4QT6A

Crystal structure of the spry domain of human herc1
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
159
structure length
159
Chain Sequence
GFDPEKAQCCLVENGQILTHGSGGKGYGLASTGVTSGCYQWKFYIVKENRGNEGTCVGVSRWPVHDFNHRTTSDMWLYRAYSGNLYHNGEQTLTLSSFTQGDFITCVLDMEARTISFGKNGEEPKLAFEDVDAAELYPCVMFYSSNPGEKVKICDMQMR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transport protein
molecule keywords Probable E3 ubiquitin-protein ligase HERC1
publication title Crystal structure of the SPRY domain of human HERC1
rcsb
source organism Homo sapiens
total genus 37
structure length 159
sequence length 159
ec nomenclature ec 2.3.2.26: HECT-type E3 ubiquitin transferase.
pdb deposition date 2014-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00622 SPRY SPRY domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.920 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4qt6A00
2IWGB 5F6LB 2VOKA 5JI7A 4N7IA 2YUEA 2YYOA 3TOJA 4P9IA 3KB5A 4P9LA 3ZO0B 2WL1A 4N7UA 4QT6A 5JIAA 4XW3A 5JI9A 4P9JA 3UV9A 4B8EA 2FBEA 4V1PA 5F6KA 5JIUA 4WVMB 2E63A 5C33A 4WVMA 4X8NA 4X8PA 4KG0A 2LM3A 4B3NA
chains in the Genus database with same CATH superfamily
3C2UA 2XL9A 5C71A 3ZXLA 3VN4A 4XF3A 3ALQA 1UAIA 1RUH3 2QQIA 4AI2A 4NO4A 2JB8A 2HWE1 3D82A 3N7MA 4EZ4A 1B35B 1QNWA 4O9GA 5B4NA 1RC6A 2WNVC 4ZZ5A 1B35A 3WW2A 4YSFA 2UY9A 2VNGA 3ETQA 1BKZA 4HKOA 4CCJA 3WDUA 4DXRA 2GNBA 2V4VA 2XMLA 4HSJA 1CD3G 4KWKA 4CP2A 2WC2A 4K1ZA 5GLVA 1HB1A 3KMHA 3DCQA 3NAPB 1RUNA 1HRV1 1U0AA 4PLNA 4BJ0A 3BOWA 2ZKNA 2XBO2 3VLBB 1NE6A 2ZHNA 2PHUA 2FHRA 3CU7A 3E6CC 5LA1A 1LEDA 4QB2A 5FYZA 3PL0A 2AACA 4RA0A 5A7SA 4IEUA 1C8M1 1W2NA 1X36A 2R6QA 2RE9A 3QBQA 4IEPA 5DZEA 3VKLA 3APBA 2OYZA 3KZ4C 4RFT0 4QM8A 1IS6A 2JDYA 3BALA 5DAPA 4BOWA 4JX0A 5IT6A 2XB6C 2RS12 2YBKA 2RM21 2VW2A 2PHXA 4ES9A 1H2NA 4NIAA 1TNRA 1MS3A 3NVCA 3VBHC 3ZMOA 2H0VA 3H8UA 3NKTA 5KC6A 2PAMA 2PFWA 5FZLA 3UV9A 2ARCA 3OUHA 3IAPA 1SLCA 4AEKA 3B5LB 4XIOA 4NIIA 3T2OA 2UWAA 1H9WA 1CAWB 1LHNA 2WA3A 1OLMA 4AGGA 1CAWA 1V6NA 1MZFA 2JECA 2FDHA 3HT1A 1DDLA 5C4WA 4NIDA 1NZIA 4NUBA 1AL23 4QB1A 5CKNA 2PLV1 3MBWA 5CFCB 2X10A 5JCTA 2Q5TA 4QGMA 2VVEA 4E9KA 1FMD1 1QDCA 4R8HA 1Z7S1 1ENXA 2QZ3A 3O7OA 1BZWA 3HNMA 1RUJ3 4UW6A 4D0QA 5F5IA 2Z5WA 5A7WB 2YFUA 3DUIA 4C0HA 5C8CC 2BTVC 1QQP3 5A7WA 5JSRA 1J1LA 1F9KA 1F35A 4MX3A 2ZZQA 1LKNA 4L99A 4CU6A 1O5LA 4LUMA 4NE9A 5I8SA 1JYTA 2CAUA 3MPPG 1EPZA 4XUTA 5CZKA 1E5HA 4U36A 1L7RA 2E7QA 4ZHNA 3B3QE 1TVGA 4COZA 3P3NA 3PUQA 3AVRA 1QXRA 2ZAHA 4N7IA 1R1A1 2WKKA 3J7HA 3RZKA 1W8NA 3LE0A 4PBPA 3BU0A 1OSGA 2WZR2 2WO7A 4JQTA 4PHZA 1A6CA 2AZ5A 1XE7A 1H8VA 1U5IA 5DZGA 3LDBA 1ASJ3 1WUVA 3UETA 1JXNA 3ACIA 1AR81 5GLUA 1AXZA 3LEKA 3PTRB 4AWDA 1AYN3 4NWWA 2X8KA 3VHOA 3WDYA 4DQAA 2R071 1C8NA 4D7TA 1JHJA 1WD3A 2WS93 2BFUS 3KVBA 5LB6A 1J58A 1DQ5A 3LDRA 3H42B 4NRPA 4IEWA 1SEFA 4RQPA 4XUQA 1RVF1 3GCXA 3RRDA 1EAH2 1W2AX 1I3HA 4MUVA 2LALA 4AI0A 1K12A 3HIFA 5DAXA 5IFTA 4LBQA 3I49A 5LZ6A 3UGHA 1OQDA 2FDJA 2JEMA 4I3PA 4Q4X1 5FO8B 5IVFA 4XJ9A 1Q43A 2P6HA 2XH6A 4QDRA 4CCOA 1H8TC 3ZYPA 2MPFA 4FOWA 1HRI1 3CBNA 5CKQA 5FFOC 5FKBA 4M3CB 2C6SA 4JKKA 4TWTA 5IK5A 1VMHA 1LGBA 4HANA 5GZCA 1JYIA 4XF9A 2BYVE 5FYVA 1O4YA 2ZGQA 3BCWA 3ZMNA 1YFUA 1OPOA 3T0BA 1XRUA 1W2TA 4XVHA 1GZWB 1W6OA 5ERLA 3K2OA 3D3AA 1EP0A 4AOCA 1CQ9A 3J7NA 3N9OA 5HCAA 3V64A 1LOFA 2OUHA 1R081 2ZKLA 4GD4A 1QQP2 1ULPA 2VU9A 4BQ4A 5C3OA 3RDIA 4B1LA 4DS0A 1UMIA 3ZFFA 3C3VA 1US2A 4FPGA 3GBGA 4P9WA 5L9BA 3RZJA 1G9DA 1PGL1 1PGW2 2SLIA 4CCNA 2I07B 3D5OA 1JYWA 2IXKA 3KT4A 1DZRA 1BEV2 4P14A 2IXJA 4F3JA 2I45A 1L7LA 3TYJA 4JGZB 4AXOA 2PHLA 3JZVA 2GC2A 1H2KA 2BNOA 1VJ2A 3VGIA 4JGZA 1N3QA 4IGOA 1MEC3 1V9U2 4FFHA 2E7TA 1QOSA 4FPJA 3DPRC 1DG6A 2BNMA 2NPIA 4OCTA 4Y1VA 5FYYA 3TWIA 4MGTA 1NA1A 1WMEA 1TQ5A 5GKAC 4CTEA 2ZS6B 2Q1ZB 2WZ8A 2ZEYA 2NMNA 3VZJA 2GMPA 2F17A 2WA4A 4K7JA 4Q0UA 3MUY1 1UYPA 4OHXA 3FHQA 2E31A 2GC1A 3TEYA 4OUMA 3N36A 3NNJA 2JXAA 1PIV3 4UW4A 1BVP1 3IPVB 2D6OX 1O4ZA 3P1IA 4XXAA 1WW5A 2Q0AA 3IPVA 4PF1A 5ACA2 4K20A 1E5IA 3I3MA 1K5MB 2DVDA 2LRPA 1K5MA 4RR3B 3ZPYA 1AVBA 1O5UA 2DDUA 4LBJA 5L73A 4RR3A 3WOGA 5F9TA 4UBGA 3MO4A 4W8JA 3M7AA 4ZZ8A 2A6YA 2W94A 2YYOA 3J26N 3KT7A 2ARAA 4PF5A 2XQRA 3ME2A 4RYDA 1OLRA 4D3WA 3WNKA 3JBG3 5FBZA 1QJY1 4MGYE 1RUF1 1JUHA 1W6NB 3W5NA 4COUA 1J3QA 5A6ZA 5FMBA 2WO2A 1FATA 5GZDA 1AUYA 4P00B 3RZMA 4AVSA 1UO9A 3MGUA 4BMBA 2JICA 1XYOA 1ULOA 1OA4A 1ZM1A 5FXWA 3ZN6A 1AR72 5FY0A 3O0VA 1LENA 1S0IA 4ZONA 5I93A 5GALA 4A7KA 2XWBB 4YGEA 3VKOA 3W59A 3BTXA 2AH2A 2RV9A 1XSQA 2QQMA 2WWUA 2YG0A 2ZGUA 3EB7A 3MFAA 2PHWA 5GZEA 4CXWA 1DGRN 5JSPA 4AHWA 4I0BA 3IZOA 4GQ7A 3RWKX 1HW5A 2DYCA 3AZVA 3POWA 3WX5A 1WCKA 3EO6A 1ACCA 3AMNA 3D4KA 5CG9A 5FZ4A 5GZGA 5I8YA 1W05A 1ZZ6A 4QXKA 3CKHA 4XQDA 5E8AA 5H9QA 1G9AA 4XJAA 2GC0A 3OB8A 2XONA 3AM2A 2PA7A 4FCAA 1Q5OA 2W47A 2RS51 1S2EA 3HMYA 1VRH2 2CDPA 1N3PA 2D6KA 4CRQA 1RUI2 3IM0A 5H9RA 1IKQA 2A3WA 1IQDC 3C8XA 1MZ5A 1QY4A 2NM1A 2VVDA 1PO23 2WN2A 4R52A 3BTZA 3KM5A 4XAAA 1GZ9A 4LTAA 5CEHA 1X82A 2HBUA 5IVCA 2VZTA 3ZDVA 1JZ2A 4BIOA 1LGNA 1K3IA 1UW8A 2BWCA 3SCHA 2XBO1 1REEA 1DQ4A 5KC5A 3N9NA 5ABJA 4QXBA 1I5PA 4Y5TA 5I0RA 3LDKA 2XJSA 4LK7A 5A3UA 3HBZA 3ILFA 5KHHA 4GMP0 5L7OB 2W52A 4M4RA 1PO13 1H8TA 2WIIB 3C7HA 1GKBA 2BV4A 2IVIB 2Y6LA 2CNAA 3E1F1 2BRTA 3J7MA 1R092 3WW3A 3WNPA 1JZ6A 3ZYJB 3LSEA 4Y26A 2B5HA 4XFCA 2RS11 3BU7A 3MW4A 3O1VA 4GALA 1VE0A 4A2UA 4CXXA 1FOD3 1ZZ9A 3H1YA 4AZZA 4N43C 3JD73 4K8FA 2PELA 3CIHA 4Q1PA 4BK4A 4LEJA 1RXFA 3M70A 4LE3A 1DFQA 2DBIA 2FBEA 4NHLA 1C57A 1GNZA 2ET7A 1S2BA 2D6PA 3VBUC 1YIPA 1HIXA 2CDOA 4CVUA 1FT9A 5FP7A 1OD3A 4W6XA 4Q4W2 5HV0A 3AMQA 2XKPA 3G6JB 2XJTA 4LO8A 5CIRA 1YUDA 1W28A 3H3ZA 5A7PA 5FY4A 1W2UA 1PK6B 3L2HA 4IEOA 4JGYB 4TYSA 5CNAA 3UKNA 1HXS3 1ND3B 2GC3A 1PK6A 3QD6A 5IYYA 4FAGA 4JGYA 4NRQA 5FZ8A 3LPGA 1X50A 1W2OA 3CZUA 3N9QA 4UBHA 2FDGA 4OULA 2P3IA 5F5AA 3NQHA 5EJ3A 1H6XA 4FFIA 5FAXA 1PM7A 3W21A 4A7ZA 3I3DA 2R32A 4Q5OA 1KS4A 2BBAA 2UWBA 4FPEA 1GQPA 1NT0A 2GMEA 4KQ7A 3Q8EA 5L36A 3Q8BA 3DECA 1H1MA 1D4M3 1SBEA 1Z78A 2R7EB 2XDVA 2YC2A 5IVEA 1AR63 4JDMA 1EPWA 2WR9A 2XR4A 3LSDA 1YNAA 2QQVA 4CEYC 5FZKA 4XHBA 4NOTA 1RUG2 5FZHA 4CP0A 4LO6B 4FO9A 4W65A 4A4AA 5A3LA 1JZ4A 2BPA2 4PDWC 1DQ0A 2WZR1 3SEEA 2BBVA 2QQOA 5E16A 2R16A 4LO7A 4AW7A 2UU8A 1LNSA 4XUNA 1REDA 4N53B 2W3JA 3DKQA 5DXDA 4DFSA 3RJ2X 1D0GA 2XPJA 1BMV1 4FSJA 4HK8A 1QH7A 1GANA 5GM0A 5F7UA 2EXIA 2O0OA 4GH4C 5EZWA 5LASA 3ZSEA 4D8MA 4JKLA 3TN93 4CSWA 2Y0OA 4QX0A 3ZYGA 1RUD3 4WM7B 4DXTA 3IDEA 4IERA 4WVVA 4AFBA 1WLTA 4WM7A 2PHRA 1E57A 2QJVA 4TLGA 3LIHA 1S55A 4QHZA 3QCWA 2R043 4QHOA 2VL4A 4AHYA 3VDDC 2DWRA 1W6MB 3WCRA 4HVQA 1SBFA 4OI0A 2NLRA 3CMGA 2DVBA 4FPKA 4XCAA 1W6MA 3ZM8A 5FOBB 5AVPA 1GQGA 4RS5A 1CIWA 1GFF2 2OVUA 3H3UA 3OPWA 3K3NA 5DAQA 2DCJA 4EQVA 2JE7A 4BQ3A 4ONUA 3GZUC 4KBBA 1AR83 1GP4A 2ZGTA 3VBSA 3AB0A 4DRRA 4XC9A 2VQAA 2AYHA 2WZEA 3S5QA 2RS32 4HBNA 4XBLA 5FMOL 3ZYBA 5IATA 3EJKA 3MICA 4Q4V2 5IVJA 4GKYA 4QHBA 5K0UB 3R05A 1RUE2 2A6ZA 2VMGA 1RVF3 1ST8A 3SISA 2YGLA 5K0UA 3VV1A 1UX6A 2WINB 3DKWA 2A70A 4BQYA 3HWJA 4P02B 2WSUA 2BVVA 2PAEA 3L9JT 4CP9B 2VXRA 2WWSA 4FPHA 4J6GA 4XUPA 4B4QA 2VOKA 4CP9A 1NE4A 5T55A 1AR92 4S2DA 2OT7A 4IESA 3DGTA 4CUBA 1JYNA 3GBWA 1QQP1 4LQRA 4Q1RA 5GZFA 2IUWA 3HN3A 4IE7A 3VBFC 3NV3A 4CDXC 2LTNA 1I9RA 4FP3A 2X05A 2YC0A 1HRI3 2YB7A 3LEGA 3I2IA 3WP3A 1BCXA 1VBE3 4Q27A 3WP5A 1JUIA 3J7LA 3W20A 5A3PA 1CZSA 5LRRA 1BEV1 3EQEA 1LECA 3GALA 1XBFA 3O1RA 3RYRA 2GH8A 4IV1C 3V0BB 3NWKA 2P5BA 5KHJA 3WT3A 3UNPA 1PVC3 2HJIA 5F3GA 1ZREA 2FZ2A 2W92A 5C33A 3GYDA 4PLOA 3U4SA 3ZXAC 3IDAA 2BDRA 1H1IA 3O1SA 2WLPA 5D8AC 2A6VA 1J3PA 1JBCA 2XGXA 5D1IA 3E6DA 5ISLA 3RZLA 1ASJ1 5FV3A 3SQOA 3ETPA 2TEPA 3MI8A 4I0WB 5F37A 2JG8B 2YXSA 2K9ZA 3TN92 1AYN1 1XNTA 2JG8A 4KG8A 1RUD2 4Q2FA 5FXVA 1LHVA 3NMBA 2R062 3HT2A 1ZRCA 4OYUA 2WS91 4IETA 3WDVA 3RVHA 2EIDA 4QQ2A 1VBB2 4LXLA 4K3UA 4MV2A 5ACA1 3EBRA 4AE2A 5SV8A 1HN0A 3WHUA 3ABZA 1CJDA 3N7KA 4Y1UA 2P3JA 2Y6KA 3ILRA 2CAVA 1Z0HA 4E8DA 2Y6FA 1C1LA 5CYYA 1I1EA 4L11A 5I0TA 3U78A 4ATFA 4CCKA 4RGGA 3IIIA 5F39A 5A6YA 1LRHA 4QQHA 1FPN3 1AF9A 1J84A 1QH6A 3GCWA 4Q4Y3 1B35C 5F3IA 1QU0A 5C3SA 4GWNA 3OY8B 2YBSA 2VOTA 3N9LA 3OY8A 1YIFA 1PX3A 4Q0PA 5IFPA 2ZXQA 4QT6A 5CVRA 2NN8A 3WG3A 2WFPA 1A78A 3I3QA 1YC61 3I2DA 3LB9A 4QWNA 5F1RA 5DAVA 4E2QA 2OXBA 3T08A 2FCVA 1UIKA 3WNNA 3T4VA 4EROA 2WNUA 2D6NA 2WYFA 3LA7A 1ENRA 3CQOA 4UW5A 3ZYHA 1UOBA 4IDZA 3T4HB 3UJOA 2XJPA 4Q26A 5AC92 2CU5A 4FFFA 3B93A 4LKFA 3HNBM 2WRAA 1LHOA 3FJSA 4INDA 2AENA 2QTWB 1ZZCA 5F3EA 3OPZA 4L2NA 2OQ7A 5IVBA 3VBRA 4XJWA 1OF4A 2WT0A 1HJFA 4KMQA 1PVC2 1X9TA 2QBXA 4JAAA 1D7PM 3AP7A 3DV8A 4CXYA 1VRH1 5LK5A 4QPIB 2ZTNA 1H2MA 3D8CA 4QPIA 5FZOB 3WF1A 4CCLA 2W68A 5FZOA 4Z2WA 4OHYA 5BUVA 1UZZA 2VAUA 4TN7A 5A80A 3U0ZA 1RJ7A 1NY72 2EALA 4C91A 1MS1A 4COWA 2JIGA 4CU9A 3AL6A 2CY6A 3PUHA 5KXCA 1VAKA 5C4WC 2GU9A 4I3GA 2BQPA 1PIV1 2WN3A 4GA9A 2VQ0A 3AP4A 4RL7A 1OH3A 5GLZA 3DN7A 3H9AA 1IHMA 3AC0A 3A21A 4HPKB 3MV11 4FVVA 4MOAA 1OVPA 3AZWA 4P9YA 4I0AA 1Y7BA 1C3HA 4HPKA 3WD5A 3NNMA 2XQXA 4Y5SA 3RZZA 4HMZA 1W8HA 4ZXEA 1ULCA 1YO8A 3AJZA 1OPMA 2BOIA 4G4FA 2ZAAA 4LO5B 4GXLA 1EUTA 3AXEA 4XYXA 5JOZA 2HWB2 1XU2A 2W1SA 3HQRA 1RINA 2D44A 3GHMA 3JBG1 1EY2A 4WM8B 3ZFGB 4A42A 3ZIWA 2W91A 3PVOA 2WFF2 2FDFA 3U1XA 4WM8A 3H1MA 3H7YA 3ZFGA 3USSA 1NX9A 4XBQA 4HN0A 5JXIA 2VD7A 4O61A 1KGYA 1SLIA 1X8EA 2WQ8A 5KXEA 1WW6A 4BQ1A 3PLQA 2VZOA 1W8FA 3KQRA 2RS13 2CTVA 1LHUA 1QJFA 3AFGA 3D0JA 2JB4A 1V00A 1JMUB 4HOOA 1T2XA 5LEJA 1OLQA 1CVNA 1LU1A 1OFSA 2PYTA 1SDWA 4XF1A 3QOPA 5F6LB 3T0DA 1RUOA 3CHXA 4AHXA 4ITCA 4R9DA 1V6MA 4RQPC 5FO7B 3OYWB 4Y5Z0 3ST7A 1DZTA 3A0KA 1POV3 2WT2A 3OYWA 5KHKA 2VMFA 1S1AA 5DDJ2 3IB3A 5C5TA 1BLZA 1KQRA 1HB2A 2PQQA 1OMIA 4OI1A 4B4PA 4AEMA 1MS8A 1W3XA 3TNQA 1OKQA 1GLHA 3E6BA 3P5BA 1NCRA 1RXGA 4V2WA 3I2OA 4PIXA 1PO21 1PM4A 2WWJA 3OGJA 4LBNA 2GSYA 3ZYRA 1UYXA 4AFMA 3ZYFA 1RUG1 1RJ8A 2XJRA 4UFIA 1OOPB 2BFUL 2I74A 2B9VA 1IKPA 4K21A 3AK0A 3GNEA 4YW3A 5A70A 2ZMKA 4M00A 3POJA 4I30A 4XFFA 3ACFA 1JW6A 3BODA 4EV0A 2DCKA 4A45A 3AKQA 1AL0G 2CGPA 2BJSA 1GQHA 4S2FA 2VW1A 4W50A 1IPSA 5LATA 1PZ9A 4LJHA 1OUXA 1PO11 1LOFC 2ZHKA 3IN9A 1RMU2 2N7GA 3Q8FA 3PMSA 1O4TA 1OKOA 3KVAA 4LR4A 3ZFFC 2VM9A 1COV2 5GLWA 4XDPA 4XW3A 1SLAA 4I2OA 1V6JA 5FPVA 2ZEXA 2C26A 1FOD1 3NAPA 4Y24A 2WZR3 4L0PA 3MEPA 3JD71 2XKOA 3FUOA 3PVEA 1W9WA 2CGNA 1CZVA 2LW8A 1PNFA 1PMIA 4JGZC 3WCSA 1CAUB 1JU3A 2QE3A 4RHV2 4CCCA 1CAUA 2AREA 2Q1MA 1NA1C 2D7FA 4N9IA 4QKNA 1QEXA 3VHRA 3H1WA 1NKGA 4BU2A 2I2SA 1VMJA 2A6XA 5EV7A 1RUE1 2PTMA 4OI4A 4UFMA 3O1UA 3DEMA 1EAH3 2ZGPA 4QX8A 5CBLA 2C24A 1OI6A 2X5IB 2ZX0A 2JDZA 1UY4A 1OA3A 1OVSA 4NN0A 1ZX5A 1HXS1 5LBEA 4BLIA 1UN1A 2UY8A 3BTAA 3K51A 3VKFC 3BVCA 1TE1B 2EXKA 4JQRA 1NQDA 2V73A 3POBA 5EYYA 4BDVB 1LGCA 1BHGA 2B9UA 1IS3A 4BYYA 1K5MC 4WV8A 2R0HA 1J3RA 4TLFA 4XURA 4LA2A 4RR3C 3CLPA 1JZ8A 2JDAA 2OS2A 1D4M1 5IVVA 3DF0A 1MQTB 1AR61 4B29A 4DO0A 1ZYBA 3SLIA 1IQAA 2G9FA 3O5SA 5CFCA 5DZFA 5GLTA 4XMIA 3BPZA 2FMYA 4OZXA 3OCPA 4NPLA 1SDDB 1ZBE2 4CUGA 2JD4A 3TBDA 2F6BA 4HVOA 1DLCA 4MGZE 2OX0A 4QMAA 1UQXA 2JDMA 5EJ1B 4R4ZA 4PI0A 4XE9A 4CDUB 3O1MA 3LWCA 1AJKA 5LA2A 1E5RA 5FY7A 2A71A 2RHPA 3FHAA 3POYA 3AZYA 1BEV3 5HXVA 3SKJE 3TN91 4CCMA 3SMHA 1RUD1 2QQNA 4Y33A 4E4ZA 2DCYA 4UXAA 4QX1A 1N1TA 5JOXA 1C5IA 2YROA 5FZFA 5A7NA 4LHSA 3S7IA 4AG4A 4BMEA 1O3TA 1CPMA 1V9U3 1JOBA 3D6EA 2R041 1N47A 3K75B 4JV4A 3KGZA 4FT8A 4Y4RA 1OBNA 2TUNA 4KWJA 2CYFA 5C7GA 4B7EA 2CL2A 3KD4A 2HWF2 2BEOA 2QQUA 1HJGA 1W8TA 2ETEA 2VBDA 2P4EA 2PAKA 4Y1XA 2VTXA 2JX9A 3ACHA 2UURA 4YPJA 4YM1A 1ZRFA 2XVKA 5BNNB 2IZWA 3MIFA 4NJ4A 4KGGA 5BNNA 2IVJA 2XLGA 4FTEA 3ZN5A 5JXGA 2IC1A 5ACA3 4AYUA 1SCRA 4D94A 3I97A 3FC0A 5L19A 3ILNA 4ZS2A 4P9GA 3UGGA 1X8MA 2Y0IA 3ZXDA 4C90A 1REFA 4AFCA 3OD4A 1AXKA 4YW1A 5ABJC 3GJAA 3RI9A 1WLDA 5M0TA 4JHTA 2VXJA 1GNHA 2XJVA 3AP5A 4GB32 2BERA 3M4FA 1VRBA 1FV2A 4N8MA 4P9JA 1GNYA 1A3KA 1HV1A 5FZAA 1LU2A 1BBT2 4UFLA 4DZGA 1Q8OA 2Y33A 4KG0A 1MS9A 1VBE1 4JZRA 2Y6JA 4M3CA 5FUNA 2B39A 4AEDB 4L92A 2YDEA 1VBC2 5FY9A 2NP0A 4AEDA 3TB0A 1Y43B 1W90A 3HQXA 3ZSLA 4QX5A 1PVC1 3V0AB 1AR73 1GMMA 2QFEA 1WMXA 4DIQA 3RSJA 4LBMA 3KGLA 1GZWA 3VB9A 2E53A 5J09A 1CX1A 3I59B 1I6XA 3W58A 3HNYM 4URAA 3I59A 1ODMA 4OMCA 4KBZA 4DOUA 4COYA 4N9HA 4NRMA 3CZJA 5FP8A 5FZDA 1DZQA 3OPTA 2DFCA 5F2WA 2KR2A 5F3CA 3OSDA 2JKXA 3VZLA 4WZCA 3N7LA 4A7YA 3HN1A 4UAPA 3RJRA 3PJQA 4IE6A 3LOBA 1DU3D 1POQA 3VZNA 5JLVA 1XNAA 3P3PA 2E26A 1US3A 4DXZA 1XJAA 4JCKA 2WNVB 3WG4A 4WBBA 1YRZA 5FZ6A 5FUIA 1VRH3 1PK6C 4BPZA 2EXJA 3N35A 4JGYC 1RUI3 5D2AA 2C4XA 1UU4A 5A1AA 4I01A 2WJSA 3IIAA 4NHYA 2NYYA 1KITA 1GWMA 5A32B 4LITA 1VBD3 1G9BA 1EUUA 4YVSB 3FBYA 2ZHMA 2HWC2 4HLTA 1ULGA 1FPN1 5A32A 5JDBA 3MPBA 4DRVA 3WNLA 3LF7A 2VQUA 3M2MA 2P17A 4Q4Y1 3T09A 3VDAA 4H3WA 1WGPA 3ZSKA 4AEJA 4ZKTB 3RMYA 5FO9B 2W1WA 2QCSB 1MVEA 2QDRA 5T5PA 3LIGA 5I0SA 4L97A 5IK4A 1F31A 3VHPA 1YQCA 5J48A 4LE4A 3B9IA 3I2FA 4R9AA 2ZEZA 4QAWA 1AYM2 5T54A 3WY6A 1NLSA 2HLEA 2J1AA 1R093 2Z79A 5E1RA 1CAXB 5FBJA 4AVBA 1ZNPA 2RMU2 3AJYA 3MYXA 2CSGA 1QIQA 5CA6A 1JN2P 1JI6A 4AI3A 2AEYA 1BVVA 3RPQA 1WCQA 4NAMA 5DABA 3S6PA 4WM7C 4ATEA 4C0BA 2YU2A 4J1WA 3VL8A 1W6NA 2IFRA 1HQNA 3OJBA 4EN0A 3B01A 1GZTA 2K0GA 3VUOA 3FBMA 5LA9A 3OEBA 5G04L 1IG3A 4RS5C 3TRSB 1J83A 1R64A 4IE5A 1ZRIA 2JDUA 4Q4W3 2HWD3 5I8TA 3OTFA 3AFKA 4YZ3A 4FPYA 1SQ4A 4LLFA 3VBSC 4RN5A 2A73B 2Y8KA 2XHKA 3VKNA 3EHKA 3GGLA 5FWJA 3OGSA 4XFGA 3GZEA 2A6WA 1LJ7A 2IXLA 2YPJA 3CNAA 4RSUA 3U4XA 5JPMB 3WF3A 3D0SA 3ZXJA 4YRDA 3OOXA 5K0UC 1GR3A 1UKGA 5KWRA 1DGLA 4K40A 2HEVF 4ASKA 4EE2A 3N9PA 1UXZA 2VZQA 4CDWB 1RMU1 1HQWA 3O0WA 4OHVA 5C9AB 5T5JA 4B1MA 4CDWA 5C9AA 4NIHA 2ZMNA 1Y9MA 2ZJCA 2VQTA 1VBD2 3AP6A 4LULA 1RUC2 1AJOA 1RUG3 1Y4WA 4MGKE 4QX7A 3ZDSA 5BNPB 5LWBA 3C7EA 1FNZA 4YM0A 2CWMA 3GHNA 1JZ3A 5BNPA 3NW4A 5EQUA 1W0OA 3AZXA 4YW6A 1SFNA 1LULA 2B7YA 3MF9A 4N90A 1SHWB 4ZS3A 2GDFA 5IVYA 4V2VA 3THCA 4D6QA 5JI9A 2LS6A 2UWCA 2GP5A 3F95A 3WNXA 3C7GA 1UU6A 3SCGA 4WVMB 1O7FA 4LBOA 1UPIA 3LFIA 1W99A 4WVMA 2EF6A 4X8PA 5L7OA 3JB4C 4I02A 1WLWA 3WQBA 5T52A 3LD8A 4J1XA 4ARXA 4AVCA 2ZOEB 3KV5A 3WG1A 4CDQB 5C6CA 5LEKA 1O3RA 3NV4A 5DPNA 2BWAA 4MGIE 1AX0A 4CDQA 1KS5A 5A3MA 1UY0A 4AGVA 4MADA 3WEZA 1Y9GA 4QU1A 2HBTA 3INAA 4BH9A 4FXGB 4SBVA 2JG8C 4PBOA 4BE3A 1W39A 2E9QA 5G05L 5JZGB 3CF6E 4OZOA 4XEZA 4GJYA 5JZGA 5JR7B 3GZAA 4RFRB 2RDRA 1XC6A 1UF2C 1IS4A 1XXNA 1YQ8A 2D3PA 2RR12 3I8TA 3N7JA 4IEYA 4EN7B 5K7PA 3ACLA 1UZ0A 1VB2A 1POV1 3ZXEA 2RS33 2WNOA 5DAWA 3K4AA 1LEMA 3P6BA 1KJLA 3CO2A 4IEQA 4Z2AA 4Q4V3 1DGWX 1MZ6A 5K8SA 3NJZA 1RUE3 2HWD2 1G9CA 3IAQA 2QKDA 2J1TA 4IGQA 4AI8A 3OBZA 3J8F2 5EYXA 4OHZA 2J7MA 3WQ1A 5FYIA 4BQ5A 1S0CA 2BW8A 4QPGB 3RZGA 4YGDA 1FAYA 1AR93 2JD9A 4QPGA 3RNSA 2V5YA 1FI2A 1ND3A 1GWLA 2W5FA 1LCLA 2F4PA 4JHZA 5FZ0A 5I91A 1RB8G 1L7QA 1RHI2 5FKCA 5FMCA 1H1AA 2D40A 1TMF2 4LBKA 4QKBA 4AHZA 3PIGA 1HV0A 4JTOA 2ZGMA 3CJIB 4H2AA 4XUOA 3GJBA 2FCUA 3MIDA 1D2QA 3CJIA 4M0NA 2WNUC 4WZFA 5LA0A 4ET7A 4DUXA 3QLQA 4NVPA 3A7QA 1H30A 1CAVB 1A34A 1NCQB 1GOFA 2PMWB 5A33B 1OC1A 3KV9A 3AYEA 1NCQA 5A33A 5A6XA 1FV3A 3PTYA 2D3SA 1N1SA 1QKQA 2MEV2 1PMHX 4Y4YA 2V09A 5J36A 3POFA 4BXFA 4YVWB 5BV6A 5LW9A 5EP9A 1B09A 4W6WA 4P9IA 3M3OA 1H4HA 4HT1T 1VBA2 4RGKA 4YVWA 3KLSA 1A8DA 3N3HA 2ID4A 1S0GA 2DVFA 4Q29A 3VBRC 2HKXA 3N9MA 4N53A 5A1FA 5HI0A 3SHRA 2YBPA 3SEPA 2VZ3A 1YCIA 3GBFA 3MLJA 4YNIA 2AUYA 5LCWL 3WW1A 2R063 4QPIC 1PHMA 4CPBD 1VAMA 1VBB3 3OBRA 1VB4A 4LHKA 4TSVA 2EIEA 4UF0B 3E5UA 1EAH1 3IDCB 3WP6A 2WNEA 4G9SB 1Q8SA 2TNFA 1V6KA 1UZWA 4XF4A 1XPWA 3ATGA 4UFJA 1LB2A 3MF6A 3MIHA 1TME2 1YI9A 2LROA 2XXZA 1Q3EA 1U12A 2TBVA 3GXUA 2FZ1A 5FWEA 5C3RA 4GB31 2HWE2 4MO3M 2JDKA 3MIGA 4BLJA 1FX5A 3L2YA 4IEZA 4IL7A 5E6HA 2J1EA 4D7YA 4SLIA 2H6BA 3FMGA 3NKGA 2SBAA 3ITQA 4Q0VA 1F15A 1S0EA 3PHMA 1HRV2 3HAGA 5JVVA 2Q8EA 2ADEA 3H3LA 2OUJA 2VY0A 4C8DA 4CYDA 2JDNA 1YWKA 2FQPA 4OMDA 4XETA 4DINB 5CADA 4UFKA 2RDNA 4A6OA 1YXWA 4FPLA 5FK7A 2QQLA 4WM8C 3ZFGC 4ES8A 1C8M2 1UNBA 1AZDA 5KHGA 5C3PA 1UOJA 5AC93 1PGW1 2D6LX 2FD8A 1ZRRA 4I09A 1K42A 1MACA 2VZPA 3WNOA 2VULA 2RM22 1NUKA 4L8QA 1JODA 4XCBA 3WUDA 3WQ7A 4LKEA 3V0BA 1V9U1 1HX6A 1ULDA 3PU8A 4B3NA 3LA2A 4LIUA 3HJRA 4B4RA 3K77A 1YI7A 3QACA 4P5HA 4LNVA 5I0DA 5K9YA 2XLAA 4XJ8A 4AL9A 5IK8A 5AVAA 4LHLA 1W06A 1O3SA 5EFUA 1H6YA 3WF0A 1SACA 3LKJA 4XHXA 4AVVA 4BIFA 2Y60A 4Y22B 4Z1VA 1WMFA 5F2SA 4Y22A 2HEWF 4BK5A 1BXHA 1W04A 2RDSA 4UOJA 3T2TA 3W5MA 1YFWA 1W8OA 1NCRC 1KFUL 1U5XA 1WW4A 3KCYA 4IV3B 1FMD2 1Z7S2 3B02A 4IV3A 3B94A 2D43A 4GMP1 1DIWA 3SXWA 2GNDA 1DQ2A 5JIUA 3DXUA 3EXUA 4LBQD 2Y38A 3A4UA 4O9EA 4ASMB 1J59A 1PGSA 1OOPC 4YZ2A 5BY5A 4FPCA 4QB6A 1APNA 5FYHA 3PVBB 2RMU1 3POEA 1EV12 2VTXJ 4M4PA 3ROUA 4D69A 2W87A 1DYKA 3KV4A 4R4XA 3MLKA 4BXSV 4UT5A 4W4ZA 1UL9A 4R9CA 4XJUA 2HWB3 3ZFEB 3AMMA 5FXZA 3WDTA 4QKFA 4PQ9A 4XZPA 3WF4A 3ZFEA 3T30A 1CN1A 2WFF3 1R1A2 2WBKA 3NO8A 3VZKA 1D0HA 3WQ0A 4ARYA 1OHFA 1YQ5A 4KU8A 5A1LA 1W6QB 3S7EA 2G1MA 1KEXA 1RYYA 3NAPC 1HLCA 3KCXA 1AR71 1W6QA 3VDCA 4NHKA 5HV4A 3B9CA 4XJZA 1XQNA 1RTVA 1ND2B 4BQWA 4FTBA 2Y64A 3LFMA 2JKBA 2HYXA 2ZZJA 4YW7A 3BUCA 1ND2A 2R072 1AXYA 5I0UA 4F8AA 1YHFA 2HH9A 3DXTA 3GZTB 2ADDA 4KL1A 2FDKA 2RVAA 4QQOA 3OUIA 5DUWA 4OHWA 3A23A 1WA6X 1YJKA 2RG4A 5DDJ3 3OBAA 5F5QA 3BB6A 2ZBJA 4MHRA 5F6KA 1LOAA 2O8OA 4YYOA 3SH3A 1G86A 4MXVA 4Q4X2 1RUI1 3IKWA 4E4DX 3U11A 3USUB 3BPSA 2LM3A 3MIEA 1ZA7A 2GH2A 4R9BA 2P3YA 4QM9A 2DUPA 4YM3A 4JRLA 1VBD1 4YG3A 1IPJA 1RUC1 5EJZB 1ZA4A 4PCRA 4PDWB 3BTYA 1QJZA 2ZGNA 1S0BA 1WBLA 1OF3A 4H14A 1Y3TA 4LKDA 5FZEA 3T2QA 1H9PA 4EN9B 1CX4A 3DYOA 1LTEA 4BM8A 2G9GA 4PJYA 1DLLA 3NL1A 4DNYA 2ORXA 3UKTA 4GH4B 5CFCC 1O59A 1SPPB 4A41A 4QU2A 3ORJA 2IXHA 5KBFA 1GICA 1SPPA 2EXHA 3ASIA 1R082 1UKRA 1RMU3 1MR5A 3FFZA 4C1XA 3S30A 5FZ1A 1R091 3VD4A 1JHNA 3HBKA 4YGCA 1COV3 3VDDB 4MYEA 3ON7A 3WNMA 2P1BA 3PUSA 4FQ4A 4FPOB 1E5SA 4AQ6A 2IXIA 4AFAA 2WT1A 1NXMA 5EXOA 4BB3A 3DYMA 2ZPXA 2Z4FA 4KI5M 2C9KA 5CAZA 1W3VA 3PU3A 4RHV3 1LOCA 3WLUA 2RR11 3AZZA 5L9RA 1DGRA 2JG9B 2W0XA 5ANNA 4M3CF 4Z8BA 2YU1A 2JG9A 4J25A 2VCMA 2YGMA 2XJUA 5LY2A 1XU1A 4YG0A 4Q4W1 3FN9A 2HWD1 3AXDA 1Q56A 3ACGA 3NRUA 1UD1A 2ERFA 4K9SA 4NR1A 5T50A 2BOJA 5BNNC 2OPKA 3WHTA 5HBAA 2VBPA 4CDXB 1JOPA 1GZCA 2DU1A 3RG0A 2ARBA 1FNYA 4YFWA 1WMDA 2JJ6A 3VZOA 3AYCA 3FX3A 3JQXA 2NZ9A 2ZACA 2VUCA 3G7DA 4FOVA 1UOFA 1MS4A 4GKXA 1D2SA 2L9LA 4IV1B 1OQEA 2W08A 4MGQA 1SZBA 3T0AA 1XOYA 1ULFA 2Q1FA 2DUQA 4H7LA 3RYPA 1F4HA 4E4HA 3B00A 4AF9A 2WABA 4BCUA 2QNKA 2QUOA 4YW5A 1ODNA 4LKSA 1ZBE3 5BNQA 1WW7A 1QJY2 4ZXKA 1RUF2 3PURA 2MEV1 4IE0A 5D8AB 1OOPA 3KWVA 1W8WA 1JTZX 2BUKA 2XHNA 5IUQA 2VNVA 1P8JA 4AEDC 4DMIA 4QXHA 2VBBA 2VOWA 3HQUA 3BKZA 1PNGA 2ORZA 4NPRA 4XF0A 5FK8A 4P5YA 2R1DA 1HDKA 2UYAA 5F32A 4HSLA 3WF2A 4LBLA 5FY1A 4Q8KA 1ONAA 5KXDA 3FLTA 3H50A 1VPHA 2VMCA 1TG7A 4IUGA 2J1RA 2BGOA 4D6SA 3O1PA 2DBNA 5CFDB 1VAVA 3FHIB 4XFIA 3U14A 1UMZA 1U5YA 4XPVA 3THDA 1UZYA 3LPFA 4CEWB 5FYMA 1T6GC 1YQ6A 2HWF3 1UYZA 2EAAA 5FUPA 1TME1 4BA6A 3H7JA 4CEWA 1TEIA 5FPXA 2QQJA 1JYXA 5FDBA 2WUHA 3M3QA 5KR7A 2RS52 4AQ2A 4QQLA 5JAXA 3LOIA 4CUCA 1QJU2 4YARA 2VW0A 4CE8A 3TOJA 2RS31 3R4UA 4UW3A 5CU1A 3U75A 3VD7A 3WUCA 3WV6A 4AAPA 3RS6A 2E6VA 4Q4V1 2OIIA 1KD7A 1DQ6A 4N7UA 3U10A 4TTGA 1QMJA 1JH5A 2VC9A 4KGQA 4QGLA 2VOVA 4YVSC 3Q8AA 1UY1A 2B8MA 4Y1ZA 4GZ9A 2X5IA 1XNBA 1PMJX 4PLMA 4JC1A 2VJXA 1QJX2 5FZ7A 3KF5A 4AVAA 4ZU7A 1AR91 1CESA 4COVA 4GB33 4QKDA 4UFHA 2AR6A 3IBMA 4BISA 4CU8A 2EA7A 3R4SA 2J22A 1TNFA 1BBT3 2VE1A 3HOBA 3NSTA 3ZYIB 4YG6A 3KQ4B 1OFNA 3LEMA 1WBFA 2JE9A 4JRAA 3R6SA 2B46X 2CV6A 4BQXA 1LOBA 2Q8OA 1KXGA 2R1BA 1VBC3 1V70A 3KB5A 4CPBA 4Z07A 1YFXA 1MQTA 3ZKUA 1HB4A 2BNNA 2QVSB 3V56A 3CEWA 3IDBB 3HVDA 5FJKA 3U37A 2BZDA 2VUJA 5JMOA 1SMVA 4ZU4A 3MDPA 1GBGA 4MHUA 2D3RA 1JYVA 5BNOB 2ZGKA 5FPLA 3A0NA 5J1XA 4FQZA 1D4VB 4CDUA 3POSA 5BNOA 2ZGLA 5C4WB 4YFZA 4X6RB 4YW4A 3VBOB 5F5CA 3UKVA 4XFBA 3M8LA 4YW2A 1T6BX 3NV1A 3VBOA 1W9YA 2R061 3FZ3A 2DVGA 1JYCA 1XE8A 1NG0A 5FZGA 3UL2A 1VBB1 4EN6B 3CL1A 4K8RB 2VCAA 4ISQA 2JDHA 4XDOA 4V1PA 2ENRA 4K6BA 1LOEA 3WXPA 5JWPA 1EV11 3LEIA 1MS0A 1RUH2 1ULEA 2EVXA 2WZPP 5H9SA 4A6SA 1XYPA 3VD9A 1MS5A 2HWC3 1X9PA 3BIWE 2D5FA 4DEQA 4Q0QA 1G8WA 3NNGA 4K1YA 4L9BA 1STMA 2VVFA 2ZX4A 2B42B 3O1TA 4LO4B 1SLBA 4CDWC 4DY5A 5C9AC 4Y1YA 1ALYA 4GMP3 1L3JA 4P9XA 3KCCA 2ET1A 4QX3A 5LK7B 5JR2A 2DFBA 2X09A 3RZHA 5BNPC 1AYM3 3NJYA 2DVAA 4P9LA 5T3NA 1PZ7A 2R49A 4QXCA 2A3XA 2E7AA 2RMU3 1IPKA 5FJHA 2XWJB 1BMV2 5EIYB 2W2IA 1HB3A 2A75A 4D7SA 4PIYA 5BXXA 1NAEA 4ISRA 2ZHLA 1SFPA 5AC91 4X8NA 1C28A 3IMMA 4O7XA 3E97A 5L7OC 4MSVA 2VUDA 3MW2A 2PHTA 4A44A 4NIGA 4RQPB 1SFYA 5EPAA 2O1QA 4CDQC 1DGWA 2XJQA 4IQPA 2VMDA 4OVEA 2GMMA 4RD7A 4XILA 2D5HA 4AK3A 2AC1A 4M01A 4LOSA 4LBQB 3TEZA 4FBFA 3M3CA 4FTSA 2X29A 5JPNB 3V0AA 3BN6A 5FZIA 1CJPA 5BYNA 2VOXA 3FLRA 2EICA 5JZGC 2KM2A 3S5AA 3MV01 3JQWA 4LK6A 3WR0A 3ZSJA 2PQSA 3TNPB 5HXMA 2G19A 4GJZA 1POV0 1NY71 2Y34A 3H8XA 4OI2A 1RL3A 4MH0E 1AL22 4HG6B 5FZBA 1W0NA 1BYHA 1CONA 1ZBA3 1W6OB 4P08A 4XOGA 4DY3A 4X6QB 2G4IA 2BP6A 3AVSA 3V65A 1RUJ2 4HXCA 4E2GA 4EWAA 5FZCA 1UWWA 5LY1A 4ASLA 2YUEA 3J4UH 2WNVA 4QPGC 3PJYA 3LGRA 1ND3C 3ZFFB 1FXZA 1WCDJ 2A5ZA 4PT6A 2P37A 2AEZA 5KXBA 1QNYA 2DCTA 3PUIA 1CIYA 1RUC3 2YV8A 5A3TA 4QPYA 4B8EA 3I2JA 2ES3A 4YVSA 4H7MA 2HWB1 1QOTA 1AHSA 3CJIC 1NYWA 5KHIA 3KHBA 5FYCA 4FOQA 3ZLIA 2H6CA 3GDBA 3M3IA 2OA2A 1UYYA 2GAUA 2WFF1 4MXWB 1NA1B 1NCQC 5JMCA 1BJQA 1OURA 4MXWA 1O91A 2J1UA 3I7DA 4NWVA 4LUKA 4BHPA 1CZTA 4OQ9A 1Q8PA 2VPVA 1ZRDA 4GWIA 4KU7A 2VZVA 3FWEA 4YVWC 1TZOA 4AGRA 1NXD1 1ASJ2 1X33A 1CAXA 2ZEWA 4H55A 3VBHB 4N53C 3POIA 2P6CA 4ZPIA 3VBHA 1W6PB 4XBNA 1AYN2 2Q8CA 1W6PA 1N1YA 5A3NA 5JXJA 4DB5A 2VZRA 2WS92 5J37A 1OUSA 1F8VA 2ILMA 5BPXA 3HR9A 4FFGA 2WAOA 3POGA 2JENA 2RR13 1NLRA 1U5ZA 3X29B 2BGCA 3AL5A 3EYPA 4HN1A 2C9AA 3IWZA 5DDJ1 2E51A 5C5UA 1C1FA 4F7ZA 3AYAA 3ES1A 4OFGA 2RDQA 1K45A 4YLZA 2Z2SB 2PN5A 3MUZ1 5AFBA 2VNRA 1ZZ8A 4FOYA 3AKTA 3PMEA 1RGSA 2C5DA 3J8F3 2WLQA 2VMHA 2Z42A 4IEXA 5FPZA 4DUVA 3HD8B 1YYNA 3ZKYA 5C8CB 1WCSA 4LOTA 3J9SA 1UY3A 2WAAA 3RWNA 3I4IA 2V5DA 3UGFA 1UOGA 5C8CA 5FLJA 3URFA 3C7FA 5F8PA 4AQSA 2JIJA 5J7MA 3TEWA 3FLPA 1RHI3 1SLLA 4IE4A 2GN3A 2GZWA 1TMF3 1S2KA 1ZBA2 4RGAA 3ZN6B 5JOYA 5L9VA 3WVJA 4XACA 3NJVA 4EN8B 1CPNA 3S0MA 1X7NA 4LLOA 5CKMA 3N4MA 1HQLA 1DYPA 1S0JA 1QJEA 2P2KA 4YGBA 2Z69A 2VNOA 1GP6A 1W8UA 2XVLA 4GWMA 3SNMA 1GU3A 2YY1A 4WVZA 4LPLA 1UCXA 3SKVA 3THPA 1LR5A 3TAYA 1COV1 2WQ4A 4TXWA 1UIJA 1Y9QA 3JB8A 3KS7A 4IEVA 4ZU5A 1NZCA 1HKDA 3AKRA 4C1WA 3VL9A 4MGSA 2MEV3 4META 1QXPA 1SBDA 2BVBA 5LBCA 4BWOA 3PIJA 1VBA3 1S0DA 3C7OA 1F5FA 5A3WA 5H9PA 3JU9A 5CISA 1MEC2 1SG3A 1DHKB 1YFYA 3AX4A 4RHV1 5FZ3A 4UWDA 3K48A 1QJU1 4Z92B 2D6MA 5DG2A 4FXKB 1OT5A 4LORA 4AI9A 2VMIA 4E27A 3DL3A 3WW4A 2K2SA 4JKMA 5APAA 3Q9OA 3LA3A 4GULA 4CU7A 5ABJB 1IG0A 1PIV2 2ZCWA 3B69A 2Q4SA 1I5ZA 1QJX1 1TME3 1JU4A 3LQCA 1A8MA 1UXXX 2X53S 4IV3C 4JVAA 4NROA 2GNTA 2JDPA 2D97A 1VMFA 2HWE3 3O0XA 1H8TB 2C1FA 3KSCA 3MW3A 4FPFA 4AVTA 3OGVA 2VUAA 1W8ZA 2R30A 1JZ7A 1GP5A 4IGPA 1V6OA 3NNLA 5C8WA 5A6QA 2FDIA 1KDMA 1LODA 3AKPA 1XSRA 1GV9A 2A1XA 2ZABA 5IHRA 1HRV3 4NHMA 1F5JA 4Q0SA 2JE8A 3GF6A 4DXSA 3ZX7A 4YM2A 2GN7A 1LHWA 5E89A 3JBG2 1ZBE1 5FP9A 3T3YA 2UYBA 3ZFEC 4EZHA 3H8RA 4TZDA 1PX4A 4A3ZA 1W03A 1JZ5A 1C8M3 2XOMA 5FTTC 1H4GA 4MLOA 4CP1A 1O6UA 2GNMA 2C0ZA 5J3UA 3O12A 4HFSA 1DYOA 2AGSA 4KNCA 3T2PA 4AFDA 4HVRA 3ZN4A 4O65A 3LZZA 1AX1A 5FZMA 4HKWA 2W9XA 2ZGSA 5FPBA 2RM23 4XFHA 4XFAA 3T1LA 2ZX1A 3DPRB 1UZVA 2VCBA 3NV2A 3FUQA 1ND2C 2ATFA 1CAVA 4FAHA 3DPRA 2EAKA 2XUEA 1WZXA 2D98A 2GP3A 4OUEA 3ZR5A 1W9FA 2YHJA 5DN2A 4BQ2A 3U07A 1WD4A 1JOJA 3RMXA 2HWF1 2XUMA 4U2AA 3WINE 4EWDA 3OEAA 5A3OA 1RUH1 4LHNA 4AAXA 1VIWB 3ZR6A 1MPXA 2DF7A 2EIBA 2J1SA 3IMNA 2PLV3 2Q30A 5FLIA 1OA2A 2WYSA 4NAOA 3R0RA 4D6RA 2VTFA 5DUUA 2WO3A 4LIVA 2ZGOA 1FMD3 4QX2A 1Z7S3 5FP3A 1PO22 1M06G 2IWGB 3SC7X 4PQQA 2W46A 1ENQA 2OPWA 3BI3A 3RGBA 1AX2A 1GSLA 2DU0A 2VECA 4UF0A 1V6IA 4HZFA 1VALA 4OLLA 2P34A 4DUWA 1EV13 3SH5A 5C3QA 4YZ1A 2PHFA 2VZUA 2DURA 4HETA 1UMHA 3ZXFA 1YEWA 4IW3A 1DF0A 1PO12 4Q8LA 1O8SA 1M4WA 5JIAA 5T5LA 1BBT1 2O8QA 1ENSA 2QQKA 2FCTA 5HCHA 2FMDA 2KXLA 4QPWA 1R1A3 1SLTA 4DPNA 2QZ2A 1VBC1 5A7OA 1QXJA 5J96B 2VZSA 3WDWA 4KWUA 1FOD2 3WDXA 4RS5B 3I2KA 4ORFA 5C70A 4PIZA 2ZX3A 3JD72 2QQWA 4AI1A 3K46A 5DQ0A 3RQ0A 4S2HA 2IFWA 3VBSB 1O8PA 1N1VA 3ZOIA 3MZHA 1OXCA 2Q8DA 4IXLA 5IAVA 5FLHA 2R073 3ZSMA 1S0FA 5HCBA 2VO5A 3ES4A 1XE0A 3PUAA 2JG9C 4QDSA 2XLFA 4BZ4A 2HYKA 5TSWA 1AL21 4KH9A 4XIKA 3TEXA 4XXPA 3BIEA 2RJKA 4XAEA 2BGPA 3H8OA 2V4AA 5DUXA 4CUAA 1UY2A 3PDQA 5FPUA 4WVWA 1RUJ1 5FOJB 1HXS2 1OLME 1IS5A 3T1MA 4Q4X3 3EMRA 3SCFA 3KHCA 2Y26A 4EWEA 5JSOA 3VZMA 2IXCA 4JTNA 2Y6GA 4E2SA 4HL0A 2HWC1 3GM8A 1VLNA 1XNKA 3I2HA 4XMAA 3WG2A 1JS9A 1D4M2 2PLV2 3W9AA 3KV6A 4AQTA 1DQ1A 1AR62 4JDOA 4XTPA 3F2ZA 2ZA9A 2W95A 3I2GA 3AMHA 1ZZBA 4MZUA 1F4AA 5HCFA 1S4CA 4PI2A 1V0AA 2R0FA 3OD0A 5DUVA 3UT0A 3ZXGA 1R083 4HONA 5IAXA 4QGNA 5LBBA 2PXJA 1AYM1 2W1QA 3ECQA 5T5OA 2DTWA 2A7AA 3WZ1A 4UI9L 5JI7A 5E88A 1GUIA 2J42A 1WWYA 3KT1A 1NOVA 4N43B 3H0OA 1PZ8A 1N3OA 2OKXA 5CB7A 5AFEA 4N43A 3OG2A 4FI9A 1KFXL 2VG9A 3UESA 2EIGA 4YZ5A 3VD5A 1UU5A 4GIQA 3AMPA 1URXA 5FY8A 2R042 2VGDA 1XYNA 4XABA 2J1VA 2QDNA 2B45X 3VBUB 2DCZA 5FYBA 4A3XA 1LAJA 5FIXA 5CFDC 3VBUA 5FMDA 1C4RA 3ELNA 3BGAA 2E63A 2MHFA 3M3EA 4EYUA 1RIRA 2DV9A 5D21A 5FY5A 4CEWC 1V6LA 2RJ2A 4QD2A 1IZ3A 1WA4A 2OQ6A 4HK9A 4W6YA 3RI8A 3PVNA 3WSOA 1OD5A 1AR82 1NQJA 3E5QA 5FQ0B 3PNAA 1Q8VA 5FQ0A 4URTA 5IJRA 2OW4A 5JXHA 2H0BA 1RITA 2ZGRA 1ZZ7A 4OUSA 3FFQA 2XL7A 1RVF2 2O14A 3MHZA 2YMZA 1DCSA 2E33A 3RFRA 3VHNA 2GALA 1YLLA 5FYTA 1ZBA1 4MVTA 3VKMA 1ZVFA 2YPDA 3I54A 3ZIXA 2X5IC 3QH6A 5CG8A 5B4XA 3AYDA 5FZ9A 2WNUB 1GWKA 2W1UA 2K46A 4QQPA 5J98B 2WQZC 3B7MA 4CEYB 3AKSA 1OQ1A 3K3OA 4YZ4A 4M3CE 1R1ZA 4CEYA 3USUA 3O1OA 5FRAA 3HPNA 1HRI2 5DG1A 1LOGA 1OH4A 2MNGA 3CJXA 3OF1A 4XQ4A 1QJY3 1VBE2 1RUF3 2DUOA 4GWJA 5FPAA 3ZXKA 4PDWA 2VMEA 5HPOA 5ANQA 3VBRB 1DP0A 5FYUA 5A7QA 1VR3A 3CDZB 3WP4A 1MQTC 3ZO0B 3AP9A 1G7YA 1MEC1 3OGGA 4GH4A 3UK9A 5K4LA 1CWPA 4LMFA 4MG2A 2PHDA 3SITA 2CGOA 2ZX2A 3RYKA 4CA9A 1UPSA 4XQWA 2WDBA 2Y6HA 1BK0A 3R4DB 3JXSA 5FMOS 5EWSA 3FL7A 3KF3A 1NLQA 4E8CA 2VH9A 4FP2A 4CCDA 1PGL2 3ZPOA 4E4SA 1GOHA 3JUUA 4M0HA 3VD3A 5BNOC 1H2LA 4CDUC 3VDDA 5LBFA 5IK7A 1J1TA 5JUVA 3LCPA 4NPMA 1IGOA 1G9FA 1WKYA 3VDBA 2YFZA 1GOGA 5B2GB 1VP6A 2JWPA 3K4DA 3VBOC 1F2NA 2G9ZA 2KD7A 2HEYF 2A3YA 1XNDA 4XZUG 1KDKA 5FR3A 2RS53 1QOOA 2B4KA 1O3QA 2XG3A 4Y20B 2WL1A 3HEIA 1QJU3 1W9SA 2OZJA 4Y20A 4KWLA 3A22A 3FE5A 4YWAA 1K5JA 2WO1A 2YC4A 4HKLA 4F83A 5SV5A 1BK1A 3DYPA 1FPN2 4CZSA 3MFCA 3BOPA 1W9TA 1IOAA 2NMOA 1MVQA 3J8F1 1C5HA 2E32A 2VZ1A 2XBO3 4NMIA 4Q4Y2 4B7KA 1SCSA 3O14A 5LRSA 1MZEA 1QJX3 3LAGA 2W39A 3E5XA 3Q8CA 3SH4A 4Z82A 4OQ8A 3VBFB 1GYKA 2YZ4A 5GJ6A 5IW0A 1DBNA 1XB9A 2VCCA 1Q8QA 2CHHA 5FXXA 3VBFA 4CDXA 3S57A 1RHI1 3IT8A 2DTYA 1TMF1 1EYBA 2NQYA 4CCEA 2RJLA 3ENRA 4ZY9A 4XDQA 1CR7A 1QWRA 3MLLA 5JOWA 4LT5A 3UJQA 1XNCA 2CWSA 3BYWA 1HN1A 3OUJA 1CGPA 5FYSA 3NNFA 1QF3A 3THTA 4AR2A 4IV1A 1YJLA 5FP4A 3OBTA 1QDOA 1QHDA 1W0PA 1KJRA 2LUWA 2VR4A 3NJXA 1WCUA 3MIBA 3UYJA 5IWFA 3JCIA 4NHXA 5FREA 2QQPA 1G6NA 2D93A 3M1HA 5D8AA 5FCCA 1KRIA 2WSVA 3ZVXA 1VBA1 3I3BA 2BU9A 5DMYA 1YQ2A 3OGRA 1UX7A 4UYBA 2V72A 5EHDA 1NCRB 2OZ6A 3K4ZA 4G3YC 2ZMLA 4JDNA 3I3EA 1BQPA 1WLCA 4S2GA 1FYUA 4QDQA 4XTMA 1H0BA 2ARXA 2F4LA 4Y3OA 4EJRA 2XVGA 4DEVA 4LA3A 1LESA 1PVXA 4GAZA 5CFDA 3QH7A 2P3KA 2KA3A 1QGLA
chains in the Genus database with same CATH topology
3C2UA 2XL9A 3ZXLA 3VN4A 4XF3A 3ALQA 1UAIA 1RUH3 4AI2A 4NO4A 2HWE1 3D82A 3N7MA 1B35B 1QNWA 4O9GA 1RC6A 2WNVC 1B35A 3WW2A 4YSFA 2UY9A 2VNGA 3ETQA 1BKZA 4HKOA 3WDUA 2GNBA 4HSJA 4CP2A 1CD3G 4KWKA 2WC2A 4K1ZA 5GLVA 3KMHA 3NAPB 1RUNA 1HRV1 1U0AA 4PLNA 3BOWA 2ZKNA 2XBO2 3VLBB 1NE6A 2ZHNA 2PHUA 2FHRA 3CU7A 3E6CC 1LEDA 4RA0A 4IEUA 1C8M1 1X36A 2R6QA 2RE9A 4IEPA 3QBQA 5DZEA 3VKLA 3APBA 2OYZA 3KZ4C 4RFT0 4QM8A 1IS6A 3BALA 4BOWA 5IT6A 2XB6C 2RS12 2RM21 2VW2A 2PHXA 4ES9A 1H2NA 1TNRA 1MS3A 3NVCA 3VBHC 3ZMOA 2H0VA 3H8UA 3NKTA 5KC6A 2PAMA 2PFWA 3UV9A 1SLCA 4AEKA 3B5LB 4XIOA 2UWAA 1H9WA 1CAWB 1LHNA 2WA3A 4AGGA 1CAWA 1V6NA 1MZFA 2JECA 3HT1A 1DDLA 5C4WA 1AL23 2PLV1 5CFCB 5JCTA 2Q5TA 4QGMA 2VVEA 4E9KA 1FMD1 1QDCA 4R8HA 1Z7S1 1ENXA 2QZ3A 3O7OA 1BZWA 4UW6A 1RUJ3 2Z5WA 3DUIA 4C0HA 5C8CC 2BTVC 1QQP3 5JSRA 1J1LA 1F9KA 4MX3A 2ZZQA 1LKNA 4L99A 1O5LA 4LUMA 5I8SA 2CAUA 3MPPG 1EPZA 4U36A 2E7QA 3B3QE 4COZA 3P3NA 1QXRA 2ZAHA 4N7IA 1R1A1 2WKKA 4PBPA 1OSGA 2WZR2 1A6CA 2AZ5A 1XE7A 1H8VA 1U5IA 5DZGA 1ASJ3 1WUVA 1JXNA 1AR81 5GLUA 1AXZA 4AWDA 1AYN3 4NWWA 2X8KA 3VHOA 3WDYA 4DQAA 2R071 1C8NA 4D7TA 1WD3A 2WS93 2BFUS 1J58A 1DQ5A 4IEWA 1SEFA 4RQPA 1RVF1 3RRDA 1EAH2 1I3HA 4MUVA 2LALA 4AI0A 3HIFA 4LBQA 1OQDA 2JEMA 4I3PA 4Q4X1 5FO8B 4XJ9A 1Q43A 2XH6A 1H8TC 3ZYPA 2MPFA 4FOWA 1HRI1 5FFOC 5IK5A 4M3CB 4TWTA 1JYIA 1LGBA 4HANA 5GZCA 4XF9A 2BYVE 1O4YA 2ZGQA 3BCWA 3ZMNA 1YFUA 1OPOA 1XRUA 1GZWB 1W6OA 1EP0A 1CQ9A 5HCAA 3V64A 1LOFA 2OUHA 1R081 2ZKLA 1QQP2 2VU9A 3RDIA 4DS0A 3ZFFA 3C3VA 4FPGA 3GBGA 4P9WA 1PGL1 1G9DA 1PGW2 2SLIA 2I07B 3D5OA 2IXKA 3KT4A 1DZRA 1BEV2 4P14A 2IXJA 4F3JA 2I45A 3TYJA 4JGZB 4AXOA 2PHLA 3JZVA 2GC2A 1H2KA 2BNOA 1VJ2A 3VGIA 4JGZA 1N3QA 1MEC3 1V9U2 2E7TA 1QOSA 4FPJA 3DPRC 2NPIA 1DG6A 2BNMA 4Y1VA 3TWIA 1NA1A 1WMEA 1TQ5A 5GKAC 4CTEA 2ZS6B 2Q1ZB 3VZJA 2NMNA 2GMPA 4K7JA 2WA4A 4Q0UA 4OHXA 2GC1A 4OUMA 3N36A 2JXAA 1PIV3 4UW4A 1BVP1 3IPVB 2D6OX 1O4ZA 4XXAA 1WW5A 2Q0AA 3IPVA 5ACA2 4K20A 1K5MB 2DVDA 1K5MA 4RR3B 3ZPYA 1AVBA 1O5UA 4LBJA 5F9TA 5L73A 4RR3A 3WOGA 4UBGA 3M7AA 2A6YA 2YYOA 3J26N 3KT7A 4PF5A 3ME2A 1OLRA 4D3WA 3JBG3 5FBZA 1QJY1 4MGYE 1RUF1 1JUHA 1W6NB 4COUA 1J3QA 5GZDA 1FATA 1AUYA 4AVSA 3MGUA 4BMBA 2JICA 1XYOA 1OA4A 1ZM1A 3ZN6A 1AR72 3O0VA 1LENA 1S0IA 5I93A 5GALA 4A7KA 2XWBB 4YGEA 3VKOA 3W59A 2AH2A 2ZGUA 5GZEA 3MFAA 2PHWA 1DGRN 5JSPA 4AHWA 4I0BA 4GQ7A 1HW5A 2DYCA 3AZVA 3POWA 3WX5A 1WCKA 3EO6A 3D4KA 3AMNA 5CG9A 5GZGA 5I8YA 1ZZ6A 4QXKA 4XQDA 5E8AA 5H9QA 1G9AA 4XJAA 2GC0A 4FCAA 3AM2A 2PA7A 1Q5OA 3HMYA 2RS51 1VRH2 1N3PA 2D6KA 4CRQA 1RUI2 3IM0A 5H9RA 1IKQA 2A3WA 1MZ5A 1QY4A 2NM1A 2VVDA 1PO23 4R52A 3KM5A 1GZ9A 4LTAA 1X82A 4BIOA 1LGNA 1UW8A 2BWCA 3SCHA 2XBO1 1REEA 1DQ4A 5KC5A 5ABJA 5I0RA 2XJSA 3HBZA 3ILFA 5KHHA 4GMP0 5L7OB 2W52A 1PO13 1H8TA 2WIIB 1GKBA 2CNAA 1R092 3WW3A 3ZYJB 3LSEA 4Y26A 2B5HA 4XFCA 2RS11 3BU7A 3MW4A 4GALA 4A2UA 1FOD3 1ZZ9A 3H1YA 4N43C 3JD73 4K8FA 2PELA 4Q1PA 4LEJA 3M70A 4LE3A 1DFQA 2FBEA 4NHLA 1C57A 1GNZA 2ET7A 1S2BA 2D6PA 3VBUC 1YIPA 1HIXA 1FT9A 4W6XA 4Q4W2 3AMQA 2XKPA 3G6JB 2XJTA 4LO8A 5CIRA 1YUDA 3H3ZA 1W2UA 1PK6B 3L2HA 4IEOA 4JGYB 4TYSA 5CNAA 3UKNA 1HXS3 1ND3B 2GC3A 1PK6A 3QD6A 4FAGA 4JGYA 4UBHA 1X50A 4OULA 2P3IA 5FAXA 5EJ3A 4A7ZA 1PM7A 2R32A 1KS4A 2UWBA 4FPEA 2GMEA 4KQ7A 5L36A 1H1MA 1D4M3 1SBEA 1Z78A 1AR63 4JDMA 1EPWA 3LSDA 1YNAA 4CEYC 4XHBA 4NOTA 1RUG2 4CP0A 4LO6B 4FO9A 4W65A 5A3LA 2BPA2 4PDWC 1DQ0A 2WZR1 2BBVA 5E16A 2R16A 4LO7A 4AW7A 2UU8A 5DXDA 4COWA 1REDA 4N53B 4DFSA 3RJ2X 1D0GA 2XPJA 1BMV1 4FSJA 4HK8A 1QH7A 1GANA 5GM0A 2EXIA 2O0OA 4GH4C 5EZWA 3ZSEA 3TN93 2Y0OA 3ZYGA 1RUD3 4WM7B 3IDEA 4IERA 4WVVA 4AFBA 1WLTA 4WM7A 2PHRA 1E57A 2QJVA 1S55A 3QCWA 2R043 4AHYA 3VDDC 2DWRA 1W6MB 3WCRA 4HVQA 1SBFA 4OI0A 2NLRA 2DVBA 4FPKA 1W6MA 5FOBB 5AVPA 1GQGA 4RS5A 1CIWA 1GFF2 2OVUA 3H3UA 2DCJA 2JE7A 4ONUA 3GZUC 4KBBA 1AR83 2ZGTA 3VBSA 3AB0A 4DRRA 2VQAA 2AYHA 2RS32 4HBNA 4XBLA 5FMOL 3EJKA 3MICA 4Q4V2 4GKYA 4QHBA 5K0UB 3R05A 1RUE2 2A6ZA 2VMGA 1RVF3 3SISA 2YGLA 5K0UA 3VV1A 1UX6A 2WINB 3DKWA 2A70A 3HWJA 2WSUA 2BVVA 2PAEA 3L9JT 2VXRA 2WWSA 4FPHA 4J6GA 4B4QA 2VOKA 1NE4A 5T55A 1AR92 4S2DA 4IESA 3DGTA 3GBWA 1QQP1 4Q1RA 5GZFA 3VBFC 4CDXC 3NV3A 2LTNA 1I9RA 4FP3A 2YC0A 1HRI3 3WP3A 1BCXA 1VBE3 4Q27A 3WP5A 1JUIA 5LRRA 1BEV1 3EQEA 1LECA 3GALA 3RYRA 2GH8A 4IV1C 3V0BB 3NWKA 5KHJA 3WT3A 1PVC3 2HJIA 1ZREA 2FZ2A 5C33A 3GYDA 4PLOA 3ZXAC 1H1IA 2WLPA 5D8AC 2A6VA 1J3PA 1JBCA 2XGXA 5D1IA 3E6DA 1ASJ1 2TEPA 3MI8A 4I0WB 2JG8B 2YXSA 2K9ZA 3TN92 1AYN1 2JG8A 4KG8A 1RUD2 4Q2FA 1LHVA 2R062 3HT2A 1ZRCA 2WS91 4IETA 3WDVA 4QQ2A 1VBB2 4K3UA 4MV2A 5ACA1 3EBRA 4AE2A 5SV8A 3WHUA 1CJDA 3N7KA 4Y1UA 2P3JA 3ILRA 2CAVA 1Z0HA 1C1LA 1I1EA 4L11A 5I0TA 4ATFA 4RGGA 1LRHA 4QQHA 1FPN3 1AF9A 1QH6A 4Q4Y3 1B35C 1QU0A 4GWNA 3OY8B 3OY8A 1YIFA 4Q0PA 5CVRA 4QT6A 3WG3A 2NN8A 2WFPA 1A78A 3I2DA 3LB9A 5F1RA 4E2QA 1UIKA 4EROA 2WNUA 2D6NA 3LA7A 1ENRA 4UW5A 3UJOA 2XJPA 4Q26A 5AC92 3B93A 3FJSA 1LHOA 4INDA 2AENA 1ZZCA 3OPZA 4L2NA 3VBRA 4XJWA 2WT0A 1PVC2 4JAAA 3AP7A 3DV8A 1VRH1 5LK5A 4QPIB 2ZTNA 1H2MA 3D8CA 4QPIA 4Z2WA 2W68A 4OHYA 5BUVA 1UZZA 3U0ZA 1RJ7A 1NY72 2EALA 4C91A 1MS1A 2CY6A 5KXCA 1VAKA 5C4WC 2GU9A 4I3GA 2BQPA 1PIV1 4GA9A 2VQ0A 3AP4A 4RL7A 5GLZA 3DN7A 3H9AA 1IHMA 4HPKB 4FVVA 3AZWA 4P9YA 4I0AA 1Y7BA 1C3HA 4HPKA 3WD5A 3RZZA 4HMZA 1ULCA 1YO8A 3AJZA 1OPMA 4G4FA 2ZAAA 4LO5B 4GXLA 5JOZA 3AXEA 4XYXA 2HWB2 1XU2A 1RINA 2D44A 3GHMA 3JBG1 1EY2A 4WM8B 3ZFGB 3ZIWA 3PVOA 2WFF2 4WM8A 3H1MA 3H7YA 3ZFGA 3USSA 4XBQA 4HN0A 1SLIA 1X8EA 5KXEA 1WW6A 4BQ1A 3PLQA 3KQRA 2RS13 2CTVA 1LHUA 3AFGA 3D0JA 1V00A 5LEJA 1OLQA 1CVNA 1LU1A 1OFSA 2PYTA 1SDWA 4XF1A 3QOPA 5F6LB 1RUOA 4AHXA 4ITCA 4R9DA 1V6MA 4RQPC 5FO7B 3OYWB 4Y5Z0 3ST7A 1DZTA 3A0KA 1POV3 2WT2A 3OYWA 5KHKA 1S1AA 5DDJ2 1KQRA 2PQQA 4OI1A 1OMIA 4B4PA 4AEMA 1MS8A 3TNQA 1OKQA 1GLHA 3E6BA 1NCRA 4PIXA 1PO21 3OGJA 4LBNA 2GSYA 3ZYRA 4AFMA 1RUG1 1RJ8A 2XJRA 1OOPB 2BFUL 2I74A 1IKPA 4K21A 3AK0A 3GNEA 4YW3A 2ZMKA 4M00A 4I30A 4EV0A 4XFFA 3BODA 1JW6A 2DCKA 3AKQA 1AL0G 2CGPA 1GQHA 4S2FA 2VW1A 1PZ9A 1PO11 1LOFC 2ZHKA 3IN9A 1RMU2 2N7GA 3PMSA 1O4TA 4LR4A 3ZFFC 1COV2 5GLWA 4XW3A 1SLAA 4I2OA 1V6JA 1FOD1 3NAPA 4Y24A 2WZR3 3MEPA 3JD71 2XKOA 3FUOA 3PVEA 2CGNA 3WCSA 1PNFA 1PMIA 4JGZC 1CAUB 2QE3A 4RHV2 1CAUA 2AREA 2Q1MA 1NA1C 2D7FA 4N9IA 3VHRA 3H1WA 2I2SA 2A6XA 5EV7A 1RUE1 2PTMA 4OI4A 1EAH3 2ZGPA 5CBLA 2X5IB 1OI6A 2ZX0A 2JDZA 1OA3A 4NN0A 1ZX5A 1HXS1 4BLIA 1UN1A 2UY8A 3BTAA 3K51A 3VKFC 1TE1B 2EXKA 4JQRA 1NQDA 2V73A 5EYYA 1LGCA 2B9UA 1IS3A 4BYYA 1K5MC 4WV8A 2R0HA 1J3RA 4TLFA 4LA2A 4RR3C 3CLPA 1D4M1 3DF0A 1MQTB 1AR61 4B29A 1ZYBA 3SLIA 1IQAA 2G9FA 3O5SA 5CFCA 5DZFA 5GLTA 4XMIA 3BPZA 2FMYA 4OZXA 3OCPA 1ZBE2 2JD4A 3TBDA 2F6BA 4HVOA 4MGZE 4QMAA 4R4ZA 4XE9A 4CDUB 3LWCA 1AJKA 2A71A 2RHPA 3POYA 3AZYA 1BEV3 5HXVA 3TN91 3SMHA 1RUD1 4E4ZA 5JOXA 2DCYA 4UXAA 1N1TA 1C5IA 2YROA 4BMEA 1O3TA 3S7IA 4AG4A 1CPMA 1V9U3 3D6EA 2R041 1N47A 4JV4A 3KGZA 4FT8A 2TUNA 4KWJA 2CYFA 4B7EA 2CL2A 3KD4A 2HWF2 2BEOA 2ETEA 2PAKA 4Y1XA 2JX9A 2UURA 4YM1A 1ZRFA 2XVKA 5BNNB 2IZWA 3MIFA 4KGGA 5BNNA 2XLGA 4FTEA 3ZN5A 2IC1A 5ACA3 4AYUA 1SCRA 4D94A 5L19A 3FC0A 3ILNA 4P9GA 1X8MA 2Y0IA 3ZXDA 4C90A 1REFA 4AFCA 3OD4A 1AXKA 4YW1A 5ABJC 3RI9A 1WLDA 4GB32 1GNHA 2XJVA 3AP5A 3M4FA 4P9JA 1FV2A 1A3KA 1HV1A 1LU2A 1BBT2 4DZGA 1Q8OA 4KG0A 1MS9A 1VBE1 4M3CA 4AEDB 2B39A 4L92A 2YDEA 1VBC2 2NP0A 4AEDA 3TB0A 1Y43B 3HQXA 3ZSLA 4QX5A 1PVC1 3V0AB 1AR73 2QFEA 3RSJA 4LBMA 3KGLA 1GZWA 2E53A 5J09A 3I59B 1I6XA 3W58A 3I59A 4DOUA 4COYA 4N9HA 1DZQA 2DFCA 3VZLA 4WZCA 3N7LA 4A7YA 3HN1A 3RJRA 3PJQA 3LOBA 1DU3D 3VZNA 5JLVA 3P3PA 4DXZA 4JCKA 2WNVB 3WG4A 4WBBA 1YRZA 1VRH3 1PK6C 4BPZA 2EXJA 3N35A 4JGYC 1RUI3 1UU4A 4I01A 2WJSA 3IIAA 2NYYA 1KITA 5A32B 1G9BA 1VBD3 4YVSB 3FBYA 2ZHMA 2HWC2 4HLTA 1ULGA 1FPN1 5A32A 5JDBA 3MPBA 4DRVA 3M2MA 4Q4Y1 2P17A 4AEJA 3ZSKA 4H3WA 1WGPA 4ZKTB 3RMYA 5FO9B 2QCSB 1MVEA 2QDRA 5T5PA 5I0SA 5IK4A 4L97A 1F31A 3VHPA 5J48A 4LE4A 3B9IA 4R9AA 1AYM2 5T54A 3WY6A 1NLSA 2Z79A 1R093 5E1RA 1CAXB 4AVBA 1ZNPA 2RMU2 3AJYA 3MYXA 5CA6A 1JN2P 4AI3A 1BVVA 3RPQA 3S6PA 4WM7C 4ATEA 4C0BA 4J1WA 3VL8A 1W6NA 2IFRA 1HQNA 3OJBA 4EN0A 3B01A 2K0GA 3VUOA 3FBMA 4RS5C 3TRSB 4Q4W3 2HWD3 5I8TA 3OTFA 3AFKA 4YZ3A 4FPYA 1SQ4A 4LLFA 3VBSC 2A73B 2XHKA 3VKNA 3EHKA 4XFGA 3U4XA 2A6WA 1LJ7A 2IXLA 2YPJA 3CNAA 4RSUA 5JPMB 3D0SA 3ZXJA 4YRDA 5K0UC 1GR3A 1UKGA 5KWRA 1DGLA 4K40A 2HEVF 4CDWB 5C9AB 1RMU1 1HQWA 3O0WA 4OHVA 5T5JA 4CDWA 5C9AA 2ZMNA 2ZJCA 4MGKE 1VBD2 3AP6A 4LULA 1RUC2 1AJOA 1RUG3 3ZDSA 5BNPB 1FNZA 4YM0A 2CWMA 3GHNA 5BNPA 3NW4A 1W0OA 3AZXA 1SFNA 1LULA 2B7YA 3MF9A 4N90A 5IK8A 5JI9A 2GDFA 2UWCA 3WNXA 3SCGA 1UU6A 4WVMB 1O7FA 4LBOA 1UPIA 4WVMA 4X8PA 2EF6A 5L7OA 3JB4C 4I02A 1WLWA 5T52A 4J1XA 4AVCA 2ZOEB 3WG1A 4CDQB 5C6CA 5LEKA 1O3RA 3NV4A 2BWAA 4MGIE 1AX0A 4CDQA 1KS5A 5A3MA 4AGVA 3INAA 4BH9A 4FXGB 4SBVA 2JG8C 4PBOA 4BE3A 1W39A 2E9QA 5JZGB 3CF6E 4XEZA 5JZGA 5JR7B 3GZAA 1UF2C 1IS4A 1XXNA 2D3PA 3I8TA 2RR12 3N7JA 4IEYA 4EN7B 5K7PA 3ACLA 1VB2A 1POV1 3ZXEA 2RS33 1LEMA 1KJLA 3CO2A 4IEQA 4Q4V3 1DGWX 1MZ6A 5K8SA 3NJZA 1RUE3 2HWD2 1G9CA 2QKDA 4AI8A 3J8F2 5EYXA 4OHZA 3WQ1A 1S0CA 2BW8A 4QPGB 4YGDA 1FAYA 1AR93 4QPGA 3RNSA 2V5YA 1FI2A 1ND3A 5I91A 1RB8G 1LCLA 2F4PA 1RHI2 1H1AA 2D40A 1TMF2 4LBKA 4AHZA 1HV0A 4JTOA 2ZGMA 3CJIB 3MIDA 1D2QA 3CJIA 4M0NA 2WNUC 4WZFA 3QLQA 4NVPA 1H30A 1CAVB 1NCQB 5A33B 3AYEA 1NCQA 5A33A 1FV3A 3PTYA 2D3SA 1N1SA 1QKQA 2MEV2 4Y4YA 2V09A 5J36A 4YVWB 5BV6A 1B09A 4W6WA 4P9IA 3M3OA 1H4HA 4HT1T 1VBA2 4YVWA 3KLSA 1A8DA 3N3HA 3VBRC 1S0GA 2DVFA 4Q29A 2HKXA 4N53A 5HI0A 3SHRA 1YCIA 3GBFA 3MLJA 4YNIA 2AUYA 3WW1A 2R063 4QPIC 1PHMA 1VAMA 1VBB3 3OBRA 1VB4A 4LHKA 4TSVA 3E5UA 1EAH1 3IDCB 3WP6A 2WNEA 4G9SB 1Q8SA 2TNFA 1V6KA 1LB2A 4XF4A 3ATGA 3MF6A 3MIHA 1TME2 1YI9A 1Q3EA 1U12A 2TBVA 2FZ1A 4GB31 2HWE2 4BLJA 3MIGA 1FX5A 3L2YA 4IEZA 4IL7A 4D7YA 4SLIA 2H6BA 3FMGA 3NKGA 2SBAA 4Q0VA 1S0EA 3PHMA 1HRV2 3HAGA 5JVVA 2OUJA 2VY0A 4CYDA 4DINB 1YWKA 2FQPA 4XETA 5CADA 1YXWA 4FPLA 4WM8C 3ZFGC 4ES8A 1C8M2 1AZDA 5KHGA 5AC93 1PGW1 2D6LX 1ZRRA 4I09A 1MACA 2VULA 2RM22 4L8QA 3WUDA 3WQ7A 3V0BA 1V9U1 1HX6A 1ULDA 4B3NA 3LA2A 4B4RA 3QACA 1YI7A 4P5HA 4LNVA 5K9YA 2XLAA 4XJ8A 5AVAA 4LHLA 1O3SA 5EFUA 1SACA 3LKJA 4XHXA 4AVVA 4BIFA 4Y22B 4Z1VA 1WMFA 4Y22A 2HEWF 1BXHA 3T2TA 1YFWA 3KCYA 1NCRC 1KFUL 1U5XA 1WW4A 4IV3B 1FMD2 1Z7S2 3B02A 4IV3A 3B94A 2D43A 4GMP1 1DIWA 3SXWA 2GNDA 1DQ2A 5JIUA 3EXUA 4LBQD 4O9EA 2Y38A 3A4UA 4ASMB 1J59A 1PGSA 1OOPC 4YZ2A 5BY5A 4FPCA 1APNA 3PVBB 2RMU1 1EV12 4D69A 3ROUA 1DYKA 4R4XA 3MLKA 1UL9A 4R9CA 4XJUA 2HWB3 3ZFEB 3AMMA 3WDTA 4PQ9A 4XZPA 3ZFEA 1CN1A 2WFF3 1R1A2 3NO8A 3VZKA 1D0HA 3WQ0A 1OHFA 4KU8A 1W6QB 3S7EA 3NAPC 1HLCA 3KCXA 1AR71 1W6QA 4NHKA 3B9CA 4XJZA 1XQNA 1RTVA 1ND2B 4FTBA 2JKBA 2ZZJA 1ND2A 2R072 1AXYA 5I0UA 4F8AA 1YHFA 3GZTB 4KL1A 4QQOA 5DUWA 4OHWA 1YJKA 5DDJ3 5F5QA 3BB6A 2ZBJA 5F6KA 1LOAA 2O8OA 4YYOA 3SH3A 1G86A 4MXVA 4Q4X2 1RUI1 3IKWA 4E4DX 3U11A 3USUB 2LM3A 3MIEA 2GH2A 4R9BA 4QM9A 2DUPA 4YM3A 4JRLA 1VBD1 4YG3A 1IPJA 1RUC1 1ZA4A 4PCRA 4PDWB 1QJZA 2ZGNA 1S0BA 1WBLA 4H14A 1Y3TA 4EN9B 1H9PA 1CX4A 1LTEA 4BM8A 2G9GA 4PJYA 1DLLA 3NL1A 4DNYA 3UKTA 4GH4B 5CFCC 4QU2A 2IXHA 5KBFA 1GICA 2EXHA 3ASIA 1R082 1UKRA 1RMU3 1MR5A 3FFZA 4C1XA 3S30A 1R091 1JHNA 4YGCA 1COV3 3VDDB 4MYEA 4FQ4A 4FPOB 4AQ6A 2IXIA 4AFAA 2WT1A 1NXMA 5EXOA 2ZPXA 5CAZA 4RHV3 1LOCA 3WLUA 2RR11 3AZZA 1DGRA 2JG9B 2W0XA 4Z8BA 4M3CF 2JG9A 2YGMA 2XJUA 1XU1A 4YG0A 4Q4W1 2HWD1 3AXDA 1Q56A 1UD1A 2ERFA 4K9SA 4NR1A 5T50A 5BNNC 2OPKA 3WHTA 5HBAA 4CDXB 1GZCA 2DU1A 3RG0A 2ARBA 1FNYA 4YFWA 1WMDA 2JJ6A 3VZOA 3AYCA 3FX3A 3JQXA 2NZ9A 2ZACA 3G7DA 4FOVA 1MS4A 4GKXA 1D2SA 4IV1B 1OQEA 2W08A 1ULFA 2DUQA 4H7LA 3RYPA 3B00A 4AF9A 4BCUA 2QNKA 2QUOA 4YW5A 1ZBE3 5BNQA 1WW7A 1QJY2 4ZXKA 1RUF2 5D8AB 2MEV1 1OOPA 1JTZX 2BUKA 5IUQA 4AEDC 4DMIA 2VOWA 1PNGA 4NPRA 4XF0A 2R1DA 1HDKA 2UYAA 4HSLA 4LBLA 4Q8KA 1ONAA 5KXDA 3FLTA 3H50A 5CFDB 1VAVA 3FHIB 4XFIA 1UMZA 1U5YA 4XPVA 1UZYA 4CEWB 1T6GC 2HWF3 4CEWA 2EAAA 1TME1 3H7JA 1TEIA 5FPXA 5FDBA 3M3QA 2RS52 4AQ2A 4QQLA 5JAXA 3LOIA 1QJU2 4YARA 2VW0A 3TOJA 2RS31 3R4UA 4UW3A 5CU1A 3WUCA 3WV6A 3RS6A 2E6VA 4Q4V1 2OIIA 1KD7A 1DQ6A 4N7UA 3U10A 1QMJA 1JH5A 4KGQA 4QGLA 2VOVA 4YVSC 2B8MA 4Y1ZA 2X5IA 1XNBA 4PLMA 4JC1A 1QJX2 4AVAA 4ZU7A 1AR91 1CESA 4COVA 4GB33 2AR6A 3IBMA 2EA7A 3R4SA 1TNFA 1BBT3 3NSTA 3ZYIB 4YG6A 4JRAA 1OFNA 3R6SA 1WBFA 2JE9A 2B46X 2CV6A 1LOBA 2Q8OA 1KXGA 2R1BA 1VBC3 1V70A 3KB5A 4Z07A 1YFXA 1MQTA 2QVSB 2BNNA 3V56A 3CEWA 3IDBB 2VUJA 1SMVA 4ZU4A 3MDPA 1GBGA 2D3RA 5BNOB 2ZGKA 3A0NA 4FQZA 1D4VB 4CDUA 3POSA 5BNOA 2ZGLA 5C4WB 4YFZA 4X6RB 4YW4A 3VBOB 3UKVA 4XFBA 3M8LA 4YW2A 3NV1A 3VBOA 2R061 3FZ3A 2DVGA 1JYCA 1XE8A 1NG0A 3UL2A 1VBB1 4EN6B 3CL1A 4ISQA 4V1PA 2ENRA 4K6BA 1LOEA 3WXPA 5JWPA 1EV11 2WZPP 1MS0A 1RUH2 1ULEA 2EVXA 5H9SA 1XYPA 1MS5A 2HWC3 3BIWE 2D5FA 4Q0QA 1G8WA 4K1YA 4L9BA 2VVFA 2ZX4A 2B42B 4LO4B 1SLBA 4CDWC 4DY5A 5C9AC 4Y1YA 1ALYA 4GMP3 1L3JA 4P9XA 3KCCA 2ET1A 5LK7B 2DFBA 5BNPC 1AYM3 4P9LA 2DVAA 5T3NA 1PZ7A 2R49A 2A3XA 2E7AA 2RMU3 1IPKA 2XWJB 1BMV2 2A75A 4D7SA 4PIYA 5BXXA 4ISRA 2ZHLA 5AC91 4X8NA 1C28A 5L7OC 3E97A 4MSVA 3MW2A 2PHTA 4RQPB 1SFYA 2O1QA 4CDQC 1DGWA 2XJQA 4IQPA 4OVEA 4RD7A 2GMMA 4XILA 2D5HA 4AK3A 4M01A 4LBQB 4FBFA 3M3CA 4FTSA 2X29A 5JPNB 3V0AA 5BYNA 1CJPA 2VOXA 3FLRA 5JZGC 2KM2A 3JQWA 3ZSJA 3WR0A 3TNPB 1POV0 1NY71 4OI2A 1RL3A 4MH0E 1AL22 1BYHA 1CONA 1ZBA3 1W6OB 4XOGA 4DY3A 4X6QB 2G4IA 3V65A 4E2GA 1RUJ2 4EWAA 4ASLA 2YUEA 3J4UH 2WNVA 4QPGC 3PJYA 3LGRA 1ND3C 3ZFFB 1FXZA 1WCDJ 2A5ZA 5KXBA 2P37A 1QNYA 2DCTA 1RUC3 2YV8A 4QPYA 4B8EA 2ES3A 4YVSA 4H7MA 2HWB1 1QOTA 1AHSA 3CJIC 1NYWA 5KHIA 4FOQA 2H6CA 3M3IA 2OA2A 4MXWB 2GAUA 2WFF1 1NA1B 1NCQC 5JMCA 1BJQA 4MXWA 1O91A 3I7DA 4NWVA 4LUKA 4BHPA 1Q8PA 2VPVA 1ZRDA 4KU7A 3FWEA