4JZRA

Structure of prolyl hydroxylase domain-containing protein (phd) with inhibitors
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
211
structure length
204
Chain Sequence
PALKLALEYIVPCMNKHGICVVDDFLGKETGQQIGDEVRALHDTGKFTDGQLVSDIRGDKITWIEGKEPGCETIGLLMSSMDDLIRHCNGKLGSYKINGRTKAMVACYPGNGTGYVRHVDNPNGDGRCVTCIYYLNKDWDAKVSGGILRIFPEGKAQFADIEPKFDRLLFFWSDRRNPHEVQPAYATRYAITVWYFDADERARA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Egl nine homolog 1
publication title Novel complex crystal structure of prolyl hydroxylase domain-containing protein 2 (PHD2): 2,8-Diazaspiro[4.5]decan-1-ones as potent, orally bioavailable PHD2 inhibitors
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 59
structure length 204
sequence length 211
ec nomenclature ec 1.14.11.29: Hypoxia-inducible factor-proline dioxygenase.
pdb deposition date 2013-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13640 2OG-FeII_Oxy_3 2OG-Fe(II) oxygenase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.620 Mainly Beta Sandwich Jelly Rolls q2cbj1_9rhob like domain 4jzrA00
5LBEA 3OBZA 4Q5OA 4ZONA 5EQUA 5LA9A 3GJAA 5LB6A 5IATA 4NHMA 2HBUA 3MGUA 3OUHA 5DAWA 3NNLA 5LBBA 5DAQA 3KT1A 3OUJA 3HQUA 2G1MA 5DAXA 3PL0A 5A3UA 3GZEA 4Y5TA 4XCAA 4NAOA 4UWDA 5C5TA 4BQXA 3NNJA 5LATA 2RDNA 2RDQA 5LBCA 4MHRA 3BVCA 5EP9A 3EMRA 2JIGA 5DAVA 5ERLA 5IAVA 3NNFA 3OUIA 4NHLA 5HV0A 2JIJA 4XACA 4NHYA 5LASA 3HQRA 4XABA 5IAXA 4XAAA 3NNMA 5L9BA 2HBTA 2A1XA 4BQWA 4XC9A 2RDSA 4BQYA 2G19A 5EPAA 5M0TA 4NHXA 2FCTA 2FCVA 4NMIA 5L9VA 4KBZA 3KT7A 4NHKA 3DKQA 2RG4A 4MHUA 4ZPIA 3W20A 3W21A 5C5UA 2Y33A 4J25A 3GJBA 5L9RA 2FCUA 2Y34A 4IW3A 3KT4A 5DAPA 2OPWA 4Y5SA 2RDRA 4XCBA 5HV4A 4JZRA 3ITQA 2V4AA 5LBFA
chains in the Genus database with same CATH superfamily
1XNBA 4COUA 4KH9A 4Q5OA 2VZTA 1VRH2 2RS31 3PMSA 3ZKYA 4CU8A 4K7JA 2DUPA 1UPIA 4CDQC 4HZFA 4MLOA 5FQ0B 3NV2A 4N90A 3MFCA 1H4GA 5HI0A 1O4ZA 2HWB3 4YVSA 1OUSA 4ZU4A 1W04A 2OKXA 2E53A 3BTAA 1W90A 1J3QA 2NMOA 1QOOA 2UU8A 1ZRCA 4Q4X3 1ZBE1 5I0SA 1YCIA 3IB3A 1ALYA 4OHZA 1HXS2 2ID4A 5LCWL 5FBJA 4HKWA 2Q1ZB 5AFBA 5JUVA 4FTSA 2ZGNA 3MFAA 1V6JA 4XMIA 5F5CA 4TSVA 5FZBA 1WLCA 4HK9A 1O8PA 1ZX5A 2OX0A 2HWD3 3BOPA 2XHNA 2ZAAA 4Q1PA 3CEWA 3NNJA 5CFCB 1JZ8A 2EVXA 5FQ0A 2YB7A 2D40A 3LPFA 1SPPA 2VOTA 4Y26A 2RM22 2ERFA 4NIAA 1GV9A 3BVCA 1V0AA 3HR9A 2YPJA 1S0CA 1BBT3 3EMRA 4XFBA 5LA2A 4CCNA 4J1WA 5FZ7A 4F8AA 3BODA 4GH4B 1UYYA 4Q4V2 2HWF3 5C4WC 1RTVA 5FYMA 1TVGA 3O1RA 3AL6A 2I07B 4KGQA 1R1A1 2UURA 2VCAA 2Q1FA 4CP2A 1C57A 1A78A 3OB8A 4XACA 2WA3A 1UD1A 3KGZA 5DN2A 4OUSA 3VZKA 1N47A 3P1IA 1IS5A 2BNNA 5JOXA 1G9CA 4QX8A 3LCPA 2PQSA 2VUDA 3GGLA 1MR5A 4D69A 3M2MA 5CVRA 4XABA 5JXHA 2Z5WA 1QQP1 2VOXA 3TWIA 5KHJA 3ZFEC 4B4PA 2V4VA 3Q8CA 3ZIXA 3IM0A 3UKVA 2FZ2A 3I3BA 1ND3C 5H9SA 3L9JT 1SBFA 4PHZA 1AUYA 4QB1A 3SQOA 1RC6A 1VALA 2WNUC 1PIV3 1HRV1 2VE1A 4QKBA 4Y1VA 5JR2A 1JXNA 3W5MA 3PHMA 3AZWA 3OGRA 1KJRA 4K21A 4ORFA 1NA1A 2FCTA 3CKHA 3ZX7A 1Q8OA 4OUMA 2FCVA 3ILNA 4Q0UA 4UFLA 2IXLA 3SCHA 3NJXA 3CQOA 4AL9A 3U07A 4DRVA 5C8WA 2P6HA 1XE0A 5FY1A 3ROUA 1FXZA 1WCSA 2ZX4A 3KQ4B 4QXHA 3IAPA 2ES3A 3U10A 1HN1A 1RMU1 1OD3A 5DDJ2 4NROA 3WVJA 1QJX1 5FAXA 1QOTA 1CVNA 4FPHA 2QQPA 1W3XA 2R062 2C5DA 3I3QA 3TEYA 3NV1A 4XJAA 1OSGA 4A6SA 1YC61 3W20A 2BWCA 2BYVE 1RUNA 2D3SA 1CPMA 4YVSB 2JDHA 4K1YA 3UGFA 5KR7A 1ZBE3 3J7MA 2DVGA 4XIOA 5BNOC 3UL2A 4YGEA 1I6XA 2PTMA 3A21A 4X8PA 2XKPA 1F31A 5FYZA 5D8AA 3IMMA 3BALA 3AFGA 5I0DA 3MIGA 3VDDC 2VCBA 5ABJB 1KEXA 4BQ2A 1NZIA 1A3KA 2XKOA 3S5QA 4GWNA 4JC1A 5JIAA 4G3YC 4OMCA 3VN4A 1SBEA 2D7FA 1MS1A 2LM3A 2W68A 2XBO3 2B5HA 1RXFA 1IS4A 1C1FA 1FNYA 2P3JA 1SPPB 4JQTA 4AI9A 3OEAA 2NM1A 5CAZA 4LK6A 1W0PA 3THTA 5L7OA 4IEOA 1X82A 3LFMA 2R6QA 2J1EA 5DUUA 4I3PA 3AYAA 4AGVA 2E51A 3H50A 2GAUA 4JQRA 2PHWA 3B7MA 3TEWA 1LEDA 3OUHA 1FX5A 2YC0A 1R1A3 2WN3A 3F95A 3PURA 4C8DA 1PGL1 4QB2A 1OPOA 1FT9A 1GLHA 1DLCA 1DZTA 3AK0A 4ISRA 1LESA 5DAQA 3NSTA 1OFSA 4QQLA 1JZ3A 4Y5TA 3EHKA 4YGCA 2DDUA 2W3JA 5F32A 4CP0A 1OD5A 3CHXA 1CAUA 3ETPA 4IE0A 4YYOA 1VPHA 1N3QA 4RYDA 1QQP3 2ZX0A 1CN1A 2VZUA 3E6BA 2A6ZA 3D4KA 4PDWC 4AWDA 1J1TA 1YIFA 2ZPXA 3VL9A 3U0ZA 2WT2A 1UXZA 3D5OA 4CCOA 3VKFC 3O12A 2BFUS 1G9AA 1W8OA 1HRV3 2BQPA 1HB2A 3E5QA 2VG9A 4ZS2A 5IYYA 2TUNA 4NIGA 4E2GA 4OCTA 1K5MC 1PVC3 3ELNA 3FFQA 5C3PA 4HL0A 1O3SA 2G9FA 3INAA 1ENQA 1CGPA 2D6KA 1W2AX 1ODNA 2VW1A 3ATGA 3GZAA 3PU8A 4CE8A 1CX1A 1YJLA 3Q8EA 1H9PA 1EUTA 1QJU3 1OH4A 2NLRA 1CAWA 5CA6A 1C5HA 1VBD1 4PJYA 1BMV2 1V6LA 1QU0A 2ZEZA 1R081 1ZZ9A 3FE5A 1ULPA 4RN5A 4M3CE 3K75B 3VDBA 3AMQA 3PJYA 1UYZA 2RJKA 4XJZA 3WNLA 4AZZA 5D21A 2XUEA 4HETA 3Q8AA 3LF7A 1NCQC 2CAVA 1JZ7A 1AVBA 3DV8A 1IPSA 1WMXA 3MW4A 1S2KA 4IEWA 4RQPC 5JIUA 5CG9A 3I59A 5T54A 4RD7A 4DUVA 3U4XA 3WCSA 2DFCA 5D8AB 5IK5A 4INDA 3ZN5A 3MLKA 2Z4FA 2QVSB 4PIXA 3U37A 1OH3A 2Y6LA 3DYPA 4RHV2 1O3RA 2ZA9A 4CDUC 3OD0A 4A44A 2Y64A 3FLPA 3VBRA 5L7OB 1LGCA 4R9AA 5JR7B 3E5XA 4AGRA 1SLIA 3DKWA 5CADA 3FBMA 3J9SA 2WZPP 5ACA2 3WT3A 1S0EA 2ATFA 1RJ8A 2CNAA 4IUGA 4NRPA 3RGBA 5BNPA 1Q5OA 1IS3A 1C5IA 3VBOB 4QQ2A 3PUSA 5AC92 1AL21 3ECQA 1WLTA 4BJ0A 4D6QA 1ZZCA 2QQOA 3T2TA 2XLAA 5IHRA 1CAUB 5LBEA 2W5FA 1X8MA 2PXJA 2ADDA 3ZPOA 4QGMA 2HWC2 1TZOA 2XVKA 3AP9A 1GZCA 1V6MA 3JXSA 4P5YA 4Y1UA 4ZONA 1W9FA 1H6XA 2ARAA 2VZ1A 1W06A 5CFCC 5JOWA 2BU9A 1YQ8A 1DYOA 2C9KA 2N7GA 4IXLA 2W87A 5IATA 4Y1ZA 3GDBA 1RUOA 4QHOA 1DG6A 4CCKA 2VUJA 2WYFA 4LBKA 5EXOA 5LRRA 3L2YA 3VZMA 1O5LA 1QJZA 3HQUA 4GH4C 4LA2A 1O6UA 1ST8A 2F4PA 1H1AA 3S30A 2JENA 1UPSA 4G4FA 5CKMA 3O0VA 2JG9A 1VBD3 1FV3A 1RIRA 2EAAA 3POFA 3E97A 5DUVA 3JD73 1CAWB 2R1DA 2W1SA 4EQVA 1WLDA 1DP0A 1R083 3C3VA 2R30A 2AEZA 3MIHA 3TN93 3FHQA 1RHI2 1WGPA 3POJA 4YFZA 2JE9A 2AYHA 1RUD2 5LBBA 1U5ZA 3DPRA 2Y60A 3IIIA 3R4SA 4R9BA 2ZXQA 4XYXA 5ERLA 1CR7A 4DUWA 4TZDA 4MOAA 1QJFA 4QM8A 4C0HA 2YZ4A 3SHRA 3H8OA 1QXRA 4DIQA 5FPUA 2DVDA 4UW6A 1UOGA 4WM8A 4SLIA 5FZAA 1IG0A 4E4DX 2OIIA 2QNKA 5GALA 2JIJA 2WA4A 3I59B 3THPA 3ZYIB 5A7OA 3HNYM 4AHYA 2WS93 4N43A 1WCDJ 3BIEA 5HCHA 3RMYA 5APAA 1OPMA 3N4MA 2HEWF 5A3WA 1IG3A 4EJRA 4HOOA 1UZZA 4FTBA 2BDRA 4G9SB 1HKDA 4P14A 1PGW1 1Y9QA 2DV9A 2E26A 2JDMA 3HQRA 4BDVB 4CVUA 1CAVA 5FZKA 2BGPA 4BMEA 2BVBA 4QMAA 3TNQA 5F7UA 1UIJA 5BXXA 3VBRB 3C7EA 2K2SA 5JDBA 2QBXA 2QDNA 2EALA 4DO0A 2ZOEB 1RUC2 4BQ4A 3D3AA 3THDA 2ZBJA 3LZZA 3I2DA 3WCRA 1W0NA 4HG6B 1PM4A 1I3HA 1SLCA 2MHFA 2QQWA 5DG2A 5EPAA 5M0TA 1B09A 1O5UA 3PVNA 2GSYA 4YVSC 2VOVA 5BNPB 5JSPA 4AFMA 2CSGA 3POGA 4HVOA 3SXWA 1CWPA 1F15A 3K4DA 1Q8QA 2DCYA 1POV1 2BTVC 5DMYA 2R0HA 1VBC2 3KT7A 1CZVA 4JKLA 4COZA 1C28A 1I5PA 1QNWA 4ITCA 1VBE1 4LHLA 3GBGA 3MPBA 3C7FA 3DKQA 2IFWA 1WW4A 1IZ3A 3CBNA 3SCFA 1JYTA 2FZ1A 1C8M3 3QH7A 1ENRA 2IC1A 2EXHA 4YM1A 4AK3A 2RV9A 2PHTA 1OLQA 1SDWA 3K46A 4YARA 1UCXA 2LTNA 2EXKA 4IW3A 1KS4A 2XR4A 3W59A 2W0XA 3M7AA 4COVA 4HKLA 5FUPA 5CFDC 5LY2A 5BNNB 3MW3A 5KXBA 2PN5A 4A45A 4L2NA 3WEZA 1SEFA 3BPZA 3ST7A 4XCBA 1Z78A 4WM7A 4IEYA 1A8DA 2J1AA 1OBNA 2JDNA 2JG9B 2WIIB 3ILFA 4U36A 4FPGA 1Y7BA 3RWKX 2RR13 1RVF3 1MEC2 1U12A 2GU9A 2AEYA 3ES1A 3T2QA 2YFUA 1RL3A 1UY3A 2WSUA 2JJ6A 1LHNA 1GWLA 2EA7A 1EP0A 4QX5A 3C7HA 1RUH1 3DPRB 4LBQA 2BP6A 2YFZA 3DYMA 2IXCA 4DY5A 5A7SA 1OVPA 5JI9A 1SLTA 4IGOA 1KD7A 1Z7S2 4WM8B 5GJ6A 1RUI1 1S0JA 4CU7A 5IFPA 2JD4A 3O1OA 2X29A 1MZ5A 4D6RA 4A41A 4N43B 2RS11 2QZ3A 3ZOIA 2MEV3 4XCAA 3B02A 2WC2A 3PUAA 3VKOA 1PMIA 2PQQA 4NE9A 2JDAA 1CJPA 4Q2FA 2H6CA 3WDUA 4B8EA 3APBA 4ATFA 1JOPA 1CAVB 5J7MA 1COV2 2AR6A 4LULA 3H42B 4CP1A 3ZR6A 3K3NA 1YO8A 2W08A 2GC0A 4W50A 3ZYJB 5A3LA 3S57A 1E5RA 4Q1RA 4BE3A 5FYVA 4BQ1A 3VD3A 2R073 2EF6A 1AYM1 5IVEA 5A6XA 5K8SA 2HKXA 2FDHA 4LTAA 4IQPA 5JAXA 5AVPA 3O1MA 1SCRA 2VNVA 3WNXA 1POV3 4AVVA 4OHWA 1N1TA 3G7DA 4BZ4A 1EV11 2QFEA 2QQVA 3I97A 3WLUA 1VBE3 2ZCWA 3IBMA 4LKFA 4AF9A 2GZWA 2E7QA 2VCCA 3CO2A 4IE5A 3C7GA 3CF6E 3MIFA 5D8AC 2XVGA 4P9JA 3NRUA 3V64A 4B29A 1W9TA 1T2XA 4W8JA 1NLSA 3FLTA 4GQ7A 1JYCA 1D4VB 2VQAA 3WW1A 1R092 3NJVA 1AR92 2VMFA 3MDPA 5GZGA 2HYXA 4AI2A 2BOJA 4AQ6A 4IGQA 3HAGA 4A2UA 4N7UA 1W8UA 5L7OC 4AVCA 2VPVA 1OLRA 1JH5A 3X29B 2E33A 3HD8B 1ACCA 3RSJA 4Z8BA 3B9IA 2ZABA 3H8UA 3I2IA 1X8EA 1BHGA 2WWJA 4KBZA 5BNQA 4XUNA 4WM7B 3O1VA 5CYYA 4PBOA 2OA2A 2NP0A 5IVVA 1WUVA 1AF9A 4Y22A 3VBOC 3ZXJA 1RB8G 4W6XA 2JG8A 1J1LA 2WT1A 3EXUA 3OYWA 1X36A 1RUH3 4LBQD 4LUMA 3WG2A 1LECA 2YMZA 4Q4Y2 4WVMA 1PO22 2DURA 5F3GA 4LBQB 3ASIA 2WINB 1WW7A 1RUI3 4A4AA 4YW2A 1W2TA 5DAPA 1OA3A 1I1EA 4NR1A 2DCZA 2YPDA 3ES4A 4CCCA 4GJYA 5JLVA 1QJY2 2W46A 4HANA 5C33A 5E1RA 1GANA 2RS13 1GUIA 2FDFA 1UAIA 1G86A 2XQRA 4N9HA 1KGYA 3KQRA 1ZRDA 5DZEA 3A0NA 2ZAHA 3ZXKA 4QPYA 3TBDA 4D7SA 5GLVA 2R0FA 3HT1A 4IDZA 4FBFA 2Y6GA 3LPGA 4QXBA 5FZIA 1T6BX 3WNMA 4O9GA 3THCA 5CG8A 3HQXA 3WSOA 4XBNA 2WFF2 3ZDSA 5SV8A 3N9QA 4KWLA 4JGYA 4Y33A 3BU0A 1LHWA 4NAMA 1AYM3 1YYNA 2VC9A 4I2OA 5FZ1A 3DF0A 1MS9A 5FY9A 3CU7A 1D7PM 3N36A 2J1TA 2NQYA 4O7XA 4OHXA 4NPMA 4PLMA 1E5IA 1FPN2 3MIEA 1BEV2 4HFSA 1X50A 1ZZ6A 3HT2A 4NJ4A 1GYKA 2Q0AA 3FWEA 3V56A 5LATA 1V9U1 5FXZA 5T55A 3ZXLA 4CA9A 4YZ2A 1YJKA 3ZSEA 2VZVA 2DU1A 1LKNA 4LO6B 3BUCA 1QXPA 1YHFA 4V2VA 4MO3M 1BLZA 1YEWA 2E63A 2GNMA 1KJLA 2LRPA 5J98B 3S7IA 1L7RA 1AJOA 1ODMA 4XEZA 5FWEA 4LHSA 1OQ1A 3CNAA 1XYOA 5CB7A 1O7FA 3LDRA 4I01A 1RXGA 4JGZA 3LKJA 1VRH1 3MPPG 1NUKA 1Q56A 1EV12 2DBIA 2WWSA 5CKQA 3UGHA 3VBRC 3VUOA 3LEGA 5C7GA 4OMDA 2CV6A 4AG4A 1W05A 2P6CA 1RUF2 4CCJA 2A6YA 4NHYA 5JZGA 1GP5A 1FI2A 4DQAA 3POWA 3H1YA 1HXS1 1JBCA 3K51A 3VHOA 5BNPC 1S0GA 2VZ3A 4Y22B 5CNAA 1JHJA 1F5FA 2A70A 4I0WB 5F3EA 3T4VA 5KWRA 1LNSA 2JG8B 3S6PA 2J1SA 3OYWB 4HN1A 3POIA 2YGMA 2YV8A 3SEEA 3VGIA 4WVMB 3I2JA 2VGDA 3K4ZA 1PMHX 5FK7A 3RZLA 2R043 3AB0A 4PQQA 2BPA2 1S0IA 2RM21 4QB6A 4LIVA 2HWE3 4YNIA 1LOGA 1APNA 1CQ9A 1WW5A 4YG3A 2GNTA 4X6QB 1J84A 5FV3A 3ZMOA 4NMIA 2WLQA 3GHNA 4XF3A 5L9VA 3IDAA 5IK4A 2DCKA 4Q4V1 5KXDA 1JUIA 4AR2A 1JUHA 1YXWA 5DPNA 5T5OA 2Q4SA 4KWJA 5BNNC 3SCGA 4QQOA 4UW4A 2VTXJ 1YRZA 3R05A 2X53S 5HXVA 2IXHA 4ASMB 5ABJA 3HEIA 3S0MA 2P5BA 2KD7A 4H7MA 2JG9C 1OKQA 2CDOA 4EZ4A 2OQ6A 3ZSJA 4JGYB 2VMHA 2Q8CA 4UXAA 3ZSMA 2OT7A 1RUG2 5FRAA 5JSOA 1H2NA 2OUHA 3H7YA 3TEXA 1OKOA 1M4WA 3FUOA 3JU9A 4DPNA 2ADEA 3DPRC 5I0RA 2YC2A 4JCKA 2GC1A 1BJQA 1SACA 2HYKA 2ORXA 5DUXA 4FXGB 1DGWX 4WM8C 2YBPA 1OT5A 1DDLA 2VQUA 5FYUA 2IXJA 2LS6A 4DOUA 3GBFA 4UFKA 1G7YA 4N43C 1OLME 3ACIA 3B9CA 4IE6A 2VBDA 4QX0A 4AQTA 3E6CC 3WZ1A 3VD7A 3ACLA 4M3CB 4AAXA 5EQUA 1PX4A 1Y4WA 3E6DA 3QBQA 1DLLA 5LA9A 4A3XA 4ASLA 4E8DA 2C6SA 5FY4A 2J1VA 3MGUA 1LHOA 1JU4A 2D5HA 1UU5A 3MUY1 2IFRA 1WMDA 4JGZB 4XFIA 5EHDA 4DS0A 3AJYA 1G8WA 4Q4W1 2R061 3KT1A 3ZPYA 1AX0A 1HQNA 1BYHA 5BY5A 1GSLA 1DZRA 3CDZB 4BQXA 2Y0OA 4KWUA 3VBSB 4A7YA 5JZGB 5HXMA 2UWAA 2RDNA 3TRSB 3J8F2 3KVAA 1TME3 1DQ0A 1AR72 4CPBA 1I5ZA 3GCWA 1ZNPA 4Z07A 5LBCA 2V5YA 3I3DA 2Y6HA 5EP9A 2WAOA 3U4SA 4D94A 1ZBA2 5A6QA 3MF6A 1VAMA 3P3NA 5KHHA 3WV6A 2PA7A 2RM23 1N1VA 2ZHKA 3O1PA 2J7MA 3AKPA 3I7DA 4DXRA 1QIQA 5JOZA 2JDZA 1W03A 4FPOB 4BH9A 4XPVA 4UFJA 4D3WA 2A7AA 1ULDA 1XSQA 4XFCA 4CTEA 3EQEA 2BVVA 4K8FA 4I3GA 4QT6A 1JYNA 4M3CF 2P4EA 5BUVA 2DVFA 4FPEA 2XONA 4IEZA 4RGGA 2BFUL 4YZ4A 3C8XA 3PNAA 4KQ7A 4RSUA 3ZSKA 1H6YA 5JCTA 5EIYB 4OI2A 5CFDA 1DU3D 2GP3A 3IDBB 1AXZA 3M70A 4S2DA 2VMCA 4WM7C 4XXPA 3T0AA 3WQ0A 3WDTA 4C1WA 4XFHA 2O14A 4MXWA 1SFYA 1NY72 3CMGA 4M0NA 1ONAA 2JKBA 1RJ7A 1FMD2 2BNMA 4YW4A 1JTZX 2G19A 1DQ1A 2DVBA 2BGOA 4BLJA 2CY6A 3E1F1 3RZKA 4LPLA 3AYCA 4NHXA 5FUNA 5FY0A 4AFAA 1XJAA 1UZYA 4META 3TNPB 1LRHA 1F35A 1RYYA 3KHCA 2ZMNA 2W1UA 2GH2A 3R0RA 2YUEA 4Q4X2 1LENA 1OQDA 3OPZA 4W65A 3B93A 4LIUA 3UJQA 4BOWA 5KC6A 1W8NA 4ARXA 1WWYA 3JB8A 5IJRA 4NIHA 5AVAA 1J59A 4XZPA 4XURA 3HNMA 2E32A 2FQPA 2ZTNA 3IIAA 2GALA 2HWD2 4IEPA 5DDJ3 3DGTA 5LEJA 4UW3A 1WCQA 4GKXA 3KVBA 3KLSA 3R4DB 1AZDA 1BMV1 3RJ2X 3I3MA 2VBBA 1AR63 3KV9A 1UMHA 4LLFA 4A42A 4A6OA 4IV3A 4RFT0 5FKBA 2FDKA 3RWNA 3LIGA 4A3ZA 3FN9A 1Q43A 2XOMA 2WNVB 4NVPA 4P00B 2B4KA 3B3QE 5JI7A 2HWF2 4CPBD 5JOYA 1UMZA 2D6NA 2ET1A 3KCXA 1PZ9A 2ARBA 2E9QA 2RS33 3FX3A 3W58A 4A7ZA 2G9GA 3UT0A 4YW3A 4MGIE 4Q4W2 2Q1MA 2QQKA 4DXZA 2TEPA 2CWMA 1JZ6A 2X09A 4AHZA 3GXUA 3GJAA 4MVTA 1CESA 3CLPA 3BTZA 1TNFA 3ZM8A 1GZWA 4RHV1 4FPLA 4LBMA 5GM0A 1YLLA 2QQIA 1VB2A 1UW8A 4RS5A 3WDYA 4YRDA 5DAXA 4GXLA 4MYEA 2YG0A 2PLV2 2FMDA 3GHMA 2ZKLA 4NAOA 1PZ7A 5J36A 1VAVA 3AP4A 4CUGA 2A6VA 2GN7A 2VVFA 4NWVA 5ACA1 2GMEA 2ET7A 2JDKA 2Z79A 4UT5A 4LE4A 3TEZA 4BQ5A 1YI7A 3WOGA 4XBQA 4MHRA 3P6BA 5IVYA 1FATA 3WDWA 5AC91 1S4CA 2XMLA 4OHVA 5CFDB 4HMZA 3OEBA 5DAVA 3SH5A 5FFOC 4C90A 1JYVA 3OUIA 4NWWA 2ETEA 4MXWB 1O8SA 4LO7A 1FYUA 1GKBA 1TG7A 4UW5A 2CL2A 4XOGA 1IGOA 2HWC1 2JG8C 2WZR2 2FHRA 4MG2A 1UX7A 4KL1A 4FQ4A 2WO2A 4I30A 3VBOA 4QQPA 3SMHA 4XUTA 1N1SA 1H30A 2ZGMA 2IXKA 3FC0A 3WINE 3S5AA 2XH6A 2WSVA 5C6CA 1DQ6A 1DYKA 1WLWA 2JD9A 4FPJA 3ZFFA 2ZJCA 2SLIA 1UKGA 1C3HA 5FCCA 3KM5A 4O9EA 2VXRA 3HN1A 5FPVA 3VZJA 3I8TA 1TMF2 3JZVA 4AQSA 1ULCA 1XYNA 2BEOA 5A7WA 1QF3A 3FLRA 1DBNA 3ILRA 2WYSA 1QDOA 3EB7A 4YVWA 2DU0A 2RMU1 2WR9A 4XC9A 5BYNA 5CISA 3I2OA 4BQYA 4DY3A 5BPXA 3VD5A 1RHI1 1HN0A 4YM0A 2Y8KA 1PVXA 3UV9A 1RUD1 1SG3A 4IV3B 4FFGA 4JGYC 4CUCA 4ZU5A 1E5HA 2VMGA 5JVVA 1GQGA 1JYIA 2XVLA 1IS6A 2Q8EA 2VOKA 1RMU3 3B94A 4D7YA 1W6PA 2WO1A 4LEJA 2QJVA 1QJX3 4Y24A 4GKYA 4MGTA 4TYSA 3LEIA 3R6SA 3U1XA 2F4LA 5HPOA 4QX1A 1Z0HA 3UNPA 4MADA 2O0OA 1ZZ7A 5J3UA 1OA4A 3B01A 1LAJA 4H14A 1OURA 4RHV3 4CDXA 2GC3A 3OG2A 1GZWB 3HN3A 2YYOA 2OPWA 1KRIA 2CHHA 3EJKA 1HJGA 5EJ3A 4OQ9A 4RS5B 3OPWA 1KITA 1RUC1 5FZ6A 4JGZC 4N53A 5H9PA 4ZXEA 1U5XA 2K9ZA 4MUVA 4QGNA 1LJ7A 1GQPA 2UWBA 3T0BA 5JMCA 2EIGA 1PVC2 3B5LB 1TNRA 1WMEA 3OGGA 3WUCA 1Y9GA 3NO8A 5AC93 3OBTA 2C0ZA 3SH4A 2XL7A 2VMEA 3VBSC 2RVAA 5HCBA 5JZGC 2XJSA 3BGAA 5A1LA 1CAXB 1VBC1 1H0BA 4JTNA 4TTGA 4PIYA 1O91A 1QJU2 3BKZA 3J7NA 4XFGA 3ZR5A 1XXNA 5DZGA 4BU2A 1YFWA 3NQHA 2RHPA 1CX4A 2L9LA 1REFA 5A1FA 2W2IA 1WZXA 3OD4A 3H3UA 2OZJA 3TAYA 1X9PA 4XFFA 3HNBM 1WD4A 4XF9A 3ZFFB 2I74A 3N9OA 5FPLA 1IQDC 3MO4A 2CTVA 1W8WA 5G04L 1JN2P 5T5PA 1ULFA 4MXVA 5A7WB 3PDQA 4QXCA 5IUQA 3I3EA 4H55A 5FZCA 4DFSA 1H2LA 1U5YA 4YVWB 3A0KA 1MEC1 2K0GA 4LO5B 1NZCA 1RHI3 2IVJA 3GNEA 4RA0A 5FLHA 4WZFA 3SKVA 5ABJC 5BNNA 4XIKA 1MS5A 2JB4A 3UKNA 1XU1A 2W95A 2BBVA 4HVRA 4P9WA 5E6HA 2VZRA 1W9SA 2WLPA 1D2QA 5F9TA 3RQ0A 3WHTA 3ZYFA 5FZ8A 1Z7S1 1REEA 3HJRA 5FZOA 1W6PB 1JZ2A 3IDCB 2Z69A 2RMU2 2AREA 1A34A 2D6PA 2ENRA 3J4UH 4HSLA 2B39A 2A3WA 1HX6A 4CZSA 2PHXA 2CDPA 2WZ8A 3VKMA 5DQ0A 2WRAA 3WF2A 1J3PA 2ZZQA 5GZCA 3BN6A 2J22A 3DXUA 5CEHA 5KBFA 1T6GC 1EAH2 2CGPA 2XXZA 1Q3EA 4LHNA 4CDXB 1YNAA 1COV1 1MACA 3KV5A 3OF1A 2AH2A 5F37A 5IW0A 1STMA 3NVCA 4QAWA 1W8ZA 4ES9A 4PT6A 1L3JA 4L92A 4EWAA 4WVVA 1O4TA 4GMP1 4LQRA 4N53B 4Q29A 2D98A 4OQ8A 1AL0G 4GB31 3O5SA 3K4AA 1Y43B 2GC2A 5E88A 4YZ1A 2D97A 3I49A 4R4ZA 2CYFA 1OLMA 3WUDA 4XE9A 2WNVC 1GWKA 4GAZA 1FOD1 1NE4A 3WQBA 2Z2SB 1JU3A 2VZPA 5FZ4A 1VBC3 4AVAA 1B35A 2V72A 2NPIA 5FP7A 3GJBA 5L9RA 5LRSA 4J6GA 1DCSA 1NLQA 2ZGRA 4E27A 4RR3A 3MW2A 4R9CA 3W9AA 3PMEA 5FZFA 3WHUA 2HJIA 3JD72 2J42A 4FFHA 1KFXL 2WO7A 5ANQA 1SMVA 3TN92 1YQ6A 3H3LA 3ZN6A 2WNEA 4XUQA 1RUE1 4QHZA 2PELA 4XHXA 1R091 1AL23 3K77A 1VMHA 3O0WA 1AR91 2RJLA 4Y1XA 3T09A 2YY1A 5HV4A 4XF1A 1A8MA 5DG1A 3ITQA 4PF5A 3U78A 4AAPA 3PUQA 1RUJ2 1YQCA 4HN0A 3OTFA 2AUYA 4P02B 3V65A 3ZXFA 4BQ3A 2VH9A 2XB6C 4GWMA 3VHRA 2D3RA 4P9YA 5E8AA 3UETA 4COWA 1YFYA 3GZUC 1H8TA 3OGVA 1VB4A 2C1FA 3SNMA 4V2WA 3WF4A 3AFKA 5FOBB 4NHMA 1J83A 2HBUA 1NKGA 2VCMA 4WV8A 4D6SA 4AVSA 4FAHA 3FFZA 2WQ4A 3RI8A 1KXGA 3M1HA 3J26N 2EXIA 5IVBA 4EYUA 1LHVA 4Q4Y1 5FXWA 1PO21 5L19A 1GNZA 1US2A 3K48A 2OXBA 5H9RA 5FMOL 1W8HA 5I93A 1AYN1 1NCRA 5FZOB 1UL9A 1XC6A 2YU1A 3IPVA 1QJY1 3HPNA 4Y1YA 1LOBA 3ME2A 2QQLA 4IESA 1W8TA 4KG0A 1UNBA 5DXDA 4AGGA 3KCYA 1XB9A 1POQA 2QQNA 2RS52 3T1LA 2VL4A 3WQ1A 3DUIA 2WN2A 1BVP1 1COV3 5GLWA 2EIEA 4IE7A 4E2QA 5A3NA 2VJXA 4MGYE 3ZXEA 5HV0A 1CIWA 2WL1A 4QKNA 3FMGA 4UOJA 2WFF1 4GZ9A 1GNHA 1UU4A 2KR2A 4GMP3 3HMYA 1FAYA 3KB5A 5FYTA 4R52A 5J37A 4HSJA 3WNNA 4NPRA 1XE7A 3AZXA 4OVEA 4YSFA 2QQJA 2ZX1A 4FP2A 4IV3C 3WG1A 2MPFA 1YQ5A 2KA3A 4LR4A 4X8NA 2QKDA 4NRMA 1H2KA 1FPN1 1US3A 1BEV1 2PFWA 3MHZA 4PQ9A 5DUWA 1DGLA 2VULA 3N7MA 4FOQA 4XQWA 5JPMB 1B35B 5FO8B 2OPKA 4BQWA 4QPIA 2CGNA 1VMJA 3HVDA 4RR3B 3WF1A 4GB32 1HRI2 1RVF2 1OHFA 2RR12 1ZM1A 1GNYA 3JB4C 4JKMA 4NRQA 4AOCA 4ZKTB 4FI9A 2P3YA 3TB0A 1SQ4A 2ZMLA 3D6EA 1AR93 3ZN6B 2NZ9A 2LROA 3QOPA 1RINA 3E5UA 4UF0A 1FOD2 3UGGA 1S55A 4GA9A 2AENA 5IVCA 2WNOA 4NHKA 2XJPA 4RS5C 2Q8OA 5FZDA 3MIBA 3Q8FA 1RUF1 1CD3G 1OOPB 4EZHA 1H8TB 4QX2A 2X10A 4TLFA 1RUE2 3UESA 1A6CA 2MEV2 3MLJA 3AMNA 1WBFA 1LODA 2R32A 4RFRB 5K4LA 1TE1B 3DXTA 2BZDA 4GWJA 4JV4A 1OF4A 1VBA2 3AM2A 3N7KA 5C9AA 2JDUA 3VBHB 4Q4Y3 2B42B 4LKEA 3IMNA 4XJUA 2C24A 2Y0IA 3H9AA 1ZRIA 4FPKA 5FO7B 3VBFA 4EWEA 4BIOA 4QQHA 1FNZA 1UWWA 2DF7A 3OJBA 1NCRB 5I91A 3SISA 2OQ7A 4ARYA 1GWMA 2V73A 3CJXA 3IPVB 4D7TA 4AFBA 4O61A 5FR3A 5A1AA 1F5JA 4XMAA 1DZQA 1VP6A 4A7KA 1E57A 4ZHNA 3N9MA 1LEMA 1W6NA 4MGKE 3AVRA 3ZFFC 2IUWA 4C0BA 4KG8A 5C71A 2D6OX 2A6XA 1QJEA 1NE6A 4CXYA 2ZGOA 1AYN2 4LXLA 2UYAA 3NNLA 1UKRA 4AVBA 1W28A 4XDQA 4YVWC 4AYUA 4B4RA 4FP3A 2WAAA 4LUKA 4AEDB 3AKQA 4UYBA 3BB6A 4W6WA 1GFF2 4AFCA 2PHUA 1RUG1 4YZ5A 3Q8BA 3DEMA 4L8QA 4IEQA 3OGJA 3WD5A 1QY4A 1FPN3 5FMOS 1BEV3 3PJQA 4CUAA 5FYBA 1NXD1 1QKQA 5LK7B 1V6KA 3NJZA 2VR4A 2LALA 3ON7A 3AYDA 1NLRA 2Q30A 5FZHA 4XZUG 4QPIB 1S2EA 5FPAA 2YHJA 2FDIA 4OI0A 2UWCA 3GF6A 2XG3A 2CWSA 4K40A 4AFDA 4PI0A 2JKXA 5FZMA 4CDXC 2D5FA 1XU2A 4UF0B 2VW2A 4LK7A 3VDAA 1EV13 4TWTA 5A3MA 4NN0A 4S2GA 4RL7A 3ABZA 5EWSA 1RUF3 3LAGA 4MZUA 4HVQA 4N53C 2JEMA 2DTWA 5FZGA 4CEWA 4M3CA 3NJYA 3GBWA 3ZYRA 4DINB 5B4NA 3J8F1 1GOFA 3KZ4C 2NMNA 1S0FA 3AX4A 1VE0A 1UY1A 3RVHA 1AR71 1X7NA 2YU2A 1OFNA 5D2AA 3ZXAC 2VTXA 2CAUA 2DUQA 3U14A 1ZBA1 1VBB2 5C9AB 1GOHA 3HIFA 1UO9A 4YW6A 3WNPA 5A6ZA 4FVVA 4QDQA 1MZEA 3MYXA 4MSVA 1S1AA 5B2GB 1HB3A 1SHWB 3VBFB 1YIPA 4MGQA 3VBSA 5KHGA 1HB4A 4GIQA 3FBYA 1KDMA 3CZUA 3PIGA 4QWNA 5JPNB 1LULA 3GCXA 2DFBA 1C4RA 4LT5A 4M0HA 1MQTA 1W6NB 3DL3A 3AXDA 1TEIA 4FOVA 4MV2A 3RS6A 2XJUA 3POBA 5J1XA 3O0XA 1XBFA 2ARXA 5TSWA 5CU1A 2WT0A 1LOFA 3VZNA 1HV1A 1D0HA 4C1XA 4DMIA 5LZ6A 2B9UA 4HK8A 3PTYA 1PM7A 2HEVF 3UKTA 4XF0A 3K3OA 1W6QA 1OC1A 2JDYA 2V4AA 4HPKB 4IV1A 2TBVA 1NY71 3N7LA 1SBDA 1XOYA 1AR82 3O1UA 1GU3A 4ATEA 1FMD1 2KXLA 3N9LA 2GNDA 3WW3A 1D4M2 3T4HB 1LU1A 3NWKA 3VZOA 1ND2A 3QCWA 5GLZA 4Z2WA 5L36A 5GZFA 1JZ4A 4Y3OA 4ZXKA 2HWB1 4Q0PA 4YG6A 5IVFA 5LB6A 1JOBA 2ZGLA 4F83A 4Q8LA 1W2UA 4Q4X1 5DAWA 1LR5A 1UOFA 2G4IA 3S7EA 3M4FA 3RI9A 1SCSA 5G05L 3M3EA 3AJZA 4AI1A 5T5LA 2G1MA 4AHXA 1MZFA 1Y9MA 1ZZ8A 3OBRA 1UY2A 1W8FA 1DF0A 2HWD1 4DUXA 1AX2A 1XRUA 2W1QA 2VAUA 1V9U3 1HIXA 5F5QA 4ES8A 1BKZA 3N3HA 4IEVA 2HWE2 1VMFA 5IK7A 3H8RA 4CEWB 5CBLA 1LB2A 3J8F3 3NNFA 4LMFA 4QXKA 1H1IA 2HWF1 5FPBA 3VV1A 1AR73 2NN8A 4WZCA 5IK8A 1VRH3 2ZACA 3KSCA 4DB5A 1R64A 1ZVFA 4EN7B 1S2BA 3EO6A 4PF1A 2FDGA 3MF9A 4DZGA 4R8HA 5GLUA 3T1MA 2ZGUA 5JMOA 1PO12 1IHMA 1B35C 4XHBA 1ZRFA 5L73A 4L0PA 3UYJA 1WA6X 2P3KA 3LB9A 4LJHA 4RR3C 1VR3A 1XSRA 4BCUA 4EV0A 1EPWA 2WNVA 2ZEXA 1NOVA 2P17A 3OGSA 5K0UA 2E7AA 1HXS3 4BB3A 1K42A 3NV4A 1UN1A 5A32B 2XJQA 4H3WA 1S0DA 2ZMKA 4FPFA 5EV7A 1W6MA 1DQ2A 1PNFA 2PLV1 4R4XA 2P2KA 3QACA 2HBTA 4XDOA 1CJDA 2BNOA 2VVDA 4YZ3A 1MQTB 5FPXA 4HKOA 4AI3A 4CUBA 3BIWE 3VL8A 2BJSA 3ZN4A 1ASJ2 1UOJA 3DCQA 4UBHA 3WG3A 2BBAA 3LOBA 1HQLA 1OOPC 4QPGA 1W2NA 1H8TC 1BCXA 4M4PA 3RYKA 2GMMA 5A3PA 3BU7A 1VIWB 4EE2A 2PYTA 4YFWA 1GZTA 1W6QB 2CU5A 3IAQA 4Q4V3 4IV1B 1PK6A 2Y6FA 2A3YA 4EROA 4UFMA 3PUIA 4K9SA 4FFIA 3VBHC 2WZR1 5KXEA 5EYYA 2WKKA 2EAKA 2A5ZA 1XNKA 2XJVA 3MBWA 2ZHNA 3WR0A 3ACFA 4MHUA 1ND2B 2GMPA 4BLIA 4FAGA 1IPJA 4L11A 5ISLA 1NCRC 3OY8A 1LOAA 2IWGB 2PAMA 3C7OA 1POV0 1CPNA 3JBG2 4Q0QA 4DNYA 5JXJA 4YG0A 2X5IB 4I0AA 2QCSB 5FPZA 1TMF1 5DZFA 5AFEA 1TME2 2OYZA 2Z42A 4CYDA 3TOJA 5HBAA 2E7TA 4JZRA 1UY0A 2VTFA 2YC4A 3POEA 1W6OA 2HWB2 4YW1A 2X05A 4YWAA 1HDKA 3HBZA 4NOTA 2XBO1 5FJHA 3O14A 1GZ9A 2ORZA 5FMBA 3RYPA 5JXGA 4AEDC 1LHUA 2XJTA 4BHPA 2JX9A 4CXXA 2C4XA 3ZYGA 1Q8VA 2JE7A 3ENRA 1IKQA 2FDJA 2XQXA 4AEJA 4COYA 2D44A 2VY0A 5FIXA 4E8CA 3WP3A 1I9RA 5T3NA 5FWJA 3LIHA 4YM2A 2DUOA 1YFXA 4J1XA 2D6MA 4XETA 2W1WA 2K46A 4Z82A 2P1BA 2WQ8A 1PNGA 5FYHA 2EIBA 4B1LA 1VJ2A 4Q4W3 2R063 4BK5A 1JI6A 1GP4A 4CP9A 3VHPA 2RJ2A 3EBRA 3PL0A 4ASKA 5A3UA 1BBT2 4E4SA 2D6LX 1VRBA 2ILMA 4EN9B 1KS5A 1OMIA 4QPIC 1YUDA 1NYWA 5CKNA 5K0UB 2JECA 2RDQA 5FJKA 1DIWA 4QKFA 3OOXA 4B7KA 3KS7A 5FDBA 5LA0A 4AQ2A 4GD4A 1UX6A 2PLV3 1W6MB 5C3OA 1H1MA 3VBUA 4NPLA 4CU6A 2FD8A 3NKGA 3FL7A 4Y20B 4TXWA 1REDA 2EXJA 1Y3TA 4QU1A 2WUHA 4LKDA 2ZGKA 4LA3A 3C2UA 4XUPA 3ZSLA 5F6LB 2XHKA 1PVC1 3WF3A 5FY5A 4N9IA 4QPGB 4AXOA 2VZQA 2F17A 1MS0A 4FCAA 2ZGSA 4KU7A 4DXTA 1NT0A 5BV6A 1QJU1 1PK6B 2WZR3 1PHMA 1QDCA 5C9AC 1PIV2 3AZVA 1FV2A 1G6NA 5IAXA 3NNMA 3M3OA 3ACGA 4P08A 3SKJE 1AR62 4XDPA 5H9QA 2DCJA 3VBFC 1MS8A 4D8MA 1BK0A 3NV3A 1ZA4A 2G9ZA 3I54A 1UMIA 2P34A 3U11A 4BM8A 3OY8B 1BK1A 1CAXA 4H7LA 4I02A 5A6YA 5F1RA 3DN7A 1TMF3 2H0VA 2YGLA 4CDWA 4N7IA 4Y5Z0 4MGZE 2RS32 2ZKNA 1WKYA 4LOTA 4CCEA 1OXCA 3WP5A 2WQZC 4L9BA 1QNYA 1GR3A 5I8TA 1CZSA 3RG0A 1W6OB 2Y6JA 4D0QA 2QTWB 3IZOA 3WP6A 1ZBE2 1O3TA 4KBBA 1UYPA 4IERA 3LDBA 2A73B 3T30A 4M4RA 4ZS3A 1W99A 1F4AA 3LA2A 1GBGA 3W21A 3LDKA 3BTXA 1JS9A 5C3SA 2Y33A 2B46X 4CEYA 4KWKA 3JCIA 2R16A 1L7QA 2FCUA 4OULA 3UJOA 3LSEA 4QX3A 3AYEA 3AKRA 4CDWB 1OI6A 1HQWA 2PAKA 1WA4A 4X6RB 4Y5SA 4LBJA 3HOBA 2XBO2 3IN9A 4LBLA 4WBBA 3LA3A 4YLZA 3T08A 4XTMA 4CP9B 2NYYA 4I0BA 1E5SA 3LWCA 4JTOA 3B69A 1EAH1 1JODA 5C8CA 5I8YA 5I0UA 5F6KA 2R1BA 3M3CA 1K3IA 2EIDA 3A22A 3AZZA 3L2HA 1R1A2 4Q26A 5A3OA 3DECA 1UZWA 2VNGA 3ZKUA 1N3OA 4XFAA 2C9AA 3ZLIA 1PMJX 4MGSA 1QHDA 3VBUB 2VNRA 1LGNA 1G9FA 2R49A 1URXA 3UK9A 1L7LA 4LBNA 5A70A 3BOWA 4YPJA 2PAEA 3ZIWA 1N3PA 1Q8PA 1F2NA 3ZFGA 1QQP2 1NA1B 5A7PA 4CEWC 5FZ0A 3USUA 2BRTA 3NL1A 3SH3A 1IQAA 3GZEA 1XNAA 1OF3A 1W3VA 4QPWA 3WW2A 3B00A 4CCLA 2BW8A 5C5TA 4LOSA 5ACA3 2D3PA 4UFIA 1HRV2 2FBEA 5LWBA 3JD71 2IVIB 4FFFA 3DYOA 3O7OA 1CZTA 2YBSA 2D93A 4IEUA 4WVWA 3TN91 4BXSV 4XTPA 1UZVA 3WNOA 3N35A 1BXHA 1K45A 2VQ0A 3RYRA 2XLGA 3MUZ1 2VZSA 1SFPA 1VAKA 2PHFA 1WCKA 4P5HA 1RUJ1 2VUAA 4OZOA 1RMU2 5F2WA 3KD4A 1CIYA 1W9YA 2B8MA 2HWC3 3OCPA 1ZZBA 4JRAA 1SDDB 2QE3A 3N9PA 1QJX2 1WBLA 2XWBB 1IPKA 2I2SA 3QLQA 4M00A 4RGKA 5FZLA 1MQTC 3T2PA 2WS91 4BISA 5C70A 3N9NA 1BVVA 3H1MA 4ZZ5A 3AP5A 3KV6A 3LSDA 2Y6KA 3FUQA 3RZGA 1LOFC 5F3IA 2VOWA 4JRLA 2R7EB 5J48A 4BIFA 3VDCA 1X9TA 4XAAA 1UXXX 1IOAA 4IV1C 4XW3A 1QEXA 5IT6A 5FY7A 2HEYF 5L9BA 2IXIA 2QUOA 3R4UA 2H0BA 1KFUL 5IFTA 4BMBA 2GNBA 4SBVA 4CEYB 2VD7A 4DEVA 2RMU3 2KM2A 2PHDA 3CJIA 3RZZA 4AI0A 2RDSA 3AMMA 4E9KA 1ND2C 5T52A 3RZMA 1RUD3 3TYJA 5IVJA 5JSRA 4LORA 2RS51 1LTEA 1UF2C 2Q5TA 3SITA 3WY6A 1EAH3 2X5IC 3LEMA 4NIIA 1QH6A 4PIZA 3T2OA 2EICA 3WNKA 1XNTA 1UYXA 1LOEA 1WW6A 5C8CB 3RRDA 3IT8A 3PVEA 3SLIA 1PGL2 3WG4A 3LGRA 1XPWA 4DEQA 1C8M1 2QQUA 4H2AA 3D82A 5F8PA 4K3UA 5DABA 2RE9A 4J25A 4XJ9A 3U75A 3NAPA 4YGDA 2Y34A 4QDRA 4KNCA 5FOJB 3MLLA 2TNFA 4CCDA 2UY8A 3GYDA 1NXMA 1H8VA 3PLQA 3LOIA 4JX0A 2RDRA 2GDFA 3ZFGB 3VD4A 1J3RA 4FSJA 2W39A 3USUB 2A6WA 5EJ1B 4P9GA 2QQMA 1LGBA 1RUC3 2BOIA 2OVUA 2VMIA 2YBKA 3POSA 1UOBA 2WBKA 1JW6A 3I2FA 5FKCA 4JKKA 1PX3A 3RFRA 1HJFA 3OBZA 1HRI1 1RVF1 2RR11 3H0OA 3W5NA 4BXFA 2DCTA 2ZX2A 5FMDA 5J09A 1HW5A 1LCLA 2PHRA 4XUOA 2WFPA 3KHBA 3IWZA 2JWPA 5FZ9A 5K0UC 2Y38A 1OQEA 3RZJA 1C1LA 1Q8SA 4QU2A 1N1YA 2DWRA 4TN7A 5A7QA 1RUJ3 1NQJA 1V00A 5FZ3A 5JXIA 2DVAA 1IKPA 2XDVA 4CU9A 5GZEA 2BWAA 1VBD2 2ZHMA 3MV11 3P5BA 3AC0A 1NX9A 4OYUA 3JUUA 2H6BA 4Y4RA 5GKAC 1EY2A 3OUJA 4JAAA 5LK5A 1R082 5EZWA 1YQ2A 4AEKA 3WDVA 4HONA 5F3CA 4QDSA 4PLOA 4QD2A 3VKNA 3GALA 2MEV1 1HV0A 4S2FA 4UWDA 5C3RA 1D2SA 4B3NA 1MVQA 1LU2A 2ZGTA 3A23A 5SV5A 1H4HA 2VUCA 2WO3A 1XNDA 4QPGC 4YM3A 1JZ5A 1VBA1 4JDOA 2ZEYA 2XLFA 1NAEA 3LEKA 4K20A 4HXCA 1OOPA 1PK6C 1UIKA 2ZX3A 4B4QA 3O1SA 2WS92 4FOYA 2OS2A 4FXKB 4CXWA 4CSWA 3ZO0B 1MEC3 4YGBA 2R071 3CJIB 3VLBB 1DQ4A 1DFQA 4AI8A 3VBHA 1DHKB 4BPZA 2RS53 3FZ3A 1RITA 3LQCA 1ZREA 4CDQA 2W47A 5FP9A 4JVAA 4LO4B 5K9YA 1Z7S3 4HBNA 4C91A 3AMHA 4DRRA 2E6VA 5FZEA 5FP8A 4AHWA 1M06G 1KDKA 1GMMA 3RZHA 4QGLA 4PCRA 1G9BA 3PU3A 1EPZA 4TLGA 3FJSA 4UAPA 3ZXGA 2O1QA 1G9DA 3CZJA 3PUHA 1AL22 3Q9OA 3NMBA 1ENSA 4LNVA 2A1XA 3NAPB 3ZXDA 3T0DA 5IWFA 4UI9L 3OSDA 4FO9A 2O8QA 3USSA 3BYWA 3FHIB 3AP6A 1DQ5A 2HLEA 2OZ6A 5FYYA 4DXSA 1P8JA 1C8M2 1W9WA 4L99A 4AEDA 1AJKA 2MNGA 4NO4A 1RGSA 3VKLA 1ZA7A 4GB33 1HRI3 2P3IA 1O4YA 2WDBA 3MICA 5C4WA 1F8VA 2W9XA 3HBKA 2LUWA 2BERA 2XL9A 1DGRA 5B4XA 4YW7A 3AXEA 5A33A 2VVEA 5FUIA 4ZPIA 1FOD3 3RNSA 2OUJA 2W92A 2ZZJA 2XWJB 4EN6B 1J58A 4K1ZA 2VZOA 5J96B 1ULOA 1MPXA 1YFUA 1QXJA 5LA1A 3KT4A 2WABA 3KMHA 2VQTA 3LA7A 3MV01 3WXPA 3VBUC 3D8CA 2SBAA 4LKSA 2UYBA 4ET7A 1UZ0A 2A71A 2JDPA 1EUUA 4I09A 3PVBB 1RUE3 4Q0SA 3WX5A 1V6NA 1R093 1D0GA 3ETQA 4LE3A 3WP4A 3ZFEA 1ND3A 1ZYBA 4K8RB 3LD8A 3PTRB 3WDXA 3A4UA 1NA1C 5LBFA 1VBA3 4V1PA 4CCMA 2WNUA 4E4ZA 4Z2AA 1QMJA 2QDRA 2W94A 2UY9A 1VBB1 5D1IA 1UU6A 3F2ZA 2CGOA 3A7QA 4EN0A 4FQZA 3NW4A 4JDNA 4QKDA 4KI5M 2YDEA 5EYXA 3M3IA 2X8KA 3WF0A 4E4HA 4IGPA 2XGXA 1SZBA 2WWUA 4BYYA 1BQPA 1PGW2 1V6OA 2P37A 3BCWA 3V0BA 3WQ7A 4KMQA 1DGRN 1YI9A 4OI4A 1GQHA 2D43A 1JMUB 3AKSA 3KF5A 3GM8A 3ZDVA 3WW4A 3BTYA 1PO23 1ULGA 1OUXA 5FREA 3ZVXA 4QX7A 4CDQB 5HCAA 2B9VA 1H9WA 4JHZA 4XF4A 4CDWC 1AYN3 3H1WA 1HB1A 4IL7A 4O65A 3VB9A 1GOGA 2JICA 4LO8A 4P9XA 5I0TA 1QJY3 1SLLA 1XQNA 2B7YA 2R072 3PIJA 5GZDA 5BNOA 2GH8A 5EJZB 4XBLA 1JOJA 3SEPA 5KHIA 5FY8A 1S0BA 4LBOA 2BGCA 4R9DA 1AR81 1K12A 2VO5A 3KV4A 4KU8A 3RPQA 3RJRA 3JQWA 1JHNA 1SFNA 2VBPA 5F5IA 3VDDA 4BWOA 4LITA 1NQDA 4S2HA 4E2SA 4NHLA 1D4M1 3AL5A 1VBE2 2PMWB 4YW5A 4LHKA 5F2SA 3IDEA 1PZ8A 1JYXA 2WFF3 2PHLA 4CEYC 4Q0VA 1W2OA 4HPKA 4OFGA 3JQXA 5F5AA 4URTA 5LASA 1O3QA 1GP6A 4FT8A 3KGLA 1QGLA 2JE8A 1MS3A 5C4WB 5FLIA 3I2HA 4PLNA 1C8NA 4BK4A 3POYA 1WMFA 5A33B 2AZ5A 4P9IA 2DBNA 1U0AA 2GN3A 5FLJA 2AGSA 3AMPA 1GICA 4M01A 5C8CC 1DYPA 2AACA 1V70A 2OW4A 2R041 3ALQA 3VHNA 5LY1A 1HLCA 3BPSA 4ISQA 3I2GA 2HWE1 5A80A 4PDWA 3P3PA 3LE0A 5FK8A 5LW9A 3T3YA 4FPYA 3ZFEB 5FMCA 2XJRA 1AXYA 4WVZA 1RUH2 3CL1A 2WJSA 1ND3B 3LFIA 4PBPA 1H2MA 5F39A 4FPCA 3ZFGC 3ACHA 4GWIA 4IETA 4GALA 1VBB3 2WNUB 5FBZA 3AVSA 1RUI2 2B45X 3KCCA 5FXXA 3ZYPA 1K5MA 1PO11 3BI3A 1AX1A 2FMYA 2ARCA 4CRQA 4Z92B 4W6YA 2AC1A 3ZYBA 4AVTA 2RS12 5C3QA 1ENXA 5EFUA 3RDIA 2XPJA 4XQDA 2ZEWA 2BUKA 1JYWA 2W91A 5KXCA 1V6IA 4XVHA 4L97A 1VLNA 3H3ZA 2VNOA 4XXAA 3V0BB 2QZ2A 3AKTA 3AP7A 2J1RA 3V0AA 2HH9A 4P9LA 4JHTA 5ANNA 4NUBA 4OHYA 2VW0A 1ASJ1 3I2KA 4N8MA 4Q8KA 1MZ6A 2GP5A 3O1TA 2E31A 3OBAA 3NNGA 5JWPA 3QD6A 1AYM2 1K5JA 5A32A 1NCQA 1SLAA 2Y26A 5BNOB 4QM9A 5K7PA 3N7JA 2Q8DA 2C26A 3CIHA 4RQPA 4AE2A 1AR83 1PGSA 1F4HA 4OI1A 5KHKA 4KGGA 4GULA 3IKWA 3VDDB 2WZEA 1SLBA 1D4M3 4EN8B 3G6JB 5E89A 5FYSA 4JDMA 4NIDA 5FP4A 3VZLA 5FO9B 4ZU7A 4HLTA 4F7ZA 3HWJA 4CDUA 4GJZA 3CJIC 3ZMNA 3JBG1 2F6BA 5A7NA 4EWDA 1RUG3 5KC5A 1XYPA 5GLTA 5FP3A 1ZRRA 2JXAA 4XAEA 1TME1 2VMDA 5HCFA 4Z1VA 4URAA 1UY4A 1UQXA 2V5DA 4K6BA 2XUMA 5LEKA 2JIGA 3MEPA 1WD3A 5IAVA 3SC7X 4QHBA 3MIDA 4RGAA 5FYCA 2YROA 3GZTB 2O8OA 2LW8A 3I4IA 3J7HA 1YWKA 2X5IA 4W4ZA 2A3XA 4Y4YA 1MVEA 4OUEA 1QWRA 4IEXA 4PDWB 1W0OA 3H7JA 3ZYHA 3NAPC 3D0JA 5CFCA 1DGWA 4XILA 4ZY9A 4ONUA 1LOCA 2ZS6B 4BA6A 5I8SA 4FTEA 1WCUA 2R042 3URFA 1PO13 2ZGPA 1AHSA 4F3JA 2ZGQA 3K2OA 5A3TA 1XNCA 1K5MB 4Q27A 2DYCA 2VXJA 3QH6A 1BBT1 4AEMA 1OVSA 1ULEA 3J7LA 4GH4A 5CIRA 2I45A 5CZKA 1CONA 2V09A 4ZZ8A 1TQ5A 4LLOA 3M8LA 1O59A 4UBGA 2VU9A 1QOSA 3AZYA 2J1UA 1ZBA3 4MH0E 1NG0A 3VD9A 1BZWA 3V0AB 4B1MA 2IZWA 1W39A 1R1ZA 2DTYA 2VM9A 3EYPA 1ASJ3 4MX3A 4PI2A 1QH7A 3OPTA 5FXVA 1OA2A 3D0SA 4UFHA 2VECA 5E16A 1KQRA 1U5IA 4FOWA 1X33A 1XE8A 3PVOA 1EYBA 2RG4A 1NCQB 3KWVA 4XJ8A 4RQPB 3MZHA 1F9KA 5C5UA 2A75A 3ORJA 4Y20A 1MS4A 4U2AA 5DDJ1 2BV4A 2W52A 4GMP0 3FHAA 3KF3A 2JB8A 3NKTA 4OLLA 1PIV1 3M3QA 5T5JA 4AW7A 5T50A 1V9U2 3RMXA 3H8XA 1AR61 2YXSA 4XQ4A 5FTTC 2ZHLA 3MI8A 4HT1T 1AXKA 4XJWA 4B7EA 3JBG3 4CDUB 4OZXA 5FYIA 1FMD3 4IE4A
chains in the Genus database with same CATH topology
5LBEA 3OBZA 4Q5OA 4ZONA 5EQUA 5LA9A 3GJAA 5LB6A 5IATA 4NHMA 2HBUA 3MGUA 3OUHA 5DAWA 3NNLA 5LBBA 5DAQA 3KT1A 3OUJA 3HQUA 2G1MA 5DAXA 3PL0A 5A3UA 3GZEA 4Y5TA 4XCAA 4NAOA 4UWDA 5C5TA 4BQXA 3NNJA 5LATA 2RDNA 2RDQA 5LBCA 4MHRA 3BVCA 5EP9A 3EMRA 2JIGA 5DAVA 5ERLA 5IAVA 3NNFA 3OUIA 4NHLA 5HV0A 2JIJA 4XACA 4NHYA 5LASA 3HQRA 4XABA 5IAXA 4XAAA 3NNMA 5L9BA 2HBTA 2A1XA 4BQWA 4XC9A 2RDSA 4BQYA 2G19A 5EPAA 5M0TA 4NHXA 2FCTA 2FCVA 4NMIA 5L9VA 4KBZA 3KT7A 4NHKA 3DKQA 2RG4A 4MHUA 4ZPIA 3W20A 3W21A 5C5UA 2Y33A 4J25A 3GJBA 5L9RA 2FCUA 2Y34A 4IW3A 3KT4A 5DAPA 2OPWA 4Y5SA 2RDRA 4XCBA 5HV4A 4JZRA 3ITQA 2V4AA 5LBFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LBE A;  3OBZ A;  4Q5O A;  4ZON A;  5EQU A;  5LA9 A;  3GJA A;  5LB6 A;  5IAT A;  4NHM A;  2HBU A;  3MGU A;  3OUH A;  5DAW A;  3NNL A;  5LBB A;  5DAQ A;  3KT1 A;  3OUJ A;  3HQU A;  2G1M A;  5DAX A;  3PL0 A;  5A3U A;  3GZE A;  4Y5T A;  4XCA A;  4NAO A;  4UWD A;  5C5T A;  4BQX A;  3NNJ A;  5LAT A;  2RDN A;  2RDQ A;  5LBC A;  4MHR A;  3BVC A;  5EP9 A;  3EMR A;  2JIG A;  5DAV A;  5ERL A;  5IAV A;  3NNF A;  3OUI A;  4NHL A;  5HV0 A;  2JIJ A;  4XAC A;  4NHY A;  5LAS A;  3HQR A;  4XAB A;  5IAX A;  4XAA A;  3NNM A;  5L9B A;  2HBT A;  2A1X A;  4BQW A;  4XC9 A;  2RDS A;  4BQY A;  2G19 A;  5EPA A;  5M0T A;  4NHX A;  2FCT A;  2FCV A;  4NMI A;  5L9V A;  4KBZ A;  3KT7 A;  4NHK A;  3DKQ A;  2RG4 A;  4MHU A;  4ZPI A;  3W20 A;  3W21 A;  5C5U A;  2Y33 A;  4J25 A;  3GJB A;  5L9R A;  2FCU A;  2Y34 A;  4IW3 A;  3KT4 A;  5DAP A;  2OPW A;  4Y5S A;  2RDR A;  4XCB A;  5HV4 A;  4JZR A;  3ITQ A;  2V4A A;  5LBF A; 
#chains in the Genus database with same CATH topology
 1XNB A;  4COU A;  4KH9 A;  4Q5O A;  2VZT A;  1VRH 2;  2RS3 1;  3PMS A;  3ZKY A;  4CU8 A;  4K7J A;  2DUP A;  1UPI A;  4CDQ C;  4HZF A;  4MLO A;  5FQ0 B;  3NV2 A;  4N90 A;  3MFC A;  1H4G A;  5HI0 A;  1O4Z A;  2HWB 3;  4YVS A;  1OUS A;  4ZU4 A;  1W04 A;  2OKX A;  2E53 A;  3BTA A;  1W90 A;  1J3Q A;  2NMO A;  1QOO A;  2UU8 A;  1ZRC A;  4Q4X 3;  1ZBE 1;  5I0S A;  1YCI A;  3IB3 A;  1ALY A;  4OHZ A;  1HXS 2;  2ID4 A;  5LCW L;  5FBJ A;  4HKW A;  2Q1Z B;  5AFB A;  5JUV A;  4FTS A;  2ZGN A;  3MFA A;  1V6J A;  4XMI A;  5F5C A;  4TSV A;  5FZB A;  1WLC A;  4HK9 A;  1O8P A;  1ZX5 A;  2OX0 A;  2HWD 3;  3BOP A;  2XHN A;  2ZAA A;  4Q1P A;  3CEW A;  3NNJ A;  5CFC B;  1JZ8 A;  2EVX A;  5FQ0 A;  2YB7 A;  2D40 A;  3LPF A;  1SPP A;  2VOT A;  4Y26 A;  2RM2 2;  2ERF A;  4NIA A;  1GV9 A;  3BVC A;  1V0A A;  3HR9 A;  2YPJ A;  1S0C A;  1BBT 3;  3EMR A;  4XFB A;  5LA2 A;  4CCN A;  4J1W A;  5FZ7 A;  4F8A A;  3BOD A;  4GH4 B;  1UYY A;  4Q4V 2;  2HWF 3;  5C4W C;  1RTV A;  5FYM A;  1TVG A;  3O1R A;  3AL6 A;  2I07 B;  4KGQ A;  1R1A 1;  2UUR A;  2VCA A;  2Q1F A;  4CP2 A;  1C57 A;  1A78 A;  3OB8 A;  4XAC A;  2WA3 A;  1UD1 A;  3KGZ A;  5DN2 A;  4OUS A;  3VZK A;  1N47 A;  3P1I A;  1IS5 A;  2BNN A;  5JOX A;  1G9C A;  4QX8 A;  3LCP A;  2PQS A;  2VUD A;  3GGL A;  1MR5 A;  4D69 A;  3M2M A;  5CVR A;  4XAB A;  5JXH A;  2Z5W A;  1QQP 1;  2VOX A;  3TWI A;  5KHJ A;  3ZFE C;  4B4P A;  2V4V A;  3Q8C A;  3ZIX A;  3IM0 A;  3UKV A;  2FZ2 A;  3I3B A;  1ND3 C;  5H9S A;  3L9J T;  1SBF A;  4PHZ A;  1AUY A;  4QB1 A;  3SQO A;  1RC6 A;  1VAL A;  2WNU C;  1PIV 3;  1HRV 1;  2VE1 A;  4QKB A;  4Y1V A;  5JR2 A;  1JXN A;  3W5M A;  3PHM A;  3AZW A;  3OGR A;  1KJR A;  4K21 A;  4ORF A;  1NA1 A;  2FCT A;  3CKH A;  3ZX7 A;  1Q8O A;  4OUM A;  2FCV A;  3ILN A;  4Q0U A;  4UFL A;  2IXL A;  3SCH A;  3NJX A;  3CQO A;  4AL9 A;  3U07 A;  4DRV A;  5C8W A;  2P6H A;  1XE0 A;  5FY1 A;  3ROU A;  1FXZ A;  1WCS A;  2ZX4 A;  3KQ4 B;  4QXH A;  3IAP A;  2ES3 A;  3U10 A;  1HN1 A;  1RMU 1;  1OD3 A;  5DDJ 2;  4NRO A;  3WVJ A;  1QJX 1;  5FAX A;  1QOT A;  1CVN A;  4FPH A;  2QQP A;  1W3X A;  2R06 2;  2C5D A;  3I3Q A;  3TEY A;  3NV1 A;  4XJA A;  1OSG A;  4A6S A;  1YC6 1;  3W20 A;  2BWC A;  2BYV E;  1RUN A;  2D3S A;  1CPM A;  4YVS B;  2JDH A;  4K1Y A;  3UGF A;  5KR7 A;  1ZBE 3;  3J7M A;  2DVG A;  4XIO A;  5BNO C;  3UL2 A;  4YGE A;  1I6X A;  2PTM A;  3A21 A;  4X8P A;  2XKP A;  1F31 A;  5FYZ A;  5D8A A;  3IMM A;  3BAL A;  3AFG A;  5I0D A;  3MIG A;  3VDD C;  2VCB A;  5ABJ B;  1KEX A;  4BQ2 A;  1NZI A;  1A3K A;  2XKO A;  3S5Q A;  4GWN A;  4JC1 A;  5JIA A;  4G3Y C;  4OMC A;  3VN4 A;  1SBE A;  2D7F A;  1MS1 A;  2LM3 A;  2W68 A;  2XBO 3;  2B5H A;  1RXF A;  1IS4 A;  1C1F A;  1FNY A;  2P3J A;  1SPP B;  4JQT A;  4AI9 A;  3OEA A;  2NM1 A;  5CAZ A;  4LK6 A;  1W0P A;  3THT A;  5L7O A;  4IEO A;  1X82 A;  3LFM A;  2R6Q A;  2J1E A;  5DUU A;  4I3P A;  3AYA A;  4AGV A;  2E51 A;  3H50 A;  2GAU A;  4JQR A;  2PHW A;  3B7M A;  3TEW A;  1LED A;  3OUH A;  1FX5 A;  2YC0 A;  1R1A 3;  2WN3 A;  3F95 A;  3PUR A;  4C8D A;  1PGL 1;  4QB2 A;  1OPO A;  1FT9 A;  1GLH A;  1DLC A;  1DZT A;  3AK0 A;  4ISR A;  1LES A;  5DAQ A;  3NST A;  1OFS A;  4QQL A;  1JZ3 A;  4Y5T A;  3EHK A;  4YGC A;  2DDU A;  2W3J A;  5F32 A;  4CP0 A;  1OD5 A;  3CHX A;  1CAU A;  3ETP A;  4IE0 A;  4YYO A;  1VPH A;  1N3Q A;  4RYD A;  1QQP 3;  2ZX0 A;  1CN1 A;  2VZU A;  3E6B A;  2A6Z A;  3D4K A;  4PDW C;  4AWD A;  1J1T A;  1YIF A;  2ZPX A;  3VL9 A;  3U0Z A;  2WT2 A;  1UXZ A;  3D5O A;  4CCO A;  3VKF C;  3O12 A;  2BFU S;  1G9A A;  1W8O A;  1HRV 3;  2BQP A;  1HB2 A;  3E5Q A;  2VG9 A;  4ZS2 A;  5IYY A;  2TUN A;  4NIG A;  4E2G A;  4OCT A;  1K5M C;  1PVC 3;  3ELN A;  3FFQ A;  5C3P A;  4HL0 A;  1O3S A;  2G9F A;  3INA A;  1ENQ A;  1CGP A;  2D6K A;  1W2A X;  1ODN A;  2VW1 A;  3ATG A;  3GZA A;  3PU8 A;  4CE8 A;  1CX1 A;  1YJL A;  3Q8E A;  1H9P A;  1EUT A;  1QJU 3;  1OH4 A;  2NLR A;  1CAW A;  5CA6 A;  1C5H A;  1VBD 1;  4PJY A;  1BMV 2;  1V6L A;  1QU0 A;  2ZEZ A;  1R08 1;  1ZZ9 A;  3FE5 A;  1ULP A;  4RN5 A;  4M3C E;  3K75 B;  3VDB A;  3AMQ A;  3PJY A;  1UYZ A;  2RJK A;  4XJZ A;  3WNL A;  4AZZ A;  5D21 A;  2XUE A;  4HET A;  3Q8A A;  3LF7 A;  1NCQ C;  2CAV A;  1JZ7 A;  1AVB A;  3DV8 A;  1IPS A;  1WMX A;  3MW4 A;  1S2K A;  4IEW A;  4RQP C;  5JIU A;  5CG9 A;  3I59 A;  5T54 A;  4RD7 A;  4DUV A;  3U4X A;  3WCS A;  2DFC A;  5D8A B;  5IK5 A;  4IND A;  3ZN5 A;  3MLK A;  2Z4F A;  2QVS B;  4PIX A;  3U37 A;  1OH3 A;  2Y6L A;  3DYP A;  4RHV 2;  1O3R A;  2ZA9 A;  4CDU C;  3OD0 A;  4A44 A;  2Y64 A;  3FLP A;  3VBR A;  5L7O B;  1LGC A;  4R9A A;  5JR7 B;  3E5X A;  4AGR A;  1SLI A;  3DKW A;  5CAD A;  3FBM A;  3J9S A;  2WZP P;  5ACA 2;  3WT3 A;  1S0E A;  2ATF A;  1RJ8 A;  2CNA A;  4IUG A;  4NRP A;  3RGB A;  5BNP A;  1Q5O A;  1IS3 A;  1C5I A;  3VBO B;  4QQ2 A;  3PUS A;  5AC9 2;  1AL2 1;  3ECQ A;  1WLT A;  4BJ0 A;  4D6Q A;  1ZZC A;  2QQO A;  3T2T A;  2XLA A;  5IHR A;  1CAU B;  5LBE A;  2W5F A;  1X8M A;  2PXJ A;  2ADD A;  3ZPO A;  4QGM A;  2HWC 2;  1TZO A;  2XVK A;  3AP9 A;  1GZC A;  1V6M A;  3JXS A;  4P5Y A;  4Y1U A;  4ZON A;  1W9F A;  1H6X A;  2ARA A;  2VZ1 A;  1W06 A;  5CFC C;  5JOW A;  2BU9 A;  1YQ8 A;  1DYO A;  2C9K A;  2N7G A;  4IXL A;  2W87 A;  5IAT A;  4Y1Z A;  3GDB A;  1RUO A;  4QHO A;  1DG6 A;  4CCK A;  2VUJ A;  2WYF A;  4LBK A;  5EXO A;  5LRR A;  3L2Y A;  3VZM A;  1O5L A;  1QJZ A;  3HQU A;  4GH4 C;  4LA2 A;  1O6U A;  1ST8 A;  2F4P A;  1H1A A;  3S30 A;  2JEN A;  1UPS A;  4G4F A;  5CKM A;  3O0V A;  2JG9 A;  1VBD 3;  1FV3 A;  1RIR A;  2EAA A;  3POF A;  3E97 A;  5DUV A;  3JD7 3;  1CAW B;  2R1D A;  2W1S A;  4EQV A;  1WLD A;  1DP0 A;  1R08 3;  3C3V A;  2R30 A;  2AEZ A;  3MIH A;  3TN9 3;  3FHQ A;  1RHI 2;  1WGP A;  3POJ A;  4YFZ A;  2JE9 A;  2AYH A;  1RUD 2;  5LBB A;  1U5Z A;  3DPR A;  2Y60 A;  3III A;  3R4S A;  4R9B A;  2ZXQ A;  4XYX A;  5ERL A;  1CR7 A;  4DUW A;  4TZD A;  4MOA A;  1QJF A;  4QM8 A;  4C0H A;  2YZ4 A;  3SHR A;  3H8O A;  1QXR A;  4DIQ A;  5FPU A;  2DVD A;  4UW6 A;  1UOG A;  4WM8 A;  4SLI A;  5FZA A;  1IG0 A;  4E4D X;  2OII A;  2QNK A;  5GAL A;  2JIJ A;  2WA4 A;  3I59 B;  3THP A;  3ZYI B;  5A7O A;  3HNY M;  4AHY A;  2WS9 3;  4N43 A;  1WCD J;  3BIE A;  5HCH A;  3RMY A;  5APA A;  1OPM A;  3N4M A;  2HEW F;  5A3W A;  1IG3 A;  4EJR A;  4HOO A;  1UZZ A;  4FTB A;  2BDR A;  4G9S B;  1HKD A;  4P14 A;  1PGW 1;  1Y9Q A;  2DV9 A;  2E26 A;  2JDM A;  3HQR A;  4BDV B;  4CVU A;  1CAV A;  5FZK A;  2BGP A;  4BME A;  2BVB A;  4QMA A;  3TNQ A;  5F7U A;  1UIJ A;  5BXX A;  3VBR B;  3C7E A;  2K2S A;  5JDB A;  2QBX A;  2QDN A;  2EAL A;  4DO0 A;  2ZOE B;  1RUC 2;  4BQ4 A;  3D3A A;  3THD A;  2ZBJ A;  3LZZ A;  3I2D A;  3WCR A;  1W0N A;  4HG6 B;  1PM4 A;  1I3H A;  1SLC A;  2MHF A;  2QQW A;  5DG2 A;  5EPA A;  5M0T A;  1B09 A;  1O5U A;  3PVN A;  2GSY A;  4YVS C;  2VOV A;  5BNP B;  5JSP A;  4AFM A;  2CSG A;  3POG A;  4HVO A;  3SXW A;  1CWP A;  1F15 A;  3K4D A;  1Q8Q A;  2DCY A;  1POV 1;  2BTV C;  5DMY A;  2R0H A;  1VBC 2;  3KT7 A;  1CZV A;  4JKL A;  4COZ A;  1C28 A;  1I5P A;  1QNW A;  4ITC A;  1VBE 1;  4LHL A;  3GBG A;  3MPB A;  3C7F A;  3DKQ A;  2IFW A;  1WW4 A;  1IZ3 A;  3CBN A;  3SCF A;  1JYT A;  2FZ1 A;  1C8M 3;  3QH7 A;  1ENR A;  2IC1 A;  2EXH A;  4YM1 A;  4AK3 A;  2RV9 A;  2PHT A;  1OLQ A;  1SDW A;  3K46 A;  4YAR A;  1UCX A;  2LTN A;  2EXK A;  4IW3 A;  1KS4 A;  2XR4 A;  3W59 A;  2W0X A;  3M7A A;  4COV A;  4HKL A;  5FUP A;  5CFD C;  5LY2 A;  5BNN B;  3MW3 A;  5KXB A;  2PN5 A;  4A45 A;  4L2N A;  3WEZ A;  1SEF A;  3BPZ A;  3ST7 A;  4XCB A;  1Z78 A;  4WM7 A;  4IEY A;  1A8D A;  2J1A A;  1OBN A;  2JDN A;  2JG9 B;  2WII B;  3ILF A;  4U36 A;  4FPG A;  1Y7B A;  3RWK X;  2RR1 3;  1RVF 3;  1MEC 2;  1U12 A;  2GU9 A;  2AEY A;  3ES1 A;  3T2Q A;  2YFU A;  1RL3 A;  1UY3 A;  2WSU A;  2JJ6 A;  1LHN A;  1GWL A;  2EA7 A;  1EP0 A;  4QX5 A;  3C7H A;  1RUH 1;  3DPR B;  4LBQ A;  2BP6 A;  2YFZ A;  3DYM A;  2IXC A;  4DY5 A;  5A7S A;  1OVP A;  5JI9 A;  1SLT A;  4IGO A;  1KD7 A;  1Z7S 2;  4WM8 B;  5GJ6 A;  1RUI 1;  1S0J A;  4CU7 A;  5IFP A;  2JD4 A;  3O1O A;  2X29 A;  1MZ5 A;  4D6R A;  4A41 A;  4N43 B;  2RS1 1;  2QZ3 A;  3ZOI A;  2MEV 3;  4XCA A;  3B02 A;  2WC2 A;  3PUA A;  3VKO A;  1PMI A;  2PQQ A;  4NE9 A;  2JDA A;  1CJP A;  4Q2F A;  2H6C A;  3WDU A;  4B8E A;  3APB A;  4ATF A;  1JOP A;  1CAV B;  5J7M A;  1COV 2;  2AR6 A;  4LUL A;  3H42 B;  4CP1 A;  3ZR6 A;  3K3N A;  1YO8 A;  2W08 A;  2GC0 A;  4W50 A;  3ZYJ B;  5A3L A;  3S57 A;  1E5R A;  4Q1R A;  4BE3 A;  5FYV A;  4BQ1 A;  3VD3 A;  2R07 3;  2EF6 A;  1AYM 1;  5IVE A;  5A6X A;  5K8S A;  2HKX A;  2FDH A;  4LTA A;  4IQP A;  5JAX A;  5AVP A;  3O1M A;  1SCR A;  2VNV A;  3WNX A;  1POV 3;  4AVV A;  4OHW A;  1N1T A;  3G7D A;  4BZ4 A;  1EV1 1;  2QFE A;  2QQV A;  3I97 A;  3WLU A;  1VBE 3;  2ZCW A;  3IBM A;  4LKF A;  4AF9 A;  2GZW A;  2E7Q A;  2VCC A;  3CO2 A;  4IE5 A;  3C7G A;  3CF6 E;  3MIF A;  5D8A C;  2XVG A;  4P9J A;  3NRU A;  3V64 A;  4B29 A;  1W9T A;  1T2X A;  4W8J A;  1NLS A;  3FLT A;  4GQ7 A;  1JYC A;  1D4V B;  2VQA A;  3WW1 A;  1R09 2;  3NJV A;  1AR9 2;  2VMF A;  3MDP A;  5GZG A;  2HYX A;  4AI2 A;  2BOJ A;  4AQ6 A;  4IGQ A;  3HAG A;  4A2U A;  4N7U A;  1W8U A;  5L7O C;  4AVC A;  2VPV A;  1OLR A;  1JH5 A;  3X29 B;  2E33 A;  3HD8 B;  1ACC A;  3RSJ A;  4Z8B A;  3B9I A;  2ZAB A;  3H8U A;  3I2I A;  1X8E A;  1BHG A;  2WWJ A;  4KBZ A;  5BNQ A;  4XUN A;  4WM7 B;  3O1V A;  5CYY A;  4PBO A;  2OA2 A;  2NP0 A;  5IVV A;  1WUV A;  1AF9 A;  4Y22 A;  3VBO C;  3ZXJ A;  1RB8 G;  4W6X A;  2JG8 A;  1J1L A;  2WT1 A;  3EXU A;  3OYW A;  1X36 A;  1RUH 3;  4LBQ D;  4LUM A;  3WG2 A;  1LEC A;  2YMZ A;  4Q4Y 2;  4WVM A;  1PO2 2;  2DUR A;  5F3G A;  4LBQ B;  3ASI A;  2WIN B;  1WW7 A;  1RUI 3;  4A4A A;  4YW2 A;  1W2T A;  5DAP A;  1OA3 A;  1I1E A;  4NR1 A;  2DCZ A;  2YPD A;  3ES4 A;  4CCC A;  4GJY A;  5JLV A;  1QJY 2;  2W46 A;  4HAN A;  5C33 A;  5E1R A;  1GAN A;  2RS1 3;  1GUI A;  2FDF A;  1UAI A;  1G86 A;  2XQR A;  4N9H A;  1KGY A;  3KQR A;  1ZRD A;  5DZE A;  3A0N A;  2ZAH A;  3ZXK A;  4QPY A;  3TBD A;  4D7S A;  5GLV A;  2R0F A;  3HT1 A;  4IDZ A;  4FBF A;  2Y6G A;  3LPG A;  4QXB A;  5FZI A;  1T6B X;  3WNM A;  4O9G A;  3THC A;  5CG8 A;  3HQX A;  3WSO A;  4XBN A;  2WFF 2;  3ZDS A;  5SV8 A;  3N9Q A;  4KWL A;  4JGY A;  4Y33 A;  3BU0 A;  1LHW A;  4NAM A;  1AYM 3;  1YYN A;  2VC9 A;  4I2O A;  5FZ1 A;  3DF0 A;  1MS9 A;  5FY9 A;  3CU7 A;  1D7P M;  3N36 A;  2J1T A;  2NQY A;  4O7X A;  4OHX A;  4NPM A;  4PLM A;  1E5I A;  1FPN 2;  3MIE A;  1BEV 2;  4HFS A;  1X50 A;  1ZZ6 A;  3HT2 A;  4NJ4 A;  1GYK A;  2Q0A A;  3FWE A;  3V56 A;  5LAT A;  1V9U 1;  5FXZ A;  5T55 A;  3ZXL A;  4CA9 A;  4YZ2 A;  1YJK A;  3ZSE A;  2VZV A;  2DU1 A;  1LKN A;  4LO6 B;  3BUC A;  1QXP A;  1YHF A;  4V2V A;  4MO3 M;  1BLZ A;  1YEW A;  2E63 A;  2GNM A;  1KJL A;  2LRP A;  5J98 B;  3S7I A;  1L7R A;  1AJO A;  1ODM A;  4XEZ A;  5FWE A;  4LHS A;  1OQ1 A;  3CNA A;  1XYO A;  5CB7 A;  1O7F A;  3LDR A;  4I01 A;  1RXG A;  4JGZ A;  3LKJ A;  1VRH 1;  3MPP G;  1NUK A;  1Q56 A;  1EV1 2;  2DBI A;  2WWS A;  5CKQ A;  3UGH A;  3VBR C;  3VUO A;  3LEG A;  5C7G A;  4OMD A;  2CV6 A;  4AG4 A;  1W05 A;  2P6C A;  1RUF 2;  4CCJ A;  2A6Y A;  4NHY A;  5JZG A;  1GP5 A;  1FI2 A;  4DQA A;  3POW A;  3H1Y A;  1HXS 1;  1JBC A;  3K51 A;  3VHO A;  5BNP C;  1S0G A;  2VZ3 A;  4Y22 B;  5CNA A;  1JHJ A;  1F5F A;  2A70 A;  4I0W B;  5F3E A;  3T4V A;  5KWR A;  1LNS A;  2JG8 B;  3S6P A;  2J1S A;  3OYW B;  4HN1 A;  3POI A;  2YGM A;  2YV8 A;  3SEE A;  3VGI A;  4WVM B;  3I2J A;  2VGD A;  3K4Z A;  1PMH X;  5FK7 A;  3RZL A;  2R04 3;  3AB0 A;  4PQQ A;  2BPA 2;  1S0I A;  2RM2 1;  4QB6 A;  4LIV A;  2HWE 3;  4YNI A;  1LOG A;  1APN A;  1CQ9 A;  1WW5 A;  4YG3 A;  2GNT A;  4X6Q B;  1J84 A;  5FV3 A;  3ZMO A;  4NMI A;  2WLQ A;  3GHN A;  4XF3 A;  5L9V A;  3IDA A;  5IK4 A;  2DCK A;  4Q4V 1;  5KXD A;  1JUI A;  4AR2 A;  1JUH A;  1YXW A;  5DPN A;  5T5O A;  2Q4S A;  4KWJ A;  5BNN C;  3SCG A;  4QQO A;  4UW4 A;  2VTX J;  1YRZ A;  3R05 A;  2X53 S;  5HXV A;  2IXH A;  4ASM B;  5ABJ A;  3HEI A;  3S0M A;  2P5B A;  2KD7 A;  4H7M A;  2JG9 C;  1OKQ A;  2CDO A;  4EZ4 A;  2OQ6 A;  3ZSJ A;  4JGY B;  2VMH A;  2Q8C A;  4UXA A;  3ZSM A;  2OT7 A;  1RUG 2;  5FRA A;  5JSO A;  1H2N A;  2OUH A;  3H7Y A;  3TEX A;  1OKO A;  1M4W A;  3FUO A;  3JU9 A;  4DPN A;  2ADE A;  3DPR C;  5I0R A;  2YC2 A;  4JCK A;  2GC1 A;  1BJQ A;  1SAC A;  2HYK A;  2ORX A;  5DUX A;  4FXG B;  1DGW X;  4WM8 C;  2YBP A;  1OT5 A;  1DDL A;  2VQU A;  5FYU A;  2IXJ A;  2LS6 A;  4DOU A;  3GBF A;  4UFK A;  1G7Y A;  4N43 C;  1OLM E;  3ACI A;  3B9C A;  4IE6 A;  2VBD A;  4QX0 A;  4AQT A;  3E6C C;  3WZ1 A;  3VD7 A;  3ACL A;  4M3C B;  4AAX A;  5EQU A;  1PX4 A;  1Y4W A;  3E6D A;  3QBQ A;  1DLL A;  5LA9 A;  4A3X A;  4ASL A;  4E8D A;  2C6S A;  5FY4 A;  2J1V A;  3MGU A;  1LHO A;  1JU4 A;  2D5H A;  1UU5 A;  3MUY 1;  2IFR A;  1WMD A;  4JGZ B;  4XFI A;  5EHD A;  4DS0 A;  3AJY A;  1G8W A;  4Q4W 1;  2R06 1;  3KT1 A;  3ZPY A;  1AX0 A;  1HQN A;  1BYH A;  5BY5 A;  1GSL A;  1DZR A;  3CDZ B;  4BQX A;  2Y0O A;  4KWU A;  3VBS B;  4A7Y A;  5JZG B;  5HXM A;  2UWA A;  2RDN A;  3TRS B;  3J8F 2;  3KVA A;  1TME 3;  1DQ0 A;  1AR7 2;  4CPB A;  1I5Z A;  3GCW A;  1ZNP A;  4Z07 A;  5LBC A;  2V5Y A;  3I3D A;  2Y6H A;  5EP9 A;  2WAO A;  3U4S A;  4D94 A;  1ZBA 2;  5A6Q A;  3MF6 A;  1VAM A;  3P3N A;  5KHH A;  3WV6 A;  2PA7 A;  2RM2 3;  1N1V A;  2ZHK A;  3O1P A;  2J7M A;  3AKP A;  3I7D A;  4DXR A;  1QIQ A;  5JOZ A;  2JDZ A;  1W03 A;  4FPO B;  4BH9 A;  4XPV A;  4UFJ A;  4D3W A;  2A7A A;  1ULD A;  1XSQ A;  4XFC A;  4CTE A;  3EQE A;  2BVV A;  4K8F A;  4I3G A;  4QT6 A;  1JYN A;  4M3C F;  2P4E A;  5BUV A;  2DVF A;  4FPE A;  2XON A;  4IEZ A;  4RGG A;  2BFU L;  4YZ4 A;  3C8X A;  3PNA A;  4KQ7 A;  4RSU A;  3ZSK A;  1H6Y A;  5JCT A;  5EIY B;  4OI2 A;  5CFD A;  1DU3 D;  2GP3 A;  3IDB B;  1AXZ A;  3M70 A;  4S2D A;  2VMC A;  4WM7 C;  4XXP A;  3T0A A;  3WQ0 A;  3WDT A;  4C1W A;  4XFH A;  2O14 A;  4MXW A;  1SFY A;  1NY7 2;  3CMG A;  4M0N A;  1ONA A;  2JKB A;  1RJ7 A;  1FMD 2;  2BNM A;  4YW4 A;  1JTZ X;  2G19 A;  1DQ1 A;  2DVB A;  2BGO A;  4BLJ A;  2CY6 A;  3E1F 1;  3RZK A;  4LPL A;  3AYC A;  4NHX A;  5FUN A;  5FY0 A;  4AFA A;  1XJA A;  1UZY A;  4MET A;  3TNP B;  1LRH A;  1F35 A;  1RYY A;  3KHC A;  2ZMN A;  2W1U A;  2GH2 A;  3R0R A;  2YUE A;  4Q4X 2;  1LEN A;  1OQD A;  3OPZ A;  4W65 A;  3B93 A;  4LIU A;  3UJQ A;  4BOW A;  5KC6 A;  1W8N A;  4ARX A;  1WWY A;  3JB8 A;  5IJR A;  4NIH A;  5AVA A;  1J59 A;  4XZP A;  4XUR A;  3HNM A;  2E32 A;  2FQP A;  2ZTN A;  3IIA A;  2GAL A;  2HWD 2;  4IEP A;  5DDJ 3;  3DGT A;  5LEJ A;  4UW3 A;  1WCQ A;  4GKX A;  3KVB A;  3KLS A;  3R4D B;  1AZD A;  1BMV 1;  3RJ2 X;  3I3M A;  2VBB A;  1AR6 3;  3KV9 A;  1UMH A;  4LLF A;  4A42 A;  4A6O A;  4IV3 A;  4RFT 0;  5FKB A;  2FDK A;  3RWN A;  3LIG A;  4A3Z A;  3FN9 A;  1Q43 A;  2XOM A;  2WNV B;  4NVP A;  4P00 B;  2B4K A;  3B3Q E;  5JI7 A;  2HWF 2;  4CPB D;  5JOY A;  1UMZ A;  2D6N A;  2ET1 A;  3KCX A;  1PZ9 A;  2ARB A;  2E9Q A;  2RS3 3;  3FX3 A;  3W58 A;  4A7Z A;  2G9G A;  3UT0 A;  4YW3 A;  4MGI E;  4Q4W 2;  2Q1M A;  2QQK A;  4DXZ A;  2TEP A;  2CWM A;  1JZ6 A;  2X09 A;  4AHZ A;  3GXU A;  3GJA A;  4MVT A;  1CES A;  3CLP A;  3BTZ A;  1TNF A;  3ZM8 A;  1GZW A;  4RHV 1;  4FPL A;  4LBM A;  5GM0 A;  1YLL A;  2QQI A;  1VB2 A;  1UW8 A;  4RS5 A;  3WDY A;  4YRD A;  5DAX A;  4GXL A;  4MYE A;  2YG0 A;  2PLV 2;  2FMD A;  3GHM A;  2ZKL A;  4NAO A;  1PZ7 A;  5J36 A;  1VAV A;  3AP4 A;  4CUG A;  2A6V A;  2GN7 A;  2VVF A;  4NWV A;  5ACA 1;  2GME A;  2ET7 A;  2JDK A;  2Z79 A;  4UT5 A;  4LE4 A;  3TEZ A;  4BQ5 A;  1YI7 A;  3WOG A;  4XBQ A;  4MHR A;  3P6B A;  5IVY A;  1FAT A;  3WDW A;  5AC9 1;  1S4C A;  2XML A;  4OHV A;  5CFD B;  4HMZ A;  3OEB A;  5DAV A;  3SH5 A;  5FFO C;  4C90 A;  1JYV A;  3OUI A;  4NWW A;  2ETE A;  4MXW B;  1O8S A;  4LO7 A;  1FYU A;  1GKB A;  1TG7 A;  4UW5 A;  2CL2 A;  4XOG A;  1IGO A;  2HWC 1;  2JG8 C;  2WZR 2;  2FHR A;  4MG2 A;  1UX7 A;  4KL1 A;  4FQ4 A;  2WO2 A;  4I30 A;  3VBO A;  4QQP A;  3SMH A;  4XUT A;  1N1S A;  1H30 A;  2ZGM A;  2IXK A;  3FC0 A;  3WIN E;  3S5A A;  2XH6 A;  2WSV A;  5C6C A;  1DQ6 A;  1DYK A;  1WLW A;  2JD9 A;  4FPJ A;  3ZFF A;  2ZJC A;  2SLI A;  1UKG A;  1C3H A;  5FCC A;  3KM5 A;  4O9E A;  2VXR A;  3HN1 A;  5FPV A;  3VZJ A;  3I8T A;  1TMF 2;  3JZV A;  4AQS A;  1ULC A;  1XYN A;  2BEO A;  5A7W A;  1QF3 A;  3FLR A;  1DBN A;  3ILR A;  2WYS A;  1QDO A;  3EB7 A;  4YVW A;  2DU0 A;  2RMU 1;  2WR9 A;  4XC9 A;  5BYN A;  5CIS A;  3I2O A;  4BQY A;  4DY3 A;  5BPX A;  3VD5 A;  1RHI 1;  1HN0 A;  4YM0 A;  2Y8K A;  1PVX A;  3UV9 A;  1RUD 1;  1SG3 A;  4IV3 B;  4FFG A;  4JGY C;  4CUC A;  4ZU5 A;  1E5H A;  2VMG A;  5JVV A;  1GQG A;  1JYI A;  2XVL A;  1IS6 A;  2Q8E A;  2VOK A;  1RMU 3;  3B94 A;  4D7Y A;  1W6P A;  2WO1 A;  4LEJ A;  2QJV A;  1QJX 3;  4Y24 A;  4GKY A;  4MGT A;  4TYS A;  3LEI A;  3R6S A;  3U1X A;  2F4L A;  5HPO A;  4QX1 A;  1Z0H A;  3UNP A;  4MAD A;  2O0O A;  1ZZ7 A;  5J3U A;  1OA4 A;  3B01 A;  1LAJ A;  4H14 A;  1OUR A;  4RHV 3;  4CDX A;  2GC3 A;  3OG2 A;  1GZW B;  3HN3 A;  2YYO A;  2OPW A;  1KRI A;  2CHH A;  3EJK A;  1HJG A;  5EJ3 A;  4OQ9 A;  4RS5 B;  3OPW A;  1KIT A;  1RUC 1;  5FZ6 A;  4JGZ C;  4N53 A;  5H9P A;  4ZXE A;  1U5X A;  2K9Z A;  4MUV A;  4QGN A;  1LJ7 A;  1GQP A;  2UWB A;  3T0B A;  5JMC A;  2EIG A;  1PVC 2;  3B5L B;  1TNR A;  1WME A;  3OGG A;  3WUC A;  1Y9G A;  3NO8 A;  5AC9 3;  3OBT A;  2C0Z A;  3SH4 A;  2XL7 A;  2VME A;  3VBS C;  2RVA A;  5HCB A;  5JZG C;  2XJS A;  3BGA A;  5A1L A;  1CAX B;  1VBC 1;  1H0B A;  4JTN A;  4TTG A;  4PIY A;  1O91 A;  1QJU 2;  3BKZ A;  3J7N A;  4XFG A;  3ZR5 A;  1XXN A;  5DZG A;  4BU2 A;  1YFW A;  3NQH A;  2RHP A;  1CX4 A;  2L9L A;  1REF A;  5A1F A;  2W2I A;  1WZX A;  3OD4 A;  3H3U A;  2OZJ A;  3TAY A;  1X9P A;  4XFF A;  3HNB M;  1WD4 A;  4XF9 A;  3ZFF B;  2I74 A;  3N9O A;  5FPL A;  1IQD C;  3MO4 A;  2CTV A;  1W8W A;  5G04 L;  1JN2 P;  5T5P A;  1ULF A;  4MXV A;  5A7W B;  3PDQ A;  4QXC A;  5IUQ A;  3I3E A;  4H55 A;  5FZC A;  4DFS A;  1H2L A;  1U5Y A;  4YVW B;  3A0K A;  1MEC 1;  2K0G A;  4LO5 B;  1NZC A;  1RHI 3;  2IVJ A;  3GNE A;  4RA0 A;  5FLH A;  4WZF A;  3SKV A;  5ABJ C;  5BNN A;  4XIK A;  1MS5 A;  2JB4 A;  3UKN A;  1XU1 A;  2W95 A;  2BBV A;  4HVR A;  4P9W A;  5E6H A;  2VZR A;  1W9S A;  2WLP A;  1D2Q A;  5F9T A;  3RQ0 A;  3WHT A;  3ZYF A;  5FZ8 A;  1Z7S 1;  1REE A;  3HJR A;  5FZO A;  1W6P B;  1JZ2 A;  3IDC B;  2Z69 A;  2RMU 2;  2ARE A;  1A34 A;  2D6P A;  2ENR A;  3J4U H;  4HSL A;  2B39 A;  2A3W A;  1HX6 A;  4CZS A;  2PHX A;  2CDP A;  2WZ8 A;  3VKM A;  5DQ0 A;  2WRA A;  3WF2 A;  1J3P A;  2ZZQ A;  5GZC A;  3BN6 A;  2J22 A;  3DXU A;  5CEH A;  5KBF A;  1T6G C;  1EAH 2;  2CGP A;  2XXZ A;  1Q3E A;  4LHN A;  4CDX B;  1YNA A;  1COV 1;  1MAC A;  3KV5 A;  3OF1 A;  2AH2 A;  5F37 A;  5IW0 A;  1STM A;  3NVC A;  4QAW A;  1W8Z A;  4ES9 A;  4PT6 A;  1L3J A;  4L92 A;  4EWA A;  4WVV A;  1O4T A;  4GMP 1;  4LQR A;  4N53 B;  4Q29 A;  2D98 A;  4OQ8 A;  1AL0 G;  4GB3 1;  3O5S A;  3K4A A;  1Y43 B;  2GC2 A;  5E88 A;  4YZ1 A;  2D97 A;  3I49 A;  4R4Z A;  2CYF A;  1OLM A;  3WUD A;  4XE9 A;  2WNV C;  1GWK A;  4GAZ A;  1FOD 1;  1NE4 A;  3WQB A;  2Z2S B;  1JU3 A;  2VZP A;  5FZ4 A;  1VBC 3;  4AVA A;  1B35 A;  2V72 A;  2NPI A;  5FP7 A;  3GJB A;  5L9R A;  5LRS A;  4J6G A;  1DCS A;  1NLQ A;  2ZGR A;  4E27 A;  4RR3 A;  3MW2 A;  4R9C A;  3W9A A;  3PME A;  5FZF A;  3WHU A;  2HJI A;  3JD7 2;  2J42 A;  4FFH A;  1KFX L;  2WO7 A;  5ANQ A;  1SMV A;  3TN9 2;  1YQ6 A;  3H3L A;  3ZN6 A;  2WNE A;  4XUQ A;  1RUE 1;  4QHZ A;  2PEL A;  4XHX A;  1R09 1;  1AL2 3;  3K77 A;  1VMH A;  3O0W A;  1AR9 1;  2RJL A;  4Y1X A;  3T09 A;  2YY1 A;  5HV4 A;  4XF1 A;  1A8M A;  5DG1 A;  3ITQ A;  4PF5 A;  3U78 A;  4AAP A;  3PUQ A;  1RUJ 2;  1YQC A;  4HN0 A;  3OTF A;  2AUY A;  4P02 B;  3V65 A;  3ZXF A;  4BQ3 A;  2VH9 A;  2XB6 C;  4GWM A;  3VHR A;  2D3R A;  4P9Y A;  5E8A A;  3UET A;  4COW A;  1YFY A;  3GZU C;  1H8T A;  3OGV A;  1VB4 A;  2C1F A;  3SNM A;  4V2W A;  3WF4 A;  3AFK A;  5FOB B;  4NHM A;  1J83 A;  2HBU A;  1NKG A;  2VCM A;  4WV8 A;  4D6S A;  4AVS A;  4FAH A;  3FFZ A;  2WQ4 A;  3RI8 A;  1KXG A;  3M1H A;  3J26 N;  2EXI A;  5IVB A;  4EYU A;  1LHV A;  4Q4Y 1;  5FXW A;  1PO2 1;  5L19 A;  1GNZ A;  1US2 A;  3K48 A;  2OXB A;  5H9R A;  5FMO L;  1W8H A;  5I93 A;  1AYN 1;  1NCR A;  5FZO B;  1UL9 A;  1XC6 A;  2YU1 A;  3IPV A;  1QJY 1;  3HPN A;  4Y1Y A;  1LOB A;  3ME2 A;  2QQL A;  4IES A;  1W8T A;  4KG0 A;  1UNB A;  5DXD A;  4AGG A;  3KCY A;  1XB9 A;  1POQ A;  2QQN A;  2RS5 2;  3T1L A;  2VL4 A;  3WQ1 A;  3DUI A;  2WN2 A;  1BVP 1;  1COV 3;  5GLW A;  2EIE A;  4IE7 A;  4E2Q A;  5A3N A;  2VJX A;  4MGY E;  3ZXE A;  5HV0 A;  1CIW A;  2WL1 A;  4QKN A;  3FMG A;  4UOJ A;  2WFF 1;  4GZ9 A;  1GNH A;  1UU4 A;  2KR2 A;  4GMP 3;  3HMY A;  1FAY A;  3KB5 A;  5FYT A;  4R52 A;  5J37 A;  4HSJ A;  3WNN A;  4NPR A;  1XE7 A;  3AZX A;  4OVE A;  4YSF A;  2QQJ A;  2ZX1 A;  4FP2 A;  4IV3 C;  3WG1 A;  2MPF A;  1YQ5 A;  2KA3 A;  4LR4 A;  4X8N A;  2QKD A;  4NRM A;  1H2K A;  1FPN 1;  1US3 A;  1BEV 1;  2PFW A;  3MHZ A;  4PQ9 A;  5DUW A;  1DGL A;  2VUL A;  3N7M A;  4FOQ A;  4XQW A;  5JPM B;  1B35 B;  5FO8 B;  2OPK A;  4BQW A;  4QPI A;  2CGN A;  1VMJ A;  3HVD A;  4RR3 B;  3WF1 A;  4GB3 2;  1HRI 2;  1RVF 2;  1OHF A;  2RR1 2;  1ZM1 A;  1GNY A;  3JB4 C;  4JKM A;  4NRQ A;  4AOC A;  4ZKT B;  4FI9 A;  2P3Y A;  3TB0 A;  1SQ4 A;  2ZML A;  3D6E A;  1AR9 3;  3ZN6 B;  2NZ9 A;  2LRO A;  3QOP A;  1RIN A;  3E5U A;  4UF0 A;  1FOD 2;  3UGG A;  1S55 A;  4GA9 A;  2AEN A;  5IVC A;  2WNO A;  4NHK A;  2XJP A;  4RS5 C;  2Q8O A;  5FZD A;  3MIB A;  3Q8F A;  1RUF 1;  1CD3 G;  1OOP B;  4EZH A;  1H8T B;  4QX2 A;  2X10 A;  4TLF A;  1RUE 2;  3UES A;  1A6C A;  2MEV 2;  3MLJ A;  3AMN A;  1WBF A;  1LOD A;  2R32 A;  4RFR B;  5K4L A;  1TE1 B;  3DXT A;  2BZD A;  4GWJ A;  4JV4 A;  1OF4 A;  1VBA 2;  3AM2 A;  3N7K A;  5C9A A;  2JDU A;  3VBH B;  4Q4Y 3;  2B42 B;  4LKE A;  3IMN A;  4XJU A;  2C24 A;  2Y0I A;  3H9A A;  1ZRI A;  4FPK A;  5FO7 B;  3VBF A;  4EWE A;  4BIO A;  4QQH A;  1FNZ A;  1UWW A;  2DF7 A;  3OJB A;  1NCR B;  5I91 A;  3SIS A;  2OQ7 A;  4ARY A;  1GWM A;  2V73 A;  3CJX A;  3IPV B;  4D7T A;  4AFB A;  4O61 A;  5FR3 A;  5A1A A;  1F5J A;  4XMA A;  1DZQ A;  1VP6 A;  4A7K A;  1E57 A;  4ZHN A;  3N9M A;  1LEM A;  1W6N A;  4MGK E;  3AVR A;  3ZFF C;  2IUW A;  4C0B A;  4KG8 A;  5C71 A;  2D6O X;  2A6X A;  1QJE A;  1NE6 A;  4CXY A;  2ZGO A;  1AYN 2;  4LXL A;  2UYA A;  3NNL A;  1UKR A;  4AVB A;  1W28 A;  4XDQ A;  4YVW C;  4AYU A;  4B4R A;  4FP3 A;  2WAA A;  4LUK A;  4AED B;  3AKQ A;  4UYB A;  3BB6 A;  4W6W A;  1GFF 2;  4AFC A;  2PHU A;  1RUG 1;  4YZ5 A;  3Q8B A;  3DEM A;  4L8Q A;  4IEQ A;  3OGJ A;  3WD5 A;  1QY4 A;  1FPN 3;  5FMO S;  1BEV 3;  3PJQ A;  4CUA A;  5FYB A;  1NXD 1;  1QKQ A;  5LK7 B;  1V6K A;  3NJZ A;  2VR4 A;  2LAL A;  3ON7 A;  3AYD A;  1NLR A;  2Q30 A;  5FZH A;  4XZU G;  4QPI B;  1S2E A;  5FPA A;  2YHJ A;  2FDI A;  4OI0 A;  2UWC A;  3GF6 A;  2XG3 A;  2CWS A;  4K40 A;  4AFD A;  4PI0 A;  2JKX A;  5FZM A;  4CDX C;  2D5F A;  1XU2 A;  4UF0 B;  2VW2 A;  4LK7 A;  3VDA A;  1EV1 3;  4TWT A;  5A3M A;  4NN0 A;  4S2G A;  4RL7 A;  3ABZ A;  5EWS A;  1RUF 3;  3LAG A;  4MZU A;  4HVQ A;  4N53 C;  2JEM A;  2DTW A;  5FZG A;  4CEW A;  4M3C A;  3NJY A;  3GBW A;  3ZYR A;  4DIN B;  5B4N A;  3J8F 1;  1GOF A;  3KZ4 C;  2NMN A;  1S0F A;  3AX4 A;  1VE0 A;  1UY1 A;  3RVH A;  1AR7 1;  1X7N A;  2YU2 A;  1OFN A;  5D2A A;  3ZXA C;  2VTX A;  2CAU A;  2DUQ A;  3U14 A;  1ZBA 1;  1VBB 2;  5C9A B;  1GOH A;  3HIF A;  1UO9 A;  4YW6 A;  3WNP A;  5A6Z A;  4FVV A;  4QDQ A;  1MZE A;  3MYX A;  4MSV A;  1S1A A;  5B2G B;  1HB3 A;  1SHW B;  3VBF B;  1YIP A;  4MGQ A;  3VBS A;  5KHG A;  1HB4 A;  4GIQ A;  3FBY A;  1KDM A;  3CZU A;  3PIG A;  4QWN A;  5JPN B;  1LUL A;  3GCX A;  2DFB A;  1C4R A;  4LT5 A;  4M0H A;  1MQT A;  1W6N B;  3DL3 A;  3AXD A;  1TEI A;  4FOV A;  4MV2 A;  3RS6 A;  2XJU A;  3POB A;  5J1X A;  3O0X A;  1XBF A;  2ARX A;  5TSW A;  5CU1 A;  2WT0 A;  1LOF A;  3VZN A;  1HV1 A;  1D0H A;  4C1X A;  4DMI A;  5LZ6 A;  2B9U A;  4HK8 A;  3PTY A;  1PM7 A;  2HEV F;  3UKT A;  4XF0 A;  3K3O A;  1W6Q A;  1OC1 A;  2JDY A;  2V4A A;  4HPK B;  4IV1 A;  2TBV A;  1NY7 1;  3N7L A;  1SBD A;  1XOY A;  1AR8 2;  3O1U A;  1GU3 A;  4ATE A;  1FMD 1;  2KXL A;  3N9L A;  2GND A;  3WW3 A;  1D4M 2;  3T4H B;  1LU1 A;  3NWK A;  3VZO A;  1ND2 A;  3QCW A;  5GLZ A;  4Z2W A;  5L36 A;  5GZF A;  1JZ4 A;  4Y3O A;  4ZXK A;  2HWB 1;  4Q0P A;  4YG6 A;  5IVF A;  5LB6 A;  1JOB A;  2ZGL A;  4F83 A;  4Q8L A;  1W2U A;  4Q4X 1;  5DAW A;  1LR5 A;  1UOF A;  2G4I A;  3S7E A;  3M4F A;  3RI9 A;  1SCS A;  5G05 L;  3M3E A;  3AJZ A;  4AI1 A;  5T5L A;  2G1M A;  4AHX A;  1MZF A;  1Y9M A;  1ZZ8 A;  3OBR A;  1UY2 A;  1W8F A;  1DF0 A;  2HWD 1;  4DUX A;  1AX2 A;  1XRU A;  2W1Q A;  2VAU A;  1V9U 3;  1HIX A;  5F5Q A;  4ES8 A;  1BKZ A;  3N3H A;  4IEV A;  2HWE 2;  1VMF A;  5IK7 A;  3H8R A;  4CEW B;  5CBL A;  1LB2 A;  3J8F 3;  3NNF A;  4LMF A;  4QXK A;  1H1I A;  2HWF 1;  5FPB A;  3VV1 A;  1AR7 3;  2NN8 A;  4WZC A;  5IK8 A;  1VRH 3;  2ZAC A;  3KSC A;  4DB5 A;  1R64 A;  1ZVF A;  4EN7 B;  1S2B A;  3EO6 A;  4PF1 A;  2FDG A;  3MF9 A;  4DZG A;  4R8H A;  5GLU A;  3T1M A;  2ZGU A;  5JMO A;  1PO1 2;  1IHM A;  1B35 C;  4XHB A;  1ZRF A;  5L73 A;  4L0P A;  3UYJ A;  1WA6 X;  2P3K A;  3LB9 A;  4LJH A;  4RR3 C;  1VR3 A;  1XSR A;  4BCU A;  4EV0 A;  1EPW A;  2WNV A;  2ZEX A;  1NOV A;  2P17 A;  3OGS A;  5K0U A;  2E7A A;  1HXS 3;  4BB3 A;  1K42 A;  3NV4 A;  1UN1 A;  5A32 B;  2XJQ A;  4H3W A;  1S0D A;  2ZMK A;  4FPF A;  5EV7 A;  1W6M A;  1DQ2 A;  1PNF A;  2PLV 1;  4R4X A;  2P2K A;  3QAC A;  2HBT A;  4XDO A;  1CJD A;  2BNO A;  2VVD A;  4YZ3 A;  1MQT B;  5FPX A;  4HKO A;  4AI3 A;  4CUB A;  3BIW E;  3VL8 A;  2BJS A;  3ZN4 A;  1ASJ 2;  1UOJ A;  3DCQ A;  4UBH A;  3WG3 A;  2BBA A;  3LOB A;  1HQL A;  1OOP C;  4QPG A;  1W2N A;  1H8T C;  1BCX A;  4M4P A;  3RYK A;  2GMM A;  5A3P A;  3BU7 A;  1VIW B;  4EE2 A;  2PYT A;  4YFW A;  1GZT A;  1W6Q B;  2CU5 A;  3IAQ A;  4Q4V 3;  4IV1 B;  1PK6 A;  2Y6F A;  2A3Y A;  4ERO A;  4UFM A;  3PUI A;  4K9S A;  4FFI A;  3VBH C;  2WZR 1;  5KXE A;  5EYY A;  2WKK A;  2EAK A;  2A5Z A;  1XNK A;  2XJV A;  3MBW A;  2ZHN A;  3WR0 A;  3ACF A;  4MHU A;  1ND2 B;  2GMP A;  4BLI A;  4FAG A;  1IPJ A;  4L11 A;  5ISL A;  1NCR C;  3OY8 A;  1LOA A;  2IWG B;  2PAM A;  3C7O A;  1POV 0;  1CPN A;  3JBG 2;  4Q0Q A;  4DNY A;  5JXJ A;  4YG0 A;  2X5I B;  4I0A A;  2QCS B;  5FPZ A;  1TMF 1;  5DZF A;  5AFE A;  1TME 2;  2OYZ A;  2Z42 A;  4CYD A;  3TOJ A;  5HBA A;  2E7T A;  4JZR A;  1UY0 A;  2VTF A;  2YC4 A;  3POE A;  1W6O A;  2HWB 2;  4YW1 A;  2X05 A;  4YWA A;  1HDK A;  3HBZ A;  4NOT A;  2XBO 1;  5FJH A;  3O14 A;  1GZ9 A;  2ORZ A;  5FMB A;  3RYP A;  5JXG A;  4AED C;  1LHU A;  2XJT A;  4BHP A;  2JX9 A;  4CXX A;  2C4X A;  3ZYG A;  1Q8V A;  2JE7 A;  3ENR A;  1IKQ A;  2FDJ A;  2XQX A;  4AEJ A;  4COY A;  2D44 A;  2VY0 A;  5FIX A;  4E8C A;  3WP3 A;  1I9R A;  5T3N A;  5FWJ A;  3LIH A;  4YM2 A;  2DUO A;  1YFX A;  4J1X A;  2D6M A;  4XET A;  2W1W A;  2K46 A;  4Z82 A;  2P1B A;  2WQ8 A;  1PNG A;  5FYH A;  2EIB A;  4B1L A;  1VJ2 A;  4Q4W 3;  2R06 3;  4BK5 A;  1JI6 A;  1GP4 A;  4CP9 A;  3VHP A;  2RJ2 A;  3EBR A;  3PL0 A;  4ASK A;  5A3U A;  1BBT 2;  4E4S A;  2D6L X;  1VRB A;  2ILM A;  4EN9 B;  1KS5 A;  1OMI A;  4QPI C;  1YUD A;  1NYW A;  5CKN A;  5K0U B;  2JEC A;  2RDQ A;  5FJK A;  1DIW A;  4QKF A;  3OOX A;  4B7K A;  3KS7 A;  5FDB A;  5LA0 A;  4AQ2 A;  4GD4 A;  1UX6 A;  2PLV 3;  1W6M B;  5C3O A;  1H1M A;  3VBU A;  4NPL A;  4CU6 A;  2FD8 A;  3NKG A;  3FL7 A;  4Y20 B;  4TXW A;  1RED A;  2EXJ A;  1Y3T A;  4QU1 A;  2WUH A;  4LKD A;  2ZGK A;  4LA3 A;  3C2U A;  4XUP A;  3ZSL A;  5F6L B;  2XHK A;  1PVC 1;  3WF3 A;  5FY5 A;  4N9I A;  4QPG B;  4AXO A;  2VZQ A;  2F17 A;  1MS0 A;  4FCA A;  2ZGS A;  4KU7 A;  4DXT A;  1NT0 A;  5BV6 A;  1QJU 1;  1PK6 B;  2WZR 3;  1PHM A;  1QDC A;  5C9A C;  1PIV 2;  3AZV A;  1FV2 A;  1G6N A;  5IAX A;  3NNM A;  3M3O A;  3ACG A;  4P08 A;  3SKJ E;  1AR6 2;  4XDP A;  5H9Q A;  2DCJ A;  3VBF C;  1MS8 A;  4D8M A;  1BK0 A;  3NV3 A;  1ZA4 A;  2G9Z A;  3I54 A;  1UMI A;  2P34 A;  3U11 A;  4BM8 A;  3OY8 B;  1BK1 A;  1CAX A;  4H7L A;  4I02 A;  5A6Y A;  5F1R A;  3DN7 A;  1TMF 3;  2H0V A;  2YGL A;  4CDW A;  4N7I A;  4Y5Z 0;  4MGZ E;  2RS3 2;  2ZKN A;  1WKY A;  4LOT A;  4CCE A;  1OXC A;  3WP5 A;  2WQZ C;  4L9B A;  1QNY A;  1GR3 A;  5I8T A;  1CZS A;  3RG0 A;  1W6O B;  2Y6J A;  4D0Q A;  2QTW B;  3IZO A;  3WP6 A;  1ZBE 2;  1O3T A;  4KBB A;  1UYP A;  4IER A;  3LDB A;  2A73 B;  3T30 A;  4M4R A;  4ZS3 A;  1W99 A;  1F4A A;  3LA2 A;  1GBG A;  3W21 A;  3LDK A;  3BTX A;  1JS9 A;  5C3S A;  2Y33 A;  2B46 X;  4CEY A;  4KWK A;  3JCI A;  2R16 A;  1L7Q A;  2FCU A;  4OUL A;  3UJO A;  3LSE A;  4QX3 A;  3AYE A;  3AKR A;  4CDW B;  1OI6 A;  1HQW A;  2PAK A;  1WA4 A;  4X6R B;  4Y5S A;  4LBJ A;  3HOB A;  2XBO 2;  3IN9 A;  4LBL A;  4WBB A;  3LA3 A;  4YLZ A;  3T08 A;  4XTM A;  4CP9 B;  2NYY A;  4I0B A;  1E5S A;  3LWC A;  4JTO A;  3B69 A;  1EAH 1;  1JOD A;  5C8C A;  5I8Y A;  5I0U A;  5F6K A;  2R1B A;  3M3C A;  1K3I A;  2EID A;  3A22 A;  3AZZ A;  3L2H A;  1R1A 2;  4Q26 A;  5A3O A;  3DEC A;  1UZW A;  2VNG A;  3ZKU A;  1N3O A;  4XFA A;  2C9A A;  3ZLI A;  1PMJ X;  4MGS A;  1QHD A;  3VBU B;  2VNR A;  1LGN A;  1G9F A;  2R49 A;  1URX A;  3UK9 A;  1L7L A;  4LBN A;  5A70 A;  3BOW A;  4YPJ A;  2PAE A;  3ZIW A;  1N3P A;  1Q8P A;  1F2N A;  3ZFG A;  1QQP 2;  1NA1 B;  5A7P A;  4CEW C;  5FZ0 A;  3USU A;  2BRT A;  3NL1 A;  3SH3 A;  1IQA A;  3GZE A;  1XNA A;  1OF3 A;  1W3V A;  4QPW A;  3WW2 A;  3B00 A;  4CCL A;  2BW8 A;  5C5T A;  4LOS A;  5ACA 3;  2D3P A;  4UFI A;  1HRV 2;  2FBE A;  5LWB A;  3JD7 1;  2IVI B;  4FFF A;  3DYO A;  3O7O A;  1CZT A;  2YBS A;  2D93 A;  4IEU A;  4WVW A;  3TN9 1;  4BXS V;  4XTP A;  1UZV A;  3WNO A;  3N35 A;  1BXH A;  1K45 A;  2VQ0 A;  3RYR A;  2XLG A;  3MUZ 1;  2VZS A;  1SFP A;  1VAK A;  2PHF A;  1WCK A;  4P5H A;  1RUJ 1;  2VUA A;  4OZO A;  1RMU 2;  5F2W A;  3KD4 A;  1CIY A;  1W9Y A;  2B8M A;  2HWC 3;  3OCP A;  1ZZB A;  4JRA A;  1SDD B;  2QE3 A;  3N9P A;  1QJX 2;  1WBL A;  2XWB B;  1IPK A;  2I2S A;  3QLQ A;  4M00 A;  4RGK A;  5FZL A;  1MQT C;  3T2P A;  2WS9 1;  4BIS A;  5C70 A;  3N9N A;  1BVV A;  3H1M A;  4ZZ5 A;  3AP5 A;  3KV6 A;  3LSD A;  2Y6K A;  3FUQ A;  3RZG A;  1LOF C;  5F3I A;  2VOW A;  4JRL A;  2R7E B;  5J48 A;  4BIF A;  3VDC A;  1X9T A;  4XAA A;  1UXX X;  1IOA A;  4IV1 C;  4XW3 A;  1QEX A;  5IT6 A;  5FY7 A;  2HEY F;  5L9B A;  2IXI A;  2QUO A;  3R4U A;  2H0B A;  1KFU L;  5IFT A;  4BMB A;  2GNB A;  4SBV A;  4CEY B;  2VD7 A;  4DEV A;  2RMU 3;  2KM2 A;  2PHD A;  3CJI A;  3RZZ A;  4AI0 A;  2RDS A;  3AMM A;  4E9K A;  1ND2 C;  5T52 A;  3RZM A;  1RUD 3;  3TYJ A;  5IVJ A;  5JSR A;  4LOR A;  2RS5 1;  1LTE A;  1UF2 C;  2Q5T A;  3SIT A;  3WY6 A;  1EAH 3;  2X5I C;  3LEM A;  4NII A;  1QH6 A;  4PIZ A;  3T2O A;  2EIC A;  3WNK A;  1XNT A;  1UYX A;  1LOE A;  1WW6 A;  5C8C B;  3RRD A;  3IT8 A;  3PVE A;  3SLI A;  1PGL 2;  3WG4 A;  3LGR A;  1XPW A;  4DEQ A;  1C8M 1;  2QQU A;  4H2A A;  3D82 A;  5F8P A;  4K3U A;  5DAB A;  2RE9 A;  4J25 A;  4XJ9 A;  3U75 A;  3NAP A;  4YGD A;  2Y34 A;  4QDR A;  4KNC A;  5FOJ B;  3MLL A;  2TNF A;  4CCD A;  2UY8 A;  3GYD A;  1NXM A;  1H8V A;  3PLQ A;  3LOI A;  4JX0 A;  2RDR A;  2GDF A;  3ZFG B;  3VD4 A;  1J3R A;  4FSJ A;  2W39 A;  3USU B;  2A6W A;  5EJ1 B;  4P9G A;  2QQM A;  1LGB A;  1RUC 3;  2BOI A;  2OVU A;  2VMI A;  2YBK A;  3POS A;  1UOB A;  2WBK A;  1JW6 A;  3I2F A;  5FKC A;  4JKK A;  1PX3 A;  3RFR A;  1HJF A;  3OBZ A;  1HRI 1;  1RVF 1;  2RR1 1;  3H0O A;  3W5N A;  4BXF A;  2DCT A;  2ZX2 A;  5FMD A;  5J09 A;  1HW5 A;  1LCL A;  2PHR A;  4XUO A;  2WFP A;  3KHB A;  3IWZ A;  2JWP A;  5FZ9 A;  5K0U C;  2Y38 A;  1OQE A;  3RZJ A;  1C1L A;  1Q8S A;  4QU2 A;  1N1Y A;  2DWR A;  4TN7 A;  5A7Q A;  1RUJ 3;  1NQJ A;  1V00 A;  5FZ3 A;  5JXI A;  2DVA A;  1IKP A;  2XDV A;  4CU9 A;  5GZE A;  2BWA A;  1VBD 2;  2ZHM A;  3MV1 1;  3P5B A;  3AC0 A;  1NX9 A;  4OYU A;  3JUU A;  2H6B A;  4Y4R A;  5GKA C;  1EY2 A;  3OUJ A;  4JAA A;  5LK5 A;  1R08 2;  5EZW A;  1YQ2 A;  4AEK A;  3WDV A;  4HON A;  5F3C A;  4QDS A;  4PLO A;  4QD2 A;  3VKN A;  3GAL A;  2MEV 1;  1HV0 A;  4S2F A;  4UWD A;  5C3R A;  1D2S A;  4B3N A;  1MVQ A;  1LU2 A;  2ZGT A;  3A23 A;  5SV5 A;  1H4H A;  2VUC A;  2WO3 A;  1XND A;  4QPG C;  4YM3 A;  1JZ5 A;  1VBA 1;  4JDO A;  2ZEY A;  2XLF A;  1NAE A;  3LEK A;  4K20 A;  4HXC A;  1OOP A;  1PK6 C;  1UIK A;  2ZX3 A;  4B4Q A;  3O1S A;  2WS9 2;  4FOY A;  2OS2 A;  4FXK B;  4CXW A;  4CSW A;  3ZO0 B;  1MEC 3;  4YGB A;  2R07 1;  3CJI B;  3VLB B;  1DQ4 A;  1DFQ A;  4AI8 A;  3VBH A;  1DHK B;  4BPZ A;  2RS5 3;  3FZ3 A;  1RIT A;  3LQC A;  1ZRE A;  4CDQ A;  2W47 A;  5FP9 A;  4JVA A;  4LO4 B;  5K9Y A;  1Z7S 3;  4HBN A;  4C91 A;  3AMH A;  4DRR A;  2E6V A;  5FZE A;  5FP8 A;  4AHW A;  1M06 G;  1KDK A;  1GMM A;  3RZH A;  4QGL A;  4PCR A;  1G9B A;  3PU3 A;  1EPZ A;  4TLG A;  3FJS A;  4UAP A;  3ZXG A;  2O1Q A;  1G9D A;  3CZJ A;  3PUH A;  1AL2 2;  3Q9O A;  3NMB A;  1ENS A;  4LNV A;  2A1X A;  3NAP B;  3ZXD A;  3T0D A;  5IWF A;  4UI9 L;  3OSD A;  4FO9 A;  2O8Q A;  3USS A;  3BYW A;  3FHI B;  3AP6 A;  1DQ5 A;  2HLE A;  2OZ6 A;  5FYY A;  4DXS A;  1P8J A;  1C8M 2;  1W9W A;  4L99 A;  4AED A;  1AJK A;  2MNG A;  4NO4 A;  1RGS A;  3VKL A;  1ZA7 A;  4GB3 3;  1HRI 3;  2P3I A;  1O4Y A;  2WDB A;  3MIC A;  5C4W A;  1F8V A;  2W9X A;  3HBK A;  2LUW A;  2BER A;  2XL9 A;  1DGR A;  5B4X A;  4YW7 A;  3AXE A;  5A33 A;  2VVE A;  5FUI A;  4ZPI A;  1FOD 3;  3RNS A;  2OUJ A;  2W92 A;  2ZZJ A;  2XWJ B;  4EN6 B;  1J58 A;  4K1Z A;  2VZO A;  5J96 B;  1ULO A;  1MPX A;  1YFU A;  1QXJ A;  5LA1 A;  3KT4 A;  2WAB A;  3KMH A;  2VQT A;  3LA7 A;  3MV0 1;  3WXP A;  3VBU C;  3D8C A;  2SBA A;  4LKS A;  2UYB A;  4ET7 A;  1UZ0 A;  2A71 A;  2JDP A;  1EUU A;  4I09 A;  3PVB B;  1RUE 3;  4Q0S A;  3WX5 A;  1V6N A;  1R09 3;  1D0G A;  3ETQ A;  4LE3 A;  3WP4 A;  3ZFE A;  1ND3 A;  1ZYB A;  4K8R B;  3LD8 A;  3PTR B;  3WDX A;  3A4U A;  1NA1 C;  5LBF A;  1VBA 3;  4V1P A;  4CCM A;  2WNU A;  4E4Z A;  4Z2A A;  1QMJ A;  2QDR A;  2W94 A;  2UY9 A;  1VBB 1;  5D1I A;  1UU6 A;  3F2Z A;  2CGO A;  3A7Q A;  4EN0 A;  4FQZ A;  3NW4 A;  4JDN A;  4QKD A;  4KI5 M;  2YDE A;  5EYX A;  3M3I A;  2X8K A;  3WF0 A;  4E4H A;  4IGP A;  2XGX A;  1SZB A;  2WWU A;  4BYY A;  1BQP A;  1PGW 2;  1V6O A;  2P37 A;  3BCW A;  3V0B A;  3WQ7 A;  4KMQ A;  1DGR N;  1YI9 A;  4OI4 A;  1GQH A;  2D43 A;  1JMU B;  3AKS A;  3KF5 A;  3GM8 A;  3ZDV A;  3WW4 A;  3BTY A;  1PO2 3;  1ULG A;  1OUX A;  5FRE A;  3ZVX A;  4QX7 A;  4CDQ B;  5HCA A;  2B9V A;  1H9W A;  4JHZ A;  4XF4 A;  4CDW C;  1AYN 3;  3H1W A;  1HB1 A;  4IL7 A;  4O65 A;  3VB9 A;  1GOG A;  2JIC A;  4LO8 A;  4P9X A;  5I0T A;  1QJY 3;  1SLL A;  1XQN A;  2B7Y A;  2R07 2;  3PIJ A;  5GZD A;  5BNO A;  2GH8 A;  5EJZ B;  4XBL A;  1JOJ A;  3SEP A;  5KHI A;  5FY8 A;  1S0B A;  4LBO A;  2BGC A;  4R9D A;  1AR8 1;  1K12 A;  2VO5 A;  3KV4 A;  4KU8 A;  3RPQ A;  3RJR A;  3JQW A;  1JHN A;  1SFN A;  2VBP A;  5F5I A;  3VDD A;  4BWO A;  4LIT A;  1NQD A;  4S2H A;  4E2S A;  4NHL A;  1D4M 1;  3AL5 A;  1VBE 2;  2PMW B;  4YW5 A;  4LHK A;  5F2S A;  3IDE A;  1PZ8 A;  1JYX A;  2WFF 3;  2PHL A;  4CEY C;  4Q0V A;  1W2O A;  4HPK A;  4OFG A;  3JQX A;  5F5A A;  4URT A;  5LAS A;  1O3Q A;  1GP6 A;  4FT8 A;  3KGL A;  1QGL A;  2JE8 A;  1MS3 A;  5C4W B;  5FLI A;  3I2H A;  4PLN A;  1C8N A;  4BK4 A;  3POY A;  1WMF A;  5A33 B;  2AZ5 A;  4P9I A;  2DBN A;  1U0A A;  2GN3 A;  5FLJ A;  2AGS A;  3AMP A;  1GIC A;  4M01 A;  5C8C C;  1DYP A;  2AAC A;  1V70 A;  2OW4 A;  2R04 1;  3ALQ A;  3VHN A;  5LY1 A;  1HLC A;  3BPS A;  4ISQ A;  3I2G A;  2HWE 1;  5A80 A;  4PDW A;  3P3P A;  3LE0 A;  5FK8 A;  5LW9 A;  3T3Y A;  4FPY A;  3ZFE B;  5FMC A;  2XJR A;  1AXY A;  4WVZ A;  1RUH 2;  3CL1 A;  2WJS A;  1ND3 B;  3LFI A;  4PBP A;  1H2M A;  5F39 A;  4FPC A;  3ZFG C;  3ACH A;  4GWI A;  4IET A;  4GAL A;  1VBB 3;  2WNU B;  5FBZ A;  3AVS A;  1RUI 2;  2B45 X;  3KCC A;  5FXX A;  3ZYP A;  1K5M A;  1PO1 1;  3BI3 A;  1AX1 A;  2FMY A;  2ARC A;  4CRQ A;  4Z92 B;  4W6Y A;  2AC1 A;  3ZYB A;  4AVT A;  2RS1 2;  5C3Q A;  1ENX A;  5EFU A;  3RDI A;  2XPJ A;  4XQD A;  2ZEW A;  2BUK A;  1JYW A;  2W91 A;  5KXC A;  1V6I A;  4XVH A;  4L97 A;  1VLN A;  3H3Z A;  2VNO A;  4XXA A;  3V0B B;  2QZ2 A;  3AKT A;  3AP7 A;  2J1R A;  3V0A A;  2HH9 A;  4P9L A;  4JHT A;  5ANN A;  4NUB A;  4OHY A;  2VW0 A;  1ASJ 1;  3I2K A;  4N8M A;  4Q8K A;  1MZ6 A;  2GP5 A;  3O1T A;  2E31 A;  3OBA A;  3NNG A;  5JWP A;  3QD6 A;  1AYM 2;  1K5J A;  5A32 A;  1NCQ A;  1SLA A;  2Y26 A;  5BNO B;  4QM9 A;  5K7P A;  3N7J A;  2Q8D A;  2C26 A;  3CIH A;  4RQP A;  4AE2 A;  1AR8 3;  1PGS A;  1F4H A;  4OI1 A;  5KHK A;  4KGG A;  4GUL A;  3IKW A;  3VDD B;  2WZE A;  1SLB A;  1D4M 3;  4EN8 B;  3G6J B;  5E89 A;  5FYS A;  4JDM A;  4NID A;  5FP4 A;  3VZL A;  5FO9 B;  4ZU7 A;  4HLT A;  4F7Z A;  3HWJ A;  4CDU A;  4GJZ A;  3CJI C;  3ZMN A;  3JBG 1;  2F6B A;  5A7N A;  4EWD A;  1RUG 3;  5KC5 A;  1XYP A;  5GLT A;  5FP3 A;  1ZRR A;  2JXA A;  4XAE A;  1TME 1;  2VMD A;  5HCF A;  4Z1V A;  4URA A;  1UY4 A;  1UQX A;  2V5D A;  4K6B A;  2XUM A;  5LEK A;  2JIG A;  3MEP A;  1WD3 A;  5IAV A;  3SC7 X;  4QHB A;  3MID A;  4RGA A;  5FYC A;  2YRO A;  3GZT B;  2O8O A;  2LW8 A;  3I4I A;  3J7H A;  1YWK A;  2X5I A;  4W4Z A;  2A3X A;  4Y4Y A;  1MVE A;  4OUE A;  1QWR A;  4IEX A;  4PDW B;  1W0O A;  3H7J A;  3ZYH A;  3NAP C;  3D0J A;  5CFC A;  1DGW A;  4XIL A;  4ZY9 A;  4ONU A;  1LOC A;  2ZS6 B;  4BA6 A;  5I8S A;  4FTE A;  1WCU A;  2R04 2;  3URF A;  1PO1 3;  2ZGP A;  1AHS A;  4F3J A;  2ZGQ A;  3K2O A;  5A3T A;  1XNC A;  1K5M B;  4Q27 A;  2DYC A;  2VXJ A;  3QH6 A;  1BBT 1;  4AEM A;  1OVS A;  1ULE A;  3J7L A;  4GH4 A;  5CIR A;  2I45 A;  5CZK A;  1CON A;  2V09 A;  4ZZ8 A;  1TQ5 A;  4LLO A;  3M8L A;  1O59 A;  4UBG A;  2VU9 A;  1QOS A;  3AZY A;  2J1U A;  1ZBA 3;  4MH0 E;  1NG0 A;  3VD9 A;  1BZW A;  3V0A B;  4B1M A;  2IZW A;  1W39 A;  1R1Z A;  2DTY A;  2VM9 A;  3EYP A;  1ASJ 3;  4MX3 A;  4PI2 A;  1QH7 A;  3OPT A;  5FXV A;  1OA2 A;  3D0S A;  4UFH A;  2VEC A;  5E16 A;  1KQR A;  1U5I A;  4FOW A;  1X33 A;  1XE8 A;  3PVO A;  1EYB A;  2RG4 A;  1NCQ B;  3KWV A;  4XJ8 A;  4RQP B;  3MZH A;  1F9K A;  5C5U A;  2A75 A;  3ORJ A;  4Y20 A;  1MS4 A;  4U2A A;  5DDJ 1;  2BV4 A;  2W52 A;  4GMP 0;  3FHA A;  3KF3 A;  2JB8 A;  3NKT A;  4OLL A;  1PIV 1;  3M3Q A;  5T5J A;  4AW7 A;  5T50 A;  1V9U 2;  3RMX A;  3H8X A;  1AR6 1;  2YXS A;  4XQ4 A;  5FTT C;  2ZHL A;  3MI8 A;  4HT1 T;  1AXK A;  4XJW A;  4B7E A;  3JBG 3;  4CDU B;  4OZX A;  5FYI A;  1FMD 3;  4IE4 A; 
#chains in the Genus database with same CATH homology
 5LBE A;  3OBZ A;  4Q5O A;  4ZON A;  5EQU A;  5LA9 A;  3GJA A;  5LB6 A;  5IAT A;  4NHM A;  2HBU A;  3MGU A;  3OUH A;  5DAW A;  3NNL A;  5LBB A;  5DAQ A;  3KT1 A;  3OUJ A;  3HQU A;  2G1M A;  5DAX A;  3PL0 A;  5A3U A;  3GZE A;  4Y5T A;  4XCA A;  4NAO A;  4UWD A;  5C5T A;  4BQX A;  3NNJ A;  5LAT A;  2RDN A;  2RDQ A;  5LBC A;  4MHR A;  3BVC A;  5EP9 A;  3EMR A;  2JIG A;  5DAV A;  5ERL A;  5IAV A;  3NNF A;  3OUI A;  4NHL A;  5HV0 A;  2JIJ A;  4XAC A;  4NHY A;  5LAS A;  3HQR A;  4XAB A;  5IAX A;  4XAA A;  3NNM A;  5L9B A;  2HBT A;  2A1X A;  4BQW A;  4XC9 A;  2RDS A;  4BQY A;  2G19 A;  5EPA A;  5M0T A;  4NHX A;  2FCT A;  2FCV A;  4NMI A;  5L9V A;  4KBZ A;  3KT7 A;  4NHK A;  3DKQ A;  2RG4 A;  4MHU A;  4ZPI A;  3W20 A;  3W21 A;  5C5U A;  2Y33 A;  4J25 A;  3GJB A;  5L9R A;  2FCU A;  2Y34 A;  4IW3 A;  3KT4 A;  5DAP A;  2OPW A;  4Y5S A;  2RDR A;  4XCB A;  5HV4 A;  4JZR A;  3ITQ A;  2V4A A;  5LBF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...