAA 5D8AB 3P3PA 1RGSA 1BEV1 5HCAA 2P1BA 1KITA 4PLNA 4DNYA 4CUBA 3BPZA 4XJUA 5BNPB 4Q8LA 4ONUA 4AWDA 5FPLA 3N7KA 1LHWA 3ZSJA 5J37A 4XTPA 1XNTA 2EICA 4AEDB 3VBHB 3VZJA 3OD4A 2F4PA 3V0AA 4LQRA 1W0OA 1JS9A 4I2OA 3THCA 2PYTA 3GHMA 3N36A 4XQ4A 4RL7A 4QD2A 3U75A 1LGNA 3PMEA 4RGAA 4XF1A 1XNDA 1LOAA 2VNVA 4MUVA 3L2YA 3WDUA 1VBA2 2JB4A 1I5PA 3DPRC 5FYVA 4TWTA 5AFBA 1CAWA 1CJDA 1PVC1 2VL4A 3FLRA 1CN1A 5FPZA 2IZWA 3OGRA 1MZ5A 2D6PA 3T3YA 5JXIA 2AZ5A 2DFCA 4AHWA 1AHSA 4D7YA 2DUQA 1NUKA 3ITQA 1FOD1 1PO21 3O0XA 2X10A 4OVEA 3RMXA 1E5IA 2NPIA 1DQ1A 4IETA 2HEWF 3SH3A 2DVGA 3T4HB 5J36A 5SV8A 1K5JA 3I3MA 5KHJA 1VBE2 3OD0A 5LZ6A 1LESA 1LHUA 3NV2A 4N43C 4OHYA 2YU1A 1K5MA 3J8F1 4DEQA 1S2BA 1ULOA 3WT3A 4Z8BA 5FDBA 5F6KA 3VL8A 2PMWB 1DGLA 1HQWA 4AVTA 4XHXA 2VY0A 3AM2A 3MIFA 5A7WA 2YFZA 4XBNA 1OPOA 1RMU2 3J7HA 4RS5B 2H6BA 5GZEA 1JZ4A 3ZN6B 4A6SA 4XDOA 1JZ2A 1N1VA 2XHKA 3LFIA 2HWD2 3ZFEB 4Y33A 1ODNA 2RS31 5DUVA 1RXGA 3B7MA 4OHVA 4CDXA 4PQQA 1DZRA 2R073 3ZMOA 4CPBD 1U5IA 2WNEA 3RZHA 3I2IA 5D1IA 3DPRA 3UJOA 1UQXA 2ZGSA 3N9NA 3PUSA 3BI3A 1JOBA 2XJUA 2YBSA 1UX6A 3BKZA 4HFSA 3QBQA 1IOAA 2LW8A 4R4XA 3W5NA 2ZGQA 1W2NA 4UBGA 3ZMNA 4M4RA 2Q8EA 1I9RA 1BJQA 2HLEA 3WDXA 1YYNA 1ULCA 1X8EA 3NNJA 2PHXA 3OUIA 4W4ZA 2JEMA 1VBD2 3Q8FA 5CVRA 1SFYA 4C1XA 2ZGOA 3WR0A 4UT5A 2X09A 5JZGC 1XYNA 1W2UA 3HQUA 1J58A 2Y0IA 4R8HA 4WM8B 5AC92 5JSRA 3T08A 4XIOA 1HRI3 4JGYA 3PL0A 4UW3A 3AKPA 4QHZA 3R4DB 1KRIA 2WYFA 1PNFA 2VOKA 2W08A 1K45A 2F4LA 4HK8A 5JMOA 1RUC1 1W39A 1PGL2 4ARYA 5EQUA 5FYMA 3WDWA 4C90A 4YW6A 1H8TB 2QZ3A 5LY1A 1OQ1A 2WJSA 2GH2A 2Q0AA 2YZ4A 3AL6A 1MZ6A 2YFUA 5A3NA 4DRVA 2FDIA 5HV0A 3I54A 3BOPA 3RYPA 3POGA 3EMRA 1Z7S2 2J1SA 2WIIB 3PURA 3K2OA 2C4XA 3MYXA 5F5QA 5FIXA 5I93A 1AJKA 3K4DA 4HANA 4OYUA 2Y6HA 4EROA 1PGW2 4Y22A 4BQXA 3GBWA 1OBNA 4AK3A 4V2VA 1X9TA 3BB6A 1JZ5A 5A7NA 1F4HA 3DKQA 4FPJA 2Q1FA 5A7SA 1AX0A 1NA1C 1WW5A 4ZU4A 4HKWA 3HT1A 2UURA 3PNAA 3WG1A 4W50A 3JXSA 3EBRA 4P9IA 4CDQB 2A3WA 4XDQA 3OGVA 4ASLA 3I3QA 1DG6A 3G7DA 3RZGA 1PIV3 4NIHA 3W58A 1WKYA 5LEKA 4XFFA 3TAYA 3VL9A 5LASA 4BQ5A 3ACIA 4RQPC 4Q27A 3ZO0B 5BNQA 5JOZA 5FYIA 4IE6A 2BNNA 2ZX3A 5JSOA 1NX9A 5K9YA 3FN9A 3KCCA 4I30A 3SH4A 4M3CE 1OH4A 1E5HA 1FNYA 1PNGA 3U4XA 1HB4A 2Z4FA 3MF6A 5CYYA 3RJ2X 4OUSA 2UU8A 3VD7A 1W3XA 3LKJA 5L73A 2RR12 5BNNC 1IKQA 1RTVA 3POEA 3RWNA 2HWB2 3I2GA 5JOYA 4LBQD 3RZJA 1RJ7A 4CEWC 4QU1A 1H2NA 3DKWA 4FXKB 2ZA9A 4YW4A 5A70A 2AC1A 1S0EA 4QT6A 5J98B 5ABJC 4GH4C 1NA1A 4NRMA 2RS53 2OQ7A 1A8DA 4XFHA 1WW6A 2XH6A 5L7OB 3IT8A 2OYZA 3FL7A 3U14A 2VW1A 2XWJB 1ENRA 3P6BA 3V0AB 4LKEA 2IC1A 5IHRA 1R1A1 4R9BA 4FOVA 2OUHA 2R30A 3T4VA 3TBDA 4GB32 3R6SA 1J1LA 1BCXA 3A21A 3CHXA 5C70A 1DZTA 2DFBA 2VTFA 2WN3A 3OUJA 5A6QA 4MGTA 2OQ6A 3WP5A 1XNBA 3CJIC 5FWJA 5HI0A 1GQPA 4DS0A 4FPGA 2XJPA 3DGTA 3ZYJB 5JOXA 1CAUA 3B94A 4MGZE 4BOWA 3I4IA 1SLBA 3AC0A 3WX5A 2WNOA 2MHFA 4LE4A 3Q8CA 3DYMA 4JGZB 2VZTA 3VBUC 5C71A 5E8AA 5B4XA 2ZEWA 4HOOA 1TMF1 1EV12 2VUAA 5IJRA 5BNNA 4XFAA 3RQ0A 1S55A 3HNYM 4CP9B 4MZUA 2QDNA 3E5XA 3IDAA 1ZBA1 4LBJA 5CG9A 1QH6A 1OSGA 4YW7A 2V5DA 3CDZB 1NKGA 3USSA 4FOQA 2ZGUA 3I3DA 3M4FA 4L2NA 4YVSA 5LA9A 1J3QA 3N9QA 2ARCA 3S7EA 3NAPB 2VOVA 5A7WB 4Y1UA 5ABJA 4KBBA 4YARA 4IQPA 4BPZA 1ZZ9A 2YXSA 3Q9OA 4IGQA 5CB7A 2RDNA 2E53A 4IEYA 2A6ZA 4CCOA 4LK6A 4BQYA 3ILRA 1RVF3 3ZSKA 1COV2 4BWOA 1XC6A 2VOXA 5ISLA 4CDXB 4Y5Z0 1O4TA 1W9SA 1HN1A 4AGVA 1UCXA 1EYBA 3K4AA 3OGSA 2FZ1A 2TEPA 4OMCA 2R042 4ZXEA 2QCSB 4QB1A 1OLRA 3CJIA 5CU1A 1X9PA 3GYDA 1SHWB 3IZOA 4HXCA 4FPHA 3KQRA 5IVJA 3K75B 1FMD3 5KXDA 4JHZA 4XPVA 1OA2A 4U2AA 1MS3A 1WLTA 3VBUA 2RDQA 3UKTA 4FQ4A 1ASJ1 3ZXAC 3J7LA 5F7UA 3LGRA 3USUA 5IW0A 4LA3A 4JRAA 3ZYBA 4B4QA 1HX6A 5IK5A 2W87A 1IPSA 1ZBE3 4MGYE 1O4YA 1UNBA 3GBFA 3S7IA 2CGPA 2WSUA 4LBLA 1HQNA 5I8YA 2PXJA 1KS5A 2D7FA 2GN7A 1OFNA 2QQIA 2YYOA 4LLOA 5FYTA 4JGYB 4BZ4A 1LHNA 3AMMA 3D8CA 3HT2A 3HEIA 1IG0A 1R1ZA 2EF6A 2WN2A 2Y0OA 1AR91 1UAIA 2WFF2 3ASIA 5KHIA 1R64A 5A3PA 1RUH2 4CPBA 4Y1VA 4AAPA 3KT7A 3WHTA 1L7QA 1UIKA 3MEPA 4E4ZA 5C8CC 4QX7A 4BA6A 2FDKA 3POWA 1QJX1 2XDVA 3MIDA 3NV3A 4KQ7A 2RS12 2P3IA 4CU6A 1HKDA 1YRZA 4PIYA 3H3LA 4M3CA 2BV4A 2FCTA 1M4WA 3VDDB 4H7LA 1PM7A 5FZCA 2WFPA 3E6DA 2FDFA 1HRV2 2ENRA 2UYAA 1R083 3BVCA 4NIGA 4XXAA 5FK7A 4Y22B 5FJHA 4KU7A 4Q5OA 2XG3A 3VB9A 2RMU2 5C4WC 5J09A 1L7LA 1TVGA 2V4AA 5JXHA 5JCTA 4EN6B 2VZVA 3PJQA 5A3MA 2Y6LA 1ZRIA 4Q4V2 4AFAA 4BQ3A 3SNMA 2GDFA 1XPWA 3H8UA 4LUKA 5FMCA 1C28A 2YC2A 3MLKA 2Q8DA 2D98A 1UY0A 1LCLA 1SCRA 3AMQA 1JW6A 3IAQA 3MO4A 3HVDA 3U37A 2CAUA 4IGPA 3N9OA 4XCBA 4ASMB 1YQ5A 4AI3A 2Z69A 5DZFA 1W6NB 4IEOA 3ZFFC 5FBZA 3H3ZA 1RUE3 1MS8A 2W46A 2D6KA 2WA4A 1EPZA 1YQ8A 4WV8A 4BB3A 1DQ6A 2WSVA 3HWJA 4GULA 4YGCA 5IUQA 5C8CA 2Y64A 5T5LA 4XFGA 1V00A 3GDBA 5EYXA 1O7FA 1AYM1 5FKCA 5FZDA 1JMUB 2XL7A 3FLPA 3LOBA 1GQHA 2ZHLA 3DUIA 4CCEA 5CA6A 3KMHA 1JUHA 2W1WA 3KVBA 3JBG3 1F5JA 1GNZA 3PUAA 5T5OA 2DBIA 3ES4A 1AL0G 5FRAA 1RINA 2W92A 4FXGB 5K0UB 1Q56A 3MIGA 1WA6X 1S0CA 1MQTC 4MO3M 4MSVA 2AR6A 5CG8A 2ARXA 2ERFA 4QPGC 4GWMA 1QOOA 5C4WA 5H9PA 4QB2A 4CDWA 1W6OB 3CBNA 2GC0A 1LR5A 1UXZA 3ZR6A 4PDWB 1YFYA 2BEOA 2SLIA 4EYUA 1OLQA 1RJ8A 2R16A 3WINE 3B9IA 4QGNA 5AVAA 1ZA7A 2O14A 2R061 3RFRA 4UWDA 1AR81 2EIGA
chains in the Genus database with same CATH topology
1FT9A 1SBEA 2C5DA 3ZXJA 3ZFFA 5GZGA 2H0BA 3WCSA 4Y24A 1YIPA 4FP3A 4KWKA 4FOYA 4RGGA 1X50A 3V65A 1CAUB 4HVOA 4NVPA 4CTEA 1X36A 4C1WA 1CJPA 1CVNA 3FC0A 3AP6A 5C33A 1AXZA 3FLTA 1HXS3 1O5UA 3D82A 4GWNA 4LBQA 5D8AC 2QFEA 1BEV3 1LJ7A 1PO11 2DUOA 2R072 4P9GA 1F2NA 3PHMA 5BNPC 4QPGA 1RUD1 4Y20A 4YVSB 4AEDC 3VBHC 3H7JA 1C5HA 1MS1A 2G4IA 5HXVA 1MEC2 1AR63 5GLWA 4HL0A 1FPN3 1QJY2 3WDYA 2ZTNA 1YLLA 1MS0A 1PVC3 1OI6A 2BFUL 4JDMA 1EAH2 4ATFA 4ZKTB 2AREA 4XXPA 3UKVA 2ET7A 4CRQA 2D97A 2HWF1 4GKYA 4HT1T 4JAAA 4DB5A 3JD72 4QGLA 1FOD3 1PMIA 5KHKA 1C8M1 3C2UA 3CL1A 3H1MA 2XL9A 4Z07A 3TRSB 4YZ5A 1EPWA 1O5LA 2MPFA 2GMMA 2VQ0A 4HKLA 5T5JA 2QZ2A 1BQPA 4LNVA 5D8AA 4L97A 1VRH1 5BUVA 2YMZA 2PA7A 2A6WA 5BNPA 2PLV3 2BGCA 2OZ6A 4RS5C 3FHIB 4JQRA 4YW2A 3MPBA 4JC1A 1R093 4HSLA 4AEDA 3VBHA 3RPQA 3ZFEC 3QLQA 5CADA 2WS91 2A70A 2B45X 1A78A 4Y1ZA 5FLJA 4AI8A 1IZ3A 4AEJA 1QXJA 4LT5A 3KCXA 3M3OA 5FAXA 3IBMA 1UD1A 1IS4A 4BHPA 1G9FA 2DU0A 4W6WA 4QQPA 5KHGA 1E57A 4FBFA 1NE4A 2VNRA 4XW3A 2ZZQA 1REFA 1IS6A 4XTMA 3T2TA 2UYBA 2UWCA 4ORFA 4E9KA 1YFXA 1JH5A 2Q1ZB 4E2GA 3AFGA 2ZZJA 4WVMB 1QQP3 4WM8C 5JSPA 5E1RA 4RS5A 3ZN6A 4X8PA 1YFUA 5GLZA 4AGRA 4OUMA 1DGWA 3ZFEA 1BVP1 4Q1RA 2YPJA 4WVVA 4YM2A 5JPNB 1N47A 1RHI1 1RUC3 4DZGA 3KD4A 4QPYA 1QKQA 1CAVB 1CD3G 1H8TC 4YLZA 2IXJA 4JVAA 2HJIA 3LAGA 2H0VA 2DYCA 4NWVA 1ULFA 1WA4A 2A75A 3I59A 3WW2A 2VECA 1F5FA 4GALA 3JUUA 1S0FA 4YVWB 1KD7A 1I6XA 1GNHA 1QJU1 5JIAA 4TYSA 3GHNA 4XJ8A 2Z5WA 2VPVA 1VBB1 4K20A 4JTOA 2HEVF 3NW4A 2PAMA 2BW8A 3ACLA 5AFEA 2P17A 4IERA 1PK6B 3E5QA 4CDWB 1NXD1 4CDQC 1BMV2 3UK9A 3ZX7A 2E7AA 3GNEA 4PF5A 5EJ3A 2ZGLA 3MW4A 4HVQA 2IFWA 1V9U2 3VZKA 4ITCA 4KNCA 3VZMA 1V6LA 1NZCA 5BNOA 5E16A 1JYIA 3AP9A 4WZCA 2R1BA 3APBA 4NHLA 2ZX1A 5JVVA 2ZGRA 1RUF1 3W59A 1UIJA 1ZVFA 1QF3A 2Q5TA 5KWRA 5FLIA 5FCCA 3ZSEA 2X29A 1VBA1 2GNDA 3HIFA 4IL7A 3SISA 4AXOA 5IT6A 4FTBA 3ZXLA 3B5LB 3FX3A 2PTMA 3VZNA 3VHOA 2A6VA 3B02A 3J9SA 3UL2A 3VKOA 4LBQB 4BLIA 2FZ2A 1VBE1 2O1QA 2FMDA 4CZSA 1WMEA 3ZYRA 4U36A 4AVSA 4YNIA 5L7OC 4CDQA 2AUYA 3VKNA 2QDRA 4LBKA 4O9EA 1R1A3 2HYKA 1RMU1 1D2SA 1GSLA 3L2HA 4YRDA 5CAZA 5BXXA 3JU9A 4AVAA 2D6OX 2HWD1 1DYPA 1S0GA 4AG4A 1ZBE2 2VW0A 4GKXA 3R4SA 4HSJA 5FO8B 5T50A 2O8QA 1O3SA 4JGZC 1TMF3 1VAKA 2UWAA 3D0SA 2K0GA 1XU1A 3EQEA 4S2HA 4R9CA 1ZBA3 3M3IA 1SFNA 1Q8QA 2B8MA 2YV8A 4LHNA 1AR71 1ULEA 5LEJA 1H8VA 3NAPC 4DMIA 3AZZA 4YZ3A 2XBO2 1VBD1 4Y26A 4WVZA 2R49A 5L7OA 3VHNA 3PLQA 1ZZ7A 1QY4A 2HWC1 2WT0A 5FREA 1AXKA 2A3XA 4JDNA 4GMP1 1R082 2Q30A 5AC91 1ENSA 1LULA 4CDXC 4AYUA 5CFDB 1OQDA 1MZFA 3AMHA 5A33B 3D0JA 4OULA 4XJZA 4AVCA 1UPSA 1PGL1 2ZAHA 4K1ZA 2VXRA 5I0SA 4JGZA 1TME1 1ASJ3 3NKTA 2ZGTA 4W6XA 3ZFGB 5FOBB 1Z7S1 3CLPA 2YC0A 4QPIB 1IKPA 1PGW1 4XBLA 4FTEA 1IPJA 4M0NA 1YJKA 3NAPA 3J4UH 5DUUA 5JDBA 4JGYC 2WL1A 1QOTA 2DCJA 2I74A 4IV1B 3WDVA 2QNKA 1UW8A 2P2KA 2XJSA 4RA0A 3RMYA 4P9YA 3I2DA 4AFMA 5CBLA 1V6IA 4XOGA 1QJX3 2B7YA 2ZX2A 3MPPG 1AL22 4XE9A 3O0WA 2D6LX 4HZFA 3VDDC 1Q8VA 1RC6A 3I59B 4Q4W2 2CL2A 2R6QA 4META 4K7JA 1VALA 4XJ9A 3W9AA 4LHLA 3GBGA 5AVPA 1Q3EA 3R4UA 2D3PA 1F8VA 1V6JA 1FXZA 1LEMA 1LU2A 3H3UA 5CNAA 3AMNA 5E89A 1UU6A 2A3YA 2AENA 3IM0A 1VLNA 1O3TA 1F31A 1ZYBA 2ZACA 1G8WA 3B9CA 3RS6A 4AI0A 4HETA 4YM1A 1TNFA 5GZDA 2X5IB 5C8WA 3GALA 4BM8A 1SMVA 5ACA2 2GALA 3M3CA 5CFCA 4NPRA 1HXS2 5BNOB 4K8FA 1GBGA 1U5ZA 1VBC2 2VNGA 1OMIA 2VQAA 1GZ9A 2ZMNA 2WLPA 2XJVA 2EXKA 5EV7A 2ZGMA 4HLTA 3EO6A 3VBFA 1ENQA 1NY72 3RG0A 3VDDA 3P3NA 4PCRA 4MXVA 1LOGA 1AR62 3VZOA 1IS3A 2PQQA 5K0UC 4H14A 3SITA 1FPN2 2GH8A 1WCKA 2IXLA 1O3RA 1EV11 3MFAA 2Q8OA 2FBEA 4GXLA 3FWEA 3SMHA 4PDWC 1O3QA 3B69A 1FOD2 3GZUC 3JCIA 5T54A 4HK9A 4BQ1A 4Q2FA 4COWA 2R063 1YXWA 1WLCA 4AGGA 4R4ZA 2BUKA 5FLHA 4AFBA 1W6NA 4YZ2A 1QHDA 2E7TA 4YW5A 4MV2A 3SCFA 3R0RA 2PLV2 4EV0A 1COV1 1ND3B 1TQ5A 3VHRA 1B09A 3S30A 3MDPA 2PHLA 1R092 4CDUB 2R041 2RM22 5FPXA 5J3UA 4PLMA 1PO13 5K0UA 1DQ2A 1N3PA 3RYRA 4UBHA 1LOEA 3LA7A 3JQXA 1H4HA 1HV0A 5DXDA 4AVVA 1RUI2 4YVSC 1W6OA 1NQDA 4P5HA 1J1TA 4PDWA 4YFZA 4LEJA 1DFQA 1ULDA 1RUJ2 1WW4A 2DWRA 1G9AA 2BVBA 3ZXFA 4I09A 2WQZC 1LOBA 1SCSA 1UF2C 1KJRA 5LRRA 4KWLA 3NKGA 2NN8A 3HQXA 2HWF3 5A32B 2WFF1 1C8M3 2QUOA 1AYN3 3AYDA 1QQP2 3IIAA 3LA3A 1RUH1 3SXWA 3DF0A 3KM5A 1U5XA 2WT2A 5T3NA 3UKNA 1MS5A 2XLFA 2RS11 1ND2B 4S2FA 2VU9A 2NQYA 3JZVA 1IPKA 3U0ZA 2XLGA 3MICA 4DPNA 2YUEA 1VRH3 1HRV1 4FPEA 2AYHA 5GLVA 2UWBA 1LOFC 4HVRA 4FPCA 4ZU5A 5JPMB 1DGRN 2QJVA 3THTA 2E9QA 3RZZA 2W39A 4Q0UA 2WS93 3ZSMA 3TN92 2DV9A 4FT8A 5KXCA 1HW5A 5C9AA 4Z1VA 4QQHA 2JG8B 3PVEA 1LKNA 1UU5A 4LO5B 3KB5A 4X6QB 3ALQA 1H9PA 1H9WA 3A0NA 1KFXL 4IEVA 1PVXA 2VULA 3WQ7A 2EXHA 3OCPA 4I0AA 4QQ2A 3ZN5A 2CV6A 4KH9A 3LA2A 5HCBA 2WZR1 4D7TA 3TYJA 4FVVA 2QVSB 4F8AA 4LBOA 2FQPA 4FPYA 1W6MB 1SBFA 4KG8A 1BZWA 1ZM1A 4Q4X3 5F6LB 2JE9A 2VH9A 1LOFA 4KU8A 5FTTC 4AHYA 1V6OA 1D4M1 3FBMA 4A7KA 4QQOA 2H6CA 2CTVA 1VAMA 5KC5A 1C57A 1PZ9A 5CFCB 2NLRA 1IGOA 4Q0QA 1XNKA 4Q4Y1 2UY9A 1QXRA 1PHMA 3NO8A 1ZA4A 2JG9B 4M00A 3WLUA 3ZYIB 1QNYA 3BOWA 1LHOA 4YVWC 3VBFB 4WBBA 4GMP0 5FFOC 1QJU3 3ECQA 1R1A2 2BBVA 1D4VB 3RNSA 3WP3A 2ZAAA 1VBB3 1DF0A 3IDEA 3IWZA 4D7SA 4AQ2A 5KHHA 5EZWA 3O7OA 1CPMA 1PK6C 4CDWC 4WVMA 4N53A 4LR4A 3LZZA 2XJTA 3B01A 4M0HA 1FYUA 2R071 2EAAA 2W68A 5GZCA 2A7AA 3AB0A 4M01A 5I8SA 2MEV2 3RDIA 3WP6A 2VVEA 5FOJB 4B4PA 1RUF3 1H1AA 1CAVA 1F9KA 2K9ZA 4AW7A 1MEC1 4JRLA 2D6MA 1LODA 1WMDA 4Q26A 5SV5A 3A4UA 5BV6A 4BIOA 1QJY1 2BWCA 2XKPA 5IK7A 4XFBA 3T1MA 1DYKA 2V09A 3HAGA 3KGZA 1EAH1 4BYYA 1Q8SA 1TE1B 4YVWA 1BBT3 3NJZA 3AYCA 1JYCA 3JB8A 2XGXA 2PAEA 2VNOA 3JD71 1UZZA 1YWKA 4GA9A 5JZGB 3WVJA 2YGLA 5J48A 1QOSA 4BE3A 1VBE3 2DU1A 3BODA 1V6MA 5FMOL 1YHFA 1VAVA 3VBSB 1FATA 3IDCB 1QDCA 1PK6A 2ET1A 1CPNA 4CEYB 3WG4A 2P3KA 5EXOA 3INAA 4NN0A 2D40A 1RMU3 1PZ7A 5L36A 1ZRFA 3H50A 3BTAA 4RSUA 4SLIA 3MI8A 4W65A 1YNAA 4YGEA 2EVXA 2HWD3 3ZXKA 4CP0A 1AX1A 2D5FA 4FPLA 1YI7A 4FQZA 4J1XA 4IEZA 1IHMA 3M2MA 2BQPA 3HN1A 1NCQB 4IEUA 4EWDA 3RI8A 2HWE1 3M1HA 1HIXA 1RUOA 1YJLA 4JCKA 1WLWA 2DVAA 4PQ9A 1SBDA 1YO8A 4HPKB 1BKZA 1CR7A 2YHJA 4NHKA 4INDA 4AI1A 4BIFA 2ZX0A 4E2SA 4Y1YA 3N4MA 2A5ZA 1AR73 5CIRA 3CNAA 4OZXA 4TSVA 3B00A 2HWC3 1OOPA 2UY8A 2QKDA 3HR9A 2ZS6B 4GMP3 1SQ4A 4PIXA 2NM1A 3KT4A 3D6EA 5C9AB 4IEWA 5CFDC 2ZPXA 3FFQA 1ZRRA 4OI1A 4LLFA 2ZGPA 3ES1A 2ZABA 1I5ZA 4H7MA 2X8KA 1C5IA 2VMHA 3CF6E 4PBOA 1PO23 3OYWA 4P9LA 1TME3 4D3WA 2PHDA 1V70A 4P9XA 4PLOA 4F83A 2R0FA 1HRI2 3ETQA 1HDKA 1POV0 3ZFGC 3JB4C 1Z7S3 2WQ4A 5TSWA 2A6XA 1OKQA 2MNGA 3J8F3 4L9BA 1U12A 4QPIC 1D0HA 3NV4A 4YG3A 3ZSLA 4XMIA 3VLBB 4MVTA 4DXZA 3N35A 3KLSA 2WC2A 4IV1C 1XXNA 4E27A 2Y26A 4EN7B 1G7YA 1BMV1 4RHV1 2RS33 1OA4A 3VKMA 4LBMA 3FE5A 3VBRB 3ZDSA 1TNRA 2I07B 5CFDA 5J7MA 1V9U1 2Y38A 5A33A 4DRRA 1RUG1 3WDTA 3THPA 4COYA 4PJYA 4FPFA 5JI9A 1L3JA 2W0XA 4MX3A 1GZWB 1LHVA 2DCKA 4LTAA 3U11A 3ZXGA 2XWBB 1DLLA 2IXKA 4C0HA 2LTNA 2RJKA 1PIV2 3ZFGA 2Z42A 2G9GA 1Q43A 3BU7A 1CAXB 5BPXA 2CWSA 2Z2SB 4FPOB 4QPIA 3PVNA 3N7LA 4NHMA 4EN8B 4N53B 4K9SA 2X5IC 5A3LA 1ZNPA 4XZPA 4IV1A 4COVA 4IV3B 1U0AA 5BNOC 1XYOA 4A7YA 3J26N 4R9AA 1Q5OA 4BCUA 3IKWA 2OIIA 3NWKA 5FMOS 1H1MA 1ONAA 4IXLA 5BYNA 1DZQA 2GC3A 1FX5A 1KQRA 4BMEA 1G9DA 2ZX4A 1B35B 4ISQA 2RS52 4KL1A 3OF1A 1BYHA 2C0ZA 1ZBE1 1YIFA 2XLAA 3AJZA 3AJYA 5EWSA 3VKLA 2CGNA 4XFIA 1KDKA 4Y4YA 3ZXEA 1S0DA 2IXIA 1I3HA 4XILA 4D94A 1XYPA 1ZREA 4XHBA 4HN1A 1EV13 5F9TA 4Q0VA 2EXJA 4WZFA 5DDJ1 1TEIA 1T6GC 1MZEA 1C8M2 1AYN2 3KT1A 4FOWA 2XKOA 4G3YC 2PAKA 1UKRA 3OGJA 2X5IA 3E97A 2ZGKA 3V56A 1KJLA 4YYOA 4E4DX 2XBO1 2D5HA 1GV9A 1XE8A 3POYA 4X8NA 1VR3A 1NLRA 4WM7B 1M06G 4H3WA 4IEXA 1COV3 1ND3C 4I3PA 4QMAA 3SH5A 3E6BA 1LGBA 4AQTA 1D2QA 3PTYA 1W6PB 2D93A 1H30A 2TUNA 3H1WA 4O9GA 3VHPA 4CDUC 2R043 4XF4A 1GLHA 3OBTA 3KSCA 1J59A 5IK4A 1NE6A 2GZWA 4FP2A 4EN9B 1QH7A 1DU3D 1U5YA 3EJKA 1LEDA 1RIRA 2JX9A 1RVF2 2TNFA 4C0BA 1WUVA 3G6JB 4K3UA 3FFZA 2CAVA 3AKRA 1DIWA 2BPA2 2BFUS 4A7ZA 5T5PA 1NG0A 1QNWA 3AP5A 2F6BA 1YFWA 2GSYA 2BWAA 2YROA 1OOPB 3R05A 5H9QA 1FMD2 4OI4A 4XMAA 1FNZA 1GYKA 4XF3A 5J96B 4QHBA 3M7AA 2XB6C 2D3SA 3N3HA 3AKSA 4R9DA 2WFF3 2GNTA 1X8MA 3V0BA 1RUH3 4Q4X2 5FO9B 1ND3A 1JXNA 1H2MA 4XQWA 2RS13 3ZIXA 1ND2C 3TOJA 4CDUA 1ZZ6A 1AL21 3OYWB 3KCYA 1N1SA 4IESA 4RD7A 1ZRCA 3M3EA 4Q4W1 3ZYGA 5L19A 3OGGA 3TNPB 1HRV3 2ES3A 2JENA 4TLFA 2DVBA 1RITA 5DG2A 1A6CA 5FQ0B 3E6CC 5LK5A 5GALA 4P9JA 1KDMA 3ENRA 1YI9A 1FV2A 1Y9QA 2VMGA 3GZTB 4N9HA 3A0KA 1GKBA 1UU4A 3FJSA 1QJU2 2TBVA 2AH2A 2JG8C 3WP4A 4XQDA 2EA7A 1FI2A 4J6GA 5A32A 5ACA1 2O8OA 4KG0A 3D5OA 1HXS1 3WW3A 4LULA 3AMPA 3ZXDA 3URFA 1VBC1 2LM3A 1C8NA 1BVVA 2WZR3 4K6BA 1ND2A 1MACA 1CQ9A 1NY71 3POSA 4HN0A 4N7UA 3U10A 2P37A 1RUF2 1ZZ8A 1AR61 1PZ8A 1RUE2 1AX2A 1FPN1 5I0UA 1DQ5A 2VGDA 1VIWB 5I8TA 4LUMA 2WNVA 3ILFA 1D4M3 2IWGB 4PIZA 1BBT2 2ZKNA 3AX4A 3OTFA 3QACA 3SCHA 4BLJA 4AE2A 1Q8PA 1BXHA 2N7GA 4RR3B 5CFCC 1AR93 1EP0A 2JG8A 3JBG2 1NQJA 4Q4Y3 3HBZA 1HV1A 2JE7A 2PELA 4B7EA 2R32A 4Z2WA 1LOCA 1YCIA 1C4RA 1MR5A 2DCZA 2JG9C 1LB2A 2PHRA 4I3GA 1Y3TA 3VBFC 2VVDA 4QXKA 5I0TA 1EY2A 2VOWA 3IPVB 2PLV1 3OPZA 5LRSA 2XVGA 4LHKA 1R091 1W6MA 4UW4A 1CX4A 2RM21 4F3JA 1XE7A 3I7DA 2RR11 3WQ0A 1OD5A 2WLQA 3PVBB 1A3KA 1JHNA 2HWB1 2R0HA 1IS5A 4S2DA 3AZXA 1RUI1 1APNA 3RRDA 2B9UA 3ELNA 5GKAC 1PGSA 3HD8B 1MEC3 1AJOA 1DQ0A 1JUIA 1DHKB 1BEV2 1JBCA 1RUJ1 1SACA 4FPKA 5JOWA 1QXPA 1QJY3 1AR72 1AUYA 2JG9A 4N43A 1MVEA 1NLSA 3VUOA 3MIBA 1EAH3 1AYM3 2JD4A 2HWC2 4GB31 2XVKA 3JD73 4DQAA 3OJBA 4DY5A 2NZ9A 4AFCA 1QQP1 2WNUB 2B39A 4WVWA 1G9BA 4YZ1A 4EWEA 2V5YA 4J1WA 5I91A 3PVOA 3VBSC 1PVC2 3EXUA 3LSDA 2Z79A 2R1DA 1MS9A 4CEYC 4G4FA 4ES9A 1JN2P 1PO22 1O4ZA 4Q0PA 1TME2 2WWSA 3O14A 3AK0A 1SLIA 4NWWA 1V6KA 5JIUA 1AR83 2VG9A 2FHRA 3J8F2 4I01A 3TN91 4B8EA 1POV1 3KGLA 3LB9A 2GU9A 1C1FA 3V0BB 1NCQC 4R52A 5GLTA 1OFSA 4KGQA 2HWE3 2V73A 2NYYA 5JR7B 4AVBA 1LENA 4YGDA 1AZDA 2HEYF 4YFWA 2BNMA 4P14A 5JZGA 3SCGA 3FUOA 2RS32 3JQWA 4QU2A 1GR3A 3ZYPA 1QMJA 3BALA 4XYXA 2ZJCA 3H0OA 3VBSA 2CY6A 3VZLA 4L92A 2RE9A 1RUD3 1UPIA 2ZBJA 4EWAA 3UJQA 3K51A 4K40A 2PHTA 4CEYA 2WT1A 1RB8G 3KS7A 2BNOA 5C9AC 4SBVA 3QOPA 1LTEA 1IQAA 2ILMA 1NYWA 4QGMA 4MGKE 4OI2A 2X53S 1NCRB 3VBOB 1CONA 3PMSA 2XJQA 1URXA 4CYDA 2JXAA 2NP0A 4AFDA 2OA2A 1W6QB 4MXWB 4KGGA 3DV8A 2GMPA 4Q0SA 1WW7A 2ZHNA 4EJRA 1Y7BA 1NCQA 1REEA 4NR1A 3WNXA 2ARBA 1QU0A 4HPKA 4LBNA 3TB0A 2I45A 3MW2A 2IXHA 1RUC2 4OHXA 4K21A 2PHUA 1DGWX 1WBFA 3CU7A 2LALA 4OLLA 1RUNA 1H2LA 2RJLA 5JI7A 4OHZA 1MS4A 3AKTA 1DBNA 1UN1A 2JICA 2JKBA 4RQPA 3ZVXA 2CYFA 1CAWB 2WNVB 1LGCA 1KS4A 2RMU1 2YY1A 1SLCA 2OPKA 5KXBA 4AQ6A 4RHV3 4L11A 4ES8A 1NOVA 3VBRC 1WMFA 4Q4V1 2E6VA 5KC6A 1V9U3 1LRHA 1RUG3 4X6RB 2MEV1 3AFKA 4L99A 3RSJA 4B3NA 2ATFA 4LE3A 3B3QE 4Z92B 2WKKA 2DCYA 4XJAA 1K5MB 4S2GA 4CEWA 4UW5A 1W0PA 4NOTA 4AEKA 1Z0HA 3QH7A 1S2KA 4GH4A 3ZPYA 2KM2A 4V1PA 5DZEA 3VN4A 2PHWA 4K1YA 4AEMA 3WUCA 4FAHA 3LOIA 2D3RA 5T52A 2A73B 2VW2A 4N53C 1YUDA 2WA3A 1DDLA 4F7ZA 1ENXA 3DPRB 4IV3C 1GZCA 4W6YA 2B5HA 3WG3A 2I2SA 4AI2A 5JLVA 2RHPA 1WCSA 1RHI3 2SBAA 3IMNA 2WZPP 4IEQA 1OQEA 3VBRA 4XF0A 1H4GA 4XIKA 3O0VA 2ZMLA 3ROUA 1UZYA 1LECA 1H2KA 2D43A 3AZYA 2E51A 1B35C 4N43B 1HQLA 1GZWA 3AP4A 4P9WA 2XPJA 4E4SA 1QGLA 2GNMA 5B2GB 4GIQA 3WOGA 2EALA 4QQLA 4B4RA 5DDJ3 2HKXA 4DOUA 1CAXA 2NMNA 4AHZA 3BCWA 1KFUL 1WBLA 1BK1A 3C3VA 1ZZCA 2JDZA 3MGUA 2WINB 3CEWA 4FSJA 1J3RA 2OW4A 1ALYA 4XF9A 4IV3A 2XBO3 3TWIA 5JMCA 3M8LA 1TMF2 1N3QA 5F1RA 1O91A 2DCTA 4UXAA 3EHKA 1ZBA2 5GZFA 3QD6A 4WM7C 2QQPA 1G86A 3KZ4C 4LA2A 2A6YA 2ZKLA 3N7JA 4Q29A 2ZGNA 4YGBA 1VBA3 4FTSA 1B35A 4MGIE 4BMBA 3WQ1A 3VGIA 5GJ6A 4PBPA 5EFUA 4ATEA 3IDBB 3BIWE 1N1TA 2O0OA 3WG2A 4I0BA 3AXDA 5GM0A 2GAUA 2JJ6A 1HRI1 4YZ4A 5K7PA 3AYEA 4L8QA 4N9IA 4XBQA 1RL3A 5KBFA 1C1LA 1FAYA 1WCDJ 3X29B 2PHFA 1HLCA 3FBYA 1JOJA 1OOPC 2WZR2 4MYEA 1A8MA 1X33A 4YW1A 4MH0E 2VMIA 4COUA 1ASJ2 3QH6A 2GN3A 3N7MA 3K48A 4LO4B 4B7KA 2YDEA 5DZGA 1WD4A 4BH9A 4WM7A 2VUJA 1AF9A 1OHFA 1W6PA 1UKGA 1S1AA 1AL23 1D4M2 1REDA 2ZHKA 1XU2A 4M3CF 1FV3A 3WXPA 2VVFA 2ZHMA 4N90A 2FMYA 1XNCA 3E5UA 3LSEA 4Z82A 3VKFC 3VV1A 1NA1B 5LK7B 4Q4W3 1AR92 2BTVC 3O5SA 4Q4Y2 4QM8A 1KXGA 1N1YA 3NVCA 2DTWA 2GC1A 3ZIWA 1QJX2 4N7IA 4C91A 4QM9A 1PIV1 2DTYA 4I0WB 3WW4A 1VBD3 1ZRDA 3AZWA 5HCFA 4IEPA 4HMZA 4RQPB 1GANA 3RYKA 3OBRA 3WCRA 1GQGA 3ME2A 1G6NA 2Q4SA 4A3XA 2XUMA 5AC93 1Z78A 2GC2A 3LWCA 4XEZA 3WUDA 5GLUA 3MZHA 5ACA3 5DUXA 1SLAA 3AXEA 3TNQA 5BNNB 3MLJA 4LO8A 2GMEA 5I0RA 1VBC3 1MQTA 1SLTA 2PN5A 3OY8A 4COZA 4CEWB 2XVLA 3NSTA 5HBAA 4YG0A 2DVFA 3ATGA 1GICA 5ABJB 4GH4B 2C1FA 2RS51 4AHXA 5KXEA 4TZDA 2D44A 4FAGA 5EYYA 5FO7B 3PJYA 3AKQA 3QCWA 5FQ0A 3WY6A 2E7QA 1AYM2 4A2UA 4RR3C 1AYN1 5H9SA 3WHUA 3FZ3A 3CJIB 4LO7A 5T55A 3L9JT 1D0GA 1ZX5A 3VBUB 2BYVE 5C6CA 1WLDA 4YM3A 1AVBA 3USUB 2OZJA 1S0JA 3GZAA 1OPMA 3CO2A 4FO9A 3GF6A 2C9AA 3D4KA 3H7YA 4CP2A 1UL9A 2R062 2RM23 1AR82 3AP7A 2RR13 3DN7A 3MIHA 3UV9A 2P3JA 2HWB3 4XFCA 2CWMA 4KWJA 1RVF1 1QJZA 2HWE2 1RUI3 2BVVA 1ZZBA 2LUWA 4M3CB 4UW6A 4RR3A 4ISRA 2B46X 2GNBA 3ST7A 1RUJ3 1H0BA 2ZMKA 1PO12 1DQ4A 2KXLA 1FMD1 1RUD2 4XJWA