4JZRA

Structure of prolyl hydroxylase domain-containing protein (phd) with inhibitors
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
211
structure length
204
Chain Sequence
PALKLALEYIVPCMNKHGICVVDDFLGKETGQQIGDEVRALHDTGKFTDGQLVSDIRGDKITWIEGKEPGCETIGLLMSSMDDLIRHCNGKLGSYKINGRTKAMVACYPGNGTGYVRHVDNPNGDGRCVTCIYYLNKDWDAKVSGGILRIFPEGKAQFADIEPKFDRLLFFWSDRRNPHEVQPAYATRYAITVWYFDADERARA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Egl nine homolog 1
publication title Novel complex crystal structure of prolyl hydroxylase domain-containing protein 2 (PHD2): 2,8-Diazaspiro[4.5]decan-1-ones as potent, orally bioavailable PHD2 inhibitors
pubmed doi rcsb
source organism Homo sapiens
total genus 59
structure length 204
sequence length 211
ec nomenclature ec 1.14.11.29: Hypoxia-inducible factor-proline dioxygenase.
pdb deposition date 2013-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13640 2OG-FeII_Oxy_3 2OG-Fe(II) oxygenase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.620 Mainly Beta Sandwich Jelly Rolls q2cbj1_9rhob like domain 4jzrA00
3W21A 2RDRA 4XABA 4KBZA 4JZRA 3GZEA 2JIGA 5IAVA 5LATA 5LA9A 2JIJA 3OUHA 2FCTA 2G1MA 4NHMA 3GJAA 5DAQA 3W20A 2A1XA 5DAPA 4UWDA 5C5UA 4XCBA 2Y34A 5LB6A 2HBUA 5HV0A 5HV4A 4XCAA 4IW3A 4Y5TA 2RDSA 3NNJA 5L9BA 5EQUA 4NMIA 4XC9A 3HQUA 5DAXA 2RG4A 3EMRA 5IAXA 3HQRA 2FCVA 3OBZA 3GJBA 3MGUA 3PL0A 2OPWA 2V4AA 4Q5OA 4Y5SA 4BQYA 3KT7A 5LBBA 5A3UA 4XAAA 2HBTA 3OUJA 4NAOA 4NHXA 5C5TA 5EPAA 5DAWA 2Y33A 2FCUA 4BQXA 5DAVA 5ERLA 3NNFA 5IATA 4MHRA 4J25A 3OUIA 3KT4A 2G19A 4ZONA 5EP9A 2RDQA 3NNMA 5LBCA 3KT1A 3BVCA 4MHUA 4NHYA 5L9RA 5LASA 4XACA 3DKQA 5M0TA 5LBFA 4ZPIA 4BQWA 4NHLA 3NNLA 2RDNA 3ITQA 4NHKA 5LBEA 5L9VA
chains in the Genus database with same CATH superfamily
5IK7A 2AR6A 4UF0A 4XBQA 1UY2A 2ZJCA 5FFOC 5BNNB 1QJEA 1XE0A 2X09A 1S0IA 4QX0A 4R9DA 3ZXFA 1JMUB 4IEPA 5CYYA 2XKOA 3WVJA 2A6WA 1AX0A 1RMU3 1QQP1 4UOJA 3NSTA 4V2VA 1C4RA 3D4KA 4O61A 3HVDA 2HYXA 2VOKA 1MVEA 3VDDC 2G1MA 2PMWB 2W68A 3GJAA 3VBSC 4Z2WA 1FNYA 2JE7A 2OIIA 1OQEA 2WLPA 2VZUA 3AJYA 4FPYA 3RQ0A 2RMU1 4YZ5A 3RRDA 1RUG2 1ZM1A 4QU2A 4UWDA 1DF0A 2ZKLA 4K3UA 1OUXA 5JZGB 1PGL1 1W3XA 2AC1A 2G9FA 1IQAA 3LSDA 3AVSA 1UMHA 1RUC1 2LTNA 2HBUA 1AYM3 5FLJA 1W2TA 5FUNA 2H0VA 5DPNA 3U07A 5A3WA 3ZSJA 1RUI1 1ND3A 2NPIA 2VOXA 1TG7A 2XJVA 5LK5A 5C71A 4XW3A 4Y1ZA 2CAUA 2XLAA 4BM8A 2Q30A 5A33B 4PF1A 5FLIA 4OI1A 4XJUA 3CDZB 1PM4A 1R1A2 4LOSA 1RUE2 1Q43A 2E26A 5F2SA 1MZFA 1BMV2 1QKQA 5A6XA 5CFCB 3ACLA 3USSA 4JHZA 5L19A 1JZ2A 4XJZA 3AKSA 5TSWA 2YUEA 1AJOA 1YIPA 2X53S 3F2ZA 4XVHA 2ID4A 2ZOEB 3KF5A 5ANQA 5BNOC 2OS2A 1DYPA 3EJKA 5GLTA 1PVC3 3MW4A 4ASLA 1V00A 1IKQA 5KHGA 2HWB3 2BFUL 2RJLA 4WVWA 5FPXA 3IN9A 3BTZA 2Q8OA 4D0QA 4HSLA 1EPZA 3ZXJA 2XB6C 5CISA 1Q5OA 1W9WA 3LIGA 4MGYE 4IE6A 2R062 2WZR2 5LBBA 1XQNA 3HEIA 1S0DA 3O14A 4JCKA 3R6SA 4AEKA 4KBBA 3J8F1 3ZYHA 4GWMA 2PHXA 4B3NA 2GC2A 4NIHA 2VJXA 4BQXA 2R071 5FP8A 2UU8A 2VNVA 1HJGA 1GZTA 4RQPB 4GMP1 4M0HA 3ZFEA 3LD8A 3MV01 1NQDA 3THDA 4ZZ5A 1FPN3 1GNHA 4I3GA 4DO0A 3K51A 3K77A 3O7OA 1W39A 2A3XA 2QBXA 3OGVA 1GP4A 3ZXAC 3O1MA 3INAA 2JDHA 4CCEA 1LENA 3N9QA 4XF3A 1QNWA 4DY5A 3OD4A 5FZFA 2XBO1 3ZXLA 5A7PA 2GC3A 4ORFA 3TAYA 2NQYA 2YG0A 3SQOA 3WQ7A 4CU6A 3W5MA 2I45A 3UKTA 3TNQA 4LUMA 3N7JA 4OCTA 5C9AA 1W2NA 3G6JB 4HVRA 4OVEA 1F5JA 5LRSA 2MEV2 2GDFA 1SBEA 5FPVA 4YGEA 2NMNA 5L9VA 4RS5C 2LRPA 1URXA 3S5AA 1UL9A 4Y1UA 5FPBA 5FZDA 3SKJE 1SBDA 1ZYBA 3VDBA 2X5IC 4AYUA 1ND2C 2IFRA 2JKBA 2TNFA 5F5AA 5IAVA 3LFIA 5LATA 4A6OA 4CCOA 2JDKA 4JC1A 4O9EA 4RR3B 5K0UB 3GDBA 1RJ8A 4AEMA 4IE0A 1ULCA 4NHMA 3LF7A 4HONA 2RV9A 3ZKUA 2QE3A 3ES4A 4YW6A 2XWJB 2JENA 5HI0A 3AVRA 1LRHA 1QQP3 3FN9A 2IC1A 2A6VA 2BERA 4NRMA 3VZOA 5DUXA 2R6QA 1NY72 4IV1A 3GXUA 4QT6A 3H7YA 3LZZA 5HV0A 3OGJA 3Q8CA 4ISRA 4PIXA 2RMU3 4XCAA 1MVQA 3T0AA 4NRQA 1F4AA 2RS11 4X6RB 2VAUA 3O1RA 3E6CC 2GNTA 1RUC3 1VBA2 1UKGA 3KD4A 3N35A 3PU8A 3SISA 1XNDA 3MIDA 4IDZA 4NMIA 3PVNA 3WF2A 5KHIA 2VMHA 3GHNA 3AMPA 1RUI3 3HQUA 4DIQA 4PLOA 1H8TA 3EMRA 1OF3A 1W6MB 3POWA 3WG3A 5JXJA 3DF0A 5FQ0B 1UMIA 5FYHA 3VDDB 2WO3A 3VBSB 4BPZA 1XPWA 2ADDA 4HANA 1D0HA 1NCQA 4NWWA 3DXTA 4FO9A 4WVZA 4FT8A 2P4EA 4K6BA 2XQRA 2YBKA 3WDXA 1AR82 4BLJA 3VKMA 4A4AA 4LO6B 2GH8A 5FY9A 3C7EA 3MI8A 5T54A 3SH3A 3VKOA 2F17A 3KF3A 4XFAA 4XBNA 3RZZA 5FYSA 1JH5A 4XHBA 5CFCC 4MGTA 1PHMA 2QTWB 3HT2A 3M8LA 2VQTA 2XH6A 4LOTA 5FXXA 5C5TA 3POIA 3LB9A 2WNVB 3QCWA 4KI5M 1PNGA 1KRIA 5FY0A 3B69A 1LJ7A 4YW1A 3WUDA 5JI9A 1G9CA 3BTXA 1PK6A 1WUVA 3N9PA 2HEYF 2WQZC 4WBBA 2P5BA 4Y22B 2RM22 1H6XA 5LEJA 1OOPC 1REFA 1H8VA 3J8F3 4AVTA 4NRPA 3POYA 3WW3A 3CF6E 2R073 1LB2A 4LKSA 2VZTA 5BNOB 3AZXA 1FV3A 5FYUA 5LBCA 4A7ZA 4GMP3 4MHUA 2R7EB 2J1EA 4FTEA 4AEDA 3UL2A 3IZOA 4P08A 4TTGA 3WUCA 2EIGA 1V6MA 4CDXA 1RXGA 4GKYA 5AC91 1QJY2 1UOFA 1DFQA 3WW4A 4MSVA 5D8AA 1WCDJ 2YHJA 1DP0A 4N43C 3USUB 1QJX2 3V0AB 1RUD1 1C28A 2GNBA 2Y8KA 1D4M1 1STMA 3WNXA 2XBO3 1JXNA 5IVJA 4C8DA 4NHKA 2VCCA 5FBJA 4AF9A 4HPKB 5F5CA 5E16A 1CONA 5IVYA 4FAHA 4QX8A 2CY6A 2DBNA 3WG4A 3PUSA 3ZFFC 1YFUA 3FWEA 2ZGNA 1X8EA 5ANNA 4NJ4A 4A7KA 4QB1A 2ZGQA 3OGGA 4J1WA 5IJRA 2J1RA 4O65A 3OG2A 1ZRIA 2JG8A 3N9LA 4H55A 3HBZA 4IEXA 5C5UA 2C24A 2WNUC 2BYVE 2XJTA 4OUSA 5APAA 4EN6B 2PHTA 2ZX4A 2C26A 3SNMA 5JSOA 2KD7A 5LRRA 2FDJA 1WMXA 5GLVA 4AZZA 2VZOA 3CZJA 3KMHA 1RB8G 5DXDA 5FOJB 1BKZA 4A3XA 4E4SA 4RS5B 4XUNA 1CWPA 1VMFA 3CLPA 2JG9A 2Y38A 1OXCA 2X5IB 3LFMA 4HKWA 5EHDA 2ZMLA 5FZ0A 1WCQA 1ND2B 2JXAA 2RS13 3MIFA 5A6ZA 1KEXA 3OYWA 2WRAA 1FMD2 4DXRA 5FXZA 1VPHA 3I2IA 3CJIC 2FCVA 3JCIA 5JXIA 1UYYA 1WLWA 4Q1PA 1AYN2 3I2DA 1AF9A 2CWMA 4ONUA 1JYWA 4QWNA 4XURA 3NKGA 4QX5A 1RHI1 1OA2A 2J22A 2VOTA 4LO5B 4XUPA 1DG6A 1VE0A 4W4ZA 3LEGA 1O59A 1LEDA 3GZUC 1CAUB 3ST7A 3SCGA 2XXZA 3SXWA 2I07B 4AHWA 5FXVA 4Q5OA 4BCUA 4BLIA 1ACCA 5GZCA 3U10A 1KITA 5GZEA 2A3WA 5KHKA 3ELNA 3KV6A 3AXDA 1OQ1A 1KS4A 2G9GA 4I09A 2WFF2 4FP3A 1SBFA 4N90A 4PLNA 1HRI2 3ZPOA 4NIIA 5LW9A 1AR62 3ATGA 1ULEA 1W0PA 5F9TA 4QGMA 1PGW2 1GZCA 2W1QA 3TBDA 2TBVA 1Q8VA 3B02A 1BK0A 3OUIA 4BQ1A 2QQWA 3N7LA 1LKNA 1C5HA 4EZHA 2HWC1 1H4GA 1GR3A 3K2OA 3QACA 4IESA 1AX1A 2CDOA 4FQ4A 4IV3C 3CMGA 1OD3A 1GOHA 3GYDA 3KS7A 2VE1A 4CDQC 3AZYA 4BMEA 1UCXA 1CJPA 3PMEA 3OEAA 3KV4A 3WSOA 4AFAA 4Q0UA 5HCBA 4QPIA 5HBAA 2ZX2A 1MR5A 4XYXA 1HB4A 5C3RA 3O1OA 1O7FA 3D3AA 1IPKA 1U5XA 2IZWA 1XOYA 2Y6KA 1VR3A 4ZPIA 1LTEA 3MFCA 4EWEA 5AFEA 1LCLA 1MQTA 1IPSA 1J3QA 1OI6A 3RYKA 1ODMA 3BU7A 3A22A 2ZMKA 5AC93 3V56A 3PUQA 4AQ2A 2ZGUA 5LY1A 2PLV2 4OLLA 5CU1A 4O7XA 1ZZ8A 1OOPB 1RUD3 1H1MA 4XABA 3ZDSA 2R0HA 4QMAA 4I0BA 2LALA 1D4M3 3I2JA 1OVPA 1GNZA 1RUG1 1EAH1 1FATA 3B7MA 3A0NA 4CU7A 5B2GB 1AXYA 1G9AA 1S0GA 1W2AX 2HWD2 3MV11 4LO8A 3RZHA 2QQOA 1ONAA 4QDSA 1DBNA 3I97A 4J6GA 2DCKA 5E88A 3ETPA 4LKFA 3WOGA 2WT0A 1O8PA 2WNOA 2XUEA 1REEA 2DUPA 2R041 4ZS3A 2JDMA 3CL1A 1SQ4A 1W9SA 4RN5A 4HN1A 1ASJ2 1N3QA 1W2OA 4UYBA 5FZ6A 2XKPA 1WLDA 4PDWC 4OZOA 4RFRB 2YGMA 3MLKA 4QXKA 4Y20A 5E89A 4ARXA 2QQKA 2AYHA 2QCSB 4Q26A 3JZVA 3VDCA 4UFLA 1BMV1 5CG8A 3JUUA 4B4PA 4JDMA 4YNIA 4Q27A 5FRAA 4Y26A 4AGVA 1HIXA 4WM8A 4YW7A 4Q4W1 1H2KA 3AMHA 3FMGA 2YY1A 4KGGA 1DCSA 2I74A 1CAXA 2YBSA 1DLLA 1POV1 4P9WA 5A3OA 4DEQA 4DQAA 2DTYA 3WP6A 1XNKA 1V6OA 4I2OA 4P9JA 1W6OB 1COV2 4C91A 3IMNA 3FZ3A 3PVEA 4RGGA 1NCRC 5A3PA 4LBQA 3I3BA 4Y1VA 5JSRA 2R1DA 2WNUB 2F4LA 2ZGTA 4FOQA 2W1SA 2RR12 2R061 3PURA 4YW5A 4M3CB 5F5QA 1DDLA 3MGUA 2D5FA 1V70A 3ZVXA 3EHKA 3H3ZA 1ZREA 1J83A 3G7DA 4HK9A 2XJPA 2YPJA 1W6QA 1BXHA 2PAMA 2R16A 3WP5A 3ZSMA 4BQ3A 1A8DA 5FYYA 1VRH2 2YU2A 5DUWA 1OQDA 1RHI3 1XYNA 4RHV1 3T1LA 1S0CA 4OHXA 4AG4A 1ZBE2 4QQ2A 4AI1A 5IVBA 3E5UA 4PT6A 5DDJ2 3RGBA 1QWRA 1QEXA 3KCYA 4V2WA 4XUOA 4AWDA 1S4CA 3H3LA 5HXMA 1EUUA 3M70A 2XONA 3I2KA 1CAWB 1ENRA 2OX0A 3CJIB 1DGWA 1XRUA 4EN7B 2ZEXA 2JEMA 1MS9A 4FAGA 3RS6A 4X8NA 4KWLA 5ABJA 1QIQA 1SDWA 2VECA 4FPKA 2Y6LA 5F6KA 4XTMA 4YZ3A 1QJFA 4DY3A 3E5QA 3PUHA 4H14A 1BBT1 2ILMA 3GNEA 4HVOA 1XBFA 2IXIA 4UAPA 2HWC3 1G86A 1F2NA 1PO12 4OHWA 4YM3A 5SV8A 2V73A 3AMMA 4JRAA 4QPGC 4B29A 4KU7A 2BJSA 4COVA 1VLNA 1UZWA 1UY0A 4XXAA 5CFCA 1OLQA 2OQ6A 5DQ0A 5D1IA 4GH4C 3HJRA 5HCHA 1MS5A 1SACA 2VMEA 2IXKA 1K42A 1K5MC 2J7MA 3VD7A 5F1RA 2DVDA 2HWE1 4Q1RA 4OQ8A 2J1UA 4QX7A 1DQ5A 1HV0A 4FFFA 2C9AA 3AM2A 1XSQA 4HXCA 4Y5Z0 3LDRA 5A6YA 4OHYA 1A3KA 2ZAAA 4AFDA 1SFNA 4IV3B 4CDQB 3UGGA 4IL7A 2Y6GA 5FTTC 3CNAA 2A70A 1UU4A 3FFZA 5A7WA 1DGRA 3B9IA 1RUG3 4HL0A 1EAH3 3PHMA 1WA4A 5BUVA 1RUJ1 3A21A 4DOUA 4FTBA 2QQIA 3T2QA 1PIV2 5FZ1A 3P5BA 3ZR5A 1W0OA 4GJZA 3T3YA 3MIBA 5JOWA 1VBA1 4AAPA 5A1LA 2JDNA 4RQPA 1UKRA 3AYAA 5FPLA 1KD7A 2VMIA 2ZHLA 4TLFA 3K4AA 1HKDA 1DQ1A 1H1IA 3I2HA 4N9IA 2LM3A 2R043 2Y64A 5L36A 2VZ1A 5EZWA 4COUA 2D43A 2WIIB 3IIAA 4CEWA 4A6SA 4BIFA 2RVAA 2VCBA 1W8OA 5DAXA 1DLCA 4ES9A 5FDBA 1GWKA 2EXIA 4S2FA 1AXKA 1N3PA 1W9YA 2RS52 4XDOA 5F5IA 1YI7A 2ARXA 2A75A 3VD3A 4CDUA 3I3MA 1JUIA 4Q4W3 1S55A 2YYOA 3BGAA 1S0JA 3HT1A 4WZCA 5JDBA 1JN2P 3MYXA 3N7MA 4BK4A 1POV3 3B3QE 1X33A 3LIHA 1VBE2 2BDRA 3P1IA 4QX3A 3GJBA 3WNOA 1QMJA 3ZN4A 4AVAA 2FHRA 5JMOA 2RJ2A 2DV9A 3ILFA 1AUYA 4PDWB 2GN3A 3KB5A 4LBNA 4F8AA 1HQLA 2XLFA 1QJU1 5A7NA 4LHLA 4D7YA 4CUCA 1HW5A 2MNGA 1NAEA 2R063 5KHHA 4DEVA 4CUAA 4RR3A 1POQA 5K0UA 2IVJA 2WZ8A 4NAOA 1VBC2 1YXWA 3AL6A 3NJYA 4FSJA 4LE4A 3P3NA 3OPTA 4GD4A 1W8HA 2B8MA 1CGPA 1NG0A 5CKQA 2WZPP 4YARA 4RHV3 4RGKA 1O6UA 5FJHA 3WX5A 1UU5A 3RI8A 1NCRB 3LCPA 2HKXA 5GLWA 1QJY1 3FBYA 3WR0A 5KXBA 2UWBA 3ACHA 4MADA 2CL2A 4Q4Y1 1SLTA 2ZHKA 5L9RA 4YZ4A 1JZ7A 3I2FA 1TME2 1U5IA 3K4DA 4AVBA 3HOBA 3JD72 1VB2A 5LA2A 2FDGA 3MICA 5LBFA 5FQ0A 1DGRN 1AVBA 4MH0E 3TB0A 2QJVA 1BBT3 2E31A 3VBSA 4NIDA 4Z82A 2IVIB 4LK6A 2CTVA 3F95A 4PHZA 3C7HA 3ZN5A 2BV4A 2Q8DA 2WWUA 4QHOA 1UY1A 1T6GC 3WV6A 3WCSA 4Y1YA 2ZMNA 4DPNA 1SCRA 2VG9A 3I54A 3ZYJB 1RJ7A 4M3CF 4FVVA 3UJQA 3HIFA 5FIXA 1R64A 3D8CA 3NJVA 1SPPB 3BTYA 3NNGA 3LWCA 1O3RA 1UIJA 3VBOB 1DQ0A 4K40A 3I59A 1AL22 1AZDA 1XC6A 2HWE3 2WZEA 3TEXA 5HCFA 1CR7A 2YDEA 3GBWA 4GZ9A 1YHFA 1JOJA 1BEV2 2VW0A 5FZ8A 4R52A 4CCNA 4QPGB 3N7KA 3FUOA 1SMVA 3LOBA 1C3HA 1NXD1 1ZNPA 2VUCA 1Q56A 3U0ZA 4Q29A 4F83A 4Z92B 4GH4B 4LA3A 4AFMA 2HLEA 2ZX1A 1RUJ3 4JVAA 4JQTA 2BQPA 5FYCA 5FZ9A 1K3IA 4O9GA 5BNOA 1ALYA 1FMD1 1O4TA 4LO7A 4B7KA 1K5MB 1VBA3 2IXCA 2OPKA 3MW3A 4PBPA 4CXXA 4L9BA 1AX2A 3L2YA 5KC5A 5I0DA 1AYN1 4XC9A 5DMYA 3BTAA 2FDKA 2GC1A 1DIWA 1Y9GA 4CCMA 4IGPA 1ZRCA 1YEWA 2QQMA 3U11A 4M0NA 4SLIA 3AKTA 3BCWA 3VBHA 1ZVFA 1NA1C 4JTNA 3SKVA 1S0EA 4BQ5A 1GANA 4HLTA 3Q8EA 2D3RA 2C0ZA 3POFA 5CNAA 3IKWA 1FOD1 1O5LA 1REDA 2QDRA 4Q4V1 1GFF2 5FMOS 4EJRA 1UYXA 3GCWA 4LHSA 1Q8SA 2AACA 1ULOA 3KGZA 1BK1A 2P3IA 2NMOA 3LE0A 4HPKA 4TYSA 2WFF1 5EWSA 1UMZA 5FOBB 1Y3TA 3C7FA 3POGA 4RYDA 4XMAA 2R1BA 1FV2A 2AH2A 3LEMA 4COYA 3KHCA 1JHNA 4UT5A 1FX5A 3MBWA 1WW5A 1LHVA 2GC0A 4QKBA 3UETA 1NZIA 5LY2A 1DQ6A 2WNVC 3M3CA 4NHXA 4HETA 4C1WA 4LBJA 1ENQA 3WNLA 4EROA 1RIRA 4NR1A 2AGSA 2VR4A 2XG3A 1QJU3 1JOPA 1AL0G 3AYEA 3OY8A 4URTA 3H50A 4BISA 4DMIA 1YO8A 1PNFA 5ERLA 3OD0A 4BE3A 1HRV2 2F4PA 1FXZA 4GQ7A 4ITCA 4YW4A 5CKNA 4MO3M 1C57A 2FDIA 2AZ5A 5C4WA 3DPRB 2GMEA 4J25A 4MHRA 4CXWA 5EIYB 2YPDA 3L2HA 3S30A 3TEZA 1J3RA 5ACA1 5FPZA 1QHDA 3AK0A 1G6NA 1NYWA 3M1HA 4RS5A 1L7QA 4ET7A 1LESA 5T5PA 2BGOA 1KGYA 4YSFA 5FZMA 1KJLA 5CFDC 5BY5A 3W58A 1K5JA 4XACA 1QJY3 2BZDA 1TMF2 2CYFA 4LK7A 1AR72 4LBQD 4YVSC 2VUAA 5JPMB 1W99A 2Z79A 5F2WA 2YGLA 4Q4Y3 3RWKX 3J7NA 5JIUA 1H1AA 2B46X 4GB32 4UW4A 3DEMA 1WBLA 5J09A 4JKKA 2QVSB 2JJ6A 2EA7A 2HWD1 2O8QA 1OT5A 2UYAA 3LGRA 4QKDA 4R4ZA 4GKXA 4W8JA 1YI9A 3T4VA 3W59A 1JW6A 2WQ4A 2TEPA 3DV8A 3S5QA 2DTWA 3T0DA 1B35C 3ES1A 1CAUA 3UKVA 1MS1A 2Q1FA 1QJZA 1UOJA 5I8TA 1D2SA 5CIRA 4XFBA 1ASJ1 1C8M2 1J1LA 5H9RA 1OURA 2R32A 3AC0A 1I6XA 4QKFA 4LT5A 4JGZA 4ASKA 1ZRDA 3CBNA 4KMQA 1CAVA 2CDPA 5A80A 3C8XA 2DVGA 1DGLA 4YGBA 2P1BA 1LHWA 1UPSA 2HYKA 3QH7A 1YWKA 4E4HA 3RG0A 2GALA 3RI9A 4UFHA 1XNTA 3WT3A 3WXPA 4KWJA 1YFXA 4RSUA 2RDSA 3OGRA 3N9MA 2WUHA 3OBRA 5FYBA 3O1VA 4LXLA 3WY6A 3NJXA 4LMFA 1J84A 1F5FA 4XFIA 1YQ8A 2VC9A 4AI9A 4P9LA 1RUH1 1FMD3 2EICA 2R30A 4QQPA 3JBG2 1BYHA 2VOVA 2HWF1 4ZKTB 2ZAHA 2B9VA 3OBZA 1WA6X 1AYN3 3DKWA 2VQ0A 2C9KA 2FDHA 1XU1A 1LEMA 1KQRA 1V9U2 3EB7A 3UJOA 2F6BA 1S2KA 1HXS2 1PO22 4IGOA 1CPMA 3OPWA 1OBNA 4YVWC 5T5LA 5C7GA 1HX6A 1YNAA 1VAKA 2ADEA 1MEC2 1CIWA 1JS9A 1AJKA 5DDJ1 2OKXA 1FOD3 2JE9A 3WDUA 1IS4A 3FX3A 4FPEA 3BI3A 2W08A 4Q4V3 4BQYA 3ME2A 3AKRA 1WLTA 1C5IA 1YQ2A 1E5SA 1WD4A 2VMFA 2WFF3 2HEWF 1RC6A 2Y0IA 3EQEA 1OHFA 1OPMA 2Y26A 3SC7X 2DVBA 4CP0A 1F8VA 3CU7A 3ZFEC 2D6PA 1WMFA 2XJQA 3UV9A 2ZTNA 4FFIA 4KL1A 5C8CB 3LKJA 1OKOA 4NOTA 3OBAA 1NA1B 4N43A 4A42A 3BIWE 2WFPA 3HQXA 5AVPA 3R4SA 1TVGA 5IYYA 1PVXA 2E9QA 1HV1A 3SEPA 4CCKA 2WN2A 4B4QA 3KVAA 4LQRA 5T55A 3VHNA 2OT7A 2W1WA 5FP9A 2P34A 1RMU2 3VL8A 1V6KA 2YC4A 4MXWB 4IEVA 1OLRA 3OBTA 2YZ4A 3ZFFA 5ACA3 1T6BX 3DL3A 1JYIA 5ISLA 3AL5A 3ZDVA 3O5SA 3GHMA 1W6OA 1YFYA 5EYXA 3R4UA 1I9RA 4MGQA 4ZXKA 3M3OA 3PVOA 5K9YA 4LPLA 1VAMA 3V65A 3S0MA 4XUQA 3VUOA 4L11A 3DYPA 5BNPB 3C2UA 2GP3A 4IEZA 3H7JA 4IEYA 4MG2A 4IE4A 4AXOA 4JZRA 4XE9A 1EY2A 2P37A 4PF5A 4V1PA 5CA6A 1Z7S1 1QDCA 1W8WA 2BFUS 2HWD3 4PIYA 4IUGA 2W87A 4XMIA 3VBFA 5CFDB 1WZXA 5KBFA 1OFNA 3FLRA 5DAQA 2XHNA 1AR91 3IDAA 3L9JT 4WM7A 5KHJA 1RUNA 4QXHA 1QH6A 1WLCA 3T09A 1CESA 3N9NA 4L8QA 4CVUA 2ZGOA 1G8WA 4YVSB 3AFGA 1VMJA 3HAGA 1ASJ3 3SH4A 5LB6A 2Z2SB 5A32B 1YQ5A 2GMPA 1W90A 3CJIA 2JB4A 4UF0B 1PVC2 3W9AA 3CQOA 1SZBA 2PHRA 2HWB2 2VTFA 1E5IA 2ENRA 2CU5A 2DFCA 2B39A 3U4XA 2RS51 4FPHA 3S7EA 2R49A 1B35B 2EXKA 5FJKA 3ZYRA 2BUKA 2WAAA 3D0SA 3FLTA 4K20A 1ZBA2 1GQGA 1VBE1 2VVDA 2Y6FA 3O1SA 2RG4A 4BU2A 2W95A 2WJSA 1ST8A 1I1EA 1QNYA 1VB4A 5I8YA 4IGQA 2D6LX 3NJZA 1N1YA 1W8FA 1NXMA 1D2QA 4EE2A 5FO7B 2Z69A 1UW8A 2W92A 3LDBA 1RGSA 1RVF1 4G9SB 3WQ0A 2XWBB 2CGNA 1UZYA 2XL9A 1FPN2 1ZRRA 1RUH3 1XE7A 4BJ0A 5J96B 2AREA 4QU1A 4KG0A 5FUIA 1VBD2 4CYDA 2HWF3 2PHFA 3GZTB 2ZGRA 5KR7A 1HB2A 1NKGA 4Y24A 5G05L 1JZ6A 3H8OA 5DG1A 3GCXA 5F8PA 1OH3A 5JPNB 2BEOA 4Q8LA 1HLCA 4IV3A 4ZU5A 4W6YA 1KDKA 3H9AA 1PK6C 3RJRA 4BH9A 1OMIA 3E1F1 4JAAA 4UXAA 5DDJ3 4ATFA 1DGWX 3HN1A 5DAWA 3BUCA 2BOIA 3N4MA 1W28A 2BBVA 3WHTA 5A70A 5JLVA 4HT1T 3OOXA 5FO9B 5AFBA 1BCXA 4WVMB 3VBRA 1ZZBA 1TNFA 4XJ9A 1XJAA 2JICA 3RZMA 2JDZA 5T50A 5A3MA 1TME1 1GP6A 4HOOA 4AEDC 1R1ZA 1GV9A 4LBLA 4CZSA 4FPFA 4GWIA 2CGOA 3NV3A 3PIJA 2Y0OA 5IWFA 4YVWB 2G9ZA 5IT6A 2RDQA 3NNMA 3DXUA 2E6VA 4XIKA 2IXHA 5F7UA 3VD9A 4B1MA 1N1SA 2W3JA 4P02B 4YG3A 2UY9A 2A6ZA 4GA9A 1NUKA 1LAJA 2FDFA 1GBGA 2IUWA 2DFBA 1L7LA 1LOGA 3MLJA 2ZXQA 4DXSA 2WT2A 1PX4A 4B1LA 4BQWA 3SHRA 4CXYA 3ZFEB 2DCZA 3PJYA 5FYZA 2GNMA 2NM1A 4FPGA 2VU9A 1APNA 4GXLA 3TEYA 4D94A 2RMU2 3NV2A 3B01A 2XLGA 3O1PA 1W8TA 1AL21 4LUKA 4ZU4A 5A7QA 4RA0A 1PGL2 3VKFC 4PDWA 1HN1A 5FWEA 1RUC2 2D6NA 1BEV1 2WQ8A 3LEKA 4IEUA 4KG8A 1F35A 2Q8EA 4K8RB 2YXSA 4LEJA 4Q4X2 3MIHA 4H7MA 4W6WA 4CUBA 4DNYA 3VBUC 5C70A 1HQWA 1U12A 5EFUA 1NLSA 3K3OA 4FPLA 4AR2A 3RZJA 5CZKA 4QGLA 5EV7A 4LJHA 2E33A 4AW7A 3HBKA 5F3EA 1HB1A 1Z7S3 5EYYA 4KU8A 3VD4A 1DQ4A 2FMYA 1V0AA 1RYYA 1OA3A 1PMIA 3MW2A 1AR93 3JQWA 4MXVA 1UOBA 4QXCA 4WV8A 4QPYA 1S2BA 4YWAA 2KA3A 1W6NA 3OF1A 5C3QA 3ECQA 2OUHA 3WZ1A 3T2PA 1WD3A 5L9BA 3V0BB 5FYMA 2P6CA 1W8ZA 4HFSA 4DS0A 1ZA4A 1GZWA 1JZ4A 1G9BA 4FPCA 4UFIA 4AVSA 1JTZX 4E2GA 1IZ3A 3UKNA 2ZHNA 2BTVC 3PIGA 3ZPYA 2RS53 3UESA 4CP2A 4FCAA 2YFUA 2XVGA 2D93A 2V4VA 3B00A 3WD5A 1IQDC 2VMGA 3VZNA 2WINB 3C3VA 5K4LA 1VBE3 1E5HA 1EPWA 1UYZA 2WDBA 3AFKA 3J8F2 2D3SA 2D6KA 3AX4A 3FBMA 2QQPA 3AMQA 4OQ9A 3RNSA 3D6EA 1C1FA 1R1A1 4N53A 2W5FA 1RUE1 5L7OC 3ROUA 2WYSA 1A78A 4HZFA 1J58A 2YROA 1RVF3 3I4IA 3ZXDA 3H0OA 1SPPA 2QQNA 4AOCA 1HRV1 4I01A 5E8AA 3ZXGA 3ZFGA 1H9WA 4LBKA 3KHBA 2ZS6B 5JI7A 4FFHA 1UIKA 4CDWC 5DAVA 3VGIA 1VALA 4A3ZA 3KLSA 1NCQB 2XBO2 4QPGA 4AI0A 4MLOA 1SHWB 2WABA 2DVAA 1W6PB 5FZHA 5LA0A 2A71A 1GICA 4NPRA 3BOPA 4H7LA 3AMNA 5B4XA 4ASMB 1WMEA 2WZR1 2ZEYA 2JWPA 4QPIC 3VZJA 2ES3A 1OA4A 3LEIA 1JOBA 1IS6A 3EYPA 3VV1A 5BNNA 1OF4A 3UNPA 1UYPA 3BVCA 1K5MA 2DDUA 2VCMA 2Q8CA 1TME3 3BPZA 5FPAA 2BVBA 2VO5A 1PX3A 3R4DB 1OC1A 2SLIA 2VUJA 4A2UA 2VCAA 4QPWA 1WW6A 2P3KA 3ZYIB 1KDMA 4M4RA 1PK6B 1R092 3POBA 3PVBB 1ULGA 2VQAA 5FCCA 1MZ5A 3T2OA 4AQSA 4N9HA 2XQXA 4C0HA 3DN7A 1A34A 1LGCA 1GQPA 2RDNA 5JZGA 3MO4A 1O3SA 2VW1A 1BHGA 1C8M1 1JI6A 1W8NA 4FXKB 3OCPA 5FZEA 3SITA 1LODA 1UF2C 2BNMA 2AEYA 4MGSA 4OZXA 4UW6A 3RZLA 1S1AA 3RYRA 3VKNA 2A7AA 3ABZA 1NLQA 2BOJA 4P9YA 4XHXA 5DABA 3I3EA 4AEDB 3HD8B 1JU4A 3PUIA 2BWCA 3VBOC 4M4PA 5A33A 3NAPC 4UW3A 1WCUA 2D40A 3Q9OA 2RS12 3JXSA 3BKZA 1AL23 2MEV1 2NP0A 4NUBA 1UD1A 3I49A 4MGKE 2ORZA 3A4UA 5FKCA 1X8MA 1ZX5A 3A0KA 2EIDA 1BEV3 3WQBA 3PDQA 5FY4A 4URAA 4NWVA 2QQLA 2FBEA 3MPBA 2ZGKA 4QDRA 5I8SA 4CCJA 3WW2A 1DYOA 1W9TA 3J7LA 4P14A 1QF3A 5FWJA 2EAKA 4QAWA 1S0FA 4WM8C 5D21A 3FC0A 3EBRA 4BWOA 5LWBA 3LA3A 4LTAA 1MACA 3AKQA 2OVUA 3MIGA 3NWKA 3D0JA 3JBG1 4F3JA 5FZBA 4N7IA 3NRUA 4NN0A 3TN92 3KCXA 3U4SA 4D7TA 1IS3A 2ATFA 4MVTA 3ZIXA 4AVVA 1MZEA 1CX1A 2WO7A 3SEEA 5FZ4A 1NY71 1LOAA 1VIWB 2BPA2 2DCYA 3CO2A 3VBUB 1D7PM 5FY7A 1S0BA 3I7DA 4EYUA 2C6SA 4AI8A 4E8CA 4XOGA 5I91A 1LU1A 3CEWA 4I02A 4JDOA 5EJ3A 2UWAA 2W94A 1LOFC 4OULA 2VVEA 2WL1A 1Z78A 3IPVB 3LDKA 3E6DA 2NZ9A 2VTXJ 4HKOA 2OPWA 3LPFA 4AI2A 4COWA 2CHHA 5BPXA 5A1AA 3ILNA 4UI9L 4OHZA 2VUDA 1JBCA 4B4RA 1WWYA 5FZLA 4EN0A 2KXLA 3QBQA 2DBIA 1M06G 1R1A3 3OYWB 1RUE3 2HH9A 1N1TA 3HR9A 2GN7A 3PLQA 4UFKA 3GGLA 1P8JA 3WDYA 5EPAA 5IW0A 4FBFA 1XNAA 1AR81 2FCUA 4YGCA 1HJFA 1HRV3 1W06A 1LGBA 3DPRC 5AC92 4BIOA 2W1UA 1DU3D 2CWSA 2YBPA 5JSPA 1QOTA 1ODNA 3MLLA 5J37A 2W39A 3LSEA 1RUD2 3EXUA 3LOIA 1SLCA 2IXJA 3ZYGA 2VL4A 2XMLA 4P9GA 4QB6A 5KWRA 1CX4A 1UXZA 5L7OB 1YJLA 1EV12 1W05A 5B4NA 2HEVF 2W0XA 4Q0QA 1JHJA 5DUVA 1LOBA 5G04L 5J48A 5JOZA 2WZR3 2WN3A 2RM21 5M0TA 2XUMA 2PHDA 1DHKB 5C8WA 3ACFA 2WA4A 5H9PA 2X05A 2W91A 1F15A 1UX7A 3WDVA 4XFFA 2AENA 1UY3A 2N7GA 3ILRA 1US3A 4NPLA 3KSCA 4CDWB 5JWPA 5K7PA 1ULPA 3IMMA 1UOGA 5FZGA 2FZ2A 3MUZ1 3PU3A 4K1YA 5FV3A 1PMJX 2RDRA 4QB2A 3IAPA 3N36A 2BNOA 4NVPA 1SDDB 1VBB2 4L0PA 1QJX1 1XB9A 3C7GA 2QKDA 4QPIB 2K46A 5LA9A 5LZ6A 1Q8PA 5FREA 1C8M3 1ULFA 2WC2A 4DFSA 4IE7A 1BQPA 4CE8A 3ZN6B 1N1VA 2X29A 3ALQA 1MS8A 3QLQA 4JGYC 3W20A 2HJIA 1JUHA 4LULA 1G7YA 1W6MA 2E32A 3CKHA 3P3PA 2VMDA 1CVNA 4I3PA 3VDDA 2PA7A 1CPNA 2WSVA 2ZGSA 5JIAA 4BHPA 2WS92 1NA1A 2MEV3 4PQQA 1BLZA 4INDA 1UNBA 3PUAA 3CHXA 4XFGA 1Q8QA 2VQUA 1GMMA 1ZBA1 1I3HA 4IE5A 2LW8A 2RS32 3VZLA 3BU0A 2UY8A 4TXWA 2UYBA 3K46A 4LBMA 5HCAA 3NNJA 4U36A 5JOYA 3AZWA 1DZRA 3WF0A 5J1XA 4CDUC 4CEYC 1LULA 1U5YA 2XOMA 2D3PA 2W47A 4QXBA 3NAPB 2PFWA 2V72A 1VBD1 3JBG3 1RL3A 1A6CA 1SLLA 1NOVA 2DU0A 2WNVA 4QM9A 5GLUA 1KJRA 3TYJA 2XPJA 5BXXA 1ZZ6A 1W04A 4BA6A 5D2AA 3WF1A 3M4FA 4AHXA 3AB0A 4Y22A 5EJZB 3JQXA 4S2DA 4D69A 4YG0A 3TRSB 4H2AA 1Y7BA 4MGIE 1RXFA 5LK7B 1OSGA 4WM8B 2VBDA 4PIZA 4YGDA 2V4AA 3KV9A 4Q0SA 4DXTA 1O4ZA 1X7NA 1GWMA 4R8HA 1GYKA 1NX9A 2DCTA 3NW4A 4X6QB 3S7IA 4DZGA 2HWC2 4AL9A 3ZYPA 1AXZA 2IWGB 3WDWA 3H8UA 5CFDA 1NQJA 4QHBA 5KC6A 4OFGA 1A8MA 1GQHA 3HPNA 4DB5A 5C8CC 1ENXA 4ES8A 2VXRA 3QD6A 5CVRA 4C90A 4AGGA 4LHKA 2PAKA 1WKYA 4WZFA 4L92A 5FUPA 1OH4A 1YQCA 2ET1A 3IDEA 3NNFA 4YVSA 3U78A 3USUA 2ZEWA 2ZZQA 4TLGA 3ZMOA 3V0AA 3RYPA 4XFCA 5A32A 4C0BA 4I30A 1SLIA 2UWCA 1K45A 1AR83 3R0RA 1O3QA 1UZ0A 1W6QB 3BALA 4ZS2A 3ZM8A 4LE3A 2A6XA 2VMCA 1HRI1 4LLOA 2DURA 4NE9A 1AR61 5SV5A 3WF3A 4YZ1A 2EAAA 2JKXA 1RUF2 3D82A 1B35A 1PZ8A 5L73A 2K0GA 5JR2A 4KNCA 5FP4A 5A6QA 1PGW1 1DZQA 2PXJA 2VNGA 1QOOA 1V6IA 5A7OA 2Y60A 1KFUL 1EAH2 1LECA 1V6LA 3HNBM 3ZKYA 3O0VA 4R4XA 2ZKNA 2E63A 4KH9A 4XQDA 1O3TA 4XZPA 4XDQA 3ITQA 5BNPC 3T1MA 2RM23 5EXOA 2VZVA 4Q4X1 3IAQA 5JAXA 5ABJB 2R0FA 2DVFA 3I8TA 5IK4A 1PZ7A 1JODA 1BVVA 2R042 2VULA 2G4IA 3M3IA 3MUY1 4JKMA 3VL9A 1JYVA 4AEJA 4COZA 5FZAA 2D5HA 1EP0A 2DYCA 2X5IA 1I5PA 1ULDA 2VZQA 3POEA 4A45A 2WO1A 1ND2A 3AP4A 2A1XA 2PLV1 1LU2A 3O12A 5FLHA 1CZVA 2V5YA 4GMP0 1QJX3 1QH7A 1IG0A 2YU1A 4QHZA 1H2NA 4Q4W2 2DUQA 4LITA 4QKNA 4BYYA 4OI0A 4EWAA 1FNZA 4WVMA 4PI2A 3EO6A 5FZ7A 3B9CA 2E7AA 3I2OA 4DUXA 3LQCA 1L3JA 5J7MA 1VAVA 4E4DX 3DUIA 4TN7A 3D5OA 2VH9A 3S6PA 4KWUA 3GF6A 1JZ8A 2OZ6A 1CZTA 1YLLA 2QDNA 2GP5A 2WWJA 3VZMA 4YVWA 5FMCA 3KZ4C 3KVBA 4QGNA 5FY8A 3P6BA 1X82A 2WT1A 1L7RA 1TZOA 3VBHC 2I2SA 1ZBA3 1GZ9A 4KGQA 1CJDA 1UWWA 5A7WB 2Q1ZB 3H3UA 4DUWA 4CTEA 5IK5A 1C1LA 4Y33A 4MYEA 2CV6A 3GBFA 3U37A 5K8SA 4C1XA 4JGYB 3WNPA 4RFT0 4RHV2 1H4HA 1KFXL 3APBA 3M7AA 2VM9A 4QX2A 1ND3C 4ZU7A 3I3DA 5FK7A 1MPXA 1C8NA 4LIUA 3VD5A 4JHTA 4CP9B 4ZZ8A 4AGRA 1VBD3 4GALA 4A41A 3N3HA 2JECA 1IHMA 5A3LA 5DZGA 2GNDA 2O8OA 1W3VA 2WBKA 3MF9A 4M00A 4BOWA 4CEWB 2W52A 3M3EA 3V64A 5JXGA 1HQNA 1COV1 1I5ZA 4LR4A 1D0GA 1XYOA 2VGDA 4XAAA 3TWIA 4ZHNA 3N9OA 3WQ1A 1SFYA 4D7SA 1UXXX 2RR11 4CDUB 3VHPA 4CEYB 2Q4SA 5C4WC 5IFTA 1R082 4YZ2A 1QY4A 3ASIA 1BBT2 4B8EA 2JE8A 4FQZA 3Q8BA 2ZA9A 1KXGA 3ZO0B 2XHKA 3VLBB 2GMMA 1VRH1 4NAMA 4HK8A 4XTPA 5F32A 1JYCA 3MDPA 2JDAA 1X36A 4XBLA 5EP9A 3J26N 4Z1VA 1ZBE1 4NROA 5HXVA 1OOPA 1LNSA 1PM7A 4LKEA 5JR7B 3T30A 1R091 1SCSA 3E6BA 4EN8B 3V0BA 4R9BA 2Z4FA 4J1XA 4R9AA 3ZX7A 2XVLA 5LASA 2Q1MA 1SEFA 4Q0VA 5FYIA 2HWE2 4YW3A 3RVHA 3ZXKA 1E57A 2EXJA 4X8PA 4XEZA 4K21A 3MIEA 1HRI3 2ZZJA 4HG6B 1AR63 3W5NA 4RL7A 1VP6A 1FYUA 3H1YA 4DRRA 3ZSEA 4NIGA 1CN1A 1QU0A 3THCA 1YJKA 5LBEA 4Z8BA 4YLZA 5JMCA 3W21A 1RUJ2 3DYOA 1PO11 1W8UA 3HNMA 2B9UA 4NO4A 5FXWA 1TNRA 2B7YA 4JGZC 4M3CE 1XU2A 2JIGA 2BGPA 4Q4X3 1H9PA 1BZWA 4YM2A 5JCTA 4LBOA 3TEWA 3KV5A 4AHYA 5FZOB 2X10A 1O8SA 3WNNA 5C9AC 2JD4A 3B5LB 3WP4A 1MS3A 1HN0A 5DAPA 4XCBA 5IVEA 5LEKA 3JB4C 3LA7A 1RTVA 2A6YA 1GU3A 5IVFA 3RFRA 3TN91 2KR2A 1RINA 3FUQA 1AYM2 1W6PA 2Y6HA 2WNUA 4BDVB 3J9SA 2PLV3 3H42B 3FE5A 2GU9A 4MUVA 4M3CA 1US2A 2A73B 2ZHMA 2VPVA 3A23A 3WINE 3FLPA 4P9XA 2ZBJA 2YC0A 4PCRA 5F37A 3ZYBA 3M2MA 1GP5A 5EQUA 4CUGA 3I59B 1PIV1 1Q3EA 2ARAA 1SG3A 1OLME 3MPPG 3AP5A 3RWNA 4BQ2A 3KCCA 1OPOA 1X9PA 2J42A 4GULA 2WSUA 5F6LB 4AFBA 1SFPA 4CA9A 3MHZA 1XNCA 3GALA 3IM0A 4IV1C 1QJU2 1Q8OA 4G4FA 3WG1A 1J59A 4ARYA 3THTA 2WR9A 4GJYA 4L2NA 5IUQA 2L9LA 2VBBA 3SMHA 1G9DA 5DZEA 4QD2A 2Z42A 4DINB 1VRBA 1CAWA 1YQ6A 2X8KA 2FMDA 2WAOA 2AEZA 3H1WA 4GWJA 4LNVA 3ACIA 2QUOA 3PL0A 3BOWA 3T2TA 5HPOA 3WCRA 1ZA7A 2LS6A 3AJZA 3ZLIA 4QQOA 1LGNA 2OQ7A 3IB3A 1XYPA 5IVCA 2ZX3A 3IT8A 1IG3A 1H8TC 1OLMA 4LA2A 4Y5SA 4YM0A 4OI2A 1Z0HA 2CNAA 1Y9MA 5FY1A 3MEPA 2YB7A 2XJRA 4CSWA 2ARCA 1XSRA 3ACGA 5C3OA 2H6BA 1H6YA 3OUJA 5CADA 3VBHB 2WLQA 1XXNA 2Q0AA 4JKLA 1NCQC 4Q4Y2 1COV3 1YC61 2VY0A 2D97A 3PTRB 4Y4YA 3T08A 1YUDA 1EV11 4Y1XA 1RITA 4WVVA 3ZSKA 3KT4A 2RR13 1OKQA 1PMHX 1ND3B 4XF9A 5A7SA 1KS5A 5J3UA 4UFJA 2PQQA 3QH6A 2P3JA 1XNBA 1VBC1 3URFA 2PHWA 1UO9A 3OSDA 1U0AA 1VRH3 2JB8A 1H30A 1CQ9A 4AE2A 4IEWA 3DKQA 4CDQA 2P3YA 2XJUA 2XJSA 1ZBE3 4OI4A 4Y4RA 4YYOA 1BVP1 2W46A 1XE8A 2J1SA 3OTFA 5C6CA 3OY8B 1R093 3VBUA 1GOGA 4FI9A 4AHZA 2BP6A 3FJSA 1VBB1 5C4WB 2PHUA 4CCCA 4CRQA 2O0OA 4E4ZA 3AYCA 4KQ7A 3WLUA 2LROA 1QDOA 3K75B 3WNKA 1MZ6A 4FXGB 4EWDA 4UBGA 5DG2A 2ZGMA 3A7QA 4CU9A 1NE4A 3IPVA 1IGOA 3JD71 5T52A 2SBAA 2VTXA 2ZEZA 4LIVA 1E5RA 2K2SA 4FPJA 3VBFC 2BW8A 4JV4A 2ZX0A 4CDXC 3AP7A 3LA2A 2VZRA 3RZKA 3AP6A 4WM7C 4XILA 4W65A 1CIYA 4PI0A 5D8AC 3H8XA 1O4YA 3S57A 5F3CA 1UY4A 3LAGA 3GBGA 4W50A 5JVVA 2CGPA 2WS91 3O0WA 4FPOB 5FYTA 2D6OX 1PO13 4XAEA 1GWLA 1PZ9A 5AVAA 5CBLA 2XL7A 5FZ3A 1QOSA 3WP3A 2RS31 1QQP2 2H0BA 4Q0PA 1WBFA 2AUYA 3KQRA 2OA2A 3RPQA 2A3YA 3NMBA 2ETEA 5E6HA 4CPBA 4XQWA 2BWAA 5CEHA 1JZ5A 2LUWA 2FZ1A 4K1ZA 3DCQA 2QQUA 3FHAA 4NPMA 3U14A 1FOD2 2Y6JA 1YFWA 2WNEA 3NO8A 1T2XA 4Q4V2 3TN93 1JYNA 5L7OA 2JG8C 4JGZB 3WEZA 4HSJA 1WW4A 4HN0A 1RUI2 3NL1A 2KM2A 4P5HA 4D6SA 1F9KA 2EVXA 3RMYA 1CAVB 1LR5A 2J1AA 3RJ2X 1K12A 1VMHA 1G9FA 2V5DA 4G3YC 5EJ1B 5I0UA 5CAZA 4E27A 2ZCWA 3WDTA 4YPJA 5C9AB 1PIV3 2J1VA 2VBPA 2VD7A 3WF4A 4CDWA 1TQ5A 4UFMA 2P17A 1FT9A 2OZJA 2MPFA 3ORJA 3KWVA 1GLHA 3AYDA 5GZDA 3RMXA 4E8DA 3IDCB 1EUTA 1NCRA 2JG9C 1IOAA 1JU3A 3FFQA 4OUMA 3UT0A 4GWNA 3LPGA 5FP3A 1YYNA 4OMCA 4ISQA 3RZGA 1H2MA 1WCKA 3VZKA 4EV0A 5ACA2 5CKMA 3TOJA 3E5XA 3T0BA 4D8MA 3VBRC 3ZN6A 4XF0A 3R05A 1WW7A 2EALA 4W6XA 4DRVA 1LOEA 2BBAA 1N47A 4XF1A 4IV1B 2PN5A 4FOYA 1QXPA 4E2QA 3HNYM 1RUF1 5F3IA 5H9SA 1S2EA 3RDIA 2G19A 2PYTA 1NT0A 2B42B 2YFZA 4ZONA 5I0RA 3FHIB 1J1TA 1NLRA 2R072 3I3QA 3NV1A 5FZKA 1O91A 2BGCA 4LHNA 1POV0 3JB8A 1EV13 1VJ2A 5BNQA 4NHYA 4IXLA 3I2GA 4I0WB 2DWRA 4IQPA 4AK3A 4D6RA 1H8TB 2XR4A 3JU9A 3VBOA 3BODA 1VBC3 4QX1A 2VVFA 3NAPA 5A3TA 1UZZA 1FAYA 2GH2A 4LORA 5T3NA 2A5ZA 4N43B 5F3GA 2B45X 4B7EA 4QQLA 5IHRA 3DYMA 4YRDA 4XXPA 4K9SA 2NYYA 2WA3A 3O0XA 2ZABA 2EIBA 5DN2A 5FYVA 2VOWA 3ZSLA 4GH4A 4U2AA 4KBZA 3E97A 1TMF1 2W2IA 4P00B 1AR71 2W9XA 4K7JA 1VBB3 4BK5A 4FOWA 2VXJA 4LKDA 3M3QA 4ZXEA 4ATEA 3ENRA 1Y43B 2D44A 2E53A 5E1RA 3ZFFB 1YIFA 3ETQA 5FO8B 2WO2A 4GB31 5FKBA 5FY5A 3TNPB 4IEQA 1MQTC 3JD73 2BU9A 1J3PA 4XPVA 2QFEA 2IXLA 3PMSA 3ZOIA 3CZUA 4FOVA 3VKLA 2JDUA 2E51A 3MF6A 1B09A 2Y34A 2WS93 2OUJA 4FFGA 4IERA 5FBZA 1HDKA 3K3NA 4Z07A 1RUH2 3BPSA 3WG2A 5HV4A 4R9CA 1UQXA 2YMZA 2HWF2 4Y5TA 2JX9A 5KXCA 1UN1A 4K8FA 2RS33 5JOXA 2ET7A 1LOFA 2WWSA 3GM8A 4MX3A 3OPZA 4YFZA 2RJKA 2VNRA 3BN6A 5A1FA 2QZ2A 5FP7A 4CCLA 3HWJA 3VHOA 3VBFB 2OW4A 4HKLA 2PQSA 5J98B 4CDXB 2RHPA 5FZCA 2YV8A 4WM7B 5BYNA 4XF4A 2WKKA 4H3WA 5D8AB 5I93A 1BJQA 5FK8A 5IAXA 1H2LA 2ORXA 4JTOA 3NKTA 1ZZCA 3DGTA 3HQRA 3FHQA 2C4XA 4TWTA 4L97A 3CIHA 3OGSA 4N53C 4S2HA 2DU1A 1QGLA 1W03A 5GKAC 3UK9A 2H6CA 1NE6A 1SLBA 4PQ9A 2OYZA 4MZUA 3FL7A 3SCHA 3VN4A 5LCWL 2BVVA 2VZSA 1GOFA 2QZ3A 2B4KA 3DPRA 4RGAA 2JDYA 1MS4A 2XGXA 5GLZA 3SLIA 4QDQA 3J4UH 3ZFGC 1R081 4SBVA 2WYFA 3AZVA 3NQHA 2PHLA 2E7QA 3C7OA 2OXBA 4QM8A 3UGFA 1QXRA 3ON7A 4L99A 2HBTA 2RE9A 2JG8B 1V9U1 4F7ZA 4M01A 4AFCA 2YC2A 1CD3G 3PJQA 4YM1A 4FTSA 1HXS1 1PO21 2Y33A 3ZXEA 3SCFA 1MEC1 4XDPA 1TEIA 2XVKA 3IDBB 4AVCA 1H0BA 3AKPA 4XQ4A 2EF6A 1W2UA 3Q8FA 4XJWA 5IATA 5BNNC 4BMBA 2ERFA 2JD9A 4HVQA 4CCDA 4CP1A 5FR3A 4Q2FA 3VDAA 4GAZA 2JDPA 2CSGA 2TUNA 2NN8A 2VZ3A 4N7UA 1QXJA 2JG9B 3KT1A 1W0NA 1X50A 1M4WA 3J7MA 1LOCA 4I0AA 1RUF3 5A3NA 4HBNA 3H8RA 1ZRFA 3B94A 5IVVA 5F39A 5DUUA 1N3OA 4UBHA 5JZGC 4TSVA 4TZDA 2CAVA 3X29B 1GSLA 3O1TA 5GJ6A 5IFPA 4EZ4A 5FMOL 1IS5A 4IETA 1Z7S2 4XFHA 3VBRB 3QOPA 1PGSA 4JGYA 4NHLA 1ZZ9A 1GNYA 2GSYA 2J1TA 3NNLA 4NIAA 3VB9A 4JQRA 5ABJC 4P9IA 1AR92 1RMU1 2ZACA 3PNAA 3SH5A 1LHOA 4CP9A 3UYJA 1V6NA 5KXEA 3DECA 2QQJA 4PJYA 3GZAA 1UU6A 3IWZA 4XJ8A 4GIQA 1D4M2 1WCSA 3GZEA 3O1UA 2O14A 3POJA 2E7TA 2FQPA 2ZGLA 3H1MA 4ZY9A 3ZR6A 2JIJA 3OUHA 5C3PA 3IIIA 2FCTA 4YG6A 3HN3A 1WGPA 3MFAA 2C5DA 5BV6A 1AYM1 1TMF3 2EIEA 1AR73 3VHRA 5CB7A 2O1QA 5LA1A 1V6JA 1NZCA 3ZMNA 1IPJA 4CEYA 2VZPA 3Q8AA 1CZSA 5JXHA 1GKBA 1YCIA 2V09A 5IK8A 5GZGA 4RD7A 1LHUA 4GB33 2NLRA 5FZIA 4D3WA 1ZZ7A 1FI2A 1HB3A 5FMBA 1JYTA 3HMYA 4AI3A 5C33A 1ENSA 4JDNA 4IW3A 2PELA 3BIEA 5KXDA 2ZPXA 3THPA 3KM5A 3KGLA 4XUTA 4OHVA 4IEOA 1RVF2 3POSA 4XZUG 3ZIWA 4BZ4A 5CG9A 3CJXA 4BXSV 4A7YA 1LHNA 3OJBA 4MOAA 2DUOA 1Y9QA 2ZGPA 4HMZA 1D4VB 1F31A 5I0SA 4BQ4A 1WMDA 4Z2AA 3NV4A 1OFSA 4AQ6A 2GZWA 1GUIA 1UX6A 1UAIA 3K48A 1PVC1 3BYWA 2DF7A 2P2KA 1MQTB 1AHSA 4QQHA 4RQPC 2HWB1 3AP9A 3B93A 2QNKA 4YW2A 3U1XA 4N8MA 2QQVA 3ZYFA 4Q8KA 5C3SA 1TE1B 1OUSA 4OMDA 2Z5WA 3UGHA 4A44A 1X9TA 5C8CA 2BRTA 3NVCA 3KQ4B 3AXEA 4PBOA 4PLMA 1W6NB 4OYUA 4OUEA 2PTMA 1JZ3A 1DYKA 4KWKA 4CEWC 5GZFA 3OEBA 4MGZE 5FPUA 4EQVA 1YRZA 2D98A 2Q5TA 3IBMA 5I0TA 2P6HA 1JYXA 2FD8A 1GZWB 1EYBA 2VW2A 3KT7A 1RHI2 5FMDA 4XIOA 5A3UA 4DXZA 4MXWA 4P5YA 4LLFA 3RSJA 5FZOA 1FPN1 4MV2A 1R083 3AZZA 4XETA 3J7HA 1O5UA 3WW1A 4CPBD 4CU8A 4YFWA 2B5HA 1DQ2A 1UZVA 1W9FA 1Y4WA 4JRLA 2D7FA 3T4HB 2GAUA 3BB6A 3MZHA 1UPIA 2C1FA 3K4ZA 4AQTA 2VNOA 5GM0A 1V9U3 4N53B 2PAEA 4Y20B 1OD5A 1HXS3 1PO23 1SLAA 2DCJA 2D6MA 4XJAA 5BNPA 3WNMA 1F4HA 1MEC3 1DZTA 3WHUA 4E9KA 2BNNA 2MHFA 2ARBA 3PTYA 4RR3C 4S2GA 5H9QA 5K0UC 2K9ZA 2UURA 4UW5A 5T5JA 3ZFGB 4BXFA 4D6QA 1CAXB 5JUVA 4LO4B 3OB8A 5T5OA 1OVSA 4Y3OA 5FAXA 4BB3A 1IKPA 1U5ZA 1MS0A 5J36A 2XDVA 4DUVA 5DZFA 4META 4LBQB 4FP2A 5GALA 3U75A 4JX0A 4E2SA 2EXHA 1RUOA 4EN9B 2IFWA 4AAXA
chains in the Genus database with same CATH topology
3W21A 2RDRA 4XABA 4KBZA 4JZRA 3GZEA 2JIGA 5IAVA 5LATA 5LA9A 2JIJA 3OUHA 2FCTA 2G1MA 4NHMA 3GJAA 5DAQA 3W20A 2A1XA 5DAPA 4UWDA 5C5UA 4XCBA 2Y34A 5LB6A 2HBUA 5HV0A 5HV4A 4XCAA 4IW3A 4Y5TA 2RDSA 3NNJA 5L9BA 5EQUA 4NMIA 4XC9A 3HQUA 5DAXA 2RG4A 3EMRA 5IAXA 3HQRA 2FCVA 3OBZA 3GJBA 3MGUA 3PL0A 2OPWA 2V4AA 4Q5OA 4Y5SA 4BQYA 3KT7A 5LBBA 5A3UA 4XAAA 2HBTA 3OUJA 4NAOA 4NHXA 5C5TA 5EPAA 5DAWA 2Y33A 2FCUA 4BQXA 5DAVA 5ERLA 3NNFA 5IATA 4MHRA 4J25A 3OUIA 3KT4A 2G19A 4ZONA 5EP9A 2RDQA 3NNMA 5LBCA 3KT1A 3BVCA 4MHUA 4NHYA 5L9RA 5LASA 4XACA 3DKQA 5M0TA 5LBFA 4ZPIA 4BQWA 4NHLA 3NNLA 2RDNA 3ITQA 4NHKA 5LBEA 5L9VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3W21 A;  2RDR A;  4XAB A;  4KBZ A;  4JZR A;  3GZE A;  2JIG A;  5IAV A;  5LAT A;  5LA9 A;  2JIJ A;  3OUH A;  2FCT A;  2G1M A;  4NHM A;  3GJA A;  5DAQ A;  3W20 A;  2A1X A;  5DAP A;  4UWD A;  5C5U A;  4XCB A;  2Y34 A;  5LB6 A;  2HBU A;  5HV0 A;  5HV4 A;  4XCA A;  4IW3 A;  4Y5T A;  2RDS A;  3NNJ A;  5L9B A;  5EQU A;  4NMI A;  4XC9 A;  3HQU A;  5DAX A;  2RG4 A;  3EMR A;  5IAX A;  3HQR A;  2FCV A;  3OBZ A;  3GJB A;  3MGU A;  3PL0 A;  2OPW A;  2V4A A;  4Q5O A;  4Y5S A;  4BQY A;  3KT7 A;  5LBB A;  5A3U A;  4XAA A;  2HBT A;  3OUJ A;  4NAO A;  4NHX A;  5C5T A;  5EPA A;  5DAW A;  2Y33 A;  2FCU A;  4BQX A;  5DAV A;  5ERL A;  3NNF A;  5IAT A;  4MHR A;  4J25 A;  3OUI A;  3KT4 A;  2G19 A;  4ZON A;  5EP9 A;  2RDQ A;  3NNM A;  5LBC A;  3KT1 A;  3BVC A;  4MHU A;  4NHY A;  5L9R A;  5LAS A;  4XAC A;  3DKQ A;  5M0T A;  5LBF A;  4ZPI A;  4BQW A;  4NHL A;  3NNL A;  2RDN A;  3ITQ A;  4NHK A;  5LBE A;  5L9V A; 
#chains in the Genus database with same CATH topology
 5IK7 A;  2AR6 A;  4UF0 A;  4XBQ A;  1UY2 A;  2ZJC A;  5FFO C;  5BNN B;  1QJE A;  1XE0 A;  2X09 A;  1S0I A;  4QX0 A;  4R9D A;  3ZXF A;  1JMU B;  4IEP A;  5CYY A;  2XKO A;  3WVJ A;  2A6W A;  1AX0 A;  1RMU 3;  1QQP 1;  4UOJ A;  3NST A;  4V2V A;  1C4R A;  3D4K A;  4O61 A;  3HVD A;  2HYX A;  2VOK A;  1MVE A;  3VDD C;  2G1M A;  2PMW B;  2W68 A;  3GJA A;  3VBS C;  4Z2W A;  1FNY A;  2JE7 A;  2OII A;  1OQE A;  2WLP A;  2VZU A;  3AJY A;  4FPY A;  3RQ0 A;  2RMU 1;  4YZ5 A;  3RRD A;  1RUG 2;  1ZM1 A;  4QU2 A;  4UWD A;  1DF0 A;  2ZKL A;  4K3U A;  1OUX A;  5JZG B;  1PGL 1;  1W3X A;  2AC1 A;  2G9F A;  1IQA A;  3LSD A;  3AVS A;  1UMH A;  1RUC 1;  2LTN A;  2HBU A;  1AYM 3;  5FLJ A;  1W2T A;  5FUN A;  2H0V A;  5DPN A;  3U07 A;  5A3W A;  3ZSJ A;  1RUI 1;  1ND3 A;  2NPI A;  2VOX A;  1TG7 A;  2XJV A;  5LK5 A;  5C71 A;  4XW3 A;  4Y1Z A;  2CAU A;  2XLA A;  4BM8 A;  2Q30 A;  5A33 B;  4PF1 A;  5FLI A;  4OI1 A;  4XJU A;  3CDZ B;  1PM4 A;  1R1A 2;  4LOS A;  1RUE 2;  1Q43 A;  2E26 A;  5F2S A;  1MZF A;  1BMV 2;  1QKQ A;  5A6X A;  5CFC B;  3ACL A;  3USS A;  4JHZ A;  5L19 A;  1JZ2 A;  4XJZ A;  3AKS A;  5TSW A;  2YUE A;  1AJO A;  1YIP A;  2X53 S;  3F2Z A;  4XVH A;  2ID4 A;  2ZOE B;  3KF5 A;  5ANQ A;  5BNO C;  2OS2 A;  1DYP A;  3EJK A;  5GLT A;  1PVC 3;  3MW4 A;  4ASL A;  1V00 A;  1IKQ A;  5KHG A;  2HWB 3;  2BFU L;  2RJL A;  4WVW A;  5FPX A;  3IN9 A;  3BTZ A;  2Q8O A;  4D0Q A;  4HSL A;  1EPZ A;  3ZXJ A;  2XB6 C;  5CIS A;  1Q5O A;  1W9W A;  3LIG A;  4MGY E;  4IE6 A;  2R06 2;  2WZR 2;  5LBB A;  1XQN A;  3HEI A;  1S0D A;  3O14 A;  4JCK A;  3R6S A;  4AEK A;  4KBB A;  3J8F 1;  3ZYH A;  4GWM A;  2PHX A;  4B3N A;  2GC2 A;  4NIH A;  2VJX A;  4BQX A;  2R07 1;  5FP8 A;  2UU8 A;  2VNV A;  1HJG A;  1GZT A;  4RQP B;  4GMP 1;  4M0H A;  3ZFE A;  3LD8 A;  3MV0 1;  1NQD A;  3THD A;  4ZZ5 A;  1FPN 3;  1GNH A;  4I3G A;  4DO0 A;  3K51 A;  3K77 A;  3O7O A;  1W39 A;  2A3X A;  2QBX A;  3OGV A;  1GP4 A;  3ZXA C;  3O1M A;  3INA A;  2JDH A;  4CCE A;  1LEN A;  3N9Q A;  4XF3 A;  1QNW A;  4DY5 A;  3OD4 A;  5FZF A;  2XBO 1;  3ZXL A;  5A7P A;  2GC3 A;  4ORF A;  3TAY A;  2NQY A;  2YG0 A;  3SQO A;  3WQ7 A;  4CU6 A;  3W5M A;  2I45 A;  3UKT A;  3TNQ A;  4LUM A;  3N7J A;  4OCT A;  5C9A A;  1W2N A;  3G6J B;  4HVR A;  4OVE A;  1F5J A;  5LRS A;  2MEV 2;  2GDF A;  1SBE A;  5FPV A;  4YGE A;  2NMN A;  5L9V A;  4RS5 C;  2LRP A;  1URX A;  3S5A A;  1UL9 A;  4Y1U A;  5FPB A;  5FZD A;  3SKJ E;  1SBD A;  1ZYB A;  3VDB A;  2X5I C;  4AYU A;  1ND2 C;  2IFR A;  2JKB A;  2TNF A;  5F5A A;  5IAV A;  3LFI A;  5LAT A;  4A6O A;  4CCO A;  2JDK A;  4JC1 A;  4O9E A;  4RR3 B;  5K0U B;  3GDB A;  1RJ8 A;  4AEM A;  4IE0 A;  1ULC A;  4NHM A;  3LF7 A;  4HON A;  2RV9 A;  3ZKU A;  2QE3 A;  3ES4 A;  4YW6 A;  2XWJ B;  2JEN A;  5HI0 A;  3AVR A;  1LRH A;  1QQP 3;  3FN9 A;  2IC1 A;  2A6V A;  2BER A;  4NRM A;  3VZO A;  5DUX A;  2R6Q A;  1NY7 2;  4IV1 A;  3GXU A;  4QT6 A;  3H7Y A;  3LZZ A;  5HV0 A;  3OGJ A;  3Q8C A;  4ISR A;  4PIX A;  2RMU 3;  4XCA A;  1MVQ A;  3T0A A;  4NRQ A;  1F4A A;  2RS1 1;  4X6R B;  2VAU A;  3O1R A;  3E6C C;  2GNT A;  1RUC 3;  1VBA 2;  1UKG A;  3KD4 A;  3N35 A;  3PU8 A;  3SIS A;  1XND A;  3MID A;  4IDZ A;  4NMI A;  3PVN A;  3WF2 A;  5KHI A;  2VMH A;  3GHN A;  3AMP A;  1RUI 3;  3HQU A;  4DIQ A;  4PLO A;  1H8T A;  3EMR A;  1OF3 A;  1W6M B;  3POW A;  3WG3 A;  5JXJ A;  3DF0 A;  5FQ0 B;  1UMI A;  5FYH A;  3VDD B;  2WO3 A;  3VBS B;  4BPZ A;  1XPW A;  2ADD A;  4HAN A;  1D0H A;  1NCQ A;  4NWW A;  3DXT A;  4FO9 A;  4WVZ A;  4FT8 A;  2P4E A;  4K6B A;  2XQR A;  2YBK A;  3WDX A;  1AR8 2;  4BLJ A;  3VKM A;  4A4A A;  4LO6 B;  2GH8 A;  5FY9 A;  3C7E A;  3MI8 A;  5T54 A;  3SH3 A;  3VKO A;  2F17 A;  3KF3 A;  4XFA A;  4XBN A;  3RZZ A;  5FYS A;  1JH5 A;  4XHB A;  5CFC C;  4MGT A;  1PHM A;  2QTW B;  3HT2 A;  3M8L A;  2VQT A;  2XH6 A;  4LOT A;  5FXX A;  5C5T A;  3POI A;  3LB9 A;  2WNV B;  3QCW A;  4KI5 M;  1PNG A;  1KRI A;  5FY0 A;  3B69 A;  1LJ7 A;  4YW1 A;  3WUD A;  5JI9 A;  1G9C A;  3BTX A;  1PK6 A;  1WUV A;  3N9P A;  2HEY F;  2WQZ C;  4WBB A;  2P5B A;  4Y22 B;  2RM2 2;  1H6X A;  5LEJ A;  1OOP C;  1REF A;  1H8V A;  3J8F 3;  4AVT A;  4NRP A;  3POY A;  3WW3 A;  3CF6 E;  2R07 3;  1LB2 A;  4LKS A;  2VZT A;  5BNO B;  3AZX A;  1FV3 A;  5FYU A;  5LBC A;  4A7Z A;  4GMP 3;  4MHU A;  2R7E B;  2J1E A;  4FTE A;  4AED A;  3UL2 A;  3IZO A;  4P08 A;  4TTG A;  3WUC A;  2EIG A;  1V6M A;  4CDX A;  1RXG A;  4GKY A;  5AC9 1;  1QJY 2;  1UOF A;  1DFQ A;  3WW4 A;  4MSV A;  5D8A A;  1WCD J;  2YHJ A;  1DP0 A;  4N43 C;  3USU B;  1QJX 2;  3V0A B;  1RUD 1;  1C28 A;  2GNB A;  2Y8K A;  1D4M 1;  1STM A;  3WNX A;  2XBO 3;  1JXN A;  5IVJ A;  4C8D A;  4NHK A;  2VCC A;  5FBJ A;  4AF9 A;  4HPK B;  5F5C A;  5E16 A;  1CON A;  5IVY A;  4FAH A;  4QX8 A;  2CY6 A;  2DBN A;  3WG4 A;  3PUS A;  3ZFF C;  1YFU A;  3FWE A;  2ZGN A;  1X8E A;  5ANN A;  4NJ4 A;  4A7K A;  4QB1 A;  2ZGQ A;  3OGG A;  4J1W A;  5IJR A;  2J1R A;  4O65 A;  3OG2 A;  1ZRI A;  2JG8 A;  3N9L A;  4H55 A;  3HBZ A;  4IEX A;  5C5U A;  2C24 A;  2WNU C;  2BYV E;  2XJT A;  4OUS A;  5APA A;  4EN6 B;  2PHT A;  2ZX4 A;  2C26 A;  3SNM A;  5JSO A;  2KD7 A;  5LRR A;  2FDJ A;  1WMX A;  5GLV A;  4AZZ A;  2VZO A;  3CZJ A;  3KMH A;  1RB8 G;  5DXD A;  5FOJ B;  1BKZ A;  4A3X A;  4E4S A;  4RS5 B;  4XUN A;  1CWP A;  1VMF A;  3CLP A;  2JG9 A;  2Y38 A;  1OXC A;  2X5I B;  3LFM A;  4HKW A;  5EHD A;  2ZML A;  5FZ0 A;  1WCQ A;  1ND2 B;  2JXA A;  2RS1 3;  3MIF A;  5A6Z A;  1KEX A;  3OYW A;  2WRA A;  1FMD 2;  4DXR A;  5FXZ A;  1VPH A;  3I2I A;  3CJI C;  2FCV A;  3JCI A;  5JXI A;  1UYY A;  1WLW A;  4Q1P A;  1AYN 2;  3I2D A;  1AF9 A;  2CWM A;  4ONU A;  1JYW A;  4QWN A;  4XUR A;  3NKG A;  4QX5 A;  1RHI 1;  1OA2 A;  2J22 A;  2VOT A;  4LO5 B;  4XUP A;  1DG6 A;  1VE0 A;  4W4Z A;  3LEG A;  1O59 A;  1LED A;  3GZU C;  1CAU B;  3ST7 A;  3SCG A;  2XXZ A;  3SXW A;  2I07 B;  4AHW A;  5FXV A;  4Q5O A;  4BCU A;  4BLI A;  1ACC A;  5GZC A;  3U10 A;  1KIT A;  5GZE A;  2A3W A;  5KHK A;  3ELN A;  3KV6 A;  3AXD A;  1OQ1 A;  1KS4 A;  2G9G A;  4I09 A;  2WFF 2;  4FP3 A;  1SBF A;  4N90 A;  4PLN A;  1HRI 2;  3ZPO A;  4NII A;  5LW9 A;  1AR6 2;  3ATG A;  1ULE A;  1W0P A;  5F9T A;  4QGM A;  1PGW 2;  1GZC A;  2W1Q A;  3TBD A;  2TBV A;  1Q8V A;  3B02 A;  1BK0 A;  3OUI A;  4BQ1 A;  2QQW A;  3N7L A;  1LKN A;  1C5H A;  4EZH A;  2HWC 1;  1H4G A;  1GR3 A;  3K2O A;  3QAC A;  4IES A;  1AX1 A;  2CDO A;  4FQ4 A;  4IV3 C;  3CMG A;  1OD3 A;  1GOH A;  3GYD A;  3KS7 A;  2VE1 A;  4CDQ C;  3AZY A;  4BME A;  1UCX A;  1CJP A;  3PME A;  3OEA A;  3KV4 A;  3WSO A;  4AFA A;  4Q0U A;  5HCB A;  4QPI A;  5HBA A;  2ZX2 A;  1MR5 A;  4XYX A;  1HB4 A;  5C3R A;  3O1O A;  1O7F A;  3D3A A;  1IPK A;  1U5X A;  2IZW A;  1XOY A;  2Y6K A;  1VR3 A;  4ZPI A;  1LTE A;  3MFC A;  4EWE A;  5AFE A;  1LCL A;  1MQT A;  1IPS A;  1J3Q A;  1OI6 A;  3RYK A;  1ODM A;  3BU7 A;  3A22 A;  2ZMK A;  5AC9 3;  3V56 A;  3PUQ A;  4AQ2 A;  2ZGU A;  5LY1 A;  2PLV 2;  4OLL A;  5CU1 A;  4O7X A;  1ZZ8 A;  1OOP B;  1RUD 3;  1H1M A;  4XAB A;  3ZDS A;  2R0H A;  4QMA A;  4I0B A;  2LAL A;  1D4M 3;  3I2J A;  1OVP A;  1GNZ A;  1RUG 1;  1EAH 1;  1FAT A;  3B7M A;  3A0N A;  4CU7 A;  5B2G B;  1AXY A;  1G9A A;  1S0G A;  1W2A X;  2HWD 2;  3MV1 1;  4LO8 A;  3RZH A;  2QQO A;  1ONA A;  4QDS A;  1DBN A;  3I97 A;  4J6G A;  2DCK A;  5E88 A;  3ETP A;  4LKF A;  3WOG A;  2WT0 A;  1O8P A;  2WNO A;  2XUE A;  1REE A;  2DUP A;  2R04 1;  4ZS3 A;  2JDM A;  3CL1 A;  1SQ4 A;  1W9S A;  4RN5 A;  4HN1 A;  1ASJ 2;  1N3Q A;  1W2O A;  4UYB A;  5FZ6 A;  2XKP A;  1WLD A;  4PDW C;  4OZO A;  4RFR B;  2YGM A;  3MLK A;  4QXK A;  4Y20 A;  5E89 A;  4ARX A;  2QQK A;  2AYH A;  2QCS B;  4Q26 A;  3JZV A;  3VDC A;  4UFL A;  1BMV 1;  5CG8 A;  3JUU A;  4B4P A;  4JDM A;  4YNI A;  4Q27 A;  5FRA A;  4Y26 A;  4AGV A;  1HIX A;  4WM8 A;  4YW7 A;  4Q4W 1;  1H2K A;  3AMH A;  3FMG A;  2YY1 A;  4KGG A;  1DCS A;  2I74 A;  1CAX A;  2YBS A;  1DLL A;  1POV 1;  4P9W A;  5A3O A;  4DEQ A;  4DQA A;  2DTY A;  3WP6 A;  1XNK A;  1V6O A;  4I2O A;  4P9J A;  1W6O B;  1COV 2;  4C91 A;  3IMN A;  3FZ3 A;  3PVE A;  4RGG A;  1NCR C;  5A3P A;  4LBQ A;  3I3B A;  4Y1V A;  5JSR A;  2R1D A;  2WNU B;  2F4L A;  2ZGT A;  4FOQ A;  2W1S A;  2RR1 2;  2R06 1;  3PUR A;  4YW5 A;  4M3C B;  5F5Q A;  1DDL A;  3MGU A;  2D5F A;  1V70 A;  3ZVX A;  3EHK A;  3H3Z A;  1ZRE A;  1J83 A;  3G7D A;  4HK9 A;  2XJP A;  2YPJ A;  1W6Q A;  1BXH A;  2PAM A;  2R16 A;  3WP5 A;  3ZSM A;  4BQ3 A;  1A8D A;  5FYY A;  1VRH 2;  2YU2 A;  5DUW A;  1OQD A;  1RHI 3;  1XYN A;  4RHV 1;  3T1L A;  1S0C A;  4OHX A;  4AG4 A;  1ZBE 2;  4QQ2 A;  4AI1 A;  5IVB A;  3E5U A;  4PT6 A;  5DDJ 2;  3RGB A;  1QWR A;  1QEX A;  3KCY A;  4V2W A;  4XUO A;  4AWD A;  1S4C A;  3H3L A;  5HXM A;  1EUU A;  3M70 A;  2XON A;  3I2K A;  1CAW B;  1ENR A;  2OX0 A;  3CJI B;  1DGW A;  1XRU A;  4EN7 B;  2ZEX A;  2JEM A;  1MS9 A;  4FAG A;  3RS6 A;  4X8N A;  4KWL A;  5ABJ A;  1QIQ A;  1SDW A;  2VEC A;  4FPK A;  2Y6L A;  5F6K A;  4XTM A;  4YZ3 A;  1QJF A;  4DY3 A;  3E5Q A;  3PUH A;  4H14 A;  1BBT 1;  2ILM A;  3GNE A;  4HVO A;  1XBF A;  2IXI A;  4UAP A;  2HWC 3;  1G86 A;  1F2N A;  1PO1 2;  4OHW A;  4YM3 A;  5SV8 A;  2V73 A;  3AMM A;  4JRA A;  4QPG C;  4B29 A;  4KU7 A;  2BJS A;  4COV A;  1VLN A;  1UZW A;  1UY0 A;  4XXA A;  5CFC A;  1OLQ A;  2OQ6 A;  5DQ0 A;  5D1I A;  4GH4 C;  3HJR A;  5HCH A;  1MS5 A;  1SAC A;  2VME A;  2IXK A;  1K42 A;  1K5M C;  2J7M A;  3VD7 A;  5F1R A;  2DVD A;  2HWE 1;  4Q1R A;  4OQ8 A;  2J1U A;  4QX7 A;  1DQ5 A;  1HV0 A;  4FFF A;  2C9A A;  3AM2 A;  1XSQ A;  4HXC A;  4Y5Z 0;  3LDR A;  5A6Y A;  4OHY A;  1A3K A;  2ZAA A;  4AFD A;  1SFN A;  4IV3 B;  4CDQ B;  3UGG A;  4IL7 A;  2Y6G A;  5FTT C;  3CNA A;  2A70 A;  1UU4 A;  3FFZ A;  5A7W A;  1DGR A;  3B9I A;  1RUG 3;  4HL0 A;  1EAH 3;  3PHM A;  1WA4 A;  5BUV A;  1RUJ 1;  3A21 A;  4DOU A;  4FTB A;  2QQI A;  3T2Q A;  1PIV 2;  5FZ1 A;  3P5B A;  3ZR5 A;  1W0O A;  4GJZ A;  3T3Y A;  3MIB A;  5JOW A;  1VBA 1;  4AAP A;  5A1L A;  2JDN A;  4RQP A;  1UKR A;  3AYA A;  5FPL A;  1KD7 A;  2VMI A;  2ZHL A;  4TLF A;  3K4A A;  1HKD A;  1DQ1 A;  1H1I A;  3I2H A;  4N9I A;  2LM3 A;  2R04 3;  2Y64 A;  5L36 A;  2VZ1 A;  5EZW A;  4COU A;  2D43 A;  2WII B;  3IIA A;  4CEW A;  4A6S A;  4BIF A;  2RVA A;  2VCB A;  1W8O A;  5DAX A;  1DLC A;  4ES9 A;  5FDB A;  1GWK A;  2EXI A;  4S2F A;  1AXK A;  1N3P A;  1W9Y A;  2RS5 2;  4XDO A;  5F5I A;  1YI7 A;  2ARX A;  2A75 A;  3VD3 A;  4CDU A;  3I3M A;  1JUI A;  4Q4W 3;  1S55 A;  2YYO A;  3BGA A;  1S0J A;  3HT1 A;  4WZC A;  5JDB A;  1JN2 P;  3MYX A;  3N7M A;  4BK4 A;  1POV 3;  3B3Q E;  1X33 A;  3LIH A;  1VBE 2;  2BDR A;  3P1I A;  4QX3 A;  3GJB A;  3WNO A;  1QMJ A;  3ZN4 A;  4AVA A;  2FHR A;  5JMO A;  2RJ2 A;  2DV9 A;  3ILF A;  1AUY A;  4PDW B;  2GN3 A;  3KB5 A;  4LBN A;  4F8A A;  1HQL A;  2XLF A;  1QJU 1;  5A7N A;  4LHL A;  4D7Y A;  4CUC A;  1HW5 A;  2MNG A;  1NAE A;  2R06 3;  5KHH A;  4DEV A;  4CUA A;  4RR3 A;  1POQ A;  5K0U A;  2IVJ A;  2WZ8 A;  4NAO A;  1VBC 2;  1YXW A;  3AL6 A;  3NJY A;  4FSJ A;  4LE4 A;  3P3N A;  3OPT A;  4GD4 A;  1W8H A;  2B8M A;  1CGP A;  1NG0 A;  5CKQ A;  2WZP P;  4YAR A;  4RHV 3;  4RGK A;  1O6U A;  5FJH A;  3WX5 A;  1UU5 A;  3RI8 A;  1NCR B;  3LCP A;  2HKX A;  5GLW A;  1QJY 1;  3FBY A;  3WR0 A;  5KXB A;  2UWB A;  3ACH A;  4MAD A;  2CL2 A;  4Q4Y 1;  1SLT A;  2ZHK A;  5L9R A;  4YZ4 A;  1JZ7 A;  3I2F A;  1TME 2;  1U5I A;  3K4D A;  4AVB A;  3HOB A;  3JD7 2;  1VB2 A;  5LA2 A;  2FDG A;  3MIC A;  5LBF A;  5FQ0 A;  1DGR N;  1AVB A;  4MH0 E;  3TB0 A;  2QJV A;  1BBT 3;  2E31 A;  3VBS A;  4NID A;  4Z82 A;  2IVI B;  4LK6 A;  2CTV A;  3F95 A;  4PHZ A;  3C7H A;  3ZN5 A;  2BV4 A;  2Q8D A;  2WWU A;  4QHO A;  1UY1 A;  1T6G C;  3WV6 A;  3WCS A;  4Y1Y A;  2ZMN A;  4DPN A;  1SCR A;  2VG9 A;  3I54 A;  3ZYJ B;  1RJ7 A;  4M3C F;  4FVV A;  3UJQ A;  3HIF A;  5FIX A;  1R64 A;  3D8C A;  3NJV A;  1SPP B;  3BTY A;  3NNG A;  3LWC A;  1O3R A;  1UIJ A;  3VBO B;  1DQ0 A;  4K40 A;  3I59 A;  1AL2 2;  1AZD A;  1XC6 A;  2HWE 3;  2WZE A;  3TEX A;  5HCF A;  1CR7 A;  2YDE A;  3GBW A;  4GZ9 A;  1YHF A;  1JOJ A;  1BEV 2;  2VW0 A;  5FZ8 A;  4R52 A;  4CCN A;  4QPG B;  3N7K A;  3FUO A;  1SMV A;  3LOB A;  1C3H A;  1NXD 1;  1ZNP A;  2VUC A;  1Q56 A;  3U0Z A;  4Q29 A;  4F83 A;  4Z92 B;  4GH4 B;  4LA3 A;  4AFM A;  2HLE A;  2ZX1 A;  1RUJ 3;  4JVA A;  4JQT A;  2BQP A;  5FYC A;  5FZ9 A;  1K3I A;  4O9G A;  5BNO A;  1ALY A;  1FMD 1;  1O4T A;  4LO7 A;  4B7K A;  1K5M B;  1VBA 3;  2IXC A;  2OPK A;  3MW3 A;  4PBP A;  4CXX A;  4L9B A;  1AX2 A;  3L2Y A;  5KC5 A;  5I0D A;  1AYN 1;  4XC9 A;  5DMY A;  3BTA A;  2FDK A;  2GC1 A;  1DIW A;  1Y9G A;  4CCM A;  4IGP A;  1ZRC A;  1YEW A;  2QQM A;  3U11 A;  4M0N A;  4SLI A;  3AKT A;  3BCW A;  3VBH A;  1ZVF A;  1NA1 C;  4JTN A;  3SKV A;  1S0E A;  4BQ5 A;  1GAN A;  4HLT A;  3Q8E A;  2D3R A;  2C0Z A;  3POF A;  5CNA A;  3IKW A;  1FOD 1;  1O5L A;  1RED A;  2QDR A;  4Q4V 1;  1GFF 2;  5FMO S;  4EJR A;  1UYX A;  3GCW A;  4LHS A;  1Q8S A;  2AAC A;  1ULO A;  3KGZ A;  1BK1 A;  2P3I A;  2NMO A;  3LE0 A;  4HPK A;  4TYS A;  2WFF 1;  5EWS A;  1UMZ A;  5FOB B;  1Y3T A;  3C7F A;  3POG A;  4RYD A;  4XMA A;  2R1B A;  1FV2 A;  2AH2 A;  3LEM A;  4COY A;  3KHC A;  1JHN A;  4UT5 A;  1FX5 A;  3MBW A;  1WW5 A;  1LHV A;  2GC0 A;  4QKB A;  3UET A;  1NZI A;  5LY2 A;  1DQ6 A;  2WNV C;  3M3C A;  4NHX A;  4HET A;  4C1W A;  4LBJ A;  1ENQ A;  3WNL A;  4ERO A;  1RIR A;  4NR1 A;  2AGS A;  2VR4 A;  2XG3 A;  1QJU 3;  1JOP A;  1AL0 G;  3AYE A;  3OY8 A;  4URT A;  3H50 A;  4BIS A;  4DMI A;  1YO8 A;  1PNF A;  5ERL A;  3OD0 A;  4BE3 A;  1HRV 2;  2F4P A;  1FXZ A;  4GQ7 A;  4ITC A;  4YW4 A;  5CKN A;  4MO3 M;  1C57 A;  2FDI A;  2AZ5 A;  5C4W A;  3DPR B;  2GME A;  4J25 A;  4MHR A;  4CXW A;  5EIY B;  2YPD A;  3L2H A;  3S30 A;  3TEZ A;  1J3R A;  5ACA 1;  5FPZ A;  1QHD A;  3AK0 A;  1G6N A;  1NYW A;  3M1H A;  4RS5 A;  1L7Q A;  4ET7 A;  1LES A;  5T5P A;  2BGO A;  1KGY A;  4YSF A;  5FZM A;  1KJL A;  5CFD C;  5BY5 A;  3W58 A;  1K5J A;  4XAC A;  1QJY 3;  2BZD A;  1TMF 2;  2CYF A;  4LK7 A;  1AR7 2;  4LBQ D;  4YVS C;  2VUA A;  5JPM B;  1W99 A;  2Z79 A;  5F2W A;  2YGL A;  4Q4Y 3;  3RWK X;  3J7N A;  5JIU A;  1H1A A;  2B46 X;  4GB3 2;  4UW4 A;  3DEM A;  1WBL A;  5J09 A;  4JKK A;  2QVS B;  2JJ6 A;  2EA7 A;  2HWD 1;  2O8Q A;  1OT5 A;  2UYA A;  3LGR A;  4QKD A;  4R4Z A;  4GKX A;  4W8J A;  1YI9 A;  3T4V A;  3W59 A;  1JW6 A;  2WQ4 A;  2TEP A;  3DV8 A;  3S5Q A;  2DTW A;  3T0D A;  1B35 C;  3ES1 A;  1CAU A;  3UKV A;  1MS1 A;  2Q1F A;  1QJZ A;  1UOJ A;  5I8T A;  1D2S A;  5CIR A;  4XFB A;  1ASJ 1;  1C8M 2;  1J1L A;  5H9R A;  1OUR A;  2R32 A;  3AC0 A;  1I6X A;  4QKF A;  4LT5 A;  4JGZ A;  4ASK A;  1ZRD A;  3CBN A;  4KMQ A;  1CAV A;  2CDP A;  5A80 A;  3C8X A;  2DVG A;  1DGL A;  4YGB A;  2P1B A;  1LHW A;  1UPS A;  2HYK A;  3QH7 A;  1YWK A;  4E4H A;  3RG0 A;  2GAL A;  3RI9 A;  4UFH A;  1XNT A;  3WT3 A;  3WXP A;  4KWJ A;  1YFX A;  4RSU A;  2RDS A;  3OGR A;  3N9M A;  2WUH A;  3OBR A;  5FYB A;  3O1V A;  4LXL A;  3WY6 A;  3NJX A;  4LMF A;  1J84 A;  1F5F A;  4XFI A;  1YQ8 A;  2VC9 A;  4AI9 A;  4P9L A;  1RUH 1;  1FMD 3;  2EIC A;  2R30 A;  4QQP A;  3JBG 2;  1BYH A;  2VOV A;  2HWF 1;  4ZKT B;  2ZAH A;  2B9V A;  3OBZ A;  1WA6 X;  1AYN 3;  3DKW A;  2VQ0 A;  2C9K A;  2FDH A;  1XU1 A;  1LEM A;  1KQR A;  1V9U 2;  3EB7 A;  3UJO A;  2F6B A;  1S2K A;  1HXS 2;  1PO2 2;  4IGO A;  1CPM A;  3OPW A;  1OBN A;  4YVW C;  5T5L A;  5C7G A;  1HX6 A;  1YNA A;  1VAK A;  2ADE A;  1MEC 2;  1CIW A;  1JS9 A;  1AJK A;  5DDJ 1;  2OKX A;  1FOD 3;  2JE9 A;  3WDU A;  1IS4 A;  3FX3 A;  4FPE A;  3BI3 A;  2W08 A;  4Q4V 3;  4BQY A;  3ME2 A;  3AKR A;  1WLT A;  1C5I A;  1YQ2 A;  1E5S A;  1WD4 A;  2VMF A;  2WFF 3;  2HEW F;  1RC6 A;  2Y0I A;  3EQE A;  1OHF A;  1OPM A;  2Y26 A;  3SC7 X;  2DVB A;  4CP0 A;  1F8V A;  3CU7 A;  3ZFE C;  2D6P A;  1WMF A;  2XJQ A;  3UV9 A;  2ZTN A;  4FFI A;  4KL1 A;  5C8C B;  3LKJ A;  1OKO A;  4NOT A;  3OBA A;  1NA1 B;  4N43 A;  4A42 A;  3BIW E;  2WFP A;  3HQX A;  5AVP A;  3R4S A;  1TVG A;  5IYY A;  1PVX A;  2E9Q A;  1HV1 A;  3SEP A;  4CCK A;  2WN2 A;  4B4Q A;  3KVA A;  4LQR A;  5T55 A;  3VHN A;  2OT7 A;  2W1W A;  5FP9 A;  2P34 A;  1RMU 2;  3VL8 A;  1V6K A;  2YC4 A;  4MXW B;  4IEV A;  1OLR A;  3OBT A;  2YZ4 A;  3ZFF A;  5ACA 3;  1T6B X;  3DL3 A;  1JYI A;  5ISL A;  3AL5 A;  3ZDV A;  3O5S A;  3GHM A;  1W6O A;  1YFY A;  5EYX A;  3R4U A;  1I9R A;  4MGQ A;  4ZXK A;  3M3O A;  3PVO A;  5K9Y A;  4LPL A;  1VAM A;  3V65 A;  3S0M A;  4XUQ A;  3VUO A;  4L11 A;  3DYP A;  5BNP B;  3C2U A;  2GP3 A;  4IEZ A;  3H7J A;  4IEY A;  4MG2 A;  4IE4 A;  4AXO A;  4JZR A;  4XE9 A;  1EY2 A;  2P37 A;  4PF5 A;  4V1P A;  5CA6 A;  1Z7S 1;  1QDC A;  1W8W A;  2BFU S;  2HWD 3;  4PIY A;  4IUG A;  2W87 A;  4XMI A;  3VBF A;  5CFD B;  1WZX A;  5KBF A;  1OFN A;  3FLR A;  5DAQ A;  2XHN A;  1AR9 1;  3IDA A;  3L9J T;  4WM7 A;  5KHJ A;  1RUN A;  4QXH A;  1QH6 A;  1WLC A;  3T09 A;  1CES A;  3N9N A;  4L8Q A;  4CVU A;  2ZGO A;  1G8W A;  4YVS B;  3AFG A;  1VMJ A;  3HAG A;  1ASJ 3;  3SH4 A;  5LB6 A;  2Z2S B;  5A32 B;  1YQ5 A;  2GMP A;  1W90 A;  3CJI A;  2JB4 A;  4UF0 B;  1PVC 2;  3W9A A;  3CQO A;  1SZB A;  2PHR A;  2HWB 2;  2VTF A;  1E5I A;  2ENR A;  2CU5 A;  2DFC A;  2B39 A;  3U4X A;  2RS5 1;  4FPH A;  3S7E A;  2R49 A;  1B35 B;  2EXK A;  5FJK A;  3ZYR A;  2BUK A;  2WAA A;  3D0S A;  3FLT A;  4K20 A;  1ZBA 2;  1GQG A;  1VBE 1;  2VVD A;  2Y6F A;  3O1S A;  2RG4 A;  4BU2 A;  2W95 A;  2WJS A;  1ST8 A;  1I1E A;  1QNY A;  1VB4 A;  5I8Y A;  4IGQ A;  2D6L X;  3NJZ A;  1N1Y A;  1W8F A;  1NXM A;  1D2Q A;  4EE2 A;  5FO7 B;  2Z69 A;  1UW8 A;  2W92 A;  3LDB A;  1RGS A;  1RVF 1;  4G9S B;  3WQ0 A;  2XWB B;  2CGN A;  1UZY A;  2XL9 A;  1FPN 2;  1ZRR A;  1RUH 3;  1XE7 A;  4BJ0 A;  5J96 B;  2ARE A;  4QU1 A;  4KG0 A;  5FUI A;  1VBD 2;  4CYD A;  2HWF 3;  2PHF A;  3GZT B;  2ZGR A;  5KR7 A;  1HB2 A;  1NKG A;  4Y24 A;  5G05 L;  1JZ6 A;  3H8O A;  5DG1 A;  3GCX A;  5F8P A;  1OH3 A;  5JPN B;  2BEO A;  4Q8L A;  1HLC A;  4IV3 A;  4ZU5 A;  4W6Y A;  1KDK A;  3H9A A;  1PK6 C;  3RJR A;  4BH9 A;  1OMI A;  3E1F 1;  4JAA A;  4UXA A;  5DDJ 3;  4ATF A;  1DGW X;  3HN1 A;  5DAW A;  3BUC A;  2BOI A;  3N4M A;  1W28 A;  2BBV A;  3WHT A;  5A70 A;  5JLV A;  4HT1 T;  3OOX A;  5FO9 B;  5AFB A;  1BCX A;  4WVM B;  3VBR A;  1ZZB A;  1TNF A;  4XJ9 A;  1XJA A;  2JIC A;  3RZM A;  2JDZ A;  5T50 A;  5A3M A;  1TME 1;  1GP6 A;  4HOO A;  4AED C;  1R1Z A;  1GV9 A;  4LBL A;  4CZS A;  4FPF A;  4GWI A;  2CGO A;  3NV3 A;  3PIJ A;  2Y0O A;  5IWF A;  4YVW B;  2G9Z A;  5IT6 A;  2RDQ A;  3NNM A;  3DXU A;  2E6V A;  4XIK A;  2IXH A;  5F7U A;  3VD9 A;  4B1M A;  1N1S A;  2W3J A;  4P02 B;  4YG3 A;  2UY9 A;  2A6Z A;  4GA9 A;  1NUK A;  1LAJ A;  2FDF A;  1GBG A;  2IUW A;  2DFB A;  1L7L A;  1LOG A;  3MLJ A;  2ZXQ A;  4DXS A;  2WT2 A;  1PX4 A;  4B1L A;  4BQW A;  3SHR A;  4CXY A;  3ZFE B;  2DCZ A;  3PJY A;  5FYZ A;  2GNM A;  2NM1 A;  4FPG A;  2VU9 A;  1APN A;  4GXL A;  3TEY A;  4D94 A;  2RMU 2;  3NV2 A;  3B01 A;  2XLG A;  3O1P A;  1W8T A;  1AL2 1;  4LUK A;  4ZU4 A;  5A7Q A;  4RA0 A;  1PGL 2;  3VKF C;  4PDW A;  1HN1 A;  5FWE A;  1RUC 2;  2D6N A;  1BEV 1;  2WQ8 A;  3LEK A;  4IEU A;  4KG8 A;  1F35 A;  2Q8E A;  4K8R B;  2YXS A;  4LEJ A;  4Q4X 2;  3MIH A;  4H7M A;  4W6W A;  4CUB A;  4DNY A;  3VBU C;  5C70 A;  1HQW A;  1U12 A;  5EFU A;  1NLS A;  3K3O A;  4FPL A;  4AR2 A;  3RZJ A;  5CZK A;  4QGL A;  5EV7 A;  4LJH A;  2E33 A;  4AW7 A;  3HBK A;  5F3E A;  1HB1 A;  1Z7S 3;  5EYY A;  4KU8 A;  3VD4 A;  1DQ4 A;  2FMY A;  1V0A A;  1RYY A;  1OA3 A;  1PMI A;  3MW2 A;  1AR9 3;  3JQW A;  4MXV A;  1UOB A;  4QXC A;  4WV8 A;  4QPY A;  1S2B A;  4YWA A;  2KA3 A;  1W6N A;  3OF1 A;  5C3Q A;  3ECQ A;  2OUH A;  3WZ1 A;  3T2P A;  1WD3 A;  5L9B A;  3V0B B;  5FYM A;  2P6C A;  1W8Z A;  4HFS A;  4DS0 A;  1ZA4 A;  1GZW A;  1JZ4 A;  1G9B A;  4FPC A;  4UFI A;  4AVS A;  1JTZ X;  4E2G A;  1IZ3 A;  3UKN A;  2ZHN A;  2BTV C;  3PIG A;  3ZPY A;  2RS5 3;  3UES A;  4CP2 A;  4FCA A;  2YFU A;  2XVG A;  2D93 A;  2V4V A;  3B00 A;  3WD5 A;  1IQD C;  2VMG A;  3VZN A;  2WIN B;  3C3V A;  5K4L A;  1VBE 3;  1E5H A;  1EPW A;  1UYZ A;  2WDB A;  3AFK A;  3J8F 2;  2D3S A;  2D6K A;  3AX4 A;  3FBM A;  2QQP A;  3AMQ A;  4OQ9 A;  3RNS A;  3D6E A;  1C1F A;  1R1A 1;  4N53 A;  2W5F A;  1RUE 1;  5L7O C;  3ROU A;  2WYS A;  1A78 A;  4HZF A;  1J58 A;  2YRO A;  1RVF 3;  3I4I A;  3ZXD A;  3H0O A;  1SPP A;  2QQN A;  4AOC A;  1HRV 1;  4I01 A;  5E8A A;  3ZXG A;  3ZFG A;  1H9W A;  4LBK A;  3KHB A;  2ZS6 B;  5JI7 A;  4FFH A;  1UIK A;  4CDW C;  5DAV A;  3VGI A;  1VAL A;  4A3Z A;  3KLS A;  1NCQ B;  2XBO 2;  4QPG A;  4AI0 A;  4MLO A;  1SHW B;  2WAB A;  2DVA A;  1W6P B;  5FZH A;  5LA0 A;  2A71 A;  1GIC A;  4NPR A;  3BOP A;  4H7L A;  3AMN A;  5B4X A;  4ASM B;  1WME A;  2WZR 1;  2ZEY A;  2JWP A;  4QPI C;  3VZJ A;  2ES3 A;  1OA4 A;  3LEI A;  1JOB A;  1IS6 A;  3EYP A;  3VV1 A;  5BNN A;  1OF4 A;  3UNP A;  1UYP A;  3BVC A;  1K5M A;  2DDU A;  2VCM A;  2Q8C A;  1TME 3;  3BPZ A;  5FPA A;  2BVB A;  2VO5 A;  1PX3 A;  3R4D B;  1OC1 A;  2SLI A;  2VUJ A;  4A2U A;  2VCA A;  4QPW A;  1WW6 A;  2P3K A;  3ZYI B;  1KDM A;  4M4R A;  1PK6 B;  1R09 2;  3POB A;  3PVB B;  1ULG A;  2VQA A;  5FCC A;  1MZ5 A;  3T2O A;  4AQS A;  4N9H A;  2XQX A;  4C0H A;  3DN7 A;  1A34 A;  1LGC A;  1GQP A;  2RDN A;  5JZG A;  3MO4 A;  1O3S A;  2VW1 A;  1BHG A;  1C8M 1;  1JI6 A;  1W8N A;  4FXK B;  3OCP A;  5FZE A;  3SIT A;  1LOD A;  1UF2 C;  2BNM A;  2AEY A;  4MGS A;  4OZX A;  4UW6 A;  3RZL A;  1S1A A;  3RYR A;  3VKN A;  2A7A A;  3ABZ A;  1NLQ A;  2BOJ A;  4P9Y A;  4XHX A;  5DAB A;  3I3E A;  4AED B;  3HD8 B;  1JU4 A;  3PUI A;  2BWC A;  3VBO C;  4M4P A;  5A33 A;  3NAP C;  4UW3 A;  1WCU A;  2D40 A;  3Q9O A;  2RS1 2;  3JXS A;  3BKZ A;  1AL2 3;  2MEV 1;  2NP0 A;  4NUB A;  1UD1 A;  3I49 A;  4MGK E;  2ORZ A;  3A4U A;  5FKC A;  1X8M A;  1ZX5 A;  3A0K A;  2EID A;  1BEV 3;  3WQB A;  3PDQ A;  5FY4 A;  4URA A;  4NWV A;  2QQL A;  2FBE A;  3MPB A;  2ZGK A;  4QDR A;  5I8S A;  4CCJ A;  3WW2 A;  1DYO A;  1W9T A;  3J7L A;  4P14 A;  1QF3 A;  5FWJ A;  2EAK A;  4QAW A;  1S0F A;  4WM8 C;  5D21 A;  3FC0 A;  3EBR A;  4BWO A;  5LWB A;  3LA3 A;  4LTA A;  1MAC A;  3AKQ A;  2OVU A;  3MIG A;  3NWK A;  3D0J A;  3JBG 1;  4F3J A;  5FZB A;  4N7I A;  3NRU A;  4NN0 A;  3TN9 2;  3KCX A;  3U4S A;  4D7T A;  1IS3 A;  2ATF A;  4MVT A;  3ZIX A;  4AVV A;  1MZE A;  1CX1 A;  2WO7 A;  3SEE A;  5FZ4 A;  1NY7 1;  1LOA A;  1VIW B;  2BPA 2;  2DCY A;  3CO2 A;  3VBU B;  1D7P M;  5FY7 A;  1S0B A;  3I7D A;  4EYU A;  2C6S A;  4AI8 A;  4E8C A;  4XOG A;  5I91 A;  1LU1 A;  3CEW A;  4I02 A;  4JDO A;  5EJ3 A;  2UWA A;  2W94 A;  1LOF C;  4OUL A;  2VVE A;  2WL1 A;  1Z78 A;  3IPV B;  3LDK A;  3E6D A;  2NZ9 A;  2VTX J;  4HKO A;  2OPW A;  3LPF A;  4AI2 A;  4COW A;  2CHH A;  5BPX A;  5A1A A;  3ILN A;  4UI9 L;  4OHZ A;  2VUD A;  1JBC A;  4B4R A;  1WWY A;  5FZL A;  4EN0 A;  2KXL A;  3QBQ A;  2DBI A;  1M06 G;  1R1A 3;  3OYW B;  1RUE 3;  2HH9 A;  1N1T A;  3HR9 A;  2GN7 A;  3PLQ A;  4UFK A;  3GGL A;  1P8J A;  3WDY A;  5EPA A;  5IW0 A;  4FBF A;  1XNA A;  1AR8 1;  2FCU A;  4YGC A;  1HJF A;  1HRV 3;  1W06 A;  1LGB A;  3DPR C;  5AC9 2;  4BIO A;  2W1U A;  1DU3 D;  2CWS A;  2YBP A;  5JSP A;  1QOT A;  1ODN A;  3MLL A;  5J37 A;  2W39 A;  3LSE A;  1RUD 2;  3EXU A;  3LOI A;  1SLC A;  2IXJ A;  3ZYG A;  2VL4 A;  2XML A;  4P9G A;  4QB6 A;  5KWR A;  1CX4 A;  1UXZ A;  5L7O B;  1YJL A;  1EV1 2;  1W05 A;  5B4N A;  2HEV F;  2W0X A;  4Q0Q A;  1JHJ A;  5DUV A;  1LOB A;  5G04 L;  5J48 A;  5JOZ A;  2WZR 3;  2WN3 A;  2RM2 1;  5M0T A;  2XUM A;  2PHD A;  1DHK B;  5C8W A;  3ACF A;  2WA4 A;  5H9P A;  2X05 A;  2W91 A;  1F15 A;  1UX7 A;  3WDV A;  4XFF A;  2AEN A;  1UY3 A;  2N7G A;  3ILR A;  1US3 A;  4NPL A;  3KSC A;  4CDW B;  5JWP A;  5K7P A;  1ULP A;  3IMM A;  1UOG A;  5FZG A;  2FZ2 A;  3MUZ 1;  3PU3 A;  4K1Y A;  5FV3 A;  1PMJ X;  2RDR A;  4QB2 A;  3IAP A;  3N36 A;  2BNO A;  4NVP A;  1SDD B;  1VBB 2;  4L0P A;  1QJX 1;  1XB9 A;  3C7G A;  2QKD A;  4QPI B;  2K46 A;  5LA9 A;  5LZ6 A;  1Q8P A;  5FRE A;  1C8M 3;  1ULF A;  2WC2 A;  4DFS A;  4IE7 A;  1BQP A;  4CE8 A;  3ZN6 B;  1N1V A;  2X29 A;  3ALQ A;  1MS8 A;  3QLQ A;  4JGY C;  3W20 A;  2HJI A;  1JUH A;  4LUL A;  1G7Y A;  1W6M A;  2E32 A;  3CKH A;  3P3P A;  2VMD A;  1CVN A;  4I3P A;  3VDD A;  2PA7 A;  1CPN A;  2WSV A;  2ZGS A;  5JIA A;  4BHP A;  2WS9 2;  1NA1 A;  2MEV 3;  4PQQ A;  1BLZ A;  4IND A;  1UNB A;  3PUA A;  3CHX A;  4XFG A;  1Q8Q A;  2VQU A;  1GMM A;  1ZBA 1;  1I3H A;  4IE5 A;  2LW8 A;  2RS3 2;  3VZL A;  3BU0 A;  2UY8 A;  4TXW A;  2UYB A;  3K46 A;  4LBM A;  5HCA A;  3NNJ A;  4U36 A;  5JOY A;  3AZW A;  1DZR A;  3WF0 A;  5J1X A;  4CDU C;  4CEY C;  1LUL A;  1U5Y A;  2XOM A;  2D3P A;  2W47 A;  4QXB A;  3NAP B;  2PFW A;  2V72 A;  1VBD 1;  3JBG 3;  1RL3 A;  1A6C A;  1SLL A;  1NOV A;  2DU0 A;  2WNV A;  4QM9 A;  5GLU A;  1KJR A;  3TYJ A;  2XPJ A;  5BXX A;  1ZZ6 A;  1W04 A;  4BA6 A;  5D2A A;  3WF1 A;  3M4F A;  4AHX A;  3AB0 A;  4Y22 A;  5EJZ B;  3JQX A;  4S2D A;  4D69 A;  4YG0 A;  3TRS B;  4H2A A;  1Y7B A;  4MGI E;  1RXF A;  5LK7 B;  1OSG A;  4WM8 B;  2VBD A;  4PIZ A;  4YGD A;  2V4A A;  3KV9 A;  4Q0S A;  4DXT A;  1O4Z A;  1X7N A;  1GWM A;  4R8H A;  1GYK A;  1NX9 A;  2DCT A;  3NW4 A;  4X6Q B;  3S7I A;  4DZG A;  2HWC 2;  4AL9 A;  3ZYP A;  1AXZ A;  2IWG B;  3WDW A;  3H8U A;  5CFD A;  1NQJ A;  4QHB A;  5KC6 A;  4OFG A;  1A8M A;  1GQH A;  3HPN A;  4DB5 A;  5C8C C;  1ENX A;  4ES8 A;  2VXR A;  3QD6 A;  5CVR A;  4C90 A;  4AGG A;  4LHK A;  2PAK A;  1WKY A;  4WZF A;  4L92 A;  5FUP A;  1OH4 A;  1YQC A;  2ET1 A;  3IDE A;  3NNF A;  4YVS A;  3U78 A;  3USU A;  2ZEW A;  2ZZQ A;  4TLG A;  3ZMO A;  3V0A A;  3RYP A;  4XFC A;  5A32 A;  4C0B A;  4I30 A;  1SLI A;  2UWC A;  1K45 A;  1AR8 3;  3R0R A;  1O3Q A;  1UZ0 A;  1W6Q B;  3BAL A;  4ZS2 A;  3ZM8 A;  4LE3 A;  2A6X A;  2VMC A;  1HRI 1;  4LLO A;  2DUR A;  4NE9 A;  1AR6 1;  5SV5 A;  3WF3 A;  4YZ1 A;  2EAA A;  2JKX A;  1RUF 2;  3D82 A;  1B35 A;  1PZ8 A;  5L73 A;  2K0G A;  5JR2 A;  4KNC A;  5FP4 A;  5A6Q A;  1PGW 1;  1DZQ A;  2PXJ A;  2VNG A;  1QOO A;  1V6I A;  5A7O A;  2Y60 A;  1KFU L;  1EAH 2;  1LEC A;  1V6L A;  3HNB M;  3ZKY A;  3O0V A;  4R4X A;  2ZKN A;  2E63 A;  4KH9 A;  4XQD A;  1O3T A;  4XZP A;  4XDQ A;  3ITQ A;  5BNP C;  3T1M A;  2RM2 3;  5EXO A;  2VZV A;  4Q4X 1;  3IAQ A;  5JAX A;  5ABJ B;  2R0F A;  2DVF A;  3I8T A;  5IK4 A;  1PZ7 A;  1JOD A;  1BVV A;  2R04 2;  2VUL A;  2G4I A;  3M3I A;  3MUY 1;  4JKM A;  3VL9 A;  1JYV A;  4AEJ A;  4COZ A;  5FZA A;  2D5H A;  1EP0 A;  2DYC A;  2X5I A;  1I5P A;  1ULD A;  2VZQ A;  3POE A;  4A45 A;  2WO1 A;  1ND2 A;  3AP4 A;  2A1X A;  2PLV 1;  1LU2 A;  3O12 A;  5FLH A;  1CZV A;  2V5Y A;  4GMP 0;  1QJX 3;  1QH7 A;  1IG0 A;  2YU1 A;  4QHZ A;  1H2N A;  4Q4W 2;  2DUQ A;  4LIT A;  4QKN A;  4BYY A;  4OI0 A;  4EWA A;  1FNZ A;  4WVM A;  4PI2 A;  3EO6 A;  5FZ7 A;  3B9C A;  2E7A A;  3I2O A;  4DUX A;  3LQC A;  1L3J A;  5J7M A;  1VAV A;  4E4D X;  3DUI A;  4TN7 A;  3D5O A;  2VH9 A;  3S6P A;  4KWU A;  3GF6 A;  1JZ8 A;  2OZ6 A;  1CZT A;  1YLL A;  2QDN A;  2GP5 A;  2WWJ A;  3VZM A;  4YVW A;  5FMC A;  3KZ4 C;  3KVB A;  4QGN A;  5FY8 A;  3P6B A;  1X82 A;  2WT1 A;  1L7R A;  1TZO A;  3VBH C;  2I2S A;  1ZBA 3;  1GZ9 A;  4KGQ A;  1CJD A;  1UWW A;  5A7W B;  2Q1Z B;  3H3U A;  4DUW A;  4CTE A;  5IK5 A;  1C1L A;  4Y33 A;  4MYE A;  2CV6 A;  3GBF A;  3U37 A;  5K8S A;  4C1X A;  4JGY B;  3WNP A;  4RFT 0;  4RHV 2;  1H4H A;  1KFX L;  3APB A;  3M7A A;  2VM9 A;  4QX2 A;  1ND3 C;  4ZU7 A;  3I3D A;  5FK7 A;  1MPX A;  1C8N A;  4LIU A;  3VD5 A;  4JHT A;  4CP9 B;  4ZZ8 A;  4AGR A;  1VBD 3;  4GAL A;  4A41 A;  3N3H A;  2JEC A;  1IHM A;  5A3L A;  5DZG A;  2GND A;  2O8O A;  1W3V A;  2WBK A;  3MF9 A;  4M00 A;  4BOW A;  4CEW B;  2W52 A;  3M3E A;  3V64 A;  5JXG A;  1HQN A;  1COV 1;  1I5Z A;  4LR4 A;  1D0G A;  1XYO A;  2VGD A;  4XAA A;  3TWI A;  4ZHN A;  3N9O A;  3WQ1 A;  1SFY A;  4D7S A;  1UXX X;  2RR1 1;  4CDU B;  3VHP A;  4CEY B;  2Q4S A;  5C4W C;  5IFT A;  1R08 2;  4YZ2 A;  1QY4 A;  3ASI A;  1BBT 2;  4B8E A;  2JE8 A;  4FQZ A;  3Q8B A;  2ZA9 A;  1KXG A;  3ZO0 B;  2XHK A;  3VLB B;  2GMM A;  1VRH 1;  4NAM A;  4HK8 A;  4XTP A;  5F32 A;  1JYC A;  3MDP A;  2JDA A;  1X36 A;  4XBL A;  5EP9 A;  3J26 N;  4Z1V A;  1ZBE 1;  4NRO A;  5HXV A;  1OOP A;  1LNS A;  1PM7 A;  4LKE A;  5JR7 B;  3T30 A;  1R09 1;  1SCS A;  3E6B A;  4EN8 B;  3V0B A;  4R9B A;  2Z4F A;  4J1X A;  4R9A A;  3ZX7 A;  2XVL A;  5LAS A;  2Q1M A;  1SEF A;  4Q0V A;  5FYI A;  2HWE 2;  4YW3 A;  3RVH A;  3ZXK A;  1E57 A;  2EXJ A;  4X8P A;  4XEZ A;  4K21 A;  3MIE A;  1HRI 3;  2ZZJ A;  4HG6 B;  1AR6 3;  3W5N A;  4RL7 A;  1VP6 A;  1FYU A;  3H1Y A;  4DRR A;  3ZSE A;  4NIG A;  1CN1 A;  1QU0 A;  3THC A;  1YJK A;  5LBE A;  4Z8B A;  4YLZ A;  5JMC A;  3W21 A;  1RUJ 2;  3DYO A;  1PO1 1;  1W8U A;  3HNM A;  2B9U A;  4NO4 A;  5FXW A;  1TNR A;  2B7Y A;  4JGZ C;  4M3C E;  1XU2 A;  2JIG A;  2BGP A;  4Q4X 3;  1H9P A;  1BZW A;  4YM2 A;  5JCT A;  4LBO A;  3TEW A;  3KV5 A;  4AHY A;  5FZO B;  2X10 A;  1O8S A;  3WNN A;  5C9A C;  2JD4 A;  3B5L B;  3WP4 A;  1MS3 A;  1HN0 A;  5DAP A;  4XCB A;  5IVE A;  5LEK A;  3JB4 C;  3LA7 A;  1RTV A;  2A6Y A;  1GU3 A;  5IVF A;  3RFR A;  3TN9 1;  2KR2 A;  1RIN A;  3FUQ A;  1AYM 2;  1W6P A;  2Y6H A;  2WNU A;  4BDV B;  3J9S A;  2PLV 3;  3H42 B;  3FE5 A;  2GU9 A;  4MUV A;  4M3C A;  1US2 A;  2A73 B;  2ZHM A;  2VPV A;  3A23 A;  3WIN E;  3FLP A;  4P9X A;  2ZBJ A;  2YC0 A;  4PCR A;  5F37 A;  3ZYB A;  3M2M A;  1GP5 A;  5EQU A;  4CUG A;  3I59 B;  1PIV 1;  1Q3E A;  2ARA A;  1SG3 A;  1OLM E;  3MPP G;  3AP5 A;  3RWN A;  4BQ2 A;  3KCC A;  1OPO A;  1X9P A;  2J42 A;  4GUL A;  2WSU A;  5F6L B;  4AFB A;  1SFP A;  4CA9 A;  3MHZ A;  1XNC A;  3GAL A;  3IM0 A;  4IV1 C;  1QJU 2;  1Q8O A;  4G4F A;  3WG1 A;  1J59 A;  4ARY A;  3THT A;  2WR9 A;  4GJY A;  4L2N A;  5IUQ A;  2L9L A;  2VBB A;  3SMH A;  1G9D A;  5DZE A;  4QD2 A;  2Z42 A;  4DIN B;  1VRB A;  1CAW A;  1YQ6 A;  2X8K A;  2FMD A;  2WAO A;  2AEZ A;  3H1W A;  4GWJ A;  4LNV A;  3ACI A;  2QUO A;  3PL0 A;  3BOW A;  3T2T A;  5HPO A;  3WCR A;  1ZA7 A;  2LS6 A;  3AJZ A;  3ZLI A;  4QQO A;  1LGN A;  2OQ7 A;  3IB3 A;  1XYP A;  5IVC A;  2ZX3 A;  3IT8 A;  1IG3 A;  1H8T C;  1OLM A;  4LA2 A;  4Y5S A;  4YM0 A;  4OI2 A;  1Z0H A;  2CNA A;  1Y9M A;  5FY1 A;  3MEP A;  2YB7 A;  2XJR A;  4CSW A;  2ARC A;  1XSR A;  3ACG A;  5C3O A;  2H6B A;  1H6Y A;  3OUJ A;  5CAD A;  3VBH B;  2WLQ A;  1XXN A;  2Q0A A;  4JKL A;  1NCQ C;  4Q4Y 2;  1COV 3;  1YC6 1;  2VY0 A;  2D97 A;  3PTR B;  4Y4Y A;  3T08 A;  1YUD A;  1EV1 1;  4Y1X A;  1RIT A;  4WVV A;  3ZSK A;  3KT4 A;  2RR1 3;  1OKQ A;  1PMH X;  1ND3 B;  4XF9 A;  5A7S A;  1KS5 A;  5J3U A;  4UFJ A;  2PQQ A;  3QH6 A;  2P3J A;  1XNB A;  1VBC 1;  3URF A;  2PHW A;  1UO9 A;  3OSD A;  1U0A A;  1VRH 3;  2JB8 A;  1H30 A;  1CQ9 A;  4AE2 A;  4IEW A;  3DKQ A;  4CDQ A;  2P3Y A;  2XJU A;  2XJS A;  1ZBE 3;  4OI4 A;  4Y4R A;  4YYO A;  1BVP 1;  2W46 A;  1XE8 A;  2J1S A;  3OTF A;  5C6C A;  3OY8 B;  1R09 3;  3VBU A;  1GOG A;  4FI9 A;  4AHZ A;  2BP6 A;  3FJS A;  1VBB 1;  5C4W B;  2PHU A;  4CCC A;  4CRQ A;  2O0O A;  4E4Z A;  3AYC A;  4KQ7 A;  3WLU A;  2LRO A;  1QDO A;  3K75 B;  3WNK A;  1MZ6 A;  4FXG B;  4EWD A;  4UBG A;  5DG2 A;  2ZGM A;  3A7Q A;  4CU9 A;  1NE4 A;  3IPV A;  1IGO A;  3JD7 1;  5T52 A;  2SBA A;  2VTX A;  2ZEZ A;  4LIV A;  1E5R A;  2K2S A;  4FPJ A;  3VBF C;  2BW8 A;  4JV4 A;  2ZX0 A;  4CDX C;  3AP7 A;  3LA2 A;  2VZR A;  3RZK A;  3AP6 A;  4WM7 C;  4XIL A;  4W65 A;  1CIY A;  4PI0 A;  5D8A C;  3H8X A;  1O4Y A;  3S57 A;  5F3C A;  1UY4 A;  3LAG A;  3GBG A;  4W50 A;  5JVV A;  2CGP A;  2WS9 1;  3O0W A;  4FPO B;  5FYT A;  2D6O X;  1PO1 3;  4XAE A;  1GWL A;  1PZ9 A;  5AVA A;  5CBL A;  2XL7 A;  5FZ3 A;  1QOS A;  3WP3 A;  2RS3 1;  1QQP 2;  2H0B A;  4Q0P A;  1WBF A;  2AUY A;  3KQR A;  2OA2 A;  3RPQ A;  2A3Y A;  3NMB A;  2ETE A;  5E6H A;  4CPB A;  4XQW A;  2BWA A;  5CEH A;  1JZ5 A;  2LUW A;  2FZ1 A;  4K1Z A;  3DCQ A;  2QQU A;  3FHA A;  4NPM A;  3U14 A;  1FOD 2;  2Y6J A;  1YFW A;  2WNE A;  3NO8 A;  1T2X A;  4Q4V 2;  3TN9 3;  1JYN A;  5L7O A;  2JG8 C;  4JGZ B;  3WEZ A;  4HSJ A;  1WW4 A;  4HN0 A;  1RUI 2;  3NL1 A;  2KM2 A;  4P5H A;  4D6S A;  1F9K A;  2EVX A;  3RMY A;  1CAV B;  1LR5 A;  2J1A A;  3RJ2 X;  1K12 A;  1VMH A;  1G9F A;  2V5D A;  4G3Y C;  5EJ1 B;  5I0U A;  5CAZ A;  4E27 A;  2ZCW A;  3WDT A;  4YPJ A;  5C9A B;  1PIV 3;  2J1V A;  2VBP A;  2VD7 A;  3WF4 A;  4CDW A;  1TQ5 A;  4UFM A;  2P17 A;  1FT9 A;  2OZJ A;  2MPF A;  3ORJ A;  3KWV A;  1GLH A;  3AYD A;  5GZD A;  3RMX A;  4E8D A;  3IDC B;  1EUT A;  1NCR A;  2JG9 C;  1IOA A;  1JU3 A;  3FFQ A;  4OUM A;  3UT0 A;  4GWN A;  3LPG A;  5FP3 A;  1YYN A;  4OMC A;  4ISQ A;  3RZG A;  1H2M A;  1WCK A;  3VZK A;  4EV0 A;  5ACA 2;  5CKM A;  3TOJ A;  3E5X A;  3T0B A;  4D8M A;  3VBR C;  3ZN6 A;  4XF0 A;  3R05 A;  1WW7 A;  2EAL A;  4W6X A;  4DRV A;  1LOE A;  2BBA A;  1N47 A;  4XF1 A;  4IV1 B;  2PN5 A;  4FOY A;  1QXP A;  4E2Q A;  3HNY M;  1RUF 1;  5F3I A;  5H9S A;  1S2E A;  3RDI A;  2G19 A;  2PYT A;  1NT0 A;  2B42 B;  2YFZ A;  4ZON A;  5I0R A;  3FHI B;  1J1T A;  1NLR A;  2R07 2;  3I3Q A;  3NV1 A;  5FZK A;  1O91 A;  2BGC A;  4LHN A;  1POV 0;  3JB8 A;  1EV1 3;  1VJ2 A;  5BNQ A;  4NHY A;  4IXL A;  3I2G A;  4I0W B;  2DWR A;  4IQP A;  4AK3 A;  4D6R A;  1H8T B;  2XR4 A;  3JU9 A;  3VBO A;  3BOD A;  1VBC 3;  4QX1 A;  2VVF A;  3NAP A;  5A3T A;  1UZZ A;  1FAY A;  2GH2 A;  4LOR A;  5T3N A;  2A5Z A;  4N43 B;  5F3G A;  2B45 X;  4B7E A;  4QQL A;  5IHR A;  3DYM A;  4YRD A;  4XXP A;  4K9S A;  2NYY A;  2WA3 A;  3O0X A;  2ZAB A;  2EIB A;  5DN2 A;  5FYV A;  2VOW A;  3ZSL A;  4GH4 A;  4U2A A;  4KBZ A;  3E97 A;  1TMF 1;  2W2I A;  4P00 B;  1AR7 1;  2W9X A;  4K7J A;  1VBB 3;  4BK5 A;  4FOW A;  2VXJ A;  4LKD A;  3M3Q A;  4ZXE A;  4ATE A;  3ENR A;  1Y43 B;  2D44 A;  2E53 A;  5E1R A;  3ZFF B;  1YIF A;  3ETQ A;  5FO8 B;  2WO2 A;  4GB3 1;  5FKB A;  5FY5 A;  3TNP B;  4IEQ A;  1MQT C;  3JD7 3;  2BU9 A;  1J3P A;  4XPV A;  2QFE A;  2IXL A;  3PMS A;  3ZOI A;  3CZU A;  4FOV A;  3VKL A;  2JDU A;  2E51 A;  3MF6 A;  1B09 A;  2Y34 A;  2WS9 3;  2OUJ A;  4FFG A;  4IER A;  5FBZ A;  1HDK A;  3K3N A;  4Z07 A;  1RUH 2;  3BPS A;  3WG2 A;  5HV4 A;  4R9C A;  1UQX A;  2YMZ A;  2HWF 2;  4Y5T A;  2JX9 A;  5KXC A;  1UN1 A;  4K8F A;  2RS3 3;  5JOX A;  2ET7 A;  1LOF A;  2WWS A;  3GM8 A;  4MX3 A;  3OPZ A;  4YFZ A;  2RJK A;  2VNR A;  3BN6 A;  5A1F A;  2QZ2 A;  5FP7 A;  4CCL A;  3HWJ A;  3VHO A;  3VBF B;  2OW4 A;  4HKL A;  2PQS A;  5J98 B;  4CDX B;  2RHP A;  5FZC A;  2YV8 A;  4WM7 B;  5BYN A;  4XF4 A;  2WKK A;  4H3W A;  5D8A B;  5I93 A;  1BJQ A;  5FK8 A;  5IAX A;  1H2L A;  2ORX A;  4JTO A;  3NKT A;  1ZZC A;  3DGT A;  3HQR A;  3FHQ A;  2C4X A;  4TWT A;  4L97 A;  3CIH A;  3OGS A;  4N53 C;  4S2H A;  2DU1 A;  1QGL A;  1W03 A;  5GKA C;  3UK9 A;  2H6C A;  1NE6 A;  1SLB A;  4PQ9 A;  2OYZ A;  4MZU A;  3FL7 A;  3SCH A;  3VN4 A;  5LCW L;  2BVV A;  2VZS A;  1GOF A;  2QZ3 A;  2B4K A;  3DPR A;  4RGA A;  2JDY A;  1MS4 A;  2XGX A;  5GLZ A;  3SLI A;  4QDQ A;  3J4U H;  3ZFG C;  1R08 1;  4SBV A;  2WYF A;  3AZV A;  3NQH A;  2PHL A;  2E7Q A;  3C7O A;  2OXB A;  4QM8 A;  3UGF A;  1QXR A;  3ON7 A;  4L99 A;  2HBT A;  2RE9 A;  2JG8 B;  1V9U 1;  4F7Z A;  4M01 A;  4AFC A;  2YC2 A;  1CD3 G;  3PJQ A;  4YM1 A;  4FTS A;  1HXS 1;  1PO2 1;  2Y33 A;  3ZXE A;  3SCF A;  1MEC 1;  4XDP A;  1TEI A;  2XVK A;  3IDB B;  4AVC A;  1H0B A;  3AKP A;  4XQ4 A;  2EF6 A;  1W2U A;  3Q8F A;  4XJW A;  5IAT A;  5BNN C;  4BMB A;  2ERF A;  2JD9 A;  4HVQ A;  4CCD A;  4CP1 A;  5FR3 A;  4Q2F A;  3VDA A;  4GAZ A;  2JDP A;  2CSG A;  2TUN A;  2NN8 A;  2VZ3 A;  4N7U A;  1QXJ A;  2JG9 B;  3KT1 A;  1W0N A;  1X50 A;  1M4W A;  3J7M A;  1LOC A;  4I0A A;  1RUF 3;  5A3N A;  4HBN A;  3H8R A;  1ZRF A;  3B94 A;  5IVV A;  5F39 A;  5DUU A;  1N3O A;  4UBH A;  5JZG C;  4TSV A;  4TZD A;  2CAV A;  3X29 B;  1GSL A;  3O1T A;  5GJ6 A;  5IFP A;  4EZ4 A;  5FMO L;  1IS5 A;  4IET A;  1Z7S 2;  4XFH A;  3VBR B;  3QOP A;  1PGS A;  4JGY A;  4NHL A;  1ZZ9 A;  1GNY A;  2GSY A;  2J1T A;  3NNL A;  4NIA A;  3VB9 A;  4JQR A;  5ABJ C;  4P9I A;  1AR9 2;  1RMU 1;  2ZAC A;  3PNA A;  3SH5 A;  1LHO A;  4CP9 A;  3UYJ A;  1V6N A;  5KXE A;  3DEC A;  2QQJ A;  4PJY A;  3GZA A;  1UU6 A;  3IWZ A;  4XJ8 A;  4GIQ A;  1D4M 2;  1WCS A;  3GZE A;  3O1U A;  2O14 A;  3POJ A;  2E7T A;  2FQP A;  2ZGL A;  3H1M A;  4ZY9 A;  3ZR6 A;  2JIJ A;  3OUH A;  5C3P A;  3III A;  2FCT A;  4YG6 A;  3HN3 A;  1WGP A;  3MFA A;  2C5D A;  5BV6 A;  1AYM 1;  1TMF 3;  2EIE A;  1AR7 3;  3VHR A;  5CB7 A;  2O1Q A;  5LA1 A;  1V6J A;  1NZC A;  3ZMN A;  1IPJ A;  4CEY A;  2VZP A;  3Q8A A;  1CZS A;  5JXH A;  1GKB A;  1YCI A;  2V09 A;  5IK8 A;  5GZG A;  4RD7 A;  1LHU A;  4GB3 3;  2NLR A;  5FZI A;  4D3W A;  1ZZ7 A;  1FI2 A;  1HB3 A;  5FMB A;  1JYT A;  3HMY A;  4AI3 A;  5C33 A;  1ENS A;  4JDN A;  4IW3 A;  2PEL A;  3BIE A;  5KXD A;  2ZPX A;  3THP A;  3KM5 A;  3KGL A;  4XUT A;  4OHV A;  4IEO A;  1RVF 2;  3POS A;  4XZU G;  3ZIW A;  4BZ4 A;  5CG9 A;  3CJX A;  4BXS V;  4A7Y A;  1LHN A;  3OJB A;  4MOA A;  2DUO A;  1Y9Q A;  2ZGP A;  4HMZ A;  1D4V B;  1F31 A;  5I0S A;  4BQ4 A;  1WMD A;  4Z2A A;  3NV4 A;  1OFS A;  4AQ6 A;  2GZW A;  1GUI A;  1UX6 A;  1UAI A;  3K48 A;  1PVC 1;  3BYW A;  2DF7 A;  2P2K A;  1MQT B;  1AHS A;  4QQH A;  4RQP C;  2HWB 1;  3AP9 A;  3B93 A;  2QNK A;  4YW2 A;  3U1X A;  4N8M A;  2QQV A;  3ZYF A;  4Q8K A;  5C3S A;  1TE1 B;  1OUS A;  4OMD A;  2Z5W A;  3UGH A;  4A44 A;  1X9T A;  5C8C A;  2BRT A;  3NVC A;  3KQ4 B;  3AXE A;  4PBO A;  4PLM A;  1W6N B;  4OYU A;  4OUE A;  2PTM A;  1JZ3 A;  1DYK A;  4KWK A;  4CEW C;  5GZF A;  3OEB A;  4MGZ E;  5FPU A;  4EQV A;  1YRZ A;  2D98 A;  2Q5T A;  3IBM A;  5I0T A;  2P6H A;  1JYX A;  2FD8 A;  1GZW B;  1EYB A;  2VW2 A;  3KT7 A;  1RHI 2;  5FMD A;  4XIO A;  5A3U A;  4DXZ A;  4MXW A;  4P5Y A;  4LLF A;  3RSJ A;  5FZO A;  1FPN 1;  4MV2 A;  1R08 3;  3AZZ A;  4XET A;  3J7H A;  1O5U A;  3WW1 A;  4CPB D;  4CU8 A;  4YFW A;  2B5H A;  1DQ2 A;  1UZV A;  1W9F A;  1Y4W A;  4JRL A;  2D7F A;  3T4H B;  2GAU A;  3BB6 A;  3MZH A;  1UPI A;  2C1F A;  3K4Z A;  4AQT A;  2VNO A;  5GM0 A;  1V9U 3;  4N53 B;  2PAE A;  4Y20 B;  1OD5 A;  1HXS 3;  1PO2 3;  1SLA A;  2DCJ A;  2D6M A;  4XJA A;  5BNP A;  3WNM A;  1F4H A;  1MEC 3;  1DZT A;  3WHU A;  4E9K A;  2BNN A;  2MHF A;  2ARB A;  3PTY A;  4RR3 C;  4S2G A;  5H9Q A;  5K0U C;  2K9Z A;  2UUR A;  4UW5 A;  5T5J A;  3ZFG B;  4BXF A;  4D6Q A;  1CAX B;  5JUV A;  4LO4 B;  3OB8 A;  5T5O A;  1OVS A;  4Y3O A;  5FAX A;  4BB3 A;  1IKP A;  1U5Z A;  1MS0 A;  5J36 A;  2XDV A;  4DUV A;  5DZF A;  4MET A;  4LBQ B;  4FP2 A;  5GAL A;  3U75 A;  4JX0 A;  4E2S A;  2EXH A;  1RUO A;  4EN9 B;  2IFW A;  4AAX A; 
#chains in the Genus database with same CATH homology
 3W21 A;  2RDR A;  4XAB A;  4KBZ A;  4JZR A;  3GZE A;  2JIG A;  5IAV A;  5LAT A;  5LA9 A;  2JIJ A;  3OUH A;  2FCT A;  2G1M A;  4NHM A;  3GJA A;  5DAQ A;  3W20 A;  2A1X A;  5DAP A;  4UWD A;  5C5U A;  4XCB A;  2Y34 A;  5LB6 A;  2HBU A;  5HV0 A;  5HV4 A;  4XCA A;  4IW3 A;  4Y5T A;  2RDS A;  3NNJ A;  5L9B A;  5EQU A;  4NMI A;  4XC9 A;  3HQU A;  5DAX A;  2RG4 A;  3EMR A;  5IAX A;  3HQR A;  2FCV A;  3OBZ A;  3GJB A;  3MGU A;  3PL0 A;  2OPW A;  2V4A A;  4Q5O A;  4Y5S A;  4BQY A;  3KT7 A;  5LBB A;  5A3U A;  4XAA A;  2HBT A;  3OUJ A;  4NAO A;  4NHX A;  5C5T A;  5EPA A;  5DAW A;  2Y33 A;  2FCU A;  4BQX A;  5DAV A;  5ERL A;  3NNF A;  5IAT A;  4MHR A;  4J25 A;  3OUI A;  3KT4 A;  2G19 A;  4ZON A;  5EP9 A;  2RDQ A;  3NNM A;  5LBC A;  3KT1 A;  3BVC A;  4MHU A;  4NHY A;  5L9R A;  5LAS A;  4XAC A;  3DKQ A;  5M0T A;  5LBF A;  4ZPI A;  4BQW A;  4NHL A;  3NNL A;  2RDN A;  3ITQ A;  4NHK A;  5LBE A;  5L9V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...