4JZRA

Structure of prolyl hydroxylase domain-containing protein (phd) with inhibitors
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
211
structure length
204
Chain Sequence
PALKLALEYIVPCMNKHGICVVDDFLGKETGQQIGDEVRALHDTGKFTDGQLVSDIRGDKITWIEGKEPGCETIGLLMSSMDDLIRHCNGKLGSYKINGRTKAMVACYPGNGTGYVRHVDNPNGDGRCVTCIYYLNKDWDAKVSGGILRIFPEGKAQFADIEPKFDRLLFFWSDRRNPHEVQPAYATRYAITVWYFDADERARA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Novel complex crystal structure of prolyl hydroxylase domain-containing protein 2 (PHD2): 2,8-Diazaspiro[4.5]decan-1-ones as potent, orally bioavailable PHD2 inhibitors
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords Egl nine homolog 1
total genus 59
structure length 204
sequence length 211
ec nomenclature ec 1.14.11.29: Hypoxia-inducible factor-proline dioxygenase.
pdb deposition date 2013-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13640 2OG-FeII_Oxy_3 2OG-Fe(II) oxygenase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.620 Mainly Beta Sandwich Jelly Rolls q2cbj1_9rhob like domain 4jzrA00
3HQUA 2RDRA 4XACA 3DKQA 5ERLA 2G19A 5DAXA 4IW3A 2Y33A 4XCAA 2FCUA 2RDNA 4NHMA 3ITQA 4NHXA 4UWDA 5LBEA 3NNJA 4J25A 5DAVA 3KT1A 3KT7A 5LBCA 4BQWA 5IAXA 5C5TA 3HQRA 5IATA 2G1MA 3OUIA 4Y5SA 3GJAA 4ZONA 5EP9A 2A1XA 4JZRA 2JIJA 5DAWA 5EQUA 5L9VA 2HBTA 3OBZA 2Y34A 3PL0A 5L9RA 5IAVA 3OUJA 3KT4A 5HV0A 5LBFA 5LA9A 4KBZA 2FCTA 5A3UA 2V4AA 5LB6A 3OUHA 2OPWA 5C5UA 4NAOA 2RDSA 4Q5OA 5DAQA 3BVCA 3NNLA 5LASA 4NMIA 4XAAA 5M0TA 3NNFA 4Y5TA 4BQXA 2RDQA 4NHYA 3GZEA 4XABA 3W20A 5LBBA 2HBUA 4MHRA 5HV4A 3EMRA 4BQYA 3NNMA 4NHLA 5L9BA 5DAPA 2JIGA 3W21A 5EPAA 3MGUA 4NHKA 4XCBA 2RG4A 3GJBA 4ZPIA 4XC9A 5LATA 2FCVA 4MHUA
chains in the Genus database with same CATH superfamily
2VG9A 1W6PA 5F6LB 5JXHA 3ZXLA 2C0ZA 3FHAA 2A6XA 2DFBA 2AACA 1RC6A 2OQ6A 1D4VB 4HSLA 3HJRA 4CDXA 2OUHA 3ZVXA 5HXMA 4PQQA 5I8SA 4HPKA 3IB3A 4L97A 1GSLA 2ZHLA 4XCAA 5E8AA 4LUMA 1JBCA 2HWC3 3NW4A 4YG3A 2G9GA 1VAKA 3B7MA 5J98B 2JDZA 1TVGA 3ZR6A 1VBE2 2YV8A 5FZDA 2WZR3 2ZMLA 2VL4A 2WSVA 2VPVA 4HVRA 3NNJA 4G4FA 2Y6KA 3THDA 5IVBA 5JSOA 1QDCA 1WCQA 5IAXA 1GICA 4GD4A 4NJ4A 3ZXAC 4J1XA 4CDXB 5FXZA 3N9QA 2YROA 3VBFC 2G1MA 5L36A 5FYIA 1HXS3 4NIHA 3OUIA 3H3LA 1ENQA 5DUXA 4YW3A 1UD1A 2WO2A 3KVBA 5HCFA 3VBOA 5AC92 1OF3A 1VBB3 3AKRA 4Q4V3 3RWKX 1POV1 2D6PA 3I3BA 3SH3A 2EVXA 3I3MA 3P3NA 1OLMA 5EZWA 3WF2A 3MI8A 3ZYPA 1HB3A 3VB9A 1FAYA 3K4AA 2ZGUA 5FMBA 3PL0A 4WZFA 1KD7A 1CZSA 3OUJA 3PDQA 1ZBA2 5F2SA 2W1WA 1T6BX 2PHLA 3K4ZA 4QM8A 4XF9A 4AFAA 1OQDA 3HIFA 1W0OA 1ZZ9A 3D0SA 5LBFA 5JLVA 2FD8A 2ZX2A 3O1UA 4JC1A 4NO4A 1UOFA 2B42B 2ZGLA 5A7OA 1QXRA 1W8HA 4K7JA 4PDWB 4ARYA 4PLNA 4XW3A 1V6IA 5FZCA 3CJIB 3VBSC 1NCQA 1VPHA 4C1WA 1R1A3 2VCCA 2BWAA 4FFGA 4EWEA 1YC61 4YFWA 2FHRA 1JTZX 1AXZA 5KXCA 3NNLA 3ZYHA 3WNPA 5EYYA 3N7JA 3WNXA 1BBT2 4BQ1A 1W8NA 4IEQA 2G9FA 4P9YA 1COV2 1QF3A 1JYIA 1NY72 4NE9A 3LCPA 5FYVA 4CU9A 3J7HA 4B7EA 3B01A 4XABA 1OXCA 2V5YA 1W3VA 4MGZE 4XJAA 5C3RA 4N53A 3EMRA 5HV4A 1TQ5A 3M8LA 1WW6A 4XJUA 1OA2A 1KEXA 1V0AA 1OFNA 5BNOC 2EXHA 5ACA1 4ES8A 4OFGA 2VQUA 3N7MA 1FI2A 2QQLA 1VMJA 4CTEA 2CGOA 3S5QA 4DUVA 1K45A 4WVWA 1KDMA 1AYM2 4LO8A 3OG2A 2BV4A 1PGW1 2AH2A 4QB6A 2RJLA 4KWUA 1ND2C 5DUVA 4N53B 4YW5A 2UY8A 4Y5Z0 1QQP2 1XE0A 2ORXA 2VZQA 4HKWA 2JDKA 2X5IB 1EV11 2XQXA 2WKKA 2WZR1 3L2HA 4XHXA 3KS7A 5ERLA 3WNMA 2RR13 2LROA 2RS32 3OGRA 3OGSA 1UY3A 5L19A 3B9CA 3W58A 1HW5A 1LEDA 4R4XA 2HWB1 2O1QA 2EAKA 5FK7A 5ANNA 5F5IA 3ECQA 3UGFA 1CD3G 3ZYFA 1JMUB 3BODA 5JOZA 3J8F3 4A6OA 5A3NA 1RUOA 1HX6A 3ZSEA 3OEBA 1UOBA 3VBRC 5B4NA 3NV2A 1PX3A 1YWKA 4OUSA 2ARXA 3UK9A 1RUNA 4QXBA 1O5UA 2PHTA 2CL2A 2WFPA 3HQRA 2XJSA 3AZWA 2O14A 1MS1A 4GWMA 4JHZA 1VBA3 1EUTA 2P2KA 3BGAA 4TN7A 2A3XA 1OKOA 1R64A 4HBNA 2F6BA 4YNIA 4RA0A 4INDA 4AVAA 3TOJA 3ATGA 1Q8VA 2VUJA 4BLJA 4Z92B 4UW3A 1PMHX 4FPOB 4IUGA 3AKTA 4Z2WA 3DF0A 5FZAA 2RS13 3AC0A 4NR1A 1VBA1 4C90A 5D8AA 2ET7A 3E6CC 1D4M3 1EYBA 4RYDA 4Q26A 1XC6A 3HQXA 2OKXA 2HWC2 4AHYA 4N43A 1QJEA 4Y1UA 2TUNA 5A7NA 3M3EA 5IT6A 3ACGA 3V0AA 3AMQA 3T2OA 1CX4A 5A32B 4LORA 5A33B 3KHCA 1ND3B 3N7KA 4I01A 2JDUA 1ZZBA 2XJVA 3O1RA 1W2OA 5FZHA 4EWDA 2WWUA 3WG2A 4L0PA 2VUDA 4LJHA 2GC2A 1JOPA 4BJ0A 3ZFFA 1O91A 1OSGA 1IS6A 2R043 3NKGA 2QQVA 4QX8A 1OHFA 4CCMA 2XJRA 4QKBA 5FZEA 1W05A 5BV6A 3FE5A 2ZX1A 4QPIB 3NO8A 4X6QB 3VD5A 1PM7A 3J8F2 4CDWB 3WDUA 1GZWB 1OLQA 3QD6A 3BVCA 2A6WA 2D40A 4FQZA 3VHOA 5BNQA 1ACCA 1QJU2 3AP6A 3TEXA 1UYZA 5K0UA 4CP0A 2ORZA 2WNUB 1CGPA 3NV3A 2VQTA 5J37A 1DZQA 2EALA 2LM3A 2XLGA 2WUHA 1T2XA 2E7TA 1I9RA 3ALQA 1OLRA 1X8MA 3JUUA 2JG8B 1GKBA 2VOWA 4DY3A 4N9HA 3LFIA 3OPZA 4AFDA 2XHKA 3V0BB 3ST7A 3MPBA 2XLAA 2D6OX 3EJKA 3ZKUA 4EN7B 5JMOA 3HNMA 3VZOA 5CKQA 5BNPA 3OB8A 4A44A 2R0FA 3B5LB 4I0BA 4GB33 4META 2VULA 1Y9QA 3JD72 5FYUA 1RHI1 4CA9A 2W2IA 4Y20A 1VAVA 5A7PA 2C1FA 2I74A 4A3ZA 4Q1RA 5BNPB 3I59A 1OH4A 4QXHA 3IWZA 3AX4A 3NRUA 1UIJA 1YNAA 1NLQA 1S0IA 1W6MB 2R0HA 2WS93 3G7DA 5CU1A 4XQDA 5FMOS 1C1FA 3B00A 1DQ0A 3VBUB 2VOTA 5GLVA 1WMEA 1FPN1 1AUYA 3HT2A 2J42A 4Y22B 1F4HA 4AE2A 3D4KA 1COV3 4JHTA 4CCCA 3MBWA 1QJX3 4GMP0 1R091 1RUE3 4Y20B 4CP9A 3I3QA 1CIWA 2JE9A 4XIKA 2DV9A 3AJYA 2WQ4A 3ZFFC 4K40A 4NHXA 1C1LA 1N3QA 3VDAA 5LBEA 4IEXA 4B1LA 2ZX4A 4DXRA 1R081 2BNMA 4NIGA 4CP1A 2ZGNA 1GNHA 1Y9MA 4LT5A 3OGVA 1XBFA 4Q0QA 2ERFA 4BQWA 3OD0A 1BVVA 2W1SA 3VKNA 1O5LA 1GWMA 3VZNA 2K9ZA 3LQCA 2MEV3 1UOJA 3A0KA 2FDFA 3KSCA 4PDWC 5B4XA 5DUUA 4BCUA 4LXLA 3O7OA 2Q1FA 1F8VA 4AWDA 5KC6A 1H8TB 1WMFA 3M70A 4W4ZA 2HEYF 1UPIA 3PIJA 1HQWA 1SFNA 4M0NA 2QDNA 5DDJ1 3JB8A 3P5BA 4JZRA 4IV1A 1AR63 4K8FA 4XBNA 4H55A 2XH6A 3AKSA 4GJZA 3JD73 3LA7A 4DUWA 4Z2AA 4DMIA 2OZ6A 4PLOA 5FAXA 4YPJA 4AEKA 1AXKA 3THCA 4HMZA 1NCRB 4XMIA 5FYYA 1M06G 4XUNA 5D2AA 1CZTA 5DDJ3 3CNAA 4ZKTB 1LEMA 1TMF3 3D6EA 4E27A 3MZHA 4Q0UA 2OIIA 2ZGSA 3TNQA 2BU9A 4CDUB 5C3SA 1YQ6A 3H50A 1MEC2 5FZ1A 5F32A 2XMLA 3RI9A 1V6JA 2VZUA 5ABJA 5A70A 1CVNA 1NA1A 3WW1A 1Q3EA 3NV1A 4UYBA 3AP5A 1CX1A 4KG0A 1VBC2 4IDZA 1QY4A 2ZZQA 1VAMA 2VZVA 5F3EA 1J84A 5DXDA 2BWCA 3URFA 1O3QA 3T30A 2WZ8A 4I30A 5JOWA 5FPVA 4LO4B 1W8UA 4H3WA 1YYNA 2WS92 3POSA 4Y4YA 4ARXA 2VMCA 2Z42A 1HRV1 2YC0A 4A2UA 3FUOA 2KXLA 3MUY1 3USUB 2RR12 1LULA 1BYHA 1UF2C 2RDQA 1NLSA 3DPRB 3FBYA 3NWKA 1RUF3 1RTVA 2ZPXA 4H2AA 4NN0A 3ZR5A 5KBFA 1NLRA 2VO5A 3NNMA 4YSFA 1APNA 1HRV3 3WNKA 3ZXDA 4EJRA 1ULCA 3V0AB 3AL5A 4G9SB 1YFXA 4KMQA 4N7UA 4FFHA 4AEMA 1ZYBA 2YGLA 4M01A 5GZEA 4XXAA 4UW6A 4XFBA 2UYBA 1FPN2 4BZ4A 1V9U2 3VBRB 2UWBA 5GZFA 1PO12 1DF0A 1I5PA 1MZFA 2P17A 3F2ZA 2Z4FA 1JXNA 2BOIA 2HYXA 1L3JA 2D6LX 2LS6A 4YW2A 3T0BA 1QJX1 4FPYA 3K75B 4IV3B 4GJYA 2ZXQA 4LBOA 1RUD2 1VBA2 2X5IA 3X29B 1HV1A 4HT1T 3I97A 2H0BA 2JICA 2G9ZA 2UWCA 2WBKA 5DG2A 5DPNA 2YPDA 2XHNA 2ZGQA 5IK5A 1WW5A 2WA4A 4LUKA 2VNVA 4BLIA 4DXTA 4J6GA 5BUVA 1ZA7A 5JDBA 3WNNA 2Y33A 5IVVA 3ZYJB 4AHXA 3KGZA 2DTYA 4U36A 1IZ3A 5IVCA 4JTOA 2WYSA 5IJRA 3CJXA 4UWDA 4COUA 1AXYA 3POGA 1D0GA 3CBNA 1KXGA 2BVVA 5FOBB 4PF5A 1JH5A 1YCIA 4ISQA 4BIOA 3ZFFB 1UY2A 1WA4A 1H2MA 3GHMA 4AQ2A 3PLQA 4FAHA 5LRRA 1OA3A 2BEOA 3VHRA 3WP4A 1S0EA 3GDBA 3UJOA 3FFZA 5IATA 3VBHB 1LAJA 3AP7A 1O59A 2K2SA 3MIBA 4M3CF 1PGL2 3DL3A 1PK6C 2GMEA 4ZONA 4RGKA 3BCWA 4XTPA 2RM22 1UX6A 2HWF2 2PLV3 3DXUA 2Q8CA 2DCJA 5FYSA 2Z69A 5D8AB 3OD4A 3SCGA 4UF0B 1HB2A 4NPMA 3VL9A 3KB5A 3VDDA 4CU7A 5FQ0A 4A41A 3WP3A 5IYYA 4P14A 3VLBB 1LOBA 3KV6A 4QT6A 1VBC1 5LZ6A 1PNGA 1ZX5A 2CGPA 4BMBA 1D2QA 2WT2A 3TB0A 4BA6A 2P6HA 2SBAA 4ASLA 5FZFA 2ZGOA 1LHUA 2AENA 3BIEA 1XNTA 3DEMA 3O1TA 5GZGA 1DQ6A 1UY4A 4XFCA 4CU6A 3R4UA 4ATEA 1PIV1 2DCYA 3RPQA 2GNTA 3QLQA 3PU8A 4YZ3A 2I45A 4KWKA 4ZU5A 1A8MA 1LOGA 4HK8A 5GZCA 2OPWA 2VZRA 1WW7A 2R7EB 4XEZA 2WAAA 5C5UA 1VBE3 3O0VA 1G9BA 2ZEZA 3HNYM 1D7PM 1KS5A 4HFSA 5TSWA 2SLIA 4OHWA 4WM7C 4JVAA 5A3OA 4CXWA 5BNOA 3BIWE 3A22A 3H7YA 2GN3A 3OY8A 5C33A 1ZBE1 5C8CC 1YJLA 3LA3A 1G8WA 4XAEA 4BWOA 1PO23 4KBBA 1IPSA 4QPGC 5F7UA 5KHGA 2P5BA 4WV8A 2IFRA 4AGGA 1DGLA 4N53C 1W9YA 3OOXA 5T5LA 3K48A 5JOXA 5K7PA 5JUVA 4FPEA 1J1TA 3U14A 1XJAA 2Y8KA 4RD7A 3H7JA 1IPKA 3WF4A 1DGWA 1KDKA 5FO9B 4CCJA 1W06A 1WLWA 1WBLA 2ZGTA 5FQ0B 3T09A 1WZXA 4AAXA 2ET1A 1DZRA 2WZPP 1VE0A 5EJ1B 3ZOIA 1DQ5A 1FX5A 1PMJX 1TE1B 3APBA 5A3PA 4IE6A 2HEWF 5JCTA 4Q2FA 2VR4A 2WNOA 3IAQA 3TNPB 3I2IA 3AYEA 1ZNPA 2ZHNA 5ACA3 3T2TA 1NA1C 4PI0A 3ZN6A 3IM0A 3MUZ1 4QMAA 3L2YA 2DCTA 3Q8BA 3WINE 1ASJ3 5JSRA 4IE7A 3NJYA 2XVLA 2JDPA 4H14A 2BNNA 3HWJA 4XJ8A 2DUPA 3ILFA 2FCUA 4KNCA 4Y26A 5FZ8A 4NIAA 2ZX0A 2W68A 2J1UA 1IS3A 3N9PA 1TG7A 1NE4A 4CDQC 3KCCA 1HN0A 5IVFA 1LHNA 4P08A 3PU3A 3U78A 3AFKA 4TYSA 4FTBA 4HZFA 5DZEA 3WG4A 4DXSA 2CWMA 1LGBA 2VE1A 2Q8DA 1RINA 1NA1B 1MS9A 3PJYA 5C5TA 3KVAA 4R9BA 5C4WB 1QQP3 4XUQA 1DQ2A 1F35A 3AL6A 2OS2A 3S5AA 5JR7B 4LLOA 2J7MA 2QTWB 3ACIA 5FP3A 3A7QA 1ODMA 1POQA 2BGOA 1N1YA 2A70A 3WLUA 2P1BA 4EN8B 2QBXA 4DEVA 1FYUA 3LSDA 1PMIA 3WF1A 4N90A 4Q4W2 3WCSA 5KHIA 4GH4B 2BFUS 1K5MB 2FDJA 5HCHA 2IFWA 3M7AA 1Z7S3 4AG4A 5CFDB 2VMDA 2XBO3 2IVJA 2WFF3 3POBA 1NT0A 5L9RA 1SEFA 2ZMKA 3IMMA 3N9NA 3KT4A 1SLBA 5FDBA 1XRUA 1V9U1 3WD5A 1SZBA 4LA3A 1MZ5A 1LOCA 1VB4A 5I0UA 3ZLIA 3AP9A 4YZ4A 1JHJA 2F17A 2XKPA 1N1TA 4YM2A 2ZAHA 4CCLA 3LFMA 4JGYB 2EIEA 4RFRB 3PTRB 1ODNA 3U37A 4CXXA 5LB6A 5JXJA 2PHUA 5K8SA 5A6YA 2D98A 3I59B 5LW9A 1HV0A 5FZLA 4PIYA 1OQ1A 1MQTC 5F5AA 2CU5A 4IV1B 4QB1A 4UBGA 2VMFA 4BH9A 3DECA 3ILNA 4H7LA 2QDRA 1IG0A 2BOJA 1ULDA 5SV8A 4C0HA 4EV0A 3O1SA 1RITA 2P3YA 4LHKA 4TSVA 5FZ6A 4W8JA 1UW8A 3H8UA 3WDWA 2WRAA 5EXOA 4BQ2A 4DRRA 5FPLA 4HXCA 2VZ3A 3VZJA 1ASJ2 5FXWA 1X9PA 4KWLA 3IT8A 3GZEA 3N7LA 1J58A 5KHKA 3CKHA 1GWLA 1WA6X 4AEDA 3WDXA 3RZLA 2BGPA 3DV8A 2BP6A 5I8YA 4EROA 2B9VA 1MQTB 5CADA 5I0RA 5L9BA 2WO3A 3MFAA 3K3OA 1DQ1A 2D43A 5JXIA 4GH4A 3BTZA 3FN9A 5FUPA 2GMMA 2VMIA 1S2BA 5K9YA 2Q1ZB 1AR81 5KXDA 4LE4A 4YGDA 1VBD3 2VW2A 4AL9A 4BK5A 4UBHA 2GNBA 4LO7A 2VTXJ 4JDNA 2A71A 3GZTB 4IXLA 3ZFEB 4B3NA 5FZ9A 4JQTA 3WQ0A 5A3WA 5L7OC 1GNZA 1D4M2 5A6QA 5GZDA 1Y3TA 4BDVB 3KCXA 1RUC2 3RMXA 2XJQA 3HQUA 2OW4A 3O1VA 3ZN5A 1W99A 1VBD1 4S2HA 3VKFC 2VZTA 2B9UA 2G19A 4XJ9A 5BNNA 1ZZ6A 3USUA 4P5YA 3D5OA 4XQWA 4M0HA 3W9AA 1LCLA 2R042 2VTXA 4DXZA 4PF1A 4XFHA 4XFIA 2XR4A 4FPCA 2XKOA 3O5SA 4N43C 4QXCA 4K21A 1PVXA 3J26N 1WCDJ 3POWA 4ZS2A 4BE3A 3H8XA 3I2HA 4GALA 5FZ4A 1UQXA 4LULA 3UV9A 4Y1VA 4K1YA 1KJLA 3RQ0A 2DVBA 1RUG1 4OLLA 4WM8B 1Q43A 3MW3A 1U5IA 2ZEWA 5FXVA 3UNPA 1QDOA 1QHDA 3NAPB 3ZSLA 5IFTA 2WNEA 5GLZA 5IW0A 4LKDA 3HT1A 3QH7A 1SPPB 2VBBA 3I2FA 1RUE2 1PVC2 3POEA 1NAEA 1LJ7A 5F5CA 3WQBA 2ENRA 4A42A 4CDUC 4EZHA 5CFCB 2OT7A 1QJY1 1VRH2 3BOPA 4AHWA 2B5HA 3M4FA 1L7QA 4AXOA 2Y26A 3UESA 1F31A 3ZFGB 3KD4A 3WG3A 1J3QA 2A5ZA 1YRZA 5DAWA 4FXKB 5F39A 3ME2A 3R4SA 4YLZA 1R092 3MO4A 4TTGA 1NCQB 4GMP3 4COYA 3KM5A 1RUG2 2GSYA 1AVBA 1HJGA 1QXJA 2R30A 1J3PA 4DZGA 4EN0A 4HN1A 3A21A 4XFAA 1GWKA 5FP7A 2XDVA 3V65A 3VL8A 2DVGA 5I93A 3FHIB 4KQ7A 5I91A 2W91A 3IDCB 4OZOA 4URTA 4MGSA 3W5MA 3WF0A 1J59A 3IN9A 3CIHA 5FJHA 2I2SA 2ZEXA 3I54A 4UXAA 2H0VA 3RGBA 2E7AA 1AYM1 2P4EA 2Q8EA 4FQ4A 1XU1A 3VHNA 3JXSA 1JYWA 1H2LA 4R9AA 3VDDB 3MDPA 2IC1A 1MVQA 1OKQA 1R1ZA 2R073 3WUCA 1POV0 2WAOA 4FXGB 1W6QB 4GH4C 4Y24A 5JIAA 5FWEA 1AHSA 2KR2A 1LHVA 1QOSA 1H8VA 4JGZB 3UYJA 5DZFA 3BALA 3WQ1A 1PVC1 2ZHMA 1AYM3 5FZKA 4EQVA 1DHKB 2Y6JA 1F9KA 2WT0A 4GB31 4LO5B 5FFOC 4UFJA 2FDIA 1V00A 4XMAA 2VW0A 5LBBA 5L7OA 4MHRA 1IG3A 2ETEA 3FUQA 1BMV1 5HBAA 2VOVA 4IERA 4YZ2A 4QPWA 4D6SA 3I3DA 1U5ZA 5FYBA 1BBT1 1WLDA 3OCPA 4X8PA 4Y33A 2JIGA 2XBO2 2ZEYA 1Y4WA 2PXJA 3J7MA 5C9AC 2QNKA 4N7IA 3O1PA 1DU3D 1CESA 3GM8A 4K8RB 1BZWA 4RS5B 5FLHA 3FJSA 4X6RB 3PUQA 2X09A 2ARAA 4FPLA 2TNFA 4WZCA 3SEPA 3LEKA 3WF3A 3WVJA 4XCBA 4W6YA 2DU1A 3WZ1A 1IGOA 1W8OA 2D6MA 1OPMA 1OVPA 1YFWA 1AL22 4FPGA 4RSUA 5C4WC 3UT0A 3EO6A 4MHUA 3OTFA 4Q0VA 2EA7A 3VZMA 3CL1A 2N7GA 4RHV3 1XOYA 1SBEA 3NAPA 1PO22 2AC1A 1S2KA 2UU8A 4L11A 2EICA 2Y6GA 4CCNA 1QJZA 4QPIC 5FP4A 4UI9L 1Q56A 1NXMA 1ZREA 4UFLA 2JDYA 4ASMB 1UU6A 2P3JA 2Y6LA 4CDWA 1IQDC 4D6RA 4M3CE 3PUIA 2VCBA 2Q30A 2PN5A 2GC1A 3AVSA 1IPJA 3OSDA 4A45A 3HAGA 3ORJA 1HB4A 2A7AA 1VMFA 2HWE3 3HMYA 4JGYA 3NMBA 4IEYA 3D0JA 4HG6B 1B09A 2DUQA 3B93A 4GA9A 2RS53 1YQ8A 3PVOA 1AR61 1W6PB 5A1FA 1ND3A 5IUQA 2B45X 2D6NA 4Q1PA 4TWTA 1W04A 3E6BA 1QOTA 1S0DA 2VM9A 5GKAC 5DN2A 1WKYA 3KHBA 4AI8A 5FZ7A 1LB2A 1EV12 3CU7A 4IV1C 2NQYA 2RS51 4TZDA 3KV5A 5F3GA 2AEZA 1LU2A 3QBQA 1GUIA 3E6DA 2HWB2 4QDRA 3RJ2X 3LPFA 3WDYA 4FOYA 2WABA 1S0CA 3GXUA 2CSGA 4LLFA 4XXPA 2EAAA 4XIOA 3WW2A 3ZXKA 4RQPB 2XB6C 5FCCA 3UL2A 5C8CB 2NPIA 4D69A 5LA9A 1FOD3 1DGWX 4RR3B 3UETA 1LRHA 3NAPC 1JYVA 5J09A 2E63A 1JZ2A 1OUSA 3M3QA 2BJSA 2HYKA 4ZXKA 2V5DA 5I0TA 3TN91 5FR3A 3TRSB 3VGIA 2WC2A 4Q0PA 1DIWA 1W6NA 4KU7A 1H0BA 4AFCA 1ZA4A 3Q8FA 4P02B 4AFBA 2YC2A 5FXXA 1PX4A 4GWJA 1BXHA 1G6NA 1SLTA 3DKWA 3H3ZA 5FZBA 2R063 1H4HA 1RUF1 4PBOA 2EXKA 2K46A 4IEPA 1W6NB 3AYCA 1X8EA 5HI0A 2EIDA 1H9PA 1MZEA 4XAAA 4A7YA 1W2NA 3I8TA 2H6BA 1FMD3 1CAVA 1LESA 2VNOA 4BQXA 1O8PA 4LOSA 2YY1A 1GLHA 4V2VA 1CN1A 2QQWA 4YVWC 2PHDA 3CEWA 3AZZA 1RUD3 2OYZA 2EIBA 3U4SA 4YGEA 3SH5A 1FNZA 3I4IA 3EB7A 3TEYA 3LWCA 1GANA 4UAPA 3CDZB 4MG2A 2RVAA 1DLLA 2IXJA 1SHWB 3W21A 5C9AA 5A80A 2VMHA 3K46A 4I02A 3LOIA 1LR5A 4MGIE 3GZAA 2IXIA 4LE3A 4FFFA 3SCHA 2FDHA 1K42A 5FZOA 2VUCA 4JRAA 3U75A 4CDQB 5FYHA 5A3MA 1HLCA 3ZXGA 3EXUA 2JDNA 5LATA 3ZSKA 4AQ6A 2E31A 2PHRA 5F5QA 3RFRA 3WHUA 2QQJA 1ZRIA 5T50A 3FZ3A 2BTVC 1AYN3 1ULFA 1JYTA 3JQWA 4BYYA 4XF3A 1W03A 2XXZA 3ZXFA 3LIHA 1A3KA 4IW3A 4QKDA 4WM7A 4Q4W1 2NLRA 2VQAA 3T1LA 1B35C 4IGOA 4AI1A 1K3IA 2CGNA 3OPWA 2R6QA 2IXHA 1JZ4A 1KRIA 1AJOA 3EBRA 3WW3A 4CUGA 4JTNA 1DCSA 3CHXA 1GZTA 2EF6A 3C7HA 2QQKA 2AGSA 3UKTA 1BLZA 2QQOA 2XJUA 3K51A 3NJVA 1EP0A 2XVKA 3WW4A 4O9GA 5FY7A 1POV3 2R1DA 4YVSA 2ID4A 1LGCA 1WBFA 1XU2A 3PMSA 1F5FA 3LSEA 2AYHA 4QGLA 5DZGA 5APAA 4CCDA 5C8WA 1TMF2 1SLAA 5ACA2 1RMU2 2DURA 3OBAA 5FUIA 4D7TA 5JPMB 4EN9B 3T2QA 5A1LA 4YM3A 5GLWA 2MPFA 2W47A 4LBQD 3AM2A 1UXZA 3VDDC 5IHRA 3W20A 2A1XA 1VRBA 3MYXA 3JBG2 1V9U3 3WV6A 1NQJA 4E2GA 3I2GA 3MIEA 3OBZA 4O9EA 3UKNA 2A3YA 1OBNA 2DFCA 1W6OB 4QXKA 1UOGA 1NXD1 3WP5A 1B35A 4D7SA 2VCMA 3G6JB 4QX2A 4XDPA 2P6CA 3POYA 4LHSA 1UU5A 1DQ4A 4GZ9A 4M4PA 4A7KA 1RUF2 1HB1A 4OHYA 2WFF1 2Z2SB 2Z79A 4XDQA 1VBB2 4Q4V2 4UW4A 4QGNA 4JRLA 1VRH1 2NM1A 3WXPA 5C3QA 1ND2A 2ILMA 1PO11 1YJKA 1FMD1 4MVTA 1PO21 4EZ4A 3CJIC 4Q4Y1 1MS4A 3VBSB 2RDSA 3HBKA 2GC3A 3QOPA 2BPA2 1RUD1 2VZSA 4NVPA 5LASA 1EPZA 2XLFA 3MHZA 3IMNA 4ZZ8A 5BNNC 5CYYA 4FSJA 2DUOA 3HD8B 1PZ7A 3J7LA 3UGHA 5I8TA 5IK4A 2J22A 5FZ0A 4Y1ZA 4XUOA 2XJPA 5CIRA 2J1TA 2X05A 3VBFB 4AFMA 4DNYA 3ZFEC 1OUXA 5L7OB 4O65A 2CWSA 4NHYA 1WW4A 4ES9A 4QHZA 4GXLA 3VV1A 5ISLA 4IV3A 1AR83 4XBLA 5LA0A 2DBIA 2ZOEB 4NHLA 2IUWA 4GKYA 5FLJA 4IEZA 4PBPA 1PHMA 2YDEA 1UNBA 1S0BA 3WSOA 4CEYC 5LA2A 4OQ9A 2QVSB 1JZ8A 4NHKA 2E51A 2CV6A 1R082 1HN1A 4FVVA 3R4DB 5CFCA 4I09A 4ZPIA 1O3RA 1RUE1 1R093 2GALA 3UKVA 2VVFA 1JUIA 3J9SA 4QGMA 2PHXA 3J7NA 1HQLA 2CDOA 2QFEA 1US3A 1W0NA 4Y4RA 4NRMA 3SISA 3POJA 2RMU3 3J8F1 1UPSA 1GQHA 2XPJA 1UX7A 2VXJA 4ORFA 5FPBA 3RJRA 5IFPA 3A23A 1DLCA 1H2NA 1PGW2 2XGXA 3HNBM 4JX0A 3GALA 2IXKA 4W50A 3AFGA 4RS5A 4FP2A 4FAGA 5FBZA 2R49A 5T5PA 2OZJA 1O8SA 2GNMA 1RYYA 3KT1A 2Z5WA 1REEA 4QKNA 2WL1A 4YW1A 2P3KA 1DP0A 1H1AA 1O4TA 5A7QA 2RJKA 4HPKB 3GGLA 4PHZA 3LA2A 2FBEA 2JE7A 1AR82 2DTWA 1SPPA 4RR3C 2AREA 3VD9A 2PAMA 4XFGA 3VD3A 1H8TC 5JWPA 3JD71 4JCKA 2XQRA 1D4M1 3GJAA 3UJQA 1ENRA 1MS5A 2W39A 3AMMA 3ZYIB 5AFBA 2TBVA 4MUVA 3HN3A 2WDBA 4Q4X3 2DVFA 3JU9A 4NPRA 1C3HA 4UFHA 4FO9A 2FDGA 2VNRA 2QKDA 4CP9B 2Y34A 4GB32 1LENA 3H1WA 4OHXA 5FYTA 1QJY3 5F1RA 3ABZA 1HRV2 2E53A 1QJFA 3C2UA 4QM9A 2WO1A 3U1XA 1OURA 1CAWB 1CAXA 1GNYA 3IAPA 4LR4A 1KGYA 5FIXA 4L92A 5DMYA 1GQPA 1LHOA 1O4YA 2VAUA 5KWRA 1YEWA 3I2KA 3RSJA 5EJZB 5AC93 4OI0A 1SBFA 3AMPA 5KXBA 2IXLA 1OOPB 3AYAA 3CZJA 1TNRA 2TEPA 2FMDA 5FZOB 1M4WA 1PM4A 1PVC3 1K5JA 2JE8A 1YO8A 2QCSB 2XG3A 3OJBA 4OMDA 3WHTA 3H0OA 1GP5A 5A7WB 2WZR2 3MLJA 3ACFA 3VZKA 3Q8EA 2C6SA 4QQ2A 4NPLA 3SXWA 1UAIA 4YW6A 4MV2A 1G9CA 4FOVA 2WQ8A 4S2DA 5A7SA 1ALYA 1UMHA 5B2GB 1OH3A 5A3LA 5A6ZA 4P00B 2NP0A 5JR2A 4GAZA 4BMEA 4ET7A 1YHFA 3ON7A 3ZXJA 3MEPA 1BEV2 5FYMA 3VHPA 1MR5A 1RXFA 2W95A 5C4WA 2Q8OA 4OI1A 4XF1A 2V72A 4DS0A 3TEZA 4JKLA 1OOPC 4XHBA 4OHZA 4GKXA 3RZZA 1SCRA 3OY8B 2RV9A 1B35B 2VOKA 3I3EA 1RL3A 4LBKA 3LIGA 1XSRA 5T52A 1SFYA 1SLLA 1I6XA 1LTEA 1IQAA 2ZGMA 2RS12 3HN1A 2OA2A 2ZTNA 1W9FA 2WR9A 2D6KA 5FKBA 3VZLA 3O0WA 4DRVA 3ETPA 1DYPA 1COV1 4IV3C 5FV3A 3SKVA 2FMYA 3DN7A 4QU1A 2VMEA 1X82A 2YXSA 1E5SA 1W0PA 2VGDA 3FX3A 3O12A 4OUMA 2CYFA 1I1EA 1C57A 2RDRA 1GU3A 2JDMA 1F5JA 1DGRA 1NZIA 2HWF3 4CRQA 5J96B 1MACA 1R083 3HBZA 2JECA 2ZGKA 4B4QA 5BY5A 3N9MA 1JYXA 1W90A 4R52A 1W6OA 4WVMB 4IE5A 1LHWA 1XB9A 4BIFA 4QX5A 1BQPA 3ES1A 1V6OA 1C8M3 4F83A 4Q4X2 2WNUC 2I07B 5F6KA 4MOAA 1C8NA 3ZKYA 1SCSA 1UZYA 3PHMA 1VALA 2HWC1 3IDEA 4DIQA 5FY4A 5ABJB 1C5HA 1ZRCA 1LECA 2WNVA 1XNCA 4XZPA 4QX7A 1C8M1 1X50A 3B3QE 4GQ7A 4OZXA 1W8FA 3FLTA 3H1YA 4XDOA 1N3PA 1AL21 2J1EA 4CDQA 1C4RA 2DVDA 2ZBJA 5DABA 1Z0HA 5D8AC 2BYVE 5CZKA 4B4RA 4DINB 4L8QA 2E6VA 1ZZ8A 4WBBA 2A75A 4M4RA 1V6LA 4QHOA 1L7RA 4XBQA 1AZDA 3B94A 1FOD1 1OT5A 2C4XA 4PJYA 2JG9B 4AAPA 3PURA 4N9IA 3QCWA 3WP6A 1U5XA 1PK6A 4XE9A 5CA6A 4E8DA 1KFUL 1QJU1 3PVNA 5F2WA 4XFFA 4I2OA 1T6GC 3C7OA 3M3CA 4AI9A 2YMZA 3HR9A 5C3PA 3S57A 4EN6B 1RB8G 2G4IA 2OPKA 4ISRA 3GHNA 4KBZA 5GALA 2J1AA 1ZRDA 5JZGA 4JV4A 1AL0G 3Q9OA 5FRAA 2RE9A 3HOBA 3MLLA 3NVCA 3BUCA 4FPHA 1UCXA 1DDLA 1W39A 2X5IC 4OCTA 2Q5TA 5IVYA 4CEYB 3CO2A 4N43B 3FLPA 1AYN2 1YQ5A 2JG9A 3A0NA 2W92A 3FL7A 1UU4A 4NAOA 3BKZA 2XWJB 1YFUA 2P37A 1OLME 1W8WA 2JDHA 5E16A 1O7FA 5LK7B 4ONUA 4KU8A 3MICA 5IVEA 4URAA 4NMIA 1VBD2 4MSVA 3L9JT 4Y5TA 1GBGA 5H9QA 1W28A 3DGTA 4FTSA 1KS4A 4AEDC 4E2SA 2EXJA 4B4PA 1RUH2 2HBUA 2Q0AA 3DPRC 1LOEA 2ZCWA 1J1LA 3WUDA 1JI6A 2JKXA 4JGZA 1MVEA 1E5HA 5DAPA 4A4AA 4CUCA 3VN4A 4ZZ5A 1S1AA 5CISA 1H1IA 4MXWB 4LBQA 1RUI2 5EPAA 3ZFGA 4CCOA 1IKQA 4C0BA 4DEQA 2QQMA 2BBVA 1EPWA 3H8OA 5DDJ2 1MQTA 1ND2B 2CDPA 5JVVA 1OOPA 2WSUA 3BYWA 4FPFA 5T54A 4AVTA 4XC9A 4AGRA 1LOFC 2F4LA 1RUH3 4LKFA 2DYCA 2V09A 2PAKA 2Y0OA 4XACA 5LY1A 1XE8A 3FWEA 3VKOA 4QU2A 1H9WA 2J1VA 2MNGA 2PA7A 2VECA 3LEIA 4OUEA 1NE6A 5EJ3A 2OVUA 1SQ4A 4Z8BA 5E1RA 1H4GA 1OVSA 3P1IA 4Q27A 1Q8OA 1RUI1 1DBNA 2B4KA 4RHV2 3KF3A 3POIA 2VD7A 1S0GA 2W3JA 4YG0A 1RUJ2 1AL23 1UY0A 1E5RA 5CBLA 2DVAA 1W2TA 3KZ4C 5LBCA 3VBOC 2E26A 4HKOA 1XNDA 2HWB3 2O8QA 1K12A 1YI7A 4HKLA 5AVAA 1VBB1 4Q4V1 3FC0A 2YYOA 2HH9A 4XF4A 3HEIA 4JQRA 2WN2A 3UGGA 1YIFA 3OEAA 2NN8A 3NKTA 3TYJA 3W5NA 1EY2A 1FMD2 2QQIA 3N3HA 3KQRA 5FY9A 5J36A 4WM8A 5EWSA 4KL1A 1YI9A 4YM1A 3ZPYA 2NMOA 4AHZA 1UIKA 4P9GA 5F3IA 1JZ7A 3U07A 1ZM1A 4I0WB 1KQRA 2D44A 2W46A 2Y6HA 2BDRA 1WMXA 4MXWA 3AZYA 2R32A 4QX0A 5L9VA 1O3TA 1HRI2 1XXNA 1I5ZA 4OYUA 3T08A 4FCAA 4IE0A 2GAUA 2HWE2 4CXYA 1LU1A 1ND3C 3GYDA 1H8TA 1MS0A 2C9KA 5BNNB 2A73B 3GCXA 4FP3A 5FO8B 2VTFA 2WIIB 1PO13 4Y22A 1BMV2 2RS11 1GFF2 1UZVA 3NL1A 4SBVA 2LUWA 2HKXA 1EAH3 5GM0A 1W2AX 3I2OA 3D3AA 4JGYC 4IEWA 4OULA 1YUDA 2XBO1 3IBMA 4LBLA 5LK5A 3SKJE 2UURA 1VJ2A 3PTYA 4RFT0 3VBUC 1WMDA 4C8DA 2XL9A 3E5UA 4NIDA 4XTMA 3T4HB 4CDWC 2FZ2A 1ZVFA 3GNEA 1RMU1 3TBDA 4YGCA 1E57A 1BKZA 1RXGA 4ASKA 1Q8SA 3ACHA 4P5HA 1R1A2 3M2MA 1UMZA 3LD8A 4XPVA 4BHPA 4EYUA 2W5FA 1O6UA 4XYXA 4F7ZA 1QNYA 2VUAA 3ZN4A 1VRH3 1ZBA1 1AJKA 2VBPA 4QB2A 3VKLA 1A78A 2ZS6B 5FP8A 4CCEA 2E9QA 3AJZA 4Q4Y3 1Y9GA 1QGLA 5FZIA 2W52A 1OQEA 1I3HA 4OMCA 3MFCA 1X7NA 4ZXEA 4X8NA 3ZX7A 1H2KA 1TNFA 4S2FA 1ZBA3 4NWWA 1JZ6A 4COVA 2PQSA 4MGQA 2VQ0A 4KGQA 1V6NA 1AR72 2W08A 5D21A 5EHDA 4GIQA 1Q8PA 4LA2A 4WVVA 5K0UC 4QQLA 4CCKA 4MH0E 4C91A 3DCQA 1SMVA 3GCWA 5BNPC 3ES4A 3K4DA 2ADEA 3LDKA 4L9BA 3PIGA 2LRPA 1F2NA 5L73A 2DU0A 2RG4A 1OD5A 2RR11 3IIIA 5JIUA 1FV2A 4MZUA 2WO7A 1N1VA 4BXSV 2A6YA 3NNGA 1KFXL 4CEWB 1BEV3 3AKQA 3NSTA 5C8CA 3BOWA 2VC9A 1JS9A 5AVPA 4QX1A 5FPZA 3JB4C 4FPKA 5DAXA 1CZVA 1UYPA 2WQZC 2D5HA 2WS91 5H9SA 3ZYGA 4M3CB 4CE8A 4BOWA 2RDNA 4NHMA 1RJ8A 2JG9C 2XONA 1GP6A 1J83A 5G04L 3V64A 4I0AA 4COZA 4O61A 3SH4A 4J25A 3PJQA 1G86A 3WDVA 3MW4A 3KT7A 2R1BA 4E2QA 4CEWC 3TN92 2ZMNA 1YXWA 4CDUA 4V2WA 1XQNA 3CF6E 3INAA 2UY9A 4RQPA 2JWPA 2ZX3A 3RYKA 1FT9A 3PVBB 3WQ7A 4F8AA 1XYNA 2B46X 4IGPA 4QQPA 5LY2A 1QMJA 3RG0A 2VZPA 1OA4A 4QPYA 2R072 3SCFA 1YQCA 2YC4A 4HONA 1K5MA 2D97A 4PI2A 5JPNB 3JZVA 1O4ZA 2KA3A 1CJPA 1JU4A 1EAH1 1ONAA 3OGJA 1UXXX 1NCRC 4BU2A 3M1HA 1S4CA 5FMDA 4IL7A 1A8DA 5HCAA 4EE2A 3N9LA 5EFUA 3RYRA 5LRSA 3WNLA 4A3XA 4LEJA 4AK3A 1ZRRA 1GP4A 4QD2A 2D5FA 3RRDA 4RN5A 1GYKA 1JODA 2ZGPA 1X33A 1CAUA 1RMU3 3RDIA 3WX5A 4BISA 5CKNA 4IETA 4BQ3A 5JZGB 4BQ5A 5CG9A 4XQ4A 4DB5A 5C3OA 3CLPA 2V4AA 2BRTA 2BQPA 2XJTA 3IPVB 1UL9A 4AQTA 3RZKA 5SV5A 4Q0SA 1RIRA 3H9AA 2E33A 3JCIA 5IK8A 1DYOA 4XZUG 5GLTA 2UYAA 4WVZA 4YYOA 2JKBA 1EAH2 5FZMA 3BU0A 2JDAA 2VNGA 2HWD1 4LBMA 4Q5OA 5EV7A 4LHLA 4AVBA 2VVDA 1V6MA 5AC91 4ZU4A 2PAEA 3EYPA 2NMNA 4YFZA 4I3PA 4K3UA 3MV01 4UT5A 3SEEA 3WR0A 1G9AA 1HRI3 2GZWA 2A3WA 1NQDA 4YRDA 2R071 1IKPA 2EXIA 1ENXA 1UN1A 3DYOA 4AQSA 1GZ9A 4IE4A 3VBHC 4BQYA 3FFQA 3LDRA 2CNAA 2GMPA 2KD7A 2D7FA 1QJX2 5DQ0A 1A34A 3AXEA 3S0MA 5DUWA 4YZ5A 1BCXA 1UWWA 2Y6FA 3HVDA 2Y64A 4CU8A 1D0HA 2J1SA 3RWNA 1TME3 4PT6A 4ZHNA 1GQGA 4QQHA 2D3PA 1DYKA 4QDSA 4COWA 5AFEA 2ZGRA 4C1XA 3VBOB 3RZJA 3RYPA 5JAXA 4LKSA 2WJSA 3GJBA 4LITA 1W9WA 4DOUA 1OMIA 2XUEA 3TEWA 4Q8KA 4QDQA 4Y1XA 3BPSA 4XETA 5ABJC 3VBUA 1CAWA 1CAXB 3P3PA 1SLIA 3IKWA 3OYWB 5KC5A 3LEGA 3RZMA 1KJRA 3MPPG 4BK4A 1BHGA 5FREA 1RUG3 4GWIA 4IEOA 1AX0A 1MEC1 3RVHA 1C8M2 3ENRA 5C71A 4PIXA 2YGMA 4JKMA 1SG3A 3O1OA 1LGNA 3VBSA 1UYXA 3RZGA 3MV11 4M3CA 1HIXA 5K4LA 4WM7B 2JJ6A 4QX3A 4FTEA 1WCSA 2WFF2 2WWJA 5CB7A 3OYWA 4WM8C 2LALA 2RMU2 4R4ZA 3O1MA 2W9XA 4JAAA 3BN6A 1FOD2 1CAUB 4D94A 1N3OA 3VD4A 3MW2A 2AUYA 4R9DA 4W6WA 5HXVA 3V56A 4GMP1 3GBFA 5DG1A 4CSWA 4AR2A 4DQAA 3N4MA 2WLQA 3AK0A 3C8XA 4AOCA 3ACLA 2VMGA 1W6QA 2E32A 4YM0A 2ZKLA 3ZXEA 3B9IA 4LBJA 5E89A 5CEHA 3JBG3 5FTTC 4UF0A 1QKQA 3GBWA 5BPXA 3USSA 4OHVA 1Z78A 4XJWA 3DYMA 1HJFA 4PIZA 1VB2A 5D1IA 2WLPA 3T0AA 3KLSA 3K77A 4PDWA 2O8OA 1P8JA 2YPJA 2GDFA 4LBNA 3WY6A 4CPBA 1YFYA 1GOGA 3IDAA 2QUOA 5LEKA 3EHKA 3T1MA 1QXPA 3T3YA 1QH6A 3JBG1 4MGYE 2HWD2 1U0AA 2IZWA 4RR3A 5CKMA 3S7EA 5GLUA 4RGGA 3SQOA 2QQNA 4Z1VA 1CWPA 2WA3A 4IEVA 4Q29A 1VBC3 4YGBA 4LHNA 1ZBE2 5CNAA 5K0UB 1BK1A 4B29A 1CPNA 1TMF1 3ZIXA 1XYPA 2CAVA 1F15A 2VJXA 1HRI1 3DXTA 3AZVA 2UWAA 2ZZJA 3CQOA 2OQ7A 4D6QA 5I0SA 4L99A 4TLGA 3TN93 4M00A 4RL7A 2PFWA 3KF5A 4Z07A 4H7MA 1ULPA 1GV9A 2ZHKA 5M0TA 4NRPA 1SDWA 2QE3A 4YVWB 1ENSA 3ZSJA 2V4VA 4JGZC 2AEYA 2WINB 4ZU7A 3FMGA 2Q1MA 1AR93 3MIDA 1RHI2 3C3VA 4LNVA 4A6SA 4BXFA 3DPRA 1LNSA 3LGRA 4Y1YA 5CFCC 5FUNA 2PLV2 4EWAA 2LTNA 3MLKA 5LA1A 5F37A 5FYCA 3E5QA 3ZFEA 3ZMNA 4BB3A 3VDBA 4DFSA 1WUVA 3LOBA 4HSJA 4LOTA 1WLCA 2B39A 2RS33 2JXAA 3C7EA 4HLTA 1UZZA 3ZFGC 1AR91 3WNOA 3JQXA 4HVQA 4OQ8A 4YW4A 3BPZA 3SHRA 2WYFA 1GOHA 2FDKA 3MGUA 4WVMA 1AYN1 5JI7A 1ZZCA 2HWF1 1WCKA 2BFUL 2VXRA 5EYXA 5CFDC 5FY8A 4AW7A 1MPXA 2VCAA 1PZ9A 3D82A 3ILRA 3SNMA 5KR7A 1GZCA 4AVCA 4QPGA 3RS6A 2Y38A 1QEXA 1QNWA 5HPOA 4P9WA 5FZGA 1CJDA 3DKQA 4CP2A 1JN2P 2GU9A 4IQPA 5E88A 1VR3A 4UFIA 4LIVA 4CZSA 4DY5A 3H1MA 5FY0A 1ST8A 4OVEA 5T5JA 3WG1A 5F3CA 4P9IA 5FYZA 4FOWA 1H6XA 4YG6A 1RUH1 3A4UA 2KM2A 3GBGA 2HWE1 2ADDA 1Z7S2 4LPLA 2JD4A 2XWBB 1UZWA 4AI3A 4F3JA 3ITQA 2MHFA 2K0GA 1REDA 1JYNA 2WN3A 1JZ5A 1ASJ1 1MS3A 2GP5A 1OF4A 2ZA9A 4MXVA 4UOJA 1D2SA 2C5DA 4Q4W3 2GH8A 4Y3OA 5JZGC 1ZZ7A 3IPVA 4HK9A 3LZZA 3PVEA 1XSQA 2GH2A 3W59A 2JG8A 5JXGA 1AX1A 1CONA 3KGLA 2VY0A 2ZKNA 4LK7A 2BNOA 4JDOA 1IOAA 1AR92 4MLOA 4P9JA 4PLMA 3S6PA 2H6CA 4ATFA 2JG8C 2RHPA 4HVOA 4YVSC 5FJKA 2YHJA 4QQOA 4E4SA 4V1PA 1G7YA 1NCRA 3N9OA 2QQPA 4LK6A 1W8TA 3ZPOA 3U10A 2WZEA 2FQPA 1K5MC 5C70A 1PGSA 2ZACA 5FKCA 3HPNA 5C6CA 1HXS1 1SDDB 2QQUA 1YLLA 1DFQA 3WCRA 1E5IA 1ULEA 1XNAA 5KHJA 1OPOA 2PHFA 2X29A 4BM8A 5IK7A 2F4PA 3AZXA 4E8CA 3MIHA 3U0ZA 1GOFA 3DYPA 3LKJA 2HEVF 2RS52 2X8KA 1R1A1 4XJZA 1JOJA 1VMHA 1DG6A 3K3NA 1Z7S1 2CHHA 2R061 2W1QA 3LEMA 4YVSB 4AVVA 1RGSA 4FI9A 4QWNA 1W6MA 2RM21 4J1WA 4HANA 2L9LA 1IHMA 2WNUA 1ULGA 3MF6A 3ZDSA 3OUHA 4YARA 4CPBD 3ZYRA 5JMCA 3RI8A 1JYCA 1A6CA 2A6ZA 3PNAA 4IGQA 1HXS2 2CTVA 1X36A 3LE0A 4AF9A 4K9SA 4S2GA 5FPUA 2FZ1A 4AGVA 3MF9A 3B69A 4LTAA 2AZ5A 2W1UA 2VZ1A 3IIAA 2RM23 3P6BA 1UKGA 3AMHA 4FPJA 3NQHA 3QH6A 3BTAA 2HLEA 2BVBA 3ZDVA 1UO9A 2ARCA 2EIGA 1S2EA 2PELA 2RS31 2BERA 4NUBA 5BXXA 4R9CA 3WEZA 1XE7A 3PUHA 1HDKA 1RJ7A 5JSPA 1C28A 4QPGB 4DO0A 3O14A 2VBDA 4ITCA 1W9TA 1OC1A 4YVWA 1QWRA 1LOAA 2GNDA 2RJ2A 2DCZA 1XPWA 2YZ4A 2C24A 4D8MA 1TZOA 3BB6A 3KV4A 2GC0A 1U5YA 3M3OA 5ANQA 1RUC1 5H9PA 1N47A 4AI0A 2DDUA 5FY1A 1BEV1 2DBNA 1MS8A 3E5XA 2BGCA 1XNKA 3OGGA 1JHNA 3AKPA 3F95A 1EV13 1OD3A 1WGPA 2X10A 3LDBA 3NV4A 1Q8QA 1XNBA 1NCQC 2YU2A 4TXWA 2VVEA 1NYWA 4D7YA 3IZOA 1UMIA 2FCVA 3H42B 1PGL1 1CIYA 5FWJA 1RUI3 3ZN6B 4HOOA 3TAYA 4KH9A 3BTXA 3R05A 2W94A 4Q4Y2 4MYEA 1AR73 1S0JA 4K1ZA 4RGAA 4FBFA 4Z82A 3SMHA 3RNSA 3THPA 1NOVA 5LEJA 4UW5A 2E7QA 3CZUA 1WWYA 1FPN3 3CMGA 2C26A 1QQP1 3VUOA 1DGRN 2CY6A 4LO6B 5FBJA 2ES3A 5A6XA 5IVJA 1AR71 1MZ6A 1VP6A 2PYTA 1LODA 4XOGA 4K20A 2JX9A 3SITA 1QJY2 1RVF1 1NUKA 5CAZA 2BBAA 1UKRA 2JD9A 4AEDB 1FNYA 3ETQA 1G9FA 1GMMA 1PIV2 4XURA 2YBPA 3IDBB 1C5IA 2D3SA 3ASIA 2JB4A 1V70A 1JZ3A 3WT3A 3BI3A 3BU7A 2ARBA 1CAVB 1BK0A 3O0XA 4YW7A 3VBFA 5J3UA 1URXA 5LCWL 4MX3A 2IWGB 1RVF3 4NROA 1JU3A 1SBDA 1L7LA 3N35A 2OXBA 2BZDA 4E4ZA 2BW8A 4W6XA 3I2DA 1IS4A 3C7FA 5CG8A 1FV3A 1JUHA 2W0XA 2YBKA 3NJXA 4JDMA 3ZYBA 2HBTA 1EUUA 4FT8A 1H6YA 4RS5C 3T2PA 3C7GA 5IAVA 5E6HA 3E1F1 3U4XA 3AYDA 5FP9A 2XVGA 5HV0A 1TEIA 2P34A 4NAMA 4Q4X1 3Q8CA 2PMWB 3ZMOA 3I49A 1NY71 3AB0A 1OFSA 1WD4A 3GF6A 4PCRA 2FCTA 2QJVA 5FMOL 4CDXC 3VD7A 2AR6A 3DUIA 3M3IA 1QU0A 2QZ2A 1SLCA 3N36A 2XL7A 1ZRFA 4I3GA 3KV9A 3AMNA 2VZOA 2A6VA 1U12A 1RUJ3 4UFKA 2VOXA 4AZZA 4B1MA 2YU1A 3D8CA 2D3RA 5DAQA 4JKKA 2ZABA 4QPIA 4L2NA 4D0QA 2R041 2XOMA 5CVRA 2YFUA 5I0DA 4KGGA 4CEYA 1JW6A 3MIFA 1S0FA 4O7XA 2NYYA 4GWNA 1QOOA 4FOQA 2DCKA 1NX9A 2VH9A 2MEV2 1W3XA 3KQ4B 4NWVA 3VBHA 2HWD3 1LOFA 1RUC3 5F9TA 3PMEA 1CQ9A 1RHI3 2X53S 1DZTA 1W8ZA 3LF7A 2B7YA 2J1RA 3SLIA 4CUAA 5C7GA 4AI2A 1O3SA 4QKFA 3AVRA 1QIQA 5F8PA 4W65A 1NKGA 2GN7A 4R8HA 1PK6B 5FMCA 5FK8A 3ZIWA 1XYOA 3T0DA 3KWVA 4NOTA 3S7IA 1H30A 3ZSMA 4LIUA 3H3UA 1GR3A 4XF0A 3BTYA 1LKNA 4B8EA 4AVSA 5A7WA 3H8RA 3U11A 3ZO0B 2RMU1 3CJIA 5J7MA 1QH7A 4G3YC 5T3NA 3ROUA 3ZM8A 2PQQA 2YG0A 2D93A 4NIIA 2JB8A 3RMYA 4E4DX 1JOBA 1MEC3 4BPZA 4YZ1A 1X9TA 1N1SA 4FFIA 4XUPA 1Y7BA 2JEMA 1UZ0A 1V6KA 3KCYA 4MADA 3T4VA 2NZ9A 1US2A 2XUMA 1RVF2 1ULOA 2CAUA 4IEUA 1SFPA 4KG8A 1PZ8A 4AEJA 4HL0A 3FLRA 2YFZA 4NRQA 3K2OA 1IS5A 5T55A 4B7KA 1AR62 5GJ6A 1J3RA 1Y43B 2MEV1 5H9RA 5G05L 2OUJA 1REFA 2B8MA 2V73A 5DAVA 5LWBA 1W2UA 1STMA 2ZJCA 2QZ3A 2DWRA 2BUKA 2VU9A 5HCBA 2WWSA 3MIGA 3OBRA 5KHHA 4QHBA 1AX2A 3THTA 3LAGA 3VKMA 4MGKE 1Q5OA 2ZAAA 1CPMA 5A1AA 5JI9A 2Y0IA 2Y60A 1HKDA 2P3IA 5BYNA 4Y5SA 2PHWA 4DUXA 3J4UH 2WNVC 4IESA 5T5OA 4KI5M 1QJU3 4PQ9A 2YBSA 5EP9A 3TWIA 4QAWA 2JENA 1TME2 4OI2A 4HN0A 2R16A 3PUSA 3VBRA 4CVUA 1GZWA 2JIJA 2ATFA 3FBMA 3Q8AA 5EQUA 1WLTA 1VIWB 1FXZA 3KMHA 1F4AA 2YB7A 4Q8LA 1UYYA 3LB9A 4LQRA 4RQPC 4LKEA 3RZHA 1NG0A 2C9AA 4D3WA 3V0BA 3AXDA 2PLV1 3WDTA 3R6SA 4MGTA 3GZUC 4GULA 1RUJ1 3R0RA 4CUBA 4K6BA 4OI4A 4ZS3A 3WOGA 1YQ2A 2WNVB 1W9SA 2OX0A 5IWFA 4AYUA 4CEWA 2O0OA 5FZ3A 5A3UA 5A3TA 5FO7B 1G9DA 4SLIA 3QACA 4LMFA 5BNOB 3PUAA 3E97A 5CFDA 4E4HA 3AP4A 3S30A 2PTMA 2DF7A 1WD3A 2VW1A 3SC7X 3I7DA 4BQ4A 2W87A 1PNFA 1KITA 2WT1A 3B02A 3EQEA 5J48A 1PIV3 1OI6A 3OBTA 3ELNA 1SACA 4XVHA 3VDCA 5FOJB 1S55A 3NNFA 1FATA 3I2JA 1VBE1 1VLNA 4ZY9A 2LW8A 1H1MA 5EIYB 2R062 3FHQA 4P9LA 1TME1 5FPXA 1BJQA 5A33A 5A32A 4DPNA 1AF9A 1ZBE3 1CR7A 2GP3A 2YUEA 4XUTA 5FY5A 4YWAA 4CYDA 1NZCA 4LBQB 4MO3M 4KWJA 1BVP1 5JOYA 2Q4SA 4RHV1 4TLFA 4E9KA 4HETA 5C9AB 5KXEA 5FLIA 3NJZA 3OPTA 1WCUA 4A7ZA 3OF1A 1YIPA 3LPGA 5J1XA 5FPAA 1BBT3 2IVIB 3POFA 2HJIA 4XILA 2IXCA 4P9XA 1UY1A 4U2AA 1HQNA 4UFMA 4N8MA
chains in the Genus database with same CATH topology
3HQUA 2RDRA 4XACA 3DKQA 5ERLA 2G19A 5DAXA 4IW3A 2Y33A 4XCAA 2FCUA 2RDNA 4NHMA 3ITQA 4NHXA 4UWDA 5LBEA 3NNJA 4J25A 5DAVA 3KT1A 3KT7A 5LBCA 4BQWA 5IAXA 5C5TA 3HQRA 5IATA 2G1MA 3OUIA 4Y5SA 3GJAA 4ZONA 5EP9A 2A1XA 4JZRA 2JIJA 5DAWA 5EQUA 5L9VA 2HBTA 3OBZA 2Y34A 3PL0A 5L9RA 5IAVA 3OUJA 3KT4A 5HV0A 5LBFA 5LA9A 4KBZA 2FCTA 5A3UA 2V4AA 5LB6A 3OUHA 2OPWA 5C5UA 4NAOA 2RDSA 4Q5OA 5DAQA 3BVCA 3NNLA 5LASA 4NMIA 4XAAA 5M0TA 3NNFA 4Y5TA 4BQXA 2RDQA 4NHYA 3GZEA 4XABA 3W20A 5LBBA 2HBUA 4MHRA 5HV4A 3EMRA 4BQYA 3NNMA 4NHLA 5L9BA 5DAPA 2JIGA 3W21A 5EPAA 3MGUA 4NHKA 4XCBA 2RG4A 3GJBA 4ZPIA 4XC9A 5LATA 2FCVA 4MHUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HQU A;  2RDR A;  4XAC A;  3DKQ A;  5ERL A;  2G19 A;  5DAX A;  4IW3 A;  2Y33 A;  4XCA A;  2FCU A;  2RDN A;  4NHM A;  3ITQ A;  4NHX A;  4UWD A;  5LBE A;  3NNJ A;  4J25 A;  5DAV A;  3KT1 A;  3KT7 A;  5LBC A;  4BQW A;  5IAX A;  5C5T A;  3HQR A;  5IAT A;  2G1M A;  3OUI A;  4Y5S A;  3GJA A;  4ZON A;  5EP9 A;  2A1X A;  4JZR A;  2JIJ A;  5DAW A;  5EQU A;  5L9V A;  2HBT A;  3OBZ A;  2Y34 A;  3PL0 A;  5L9R A;  5IAV A;  3OUJ A;  3KT4 A;  5HV0 A;  5LBF A;  5LA9 A;  4KBZ A;  2FCT A;  5A3U A;  2V4A A;  5LB6 A;  3OUH A;  2OPW A;  5C5U A;  4NAO A;  2RDS A;  4Q5O A;  5DAQ A;  3BVC A;  3NNL A;  5LAS A;  4NMI A;  4XAA A;  5M0T A;  3NNF A;  4Y5T A;  4BQX A;  2RDQ A;  4NHY A;  3GZE A;  4XAB A;  3W20 A;  5LBB A;  2HBU A;  4MHR A;  5HV4 A;  3EMR A;  4BQY A;  3NNM A;  4NHL A;  5L9B A;  5DAP A;  2JIG A;  3W21 A;  5EPA A;  3MGU A;  4NHK A;  4XCB A;  2RG4 A;  3GJB A;  4ZPI A;  4XC9 A;  5LAT A;  2FCV A;  4MHU A; 
#chains in the Genus database with same CATH topology
 2VG9 A;  1W6P A;  5F6L B;  5JXH A;  3ZXL A;  2C0Z A;  3FHA A;  2A6X A;  2DFB A;  2AAC A;  1RC6 A;  2OQ6 A;  1D4V B;  4HSL A;  3HJR A;  4CDX A;  2OUH A;  3ZVX A;  5HXM A;  4PQQ A;  5I8S A;  4HPK A;  3IB3 A;  4L97 A;  1GSL A;  2ZHL A;  4XCA A;  5E8A A;  4LUM A;  1JBC A;  2HWC 3;  3NW4 A;  4YG3 A;  2G9G A;  1VAK A;  3B7M A;  5J98 B;  2JDZ A;  1TVG A;  3ZR6 A;  1VBE 2;  2YV8 A;  5FZD A;  2WZR 3;  2ZML A;  2VL4 A;  2WSV A;  2VPV A;  4HVR A;  3NNJ A;  4G4F A;  2Y6K A;  3THD A;  5IVB A;  5JSO A;  1QDC A;  1WCQ A;  5IAX A;  1GIC A;  4GD4 A;  4NJ4 A;  3ZXA C;  4J1X A;  4CDX B;  5FXZ A;  3N9Q A;  2YRO A;  3VBF C;  2G1M A;  5L36 A;  5FYI A;  1HXS 3;  4NIH A;  3OUI A;  3H3L A;  1ENQ A;  5DUX A;  4YW3 A;  1UD1 A;  2WO2 A;  3KVB A;  5HCF A;  3VBO A;  5AC9 2;  1OF3 A;  1VBB 3;  3AKR A;  4Q4V 3;  3RWK X;  1POV 1;  2D6P A;  3I3B A;  3SH3 A;  2EVX A;  3I3M A;  3P3N A;  1OLM A;  5EZW A;  3WF2 A;  3MI8 A;  3ZYP A;  1HB3 A;  3VB9 A;  1FAY A;  3K4A A;  2ZGU A;  5FMB A;  3PL0 A;  4WZF A;  1KD7 A;  1CZS A;  3OUJ A;  3PDQ A;  1ZBA 2;  5F2S A;  2W1W A;  1T6B X;  2PHL A;  3K4Z A;  4QM8 A;  4XF9 A;  4AFA A;  1OQD A;  3HIF A;  1W0O A;  1ZZ9 A;  3D0S A;  5LBF A;  5JLV A;  2FD8 A;  2ZX2 A;  3O1U A;  4JC1 A;  4NO4 A;  1UOF A;  2B42 B;  2ZGL A;  5A7O A;  1QXR A;  1W8H A;  4K7J A;  4PDW B;  4ARY A;  4PLN A;  4XW3 A;  1V6I A;  5FZC A;  3CJI B;  3VBS C;  1NCQ A;  1VPH A;  4C1W A;  1R1A 3;  2VCC A;  2BWA A;  4FFG A;  4EWE A;  1YC6 1;  4YFW A;  2FHR A;  1JTZ X;  1AXZ A;  5KXC A;  3NNL A;  3ZYH A;  3WNP A;  5EYY A;  3N7J A;  3WNX A;  1BBT 2;  4BQ1 A;  1W8N A;  4IEQ A;  2G9F A;  4P9Y A;  1COV 2;  1QF3 A;  1JYI A;  1NY7 2;  4NE9 A;  3LCP A;  5FYV A;  4CU9 A;  3J7H A;  4B7E A;  3B01 A;  4XAB A;  1OXC A;  2V5Y A;  1W3V A;  4MGZ E;  4XJA A;  5C3R A;  4N53 A;  3EMR A;  5HV4 A;  1TQ5 A;  3M8L A;  1WW6 A;  4XJU A;  1OA2 A;  1KEX A;  1V0A A;  1OFN A;  5BNO C;  2EXH A;  5ACA 1;  4ES8 A;  4OFG A;  2VQU A;  3N7M A;  1FI2 A;  2QQL A;  1VMJ A;  4CTE A;  2CGO A;  3S5Q A;  4DUV A;  1K45 A;  4WVW A;  1KDM A;  1AYM 2;  4LO8 A;  3OG2 A;  2BV4 A;  1PGW 1;  2AH2 A;  4QB6 A;  2RJL A;  4KWU A;  1ND2 C;  5DUV A;  4N53 B;  4YW5 A;  2UY8 A;  4Y5Z 0;  1QQP 2;  1XE0 A;  2ORX A;  2VZQ A;  4HKW A;  2JDK A;  2X5I B;  1EV1 1;  2XQX A;  2WKK A;  2WZR 1;  3L2H A;  4XHX A;  3KS7 A;  5ERL A;  3WNM A;  2RR1 3;  2LRO A;  2RS3 2;  3OGR A;  3OGS A;  1UY3 A;  5L19 A;  3B9C A;  3W58 A;  1HW5 A;  1LED A;  4R4X A;  2HWB 1;  2O1Q A;  2EAK A;  5FK7 A;  5ANN A;  5F5I A;  3ECQ A;  3UGF A;  1CD3 G;  3ZYF A;  1JMU B;  3BOD A;  5JOZ A;  3J8F 3;  4A6O A;  5A3N A;  1RUO A;  1HX6 A;  3ZSE A;  3OEB A;  1UOB A;  3VBR C;  5B4N A;  3NV2 A;  1PX3 A;  1YWK A;  4OUS A;  2ARX A;  3UK9 A;  1RUN A;  4QXB A;  1O5U A;  2PHT A;  2CL2 A;  2WFP A;  3HQR A;  2XJS A;  3AZW A;  2O14 A;  1MS1 A;  4GWM A;  4JHZ A;  1VBA 3;  1EUT A;  2P2K A;  3BGA A;  4TN7 A;  2A3X A;  1OKO A;  1R64 A;  4HBN A;  2F6B A;  4YNI A;  4RA0 A;  4IND A;  4AVA A;  3TOJ A;  3ATG A;  1Q8V A;  2VUJ A;  4BLJ A;  4Z92 B;  4UW3 A;  1PMH X;  4FPO B;  4IUG A;  3AKT A;  4Z2W A;  3DF0 A;  5FZA A;  2RS1 3;  3AC0 A;  4NR1 A;  1VBA 1;  4C90 A;  5D8A A;  2ET7 A;  3E6C C;  1D4M 3;  1EYB A;  4RYD A;  4Q26 A;  1XC6 A;  3HQX A;  2OKX A;  2HWC 2;  4AHY A;  4N43 A;  1QJE A;  4Y1U A;  2TUN A;  5A7N A;  3M3E A;  5IT6 A;  3ACG A;  3V0A A;  3AMQ A;  3T2O A;  1CX4 A;  5A32 B;  4LOR A;  5A33 B;  3KHC A;  1ND3 B;  3N7K A;  4I01 A;  2JDU A;  1ZZB A;  2XJV A;  3O1R A;  1W2O A;  5FZH A;  4EWD A;  2WWU A;  3WG2 A;  4L0P A;  2VUD A;  4LJH A;  2GC2 A;  1JOP A;  4BJ0 A;  3ZFF A;  1O91 A;  1OSG A;  1IS6 A;  2R04 3;  3NKG A;  2QQV A;  4QX8 A;  1OHF A;  4CCM A;  2XJR A;  4QKB A;  5FZE A;  1W05 A;  5BV6 A;  3FE5 A;  2ZX1 A;  4QPI B;  3NO8 A;  4X6Q B;  3VD5 A;  1PM7 A;  3J8F 2;  4CDW B;  3WDU A;  1GZW B;  1OLQ A;  3QD6 A;  3BVC A;  2A6W A;  2D40 A;  4FQZ A;  3VHO A;  5BNQ A;  1ACC A;  1QJU 2;  3AP6 A;  3TEX A;  1UYZ A;  5K0U A;  4CP0 A;  2ORZ A;  2WNU B;  1CGP A;  3NV3 A;  2VQT A;  5J37 A;  1DZQ A;  2EAL A;  2LM3 A;  2XLG A;  2WUH A;  1T2X A;  2E7T A;  1I9R A;  3ALQ A;  1OLR A;  1X8M A;  3JUU A;  2JG8 B;  1GKB A;  2VOW A;  4DY3 A;  4N9H A;  3LFI A;  3OPZ A;  4AFD A;  2XHK A;  3V0B B;  3ST7 A;  3MPB A;  2XLA A;  2D6O X;  3EJK A;  3ZKU A;  4EN7 B;  5JMO A;  3HNM A;  3VZO A;  5CKQ A;  5BNP A;  3OB8 A;  4A44 A;  2R0F A;  3B5L B;  4I0B A;  4GB3 3;  4MET A;  2VUL A;  1Y9Q A;  3JD7 2;  5FYU A;  1RHI 1;  4CA9 A;  2W2I A;  4Y20 A;  1VAV A;  5A7P A;  2C1F A;  2I74 A;  4A3Z A;  4Q1R A;  5BNP B;  3I59 A;  1OH4 A;  4QXH A;  3IWZ A;  3AX4 A;  3NRU A;  1UIJ A;  1YNA A;  1NLQ A;  1S0I A;  1W6M B;  2R0H A;  2WS9 3;  3G7D A;  5CU1 A;  4XQD A;  5FMO S;  1C1F A;  3B00 A;  1DQ0 A;  3VBU B;  2VOT A;  5GLV A;  1WME A;  1FPN 1;  1AUY A;  3HT2 A;  2J42 A;  4Y22 B;  1F4H A;  4AE2 A;  3D4K A;  1COV 3;  4JHT A;  4CCC A;  3MBW A;  1QJX 3;  4GMP 0;  1R09 1;  1RUE 3;  4Y20 B;  4CP9 A;  3I3Q A;  1CIW A;  2JE9 A;  4XIK A;  2DV9 A;  3AJY A;  2WQ4 A;  3ZFF C;  4K40 A;  4NHX A;  1C1L A;  1N3Q A;  3VDA A;  5LBE A;  4IEX A;  4B1L A;  2ZX4 A;  4DXR A;  1R08 1;  2BNM A;  4NIG A;  4CP1 A;  2ZGN A;  1GNH A;  1Y9M A;  4LT5 A;  3OGV A;  1XBF A;  4Q0Q A;  2ERF A;  4BQW A;  3OD0 A;  1BVV A;  2W1S A;  3VKN A;  1O5L A;  1GWM A;  3VZN A;  2K9Z A;  3LQC A;  2MEV 3;  1UOJ A;  3A0K A;  2FDF A;  3KSC A;  4PDW C;  5B4X A;  5DUU A;  4BCU A;  4LXL A;  3O7O A;  2Q1F A;  1F8V A;  4AWD A;  5KC6 A;  1H8T B;  1WMF A;  3M70 A;  4W4Z A;  2HEY F;  1UPI A;  3PIJ A;  1HQW A;  1SFN A;  4M0N A;  2QDN A;  5DDJ 1;  3JB8 A;  3P5B A;  4JZR A;  4IV1 A;  1AR6 3;  4K8F A;  4XBN A;  4H55 A;  2XH6 A;  3AKS A;  4GJZ A;  3JD7 3;  3LA7 A;  4DUW A;  4Z2A A;  4DMI A;  2OZ6 A;  4PLO A;  5FAX A;  4YPJ A;  4AEK A;  1AXK A;  3THC A;  4HMZ A;  1NCR B;  4XMI A;  5FYY A;  1M06 G;  4XUN A;  5D2A A;  1CZT A;  5DDJ 3;  3CNA A;  4ZKT B;  1LEM A;  1TMF 3;  3D6E A;  4E27 A;  3MZH A;  4Q0U A;  2OII A;  2ZGS A;  3TNQ A;  2BU9 A;  4CDU B;  5C3S A;  1YQ6 A;  3H50 A;  1MEC 2;  5FZ1 A;  5F32 A;  2XML A;  3RI9 A;  1V6J A;  2VZU A;  5ABJ A;  5A70 A;  1CVN A;  1NA1 A;  3WW1 A;  1Q3E A;  3NV1 A;  4UYB A;  3AP5 A;  1CX1 A;  4KG0 A;  1VBC 2;  4IDZ A;  1QY4 A;  2ZZQ A;  1VAM A;  2VZV A;  5F3E A;  1J84 A;  5DXD A;  2BWC A;  3URF A;  1O3Q A;  3T30 A;  2WZ8 A;  4I30 A;  5JOW A;  5FPV A;  4LO4 B;  1W8U A;  4H3W A;  1YYN A;  2WS9 2;  3POS A;  4Y4Y A;  4ARX A;  2VMC A;  2Z42 A;  1HRV 1;  2YC0 A;  4A2U A;  3FUO A;  2KXL A;  3MUY 1;  3USU B;  2RR1 2;  1LUL A;  1BYH A;  1UF2 C;  2RDQ A;  1NLS A;  3DPR B;  3FBY A;  3NWK A;  1RUF 3;  1RTV A;  2ZPX A;  4H2A A;  4NN0 A;  3ZR5 A;  5KBF A;  1NLR A;  2VO5 A;  3NNM A;  4YSF A;  1APN A;  1HRV 3;  3WNK A;  3ZXD A;  4EJR A;  1ULC A;  3V0A B;  3AL5 A;  4G9S B;  1YFX A;  4KMQ A;  4N7U A;  4FFH A;  4AEM A;  1ZYB A;  2YGL A;  4M01 A;  5GZE A;  4XXA A;  4UW6 A;  4XFB A;  2UYB A;  1FPN 2;  4BZ4 A;  1V9U 2;  3VBR B;  2UWB A;  5GZF A;  1PO1 2;  1DF0 A;  1I5P A;  1MZF A;  2P17 A;  3F2Z A;  2Z4F A;  1JXN A;  2BOI A;  2HYX A;  1L3J A;  2D6L X;  2LS6 A;  4YW2 A;  3T0B A;  1QJX 1;  4FPY A;  3K75 B;  4IV3 B;  4GJY A;  2ZXQ A;  4LBO A;  1RUD 2;  1VBA 2;  2X5I A;  3X29 B;  1HV1 A;  4HT1 T;  3I97 A;  2H0B A;  2JIC A;  2G9Z A;  2UWC A;  2WBK A;  5DG2 A;  5DPN A;  2YPD A;  2XHN A;  2ZGQ A;  5IK5 A;  1WW5 A;  2WA4 A;  4LUK A;  2VNV A;  4BLI A;  4DXT A;  4J6G A;  5BUV A;  1ZA7 A;  5JDB A;  3WNN A;  2Y33 A;  5IVV A;  3ZYJ B;  4AHX A;  3KGZ A;  2DTY A;  4U36 A;  1IZ3 A;  5IVC A;  4JTO A;  2WYS A;  5IJR A;  3CJX A;  4UWD A;  4COU A;  1AXY A;  3POG A;  1D0G A;  3CBN A;  1KXG A;  2BVV A;  5FOB B;  4PF5 A;  1JH5 A;  1YCI A;  4ISQ A;  4BIO A;  3ZFF B;  1UY2 A;  1WA4 A;  1H2M A;  3GHM A;  4AQ2 A;  3PLQ A;  4FAH A;  5LRR A;  1OA3 A;  2BEO A;  3VHR A;  3WP4 A;  1S0E A;  3GDB A;  3UJO A;  3FFZ A;  5IAT A;  3VBH B;  1LAJ A;  3AP7 A;  1O59 A;  2K2S A;  3MIB A;  4M3C F;  1PGL 2;  3DL3 A;  1PK6 C;  2GME A;  4ZON A;  4RGK A;  3BCW A;  4XTP A;  2RM2 2;  1UX6 A;  2HWF 2;  2PLV 3;  3DXU A;  2Q8C A;  2DCJ A;  5FYS A;  2Z69 A;  5D8A B;  3OD4 A;  3SCG A;  4UF0 B;  1HB2 A;  4NPM A;  3VL9 A;  3KB5 A;  3VDD A;  4CU7 A;  5FQ0 A;  4A41 A;  3WP3 A;  5IYY A;  4P14 A;  3VLB B;  1LOB A;  3KV6 A;  4QT6 A;  1VBC 1;  5LZ6 A;  1PNG A;  1ZX5 A;  2CGP A;  4BMB A;  1D2Q A;  2WT2 A;  3TB0 A;  4BA6 A;  2P6H A;  2SBA A;  4ASL A;  5FZF A;  2ZGO A;  1LHU A;  2AEN A;  3BIE A;  1XNT A;  3DEM A;  3O1T A;  5GZG A;  1DQ6 A;  1UY4 A;  4XFC A;  4CU6 A;  3R4U A;  4ATE A;  1PIV 1;  2DCY A;  3RPQ A;  2GNT A;  3QLQ A;  3PU8 A;  4YZ3 A;  2I45 A;  4KWK A;  4ZU5 A;  1A8M A;  1LOG A;  4HK8 A;  5GZC A;  2OPW A;  2VZR A;  1WW7 A;  2R7E B;  4XEZ A;  2WAA A;  5C5U A;  1VBE 3;  3O0V A;  1G9B A;  2ZEZ A;  3HNY M;  1D7P M;  1KS5 A;  4HFS A;  5TSW A;  2SLI A;  4OHW A;  4WM7 C;  4JVA A;  5A3O A;  4CXW A;  5BNO A;  3BIW E;  3A22 A;  3H7Y A;  2GN3 A;  3OY8 A;  5C33 A;  1ZBE 1;  5C8C C;  1YJL A;  3LA3 A;  1G8W A;  4XAE A;  4BWO A;  1PO2 3;  4KBB A;  1IPS A;  4QPG C;  5F7U A;  5KHG A;  2P5B A;  4WV8 A;  2IFR A;  4AGG A;  1DGL A;  4N53 C;  1W9Y A;  3OOX A;  5T5L A;  3K48 A;  5JOX A;  5K7P A;  5JUV A;  4FPE A;  1J1T A;  3U14 A;  1XJA A;  2Y8K A;  4RD7 A;  3H7J A;  1IPK A;  3WF4 A;  1DGW A;  1KDK A;  5FO9 B;  4CCJ A;  1W06 A;  1WLW A;  1WBL A;  2ZGT A;  5FQ0 B;  3T09 A;  1WZX A;  4AAX A;  2ET1 A;  1DZR A;  2WZP P;  1VE0 A;  5EJ1 B;  3ZOI A;  1DQ5 A;  1FX5 A;  1PMJ X;  1TE1 B;  3APB A;  5A3P A;  4IE6 A;  2HEW F;  5JCT A;  4Q2F A;  2VR4 A;  2WNO A;  3IAQ A;  3TNP B;  3I2I A;  3AYE A;  1ZNP A;  2ZHN A;  5ACA 3;  3T2T A;  1NA1 C;  4PI0 A;  3ZN6 A;  3IM0 A;  3MUZ 1;  4QMA A;  3L2Y A;  2DCT A;  3Q8B A;  3WIN E;  1ASJ 3;  5JSR A;  4IE7 A;  3NJY A;  2XVL A;  2JDP A;  4H14 A;  2BNN A;  3HWJ A;  4XJ8 A;  2DUP A;  3ILF A;  2FCU A;  4KNC A;  4Y26 A;  5FZ8 A;  4NIA A;  2ZX0 A;  2W68 A;  2J1U A;  1IS3 A;  3N9P A;  1TG7 A;  1NE4 A;  4CDQ C;  3KCC A;  1HN0 A;  5IVF A;  1LHN A;  4P08 A;  3PU3 A;  3U78 A;  3AFK A;  4TYS A;  4FTB A;  4HZF A;  5DZE A;  3WG4 A;  4DXS A;  2CWM A;  1LGB A;  2VE1 A;  2Q8D A;  1RIN A;  1NA1 B;  1MS9 A;  3PJY A;  5C5T A;  3KVA A;  4R9B A;  5C4W B;  1QQP 3;  4XUQ A;  1DQ2 A;  1F35 A;  3AL6 A;  2OS2 A;  3S5A A;  5JR7 B;  4LLO A;  2J7M A;  2QTW B;  3ACI A;  5FP3 A;  3A7Q A;  1ODM A;  1POQ A;  2BGO A;  1N1Y A;  2A70 A;  3WLU A;  2P1B A;  4EN8 B;  2QBX A;  4DEV A;  1FYU A;  3LSD A;  1PMI A;  3WF1 A;  4N90 A;  4Q4W 2;  3WCS A;  5KHI A;  4GH4 B;  2BFU S;  1K5M B;  2FDJ A;  5HCH A;  2IFW A;  3M7A A;  1Z7S 3;  4AG4 A;  5CFD B;  2VMD A;  2XBO 3;  2IVJ A;  2WFF 3;  3POB A;  1NT0 A;  5L9R A;  1SEF A;  2ZMK A;  3IMM A;  3N9N A;  3KT4 A;  1SLB A;  5FDB A;  1XRU A;  1V9U 1;  3WD5 A;  1SZB A;  4LA3 A;  1MZ5 A;  1LOC A;  1VB4 A;  5I0U A;  3ZLI A;  3AP9 A;  4YZ4 A;  1JHJ A;  2F17 A;  2XKP A;  1N1T A;  4YM2 A;  2ZAH A;  4CCL A;  3LFM A;  4JGY B;  2EIE A;  4RFR B;  3PTR B;  1ODN A;  3U37 A;  4CXX A;  5LB6 A;  5JXJ A;  2PHU A;  5K8S A;  5A6Y A;  2D98 A;  3I59 B;  5LW9 A;  1HV0 A;  5FZL A;  4PIY A;  1OQ1 A;  1MQT C;  5F5A A;  2CU5 A;  4IV1 B;  4QB1 A;  4UBG A;  2VMF A;  4BH9 A;  3DEC A;  3ILN A;  4H7L A;  2QDR A;  1IG0 A;  2BOJ A;  1ULD A;  5SV8 A;  4C0H A;  4EV0 A;  3O1S A;  1RIT A;  2P3Y A;  4LHK A;  4TSV A;  5FZ6 A;  4W8J A;  1UW8 A;  3H8U A;  3WDW A;  2WRA A;  5EXO A;  4BQ2 A;  4DRR A;  5FPL A;  4HXC A;  2VZ3 A;  3VZJ A;  1ASJ 2;  5FXW A;  1X9P A;  4KWL A;  3IT8 A;  3GZE A;  3N7L A;  1J58 A;  5KHK A;  3CKH A;  1GWL A;  1WA6 X;  4AED A;  3WDX A;  3RZL A;  2BGP A;  3DV8 A;  2BP6 A;  5I8Y A;  4ERO A;  2B9V A;  1MQT B;  5CAD A;  5I0R A;  5L9B A;  2WO3 A;  3MFA A;  3K3O A;  1DQ1 A;  2D43 A;  5JXI A;  4GH4 A;  3BTZ A;  3FN9 A;  5FUP A;  2GMM A;  2VMI A;  1S2B A;  5K9Y A;  2Q1Z B;  1AR8 1;  5KXD A;  4LE4 A;  4YGD A;  1VBD 3;  2VW2 A;  4AL9 A;  4BK5 A;  4UBH A;  2GNB A;  4LO7 A;  2VTX J;  4JDN A;  2A71 A;  3GZT B;  4IXL A;  3ZFE B;  4B3N A;  5FZ9 A;  4JQT A;  3WQ0 A;  5A3W A;  5L7O C;  1GNZ A;  1D4M 2;  5A6Q A;  5GZD A;  1Y3T A;  4BDV B;  3KCX A;  1RUC 2;  3RMX A;  2XJQ A;  3HQU A;  2OW4 A;  3O1V A;  3ZN5 A;  1W99 A;  1VBD 1;  4S2H A;  3VKF C;  2VZT A;  2B9U A;  2G19 A;  4XJ9 A;  5BNN A;  1ZZ6 A;  3USU A;  4P5Y A;  3D5O A;  4XQW A;  4M0H A;  3W9A A;  1LCL A;  2R04 2;  2VTX A;  4DXZ A;  4PF1 A;  4XFH A;  4XFI A;  2XR4 A;  4FPC A;  2XKO A;  3O5S A;  4N43 C;  4QXC A;  4K21 A;  1PVX A;  3J26 N;  1WCD J;  3POW A;  4ZS2 A;  4BE3 A;  3H8X A;  3I2H A;  4GAL A;  5FZ4 A;  1UQX A;  4LUL A;  3UV9 A;  4Y1V A;  4K1Y A;  1KJL A;  3RQ0 A;  2DVB A;  1RUG 1;  4OLL A;  4WM8 B;  1Q43 A;  3MW3 A;  1U5I A;  2ZEW A;  5FXV A;  3UNP A;  1QDO A;  1QHD A;  3NAP B;  3ZSL A;  5IFT A;  2WNE A;  5GLZ A;  5IW0 A;  4LKD A;  3HT1 A;  3QH7 A;  1SPP B;  2VBB A;  3I2F A;  1RUE 2;  1PVC 2;  3POE A;  1NAE A;  1LJ7 A;  5F5C A;  3WQB A;  2ENR A;  4A42 A;  4CDU C;  4EZH A;  5CFC B;  2OT7 A;  1QJY 1;  1VRH 2;  3BOP A;  4AHW A;  2B5H A;  3M4F A;  1L7Q A;  4AXO A;  2Y26 A;  3UES A;  1F31 A;  3ZFG B;  3KD4 A;  3WG3 A;  1J3Q A;  2A5Z A;  1YRZ A;  5DAW A;  4FXK B;  5F39 A;  3ME2 A;  3R4S A;  4YLZ A;  1R09 2;  3MO4 A;  4TTG A;  1NCQ B;  4GMP 3;  4COY A;  3KM5 A;  1RUG 2;  2GSY A;  1AVB A;  1HJG A;  1QXJ A;  2R30 A;  1J3P A;  4DZG A;  4EN0 A;  4HN1 A;  3A21 A;  4XFA A;  1GWK A;  5FP7 A;  2XDV A;  3V65 A;  3VL8 A;  2DVG A;  5I93 A;  3FHI B;  4KQ7 A;  5I91 A;  2W91 A;  3IDC B;  4OZO A;  4URT A;  4MGS A;  3W5M A;  3WF0 A;  1J59 A;  3IN9 A;  3CIH A;  5FJH A;  2I2S A;  2ZEX A;  3I54 A;  4UXA A;  2H0V A;  3RGB A;  2E7A A;  1AYM 1;  2P4E A;  2Q8E A;  4FQ4 A;  1XU1 A;  3VHN A;  3JXS A;  1JYW A;  1H2L A;  4R9A A;  3VDD B;  3MDP A;  2IC1 A;  1MVQ A;  1OKQ A;  1R1Z A;  2R07 3;  3WUC A;  1POV 0;  2WAO A;  4FXG B;  1W6Q B;  4GH4 C;  4Y24 A;  5JIA A;  5FWE A;  1AHS A;  2KR2 A;  1LHV A;  1QOS A;  1H8V A;  4JGZ B;  3UYJ A;  5DZF A;  3BAL A;  3WQ1 A;  1PVC 1;  2ZHM A;  1AYM 3;  5FZK A;  4EQV A;  1DHK B;  2Y6J A;  1F9K A;  2WT0 A;  4GB3 1;  4LO5 B;  5FFO C;  4UFJ A;  2FDI A;  1V00 A;  4XMA A;  2VW0 A;  5LBB A;  5L7O A;  4MHR A;  1IG3 A;  2ETE A;  3FUQ A;  1BMV 1;  5HBA A;  2VOV A;  4IER A;  4YZ2 A;  4QPW A;  4D6S A;  3I3D A;  1U5Z A;  5FYB A;  1BBT 1;  1WLD A;  3OCP A;  4X8P A;  4Y33 A;  2JIG A;  2XBO 2;  2ZEY A;  1Y4W A;  2PXJ A;  3J7M A;  5C9A C;  2QNK A;  4N7I A;  3O1P A;  1DU3 D;  1CES A;  3GM8 A;  4K8R B;  1BZW A;  4RS5 B;  5FLH A;  3FJS A;  4X6R B;  3PUQ A;  2X09 A;  2ARA A;  4FPL A;  2TNF A;  4WZC A;  3SEP A;  3LEK A;  3WF3 A;  3WVJ A;  4XCB A;  4W6Y A;  2DU1 A;  3WZ1 A;  1IGO A;  1W8O A;  2D6M A;  1OPM A;  1OVP A;  1YFW A;  1AL2 2;  4FPG A;  4RSU A;  5C4W C;  3UT0 A;  3EO6 A;  4MHU A;  3OTF A;  4Q0V A;  2EA7 A;  3VZM A;  3CL1 A;  2N7G A;  4RHV 3;  1XOY A;  1SBE A;  3NAP A;  1PO2 2;  2AC1 A;  1S2K A;  2UU8 A;  4L11 A;  2EIC A;  2Y6G A;  4CCN A;  1QJZ A;  4QPI C;  5FP4 A;  4UI9 L;  1Q56 A;  1NXM A;  1ZRE A;  4UFL A;  2JDY A;  4ASM B;  1UU6 A;  2P3J A;  2Y6L A;  4CDW A;  1IQD C;  4D6R A;  4M3C E;  3PUI A;  2VCB A;  2Q30 A;  2PN5 A;  2GC1 A;  3AVS A;  1IPJ A;  3OSD A;  4A45 A;  3HAG A;  3ORJ A;  1HB4 A;  2A7A A;  1VMF A;  2HWE 3;  3HMY A;  4JGY A;  3NMB A;  4IEY A;  3D0J A;  4HG6 B;  1B09 A;  2DUQ A;  3B93 A;  4GA9 A;  2RS5 3;  1YQ8 A;  3PVO A;  1AR6 1;  1W6P B;  5A1F A;  1ND3 A;  5IUQ A;  2B45 X;  2D6N A;  4Q1P A;  4TWT A;  1W04 A;  3E6B A;  1QOT A;  1S0D A;  2VM9 A;  5GKA C;  5DN2 A;  1WKY A;  3KHB A;  4AI8 A;  5FZ7 A;  1LB2 A;  1EV1 2;  3CU7 A;  4IV1 C;  2NQY A;  2RS5 1;  4TZD A;  3KV5 A;  5F3G A;  2AEZ A;  1LU2 A;  3QBQ A;  1GUI A;  3E6D A;  2HWB 2;  4QDR A;  3RJ2 X;  3LPF A;  3WDY A;  4FOY A;  2WAB A;  1S0C A;  3GXU A;  2CSG A;  4LLF A;  4XXP A;  2EAA A;  4XIO A;  3WW2 A;  3ZXK A;  4RQP B;  2XB6 C;  5FCC A;  3UL2 A;  5C8C B;  2NPI A;  4D69 A;  5LA9 A;  1FOD 3;  1DGW X;  4RR3 B;  3UET A;  1LRH A;  3NAP C;  1JYV A;  5J09 A;  2E63 A;  1JZ2 A;  1OUS A;  3M3Q A;  2BJS A;  2HYK A;  4ZXK A;  2V5D A;  5I0T A;  3TN9 1;  5FR3 A;  3TRS B;  3VGI A;  2WC2 A;  4Q0P A;  1DIW A;  1W6N A;  4KU7 A;  1H0B A;  4AFC A;  1ZA4 A;  3Q8F A;  4P02 B;  4AFB A;  2YC2 A;  5FXX A;  1PX4 A;  4GWJ A;  1BXH A;  1G6N A;  1SLT A;  3DKW A;  3H3Z A;  5FZB A;  2R06 3;  1H4H A;  1RUF 1;  4PBO A;  2EXK A;  2K46 A;  4IEP A;  1W6N B;  3AYC A;  1X8E A;  5HI0 A;  2EID A;  1H9P A;  1MZE A;  4XAA A;  4A7Y A;  1W2N A;  3I8T A;  2H6B A;  1FMD 3;  1CAV A;  1LES A;  2VNO A;  4BQX A;  1O8P A;  4LOS A;  2YY1 A;  1GLH A;  4V2V A;  1CN1 A;  2QQW A;  4YVW C;  2PHD A;  3CEW A;  3AZZ A;  1RUD 3;  2OYZ A;  2EIB A;  3U4S A;  4YGE A;  3SH5 A;  1FNZ A;  3I4I A;  3EB7 A;  3TEY A;  3LWC A;  1GAN A;  4UAP A;  3CDZ B;  4MG2 A;  2RVA A;  1DLL A;  2IXJ A;  1SHW B;  3W21 A;  5C9A A;  5A80 A;  2VMH A;  3K46 A;  4I02 A;  3LOI A;  1LR5 A;  4MGI E;  3GZA A;  2IXI A;  4LE3 A;  4FFF A;  3SCH A;  2FDH A;  1K42 A;  5FZO A;  2VUC A;  4JRA A;  3U75 A;  4CDQ B;  5FYH A;  5A3M A;  1HLC A;  3ZXG A;  3EXU A;  2JDN A;  5LAT A;  3ZSK A;  4AQ6 A;  2E31 A;  2PHR A;  5F5Q A;  3RFR A;  3WHU A;  2QQJ A;  1ZRI A;  5T50 A;  3FZ3 A;  2BTV C;  1AYN 3;  1ULF A;  1JYT A;  3JQW A;  4BYY A;  4XF3 A;  1W03 A;  2XXZ A;  3ZXF A;  3LIH A;  1A3K A;  4IW3 A;  4QKD A;  4WM7 A;  4Q4W 1;  2NLR A;  2VQA A;  3T1L A;  1B35 C;  4IGO A;  4AI1 A;  1K3I A;  2CGN A;  3OPW A;  2R6Q A;  2IXH A;  1JZ4 A;  1KRI A;  1AJO A;  3EBR A;  3WW3 A;  4CUG A;  4JTN A;  1DCS A;  3CHX A;  1GZT A;  2EF6 A;  3C7H A;  2QQK A;  2AGS A;  3UKT A;  1BLZ A;  2QQO A;  2XJU A;  3K51 A;  3NJV A;  1EP0 A;  2XVK A;  3WW4 A;  4O9G A;  5FY7 A;  1POV 3;  2R1D A;  4YVS A;  2ID4 A;  1LGC A;  1WBF A;  1XU2 A;  3PMS A;  1F5F A;  3LSE A;  2AYH A;  4QGL A;  5DZG A;  5APA A;  4CCD A;  5C8W A;  1TMF 2;  1SLA A;  5ACA 2;  1RMU 2;  2DUR A;  3OBA A;  5FUI A;  4D7T A;  5JPM B;  4EN9 B;  3T2Q A;  5A1L A;  4YM3 A;  5GLW A;  2MPF A;  2W47 A;  4LBQ D;  3AM2 A;  1UXZ A;  3VDD C;  5IHR A;  3W20 A;  2A1X A;  1VRB A;  3MYX A;  3JBG 2;  1V9U 3;  3WV6 A;  1NQJ A;  4E2G A;  3I2G A;  3MIE A;  3OBZ A;  4O9E A;  3UKN A;  2A3Y A;  1OBN A;  2DFC A;  1W6O B;  4QXK A;  1UOG A;  1NXD 1;  3WP5 A;  1B35 A;  4D7S A;  2VCM A;  3G6J B;  4QX2 A;  4XDP A;  2P6C A;  3POY A;  4LHS A;  1UU5 A;  1DQ4 A;  4GZ9 A;  4M4P A;  4A7K A;  1RUF 2;  1HB1 A;  4OHY A;  2WFF 1;  2Z2S B;  2Z79 A;  4XDQ A;  1VBB 2;  4Q4V 2;  4UW4 A;  4QGN A;  4JRL A;  1VRH 1;  2NM1 A;  3WXP A;  5C3Q A;  1ND2 A;  2ILM A;  1PO1 1;  1YJK A;  1FMD 1;  4MVT A;  1PO2 1;  4EZ4 A;  3CJI C;  4Q4Y 1;  1MS4 A;  3VBS B;  2RDS A;  3HBK A;  2GC3 A;  3QOP A;  2BPA 2;  1RUD 1;  2VZS A;  4NVP A;  5LAS A;  1EPZ A;  2XLF A;  3MHZ A;  3IMN A;  4ZZ8 A;  5BNN C;  5CYY A;  4FSJ A;  2DUO A;  3HD8 B;  1PZ7 A;  3J7L A;  3UGH A;  5I8T A;  5IK4 A;  2J22 A;  5FZ0 A;  4Y1Z A;  4XUO A;  2XJP A;  5CIR A;  2J1T A;  2X05 A;  3VBF B;  4AFM A;  4DNY A;  3ZFE C;  1OUX A;  5L7O B;  4O65 A;  2CWS A;  4NHY A;  1WW4 A;  4ES9 A;  4QHZ A;  4GXL A;  3VV1 A;  5ISL A;  4IV3 A;  1AR8 3;  4XBL A;  5LA0 A;  2DBI A;  2ZOE B;  4NHL A;  2IUW A;  4GKY A;  5FLJ A;  4IEZ A;  4PBP A;  1PHM A;  2YDE A;  1UNB A;  1S0B A;  3WSO A;  4CEY C;  5LA2 A;  4OQ9 A;  2QVS B;  1JZ8 A;  4NHK A;  2E51 A;  2CV6 A;  1R08 2;  1HN1 A;  4FVV A;  3R4D B;  5CFC A;  4I09 A;  4ZPI A;  1O3R A;  1RUE 1;  1R09 3;  2GAL A;  3UKV A;  2VVF A;  1JUI A;  3J9S A;  4QGM A;  2PHX A;  3J7N A;  1HQL A;  2CDO A;  2QFE A;  1US3 A;  1W0N A;  4Y4R A;  4NRM A;  3SIS A;  3POJ A;  2RMU 3;  3J8F 1;  1UPS A;  1GQH A;  2XPJ A;  1UX7 A;  2VXJ A;  4ORF A;  5FPB A;  3RJR A;  5IFP A;  3A23 A;  1DLC A;  1H2N A;  1PGW 2;  2XGX A;  3HNB M;  4JX0 A;  3GAL A;  2IXK A;  4W50 A;  3AFG A;  4RS5 A;  4FP2 A;  4FAG A;  5FBZ A;  2R49 A;  5T5P A;  2OZJ A;  1O8S A;  2GNM A;  1RYY A;  3KT1 A;  2Z5W A;  1REE A;  4QKN A;  2WL1 A;  4YW1 A;  2P3K A;  1DP0 A;  1H1A A;  1O4T A;  5A7Q A;  2RJK A;  4HPK B;  3GGL A;  4PHZ A;  3LA2 A;  2FBE A;  2JE7 A;  1AR8 2;  2DTW A;  1SPP A;  4RR3 C;  2ARE A;  3VD9 A;  2PAM A;  4XFG A;  3VD3 A;  1H8T C;  5JWP A;  3JD7 1;  4JCK A;  2XQR A;  1D4M 1;  3GJA A;  3UJQ A;  1ENR A;  1MS5 A;  2W39 A;  3AMM A;  3ZYI B;  5AFB A;  2TBV A;  4MUV A;  3HN3 A;  2WDB A;  4Q4X 3;  2DVF A;  3JU9 A;  4NPR A;  1C3H A;  4UFH A;  4FO9 A;  2FDG A;  2VNR A;  2QKD A;  4CP9 B;  2Y34 A;  4GB3 2;  1LEN A;  3H1W A;  4OHX A;  5FYT A;  1QJY 3;  5F1R A;  3ABZ A;  1HRV 2;  2E53 A;  1QJF A;  3C2U A;  4QM9 A;  2WO1 A;  3U1X A;  1OUR A;  1CAW B;  1CAX A;  1GNY A;  3IAP A;  4LR4 A;  1KGY A;  5FIX A;  4L92 A;  5DMY A;  1GQP A;  1LHO A;  1O4Y A;  2VAU A;  5KWR A;  1YEW A;  3I2K A;  3RSJ A;  5EJZ B;  5AC9 3;  4OI0 A;  1SBF A;  3AMP A;  5KXB A;  2IXL A;  1OOP B;  3AYA A;  3CZJ A;  1TNR A;  2TEP A;  2FMD A;  5FZO B;  1M4W A;  1PM4 A;  1PVC 3;  1K5J A;  2JE8 A;  1YO8 A;  2QCS B;  2XG3 A;  3OJB A;  4OMD A;  3WHT A;  3H0O A;  1GP5 A;  5A7W B;  2WZR 2;  3MLJ A;  3ACF A;  3VZK A;  3Q8E A;  2C6S A;  4QQ2 A;  4NPL A;  3SXW A;  1UAI A;  4YW6 A;  4MV2 A;  1G9C A;  4FOV A;  2WQ8 A;  4S2D A;  5A7S A;  1ALY A;  1UMH A;  5B2G B;  1OH3 A;  5A3L A;  5A6Z A;  4P00 B;  2NP0 A;  5JR2 A;  4GAZ A;  4BME A;  4ET7 A;  1YHF A;  3ON7 A;  3ZXJ A;  3MEP A;  1BEV 2;  5FYM A;  3VHP A;  1MR5 A;  1RXF A;  2W95 A;  5C4W A;  2Q8O A;  4OI1 A;  4XF1 A;  2V72 A;  4DS0 A;  3TEZ A;  4JKL A;  1OOP C;  4XHB A;  4OHZ A;  4GKX A;  3RZZ A;  1SCR A;  3OY8 B;  2RV9 A;  1B35 B;  2VOK A;  3I3E A;  1RL3 A;  4LBK A;  3LIG A;  1XSR A;  5T52 A;  1SFY A;  1SLL A;  1I6X A;  1LTE A;  1IQA A;  2ZGM A;  2RS1 2;  3HN1 A;  2OA2 A;  2ZTN A;  1W9F A;  2WR9 A;  2D6K A;  5FKB A;  3VZL A;  3O0W A;  4DRV A;  3ETP A;  1DYP A;  1COV 1;  4IV3 C;  5FV3 A;  3SKV A;  2FMY A;  3DN7 A;  4QU1 A;  2VME A;  1X82 A;  2YXS A;  1E5S A;  1W0P A;  2VGD A;  3FX3 A;  3O12 A;  4OUM A;  2CYF A;  1I1E A;  1C57 A;  2RDR A;  1GU3 A;  2JDM A;  1F5J A;  1DGR A;  1NZI A;  2HWF 3;  4CRQ A;  5J96 B;  1MAC A;  1R08 3;  3HBZ A;  2JEC A;  2ZGK A;  4B4Q A;  5BY5 A;  3N9M A;  1JYX A;  1W90 A;  4R52 A;  1W6O A;  4WVM B;  4IE5 A;  1LHW A;  1XB9 A;  4BIF A;  4QX5 A;  1BQP A;  3ES1 A;  1V6O A;  1C8M 3;  4F83 A;  4Q4X 2;  2WNU C;  2I07 B;  5F6K A;  4MOA A;  1C8N A;  3ZKY A;  1SCS A;  1UZY A;  3PHM A;  1VAL A;  2HWC 1;  3IDE A;  4DIQ A;  5FY4 A;  5ABJ B;  1C5H A;  1ZRC A;  1LEC A;  2WNV A;  1XNC A;  4XZP A;  4QX7 A;  1C8M 1;  1X50 A;  3B3Q E;  4GQ7 A;  4OZX A;  1W8F A;  3FLT A;  3H1Y A;  4XDO A;  1N3P A;  1AL2 1;  2J1E A;  4CDQ A;  1C4R A;  2DVD A;  2ZBJ A;  5DAB A;  1Z0H A;  5D8A C;  2BYV E;  5CZK A;  4B4R A;  4DIN B;  4L8Q A;  2E6V A;  1ZZ8 A;  4WBB A;  2A75 A;  4M4R A;  1V6L A;  4QHO A;  1L7R A;  4XBQ A;  1AZD A;  3B94 A;  1FOD 1;  1OT5 A;  2C4X A;  4PJY A;  2JG9 B;  4AAP A;  3PUR A;  4N9I A;  3QCW A;  3WP6 A;  1U5X A;  1PK6 A;  4XE9 A;  5CA6 A;  4E8D A;  1KFU L;  1QJU 1;  3PVN A;  5F2W A;  4XFF A;  4I2O A;  1T6G C;  3C7O A;  3M3C A;  4AI9 A;  2YMZ A;  3HR9 A;  5C3P A;  3S57 A;  4EN6 B;  1RB8 G;  2G4I A;  2OPK A;  4ISR A;  3GHN A;  4KBZ A;  5GAL A;  2J1A A;  1ZRD A;  5JZG A;  4JV4 A;  1AL0 G;  3Q9O A;  5FRA A;  2RE9 A;  3HOB A;  3MLL A;  3NVC A;  3BUC A;  4FPH A;  1UCX A;  1DDL A;  1W39 A;  2X5I C;  4OCT A;  2Q5T A;  5IVY A;  4CEY B;  3CO2 A;  4N43 B;  3FLP A;  1AYN 2;  1YQ5 A;  2JG9 A;  3A0N A;  2W92 A;  3FL7 A;  1UU4 A;  4NAO A;  3BKZ A;  2XWJ B;  1YFU A;  2P37 A;  1OLM E;  1W8W A;  2JDH A;  5E16 A;  1O7F A;  5LK7 B;  4ONU A;  4KU8 A;  3MIC A;  5IVE A;  4URA A;  4NMI A;  1VBD 2;  4MSV A;  3L9J T;  4Y5T A;  1GBG A;  5H9Q A;  1W28 A;  3DGT A;  4FTS A;  1KS4 A;  4AED C;  4E2S A;  2EXJ A;  4B4P A;  1RUH 2;  2HBU A;  2Q0A A;  3DPR C;  1LOE A;  2ZCW A;  1J1L A;  3WUD A;  1JI6 A;  2JKX A;  4JGZ A;  1MVE A;  1E5H A;  5DAP A;  4A4A A;  4CUC A;  3VN4 A;  4ZZ5 A;  1S1A A;  5CIS A;  1H1I A;  4MXW B;  4LBQ A;  1RUI 2;  5EPA A;  3ZFG A;  4CCO A;  1IKQ A;  4C0B A;  4DEQ A;  2QQM A;  2BBV A;  1EPW A;  3H8O A;  5DDJ 2;  1MQT A;  1ND2 B;  2CDP A;  5JVV A;  1OOP A;  2WSU A;  3BYW A;  4FPF A;  5T54 A;  4AVT A;  4XC9 A;  4AGR A;  1LOF C;  2F4L A;  1RUH 3;  4LKF A;  2DYC A;  2V09 A;  2PAK A;  2Y0O A;  4XAC A;  5LY1 A;  1XE8 A;  3FWE A;  3VKO A;  4QU2 A;  1H9W A;  2J1V A;  2MNG A;  2PA7 A;  2VEC A;  3LEI A;  4OUE A;  1NE6 A;  5EJ3 A;  2OVU A;  1SQ4 A;  4Z8B A;  5E1R A;  1H4G A;  1OVS A;  3P1I A;  4Q27 A;  1Q8O A;  1RUI 1;  1DBN A;  2B4K A;  4RHV 2;  3KF3 A;  3POI A;  2VD7 A;  1S0G A;  2W3J A;  4YG0 A;  1RUJ 2;  1AL2 3;  1UY0 A;  1E5R A;  5CBL A;  2DVA A;  1W2T A;  3KZ4 C;  5LBC A;  3VBO C;  2E26 A;  4HKO A;  1XND A;  2HWB 3;  2O8Q A;  1K12 A;  1YI7 A;  4HKL A;  5AVA A;  1VBB 1;  4Q4V 1;  3FC0 A;  2YYO A;  2HH9 A;  4XF4 A;  3HEI A;  4JQR A;  2WN2 A;  3UGG A;  1YIF A;  3OEA A;  2NN8 A;  3NKT A;  3TYJ A;  3W5N A;  1EY2 A;  1FMD 2;  2QQI A;  3N3H A;  3KQR A;  5FY9 A;  5J36 A;  4WM8 A;  5EWS A;  4KL1 A;  1YI9 A;  4YM1 A;  3ZPY A;  2NMO A;  4AHZ A;  1UIK A;  4P9G A;  5F3I A;  1JZ7 A;  3U07 A;  1ZM1 A;  4I0W B;  1KQR A;  2D44 A;  2W46 A;  2Y6H A;  2BDR A;  1WMX A;  4MXW A;  3AZY A;  2R32 A;  4QX0 A;  5L9V A;  1O3T A;  1HRI 2;  1XXN A;  1I5Z A;  4OYU A;  3T08 A;  4FCA A;  4IE0 A;  2GAU A;  2HWE 2;  4CXY A;  1LU1 A;  1ND3 C;  3GYD A;  1H8T A;  1MS0 A;  2C9K A;  5BNN B;  2A73 B;  3GCX A;  4FP3 A;  5FO8 B;  2VTF A;  2WII B;  1PO1 3;  4Y22 A;  1BMV 2;  2RS1 1;  1GFF 2;  1UZV A;  3NL1 A;  4SBV A;  2LUW A;  2HKX A;  1EAH 3;  5GM0 A;  1W2A X;  3I2O A;  3D3A A;  4JGY C;  4IEW A;  4OUL A;  1YUD A;  2XBO 1;  3IBM A;  4LBL A;  5LK5 A;  3SKJ E;  2UUR A;  1VJ2 A;  3PTY A;  4RFT 0;  3VBU C;  1WMD A;  4C8D A;  2XL9 A;  3E5U A;  4NID A;  4XTM A;  3T4H B;  4CDW C;  2FZ2 A;  1ZVF A;  3GNE A;  1RMU 1;  3TBD A;  4YGC A;  1E57 A;  1BKZ A;  1RXG A;  4ASK A;  1Q8S A;  3ACH A;  4P5H A;  1R1A 2;  3M2M A;  1UMZ A;  3LD8 A;  4XPV A;  4BHP A;  4EYU A;  2W5F A;  1O6U A;  4XYX A;  4F7Z A;  1QNY A;  2VUA A;  3ZN4 A;  1VRH 3;  1ZBA 1;  1AJK A;  2VBP A;  4QB2 A;  3VKL A;  1A78 A;  2ZS6 B;  5FP8 A;  4CCE A;  2E9Q A;  3AJZ A;  4Q4Y 3;  1Y9G A;  1QGL A;  5FZI A;  2W52 A;  1OQE A;  1I3H A;  4OMC A;  3MFC A;  1X7N A;  4ZXE A;  4X8N A;  3ZX7 A;  1H2K A;  1TNF A;  4S2F A;  1ZBA 3;  4NWW A;  1JZ6 A;  4COV A;  2PQS A;  4MGQ A;  2VQ0 A;  4KGQ A;  1V6N A;  1AR7 2;  2W08 A;  5D21 A;  5EHD A;  4GIQ A;  1Q8P A;  4LA2 A;  4WVV A;  5K0U C;  4QQL A;  4CCK A;  4MH0 E;  4C91 A;  3DCQ A;  1SMV A;  3GCW A;  5BNP C;  3ES4 A;  3K4D A;  2ADE A;  3LDK A;  4L9B A;  3PIG A;  2LRP A;  1F2N A;  5L73 A;  2DU0 A;  2RG4 A;  1OD5 A;  2RR1 1;  3III A;  5JIU A;  1FV2 A;  4MZU A;  2WO7 A;  1N1V A;  4BXS V;  2A6Y A;  3NNG A;  1KFX L;  4CEW B;  1BEV 3;  3AKQ A;  3NST A;  5C8C A;  3BOW A;  2VC9 A;  1JS9 A;  5AVP A;  4QX1 A;  5FPZ A;  3JB4 C;  4FPK A;  5DAX A;  1CZV A;  1UYP A;  2WQZ C;  2D5H A;  2WS9 1;  5H9S A;  3ZYG A;  4M3C B;  4CE8 A;  4BOW A;  2RDN A;  4NHM A;  1RJ8 A;  2JG9 C;  2XON A;  1GP6 A;  1J83 A;  5G04 L;  3V64 A;  4I0A A;  4COZ A;  4O61 A;  3SH4 A;  4J25 A;  3PJQ A;  1G86 A;  3WDV A;  3MW4 A;  3KT7 A;  2R1B A;  4E2Q A;  4CEW C;  3TN9 2;  2ZMN A;  1YXW A;  4CDU A;  4V2W A;  1XQN A;  3CF6 E;  3INA A;  2UY9 A;  4RQP A;  2JWP A;  2ZX3 A;  3RYK A;  1FT9 A;  3PVB B;  3WQ7 A;  4F8A A;  1XYN A;  2B46 X;  4IGP A;  4QQP A;  5LY2 A;  1QMJ A;  3RG0 A;  2VZP A;  1OA4 A;  4QPY A;  2R07 2;  3SCF A;  1YQC A;  2YC4 A;  4HON A;  1K5M A;  2D97 A;  4PI2 A;  5JPN B;  3JZV A;  1O4Z A;  2KA3 A;  1CJP A;  1JU4 A;  1EAH 1;  1ONA A;  3OGJ A;  1UXX X;  1NCR C;  4BU2 A;  3M1H A;  1S4C A;  5FMD A;  4IL7 A;  1A8D A;  5HCA A;  4EE2 A;  3N9L A;  5EFU A;  3RYR A;  5LRS A;  3WNL A;  4A3X A;  4LEJ A;  4AK3 A;  1ZRR A;  1GP4 A;  4QD2 A;  2D5F A;  3RRD A;  4RN5 A;  1GYK A;  1JOD A;  2ZGP A;  1X33 A;  1CAU A;  1RMU 3;  3RDI A;  3WX5 A;  4BIS A;  5CKN A;  4IET A;  4BQ3 A;  5JZG B;  4BQ5 A;  5CG9 A;  4XQ4 A;  4DB5 A;  5C3O A;  3CLP A;  2V4A A;  2BRT A;  2BQP A;  2XJT A;  3IPV B;  1UL9 A;  4AQT A;  3RZK A;  5SV5 A;  4Q0S A;  1RIR A;  3H9A A;  2E33 A;  3JCI A;  5IK8 A;  1DYO A;  4XZU G;  5GLT A;  2UYA A;  4WVZ A;  4YYO A;  2JKB A;  1EAH 2;  5FZM A;  3BU0 A;  2JDA A;  2VNG A;  2HWD 1;  4LBM A;  4Q5O A;  5EV7 A;  4LHL A;  4AVB A;  2VVD A;  1V6M A;  5AC9 1;  4ZU4 A;  2PAE A;  3EYP A;  2NMN A;  4YFZ A;  4I3P A;  4K3U A;  3MV0 1;  4UT5 A;  3SEE A;  3WR0 A;  1G9A A;  1HRI 3;  2GZW A;  2A3W A;  1NQD A;  4YRD A;  2R07 1;  1IKP A;  2EXI A;  1ENX A;  1UN1 A;  3DYO A;  4AQS A;  1GZ9 A;  4IE4 A;  3VBH C;  4BQY A;  3FFQ A;  3LDR A;  2CNA A;  2GMP A;  2KD7 A;  2D7F A;  1QJX 2;  5DQ0 A;  1A34 A;  3AXE A;  3S0M A;  5DUW A;  4YZ5 A;  1BCX A;  1UWW A;  2Y6F A;  3HVD A;  2Y64 A;  4CU8 A;  1D0H A;  2J1S A;  3RWN A;  1TME 3;  4PT6 A;  4ZHN A;  1GQG A;  4QQH A;  2D3P A;  1DYK A;  4QDS A;  4COW A;  5AFE A;  2ZGR A;  4C1X A;  3VBO B;  3RZJ A;  3RYP A;  5JAX A;  4LKS A;  2WJS A;  3GJB A;  4LIT A;  1W9W A;  4DOU A;  1OMI A;  2XUE A;  3TEW A;  4Q8K A;  4QDQ A;  4Y1X A;  3BPS A;  4XET A;  5ABJ C;  3VBU A;  1CAW A;  1CAX B;  3P3P A;  1SLI A;  3IKW A;  3OYW B;  5KC5 A;  3LEG A;  3RZM A;  1KJR A;  3MPP G;  4BK4 A;  1BHG A;  5FRE A;  1RUG 3;  4GWI A;  4IEO A;  1AX0 A;  1MEC 1;  3RVH A;  1C8M 2;  3ENR A;  5C71 A;  4PIX A;  2YGM A;  4JKM A;  1SG3 A;  3O1O A;  1LGN A;  3VBS A;  1UYX A;  3RZG A;  3MV1 1;  4M3C A;  1HIX A;  5K4L A;  4WM7 B;  2JJ6 A;  4QX3 A;  4FTE A;  1WCS A;  2WFF 2;  2WWJ A;  5CB7 A;  3OYW A;  4WM8 C;  2LAL A;  2RMU 2;  4R4Z A;  3O1M A;  2W9X A;  4JAA A;  3BN6 A;  1FOD 2;  1CAU B;  4D94 A;  1N3O A;  3VD4 A;  3MW2 A;  2AUY A;  4R9D A;  4W6W A;  5HXV A;  3V56 A;  4GMP 1;  3GBF A;  5DG1 A;  4CSW A;  4AR2 A;  4DQA A;  3N4M A;  2WLQ A;  3AK0 A;  3C8X A;  4AOC A;  3ACL A;  2VMG A;  1W6Q A;  2E32 A;  4YM0 A;  2ZKL A;  3ZXE A;  3B9I A;  4LBJ A;  5E89 A;  5CEH A;  3JBG 3;  5FTT C;  4UF0 A;  1QKQ A;  3GBW A;  5BPX A;  3USS A;  4OHV A;  1Z78 A;  4XJW A;  3DYM A;  1HJF A;  4PIZ A;  1VB2 A;  5D1I A;  2WLP A;  3T0A A;  3KLS A;  3K77 A;  4PDW A;  2O8O A;  1P8J A;  2YPJ A;  2GDF A;  4LBN A;  3WY6 A;  4CPB A;  1YFY A;  1GOG A;  3IDA A;  2QUO A;  5LEK A;  3EHK A;  3T1M A;  1QXP A;  3T3Y A;  1QH6 A;  3JBG 1;  4MGY E;  2HWD 2;  1U0A A;  2IZW A;  4RR3 A;  5CKM A;  3S7E A;  5GLU A;  4RGG A;  3SQO A;  2QQN A;  4Z1V A;  1CWP A;  2WA3 A;  4IEV A;  4Q29 A;  1VBC 3;  4YGB A;  4LHN A;  1ZBE 2;  5CNA A;  5K0U B;  1BK1 A;  4B29 A;  1CPN A;  1TMF 1;  3ZIX A;  1XYP A;  2CAV A;  1F15 A;  2VJX A;  1HRI 1;  3DXT A;  3AZV A;  2UWA A;  2ZZJ A;  3CQO A;  2OQ7 A;  4D6Q A;  5I0S A;  4L99 A;  4TLG A;  3TN9 3;  4M00 A;  4RL7 A;  2PFW A;  3KF5 A;  4Z07 A;  4H7M A;  1ULP A;  1GV9 A;  2ZHK A;  5M0T A;  4NRP A;  1SDW A;  2QE3 A;  4YVW B;  1ENS A;  3ZSJ A;  2V4V A;  4JGZ C;  2AEY A;  2WIN B;  4ZU7 A;  3FMG A;  2Q1M A;  1AR9 3;  3MID A;  1RHI 2;  3C3V A;  4LNV A;  4A6S A;  4BXF A;  3DPR A;  1LNS A;  3LGR A;  4Y1Y A;  5CFC C;  5FUN A;  2PLV 2;  4EWA A;  2LTN A;  3MLK A;  5LA1 A;  5F37 A;  5FYC A;  3E5Q A;  3ZFE A;  3ZMN A;  4BB3 A;  3VDB A;  4DFS A;  1WUV A;  3LOB A;  4HSJ A;  4LOT A;  1WLC A;  2B39 A;  2RS3 3;  2JXA A;  3C7E A;  4HLT A;  1UZZ A;  3ZFG C;  1AR9 1;  3WNO A;  3JQX A;  4HVQ A;  4OQ8 A;  4YW4 A;  3BPZ A;  3SHR A;  2WYF A;  1GOH A;  2FDK A;  3MGU A;  4WVM A;  1AYN 1;  5JI7 A;  1ZZC A;  2HWF 1;  1WCK A;  2BFU L;  2VXR A;  5EYX A;  5CFD C;  5FY8 A;  4AW7 A;  1MPX A;  2VCA A;  1PZ9 A;  3D82 A;  3ILR A;  3SNM A;  5KR7 A;  1GZC A;  4AVC A;  4QPG A;  3RS6 A;  2Y38 A;  1QEX A;  1QNW A;  5HPO A;  4P9W A;  5FZG A;  1CJD A;  3DKQ A;  4CP2 A;  1JN2 P;  2GU9 A;  4IQP A;  5E88 A;  1VR3 A;  4UFI A;  4LIV A;  4CZS A;  4DY5 A;  3H1M A;  5FY0 A;  1ST8 A;  4OVE A;  5T5J A;  3WG1 A;  5F3C A;  4P9I A;  5FYZ A;  4FOW A;  1H6X A;  4YG6 A;  1RUH 1;  3A4U A;  2KM2 A;  3GBG A;  2HWE 1;  2ADD A;  1Z7S 2;  4LPL A;  2JD4 A;  2XWB B;  1UZW A;  4AI3 A;  4F3J A;  3ITQ A;  2MHF A;  2K0G A;  1RED A;  1JYN A;  2WN3 A;  1JZ5 A;  1ASJ 1;  1MS3 A;  2GP5 A;  1OF4 A;  2ZA9 A;  4MXV A;  4UOJ A;  1D2S A;  2C5D A;  4Q4W 3;  2GH8 A;  4Y3O A;  5JZG C;  1ZZ7 A;  3IPV A;  4HK9 A;  3LZZ A;  3PVE A;  1XSQ A;  2GH2 A;  3W59 A;  2JG8 A;  5JXG A;  1AX1 A;  1CON A;  3KGL A;  2VY0 A;  2ZKN A;  4LK7 A;  2BNO A;  4JDO A;  1IOA A;  1AR9 2;  4MLO A;  4P9J A;  4PLM A;  3S6P A;  2H6C A;  4ATF A;  2JG8 C;  2RHP A;  4HVO A;  4YVS C;  5FJK A;  2YHJ A;  4QQO A;  4E4S A;  4V1P A;  1G7Y A;  1NCR A;  3N9O A;  2QQP A;  4LK6 A;  1W8T A;  3ZPO A;  3U10 A;  2WZE A;  2FQP A;  1K5M C;  5C70 A;  1PGS A;  2ZAC A;  5FKC A;  3HPN A;  5C6C A;  1HXS 1;  1SDD B;  2QQU A;  1YLL A;  1DFQ A;  3WCR A;  1E5I A;  1ULE A;  1XNA A;  5KHJ A;  1OPO A;  2PHF A;  2X29 A;  4BM8 A;  5IK7 A;  2F4P A;  3AZX A;  4E8C A;  3MIH A;  3U0Z A;  1GOF A;  3DYP A;  3LKJ A;  2HEV F;  2RS5 2;  2X8K A;  1R1A 1;  4XJZ A;  1JOJ A;  1VMH A;  1DG6 A;  3K3N A;  1Z7S 1;  2CHH A;  2R06 1;  2W1Q A;  3LEM A;  4YVS B;  4AVV A;  1RGS A;  4FI9 A;  4QWN A;  1W6M A;  2RM2 1;  4J1W A;  4HAN A;  2L9L A;  1IHM A;  2WNU A;  1ULG A;  3MF6 A;  3ZDS A;  3OUH A;  4YAR A;  4CPB D;  3ZYR A;  5JMC A;  3RI8 A;  1JYC A;  1A6C A;  2A6Z A;  3PNA A;  4IGQ A;  1HXS 2;  2CTV A;  1X36 A;  3LE0 A;  4AF9 A;  4K9S A;  4S2G A;  5FPU A;  2FZ1 A;  4AGV A;  3MF9 A;  3B69 A;  4LTA A;  2AZ5 A;  2W1U A;  2VZ1 A;  3IIA A;  2RM2 3;  3P6B A;  1UKG A;  3AMH A;  4FPJ A;  3NQH A;  3QH6 A;  3BTA A;  2HLE A;  2BVB A;  3ZDV A;  1UO9 A;  2ARC A;  2EIG A;  1S2E A;  2PEL A;  2RS3 1;  2BER A;  4NUB A;  5BXX A;  4R9C A;  3WEZ A;  1XE7 A;  3PUH A;  1HDK A;  1RJ7 A;  5JSP A;  1C28 A;  4QPG B;  4DO0 A;  3O14 A;  2VBD A;  4ITC A;  1W9T A;  1OC1 A;  4YVW A;  1QWR A;  1LOA A;  2GND A;  2RJ2 A;  2DCZ A;  1XPW A;  2YZ4 A;  2C24 A;  4D8M A;  1TZO A;  3BB6 A;  3KV4 A;  2GC0 A;  1U5Y A;  3M3O A;  5ANQ A;  1RUC 1;  5H9P A;  1N47 A;  4AI0 A;  2DDU A;  5FY1 A;  1BEV 1;  2DBN A;  1MS8 A;  3E5X A;  2BGC A;  1XNK A;  3OGG A;  1JHN A;  3AKP A;  3F95 A;  1EV1 3;  1OD3 A;  1WGP A;  2X10 A;  3LDB A;  3NV4 A;  1Q8Q A;  1XNB A;  1NCQ C;  2YU2 A;  4TXW A;  2VVE A;  1NYW A;  4D7Y A;  3IZO A;  1UMI A;  2FCV A;  3H42 B;  1PGL 1;  1CIY A;  5FWJ A;  1RUI 3;  3ZN6 B;  4HOO A;  3TAY A;  4KH9 A;  3BTX A;  3R05 A;  2W94 A;  4Q4Y 2;  4MYE A;  1AR7 3;  1S0J A;  4K1Z A;  4RGA A;  4FBF A;  4Z82 A;  3SMH A;  3RNS A;  3THP A;  1NOV A;  5LEJ A;  4UW5 A;  2E7Q A;  3CZU A;  1WWY A;  1FPN 3;  3CMG A;  2C26 A;  1QQP 1;  3VUO A;  1DGR N;  2CY6 A;  4LO6 B;  5FBJ A;  2ES3 A;  5A6X A;  5IVJ A;  1AR7 1;  1MZ6 A;  1VP6 A;  2PYT A;  1LOD A;  4XOG A;  4K20 A;  2JX9 A;  3SIT A;  1QJY 2;  1RVF 1;  1NUK A;  5CAZ A;  2BBA A;  1UKR A;  2JD9 A;  4AED B;  1FNY A;  3ETQ A;  1G9F A;  1GMM A;  1PIV 2;  4XUR A;  2YBP A;  3IDB B;  1C5I A;  2D3S A;  3ASI A;  2JB4 A;  1V70 A;  1JZ3 A;  3WT3 A;  3BI3 A;  3BU7 A;  2ARB A;  1CAV B;  1BK0 A;  3O0X A;  4YW7 A;  3VBF A;  5J3U A;  1URX A;  5LCW L;  4MX3 A;  2IWG B;  1RVF 3;  4NRO A;  1JU3 A;  1SBD A;  1L7L A;  3N35 A;  2OXB A;  2BZD A;  4E4Z A;  2BW8 A;  4W6X A;  3I2D A;  1IS4 A;  3C7F A;  5CG8 A;  1FV3 A;  1JUH A;  2W0X A;  2YBK A;  3NJX A;  4JDM A;  3ZYB A;  2HBT A;  1EUU A;  4FT8 A;  1H6Y A;  4RS5 C;  3T2P A;  3C7G A;  5IAV A;  5E6H A;  3E1F 1;  3U4X A;  3AYD A;  5FP9 A;  2XVG A;  5HV0 A;  1TEI A;  2P34 A;  4NAM A;  4Q4X 1;  3Q8C A;  2PMW B;  3ZMO A;  3I49 A;  1NY7 1;  3AB0 A;  1OFS A;  1WD4 A;  3GF6 A;  4PCR A;  2FCT A;  2QJV A;  5FMO L;  4CDX C;  3VD7 A;  2AR6 A;  3DUI A;  3M3I A;  1QU0 A;  2QZ2 A;  1SLC A;  3N36 A;  2XL7 A;  1ZRF A;  4I3G A;  3KV9 A;  3AMN A;  2VZO A;  2A6V A;  1U12 A;  1RUJ 3;  4UFK A;  2VOX A;  4AZZ A;  4B1M A;  2YU1 A;  3D8C A;  2D3R A;  5DAQ A;  4JKK A;  2ZAB A;  4QPI A;  4L2N A;  4D0Q A;  2R04 1;  2XOM A;  5CVR A;  2YFU A;  5I0D A;  4KGG A;  4CEY A;  1JW6 A;  3MIF A;  1S0F A;  4O7X A;  2NYY A;  4GWN A;  1QOO A;  4FOQ A;  2DCK A;  1NX9 A;  2VH9 A;  2MEV 2;  1W3X A;  3KQ4 B;  4NWV A;  3VBH A;  2HWD 3;  1LOF A;  1RUC 3;  5F9T A;  3PME A;  1CQ9 A;  1RHI 3;  2X53 S;  1DZT A;  1W8Z A;  3LF7 A;  2B7Y A;  2J1R A;  3SLI A;  4CUA A;  5C7G A;  4AI2 A;  1O3S A;  4QKF A;  3AVR A;  1QIQ A;  5F8P A;  4W65 A;  1NKG A;  2GN7 A;  4R8H A;  1PK6 B;  5FMC A;  5FK8 A;  3ZIW A;  1XYO A;  3T0D A;  3KWV A;  4NOT A;  3S7I A;  1H30 A;  3ZSM A;  4LIU A;  3H3U A;  1GR3 A;  4XF0 A;  3BTY A;  1LKN A;  4B8E A;  4AVS A;  5A7W A;  3H8R A;  3U11 A;  3ZO0 B;  2RMU 1;  3CJI A;  5J7M A;  1QH7 A;  4G3Y C;  5T3N A;  3ROU A;  3ZM8 A;  2PQQ A;  2YG0 A;  2D93 A;  4NII A;  2JB8 A;  3RMY A;  4E4D X;  1JOB A;  1MEC 3;  4BPZ A;  4YZ1 A;  1X9T A;  1N1S A;  4FFI A;  4XUP A;  1Y7B A;  2JEM A;  1UZ0 A;  1V6K A;  3KCY A;  4MAD A;  3T4V A;  2NZ9 A;  1US2 A;  2XUM A;  1RVF 2;  1ULO A;  2CAU A;  4IEU A;  1SFP A;  4KG8 A;  1PZ8 A;  4AEJ A;  4HL0 A;  3FLR A;  2YFZ A;  4NRQ A;  3K2O A;  1IS5 A;  5T55 A;  4B7K A;  1AR6 2;  5GJ6 A;  1J3R A;  1Y43 B;  2MEV 1;  5H9R A;  5G05 L;  2OUJ A;  1REF A;  2B8M A;  2V73 A;  5DAV A;  5LWB A;  1W2U A;  1STM A;  2ZJC A;  2QZ3 A;  2DWR A;  2BUK A;  2VU9 A;  5HCB A;  2WWS A;  3MIG A;  3OBR A;  5KHH A;  4QHB A;  1AX2 A;  3THT A;  3LAG A;  3VKM A;  4MGK E;  1Q5O A;  2ZAA A;  1CPM A;  5A1A A;  5JI9 A;  2Y0I A;  2Y60 A;  1HKD A;  2P3I A;  5BYN A;  4Y5S A;  2PHW A;  4DUX A;  3J4U H;  2WNV C;  4IES A;  5T5O A;  4KI5 M;  1QJU 3;  4PQ9 A;  2YBS A;  5EP9 A;  3TWI A;  4QAW A;  2JEN A;  1TME 2;  4OI2 A;  4HN0 A;  2R16 A;  3PUS A;  3VBR A;  4CVU A;  1GZW A;  2JIJ A;  2ATF A;  3FBM A;  3Q8A A;  5EQU A;  1WLT A;  1VIW B;  1FXZ A;  3KMH A;  1F4A A;  2YB7 A;  4Q8L A;  1UYY A;  3LB9 A;  4LQR A;  4RQP C;  4LKE A;  3RZH A;  1NG0 A;  2C9A A;  4D3W A;  3V0B A;  3AXD A;  2PLV 1;  3WDT A;  3R6S A;  4MGT A;  3GZU C;  4GUL A;  1RUJ 1;  3R0R A;  4CUB A;  4K6B A;  4OI4 A;  4ZS3 A;  3WOG A;  1YQ2 A;  2WNV B;  1W9S A;  2OX0 A;  5IWF A;  4AYU A;  4CEW A;  2O0O A;  5FZ3 A;  5A3U A;  5A3T A;  5FO7 B;  1G9D A;  4SLI A;  3QAC A;  4LMF A;  5BNO B;  3PUA A;  3E97 A;  5CFD A;  4E4H A;  3AP4 A;  3S30 A;  2PTM A;  2DF7 A;  1WD3 A;  2VW1 A;  3SC7 X;  3I7D A;  4BQ4 A;  2W87 A;  1PNF A;  1KIT A;  2WT1 A;  3B02 A;  3EQE A;  5J48 A;  1PIV 3;  1OI6 A;  3OBT A;  3ELN A;  1SAC A;  4XVH A;  3VDC A;  5FOJ B;  1S55 A;  3NNF A;  1FAT A;  3I2J A;  1VBE 1;  1VLN A;  4ZY9 A;  2LW8 A;  1H1M A;  5EIY B;  2R06 2;  3FHQ A;  4P9L A;  1TME 1;  5FPX A;  1BJQ A;  5A33 A;  5A32 A;  4DPN A;  1AF9 A;  1ZBE 3;  1CR7 A;  2GP3 A;  2YUE A;  4XUT A;  5FY5 A;  4YWA A;  4CYD A;  1NZC A;  4LBQ B;  4MO3 M;  4KWJ A;  1BVP 1;  5JOY A;  2Q4S A;  4RHV 1;  4TLF A;  4E9K A;  4HET A;  5C9A B;  5KXE A;  5FLI A;  3NJZ A;  3OPT A;  1WCU A;  4A7Z A;  3OF1 A;  1YIP A;  3LPG A;  5J1X A;  5FPA A;  1BBT 3;  2IVI B;  3POF A;  2HJI A;  4XIL A;  2IXC A;  4P9X A;  1UY1 A;  4U2A A;  1HQN A;  4UFM A;  4N8M A; 
#chains in the Genus database with same CATH homology
 3HQU A;  2RDR A;  4XAC A;  3DKQ A;  5ERL A;  2G19 A;  5DAX A;  4IW3 A;  2Y33 A;  4XCA A;  2FCU A;  2RDN A;  4NHM A;  3ITQ A;  4NHX A;  4UWD A;  5LBE A;  3NNJ A;  4J25 A;  5DAV A;  3KT1 A;  3KT7 A;  5LBC A;  4BQW A;  5IAX A;  5C5T A;  3HQR A;  5IAT A;  2G1M A;  3OUI A;  4Y5S A;  3GJA A;  4ZON A;  5EP9 A;  2A1X A;  4JZR A;  2JIJ A;  5DAW A;  5EQU A;  5L9V A;  2HBT A;  3OBZ A;  2Y34 A;  3PL0 A;  5L9R A;  5IAV A;  3OUJ A;  3KT4 A;  5HV0 A;  5LBF A;  5LA9 A;  4KBZ A;  2FCT A;  5A3U A;  2V4A A;  5LB6 A;  3OUH A;  2OPW A;  5C5U A;  4NAO A;  2RDS A;  4Q5O A;  5DAQ A;  3BVC A;  3NNL A;  5LAS A;  4NMI A;  4XAA A;  5M0T A;  3NNF A;  4Y5T A;  4BQX A;  2RDQ A;  4NHY A;  3GZE A;  4XAB A;  3W20 A;  5LBB A;  2HBU A;  4MHR A;  5HV4 A;  3EMR A;  4BQY A;  3NNM A;  4NHL A;  5L9B A;  5DAP A;  2JIG A;  3W21 A;  5EPA A;  3MGU A;  4NHK A;  4XCB A;  2RG4 A;  3GJB A;  4ZPI A;  4XC9 A;  5LAT A;  2FCV A;  4MHU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...