4JZRA

Structure of prolyl hydroxylase domain-containing protein (phd) with inhibitors
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
211
structure length
204
Chain Sequence
PALKLALEYIVPCMNKHGICVVDDFLGKETGQQIGDEVRALHDTGKFTDGQLVSDIRGDKITWIEGKEPGCETIGLLMSSMDDLIRHCNGKLGSYKINGRTKAMVACYPGNGTGYVRHVDNPNGDGRCVTCIYYLNKDWDAKVSGGILRIFPEGKAQFADIEPKFDRLLFFWSDRRNPHEVQPAYATRYAITVWYFDADERARA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Egl nine homolog 1
publication title Novel complex crystal structure of prolyl hydroxylase domain-containing protein 2 (PHD2): 2,8-Diazaspiro[4.5]decan-1-ones as potent, orally bioavailable PHD2 inhibitors
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 59
structure length 204
sequence length 211
ec nomenclature ec 1.14.11.29: Hypoxia-inducible factor-proline dioxygenase.
pdb deposition date 2013-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13640 2OG-FeII_Oxy_3 2OG-Fe(II) oxygenase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.620 Mainly Beta Sandwich Jelly Rolls q2cbj1_9rhob like domain 4jzrA00
2RDRA 5LB6A 4NHXA 3OUHA 4NHYA 5LBBA 3OUIA 5C5TA 4Q5OA 4Y5TA 3DKQA 5DAVA 4NHKA 5HV4A 3W21A 2HBUA 3NNJA 4BQXA 2FCTA 5LBEA 5HV0A 5LBCA 2RDSA 5IAXA 5EQUA 4XC9A 3W20A 4BQWA 3KT4A 5LASA 3HQUA 5DAPA 2A1XA 2FCVA 4ZONA 4XAAA 4MHRA 4J25A 3GZEA 3MGUA 2OPWA 2FCUA 4XCAA 4UWDA 2RG4A 5IATA 4XACA 3OUJA 3HQRA 3KT1A 3NNLA 4BQYA 5EP9A 5DAWA 5DAQA 5LATA 2RDNA 5ERLA 3NNMA 5IAVA 4NAOA 2G19A 4NHLA 3KT7A 3GJBA 4IW3A 5LBFA 2HBTA 5DAXA 4XCBA 2JIGA 5A3UA 5M0TA 4ZPIA 2JIJA 5EPAA 4Y5SA 5L9BA 2Y33A 4KBZA 3BVCA 4MHUA 3ITQA 2G1MA 2RDQA 4NHMA 4NMIA 3OBZA 3EMRA 5L9RA 2Y34A 4JZRA 5L9VA 3NNFA 3GJAA 4XABA 5C5UA 2V4AA 3PL0A 5LA9A
chains in the Genus database with same CATH superfamily
3ZKUA 2VOXA 3OBRA 4FPFA 4IEWA 3PTRB 2DBNA 2EAKA 1I5PA 4XUTA 4WM8A 1ASJ3 4NR1A 1XYPA 2E53A 4YG3A 2P2KA 3VBHC 1ZRCA 1LGNA 1NA1B 2ZBJA 3VD3A 3ACLA 2CGNA 4HG6B 3VV1A 4D7TA 4GIQA 5AVPA 3MYXA 5FLJA 1DYKA 2Y6LA 3HOBA 3IMNA 4JDNA 2RS52 5HCBA 4GMP0 4AEMA 1CPNA 3H3ZA 4XC9A 4QWNA 1N47A 3EXUA 2HH9A 4HVRA 1UIKA 3NV3A 2XBO3 3AMQA 5F37A 5SV8A 3HWJA 4M0NA 3HNYM 4D6RA 2HEYF 4A45A 1PMIA 1JUHA 2VR4A 1W04A 1EYBA 1Z7S3 2ZX1A 5EWSA 3NQHA 1KDMA 3FC0A 2Q8OA 2IXJA 2WS92 5G05L 5DUUA 1Y9QA 4O7XA 3ZFFB 4WBBA 2X05A 1S0FA 2HKXA 2XXZA 3X29B 3ZYFA 4IGQA 1HB1A 4MG2A 5FMOS 3RFRA 1IS5A 2VTXA 3WQ1A 2UY9A 5LK5A 4ASMB 1RUJ1 2FDGA 1DDLA 5FAXA 4RS5A 4LKFA 1O5UA 5IK8A 1KRIA 3BKZA 2ZEYA 2G9GA 2HWE2 4KWJA 3POSA 3OGVA 3ZFEC 3I49A 1UIJA 5DAWA 5DAQA 1SPPB 4EV0A 4OI1A 1H8TB 4L99A 1IG0A 3OPZA 1FI2A 2AREA 4F83A 1DIWA 1ULDA 1UZWA 4COWA 5KHGA 4R9AA 1LOAA 2VMDA 3NAPC 1RUE3 1OT5A 1W9FA 2ZPXA 2DU0A 5JIAA 2VU9A 3WF3A 3AL6A 5JDBA 3D6EA 1S1AA 4QXHA 3LSDA 3VBSA 3MDPA 2G19A 3ZPYA 4IEYA 1NCRB 1RMU1 2D5HA 2VECA 4AAPA 4V1PA 2RJ2A 2HWF1 1REFA 4M3CE 5CFDB 2RR12 3CLPA 3Q8FA 5DAXA 1XC6A 1ODNA 1K5MA 1KS4A 1QQP1 4J1XA 3T1LA 2XLFA 2VTXJ 5F2WA 2OVUA 4YZ5A 5C4WB 4PBOA 4MXWA 4AI1A 4FPKA 2Y6KA 3ZVXA 3WR0A 1O7FA 1JHJA 1TME1 1UMIA 3HQXA 3L9JT 5CEHA 4L0PA 3J8F3 4B1MA 4XETA 2JG8A 3WEZA 3PJYA 4Q4V2 4LBQD 4KWLA 2JJ6A 4RSUA 2R072 4JGZC 1SMVA 4E8CA 4BK5A 5F3EA 5JCTA 3VDAA 3AKSA 4BIOA 4QM9A 1OLME 1C3HA 3OBZA 5CIRA 4CDQC 2BGOA 3MIFA 3MW3A 1FOD3 4N8MA 2KM2A 3T1MA 2NPIA 3Q9OA 4N90A 4AQ6A 4TSVA 4LHNA 4EROA 1BEV2 2NM1A 1B35B 4CCNA 2BOIA 2ATFA 3O1TA 3I2IA 1UF2C 4Q4V1 2GAUA 5JZGC 2I2SA 2X29A 3I97A 4H7LA 1QJY3 3GM8A 2QQIA 1ALYA 1UZYA 4QGMA 4PQQA 3I3DA 4XZUG 4QPGC 3U75A 4CEYA 3WW2A 3H8XA 3M3IA 4IEVA 1ZA7A 3IAPA 4UFJA 2CAVA 1GKBA 1ST8A 4SLIA 2QDNA 3AP4A 1JYXA 4IEOA 4P9IA 3UV9A 2QNKA 3KV5A 5FYUA 3VBOB 2X5IB 4XUNA 2Q8CA 5A1FA 5B4NA 5HCHA 5T3NA 2YYOA 4D94A 4FQ4A 4ZU4A 2D44A 1YQ5A 4LKEA 1GOGA 1NA1A 3MPPG 5DMYA 2WUHA 2PAMA 4XFCA 1MS9A 1N3OA 1GOFA 1F15A 4BQ4A 3HQUA 5FPXA 5DAPA 1YJKA 3MIGA 1DQ2A 5C3OA 4COUA 3LB9A 2OPKA 1XNTA 3I3BA 3MLJA 1AYN2 1EAH2 2QQJA 5ACA2 3T2TA 4IESA 5EJ1B 4QX3A 4M3CB 4I3GA 3ZOIA 3ZN4A 4NWVA 5CKQA 2TUNA 2D98A 4J25A 1RUOA 1BMV2 3HNBM 1FV2A 1PO13 4NE9A 1HQLA 3MW2A 2FMDA 2A7AA 4JKMA 4Q4X1 1K12A 3B3QE 2YPDA 4P9JA 3ZFFA 5FZGA 1DLLA 1TG7A 1QDOA 1XB9A 5ACA1 3PUHA 4JVAA 1YQ2A 3WP3A 5FOJB 5EP9A 1CAXB 3AYEA 3K48A 1E57A 3N9LA 1PVC3 1D4M2 5LATA 3T30A 3KM5A 5F5IA 4Z2AA 5HXVA 4ZZ8A 3AVSA 3VD9A 4Z07A 1MS0A 5ABJB 3DECA 2CHHA 2JD4A 3LDBA 1JYCA 1F2NA 3NNMA 1MZ6A 2YGMA 1XE7A 5JUVA 4FO9A 3TEYA 3M3CA 1SPPA 4QPYA 3AP6A 1FYUA 2WWSA 2VCBA 2ZGNA 4Q4W1 1PHMA 4MGZE 4Q4Y3 2IFWA 4OCTA 1H4HA 1GWLA 3O0XA 4P08A 4C0HA 4YGDA 4URTA 4LA3A 2P3KA 5BY5A 1IKQA 1MVQA 2RS53 5SV5A 2JDNA 4WM7B 4GH4C 1QOTA 3CF6E 5L7OB 1JYIA 2EF6A 3R4DB 3VDCA 1NCRA 3ATGA 5FJHA 2ZAHA 1ZRFA 3EO6A 2VZOA 5FPLA 1CVNA 5JOWA 5CFDA 2VMHA 1UYXA 4Y5SA 1WD3A 4I09A 3KF5A 1J3PA 2GH8A 5CVRA 1ZRRA 5L9BA 3HD8B 1HRV1 5C4WA 4BCUA 1W9TA 2WS93 1AZDA 2A6XA 4NMIA 5CKNA 4JCKA 4LBLA 2E7AA 1YYNA 4BISA 2NQYA 3WDUA 1NE4A 5J7MA 2W08A 2CV6A 4JRLA 1AR92 5FZ0A 2GDFA 1RUC2 2A70A 3MI8A 2Q1ZB 1UKRA 5J37A 1SLAA 2RM23 1VRBA 4WM8C 1JMUB 4YVWB 3VKFC 5FKCA 1LU1A 2EXJA 3TEZA 3PL0A 1ZBE1 2W46A 3DPRB 4W65A 2HWE3 1DYPA 2VC9A 2WT1A 5A32B 2Q8DA 3WQ0A 3GHNA 5AFBA 3LA7A 5B4XA 2AEZA 4D0QA 4CRQA 2HEWF 2VBBA 4PF1A 4WVZA 4U2AA 2YB7A 2FHRA 4CYDA 1B35A 2VOKA 4FPOB 5A1AA 1Q8QA 4Q0SA 4OHYA 4ATEA 3E6DA 3TN91 2HBUA 2B8MA 1EV11 1PIV2 3ZXLA 1PM4A 2AGSA 5BNOA 3ZR6A 2BDRA 4FI9A 2WZ8A 4AEDA 4HPKB 4QPWA 4X6QB 3MV01 2JXAA 2MPFA 4TN7A 4UFMA 2RDSA 5IAXA 4LBQB 5C8CC 2RR13 3KV4A 2W3JA 2WC2A 3WINE 2BVBA 2LROA 2QZ2A 2ZX4A 1AX2A 1PO22 1Q5OA 3C8XA 4Z8BA 3ZIXA 2RS31 2IXIA 4HOOA 2BU9A 4B4QA 4YM1A 3HT1A 2I45A 3O1UA 5IFPA 5GJ6A 3AJZA 3VBHB 4HONA 3E1F1 1H9PA 4XJAA 2IUWA 5JPMB 3O1OA 1EP0A 3ZSEA 4RQPB 1CJDA 2WFF2 1S0BA 3M70A 1J1TA 2A3WA 3GZEA 1S0DA 4HXCA 3NKTA 4RS5C 4XQ4A 1OLQA 1NCQC 2OQ6A 1PX3A 3WHTA 4A7KA 1URXA 3VHPA 1VP6A 2JE8A 1SLBA 2VM9A 3HMYA 5FQ0B 1AR81 2VZ1A 1EUTA 1CESA 4M3CA 5LCWL 2VCCA 4NIIA 3WDXA 4COYA 1WCQA 2MHFA 1JZ6A 4LBOA 1BEV3 3U14A 3CDZB 3UK9A 3I2OA 4B7KA 1CJPA 1SLTA 5D1IA 5A7PA 4LO8A 4Q27A 5KC5A 3SKVA 3VBSC 1UY1A 2PN5A 3NW4A 4YFWA 3OCPA 5C70A 3K75B 3OY8B 4OI4A 1CZSA 2C4XA 2FDFA 4CP9B 4J1WA 4P9YA 2DTWA 4D69A 1W05A 4UFHA 1K5MC 1TMF2 5L73A 5A6QA 5BNQA 3AKTA 4NHLA 2XUEA 2DVGA 2G9ZA 2ZX2A 2VQAA 4Q1PA 1OLMA 5A3LA 5F7UA 2Y38A 1FNYA 3A23A 5IUQA 5ABJA 1WCDJ 1UWWA 3BU7A 5DG2A 2QQOA 3ZFEB 5FRAA 5IVJA 2AC1A 1H6XA 3HAGA 3QCWA 2JG8C 1KEXA 1NG0A 1MS1A 3B7MA 4DEVA 2D6PA 5EPAA 4QKDA 1L3JA 1LOGA 4DQAA 1TMF1 5B2GB 3NAPB 4KL1A 5FIXA 4LORA 2VTFA 1HJFA 4WM7A 5T5LA 1YEWA 2OQ7A 4XJ8A 1AYN3 1EAH3 1VBC2 5L7OA 3N36A 2Y60A 2P3IA 1I1EA 1PGSA 1SACA 1RVF1 3ITQA 3OEAA 2GN3A 1RUH1 3DL3A 3UJQA 1I6XA 5HXMA 1AL22 2PHXA 2P5BA 4UT5A 5KBFA 5GZCA 1VRH1 2VBPA 1S0GA 1AXZA 2MEV2 2DCTA 5APAA 3J7MA 3HT2A 4AOCA 4URAA 3ME2A 3V0AA 3AZWA 1X8MA 4NUBA 4UF0B 5FXXA 4EN0A 1V6KA 3D82A 3VL8A 3WF1A 4CEYC 4IUGA 1X33A 1JW6A 1XQNA 2VOTA 1VR3A 1BBT2 1LENA 1OF4A 1PVXA 3OPTA 3L2HA 5E1RA 4N7UA 2KD7A 4EJRA 3V0BA 4QD2A 5T5JA 2K46A 5C33A 1RUG2 1S2BA 3IWZA 4QPIA 1D4M3 1XYNA 3NRUA 5LBBA 1AL21 2VXRA 3T2QA 4IERA 1XNAA 2WA3A 1GP5A 1RHI1 4JGZB 4YVWA 2MEV1 2D6LX 3DPRA 5A32A 3SEEA 1PMHX 1QOOA 4GWIA 3P6BA 4CDQB 1NA1C 3EB7A 3VDBA 2R042 4L8QA 1F4AA 5CZKA 5KHIA 3GCXA 1BHGA 4Y1ZA 4YRDA 4ES8A 2B46X 3H8UA 2XMLA 1RUG1 1D2QA 1R64A 2XHNA 5F3IA 1WLTA 2ZKNA 1ZZ8A 4LBMA 2XVLA 4FBFA 5JZGB 3AP7A 3IKWA 4EE2A 3U0ZA 1OA3A 4AHWA 4QB6A 2YU2A 1COV2 1YLLA 1J84A 4YARA 4LBQA 4ZXEA 2CU5A 2D7FA 4ZONA 1W8OA 1RUD1 3KD4A 3POEA 1QJU2 2ZAAA 3BODA 1VBE2 2JG9A 1SFYA 2V72A 1UO9A 3U4SA 4CCJA 3CZJA 4OULA 1HRI2 3DKWA 1AR62 5JI7A 3U4XA 3I2DA 3ZFFC 3B01A 3MGUA 3OGGA 3LPFA 4CSWA 4XYXA 3V65A 2YUEA 4RR3C 5FCCA 2XONA 5DUWA 2EIBA 1X7NA 3VUOA 5A80A 1AR93 1WUVA 4YNIA 4C90A 1RUC3 2WZR1 1COV1 4RQPA 1RUF2 1YFYA 2Q8EA 1O3SA 4XACA 4NAMA 5DXDA 2YROA 4JAAA 4NO4A 1VBE1 2B5HA 2QQLA 4FFFA 4GQ7A 1UZ0A 4HFSA 4HN0A 5FZAA 4C91A 5FP8A 5JWPA 5LW9A 3BOWA 4RHV3 2ADEA 2GNBA 4WV8A 2DV9A 3WNMA 3H3UA 3O1RA 3M3EA 1GFF2 1RUI2 3K3NA 2YBKA 5C3SA 2HWD2 4JKLA 5IAVA 5K9YA 4PQ9A 1BCXA 3CU7A 1DLCA 1PIV3 2ORXA 3AZZA 3B5LB 4L11A 1ZVFA 4EN6B 1QH7A 3O14A 1NCRC 3OY8A 4MH0E 1WW5A 4ASLA 1ONAA 3ACFA 3CJIB 5CFDC 4CP9A 1W2UA 3BALA 3WF0A 1MZEA 5JXHA 1R083 5GLTA 2QVSB 1W6MB 2AUYA 3IBMA 1PO23 3IMMA 1G7YA 2A6VA 3P1IA 4AFAA 4GKYA 1S0EA 2DF7A 4WVVA 3RYPA 2VCAA 2Z79A 1U0AA 3PUSA 3UGFA 4EYUA 4QX8A 3TBDA 2XJTA 4A6OA 1V9U1 1FATA 4AGVA 5I91A 1VAMA 2GC2A 4CUCA 4R4ZA 5BNPB 2WFF3 2WSVA 2XPJA 5DDJ3 3WNOA 4AVCA 1UYZA 1BK0A 4GH4B 2RHPA 3RJ2X 3GJAA 4XABA 2VJXA 4CXXA 1NKGA 4QMAA 2UY8A 2EXHA 4BMBA 1JYNA 2GSYA 4ATFA 4XUOA 1WWYA 1Q8VA 2A73B 2ZCWA 4XUQA 5LZ6A 2X10A 3LOBA 3WUDA 5C7GA 5HCFA 1G9BA 4Q8LA 1H1MA 4DFSA 3VD4A 5E88A 1V6IA 3FUOA 3BGAA 4UF0A 3UKNA 4LBJA 3T0BA 4AE2A 5BNOC 3IDBB 5FP9A 2XG3A 2ENRA 4AEDC 3THPA 2VMIA 4Y4RA 1NX9A 1W0PA 4Y5TA 2QCSB 1PGW2 2K9ZA 2BPA2 1VMFA 2JKBA 1H1AA 3R6SA 4XBNA 3NNJA 3OYWA 4BQXA 2YGLA 3LPGA 5F2SA 2BERA 5LBEA 3WW3A 5LBCA 1ASJ1 4QU1A 3T4VA 3EJKA 4LKSA 2ZEXA 4WM8B 3EQEA 1UX7A 3BTYA 4MZUA 4LNVA 3FFQA 2YPJA 2EIDA 3AJYA 4ZXKA 4CDQA 1LHNA 1D0GA 1D7PM 1DQ1A 1V00A 1VMJA 1JOBA 4B29A 2J1TA 1OVSA 1RJ8A 3U78A 1ODMA 2CWMA 2HWB2 4EN7B 1LKNA 4OI2A 2LW8A 1LHWA 4GJZA 5A7QA 2ZOEB 1VBC3 3I8TA 3ZPOA 3GALA 5TSWA 2BBAA 3PTYA 4CUGA 5ANQA 5FYSA 4IGPA 4F3JA 2AZ5A 2DYCA 2A3YA 3E97A 1D2SA 5C8CB 3LEMA 3ZXFA 5A1LA 1GQGA 4UWDA 2ZMNA 4DMIA 2F4LA 4FPCA 5LA0A 1HXS2 2QDRA 2WFPA 5I0TA 2X09A 3LKJA 1K42A 3HQRA 4NIDA 2W94A 1FX5A 2OIIA 1BBT3 3JD72 3KQRA 2YC4A 4GULA 2J1SA 3I2KA 3WDWA 4YW6A 2JWPA 2VL4A 3KHCA 1OD3A 2Q5TA 5C9AB 4OQ8A 1Y43B 1OMIA 3AM2A 4DXTA 5ABJC 1YI9A 4OVEA 2QJVA 4YFZA 1NCQB 3H3LA 4PLNA 1VBA2 4RYDA 5G04L 1JYVA 1M4WA 2VY0A 4NPRA 2Y0IA 2R043 3GBFA 3FLTA 3HIFA 3Q8BA 5IK4A 1SFPA 3J7HA 1I3HA 4AVAA 4BLJA 3URFA 5E16A 4XXPA 4IEUA 5C6CA 4WM7C 1T6GC 3JBG2 5K8SA 2D6NA 3AB0A 5L7OC 2O8OA 2UYAA 1QXRA 1MEC2 1XJAA 4AI2A 4AVBA 1F5FA 3SC7X 1PX4A 2Z4FA 3CJIA 4Q2FA 4CDUA 1GNHA 4NOTA 2VW1A 3INAA 3I2GA 1QJU3 3A21A 2R061 5D21A 5H9QA 4CZSA 1CR7A 4HMZA 3KWVA 2E26A 4HN1A 4LO7A 4Y20B 2VAUA 1HRI3 3S6PA 2ZHNA 1AR63 3OD0A 3T09A 4MXWB 3EMRA 5FZIA 2VOVA 5LRRA 2Q4SA 1XRUA 1U12A 2TNFA 3J8F1 4K3UA 2IFRA 4DIQA 2GN7A 3FLPA 1YXWA 1U5YA 2WN3A 4QPIC 5DABA 1JYTA 2JG8B 5BNPA 2V4AA 3I3MA 1R092 4YVWC 2BP6A 3ZDSA 2HYKA 3ZN5A 4CVUA 1FPN1 3PLQA 4BYYA 4BQ1A 4IE4A 2C24A 5FREA 2VXJA 1FV3A 1QJFA 3ETPA 4GWMA 4MGYE 5DAVA 4N9HA 3W21A 2JDPA 2D5FA 5CYYA 4DXZA 4HKWA 2HWD3 3POGA 4DUXA 1VBD1 2LUWA 3VD5A 4J6GA 1WMDA 2B9VA 2WN2A 1R091 3DXTA 1DGRA 1NLSA 3R4UA 4K8RB 2PLV1 2BZDA 5EJZB 4LHLA 4QQPA 3D0JA 1BXHA 2GU9A 1MZ5A 3HPNA 5CADA 2BJSA 2XH6A 3E6BA 3IDCB 3MFCA 4Y4YA 1O4ZA 1KITA 2VZVA 2WWUA 3CEWA 5A3OA 5FKBA 2JG9C 5C8WA 1JOPA 4DRRA 2PA7A 3KVBA 2JDZA 4PIZA 3VB9A 4BXFA 4H14A 3ZSLA 3S57A 4I30A 4YGEA 3IB3A 1H9WA 2D3RA 1U5ZA 2IXHA 2J1UA 4JC1A 5FYMA 5CAZA 4YM0A 5FZEA 3ZXJA 2ZX0A 1L7QA 4RQPC 2B39A 4BA6A 1YC61 3J9SA 3A4UA 3IAQA 4YG6A 1OH3A 4AQ2A 2HWC1 3PU8A 1O8PA 4DY3A 1OH4A 4LO6B 2ZGMA 4YG0A 1T6BX 3C7HA 2VULA 1N3PA 2A6YA 3LDRA 4BHPA 4KWKA 5FY0A 3PJQA 5FZ4A 1YFWA 3T4HB 3JB8A 2VMGA 1LOEA 1UL9A 1RUJ2 2VOWA 5C8CA 3ZN6B 3D0SA 2RDNA 4PI0A 1ULEA 2UYBA 2IWGB 2PELA 4BQ3A 4A41A 2H6BA 5CA6A 5KXBA 1H2LA 3QOPA 1S0IA 5IVFA 3SLIA 5K4LA 3ES4A 4BLIA 1YO8A 3U10A 3VBFA 3BIEA 4QB2A 1XU1A 3KT7A 1C5IA 4K1ZA 4RR3B 3IM0A 5J3UA 4IW3A 3BTAA 1UNBA 2DU1A 4P02B 1SLIA 2Q1FA 5C9AA 1AYM1 5EHDA 3BPZA 4Q0UA 4QX2A 3H9AA 4YZ3A 1LB2A 1D4VB 3GF6A 1NCQA 1NY72 1RMU2 1SZBA 4GAZA 2V4VA 2HWF2 1LGBA 1KQRA 4EWDA 4LK7A 4A3ZA 2ZMKA 1QQP2 2ZZQA 1C8M1 3OGSA 1CAUA 5FP3A 1V6LA 1GNZA 2YG0A 1LTEA 2RJLA 2HWB3 1RC6A 5F39A 1AJOA 2K0GA 5BPXA 3FN9A 5FXZA 4NHMA 1PZ7A 4AEKA 1POV0 2GC1A 2PHLA 1TME2 1JOJA 4W6XA 3LDKA 4Q0QA 5HI0A 1H30A 1NY71 3JQWA 4FXGB 4X8NA 3WDTA 3WQBA 3N9OA 4FTSA 2Y34A 2O0OA 1C8NA 4AQTA 1E5HA 1GZTA 3Q8EA 2W68A 3MIHA 2VBDA 2BOJA 4LR4A 2GMPA 2IC1A 3LFIA 1HXS3 4Y20A 3TNPB 3LQCA 2J42A 3ZXEA 1ZREA 5LRSA 5FUIA 2NLRA 4GALA 2XJRA 1F31A 1RUNA 1VJ2A 3JD73 1QU0A 1QIQA 2DUQA 3N9QA 4XFBA 4CCKA 1LOBA 1SLCA 2YV8A 2IVIB 3W59A 2ZS6B 4Y26A 5H9PA 4LJHA 4G4FA 5F1RA 3RYRA 4QKBA 4WVMA 3DYMA 2IXKA 1RXGA 4QU2A 4JRAA 5IVVA 3W5MA 2Y0OA 1UOGA 2P6CA 3M1HA 1AR73 2QTWB 2XKOA 2W9XA 1VBA3 3ZXGA 3N9MA 2R6QA 5FXWA 1PMJX 1W2OA 1SEFA 2B7YA 3WD5A 1OQDA 4XILA 2C1FA 2D93A 2E31A 4D7YA 2OA2A 4CCCA 2R49A 1NOVA 4I2OA 1YHFA 4YZ2A 1VAKA 3JBG3 2ZHMA 1UW8A 4K21A 2A1XA 4V2VA 4XBLA 4XTPA 2QQKA 1MEC3 1W8ZA 5BNOB 4FP3A 1KFUL 4AEDB 5EYXA 1A6CA 1CIWA 3A0KA 3VZNA 2VUDA 3N9NA 1DHKB 1Q8SA 2CL2A 1BLZA 4QAWA 2VNOA 1F9KA 2AENA 4IV3B 3RZGA 1WBLA 5A6XA 4B7EA 3LFMA 4OZXA 3N9PA 4NIGA 2CTVA 3WDVA 5EZWA 2KA3A 1CAWA 5E89A 5H9RA 1APNA 2XJUA 3AMNA 3KHBA 3NJYA 3O0WA 3DN7A 4PBPA 2WO2A 3T2OA 3M8LA 1B09A 1H2KA 5F6KA 1DQ6A 2P6HA 5H9SA 1ZBA1 2X53S 5T50A 4Q4X2 2ZEWA 5I8YA 1UPIA 1IG3A 2KXLA 1JODA 4XHXA 4BWOA 1EY2A 5LEKA 5KHJA 4AFMA 4QDRA 2O14A 4JTNA 4LOSA 1R1ZA 3D8CA 5FLIA 2W91A 3POJA 4OUEA 1MVEA 1WW4A 2W39A 3H7YA 3ZN6A 5GALA 4O9GA 3C7EA 4UFKA 3ZX7A 2YY1A 4KG0A 1W6PB 3T0AA 5CU1A 2PAEA 4NPLA 5A3UA 4ZPIA 1V6OA 1W03A 5GLWA 5JOZA 4Q4W2 3CJIC 3OF1A 3H1YA 4CDUC 3LZZA 4ISQA 1LJ7A 1J58A 1PNGA 1JUIA 3AZXA 3BYWA 4RR3A 1DFQA 4K1YA 4X8PA 1G9FA 3B69A 4DB5A 1OUSA 2VD7A 3KSCA 1YQ6A 1AHSA 2E7TA 4OLLA 4XVHA 1PGL1 2E9QA 1N1VA 4LPLA 3ILNA 1OF3A 1HKDA 3K77A 4R4XA 3JXSA 2FD8A 1YIFA 2UURA 1CZVA 2ARAA 4LXLA 3WOGA 3AFKA 3K3OA 1HRV2 4CDWB 4EZ4A 3FUQA 5BNPC 1W2AX 2DFBA 2GALA 2LALA 4IV1A 3E6CC 4AFDA 4IDZA 4B1LA 1GR3A 2VW0A 3SH5A 2YBPA 3IZOA 2F6BA 4QKFA 1AUYA 3WCSA 2WSUA 1OFSA 3PU3A 3VHRA 1LHUA 4NHXA 5FY8A 2JDHA 3N3HA 2XOMA 2E6VA 1RUJ3 3AKQA 3I2HA 5JSPA 1FMD1 4QHOA 3OUIA 1REDA 2WAOA 5FO7B 4Y22A 5A6ZA 2H0BA 3ZMNA 4HLTA 4FTBA 2B9UA 1TQ5A 3B93A 3V0AB 1ZBE2 4IE7A 2HLEA 4MX3A 2Z5WA 4ONUA 3VKMA 1W8NA 5IJRA 4H55A 2RS11 2E7QA 2PAKA 4HSLA 5LA2A 3ZYHA 3BUCA 4XF1A 4K7JA 3V0BB 3N7JA 3MFAA 4IEZA 4ARXA 4QPIB 2QQVA 1EPZA 1J59A 3LIHA 1DBNA 1IQDC 4YVSA 3TN92 1ND2C 2Y6JA 1EV12 4H3WA 4AEJA 5IVBA 1UOJA 3LEGA 3NWKA 3WG3A 1RMU3 1HW5A 3UKTA 4NWWA 3VHNA 3AKPA 4AHZA 2HWF3 5C71A 1ZM1A 3PVBB 4UFLA 1ACCA 1QQP3 2A5ZA 5FZ1A 3VDDB 2Q30A 3D4KA 1X82A 5JSRA 2RS32 4MO3M 1BQPA 3ON7A 3GZTB 5JOYA 1HV1A 3SCHA 3WY6A 4AR2A 1TNFA 3A0NA 1TME3 4P00B 5EJ3A 2V09A 5IHRA 5LK7B 3ZYIB 3BIWE 3VZOA 5GLUA 1VBB1 3TB0A 3KCCA 3DYPA 4JGYB 4DZGA 3MUY1 4LBKA 1S0CA 2JB4A 4P9LA 5FFOC 4MGKE 3P3NA 2JG9B 4IV3A 2D3PA 1MPXA 5CG8A 1NAEA 1AR82 1JTZX 3ZYRA 2PYTA 3G6JB 3V56A 3VBFC 1W8FA 1NQDA 2Q1MA 3LEIA 5FYBA 3SH4A 1ZRIA 1PM7A 2RMU1 2ADDA 2YBSA 4G3YC 1IOAA 4MGSA 1JZ4A 2JDKA 5C9AC 4Q4V3 3ZO0B 3N4MA 2R073 1TZOA 3POBA 4HK8A 3ALQA 1PZ9A 3IDAA 4FFHA 2ZGUA 4L92A 4GMP1 2ZMLA 1NXMA 5EFUA 2H0VA 2BV4A 2PFWA 3CJXA 5GLVA 1Q56A 2VZRA 1A8DA 1ULOA 2FQPA 3WG2A 1LHOA 4DEQA 2WNEA 2HEVF 4GA9A 3ASIA 4I3PA 1XXNA 1K3IA 2H6CA 1Y9MA 5I0RA 1C1LA 3UNPA 4MYEA 4NRMA 1YI7A 1ZNPA 1W6PA 4P14A 3RG0A 4DPNA 1ULGA 4GXLA 4TWTA 2VQ0A 5IVEA 2CDPA 4M01A 1AXYA 2EIGA 1BK1A 2OT7A 3ZYBA 2AYHA 4YSFA 1QJEA 1OXCA 1R081 1W3VA 3ZLIA 3J4UH 1SBDA 1WW6A 1DP0A 4OZOA 2BGPA 4JZRA 4QQLA 5FZKA 3K4DA 1RVF2 4Y24A 1RUH2 1QJX1 4LITA 4M00A 2QQPA 3WNXA 2W0XA 1VRH2 3U37A 1SBFA 3VZKA 4CDWA 1YUDA 1Y9GA 4KI5M 3KS7A 3QLQA 5JXGA 2C26A 5ACA3 4YZ1A 1POV1 2ARCA 2EA7A 4XUPA 3WP5A 2DCZA 5J98B 3RZJA 2C6SA 1UMZA 4YW7A 1O5LA 2XKPA 4P9WA 5F3GA 1C28A 2FCTA 1QKQA 2JECA 2VMCA 2YMZA 3MPBA 4HVOA 4AZZA 1RHI2 4S2FA 3K51A 3BPSA 2XB6C 1DF0A 2WBKA 3I2FA 3MIEA 2XLAA 4S2GA 2Y26A 1IGOA 4LULA 2UWAA 3W20A 1BKZA 2IXCA 5JI9A 2ZHKA 2WNOA 4IETA 1STMA 1V6MA 4Q4W3 4ZU5A 3RZZA 4O65A 3UKVA 5JAXA 1UY0A 3MLKA 1GP4A 5JSOA 3OYWB 2GP3A 2R1BA 4ASKA 4NVPA 5BXXA 1VMHA 3F2ZA 3VBUA 4E4SA 1LCLA 3OJBA 5DZEA 1XNKA 3B00A 2DCYA 1E5RA 1V6JA 1EPWA 1RUD2 3USUB 2ZGQA 1S0JA 5C3QA 4LK6A 4KNCA 5DG1A 4DUWA 1HRV3 4Z82A 3VDDA 4LTAA 4ZKTB 5IATA 1NQJA 2QUOA 4KBBA 4BQYA 2Z2SB 4FCAA 3ECQA 2WZPP 3N7KA 3BCWA 4GB31 4IE0A 4P9GA 4PDWB 4BH9A 4BZ4A 4QQ2A 1IPKA 3WF4A 1IQAA 4AGGA 2YZ4A 3CO2A 1R1A2 1YRZA 3I54A 3U1XA 1WBFA 2WZR2 1KGYA 3RGBA 3ZSKA 2P34A 1KXGA 4JGYA 1FT9A 4Y5Z0 1BJQA 3NV4A 1W6OB 3POYA 1ZBE3 2Q0AA 1FXZA 4NAOA 1UZZA 3PVNA 2VZPA 3BB6A 5IFTA 3WG4A 1DZQA 4BK4A 5AC91 1HIXA 3O1VA 1ENSA 1CONA 3WF2A 5EIYB 2OUJA 5IT6A 3WLUA 1K45A 1R1A1 1YWKA 5M0TA 3TN93 2E33A 1EV13 3WP4A 5I93A 1UU5A 3DUIA 4XJZA 3WDYA 1YFXA 2XLGA 2ARXA 2BWAA 3TEXA 2XJPA 4GWJA 1C1FA 2PHTA 1G86A 3L2YA 3AKRA 2RS33 2GC3A 4IV1C 4S2HA 2YFZA 3PVEA 3W9AA 3KCYA 3KQ4B 5KXCA 4UBHA 4OMDA 4XZPA 3B9CA 1V9U2 1QWRA 1VB4A 4QX5A 1IS4A 2FDHA 4PI2A 5JMCA 2NYYA 4CDUB 3LEKA 4BDVB 3FFZA 5FZ3A 5CNAA 3WCRA 4E4HA 4LE3A 3U11A 2Y64A 1A8MA 1AR83 3AYAA 1IHMA 5C5TA 3FMGA 3MBWA 5HPOA 4OYUA 5T55A 4CCMA 3MF6A 3OGJA 2FZ2A 2CWSA 3DKQA 4MXVA 4RGKA 2PMWB 4NHKA 3WUCA 1FAYA 3FWEA 1RIRA 4YVSC 1V0AA 3TAYA 5J1XA 4IEQA 1WZXA 3O5SA 2EAAA 4UYBA 2ZGLA 4OMCA 1W2TA 2VZUA 4PIXA 1KS5A 3BOPA 3HNMA 1JXNA 5KWRA 1UX6A 3WNKA 4AG4A 3O1PA 4DRVA 3KGLA 1H1IA 4NRQA 1ASJ2 4G9SB 3LGRA 2FCVA 4ZS3A 2PQQA 1DZTA 4CPBD 4E2SA 2JDAA 1JI6A 1XNCA 2P3JA 1JH5A 4QT6A 5AFEA 1GSLA 5F5CA 1SG3A 3H7JA 4OQ9A 2YXSA 3SMHA 4XAAA 1X9TA 4YW3A 5K7PA 2WQ8A 3RZLA 2GP5A 4HKLA 4A7ZA 2XJQA 1NZCA 1U5XA 4N43B 4BOWA 4YM2A 4QB1A 2FMYA 2NMNA 2W1UA 1TMF3 2D3SA 5A7WB 1SDDB 3O12A 1I9RA 4E27A 4IV3C 5IYYA 2IXLA 3MV11 1ND2B 2PHUA 2RG4A 4XHBA 4CU6A 2O1QA 1RVF3 5J48A 3RZHA 1WA6X 1RUH3 2WYSA 1VALA 3LF7A 4JQRA 1Z7S2 2DBIA 4R9BA 4RD7A 1VRH3 4XJWA 1LHVA 1W2NA 2YC0A 3USUA 4AK3A 3RYKA 1OQ1A 5ERLA 5GM0A 2UU8A 3NMBA 4FPHA 4R8HA 1UCXA 1A34A 1DGLA 1OPMA 2WA4A 1QDCA 4XFHA 5DPNA 2DUPA 1LEMA 3WNNA 1HB4A 5A7NA 2XBO1 2ZGSA 4FPLA 4P5HA 4PDWA 3WSOA 3ZDVA 4DXRA 3KCXA 5JR2A 5DN2A 1MACA 4CXWA 1AL23 3UT0A 1LODA 1Z7S1 2HBTA 4OUSA 3M3QA 5T5OA 1RHI3 1IZ3A 1U5IA 2MEV3 4XURA 3PVOA 3IN9A 3IPVB 1W6OA 4FFGA 3ELNA 1JYWA 2ETEA 3MLLA 4Y1VA 3UESA 4Q26A 1OPOA 1MQTC 4O61A 3BTZA 4CCDA 4YYOA 1GWKA 4M4PA 2ILMA 2X8KA 3VBFB 1XU2A 3MEPA 3MHZA 5JOXA 1CGPA 3ZYGA 3T3YA 1RUG3 3FBYA 4ZU7A 2JB8A 2VUAA 5A3MA 4JV4A 4P9XA 4ISRA 4KU7A 3SITA 1AL0G 2L9LA 5FJKA 5FZ9A 3WW4A 4N7IA 1LEDA 3TRSB 4B8EA 4XIKA 1KJRA 5JR7B 4AI0A 2JDYA 5CFCC 1RUD3 3ZR5A 1Y4WA 1YQCA 4H7MA 2R062 3W58A 3POWA 3WV6A 2GMEA 3ACIA 4CDWC 4RA0A 3VL9A 1RUE1 2WNUA 2VVEA 1CAUB 1UOFA 1DYOA 4BPZA 2PQSA 4E2QA 2PXJA 1GZCA 2C5DA 1JHNA 1Z78A 2RDRA 2D6KA 4ZS2A 3UGGA 3J8F2 4FT8A 1SDWA 4FPEA 2ZGOA 4NHYA 4HL0A 3DGTA 1PZ8A 1W9WA 2PHWA 3ILRA 4MLOA 4P5YA 2WZR3 3NV2A 1COV3 5A33A 1TVGA 3ILFA 2BTVC 2P4EA 4NIAA 1CPMA 1P8JA 2C9KA 1O59A 1O6UA 3Q8AA 4FQZA 1W8UA 4HBNA 5IVCA 2JDMA 3FHAA 3I59B 4K8FA 3HN3A 1FPN2 1GWMA 1VBE3 4LQRA 2OYZA 1W90A 1VIWB 4TLGA 4CDXB 1WCUA 2DVFA 4EN9B 1US3A 1A78A 2YFUA 4XAEA 1JU3A 1ZX5A 3FZ3A 1M06G 4IQPA 2ZHLA 1CAVA 1C5HA 3O7OA 1NUKA 4XXAA 1QJY2 1RUF3 1VBD2 4WVMB 5FYCA 5A3TA 1UKGA 5C3PA 4XOGA 3LA3A 3VBUC 2GNTA 3CL1A 2PLV2 3K4AA 4LHSA 4OHZA 3CHXA 4FPJA 1KDKA 3UETA 1FOD1 4OUMA 2BEOA 3IT8A 3T0DA 1YCIA 1OQEA 1ULPA 4FOWA 1JZ3A 2NN8A 2ZGTA 1JZ7A 3H42B 4C1XA 3QBQA 3ORJA 3AC0A 1JZ8A 4U36A 3VDDC 3MW4A 1RUI3 4ET7A 2BUKA 5J36A 1ZRDA 4CA9A 3OB8A 4I0AA 1GP6A 1QJY1 2A6WA 4XDPA 2JKXA 1TEIA 4PCRA 3ZSMA 1V9U3 5FP4A 2VE1A 1GQPA 4KU8A 3KGZA 5L19A 5K0UA 1AF9A 4MGTA 4V2WA 2NMOA 4ZZ5A 4N43A 3NNLA 4XIOA 4JGYC 3ZKYA 5FPBA 5KXEA 5A7WA 3VZJA 4DUVA 2HWC2 1XOYA 2XHKA 5D8AB 4MUVA 4AQSA 4CEWC 1ND2A 1HB3A 4YLZA 3WNPA 5ANNA 1G9AA 1DGWA 3DV8A 1CAWB 5FP7A 5FYVA 1PO12 2VNGA 2XL7A 3RZKA 1S2EA 3SEPA 2EVXA 2ES3A 1OUXA 1SLLA 3M2MA 4RFT0 2N7GA 1REEA 2YDEA 3H50A 5FUNA 3RWKX 2FDJA 4W50A 2XR4A 4GJYA 4FTEA 1XPWA 5FY4A 4XBQA 5FZDA 2BNMA 2P37A 5FBJA 3OEBA 2WINB 2DCKA 5FZOB 4CU9A 1ENRA 5IWFA 1GLHA 4IXLA 2WNVB 2V73A 3LA2A 1PO11 3IIIA 1AYM2 4QX0A 4CCEA 1G9CA 2D6OX 4KBZA 3IPVA 4BQ5A 4PLOA 5DQ0A 2AEYA 2BQPA 3GBWA 4YW5A 4AVVA 1OSGA 4Q4Y2 2VZ3A 4DS0A 4PJYA 1C8M2 5FY5A 1PVC1 4QXKA 4XW3A 1BYHA 1QNYA 2BBVA 1RTVA 2CSGA 4K40A 1W8WA 2MNGA 1C57A 2DVDA 1UOBA 2DTYA 5FBZA 3RS6A 3NJZA 3THTA 1EUUA 2ZJCA 3MO4A 1W6QA 1OOPB 2W2IA 4EZHA 5FO9B 2XVKA 4QGNA 4CTEA 5LA9A 1UY3A 3AFGA 4EN8B 4EQVA 1QF3A 1LULA 4CUBA 2O8QA 1DU3D 1UY4A 4Q4Y1 1O3RA 1J3QA 1GQHA 3LAGA 4W6YA 4YWAA 4D8MA 3VBRC 2VPVA 1UZVA 5I8SA 2RS51 3GCWA 1RITA 1NYWA 4IV1B 4GD4A 4QX7A 4TZDA 4AAXA 5FPZA 5JLVA 1XE8A 2WDBA 5HCAA 2VUCA 1F4HA 4AW7A 2RM22 5FV3A 5GLZA 3AZVA 5DZFA 4Y22B 2OZ6A 3I59A 4BQWA 3ZXKA 2WS91 1OURA 3ACHA 2AH2A 3C7GA 5JXIA 4CDXA 2EICA 5FLHA 2JEMA 1MS3A 3VKOA 1W0NA 1H8VA 1CD3G 3MICA 1V6NA 2KR2A 4MSVA 3B94A 1ND3B 3ZYJB 1H2MA 3SH3A 4AI3A 1L7RA 2VG9A 4Y1UA 4N9IA 4BMEA 3H1MA 2RM21 4BM8A 4IEXA 2ERFA 4YVSB 1DGRN 1OVPA 3JCIA 5FMDA 2W1QA 2HWE1 4AFBA 1LR5A 2QFEA 3VZMA 4HVQA 5GKAC 4R9DA 2UWCA 4XCAA 2WT0A 1UD1A 2ZKLA 3JZVA 2R063 4IE6A 3C3VA 2TBVA 3WXPA 3SKJE 3BTXA 1H6YA 4ITCA 3KF3A 2P3YA 1QGLA 3MF9A 1ZZCA 2OUHA 1ZZBA 1Q43A 2BNOA 2BYVE 3CQOA 3H1WA 2GZWA 1GOHA 3CKHA 2SLIA 1WLWA 4PDWC 4QHBA 3RDIA 3BI3A 3NO8A 5EYYA 2RR11 4N53B 4AFCA 5LA1A 1OA2A 4I01A 3MUZ1 4COVA 1ZBA2 2LM3A 2VMFA 3AMMA 1IS6A 1CZTA 3FX3A 3NV1A 2DCJA 1HN0A 1FPN3 5D8AA 3TEWA 2VZSA 3WX5A 2J1VA 5BYNA 1X36A 5GZDA 2FDIA 3LD8A 4XCBA 1N1SA 1XNBA 3RSJA 3ENRA 5T5PA 3UJOA 3FBMA 5FMOL 1AX1A 2R0FA 5FZ8A 3EHKA 1NLRA 4CPBA 3OSDA 4YPJA 2R071 2ZGPA 3AL5A 2ZA9A 4ZHNA 1VBD3 2WLPA 3HBKA 1R093 4FAHA 4CE8A 1GU3A 5CKMA 1O8SA 2PLV3 1LESA 4KGGA 5FMBA 1F35A 4SBVA 4MGIE 2F4PA 4FXKB 1WCKA 2W95A 4E8DA 1G9DA 3AVRA 2NP0A 5FZOA 4Q29A 5E6HA 2G1MA 4CCLA 1HV0A 2RDQA 4EWAA 1BEV1 1QXPA 4QQHA 5A3NA 2WNVA 2FDKA 3SQOA 4I02A 2WNUC 3HBZA 1IPJA 4TYSA 5BNNB 4AHXA 4NJ4A 3VN4A 3PURA 2R30A 4KH9A 1WLCA 2XQXA 5L9VA 2XL9A 1PGL2 2DVAA 2UWBA 4TTGA 1ULFA 1MQTB 4UBGA 1WA4A 1E5SA 1UN1A 2Z69A 3FL7A 3RI8A 4LIVA 3WZ1A 2V5YA 3GXUA 1N3QA 3O1MA 2R7EB 3OUHA 2HWC3 5JPNB 3KLSA 3TYJA 4E4DX 1GICA 1W99A 4PF5A 4HZFA 3ZFGB 1OOPA 3ETQA 3LCPA 2IVJA 4CU8A 3OG2A 5ISLA 1HJGA 3QH7A 1FMD2 1H4GA 5T54A 3C7FA 3ROUA 4BIFA 1UU4A 5CFCB 4HANA 4YW1A 4DXSA 4E4ZA 3H8OA 4XFGA 2I74A 2NZ9A 5FDBA 4I0WB 3DYOA 3RI9A 4E2GA 4LO4B 4UAPA 1AYN1 1EAH1 2RS12 4KMQA 5LASA 3RWNA 4MGQA 4Y1XA 4ZY9A 1RXFA 1SFNA 1WCSA 2WO3A 3THDA 3GZAA 1W9YA 5FYHA 4PIYA 1JZ2A 1BMV1 2OKXA 3S0MA 1AYM3 3QH6A 4LUKA 4Z1VA 3P3PA 1JU4A 2XDVA 2J7MA 3FE5A 2BFUS 2B4KA 1O4TA 1JZ5A 2F17A 2ZABA 4OI0A 2XVGA 1H8TA 5CB7A 2C0ZA 5K0UC 4LUMA 3S5AA 2QZ3A 1YFUA 2EXIA 4N43C 4FOVA 2RE9A 2QKDA 1C8M3 1ND3A 4QDSA 3ZM8A 1D4M1 4XF0A 4A2UA 1G8WA 1CN1A 1VE0A 2CY6A 2ET7A 3NSTA 2OXBA 3KT1A 1ENQA 4FAGA 1L7LA 3E5XA 3BU0A 1PK6C 3VBUB 3H8RA 3AMPA 1UU6A 4TXWA 4AGRA 4XTMA 3D3AA 4CXYA 2G9FA 2Y6GA 1VBB2 3F95A 2OZJA 1LAJA 4AL9A 1KJLA 2ZGKA 1VB2A 4YGCA 1RYYA 1DGWX 2DFCA 3AP9A 1O3TA 3IIAA 3ZXAC 4A42A 4DY5A 1QHDA 2Y6FA 1CX4A 1W39A 2ZEZA 3DCQA 2ZACA 5FZLA 1ULCA 2WO7A 2P1BA 3ZMOA 2RMU2 1GZWB 1N1YA 4N53A 5EV7A 2I07B 3LSEA 4PLMA 1HX6A 3HEIA 2CDOA 2XGXA 3OBAA 4QX1A 4A6SA 2JIJA 3PUAA 4FOQA 2W52A 5FZBA 2VNRA 1ENXA 1OKQA 2D97A 4RHV2 4XFFA 4CEWB 5FXVA 3ES1A 3VZLA 1QNWA 3Q8CA 3RJRA 3GHMA 3RVHA 1A3KA 1N1TA 3EYPA 4BXSV 1AR91 1RUC1 4IGOA 2BVVA 5KHKA 1ZZ7A 1WMFA 3N7LA 4BE3A 3U07A 2VCMA 2DURA 1VAVA 4RGGA 4QXCA 1POQA 4Z92B 5FYYA 5L9RA 2J1AA 3AYCA 4HKOA 5FK7A 3VLBB 4LT5A 2BFUL 1LGCA 4RHV1 1R082 2JE9A 2Y8KA 1K5JA 3VBOA 3O0VA 2X5IA 1HLCA 3M7AA 4W6WA 5BNNA 2VMEA 4F7ZA 5DUVA 5LB6A 1WW7A 1Q3EA 4K20A 5KXDA 3W5NA 1PIV1 1WD4A 5FR3A 3PDQA 3I3QA 3WP6A 4XJ9A 1QJX2 1O4YA 5FPVA 1OBNA 1MQTA 3KMHA 3K4ZA 4LKDA 1UYPA 4WZFA 2VZQA 3QD6A 1BZWA 4UI9L 1GV9A 1IPSA 1ZBA3 5DDJ2 4L9BA 4NPMA 4BJ0A 4C0BA 1PO21 1V70A 1RINA 3GGLA 5JXJA 2JD9A 4CDXC 2VO5A 4LE4A 5EQUA 4QQOA 3ZFGA 2QE3A 1OFNA 3ZIWA 4Q0PA 4ARYA 4Z2WA 4XPVA 3OPWA 2BRTA 4QGLA 4XF4A 3VHOA 2VQTA 5IK5A 3KZ4C 5CFCA 3AMHA 1T2XA 3APBA 5F9TA 4NIHA 1UMHA 2WFF1 3ACGA 3ABZA 4D6QA 3JB4C 1AXKA 5FWJA 5DDJ1 3VBRB 1RL3A 1S4CA 4Q4X3 3NNGA 4K6BA 3KB5A 4Y1YA 2WIIB 3G7DA 1SHWB 3C2UA 4AHYA 1CAXA 2WQZC 1H2NA 3I7DA 4CUAA 4I0BA 3LIGA 3WQ7A 2R32A 1MZFA 5HBAA 1W8TA 2GNDA 2R0HA 5GZEA 3HN1A 2LTNA 1MS8A 3NJXA 2FCUA 3S5QA 2HJIA 4AWDA 1GBGA 2DVBA 2JDUA 2JX9A 3MIBA 4LBNA 5JIUA 2QQWA 4W4ZA 4JDMA 1OA4A 2WKKA 3IDEA 3USSA 2WWJA 1AVBA 4FFIA 4LHKA 3S7EA 5FPUA 3RNSA 3WHUA 2A75A 1MS5A 2J22A 4OHWA 5FZHA 3PNAA 2RV9A 1XSRA 2CAUA 4CP1A 3DEMA 1GUIA 5D8AC 2FBEA 2J1RA 2K2SA 4C8DA 1XYOA 1YQ8A 3J7LA 2DUOA 4GB32 4BB3A 2J1EA 4LO5B 3WNLA 4PHZA 5FZFA 1W9SA 3NVCA 4MADA 3A22A 3HVDA 3AK0A 1FMD3 3THCA 3GJBA 3UGHA 4XMIA 2R1DA 4MVTA 3PMEA 4XEZA 4GKXA 2W5FA 5AVAA 5FYTA 3OOXA 3KV9A 4JHTA 5CISA 5FY1A 1DQ4A 1TE1B 1VBC1 3PIJA 5FMCA 2RS13 3GDBA 5AC92 4LMFA 1JN2P 1UYYA 4NRPA 5A7SA 1LOFA 2PHDA 1GZWA 1W06A 4XDQA 1SCSA 4YZ4A 4UFIA 4Q8KA 4JKKA 2WNVC 2WRAA 3R4SA 1DQ0A 4FPYA 3T2PA 1ZZ6A 5BUVA 5I0DA 1WMEA 4XE9A 4MHUA 5A6YA 3GZUC 3CBNA 1QXJA 5FUPA 2IZWA 3TWIA 2E32A 1QMJA 4B3NA 4CEWA 2JICA 1BBT1 3AP5A 4KGQA 4LIUA 3RMYA 1XSQA 1BVVA 1I5ZA 2D43A 4HSJA 4UOJA 2D40A 1Q8PA 2DWRA 2BGCA 3POIA 4IL7A 2WAAA 4OHXA 1OLRA 4UW4A 2WR9A 4COZA 2YU1A 4LOTA 4QKNA 2WABA 2ID4A 2JE7A 2CGPA 4HPKA 3CMGA 3JU9A 4AVSA 2WJSA 1OOPC 4QPGB 2W1WA 4M0HA 2AR6A 5GZFA 4AF9A 4AI8A 2R041 5FYZA 1LRHA 1VBB3 2WQ4A 1O91A 4Q5OA 4PT6A 5A3PA 4XDOA 1Y7BA 2B45X 1X50A 1LNSA 2WNUB 3E5UA 3RPQA 1E5IA 1LOCA 3UYJA 3VBHA 5HV0A 2A3XA 2WL1A 4XF9A 1XNDA 3QACA 3CIHA 4YW2A 2RMU3 5J09A 4UW3A 1O3QA 3GNEA 2BW8A 2GNMA 3AX4A 3AXEA 4KG8A 5A33B 2EXKA 3KT4A 1QJU1 5I8TA 1GMMA 3M4FA 2Z42A 3AYDA 4L97A 4NROA 4UW6A 2PTMA 1W6NB 3RQ0A 5FQ0A 1SQ4A 3VGIA 1HRI1 1AR61 4GMP3 1UXXX 4H2AA 2LRPA 4KWUA 1H8TC 2XJSA 4FOYA 4QXBA 1LU2A 2R16A 4JDOA 4JHZA 1CX1A 4O9EA 5IW0A 1OKOA 1OHFA 5FZ6A 1JS9A 1YJLA 1ND3C 4INDA 3ST7A 4DOUA 4LLFA 4MHRA 5I0SA 1Q8OA 5F5AA 4D7SA 1RUF1 2VW2A 4YW4A 1CAVB 1TNRA 3KV6A 1F5JA 3R05A 3FLRA 2XJVA 4OHVA 1NXD1 2B42B 3VBRA 1UY2A 1GANA 2OW4A 4FPGA 3WW1A 5KHHA 1WKYA 4TLFA 4R9CA 4RL7A 3PUQA 1VLNA 2ZGRA 1H0BA 4EWEA 4L2NA 1DG6A 1QH6A 4IE5A 4LA2A 4QHZA 5F5QA 1LECA 3DXUA 4IEPA 3OUJA 2C9AA 5C4WC 2D6MA 2VQUA 1CIYA 4Q0VA 1X9PA 1NLQA 1RUI1 3P5BA 3VKLA 4CCOA 5I0UA 2DDUA 1QEXA 2HWD1 5A7OA 1MR5A 4UW5A 1CWPA 4M4RA 3ZFEA 1NZIA 1UQXA 1WLDA 1UAIA 1QJX3 2A6ZA 2BNNA 4JQTA 1UPSA 1Y3TA 4XQWA 2W47A 3T08A 4B4PA 5K0UB 4N53C 1W0OA 5E8AA 3N7MA 1S55A 2P17A 2XQRA 3NAPA 1OI6A 4LEJA 3OBTA 2GH2A 4RGAA 1HDKA 2YC2A 2W87A 3AXDA 3RZMA 3WG1A 5CG9A 1US2A 2CNAA 4UXAA 5FYIA 1POV3 4F8AA 4META 3NKGA 2XBO2 5FY9A 4CU7A 1Z0HA 2WO1A 4K9SA 5LEJA 4XMAA 1PK6B 4X6RB 2FZ1A 1B35C 5FTTC 3O1SA 2E51A 2EALA 4CP2A 3FHQA 2XWJB 4D3WA 3GBGA 4A44A 2OS2A 1AX0A 5FZMA 1KFXL 4XJUA 5EXOA 4DNYA 3CNAA 4DINB 2VUJA 3HR9A 1KD7A 4Y3OA 4XFAA 1ZA4A 4D6SA 3BVCA 1WGPA 3WT3A 4JTOA 5JVVA 2ZTNA 2EIEA 5FWEA 2WLQA 1XBFA 1HN1A 2CGOA 3FHIB 2ORZA 2XUMA 3SNMA 3VBOC 1DZRA 2X5IC 2E63A 1GZ9A 5F32A 3J7NA 4GZ9A 4JGZA 3ZSJA 3K46A 4HT1T 4C1WA 5BNNC 3DF0A 4FSJA 2VNVA 2QBXA 3NNFA 1CQ9A 2BWCA 5C5UA 4MV2A 3BN6A 1W3XA 2JENA 4JX0A 2HYXA 2PHFA 4DO0A 1HB2A 5FO8B 5F8PA 2AACA 2QQUA 1PGW1 5FPAA 4YGBA 3WVJA 4WVWA 3POFA 4ORFA 4CP0A 1ZYBA 1RUE2 3PIGA 5J96B 3GYDA 5JZGA 3J26N 3N35A 4GWNA 2ET1A 1HQWA 3MIDA 4Y33A 5HV4A 1UXZA 4GB33 3ZFGC 4QPGA 1OD5A 3AZYA 1RGSA 1W6QB 2TEPA 2GC0A 2ARBA 2VH9A 4QDQA 3TNQA 4A4AA 5GZGA 1XE0A 3M3OA 1ZZ9A 3PMSA 2RJKA 3H0OA 2HWB1 2SBAA 4FP2A 4R52A 3ZYPA 1J83A 3SCGA 3I3EA 2Y6HA 1VPHA 3R0RA 4M3CF 1GNYA 5FZCA 5AC93 3KVAA 2GMMA 5C3RA 1C4RA 1R1A3 1G6NA 2LS6A 5A3WA 1YNAA 2VVFA 2WZEA 1GYKA 4RS5B 1AR72 1W6NA 1HXS1 4RN5A 1AJKA 1J3RA 3NL1A 4LLOA 1FOD2 1YIPA 3TOJA 1QOSA 2YHJA 2CYFA 2QQNA 2OPWA 3JD71 1S2KA 2RVAA 4FVVA 3A7QA 3SXWA 1D0HA 3I2JA 5LY1A 5A70A 5FY7A 1J1LA 4E9KA 1IKPA 3PHMA 2W92A 5D2AA 3ZXDA 5IVYA 1RB8G 3VBSB 4WZCA 3SCFA 1AR71 4AYUA 3HJRA 5IK7A 4OFGA 5BV6A 1VBA1 1W8HA 1JBCA 4MOAA 4B4RA 4AXOA 4HETA 1W6MA 4XQDA 5CBLA 1K5MB 2ZXQA 2A71A 1NT0A 1WMXA 3EBRA 3I4IA 3V64A 3NJVA 3VKNA 1BVP1 3K2OA 5FOBB 3JBG1 4AVTA 1SBEA 4RFRB 4YM3A 3B02A 5LBFA 1W28A 3C7OA 5LWBA 2W1SA 5DZGA 1MEC1 1QY4A 4NN0A 5JMOA 1F8VA 1DCSA 1IS3A 1HQNA 3JQXA 5KR7A 2JIGA 1LOFC 4QM8A 1PNFA 4XFIA 4BQ2A 5KC6A 2VGDA 4W8JA 5FK8A 3LE0A 3OD4A 2WYFA 2XWBB 2ZZJA 3DPRC 3RRDA 4ES9A 4GH4A 2PHRA 3RMXA 1X8EA 2Y33A 3D5OA 5FZ7A 5DUXA 2VVDA 3E5QA 3VD7A 4KQ7A 1PK6A 5F6LB 1NE6A 3UL2A 4A7YA 5L36A 1SCRA 5F3CA 5T52A 3S7IA 1FNZA 3PUIA 3SHRA 4A3XA 3FJSA 1RJ7A 4S2DA 3CZUA 1DQ5A 4AI9A 2VZTA 4HK9A 4Q1RA 3LOIA 3LWCA 2G4IA 2WT2A 4CEYB 2OX0A 3JUUA 2V5DA 3S30A 1QJZA 4XF3A 5LY2A 4BU2A 2QQMA 3B9IA 1OC1A 2ZX3A 1MS4A 3MZHA 3SISA 3OTFA 1PVC2 3OGRA
chains in the Genus database with same CATH topology
2RDRA 5LB6A 4NHXA 3OUHA 4NHYA 5LBBA 3OUIA 5C5TA 4Q5OA 4Y5TA 3DKQA 5DAVA 4NHKA 5HV4A 3W21A 2HBUA 3NNJA 4BQXA 2FCTA 5LBEA 5HV0A 5LBCA 2RDSA 5IAXA 5EQUA 4XC9A 3W20A 4BQWA 3KT4A 5LASA 3HQUA 5DAPA 2A1XA 2FCVA 4ZONA 4XAAA 4MHRA 4J25A 3GZEA 3MGUA 2OPWA 2FCUA 4XCAA 4UWDA 2RG4A 5IATA 4XACA 3OUJA 3HQRA 3KT1A 3NNLA 4BQYA 5EP9A 5DAWA 5DAQA 5LATA 2RDNA 5ERLA 3NNMA 5IAVA 4NAOA 2G19A 4NHLA 3KT7A 3GJBA 4IW3A 5LBFA 2HBTA 5DAXA 4XCBA 2JIGA 5A3UA 5M0TA 4ZPIA 2JIJA 5EPAA 4Y5SA 5L9BA 2Y33A 4KBZA 3BVCA 4MHUA 3ITQA 2G1MA 2RDQA 4NHMA 4NMIA 3OBZA 3EMRA 5L9RA 2Y34A 4JZRA 5L9VA 3NNFA 3GJAA 4XABA 5C5UA 2V4AA 3PL0A 5LA9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RDR A;  5LB6 A;  4NHX A;  3OUH A;  4NHY A;  5LBB A;  3OUI A;  5C5T A;  4Q5O A;  4Y5T A;  3DKQ A;  5DAV A;  4NHK A;  5HV4 A;  3W21 A;  2HBU A;  3NNJ A;  4BQX A;  2FCT A;  5LBE A;  5HV0 A;  5LBC A;  2RDS A;  5IAX A;  5EQU A;  4XC9 A;  3W20 A;  4BQW A;  3KT4 A;  5LAS A;  3HQU A;  5DAP A;  2A1X A;  2FCV A;  4ZON A;  4XAA A;  4MHR A;  4J25 A;  3GZE A;  3MGU A;  2OPW A;  2FCU A;  4XCA A;  4UWD A;  2RG4 A;  5IAT A;  4XAC A;  3OUJ A;  3HQR A;  3KT1 A;  3NNL A;  4BQY A;  5EP9 A;  5DAW A;  5DAQ A;  5LAT A;  2RDN A;  5ERL A;  3NNM A;  5IAV A;  4NAO A;  2G19 A;  4NHL A;  3KT7 A;  3GJB A;  4IW3 A;  5LBF A;  2HBT A;  5DAX A;  4XCB A;  2JIG A;  5A3U A;  5M0T A;  4ZPI A;  2JIJ A;  5EPA A;  4Y5S A;  5L9B A;  2Y33 A;  4KBZ A;  3BVC A;  4MHU A;  3ITQ A;  2G1M A;  2RDQ A;  4NHM A;  4NMI A;  3OBZ A;  3EMR A;  5L9R A;  2Y34 A;  4JZR A;  5L9V A;  3NNF A;  3GJA A;  4XAB A;  5C5U A;  2V4A A;  3PL0 A;  5LA9 A; 
#chains in the Genus database with same CATH topology
 3ZKU A;  2VOX A;  3OBR A;  4FPF A;  4IEW A;  3PTR B;  2DBN A;  2EAK A;  1I5P A;  4XUT A;  4WM8 A;  1ASJ 3;  4NR1 A;  1XYP A;  2E53 A;  4YG3 A;  2P2K A;  3VBH C;  1ZRC A;  1LGN A;  1NA1 B;  2ZBJ A;  3VD3 A;  3ACL A;  2CGN A;  4HG6 B;  3VV1 A;  4D7T A;  4GIQ A;  5AVP A;  3MYX A;  5FLJ A;  1DYK A;  2Y6L A;  3HOB A;  3IMN A;  4JDN A;  2RS5 2;  5HCB A;  4GMP 0;  4AEM A;  1CPN A;  3H3Z A;  4XC9 A;  4QWN A;  1N47 A;  3EXU A;  2HH9 A;  4HVR A;  1UIK A;  3NV3 A;  2XBO 3;  3AMQ A;  5F37 A;  5SV8 A;  3HWJ A;  4M0N A;  3HNY M;  4D6R A;  2HEY F;  4A45 A;  1PMI A;  1JUH A;  2VR4 A;  1W04 A;  1EYB A;  1Z7S 3;  2ZX1 A;  5EWS A;  3NQH A;  1KDM A;  3FC0 A;  2Q8O A;  2IXJ A;  2WS9 2;  5G05 L;  5DUU A;  1Y9Q A;  4O7X A;  3ZFF B;  4WBB A;  2X05 A;  1S0F A;  2HKX A;  2XXZ A;  3X29 B;  3ZYF A;  4IGQ A;  1HB1 A;  4MG2 A;  5FMO S;  3RFR A;  1IS5 A;  2VTX A;  3WQ1 A;  2UY9 A;  5LK5 A;  4ASM B;  1RUJ 1;  2FDG A;  1DDL A;  5FAX A;  4RS5 A;  4LKF A;  1O5U A;  5IK8 A;  1KRI A;  3BKZ A;  2ZEY A;  2G9G A;  2HWE 2;  4KWJ A;  3POS A;  3OGV A;  3ZFE C;  3I49 A;  1UIJ A;  5DAW A;  5DAQ A;  1SPP B;  4EV0 A;  4OI1 A;  1H8T B;  4L99 A;  1IG0 A;  3OPZ A;  1FI2 A;  2ARE A;  4F83 A;  1DIW A;  1ULD A;  1UZW A;  4COW A;  5KHG A;  4R9A A;  1LOA A;  2VMD A;  3NAP C;  1RUE 3;  1OT5 A;  1W9F A;  2ZPX A;  2DU0 A;  5JIA A;  2VU9 A;  3WF3 A;  3AL6 A;  5JDB A;  3D6E A;  1S1A A;  4QXH A;  3LSD A;  3VBS A;  3MDP A;  2G19 A;  3ZPY A;  4IEY A;  1NCR B;  1RMU 1;  2D5H A;  2VEC A;  4AAP A;  4V1P A;  2RJ2 A;  2HWF 1;  1REF A;  4M3C E;  5CFD B;  2RR1 2;  3CLP A;  3Q8F A;  5DAX A;  1XC6 A;  1ODN A;  1K5M A;  1KS4 A;  1QQP 1;  4J1X A;  3T1L A;  2XLF A;  2VTX J;  5F2W A;  2OVU A;  4YZ5 A;  5C4W B;  4PBO A;  4MXW A;  4AI1 A;  4FPK A;  2Y6K A;  3ZVX A;  3WR0 A;  1O7F A;  1JHJ A;  1TME 1;  1UMI A;  3HQX A;  3L9J T;  5CEH A;  4L0P A;  3J8F 3;  4B1M A;  4XET A;  2JG8 A;  3WEZ A;  3PJY A;  4Q4V 2;  4LBQ D;  4KWL A;  2JJ6 A;  4RSU A;  2R07 2;  4JGZ C;  1SMV A;  4E8C A;  4BK5 A;  5F3E A;  5JCT A;  3VDA A;  3AKS A;  4BIO A;  4QM9 A;  1OLM E;  1C3H A;  3OBZ A;  5CIR A;  4CDQ C;  2BGO A;  3MIF A;  3MW3 A;  1FOD 3;  4N8M A;  2KM2 A;  3T1M A;  2NPI A;  3Q9O A;  4N90 A;  4AQ6 A;  4TSV A;  4LHN A;  4ERO A;  1BEV 2;  2NM1 A;  1B35 B;  4CCN A;  2BOI A;  2ATF A;  3O1T A;  3I2I A;  1UF2 C;  4Q4V 1;  2GAU A;  5JZG C;  2I2S A;  2X29 A;  3I97 A;  4H7L A;  1QJY 3;  3GM8 A;  2QQI A;  1ALY A;  1UZY A;  4QGM A;  4PQQ A;  3I3D A;  4XZU G;  4QPG C;  3U75 A;  4CEY A;  3WW2 A;  3H8X A;  3M3I A;  4IEV A;  1ZA7 A;  3IAP A;  4UFJ A;  2CAV A;  1GKB A;  1ST8 A;  4SLI A;  2QDN A;  3AP4 A;  1JYX A;  4IEO A;  4P9I A;  3UV9 A;  2QNK A;  3KV5 A;  5FYU A;  3VBO B;  2X5I B;  4XUN A;  2Q8C A;  5A1F A;  5B4N A;  5HCH A;  5T3N A;  2YYO A;  4D94 A;  4FQ4 A;  4ZU4 A;  2D44 A;  1YQ5 A;  4LKE A;  1GOG A;  1NA1 A;  3MPP G;  5DMY A;  2WUH A;  2PAM A;  4XFC A;  1MS9 A;  1N3O A;  1GOF A;  1F15 A;  4BQ4 A;  3HQU A;  5FPX A;  5DAP A;  1YJK A;  3MIG A;  1DQ2 A;  5C3O A;  4COU A;  3LB9 A;  2OPK A;  1XNT A;  3I3B A;  3MLJ A;  1AYN 2;  1EAH 2;  2QQJ A;  5ACA 2;  3T2T A;  4IES A;  5EJ1 B;  4QX3 A;  4M3C B;  4I3G A;  3ZOI A;  3ZN4 A;  4NWV A;  5CKQ A;  2TUN A;  2D98 A;  4J25 A;  1RUO A;  1BMV 2;  3HNB M;  1FV2 A;  1PO1 3;  4NE9 A;  1HQL A;  3MW2 A;  2FMD A;  2A7A A;  4JKM A;  4Q4X 1;  1K12 A;  3B3Q E;  2YPD A;  4P9J A;  3ZFF A;  5FZG A;  1DLL A;  1TG7 A;  1QDO A;  1XB9 A;  5ACA 1;  3PUH A;  4JVA A;  1YQ2 A;  3WP3 A;  5FOJ B;  5EP9 A;  1CAX B;  3AYE A;  3K48 A;  1E57 A;  3N9L A;  1PVC 3;  1D4M 2;  5LAT A;  3T30 A;  3KM5 A;  5F5I A;  4Z2A A;  5HXV A;  4ZZ8 A;  3AVS A;  3VD9 A;  4Z07 A;  1MS0 A;  5ABJ B;  3DEC A;  2CHH A;  2JD4 A;  3LDB A;  1JYC A;  1F2N A;  3NNM A;  1MZ6 A;  2YGM A;  1XE7 A;  5JUV A;  4FO9 A;  3TEY A;  3M3C A;  1SPP A;  4QPY A;  3AP6 A;  1FYU A;  2WWS A;  2VCB A;  2ZGN A;  4Q4W 1;  1PHM A;  4MGZ E;  4Q4Y 3;  2IFW A;  4OCT A;  1H4H A;  1GWL A;  3O0X A;  4P08 A;  4C0H A;  4YGD A;  4URT A;  4LA3 A;  2P3K A;  5BY5 A;  1IKQ A;  1MVQ A;  2RS5 3;  5SV5 A;  2JDN A;  4WM7 B;  4GH4 C;  1QOT A;  3CF6 E;  5L7O B;  1JYI A;  2EF6 A;  3R4D B;  3VDC A;  1NCR A;  3ATG A;  5FJH A;  2ZAH A;  1ZRF A;  3EO6 A;  2VZO A;  5FPL A;  1CVN A;  5JOW A;  5CFD A;  2VMH A;  1UYX A;  4Y5S A;  1WD3 A;  4I09 A;  3KF5 A;  1J3P A;  2GH8 A;  5CVR A;  1ZRR A;  5L9B A;  3HD8 B;  1HRV 1;  5C4W A;  4BCU A;  1W9T A;  2WS9 3;  1AZD A;  2A6X A;  4NMI A;  5CKN A;  4JCK A;  4LBL A;  2E7A A;  1YYN A;  4BIS A;  2NQY A;  3WDU A;  1NE4 A;  5J7M A;  2W08 A;  2CV6 A;  4JRL A;  1AR9 2;  5FZ0 A;  2GDF A;  1RUC 2;  2A70 A;  3MI8 A;  2Q1Z B;  1UKR A;  5J37 A;  1SLA A;  2RM2 3;  1VRB A;  4WM8 C;  1JMU B;  4YVW B;  3VKF C;  5FKC A;  1LU1 A;  2EXJ A;  3TEZ A;  3PL0 A;  1ZBE 1;  2W46 A;  3DPR B;  4W65 A;  2HWE 3;  1DYP A;  2VC9 A;  2WT1 A;  5A32 B;  2Q8D A;  3WQ0 A;  3GHN A;  5AFB A;  3LA7 A;  5B4X A;  2AEZ A;  4D0Q A;  4CRQ A;  2HEW F;  2VBB A;  4PF1 A;  4WVZ A;  4U2A A;  2YB7 A;  2FHR A;  4CYD A;  1B35 A;  2VOK A;  4FPO B;  5A1A A;  1Q8Q A;  4Q0S A;  4OHY A;  4ATE A;  3E6D A;  3TN9 1;  2HBU A;  2B8M A;  1EV1 1;  1PIV 2;  3ZXL A;  1PM4 A;  2AGS A;  5BNO A;  3ZR6 A;  2BDR A;  4FI9 A;  2WZ8 A;  4AED A;  4HPK B;  4QPW A;  4X6Q B;  3MV0 1;  2JXA A;  2MPF A;  4TN7 A;  4UFM A;  2RDS A;  5IAX A;  4LBQ B;  5C8C C;  2RR1 3;  3KV4 A;  2W3J A;  2WC2 A;  3WIN E;  2BVB A;  2LRO A;  2QZ2 A;  2ZX4 A;  1AX2 A;  1PO2 2;  1Q5O A;  3C8X A;  4Z8B A;  3ZIX A;  2RS3 1;  2IXI A;  4HOO A;  2BU9 A;  4B4Q A;  4YM1 A;  3HT1 A;  2I45 A;  3O1U A;  5IFP A;  5GJ6 A;  3AJZ A;  3VBH B;  4HON A;  3E1F 1;  1H9P A;  4XJA A;  2IUW A;  5JPM B;  3O1O A;  1EP0 A;  3ZSE A;  4RQP B;  1CJD A;  2WFF 2;  1S0B A;  3M70 A;  1J1T A;  2A3W A;  3GZE A;  1S0D A;  4HXC A;  3NKT A;  4RS5 C;  4XQ4 A;  1OLQ A;  1NCQ C;  2OQ6 A;  1PX3 A;  3WHT A;  4A7K A;  1URX A;  3VHP A;  1VP6 A;  2JE8 A;  1SLB A;  2VM9 A;  3HMY A;  5FQ0 B;  1AR8 1;  2VZ1 A;  1EUT A;  1CES A;  4M3C A;  5LCW L;  2VCC A;  4NII A;  3WDX A;  4COY A;  1WCQ A;  2MHF A;  1JZ6 A;  4LBO A;  1BEV 3;  3U14 A;  3CDZ B;  3UK9 A;  3I2O A;  4B7K A;  1CJP A;  1SLT A;  5D1I A;  5A7P A;  4LO8 A;  4Q27 A;  5KC5 A;  3SKV A;  3VBS C;  1UY1 A;  2PN5 A;  3NW4 A;  4YFW A;  3OCP A;  5C70 A;  3K75 B;  3OY8 B;  4OI4 A;  1CZS A;  2C4X A;  2FDF A;  4CP9 B;  4J1W A;  4P9Y A;  2DTW A;  4D69 A;  1W05 A;  4UFH A;  1K5M C;  1TMF 2;  5L73 A;  5A6Q A;  5BNQ A;  3AKT A;  4NHL A;  2XUE A;  2DVG A;  2G9Z A;  2ZX2 A;  2VQA A;  4Q1P A;  1OLM A;  5A3L A;  5F7U A;  2Y38 A;  1FNY A;  3A23 A;  5IUQ A;  5ABJ A;  1WCD J;  1UWW A;  3BU7 A;  5DG2 A;  2QQO A;  3ZFE B;  5FRA A;  5IVJ A;  2AC1 A;  1H6X A;  3HAG A;  3QCW A;  2JG8 C;  1KEX A;  1NG0 A;  1MS1 A;  3B7M A;  4DEV A;  2D6P A;  5EPA A;  4QKD A;  1L3J A;  1LOG A;  4DQA A;  1TMF 1;  5B2G B;  3NAP B;  4KL1 A;  5FIX A;  4LOR A;  2VTF A;  1HJF A;  4WM7 A;  5T5L A;  1YEW A;  2OQ7 A;  4XJ8 A;  1AYN 3;  1EAH 3;  1VBC 2;  5L7O A;  3N36 A;  2Y60 A;  2P3I A;  1I1E A;  1PGS A;  1SAC A;  1RVF 1;  3ITQ A;  3OEA A;  2GN3 A;  1RUH 1;  3DL3 A;  3UJQ A;  1I6X A;  5HXM A;  1AL2 2;  2PHX A;  2P5B A;  4UT5 A;  5KBF A;  5GZC A;  1VRH 1;  2VBP A;  1S0G A;  1AXZ A;  2MEV 2;  2DCT A;  5APA A;  3J7M A;  3HT2 A;  4AOC A;  4URA A;  3ME2 A;  3V0A A;  3AZW A;  1X8M A;  4NUB A;  4UF0 B;  5FXX A;  4EN0 A;  1V6K A;  3D82 A;  3VL8 A;  3WF1 A;  4CEY C;  4IUG A;  1X33 A;  1JW6 A;  1XQN A;  2VOT A;  1VR3 A;  1BBT 2;  1LEN A;  1OF4 A;  1PVX A;  3OPT A;  3L2H A;  5E1R A;  4N7U A;  2KD7 A;  4EJR A;  3V0B A;  4QD2 A;  5T5J A;  2K46 A;  5C33 A;  1RUG 2;  1S2B A;  3IWZ A;  4QPI A;  1D4M 3;  1XYN A;  3NRU A;  5LBB A;  1AL2 1;  2VXR A;  3T2Q A;  4IER A;  1XNA A;  2WA3 A;  1GP5 A;  1RHI 1;  4JGZ B;  4YVW A;  2MEV 1;  2D6L X;  3DPR A;  5A32 A;  3SEE A;  1PMH X;  1QOO A;  4GWI A;  3P6B A;  4CDQ B;  1NA1 C;  3EB7 A;  3VDB A;  2R04 2;  4L8Q A;  1F4A A;  5CZK A;  5KHI A;  3GCX A;  1BHG A;  4Y1Z A;  4YRD A;  4ES8 A;  2B46 X;  3H8U A;  2XML A;  1RUG 1;  1D2Q A;  1R64 A;  2XHN A;  5F3I A;  1WLT A;  2ZKN A;  1ZZ8 A;  4LBM A;  2XVL A;  4FBF A;  5JZG B;  3AP7 A;  3IKW A;  4EE2 A;  3U0Z A;  1OA3 A;  4AHW A;  4QB6 A;  2YU2 A;  1COV 2;  1YLL A;  1J84 A;  4YAR A;  4LBQ A;  4ZXE A;  2CU5 A;  2D7F A;  4ZON A;  1W8O A;  1RUD 1;  3KD4 A;  3POE A;  1QJU 2;  2ZAA A;  3BOD A;  1VBE 2;  2JG9 A;  1SFY A;  2V72 A;  1UO9 A;  3U4S A;  4CCJ A;  3CZJ A;  4OUL A;  1HRI 2;  3DKW A;  1AR6 2;  5JI7 A;  3U4X A;  3I2D A;  3ZFF C;  3B01 A;  3MGU A;  3OGG A;  3LPF A;  4CSW A;  4XYX A;  3V65 A;  2YUE A;  4RR3 C;  5FCC A;  2XON A;  5DUW A;  2EIB A;  1X7N A;  3VUO A;  5A80 A;  1AR9 3;  1WUV A;  4YNI A;  4C90 A;  1RUC 3;  2WZR 1;  1COV 1;  4RQP A;  1RUF 2;  1YFY A;  2Q8E A;  1O3S A;  4XAC A;  4NAM A;  5DXD A;  2YRO A;  4JAA A;  4NO4 A;  1VBE 1;  2B5H A;  2QQL A;  4FFF A;  4GQ7 A;  1UZ0 A;  4HFS A;  4HN0 A;  5FZA A;  4C91 A;  5FP8 A;  5JWP A;  5LW9 A;  3BOW A;  4RHV 3;  2ADE A;  2GNB A;  4WV8 A;  2DV9 A;  3WNM A;  3H3U A;  3O1R A;  3M3E A;  1GFF 2;  1RUI 2;  3K3N A;  2YBK A;  5C3S A;  2HWD 2;  4JKL A;  5IAV A;  5K9Y A;  4PQ9 A;  1BCX A;  3CU7 A;  1DLC A;  1PIV 3;  2ORX A;  3AZZ A;  3B5L B;  4L11 A;  1ZVF A;  4EN6 B;  1QH7 A;  3O14 A;  1NCR C;  3OY8 A;  4MH0 E;  1WW5 A;  4ASL A;  1ONA A;  3ACF A;  3CJI B;  5CFD C;  4CP9 A;  1W2U A;  3BAL A;  3WF0 A;  1MZE A;  5JXH A;  1R08 3;  5GLT A;  2QVS B;  1W6M B;  2AUY A;  3IBM A;  1PO2 3;  3IMM A;  1G7Y A;  2A6V A;  3P1I A;  4AFA A;  4GKY A;  1S0E A;  2DF7 A;  4WVV A;  3RYP A;  2VCA A;  2Z79 A;  1U0A A;  3PUS A;  3UGF A;  4EYU A;  4QX8 A;  3TBD A;  2XJT A;  4A6O A;  1V9U 1;  1FAT A;  4AGV A;  5I91 A;  1VAM A;  2GC2 A;  4CUC A;  4R4Z A;  5BNP B;  2WFF 3;  2WSV A;  2XPJ A;  5DDJ 3;  3WNO A;  4AVC A;  1UYZ A;  1BK0 A;  4GH4 B;  2RHP A;  3RJ2 X;  3GJA A;  4XAB A;  2VJX A;  4CXX A;  1NKG A;  4QMA A;  2UY8 A;  2EXH A;  4BMB A;  1JYN A;  2GSY A;  4ATF A;  4XUO A;  1WWY A;  1Q8V A;  2A73 B;  2ZCW A;  4XUQ A;  5LZ6 A;  2X10 A;  3LOB A;  3WUD A;  5C7G A;  5HCF A;  1G9B A;  4Q8L A;  1H1M A;  4DFS A;  3VD4 A;  5E88 A;  1V6I A;  3FUO A;  3BGA A;  4UF0 A;  3UKN A;  4LBJ A;  3T0B A;  4AE2 A;  5BNO C;  3IDB B;  5FP9 A;  2XG3 A;  2ENR A;  4AED C;  3THP A;  2VMI A;  4Y4R A;  1NX9 A;  1W0P A;  4Y5T A;  2QCS B;  1PGW 2;  2K9Z A;  2BPA 2;  1VMF A;  2JKB A;  1H1A A;  3R6S A;  4XBN A;  3NNJ A;  3OYW A;  4BQX A;  2YGL A;  3LPG A;  5F2S A;  2BER A;  5LBE A;  3WW3 A;  5LBC A;  1ASJ 1;  4QU1 A;  3T4V A;  3EJK A;  4LKS A;  2ZEX A;  4WM8 B;  3EQE A;  1UX7 A;  3BTY A;  4MZU A;  4LNV A;  3FFQ A;  2YPJ A;  2EID A;  3AJY A;  4ZXK A;  4CDQ A;  1LHN A;  1D0G A;  1D7P M;  1DQ1 A;  1V00 A;  1VMJ A;  1JOB A;  4B29 A;  2J1T A;  1OVS A;  1RJ8 A;  3U78 A;  1ODM A;  2CWM A;  2HWB 2;  4EN7 B;  1LKN A;  4OI2 A;  2LW8 A;  1LHW A;  4GJZ A;  5A7Q A;  2ZOE B;  1VBC 3;  3I8T A;  3ZPO A;  3GAL A;  5TSW A;  2BBA A;  3PTY A;  4CUG A;  5ANQ A;  5FYS A;  4IGP A;  4F3J A;  2AZ5 A;  2DYC A;  2A3Y A;  3E97 A;  1D2S A;  5C8C B;  3LEM A;  3ZXF A;  5A1L A;  1GQG A;  4UWD A;  2ZMN A;  4DMI A;  2F4L A;  4FPC A;  5LA0 A;  1HXS 2;  2QDR A;  2WFP A;  5I0T A;  2X09 A;  3LKJ A;  1K42 A;  3HQR A;  4NID A;  2W94 A;  1FX5 A;  2OII A;  1BBT 3;  3JD7 2;  3KQR A;  2YC4 A;  4GUL A;  2J1S A;  3I2K A;  3WDW A;  4YW6 A;  2JWP A;  2VL4 A;  3KHC A;  1OD3 A;  2Q5T A;  5C9A B;  4OQ8 A;  1Y43 B;  1OMI A;  3AM2 A;  4DXT A;  5ABJ C;  1YI9 A;  4OVE A;  2QJV A;  4YFZ A;  1NCQ B;  3H3L A;  4PLN A;  1VBA 2;  4RYD A;  5G04 L;  1JYV A;  1M4W A;  2VY0 A;  4NPR A;  2Y0I A;  2R04 3;  3GBF A;  3FLT A;  3HIF A;  3Q8B A;  5IK4 A;  1SFP A;  3J7H A;  1I3H A;  4AVA A;  4BLJ A;  3URF A;  5E16 A;  4XXP A;  4IEU A;  5C6C A;  4WM7 C;  1T6G C;  3JBG 2;  5K8S A;  2D6N A;  3AB0 A;  5L7O C;  2O8O A;  2UYA A;  1QXR A;  1MEC 2;  1XJA A;  4AI2 A;  4AVB A;  1F5F A;  3SC7 X;  1PX4 A;  2Z4F A;  3CJI A;  4Q2F A;  4CDU A;  1GNH A;  4NOT A;  2VW1 A;  3INA A;  3I2G A;  1QJU 3;  3A21 A;  2R06 1;  5D21 A;  5H9Q A;  4CZS A;  1CR7 A;  4HMZ A;  3KWV A;  2E26 A;  4HN1 A;  4LO7 A;  4Y20 B;  2VAU A;  1HRI 3;  3S6P A;  2ZHN A;  1AR6 3;  3OD0 A;  3T09 A;  4MXW B;  3EMR A;  5FZI A;  2VOV A;  5LRR A;  2Q4S A;  1XRU A;  1U12 A;  2TNF A;  3J8F 1;  4K3U A;  2IFR A;  4DIQ A;  2GN7 A;  3FLP A;  1YXW A;  1U5Y A;  2WN3 A;  4QPI C;  5DAB A;  1JYT A;  2JG8 B;  5BNP A;  2V4A A;  3I3M A;  1R09 2;  4YVW C;  2BP6 A;  3ZDS A;  2HYK A;  3ZN5 A;  4CVU A;  1FPN 1;  3PLQ A;  4BYY A;  4BQ1 A;  4IE4 A;  2C24 A;  5FRE A;  2VXJ A;  1FV3 A;  1QJF A;  3ETP A;  4GWM A;  4MGY E;  5DAV A;  4N9H A;  3W21 A;  2JDP A;  2D5F A;  5CYY A;  4DXZ A;  4HKW A;  2HWD 3;  3POG A;  4DUX A;  1VBD 1;  2LUW A;  3VD5 A;  4J6G A;  1WMD A;  2B9V A;  2WN2 A;  1R09 1;  3DXT A;  1DGR A;  1NLS A;  3R4U A;  4K8R B;  2PLV 1;  2BZD A;  5EJZ B;  4LHL A;  4QQP A;  3D0J A;  1BXH A;  2GU9 A;  1MZ5 A;  3HPN A;  5CAD A;  2BJS A;  2XH6 A;  3E6B A;  3IDC B;  3MFC A;  4Y4Y A;  1O4Z A;  1KIT A;  2VZV A;  2WWU A;  3CEW A;  5A3O A;  5FKB A;  2JG9 C;  5C8W A;  1JOP A;  4DRR A;  2PA7 A;  3KVB A;  2JDZ A;  4PIZ A;  3VB9 A;  4BXF A;  4H14 A;  3ZSL A;  3S57 A;  4I30 A;  4YGE A;  3IB3 A;  1H9W A;  2D3R A;  1U5Z A;  2IXH A;  2J1U A;  4JC1 A;  5FYM A;  5CAZ A;  4YM0 A;  5FZE A;  3ZXJ A;  2ZX0 A;  1L7Q A;  4RQP C;  2B39 A;  4BA6 A;  1YC6 1;  3J9S A;  3A4U A;  3IAQ A;  4YG6 A;  1OH3 A;  4AQ2 A;  2HWC 1;  3PU8 A;  1O8P A;  4DY3 A;  1OH4 A;  4LO6 B;  2ZGM A;  4YG0 A;  1T6B X;  3C7H A;  2VUL A;  1N3P A;  2A6Y A;  3LDR A;  4BHP A;  4KWK A;  5FY0 A;  3PJQ A;  5FZ4 A;  1YFW A;  3T4H B;  3JB8 A;  2VMG A;  1LOE A;  1UL9 A;  1RUJ 2;  2VOW A;  5C8C A;  3ZN6 B;  3D0S A;  2RDN A;  4PI0 A;  1ULE A;  2UYB A;  2IWG B;  2PEL A;  4BQ3 A;  4A41 A;  2H6B A;  5CA6 A;  5KXB A;  1H2L A;  3QOP A;  1S0I A;  5IVF A;  3SLI A;  5K4L A;  3ES4 A;  4BLI A;  1YO8 A;  3U10 A;  3VBF A;  3BIE A;  4QB2 A;  1XU1 A;  3KT7 A;  1C5I A;  4K1Z A;  4RR3 B;  3IM0 A;  5J3U A;  4IW3 A;  3BTA A;  1UNB A;  2DU1 A;  4P02 B;  1SLI A;  2Q1F A;  5C9A A;  1AYM 1;  5EHD A;  3BPZ A;  4Q0U A;  4QX2 A;  3H9A A;  4YZ3 A;  1LB2 A;  1D4V B;  3GF6 A;  1NCQ A;  1NY7 2;  1RMU 2;  1SZB A;  4GAZ A;  2V4V A;  2HWF 2;  1LGB A;  1KQR A;  4EWD A;  4LK7 A;  4A3Z A;  2ZMK A;  1QQP 2;  2ZZQ A;  1C8M 1;  3OGS A;  1CAU A;  5FP3 A;  1V6L A;  1GNZ A;  2YG0 A;  1LTE A;  2RJL A;  2HWB 3;  1RC6 A;  5F39 A;  1AJO A;  2K0G A;  5BPX A;  3FN9 A;  5FXZ A;  4NHM A;  1PZ7 A;  4AEK A;  1POV 0;  2GC1 A;  2PHL A;  1TME 2;  1JOJ A;  4W6X A;  3LDK A;  4Q0Q A;  5HI0 A;  1H30 A;  1NY7 1;  3JQW A;  4FXG B;  4X8N A;  3WDT A;  3WQB A;  3N9O A;  4FTS A;  2Y34 A;  2O0O A;  1C8N A;  4AQT A;  1E5H A;  1GZT A;  3Q8E A;  2W68 A;  3MIH A;  2VBD A;  2BOJ A;  4LR4 A;  2GMP A;  2IC1 A;  3LFI A;  1HXS 3;  4Y20 A;  3TNP B;  3LQC A;  2J42 A;  3ZXE A;  1ZRE A;  5LRS A;  5FUI A;  2NLR A;  4GAL A;  2XJR A;  1F31 A;  1RUN A;  1VJ2 A;  3JD7 3;  1QU0 A;  1QIQ A;  2DUQ A;  3N9Q A;  4XFB A;  4CCK A;  1LOB A;  1SLC A;  2YV8 A;  2IVI B;  3W59 A;  2ZS6 B;  4Y26 A;  5H9P A;  4LJH A;  4G4F A;  5F1R A;  3RYR A;  4QKB A;  4WVM A;  3DYM A;  2IXK A;  1RXG A;  4QU2 A;  4JRA A;  5IVV A;  3W5M A;  2Y0O A;  1UOG A;  2P6C A;  3M1H A;  1AR7 3;  2QTW B;  2XKO A;  2W9X A;  1VBA 3;  3ZXG A;  3N9M A;  2R6Q A;  5FXW A;  1PMJ X;  1W2O A;  1SEF A;  2B7Y A;  3WD5 A;  1OQD A;  4XIL A;  2C1F A;  2D93 A;  2E31 A;  4D7Y A;  2OA2 A;  4CCC A;  2R49 A;  1NOV A;  4I2O A;  1YHF A;  4YZ2 A;  1VAK A;  3JBG 3;  2ZHM A;  1UW8 A;  4K21 A;  2A1X A;  4V2V A;  4XBL A;  4XTP A;  2QQK A;  1MEC 3;  1W8Z A;  5BNO B;  4FP3 A;  1KFU L;  4AED B;  5EYX A;  1A6C A;  1CIW A;  3A0K A;  3VZN A;  2VUD A;  3N9N A;  1DHK B;  1Q8S A;  2CL2 A;  1BLZ A;  4QAW A;  2VNO A;  1F9K A;  2AEN A;  4IV3 B;  3RZG A;  1WBL A;  5A6X A;  4B7E A;  3LFM A;  4OZX A;  3N9P A;  4NIG A;  2CTV A;  3WDV A;  5EZW A;  2KA3 A;  1CAW A;  5E89 A;  5H9R A;  1APN A;  2XJU A;  3AMN A;  3KHB A;  3NJY A;  3O0W A;  3DN7 A;  4PBP A;  2WO2 A;  3T2O A;  3M8L A;  1B09 A;  1H2K A;  5F6K A;  1DQ6 A;  2P6H A;  5H9S A;  1ZBA 1;  2X53 S;  5T50 A;  4Q4X 2;  2ZEW A;  5I8Y A;  1UPI A;  1IG3 A;  2KXL A;  1JOD A;  4XHX A;  4BWO A;  1EY2 A;  5LEK A;  5KHJ A;  4AFM A;  4QDR A;  2O14 A;  4JTN A;  4LOS A;  1R1Z A;  3D8C A;  5FLI A;  2W91 A;  3POJ A;  4OUE A;  1MVE A;  1WW4 A;  2W39 A;  3H7Y A;  3ZN6 A;  5GAL A;  4O9G A;  3C7E A;  4UFK A;  3ZX7 A;  2YY1 A;  4KG0 A;  1W6P B;  3T0A A;  5CU1 A;  2PAE A;  4NPL A;  5A3U A;  4ZPI A;  1V6O A;  1W03 A;  5GLW A;  5JOZ A;  4Q4W 2;  3CJI C;  3OF1 A;  3H1Y A;  4CDU C;  3LZZ A;  4ISQ A;  1LJ7 A;  1J58 A;  1PNG A;  1JUI A;  3AZX A;  3BYW A;  4RR3 A;  1DFQ A;  4K1Y A;  4X8P A;  1G9F A;  3B69 A;  4DB5 A;  1OUS A;  2VD7 A;  3KSC A;  1YQ6 A;  1AHS A;  2E7T A;  4OLL A;  4XVH A;  1PGL 1;  2E9Q A;  1N1V A;  4LPL A;  3ILN A;  1OF3 A;  1HKD A;  3K77 A;  4R4X A;  3JXS A;  2FD8 A;  1YIF A;  2UUR A;  1CZV A;  2ARA A;  4LXL A;  3WOG A;  3AFK A;  3K3O A;  1HRV 2;  4CDW B;  4EZ4 A;  3FUQ A;  5BNP C;  1W2A X;  2DFB A;  2GAL A;  2LAL A;  4IV1 A;  3E6C C;  4AFD A;  4IDZ A;  4B1L A;  1GR3 A;  2VW0 A;  3SH5 A;  2YBP A;  3IZO A;  2F6B A;  4QKF A;  1AUY A;  3WCS A;  2WSU A;  1OFS A;  3PU3 A;  3VHR A;  1LHU A;  4NHX A;  5FY8 A;  2JDH A;  3N3H A;  2XOM A;  2E6V A;  1RUJ 3;  3AKQ A;  3I2H A;  5JSP A;  1FMD 1;  4QHO A;  3OUI A;  1RED A;  2WAO A;  5FO7 B;  4Y22 A;  5A6Z A;  2H0B A;  3ZMN A;  4HLT A;  4FTB A;  2B9U A;  1TQ5 A;  3B93 A;  3V0A B;  1ZBE 2;  4IE7 A;  2HLE A;  4MX3 A;  2Z5W A;  4ONU A;  3VKM A;  1W8N A;  5IJR A;  4H55 A;  2RS1 1;  2E7Q A;  2PAK A;  4HSL A;  5LA2 A;  3ZYH A;  3BUC A;  4XF1 A;  4K7J A;  3V0B B;  3N7J A;  3MFA A;  4IEZ A;  4ARX A;  4QPI B;  2QQV A;  1EPZ A;  1J59 A;  3LIH A;  1DBN A;  1IQD C;  4YVS A;  3TN9 2;  1ND2 C;  2Y6J A;  1EV1 2;  4H3W A;  4AEJ A;  5IVB A;  1UOJ A;  3LEG A;  3NWK A;  3WG3 A;  1RMU 3;  1HW5 A;  3UKT A;  4NWW A;  3VHN A;  3AKP A;  4AHZ A;  2HWF 3;  5C71 A;  1ZM1 A;  3PVB B;  4UFL A;  1ACC A;  1QQP 3;  2A5Z A;  5FZ1 A;  3VDD B;  2Q30 A;  3D4K A;  1X82 A;  5JSR A;  2RS3 2;  4MO3 M;  1BQP A;  3ON7 A;  3GZT B;  5JOY A;  1HV1 A;  3SCH A;  3WY6 A;  4AR2 A;  1TNF A;  3A0N A;  1TME 3;  4P00 B;  5EJ3 A;  2V09 A;  5IHR A;  5LK7 B;  3ZYI B;  3BIW E;  3VZO A;  5GLU A;  1VBB 1;  3TB0 A;  3KCC A;  3DYP A;  4JGY B;  4DZG A;  3MUY 1;  4LBK A;  1S0C A;  2JB4 A;  4P9L A;  5FFO C;  4MGK E;  3P3N A;  2JG9 B;  4IV3 A;  2D3P A;  1MPX A;  5CG8 A;  1NAE A;  1AR8 2;  1JTZ X;  3ZYR A;  2PYT A;  3G6J B;  3V56 A;  3VBF C;  1W8F A;  1NQD A;  2Q1M A;  3LEI A;  5FYB A;  3SH4 A;  1ZRI A;  1PM7 A;  2RMU 1;  2ADD A;  2YBS A;  4G3Y C;  1IOA A;  4MGS A;  1JZ4 A;  2JDK A;  5C9A C;  4Q4V 3;  3ZO0 B;  3N4M A;  2R07 3;  1TZO A;  3POB A;  4HK8 A;  3ALQ A;  1PZ9 A;  3IDA A;  4FFH A;  2ZGU A;  4L92 A;  4GMP 1;  2ZML A;  1NXM A;  5EFU A;  2H0V A;  2BV4 A;  2PFW A;  3CJX A;  5GLV A;  1Q56 A;  2VZR A;  1A8D A;  1ULO A;  2FQP A;  3WG2 A;  1LHO A;  4DEQ A;  2WNE A;  2HEV F;  4GA9 A;  3ASI A;  4I3P A;  1XXN A;  1K3I A;  2H6C A;  1Y9M A;  5I0R A;  1C1L A;  3UNP A;  4MYE A;  4NRM A;  1YI7 A;  1ZNP A;  1W6P A;  4P14 A;  3RG0 A;  4DPN A;  1ULG A;  4GXL A;  4TWT A;  2VQ0 A;  5IVE A;  2CDP A;  4M01 A;  1AXY A;  2EIG A;  1BK1 A;  2OT7 A;  3ZYB A;  2AYH A;  4YSF A;  1QJE A;  1OXC A;  1R08 1;  1W3V A;  3ZLI A;  3J4U H;  1SBD A;  1WW6 A;  1DP0 A;  4OZO A;  2BGP A;  4JZR A;  4QQL A;  5FZK A;  3K4D A;  1RVF 2;  4Y24 A;  1RUH 2;  1QJX 1;  4LIT A;  4M00 A;  2QQP A;  3WNX A;  2W0X A;  1VRH 2;  3U37 A;  1SBF A;  3VZK A;  4CDW A;  1YUD A;  1Y9G A;  4KI5 M;  3KS7 A;  3QLQ A;  5JXG A;  2C26 A;  5ACA 3;  4YZ1 A;  1POV 1;  2ARC A;  2EA7 A;  4XUP A;  3WP5 A;  2DCZ A;  5J98 B;  3RZJ A;  2C6S A;  1UMZ A;  4YW7 A;  1O5L A;  2XKP A;  4P9W A;  5F3G A;  1C28 A;  2FCT A;  1QKQ A;  2JEC A;  2VMC A;  2YMZ A;  3MPB A;  4HVO A;  4AZZ A;  1RHI 2;  4S2F A;  3K51 A;  3BPS A;  2XB6 C;  1DF0 A;  2WBK A;  3I2F A;  3MIE A;  2XLA A;  4S2G A;  2Y26 A;  1IGO A;  4LUL A;  2UWA A;  3W20 A;  1BKZ A;  2IXC A;  5JI9 A;  2ZHK A;  2WNO A;  4IET A;  1STM A;  1V6M A;  4Q4W 3;  4ZU5 A;  3RZZ A;  4O65 A;  3UKV A;  5JAX A;  1UY0 A;  3MLK A;  1GP4 A;  5JSO A;  3OYW B;  2GP3 A;  2R1B A;  4ASK A;  4NVP A;  5BXX A;  1VMH A;  3F2Z A;  3VBU A;  4E4S A;  1LCL A;  3OJB A;  5DZE A;  1XNK A;  3B00 A;  2DCY A;  1E5R A;  1V6J A;  1EPW A;  1RUD 2;  3USU B;  2ZGQ A;  1S0J A;  5C3Q A;  4LK6 A;  4KNC A;  5DG1 A;  4DUW A;  1HRV 3;  4Z82 A;  3VDD A;  4LTA A;  4ZKT B;  5IAT A;  1NQJ A;  2QUO A;  4KBB A;  4BQY A;  2Z2S B;  4FCA A;  3ECQ A;  2WZP P;  3N7K A;  3BCW A;  4GB3 1;  4IE0 A;  4P9G A;  4PDW B;  4BH9 A;  4BZ4 A;  4QQ2 A;  1IPK A;  3WF4 A;  1IQA A;  4AGG A;  2YZ4 A;  3CO2 A;  1R1A 2;  1YRZ A;  3I54 A;  3U1X A;  1WBF A;  2WZR 2;  1KGY A;  3RGB A;  3ZSK A;  2P34 A;  1KXG A;  4JGY A;  1FT9 A;  4Y5Z 0;  1BJQ A;  3NV4 A;  1W6O B;  3POY A;  1ZBE 3;  2Q0A A;  1FXZ A;  4NAO A;  1UZZ A;  3PVN A;  2VZP A;  3BB6 A;  5IFT A;  3WG4 A;  1DZQ A;  4BK4 A;  5AC9 1;  1HIX A;  3O1V A;  1ENS A;  1CON A;  3WF2 A;  5EIY B;  2OUJ A;  5IT6 A;  3WLU A;  1K45 A;  1R1A 1;  1YWK A;  5M0T A;  3TN9 3;  2E33 A;  1EV1 3;  3WP4 A;  5I93 A;  1UU5 A;  3DUI A;  4XJZ A;  3WDY A;  1YFX A;  2XLG A;  2ARX A;  2BWA A;  3TEX A;  2XJP A;  4GWJ A;  1C1F A;  2PHT A;  1G86 A;  3L2Y A;  3AKR A;  2RS3 3;  2GC3 A;  4IV1 C;  4S2H A;  2YFZ A;  3PVE A;  3W9A A;  3KCY A;  3KQ4 B;  5KXC A;  4UBH A;  4OMD A;  4XZP A;  3B9C A;  1V9U 2;  1QWR A;  1VB4 A;  4QX5 A;  1IS4 A;  2FDH A;  4PI2 A;  5JMC A;  2NYY A;  4CDU B;  3LEK A;  4BDV B;  3FFZ A;  5FZ3 A;  5CNA A;  3WCR A;  4E4H A;  4LE3 A;  3U11 A;  2Y64 A;  1A8M A;  1AR8 3;  3AYA A;  1IHM A;  5C5T A;  3FMG A;  3MBW A;  5HPO A;  4OYU A;  5T55 A;  4CCM A;  3MF6 A;  3OGJ A;  2FZ2 A;  2CWS A;  3DKQ A;  4MXV A;  4RGK A;  2PMW B;  4NHK A;  3WUC A;  1FAY A;  3FWE A;  1RIR A;  4YVS C;  1V0A A;  3TAY A;  5J1X A;  4IEQ A;  1WZX A;  3O5S A;  2EAA A;  4UYB A;  2ZGL A;  4OMC A;  1W2T A;  2VZU A;  4PIX A;  1KS5 A;  3BOP A;  3HNM A;  1JXN A;  5KWR A;  1UX6 A;  3WNK A;  4AG4 A;  3O1P A;  4DRV A;  3KGL A;  1H1I A;  4NRQ A;  1ASJ 2;  4G9S B;  3LGR A;  2FCV A;  4ZS3 A;  2PQQ A;  1DZT A;  4CPB D;  4E2S A;  2JDA A;  1JI6 A;  1XNC A;  2P3J A;  1JH5 A;  4QT6 A;  5AFE A;  1GSL A;  5F5C A;  1SG3 A;  3H7J A;  4OQ9 A;  2YXS A;  3SMH A;  4XAA A;  1X9T A;  4YW3 A;  5K7P A;  2WQ8 A;  3RZL A;  2GP5 A;  4HKL A;  4A7Z A;  2XJQ A;  1NZC A;  1U5X A;  4N43 B;  4BOW A;  4YM2 A;  4QB1 A;  2FMY A;  2NMN A;  2W1U A;  1TMF 3;  2D3S A;  5A7W B;  1SDD B;  3O12 A;  1I9R A;  4E27 A;  4IV3 C;  5IYY A;  2IXL A;  3MV1 1;  1ND2 B;  2PHU A;  2RG4 A;  4XHB A;  4CU6 A;  2O1Q A;  1RVF 3;  5J48 A;  3RZH A;  1WA6 X;  1RUH 3;  2WYS A;  1VAL A;  3LF7 A;  4JQR A;  1Z7S 2;  2DBI A;  4R9B A;  4RD7 A;  1VRH 3;  4XJW A;  1LHV A;  1W2N A;  2YC0 A;  3USU A;  4AK3 A;  3RYK A;  1OQ1 A;  5ERL A;  5GM0 A;  2UU8 A;  3NMB A;  4FPH A;  4R8H A;  1UCX A;  1A34 A;  1DGL A;  1OPM A;  2WA4 A;  1QDC A;  4XFH A;  5DPN A;  2DUP A;  1LEM A;  3WNN A;  1HB4 A;  5A7N A;  2XBO 1;  2ZGS A;  4FPL A;  4P5H A;  4PDW A;  3WSO A;  3ZDV A;  4DXR A;  3KCX A;  5JR2 A;  5DN2 A;  1MAC A;  4CXW A;  1AL2 3;  3UT0 A;  1LOD A;  1Z7S 1;  2HBT A;  4OUS A;  3M3Q A;  5T5O A;  1RHI 3;  1IZ3 A;  1U5I A;  2MEV 3;  4XUR A;  3PVO A;  3IN9 A;  3IPV B;  1W6O A;  4FFG A;  3ELN A;  1JYW A;  2ETE A;  3MLL A;  4Y1V A;  3UES A;  4Q26 A;  1OPO A;  1MQT C;  4O61 A;  3BTZ A;  4CCD A;  4YYO A;  1GWK A;  4M4P A;  2ILM A;  2X8K A;  3VBF B;  1XU2 A;  3MEP A;  3MHZ A;  5JOX A;  1CGP A;  3ZYG A;  3T3Y A;  1RUG 3;  3FBY A;  4ZU7 A;  2JB8 A;  2VUA A;  5A3M A;  4JV4 A;  4P9X A;  4ISR A;  4KU7 A;  3SIT A;  1AL0 G;  2L9L A;  5FJK A;  5FZ9 A;  3WW4 A;  4N7I A;  1LED A;  3TRS B;  4B8E A;  4XIK A;  1KJR A;  5JR7 B;  4AI0 A;  2JDY A;  5CFC C;  1RUD 3;  3ZR5 A;  1Y4W A;  1YQC A;  4H7M A;  2R06 2;  3W58 A;  3POW A;  3WV6 A;  2GME A;  3ACI A;  4CDW C;  4RA0 A;  3VL9 A;  1RUE 1;  2WNU A;  2VVE A;  1CAU B;  1UOF A;  1DYO A;  4BPZ A;  2PQS A;  4E2Q A;  2PXJ A;  1GZC A;  2C5D A;  1JHN A;  1Z78 A;  2RDR A;  2D6K A;  4ZS2 A;  3UGG A;  3J8F 2;  4FT8 A;  1SDW A;  4FPE A;  2ZGO A;  4NHY A;  4HL0 A;  3DGT A;  1PZ8 A;  1W9W A;  2PHW A;  3ILR A;  4MLO A;  4P5Y A;  2WZR 3;  3NV2 A;  1COV 3;  5A33 A;  1TVG A;  3ILF A;  2BTV C;  2P4E A;  4NIA A;  1CPM A;  1P8J A;  2C9K A;  1O59 A;  1O6U A;  3Q8A A;  4FQZ A;  1W8U A;  4HBN A;  5IVC A;  2JDM A;  3FHA A;  3I59 B;  4K8F A;  3HN3 A;  1FPN 2;  1GWM A;  1VBE 3;  4LQR A;  2OYZ A;  1W90 A;  1VIW B;  4TLG A;  4CDX B;  1WCU A;  2DVF A;  4EN9 B;  1US3 A;  1A78 A;  2YFU A;  4XAE A;  1JU3 A;  1ZX5 A;  3FZ3 A;  1M06 G;  4IQP A;  2ZHL A;  1CAV A;  1C5H A;  3O7O A;  1NUK A;  4XXA A;  1QJY 2;  1RUF 3;  1VBD 2;  4WVM B;  5FYC A;  5A3T A;  1UKG A;  5C3P A;  4XOG A;  3LA3 A;  3VBU C;  2GNT A;  3CL1 A;  2PLV 2;  3K4A A;  4LHS A;  4OHZ A;  3CHX A;  4FPJ A;  1KDK A;  3UET A;  1FOD 1;  4OUM A;  2BEO A;  3IT8 A;  3T0D A;  1YCI A;  1OQE A;  1ULP A;  4FOW A;  1JZ3 A;  2NN8 A;  2ZGT A;  1JZ7 A;  3H42 B;  4C1X A;  3QBQ A;  3ORJ A;  3AC0 A;  1JZ8 A;  4U36 A;  3VDD C;  3MW4 A;  1RUI 3;  4ET7 A;  2BUK A;  5J36 A;  1ZRD A;  4CA9 A;  3OB8 A;  4I0A A;  1GP6 A;  1QJY 1;  2A6W A;  4XDP A;  2JKX A;  1TEI A;  4PCR A;  3ZSM A;  1V9U 3;  5FP4 A;  2VE1 A;  1GQP A;  4KU8 A;  3KGZ A;  5L19 A;  5K0U A;  1AF9 A;  4MGT A;  4V2W A;  2NMO A;  4ZZ5 A;  4N43 A;  3NNL A;  4XIO A;  4JGY C;  3ZKY A;  5FPB A;  5KXE A;  5A7W A;  3VZJ A;  4DUV A;  2HWC 2;  1XOY A;  2XHK A;  5D8A B;  4MUV A;  4AQS A;  4CEW C;  1ND2 A;  1HB3 A;  4YLZ A;  3WNP A;  5ANN A;  1G9A A;  1DGW A;  3DV8 A;  1CAW B;  5FP7 A;  5FYV A;  1PO1 2;  2VNG A;  2XL7 A;  3RZK A;  1S2E A;  3SEP A;  2EVX A;  2ES3 A;  1OUX A;  1SLL A;  3M2M A;  4RFT 0;  2N7G A;  1REE A;  2YDE A;  3H50 A;  5FUN A;  3RWK X;  2FDJ A;  4W50 A;  2XR4 A;  4GJY A;  4FTE A;  1XPW A;  5FY4 A;  4XBQ A;  5FZD A;  2BNM A;  2P37 A;  5FBJ A;  3OEB A;  2WIN B;  2DCK A;  5FZO B;  4CU9 A;  1ENR A;  5IWF A;  1GLH A;  4IXL A;  2WNV B;  2V73 A;  3LA2 A;  1PO1 1;  3III A;  1AYM 2;  4QX0 A;  4CCE A;  1G9C A;  2D6O X;  4KBZ A;  3IPV A;  4BQ5 A;  4PLO A;  5DQ0 A;  2AEY A;  2BQP A;  3GBW A;  4YW5 A;  4AVV A;  1OSG A;  4Q4Y 2;  2VZ3 A;  4DS0 A;  4PJY A;  1C8M 2;  5FY5 A;  1PVC 1;  4QXK A;  4XW3 A;  1BYH A;  1QNY A;  2BBV A;  1RTV A;  2CSG A;  4K40 A;  1W8W A;  2MNG A;  1C57 A;  2DVD A;  1UOB A;  2DTY A;  5FBZ A;  3RS6 A;  3NJZ A;  3THT A;  1EUU A;  2ZJC A;  3MO4 A;  1W6Q A;  1OOP B;  2W2I A;  4EZH A;  5FO9 B;  2XVK A;  4QGN A;  4CTE A;  5LA9 A;  1UY3 A;  3AFG A;  4EN8 B;  4EQV A;  1QF3 A;  1LUL A;  4CUB A;  2O8Q A;  1DU3 D;  1UY4 A;  4Q4Y 1;  1O3R A;  1J3Q A;  1GQH A;  3LAG A;  4W6Y A;  4YWA A;  4D8M A;  3VBR C;  2VPV A;  1UZV A;  5I8S A;  2RS5 1;  3GCW A;  1RIT A;  1NYW A;  4IV1 B;  4GD4 A;  4QX7 A;  4TZD A;  4AAX A;  5FPZ A;  5JLV A;  1XE8 A;  2WDB A;  5HCA A;  2VUC A;  1F4H A;  4AW7 A;  2RM2 2;  5FV3 A;  5GLZ A;  3AZV A;  5DZF A;  4Y22 B;  2OZ6 A;  3I59 A;  4BQW A;  3ZXK A;  2WS9 1;  1OUR A;  3ACH A;  2AH2 A;  3C7G A;  5JXI A;  4CDX A;  2EIC A;  5FLH A;  2JEM A;  1MS3 A;  3VKO A;  1W0N A;  1H8V A;  1CD3 G;  3MIC A;  1V6N A;  2KR2 A;  4MSV A;  3B94 A;  1ND3 B;  3ZYJ B;  1H2M A;  3SH3 A;  4AI3 A;  1L7R A;  2VG9 A;  4Y1U A;  4N9I A;  4BME A;  3H1M A;  2RM2 1;  4BM8 A;  4IEX A;  2ERF A;  4YVS B;  1DGR N;  1OVP A;  3JCI A;  5FMD A;  2W1Q A;  2HWE 1;  4AFB A;  1LR5 A;  2QFE A;  3VZM A;  4HVQ A;  5GKA C;  4R9D A;  2UWC A;  4XCA A;  2WT0 A;  1UD1 A;  2ZKL A;  3JZV A;  2R06 3;  4IE6 A;  3C3V A;  2TBV A;  3WXP A;  3SKJ E;  3BTX A;  1H6Y A;  4ITC A;  3KF3 A;  2P3Y A;  1QGL A;  3MF9 A;  1ZZC A;  2OUH A;  1ZZB A;  1Q43 A;  2BNO A;  2BYV E;  3CQO A;  3H1W A;  2GZW A;  1GOH A;  3CKH A;  2SLI A;  1WLW A;  4PDW C;  4QHB A;  3RDI A;  3BI3 A;  3NO8 A;  5EYY A;  2RR1 1;  4N53 B;  4AFC A;  5LA1 A;  1OA2 A;  4I01 A;  3MUZ 1;  4COV A;  1ZBA 2;  2LM3 A;  2VMF A;  3AMM A;  1IS6 A;  1CZT A;  3FX3 A;  3NV1 A;  2DCJ A;  1HN0 A;  1FPN 3;  5D8A A;  3TEW A;  2VZS A;  3WX5 A;  2J1V A;  5BYN A;  1X36 A;  5GZD A;  2FDI A;  3LD8 A;  4XCB A;  1N1S A;  1XNB A;  3RSJ A;  3ENR A;  5T5P A;  3UJO A;  3FBM A;  5FMO L;  1AX1 A;  2R0F A;  5FZ8 A;  3EHK A;  1NLR A;  4CPB A;  3OSD A;  4YPJ A;  2R07 1;  2ZGP A;  3AL5 A;  2ZA9 A;  4ZHN A;  1VBD 3;  2WLP A;  3HBK A;  1R09 3;  4FAH A;  4CE8 A;  1GU3 A;  5CKM A;  1O8S A;  2PLV 3;  1LES A;  4KGG A;  5FMB A;  1F35 A;  4SBV A;  4MGI E;  2F4P A;  4FXK B;  1WCK A;  2W95 A;  4E8D A;  1G9D A;  3AVR A;  2NP0 A;  5FZO A;  4Q29 A;  5E6H A;  2G1M A;  4CCL A;  1HV0 A;  2RDQ A;  4EWA A;  1BEV 1;  1QXP A;  4QQH A;  5A3N A;  2WNV A;  2FDK A;  3SQO A;  4I02 A;  2WNU C;  3HBZ A;  1IPJ A;  4TYS A;  5BNN B;  4AHX A;  4NJ4 A;  3VN4 A;  3PUR A;  2R30 A;  4KH9 A;  1WLC A;  2XQX A;  5L9V A;  2XL9 A;  1PGL 2;  2DVA A;  2UWB A;  4TTG A;  1ULF A;  1MQT B;  4UBG A;  1WA4 A;  1E5S A;  1UN1 A;  2Z69 A;  3FL7 A;  3RI8 A;  4LIV A;  3WZ1 A;  2V5Y A;  3GXU A;  1N3Q A;  3O1M A;  2R7E B;  3OUH A;  2HWC 3;  5JPN B;  3KLS A;  3TYJ A;  4E4D X;  1GIC A;  1W99 A;  4PF5 A;  4HZF A;  3ZFG B;  1OOP A;  3ETQ A;  3LCP A;  2IVJ A;  4CU8 A;  3OG2 A;  5ISL A;  1HJG A;  3QH7 A;  1FMD 2;  1H4G A;  5T54 A;  3C7F A;  3ROU A;  4BIF A;  1UU4 A;  5CFC B;  4HAN A;  4YW1 A;  4DXS A;  4E4Z A;  3H8O A;  4XFG A;  2I74 A;  2NZ9 A;  5FDB A;  4I0W B;  3DYO A;  3RI9 A;  4E2G A;  4LO4 B;  4UAP A;  1AYN 1;  1EAH 1;  2RS1 2;  4KMQ A;  5LAS A;  3RWN A;  4MGQ A;  4Y1X A;  4ZY9 A;  1RXF A;  1SFN A;  1WCS A;  2WO3 A;  3THD A;  3GZA A;  1W9Y A;  5FYH A;  4PIY A;  1JZ2 A;  1BMV 1;  2OKX A;  3S0M A;  1AYM 3;  3QH6 A;  4LUK A;  4Z1V A;  3P3P A;  1JU4 A;  2XDV A;  2J7M A;  3FE5 A;  2BFU S;  2B4K A;  1O4T A;  1JZ5 A;  2F17 A;  2ZAB A;  4OI0 A;  2XVG A;  1H8T A;  5CB7 A;  2C0Z A;  5K0U C;  4LUM A;  3S5A A;  2QZ3 A;  1YFU A;  2EXI A;  4N43 C;  4FOV A;  2RE9 A;  2QKD A;  1C8M 3;  1ND3 A;  4QDS A;  3ZM8 A;  1D4M 1;  4XF0 A;  4A2U A;  1G8W A;  1CN1 A;  1VE0 A;  2CY6 A;  2ET7 A;  3NST A;  2OXB A;  3KT1 A;  1ENQ A;  4FAG A;  1L7L A;  3E5X A;  3BU0 A;  1PK6 C;  3VBU B;  3H8R A;  3AMP A;  1UU6 A;  4TXW A;  4AGR A;  4XTM A;  3D3A A;  4CXY A;  2G9F A;  2Y6G A;  1VBB 2;  3F95 A;  2OZJ A;  1LAJ A;  4AL9 A;  1KJL A;  2ZGK A;  1VB2 A;  4YGC A;  1RYY A;  1DGW X;  2DFC A;  3AP9 A;  1O3T A;  3IIA A;  3ZXA C;  4A42 A;  4DY5 A;  1QHD A;  2Y6F A;  1CX4 A;  1W39 A;  2ZEZ A;  3DCQ A;  2ZAC A;  5FZL A;  1ULC A;  2WO7 A;  2P1B A;  3ZMO A;  2RMU 2;  1GZW B;  1N1Y A;  4N53 A;  5EV7 A;  2I07 B;  3LSE A;  4PLM A;  1HX6 A;  3HEI A;  2CDO A;  2XGX A;  3OBA A;  4QX1 A;  4A6S A;  2JIJ A;  3PUA A;  4FOQ A;  2W52 A;  5FZB A;  2VNR A;  1ENX A;  1OKQ A;  2D97 A;  4RHV 2;  4XFF A;  4CEW B;  5FXV A;  3ES1 A;  3VZL A;  1QNW A;  3Q8C A;  3RJR A;  3GHM A;  3RVH A;  1A3K A;  1N1T A;  3EYP A;  4BXS V;  1AR9 1;  1RUC 1;  4IGO A;  2BVV A;  5KHK A;  1ZZ7 A;  1WMF A;  3N7L A;  4BE3 A;  3U07 A;  2VCM A;  2DUR A;  1VAV A;  4RGG A;  4QXC A;  1POQ A;  4Z92 B;  5FYY A;  5L9R A;  2J1A A;  3AYC A;  4HKO A;  5FK7 A;  3VLB B;  4LT5 A;  2BFU L;  1LGC A;  4RHV 1;  1R08 2;  2JE9 A;  2Y8K A;  1K5J A;  3VBO A;  3O0V A;  2X5I A;  1HLC A;  3M7A A;  4W6W A;  5BNN A;  2VME A;  4F7Z A;  5DUV A;  5LB6 A;  1WW7 A;  1Q3E A;  4K20 A;  5KXD A;  3W5N A;  1PIV 1;  1WD4 A;  5FR3 A;  3PDQ A;  3I3Q A;  3WP6 A;  4XJ9 A;  1QJX 2;  1O4Y A;  5FPV A;  1OBN A;  1MQT A;  3KMH A;  3K4Z A;  4LKD A;  1UYP A;  4WZF A;  2VZQ A;  3QD6 A;  1BZW A;  4UI9 L;  1GV9 A;  1IPS A;  1ZBA 3;  5DDJ 2;  4L9B A;  4NPM A;  4BJ0 A;  4C0B A;  1PO2 1;  1V70 A;  1RIN A;  3GGL A;  5JXJ A;  2JD9 A;  4CDX C;  2VO5 A;  4LE4 A;  5EQU A;  4QQO A;  3ZFG A;  2QE3 A;  1OFN A;  3ZIW A;  4Q0P A;  4ARY A;  4Z2W A;  4XPV A;  3OPW A;  2BRT A;  4QGL A;  4XF4 A;  3VHO A;  2VQT A;  5IK5 A;  3KZ4 C;  5CFC A;  3AMH A;  1T2X A;  3APB A;  5F9T A;  4NIH A;  1UMH A;  2WFF 1;  3ACG A;  3ABZ A;  4D6Q A;  3JB4 C;  1AXK A;  5FWJ A;  5DDJ 1;  3VBR B;  1RL3 A;  1S4C A;  4Q4X 3;  3NNG A;  4K6B A;  3KB5 A;  4Y1Y A;  2WII B;  3G7D A;  1SHW B;  3C2U A;  4AHY A;  1CAX A;  2WQZ C;  1H2N A;  3I7D A;  4CUA A;  4I0B A;  3LIG A;  3WQ7 A;  2R32 A;  1MZF A;  5HBA A;  1W8T A;  2GND A;  2R0H A;  5GZE A;  3HN1 A;  2LTN A;  1MS8 A;  3NJX A;  2FCU A;  3S5Q A;  2HJI A;  4AWD A;  1GBG A;  2DVB A;  2JDU A;  2JX9 A;  3MIB A;  4LBN A;  5JIU A;  2QQW A;  4W4Z A;  4JDM A;  1OA4 A;  2WKK A;  3IDE A;  3USS A;  2WWJ A;  1AVB A;  4FFI A;  4LHK A;  3S7E A;  5FPU A;  3RNS A;  3WHU A;  2A75 A;  1MS5 A;  2J22 A;  4OHW A;  5FZH A;  3PNA A;  2RV9 A;  1XSR A;  2CAU A;  4CP1 A;  3DEM A;  1GUI A;  5D8A C;  2FBE A;  2J1R A;  2K2S A;  4C8D A;  1XYO A;  1YQ8 A;  3J7L A;  2DUO A;  4GB3 2;  4BB3 A;  2J1E A;  4LO5 B;  3WNL A;  4PHZ A;  5FZF A;  1W9S A;  3NVC A;  4MAD A;  3A22 A;  3HVD A;  3AK0 A;  1FMD 3;  3THC A;  3GJB A;  3UGH A;  4XMI A;  2R1D A;  4MVT A;  3PME A;  4XEZ A;  4GKX A;  2W5F A;  5AVA A;  5FYT A;  3OOX A;  3KV9 A;  4JHT A;  5CIS A;  5FY1 A;  1DQ4 A;  1TE1 B;  1VBC 1;  3PIJ A;  5FMC A;  2RS1 3;  3GDB A;  5AC9 2;  4LMF A;  1JN2 P;  1UYY A;  4NRP A;  5A7S A;  1LOF A;  2PHD A;  1GZW A;  1W06 A;  4XDQ A;  1SCS A;  4YZ4 A;  4UFI A;  4Q8K A;  4JKK A;  2WNV C;  2WRA A;  3R4S A;  1DQ0 A;  4FPY A;  3T2P A;  1ZZ6 A;  5BUV A;  5I0D A;  1WME A;  4XE9 A;  4MHU A;  5A6Y A;  3GZU C;  3CBN A;  1QXJ A;  5FUP A;  2IZW A;  3TWI A;  2E32 A;  1QMJ A;  4B3N A;  4CEW A;  2JIC A;  1BBT 1;  3AP5 A;  4KGQ A;  4LIU A;  3RMY A;  1XSQ A;  1BVV A;  1I5Z A;  2D43 A;  4HSJ A;  4UOJ A;  2D40 A;  1Q8P A;  2DWR A;  2BGC A;  3POI A;  4IL7 A;  2WAA A;  4OHX A;  1OLR A;  4UW4 A;  2WR9 A;  4COZ A;  2YU1 A;  4LOT A;  4QKN A;  2WAB A;  2ID4 A;  2JE7 A;  2CGP A;  4HPK A;  3CMG A;  3JU9 A;  4AVS A;  2WJS A;  1OOP C;  4QPG B;  2W1W A;  4M0H A;  2AR6 A;  5GZF A;  4AF9 A;  4AI8 A;  2R04 1;  5FYZ A;  1LRH A;  1VBB 3;  2WQ4 A;  1O91 A;  4Q5O A;  4PT6 A;  5A3P A;  4XDO A;  1Y7B A;  2B45 X;  1X50 A;  1LNS A;  2WNU B;  3E5U A;  3RPQ A;  1E5I A;  1LOC A;  3UYJ A;  3VBH A;  5HV0 A;  2A3X A;  2WL1 A;  4XF9 A;  1XND A;  3QAC A;  3CIH A;  4YW2 A;  2RMU 3;  5J09 A;  4UW3 A;  1O3Q A;  3GNE A;  2BW8 A;  2GNM A;  3AX4 A;  3AXE A;  4KG8 A;  5A33 B;  2EXK A;  3KT4 A;  1QJU 1;  5I8T A;  1GMM A;  3M4F A;  2Z42 A;  3AYD A;  4L97 A;  4NRO A;  4UW6 A;  2PTM A;  1W6N B;  3RQ0 A;  5FQ0 A;  1SQ4 A;  3VGI A;  1HRI 1;  1AR6 1;  4GMP 3;  1UXX X;  4H2A A;  2LRP A;  4KWU A;  1H8T C;  2XJS A;  4FOY A;  4QXB A;  1LU2 A;  2R16 A;  4JDO A;  4JHZ A;  1CX1 A;  4O9E A;  5IW0 A;  1OKO A;  1OHF A;  5FZ6 A;  1JS9 A;  1YJL A;  1ND3 C;  4IND A;  3ST7 A;  4DOU A;  4LLF A;  4MHR A;  5I0S A;  1Q8O A;  5F5A A;  4D7S A;  1RUF 1;  2VW2 A;  4YW4 A;  1CAV B;  1TNR A;  3KV6 A;  1F5J A;  3R05 A;  3FLR A;  2XJV A;  4OHV A;  1NXD 1;  2B42 B;  3VBR A;  1UY2 A;  1GAN A;  2OW4 A;  4FPG A;  3WW1 A;  5KHH A;  1WKY A;  4TLF A;  4R9C A;  4RL7 A;  3PUQ A;  1VLN A;  2ZGR A;  1H0B A;  4EWE A;  4L2N A;  1DG6 A;  1QH6 A;  4IE5 A;  4LA2 A;  4QHZ A;  5F5Q A;  1LEC A;  3DXU A;  4IEP A;  3OUJ A;  2C9A A;  5C4W C;  2D6M A;  2VQU A;  1CIY A;  4Q0V A;  1X9P A;  1NLQ A;  1RUI 1;  3P5B A;  3VKL A;  4CCO A;  5I0U A;  2DDU A;  1QEX A;  2HWD 1;  5A7O A;  1MR5 A;  4UW5 A;  1CWP A;  4M4R A;  3ZFE A;  1NZI A;  1UQX A;  1WLD A;  1UAI A;  1QJX 3;  2A6Z A;  2BNN A;  4JQT A;  1UPS A;  1Y3T A;  4XQW A;  2W47 A;  3T08 A;  4B4P A;  5K0U B;  4N53 C;  1W0O A;  5E8A A;  3N7M A;  1S55 A;  2P17 A;  2XQR A;  3NAP A;  1OI6 A;  4LEJ A;  3OBT A;  2GH2 A;  4RGA A;  1HDK A;  2YC2 A;  2W87 A;  3AXD A;  3RZM A;  3WG1 A;  5CG9 A;  1US2 A;  2CNA A;  4UXA A;  5FYI A;  1POV 3;  4F8A A;  4MET A;  3NKG A;  2XBO 2;  5FY9 A;  4CU7 A;  1Z0H A;  2WO1 A;  4K9S A;  5LEJ A;  4XMA A;  1PK6 B;  4X6R B;  2FZ1 A;  1B35 C;  5FTT C;  3O1S A;  2E51 A;  2EAL A;  4CP2 A;  3FHQ A;  2XWJ B;  4D3W A;  3GBG A;  4A44 A;  2OS2 A;  1AX0 A;  5FZM A;  1KFX L;  4XJU A;  5EXO A;  4DNY A;  3CNA A;  4DIN B;  2VUJ A;  3HR9 A;  1KD7 A;  4Y3O A;  4XFA A;  1ZA4 A;  4D6S A;  3BVC A;  1WGP A;  3WT3 A;  4JTO A;  5JVV A;  2ZTN A;  2EIE A;  5FWE A;  2WLQ A;  1XBF A;  1HN1 A;  2CGO A;  3FHI B;  2ORZ A;  2XUM A;  3SNM A;  3VBO C;  1DZR A;  2X5I C;  2E63 A;  1GZ9 A;  5F32 A;  3J7N A;  4GZ9 A;  4JGZ A;  3ZSJ A;  3K46 A;  4HT1 T;  4C1W A;  5BNN C;  3DF0 A;  4FSJ A;  2VNV A;  2QBX A;  3NNF A;  1CQ9 A;  2BWC A;  5C5U A;  4MV2 A;  3BN6 A;  1W3X A;  2JEN A;  4JX0 A;  2HYX A;  2PHF A;  4DO0 A;  1HB2 A;  5FO8 B;  5F8P A;  2AAC A;  2QQU A;  1PGW 1;  5FPA A;  4YGB A;  3WVJ A;  4WVW A;  3POF A;  4ORF A;  4CP0 A;  1ZYB A;  1RUE 2;  3PIG A;  5J96 B;  3GYD A;  5JZG A;  3J26 N;  3N35 A;  4GWN A;  2ET1 A;  1HQW A;  3MID A;  4Y33 A;  5HV4 A;  1UXZ A;  4GB3 3;  3ZFG C;  4QPG A;  1OD5 A;  3AZY A;  1RGS A;  1W6Q B;  2TEP A;  2GC0 A;  2ARB A;  2VH9 A;  4QDQ A;  3TNQ A;  4A4A A;  5GZG A;  1XE0 A;  3M3O A;  1ZZ9 A;  3PMS A;  2RJK A;  3H0O A;  2HWB 1;  2SBA A;  4FP2 A;  4R52 A;  3ZYP A;  1J83 A;  3SCG A;  3I3E A;  2Y6H A;  1VPH A;  3R0R A;  4M3C F;  1GNY A;  5FZC A;  5AC9 3;  3KVA A;  2GMM A;  5C3R A;  1C4R A;  1R1A 3;  1G6N A;  2LS6 A;  5A3W A;  1YNA A;  2VVF A;  2WZE A;  1GYK A;  4RS5 B;  1AR7 2;  1W6N A;  1HXS 1;  4RN5 A;  1AJK A;  1J3R A;  3NL1 A;  4LLO A;  1FOD 2;  1YIP A;  3TOJ A;  1QOS A;  2YHJ A;  2CYF A;  2QQN A;  2OPW A;  3JD7 1;  1S2K A;  2RVA A;  4FVV A;  3A7Q A;  3SXW A;  1D0H A;  3I2J A;  5LY1 A;  5A70 A;  5FY7 A;  1J1L A;  4E9K A;  1IKP A;  3PHM A;  2W92 A;  5D2A A;  3ZXD A;  5IVY A;  1RB8 G;  3VBS B;  4WZC A;  3SCF A;  1AR7 1;  4AYU A;  3HJR A;  5IK7 A;  4OFG A;  5BV6 A;  1VBA 1;  1W8H A;  1JBC A;  4MOA A;  4B4R A;  4AXO A;  4HET A;  1W6M A;  4XQD A;  5CBL A;  1K5M B;  2ZXQ A;  2A71 A;  1NT0 A;  1WMX A;  3EBR A;  3I4I A;  3V64 A;  3NJV A;  3VKN A;  1BVP 1;  3K2O A;  5FOB B;  3JBG 1;  4AVT A;  1SBE A;  4RFR B;  4YM3 A;  3B02 A;  5LBF A;  1W28 A;  3C7O A;  5LWB A;  2W1S A;  5DZG A;  1MEC 1;  1QY4 A;  4NN0 A;  5JMO A;  1F8V A;  1DCS A;  1IS3 A;  1HQN A;  3JQX A;  5KR7 A;  2JIG A;  1LOF C;  4QM8 A;  1PNF A;  4XFI A;  4BQ2 A;  5KC6 A;  2VGD A;  4W8J A;  5FK8 A;  3LE0 A;  3OD4 A;  2WYF A;  2XWB B;  2ZZJ A;  3DPR C;  3RRD A;  4ES9 A;  4GH4 A;  2PHR A;  3RMX A;  1X8E A;  2Y33 A;  3D5O A;  5FZ7 A;  5DUX A;  2VVD A;  3E5Q A;  3VD7 A;  4KQ7 A;  1PK6 A;  5F6L B;  1NE6 A;  3UL2 A;  4A7Y A;  5L36 A;  1SCR A;  5F3C A;  5T52 A;  3S7I A;  1FNZ A;  3PUI A;  3SHR A;  4A3X A;  3FJS A;  1RJ7 A;  4S2D A;  3CZU A;  1DQ5 A;  4AI9 A;  2VZT A;  4HK9 A;  4Q1R A;  3LOI A;  3LWC A;  2G4I A;  2WT2 A;  4CEY B;  2OX0 A;  3JUU A;  2V5D A;  3S30 A;  1QJZ A;  4XF3 A;  5LY2 A;  4BU2 A;  2QQM A;  3B9I A;  1OC1 A;  2ZX3 A;  1MS4 A;  3MZH A;  3SIS A;  3OTF A;  1PVC 2;  3OGR A; 
#chains in the Genus database with same CATH homology
 2RDR A;  5LB6 A;  4NHX A;  3OUH A;  4NHY A;  5LBB A;  3OUI A;  5C5T A;  4Q5O A;  4Y5T A;  3DKQ A;  5DAV A;  4NHK A;  5HV4 A;  3W21 A;  2HBU A;  3NNJ A;  4BQX A;  2FCT A;  5LBE A;  5HV0 A;  5LBC A;  2RDS A;  5IAX A;  5EQU A;  4XC9 A;  3W20 A;  4BQW A;  3KT4 A;  5LAS A;  3HQU A;  5DAP A;  2A1X A;  2FCV A;  4ZON A;  4XAA A;  4MHR A;  4J25 A;  3GZE A;  3MGU A;  2OPW A;  2FCU A;  4XCA A;  4UWD A;  2RG4 A;  5IAT A;  4XAC A;  3OUJ A;  3HQR A;  3KT1 A;  3NNL A;  4BQY A;  5EP9 A;  5DAW A;  5DAQ A;  5LAT A;  2RDN A;  5ERL A;  3NNM A;  5IAV A;  4NAO A;  2G19 A;  4NHL A;  3KT7 A;  3GJB A;  4IW3 A;  5LBF A;  2HBT A;  5DAX A;  4XCB A;  2JIG A;  5A3U A;  5M0T A;  4ZPI A;  2JIJ A;  5EPA A;  4Y5S A;  5L9B A;  2Y33 A;  4KBZ A;  3BVC A;  4MHU A;  3ITQ A;  2G1M A;  2RDQ A;  4NHM A;  4NMI A;  3OBZ A;  3EMR A;  5L9R A;  2Y34 A;  4JZR A;  5L9V A;  3NNF A;  3GJA A;  4XAB A;  5C5U A;  2V4A A;  3PL0 A;  5LA9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...