1UZZA

Erythrina cristagalli bound to n-linked oligosaccharide and lactose
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
239
structure length
239
Chain Sequence
b'VETISFSFSEFEPGNNDLTLQGAAIITQSGVLQLTKINQNGMPAWDSTGRTLYTKPVHIWDMTTGTVASFETRFSFSIEQPYTRPLPADGLVFFMGPTKSKPAQGYGYLGVFNNSKQDNSYQTLAVEFDTFSNPWDPPQVPHIGIDVNSIRSIKTQPFQLDNGQVANVVIKYDASSKILLAVLVYPSSGAIYTIAEIVDVKQVLPEWVDVGLSGATGAQRDAAETHDVYSWSFHASLPE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lectin
publication title Crystal structures of Erythrina cristagalli lectin with bound N-linked oligosaccharide and lactose.
pubmed doi rcsb
source organism Erythrina crista-galli
molecule tags Lectin
total genus 55
structure length 239
sequence length 239
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2004-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00139 Lectin_legB Legume lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1uzzA00
4DRRA 1KITA 2PHXA 3POWA 5GZDA 4YZ5A 2V5YA 1G8WA 4Q27A 1LHOA 1BKZA 2DTYA 4LBQB 2SBAA 1MVEA 4P9WA 1U0AA 3ZXFA 1Q8QA 1MS9A 3A0NA 2A3YA 3AYAA 3D6EA 1UZZA 3OBRA 4FQZA 3WUDA 3SH5A 3LSDA 4YM3A 2WLQA 3AXEA 5CA6A 4LBKA 3ZXKA 3AJYA 1W6QA 1DQ2A 1YO8A 1J1TA 4XJWA 1QDOA 2VU9A 2GNDA 5HCAA 1SLAA 1LCLA 4MYEA 3A4UA 3WHTA 1APNA 1MZ6A 4BOWA 3TAYA 3WLUA 4GKXA 1LULA 1LHNA 1JUIA 1NXD1 4Y22A 1UKGA 2D44A 1QU0A 2P37A 1SBEA 1GNHA 4FPJA 1IKPA 3HN1A 4OZXA 4PCRA 4CRQA 3VUOA 4BQ1A 2DTWA 1AJOA 4YM0A 4K1ZA 1V6IA 1SFYA 3R05A 2EIGA 2A70A 1JW6A 2W39A 4FPOB 3V65A 1FAYA 1W0OA 1W0PA 2GNMA 1DQ0A 4PBPA 4Q1PA 4ATFA 2DWRA 4YG3A 4BPZA 1CR7A 1LEMA 1ULCA 1HKDA 4YGEA 3WDWA 4DFSA 2WT2A 3AYDA 2DUQA 3CNAA 4LBMA 4XJUA 4ZXKA 3WG3A 1SBDA 1N47A 5CB7A 5GLVA 2NM1A 2UWCA 4FOQA 3T1LA 3UJQA 3UJOA 1V00A 2XB6C 1CVNA 4Y1UA 1LENA 1V6NA 2GMMA 3VKNA 1SCRA 3ENRA 4DQAA 1SLBA 1QNYA 2A3WA 5E88A 2WSVA 1ULFA 1XQNA 3FUOA 3IN9A 3MW3A 1BYHA 2Q5TA 3B00A 3B9CA 3T2TA 1ONAA 1N3PA 2D6KA 3DGTA 5GZCA 1QOTA 3OY8B 2TEPA 2YZ4A 4WV8A 4BMEA 2FMDA 3BTAA 5IT6A 1BXHA 2A7AA 1G9FA 4XIKA 2G4IA 4Q1RA 5DUXA 4C1XA 5H9RA 4D69A 4Y1ZA 5IK5A 4TYSA 4YLZA 2VY0A 3VKMA 2ARXA 4P9YA 4K20A 2ZGKA 2D6NA 3PMEA 1KQRA 3OGGA 1ULDA 3N36A 2R1BA 1FV2A 4PF5A 1Z78A 3V0BA 3M3QA 4FP3A 1GZWA 3N35A 1DYPA 3AK0A 1S0EA 5JDBA 2E7QA 1JOJA 4K1YA 4WZFA 1LHVA 2WT0A 3M2MA 3BIWE 4UW3A 3GNEA 5E89A 2ZGUA 4FPLA 4UW5A 1QNWA 4XXAA 1SLTA 2UWAA 2ZHMA 4FPFA 1CONA 1FNZA 1LGCA 4YM1A 4YW3A 1S0DA 1RITA 4R9CA 1AF9A 4YW2A 1DLLA 3ATGA 1V6MA 4BLJA 1S0BA 3N3HA 3W59A 4P9XA 1S0GA 1AXYA 1SBFA 1MS1A 1WBFA 2DU0A 3R4SA 4F83A 3ZSKA 4Z8BA 5F5QA 5JMCA 4XYXA 3AZYA 1N1TA 4Y20B 2AR6A 1ULEA 2WQZC 3N7JA 2WKKA 5T5JA 4AGVA 5KXEA 1FNYA 2KM2A 2WSUA 2CYFA 3OYWB 3PJQA 4UW6A 1D2SA 3USUB 2WT1A 3MEPA 5AVAA 3WV6A 3SITA 5KXDA 2EF6A 1ZM1A 2PHUA 5DUUA 3O0WA 1W6NA 4XMAA 1N1VA 4UW4A 1N1SA 2NMOA 5JOZA 4XJAA 3V0AA 4LBNA 4YW5A 1W6OA 3I8TA 1GZ9A 2DVDA 1GLHA 5T52A 1JYIA 2WJSA 3AZXA 2GNBA 1QF3A 4HL0A 5GM0A 4YGCA 3ZSMA 4M3CB 4XBNA 3RSJA 3IMNA 2AYHA 2VW2A 1GICA 1BJQA 1HDKA 2D6LX 3B01A 3FLRA 4RL7A 2D3SA 5JVVA 3SNMA 4K21A 1B09A 1DQ5A 4P14A 4YZ1A 5GLZA 3AX4A 1KDKA 1CJPA 2P3KA 1QKQA 3D4KA 4FOVA 2DVBA 2EAKA 1NLSA 4DRVA 2ZGMA 1IOAA 2JKBA 2E53A 4R9BA 1GBGA 1JXNA 4C1WA 2DVAA 2CL2A 1VAVA 1LEDA 3AYEA 1LHUA 3Q9OA 4FOWA 3RRDA 1Y7BA 3VKOA 1R1ZA 1GSLA 1URXA 2WNEA 4LBLA 2ZGQA 1ENQA 1LOGA 2EXHA 5DUVA 1DBNA 1JBCA 2ZGSA 1ENSA 2D7FA 1UX6A 3KM5A 2GMPA 2ZGNA 4ISQA 4YG6A 4FVVA 2OUHA 3NV2A 3WG1A 3AZWA 5GZGA 1TEIA 5HCBA 1GNZA 1IS4A 1KRIA 1GKBA 2ES3A 1LGBA 1OQ1A 1UMZA 1WW7A 2JJ6A 1DQ1A 2VW1A 2ZMNA 3IPVB 4NO4A 5FREA 3MW2A 4Y1XA 2A75A 2BQPA 4M01A 1CQ9A 2GN7A 2UURA 2ZA9A 1KJLA 1G9DA 2HYKA 1ZA4A 3N7LA 2A6WA 4XHXA 1DYKA 3SH3A 1BZWA 1PZ8A 2D3PA 1KJRA 3ZSJA 1Q56A 3WNXA 2DV9A 2A3XA 4ASMB 4GWMA 5GLTA 4XTMA 2ZGOA 3AP4A 4XTPA 1LOAA 4Y24A 3V64A 2EXIA 1ULGA 2YMZA 1V6JA 1SCSA 3SH4A 2A5ZA 4LBJA 1S1AA 3AZVA 4ZKTB 3NWKA 4W65A 2GMEA 5H9QA 4XJ8A 2W08A 3AP5A 1HQWA 1WW6A 1D0HA 4FPYA 3B69A 4XDQA 2CWSA 1EPWA 2JE7A 3FUQA 3M3EA 1C4RA 1Q8SA 2R0HA 2NZ9A 3FFZA 3L2YA 1WLCA 5LK5A 2V73A 3JU9A 3ILNA 4ISRA 2OUJA 3WG4A 1CN1A 3WDVA 1WUVA 1V6KA 1N1YA 3OY8A 3UL2A 1HQLA 1JYCA 1JN2P 1V6OA 1QDCA 3U4XA 4XIOA 4XJ9A 3AFKA 2CWMA 1MS5A 3C2UA 3UK9A 1W6MA 1QOOA 5FRAA 5E8AA 4XILA 2D6PA 3MW4A 1LOCA 5IK7A 1S0FA 1G9CA 2DURA 3NV1A 3SLIA 1LU2A 1V6LA 1WLDA 1N3OA 1IKQA 1YIFA 3BODA 1AX0A 3AJZA 2DVGA 2E7TA 2R0FA 1MS4A 1IS3A 3AZZA 3ILRA 2NYYA 1WW4A 3ZPYA 3RG0A 2XG3A 3ZXLA 2B7YA 2ZGPA 1CESA 2P2KA 4XBQA 4ITCA 1CPMA 5CAZA 4GA9A 4RA0A 3V0BB 1W6PB 2D6OX 3ZXEA 3WDYA 2ENRA 4FPKA 4Y1VA 3N7MA 1AJKA 3O0XA 4M3CE 1LTEA 1GANA 1S0JA 1WW5A 2EXJA 1RIRA 1O4ZA 3M3CA 4GXLA 3PVNA 1UAIA 4PBOA 1QGLA 3WZ1A 3LCPA 2GDFA 4XJZA 3WHUA 2E51A 4I30A 3POSA 4Y20A 1SLLA 5JOWA 2DU1A 5JOXA 2GALA 3OYWA 1H30A 3USUA 1UPSA 2AREA 1VAMA 4YZ3A 1PZ9A 4ATEA 1I1EA 4YM2A 3O12A 2PHWA 2ZHLA 3OJBA 5JOYA 1G7YA 1WLWA 4NOTA 2ZHKA 3H0OA 4R9DA 1RINA 1SACA 1YI7A 3FLTA 1DHKB 5GJ6A 4DS0A 2P3IA 4YW4A 5EXOA 3B3QE 5T5OA 4WVWA 4M3CA 2JDZA 1DQ4A 4XE9A 1C57A 2AGSA 3AYCA 1UZYA 4YFZA 3PVEA 3WVJA 4U36A 3GALA 3WG2A 3IKWA 4WVVA 4Q8LA 2W68A 4Y26A 3WUCA 4TZDA 1LOEA 3APBA 3QLQA 4CTEA 2YV8A 2ARBA 3O5SA 2AENA 1I3HA 4SLIA 2VW0A 1LGNA 4LBQA 2UWBA 1AX1A 1MR5A 5GZFA 2R1DA 3WDTA 2R49A 5EYYA 2P3JA 2EALA 1LOFC 4FOYA 3NV4A 3ZYRA 1DQ6A 1DFQA 1G86A 2A6YA 1X50A 2PHRA 1W6QB 2ZHNA 2A71A 2C9AA 4LBOA 1YRZA 2JECA 3JUUA 1CIWA 1YXWA 1LOFA 1ENRA 1UN1A 5DZEA 1MVQA 5CBLA 2CTVA 2YROA 3IPVA 4AWDA 4FPHA 4Y22B 2GN3A 4Y1YA 4AVVA 3OPZA 3W58A 1CPNA 2NN8A 2YXSA 2DVFA 4Q2FA 4AVTA 1MS0A 2LALA 1FYUA 5DXDA 1JHNA 2AH2A 2LTNA 1Q8PA 4CZSA 3ASIA 4XBLA 4YGDA 4YGBA 4DPNA 4FP2A 1HLCA 1Q8OA 1VIWB 1MS3A 1DZQA 5JLVA 1FV3A 1O4YA 2VH9A 2I2SA 5EWSA 2ZGLA 3FLPA 4AGGA 1VLNA 1PZ7A 1AXKA 2ZACA 1H9PA 1S0IA 2VXRA 1DGLA 4PQ9A 3RMXA 2NP0A 2OW4A 5L73A 4H55A 4L8QA 3WCRA 1A3KA 2EXKA 1FX5A 5SV8A 5EYXA 4GKYA 4YZ4A 1LOBA 4GALA 2VUAA 3ZVXA 3ZYPA 4AYUA 5DG2A 2OVUA 3NV3A 1C1FA 2DYCA 4YFWA 3VKLA 3AP9A 3R4UA 3SISA 4U2AA 1SLIA 2ZKNA 2ZMLA 2YY1A 5GLUA 2RHPA 1SLCA 1UL9A 2FHRA 3VV1A 1F31A 2ZZJA 2D43A 1GZCA 1S0CA 2PHTA 4XHBA 5DZGA 4FQ4A 5H9PA 1F9KA 2PELA 1W6MB 1MZ5A 2NMNA 2CY6A 1Q8VA 1FATA 2JD4A 1Z0HA 1OKQA 1GZWB 1WD4A 1LECA 5HCFA 5IK4A 4HANA 2SLIA 2A6VA 1C1LA 2ZGTA 1LHWA 3AXDA 5DG1A 5KXBA 4GWNA 1A78A 1W6PA 2ZABA 2ZMKA 3A0KA 4BLIA 1N3QA 3M1HA 4FPCA 3INAA 4XMIA 4KBBA 5T5LA 4Q8KA 4YZ2A 2AUYA 3PVOA 4XOGA 2PHFA 4AGRA 3DUIA 5DUWA 1QMJA 1WD3A 1AVBA 5T54A 2ZGRA 3HMYA 3ZSLA 2E6VA 3LSEA 3BOPA 1YYNA 2P34A 5T50A 2W52A 3RS6A 4YG0A 1GYKA 3RMYA 1BQPA 1GV9A 1A8DA 4M00A 1LU1A 3ZXJA 5DZFA 3M3OA 1QOSA 2A6ZA 2Z42A 2ZBJA 1G9BA 2D6MA 1OFSA 2DUOA 2UU8A 4BM8A 1F5FA 5T55A 4FPGA 5GALA 2JE9A 1W6NB 3AP7A 3RQ0A 5IK8A 4JCKA 5BYNA 3OBTA 3WOGA 3HR9A 5T5PA 3WCSA 3WDXA 1LJ7A 3TB0A 5KXCA 2H0BA 3V0AB 1LODA 2DUPA 2C5DA 1W6OB 3KQRA 5IUQA 1AZDA 4R9AA 5GZEA 5F9TA 1AX2A 1AXZA 1IS5A 2R16A 1LESA 2D3RA 2ZAAA 1IS6A 4XXPA 1MACA 2ERFA 3N7KA 3POYA 4M3CF 5GLWA 3VKFC 3QCWA 1WCSA 4FPEA 1G9AA 1WBLA 3D5OA 4YW1A 5H9SA 4AVSA 4BMBA 3T1MA 3O0VA 3IM0A 3AP6A 2A6XA 2GNTA 3I4IA 4JRAA 4XZPA 1H9WA 3FBYA 4LBQD 4Q26A 4IQPA 5CNAA 1MS8A 1DIWA 3MPPG 4JC1A 3WDUA 1VALA 2CNAA 1KDMA 3ILFA
chains in the Genus database with same CATH superfamily
2RR13 2JDPA 3O1VA 1NCQC 2OXBA 4WM7B 3DEMA 3LF7A 1G8WA 4KBZA 3OGJA 1BBT2 1BKZA 1AL22 4HFSA 5F3GA 4QXHA 5AVPA 3K4DA 2B8MA 4P9WA 1FOD1 1Q8QA 3THDA 3VBOB 5CEHA 4I3GA 2B45X 3LWCA 3CKHA 2Q1ZB 4D7TA 3NNJA 3WUDA 3P3NA 4MHUA 1QJX1 1YUDA 2I74A 3LEIA 1W6QA 1QJU3 4B7EA 2QQOA 4MG2A 1S4CA 2GNDA 1SLAA 1C5HA 4Q0PA 5DABA 4YVWB 3WHTA 4BOWA 5C7GA 3TAYA 1O8SA 2O8OA 2HWC2 3WNPA 3MLKA 4Y22A 4Q4X2 5IWFA 3ZIWA 1GNHA 3OPWA 1IKPA 2KXLA 3OSDA 1AJOA 3ZYHA 4YM0A 3ZM8A 5HXMA 5F3EA 2IXIA 3ZPOA 1SHWB 2PAMA 1W0PA 3USSA 2UY9A 3IAQA 4H14A 2DWRA 3M7AA 4Q1PA 4YG3A 5FY0A 4BPZA 5JXIA 1CR7A 3D8CA 4Y33A 3BUCA 1OSGA 2DFCA 1VBB2 2PA7A 2QJVA 4XJUA 5FK7A 2V72A 4P9IA 5GLVA 2UWCA 3T1LA 2BNNA 1W8HA 3WQ0A 1CVNA 1COV1 1UU6A 3VKNA 4O61A 1GQHA 3ZFFA 1WMDA 3NW4A 1CAXB 1GFF2 2WSVA 3PIGA 3ZIXA 3IN9A 1BYHA 3B00A 4RS5B 4YVSC 1ONAA 1N3PA 1PIV1 5E16A 3QH6A 2D6KA 1AYM2 2J1SA 4IV3C 5LY2A 1ND3A 3HNMA 3VL8A 1UU4A 3BU0A 4IUGA 2ZZQA 1JTZX 1O5LA 4KWLA 4XC9A 2QQNA 3GJAA 3BTAA 1JU4A 5FPZA 1W8FA 2A7AA 4AI3A 4PDWB 4IL7A 4C1XA 5H9RA 4CEYA 2WNOA 4RN5A 4D69A 5JWPA 4Y1ZA 4CXXA 4GQ7A 5KBFA 2QCSB 4TYSA 1B35A 4YLZA 3AKQA 2CGOA 4A6OA 2B39A 4K20A 3OGGA 3JBG1 1ULDA 4JAAA 3LFIA 1RUC1 4NE9A 1DYPA 4GB33 4UBHA 3H8OA 5FAXA 4KQ7A 3VZMA 3ABZA 4ZHNA 3M2MA 5I91A 1WZXA 5FY8A 1QNWA 1EV13 3GDBA 2BFUS 1ND2A 4RR3A 1CONA 1TMF3 3E6DA 3LOBA 5CFDC 4YWAA 1DLLA 3S7IA 3ON7A 3N3HA 1YHFA 4AI2A 2G9GA 3T2QA 1AXYA 1EP0A 4YYOA 4Z2AA 1YQ5A 2ETEA 1JZ8A 5JMCA 3I2OA 3BI3A 1AL0G 3IAPA 1N1TA 2X53S 4Y20B 3N7JA 5FV3A 4XABA 5FZLA 2N7GA 3CIHA 3KZ4C 4HETA 1HV0A 3USUB 1YEWA 4GH4B 4ZU5A 3U78A 5EIYB 3WV6A 4A3XA 3SITA 1AL23 5DUUA 4UFLA 5I8SA 3POBA 4AE2A 4JGZB 1ZBA3 2VNOA 4UW4A 1J58A 1N1SA 2NMOA 5JOZA 3C7GA 2R063 4XCAA 2QQVA 4HKOA 4JDOA 1C8M2 1ZBE2 5IYYA 3S57A 4Z92B 2QZ2A 3NKTA 4L92A 2ORXA 1OUSA 2HEVF 3AZXA 1HV1A 4BIFA 5LCWL 2GNBA 2QQJA 2QDRA 1POV3 4XFFA 3ZX7A 4M3CB 4XBNA 3AC0A 3IMNA 2JIJA 1QJEA 2W1WA 1BVP1 4LLFA 4RL7A 2PQSA 1CAWB 5F8PA 1H2LA 5FMBA 3TEXA 3K77A 4K21A 3LEMA 3SNMA 2HWC3 5GLZA 2X5IB 2D5HA 1KDKA 1CJPA 3FHIB 1JYXA 3GBGA 4AEJA 2B5HA 2ZGMA 5C3PA 5FYIA 4DXSA 1REEA 1HB4A 4HLTA 5FTTC 1JXNA 3MO4A 1LAJA 4N7UA 2JDKA 4FSJA 4GMP0 3AYEA 1LHUA 3CL1A 3Q9OA 2JX9A 2WABA 4NIAA 3RRDA 3K46A 3VKOA 1R1ZA 1GSLA 5I0UA 4LT5A 2WNEA 3ZDSA 1LOGA 3J26N 1YCIA 5GKAC 1ENSA 4GZ9A 2PYTA 3GZTB 5FBZA 1VBE3 1YQ6A 3CO2A 1VRH2 4IE4A 4N9HA 4ISQA 1W0NA 5A7QA 4CVUA 1HB3A 4PF1A 2RM21 2O8QA 5KXDA 4EYUA 1XSQA 1GNZA 2A1XA 2P1BA 3LPFA 1JOBA 3FJSA 2WZPP 4ES9A 2WZR2 1OQ1A 1DQ1A 4XURA 3PUQA 1D4M1 1NE6A 2HKXA 2DCJA 2XBO3 1YFUA 3H9AA 3I7DA 2TNFA 2WZ8A 3POIA 2OZJA 1H4HA 1RHI1 3PDQA 5BY5A 1JU3A 1IHMA 5C4WA 4XF4A 5GLTA 2ZGOA 3AP4A 2HWD1 4XTPA 5F3CA 2EXIA 3ITQA 1ULGA 4AVCA 2YMZA 2WN3A 3SH4A 3FHQA 4Q4W3 1W9FA 3LEKA 3NWKA 4K9SA 2VUCA 1KS4A 1W9WA 5KHHA 3T0DA 1UZWA 5FP9A 1R1A3 4CE8A 3TEYA 3VZNA 4CEWC 3AP5A 2BNMA 1D0HA 1GR3A 1KXGA 3VZLA 1RB8G 4AW7A 2R0HA 3H8UA 1PMIA 3CJIC 2V73A 3WNNA 1OURA 3VHNA 2WA4A 1F35A 5HI0A 1F4AA 5FO9B 1QJFA 2R043 2ZEZA 3WDVA 4BQWA 5ABJC 1WUVA 1V6KA 4JKLA 2YC4A 1VBC1 1QDCA 2ET7A 4XIOA 4XJ9A 5SV5A 3UGGA 1OD3A 4QX7A 5LBEA 5A7PA 1XRUA 1L7QA 2VMHA 3AB0A 5K8SA 2JDAA 3IDBB 5IK7A 1ALYA 3DPRA 4MZUA 1ZX5A 3NV1A 4G4FA 3BODA 1N3OA 3VD5A 1AX0A 4IDZA 3CDZB 1MS4A 3ILRA 2NYYA 2VZUA 3ZXLA 5ACA1 2ZGPA 5E6HA 5FO8B 5LA2A 4XBQA 1FOD2 2BW8A 1CPMA 2XJRA 3NJYA 5C3OA 3I3DA 3I2HA 2D6OX 4MGYE 3RGBA 4BJ0A 3QOPA 1QJX2 1HN1A 2JDHA 2W5FA 1LTEA 5FLHA 5KC6A 2KD7A 2WNVB 1QXJA 1S0JA 2VTXA 2HWE3 1QY4A 1WW5A 1H1IA 2QQKA 4CDUC 3G7DA 3PUIA 5FKBA 1O4ZA 3UKNA 1CZSA 3HN3A 3PVNA 1OI6A 5C5UA 4PBOA 5DAPA 1QGLA 2XL7A 3MI8A 1NA1A 4DEVA 3LCPA 3U10A 4CP9B 3POSA 2VVEA 3MIFA 2BU9A 3OYWA 4KG0A 2BRTA 3E6CC 2X29A 4RGKA 4IGQA 1QH7A 1RUH3 2ZOEB 4DZGA 3VHPA 1H2NA 2JKXA 4JGYC 5ANNA 4HPKA 1NQDA 2VZPA 2PHWA 4C91A 5JOYA 2VVFA 4YW6A 3ZKYA 1MEC3 3H0OA 5AC92 5CFCC 5J3UA 5GJ6A 5CKQA 2WFF1 1H2MA 1MQTC 3H1MA 3Q8EA 4UWDA 1BEV2 3ALQA 2WZR3 1COV2 5BNPC 4I2OA 1RVF3 2R30A 3H7YA 3I2JA 4QMAA 1WLTA 2BGPA 4XE9A 4DUVA 3GCWA 1E57A 2K2SA 3OBAA 1PIV2 4HVQA 2YDEA 1X8MA 3PVEA 4XACA 3WVJA 3WG2A 1J3PA 1PO11 4E4SA 1XSRA 3AL5A 3T2PA 4TZDA 4FO9A 4L9BA 4CUBA 4CTEA 2VOWA 4FFHA 4JKKA 2AENA 1OQEA 4LLOA 2QQUA 4O9EA 4SLIA 1NXMA 4S2GA 4LQRA 4LBQA 5FZ7A 4QB1A 1AX1A 3JB4C 4CCMA 1BCXA 1U5YA 4HXCA 4D94A 2Y6GA 4QWNA 2GC0A 3G6JB 1RUJ3 4R52A 5EYYA 1CX4A 5LEKA 1CWPA 3K48A 5FYBA 3ZYRA 1W28A 3JBG2 4RHV1 2ZKLA 1DFQA 2MEV1 3JD72 3OB8A 2QQIA 4N53B 4Z2WA 1X50A 1RUC2 1YQ2A 2VXJA 5DDJ1 2ZHNA 3BVCA 3ZXGA 2W87A 4QDRA 3MICA 4LBOA 4CUGA 1YRZA 5CG8A 3I54A 5K0UB 1LOFA 1UN1A 2ZXQA 3KV4A 4GJYA 3S6PA 5JIAA 3IPVA 3WF3A 4AEDC 4HN0A 4FPHA 3K51A 4Y1YA 1UW8A 2J1TA 1OF4A 5DAXA 1WA6X 2DCZA 4CDXB 4M4PA 3JXSA 2AC1A 5TSWA 2VJXA 2LALA 5LA9A 1JHNA 4XF0A 4IEYA 5F5AA 3I3BA 3DYOA 4QM8A 1J59A 4PJYA 3VBRC 2RJ2A 5JLVA 2YBPA 1YJKA 2I2SA 2YBSA 4UBGA 1VBA1 3FLPA 2FZ2A 4PT6A 1VLNA 1J3QA 4E2SA 3SMHA 4HONA 4B4PA 1S0IA 2WS93 1W05A 1DGLA 2JB4A 2VXRA 2XWBB 2OW4A 3DV8A 4MGQA 5ERLA 5L73A 3RMXA 3C7HA 4L8QA 4AYUA 2IZWA 5A3PA 5DG2A 4Q4Y3 1UQXA 2K9ZA 4ZU4A 4D6QA 5HV4A 5HXVA 3R4UA 3ZN6B 1ZZ8A 1XNDA 1XXNA 2VZSA 2VCAA 2ZKNA 1NT0A 4Q0QA 1HN0A 4KWUA 1SLCA 1M4WA 4HOOA 4AFAA 2ZZJA 4OVEA 3GHNA 1GZCA 3T4VA 2XJPA 4Y5TA 1J3RA 4FQ4A 5ISLA 1F9KA 1PVC1 3GM8A 4A2UA 4YVSA 3KHBA 3BTZA 2WWSA 1K5JA 5FZ6A 2FCVA 4MLOA 4OI2A 2FBEA 3WT3A 5FQ0A 1GZWB 1UYYA 3U75A 1WD4A 4CUCA 1PK6C 5G04L 1TNFA 4HANA 3OGSA 4RQPB 5CG9A 1V9U2 3FHAA 5A1FA 1T6BX 1C1LA 1Z7S3 1LHWA 3AXDA 3PU3A 3VBHA 1X7NA 5B2GB 4GWNA 1A78A 1BEV3 2ZMKA 2D93A 5LATA 2RM22 4AAPA 4NWVA 4Q8KA 5KR7A 4D8MA 2PHFA 4BQ3A 3MF9A 5T3NA 1WD3A 5T54A 3PUSA 1QJY3 1PIV3 4FAHA 4A44A 3VLBB 3ZSLA 2E6VA 2XJTA 5A3LA 4BISA 1D4M2 2P34A 4UT5A 5T50A 5CKNA 1R091 4YG0A 3RMYA 2ZEXA 1AYN2 2RE9A 3FL7A 1W2TA 4D7YA 3RZHA 1RHI2 1ZZBA 1ZZCA 4R4XA 5FZOB 3RWKX 3WINE 1K5MB 5JZGB 1NA1B 1QOSA 2ZBJA 5L7OB 1GQGA 1NLRA 2AEZA 5A1AA 5T55A 4PLMA 4RFRB 2JICA 5GALA 1W6NB 3ZXDA 1RUNA 4OHYA 3OBTA 3WOGA 4IEWA 5CFDA 5T5PA 3EHKA 1NG0A 2H0BA 2HWF3 3TB0A 5A7SA 1KD7A 1W6OB 3JD73 2WIIB 1BMV1 1AZDA 2O1QA 4OLLA 4QPYA 4ZZ8A 4DIQA 1OFNA 1IS5A 4HK8A 4NPMA 1LESA 2D3RA 2Z79A 3ACHA 5FBJA 2WQ4A 4YSFA 3I2KA 4M3CF 5GLWA 3ZKUA 1OLME 1WCSA 2RS33 1Y9GA 3VBUC 2QQWA 3VHOA 4YW1A 3WP3A 5C8CC 5LBBA 3ZR5A 3O0VA 1L3JA 3SQOA 3KV6A 2WUHA 2A6XA 1K12A 3EMRA 1OD5A 4QX1A 4IQPA 3LIGA 3MPPG 1VALA 1PO21 1VBC2 3FBMA 1KDMA 3AZZA 3NAPC 4OUMA 4BQYA 4A41A 5C33A 5GZDA 1AR72 3RZKA 2QE3A 1C8NA 2OIIA 5A3MA 5FZ8A 3HT2A 2WO7A 2FQPA 4QHBA 4AG4A 4NUBA 4QX2A 4FTSA 4LBQB 1XC6A 2AACA 1JH5A 2C24A 4HKLA 1EAH3 2A3YA 2J1EA 1OOPC 3K3NA 4CPBD 3O1OA 4QQHA 4EV0A 1WMEA 3SKJE 3LSDA 4CDWB 3HJRA 5CA6A 2VUDA 1UPIA 1I6XA 4LBKA 3ZXKA 3AJYA 4CCEA 3MZHA 1CAVA 1J1TA 1UCXA 2Z5WA 1LCLA 2EICA 3A4UA 5JSOA 3IT8A 3J7HA 5K7PA 5JCTA 3NVCA 3OUIA 5IVVA 1UYXA 1LULA 1RUI1 1UY2A 5I0TA 2JD9A 2D44A 3IIAA 5FYHA 1QU0A 2P37A 3LA7A 4EWDA 5C8WA 2WN2A 4CRQA 2DTWA 4KG8A 2Y6KA 2XWJB 4QQPA 1DGWA 4GMP3 1YQ8A 1JW6A 1STMA 2A70A 2W39A 4P08A 4FPOB 1XNAA 3V65A 1FAYA 4XETA 4AXOA 4TSVA 2VNGA 4COWA 4PBPA 1G6NA 2W95A 3N9QA 2Y0IA 4K40A 4Q5OA 4E27A 4LKSA 2ZX3A 1E5SA 2BZDA 1ULCA 3WDWA 1R64A 4YGEA 1UD1A 4MGKE 4DFSA 3VD9A 1YWKA 3LAGA 2V4VA 1OQDA 3ETQA 3TWIA 2NM1A 4FOQA 1V9U3 3ZN5A 3UJOA 2VZQA 4Y1UA 1LRHA 5L9BA 1LENA 4XUPA 1F8VA 5A1LA 3ENRA 3B5LB 4DQAA 2WC2A 1ULFA 2WFF2 1YFWA 3FUOA 4N90A 3RI8A 3VGIA 5A33B 1CIYA 5C9AC 3DGTA 2FD8A 3AM2A 4IEUA 4O9GA 3VBSB 3VN4A 5HCHA 1QOTA 2GU9A 4JZRA 2K46A 2TEPA 2X09A 3GF6A 4LA2A 4WV8A 4L99A 4BMEA 2FMDA 4AFCA 1AYN3 1I5PA 1BXHA 4Q4V2 2CDPA 4XIKA 1G9FA 1HJGA 4Q1RA 4CEWA 2QQLA 4XUQA 3HEIA 1OVPA 2ARCA 2RDRA 2ZAHA 4LHKA 5IK5A 4J6GA 2KR2A 4LE4A 3ZFGC 4QDSA 2ARXA 4P9YA 5BNOC 3CJIA 2RS11 4XFAA 5F32A 1J83A 2D6NA 3M8LA 3D3AA 1KQRA 1OUXA 1RMU2 3UKTA 1XU2A 2JDMA 4PF5A 1SDWA 1Z78A 4GD4A 4MVTA 2A73B 3POEA 2XOMA 2OZ6A 3AK0A 5ABJA 1IPKA 5A6YA 4RGGA 3H1YA 4K1YA 4WZFA 1LHVA 1OA3A 1OMIA 4YM3A 3GNEA 2ZGUA 4B7KA 1UOBA 2MEV2 1SLTA 2UWAA 1JZ3A 4P00B 3UNPA 3VBHB 4CDQA 4NVPA 1NZIA 1VJ2A 1QQP1 2JG8C 4R9CA 4A3ZA 3U0ZA 1FPN1 1AF9A 3ATGA 4FXKB 3W59A 4WVZA 4CP1A 1ODNA 1S0GA 1FMD3 2XQRA 2VBPA 4Z8BA 3R4SA 2IXJA 3OEAA 3AZYA 1H6XA 1TNRA 2WKKA 2VE1A 1UXZA 1VBC3 1U5IA 3DKQA 1D2SA 2XUMA 3ACLA 3GHMA 4LPLA 1AR73 3CZJA 3SXWA 4WVMA 3MEPA 2JWPA 2JEMA 3KVAA 1HXS1 2XKOA 4P9JA 4OUSA 5FYZA 4A45A 4XMAA 1H1AA 2VM9A 4CDUA 1VPHA 4QPWA 1JMUB 4DXTA 4XJAA 3V0AA 4LBNA 1VBA2 4YW5A 4BQ2A 2WNUC 1HJFA 1GLHA 4MXWB 4AEKA 5GM0A 3VD4A 1H8VA 4YGCA 3EBRA 2Z2SB 3ES4A 1HRV1 1GICA 1BJQA 1HDKA 3FLRA 1EPZA 1B09A 4PIZA 4QKFA 2VMFA 4CCNA 1JODA 2EAKA 2F4LA 2W9XA 3ZLIA 2P4EA 5D8AB 5CFCA 1IOAA 2E53A 3J8F1 2IFWA 3I3EA 2VAUA 3RVHA 2DVAA 2RMU3 1MQTA 3N9NA 1NLQA 1VAVA 1WMFA 3MIGA 3BN6A 5FXWA 3VDDC 3WW3A 4DB5A 5BNNC 1QH6A 5BNPA 5DAQA 1Y7BA 1URXA 4IGOA 2BWCA 2ZGQA 1ENQA 5FY5A 4DO0A 5DUVA 4QQLA 5JPMB 2GP5A 1PVC2 2D7FA 2ZX2A 2WO2A 1A8MA 4K3UA 5FUNA 1UX6A 2RDQA 4FVVA 4K8RB 3PMSA 4COVA 4P5YA 3AZWA 5HCBA 2FCUA 1DG6A 1GKBA 4M4RA 2VQAA 2ES3A 2UYAA 5FZKA 4OHZA 1UMZA 2JJ6A 3OD4A 1NE4A 5FP7A 1CAVB 2A75A 2BQPA 1CQ9A 2GN7A 2VNRA 2ZA9A 3I2FA 3MBWA 3P1IA 3DECA 2CGNA 3WW2A 1QJZA 1WWYA 2HYKA 4CPBA 1HRI3 3RZJA 4XHXA 2JG9C 3TN93 4MO3M 3H8RA 4Q4V3 3H1WA 2XJVA 1IZ3A 1VBD1 4JVAA 2XL9A 3ZSJA 5JSPA 1R092 3KF5A 3SCFA 2V09A 2DV9A 4URTA 3RNSA 1RUD1 4EQVA 5F2WA 3IWZA 3NSTA 1LOAA 3GZEA 4ONUA 1RMU3 3WP5A 3RWNA 3KCYA 5A7WB 2PXJA 4AEDA 2D5FA 2A5ZA 4LBJA 1S1AA 3AZVA 3WNLA 3ZOIA 2GMEA 1R081 5J7MA 2ATFA 2RS51 4D7SA 1H4GA 1GP4A 2ZEWA 1IPJA 2YFUA 2CWSA 1BMV2 3TYJA 1TME3 5IVEA 3M3EA 4E9KA 1C4RA 4AVBA 2NZ9A 3MFCA 1WLCA 5FLIA 5LK5A 3VBRA 3F2ZA 3JU9A 4QQOA 4CCDA 1KFXL 1XNTA 3IIIA 3C7EA 4WBBA 3D0SA 4I0BA 3MV01 4W4ZA 3OY8A 1PMHX 1XBFA 2WZEA 1MS5A 5JI9A 4AHXA 5FRAA 3ETPA 1E5IA 2VGDA 4AL9A 2D6PA 2B9VA 2QZ3A 2IC1A 1PO22 3H50A 5FZEA 3SHRA 4Y3OA 1AR61 1G9CA 3IBMA 1W8NA 2FDKA 1V6LA 1YIFA 4CSWA 3UJQA 1IKQA 4ZS3A 3AJZA 2E7TA 2R0FA 3EYPA 1ASJ3 3LD8A 1WW4A 3ZPYA 3RG0A 2CU5A 1CESA 4LIUA 4XAEA 5CIRA 4N43B 4AHZA 4A7ZA 3ACIA 3HBZA 5JXHA 2JXAA 2ENRA 2G9FA 1DGRA 1AJKA 3HWJA 1XJAA 5FZ1A 2J1VA 1BHGA 3VDCA 1GANA 2HH9A 5FK8A 4HKWA 5IHRA 3CMGA 3M3CA 5FMDA 4CDQB 1UAIA 4LKEA 3C3VA 1XPWA 4QPIC 1RUI2 4NN0A 4NROA 5DPNA 3WHUA 3RZMA 5JOWA 4NIHA 3MYXA 1BBT3 2OQ7A 4Y4RA 3ZDVA 2Y0OA 3JZVA 4KH9A 4RD7A 1K3IA 2AREA 4MXVA 4YZ3A 4UXAA 3A22A 1W9YA 4QPGB 3VBFB 4YM2A 3I2IA 3O12A 3OJBA 4N8MA 4WM8B 2W3JA 3WD5A 5LA1A 4A42A 2X8KA 2ZHKA 1RINA 4NHYA 2W1QA 1DHKB 4DS0A 3I3MA 1NCRB 1RXFA 4YW4A 1W2NA 5A80A 4QB6A 5F1RA 4Q4X3 3PHMA 3HOBA 3KCCA 1SMVA 3V56A 2IVIB 3UGHA 4V2WA 4L97A 4WM7C 4LEJA 4EZ4A 2VTFA 5AC93 2AGSA 3U37A 5LB6A 2DCKA 3VBOC 4CXWA 3S5AA 2BBAA 4KMQA 3AMQA 4XUNA 4G3YC 4WVVA 1DGRN 4PIXA 2IXKA 5LBFA 1LOEA 1O6UA 3APBA 4CU8A 2XUEA 3H8XA 1R093 3DF0A 1VBB3 2ARBA 3O5SA 4S2FA 3ZMOA 3CF6E 2ET1A 1LGNA 4EN6B 2UWBA 3BB6A 4JDMA 4I0AA 4YVWC 3W9AA 1OA2A 2QTWB 3FFQA 3WDTA 2IUWA 3VBUA 1ENXA 4ASKA 2EALA 1X8EA 2GP3A 5BNPB 5C8CA 5HPOA 4FOYA 1G86A 4EN9B 2PHRA 1AYM3 1RUG1 1W6QB 3KHCA 4IERA 2A71A 2C9AA 4LMFA 2VUJA 3H3UA 3WSOA 3D0JA 2EVXA 2TBVA 4QXBA 5A70A 5C71A 3NAPA 1CIWA 2Y6HA 1MZEA 5DZEA 1TZOA 4AEMA 5JAXA 3HQRA 4Y22B 2VBDA 1JYTA 2YG0A 1QQP2 3OPZA 2QVSB 3KCXA 2DVFA 1FPN2 1AUYA 2BDRA 1ULPA 5FYYA 4AVTA 2E32A 1MPXA 4QB2A 2IFRA 2PLV1 4UFMA 1OOPA 4CU7A 4CCJA 1F4HA 2LTNA 5FDBA 4IEVA 2VQTA 3ASIA 5FY7A 4YGBA 1X9TA 4RS5C 1VIWB 4UYBA 3PURA 2VH9A 1ZZ7A 1SPPA 2XR4A 5FZ4A 2QUOA 4IE5A 2GSYA 1VMHA 1QHDA 3J4UH 1F5JA 1PZ7A 1AXKA 2VO5A 3B94A 4ZY9A 4PQ9A 2Q8OA 4H55A 3ZFFB 4PDWC 4DEQA 2FDJA 3WCRA 1A3KA 1OH4A 2VECA 1FX5A 4KNCA 2VNVA 1LOBA 4GALA 3ZVXA 5FYCA 1ND3B 2E9QA 2Q4SA 3NV3A 2HEYF 4YFWA 3QH7A 3AP9A 1QEXA 2E26A 5K9YA 4LO8A 4GJZA 2C6SA 4I09A 1S2KA 2RHPA 5BV6A 3O14A 2GH2A 2FHRA 3WQ1A 4CEYB 3VV1A 1F31A 4D6SA 4COUA 1B35B 4XAAA 5JSRA 2Y38A 3NRUA 5H9PA 1POQA 3K4ZA 1OF3A 2PELA 1C8M3 1LKNA 1MZ5A 1ZBE3 1Q8VA 2VQ0A 3SCHA 4MSVA 1ODMA 2ZX1A 1VRBA 4ZS2A 5C9AA 3MUY1 4QXKA 1LECA 2LS6A 5IK4A 2FDHA 3PJYA 4X8NA 4R4ZA 3POGA 1O4TA 5LY1A 2ZGTA 5DAWA 4XFHA 5DG1A 5KHIA 1ND2B 1W6PA 3RDIA 4RR3B 2HWB1 1AR81 1QXRA 3M1HA 4GH4C 4SBVA 4KU8A 3NJXA 2BVVA 3CHXA 4MOAA 4XOGA 3ZFGA 1UKRA 1HB1A 4UI9L 3HNBM 1BVVA 2R7EB 5BNOA 5L9RA 5IVBA 2YHJA 4JGZC 2HJIA 3VZOA 1H0BA 3BTYA 1K42A 3LSEA 2R071 2D40A 2W52A 3AVRA 4NIGA 4BE3A 4IW3A 4HG6B 5K4LA 1XE8A 5I8TA 4XQDA 1O8PA 1UY1A 3MIBA 5DZFA 3ZFEA 3ZXJA 1VBD2 2Z42A 1VRH3 1EUTA 1AR91 2UU8A 4KGQA 4MV2A 1F5FA 1RUD2 4FPGA 1JZ2A 2RR11 1XYOA 2X5IC 3DXTA 2XQXA 1H8TC 1UU5A 1LJ7A 5FPVA 1W99A 3KQRA 4XFIA 5IUQA 2VMDA 5GZEA 3SKVA 3CZUA 5EQUA 2EIDA 3LIHA 1AX2A 5FFOC 4A7YA 1R082 1QIQA 2RS52 2E63A 2ERFA 4M0NA 3RYPA 3S7EA 3NKGA 3VKFC 4C0BA 4W6XA 4NPRA 4UF0A 5A3NA 1JOPA 3CQOA 3PVBB 1QJU1 1G9AA 3KV5A 1WBLA 2OX0A 4BMBA 4PLOA 4K8FA 2Z69A 1CAUA 3W20A 4JDNA 1UZVA 4IEOA 4B29A 3SC7X 1BK1A 2FDIA 4ASLA 3RYKA 3FBYA 3MLLA 4Q26A 2CHHA 2WNUA 1O3TA 3WDUA 4FCAA 4QU1A 4C8DA 4DRRA 3ROUA 3POWA 5A32A 2Q1FA 1D7PM 2V5YA 3JB8A 4OZOA 4B1MA 1LHOA 2DTYA 1IPSA 4QAWA 2SBAA 4GWIA 1MVEA 4W8JA 1U0AA 3TNPB 3ZXFA 1AR62 5LW9A 3NMBA 3AYAA 2W1SA 2ILMA 1EYBA 2MNGA 3OBRA 2E31A 4FQZA 4FTBA 2WLQA 1ZRIA 3NNFA 1GWLA 4JRLA 2WYFA 5FMCA 1HQNA 1NCQA 2VG9A 2BP6A 2ARAA 4XF3A 5AFBA 1YO8A 2BVBA 1QDOA 2Y6JA 3I59A 2VU9A 5HCAA 1O3RA 3O7OA 5BNNA 1OC1A 2DCYA 2WL1A 1X36A 1MZ6A 3BPSA 4GKXA 1LHNA 1NXD1 1PGW1 4HN1A 2WINB 5LK7B 3C7FA 4OZXA 1RJ8A 3HN1A 3PUAA 4AI1A 5EPAA 4BQ1A 2H6BA 5F7UA 1FI2A 2XJQA 1NQJA 1V6IA 4LUMA 2EIGA 3IZOA 2ID4A 5C4WB 4CCCA 5F37A 1W0OA 2GNMA 3UKVA 1DQ0A 5JXJA 3HBKA 4HK9A 5IATA 1FOD3 3EB7A 1LEMA 4AFDA 1HKDA 2GC3A 3T0AA 3MV11 3MHZA 2UY8A 2WT2A 1UWWA 3WG3A 3ZO0B 1QJX3 1SBDA 1N47A 1HB2A 2OKXA 4CUAA 1PX4A 1SPPB 2IWGB 2EA7A 2JG9A 1V00A 5L36A 4QD2A 4MGZE 1V0AA 2GMMA 1SLBA 1QNYA 2A3WA 4NHMA 5E88A 3H3LA 1WCUA 2PFWA 3AKTA 2WFPA 3MW3A 2Q5TA 1EV11 1UIJA 5B4NA 1WCKA 3X29B 3T30A 1TMF1 3ZYIB 4IV1C 4O7XA 4J25A 2WWJA 4UFHA 1W39A 5IFPA 4COZA 2W92A 2YZ4A 2WYSA 1GOFA 5IT6A 1WCQA 1YNAA 4NWWA 3WP4A 2G4IA 2YFZA 5DUXA 4IV3A 3TNQA 2OA2A 3MF6A 5KHJA 4O65A 1W3VA 3LGRA 5FYMA 2DBNA 4LIVA 2VY0A 2VQUA 2WNVC 3DPRB 1HIXA 4BCUA 4E8CA 5J37A 2YUEA 3O1UA 1DDLA 2P6CA 1EY2A 3TOJA 1W8ZA 4FAGA 3V0BA 1AL21 1COV3 1YFYA 1NYWA 1ZBA1 1S0EA 1WCDJ 3LDBA 2E7QA 3LFMA 4IEQA 1DLCA 3NNLA 5A6XA 5JDBA 3BIWE 5E89A 4FPLA 2EIBA 4UW5A 2R061 4XXAA 4XQWA 2B42B 2ADDA 1H6YA 1AHSA 1RUG2 1UNBA 5AFEA 2P3YA 2VVDA 1POV1 2C1FA 1NY71 3Q8AA 3M4FA 4YW2A 1V6MA 3WNKA 2XH6A 3ZMNA 4BLJA 1S0BA 3KWVA 1POV0 3KMHA 3ZFGB 1WBFA 2DU0A 3KT1A 4ZONA 4DXZA 4F83A 4XYXA 1W2UA 2AR6A 1ULEA 2W2IA 2WQZC 5T5JA 3VL9A 1ZRRA 3WNMA 4AGVA 1FNYA 5FP3A 3OYWB 1W90A 2CYFA 3DYMA 2PLV2 2HWD2 4DNYA 2JDUA 2W46A 5BPXA 1IQDC 3JBG3 5AVAA 4BQ4A 4HPKB 4AVAA 3ZFEB 3Q8BA 2EF6A 1RUC3 1ZM1A 2PHUA 4V1PA 5A3WA 1AR63 1N1VA 1NZCA 3KGLA 4E4HA 4BYYA 1K45A 4KWKA 5EV7A 4ZPIA 1VBE1 3BCWA 2BWAA 4QPIA 5T52A 1WMXA 3BALA 2WJSA 4IGPA 3KQ4B 5D2AA 4PI0A 3ZSMA 3RSJA 4YNIA 5EJ3A 4EN7B 2AYHA 3LKJA 4XFBA 3B01A 3F95A 1VE0A 4XF1A 2YYOA 4PI2A 2P3KA 1L7RA 4JV4A 3D4KA 3KT7A 4FOVA 5FZIA 1YLLA 2XBO1 4N53C 1CJDA 4LR4A 1BLZA 2JKBA 1YFXA 2OS2A 1GBGA 1C28A 2CL2A 2CDOA 1LEDA 5K0UC 4FOWA 4OI0A 5I0DA 5KHGA 4CYDA 3KGZA 3SEPA 3FN9A 1OT5A 2BV4A 2Q0AA 4WM7A 2VR4A 5FZDA 1DBNA 1JBCA 2ZGSA 5IJRA 4OYUA 5ACA2 4NHLA 5A32B 3IDAA 3GGLA 1JS9A 4CDXC 3PTYA 4DY5A 3WW1A 2O0OA 4MH0E 4RFT0 4FFGA 3VBOA 3KM5A 2GMPA 1OLMA 4Q4W1 3UV9A 2OUHA 3NV2A 4NJ4A 5FXVA 1L7LA 1TEIA 2G9ZA 3MLJA 1IS4A 1RC6A 2RDSA 1R1A1 3NJZA 2OYZA 5J98B 1WW7A 2VW1A 2ZMNA 3IPVB 4CCLA 1NCQB 4Z82A 4YVWA 4Y1XA 5FREA 5FZGA 4M01A 2HEWF 1KJLA 3I59B 5FPAA 4G9SB 1ZA4A 5FZCA 2W91A 2QBXA 2A6WA 3EJKA 2VOKA 5LRSA 3SH3A 2R041 4IE7A 4QKBA 4D0QA 2R072 1PZ8A 1GMMA 1RUOA 1KJRA 2GZWA 1Q56A 3VD7A 5LEJA 1VAKA 1JZ4A 4GWMA 4XTMA 4ARYA 1REDA 3N9PA 4Y24A 4I0WB 3BPZA 2BTVC 5JPNB 5BNQA 1JHJA 2KA3A 1AR92 1V6JA 1SCSA 3FZ3A 4XEZA 1JYWA 4LKDA 5I0SA 1PHMA 2RM23 5EP9A 4W65A 2RR12 1A34A 3QACA 1O3SA 1IQAA 2YPJA 4XDOA 4FPYA 4F8AA 4MGIE 4BWOA 2JE7A 3WQBA 1GQPA 4DINB 2VMIA 4FTEA 1Q8SA 3BTXA 1RUG3 3B02A 1CAXA 3L2YA 1D4M3 3LB9A 3D82A 3VZJA 4RS5A 2LUWA 4BXFA 4GAZA 4NHKA 3OEBA 3E5XA 1PO12 1O7FA 1RHI3 1CN1A 1PX3A 3WG4A 4X8PA 2HWE1 4AQTA 1N1YA 1XOYA 1HQLA 1JYCA 1JN2P 4RQPC 2J7MA 4LOTA 2V4AA 1W8UA 1RUE1 4UFJA 4L11A 2HWD3 3VDAA 4PDWA 3WXPA 1PGSA 5E8AA 3RYRA 1GOGA 3MW4A 3OD0A 1XNCA 1LOCA 4YVSB 5HBAA 1JYNA 1ZVFA 5FQ0B 2P17A 3CLPA 4IV3B 3SLIA 4BH9A 1G9DA 1RUH1 2DVGA 4RHV2 1IS3A 3AMNA 4B3NA 2VZVA 2B9UA 3O1RA 2B7YA 2L9LA 5DDJ2 1ST8A 1MEC1 4ITCA 4GA9A 4META 4RA0A 5CAZA 3V0BB 3O1TA 4NRPA 4DUXA 2VZOA 3ZXEA 1JI6A 3WDYA 1K5MC 5JZGC 2WA3A 1NA1C 1XU1A 2OT7A 3N7MA 4Y1VA 3LDKA 5L7OC 4M3CE 5C3QA 5IFTA 1RVF1 2HLEA 2EXJA 1DF0A 1RIRA 5F2SA 4AR2A 3HQXA 2QKDA 3J7LA 4QX8A 1KGYA 2XVKA 4ARXA 1PGW2 3WF0A 3ACFA 2E51A 2VPVA 3JQXA 4I30A 4Y20A 2D97A 2BUKA 4PHZA 5FYSA 2DU1A 2YGLA 3WR0A 2GALA 1H30A 1ZREA 3USUA 4B1LA 2HYXA 1UPSA 3MFAA 1VAMA 1RXGA 4GH4A 4DY3A 4J1WA 4Q29A 2OPKA 1I1EA 1O5UA 5ACA3 5CFDB 3QBQA 1G7YA 1WLWA 3HD8B 2BGOA 1UYPA 4JGZA 4NOTA 2XJUA 4R9DA 3UETA 1SACA 5FP8A 2BERA 1RUJ1 5IVYA 5EXOA 4HSJA 3POJA 4JGYA 2P5BA 3B3QE 3LPGA 5L9VA 5T5OA 1SFPA 3BOWA 4M3CA 5FYTA 4HBNA 2JDZA 1DQ4A 5LRRA 4A6SA 1CAWA 1ACCA 3AYCA 3MIDA 1EV12 3L9JT 1RGSA 4AQ6A 4YFZA 2X5IA 3VD3A 3B9IA 3U11A 1H8TA 1TMF2 1VMJA 3GALA 4U36A 3VB9A 1RUF1 5EFUA 2DF7A 4Q8LA 2DBIA 4Y26A 1UY0A 5FWEA 4CDWC 2E7AA 3QLQA 4W6YA 2YV8A 1IG0A 1WGPA 1I3HA 4IE6A 2VW0A 3R6SA 4BB3A 5JIUA 2VOXA 3LDRA 4UAPA 4Q0SA 3N9MA 3PLQA 3NJVA 2PTMA 2R1DA 3LA2A 5C3RA 3ME2A 5JUVA 2TUNA 3VZKA 2P3JA 4XQ4A 2QQMA 1LOFC 1DQ6A 1X9PA 2WFF3 2VMEA 3K2OA 4JQTA 4MGTA 1VB2A 5B4XA 4Y5SA 2J22A 5EJ1B 4QM9A 4QX5A 5A3OA 4JHTA 2VMCA 1ZBA2 2WS91 4QXCA 2JECA 4QDQA 3JUUA 4EN8B 1YXWA 3A7QA 2R062 4JTNA 1MVQA 5CBLA 2Q8DA 1W03A 2YU2A 2BPA2 1YIPA 1W2AX 4AWDA 1PO13 1OLRA 2GN3A 4Q4Y1 3W58A 1CPNA 2NN8A 1E5RA 1MZFA 5IVJA 1NY72 1MS0A 1OXCA 2YBKA 4XCBA 5DXDA 4D3WA 2CSGA 3K3OA 3O1PA 1Q8PA 4OI4A 4XBLA 4DPNA 1DP0A 1HLCA 1Q8OA 2ZJCA 1MS3A 2AZ5A 3HPNA 1O4YA 2R32A 4CP0A 1SFNA 2ZGLA 3VBSC 1J84A 4AGGA 4RHV3 1UO9A 2F6BA 2FZ1A 2MEV3 1OKOA 4NIDA 2H6CA 1E5HA 1F15A 2H0VA 4MHRA 2XLFA 4FI9A 5I93A 2XPJA 5DDJ3 4P9LA 1DGWX 5J1XA 1UXXX 3N4MA 1YJLA 4Q0UA 2NP0A 3LE0A 5EJZB 4PLNA 3RJ2X 5FYVA 1VBE2 5FMOL 1Z7S1 4LO5B 2VUAA 4QHZA 5C5TA 4CXYA 1BEV1 3ZXAC 1REFA 2OVUA 5CU1A 3KB5A 2DYCA 5FIXA 4AI8A 3I2DA 4IESA 3SISA 2BFUL 4GULA 3TRSB 2ZMLA 5JR2A 1ZNPA 1QJY1 1ZRFA 5GLUA 3DCQA 1CGPA 4DMIA 3AKSA 1I5ZA 3AMHA 4XW3A 3EO6A 4CEWB 2XBO2 2CV6A 3I3QA 4OQ8A 4BQXA 4B8EA 1LR5A 4XHBA 5DZGA 1VBA3 4QX3A 3VBHC 3CJIB 2NMNA 2XDVA 4FFIA 1FATA 1Z0HA 2PHDA 1HW5A 1OKQA 4IV1A 4LK6A 3N9OA 5ABJB 5HCFA 4AFBA 4I3PA 1H1MA 5C70A 1WA4A 1H2KA 2SLIA 2A6VA 1OLQA 2HWF1 3JCIA 4XUTA 4ZXEA 5KXBA 3JD71 5LASA 1C3HA 5FMOS 4Q4W2 3ACGA 4DXRA 2VBBA 3A0KA 3LOIA 4BA6A 1N3QA 4BLIA 4XMIA 5J48A 1JZ5A 4KBBA 2C0ZA 3DKWA 2WWUA 2PN5A 3PVOA 1R1A2 1PK6A 2WNVA 1GP5A 1SG3A 2RS31 2XLGA 4AHYA 3DXUA 2Q8EA 1YYNA 3NQHA 4H7LA 4LITA 4QGNA 4COYA 1GYKA 4Y5Z0 4ZU7A 1BQPA 4LXLA 1A8DA 3T2OA 4M00A 4CP9A 2ZEYA 4JQRA 2R042 4E4DX 5FJHA 1PVC3 3M3OA 1DZRA 4WVMB 1CD3G 2VZ1A 1OFSA 2DUOA 4AQ2A 1GWMA 2W94A 4LO7A 4RGAA 2NPIA 1BK0A 2PMWB 2ZS6B 3RQ0A 5JMOA 4Y4YA 1OHFA 3E5QA 3N9LA 4NAOA 4CDUB 5IK8A 3HR9A 2JE8A 4LO4B 4UFKA 3WCSA 2PAKA 3WDXA 4D6RA 4EWEA 3V0AB 1LODA 4BK4A 4OQ9A 5D8AC 5A7NA 3MUZ1 2ZX4A 4AF9A 1Q3EA 1X33A 2R16A 4OMCA 5F9TA 3OBZA 1EAH1 2ZAAA 1IS6A 4H3WA 1MACA 1Y9MA 1S2EA 3HAGA 3N7KA 1O59A 3POYA 1JYVA 1W8TA 4CU6A 1W9SA 3D5OA 4BU2A 3W5NA 4V2VA 2DCTA 2IXCA 4JGYB 2CAUA 3RFRA 3UT0A 1Q5OA 4H2AA 4C90A 1YC61 1IGOA 3IB3A 2GC1A 3IM0A 5DN2A 3CEWA 3R0RA 4S2HA 2RVAA 3ST7A 5CFCB 2GNTA 2Y8KA 3BYWA 4XZPA 1CX1A 1H9WA 4LBQD 2ORZA 1DIWA 2HWE2 4QHOA 4LORA 1MQTB 1H8TB 2CNAA 4RSUA 2VCMA 4LTAA 4AI0A 1UZ0A 4EJRA 3KD4A 2RS12 1KITA 1RUE2 2PHXA 4GMP1 4YZ5A 2FDGA 2VC9A 1W04A 4HMZA 1GWKA 1PNGA 5FY1A 4Q27A 4UFIA 5CZKA 4I01A 1MS9A 3A0NA 4L0PA 1RUH2 4LHNA 5KC5A 1CZTA 3D6EA 1UZZA 3DL3A 3SH5A 4BHPA 1PVXA 3AXEA 3OG2A 4N53A 5IAXA 2LRPA 1V9U1 1XYNA 1OVSA 4NHXA 1DQ2A 3KT4A 4XJWA 4Z07A 1MEC2 1ZA7A 1NX9A 5K0UA 4MYEA 3U14A 1APNA 1NAEA 1D4VB 3TBDA 1GU3A 4LOSA 3WLUA 4CCOA 1JUIA 4JX0A 1UKGA 5CKMA 1RVF2 3P5BA 2WLPA 1SBEA 4FPJA 4PCRA 5FZHA 3W21A 4JTOA 4CDXA 1PO23 3VUOA 1XYPA 1UX7A 3FC0A 4K1ZA 3T4HB 1OH3A 1SFYA 3PU8A 3R05A 1TVGA 1AYN1 2ZPXA 1RYYA 1UOFA 2J1AA 4FBFA 4F7ZA 2JB8A 4AI9A 1HXS2 4ATFA 1UY4A 4NAMA 2JENA 4AHWA 4AEDB 5FZFA 2WDBA 4IEPA 3PL0A 3A21A 3AYDA 2DUQA 3CNAA 4LBMA 4ZXKA 1UY3A 2VL4A 5CB7A 3S5QA 3UYJA 4NR1A 4OMDA 4LHLA 2XB6C 1PMJX 1V6NA 4NRMA 1SCRA 1RUJ2 2R6QA 1HRV2 1XQNA 3E6BA 3T2TA 4K6BA 3B9CA 3VBRB 2OPWA 2Y60A 4YARA 1RUI3 4NRQA 1KS5A 3WQ7A 4L2NA 5GZCA 2FCTA 4LA3A 3QD6A 1RTVA 1PGL1 3ZN6A 3M70A 2NLRA 3OY8B 3LEGA 4OFGA 3J8F2 3AL6A 1W8WA 4N43C 5F5CA 4PIYA 4BK5A 1FMD1 1X82A 5FKCA 4DOUA 1RUF2 4TN7A 2Y33A 2HBTA 2BGCA 4TLFA 3POFA 3IMMA 2DFBA 4HVOA 3FE5A 3VKMA 3VHRA 2ZGKA 1AR71 3PMEA 1PM4A 5A7OA 1DU3D 3N36A 2R1BA 1FV2A 1W8OA 4CDQC 3M3QA 4FP3A 3FX3A 1GZWA 2BEOA 3N35A 4W6WA 2VTXJ 1JOJA 4HZFA 4RQPA 4YW3A 2WT0A 4IV1B 4UW3A 4E2QA 4N7IA 1UMIA 4YPJA 4NIIA 5L19A 5EHDA 2ZHMA 4FPFA 2CGPA 1D2QA 1FNZA 1LGCA 2D98A 2WS92 3KSCA 4YM1A 1S0DA 1RITA 4LO6B 3C7OA 5IW0A 5FXXA 2YC2A 4QPGC 3VBFC 3FMGA 4XF9A 2XJSA 4WM8C 4MUVA 2ZTNA 4P9XA 3GZUC 1F2NA 1SBFA 1MS1A 2B4KA 4HVRA 1PK6B 5JR7B 3ZSKA 2C9KA 4Q4Y2 5F5QA 1NCRC 2PHLA 2YGMA 3ES1A 1KEXA 5KXEA 2KM2A 2WSUA 2ADEA 3PJQA 1OPOA 2JG8A 3H7JA 4UW6A 5LA0A 5FZOA 2RS13 1RUE3 2WT1A 3BIEA 5JZGA 1K5MA 5DAVA 1JUHA 5L7OA 2RMU1 2EIEA 3M3IA 3MGUA 1FT9A 5FY4A 1S55A 3O0WA 1W6NA 4XVHA 5ANQA 3AFGA 2BJSA 4BXSV 5FPXA 1W6OA 3I8TA 4JHZA 1JZ7A 1GZ9A 4OULA 3BU7A 2EAAA 2DVDA 2GAUA 2WO1A 4YW7A 2W47A 2YU1A 3FWEA 3GCXA 5CISA 1JYIA 2I07B 1QF3A 3L2HA 1QQP3 4HL0A 5A6ZA 1FPN3 2VW2A 3R4DB 4OHWA 2QDNA 2D6LX 5JVVA 2D3SA 1Z7S2 5FUIA 1DQ5A 4P14A 4TXWA 4B4QA 3AX4A 4YZ1A 5A3TA 4RYDA 3WW4A 5G05L 3J7MA 1QKQA 3IDEA 3OUJA 2DVBA 1UOGA 1NLSA 3A23A 1ZZ9A 4DRVA 3J7NA 1UMHA 4H7MA 1HRI1 4XDPA 4R9BA 2Z4FA 1QJY2 3TN91 3RI9A 4NPLA 4C1WA 3I49A 4Q4V1 2VOTA 5E1RA 4F3JA 1HXS3 4ZZ5A 4A7KA 4QKNA 1ZZ6A 2WR9A 4LBLA 3VBUB 2EXHA 3ZSEA 5DQ0A 5C8CB 2VD7A 1RL3A 1UOJA 1RMU1 1U12A 1W06A 4EE2A 5F3IA 2ZGNA 1SZBA 4IETA 4YG6A 3WY6A 2X05A 3VDDA 3WG1A 2ZCWA 4FXGB 4CDWA 5GZGA 4R8HA 3RZLA 1VB4A 1KRIA 1HRV3 4E8DA 1UIKA 2HWF2 3NAPB 4ET7A 1LGBA 3J9SA 4BQ5A 1TME1 3S30A 4NO4A 3MW2A 4LHSA 2UURA 4ORFA 4P9GA 3RZGA 5M0TA 2P6HA 3AMMA 2Y26A 4E4ZA 3J8F3 3N7LA 2RS32 1OOPB 1DYKA 2BOIA 3WP6A 3P3PA 1BZWA 3ZFFC 3RZZA 1RUF3 4EROA 2D3PA 3WNXA 4I02A 2A3XA 4ASMB 1A6CA 5FO7B 3B7MA 2RJLA 3T3YA 2XVGA 4ATEA 4QQ2A 3V64A 1ND3C 3H3ZA 4YRDA 1V70A 3LA3A 5FLJA 4GB31 4OI1A 2WAOA 4ZKTB 3W5MA 4P5HA 4M0HA 1ASJ1 5H9QA 4XJ8A 4CEYC 2W08A 4TTGA 1HQWA 1WW6A 4KI5M 1PNFA 3B69A 4S2DA 4XDQA 1EPWA 1U5XA 3FUQA 4UOJA 1B35C 3FFZA 1NUKA 1EAH2 1W3XA 2HBUA 4P02B 3OGVA 1ZYBA 5BUVA 1M06G 3ILNA 2XKPA 4ISRA 5A33A 3URFA 4KU7A 2OUJA 3WEZA 4OCTA 3ZN4A 3VBSA 2C26A 4J1XA 4CA9A 2UYBA 1VBD3 4INDA 2J42A 5F39A 3EQEA 3UL2A 5EZWA 5FZMA 5IVFA 1V6OA 2Q1MA 3TEZA 3U4XA 3AFKA 1RUD3 2K0GA 2ZX0A 2CWMA 1IG3A 4XFCA 3T08A 1ND2C 3C2UA 3UK9A 1W6MA 1SQ4A 4RR3C 1QOOA 4XILA 3NL1A 1EUUA 5LWBA 1BBT1 1P8JA 4XPVA 1S0FA 2DURA 2E33A 2BBVA 2YB7A 4KWJA 3LZZA 1LU2A 5C9AB 1R083 1WLDA 4A4AA 2QFEA 2RS53 2BNOA 4HSLA 2PQQA 3OF1A 2GH8A 1VR3A 2JIGA 2XG3A 4LULA 2F17A 4AFMA 4DUWA 5FZBA 3ELNA 2P2KA 3PUHA 5JI7A 2LM3A 1W6PB 2J1RA 4KGGA 1ZRCA 4FPKA 2Y6LA 5BXXA 3U4SA 3O0XA 2HWC1 1YQCA 3PTRB 4Q4X1 5DMYA 4ES8A 5BNOB 4C0HA 3H42B 2RV9A 4GXLA 1GZTA 3OOXA 5AC91 4OHVA 2IXHA 3WZ1A 4XJZA 1US2A 2GDFA 4QKDA 4MADA 5FPLA 1SLLA 3OPTA 3WX5A 5JOXA 4FT8A 2DDUA 3T0BA 1VBB1 3IDCB 5FWJA 4URAA 2JG8B 3VDBA 3OCPA 1PZ9A 4AOCA 2PAEA 5FY9A 5D1IA 1NOVA 2ZHLA 2OQ6A 5F5IA 2WRAA 5FPUA 1D0GA 3NNGA 2J1UA 1YI7A 3FLTA 2BYVE 4JKMA 5FR3A 1SEFA 2P3IA 2W1UA 3ZYJB 2Y6FA 3DN7A 5FPBA 4MXWA 1WKYA 2GC2A 2VZ3A 1AYM1 3KV9A 4UF0B 4XZUG 3ZYBA 3KF3A 4WVWA 5APAA 4EN0A 1GOHA 2X10A 5C3SA 1C57A 1TQ5A 3Q8CA 5IVCA 1UZYA 1CAUB 2CAVA 1Y3TA 4CCKA 5FOBB 3AKPA 5FZ9A 3KLSA 4FFFA 1OA4A 2BOJA 2JDNA 1DYOA 3IKWA 1PGL2 1QXPA 2W68A 5A6QA 5D8AA 2WNUB 3WUCA 2F4PA 1HX6A 2YC0A 3E1F1 3KVBA 3NO8A 5I0RA 3HQUA 3PNAA 3THPA 4IEZA 1QWRA 1Y43B 1FMD2 5J96B 1CZVA 3MPBA 1MR5A 5FZAA 3OGRA 5GZFA 3JQWA 4CU9A 2LW8A 2R49A 2XXZA 4XFGA 5KHKA 3NV4A 5FYUA 3Q8FA 3GYDA 3MIHA 4PQQA 5J09A 2A6YA 4IEXA 4GWJA 3S0MA 2HWB2 1AR82 2VZTA 3T09A 5C4WC 2VCCA 3OTFA 4B4RA 5FZ3A 1XNKA 3VDDB 5BNNB 1ENRA 4X6RB 4AZZA 2CTVA 4TWTA 2YROA 4EZHA 3BKZA 1OBNA 2WBKA 4LE3A 3GBFA 1PM7A 3THTA 2QNKA 2IXLA 3B93A 4LNVA 4AVVA 5HV0A 3CJXA 2YXSA 5FCCA 2VOVA 1W9TA 4Q2FA 1JZ6A 2IVJA 3UGFA 3ZYFA 3ORJA 3HIFA 2AH2A 3HNYM 2FMYA 2W0XA 1Y9QA 4QGLA 4MGSA 5FUPA 5J36A 4CZSA 4WZCA 4YGDA 1J1LA 2G1MA 4FP2A 4BZ4A 5C6CA 3HVDA 3O1SA 5FXZA 1DZQA 2WAAA 1LB2A 3WF2A 1FV3A 3O1MA 1U5ZA 5EWSA 2RMU2 5A7WA 4N9IA 2AEYA 1UF2C 1C8M1 1ZBE1 5LBCA 3RJRA 2ZACA 1H9PA 2JG9B 3HT1A 1XE0A 5FJKA 1T2XA 1OPMA 2MPFA 1GUIA 2EXKA 1QJU2 5SV8A 5EYXA 4GKYA 4YZ4A 3ZYPA 3DPRC 3GBWA 1DZTA 3AKRA 5A3UA 3P6BA 5F6LB 1C1FA 4GIQA 4TLGA 3VKLA 3SCGA 3KS7A 2PLV3 4U2AA 1SLIA 4HT1T 3E97A 4XUOA 1XE7A 2YY1A 4X6QB 1UL9A 1C5IA 5CADA 4IXLA 3WF1A 2WQ8A 5FOJB 2D43A 1HRI2 4MX3A 1YI9A 3ZR6A 1S0CA 2PHTA 2WO3A 3TN92 4OHXA 4IE0A 3CBNA 1VP6A 2JDYA 3OUHA 1ZRDA 3K75B 1W6MB 3AMPA 3THCA 1VRH1 2CY6A 2NQYA 2Q30A 3I97A 3PIJA 4LKFA 2JD4A 2VULA 5CYYA 3U07A 5CVRA 3RPQA 1SDDB 4CP2A 2QQPA 3GJBA 1Y4WA 2O14A 2B46X 2WZR1 4N43A 1W2OA 3ZYGA 2ZABA 4Q0VA 4QT6A 1XB9A 2LROA 2XVLA 3MDPA 2XMLA 4FPCA 3INAA 1US3A 5D21A 5T5LA 1S2BA 4YZ2A 2AUYA 2I45A 3K4AA 3DUIA 1LNSA 5DUWA 3ZFEC 4AGRA 1QMJA 1Q43A 1AVBA 2MHFA 2VZRA 2XHKA 2ZGRA 1TME2 1RJ7A 2RDNA 2XGXA 3HMYA 5FP4A 2XHNA 3BOPA 3TEWA 2Y34A 3BGAA 3RS6A 2VCBA 4K7JA 1I9RA 3E5UA 2FDFA 1GV9A 3MIEA 1GNYA 1LU1A 1KFUL 2A6ZA 1G9BA 1UYZA 2D6MA 1FXZA 4E2GA 4BM8A 1TE1B 2XLAA 5F6KA 2JE9A 3AP7A 5IAVA 4JCKA 4W50A 5BYNA 3VBFA 4LK7A 4QPGA 2RJKA 2G19A 4WM8A 5KXCA 2DUPA 2YPDA 2C5DA 4AK3A 4NMIA 2RG4A 2C4XA 4R9AA 4LJHA 3UESA 4GB32 1GP6A 4QPIB 2HWB3 1AXZA 3GZAA 1AR83 1NCRA 3I2GA 4XXPA 4EWAA 5KWRA 3NNMA 4OUEA 1ASJ2 3ECQA 3SEEA 4QX0A 3QCWA 1O91A 1DCSA 4BIOA 2VMGA 4FPEA 4QU2A 5LZ6A 2Y64A 1T6GC 3C8XA 5H9SA 4AVSA 2R073 3CU7A 3T1MA 4KL1A 3DYPA 4LUKA 1TG7A 5FZ0A 2V5DA 3GXUA 1NKGA 3AVSA 5JXGA 3WNOA 3WF4A 1O3QA 1ULOA 3AP6A 3I4IA 1VMFA 4JRAA 2Q8CA 4AAXA 5CNAA 4AQSA 4BDVB 4Z1VA 1MS8A 3EXUA 3LQCA 1XNBA 3U1XA 4JC1A 4QGMA 1AR93 5I8YA 1FYUA 3ILFA 2XONA
chains in the Genus database with same CATH topology
2RR13 1NCQC 4WM7B 1G8WA 3OGJA 1BBT2 1BKZA 1AL22 4HFSA 5AVPA 2B8MA 4P9WA 1FOD1 1Q8QA 3VBOB 4I3GA 2B45X 3LWCA 4D7TA 2Q1ZB 3WUDA 3P3NA 1QJX1 1YUDA 2I74A 1W6QA 1QJU3 4B7EA 2GNDA 1SLAA 1C5HA 4Q0PA 4YVWB 3WHTA 4BOWA 3TAYA 2O8OA 2HWC2 3MLKA 4Y22A 4Q4X2 3ZIWA 1GNHA 1IKPA 2KXLA 1AJOA 4YM0A 2IXIA 2PAMA 1W0PA 3USSA 2UY9A 4Q1PA 4H14A 2DWRA 3M7AA 4YG3A 4BPZA 1CR7A 3D8CA 1OSGA 2DFCA 1VBB2 2PA7A 2QJVA 4XJUA 4P9IA 5GLVA 2UWCA 3T1LA 2BNNA 3WQ0A 1CVNA 1COV1 1UU6A 3VKNA 1GQHA 3ZFFA 1WMDA 3NW4A 1CAXB 1GFF2 2WSVA 3ZIXA 3IN9A 1BYHA 3B00A 4RS5B 4YVSC 1ONAA 1N3PA 1PIV1 5E16A 3QH6A 2D6KA 1AYM2 4IV3C 1ND3A 3VL8A 1UU4A 2ZZQA 1JTZX 1O5LA 4KWLA 3BTAA 5FPZA 2A7AA 4AI3A 4PDWB 4IL7A 4C1XA 5H9RA 4CEYA 4D69A 5JWPA 4Y1ZA 4GQ7A 5KBFA 2QCSB 4TYSA 1B35A 4YLZA 3AKQA 2CGOA 2B39A 4K20A 3OGGA 3JBG1 1ULDA 4JAAA 1RUC1 1DYPA 4GB33 4UBHA 5FAXA 4KQ7A 3VZMA 3M2MA 5I91A 1QNWA 1EV13 2BFUS 1ND2A 4RR3A 1CONA 1TMF3 3E6DA 3LOBA 5CFDC 1DLLA 3S7IA 4AI2A 3N3HA 1YHFA 2G9GA 1AXYA 1EP0A 4YYOA 2ETEA 5JMCA 1AL0G 1N1TA 2X53S 4Y20B 3N7JA 2N7GA 3KZ4C 4HETA 1HV0A 3USUB 4GH4B 4ZU5A 3WV6A 4A3XA 3SITA 1AL23 5DUUA 5I8SA 4AE2A 4JGZB 1ZBA3 2VNOA 4UW4A 1J58A 1N1SA 2NMOA 5JOZA 2R063 4HKOA 4JDOA 1C8M2 1ZBE2 4Z92B 2QZ2A 3NKTA 4L92A 2HEVF 3AZXA 1HV1A 4BIFA 2GNBA 2QDRA 1POV3 4XFFA 3ZX7A 4M3CB 4XBNA 3IMNA 1BVP1 4LLFA 4RL7A 4ES9A 1CAWB 1H2LA 3SNMA 4K21A 2HWC3 5GLZA 2X5IB 2D5HA 1KDKA 1CJPA 3FHIB 3GBGA 4AEJA 2B5HA 2ZGMA 1REEA 4HLTA 5FTTC 1JXNA 4N7UA 4FSJA 4GMP0 3AYEA 1LHUA 3CL1A 3Q9OA 2JX9A 3RRDA 3VKOA 1R1ZA 1GSLA 5I0UA 4LT5A 2WNEA 3ZDSA 1LOGA 3J26N 1YCIA 5GKAC 1ENSA 2PYTA 3GZTB 5FBZA 1VBE3 3CO2A 1VRH2 4N9HA 4ISQA 2RM21 2O8QA 1GNZA 2WZPP 3FJSA 2WZR2 1OQ1A 1DQ1A 1D4M1 1NE6A 2HKXA 2DCJA 2XBO3 1YFUA 3H9AA 3I7DA 2TNFA 2OZJA 1H4HA 1RHI1 5BY5A 1IHMA 5C4WA 4XF4A 5GLTA 2ZGOA 3AP4A 2HWD1 4XTPA 2EXIA 1ULGA 4AVCA 2YMZA 3SH4A 4Q4W3 3NWKA 4K9SA 1KS4A 5KHHA 1R1A3 3VZNA 4CEWC 3AP5A 2BNMA 1D0HA 1GR3A 1KXGA 3VZLA 1RB8G 4AW7A 2R0HA 3H8UA 1PMIA 3CJIC 2V73A 3VHNA 2WA4A 5HI0A 5FO9B 2R043 3WDVA 5ABJC 1WUVA 1V6KA 1VBC1 1QDCA 2ET7A 4XIOA 4XJ9A 5SV5A 1XRUA 2VMHA 3AB0A 5K8SA 3IDBB 5IK7A 1ALYA 3DPRA 4MZUA 1ZX5A 3NV1A 4G4FA 3BODA 1N3OA 1AX0A 1MS4A 3ILRA 2NYYA 3ZXLA 5ACA1 2ZGPA 5FO8B 4XBQA 1FOD2 2BW8A 1CPMA 2XJRA 2D6OX 4MGYE 3QOPA 1QJX2 1LTEA 5FLHA 5KC6A 2WNVB 1QXJA 1S0JA 2HWE3 1QY4A 1WW5A 1H1IA 4CDUC 3G7DA 1O4ZA 3UKNA 3PVNA 1OI6A 4PBOA 1QGLA 2XL7A 3MI8A 1NA1A 3LCPA 3U10A 3POSA 2VVEA 3MIFA 3OYWA 4KG0A 3E6CC 2X29A 1QH7A 1RUH3 2ZOEB 4DZGA 3VHPA 1H2NA 4JGYC 4HPKA 1NQDA 2PHWA 4C91A 5JOYA 2VVFA 1MEC3 3H0OA 5CFCC 5J3UA 5GJ6A 2WFF1 1H2MA 1MQTC 3H1MA 1BEV2 3ALQA 2WZR3 1COV2 5BNPC 4I2OA 1RVF3 2R30A 3H7YA 4QMAA 1WLTA 4XE9A 1E57A 2K2SA 1PIV2 4HVQA 2YDEA 1X8MA 3PVEA 3WVJA 3WG2A 1J3PA 1PO11 4E4SA 4TZDA 4FO9A 4L9BA 4CTEA 2VOWA 2AENA 1OQEA 4LLOA 4SLIA 4O9EA 1NXMA 4S2GA 4LBQA 1AX1A 3JB4C 1BCXA 1U5YA 4D94A 2GC0A 3G6JB 1RUJ3 4R52A 5EYYA 1CX4A 5LEKA 3K48A 3ZYRA 3JBG2 4RHV1 2ZKLA 1DFQA 2MEV1 3JD72 4N53B 4Z2WA 1X50A 1RUC2 5DDJ1 2ZHNA 3ZXGA 3MICA 4LBOA 1YRZA 5CG8A 3I54A 5K0UB 1LOFA 1UN1A 3S6PA 5JIAA 3IPVA 4AEDC 4HN0A 4FPHA 3K51A 4Y1YA 1UW8A 2DCZA 4CDXB 5TSWA 2LALA 1JHNA 4XF0A 4IEYA 1J59A 4QM8A 4PJYA 3VBRC 5JLVA 1YJKA 2I2SA 4UBGA 1VBA1 3FLPA 2FZ2A 1VLNA 1J3QA 4E2SA 3SMHA 4B4PA 1S0IA 2WS93 2VXRA 1DGLA 2XWBB 3DV8A 3RMXA 2OW4A 5L73A 4L8QA 4AYUA 2IZWA 5DG2A 4Q4Y3 4ZU4A 2K9ZA 5HXVA 3R4UA 3ZN6B 1ZZ8A 1XNDA 1XXNA 2ZKNA 4Q0QA 1SLCA 1M4WA 4AFAA 2ZZJA 4OVEA 3GHNA 1GZCA 2XJPA 1J3RA 4FQ4A 1F9KA 1PVC1 4A2UA 4YVSA 2WWSA 5FQ0A 4OI2A 4MLOA 2FBEA 3WT3A 1GZWB 1WD4A 1PK6C 1TNFA 4HANA 4RQPB 5CG9A 1V9U2 1C1LA 1Z7S3 1LHWA 3AXDA 3VBHA 1X7NA 5B2GB 4GWNA 1A78A 1BEV3 2ZMKA 2D93A 2RM22 4NWVA 4Q8KA 2PHFA 3MF9A 5T3NA 1WD3A 5T54A 1QJY3 1PIV3 4FAHA 3VLBB 3ZSLA 2E6VA 2XJTA 5A3LA 1D4M2 2P34A 5T50A 1R091 4YG0A 3RMYA 1AYN2 2RE9A 4D7YA 1RHI2 1ZZBA 1ZZCA 4R4XA 3WINE 5JZGB 1K5MB 1NA1B 1QOSA 2ZBJA 5L7OB 1GQGA 1NLRA 5T55A 4PLMA 5GALA 2JICA 4OHYA 1W6NB 3ZXDA 1RUNA 3OBTA 3WOGA 4IEWA 5CFDA 5T5PA 3EHKA 1NG0A 2H0BA 2HWF3 3TB0A 1KD7A 1W6OB 3JD73 2WIIB 1BMV1 1AZDA 2O1QA 4OLLA 4QPYA 1OFNA 1IS5A 4HK8A 1LESA 2D3RA 2Z79A 2WQ4A 4YSFA 5GLWA 4M3CF 1WCSA 2RS33 3VBUC 3VHOA 4YW1A 3WP3A 5C8CC 3O0VA 1L3JA 2A6XA 1OD5A 4IQPA 3MPPG 1VALA 1PO21 1VBC2 3FBMA 1KDMA 3AZZA 3NAPC 4OUMA 5C33A 5GZDA 1AR72 2QE3A 1C8NA 2OIIA 5A3MA 3HT2A 4AG4A 2FQPA 4QHBA 4FTSA 4LBQB 1JH5A 4HKLA 1EAH3 2A3YA 1OOPC 4QQHA 4EV0A 1WMEA 3LSDA 4CDWB 5CA6A 1UPIA 1I6XA 4LBKA 3ZXKA 3AJYA 3MZHA 1CAVA 1J1TA 1UCXA 2Z5WA 1LCLA 3A4UA 5JSOA 3IT8A 5K7PA 5JCTA 3NVCA 1LULA 1RUI1 5I0TA 2D44A 3IIAA 4EWDA 1QU0A 2P37A 3LA7A 5C8WA 4CRQA 2DTWA 4KG8A 2XWJB 4QQPA 1DGWA 4GMP3 2A70A 1JW6A 2W39A 4FPOB 3V65A 1FAYA 4XETA 4AXOA 4TSVA 2VNGA 4COWA 4PBPA 1G6NA 4K40A 2Y0IA 4E27A 2ZX3A 1ULCA 3WDWA 4YGEA 4DFSA 1UD1A 4MGKE 1YWKA 3LAGA 1OQDA 3ETQA 3TWIA 2NM1A 4FOQA 1V9U3 3ZN5A 3UJOA 4Y1UA 1LRHA 1F8VA 1LENA 3ENRA 3B5LB 4DQAA 2WC2A 1ULFA 2WFF2 1YFWA 3FUOA 4N90A 3RI8A 3VGIA 5A33B 5C9AC 3DGTA 3AM2A 4IEUA 4O9GA 3VBSB 3VN4A 1QOTA 2GU9A 2TEPA 3GF6A 4LA2A 4WV8A 4L99A 4BMEA 2FMDA 4AFCA 1AYN3 1BXHA 4Q4V2 4XIKA 1G9FA 4Q1RA 4CEWA 2ZAHA 4LHKA 5IK5A 4J6GA 4LE4A 3ZFGC 2ARXA 4P9YA 5BNOC 3CJIA 2RS11 4XFAA 2D6NA 3M8LA 1KQRA 1RMU2 3UKTA 1XU2A 4PF5A 1SDWA 1Z78A 4MVTA 2A73B 2OZ6A 3AK0A 5ABJA 1IPKA 4RGGA 3H1YA 4K1YA 4WZFA 1LHVA 1OA3A 1OMIA 4YM3A 3GNEA 2ZGUA 4B7KA 2MEV2 1SLTA 2UWAA 3VBHB 4CDQA 4NVPA 1VJ2A 1QQP1 2JG8C 4R9CA 3U0ZA 1FPN1 1AF9A 3ATGA 4FXKB 3W59A 4WVZA 4CP1A 1S0GA 1FMD3 4Z8BA 3R4SA 2IXJA 3AZYA 1TNRA 2WKKA 1VBC3 1U5IA 1D2SA 2XUMA 3ACLA 3GHMA 1AR73 3SXWA 4WVMA 3MEPA 2JEMA 1HXS1 2XKOA 4P9JA 4OUSA 4XMAA 1H1AA 4CDUA 4XJAA 3V0AA 4LBNA 1VBA2 4YW5A 2WNUC 1GLHA 4MXWB 4AEKA 5GM0A 1H8VA 4YGCA 3EBRA 2Z2SB 3ES4A 1HRV1 1GICA 1BJQA 1HDKA 3FLRA 1EPZA 1B09A 4PIZA 2EAKA 5D8AB 5CFCA 1IOAA 2E53A 3J8F1 2IFWA 2DVAA 2RMU3 1MQTA 4FAGA 1WMFA 1VAVA 3MIGA 3VDDC 3WW3A 4DB5A 5BNNC 1QH6A 5BNPA 1Y7BA 1URXA 2BWCA 2ZGQA 1ENQA 5DUVA 4QQLA 5JPMB 1PVC2 2D7FA 2ZX2A 4K3UA 1A8MA 1UX6A 4FVVA 3PMSA 4COVA 3AZWA 5HCBA 1DG6A 1GKBA 2VQAA 2ES3A 2UYAA 4OHZA 1UMZA 2JJ6A 3OD4A 1NE4A 1CAVB 2A75A 2BQPA 1CQ9A 2GN7A 2VNRA 2ZA9A 3WW2A 5AC92 2CGNA 1QJZA 2HYKA 1HRI3 4XHXA 2JG9C 3TN93 4Q4V3 3H1WA 2XJVA 1IZ3A 1VBD1 4JVAA 2XL9A 3ZSJA 5JSPA 1R092 3SCFA 2V09A 2DV9A 4URTA 3RNSA 1RUD1 3IWZA 3NSTA 1LOAA 4ONUA 1RMU3 3WP5A 3RWNA 3KCYA 4AEDA 2D5FA 2A5ZA 4LBJA 1S1AA 3AZVA 2GMEA 1R081 5J7MA 2ATFA 2RS51 4D7SA 1H4GA 1IPJA 2CWSA 1BMV2 3TYJA 1TME3 3M3EA 4E9KA 1C4RA 4AVBA 2NZ9A 3MFCA 1WLCA 5FLIA 5LK5A 3VBRA 3JU9A 4QQOA 1KFXL 4WBBA 3D0SA 4I0BA 3OY8A 1MS5A 5JI9A 4AHXA 5FRAA 2VGDA 2D6PA 2QZ3A 2IC1A 1PO22 3H50A 3SHRA 1AR61 1G9CA 3IBMA 1V6LA 1YIFA 3UJQA 1IKQA 3AJZA 2E7TA 2R0FA 1ASJ3 1WW4A 3ZPYA 3RG0A 1CESA 5CIRA 4N43B 4AHZA 4A7ZA 3HBZA 2JXAA 2ENRA 2G9FA 1DGRA 1AJKA 3HWJA 1GANA 4HKWA 3M3CA 4CDQB 1UAIA 3C3VA 4QPIC 1RUI2 4NN0A 3WHUA 5JOWA 3MYXA 1BBT3 2Y0OA 3JZVA 4KH9A 4RD7A 2AREA 4MXVA 4YZ3A 4UXAA 3VBFB 4QPGB 4ATEA 4YM2A 3O12A 3OJBA 3WD5A 4WM8B 2X8KA 2ZHKA 1RINA 1DHKB 4DS0A 1NCRB 4YW4A 5F1RA 4Q4X3 3PHMA 3KCCA 1SMVA 3V56A 4L97A 4WM7C 4LEJA 5AC93 2AGSA 2DCKA 3VBOC 3AMQA 4G3YC 4WVVA 1DGRN 4PIXA 2IXKA 1LOEA 3APBA 1R093 3DF0A 1VBB3 2ARBA 3O5SA 4S2FA 3ZMOA 3CF6E 2ET1A 1LGNA 4EN6B 2UWBA 3BB6A 4JDMA 4I0AA 4YVWC 3W9AA 1OA2A 3FFQA 3WDTA 3VBUA 1ENXA 2EALA 1X8EA 5BNPB 5C8CA 4FOYA 1G86A 4EN9B 2PHRA 1AYM3 1RUG1 1W6QB 4IERA 2A71A 2C9AA 2VUJA 3H3UA 3D0JA 2EVXA 2TBVA 3NAPA 1CIWA 5JAXA 1MZEA 5DZEA 4AEMA 4Y22B 1QQP2 3OPZA 2QVSB 3KCXA 1FPN2 1AUYA 2DVFA 4AVTA 2IFRA 2PLV1 1OOPA 2LTNA 5FDBA 4IEVA 3ASIA 4YGBA 4RS5C 1VIWB 2VH9A 1ZZ7A 2QUOA 2GSYA 1QHDA 3J4UH 1F5JA 1PZ7A 1AXKA 3B94A 4PQ9A 2Q8OA 4H55A 3ZFFB 4PDWC 3WCRA 1A3KA 2VECA 1FX5A 4KNCA