4QT6A

Crystal structure of the spry domain of human herc1
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
159
structure length
159
Chain Sequence
GFDPEKAQCCLVENGQILTHGSGGKGYGLASTGVTSGCYQWKFYIVKENRGNEGTCVGVSRWPVHDFNHRTTSDMWLYRAYSGNLYHNGEQTLTLSSFTQGDFITCVLDMEARTISFGKNGEEPKLAFEDVDAAELYPCVMFYSSNPGEKVKICDMQMR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Probable E3 ubiquitin-protein ligase HERC1
publication title Crystal structure of the SPRY domain of human HERC1
rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 37
structure length 159
sequence length 159
ec nomenclature ec 2.3.2.26: HECT-type E3 ubiquitin transferase.
pdb deposition date 2014-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00622 SPRY SPRY domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.920 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4qt6A00
4P9IA 5JIAA 4WVMA 5JI7A 4B3NA 2LM3A 4QT6A 4N7IA 3KB5A 2FBEA 4P9JA 2WL1A 5JI9A 4N7UA 2VOKA 2E63A 5F6LB 4WVMB 3TOJA 4X8PA 4P9LA 4XW3A 4B8EA 5F6KA 2YUEA 4X8NA 2IWGB 3ZO0B 4V1PA 2YYOA 5C33A 4KG0A 3UV9A 5JIUA
chains in the Genus database with same CATH superfamily
1GWKA 3AYEA 3APBA 3AB0A 3O1VA 1JOBA 4HVQA 2VJXA 2JDZA 1EYBA 4HVRA 3VD5A 2BVVA 1HXS2 4UW3A 3IMMA 1AYN2 1IS6A 1H8TB 2HWF2 3DPRA 3V56A 4COWA 3WNLA 2BQPA 2JDPA 3ILNA 3X29B 4J1WA 4FAHA 1OD3A 2BFUL 2VOVA 2V5YA 1K5MB 4AI8A 1REDA 5FY9A 3OUJA 2WYFA 1UOGA 3NV1A 1Q8PA 1A8DA 3J7LA 3TWIA 3A0KA 3LKJA 3ZKUA 1L7RA 1LU2A 2GN7A 1PGL2 3I2DA 3JUUA 1ND3A 1NX9A 1JH5A 4MADA 4OUEA 1ZZBA 1RJ7A 5DAVA 3V0BA 4WM8B 2F4PA 2QQKA 2MHFA 3AZXA 3RS6A 5FYCA 2VW0A 4XXAA 1BBT1 4R9CA 5FYYA 1AUYA 5I0SA 4G9SB 3UNPA 1JODA 3WP3A 5FKBA 4IEYA 3K48A 2WN3A 3BU7A 3LA7A 3NJYA 1IKPA 2KA3A 3DUIA 2RHPA 3PLQA 4HVOA 5KHJA 1OA2A 4Q4W1 3UT0A 1NQDA 2AEYA 3R4SA 3I7DA 4CEWC 4P9YA 1QJEA 3WQ1A 5BNNA 3I2GA 1Q3EA 2IFRA 1AR81 2XVGA 2FDGA 4KBZA 2AACA 2RM23 2JE9A 1IS5A 1QJFA 1RVF2 3W58A 1Q8SA 1AF9A 4AOCA 4WM7A 3FLRA 3ACFA 1TME3 1B35C 1AR71 1DGWX 3ATGA 5A6YA 3A22A 4GWJA 3LDKA 5EXOA 2ZGMA 4LR4A 1F2NA 2TNFA 3IMNA 3PURA 4QT6A 3FX3A 3P6BA 4XHXA 5T55A 4YVWC 3Q9OA 2ENRA 3WUCA 2ID4A 2X10A 3ZXKA 2WFF3 3MF6A 2A3YA 1V9U1 2CTVA 5F6LB 1YCIA 1CAWB 2VVEA 2ERFA 3D8CA 4SLIA 4AG4A 1QJX1 1F5FA 3USUA 3FC0A 1POV1 1OA3A 4NHLA 3WNMA 1HJFA 3NMBA 4MHUA 5EJ3A 1ZA7A 2BV4A 3LAGA 2Y34A 3OD4A 2VY0A 2EXHA 4MH0E 4PDWC 4Y1VA 2GH2A 2HWD2 2R063 5FPVA 1D0GA 1DQ4A 1EV13 1W2OA 5KR7A 1ENQA 4QAWA 1POV0 1WW4A 4RS5A 2VXRA 3FJSA 4ZU5A 5IAVA 3SLIA 1HRI2 3MO4A 4C1XA 3JB4C 2KM2A 3E6BA 1ZBA1 5CEHA 3OF1A 3HOBA 4NO4A 4Y1UA 1ULOA 4D7SA 4Z2AA 5KC6A 4QX0A 5EQUA 1DLCA 2VNGA 4JTOA 5A6XA 4NPRA 1X82A 2WS93 3OPWA 3VBUC 3ES1A 5J1XA 4DO0A 2D6NA 4CDUB 1VE0A 1R1A1 1N47A 1H9WA 4OHXA 5KHIA 2YU1A 1CPNA 1PX4A 4Q27A 3SCFA 4PIYA 1VBA3 3VKMA 3ZPYA 1HRV2 3W59A 2VBDA 2GNDA 2W92A 3NJXA 4IEOA 4O9EA 2IFWA 2YYOA 4LHLA 4FPEA 4QM9A 4YVSA 3VZKA 5EV7A 4IETA 5IVFA 3WUDA 4A6SA 1SHWB 4DUWA 5C9AA 5FREA 4IL7A 5B2GB 4RA0A 5FDBA 4XFBA 4XJZA 3VZMA 1QXRA 2VCBA 5JR7B 2VZTA 3ZFFC 1LRHA 2ZGRA 1JYTA 3IIAA 3OEBA 2A71A 4AHYA 3S0MA 2Y6FA 3ECQA 3M8LA 2RDQA 2C9AA 1A34A 4AVBA 3H50A 1HKDA 3HBZA 2QUOA 4K9SA 4QKNA 5FBJA 2R7EB 3POIA 4BWOA 1UU5A 1WGPA 3W20A 4AZZA 5CFDC 2BP6A 4AWDA 5A7WA 2ZMLA 2O1QA 3WVJA 4XABA 2CGOA 4UT5A 4CCCA 2JXAA 2BTVC 5LA9A 2W94A 1W6NB 2Y6GA 4HK9A 4MSVA 3KV5A 4AVTA 2G1MA 3SEEA 3EMRA 5FK7A 2LS6A 5ACA2 4INDA 4BJ0A 5FCCA 5FAXA 3FWEA 5HBAA 3LIGA 1MEC3 4UBGA 5D8AA 3ZVXA 5ABJC 1LGNA 3QD6A 4YM1A 1JHJA 3KM5A 2VAUA 1EUTA 1PVC1 1JZ4A 5G05L 2XL7A 3PIJA 1X50A 1X8EA 4C8DA 5FXVA 5FZAA 4M01A 1JYIA 3MYXA 3LOIA 5FZIA 3RDIA 4LK6A 1U5XA 2C5DA 4KWJA 4UI9L 3UKTA 1OKQA 2ZMNA 1Q8OA 2WFF2 3E5XA 3NW4A 4QPIB 2A6XA 2EALA 2ZZJA 3GDBA 1JZ3A 4Q4V3 3VZJA 1CX1A 2JJ6A 4Q8KA 5FO8B 4UW5A 1W9YA 2ET1A 4CVUA 3MLKA 3P3NA 4UW4A 3H3ZA 4FPLA 4FFGA 1LOGA 5JVVA 5L9VA 1CN1A 1SFPA 2W5FA 1EV12 1OFNA 5IVYA 4KWLA 3ZSMA 3PU8A 4BYYA 1NAEA 1UYZA 2J1SA 3IDEA 3MIHA 5JSRA 4F83A 4KNCA 1WCKA 5EJ1B 1J84A 5E88A 1CJPA 1UY4A 1XYNA 1GNYA 2DCKA 1RUI3 2HYKA 3U37A 2OQ6A 2GZWA 2HLEA 4JHZA 4HKWA 4LHKA 2DBNA 3OJBA 2WS92 4IEXA 4QX1A 2VUJA 2RG4A 1OLME 5DUXA 1ODMA 1CAVA 1ND2B 1QQP1 3POFA 4MYEA 5L73A 4F7ZA 1GQPA 4HT1T 4ITCA 4LKSA 4YLZA 4LEJA 2VQUA 1J58A 5D1IA 5JSPA 1MZEA 1CX4A 1R091 4LBQA 4U2AA 5CU1A 4UBHA 4BQWA 1BXHA 1A3KA 1ZRCA 4URAA 3AKRA 5FO9B 1WBLA 4EZHA 5FZLA 3SKJE 3CQOA 2R0HA 3PUSA 5FY7A 4AQ2A 1JXNA 2BUKA 3WOGA 2W0XA 2ILMA 4HMZA 1NCRC 2EAKA 1MS5A 2GP5A 5F5CA 4AF9A 1OUXA 1AZDA 4BQ3A 3NKTA 1H2LA 4C91A 4XEZA 5IVCA 1CAXB 3NNJA 4LBOA 4QPWA 3ZXGA 1SDDB 2WZEA 1BBT3 1WD3A 3NSTA 3MIDA 4AFBA 3IN9A 5FZ1A 1JU4A 2ETEA 2JDNA 3C7HA 4MXWA 2D7FA 3VKLA 3KCYA 3KMHA 1W6OA 4RQPC 3N9OA 3ZKYA 1KDKA 3ZFGC 1ZRDA 4DXTA 4Q4W3 3MDPA 3K4DA 2A6YA 4WZCA 4Q8LA 1CPMA 2W08A 4E2SA 2E7QA 4QKBA 1IOAA 1AR83 1BK1A 2ZHLA 2RS31 2Y6HA 5LEKA 1V70A 1C8M2 4IEQA 2VMIA 5H9QA 2XR4A 4GXLA 2WT2A 4P00B 2WLQA 3K2OA 4UF0B 4A7YA 1ULPA 1DYOA 3WDWA 3B94A 2VC9A 5D21A 1TMF2 4PCRA 2NLRA 1UX7A 3M4FA 2BYVE 3PHMA 3M7AA 4BQXA 1QJY2 5CG9A 1RTVA 1D7PM 2Z5WA 3FHQA 1AR73 1UMIA 2QQJA 3ZR6A 5HI0A 1WLCA 3ACGA 2D3SA 1XOYA 4UWDA 4DS0A 2BNNA 2VOXA 3IM0A 2Y6JA 3MIGA 4AGGA 4E4HA 1ZBE1 4XQ4A 2ZHNA 1BQPA 1DZRA 4CCOA 1AYM1 5JLVA 5KWRA 3RZLA 1MS9A 1O8PA 3A21A 2WZ8A 2P3KA 2Y60A 1W2UA 3EO6A 3S7IA 1V9U3 3CMGA 3O1RA 1NYWA 1PNGA 4XXPA 5DG2A 1QJX3 4XIOA 1U0AA 3N9LA 2HWC1 2PHUA 3C8XA 2E31A 2RDSA 2Q1FA 1A6CA 2PAEA 1MQTB 1DGRN 2ORZA 2Q0AA 3KZ4C 1POV3 3IPVA 3OUIA 2ZMKA 3WP6A 5CKMA 4AFAA 2RDRA 1F8VA 1GNZA 2JICA 1H1IA 1LCLA 1OOPB 3BB6A 3C2UA 4XFAA 4D3WA 5L7OB 3WDVA 2L9LA 2QQLA 2QDNA 4W4ZA 2FQPA 5J09A 4XF3A 1RUI2 2IXHA 3MW2A 1ZBA3 1JW6A 3LA3A 4DPNA 5IK5A 2W95A 3AX4A 2UYAA 3P1IA 1LOCA 3BI3A 1AL0G 1JTZX 3J8F2 4CCMA 3CZJA 1PVXA 3I2FA 2PTMA 1VR3A 2YHJA 4YW4A 4ZU4A 1BEV1 3TN91 5FZHA 1JYNA 1R1A3 4HPKA 3ZN6B 1HB2A 3VLBB 3MUZ1 4IV1A 1OH3A 3BU0A 1IS3A 1V0AA 3ZMNA 2UWAA 3HN1A 3I97A 3O1OA 1G8WA 2P34A 1NLQA 5HXVA 4EWEA 4BK4A 5CFCB 2ARBA 3D4KA 2B7YA 4IEZA 1XBFA 2YGLA 4P9IA 3ZIWA 1MZFA 1S0FA 1W06A 2XONA 3O0WA 5CBLA 5FP3A 1O4TA 1CQ9A 1SLBA 4LKDA 5F5IA 3OGSA 1UU4A 3CJIC 2NYYA 3TEWA 4G4FA 3LCPA 4N8MA 4COYA 3KF5A 2TUNA 1X33A 4EN8B 4A4AA 3BTAA 2DU1A 2O8QA 2GNTA 5JXJA 2VCCA 1CR7A 2VE1A 3H1WA 2XJPA 1RUE1 4FPFA 4SBVA 3AKTA 2DUPA 1ASJ1 3ZOIA 1AR82 1L7LA 1Z7S1 2WA3A 3ZSJA 1UF2C 2WSUA 1P8JA 3I2IA 1H8TA 3DKWA 5FK8A 1US2A 3I3QA 2WABA 1LENA 1PIV1 5JIAA 3RJRA 1LGBA 4QPGA 3U78A 2W9XA 1AR72 5LASA 1K5MA 2RJKA 2QQMA 1S4CA 3AC0A 4QGMA 3ZLIA 3EHKA 5DUWA 3T0AA 3NAPC 1PVC3 4QX3A 1LOAA 3D82A 2O8OA 2VU9A 4IQPA 3ZMOA 1KS4A 1PM7A 3POGA 3OYWB 4JRAA 2RV9A 1Q56A 1AJKA 1YYNA 1XC6A 2FMYA 1V9U2 4JKMA 4WM8A 1WMXA 1QKQA 4Y24A 1QJX2 1GOFA 5K0UC 3EB7A 2NM1A 1DGLA 5F5AA 3OGRA 3H8RA 3BTYA 3ZPOA 1MZ6A 2ZABA 3VHNA 1QIQA 4Q4Y1 3WZ1A 3LDRA 4QDRA 1XJAA 4LMFA 1XU2A 2C9KA 4P14A 4B3NA 4YSFA 2A3XA 1PMHX 2RE9A 3CNAA 3K4ZA 1I3HA 1ZBA2 4CCNA 4JGZC 2V4VA 3JBG2 5FZ0A 1HB3A 1DFQA 1S2EA 2WINB 1ZNPA 4EN9B 5LRRA 2QCSB 3I54A 2PHDA 1SEFA 1OI6A 3AKQA 2Y33A 3VBHB 4BM8A 1QQP3 1R1A2 1DU3D 5C5TA 4XJWA 4XYXA 1V00A 4HG6B 4U36A 4GKXA 1NLSA 2O0OA 2ZGSA 1R093 2Q8OA 3ZYRA 1LKNA 1CAWA 1MACA 3GHNA 3VBOC 3B01A 5C71A 3IBMA 3BODA 3BIEA 1RHI1 2BZDA 2OT7A 1LHVA 3AZWA 3GCXA 3VDDB 3W21A 2X5IB 5FYBA 3OGGA 3JQXA 4OVEA 1E57A 1F4HA 4QXBA 4CDQB 1FAYA 1L7QA 4BQ2A 4NAMA 1GU3A 5JOZA 3T08A 2UY9A 2R32A 1O8SA 4LUMA 4DY3A 3GBGA 2R16A 4ZONA 4YZ3A 2B45X 5GLVA 1S55A 4BMBA 4QB2A 3ILFA 1YJLA 3UGHA 3NV4A 5FO7B 1IG0A 1BLZA 1LJ7A 1J59A 5FYHA 1AXZA 3LSEA 2W87A 3FBYA 2R6QA 3A0NA 4QQLA 4I2OA 3VDAA 1DG6A 2V5DA 4HN1A 3KCXA 5FZBA 1MS3A 2Q8EA 5H9SA 4AE2A 4CDUA 3ZYGA 4AQTA 2WLPA 1XSRA 2RS33 1S0DA 5FZ9A 3U75A 2BJSA 2YC0A 3ZFEC 2DYCA 4ZU7A 4K7JA 3MLJA 5KXDA 3VZOA 4KBBA 4BE3A 4AI9A 4DXZA 1FMD2 5K4LA 3VBRA 4HOOA 2DCTA 1KDMA 2W1QA 4D69A 1G86A 5KHGA 3I49A 2QQVA 1HQNA 1FXZA 2VZRA 3RJ2X 4NIDA 2DDUA 1QOSA 2PXJA 1I5ZA 2Y0OA 5FY4A 1RIRA 5M0TA 4FPOB 3NJVA 4MXVA 1AYM3 1XNAA 5T5OA 4MGIE 2BRTA 5FPZA 1FX5A 4CCLA 2NMOA 4RGAA 3E6DA 1M4WA 4P02B 4EN7B 1ENSA 3CZUA 1OQ1A 1GQGA 2HWC3 1BMV2 3QH7A 4OMDA 2AREA 4OFGA 1RUC1 5DQ0A 2E63A 1MS4A 2RR12 4DIQA 1OBNA 2MEV2 4Q26A 1G9BA 1PX3A 4FXKB 3MI8A 4AHZA 4YW2A 4AXOA 1W6NA 1VPHA 2EA7A 3CKHA 4CCEA 3NVCA 2VMDA 3T30A 2C6SA 3N7MA 4FPHA 3UKNA 3SC7X 4RHV1 2ZHMA 3V65A 4ISRA 5F3IA 1QY4A 5AFEA 4Z1VA 3LPGA 3MIFA 4N43B 4QHZA 3MLLA 1BEV3 4XBNA 3TN93 1R092 4QPIA 5FMDA 4PF5A 1YUDA 2R073 3LD8A 1W0OA 3VL9A 5C8CB 4MXWB 4KQ7A 3S30A 5FYMA 1UAIA 4AEDC 3GHMA 1DBNA 2RS11 1PGSA 1F35A 4GH4B 4XPVA 3VHOA 3VBFB 5I8SA 4RL7A 3AFKA 2ET7A 5C6CA 4IE0A 4DRVA 1XE0A 3K3OA 1HX6A 1F15A 3HNYM 2PMWB 2VPVA 3IAPA 4OI4A 4CXWA 4IUGA 1KD7A 3H7YA 4C90A 1PO21 3O5SA 5LA0A 3RZGA 2W91A 1V6LA 3AMQA 5JXIA 5GZEA 1GQHA 3U1XA 3C3VA 3H0OA 1R081 3H1YA 3PVNA 5DG1A 2GMPA 1RUE3 1AVBA 2X05A 3KV4A 1ASJ3 1E5HA 1ND2A 2YZ4A 1OPOA 1TEIA 1Z7S3 1OC1A 3N9NA 2RS32 3H1MA 3VDCA 3BALA 4HZFA 4MGTA 4YPJA 1NUKA 4QXHA 2A70A 4ONUA 1QGLA 4AGRA 4N90A 2WKKA 3ZO0B 1PIV3 2D40A 2VOTA 2P17A 1LHUA 1WUVA 1LTEA 4LTAA 5DAWA 2BOIA 1DQ2A 3ASIA 4Z2WA 5I91A 1LESA 1UY2A 1AYM2 4XCBA 2XVLA 4JVAA 4XF1A 4AEMA 3DKQA 3HEIA 4XUTA 4CDWC 1DGRA 5E89A 5A1FA 2DU0A 3OBRA 3AZZA 4WVMB 1CAXA 4CEYC 1YLLA 3VL8A 5C8WA 2D6MA 2UURA 3WW1A 2J1AA 4CEWB 2VO5A 4E8DA 1RGSA 1Y43B 2OQ7A 3GALA 1O5UA 5LBCA 1VBB1 2QDRA 4NWWA 5FJKA 4NPLA 5A33A 3F2ZA 4Q4Y3 2GMMA 4RR3C 4DOUA 4E2QA 4AR2A 4CUBA 1S0BA 3LEMA 2D3RA 3UJOA 3BKZA 1SDWA 3MGUA 3KLSA 4S2FA 2XVKA 3MBWA 2HBTA 3VD7A 4IV1B 3WHUA 1B35B 4LHNA 1NA1C 2LALA 3VV1A 2GDFA 1YI9A 1LNSA 3S6PA 2P1BA 4NVPA 1DQ1A 1FNYA 4UF0A 4Z07A 5DUUA 1KITA 4YVWB 4I3PA 4CDXC 4ES8A 3MZHA 5LK7B 2JG8C 3TN92 1UD1A 2A6VA 1U5YA 2I07B 4XJAA 2E7AA 2R072 4XZUG 5D2AA 5DZGA 1LGCA 1ULGA 4P5YA 5TSWA 4CU6A 4EWDA 5F37A 3VGIA 2JIGA 2YPDA 2FMDA 3PMSA 4XDOA 4E4SA 2IXJA 3ACHA 3NRUA 2D97A 4D94A 2FD8A 1OVPA 5GLWA 4CU8A 1AR61 4YFZA 2QZ3A 1MQTA 1GICA 1RHI3 2P2KA 1Q8QA 4JHTA 5GALA 1JZ6A 2BNOA 4M3CF 5GJ6A 3KD4A 5L9BA 1OOPA 3OB8A 4XCAA 5L7OA 5ANQA 5SV5A 1NZCA 1G9FA 3BVCA 3ZXAC 2I2SA 4MLOA 1UOBA 3LE0A 4AFDA 1VB2A 3VBUB 4QPGB 5F8PA 4XFGA 5FZ4A 1HV1A 1ZRRA 3AVRA 5A7NA 1CZTA 4Y3OA 1K5JA 2OXBA 3RI8A 2QQUA 1ASJ2 1VLNA 4IEVA 1Z7S2 3OGVA 2WA4A 2ARCA 5FFOC 2PHLA 1YXWA 3K51A 4N9HA 2F4LA 1IPKA 4KWKA 1KGYA 1PK6A 1T6GC 4I02A 1H6XA 3ZN6A 4CP9B 3IAQA 4CUAA 2WQZC 1TQ5A 5AVAA 2EIGA 2WBKA 3AMPA 5CNAA 4KG8A 4YG0A 1AL23 4PI2A 1RUH1 4Q0PA 5CFCA 1W0PA 3ZFFB 4XDPA 3KHBA 1APNA 4WVWA 3HVDA 3LFMA 4M00A 4NOTA 4Q4X2 3ZIXA 1FOD1 4BISA 1TNFA 2C24A 1PO11 4GA9A 2QQNA 3GXUA 5LWBA 1COV2 2K46A 1ACCA 3VN4A 3UKVA 3JD72 1OQDA 1LOEA 4CE8A 2R041 1RUJ1 1YO8A 2WNVC 3W5MA 3VBSC 1QJU2 4HONA 3BTZA 2WNUC 4XUQA 3ELNA 1CWPA 5FZGA 3POWA 4MGSA 1D2QA 1MS1A 2BGCA 1DIWA 1EUUA 1W99A 1NT0A 1RUG1 4ATFA 3J7MA 3SQOA 4O7XA 4UFIA 3U07A 3IZOA 1WMDA 2KXLA 3M1HA 5ABJB 1W03A 3DL3A 3WX5A 2XJUA 4W8JA 5C5UA 1PZ9A 1YQ8A 4P08A 5FMCA 3OEAA 5DPNA 4FPCA 4QDSA 3WG3A 4AQSA 2BBAA 1DHKB 4BA6A 1NY71 5CISA 4RHV3 4ZS3A 4ARXA 3DXTA 5EYYA 2R30A 3T2TA 5IK4A 2JWPA 3SHRA 1HQLA 2EXJA 2D44A 1ALYA 2EIDA 4ASLA 1WD4A 4BK5A 4HKLA 4EE2A 2P6HA 3OYWA 2ZAHA 3P3PA 1UY3A 1GOGA 3ZSKA 4Q0UA 4RN5A 1NCQC 4YW3A 2FDFA 3DGTA 4GWNA 1WWYA 2UU8A 3V0AB 4LA3A 3SH3A 4FPGA 2B5HA 2D5HA 1K42A 4FFHA 4IV3C 2JDMA 1AX2A 2DTYA 1S0EA 3T2OA 4PF1A 3EBRA 5F32A 2RS13 1U5IA 2HEVF 5JZGC 1ENXA 4ZKTB 1X8MA 1SBEA 4EQVA 3RGBA 4W65A 5CAZA 5F7UA 5IK8A 4DXSA 4LOSA 2XQXA 1FYUA 3ETQA 4W6WA 2GC3A 2ZGPA 4MV2A 1D4M1 2CDOA 2P4EA 5LBEA 1WLWA 3L2YA 3GBWA 2QE3A 4B4RA 1PO23 2A3WA 3VBRB 4N53C 2JB8A 2RS51 4QU2A 4YGDA 5BNOA 3FN9A 1H8TC 4BLJA 1O6UA 1A8MA 2O14A 1DYPA 1IGOA 1F9KA 1XNBA 1R083 3JXSA 4ET7A 2D98A 3HR9A 2H6BA 2JG9C 3VBHA 4K3UA 1WCUA 2WIIB 4UFHA 2CSGA 1ENRA 2IXKA 4ATEA 3C7GA 3OPZA 3HNBM 1OA4A 3AMMA 1VBC1 3MV11 1AL22 2EXIA 2DFCA 3IDBB 1NCRB 4I01A 4KGQA 3I4IA 5I93A 3CEWA 2VNOA 1ZA4A 1QMJA 5JWPA 5I0TA 3VDDA 5IAXA 3RZKA 4BU2A 5T50A 2X5IA 4XBLA 4YWAA 2OW4A 2WYSA 4B1LA 4CDQA 5CA6A 2RM22 4AW7A 3TNQA 3J4UH 1LHOA 3AZVA 3S5AA 3A7QA 2FDKA 3MW4A 2PQQA 2RMU1 4HFSA 4RQPB 4V2WA 5JCTA 5T3NA 5AC93 1TME2 2GH8A 4J1XA 1RINA 2E53A 1EAH1 1RJ8A 3LEKA 4META 1NQJA 1VBB3 1EP0A 2ZJCA 4XMAA 4MZUA 5FWJA 4KI5M 2DVGA 3V64A 5DMYA 5F5QA 5FPXA 3AM2A 1VBD1 2VZPA 1URXA 2D43A 5JDBA 2VW1A 1DZQA 3AKSA 3RZJA 4IEUA 3TEZA 4MVTA 5IVEA 5DAXA 3ILRA 1Z78A 3MF9A 4DUVA 5LBFA 1T2XA 3D6EA 4I3GA 3VUOA 2VZ3A 5C3PA 2WR9A 4HANA 2JDKA 2Q5TA 4YG3A 1QDCA 1V6IA 5IW0A 3ZSEA 5C4WC 1W3XA 5FZ3A 2R062 5FZ6A 1TZOA 1G9DA 4B4PA 1IS4A 1CONA 3LQCA 1O5LA 4JGYC 1RMU1 1U5ZA 5ANNA 5KXEA 4FPJA 2P3YA 3NO8A 3PUQA 4HETA 3RQ0A 4ASMB 3PJYA 1LULA 2J1TA 4NIIA 2IXLA 4NIHA 2EIBA 3AKPA 5FY1A 3WR0A 4EYUA 4JZRA 3AXEA 2OKXA 5L36A 3AYDA 4NRQA 4DEQA 3HN3A 5FMBA 1JZ8A 4NRMA 5SV8A 5DZFA 5I0RA 2WJSA 2XKPA 2AR6A 1XNTA 4LO7A 4XJ9A 1WA6X 3E1F1 3L9JT 4JQRA 1AR63 1DYKA 4OZXA 1YWKA 5DDJ1 2VOWA 3SEPA 2PA7A 4PQQA 4QU1A 5A3OA 4CP1A 4XTPA 5E1RA 1IPSA 1FV3A 4R9AA 1VBA2 2B8MA 5K9YA 3LZZA 1GP6A 5LY1A 2WO7A 1UZVA 3ZR5A 4L2NA 4NHXA 1W6PA 2VD7A 1XYOA 3HBKA 4FFIA 1LEMA 2JB4A 3B7MA 4XILA 5KHHA 1H4GA 3TOJA 4CRQA 1UN1A 1R082 1SBFA 1LOFA 4XC9A 1QH6A 4PLOA 5JOXA 2YC2A 3HPNA 4N43A 4XAEA 3GNEA 4XQWA 2DCZA 3HT1A 2QBXA 3WG1A 3HT2A 1GZ9A 4GKYA 4O65A 2JIJA 2ZA9A 3DN7A 5C8CA 4ZXEA 3G6JB 1RYYA 1IQAA 5F2SA 1RUH3 1VIWB 4YM3A 5A33B 4A42A 2G4IA 3POYA 2VUCA 3MEPA 5FZ8A 4OHWA 5GLUA 4ZY9A 2UY8A 3AP9A 3QACA 1FOD3 4GH4A 4P5HA 4D6SA 4EROA 3MUY1 5F3EA 3VBFA 1PO13 2OZ6A 5AC92 5F3GA 5GLZA 3UGGA 1MEC2 1C28A 2A1XA 3H9AA 5A7QA 5JXHA 3ZDSA 1G9AA 1JS9A 2R043 3NNFA 1RUJ3 2GMEA 5FBZA 1V6KA 4O61A 5FLIA 5FPLA 1GZCA 1I5PA 1RUOA 3AMNA 2CAVA 4GWMA 3CO2A 2DCJA 5JOWA 1OLQA 1RUG3 3ROUA 3B9CA 2PLV1 5LA2A 2XLAA 2VZUA 1UPSA 4L8QA 4XDQA 3ZYBA 3NNGA 4IEPA 4Q4V2 1BYHA 3H8UA 2K2SA 2YGMA 1Y7BA 5IWFA 3VHPA 3NAPB 1GZWB 4XJ8A 4MG2A 5FQ0A 3J7NA 2VQTA 2ZAAA 1UY0A 1J1TA 4YW6A 5A1AA 4OLLA 5FY0A 1BCXA 4K40A 5FZFA 5HCFA 3CBNA 3VKOA 4ORFA 4RGGA 1WLDA 3QCWA 4UFLA 4OHZA 1NLRA 4XFHA 1SPPB 5K0UB 2VQAA 2X09A 1PGW2 2VUAA 1JUIA 3RI9A 2ADEA 5C33A 1UYPA 3O0VA 4GAZA 4WVMA 3LB9A 1JOPA 3ZYJB 3KQRA 3POEA 4CEWA 2PFWA 1H1AA 1AR62 4ZXKA 2RJLA 4H7LA 2VXJA 3NNLA 3DEMA 4X6RB 4JGZB 5EJZB 4YYOA 4FBFA 4M3CE 2BOJA 3N35A 3TRSB 4AQ6A 3B93A 1RUNA 3LIHA 3E97A 1LHWA 1PK6B 1WMFA 2ARAA 2IVJA 4LK7A 4YM0A 3T4HB 4FTSA 4HSJA 3PDQA 1D4M3 4FXGB 4JV4A 1B35A 1RL3A 3RWNA 3U10A 2DF7A 4BZ4A 5IVJA 1CGPA 2NQYA 1ND2C 2RS53 1ZZCA 1ZZ9A 4YARA 2ORXA 4YVWA 4R4ZA 1FI2A 2PHXA 4AI0A 4EV0A 2VZVA 4DXRA 3T0BA 1DDLA 3M70A 2FHRA 1RUF1 2Z2SB 4JX0A 3VBOB 2H0VA 5HCAA 4JDMA 1SFYA 5GZFA 4FOYA 3N36A 1BBT2 3N3HA 5GLTA 2VECA 4FTBA 3NV3A 1VB4A 5IT6A 2VTXJ 2Z79A 4PDWA 1VBC3 2DVDA 4FO9A 1NG0A 1UYYA 1NXD1 1RUH2 2CHHA 4FOWA 4PIZA 3RRDA 1OD5A 3GM8A 3UK9A 4OHYA 1HB4A 4QKFA 5IYYA 3J9SA 4QWNA 2D6OX 4Q4W2 3QBQA 1JZ7A 4QGNA 4RYDA 4XBQA 4LKFA 4CCDA 3HJRA 4CPBA 3SMHA 2Y8KA 2VZOA 3BUCA 1RXGA 4AGVA 4Q5OA 1BJQA 1AYN1 2HWF1 1XQNA 2HWB1 1CIYA 1ZZ7A 2RMU3 4P9WA 4XMIA 4LBJA 3VBUA 2VZQA 2WQ4A 2FZ2A 1C5HA 1ULCA 5FY5A 1EAH3 1SBDA 1US3A 2CDPA 3BCWA 1OXCA 4NAOA 3WEZA 3WT3A 3WDXA 2GN3A 3ZFEB 5J36A 3BIWE 5L19A 1QOOA 2OUJA 4HKOA 1VBD3 1NOVA 4GALA 4X8PA 1IHMA 5FP7A 1XNDA 4AHXA 2XJQA 2ZGOA 4CP9A 4DFSA 3PMEA 2R1BA 5F39A 1SLIA 2HEWF 4XZPA 4BQ5A 2E6VA 5LBBA 1ODNA 4IESA 4XTMA 1KQRA 2D6PA 1WW6A 4MGQA 3ZFFA 3NV2A 5JI7A 2JD9A 2YV8A 4ASKA 1RMU3 5A7SA 2SBAA 5K7PA 3LDBA 1LR5A 2FBEA 1E5SA 2DVBA 1FV2A 2B4KA 2VNRA 2X53S 3BOWA 3ETPA 4JKLA 3SH4A 2AH2A 2PAMA 4G3YC 2QQPA 1J3PA 3UETA 2JE8A 2VG9A 3CHXA 3O12A 5CFDA 2OYZA 1UZWA 5BNOB 5EIYB 3ENRA 1RVF1 5KBFA 2IXCA 3DPRC 2B46X 4EN0A 4FPYA 1H30A 5FTTC 3GZTB 5DDJ3 4CUGA 1IZ3A 3UESA 1VMFA 2V09A 4ZHNA 3AP4A 3K46A 5JPNB 1U12A 1W2AX 2IVIB 3OCPA 5ABJA 4DZGA 1SMVA 4TSVA 2JDHA 3CJXA 5FYZA 1WA4A 2RS52 4H7MA 3S7EA 4AFMA 1ND3C 1IG3A 1JUHA 3GGLA 5DABA 3A4UA 3B9IA 4XETA 5E6HA 5FRAA 2P3JA 2YBSA 4Q0SA 1RC6A 1C5IA 1XU1A 4LO8A 3FUQA 1W05A 4RD7A 1W9TA 4AEDB 3HAGA 3KSCA 2HWD1 4R8HA 5C7GA 2P5BA 5IFTA 1F5JA 2J1UA 3U11A 4BQ4A 4HBNA 4JQTA 1NE4A 4NN0A 3V0AA 3T0DA 3UL2A 4IGOA 4D7TA 2MNGA 2BBVA 1HRI1 5BNNC 4LIVA 3W5NA 2P37A 5FXXA 2UYBA 3ZXJA 1I1EA 2LTNA 2FCTA 4Y4YA 1ZREA 2HWE1 3ES4A 4K1ZA 1GUIA 4QQ2A 1FPN1 5A70A 2JDYA 3C7FA 4JDOA 2AUYA 3R4UA 4Q0VA 4WM7C 3U4SA 4COUA 3H8OA 3N9QA 5A80A 5T5LA 4QXKA 2GC2A 5EYXA 3BYWA 1PVC2 1HRV1 4IGPA 2A7AA 4W6XA 5HCBA 2VULA 3WY6A 3WHTA 4H14A 5FZ7A 5BNPC 1F31A 2YPJA 2QNKA 1QXJA 1ULFA 1GZTA 3OTFA 4URTA 4CPBD 2PLV3 1OMIA 1ZBE3 2PHRA 4A2UA 2XLGA 5CIRA 5HPOA 5LW9A 3FMGA 5FLHA 1XE7A 4QGLA 1N3QA 1JYVA 1WKYA 2J1RA 4OULA 3WDUA 4FOVA 4Y33A 2E9QA 2GNBA 5KHKA 4LT5A 1BHGA 5EFUA 5FXWA 1NCRA 2V72A 4OZOA 2DCYA 4RS5C 4A3ZA 3B69A 2G9ZA 5A7OA 4CDWB 4CP0A 2A6ZA 2RDNA 3KGZA 4JTNA 1RMU2 4E8CA 4CEYB 4CTEA 1IPJA 3T1LA 3PIGA 1T6BX 3IIIA 2B42B 3GZAA 2VH9A 1H2KA 1SACA 4LULA 5BPXA 4CCJA 2Q1ZB 4TN7A 1W6PB 2FDJA 4YGCA 4FQ4A 4K8FA 4S2HA 2CV6A 4R9BA 4RQPA 3WDYA 3ZFGA 1JN2P 1GNHA 2BGPA 2ZEYA 1UCXA 3N9PA 4LE4A 3POBA 3ME2A 1QJZA 5DAQA 5ACA1 1GFF2 1O3RA 3I59B 4OYUA 4IEWA 3I3MA 3K4AA 1QQP2 1O4YA 1R64A 2JENA 3Q8CA 5G04L 3WCRA 4Z8BA 2EVXA 5HV4A 3TB0A 3AJYA 3C7OA 4FT8A 5GZDA 1G6NA 1WCDJ 4YVSC 5A32B 5A3PA 2YXSA 1JZ2A 5I8YA 2ZGLA 5C9AC 2CU5A 2JG8B 3D5OA 2Q1MA 4K6BA 5F2WA 1CIWA 1JU3A 4IGQA 3OBTA 5EWSA 4XACA 3ZSLA 5K8SA 2VNVA 1X7NA 2DVFA 1NXMA 5IUQA 4Y22A 5FMOS 3WW3A 2W2IA 3KGLA 1X36A 4Y20B 3ZYIB 3QH6A 3WINE 3O1PA 4DNYA 4YM2A 1K12A 1TNRA 3VDDC 5IHRA 2VR4A 4L99A 4ZZ8A 5A7PA 5HCHA 1W04A 2AZ5A 1AXYA 1V6NA 1ZZ6A 3I3EA 1SLAA 2VGDA 1XPWA 5A3WA 1UXZA 2ES3A 1K45A 4UXAA 1YQ6A 3GZUC 1UWWA 3OBAA 1CZSA 1ZX5A 2BU9A 3WF1A 4AI1A 5HXMA 2QZ2A 2XG3A 3KV9A 5CZKA 5D8AC 4HLTA 2X8KA 5IATA 4JAAA 2XHKA 3HQXA 2XL9A 5FQ0B 1AYN3 1WBFA 2HWB3 2HWF3 1E5RA 1G9CA 4KL1A 5IJRA 4Q1PA 4W50A 4HK8A 3R6SA 3FL7A 2LM3A 4AI2A 4XUPA 1MS8A 2GU9A 1N3PA 4BHPA 3PNAA 2EIEA 1S0JA 1ZBE2 4XOGA 1DLLA 1XB9A 3AMHA 1Q8VA 1UOFA 1MR5A 1DGWA 2QQIA 3ZYFA 5FZOA 1GV9A 1EY2A 1KFUL 2D6LX 3Q8FA 3ON7A 3MPBA 3WNOA 1N1VA 2HWC2 4BLIA 3RG0A 3RZMA 1CZVA 3TYJA 3AFGA 4DEVA 3B3QE 1YRZA 2HEYF 5A3UA 2HH9A 4K20A 1W8WA 2EF6A 4CUCA 4K1YA 3WP4A 3CJIA 3I2JA 4AVAA 5F1RA 5KXCA 1WCSA 3ZDVA 2GNMA 1H0BA 3O1MA 1MVQA 1GLHA 2UWBA 2WNVB 1C8NA 3VBSB 2XDVA 3WNKA 5KXBA 2ZX3A 1TG7A 4QQOA 1WLTA 2XWJB 2HBUA 2VMHA 2VQ0A 3CIHA 3U4XA 1EPZA 1OF3A 2RJ2A 1C8M1 3WW4A 1WCQA 1N1YA 1LB2A 1W9FA 2VZ1A 3K3NA 1RVF3 5AVPA 2OPWA 1LOBA 4NJ4A 4MOAA 2Q8CA 1TMF1 3LFIA 5FPUA 4J6GA 4L97A 4EN6B 1BEV2 1QJY1 1VRBA 1JZ5A 1YNAA 1Y9MA 1XXNA 2ZHKA 2XPJA 5A3TA 4XJUA 2JX9A 4UFMA 4FVVA 5FYUA 3PUAA 4UFKA 3H42B 3SCHA 2W1WA 4MO3M 1YC61 1AHSA 4PDWB 3VZLA 3NAPA 1GZWA 2ATFA 3GCWA 4FCAA 2GAUA 4KG0A 4F8AA 2JKBA 3VKFC 3MFCA 2P3IA 2BDRA 1PZ8A 3KVBA 4V2VA 3PVOA 1KRIA 2WWUA 3VZNA 3W9AA 2ZX0A 3H8XA 3BTXA 1YFUA 1SPPA 5K0UA 3D3AA 2ZTNA 4IV3B 2HWD3 4NMIA 4BQYA 3R05A 1CJDA 1H8VA 1X9TA 1YIFA 4GWIA 5JZGB 2EXKA 2XH6A 1REFA 5DN2A 4LOTA 1RUI1 3IDAA 4YRDA 2GC1A 3JQWA 5H9PA 1RUE2 1UYXA 2W47A 2XJTA 5LY2A 3N7KA 1GWLA 4GB31 4EJRA 3UV9A 4JGZA 1RUD1 3J8F1 1WW5A 1A78A 2WFPA 4B1MA 3E6CC 2HWE3 1RB8G 1IKQA 4NE9A 4N53B 1FPN3 1SCRA 1LEDA 4PHZA 4XFCA 4DY5A 1UOJA 1HV0A 1DCSA 2HWB2 5J48A 1PIV2 3CF6E 3WQBA 5JI9A 3GBFA 4LQRA 3WF4A 3I3BA 2BEOA 3D0SA 3HMYA 2JG9B 5FIXA 3THDA 4BMEA 5EPAA 4CXYA 2LRPA 1DZTA 3CDZB 3WSOA 4I0BA 1HRV3 1DQ5A 1KEXA 1VAVA 1Y9GA 1ST8A 4CCKA 4HL0A 4CYDA 4LKEA 3T2QA 3VD4A 4RGKA 2AC1A 2J22A 1BZWA 4XIKA 5FZKA 2VBBA 2C26A 3VBOA 4FPKA 5GZGA 2WAOA 3POJA 3OSDA 2R0FA 5CFDB 2WT0A 3MW3A 4QX8A 3ZXEA 2J1VA 4ES9A 5JXGA 1W8NA 2ZBJA 2BPA2 2WQ8A 2ZGQA 2ZKNA 2XMLA 3KS7A 2D93A 1LODA 2VVFA 4QDQA 4QQPA 4Q4Y2 4N7IA 2A75A 2ADDA 1RUC3 2WL1A 3PL0A 1UZYA 3ZYHA 5IVBA 4QHOA 4DQAA 2CYFA 5EHDA 3ZX7A 1X9PA 3AP6A 1NE6A 2WRAA 3BPZA 4DRRA 3ZN4A 4EWAA 3FHAA 2FZ1A 4D6RA 2VTXA 4WBBA 2XLFA 1JMUB 3EQEA 3FUOA 4Y5Z0 5GZCA 4BCUA 1C1LA 4C0HA 2PHWA 2DTWA 1QXPA 4Q2FA 1H2MA 2JE7A 4E27A 5ACA3 2D6KA 2DFBA 2YFZA 3DXUA 3POSA 3H7JA 4IV1C 2YROA 4KU8A 3OY8B 3ZFEA 4LO5B 4LO4B 2OZJA 4NROA 5BY5A 2FDIA 3OGJA 3M3CA 3NWKA 4OI0A 3O0XA 2ZEXA 1BVVA 4X6QB 2HYXA 3RPQA 5C4WB 1IQDC 1KFXL 3KF3A 3M3IA 1I9RA 4JGYB 4O9GA 1JOJA 4NRPA 1GMMA 2XUEA 1RHI2 1JI6A 3AP7A 5E8AA 4IE7A 3WNPA 2WNEA 2UWCA 1WZXA 3KWVA 4QX2A 4Y4RA 2XBO1 1S1AA 1HB1A 4X8NA 3HD8B 1C57A 2K9ZA 2QFEA 1F4AA 2NP0A 2DBIA 2SLIA 3U14A 4NHYA 4K8RB 5ISLA 1UNBA 4TZDA 2P6CA 5LZ6A 4CU9A 4AEKA 1D0HA 3JBG1 2VW2A 4D0QA 3AL6A 4Q0QA 4D8MA 4XE9A 4MGKE 2HWE2 3MIBA 3RNSA 2R49A 1S0GA 3OBZA 4GIQA 1FPN2 4TLFA 2Y6LA 4QPGC 3LEGA 1UMZA 5BNQA 1K5MC 1W0NA 3WNXA 5FZMA 1ZRIA 4Y1XA 3AXDA 2A5ZA 2J1EA 4YNIA 4S2GA 2JKXA 3LEIA 2BERA 1HQWA 2AYHA 4Z82A 4CA9A 4GD4A 4IW3A 4WM8C 2CL2A 2JDUA 3DCQA 4QXCA 4OQ9A 1V6OA 4IDZA 4OCTA 1L3JA 2ZGNA 4LIUA 4XHBA 4YFWA 4AEDA 1HLCA 2V4AA 1JYXA 2ZOEB 3NKGA 4JDNA 4J25A 3ZFGB 2ZS6B 3IKWA 3ORJA 1Z0HA 5B4XA 3SITA 5T5PA 4R9DA 4MHRA 3KV6A 1Q5OA 3S5QA 5EZWA 1QF3A 3O7OA 3PTRB 2GP3A 1O3QA 1OT5A 1RUC2 1UIJA 1CVNA 2CAUA 2LW8A 3JB8A 4A7KA 1O3TA 4QD2A 5CYYA 5FMOL 1QNWA 1GOHA 5KC5A 5JMCA 1SG3A 3DV8A 5I8TA 1BK0A 3I2HA 2G9GA 1YQ5A 3T2PA 5A1LA 1W6QA 2XHNA 3THCA 1C3HA 4JRLA 4YG6A 3NJZA 4RHV2 1W2TA 4AVCA 4CZSA 2ZACA 1C8M3 2WZPP 4AAXA 1XNKA 1MPXA 2WNOA 3F95A 4YGBA 1B09A 4COVA 4P9JA 5FYVA 4FP3A 1LU1A 2WO1A 3DYOA 4AVSA 3HWJA 3IWZA 1TMF3 1FMD1 4LJHA 5J37A 4Y22B 3DYMA 4BH9A 1UKRA 1QJY3 4BOWA 4XF9A 1VJ2A 1FT9A 1OSGA 4M0NA 4QX5A 3KT4A 2Z4FA 3THPA 1GSLA 3RSJA 4LE3A 3C7EA 1YEWA 3KVAA 5IFPA 2ZGTA 1CD3G 2WUHA 3ITQA 4PJYA 5FWEA 3SH5A 3WDTA 1DF0A 5E16A 1H2NA 2RS12 2YB7A 3DECA 1D4VB 3ZXFA 4CDWA 2NPIA 2WO2A 1OLMA 1M06G 5JSOA 1AX0A 3ACLA 4LO6B 1BMV1 4CEYA 5IVVA 3RVHA 1K3IA 2XJSA 2E32A 4AI3A 2RR11 4FTEA 2MEV1 4I0WB 4PQ9A 3J26N 4BB3A 1PO22 4BXFA 2ARXA 3L2HA 1NZIA 2ZZQA 1HN0A 2C0ZA 1JBCA 3OUHA 2CWSA 4RR3A 2PHTA 4XW3A 4P9GA 5FUIA 4KMQA 3FFQA 3Q8EA 4CDUC 3LOBA 2YMZA 5FYTA 3I59A 3PVBB 4BXSV 5JR2A 4GB33 5GKAC 1NA1A 1UX6A 4PI0A 1RUD3 2W39A 3J8F3 3WV6A 1ULDA 2G9FA 3WXPA 4V1PA 3ST7A 4FOQA 2BVBA 5FZOB 3VBRC 5JIUA 5A32A 5DAPA 4CDXA 1HIXA 1UQXA 3O1SA 3LPFA 2VCMA 1R1ZA 2JG8A 1UMHA 3PVEA 5T54A 1J1LA 2FCUA 2Q30A 3CJIB 3RZHA 1OFSA 3UJQA 1VRH1 2DV9A 4QB1A 4OMCA 4A44A 2FDHA 2ZEZA 3J7HA 4R4XA 3E5UA 4FSJA 3WP5A 1ONAA 1W8ZA 2TBVA 2QQWA 2W52A 1N1TA 4Y20A 1S2BA 5C3OA 3SNMA 4XFIA 1OVSA 2Z42A 4RFT0 5FP9A 5J98B 1PHMA 3TNPB 4WVVA 1AR91 3PU3A 1VBB2 2G19A 2YU2A 2WZR1 4B4QA 3Q8AA 5T52A 4F3JA 1W6MB 3LSDA 1OKOA 1UU6A 3PTYA 4EZ4A 1LAJA 2WC2A 2ZX2A 2VM9A 4B7KA 3FBMA 2E33A 4KGGA 4QMAA 1D2SA 2KD7A 3OD0A 4H55A 2JECA 4A45A 2HKXA 4E2GA 1YI7A 2I74A 2VMCA 2IC1A 2QVSB 5C3RA 3CL1A 4N9IA 2WDBA 5J96B 2ZXQA 1O7FA 1C4RA 4NWVA 3WQ0A 2OS2A 4D6QA 3HNMA 5FOJB 2YC4A 3WQ7A 5FUNA 4AHWA 2YBPA 4QPIC 5CKQA 4YW1A 2OX0A 4GZ9A 3LA2A 1VBE1 3HQRA 2PN5A 5A3LA 1CAUB 4Q1RA 3WD5A 5A6ZA 3TBDA 5J7MA 3RYRA 2LUWA 3FFZA 4LPLA 3T3YA 1YQCA 3IDCB 5FXZA 4XFFA 1RXFA 2J42A 1OQEA 4LUKA 3G7DA 4YZ4A 2PQSA 4FFFA 4OQ8A 1STMA 1XSQA 1QDOA 1OPMA 4NHMA 2ZGUA 4M3CA 3RFRA 2XBO3 3K77A 1UIKA 3TEYA 2A6WA 1W2NA 2WNVA 3VBSA 3I8TA 1GP5A 2ZPXA 3DPRB 3ZXDA 2W1SA 2WNUA 5FPAA 1O4ZA 1S0CA 2D5FA 3SCGA 1N1SA 1W8OA 4I30A 1W9SA 3VD3A 4LBLA 3RZZA 2BGOA 4DINB 2VBPA 2E7TA 4AYUA 1VALA 4TLGA 3JBG3 5L9RA 2OUHA 2W68A 4GB32 2ZEWA 1JYWA 2XXZA 3IB3A 2F6BA 1RUD2 1TVGA 3JZVA 1WW7A 3WF3A 5IK7A 3MV01 2AGSA 1ZM1A 4JCKA 1ND3B 5BYNA 5C3QA 3BN6A 4CU7A 3V0BB 3MHZA 5CG8A 1VMJA 5EP9A 5FYSA 5DZEA 2R071 3HIFA 4TYSA 1W8TA 1SLCA 4M4RA 3FHIB 2B39A 2DUQA 4B8EA 1PMJX 1GR3A 4IXLA 1W39A 1KJRA 3M3QA 1NCQA 3M3OA 1FOD2 5JMOA 3FZ3A 5A3MA 1PO12 4BDVB 2J7MA 3ZYPA 2YY1A 2VUDA 2VL4A 2Y64A 1ULEA 1O59A 5BNNB 3E5QA 3UYJA 4IV3A 1HXS1 2B9UA 4PLMA 2E51A 2EAAA 1MZ5A 2R042 1H4HA 1RUJ2 2ZX4A 3RWKX 3KHCA 4LBQD 4DB5A 5FOBB 4YW5A 4XVHA 2XUMA 5JZGA 1OH4A 2NMNA 2WAAA 3AL5A 3PJQA 4WM7B 5LB6A 4C0BA 1E5IA 4ARYA 1RUG2 2VMGA 1RITA 3PUHA 4COZA 4P9LA 2PYTA 2C4XA 4CP2A 4BIOA 2PELA 1VAMA 3GJBA 4DMIA 4N53A 5F6KA 4BIFA 1FATA 5B4NA 4MGZE 2WT1A 1SZBA 1W8FA 4Y5TA 1PGL1 4LLFA 1HJGA 5BNPB 4Y5SA 3O1TA 4GJYA 2A73B 1NY72 2YFUA 1XNCA 4MGYE 2YG0A 2CWMA 3M2MA 2JG9A 2Q8DA 3VD9A 2DURA 3USUB 5LRSA 1HW5A 4L11A 1QHDA 4RFRB 3KT1A 5FZCA 1EPWA 3DF0A 4ZS2A 1UZZA 2VMEA 4A41A 1FMD3 1UKGA 5JOYA 3SXWA 1QU0A 1WMEA 4Q4X1 2CGPA 2AEZA 1J3QA 1Y9QA 4RS5B 1MQTC 3JU9A 3UGFA 1UXXX 1REEA 2HJIA 2YBKA 3AVSA 1H1MA 2WSVA 1COV1 3ABZA 3BGAA 3WNNA 1OOPC 5F3CA 4C1WA 1W9WA 2NN8A 5L7OC 3JD71 1OLRA 2Q4SA 1KS5A 4ISQA 4RSUA 1PM4A 2ZX1A 2IUWA 1QJU1 4OI2A 2BFUS 2XBO2 1J83A 1GANA 4PLNA 4UW6A 5H9RA 3P5BA 4GMP1 2FCVA 3KQ4B 1YQ2A 3H3LA 4XUNA 1D4M2 3LWCA 2RR13 2MEV3 4AEJA 5AFBA 4WVZA 5FV3A 2R1DA 4GMP0 2XOMA 3O14A 3FE5A 4ZZ5A 4OI1A 4A7ZA 1PK6C 4YVSB 2XKOA 1S0IA 4KU7A 1LECA 5C9AB 4B29A 3OY8A 2JEMA 5I0DA 4NUBA 1UO9A 3I3DA 1I6XA 1DP0A 2DVAA 4GJZA 4KH9A 5C4WA 5CFCC 1W90A 1VBC2 2MPFA 3NNMA 4IE5A 4CXXA 4FAGA 1JYCA 5LK5A 4AFCA 2LROA 3ALQA 4JGYA 1GWMA 4LNVA 3ZXLA 1QWRA 5LATA 1QEXA 4Q29A 4Z92B 4QPYA 1UY1A 3THTA 4LXLA 1VRH3 1GKBA 4PIXA 4NPMA 3RYKA 1OURA 3AP5A 5A7WB 5C70A 5JPMB 3VDBA 3CLPA 3S57A 3MFAA 2RMU2 4H3WA 1DQ0A 1W6QB 2E26A 2W3JA 3K75B 2WN2A 4P9XA 1KJLA 2D3PA 4BQ1A 1YFYA 1EAH2 3QLQA 2W46A 1YJKA 1AR93 2Y0IA 3AK0A 4WV8A 4XUOA 5D8AB 1O3SA 3OG2A 2PAKA 2WZR3 1VBD2 5C3SA 1TE1B 2X29A 4D7YA 3SKVA 3U0ZA 2OVUA 2CNAA 1HDKA 4CSWA 2Y6KA 1Q43A 1XE8A 4L0PA 4QX7A 3VHRA 3ZM8A 4NHKA 5FZDA 2OIIA 2QQOA 2YDEA 2ZCWA 3AJZA 4HSLA 3T09A 2K0GA 1OF4A 5LEJA 2RVAA 3AYAA 4UFJA 4XF0A 3CU7A 1N3OA 3GJAA 3H3UA 1PMIA 3A23A 4LITA 4LHSA 2VZSA 1YFXA 4UAPA 5FP4A 5FYIA 3WG4A 1QOTA 5DUVA 1AL21 4Y1ZA 2XB6C 1Y3TA 4GQ7A 1W8HA 2C1FA 3NQHA 1UW8A 1VBE3 1Y4WA 3FLPA 5CVRA 5ERLA 2CGNA 2QKDA 3D0JA 2BWAA 3N7JA 4LBMA 2XJVA 1YHFA 2XJRA 3EXUA 1S2KA 2RM21 4NR1A 3HQUA 5FR3A 2B9VA 4YGEA 4HN0A 4RR3B 4AK3A 2V73A 4M0HA 3KT7A 3O1UA 4YZ2A 1JHNA 4XAAA 1MS0A 5LA1A 4WZFA 3RMXA 4E4DX 5DDJ2 3KCCA 1SCSA 2VMFA 1TME1 5CKNA 1H9PA 1NA1B 1VP6A 4TWTA 2JD4A 1ZYBA 2XWBB 3MPPG 1CAVB 3RYPA 2IZWA 4XQDA 3ZN5A 5BNOC 2ZKLA 3MICA 4CDXB 1VMHA 1GBGA 5APAA 3MIEA 4W6YA 2Y38A 3N7LA 2CY6A 2VVDA 4LBQB 2WFF1 5CB7A 4KWUA 3R0RA 4NIAA 5FJHA 4AL9A 3VBHC 1W8UA 2VCAA 2ZGKA 2KR2A 2GALA 3B00A 3B5LB 4DUXA 1SFNA 4LORA 1MVEA 1SLLA 3WF0A 2R061 4OHVA 1RUF3 1O91A 4B7EA 1FNZA 1QNYA 4XF4A 1EV11 4OUMA 5FUPA 4PBPA 1G7YA 2OPKA 4N7UA 4Y1YA 2X5IC 5FPBA 5BNPA 4CDQC 3DYPA 2JDAA 2WO3A 2H6CA 5BXXA 1AX1A 5HV0A 1VRH2 3TAYA 1AJOA 2I45A 1XYPA 2GSYA 5BV6A 1W6OB 3I2OA 2WS91 1ZVFA 3RMYA 4IE4A 1OHFA 2IWGB 3B02A 4FI9A 4Y26A 3Q8BA 2NZ9A 4A3XA 1HXS3 1POQA 1V6MA 2BW8A 3T1MA 5LCWL 1VBA1 4OUSA 3FLTA 1AR92 1SQ4A 2WZR2 3ACIA 3WG2A 2XGXA 5A3NA 3VB9A 1CESA 5JUVA 2PLV2 2GC0A 5DXDA 4NIGA 1QH7A 1UL9A 5A6QA 2Y26A 3GZEA 4IE6A 1DQ6A 3BOPA 3IT8A 4I0AA 4QHBA 4QB6A 4E4ZA 5BUVA 1YIPA 3JCIA 1PNFA 3OOXA 4QQHA 1W3VA 1ZRFA 1VAKA 1UZ0A 4LLOA 2QTWB 2YUEA 2H0BA 5F9TA 4LBNA 3INAA 3URFA 2DWRA 3IPVB 4M3CB 1VBE2 3VKNA 5GM0A 4FP2A 3LF7A 1BVP1 1UPIA 1LHNA 3AYCA 4JKKA 5FZEA 1H6YA 3TEXA 1NKGA 2DUOA 4YZ5A 3N4MA 3SISA 2WNUB 3AZYA 3WLUA 4Q4X3 3EJKA 3LGRA 4IERA 1SLTA 4HXCA 4FQZA 1KXGA 4QKDA 2OA2A 4AAPA 1COV3 5AC91 4M4PA 2IXIA 4JC1A 1MEC1 3JD73 3WCSA 1PZ7A 4LBKA 1AXKA 1OUSA 4AVVA 3PUIA 1W6MA 1QJU3 3NL1A 2TEPA 4TXWA 1W28A 4GMP3 1J3RA 2BNMA 2WWJA 1C1FA 4QM8A 3EYPA 4H2AA 4TTGA 4R52A 4HPKB 4ZPIA 4MX3A 2XQRA 4E9KA 1BKZA 3GF6A 1ZZ8A 1HN1A 2WWSA 4Q4V1 4XURA 1LOFC 2QJVA 4YW7A 4GULA 2W1UA 4BPZA 3I2KA 3M3EA 1GP4A 4N43C 3BPSA 4A6OA 5FKCA 5I0UA 3N9MA 5J3UA 3OPTA 4YZ1A 1NCQB 3KB5A 4MUVA 1YFWA 2VOKA 4S2DA 1RUF2 2BWCA 3QOPA 5T5JA 5CADA 3R4DB 4K21A 5FY8A 2AENA 3USSA 3T4VA 4UOJA 4UYBA 2F17A 5FLJA 2PHFA 1CAUA 4I09A 5FP8A 3WF2A 5C8CC 1V6JA 4L92A 2VTFA 4PT6A 1PGW1 4PBOA 2Z69A 2N7GA 1GYKA 4GH4C 4LA2A 1HRI3 5JAXA 3GYDA 4L9BA 2EICA 3VBFC 3WW2A 1XRUA
chains in the Genus database with same CATH topology
3AYEA 3APBA 3AB0A 4HVQA 2JDZA 1EYBA 4HVRA 2BVVA 1HXS2 4UW3A 1AYN2 1IS6A 1H8TB 2HWF2 3DPRA 3V56A 4COWA 2BQPA 3ILNA 3X29B 4J1WA 4FAHA 2BFUL 2VOVA 2V5YA 1K5MB 4AI8A 1REDA 3NV1A 1Q8PA 1A8DA 3TWIA 3A0KA 3LKJA 1LU2A 2GN7A 1PGL2 3I2DA 3JUUA 1ND3A 1JH5A 1ZZBA 1RJ7A 3V0BA 4WM8B 2F4PA 3AZXA 2MHFA 3RS6A 2VW0A 4XXAA 1BBT1 4R9CA 5I0SA 1AUYA 4G9SB 3WP3A 4IEYA 3K48A 3BU7A 3LA7A 5KHJA 1IKPA 2KA3A 3DUIA 2RHPA 3PLQA 4HVOA 1OA2A 4Q4W1 1NQDA 3R4SA 3I7DA 4CEWC 4P9YA 3WQ1A 5BNNA 1Q3EA 2IFRA 1AR81 2XVGA 2RM23 2JE9A 1IS5A 1RVF2 3W58A 1Q8SA 1AF9A 4WM7A 3FLRA 1TME3 1B35C 1AR71 1DGWX 3ATGA 5EXOA 2ZGMA 4LR4A 1F2NA 2TNFA 3IMNA 4QT6A 3FX3A 4XHXA 5T55A 4YVWC 3Q9OA 2ENRA 3WUCA 3ZXKA 2WFF3 3MF6A 2A3YA 1V9U1 2CTVA 5F6LB 1YCIA 1CAWB 2VVEA 2ERFA 3D8CA 4SLIA 4AG4A 1QJX1 1F5FA 3USUA 3FC0A 1POV1 1OA3A 4NHLA 5EJ3A 5GM0A 3OD4A 3LAGA 4MH0E 4DPNA 4Y1VA 2VY0A 2EXHA 4PDWC 2GH2A 2HWD2 2R063 1D0GA 1DQ4A 1EV13 1ENQA 1POV0 1WW4A 4RS5A 2VXRA 3FJSA 4ZU5A 4C1XA 3SLIA 1HRI2 3JB4C 2KM2A 3E6BA 1ZBA1 3OF1A 4NO4A 4Y1UA 4D7SA 5KC6A 2VNGA 4JTOA 4NPRA 1X82A 2WS93 3VBUC 3ES1A 2D6NA 4CDUB 1R1A1 1N47A 1H9WA 4OHXA 5KHIA 1CPNA 4Q27A 3SCFA 4PIYA 1VBA3 3VKMA 3ZPYA 1HRV2 3W59A 2GNDA 4O9EA 4IEOA 2IFWA 2YYOA 4LHLA 4FPEA 4QM9A 4YVSA 3VZKA 5EV7A 4IETA 3WUDA 5C9AA 5FREA 4IL7A 5B2GB 4RA0A 5FDBA 4XFBA 4XJZA 3VZMA 1QXRA 5JR7B 3ZFFC 1LRHA 2ZGRA 3IIAA 2A71A 4AHYA 3S0MA 3ECQA 3M8LA 2C9AA 4AVBA 3H50A 1HKDA 3HBZA 2QUOA 4K9SA 4BWOA 1UU5A 1WGPA 5CFDC 4AWDA 2ZMLA 2O1QA 3WVJA 2CGOA 2JXAA 2BTVC 1W6NB 4HK9A 4MSVA 4AVTA 5ACA2 4INDA 5FCCA 5FAXA 3FWEA 5HBAA 1MEC3 4UBGA 5D8AA 3ZVXA 5ABJC 1LGNA 3QD6A 4YM1A 3KM5A 1PVC1 2XL7A 1X50A 1X8EA 4M01A 1JYIA 3MYXA 3LOIA 3RDIA 1U5XA 2C5DA 4KWJA 3UKTA 1OKQA 2ZMNA 1Q8OA 2WFF2 3E5XA 3NW4A 4QPIB 2A6XA 2EALA 2ZZJA 4Q4V3 3VZJA 2JJ6A 4Q8KA 5FO8B 4UW5A 2ET1A 3MLKA 3P3NA 4UW4A 3H3ZA 4FPLA 1LOGA 5JVVA 1CN1A 1EV12 1OFNA 4KWLA 3ZSMA 4BYYA 3IDEA 3MIHA 5JSRA 4F83A 4KNCA 1WCKA 5E88A 1CJPA 1XYNA 2DCKA 1RUI3 2HYKA 2GZWA 4HKWA 4LHKA 3OJBA 4IEXA 2WS92 2VUJA 5DUXA 1CAVA 1ND2B 1QQP1 4MYEA 5L73A 4F7ZA 4HT1T 4ITCA 4YLZA 4LEJA 5D1IA 1J58A 5JSPA 1DDLA 1MZEA 1CX4A 1R091 4LBQA 4U2AA 5CU1A 4UBHA 1ZRCA 1BXHA 1A3KA 3AKRA 5FO9B 1WBLA 2R0HA 4AQ2A 1JXNA 2BUKA 3WOGA 2W0XA 2ILMA 4HMZA 1NCRC 2EAKA 1MS5A 4AF9A 1AZDA 3NKTA 1H2LA 4C91A 4XEZA 1CAXB 4LBOA 3ZXGA 1BBT3 1WD3A 3NSTA 3MIDA 4AFBA 3IN9A 2ETEA 4MXWA 2D7FA 3VKLA 3KCYA 3KMHA 1W6OA 4RQPC 1KDKA 3ZFGC 1ZRDA 4Q4W3 3MDPA 2A6YA 4WZCA 4Q8LA 1CPMA 2W08A 4E2SA 2E7QA 1IOAA 1AR83 1BK1A 2ZHLA 2RS31 5LEKA 1V70A 1C8M2 4IEQA 2VMIA 5H9QA 4GXLA 2WT2A 2WLQA 4A7YA 3WDWA 3B94A 1TMF2 4PCRA 2NLRA 3M4FA 2BYVE 3PHMA 3M7AA 5CG9A 1QJY2 1RTVA 2Z5WA 1AR73 5HI0A 1WLCA 2D3SA 4DS0A 2BNNA 2VOXA 3IM0A 3MIGA 4AGGA 1ZBE1 4XQ4A 2ZHNA 1BQPA 1DZRA 5JLVA 1AYM1 5KWRA 1MS9A 2P3KA 1W2UA 3EO6A 3S7IA 1V9U3 1NYWA 1PNGA 4XXPA 5DG2A 1QJX3 4XIOA 1U0AA 2HWC1 2PHUA 1A6CA 2PAEA 1MQTB 1DGRN 2Q0AA 3KZ4C 1POV3 3IPVA 2ZMKA 3WP6A 4AFAA 1F8VA 2JICA 1GNZA 1H1IA 1LCLA 1OOPB 3BB6A 3C2UA 4XFAA 4D3WA 5L7OB 3WDVA 2QDNA 2FQPA 5J09A 4XF3A 1RUI2 2IXHA 3MW2A 1ZBA3 1JW6A 3LA3A 5IK5A 3AX4A 2UYAA 1LOCA 1AL0G 1JTZX 3J8F2 1PVXA 2PTMA 1VR3A 2YHJA 4YW4A 4ZU4A 1BEV1 3TN91 1R1A3 4HPKA 3ZN6B 3VLBB 4IV1A 1IS3A 3ZMNA 2UWAA 3HN1A 1G8WA 2P34A 4EWEA 5HXVA 5CFCB 2ARBA 3D4KA 2B7YA 4IEZA 2YGLA 4P9IA 3ZIWA 1MZFA 1S0FA 3O0WA 5CBLA 1O4TA 1CQ9A 1SLBA 1UU4A 3CJIC 2NYYA 4G4FA 3LCPA 4COYA 2TUNA 1X33A 4EN8B 3BTAA 2DU1A 2O8QA 2GNTA 1CR7A 3H1WA 2XJPA 1RUE1 4FPFA 4SBVA 3AKTA 2DUPA 1ASJ1 1AR82 1Z7S1 2WA3A 3ZSJA 1UF2C 2WSUA 1H8TA 3DKWA 3RJRA 1LENA 1PIV1 5JIAA 1LGBA 4QPGA 1AR72 1K5MA 2RJKA 4QGMA 3EHKA 5DUWA 3NAPC 1PVC3 1LOAA 3D82A 2O8OA 2VU9A 4IQPA 3ZMOA 1KS4A 1PM7A 3OYWB 4JRAA 1Q56A 1AJKA 1YYNA 2FMYA 1V9U2 4WM8A 1QKQA 4Y24A 1QJX2 5K0UC 2NM1A 1DGLA 1MZ6A 2ZABA 3VHNA 4Q4Y1 3WZ1A 1XU2A 4B3NA 4P14A 4YSFA 2A3XA 2RE9A 3CNAA 1I3HA 1ZBA2 4JGZC 3JBG2 1DFQA 2WINB 1ZNPA 4EN9B 5LRRA 2QCSB 3I54A 2PHDA 1SEFA 1OI6A 3AKQA 3VBHB 4BM8A 1QQP3 1R1A2 1DU3D 4XJWA 4XYXA 1V00A 4U36A 4GKXA 1NLSA 2O0OA 2ZGSA 1R093 2Q8OA 3ZYRA 1LKNA 1CAWA 1MACA 3GHNA 3VBOC 3B01A 3IBMA 3BODA 1RHI1 1LHVA 3AZWA 3VDDB 2X5IB 4CRQA 3OGGA 3JQXA 4OVEA 1E57A 4CDQB 1FAYA 5JOZA 2UY9A 2R32A 4LUMA 4DY3A 3GBGA 2R16A 4YZ3A 2B45X 5GLVA 1S55A 4BMBA 3ILFA 1YJLA 3NV4A 5FO7B 1LJ7A 1J59A 1AXZA 3LSEA 3FBYA 2R6QA 3A0NA 4QQLA 4I2OA 1DG6A 4HN1A 3KCXA 1MS3A 5H9SA 4AE2A 4CDUA 3ZYGA 4AQTA 2WLPA 3ZFEC 2RS33 1S0DA 2YC0A 4ZU7A 2DYCA 4K7JA 3MLJA 5KXDA 3VZOA 4KBBA 4BE3A 4DXZA 1FMD2 3VBRA 2DCTA 1KDMA 4D69A 1G86A 5KHGA 1HQNA 1FXZA 3RJ2X 1QOSA 1I5ZA 2Y0OA 1RIRA 4FPOB 4MXVA 1AYM3 5T5OA 4MGIE 5FPZA 1FX5A 2NMOA 4RGAA 3E6DA 1M4WA 4EN7B 1ENSA 1OQ1A 1GQGA 2HWC3 1BMV2 3QH7A 2AREA 4OFGA 1RUC1 2E63A 1MS4A 2RR12 2MEV2 4Q26A 1G9BA 4FXKB 3MI8A 4AHZA 4YW2A 4AXOA 1W6NA 2EA7A 3NVCA 3N7MA 4FPHA 3UKNA 4RHV1 2ZHMA 3V65A 4ISRA 1QY4A 5AFEA 4Z1VA 4N43B 3MIFA 3MLLA 1BEV3 4XBNA 3TN93 1R092 4QPIA 4PF5A 1YUDA 2R073 3VL9A 1W0OA 5C8CB 4MXWB 4KQ7A 3S30A 1UAIA 4AEDC 3GHMA 1DBNA 2RS11 1PGSA 4GH4B 4XPVA 3VHOA 3VBFB 5I8SA 4RL7A 3AFKA 2ET7A 5C6CA 4DRVA 1HX6A 2VPVA 4OI4A 1KD7A 3H7YA 4C90A 1PO21 3O5SA 1V6LA 3AMQA 5GZEA 1GQHA 3C3VA 3H0OA 1R081 3H1YA 3PVNA 5DG1A 2GMPA 1RUE3 1AVBA 1ASJ3 1ND2A 2YZ4A 1OPOA 1TEIA 1Z7S3 2RS32 3H1MA 3BALA 4HZFA 2A70A 4ONUA 1QGLA 4AGRA 4N90A 2WKKA 3ZO0B 1PIV3 2D40A 2P17A 1LHUA 1WUVA 1LTEA 4LTAA 1DQ2A 3ASIA 4Z2WA 5I91A 1LESA 4XF1A 1AYM2 2XVLA 4JVAA 4AEMA 4CDWC 1DGRA 5E89A 2DU0A 3OBRA 3AZZA 4WVMB 1CAXA 4CEYC 1YLLA 3VL8A 5C8WA 2D6MA 2UURA 3WW1A 4CEWB 1RGSA 1Y43B 3GALA 1O5UA 1VBB1 2QDRA 4NWWA 5A33A 4Q4Y3 2GMMA 4RR3C 4DOUA 4E2QA 1S0BA 2D3RA 3UJOA 1SDWA 3MGUA 3KLSA 4S2FA 2XVKA 3WHUA 4IV1B 1B35B 4LHNA 1NA1C 2LALA 3VV1A 2GDFA 1YI9A 3S6PA 4NVPA 1DQ1A 1FNYA 4Z07A 5DUUA 1KITA 4YVWB 4I3PA 4CDXC 4ES8A 3MZHA 5LK7B 2JG8C 3TN92 1UD1A 2A6VA 1U5YA 2I07B 4XJAA 2E7AA 2R072 5DZGA 5TSWA 1LGCA 1ULGA 4EWDA 3VGIA 2FMDA 3PMSA 4E4SA 2IXJA 2D97A 4D94A 5GLWA 4YFZA 1AR61 2QZ3A 1MQTA 1GICA 1RHI3 2P2KA 1Q8QA 5GALA 2BNOA 4M3CF 5GJ6A 3KD4A 1OOPA 5L7OA 5SV5A 1NZCA 1G9FA 3ZXAC 2I2SA 4MLOA 4AFDA 1VB2A 3VBUB 4QPGB 4XFGA 1HV1A 1ZRRA 3RI8A 1ASJ2 1VLNA 4IEVA 1Z7S2 2WA4A 5FFOC 2PHLA 1YXWA 3K51A 4N9HA 1IPKA 4KWKA 1PK6A 1T6GC 4I02A 3ZN6A 2WQZC 1TQ5A 5AVAA 2EIGA 3AMPA 5CNAA 4KG8A 4YG0A 1AL23 1RUH1 4Q0PA 5CFCA 1W0PA 3ZFFB 1APNA 4WVWA 4M00A 4NOTA 4Q4X2 3ZIXA 1FOD1 1TNFA 1PO11 4GA9A 1COV2 3VN4A 3UKVA 3JD72 1OQDA 1LOEA 2R041 1RUJ1 1YO8A 2WNVC 3VBSC 1QJU2 2WNUC 3ELNA 3POWA 1D2QA 1MS1A 2BGCA 1DIWA 1RUG1 4ATFA 3U07A 1WMDA 2KXLA 3M1HA 5ABJB 3DL3A 3WX5A 2XJUA 1PZ9A 4FPCA 3WG3A 4AQSA 4BA6A 1DHKB 1NY71 4RHV3 5EYYA 2R30A 3T2TA 5IK4A 3SHRA 1HQLA 2EXJA 2D44A 1ALYA 4ASLA 1WD4A 4HKLA 3P3PA 3OYWA 2ZAHA 3ZSKA 4Q0UA 1NCQC 4YW3A 3DGTA 4GWNA 2UU8A 3V0AB 4LA3A 3SH3A 4FPGA 2B5HA 2D5HA 4IV3C 1AX2A 2DTYA 1S0EA 3EBRA 2RS13 1U5IA 2HEVF 5JZGC 1ENXA 4ZKTB 1X8MA 1SBEA 5CAZA 4W65A 5IK8A 1FYUA 3ETQA 4W6WA 2GC3A 2ZGPA 4MV2A 1D4M1 1WLWA 3L2YA 3GBWA 2QE3A 4B4RA 1PO23 2A3WA 3VBRB 4N53C 4QU2A 2RS51 4YGDA 5BNOA 1H8TC 4BLJA 1A8MA 1DYPA 1IGOA 1F9KA 1XNBA 1R083 2D98A 3HR9A 2H6BA 2JG9C 3VBHA 4K3UA 2WIIB 1ENRA 2IXKA 4ATEA 3OPZA 1OA4A 3AMMA 1VBC1 1AL22 2EXIA 2DFCA 3IDBB 1NCRB 4I01A 4KGQA 3I4IA 5I93A 3CEWA 2VNOA 1ZA4A 1QMJA 5JWPA 5I0TA 3VDDA 5T50A 2X5IA 4XBLA 2OW4A 4CDQA 5CA6A 2RM22 4AW7A 3TNQA 3J4UH 1LHOA 3AZVA 3MW4A 2PQQA 2RMU1 4HFSA 4RQPB 5JCTA 5T3NA 5AC93 1TME2 2GH8A 4J1XA 1RINA 2E53A 1EAH1 1RJ8A 4META 1NQJA 1VBB3 1EP0A 2ZJCA 4XMAA 4MZUA 2DVGA 3V64A 5F5QA 5FPXA 3AM2A 1VBD1 1URXA 2D43A 5JDBA 2VW1A 1DZQA 3AKSA 4IEUA 4MVTA 3ILRA 1Z78A 3MF9A 3D6EA 4I3GA 3VUOA 4HANA 2Q5TA 4YG3A 1QDCA 1V6IA 3ZSEA 5C4WC 2R062 1G9DA 4B4PA 1IS4A 1CONA 1O5LA 4JGYC 1RMU1 1U5ZA 5KXEA 4FPJA 4HETA 3NO8A 3RQ0A 4ASMB 3PJYA 1LULA 2IXLA 3AKPA 3WR0A 5L36A 3AXEA 3AYDA 5SV8A 5DZFA 5I0RA 2WJSA 2XKPA 2AR6A 4LO7A 4XJ9A 3L9JT 4JQRA 1AR63 1DYKA 4OZXA 1YWKA 5DDJ1 2VOWA 2PA7A 4CP1A 4XTPA 5E1RA 1FV3A 4R9AA 1VBA2 2B8MA 5K9YA 3LZZA 4L2NA 1W6PA 1XYOA 1LEMA 5KHHA 3B7MA 4XILA 3TOJA 1H4GA 1UN1A 1R082 1SBFA 1LOFA 1QH6A 4PLOA 5JOXA 4N43A 4XQWA 3GNEA 2DCZA 3HT1A 3WG1A 3HT2A 1GZ9A 4GKYA 2ZA9A 3DN7A 5C8CA 3G6JB 1IQAA 1RUH3 1VIWB 4YM3A 5A33B 2G4IA 3POYA 3MEPA 4OHWA 5GLUA 4EROA 2UY8A 3AP9A 3QACA 1FOD3 4GH4A 4P5HA 3VBFA 1PO13 2OZ6A 5AC92 5GLZA 1MEC2 1C28A 3H9AA 3ZDSA 2R043 1RUJ3 2GMEA 5FBZA 1V6KA 5FLIA 1GZCA 1RUOA 3AMNA 2CAVA 4GWMA 3CO2A 2DCJA 5JOWA 1OLQA 1RUG3 3ROUA 3B9CA 2PLV1 1G9AA 2XLAA 4L8QA 1UPSA 4XDQA 4IEPA 4Q4V2 1BYHA 3H8UA 2K2SA 2YGMA 1Y7BA 3VHPA 3NAPB 1GZWB 4XJ8A 5FQ0A 2ZAAA 1J1TA 4OLLA 1BCXA 4K40A 5HCFA 3VKOA 4ORFA 4RGGA 1WLDA 3QCWA 4OHZA 1NLRA 4XFHA 5K0UB 2VQAA 1PGW2 2VUAA 1JUIA 3RI9A 5C33A 3O0VA 4WVMA 3LB9A 3ZYJB 3KQRA 4CEWA 2PFWA 1H1AA 1AR62 4ZXKA 2RJLA 4H7LA 4YYOA 4X6RB 4JGZB 4FBFA 4M3CE 3N35A 4AQ6A 3TRSB 3B93A 1RUNA 3E97A 1LHWA 1PK6B 1WMFA 4FTSA 4YM0A 4HSJA 4JV4A 1D4M3 4FXGB 1B35A 1RL3A 3RWNA 3U10A 2DF7A 4BZ4A 1CGPA 2NQYA 1ND2C 2RS53 1ZZCA 1ZZ9A 4YARA 4YVWA 4R4ZA 1FI2A 2PHXA 4AI0A 4EV0A 3M70A 2FHRA 1RUF1 2Z2SB 3VBOB 2H0VA 5HCAA 4JDMA 1SFYA 5GZFA 4FOYA 3N36A 1BBT2 3N3HA 5GLTA 2VECA 4FTBA 3NV3A 1VB4A 5IT6A 2Z79A 4PDWA 1VBC3 2DVDA 4FO9A 1NG0A 4PIZA 1NXD1 1RUH2 4FOWA 3RRDA 3UK9A 4OHYA 1OD5A 3J9SA 2D6OX 4Q4W2 3QBQA 4QGNA 4XBQA 3SMHA 4AGVA 1BJQA 1AYN1 2HWF1 1XQNA 2HWB1 1ZZ7A 2RMU3 4P9WA 4XMIA 4LBJA 3VBUA 2WQ4A 2FZ2A 1C5HA 1ULCA 1EAH3 1SBDA 3BCWA 3ZFEB 3WT3A 3WDXA 2GN3A 5J36A 3BIWE 5L19A 1QOOA 2OUJA 4HKOA 1VBD3 1NOVA 4GALA 4X8PA 1IHMA 1XNDA 4AHXA 2XJQA 2ZGOA 4DFSA 3PMEA 2R1BA 1SLIA 2HEWF 4XZPA 2E6VA 4IESA 4XTMA 1KQRA 2D6PA 1WW6A 3ZFFA 3NV2A 5JI7A 2YV8A 5K7PA 1RMU3 2SBAA 1LR5A 2FBEA 2DVBA 2VNRA 1FV2A 2X53S 3BOWA 3SH4A 2AH2A 2PAMA 4G3YC 2QQPA 1J3PA 2VG9A 3O12A 5CFDA 2OYZA 5BNOB 3ENRA 1RVF1 5KBFA 2IXCA 3DPRC 2B46X 4EN0A 4FPYA 1H30A 5FTTC 3GZTB 5DDJ3 1IZ3A 2V09A 3AP4A 5JPNB 1U12A 3OCPA 5ABJA 4DZGA 1SMVA 4TSVA 3CJXA 1WA4A 2RS52 4H7MA 3S7EA 4AFMA 1ND3C 1JUHA 3A4UA 3B9IA 4XETA 5FRAA 2P3JA 4Q0SA 1RC6A 1C5IA 1XU1A 4LO8A 3FUQA 4RD7A 4AEDB 3HAGA 3KSCA 2HWD1 4R8HA 1F5JA 3U11A 4HBNA 1NE4A 4NN0A 3V0AA 3UL2A 2BBVA 4D7TA 2MNGA 1HRI1 5BNNC 2P37A 2UYBA 3ZXJA 1I1EA 2LTNA 4Y4YA 1ZREA 2HWE1 3ES4A 4K1ZA 4QQ2A 1FPN1 4COUA 4JDOA 4Q0VA 2AUYA 3R4UA 4WM7C 5T5LA 4QXKA 2GC2A 5EYXA 1PVC2 1HRV1 4W6XA 2A7AA 5HCBA 2VULA 3WY6A 3WHTA 4H14A 5BNPC 1F31A 2YPJA 2QNKA 1QXJA 1ULFA 3OTFA 4URTA 2PLV3 1OMIA 1ZBE3 2PHRA 4A2UA 2XLGA 5CIRA 3FMGA 5FLHA 1XE7A 4QGLA 1N3QA 3WDUA 4OULA 4FOVA 4LT5A 2E9QA 2GNBA 5KHKA 5EFUA 1NCRA 2DCYA 4RS5C 3B69A 4CDWB 4CP0A 2A6ZA 3KGZA 4JTNA 1RMU2 4CEYB 4CTEA 1IPJA 3T1LA 2B42B 3GZAA 2VH9A 1H2KA 1SACA 4LULA 5BPXA 2Q1ZB 1W6PB 4YGCA 4FQ4A 4K8FA 4S2HA 2CV6A 4R9BA 4RQPA 3WDYA 3ZFGA 1JN2P 1GNHA 1UCXA 4LE4A 3ME2A 1QJZA 5ACA1 1O3RA 1GFF2 3I59B 4IEWA 1QQP2 1O4YA 2JENA 3WCRA 4Z8BA 2EVXA 3TB0A 3AJYA 4FT8A 5GZDA 1G6NA 1WCDJ 4YVSC 5A32B 2YXSA 5I8YA 2ZGLA 5C9AC 2JG8B 3D5OA 2Q1MA 4K6BA 1CIWA 3OBTA 5EWSA 3ZSLA 5K8SA 1X7NA 2DVFA 1NXMA 5IUQA 4Y22A 5FMOS 3WW3A 3KGLA 1X36A 4Y20B 3ZYIB 3QH6A 3WINE 4DNYA 4YM2A 1TNRA 3VDDC 4L99A 2AZ5A 1AXYA 1V6NA 1ZZ6A 1SLAA 2VGDA 2ES3A 4UXAA 3GZUC 1ZX5A 4AI1A 2QZ2A 2XG3A 5D8AC 4HLTA 2X8KA 4JAAA 2XHKA 3HQXA 2XL9A 5FQ0B 1AYN3 1WBFA 2HWF3 2HWB3 1G9CA 4KL1A 4Q1PA 4HK8A 3R6SA 4AI2A 2LM3A 1MS8A 2GU9A 1N3PA 4BHPA 3PNAA 1S0JA 1ZBE2 4XOGA 1DLLA 3AMHA 1Q8VA 1MR5A 1DGWA 1GV9A 1EY2A 1KFUL 2D6LX 3MPBA 1N1VA 2HWC2 4BLIA 3RG0A 3TYJA 3AFGA 3B3QE 1YRZA 2HEYF 4K20A 2EF6A 4K1YA 3WP4A 3CJIA 4AVAA 5F1RA 5KXCA 1WCSA 2GNMA 1H0BA 1MVQA 1GLHA 2UWBA 2WNVB 1C8NA 3VBSB 5KXBA 2ZX3A 4QQOA 2XWJB 1WLTA 3U4XA 2VMHA 2VQ0A 1EPZA 3WW4A 1C8M1 1N1YA 1LB2A 5AVPA 1RVF3 1LOBA 1TMF1 4J6GA 4L97A 4EN6B 1BEV2 1QJY1 1YNAA 1XXNA 2ZHKA 2XPJA 4XJUA 2JX9A 4FVVA 3SCHA 1AHSA 4PDWB 3VZLA 3NAPA 1GZWA 2ATFA 4FCAA 4KG0A 2GAUA 4F8AA 2JKBA 3VKFC 3MFCA 2P3IA 1PZ8A 3PVOA 1KRIA 3VZNA 3W9AA 2ZX0A 1YFUA 5K0UA 2ZTNA 4IV3B 2HWD3 3R05A 1CJDA 1H8VA 1YIFA 5JZGB 2EXKA 2XH6A 1REFA 1RUI1 4YRDA 2GC1A 3JQWA 5H9PA 1RUE2 2XJTA 3N7KA 4GB31 4EJRA 3UV9A 4JGZA 1RUD1 3J8F1 1WW5A 1A78A 2WFPA 1RB8G 3E6CC 2HWE3 1IKQA 4N53B 1FPN3 1SCRA 1LEDA 4XFCA 4DY5A 1HV0A 2HWB2 5J48A 1PIV2 3CF6E 5JI9A 3GBFA 2BEOA 3D0SA 3HMYA 2JG9B 4BMEA 1DZTA 4I0BA 1HRV3 1DQ5A 1VAVA 4HL0A 4CYDA 1BZWA 4XIKA 3VBOA 4FPKA 5GZGA 2R0FA 5CFDB 2WT0A 3MW3A 3ZXEA 4ES9A 2ZBJA 2BPA2 2ZGQA 2ZKNA 3KS7A 2D93A 1LODA 2VVFA 4QQPA 4Q4Y2 4N7IA 2A75A 1RUC3 2WL1A 1UZYA 4DQAA 2CYFA 3ZX7A 3AP6A 1NE6A 3BPZA 4DRRA 3ZN4A 4EWAA 2FZ1A 4WBBA 4Y5Z0 2XLFA 3EQEA 3FUOA 5GZCA 4BCUA 1C1LA 4C0HA 2PHWA 2DTWA 1QXPA 4Q2FA 1H2MA 2JE7A 4E27A 5ACA3 2D6KA 2DFBA 3POSA 3H7JA 4IV1C 2YROA 4KU8A 3OY8B 3ZFEA 4LO5B 4LO4B 2OZJA 5BY5A 4OI0A 3OGJA 3M3CA 3NWKA 3O0XA 1BVVA 4X6QB 3RPQA 5C4WB 1KFXL 3M3IA 1I9RA 4JGYB 4O9GA 1JOJA 1RHI2 3AP7A 5E8AA 2WNEA 2UWCA 2XBO1 1S1AA 4X8NA 3HD8B 1C57A 2K9ZA 2QFEA 2NP0A 2SLIA 4TZDA 4AEKA 1D0HA 3JBG1 2VW2A 4Q0QA 4XE9A 4MGKE 2HWE2 3MIBA 3RNSA 2R49A 1S0GA 4GIQA 4TLFA 1FPN2 4QPGC 1UMZA 5BNQA 1K5MC 3WNXA 4Y1XA 3AXDA 2A5ZA 4YNIA 4S2GA 1HQWA 2AYHA 4Z82A 4WM8C 2CL2A 1V6OA 1L3JA 2ZGNA 4XHBA 4YFWA 4AEDA 1HLCA 2ZOEB 3NKGA 4JDNA 3ZFGB 2ZS6B 3IKWA 1Z0HA 3SITA 5T5PA 4R9DA 1Q5OA 5EZWA 1QF3A 3O7OA 1O3QA 1RUC2 1UIJA 1CVNA 2CAUA 1O3TA 3JB8A 4A7KA 4QD2A 5FMOL 1QNWA 5KC5A 5JMCA 3DV8A 5I8TA 2G9GA 1W6QA 1C3HA 4JRLA 4YG6A 3NJZA 4RHV2 4AVCA 4CZSA 2ZACA 1C8M3 2WZPP 1XNKA 4YGBA 1B09A 4COVA 4P9JA 4FP3A 1LU1A 4AVSA 3HWJA 3IWZA 1TMF3 1FMD1 5J37A 4Y22B 4BH9A 1UKRA 1QJY3 4BOWA 4XF9A 1VJ2A 1FT9A 1OSGA 4M0NA 4QX5A 3KT4A 3THPA 1GSLA 3RSJA 4LE3A 2ZGTA 1CD3G 4PJYA 3WDTA 3SH5A 1DF0A 1H2NA 2RS12 1D4VB 3ZXFA 4CDWA 2NPIA 1M06G 5JSOA 1AX0A 3ACLA 4LO6B 1BMV1 4CEYA 2XJSA 4AI3A 2RR11 4FTEA 2MEV1 4I0WB 4PQ9A 3J26N 1PO22 2ARXA 3L2HA 2ZZQA 2C0ZA 1JBCA 2CWSA 4RR3A 2PHTA 4XW3A 4P9GA 3FFQA 4CDUC 3LOBA 2YMZA 3I59A 3PVBB 4GB33