4QT6A

Crystal structure of the spry domain of human herc1
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
159
structure length
159
Chain Sequence
GFDPEKAQCCLVENGQILTHGSGGKGYGLASTGVTSGCYQWKFYIVKENRGNEGTCVGVSRWPVHDFNHRTTSDMWLYRAYSGNLYHNGEQTLTLSSFTQGDFITCVLDMEARTISFGKNGEEPKLAFEDVDAAELYPCVMFYSSNPGEKVKICDMQMR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Probable E3 ubiquitin-protein ligase HERC1
publication title Crystal structure of the SPRY domain of human HERC1
rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 37
structure length 159
sequence length 159
ec nomenclature ec 2.3.2.26: HECT-type E3 ubiquitin transferase.
pdb deposition date 2014-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00622 SPRY SPRY domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.920 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4qt6A00
4WVMB 4KG0A 4V1PA 3UV9A 5JIUA 4P9IA 5JI9A 2IWGB 2WL1A 4WVMA 5F6KA 2VOKA 4P9JA 2YYOA 5JIAA 2E63A 5JI7A 4N7UA 5F6LB 3ZO0B 5C33A 2YUEA 2FBEA 4B8EA 2LM3A 3KB5A 3TOJA 4N7IA 4X8NA 4B3NA 4XW3A 4P9LA 4X8PA 4QT6A
chains in the Genus database with same CATH superfamily
3VBFB 2XH6A 1ZZCA 5DQ0A 3QH7A 2O8QA 1ZX5A 3LFIA 2XKPA 2JB8A 3CF6E 2WS91 3K51A 4XFIA 5JR7B 2BZDA 1SCRA 1UOJA 2PAMA 3WD5A 5F3GA 1KS5A 3AMNA 3WW3A 1I3HA 4L2NA 2ZCWA 1IPJA 3O1TA 3SEPA 5KBFA 1HRI2 1W06A 2DFBA 3HAGA 1YXWA 1DIWA 2BWAA 2QQOA 4XF1A 1D2SA 4Y1YA 2PLV1 3I3BA 4QB6A 3TNQA 1WMEA 3GF6A 1W9TA 1BKZA 3W5MA 4XMAA 4NAMA 1QJZA 2QQJA 4QPWA 4COVA 4I2OA 1A8DA 1HJFA 5D8AC 1S0DA 2R7EB 4ITCA 1H30A 2OIIA 1W8NA 5FLHA 4Q4X2 4DEVA 4A42A 3AMPA 4WV8A 4XF0A 1V0AA 3VKOA 1ZM1A 2ARBA 4O9EA 3WNMA 2G1MA 4CCLA 1OOPA 4OUMA 3KGZA 5CFCC 4XHXA 4IEYA 1NZCA 4EWAA 4D69A 5J36A 1GZ9A 4NHXA 3OEAA 2FDFA 5FPXA 5D1IA 4RQPB 5E16A 1JOJA 4IGOA 3T2QA 2JEMA 3K75B 1HDKA 1WCQA 3E6DA 4O9GA 4D6QA 1AR62 3POGA 4BQYA 4NIAA 5ABJA 4IEOA 2A7AA 1QXPA 4JTNA 1GKBA 4YLZA 2VE1A 2Q1FA 1XB9A 2C9AA 4FOWA 3T09A 3TEWA 1X50A 4H7LA 4LHLA 4XFFA 4FT8A 3VDDB 1LESA 5T3NA 1X33A 3O0XA 5BNOA 4FPKA 3N35A 5KHJA 1KDMA 1VBE3 3RYKA 3BALA 3J7MA 1Y9MA 2YYOA 4NPRA 3NNMA 2WO2A 4QX8A 2Z2SB 3VLBB 5FZOB 1J59A 2OZ6A 4Q4W1 2F17A 4FVVA 4DZGA 5C71A 1VRH1 5JXHA 2W1UA 1CAUA 5CU1A 1GP4A 1SHWB 1LAJA 1APNA 3GBWA 1AR73 1S0FA 5CIRA 2WQZC 3JCIA 1CAWA 2WFF1 5FZMA 1LEMA 3VBRA 4DB5A 4CTEA 1E5RA 1YIFA 3V56A 3PMEA 3WQ7A 4QX5A 5GZEA 5L9RA 2ZEYA 4BOWA 1FOD1 2YG0A 4Y1VA 3RS6A 4OZXA 3V64A 4A44A 4AVTA 3USUB 3PVBB 2W1SA 1QJEA 4BXSV 1Z7S3 4HPKA 2EIEA 1W05A 5BY5A 4R9CA 4XURA 2P3IA 2GNDA 1EPWA 5LBEA 5A3LA 5L36A 4DNYA 4LO4B 5FUIA 3I4IA 4LBNA 4LIVA 2RS52 5CKQA 3SMHA 3ZYGA 4CDWC 1BEV3 2JDNA 2JDUA 2V09A 2YU1A 3WG1A 5DDJ3 4CP0A 1QJU1 3U75A 4CU9A 2ADEA 4P5YA 1VR3A 5FZ3A 1QIQA 4XUNA 2JG9B 2ENRA 1Q8OA 1XNKA 2HEVF 2IUWA 3D4KA 3MLJA 1QGLA 2XDVA 1CZVA 5DPNA 4YW1A 4KG0A 4MGKE 3V0AA 4IERA 4FP3A 1RUF1 2E51A 3GBGA 1OF3A 3POWA 3SKJE 1DDLA 5LK7B 5FPLA 5F6KA 2ZMLA 3CKHA 5FP9A 1OQEA 1S0JA 1XE7A 1YFYA 5C4WA 4BMEA 4QKBA 4EN9B 3E97A 1URXA 2JG8C 3OUIA 3PTYA 2GAUA 4AFAA 1UX7A 4AQTA 1NCRA 1RUE3 3RYPA 4DXRA 3LEGA 2P3JA 3VZNA 5CFDC 1RYYA 4LBQA 3VBSB 3I3MA 3WDWA 2VUJA 2WAAA 3UGGA 1NA1B 4IGQA 3T0AA 4YVWA 1RGSA 5IVBA 1ND3A 4FPGA 1K45A 1EV11 4QHOA 4BA6A 5EIYB 1UAIA 4GH4A 4JHZA 2PAKA 2WNVA 4L92A 2W5FA 1IS3A 4TWTA 3DEMA 3BU7A 3NJVA 3H8XA 4P08A 3MV11 3I2IA 4Q0PA 1Y7BA 2A71A 2VY0A 3FHIB 1AZDA 3OPZA 4LA2A 1SEFA 3VKFC 1O8SA 1JH5A 3ZXDA 1MS0A 1O3SA 4GJZA 2VTFA 1M06G 3TEXA 3J8F1 1RTVA 3OTFA 1VP6A 1H9PA 1ZA7A 2VOXA 3MIGA 1GNZA 4L0PA 1VBD1 2XR4A 3OPTA 4WM7C 4QPYA 3MIHA 4YVSC 4ZS3A 1LRHA 3VHOA 1PO13 4KBZA 5HXVA 4CDUB 1W6NA 4FO9A 3A0KA 2HWD1 5DAPA 4WVMB 4I01A 2KXLA 3VDCA 1ZBA1 5FZ7A 5ERLA 5F5QA 5BYNA 3BU0A 1DP0A 4HKOA 4MSVA 4N43B 2E53A 4UBHA 2Q1ZB 1NAEA 2WNUC 3ECQA 1R1A3 4HKLA 4GALA 1Q8PA 5IW0A 2R041 4BISA 1PVXA 1QJX1 3OGJA 1JMUB 3ON7A 2DCKA 4KNCA 4Q4V1 1UIKA 3PJYA 2A6YA 2R32A 3S5QA 1NCQB 1VBB3 1CPMA 2W08A 4PIZA 4XUPA 5LB6A 4IQPA 5L73A 3BPZA 3GZTB 5FOJB 4UFMA 4P5HA 1FX5A 2OPWA 3QD6A 1C8M3 5FUNA 2JDAA 1TNFA 1LNSA 1UWWA 5CADA 1OLQA 4Y22B 1O6UA 4LLFA 1PX3A 4RHV3 4ZU7A 1B35C 2P6CA 4I3GA 3JBG1 2VU9A 3OYWA 4C0HA 2EXHA 4PJYA 4B1MA 3R4SA 1PO23 2VOTA 1JHJA 5HCAA 2UURA 1QDOA 2NYYA 2WWJA 2FDHA 1K5MB 3ZN6A 1ZRIA 1BVP1 3O1SA 5C6CA 1BBT2 3GCXA 4MADA 3H3UA 1QKQA 1ULDA 5FY5A 1CQ9A 4YPJA 1WBFA 2OUJA 3U78A 1RUG3 2LROA 4LBLA 4HVQA 3DF0A 2ZBJA 5FPVA 2VW0A 4L9BA 2CWMA 2XHKA 3WNNA 5A7SA 3POEA 5BNPB 2VCBA 3NQHA 1YFUA 1HB1A 4PDWB 3ZVXA 3RGBA 1RUI2 3UK9A 2LRPA 3VBHB 3ROUA 1V6LA 4EN6B 2QNKA 3ZPYA 3IT8A 2VAUA 4AFDA 1H4GA 1BZWA 1ND2B 2ERFA 3ATGA 3GXUA 4RGAA 5FK8A 4UFLA 3U11A 4EN8B 3G7DA 2RS33 3ZO0B 1LHOA 5FXXA 4HXCA 1AR72 1VBA3 5FZLA 4AQ6A 1IKPA 1MR5A 3AYCA 3GHNA 3IAPA 1GZCA 1XU1A 3MPBA 1FXZA 2XVKA 1HIXA 4LEJA 3WP3A 3WP6A 5JMOA 1S0GA 2BUKA 2JE8A 2QE3A 3AZVA 3D8CA 5JDBA 3R0RA 4M01A 2Q8OA 3TRSB 3I2GA 1UMHA 3WG3A 2K2SA 3T3YA 1JZ4A 3ZYJB 2QZ3A 3JXSA 5BNNA 1UU4A 3RMXA 1MQTB 1WA4A 2BERA 4LUKA 3MUY1 2D6NA 4FQZA 4AI2A 4PCRA 5HV4A 4QPIB 5CAZA 1QOTA 2FDJA 2AGSA 4ARXA 5LBBA 2W87A 5FDBA 1PZ8A 2BYVE 4AR2A 5L7OB 4WM8C 4CDQA 3KF5A 2E7QA 2R0FA 1AR81 2XBO1 2HWE1 2WZR3 5IHRA 4RS5A 2WYFA 1GWLA 3LWCA 4B8EA 1X9PA 4PLOA 5LY2A 1FNYA 3WF4A 1H2MA 2GU9A 1E5HA 3IKWA 3P5BA 1R091 4CUBA 3VL8A 1S2KA 3C7OA 4AG4A 3OBZA 1C3HA 4CP9A 2Y0OA 5FP8A 2BGCA 4MV2A 5M0TA 1HN1A 1UZVA 1PNGA 1XE8A 2ZAHA 4LORA 4Q4Y1 4QU1A 2ZACA 3JB8A 4TZDA 4LHNA 4XEZA 5H9PA 4AVBA 4CU6A 3JUUA 4DO0A 3VBOA 1LB2A 3ILRA 1LGNA 2OQ6A 3AP5A 5FKCA 1V6JA 1RUJ1 2LALA 1QJY1 4C91A 1IS5A 5DUUA 5FYSA 2Q4SA 2JB4A 5LRRA 3WF2A 1W6QB 2RS13 3ZYBA 4EE2A 2QDRA 2ZOEB 1J3QA 4NHKA 2R063 4ZZ5A 3H8RA 2ZZQA 1UYYA 2YPDA 3ELNA 4LBOA 3BOWA 1JS9A 3DGTA 1ULFA 1BHGA 1FMD3 3ZR6A 1QWRA 1RITA 2BBAA 2YY1A 4PIYA 4YRDA 1K42A 1OQ1A 4W8JA 1VMJA 1MZ6A 2WBKA 3PUAA 4ASLA 2XJPA 3M3OA 4EROA 3OPWA 1UCXA 2VM9A 1HRV3 1JTZX 3NV2A 4LBKA 3LSDA 3IBMA 4CEYC 1JYVA 2X5IA 1PVC3 4FPHA 4CEWB 3U4XA 5BPXA 4MVTA 4DIQA 2G9ZA 1GQGA 2GNTA 3VDBA 2XJSA 4D0QA 3I59B 4FP2A 4E27A 4NHYA 3RMYA 1MPXA 2C6SA 1WD3A 2O8OA 1NYWA 2CSGA 4LLOA 2DU1A 3ZFEA 2WUHA 5C9AB 2X53S 1HLCA 4C1XA 1Y4WA 5B4NA 4N9HA 4IV3B 1IPSA 3LPFA 2A1XA 4OHWA 3NNLA 1HQWA 2BOJA 1UMZA 4QHBA 4Y1XA 3UJQA 4XYXA 1MS3A 3RVHA 1N1VA 4NPMA 2XL9A 2BVBA 1LKNA 1YCIA 1LGBA 3HNMA 1F5FA 4QU2A 5IAVA 3I49A 2WWUA 4XVHA 4EYUA 1H8TA 4JKKA 3ZXJA 1ZZ7A 4HSJA 1BXHA 5EXOA 3TOJA 4B4RA 4N7IA 3VBFC 4AHYA 1C8M2 4HN0A 1PGL1 1H2NA 2BU9A 4IUGA 3DKQA 1A8MA 2PELA 4IEXA 3DUIA 4D7YA 4ES9A 5J98B 2BFUL 3A23A 3ZYIB 4NIDA 1PO22 3NV1A 3AKSA 3N9OA 1S2BA 1OUXA 1CAXA 5FYBA 2JE9A 1UOFA 1RVF1 4QM8A 4IV1A 5FYZA 1YWKA 3HBKA 3IAQA 5G05L 5A3WA 3TAYA 3S7EA 5I8TA 3VD9A 3AMMA 5LK5A 4YYOA 3H1MA 3AM2A 1UF2C 1GOFA 5KXEA 4MHUA 1BYHA 2ZMKA 4MO3M 1XYNA 2VPVA 3OCPA 1BQPA 4K8FA 5FMOL 1ZBE2 2ZGMA 1ZRDA 4IEPA 1RMU3 3A22A 5EQUA 4WM7B 4CCEA 4LHKA 3ACGA 2EICA 4IESA 1KQRA 2BFUS 3PTRB 1ZRCA 4FOYA 1MS1A 4O65A 4HFSA 2BGOA 2RMU1 1VBC1 4YG0A 1XNDA 5FOBB 1EUUA 2P2KA 4PHZA 5FZAA 3HT1A 1LHNA 2Y0IA 2YPJA 3VKLA 3L2HA 1AR91 1OT5A 4XF3A 4RQPC 2PYTA 3GYDA 3HQRA 5J37A 3THTA 1VBA2 3RPQA 4E9KA 4AI0A 1PMJX 3INAA 5AFBA 1SLCA 1CWPA 1HXS2 2TNFA 1SMVA 5JXGA 2P34A 3J7HA 1U5YA 3VDDC 3FFQA 1AJKA 3FX3A 3N9QA 1WCKA 4FXKB 3K77A 1PIV3 1BVVA 1TMF3 4YNIA 4A3XA 1ODMA 2D6KA 3IIAA 2HBUA 2R1DA 1MEC3 4E2GA 5LCWL 3Q8AA 5T52A 1W8ZA 1V9U2 2OUHA 2RJLA 4L8QA 3THCA 1GZTA 2Y6JA 3MF6A 1VIWB 5D8AA 5GLWA 5FWJA 4NHLA 1J1LA 3ENRA 3I3DA 2WA3A 4YSFA 1G8WA 3M3CA 4O7XA 5JLVA 3O1VA 4AXOA 1NE6A 2B39A 4IE7A 5FPZA 5CFCA 4C90A 5JVVA 4DY5A 1O4TA 1HRI3 4CU8A 4RR3B 4XDPA 4UFHA 4CCDA 3PHMA 4CRQA 1DHKB 1YLLA 5IYYA 4AGRA 4CCOA 5H9RA 3TNPB 3HWJA 1IS6A 3QCWA 4P9IA 2QJVA 3VDAA 3FL7A 3JD71 2OW4A 5A1AA 2ZHMA 3H8UA 4GB32 3CNAA 4Q4X3 1D0HA 1GMMA 4RFRB 5DXDA 3WW1A 4M4PA 2V4AA 5A33A 1D4VB 5DAWA 1LOEA 2PHXA 2EIGA 1ZNPA 3EYPA 3T1LA 1OQDA 3U0ZA 4FSJA 1GNHA 3MW2A 3KM5A 4UW6A 2RDNA 2JG9C 4EN0A 5DUXA 1TQ5A 2HWC1 4YM1A 5FAXA 2VMEA 1AR63 4QX1A 1WW5A 1EAH2 1KD7A 4XZUG 3SH3A 1WLDA 2X10A 3ZMNA 3W21A 1S0IA 1V6KA 3GHMA 2VZPA 2LW8A 3T4VA 1OOPB 1SPPA 3HIFA 3ZIXA 2IVJA 4YG3A 3WDTA 4LKEA 2IXJA 1HKDA 1US2A 4GAZA 1HRV2 2ZX3A 3DPRB 1ENRA 1XXNA 1LHWA 3H42B 2QQVA 1W9FA 1UZWA 4P14A 3RQ0A 5C70A 2IC1A 1JZ6A 1PVC2 5GJ6A 3JB4C 1RUH3 3VBSC 5LZ6A 4QXCA 1AL0G 2RR12 4PLMA 1GFF2 5FPBA 1NA1C 3UYJA 4OHYA 5FO7B 4LUMA 3AJZA 2IFRA 4GXLA 3BTXA 3MIFA 4KH9A 3ZXAC 5FZ0A 3FN9A 1W9WA 5DUWA 1COV3 2V4VA 4KMQA 2VD7A 5LATA 2W9XA 1W6MA 3OUJA 4CDWA 2QBXA 2HYKA 4FQ4A 2CHHA 2ADDA 1PK6B 2W39A 4GD4A 4Q0VA 3HMYA 4UAPA 3BOPA 4JDOA 1RUOA 4JRAA 3VBUB 2JDHA 3WHUA 2YFZA 1VALA 3NV4A 5F6LB 1RJ8A 2HWB2 3RG0A 2OVUA 2WT2A 5FRAA 3I2OA 3TB0A 5FFOC 4N9IA 2GMPA 1NUKA 1WLWA 3U14A 4CDUC 3RZGA 1J83A 1UXXX 3GM8A 1DF0A 2MEV1 2RS53 4OULA 3C7FA 2G19A 1QXJA 1WMXA 4F7ZA 4YZ2A 3DN7A 4N43C 3MFAA 1K12A 2WZEA 4JGZA 5CFDA 4QDRA 3TEYA 4XZPA 5LA9A 2ZAAA 4D6SA 4HPKB 1EP0A 3ZIWA 5IK4A 4F8AA 1W0NA 3U4SA 3VHNA 2PHWA 2WLPA 3I3QA 1ZZ6A 4D8MA 4W6XA 2ZTNA 1WWYA 2VZOA 1POV3 2ZPXA 3VZJA 4FTEA 5FP3A 4AEMA 5C7GA 1NCQC 2C0ZA 5EPAA 5FYIA 3ZSLA 5GZGA 2DTYA 2YC2A 3NJXA 3LA3A 5ANNA 2LS6A 3BB6A 4CCKA 4FTSA 4HOOA 1WKYA 3LGRA 2QQLA 4KL1A 3EB7A 1RMU2 2C9KA 3GBFA 3TYJA 3VZLA 1WW6A 1CPNA 1HQNA 1W99A 1FV2A 5AFEA 4S2DA 3PUIA 2D5HA 1AX2A 5FQ0B 3ZR5A 4YZ5A 2AZ5A 3Q8FA 4QX2A 1VMFA 1F9KA 1OD5A 1S0EA 4GULA 5T50A 3H8OA 4D94A 3PU3A 3KT7A 4YVSA 2ARAA 4UF0A 2IVIB 4N53B 1OPMA 3ALQA 4M3CE 4ISRA 2VCCA 3ASIA 4FFGA 1C57A 5DG1A 4QX7A 3LQCA 4KGQA 2J1UA 4HG6B 2DBNA 2OZJA 4NN0A 1UKRA 5KHHA 4EV0A 4JZRA 3C7EA 1PGW2 3MW4A 2WQ4A 1KDKA 4Y5SA 5I8SA 1YJKA 2WNUA 3WDYA 3NNJA 4YVWB 5BNPC 4FBFA 1YQ5A 3KS7A 3G6JB 3LF7A 1RL3A 1ULPA 5LA0A 4PDWC 1BMV1 5FWEA 3UNPA 3N7MA 1W2OA 4UFIA 3RZLA 1PIV2 3MIEA 4PF1A 3VBHC 2R072 3AVRA 4X6QB 1N3QA 1JBCA 4GQ7A 4JKLA 4D7TA 2GH8A 1MEC2 3VL9A 4C0BA 1ND2C 3OF1A 3WDXA 1FAYA 3IDBB 1U5XA 2GALA 1RUD2 1J1TA 4LK7A 4Y4YA 5A3NA 4A7YA 4P00B 1VBE1 2Q5TA 4J1WA 1VB2A 1LOBA 4QGMA 3TN91 3BTYA 2K0GA 1V6MA 3DCQA 2OX0A 1B35A 2A5ZA 4K9SA 3UL2A 4XFHA 3LA2A 2DUOA 1TEIA 4UI9L 1Q43A 3SH4A 3OOXA 5FBZA 1XNCA 4MHRA 4Y4RA 3GZEA 4R4XA 2ZA9A 4OUSA 3NMBA 3BIEA 2BDRA 2A6ZA 1MQTC 1LOCA 2VBPA 1JI6A 4A7KA 3O5SA 1GU3A 1V6OA 4XBNA 4XFAA 1H9WA 4QPIC 5EYXA 2NLRA 4KBBA 3WUCA 4BE3A 4YG6A 3I97A 3LOBA 5C3PA 3VB9A 5L7OC 2Y33A 4L99A 2JWPA 3HQUA 1LEDA 1DGWA 1JW6A 3BN6A 3POJA 4GKXA 4O61A 5A32B 3USSA 4AL9A 2W1QA 1Z7S1 1NZIA 2W2IA 4NIIA 5F8PA 2AYHA 4Q0SA 5HI0A 3TBDA 1RHI1 3CQOA 5C3SA 1BBT3 1DYPA 5FP4A 1SCSA 4ES8A 5F3CA 2QZ2A 5A7QA 2VVEA 3IPVB 1IG0A 2KR2A 4OVEA 4MGQA 2RV9A 4Q2FA 1NXMA 2IXCA 4BPZA 1LOFC 1BEV1 1W0PA 3HR9A 1F5JA 2B7YA 2Z79A 5DDJ1 4R9AA 3ZDSA 4YZ3A 2G9FA 3M3IA 4L97A 4FFFA 1SFYA 1AYM1 3ZXEA 3FC0A 1OKQA 3DECA 2RJ2A 4JDMA 1BJQA 2ATFA 4QKNA 4QGNA 1RUI3 2Z69A 1OLME 1QJFA 3N9LA 1HB3A 4YGCA 2D97A 1XYOA 5IUQA 3BCWA 2Y6LA 1RUH2 2D6PA 2JJ6A 4S2FA 3DV8A 5FLJA 1S0BA 1LGCA 2E33A 3LCPA 5DABA 2R30A 3TWIA 3KV6A 4GWNA 5FYVA 4YW2A 2NM1A 5LW9A 3APBA 2P17A 1JN2P 3GGLA 3CZJA 5CVRA 1RUE1 1QHDA 1COV2 1VMHA 2VZSA 4LPLA 4RD7A 4WM8A 2GC3A 1HB4A 3OY8A 4ATEA 4XFGA 2J42A 3IZOA 4MXVA 1H2KA 4CZSA 1NY72 1ASJ1 1YI9A 2VW1A 1KJRA 4ZONA 5SV5A 4NIHA 1A78A 3LE0A 5FJHA 4MG2A 4G4FA 2ET1A 4AVCA 4CEWC 2PHFA 4HSLA 2XQRA 3RJRA 4A6OA 4Z8BA 5A7WA 2FDIA 1DG6A 1DGRN 1OSGA 3ZKYA 4CE8A 5ISLA 1FV3A 2TEPA 2VMDA 1ZRFA 2KM2A 3RYRA 2X29A 3THDA 2ZEWA 1HN0A 2CAUA 2W68A 4GWMA 5C9AC 4FAHA 1PO11 1UY0A 2XUMA 3B93A 3IDEA 2ZABA 3POYA 4JVAA 4C8DA 2EIDA 2RHPA 4IEZA 4IV3C 1GZWA 2QVSB 4GMP3 4QD2A 2EALA 4XDQA 1PHMA 4A6SA 4FCAA 2UYAA 3GZAA 3CDZB 4JQRA 5C8CB 4NE9A 1Y43B 3B69A 4FPOB 5FUPA 4LBJA 1R1A1 3VN4A 1ZA4A 2GMEA 4HANA 3SKVA 3WG2A 4AZZA 2JIJA 1XSQA 4I0WB 4URAA 3PIGA 4QXHA 1RB8G 4BJ0A 1N1YA 1R64A 4MLOA 1O59A 1O7FA 4AE2A 5JXIA 3H9AA 1RUC3 2JE7A 3NKTA 1STMA 5K0UB 3ZFFB 3VD4A 1VBB1 3LEKA 1NE4A 4CEYA 4SLIA 1JXNA 1LTEA 4ZZ8A 1GANA 2FD8A 1C8M1 1BK1A 4YFWA 5HXMA 2BTVC 2VNGA 4LKSA 4YM2A 2WT1A 5KHKA 3M8LA 1DFQA 1XOYA 2WWSA 4RHV1 4AQSA 3O1UA 2H0BA 1R082 1JYXA 5A7PA 3BTZA 1SLTA 1CAVB 5J09A 4META 4OQ8A 1PO21 3CJIB 2LTNA 5FZKA 3NKGA 2DV9A 2VOWA 4K1YA 3T1MA 2UWAA 2E31A 3BVCA 1LCLA 2AACA 3VZMA 5F9TA 1X9TA 2VUDA 3PUQA 4XF4A 1PM7A 1RUG1 3WP5A 1QQP2 1S0CA 2ET7A 4XW3A 4ZXKA 1LOGA 5I0TA 5FZHA 2NMOA 4XETA 3AKTA 5ACA2 4JGYC 1ZZ9A 2JKBA 3K46A 3VBFA 3GJBA 1QH6A 3OGVA 2B4KA 1VRBA 1JZ8A 4Y1ZA 5FZ9A 2JX9A 3MICA 3KMHA 3R4UA 4CSWA 2CYFA 4XTPA 3AFKA 3T08A 5A3MA 5J7MA 2HBTA 2VQTA 1D4M2 2RS31 1UMIA 1I5ZA 1GWKA 1NLSA 1VLNA 3AC0A 4H2AA 5AC92 4Y3OA 1XE0A 4AFCA 1ALYA 3DXTA 1QNWA 5KXDA 4QXKA 1X36A 1SG3A 2A75A 3W20A 1GNYA 2XMLA 5FO9B 4EQVA 2W46A 1AL21 2V5YA 3ZFGC 4CDXA 4QGLA 1UW8A 3RFRA 5CNAA 4IETA 1AXZA 1PGSA 2O14A 5C3OA 2EXIA 3RDIA 5IK5A 3MIBA 2P4EA 5LEJA 4XACA 5H9QA 3PL0A 1I1EA 2GDFA 2ARCA 1ULGA 5DZGA 2AREA 2HWF2 3ZMOA 1TME1 4MOAA 4LTAA 5LEKA 1UQXA 4P9GA 3ORJA 1WMDA 4RR3C 5EJ1B 3Q8BA 3OGSA 1POQA 4YW4A 2WZR1 2BW8A 1G6NA 4XPVA 2DUQA 4H55A 4RQPA 1DQ5A 1O91A 2VVFA 3VD3A 1QDCA 3JQXA 4P9LA 3WZ1A 4FPLA 1IHMA 1DQ2A 1ZBE3 1E5IA 1X8EA 3AMQA 5IJRA 1JHNA 2CNAA 4OZOA 2Y6GA 1JZ7A 5TSWA 3VDDA 2B45X 1NLRA 3RZJA 3O14A 2J22A 1MZFA 4AYUA 3B5LB 3C8XA 2Q8EA 2VCAA 3R05A 2QQMA 3VHRA 4XILA 3EHKA 3OGRA 1G9CA 3BI3A 1IOAA 1LJ7A 3L9JT 4W65A 3LEIA 2DU0A 5GLZA 2VZQA 2JDMA 4ORFA 4QWNA 5JOYA 5FZOA 1W6OB 3I54A 2C5DA 5JZGB 3WINE 3W9AA 4MGTA 3UKTA 4LT5A 1YQ2A 2QQIA 1HXS3 5JOWA 2WS92 2RS11 2XLFA 3FLRA 1OOPC 2R061 5D21A 3KT4A 1H1AA 3T2PA 5FYHA 4Y20B 1W6PB 2IXIA 2VJXA 2WC2A 5JI9A 3HQXA 5T55A 3DPRC 5BUVA 5FZ8A 1UL9A 2YB7A 3OD0A 5FZ6A 3E5XA 1FMD1 1QOOA 1XQNA 2OXBA 5JR2A 3USUA 2BOIA 2WDBA 4Q4V3 1UYPA 3QACA 2XJTA 1V9U3 3NV3A 5HCBA 2PLV2 1ZREA 5A3PA 1YI7A 4M3CF 4QQPA 1D0GA 1HRV1 5F2WA 5CG8A 5A70A 3IM0A 3UT0A 2DTWA 1PVC1 2BBVA 4COZA 2GN3A 1EYBA 1CESA 4PI2A 3EBRA 4M3CB 1UN1A 2WNEA 1Q56A 1WUVA 2Y6HA 3P6BA 1WA6X 4BHPA 5T5PA 2GNBA 2CL2A 2JD9A 2I45A 1PK6C 2JG9A 1DZRA 1F35A 3WVJA 5G04L 3PIJA 3VBUC 4Q8KA 3CJXA 1C8NA 4LQRA 1UPIA 4CUGA 1DQ1A 1B09A 3AYEA 3AXDA 3ACLA 4HONA 1ULEA 3WP4A 2VTXA 1R1ZA 4G9SB 1H1IA 4AVAA 4GB33 1SFNA 5FK7A 1RUC2 1GSLA 3H1WA 4JHTA 3H7YA 4QPGB 2IXHA 2JDZA 3GZUC 5JPMB 4WBBA 3K4ZA 3BPSA 3N3HA 2BJSA 2BNMA 2NQYA 4I0BA 2HYXA 1BLZA 3PUHA 1TVGA 5JOXA 2PN5A 3VBSA 2PQQA 2VL4A 2YC0A 4N8MA 1PM4A 4BU2A 1T6BX 1U0AA 1NA1A 3NWKA 4FPJA 4XF9A 5K4LA 5L9BA 3J7LA 1EAH3 1HB2A 4XBLA 3RRDA 1ZYBA 1GP5A 1YQ8A 2BGPA 2PHRA 2L9LA 3SC7X 3IN9A 4AI8A 4CPBA 5A33B 3D82A 4Q4W2 3AVSA 4XQDA 3DYPA 1VRH2 1XNBA 1AYN3 1O5UA 4P9JA 4QQHA 3RZMA 1EY2A 3NAPB 3IDAA 1ACCA 5IVEA 2WFF2 1XPWA 1DZTA 2FMYA 2XJUA 2RR13 2AUYA 4Z82A 1OH3A 1FOD2 5FMCA 2W94A 2BPA2 5B2GB 3NJZA 4FFHA 2PTMA 1SFPA 5C4WC 1UPSA 1OI6A 1WZXA 2TBVA 4IL7A 1W3VA 4N53C 4CDUA 4KQ7A 4GZ9A 3ZPOA 4A2UA 3MGUA 1ULOA 2XJQA 3VHPA 1ENSA 1W90A 4UW4A 1V70A 4FI9A 2XJRA 2Q8DA 3QBQA 1HX6A 4N43A 2DYCA 4QX0A 3CO2A 4YVWC 2VO5A 2MHFA 2AR6A 5EYYA 1UY3A 1QJU2 1W3XA 1N1TA 4I02A 2OQ7A 1H1MA 4MGYE 2DCTA 2FQPA 1EPZA 1UX6A 4HVRA 3ZSEA 1W2UA 1R093 4OI0A 1QNYA 3POBA 3WF1A 2HWB3 2DCZA 4LXLA 3IMMA 2CTVA 1NCQA 5FKBA 4ZHNA 5EJ3A 1JZ3A 1VB4A 2B42B 2BRTA 1LHVA 1TMF1 5APAA 2YHJA 2ZHNA 4MGSA 4Y22A 2Y26A 2PA7A 4A4AA 4NHMA 2AEZA 4MXWB 4URTA 5HCFA 1Q8VA 5KHIA 4HBNA 4MH0E 3ES4A 5AVPA 3W5NA 3O7OA 1QU0A 2JENA 2PHDA 1S1AA 1UNBA 2DCJA 1K5MA 2RM23 2ZGPA 3VGIA 1EV12 1N3OA 2GH2A 2MNGA 3HBZA 4JGZB 4AWDA 3OJBA 5FZ4A 2DVAA 1F4AA 2E6VA 4UOJA 3RJ2X 1NX9A 1BK0A 2DVBA 4BQWA 2WKKA 1HRI1 4Q8LA 5F39A 5BNPA 2ZX2A 3N4MA 2YU2A 3I2HA 4JX0A 2BEOA 3MO4A 4PDWA 4AHZA 1UYXA 4IXLA 3VBHA 5KC5A 3OBRA 3LIHA 3J8F2 4JGYB 1H6YA 2D6OX 5GZFA 5L9VA 2W3JA 1VBD2 1W03A 2XKOA 1OH4A 3H1YA 5FZDA 3URFA 4Q4X1 1CIYA 3KV4A 3HVDA 1ND2A 5BNQA 3KQ4B 3GALA 3THPA 3ZXGA 3SCHA 2XXZA 5FYTA 3LFMA 2HWD2 4ZY9A 3V0BB 2LM3A 4LNVA 1ODNA 3BTAA 1UZ0A 1ZBA2 4HVOA 1W8TA 2PFWA 5FREA 5JSRA 5BV6A 2EF6A 2J1VA 2UYBA 3T2TA 5FZCA 1AR61 1IG3A 3NJYA 1MS4A 3ZXFA 2R042 1DCSA 3ILFA 3BKZA 3UGHA 1QJX2 4FFIA 2R073 2R49A 1LOAA 5A3UA 5CBLA 4XXAA 5JCTA 5HBAA 5KXCA 1FT9A 2VULA 3M4FA 2YFUA 2F4PA 5I91A 4AEDB 4QDSA 4QQLA 4ZXEA 3VZOA 4Q4V2 3ZFGB 1GQPA 1HV0A 1JZ5A 3P3PA 1WCDJ 1MQTA 4XJZA 2W92A 1FI2A 3PUSA 1KFUL 5HV0A 1RUD3 3ZYRA 4IGPA 4KWKA 1YJLA 5F1RA 4OI2A 1C5IA 4QPIA 3I2JA 4RSUA 3WNPA 3N9PA 1VAVA 4B4QA 4DXZA 4JV4A 1RUH1 5L7OA 4GA9A 1AUYA 2O0OA 2QCSB 3IWZA 2UWBA 4K7JA 2VCMA 2ZGUA 3M3EA 4TN7A 1DLLA 1IPKA 3N9NA 4DPNA 3U37A 4RN5A 5FO8B 5E6HA 2GC0A 4KU7A 4QX3A 3OEBA 2Z5WA 4BWOA 4AAXA 3RZZA 1COV1 4LO6B 5CB7A 2D40A 2VQAA 1IKQA 5KXBA 4QXBA 4WZFA 1RVF3 4LKDA 2Y38A 1LOFA 2VVDA 4ONUA 1J58A 1CJDA 4TYSA 4XCBA 1ST8A 1MS5A 2BP6A 1NY71 4K1ZA 4DS0A 4DXTA 4DXSA 4COYA 2UY8A 1WW4A 1WGPA 1V6NA 4MZUA 1OHFA 2DVFA 2X8KA 3KWVA 2ZKNA 2ILMA 1OMIA 4MUVA 3O12A 3SNMA 5FZEA 3GNEA 4NWVA 1W8WA 3L2YA 3S6PA 4JC1A 3UJOA 1REDA 1V6IA 5JXJA 3C3VA 2OA2A 2D6LX 2RS51 4S2HA 1CN1A 3WXPA 4QKFA 4QDQA 1Y3TA 1L7QA 2D3SA 4IE5A 4UYBA 5C8CC 4P9WA 4NIGA 3N7JA 4PBOA 2RDSA 1AYN2 4HL0A 4RS5C 2QTWB 1NQDA 3DL3A 5EJZB 1REEA 3NNFA 2WN3A 4XIKA 4CPBD 3P1IA 1AJOA 1UIJA 3M7AA 5LBFA 1PZ7A 4EN7B 2E32A 5EHDA 5KHGA 2XHNA 3A4UA 1SLLA 2AEYA 2YXSA 4AEKA 5ABJB 3WCRA 5K0UC 4ZPIA 3ZFFC 4BQ5A 4Z1VA 4TLGA 1U5IA 2WABA 4OI1A 3KB5A 4FPEA 4CEWA 2PAEA 4HZFA 2CV6A 2IXLA 1LU1A 2R16A 2G4IA 2Y64A 2XQXA 2UY9A 2Y6FA 3H3LA 5BNOB 3I59A 3FBMA 5FY0A 2QKDA 2QQNA 4U2AA 2VZVA 4PQQA 4HK9A 2XOMA 1PNFA 2D98A 3CJIC 3FWEA 5C9AA 1AR82 2XBO2 2HWE2 2P5BA 5EP9A 4LO5B 1DZQA 4IV3A 4E8DA 1CAUB 3S30A 1R092 1CAWB 2ZGKA 1TZOA 2FBEA 2LUWA 2XLAA 3AZYA 3B02A 3RI8A 2RVAA 3VBRB 3E6CC 1AHSA 2VZ3A 2HH9A 3N7LA 4RYDA 4NVPA 1O5LA 2ID4A 4E8CA 2ZGLA 2JG8A 1H6XA 2OYZA 2QQWA 4K6BA 2WA4A 3ETQA 1W2TA 4XJUA 5JMCA 5IVYA 2WT0A 3B9CA 3UKNA 3J9SA 5FYUA 4KWLA 1J84A 1RUJ2 4I09A 1QJY2 4GKYA 5F37A 1FYUA 2RM22 5E88A 2PHTA 2ZJCA 1ZRRA 4FPFA 2HWC3 2YUEA 5IVJA 5CKMA 3BUCA 3A0NA 1IGOA 4K40A 5DAVA 2Y34A 3KSCA 3P3NA 4HT1T 2W0XA 3V0AB 1JYIA 1F4HA 1E57A 1MS9A 2ORZA 4JDNA 3DXUA 4HKWA 4OMCA 3NW4A 2ZGNA 4Q26A 1T6GC 1DU3D 4WM7A 3S7IA 4BLJA 1W8HA 2DFCA 5JWPA 1M4WA 5C4WB 4J25A 5I8YA 1IS4A 4XABA 3AZZA 1EUTA 2D93A 3HT2A 1NCRB 1R083 5F3EA 4EWDA 5I0UA 2WFPA 5FYCA 4BK5A 4CP1A 4YFZA 2AENA 3N36A 4LBQB 2W91A 3WOGA 4QKDA 1LHUA 1WLTA 5C3QA 4DOUA 5FR3A 4Z92B 4NR1A 5K7PA 1OXCA 1SDWA 2WQ8A 1ND3B 2RG4A 1BBT1 2WRAA 4AFMA 4X8NA 3H50A 4GH4B 4DRRA 1A3KA 1W8FA 2WNVB 3WNLA 4OMDA 4IV1C 3FZ3A 1QQP3 4YM0A 1OFSA 4DFSA 2VMIA 2XONA 2GP5A 2Q0AA 4KGGA 2NP0A 1VJ2A 3AKPA 5E89A 1LENA 3RI9A 5GALA 2IFWA 5KC6A 5ACA3 4COWA 1KFXL 4ATFA 2FDGA 1RUI1 3T0DA 1TNRA 2F4LA 2C1FA 2H6BA 3QLQA 4PF5A 1W9SA 1MACA 4MGIE 1SBEA 5JI7A 2Y60A 2JXAA 4D6RA 3AK0A 2B5HA 4R9DA 1PGL2 3AP4A 2EAKA 3MHZA 5JZGC 5F5IA 3MI8A 5FZ1A 2IZWA 5LWBA 4GWJA 3RSJA 4XFCA 3F95A 1ONAA 1W6NB 2W1WA 4UXAA 1D4M3 2A3YA 4BIFA 2GC2A 1AR71 1DBNA 1GUIA 1QMJA 3IMNA 1RXGA 5AC93 4DEQA 1NT0A 4RR3A 4BQXA 1RVF2 3ES1A 4W6WA 2BNNA 3B9IA 5A3TA 1U12A 4ET7A 3LD8A 2WJSA 5I93A 5HPOA 4TXWA 5IK8A 5CZKA 3MLLA 3D0JA 1WBLA 1IQDC 1XBFA 1GV9A 2W52A 3ETPA 2FZ1A 2JD4A 2YDEA 5LASA 5K8SA 2DVGA 3AKRA 3EO6A 3MLKA 5FY1A 2SBAA 1MVEA 2XPJA 2HWF3 4XDOA 1FPN3 2JDKA 2CDOA 1G9BA 3S57A 1O4ZA 3OD4A 2OKXA 1LULA 3JQWA 3PLQA 4NJ4A 4BLIA 5JSPA 1SLIA 4JKMA 1F2NA 5SV8A 4CDXB 4OHXA 2RMU2 1Q8SA 1VBC2 2JDPA 4GMP0 4B7EA 3N7KA 4W6YA 3OYWB 1XU2A 4LULA 4RA0A 2VH9A 1AR92 5J96B 2XGXA 1DQ4A 1DYOA 3KVBA 4OI4A 4OCTA 5HCHA 2EVXA 4GMP1 4QAWA 1Q8QA 3O1PA 3ZN6B 1K5JA 5E8AA 1OUSA 4QPGC 5K9YA 1FATA 2CGNA 4MYEA 1S55A 3DPRA 1S2EA 4RFT0 2PQSA 1MZ5A 2QDNA 3RZKA 4LK6A 3CBNA 4LMFA 4CCMA 3I3EA 3LB9A 3HJRA 1JYCA 1OFNA 1X7NA 1H0BA 2A6VA 2ZGRA 1RUC1 2AH2A 4KG8A 4AI9A 1YO8A 2FDKA 4Q1PA 4YW5A 1BCXA 3NNGA 1OPOA 2WZ8A 3ILNA 4M0HA 3WF3A 5H9SA 4AOCA 4Y26A 3O1RA 3MZHA 2WS93 2A3XA 3I2DA 4YARA 5IT6A 3OGGA 4QQOA 2B8MA 4E4SA 3TN93 2YGLA 2MPFA 4EWEA 3NAPC 3ZLIA 1YFWA 4PIXA 3S5AA 1UO9A 2VZTA 1PK6A 4WVZA 3SCFA 5FXVA 3I2FA 4Y24A 1DGWX 4DUXA 2FCVA 3FUOA 4DRVA 3VBUA 2C26A 3KF3A 5FPAA 2PLV3 1OA2A 1W2AX 3SHRA 4BDVB 1W2NA 3C2UA 5CA6A 2XG3A 4QM9A 1Y9GA 3VKMA 3RWNA 1QOSA 5BNNB 3J26N 3JD72 4N90A 3PJQA 1OC1A 4KI5M 1REFA 1HJGA 5F5CA 4LOTA 1AXYA 1DGRA 1YFXA 1YNAA 3I2KA 4IEQA 5LA1A 2VQ0A 3EXUA 3FFZA 4M0NA 3SQOA 3VKNA 3WLUA 3AFGA 4CDQB 4TTGA 1RHI3 4F3JA 3AYDA 4RS5B 4A3ZA 1UU6A 4NWWA 2HWC2 1UZZA 3AZWA 4N7UA 2PMWB 3PVOA 2A70A 1C1FA 3WCSA 4AF9A 2DBIA 5CISA 1AX1A 4R9BA 5T5LA 2QQKA 3RZHA 2DDUA 5EFUA 4CP9B 2R1BA 2VMHA 5FZFA 1OA3A 3ABZA 4UW3A 1CONA 1SLBA 1AYM3 2WZPP 2EXJA 1W04A 2ARXA 2XL7A 2UU8A 3A7QA 3FLTA 2JIGA 2D6MA 4CUAA 5FQ0A 3WQBA 4QMAA 5JIUA 1D7PM 3JU9A 1UD1A 4CCJA 2NZ9A 2EXKA 4CVUA 4IEVA 2VNVA 1G86A 4R8HA 4XUOA 4E4ZA 3ME2A 3VBOB 1KGYA 3MBWA 1PX4A 2XWBB 4KWJA 4NRQA 5A1LA 2YC4A 4N53A 2RJKA 4Q4W3 5JIAA 1GQHA 1VRH3 2VZUA 2I74A 2OT7A 3WG4A 3KGLA 4OLLA 4U36A 1KEXA 4NROA 5A1FA 5C33A 4XAEA 5F7UA 4JGZC 1J3RA 2VC9A 2J1EA 4NRMA 4PBPA 4QB1A 3WDUA 4A7ZA 1C4RA 1US3A 2WFF3 4BQ2A 2DVDA 3E1F1 4ZU5A 3C7GA 1JYWA 3HEIA 4B3NA 4AEJA 1VE0A 3NO8A 4NUBA 4A45A 2XUEA 5CYYA 4INDA 1ASJ3 3E5UA 3LPGA 5C8WA 1FOD3 1RIRA 4E4HA 5JAXA 3NVCA 5D2AA 4HN1A 5GLUA 5EWSA 4OHVA 1Z0HA 1NG0A 1ZBE1 1FNZA 2WR9A 2YMZA 3LDKA 1PMIA 3OSDA 1W39A 2FHRA 3D6EA 3LKJA 4ZS2A 5A3OA 1ENXA 4CYDA 2X5IB 3OB8A 4GIQA 1CIWA 4AW7A 4YW6A 2A6XA 5JPNB 4PQ9A 2MEV2 3ZXKA 2EA7A 4Z2WA 1LU2A 1QJU3 3C7HA 4Y1UA 1RXFA 4IDZA 2WAOA 3I8TA 1VBA1 4HETA 1KITA 2ZGQA 2YGMA 5IWFA 2D3PA 3ZFEB 4YGEA 2VUCA 3PNAA 1HXS1 1RUF3 3KV5A 3MFCA 4UFKA 1OVSA 4ASKA 3WNKA 4AEDC 3UKVA 3AMHA 2ZX0A 3LA7A 3U10A 4CCCA 4RL7A 5I0DA 3SISA 3WV6A 4B4PA 1X82A 2WYSA 2Z4FA 4UBGA 3POFA 1MS8A 3X29B 3ZKUA 4LR4A 5EZWA 3LZZA 5FV3A 3AXEA 1GBGA 2YBKA 1Q5OA 1NXD1 1SQ4A 3KCCA 5FYYA 3WW2A 3WNOA 1JODA 1H8TB 5DUVA 1V00A 1E5SA 3BODA 4XQ4A 4YZ4A 3NSTA 4NOTA 5AVAA 1GP6A 5A32A 1V9U1 1FPN2 2O1QA 4CXXA 1LODA 3CMGA 1NOVA 2QFEA 3NRUA 4BCUA 4CCNA 2JKXA 1EV13 4XCAA 4W50A 5FXWA 3MUZ1 3PU8A 5A80A 2D43A 4X8PA 3IPVA 1YUDA 2BV4A 5IATA 3AKQA 3HN1A 2YZ4A 2WO1A 3DYOA 4H3WA 1C1LA 2D3RA 3KVAA 1O3QA 2YBPA 2OPKA 1ENQA 1OD3A 1YC61 2HJIA 3LDBA 1CAXB 2NPIA 3CIHA 5DZEA 2FZ2A 4IV1B 1UYZA 3D0SA 1J3PA 4XJ8A 4COUA 3OG2A 3WUDA 2F6BA 1W28A 3J8F3 3CU7A 1BMV2 4A41A 4G3YC 1VBD3 2ZX1A 4YGDA 2J1TA 2RDRA 1RUNA 4GB31 4IEWA 1UY1A 3HNBM 3CLPA 4P9XA 4BQ1A 4LO8A 2WSUA 2FCTA 1H2LA 1G9DA 4L11A 3BYWA 1UKGA 2HWD3 4XUTA 5GM0A 2YROA 4D7SA 2J1AA 1AF9A 1ZBA3 1JZ2A 1SDDB 1KXGA 1VBE2 2SLIA 2E7TA 3TN92 4YWAA 4NPLA 1EAH1 2V5DA 1JYTA 2R043 3MW3A 3LAGA 2NN8A 1QJX3 1O8PA 2XLGA 3J4UH 4IE6A 5FYMA 3VZKA 3M1HA 5FXZA 5ABJC 1CJPA 4LITA 2Y8KA 1AYN1 1NLQA 1ULCA 2C24A 1CR7A 2ZGOA 4R52A 5FZGA 3ZSMA 3JZVA 2DURA 2Z42A 3D3AA 4DINB 2VECA 1GLHA 4IW3A 5FBJA 5FLIA 4S2GA 4Z2AA 5A6QA 5BNOC 1OVPA 3GJAA 3K48A 4K20A 4UFJA 3R4DB 2RR11 1AL23 4MGZE 1WD4A 1CX1A 2D7FA 1WW7A 4EJRA 4OYUA 3WNXA 1GWMA 3JBG3 3ACHA 3R6SA 4XQWA 3ITQA 4ASMB 4EZ4A 5DMYA 5F32A 3EJKA 1OF4A 5D8AB 1Z7S2 5FZBA 5ANQA 3LDRA 4IE4A 1RHI2 3ZM8A 2XVLA 1TME3 3O1MA 5A7OA 1ZVFA 3KCYA 5KR7A 3O1OA 3AYAA 4XOGA 2E63A 4TSVA 5C8CA 3VBRC 4PLNA 1P8JA 3ZXLA 3ZX7A 2DF7A 1BEV2 3AL5A 2BVVA 2ZHKA 1S4CA 3B01A 5CFCB 2W95A 3FJSA 5DDJ2 4BH9A 3B3QE 4R4ZA 2ZMNA 3B00A 4BM8A 4H7MA 1QY4A 4CXWA 1AYM2 4LBMA 1NQJA 3UGFA 4AHWA 2HWB1 2CAVA 4W4ZA 5EV7A 3T4HB 4P9YA 5K0UA 3SEEA 4BMBA 3ZFFA 3T30A 2IXKA 1KS4A 5FY9A 3SH5A 4Y5Z0 5FY7A 4JQTA 2CGPA 4F83A 1I6XA 1UU5A 1GOHA 5LA2A 4RGGA 1WCUA 5I0RA 2DWRA 4YGBA 4K3UA 1QXRA 2VMFA 5LY1A 1CVNA 1RUE2 1I9RA 5KWRA 1C5HA 3KT1A 1CAVA 3E5QA 3HPNA 5LBCA 3WEZA 3CJIA 4Q0QA 2QQUA 4YW3A 4UT5A 5C5TA 2ETEA 1OLRA 2RM21 2I2SA 2UWCA 4WVVA 4LBQD 2ZX4A 4CUCA 4X6RB 5DN2A 1ASJ2 3MF9A 3RWKX 3OBTA 3T0BA 3OBAA 2GC1A 1SPPB 4ISQA 3WR0A 1PZ9A 2VTXJ 3ZOIA 4AHXA 1MVQA 5A6YA 1RMU1 1H8VA 4KU8A 2CDPA 1W9YA 1QF3A 1OBNA 1VAMA 5F3IA 1W0OA 3WY6A 4LO7A 2JDYA 1NCRC 2K46A 3POIA 4JTOA 3EMRA 1GICA 4I3PA 2WN2A 4WVMA 4WZCA 4I30A 2WINB 4QB2A 3DKWA 1AR83 4OQ9A 2XBO3 2HWE3 1ND3C 1IQAA 4PI0A 2VOVA 2VR4A 3K3OA 5FTTC 3FMGA 3PURA 4GH4C 1PO12 4QQ2A 2WNVC 4B7KA 1YHFA 3ZYFA 3UETA 4ARYA 2RDQA 1YQCA 1PGW1 1W6MB 5T5OA 4XC9A 2Q30A 3HD8B 1RUF2 2D5FA 3ZYPA 3KV9A 4CDWB 1U5ZA 5IAXA 1I5PA 1HQLA 1UY4A 1XNAA 3WSOA 4Q4Y3 3AL6A 1R1A2 3OUHA 3UV9A 1QEXA 2VBBA 1K3IA 5DAXA 1TE1B 1PIV1 4IE0A 4TLFA 1SZBA 1A6CA 2WL1A 4JAAA 1CX4A 1XRUA 4UW5A 4E4DX 2R071 4WVWA 4FOQA 1G9FA 2ES3A 2WIIB 4M4RA 4C1WA 1MEC1 1SLAA 3PMSA 2B9UA 2GZWA 1RUJ3 1Q3EA 1QJY3 1RJ7A 1RUD1 1VBB2 3N9MA 4BZ4A 1N3PA 1QH7A 3M70A 1XSRA 4Q29A 1PMHX 1OURA 2JG8B 3F2ZA 3HNYM 2HEYF 2ZKLA 2P1BA 3NL1A 4DMIA 5IFTA 4QHZA 2DCYA 5CFDB 2BNOA 1F31A 2J1SA 2PHLA 1UOGA 4RHV2 4XXPA 1G9AA 5IFPA 4Q1RA 2ORXA 3FUQA 4LKFA 2BWCA 3UESA 3ZSKA 2QUOA 4M00A 2DUPA 4AVSA 5FP7A 1L3JA 3S0MA 2BQPA 4AAPA 1GOGA 2ZEZA 3VD5A 1RUG2 2AC1A 2P3YA 3CL1A 3PVNA 4AI3A 3MDPA 5FMDA 1JOBA 1JYNA 4JRLA 1IZ3A 3FLPA 4CDXC 4HMZA 1O3TA 1AX0A 2RE9A 2X05A 3KLSA 2ZZJA 3ACFA 4NMIA 2GNMA 5F5AA 2A3WA 1W6OA 2ZEXA 1OA4A 2XB6C 5JZGA 1SBFA 4YVSB 4BQ4A 4UF0B 1GR3A 3HOBA 3W58A 1DQ6A 2YBSA 3Q8EA 2TUNA 1Y9QA 5GZDA 5FY4A 3BGAA 2KD7A 3QOPA 4ZKTB 4Y20A 1W6PA 4E2SA 2PXJA 3AB0A 2RS32 1HV1A 2HLEA 4PT6A 5J3UA 5FY8A 3FBYA 2WNUB 2VMGA 3LEMA 4CU7A 1LR5A 3M3QA 3WHTA 4KWUA 1NKGA 5FMOS 3I7DA 1AL22 1KJLA 2GN7A 5BXXA 1LECA 4OFGA 1L7LA 2A6WA 3JBG2 3MEPA 5IVCA 3K2OA 1WMFA 4GJYA 1MZEA 4M3CA 2EAAA 2Y6KA 3IDCB 4LE4A 4V1PA 5GLTA 3AP9A 4CA9A 5J48A 5JUVA 1N47A 3W59A 1YRZA 3KHBA 1TME2 1L7RA 1B35B 2K9ZA 3O0WA 5DZFA 1UOBA 1YYNA 2VZRA 3AX4A 2VZ1A 1F15A 4FOVA 2WZR2 4LE3A 3K3NA 3LSEA 3WDVA 3V65A 3AP7A 2CU5A 2YV8A 2KA3A 1JU3A 2WNOA 4E2QA 4AVVA 2P6HA 1H4HA 2VMCA 3KCXA 4QPGA 2ZXQA 5BNNC 1XJAA 4CXYA 5J1XA 3WQ0A 1JOPA 1CD3G 4Q5OA 4B1LA 4BB3A 5GKAC 1DLCA 4B29A 5IVVA 1W6QA 5B4XA 2A73B 5CEHA 3B7MA 2RMU3 1VBC3 1TG7A 4AQ2A 1X8MA 4BIOA 5FCCA 4CDQC 2WO3A 4IEUA 5JOZA 1WCSA 1GYKA 2H0VA 1AR93 1POV0 4LA3A 4ZU4A 5L19A 4XUQA 2JICA 4NAOA 3FE5A 1W8UA 3K4AA 4YM3A 2I07B 1DGLA 1ZZ8A 3LOIA 3POSA 4AGGA 4AK3A 1POV1 2CY6A 4Q27A 4LOSA 4XJAA 1O3RA 1XNTA 2RS12 4NRPA 3NAPA 3KHCA 4BK4A 1KRIA 2R062 1XC6A 3H3ZA 3MPPG 4H14A 5C5UA 2FMDA 3ZSJA 2WO7A 2ZS6B 5FIXA 3WT3A 2Q1MA 3B94A 3CHXA 3ZYHA 1FMD2 2R6QA 3K4DA 4HLTA 2GSYA 2C4XA 2ZHLA 1C28A 4Y5TA 4OHZA 3VBOC 2QQPA 4BQ3A 3CZUA 4BXFA 3H0OA 1RC6A 2VXRA 2J7MA 1XYPA 5DG2A 5T54A 5FZIA 3VD7A 3SITA 2G9GA 3CEWA 2E7AA 2W47A 1DYKA 3ACIA 3E6BA 2D44A 4RGKA 3D5OA 2P37A 1R081 2CWSA 2J1RA 1T2XA 2V72A 3BIWE 4V2VA 4XHBA 5GLVA 1SBDA 1YIPA 3HN3A 5IK7A 4XJ9A 1SACA 1ZZBA 4WM8B 3Q8CA 4GWIA 3SLIA 3OY8B 2VW2A 1JU4A 2B46X 4FXGB 3EQEA 1WLCA 3T2OA 4K21A 4QT6A 1DQ0A 2V73A 4Q4Y2 4V2WA 1OLMA 4XE9A 4YZ1A 1AVBA 3J7NA 5FPUA 5GZCA 5I0SA 4AI1A 3WX5A 1QQP1 2XWJB 4J6GA 3JD73 2E26A 2IWGB 2P3KA 3ST7A 4HK8A 2X5IC 3VUOA 4FTBA 2VG9A 2VNRA 5A7WB 5ACA1 2VBDA 5E1RA 2EIBA 3WQ1A 1F8VA 5CKNA 4LIUA 4JCKA 3PVEA 4MXWA 5A7NA 3Q9OA 1W8OA 3AP6A 4UWDA 4YW7A 3ZN4A 1N1SA 1D2QA 3ZFEC 4AFBA 2CGOA 3WW4A 1CGPA 2Q8CA 3U07A 2E9QA 3MIDA 1GZWB 1D4M1 5FMBA 3KD4A 4Q0UA 4OUEA 2HKXA 2NMNA 1YQ6A 2B9VA 2ZGTA 1HW5A 4K8RB 4Z07A 5AC91 4XMIA 4DUVA 3TEZA 4XTMA 4FPYA 4NO4A 4DUWA 1H8TC 1UZYA 4LJHA 3GCWA 1CZTA 2WSVA 3AZXA 3RNSA 2HEWF 3ZN5A 3DYMA 3AJYA 4DQAA 1A34A 4JGYA 3GDBA 2ZGSA 3ZDVA 2VNOA 1CZSA 1RINA 4XBQA 1VAKA 1VPHA 3WF0A 4I0AA 2GMMA 2OS2A 4CEYB 4CP2A 2VQUA 3H7JA 2VXJA 2HWF1 5T5JA 5LRSA 1JUHA 4MX3A 4D3WA 1FPN1 3PDQA 5IVFA 4XIOA 3IIIA 5JSOA 1UXZA 2VGDA 3V0BA 2WLQA 4LHSA 3MYXA 4FPCA 4XJWA 1AXKA 3IB3A 4J1XA 3SCGA 5C3RA 4EZHA 3KQRA 3A21A 4AGVA 3O0VA 2PHUA 1K5MC 1Z78A 5FJKA 2FCUA 2JECA 2XVGA 3QH6A 5DAQA 4XFBA 2VOKA 3MV01 5A6ZA 1O4YA 1UY2A 3M2MA 3LIGA 4AEDA 4Y33A 4DY3A 4FAGA 3KZ4C 3ZFGA 5CG9A 4P02B 1G7YA 4SBVA 3SXWA 1OKOA 2H6CA 2VUAA 3U1XA 2MEV3 3FHAA 2N7GA 2GP3A 2R0HA 3VV1A 1JUIA 4BYYA 5A6XA 2X09A 4XAAA 3FHQA 1YEWA 1TMF2 5F2SA 2XJVA
chains in the Genus database with same CATH topology
3VBFB 2XH6A 1ZZCA 3QH7A 2O8QA 1ZX5A 2XKPA 3CF6E 2WS91 3K51A 4XFIA 5JR7B 1SCRA 2PAMA 3WD5A 1KS5A 3AMNA 3WW3A 1I3HA 4L2NA 2ZCWA 1IPJA 5KBFA 1HRI2 2DFBA 3HAGA 1YXWA 1DIWA 2BWAA 4XF1A 1D2SA 4Y1YA 2PLV1 3TNQA 1WMEA 3GF6A 1BKZA 4XMAA 1QJZA 4COVA 4I2OA 1A8DA 5D8AC 1S0DA 4ITCA 1H30A 2OIIA 5FLHA 4Q4X2 3AMPA 4WV8A 4XF0A 3VKOA 1ZM1A 2ARBA 4O9EA 1OOPA 4OUMA 3KGZA 5CFCC 4XHXA 4IEYA 1NZCA 4EWAA 4D69A 5J36A 1GZ9A 5FPXA 5D1IA 4RQPB 5E16A 1JOJA 2JEMA 1AR62 1HDKA 3E6DA 4O9GA 5ABJA 4IEOA 2A7AA 1QXPA 4JTNA 1GKBA 4YLZA 4FOWA 2C9AA 1X50A 4H7LA 4LHLA 4XFFA 4FT8A 3VDDB 1LESA 5T3NA 1X33A 3O0XA 5BNOA 4FPKA 3N35A 5KHJA 1KDMA 1VBE3 3RYKA 3BALA 2YYOA 4NPRA 2Z2SB 3VLBB 1J59A 2OZ6A 4Q4W1 4FVVA 4DZGA 1VRH1 1CAUA 5CU1A 1APNA 3GBWA 1AR73 1S0FA 5CIRA 2WQZC 3JCIA 1CAWA 2WFF1 1LEMA 3VBRA 4DB5A 4CTEA 1YIFA 3V56A 3PMEA 3WQ7A 4QX5A 5GZEA 4BOWA 1FOD1 4Y1VA 3RS6A 3V64A 4OZXA 4AVTA 3USUB 3PVBB 1Z7S3 4HPKA 5BY5A 4R9CA 2P3IA 2GNDA 1EPWA 5A3LA 5L36A 4DNYA 4LO4B 3I4IA 4LBNA 3ZYGA 2RS52 3SMHA 4CDWC 1BEV3 2V09A 3WG1A 5DDJ3 4CP0A 1QJU1 1VR3A 2JG9B 2ENRA 1Q8OA 1XNKA 2HEVF 3MLJA 3D4KA 1QGLA 4YW1A 4KG0A 4MGKE 3V0AA 4IERA 4FP3A 1RUF1 2E51A 3GBGA 3POWA 1DDLA 5LK7B 5F6KA 2ZMLA 1OQEA 1S0JA 1XE7A 1YFYA 5C4WA 4BMEA 4EN9B 3E97A 1URXA 2JG8C 3PTYA 2GAUA 4AFAA 4AQTA 1NCRA 1RUE3 3RYPA 2P3JA 3VZNA 5CFDC 4LBQA 3VBSB 3WDWA 2VUJA 1NA1B 4YVWA 1RGSA 1ND3A 4FPGA 1EV11 4BA6A 1UAIA 4GH4A 2PAKA 2WNVA 4L92A 1IS3A 4TWTA 3BU7A 4Q0PA 1Y7BA 2A71A 2VY0A 3FHIB 1AZDA 3OPZA 4LA2A 1SEFA 3VKFC 3ZXDA 1JH5A 1MS0A 1O3SA 1M06G 3J8F1 1RTVA 3OTFA 1VP6A 1H9PA 2VOXA 3MIGA 1GNZA 1VBD1 4WM7C 4QPYA 3MIHA 4YVSC 1LRHA 3VHOA 1PO13 5HXVA 4CDUB 1W6NA 4FO9A 3A0KA 2HWD1 4WVMB 4I01A 2KXLA 1ZBA1 5BYNA 5F5QA 4HKOA 4MSVA 4N43B 2E53A 4UBHA 2Q1ZB 3ECQA 2WNUC 1R1A3 4HKLA 4GALA 1Q8PA 2R041 1PVXA 1QJX1 3OGJA 2DCKA 4KNCA 4Q4V1 1UIKA 3PJYA 2A6YA 2R32A 1NCQB 1VBB3 1CPMA 2W08A 4PIZA 4IQPA 5L73A 3BPZA 3GZTB 5FOJB 4P5HA 1FX5A 3QD6A 1C8M3 1TNFA 5CADA 1OLQA 4Y22B 4LLFA 4ZU7A 4RHV3 1B35C 4I3GA 3JBG1 2VU9A 3OYWA 4C0HA 2EXHA 4PJYA 3R4SA 1PO23 5HCAA 2UURA 1QDOA 2NYYA 1K5MB 3ZN6A 1BVP1 5C6CA 1BBT2 3H3UA 1QKQA 1ULDA 1CQ9A 1WBFA 2OUJA 1RUG3 4LBLA 4HVQA 3DF0A 2ZBJA 2VW0A 4L9BA 2CWMA 2XHKA 5BNPB 1YFUA 4PDWB 3ZVXA 1RUI2 3UK9A 3VBHB 3ROUA 1V6LA 4EN6B 2QNKA 3ZPYA 3IT8A 4AFDA 1H4GA 1BZWA 1ND2B 2ERFA 3ATGA 4RGAA 3U11A 4EN8B 3G7DA 2RS33 3ZO0B 1LHOA 1AR72 1VBA3 4AQ6A 1IKPA 1MR5A 3AYCA 3GHNA 1GZCA 1XU1A 3MPBA 1FXZA 2XVKA 1HIXA 4LEJA 3WP3A 3WP6A 1S0GA 2BUKA 5JDBA 2QE3A 3AZVA 3D8CA 3R0RA 4M01A 2Q8OA 3TRSB 3WG3A 2K2SA 3ZYJB 2QZ3A 5BNNA 1UU4A 3RMXA 1MQTB 1WA4A 4LUKA 2D6NA 4FQZA 4AI2A 4PCRA 4QPIB 5CAZA 1QOTA 2AGSA 5FDBA 1PZ8A 2BYVE 5L7OB 4WM8C 4CDQA 2E7QA 2R0FA 1AR81 2XBO1 2HWE1 2WZR3 4RS5A 3LWCA 4B8EA 4PLOA 1FNYA 1H2MA 2GU9A 3IKWA 1R091 3VL8A 1S2KA 4AG4A 1C3HA 2Y0OA 2BGCA 4MV2A 1PNGA 1XE8A 2ZAHA 4Q4Y1 2ZACA 3JB8A 4TZDA 4LHNA 4XEZA 5H9PA 4AVBA 3JUUA 3VBOA 1LB2A 3ILRA 1LGNA 3AP5A 1V6JA 1RUJ1 2LALA 1QJY1 4C91A 1IS5A 5DUUA 2Q4SA 5LRRA 1W6QB 2RS13 2QDRA 2ZOEB 1J3QA 4NHKA 2R063 2ZZQA 4LBOA 3ELNA 3BOWA 3DGTA 1ULFA 1FMD3 1QWRA 1RITA 4PIYA 2YY1A 4YRDA 1OQ1A 4ASLA 1MZ6A 2XJPA 3M3OA 4EROA 1UCXA 1HRV3 1JTZX 3NV2A 4LBKA 3LSDA 3IBMA 4CEYC 2X5IA 1PVC3 4FPHA 4CEWB 3U4XA 5BPXA 4MVTA 1GQGA 2GNTA 2XJSA 3I59B 4FP2A 4E27A 3RMYA 1WD3A 2O8OA 1NYWA 4LLOA 2DU1A 3ZFEA 5C9AB 2X53S 1HLCA 4C1XA 4N9HA 4IV3B 4OHWA 4Y1XA 1HQWA 4QHBA 1UMZA 3UJQA 4XYXA 1MS3A 1N1VA 2XL9A 2BVBA 1LKNA 1YCIA 1LGBA 1F5FA 4QU2A 1H8TA 3ZXJA 1ZZ7A 4HSJA 1BXHA 5EXOA 3TOJA 4B4RA 4N7IA 3VBFC 4AHYA 1C8M2 4HN0A 1PGL1 1H2NA 1A8MA 2PELA 4IEXA 3DUIA 4D7YA 4ES9A 5J98B 2BFUL 3ZYIB 1PO22 3NV1A 3AKSA 1S2BA 1CAXA 2JE9A 1RVF1 4QM8A 4IV1A 3TAYA 1YWKA 5I8TA 3S7EA 3AMMA 5LK5A 4YYOA 3H1MA 3AM2A 1UF2C 5KXEA 1BYHA 2ZMKA 1XYNA 2VPVA 3OCPA 1BQPA 4K8FA 5FMOL 1ZBE2 2ZGMA 1ZRDA 4IEPA 1RMU3 4WM7B 4LHKA 4IESA 1KQRA 2BFUS 1ZRCA 4FOYA 1MS1A 4HFSA 4YG0A 2RMU1 1VBC1 1XNDA 5FOBB 2P2KA 3HT1A 1LHNA 2Y0IA 2YPJA 3VKLA 3L2HA 1AR91 4XF3A 4RQPC 2PYTA 3GYDA 5J37A 3THTA 1VBA2 3RPQA 4E9KA 4AI0A 3INAA 5AFBA 1SLCA 1HXS2 2TNFA 1SMVA 2P34A 1U5YA 3VDDC 3FFQA 1AJKA 3FX3A 1WCKA 4FXKB 1PIV3 1BVVA 1TMF3 4YNIA 4A3XA 2D6KA 3IIAA 2R1DA 1MEC3 4E2GA 5T52A 2OUHA 1V9U2 2RJLA 4L8QA 3MF6A 5GLWA 5D8AA 1VIWB 4NHLA 1J1LA 3ENRA 2WA3A 4YSFA 1G8WA 3M3CA 5JLVA 4AXOA 1NE6A 2B39A 5FPZA 5CFCA 4C90A 5JVVA 4DY5A 1O4TA 1HRI3 4RR3B 4CRQA 3PHMA 1DHKB 1YLLA 4AGRA 5H9RA 3TNPB 3HWJA 1IS6A 3QCWA 4P9IA 2QJVA 3JD71 2OW4A 2ZHMA 3H8UA 4GB32 3CNAA 4Q4X3 1D0HA 5DXDA 3WW1A 5A33A 1D4VB 1LOEA 2PHXA 2EIGA 1ZNPA 3T1LA 1OQDA 3U0ZA 4FSJA 1GNHA 3MW2A 3KM5A 4UW6A 4EN0A 2JG9C 5DUXA 1TQ5A 2HWC1 4YM1A 5FAXA 1AR63 1WW5A 1EAH2 1KD7A 3SH3A 1WLDA 3ZMNA 1S0IA 1V6KA 3GHMA 1OOPB 3ZIXA 3HIFA 4YG3A 3WDTA 2IXJA 1HKDA 1HRV2 2ZX3A 3DPRB 1ENRA 1XXNA 1LHWA 4P14A 3RQ0A 2IC1A 1PVC2 5GJ6A 3JB4C 1RUH3 3VBSC 1AL0G 2RR12 4PLMA 1GFF2 1NA1C 4OHYA 5FO7B 4LUMA 3AJZA 2IFRA 4GXLA 3MIFA 4KH9A 3ZXAC 5DUWA 1COV3 1W6MA 4CDWA 2HYKA 4FQ4A 1PK6B 2W39A 4Q0VA 3HMYA 3BOPA 4JDOA 1RUOA 4JRAA 3VBUB 3WHUA 1VALA 3NV4A 5F6LB 1RJ8A 2HWB2 3RG0A 2OVUA 2WT2A 5FRAA 3TB0A 5FFOC 4N9IA 2GMPA 1WLWA 4CDUC 1DF0A 2MEV1 2RS53 4OULA 4F7ZA 1QXJA 4YZ2A 3DN7A 4N43C 3MFAA 4JGZA 5CFDA 4XZPA 2ZAAA 4HPKB 1EP0A 3ZIWA 5IK4A 4F8AA 3VHNA 2PHWA 2WLPA 1ZZ6A 4W6XA 2ZTNA 2ZPXA 3VZJA 1POV3 4FTEA 4AEMA 1NCQC 2C0ZA 3ZSLA 5GZGA 2DTYA 3LA3A 3BB6A 4FTSA 3VZLA 3LGRA 4KL1A 3GBFA 1RMU2 3TYJA 1WW6A 1CPNA 1HQNA 5AFEA 1FV2A 4S2DA 2D5HA 1AX2A 5FQ0B 4YZ5A 2AZ5A 5T50A 1S0EA 1F9KA 1OD5A 4GULA 4D94A 3KT7A 4YVSA 4N53B 1OPMA 3ALQA 4M3CE 4ISRA 3ASIA 5DG1A 1C57A 4KGQA 2OZJA 4NN0A 1UKRA 5KHHA 4EV0A 3MW4A 1PGW2 5I8SA 2WQ4A 1KDKA 3WDYA 1YJKA 2WNUA 4YVWB 5BNPC 4FBFA 3KS7A 3G6JB 1RL3A 4PDWC 1BMV1 3N7MA 1PIV2 3MIEA 3VBHC 2R072 4X6QB 1N3QA 1JBCA 4GQ7A 4D7TA 2GH8A 1MEC2 3VL9A 4C0BA 1ND2C 3OF1A 3WDXA 1FAYA 3IDBB 1U5XA 2GALA 1RUD2 1J1TA 4Y4YA 4A7YA 1VBE1 2Q5TA 4J1WA 1VB2A 1LOBA 4QGMA 3TN91 2K0GA 1V6MA 1B35A 2A5ZA 4K9SA 3UL2A 4XFHA 3LA2A 2DUOA 1TEIA 1Q43A 3SH4A 5FBZA 1XNCA 4R4XA 2ZA9A 4OUSA 2A6ZA 1MQTC 1LOCA 4A7KA 3O5SA 1V6OA 4XBNA 4XFAA 1H9WA 4QPIC 5EYXA 2NLRA 4KBBA 3WUCA 4BE3A 4YG6A 3LOBA 5L7OC 4L99A 1LEDA 1DGWA 1JW6A 5A32B 4GKXA 3USSA 1Z7S1 2AYHA 4Q0SA 5HI0A 3TBDA 1RHI1 1BBT3 1DYPA 1SCSA 4ES8A 2QZ2A 2VVEA 3IPVB 4OVEA 4Q2FA 1NXMA 2IXCA 4BPZA 1LOFC 1BEV1 1W0PA 3HR9A 1F5JA 2B7YA 2Z79A 5DDJ1 4R9AA 3ZDSA 4YZ3A 2G9FA 3M3IA 4L97A 1SFYA 1AYM1 3ZXEA 3FC0A 1OKQA 4JDMA 1BJQA 2ATFA 4QGNA 1RUI3 2Z69A 4YGCA 2D97A 1XYOA 5IUQA 3BCWA 1RUH2 2D6PA 2JJ6A 4S2FA 3DV8A 5FLJA 1S0BA 1LGCA 3LCPA 2R30A 3TWIA 4GWNA 4YW2A 2NM1A 3APBA 2P17A 1JN2P 5CVRA 1RUE1 1QHDA 1COV2 4RD7A 4WM8A 2GC3A 3OY8A 4ATEA 4XFGA 4MXVA 1H2KA 4CZSA 1NY72 1ASJ1 1YI9A 2VW1A 1KJRA 5SV5A 1A78A 4G4FA 2ET1A 4AVCA 4CEWC 2PHFA 4HSLA 3RJRA 4Z8BA 1DG6A 1DGRN 1OSGA 1FV3A 2TEPA 2KM2A 3RYRA 2X29A 2CAUA 2W68A 5C9AC 4GWMA 5J3UA 4FAHA 1PO11 2XUMA 3IDEA 3B93A 3POYA 2ZABA 4JVAA 5K8SA 2RHPA 4IEZA 4IV3C 1GZWA 2QVSB 4GMP3 4QD2A 2EALA 4XDQA 1PHMA 4FCAA 2UYAA 3GZAA 4JQRA 5C8CB 1Y43B 3B69A 4FPOB 4LBJA 1R1A1 3VN4A 1ZA4A 2GMEA 4HANA 3WG2A 4I0WB 1RB8G 1N1YA 4MLOA 1O7FA 4AE2A 3H9AA 1RUC3 2JE7A 3NKTA 5K0UB 3ZFFB 1VBB1 4CEYA 1NE4A 4SLIA 1JXNA 1LTEA 1GANA 1C8M1 1BK1A 4YFWA 2BTVC 2VNGA 4YM2A 2WT1A 5KHKA 3M8LA 1DFQA 2WWSA 4RHV1 4AQSA 2H0BA 1R082 1SLTA 1CAVB 5J09A 4META 1PO21 3CJIB 2LTNA 3NKGA 2DV9A 2VOWA 4K1YA 3T1MA 2UWAA 5F9TA 1LCLA 3VZMA 4XF4A 1PM7A 1RUG1 3WP5A 1QQP2 1S0CA 2ET7A 4XW3A 1LOGA 5I0TA 2NMOA 4XETA 3AKTA 5ACA2 4JGYC 1ZZ9A 2JKBA 3VBFA 1QH6A 4Y1ZA 2JX9A 3MICA 3KMHA 3R4UA 5A3MA 2CYFA 4XTPA 3AFKA 5J7MA 1D4M2 2RS31 1I5ZA 1NLSA 1VLNA 5AC92 4AFCA 1ALYA 5KXDA 1QNWA 4QXKA 1X36A 2A75A 5FO9B 1AL21 2V5YA 3ZFGC 4CDXA 4QGLA 1UW8A 5CNAA 4IETA 1AXZA 1PGSA 2EXIA 3RDIA 5IK5A 3MIBA 5LEJA 5H9QA 1I1EA 2GDFA 1ULGA 5DZGA 2AREA 2HWF2 3ZMOA 1TME1 4LTAA 5LEKA 4P9GA 1WMDA 4RR3C 4YW4A 2WZR1 1G6NA 2BW8A 4XPVA 2DUQA 4H55A 4RQPA 1DQ5A 1O91A 2VVFA 1QDCA 3JQXA 4P9LA 3WZ1A 4FPLA 1IHMA 1DQ2A 1ZBE3 1X8EA 3AMQA 1JHNA 2CNAA 5TSWA 3VDDA 2B45X 1NLRA 3O14A 1MZFA 4AYUA 3B5LB 3R05A 3VHRA 4XILA 3EHKA 1G9CA 1IOAA 1LJ7A 3L9JT 4W65A 2DU0A 5GLZA 4ORFA 5JOYA 1W6OB 3I54A 2C5DA 5JZGB 3WINE 3W9AA 3UKTA 4LT5A 1HXS3 5JOWA 2WS92 2RS11 2XLFA 3FLRA 1OOPC 2R061 3KT4A 1H1AA 4Y20B 1W6PB 2IXIA 2WC2A 5JI9A 3HQXA 5T55A 3DPRC 5BUVA 1UL9A 3OD0A 3E5XA 1FMD1 1QOOA 1XQNA 3USUA 4Q4V3 3QACA 2XJTA 1V9U3 3NV3A 5HCBA 2PLV2 1ZREA 1YI7A 4M3CF 4QQPA 1D0GA 1HRV1 5CG8A 3IM0A 2DTWA 1PVC1 2BBVA 4COZA 2GN3A 1EYBA 1CESA 3EBRA 4M3CB 1UN1A 2WNEA 1Q56A 1WUVA 4BHPA 5T5PA 2GNBA 2CL2A 2I45A 1PK6C 2JG9A 1DZRA 3WVJA 3VBUC 4Q8KA 3CJXA 1C8NA 1UPIA 1DQ1A 1B09A 3AYEA 3AXDA 3ACLA 3WP4A 1ULEA 1R1ZA 4G9SB 1H1IA 4AVAA 4GB33 1SFNA 1RUC2 1GSLA 3H1WA 3H7YA 4QPGB 2IXHA 2JDZA 3GZUC 5JPMB 4WBBA 4I0BA 3N3HA 2BNMA 2NQYA 5JOXA 2PN5A 3VBSA 2PQQA 2YC0A 1U0AA 1NA1A 3NWKA 4FPJA 4XF9A 1EAH3 4XBLA 3RRDA 1ZYBA 2PHRA 4AI8A 3IN9A 5A33B 3D82A 4Q4W2 4XQDA 1VRH2 1XNBA 1AYN3 1O5UA 4P9JA 4QQHA 1EY2A 3NAPB 2WFF2 1DZTA 2FMYA 2XJUA 2RR13 2AUYA 4Z82A 1FOD2 2BPA2 5B2GB 3NJZA 2PTMA 5C4WC 1UPSA 1OI6A 2TBVA 4IL7A 4N53C 4CDUA 4KQ7A 4A2UA 3MGUA 2XJQA 3VHPA 1ENSA 4UW4A 1V70A 2XJRA 3QBQA 1HX6A 4N43A 2DYCA 3CO2A 4YVWC 2MHFA 2AR6A 5EYYA 1QJU2 4I02A 1N1TA 4MGYE 1H1MA 2DCTA 2FQPA 1EPZA 1UX6A 4HVRA 3ZSEA 1W2UA 1R093 4OI0A 1QNYA 2HWB3 2DCZA 2CTVA 1NCQA 5EJ3A 1VB4A 2B42B 1LHVA 1TMF1 2YHJA 2ZHNA 4Y22A 2Y26A 2PA7A 4NHMA 4MXWB 4URTA 5HCFA 1Q8VA 5KHIA 4HBNA 4MH0E 3ES4A 5AVPA 3O7OA 1QU0A 2JENA 2PHDA 1S1AA 2RM23 2DCJA 1K5MA 3VGIA 2ZGPA 1EV12 1N3OA 2GH2A 2MNGA 3HBZA 4JGZB 4AWDA 3OJBA 2DVAA 2E6VA 3RJ2X 2DVBA 2WKKA 1HRI1 4Q8LA 5BNPA 2ZX2A 3N4MA 4AHZA 2BEOA 4PDWA 4IXLA 3VBHA 5KC5A 3OBRA 3J8F2 4JGYB 2D6OX 5GZFA 1VBD2 2XKOA 3H1YA 3URFA 4Q4X1 5BNQA 1ND2A 3GALA 3THPA 3ZXGA 3SCHA 2HWD2 3V0BB 2LM3A 4LNVA 3BTAA 1ZBA2 4HVOA 5FREA 5JSRA 2PFWA 5BV6A 2EF6A 2UYBA 3T2TA 1AR61 1MS4A 3ZXFA 2R042 3ILFA 1QJX2 5CBLA 2R073 2R49A 1LOAA 5JCTA 4XXAA 5HBAA 5KXCA 1FT9A 2VULA 3M4FA 5I91A 2F4PA 4AEDB 4QQLA 3VZOA 4Q4V2 3ZFGB 1HV0A 3P3PA 1WCDJ 1MQTA 4XJZA 1FI2A 1KFUL 1RUD3 3ZYRA 5F1RA 4KWKA 1YJLA 4OI2A 1C5IA 4QPIA 4RSUA 1VAVA 4B4QA 4DXZA 4JV4A 1RUH1 5L7OA 4GA9A 1AUYA 2O0OA 2QCSB 3IWZA 2UWBA 4K7JA 1O3TA 2ZGUA 3M3EA 4DPNA 1DLLA 1IPKA 5FO8B 2GC0A 4KU7A 2Z5WA 4BWOA 3RZZA 1COV1 4LO6B 5CB7A 2D40A 2VQAA 1IKQA 5KXBA 4WZFA 1RVF3 2Y38A 1LOFA 2VVDA 4ONUA 1J58A 1CJDA 4TYSA 1MS5A 1NY71 4K1ZA 4DS0A 4COYA 2UY8A 1WW4A 1WGPA 1V6NA 4MZUA 1OHFA 2DVFA 2X8KA 2ZKNA 2ILMA 1OMIA 4MUVA 3O12A 3SNMA 3GNEA 4NWVA 3L2YA 3S6PA 4JC1A 3UJOA 1REDA 1V6IA 3C3VA 2OA2A 2D6LX 2RS51 4S2HA 1CN1A 3WXPA 1Y3TA 2D3SA 5C8CC 4P9WA 3N7JA 4PBOA 4HL0A 1AYN2 4RS5C 1NQDA 3DL3A 1REEA 4XIKA 1AJOA 1UIJA 3M7AA 1PZ7A 4EN7B 5KHGA 3A4UA 1SLLA 2YXSA 4AEKA 5ABJB 5K0UC 3WCRA 3ZFFC 4Z1VA 1U5IA 4OI1A 3KB5A 4FPEA 4CEWA 2PAEA 4HZFA 2IXLA 2CV6A 1LU1A 2R16A 2G4IA 2UY9A 5BNOB 3I59A 3FBMA 2QKDA 4U2AA 4HK9A 1PNFA 2D98A 3CJIC 3FWEA 5C9AA 1AR82 2XBO2 2HWE2 4LO5B 1DZQA 4IV3A 1CAUB 3S30A 1R092 1CAWB 2ZGKA 3B02A 2FBEA 2LUWA 2XLAA 3AZYA 3RI8A 3VBRB 3E6CC 1AHSA 3N7LA 4NVPA 1O5LA 2ZGLA 2JG8A 2OYZA 4K6BA 2WA4A 3ETQA 4XJUA 5JMCA 2WT0A 3B9CA 3UKNA 3J9SA 4KWLA 1RUJ2 4I09A 1QJY2 4GKYA 1FYUA 2RM22 5E88A 2PHTA 2ZJCA 1ZRRA 4FPFA 2HWC3 2YUEA 3A0NA 1IGOA 4K40A 3KSCA 3P3NA 4HT1T 2W0XA 3V0AB 1JYIA 1E57A 1MS9A 4JDNA 4HKWA 3NW4A 2ZGNA 4Q26A 1T6GC 1DU3D 4WM7A 3S7IA 4BLJA 2DFCA 5JWPA 1M4WA 5C4WB 5I8YA 1IS4A 3AZZA 2D93A 3HT2A 1NCRB 1R083 4EWDA 5I0UA 2WFPA 4CP1A 4YFZA 2AENA 3N36A 4LBQB 3WOGA 1LHUA 1WLTA 4DOUA 4Z92B 4NR1A 5K7PA 1SDWA 1ND3B 1BBT1 4AFMA 4X8NA 3H50A 4GH4B 4DRRA 1A3KA 2WNVB 4IV1C 3FZ3A 1QQP3 4YM0A 1OFSA 4DFSA 2VMIA 2Q0AA 4KGGA 2NP0A 1VJ2A 3AKPA 5E89A 1LENA 3RI9A 5GALA 2IFWA 5KC6A 5ACA3 4COWA 1KFXL 4ATFA 1RUI1 1TNRA 3QLQA 2C1FA 2H6BA 4PF5A 1MACA 4MGIE 1SBEA 5JI7A 2JXAA 3AK0A 2B5HA 4R9DA 1PGL2 3AP4A 2EAKA 5JZGC 3MI8A 2IZWA 3RSJA 4XFCA 1ONAA 1W6NB 4UXAA 1D4M3 2A3YA 4BIFA 2GC2A 1AR71 1DBNA 1QMJA 3IMNA 5AC93 4RR3A 1RVF2 3ES1A 4W6WA 2BNNA 3B9IA 1U12A 2WJSA 5I93A 5IK8A 3MLLA 3D0JA 1WBLA 1GV9A 2W52A 2FZ1A 2JD4A 2YDEA 2DVGA 3AKRA 3EO6A 3MLKA 2SBAA 1MVEA 2XPJA 2HWF3 1FPN3 1G9BA 1O4ZA 3OD4A 4BLIA 1LULA 3JQWA 3PLQA 5JSPA 1SLIA 5SV8A 1F2NA 4CDXB 4OHXA 2RMU2 1Q8SA 1VBC2 4GMP0 4B7EA 3N7KA 4W6YA 3OYWB 1XU2A 4LULA 4RA0A 2VH9A 1AR92 5J96B 2XGXA 1DQ4A 4OI4A 2EVXA 4GMP1 1Q8QA 3ZN6B 5E8AA 4QPGC 5K9YA 1FATA 2CGNA 4MYEA 1S55A 3DPRA 4RFT0 1MZ5A 2QDNA 3LB9A 1JYCA 1OFNA 1X7NA 1H0BA 2A6VA 2ZGRA 1RUC1 2AH2A 4KG8A 1YO8A 4Q1PA 4YW5A 1BCXA 1OPOA 3ILNA 4M0HA 5H9SA 4Y26A 3MZHA 2WS93 2A3XA 3I2DA 4YARA 5IT6A 3OGGA 4QQOA 2B8MA 4E4SA 3TN93 2YGLA 2MPFA 4EWEA 3NAPC 1YFWA 4PIXA 1PK6A 4WVZA 3SCFA 4Y24A 1DGWX 3FUOA 4DRVA 3VBUA 2PLV3 1OA2A 3SHRA 3C2UA 5CA6A 2XG3A 4QM9A 3VKMA 3RWNA 1QOSA 5BNNB 3J26N 3JD72 4N90A 3PJQA 1REFA 1AXYA 1DGRA 1YFXA 1YNAA 4IEQA 2VQ0A 3EXUA 3FFZA 4M0NA 3VKNA 3WLUA 3AFGA 4CDQB 1RHI3 4F3JA 3AYDA 4RS5B 1UU6A 4NWWA 2HWC2 1UZZA 3AZWA 4N7UA 3PVOA 3WCSA 2A70A 1C1FA 4AF9A 1AX1A 4R9BA 5T5LA 5EFUA 2R1BA 2VMHA 1OA3A 4UW3A 1CONA 1SLBA 1AYM3 2WZPP 2EXJA 2ARXA 2XL7A 2UU8A 3FLTA 2D6MA 5FQ0A 4QMAA 5JIUA 3JU9A 1UD1A 2NZ9A 2EXKA 4IEVA 1G86A 4R8HA 4E4ZA 3ME2A 3VBOB 2XWBB 4KWJA 4N53A 2RJKA 4Q4W3 5JIAA 1GQHA 1VRH3 2I74A 3WG4A 3KGLA 4OLLA 4U36A 5C33A 4JGZC 1J3RA 4PBPA 3WDUA 4A7ZA 1C4RA 2WFF3 2DVDA 4ZU5A 4B3NA 4AEJA 3NO8A 4INDA 1ASJ3 3E5UA 5C8WA 1FOD3 1RIRA 5JAXA 3NVCA 4HN1A 5GLUA 5EWSA 4OHVA 1Z0HA 1NG0A 1ZBE1 1FNZA 2YMZA 1PMIA 1W39A 2FHRA 3D6EA 3LKJA 1ENXA 4CYDA 2X5IB 4GIQA 1CIWA 4AW7A 2A6XA 5JPNB 4PQ9A 2MEV2 3ZXKA 2EA7A 4Z2WA 1LU2A 1QJU3 4Y1UA 3I8TA 1VBA1 4HETA 1KITA 2ZGQA 2YGMA 2D3PA 3ZFEB 4YGEA 3PNAA 1HXS1 1RUF3 3MFCA 4AEDC 3UKVA 3AMHA 2ZX0A 3LA7A 3U10A 4RL7A 3SISA 3WV6A 4B4PA 1X82A 4UBGA 1MS8A 3X29B 4LR4A 5EZWA 3LZZA 3AXEA 1GBGA 1Q5OA 1NXD1