1UZZA

Erythrina cristagalli bound to n-linked oligosaccharide and lactose
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
239
structure length
239
Chain Sequence
b'VETISFSFSEFEPGNNDLTLQGAAIITQSGVLQLTKINQNGMPAWDSTGRTLYTKPVHIWDMTTGTVASFETRFSFSIEQPYTRPLPADGLVFFMGPTKSKPAQGYGYLGVFNNSKQDNSYQTLAVEFDTFSNPWDPPQVPHIGIDVNSIRSIKTQPFQLDNGQVANVVIKYDASSKILLAVLVYPSSGAIYTIAEIVDVKQVLPEWVDVGLSGATGAQRDAAETHDVYSWSFHASLPE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lectin
molecule tags Lectin
source organism Erythrina crista-galli
publication title Crystal structures of Erythrina cristagalli lectin with bound N-linked oligosaccharide and lactose.
pubmed doi rcsb
total genus 55
structure length 239
sequence length 239
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2004-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00139 Lectin_legB Legume lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1uzzA00
5T5LA 1Q8SA 2PHTA 1SCRA 2D6MA 2E7QA 2D6OX 2NN8A 4YZ1A 1JHNA 1TEIA 1QNYA 3N36A 4K21A 1LOBA 1U0AA 3W58A 4F83A 4R9AA 5F5QA 2ZGKA 2ZHNA 1GSLA 1GZWB 3FUOA 1SBDA 5GZEA 5KXCA 4BOWA 3M3EA 2HYKA 4YGCA 1KJRA 1LOCA 4UW3A 1DHKB 1LHWA 1URXA 1W6OA 3R4UA 1CJPA 1Q56A 2CYFA 3DUIA 3N7JA 5DUXA 2DTYA 3CNAA 5HCFA 2SBAA 4XXAA 1LGBA 4AYUA 1W6NA 2CWSA 3B9CA 3OY8A 1ULFA 3UJQA 3O0XA 4BMEA 4YW1A 4FPLA 2GNMA 1S0GA 2UWCA 5HCAA 2ZBJA 2D7FA 1WD3A 2ZZJA 3AZWA 4ITCA 1KRIA 1EPWA 2NM1A 1SLTA 2D6NA 4CTEA 3V0AB 1X50A 3V64A 3MW2A 4LBOA 1S0JA 1YO8A 3LSEA 3WHUA 3SISA 2WQZC 3AZYA 3ZPYA 4XYXA 4PQ9A 1APNA 2ZGUA 5JOZA 1S0CA 2R0HA 3AK0A 1BQPA 3TB0A 1GNHA 2R0FA 1O4YA 2NZ9A 4XHBA 1GKBA 4XHXA 1DIWA 2ERFA 1AJOA 2DVBA 4Y22A 3AP4A 1W6PB 3ZXLA 1G86A 2WT1A 2YXSA 2FHRA 1QDOA 3WCRA 4FOYA 5GLZA 5DUVA 2DVFA 1GZCA 1SACA 2DVDA 2A75A 1C57A 4XOGA 4AWDA 2PELA 1V6OA 4R9DA 1GANA 1WD4A 2GNBA 3N7KA 5DZFA 1W0PA 4LBKA 3WDXA 4BLJA 3UK9A 2DVGA 2ENRA 3IMNA 2LTNA 4Y1YA 4YG3A 3WG1A 1N1VA 4XJ9A 5E8AA 4YW4A 3AYAA 3MPPG 1FAYA 1PZ9A 1GBGA 1SLIA 3AJYA 3ZSLA 4H55A 3O0VA 4FPKA 1LULA 3WDVA 3ATGA 2AREA 1YRZA 3C2UA 1GZ9A 1VAMA 3NV1A 1N3QA 2WJSA 2XB6C 2P37A 3WDTA 1MACA 1IOAA 4CZSA 5BYNA 1MS1A 1S0EA 1JOJA 3FLPA 5T5OA 4XIOA 2W08A 1DGLA 3B00A 3JU9A 1ENSA 5IT6A 3WNXA 3AZVA 1LHVA 3OPZA 3VUOA 4FQZA 2D6PA 1F5FA 5FREA 2DWRA 3MEPA 2A6XA 1QKQA 1DZQA 1LGNA 3BTAA 4YLZA 2JE7A 1QGLA 1W6QA 4XDQA 4XJ8A 2ZACA 4FPEA 1DFQA 5LK5A 3ZSKA 3POYA 3AP9A 4C1WA 3AYCA 2EALA 2UWAA 4PBPA 1SLLA 1HDKA 3OYWB 4RL7A 1DQ5A 5H9PA 3ZXFA 2ZAAA 5DUWA 4YZ5A 3AP5A 3Q9OA 5GZCA 4XJAA 4XJWA 3UJOA 5DG2A 3RG0A 3M1HA 4XBLA 4DRRA 1Z78A 4R9CA 4Q26A 1NLSA 4XTMA 4XZPA 3M3OA 3A0NA 1R1ZA 4C1XA 1JYCA 2D43A 1QOTA 1Y7BA 2C9AA 1LENA 1S0FA 1DQ0A 1FATA 1WBFA 4YM0A 2EAKA 4LBQA 2VXRA 1VAVA 1SFYA 3LCPA 5JVVA 2GMEA 2P34A 1IS4A 3ILFA 1ULCA 4YGBA 4ATFA 3V0BB 1PZ7A 1F9KA 2E53A 3GNEA 3IM0A 3PVNA 1JUIA 1CIWA 2WSUA 1MZ6A 3AX4A 3W59A 4M3CF 1DQ6A 3QLQA 4WV8A 3IPVA 2CL2A 4Y20A 1LTEA 2ZGQA 5SV8A 3WDWA 2YV8A 2A6YA 2ZA9A 1QF3A 2ZGPA 3ILRA 4JRAA 5CNAA 3M3QA 5T54A 1D0HA 1OFSA 2JE9A 3WG4A 3T2TA 5T5PA 3AZZA 3RMYA 5CA6A 4GWNA 3OGGA 4HANA 5JOWA 4LBMA 2ZABA 5IK7A 3AXDA 1A3KA 1GICA 2NP0A 5L73A 2WNEA 5GZGA 3T1MA 2EF6A 1WW5A 1W6QB 1QOSA 1LEMA 1ENRA 2DVAA 2UWBA 3WUCA 1MS3A 1CQ9A 2ZMLA 2AGSA 5IK4A 1FV2A 4SLIA 1CN1A 1N47A 3RQ0A 1LOAA 2VW1A 2D6LX 4DS0A 4YZ2A 1JN2P 1GYKA 4U2AA 4LBQD 1UMZA 5DG1A 1HLCA 4XXPA 1MS0A 5JOYA 2WT2A 3N35A 1N1SA 1H30A 5JMCA 1XQNA 3ILNA 2JJ6A 4GKXA 4FVVA 3H0OA 3ZXEA 1WLCA 3SH4A 3BOPA 1FNZA 3AYEA 1F31A 2AH2A 2YY1A 1W6NB 3IKWA 1C1FA 1HQWA 4Q1RA 1V6IA 2GALA 3ZSMA 2W68A 3HN1A 1BYHA 3APBA 3WDYA 4YGEA 5DZEA 4CRQA 2AUYA 1PZ8A 4YFWA 1Z0HA 4NO4A 4XJUA 3ZVXA 1S0BA 1N1TA 4P9WA 1LOEA 2B7YA 4YM3A 2W39A 5IK5A 3A4UA 2VUAA 1GNZA 1AJKA 1SLCA 2PHWA 2NMOA 2OUHA 3VKMA 1LESA 1WW7A 1IS3A 2R1BA 4YZ4A 4ZKTB 5EYXA 3FBYA 1DQ2A 2EXKA 4FPCA 4YGDA 2GMPA 2VH9A 4FPFA 1MVQA 1WW6A 3FFZA 2GNDA 1HQLA 1HKDA 4M01A 1AX0A 1G9CA 2DV9A 1Q8OA 1W6MA 3BIWE 1QU0A 1A8DA 3OBRA 2A5ZA 2A70A 2UURA 4UW5A 4YM1A 1SBEA 4AGRA 2ZGOA 3POWA 1WW4A 5GJ6A 5IK8A 1ULDA 2W52A 5KXDA 5GZDA 1CVNA 4FPJA 4LBJA 4Q8LA 3ZSJA 4LBNA 4K1ZA 1MS8A 1UN1A 1LOGA 3GALA 5H9QA 2SLIA 5GLTA 1LEDA 3WG2A 3U4XA 2WLQA 3WZ1A 2A71A 2ZGRA 5E89A 1I3HA 4OZXA 4DRVA 2G4IA 4GA9A 2D3RA 3NWKA 2GNTA 1UL9A 1W6OB 2RHPA 1JBCA 1BKZA 2P3JA 3NV4A 3V0AA 1DQ1A 2JDZA 4P14A 4Q8KA 4K20A 4AGGA 3B01A 3AP6A 2H0BA 5CBLA 1YXWA 2VU9A 5JDBA 4Y1ZA 5IUQA 3WG3A 4ISRA 1QOOA 3WCSA 2DURA 3VV1A 1O4ZA 3TAYA 1AZDA 2JECA 1J1TA 4GKYA 4FPOB 3RSJA 2LALA 5H9RA 1YYNA 3SITA 4JCKA 1W0OA 2GN3A 2OVUA 1FYUA 1H9WA 1LHNA 2YROA 3IN9A 1V6JA 2AYHA 1AXKA 4M3CA 3ENRA 4M3CE 4UW4A 2ZGTA 5DXDA 4YW5A 1V6LA 1D2SA 2EXHA 2E51A 1A78A 1QNWA 5EYYA 3M3CA 1LU2A 1SCSA 3B69A 2D6KA 1G7YA 4YG6A 5CB7A 3O5SA 1WLWA 1VIWB 2R16A 1BXHA 1KITA 1DYKA 4Q2FA 1DYPA 3AZXA 4FOQA 4AVTA 5F9TA 2ZGSA 1YIFA 2A3XA 2E7TA 3WDUA 2XG3A 1WCSA 4XMIA 1N3OA 2Z42A 1UZYA 3L2YA 1QDCA 1V00A 2TEPA 3WLUA 1W6PA 2ZGMA 2GDFA 5H9SA 3MW4A 2BQPA 1FNYA 2EXIA 1MS4A 1CR7A 3A0KA 1Q8VA 3BODA 1H9PA 3ZXJA 5JLVA 1BJQA 1IKQA 4U36A 3USUB 1UAIA 2VW2A 4P9YA 3WUDA 1KJLA 1KQRA 1Q8PA 3NV3A 1V6NA 2DUOA 4DFSA 3OYWA 4KBBA 2ZMKA 3FLTA 2D44A 3INAA 3RRDA 3WV6A 1ZM1A 3AJZA 4PCRA 3D4KA 1FV3A 3VKNA 2P3KA 1CPMA 1SBFA 3SNMA 3D6EA 1WLDA 3N7LA 3KQRA 4Y26A 2YZ4A 3FUQA 2A7AA 1BZWA 5GLWA 3O12A 1G9DA 4XILA 5DZGA 4GXLA 3OJBA 1VALA 2R1DA 1VLNA 2NYYA 2WT0A 1LGCA 1WBLA 3KM5A 1LODA 1MVEA 4MYEA 4BLIA 5EWSA 1B09A 4LBQB 2UU8A 3ZYRA 1CESA 4NOTA 4AVSA 2I2SA 4Z8BA 3PMEA 2A3WA 2A6ZA 4YFZA 5FRAA 1JYIA 4PF5A 1CONA 3N7MA 4TYSA 1LECA 1SLAA 4FQ4A 1ZA4A 4FP3A 2GN7A 3SH5A 1G9FA 2OUJA 2Q5TA 3T1LA 1JW6A 2CTVA 1KDMA 4BQ1A 5GLVA 1DBNA 5CAZA 3POSA 1AXYA 3PJQA 3ZXKA 1GLHA 1V6KA 2A6VA 4XBNA 5E88A 1S0IA 4GALA 3D5OA 2CWMA 5T52A 3ZYPA 1N1YA 1RINA 2GMMA 4FP2A 4ISQA 4Y1VA 2R49A 2PHRA 3RMXA 1IKPA 4Y20B 3AXEA 5DUUA 1ULEA 3WHTA 2YMZA 1CPNA 1RITA 3V65A 2DYCA 1UX6A 1AVBA 4HL0A 4PBOA 1I1EA 1OKQA 5EXOA 3OY8B 3R4SA 2P3IA 2PHFA 2ZGLA 4ATEA 3M2MA 2V73A 4WVWA 3AFKA 2ES3A 2V5YA 2ZKNA 2AENA 5GLUA 3O0WA 1RIRA 4K1YA 4YZ3A 1IS6A 1YI7A 2A6WA 1C4RA 4M00A 1MS9A 5AVAA 1UZZA 3DGTA 1LHUA 4Y1XA 3B3QE 3HR9A 3MW3A 1UPSA 1FX5A 2ZGNA 4AGVA 4AVVA 5KXBA 1G9AA 2ZHLA 3VKLA 4ZXKA 3R05A 3VKFC 1LOFC 2JKBA 3N3HA 4Q1PA 4Q27A 1C1LA 2C5DA 4XBQA 1LOFA 2E6VA 2CY6A 2DUPA 1W6MB 2D3SA 4XIKA 1GZWA 1ONAA 2DU1A 5HCBA 1OQ1A 2ARXA 3WVJA 1AX2A 4BMBA 4YG0A 2DU0A 1Q8QA 2ZHKA 4GWMA 4BM8A 4D69A 3ASIA 5GZFA 4BPZA 3RS6A 2PHXA 1WUVA 3VKOA 1MZ5A 3LSDA 1LU1A 1AF9A 4W65A 2A3YA 4P9XA 5GM0A 3I8TA 3V0BA 4WVVA 1MR5A 1JXNA 2FMDA 5GALA 4ASMB 4R9BA 1N3PA 1S0DA 1DLLA 4I30A 1DQ4A 2DTWA 2VY0A 3HMYA 4LBLA 2JD4A 1UKGA 4YM2A 4XTPA 2EIGA 4TZDA 3AP7A 2ARBA 2WSVA 1LHOA 4XJZA 4FOWA 1GV9A 5KXEA 4UW6A 3FLRA 2P2KA 2ZHMA 1NXD1 2AR6A 3JUUA 4XMAA 5T50A 4Y24A 3WOGA 3I4IA 3PVOA 1V6MA 2EXJA 1KDKA 4FOVA 3IPVB 4DPNA 2D3PA 2VW0A 4FPYA 4M3CB 1AXZA 2NMNA 3SH3A 3NV2A 4FPGA 4YW3A 4YW2A 3USUA 5T5JA 1LJ7A 5JOXA 2KM2A 3UL2A 3OBTA 5T55A 2CNAA 2OW4A 1G9BA 1SLBA 4Y22B 2ZMNA 4FPHA 1AX1A 1ULGA 3QCWA 1S1AA 2PHUA 4JC1A 1IS5A 4L8QA 4RA0A 4DQAA 4IQPA 3PVEA 4WZFA 4XE9A 4Y1UA 3SLIA 1MS5A 3AYDA 2WKKA 1G8WA 1LCLA 2DUQA 1ENQA 1QMJA
chains in the Genus database with same CATH superfamily
5T5LA 1Q8SA 1UOFA 1YC61 2D6MA 3I3DA 3N9PA 1QNYA 2R6QA 4AI9A 1U0AA 2F6BA 4OUEA 2VVFA 3ACHA 1PGSA 5GZEA 4A3ZA 1JYNA 5D8AA 4NIIA 2W1WA 2JEMA 3M3EA 3O1PA 3MFCA 2HYKA 1W8NA 1NCRC 1LOCA 5C9AC 4EN8B 5LA9A 4DY5A 4UBHA 5CFCC 1W04A 1JZ2A 2EICA 1EUTA 4G4FA 4C8DA 5FYZA 1R1A3 2VC9A 2DTYA 4ARYA 3OY8A 4N43A 4YW1A 1GU3A 4FPLA 4EROA 2UWCA 4ASKA 4AHYA 2ZBJA 1MEC3 1OA2A 2D7FA 1W2AX 3NNGA 3PL0A 4RN5A 3AZWA 1J83A 5L9BA 4EN9B 2NM1A 2JENA 1SLTA 3V0AB 1OUSA 2BYVE 1QXJA 4JDNA 1S0JA 1YO8A 1DDLA 1FMD2 5CG9A 1CAWB 3WNLA 1XU1A 4XYXA 4MGKE 3NAPB 1BQPA 4MO3M 5IVFA 1RUJ2 4KWKA 4LKFA 4S2DA 4UFJA 4MV2A 4XHBA 2VO5A 1GKBA 1TNFA 3U11A 1ALYA 5C4WB 1F5JA 1R091 1W6PB 2PMWB 2WT1A 2YXSA 2WNUA 3T4VA 3WCRA 5CADA 2QQJA 3KS7A 4J1WA 3KMHA 1UCXA 5BY5A 4LO5B 2A75A 1C57A 5FYYA 4CDUC 1VAKA 1V6OA 2AC1A 2WINB 2R063 5DZFA 3WF3A 2J1EA 3T2OA 4UFHA 5BPXA 5LW9A 2JG9A 3IMNA 3R6SA 1RB8G 1H1MA 4GJYA 4CEYB 5E8AA 1RYYA 1W90A 4QX8A 4YW4A 1MEC2 1FAYA 5E6HA 5FOJB 2R071 3ZSLA 1H0BA 1UY1A 3O0VA 4UBGA 2NLRA 4AR2A 2VOTA 1COV1 1LULA 3WDVA 4W6XA 1NLRA 2AREA 3DPRB 4MX3A 3GZUC 5L9RA 1VAMA 3OGJA 5A32A 5JCTA 1N3QA 2RDQA 3LFIA 2WJSA 2DBIA 2P37A 1ASJ3 1OLQA 2WABA 2YG0A 3N9OA 3P6BA 1W8WA 4G9SB 2FZ2A 3AKQA 1RUF2 2Q8DA 5T5OA 1BEV2 3ZYIB 2JE8A 1DGLA 1ENSA 3SKJE 4CP0A 5JIUA 4D7YA 3VBOA 4DEVA 4WM7C 5C9AA 5FZ9A 1DGRN 2XBO2 4I0AA 4FFIA 4HKOA 1IQDC 2VQ0A 4FPEA 3ZSKA 3AP9A 5FLJA 4NUBA 3LE0A 3I3MA 4ZZ5A 2J7MA 2CU5A 4LKEA 4Q0QA 1DQ5A 5LCWL 4DOUA 3ALQA 3H8UA 4QPIA 1OD5A 4YZ5A 3ETQA 2RM21 3Q9OA 3N9LA 2Q8CA 3THDA 5CVRA 1W8UA 3B02A 4Q5OA 4XJWA 3S6PA 5DG2A 3RG0A 4AVAA 4DRRA 5FYTA 3RJ2X 1AR82 2Y0IA 3E97A 3A0NA 1C3HA 2W1UA 3QBQA 5FYVA 2C9AA 4NRQA 5BNOA 5C8WA 1LENA 5F3EA 1S0FA 1FATA 2BNOA 1WBFA 2ADEA 3ZXDA 2G1MA 3HQXA 1X82A 2MEV3 3Q8AA 5FZMA 4FBFA 1XNCA 4AAPA 2JDYA 4C90A 2GMEA 3W5NA 3ILFA 1ULCA 5FZBA 1ZRFA 1XE7A 1HRV3 3GF6A 2BGCA 3V0BB 1QH7A 2VR4A 2RS52 2VUCA 3IM0A 3TWIA 5AC91 1BBT2 4ONUA 2B45X 3LDKA 4BHPA 3DXUA 4M3CF 3F2ZA 5FCCA 1AR92 4XCAA 3O1MA 1W9FA 2OPWA 5A7PA 4NPRA 4Z1VA 2A6YA 5FUNA 1QF3A 2ZGPA 3ILRA 5F39A 4AAXA 3S5AA 4AQSA 1DYOA 2IUWA 5A3LA 2XQRA 4LLFA 4CDQC 3T2TA 3OPWA 4HANA 4S2FA 3AM2A 5JOWA 4LNVA 1A3KA 4W4ZA 5C9AB 2EA7A 1FMD1 2DCZA 2WNEA 2Y38A 4Q4Y2 5F6LB 5GZGA 1JZ8A 1WW5A 4LR4A 2XUEA 2XJPA 5C71A 1ENRA 3RYPA 5IK4A 5TSWA 1MS3A 1CQ9A 1FV2A 1CN1A 1QHDA 4YRDA 3UKVA 4FSJA 1S2BA 1XXNA 3IBMA 4U2AA 5DABA 5DG1A 5BNQA 1LB2A 1XNTA 1HLCA 2JB8A 1RUG1 2VNGA 1VMJA 3NRUA 4OQ9A 2K46A 2VMHA 3CIHA 3SC7X 4DXTA 2JJ6A 3H8XA 2LW8A 3WW2A 3KSCA 5CU1A 1FNZA 2IXKA 1FPN2 3NNJA 1W8FA 1F31A 4PDWB 5FMDA 1TME3 1AR91 5FUPA 2W68A 3HN1A 2VMEA 3KGZA 1BYHA 4QGNA 5CKMA 4BQ5A 3H1YA 2AUYA 3DKQA 1S0BA 1NUKA 5FV3A 4CUAA 2W39A 3A4UA 4LA2A 5I0TA 4QQOA 3HT2A 3VD3A 2VM9A 5DAQA 1SFPA 5BV6A 1CAXA 1JZ7A 4DIQA 4IEPA 1H2LA 4E8CA 5A6YA 4IGPA 1X33A 1EAH3 4N53B 3LDBA 5EHDA 4IEVA 3LA7A 5FMCA 5C8CA 4YGDA 2QQMA 5K4LA 4CA9A 2VH9A 3LEMA 1PIV3 2DDUA 5FZ7A 1L3JA 3P1IA 1OH3A 2OQ7A 3CU7A 3U75A 1WW6A 1NA1A 3I59A 1W2OA 4OVEA 4KH9A 5CISA 2GNDA 4QAWA 1HKDA 1UIJA 4Y4YA 1TNRA 1G9CA 1Q8OA 3BIWE 3HBZA 4HBNA 1A8DA 2VZPA 2A70A 5IATA 1S2KA 4LT5A 1IG3A 1SBEA 1FPN3 4CUCA 2ZGOA 4HOOA 4CCMA 3POWA 4N7UA 5J37A 4BK5A 3HIFA 5GJ6A 4BCUA 4PIZA 3ZFEB 5A1LA 1SDDB 1EY2A 1AR61 2FD8A 3ZLIA 3ACIA 1QQP2 1AL21 4IEQA 2Q1ZB 2JDUA 1UOBA 2BBAA 3GHNA 1H4GA 2G19A 2FDGA 3R4DB 2WLQA 2WWUA 1MQTA 5D8AB 1I3HA 3JQWA 2JKXA 2WS91 3GDBA 4I2OA 5F2SA 3NWKA 2B8MA 4HKLA 4M4PA 1UMHA 1RUI3 1TQ5A 3NV4A 3V0AA 2CAVA 4HVOA 3HNMA 3WQBA 2JXAA 1RHI2 1OKOA 2H0BA 4LXLA 5GZCA 1YXWA 1QXPA 2BV4A 2VU9A 3D82A 4Y1ZA 5IUQA 2YC4A 1FOD1 3WCSA 1GOHA 1FT9A 5K7PA 4GD4A 3TAYA 1H1IA 1JYTA 2RDSA 4QKNA 4FPOB 4QQPA 2W47A 5ABJC 4EZHA 4BE3A 1AHSA 4QPGA 3C7HA 4JCKA 1TE1B 2HKXA 5FZGA 3I49A 2FQPA 1LHNA 4M3CA 1UKRA 3ENRA 3DYMA 4MGIE 4Q0VA 4NPLA 4CP2A 5JSOA 2ARAA 2C6SA 3JQXA 4HXCA 1QNWA 1CAUA 1RC6A 1GMMA 3P5BA 1CGPA 1O4TA 5HXMA 1BK1A 5ABJA 1G7YA 3HEIA 5LK7B 1C5IA 2E31A 3F95A 1Z7S3 2RJ2A 5FY1A 2VZQA 4Q4V2 4YVWC 1NLQA 1KITA 4Q2FA 1DGWA 4RGKA 1RUI1 3C7EA 4FOQA 2PLV1 4K3UA 1AR83 1YIFA 2A3XA 2XG3A 4QXBA 2ID4A 3DPRA 4WVMA 1UPIA 1RUF3 2W92A 4P9LA 4BQWA 4MUVA 4CYDA 2E63A 2XVGA 2BQPA 4IEUA 2RM23 4XABA 3A0KA 1NG0A 3VBOB 1H9PA 5HCHA 2R30A 2ARCA 4U36A 1WA4A 5FP8A 1YQ2A 4QX3A 4PLMA 3WF2A 2WA3A 1GWLA 4XFHA 1SFNA 4COZA 3SKVA 1V6NA 2DUOA 4PT6A 2QBXA 3INAA 4QXHA 1UY2A 1QWRA 5G05L 2JICA 2VMIA 3VKNA 2P3KA 4BH9A 2HWD3 1SBFA 4CDWC 2XHKA 3OGSA 3JBG2 5D1IA 2N7GA 4C0HA 4EYUA 4Y26A 2YZ4A 1BEV3 3J7NA 3ZN5A 5B4NA 1G9DA 2VD7A 4XILA 2GC3A 5DZGA 1L7RA 1BVVA 3OJBA 1VALA 4RQPB 5A7QA 2XHNA 3K77A 1RJ7A 4YYOA 3A23A 1VLNA 3KM5A 4Q8KA 4MYEA 1LODA 1B09A 1D4M3 4PJYA 2Z79A 3ZFEA 2C0ZA 2O1QA 3ZYRA 2K9ZA 3U0ZA 4NOTA 1R64A 4Z8BA 3PMEA 1HX6A 1RUD1 4K9SA 5FRAA 2V5DA 4CXXA 4YFZA 3BU0A 2JD9A 2VTXJ 4KGQA 4QPWA 2JG9B 4QKBA 5E16A 3ZO0B 3LQCA 1VMFA 4ZU7A 1G9FA 2D98A 3WW4A 1VBD3 2BJSA 3ITQA 3I2HA 4LMFA 5GLVA 4Q4W3 1AXYA 1ST8A 2YC2A 4KG8A 2LROA 1XOYA 3ZXKA 4PLNA 2A6VA 1GP4A 3DYOA 4ZZ8A 2HWC2 5JUVA 1N1YA 4FP2A 4QDQA 4ZXEA 4BQ3A 4ISQA 3K4DA 4JRLA 2ORXA 4LA3A 2C1FA 3RMXA 2WWSA 3ZSEA 4IUGA 2DFCA 2GC0A 1ULEA 3WNPA 2YMZA 1CPNA 2D40A 4IE4A 4UFKA 1OQDA 1X9TA 2DYCA 4LTAA 2BP6A 4AVCA 3OY8B 4FCAA 2QDNA 1H1AA 2YPJA 2ZGLA 3IIIA 4N43B 4ARXA 5BNNB 2V73A 2E7AA 3AFKA 2V5YA 2ZKNA 5GLUA 2BUKA 3GBWA 5FZ8A 1IS6A 2JDHA 2VVDA 3OGVA 3N9QA 3IIAA 1J3RA 3E5XA 3DGTA 2VZ3A 4RGGA 4PDWC 1FMD3 3B3QE 1OH4A 3MW3A 4MLOA 3HPNA 1K5MA 1FX5A 2ZZQA 1ND2A 5JXGA 3URFA 1RUNA 1ZVFA 5KXBA 3B5LB 3ABZA 1G9AA 2QQPA 1JODA 1VP6A 3R05A 4N8MA 1ND3B 5FKCA 1Y9MA 2LM3A 3K48A 1EV11 1C1LA 2IXIA 4XBQA 2E6VA 3CF6E 4AEKA 5FR3A 2DUPA 3DECA 1X9PA 2D3SA 1W6MB 4LK7A 5HCBA 1XE0A 5FP3A 4NWWA 1YCIA 2ARXA 3WVJA 1AX2A 1JYVA 2R072 2DU0A 3ZYFA 3VDDC 4IGQA 4QMAA 4KU7A 2PHXA 1DZTA 1WUVA 1XJAA 3BTYA 1HRV1 1XC6A 1MZ5A 1ZZ9A 3LSDA 3KCXA 4IV1C 4BB3A 4EQVA 2TUNA 2FCTA 2Y6JA 3I54A 4Q0PA 1W8OA 1MR5A 1RJ8A 4LKDA 2HBUA 2OPKA 3NKGA 3GZEA 4I30A 3E5UA 1DQ4A 1PVC1 1TME1 2DTWA 2AACA 2OYZA 2HWB3 3HMYA 1QJX2 2JD4A 1UKGA 3ZN6B 3ZR5A 4XTPA 4E2QA 4EN7B 3OUIA 4AI0A 2VCMA 1UZ0A 4XJZA 2ZX1A 1DF0A 4UW6A 1QY4A 3U1XA 3BPZA 1RUD3 4ZU4A 4XMAA 5AVPA 1O8PA 2HWF2 4Y24A 1F4HA 4IEOA 3RJRA 5D21A 3WW1A 2EXJA 1KDKA 4HPKA 4DEQA 1J3PA 1XNAA 2D3PA 1U12A 3PNAA 3IDBB 3Q8BA 4FPYA 5DAPA 2YDEA 3CJIB 3NV2A 4FPGA 3SEEA 3NNMA 1LJ7A 1T6BX 1OLRA 5EZWA 4JQRA 2CNAA 2OW4A 4FPHA 4B1MA 1NQJA 4QX5A 4P00B 2RMU1 3AVRA 4Y1UA 5FZLA 3ZMNA 3KV4A 2Y33A 4LHKA 5DDJ3 1ENQA 4V1PA 3BGAA 4W50A 2VE1A 4J25A 2D97A 5FUIA 1ZRCA 3RI9A 2D6OX 4CCCA 2GH2A 1JHNA 1TEIA 3N36A 3N9NA 4LEJA 1Y3TA 1Z7S2 1O5UA 3SMHA 3FUOA 4CDWA 5L36A 1SBDA 3HQUA 4XACA 3ZXGA 5KHGA 1TMF2 4UW3A 1PVC2 1URXA 2QQUA 1X8EA 4OHVA 4UFIA 4ZPIA 1QJU3 5DAVA 4V2WA 1I5ZA 1UOGA 3VBRC 3N7JA 3H8OA 4WM7B 5A7SA 2SBAA 2CDOA 4IEYA 4XXAA 5IVVA 5F37A 4KNCA 5JIAA 3B9CA 2CWSA 1JZ4A 1ULFA 2VL4A 2WS93 3LEGA 4IE7A 5K9YA 1S0GA 3GJBA 1WD3A 1SPPA 1WMEA 2ZZJA 3U07A 3U78A 1RUC2 2WQ4A 4IV1B 2WWJA 5F5IA 4TLGA 3M4FA 1XYPA 2V09A 1G6NA 2WQZC 1KXGA 3LEIA 3RYRA 4LO8A 1I5PA 1BVP1 2ZGUA 4LUKA 1S0CA 4PQ9A 1JZ5A 3KD4A 1ZRRA 4YVWB 2R0FA 1UNBA 4CDXA 2NZ9A 5A3OA 3PHMA 1DIWA 3H50A 4KGGA 3MF9A 4Y22A 2WIIB 4WM8B 5JSRA 3HWJA 1H8TA 2ZPXA 1G86A 1Y43B 1PVC3 2XL9A 4FOYA 5DUVA 2GC1A 3C7GA 5I91A 5IWFA 2Q1MA 3MZHA 1OXCA 2DVDA 4O65A 1UY3A 3NQHA 1NE6A 1POV1 2PELA 1UO9A 4PF1A 1W0PA 4LBKA 4UFLA 3CJIC 4F8AA 2IZWA 4Y1YA 5IFTA 2YBKA 3IT8A 3WG1A 3ELNA 2B5HA 5IW0A 4Q4X3 4NAMA 3AYAA 4BIFA 1SLIA 3AJYA 1AR71 2BGPA 3U14A 1OVSA 3KGLA 3VHNA 1IGOA 3U4SA 3MHZA 1RUC3 1YQ8A 4WVZA 5FWJA 3FZ3A 3ATGA 1YRZA 5F3GA 2BPA2 4MXVA 1OA4A 1S55A 3JBG3 1FOD3 2DCKA 3VDAA 2Y6LA 4GAZA 4XUTA 5LBCA 4HPKB 1OSGA 1IOAA 4CZSA 1Y9QA 1MQTC 4QB1A 1E57A 2RJKA 1JOJA 3LOBA 2G9FA 4A7ZA 1UYZA 3FLPA 5FYMA 2E33A 1NZCA 4IE5A 1QJEA 3WNXA 3AZVA 1LHVA 4OHZA 4ASLA 5FPLA 2J1SA 2WL1A 2D6PA 4QX1A 3VHOA 1KFUL 5LRSA 3MEPA 4MOAA 1ODMA 2Y64A 2OKXA 1CX1A 1DZQA 4LULA 4H3WA 1W6QA 5J36A 1WMDA 4CXYA 3K46A 3LF7A 3POYA 1YQCA 2UWAA 5FXVA 3WT3A 4B7EA 3S0MA 4RL7A 4P5YA 5H9PA 3ZX7A 4CXWA 4D7TA 3DCQA 5FJHA 2B46X 2FCVA 3BU7A 3ZFFB 1H8TB 4D6SA 1W99A 3KCYA 4GZ9A 2VECA 1B35B 1EV13 1HJFA 1Q5OA 2JDAA 1JYCA 2D43A 2ILMA 3GCXA 1QOTA 4I3GA 5HV4A 2BBVA 5IFPA 1DQ0A 4YM0A 3RNSA 3IDEA 1VAVA 4N43C 5KR7A 1DP0A 4CCJA 1PNFA 3PMSA 1CJDA 2RM22 2PQSA 4IEWA 4ATFA 2RV9A 2XBO1 4QPGB 3PVNA 4OYUA 1F35A 1JUIA 3KVBA 3VHPA 1J59A 4MZUA 3CO2A 2K0GA 4QHZA 1IPSA 4RS5A 2X29A 3QLQA 5BXXA 2AEZA 2A1XA 1C8NA 3IPVA 4Y20A 4F3JA 5F32A 5FLHA 2YV8A 3HNBM 2ZA9A 3J26N 1U5YA 2C9KA 1REEA 3WG4A 1OFSA 2JE9A 4AEDC 5JXIA 5T5PA 1JTZX 5FYCA 1DGWX 2VQTA 4L92A 4XVHA 1JOPA 2EIDA 1QJX1 3C3VA 4IW3A 4CEWA 3LPFA 2EF6A 2W87A 5FZ6A 2WYSA 1QOSA 4NHMA 2DVAA 4JV4A 5A33A 1OVPA 2AGSA 2WZR1 4OCTA 4JHZA 1RTVA 2BTVC 2QQKA 2ZX3A 5FKBA 2FDJA 4DS0A 4YZ2A 1UMZA 2QZ2A 2W46A 3AB0A 1HB3A 3NVCA 2VBBA 1ND3A 2GZWA 1MS0A 3H42B 2WT2A 1VBA1 3ECQA 4KL1A 4NR1A 1H30A 4XIKA 5JMCA 3ILNA 5FPAA 1F15A 2YU2A 2PHDA 4N90A 3PTYA 4FVVA 3ZXEA 2WFF1 1GOFA 3POFA 3SH4A 2UYBA 3AYEA 2WO3A 5JZGB 5CYYA 3KT1A 4YW6A 4CU8A 1V9U2 1HQWA 1MZEA 1V6IA 1YIPA 3A22A 3WX5A 4XZUG 3ZSMA 4A4AA 1IG0A 2Y6GA 3T30A 5K0UB 5LASA 2WO1A 3TRSB 4H14A 4ZHNA 1E5SA 1N1TA 1Z7S1 3DPRC 1ZREA 4P9WA 5C5TA 1LOEA 3PIGA 3AL6A 1PX4A 3MUZ1 4A42A 2QQLA 2X53S 2ZEXA 1GNZA 1SLCA 2P4EA 3TEYA 2OUHA 1WW7A 1SPPB 2IXJA 3GBFA 5BNNA 5DDJ2 3N4MA 3CJXA 3U37A 2VBPA 4KWUA 2WNVB 1HB1A 1VBB2 2EXKA 4QU2A 4E9KA 4LITA 2XUMA 4FPFA 1A8MA 4OHXA 1JZ6A 3THCA 4BZ4A 5AC93 2YPDA 1MVQA 1O6UA 3FFZA 2WYFA 5FP9A 5C3RA 1HXS1 2PTMA 1AX0A 4BQ2A 4CDXB 1PK6C 1W6MA 3J7LA 1QU0A 4YM1A 2A5ZA 4HVRA 3WSOA 1GNYA 4EWEA 3VDBA 1E5RA 3K4ZA 5JXHA 1U5ZA 1BK0A 2UY8A 5GZDA 1CVNA 4FPJA 2PHLA 2ZKLA 4OULA 5I8SA 4Q8LA 4IERA 2ZEYA 4RHV3 4AFAA 3ZSJA 1WA6X 4XDPA 5H9QA 1A34A 5GLTA 1LEDA 1PO22 3WG2A 3WZ1A 4UT5A 5FO7B 1EYBA 3VB9A 4GA9A 4GWIA 2BOIA 3HAGA 3VZOA 1XPWA 1W6OB 1CD3G 4I0WB 1D7PM 3BI3A 3RZLA 4CPBA 1RUH3 2RS11 2CGOA 1QJU2 3GZAA 3OD0A 3WG3A 1NQDA 4ISRA 4BA6A 2W2IA 1O4ZA 3I7DA 1COV3 3RSJA 3H3LA 2E26A 3KLSA 4YWAA 3O1UA 1XNDA 1POQA 3OUHA 1Y9GA 3UGFA 3K4AA 2OVUA 4XQ4A 4WM8A 3RDIA 2YROA 4AZZA 2IXCA 4LIVA 3CJIA 2EIBA 3CL1A 2QE3A 4AHXA 5LBBA 2ZGTA 5DXDA 1AL22 4YW5A 5FQ0B 1AYM1 1RUE1 4A45A 5KHKA 2BEOA 2EXHA 2E51A 1ZRIA 2WBKA 3VBSB 4FTBA 4AFDA 2XLGA 3J8F3 1AR62 1VBC1 4Y5Z0 5FYIA 4NIHA 5FZ3A 1SCSA 1HV1A 2K2SA 3LIHA 4ZY9A 1U5IA 2O8OA 2R061 4YG6A 1HRI1 1RMU1 1HN1A 3WXPA 1WLWA 2Z5WA 2R16A 4RFT0 5EP9A 1DYKA 5FY8A 2OT7A 2W94A 2RS13 2BVBA 3POJA 5F9TA 1UX7A 3AMMA 3EXUA 5JPMB 1ZZ7A 4XMIA 1WCSA 3ZKYA 3MICA 2W5FA 3PUIA 4RQPC 5FY7A 4QD2A 3UNPA 1V00A 3WLUA 1GOGA 1TME2 2GDFA 5H9SA 1QEXA 1RUH1 2PYTA 5FO9B 1FNYA 2EXIA 1QJY3 1Q8VA 3M8LA 4Z2WA 1IKQA 4HSLA 2FDFA 4CP1A 1ZNPA 4I3PA 3LWCA 1NX9A 3WNKA 1UAIA 2VW2A 4P9YA 5F5AA 3TN91 4BQ4A 3I2IA 1W03A 1KJLA 1Q8PA 3TN93 4H7MA 1VBE3 3LIGA 1BMV2 2R043 2PFWA 2XBO3 4DFSA 3B7MA 4JHTA 2QUOA 4KBBA 3FLTA 4RS5B 3MF6A 2HWD2 1ZM1A 2V4VA 3AJZA 3D4KA 5FYHA 1RUH2 1O8SA 2HEWF 2XJVA 3D6EA 3FN9A 3KV9A 5FPBA 3UKTA 3VD5A 2GSYA 4MGYE 3X29B 5FYSA 4CDUB 3HT1A 2A7AA 5GLWA 2XVKA 1VBC2 4GULA 1U5XA 4KMQA 2I45A 3WNMA 1WBLA 1MVEA 3BB6A 5FJKA 5EWSA 4LBQB 5F3CA 1WMXA 4XUQA 2C26A 1CESA 2I2SA 3FL7A 2A3WA 2A6ZA 1JYIA 4PF5A 1CONA 2J1TA 3N7MA 3RPQA 1SLAA 3H7YA 3HJRA 1ZA4A 4FP3A 1PM7A 3SH5A 1AR73 1HQNA 1PMJX 3T1LA 2VZSA 2XKPA 4JDMA 1ZBA1 1JHJA 2YFUA 4QX2A 1JW6A 2CTVA 1KDMA 5I0UA 3S30A 3VN4A 4A6OA 4BQ1A 5A70A 2VGDA 4RS5C 3TEZA 2F4PA 3PJQA 3LZZA 1GLHA 1V6KA 5FK7A 5EQUA 4GALA 2BNMA 5KWRA 3VD4A 3H1WA 2WNVC 5F8PA 2ZX0A 5FMOL 5AFBA 5FXXA 2GMMA 2QJVA 2IFRA 5DAXA 4TLFA 2VQUA 2R49A 4DY3A 1V9U3 2PHRA 5CZKA 3RZZA 3AXEA 5F6KA 4S2HA 4P02B 1YJLA 1OC1A 2VZVA 3AMNA 1I1EA 4HL0A 1W9YA 4PI0A 3EJKA 4QHBA 1YQ5A 1F2NA 4NVPA 5IYYA 3NJZA 4P9IA 5BNOC 5FP4A 5CG8A 2AENA 3O0WA 4Q4Y3 1RIRA 2FDKA 4KWJA 1YI7A 3IAPA 2RS53 2JWPA 4BXFA 5JZGC 3LFMA 4IV3C 2Z69A 4RFRB 3O1SA 1BBT1 4Q0UA 4YVSA 2ZGNA 3KQ4B 1DZRA 3VBFC 5JAXA 3VKFC 4YVWA 5EIYB 5J3UA 2X8KA 1PIV1 2C5DA 1LOFA 3ZYGA 4PIXA 4XFCA 1HW5A 1HXS2 1GZWA 3LDRA 1H6YA 5LY2A 4BMBA 1R083 3M70A 4CDQA 1W28A 1Q8QA 3VZNA 2ZHKA 4J6GA 4BM8A 1PM4A 2X5IB 1YI9A 3MIBA 1RMU2 2XJTA 3ZOIA 4XF0A 1TZOA 1RUOA 4LO7A 3E6BA 3KVAA 4W65A 3CZJA 2Y0OA 4GWJA 5I0SA 1PGW1 5C6CA 5GM0A 5LRRA 3I8TA 1OA3A 3VHRA 4WVVA 4OHYA 3Q8CA 4ASMB 2VZ1A 3THPA 2QVSB 3ON7A 1J58A 4AOCA 1WCQA 2ZX4A 5B2GB 1AR93 4GB31 1XSRA 3PIJA 2XL7A 5FZDA 4IEZA 1LHOA 1RXGA 4FOWA 2WAAA 4CCOA 4YSFA 2HWF3 3NJVA 4AI8A 2P2KA 5T50A 1UYXA 3PVOA 1V6MA 4A7KA 1QJU1 2W9XA 4FOVA 3ORJA 1EAH1 2OX0A 3ZDSA 3ROUA 3LPGA 4RD7A 4LO4B 5T5JA 3BTXA 5JOXA 1OFNA 3UL2A 4CEWB 2X5IC 4COWA 5A3NA 1UY4A 5ERLA 3POGA 3ZFEC 1SLBA 4QWNA 4Y22B 3VGIA 4HVQA 1G9BA 1AX1A 2YGMA 1T6GC 1OOPA 1US3A 3SLIA 3AYDA 2WKKA 1G8WA 1GFF2 3ZYHA 4N53C 2WNUC 3PU8A 3TBDA 1QMJA 3IKWA 4XCBA 3TOJA 4N7IA 3MBWA 1EAH2 3MLKA 2H0VA 3VBFA 1X36A 4XFIA 2NN8A 4YZ1A 3RZHA 1WLTA 1LOBA 4URTA 4F83A 2GAUA 5F5QA 4AK3A 1GSLA 2A73B 4IV3B 3WQ1A 3MDPA 4AW7A 4DZGA 1C8M1 3NO8A 4O7XA 5C8CC 5JZGA 4YGCA 1KS5A 3QACA 5FLIA 1ZBA2 1LHWA 3I2DA 2RDNA 3GGLA 3R4UA 2VQAA 4QXCA 1Q56A 3LA3A 3O1RA 5DUXA 2VOWA 1WCUA 1RMU3 3CNAA 2R062 4A6SA 1LGBA 3P3PA 1W6NA 4BMEA 4XFFA 5FZAA 3I2GA 3UJQA 3AVSA 2OXBA 2GNMA 5HCAA 4LPLA 3BUCA 1STMA 4BQXA 3VBHC 4O61A 4ITCA 2C4XA 1EPWA 4O9GA 2WZEA 1JMUB 3CKHA 4CTEA 4B8EA 2CAUA 1X50A 3V64A 3MW2A 3J8F2 4LBOA 4Y3OA 3SQOA 3T2PA 5J7MA 5SV5A 2OA2A 3HD8B 3LSEA 5IAVA 3WHUA 3SISA 2ZJCA 3AZYA 3FJSA 3ZPYA 1B35C 3G7DA 4EJRA 5JOZA 2R0HA 2WAOA 3AK0A 3O14A 1RHI3 4MGZE 3THTA 4OMCA 1O4YA 4CU9A 4JKMA 5EJ3A 4XETA 4XHXA 4HKWA 3MIEA 5BUVA 4D8MA 3LAGA 2H6BA 1GUIA 1PX3A 2HWD1 2QCSB 4NE9A 5IVYA 2FDHA 4JQTA 5FK8A 2JG8C 4RHV1 5GLZA 2FMYA 2DVFA 1SACA 4CP9B 1C8M2 4JZRA 1CAUB 1XYNA 2W3JA 4BJ0A 1YLLA 4CEWC 2GNBA 3N7KA 3OBAA 4JGYC 1QQP3 2P3YA 2W1SA 3MPBA 4Q4X1 5ANNA 3EB7A 3GBGA 5FFOC 5FXZA 2LTNA 4YG3A 5K0UC 1N1VA 4XJ9A 1W05A 3MPPG 1GBGA 2R042 3PUSA 3T3YA 5LA0A 4AEDB 3NL1A 2I74A 4FPKA 2RVAA 4CU6A 4D6QA 2XMLA 3UGHA 5ABJB 4E4DX 1CAVA 2HWB2 5CKNA 3C2UA 3IWZA 1MQTB 1HJGA 4H7LA 1C28A 1GZ9A 4NHYA 4NPMA 2XJSA 3NV1A 2XB6C 5I8TA 5ACA3 3B9IA 5BYNA 1MS1A 3IB3A 5A6XA 3QD6A 5FZCA 3M7AA 4XIOA 4A3XA 4XF3A 2W08A 5IT6A 5DMYA 3JU9A 4GJZA 1NY71 1QXRA 4HETA 2HWE2 2VTFA 3OPZA 4CCEA 2J1UA 1F5FA 2O14A 2RR13 1YFXA 1D4M2 1VBE2 1QKQA 4AEMA 5KHJA 1LGNA 2JE7A 1QGLA 3CEWA 4XDQA 4XJ8A 2RS32 2ZACA 4MGSA 1DFQA 1XB9A 3MV01 1UD1A 4C1WA 4L99A 1OI6A 3AYCA 2EALA 5J98B 2Q30A 1ND2B 3H3ZA 1K5MB 3OYWB 3ZXFA 3I97A 4UWDA 2QQNA 4XFGA 5DUWA 4DUWA 3AP5A 4FFFA 1OBNA 1RUJ3 4LOTA 3QH6A 3VBUC 2P1BA 1XRUA 4GMP0 4XJAA 3SCFA 3UYJA 1CWPA 1JYWA 2BFUS 3M1HA 5EJZB 2BOJA 3ZYJB 3RZMA 5F1RA 4LLOA 2MPFA 1Z78A 1UYPA 4R9CA 4Q26A 1NLSA 4XZPA 1RL3A 1VE0A 3M3OA 1R1ZA 4TXWA 1D4VB 5FZKA 4D3WA 1R082 1Y7BA 3ZYBA 2IFWA 4QPGC 4BXSV 3WP3A 2VXRA 5L19A 1SFYA 5JVVA 2RMU3 3CDZB 4O9EA 4W6YA 2P34A 1IS4A 4ZS3A 4E4HA 2WA4A 3T0DA 5B4XA 1QH6A 1PZ7A 3UESA 1F9KA 2E53A 2ZCWA 4LE3A 1CIWA 4A7YA 1MZ6A 4OI2A 4NRMA 4INDA 4IV1A 3W59A 4XUOA 1ZRDA 1DQ6A 1CZTA 5CKQA 3MIDA 1M06G 3K75B 4BWOA 2CL2A 4X8PA 2ZGQA 3HNYM 4JRAA 4B4RA 1ASJ2 4M4RA 5T54A 1H2NA 3RVHA 4Y33A 3AZZA 3RMYA 5CA6A 4GWNA 4OMDA 4QGMA 2QFEA 4LBMA 1AR81 2ZABA 4PIYA 2XDVA 1GICA 2NP0A 3UT0A 3I2FA 5L73A 4ET7A 5JMOA 4UI9L 4NWVA 4EN6B 2P5BA 1W6QB 3WP4A 2WZ8A 3FHIB 1LEMA 5FYBA 4CUGA 2J1AA 2ZMLA 4Z2AA 4SLIA 2IC1A 1LOAA 2OZ6A 2D6LX 1AYM2 1RUE2 2JDKA 5FP7A 4H2AA 1GYKA 4WM8C 4LBQD 4CSWA 4QPIC 4KI5M 4UAPA 5JOYA 3N35A 4QM9A 1F8VA 4E2GA 2JDMA 4AHWA 2RG4A 2YGLA 1K5MC 5FXWA 3H0OA 3IAQA 2WLPA 3CHXA 4FT8A 3BOPA 3WW3A 3BKZA 2XONA 3VDCA 2PXJA 1HB2A 1W6NB 4E27A 4Q1RA 1MZFA 2GALA 3A7QA 5APAA 4EN0A 3WDYA 4FXKB 4XAAA 3JCIA 4HFSA 4YGEA 3GM8A 3PTRB 1PZ8A 4NIAA 4XJUA 2IXHA 1PO11 3CMGA 4NO4A 2IVIB 3EHKA 3ZVXA 2VMDA 2BU9A 4JDOA 2HH9A 2HWB1 2B7YA 4YM3A 4D0QA 3W20A 1F4AA 1UXZA 4HSJA 5IK5A 1HRV2 1AJKA 2NMOA 1GQPA 3VBRA 3VKMA 5A1AA 4JGYA 1LESA 2QDRA 3G6JB 2W95A 3CBNA 3DF0A 3DN7A 4MXWB 4XC9A 4QT6A 3EBRA 5EYXA 4ZKTB 5JR2A 3FE5A 5FPXA 1DQ2A 3WR0A 1Q43A 4FPCA 5FZFA 1WCDJ 1ZBE1 4LE4A 1BCXA 1UY0A 2VUDA 3JBG1 3H8RA 1CAWA 4JGZA 5C4WA 4SBVA 2ET7A 1E5HA 4HN0A 1H6XA 1PMIA 3DEMA 4JGZC 2O0OA 2FDIA 4FXGB 1HQLA 4M01A 4D7SA 3ES1A 1FPN1 2DV9A 5CFDC 1J3QA 3IMMA 3ZPOA 2XJQA 1US2A 3OBRA 4MHUA 4TSVA 4AGRA 1ULOA 3RWNA 5IK8A 5IJRA 1AUYA 3GHMA 4QB2A 5KXDA 1VPHA 1VBB1 1C8M3 3V56A 5A6QA 1W9TA 3ZMOA 3I3EA 4EE2A 3TEXA 3KCCA 3PUQA 3AC0A 2J22A 1Q3EA 4C0BA 4LBNA 1ZYBA 5LA1A 3S57A 1LOGA 1UOJA 3GALA 5KHHA 3VBOC 3WF1A 4BDVB 1CAVB 1ODNA 1PO13 1RVF2 5F5CA 3S7IA 3SHRA 3U4XA 2A71A 2ZGRA 4MSVA 5E89A 2VOXA 2BZDA 5BNNC 2D3RA 3MGUA 4ORFA 3AKPA 2CGPA 2RHPA 4C91A 4P9JA 4D94A 1JBCA 1M4WA 2P3JA 2QZ3A 1DQ1A 4K20A 2PAMA 4AGGA 2PAKA 3AP6A 4NJ4A 1WZXA 3JXSA 5JI7A 2X05A 3VL9A 2OIIA 5IVCA 1QOOA 3UV9A 3VV1A 1AZDA 1ZA7A 1BLZA 1O59A 4CPBD 3BOWA 1HB4A 5FYUA 5H9RA 2B9UA 3WNNA 3SITA 3OTFA 4E2SA 2W91A 2GN3A 3POIA 3IN9A 4LIUA 4M3CE 2P6HA 3JB8A 1SMVA 3BCWA 1ND3C 4A44A 1NOVA 4MG2A 2WNOA 1D2SA 2AEYA 3USSA 4J1XA 1HN0A 3NAPA 3OCPA 1LU2A 4FI9A 1O3TA 5FZOA 3B69A 2D6KA 2W0XA 1SQ4A 3LKJA 2KD7A 3O5SA 2Y6KA 1VIWB 1BXHA 2EIEA 3K51A 4AHZA 4CCNA 2ZGSA 1RUJ1 4NN0A 2E7TA 4CP9A 4OI0A 1FOD2 4ZS2A 2Z42A 3IZOA 2GC2A 4JAAA 4WM7A 1W6PA 1ZBA3 2MEV2 5FO8B 1CR7A 3BODA 3ZXJA 3NSTA 4X6QB 4A41A 5IAXA 5JLVA 2QQIA 2RE9A 3FFQA 3DYPA 3USUB 1I6XA 5FPVA 2FCUA 1D2QA 2P17A 1W9WA 3ES4A 2X09A 5JSPA 4Q4W2 4AQ6A 3MYXA 2BGOA 4AXOA 1W8TA 4FFGA 5A1FA 3OYWA 1E5IA 1R093 1W06A 4PCRA 4I0BA 1CPMA 3SNMA 3N7LA 3KQRA 1VBB3 4FAHA 3O1VA 3KV5A 5M0TA 3FBMA 4RR3C 1S2EA 1YNAA 3FUQA 2KR2A 1DCSA 5FBJA 5A32B 3ZFFC 2YB7A 1VRH1 2Y6HA 3J9SA 2PLV2 5ANQA 2BERA 5A33B 4JKKA 4KG0A 4RSUA 2WT0A 4OLLA 3EQEA 3OSDA 2CGNA 2UU8A 4CCDA 5EPAA 2R073 2WR9A 1VR3A 4NIGA 4BYYA 1CAXB 4QM8A 2YFZA 3NJXA 4TYSA 3ETPA 4FQ4A 4AFCA 1D0GA 5AC92 4D6RA 1MEC1 2LS6A 2BNNA 4YVSC 4JGZB 1ZZ6A 2QNKA 1BMV1 5CAZA 2W1QA 1ZZ8A 1UIKA 2DCYA 1PVXA 2J1VA 4MH0E 4NMIA 1S0IA 1W8HA 3D5OA 2CWMA 3WF4A 2WUHA 5C5UA 2WZR2 3PVBB 1UZWA 1RINA 4CVUA 1RHI1 2DF7A 2F4LA 1HV0A 5CFCA 4IDZA 2YHJA 1NAEA 1UU5A 4FTSA 3AMHA 1I9RA 1W2TA 1YJKA 1AL0G 2ZTNA 3J8F1 5T3NA 3V65A 3DL3A 1UX6A 4PBOA 5FPZA 3WQ0A 4AFBA 5BNOB 1OKQA 5F3IA 4ATEA 2P3IA 2PHFA 3RZJA 2Z4FA 3M2MA 5LATA 2ES3A 2PAEA 4R52A 2OQ6A 3TNPB 4K1YA 4YZ3A 2TBVA 4QQLA 3S5QA 1K5JA 1MS9A 3JD72 1UZZA 2JX9A 2XLAA 4QKDA 3SXWA 2HEVF 4X6RB 3OOXA 3WP5A 3T0BA 1W3XA 1OHFA 4R4ZA 3MIGA 1VBD2 4AGVA 5EJ1B 4AVVA 1PK6A 5C8CB 1O3QA 4I02A 2GP5A 4BQYA 3N3HA 1OURA 4Q1PA 4Z07A 5D2AA 2CY6A 3L2HA 1XNBA 1OUXA 4LHNA 3OD4A 1VJ2A 1W3VA 3MFAA 4GH4C 1HXS3 3B94A 4G3YC 2YU1A 3UETA 5KC6A 5FPUA 5C3PA 4MGTA 4COUA 4UF0B 2J42A 4GWMA 4E4SA 3ASIA 2XQXA 4K6BA 4BPZA 2R7EB 3VKOA 2Z2SB 3J7MA 1LU1A 5FDBA 3BYWA 2A3YA 4P9XA 4K40A 4GMP1 1QJY2 4OUSA 1YUDA 4URAA 2VCAA 3V0BA 3RI8A 4R9BA 4UXAA 3KHCA 3HVDA 2XKOA 3FMGA 3OUJA 5AFEA 1PO21 2VY0A 3JD73 4FO9A 4LBLA 4TWTA 2XVLA 2EIGA 4X8NA 2ORZA 3PUAA 3Q8FA 3AP7A 5E1RA 1CZSA 2WSVA 4TZDA 1POV3 2WZPP 1GV9A 2V4AA 3PU3A 5KXEA 3BPSA 4XF9A 2ZHMA 2AR6A 3JUUA 1UF2C 2XH6A 5KBFA 2CDPA 3WOGA 1T2XA 1OQEA 2Q4SA 4QHOA 4DPNA 1RVF1 1ZZCA 3OBZA 3R0RA 1YEWA 2BDRA 2VW0A 4M0NA 2HBTA 3GYDA 3SH3A 4N9HA 4YW3A 4YW2A 4MADA 3USUA 2VOVA 2RR12 2EVXA 4L97A 3LEKA 2GU9A 1LAJA 5T55A 3H7JA 4GB32 4RA0A 4JC1A 4K8FA 1LNSA 1IS5A 2VCCA 3NJYA 4IQPA 1IHMA 1PGW2 2H6CA 4XE9A 1GZTA 5L7OA 4JVAA 2FZ1A 4I01A 5KHIA 4M0HA 4YNIA 2Q8EA 5DDJ1 2PHTA 5JI9A 1K3IA 1SCRA 4OI4A 2E7QA 2WQ8A 2P6CA 4QX7A 2RS12 2RR11 3A21A 4K21A 2HJIA 3W58A 4R9AA 2ZGKA 2ZHNA 1KS4A 1GZWB 3NNFA 5KXCA 3T0AA 1AYN2 4BOWA 2HWC1 4PDWA 3CQOA 1VRH3 3SCHA 2VULA 2HWF1 2WO2A 1KJRA 2B42B 1GQGA 1DHKB 1UXXX 4QX0A 5FZ0A 2HYXA 1O91A 1W6OA 1WMFA 4I09A 5A3TA 1CJPA 3DV8A 2IWGB 2CYFA 3DUIA 1X8MA 3ACFA 3WY6A 3ACGA 3TEWA 5HCFA 1Y4WA 1H2MA 4AYUA 1C5HA 3KT4A 5FWEA 5FMBA 3O0XA 2ZXQA 3WNOA 1COV2 3W5MA 2CV6A 5ISLA 4BIOA 3GCWA 4JGYB 2XJRA 3VBRB 3KT7A 1IPKA 5D8AC 4DNYA 1KRIA 2ZEWA 4WZCA 1DG6A 4COYA 3ZN4A 3CZUA 1VB2A 5FY0A 2D6NA 5JXJA 3DKWA 5C33A 4XFBA 2HEYF 1JU3A 4YVSB 4E8DA 4UFMA 1REFA 3WQ7A 1APNA 3AKTA 3ZDVA 3ME2A 5IVBA 4P5HA 2L9LA 3I59B 1GNHA 1SZBA 4QQ2A 3TB0A 4B1LA 4Z82A 2VMCA 2AZ5A 2HLEA 5JPNB 2JB4A 5FBZA 2ERFA 2E32A 1AJOA 1AYN3 2DVBA 2D5HA 1VRH2 3AP4A 5J48A 1NA1C 4BISA 3ZXLA 1POV0 4HONA 1UU6A 2FHRA 1NCQC 1QDOA 1H8TC 2V72A 4LHLA 4XUPA 4BU2A 3GJAA 4CE8A 1NCQA 1GZCA 1QQP1 1LRHA 5A7OA 4AWDA 1WWYA 1TVGA 4XOGA 4R9DA 4UOJA 1GANA 1WD4A 3WINE 1J1LA 4Z92B 2VBDA 3WDXA 3PDQA 5EFUA 4BLJA 3UK9A 2DVGA 2ENRA 3AFGA 4TTGA 4NHKA 5HV0A 1O3RA 1PZ9A 2B4KA 4LQRA 1JYXA 4H55A 2JDPA 4HG6B 4DXZA 1GQHA 4RR3A 3ZN6A 3ZM8A 2WRAA 2XWJB 1W2UA 4W8JA 2JIJA 2WZR3 4XDOA 3MLLA 4WVMB 4XQDA 1TMF3 3K3OA 4NROA 3WDTA 1MACA 1FI2A 1RUI2 2PN5A 5ACA2 1A6CA 1RUG3 1S0EA 3KWVA 5DN2A 4AE2A 3B00A 5FY5A 2R041 1VBC3 4QB6A 1ZBE2 3VUOA 1NCRB 1H8VA 2X10A 4FQZA 3J4UH 4LHSA 5HXVA 4LO6B 2DWRA 2MNGA 5FREA 5F7UA 4GQ7A 2D93A 2A6XA 2JG8A 2YUEA 4Q4V1 3E6DA 4AL9A 3BTAA 4YLZA 1W39A 2RS33 5FQ0A 5HBAA 3TN92 2XOMA 3B93A 2OS2A 3AKSA 5G04L 5LK5A 2VNRA 4AF9A 4Y5TA 3AMQA 2E9QA 4MHRA 1ENXA 4K8RB 4PBPA 1SLLA 1HDKA 2XR4A 1PGL2 5BNPA 2ZAAA 5C4WC 5L9VA 1JOBA 3KV6A 4IV3A 3OF1A 2VJXA 3UJOA 1O3SA 4OFGA 3I2OA 5C70A 3LA2A 4IE0A 4XBLA 1OMIA 1IQAA 3NW4A 1TMF1 3NAPC 4XTMA 3PLQA 3VL8A 1OPOA 4COVA 3MI8A 3WD5A 4C1XA 3ST7A 3FHQA 4FTEA 4L2NA 1K12A 1VBD1 1RUG2 2EAKA 1GR3A 4LBQA 3POEA 4F7ZA 3VBHA 5FIXA 3LCPA 2QQWA 2VG9A 3OGRA 4IEXA 3HOBA 5JR7B 4OZOA 4YGBA 4ES9A 3T4HB 1TG7A 2JIGA 3E5QA 3GNEA 5CIRA 2RS31 2WSUA 3W21A 2YYOA 1NY72 4JKLA 3AX4A 1DLCA 2TNFA 2BRTA 3J7HA 1WGPA 4XFAA 5K8SA 4L11A 4WV8A 1XE8A 3AMPA 4DB5A 4CUBA 4DMIA 4JX0A 3WDWA 1LTEA 2JDNA 5SV8A 4CEYC 5I93A 3VD9A 3EMRA 1UQXA 3C7FA 3JB4C 1NYWA 3CLPA 3M3QA 3PURA 5CNAA 2MHFA 5FTTC 5FZOB 1D0HA 2DBNA 4NHLA 3VBUA 3OPTA 4RQPA 3OGGA 5EV7A 4LOSA 4XW3A 2OZJA 3ZFGC 3VD7A 1NA1B 5IK7A 3E6CC 3FHAA 3AXDA 3VZMA 5IHRA 2NPIA 3KB5A 3BALA 1PGL1 1OOPC 3D8CA 4JTOA 3T1MA 4R8HA 1W2NA 5A7WB 4EWAA 1EUUA 1JI6A 1FXZA 2VNOA 3NNLA 1P8JA 2G9GA 2UWBA 3WUCA 3VLBB 3PUHA 4MGQA 4QDRA 1N47A 3RQ0A 2RJLA 2VW1A 3OB8A 3RFRA 2G9ZA 4R4XA 1JN2P 2VCBA 2X5IA 4YW7A 1R081 4YARA 2EAAA 3IDAA 2VZUA 4XXPA 2QQVA 1W8ZA 1SEFA 1N1SA 3FX3A 3VBFB 2ZEZA 1XQNA 3ZXAC 3D3AA 2WFF3 4QQHA 3O1TA 3LD8A 1GP6A 4GKXA 5KC5A 1CX4A 2VVEA 1WLCA 2DCTA 1UYYA 2AH2A 1AYN1 1UW8A 4Y5SA 5FZEA 1JS9A 2YY1A 5C7GA 1EV12 1C1FA 2HWC3 2FBEA 3UGGA 4HMZA 3O7OA 3BN6A 5FY4A 4FAGA 2B9VA 3APBA 2QQOA 5DZEA 4CRQA 4Q0SA 1JU4A 2ZOEB 4YFWA 1Z0HA 1DU3D 4Y4RA 1VB4A 1GWKA 4AQ2A 4UF0A 1OT5A 2WS92 1RXFA 4JTNA 2GP3A 3ZIWA 2VZRA 2VUAA 1OF3A 1NZIA 3MLJA 5A3MA 2PHWA 4XEZA 1IS3A 1QJX3 2R1BA 4YZ4A 4OHWA 1RUF1 4DXRA 2ETEA 2ATFA 3MUY1 4PI2A 1ZX5A 3FBYA 3LB9A 4ZU5A 2I07B 5FMOS 2XWBB 1PK6B 3BVCA 5A7NA 2GMPA 2D5FA 3LOIA 3RZKA 4FFHA 1KFXL 2J1RA 5CFDB 4PQQA 2DCJA 2XGXA 5I8YA 4CDUA 3MV11 2WFF2 1JH5A 3VDDA 1OLME 2RDRA 4KU8A 4NAOA 3RRDA 3WEZA 4UW5A 2R32A 1V9U1 2UURA 1ND2C 4RYDA 5LWBA 3EYPA 1CIYA 3N9MA 4QDSA 2BVVA 1WW4A 1ULDA 3D0JA 2VUJA 2W52A 3HQRA 3JZVA 2Y8KA 3P3NA 4AQTA 4AEJA 3BIEA 3BTZA 1AL23 4LBJA 1V70A 4QKFA 5IVJA 5FZ1A 1XBFA 3ZFGA 3HN3A 1OOPB 1UWWA 4K1ZA 1MS8A 3NKTA 5FZIA 1UN1A 4AVBA 5FZ4A 2SLIA 2RS51 4Q4X2 5A3UA 3HBKA 4MVTA 1LKNA 2WN2A 2Q8OA 1PO12 1RVF3 3W9AA 4OZXA 3WP6A 4DRVA 2G4IA 2ZX2A 5A80A 1GP5A 4RR3B 2GNTA 1UL9A 1QJZA 1XNKA 1YWKA 3TNQA 2YBSA 1BKZA 1K42A 4AI3A 2JDZA 4P14A 5FAXA 5CBLA 3B01A 1ZZBA 4OUMA 5FOBB 2VTXA 4XURA 4XPVA 5JDBA 5LZ6A 1NCRA 5CFCB 3FC0A 3WF0A 1NKGA 2DURA 1XU2A 4RGAA 1EP0A 4K7JA 2WNUB 2JECA 1J1TA 3C8XA 4GKYA 5DQ0A 3ZKUA 4CCLA 4DXSA 2LALA 5ACA1 1VMHA 1YYNA 3QH7A 3NMBA 3VBSC 4HLTA 1W0OA 2HWE1 4EV0A 1FYUA 1H9WA 4HK8A 4GH4B 4PLOA 1V6JA 2AYHA 1AXKA 3IDCB 3TYJA 5I0RA 4AFMA 4UW4A 5L7OB 4QPYA 5LEKA 4GMP3 3H3UA 1VBE1 4Q29A 1V6LA 1KEXA 1AR72 1LR5A 1A78A 5EYYA 3M3CA 3M3IA 1AYM3 1RUE3 4ZONA 3ZFFA 4PHZA 5C3SA 1R1A1 4OI1A 3ZIXA 5LEJA 4Q4V3 5CB7A 1ULPA 1B35A 3E1F1 1D4M1 2C24A 1CZVA 3OG2A 3O1OA 1DYPA 3AZXA 4WBBA 3SEPA 3I2JA 3KF3A 4E4ZA 2ZAHA 4AVTA 5JWPA 1WKYA 1PNGA 3WDUA 1N3OA 3KZ4C 1UZYA 3L2YA 1QDCA 1RUC1 2TEPA 2VXJA 5A6ZA 2ZGMA 3MW4A 4IL7A 1MS4A 2BWAA 1UZVA 3GZTB 3OEAA 1ZBE3 1YFUA 2VOKA 5IVEA 1BJQA 4LKSA 4RHV2 4B3NA 3Q8EA 1QJY1 2F17A 4CU7A 2HWE3 2IVJA 5FZHA 3VZLA 3WUDA 3KHBA 1KQRA 3H9AA 3T08A 4L9BA 5C3OA 1OPMA 3ZR6A 1IPJA 1SDWA 1XSQA 2Y26A 3NV3A 1R092 4LORA 2ZMKA 2D44A 5BNPB 3WV6A 1RUD2 4IGOA 1FV3A 3H1MA 4QPIB 2QTWB 3VDDB 4HZFA 1AR63 1WLDA 2QKDA 2ZS6B 3SCGA 4B7KA 2DFBA 1HRI3 2CHHA 1BZWA 1O5LA 3O12A 3VBUB 5A3WA 3C7OA 4XF1A 1JZ3A 4GXLA 3DXTA 2PLV3 5DAWA 2R1DA 5LB6A 2NYYA 4GB33 1LGCA 3S7EA 4BLIA 3LGRA 1WCKA 2ADDA 4AVSA 4B4QA 3VZKA 5I0DA 3GXUA 5LBFA 1KGYA 1EPZA 4CDQB 4EZ4A 1PMHX 2XXZA 4B29A 1LECA 1OF4A 4S2GA 2PA7A 4GIQA 2GN7A 2WO7A 4HN1A 2YBPA 2OUJA 2Q5TA 3I2KA 4Q4W1 3T09A 5HPOA 1PHMA 2LRPA 2Y60A 2MEV1 1DBNA 4NRPA 3POSA 3OEBA 1YFYA 5CEHA 1QIQA 2KA3A 4XBNA 5E88A 1NXMA 4XAEA 1ASJ1 2XJUA 5J09A 3I3QA 2CSGA 5T52A 3ZYPA 5A3PA 1SHWB 3K3NA 4AEDA 5J1XA 5J96B 1NT0A 2WDBA 4Y1VA 1W0NA 1BEV1 3VBHB 1S4CA 1K45A 4P08A 1IKPA 1H2KA 3ACLA 4Y20B 5DUUA 5LA2A 3RWKX 4YPJA 3U10A 3WHTA 4A2UA 1RITA 4NIDA 4IESA 4DINB 2O8QA 2XPJA 1AVBA 2KXLA 3KF5A 4XQWA 5LY1A 5EXOA 5FY9A 4KQ7A 3R4SA 2B39A 2BFUL 4WVWA 3FWEA 3K2OA 2VZTA 2JG9C 2Q1FA 2A6WA 2IXLA 1H4HA 1C4RA 4M00A 5AVAA 1NCQB 1BBT3 1LHUA 4Y1XA 1L7QA 3HR9A 5CFDA 1UPSA 2JG8B 4META 4QU1A 4TN7A 4V2VA 1X7NA 2YC0A 4N53A 3MIFA 2VPVA 1DGRA 1VRBA 1HRI2 1RGSA 2ZHLA 3T2QA 1QJFA 4L0PA 4ZXKA 3VKLA 4DUXA 1GWMA 1LOFC 3AKRA 1IZ3A 2JKBA 4CDXC 4Q27A 4EWDA 5C3QA 5BNPC 1YQ6A 1V0AA 5GKAC 2Y6FA 2BWCA 1VBA3 2VMFA 2DU1A 1ONAA 1YHFA 2ET1A 2WC2A 1OQ1A 4LK6A 4CDWB 4OQ8A 4XUNA 4XF4A 4AI2A 2WFPA 2VAUA 2WN3A 5L7OC 4YG0A 1R1A2 4D69A 1XYOA 4QXKA 5GZFA 3RS6A 1OLMA 2PQQA 1AF9A 1BHGA 5LBEA 3VBSA 2VNVA 3QOPA 2RMU2 2UYAA 4DUVA 1SG3A 2VMGA 2LUWA 2Q0AA 1JXNA 2FMDA 3AL5A 5GALA 3ZFGB 4MXWA 4AI1A 4CEYA 1PO23 3JD71 1KD7A 1N3PA 1OD3A 1S0DA 1DLLA 2WNVA 4IETA 4KBZA 4YM2A 4B4PA 4HK9A 4Q4Y1 2ARBA 1REDA 3MIHA 3PJYA 4HT1T 4BK4A 5HI0A 2UY9A 3FLRA 4QGLA 3RGBA 1NXD1 4KWLA 3I4IA 3POBA 1JUHA 1UMIA 3D0SA 1J84A 1ACCA 1PIV2 4NHXA 3EO6A 3IPVB 1W9SA 5DPNA 3I3BA 4CCKA 3MO4A 4M3CB 1AXZA 1HIXA 1L7LA 2NMNA 3RZGA 2BW8A 1MPXA 1NE4A 4LUMA 4IXLA 1UU4A 5F2WA 1VBA2 1YFWA 2KM2A 3L9JT 5K0UA 3OBTA 5A7WA 3RYKA 4DO0A 3UKNA 2VZOA 2ZMNA 4W6WA 1ULGA 3QCWA 1S1AA 2PHUA 2Y34A 3VZJA 4L8QA 4GH4A 1O7FA 4DQAA 3PVEA 4UYBA 4WZFA 4AG4A 2GH8A 4IE6A 1MS5A 4LJHA 4ES8A 4P9GA 2NQYA 1LCLA 2XLFA 2DUQA 4N9IA
chains in the Genus database with same CATH topology
5T5LA 1Q8SA 2D6MA 1QNYA 2R6QA 1U0AA 2F6BA 2VVFA 1PGSA 5GZEA 5D8AA 2JEMA 3M3EA 3MFCA 2HYKA 1NCRC 1LOCA 5C9AC 4EN8B 4DY5A 4UBHA 5CFCC 4G4FA 1R1A3 2DTYA 3OY8A 4N43A 4YW1A 4EROA 4FPLA 2UWCA 4AHYA 2ZBJA 1MEC3 1OA2A 2D7FA 3AZWA 4EN9B 2NM1A 2JENA 1SLTA 3V0AB 2BYVE 1QXJA 4JDNA 1S0JA 1YO8A 1DDLA 1FMD2 5CG9A 1CAWB 1XU1A 4XYXA 4MGKE 3NAPB 1BQPA 1RUJ2 4KWKA 4S2DA 4MV2A 4XHBA 1GKBA 1TNFA 3U11A 1ALYA 5C4WB 1F5JA 1R091 1W6PB 2YXSA 2WT1A 2WNUA 3WCRA 5CADA 3KS7A 4J1WA 3KMHA 1UCXA 5BY5A 4LO5B 2A75A 1C57A 4CDUC 1VAKA 1V6OA 2WINB 2R063 5DZFA 5BPXA 2JG9A 3IMNA 3R6SA 1RB8G 1H1MA 4CEYB 5E8AA 4YW4A 1MEC2 1FAYA 5FOJB 2R071 3ZSLA 1H0BA 3O0VA 4UBGA 2NLRA 1COV1 1LULA 3WDVA 4W6XA 1NLRA 2AREA 3DPRB 4MX3A 3GZUC 1VAMA 3OGJA 5A32A 5JCTA 1N3QA 2WJSA 2P37A 1ASJ3 1OLQA 2FZ2A 4G9SB 3AKQA 1RUF2 3ZYIB 5T5OA 1BEV2 1DGLA 1ENSA 4CP0A 5JIUA 4D7YA 3VBOA 4WM7C 5C9AA 1DGRN 2XBO2 4I0AA 4HKOA 2VQ0A 4FPEA 3ZSKA 3AP9A 5FLJA 4Q0QA 1DQ5A 4DOUA 3ALQA 3H8UA 4QPIA 1OD5A 4YZ5A 3ETQA 2RM21 3Q9OA 5CVRA 3B02A 4XJWA 3S6PA 5DG2A 3RG0A 4AVAA 4DRRA 3RJ2X 1AR82 2Y0IA 3E97A 3A0NA 1C3HA 3QBQA 5C8WA 2C9AA 5BNOA 1LENA 1S0FA 1FATA 2BNOA 1WBFA 3ZXDA 3HQXA 1X82A 2MEV3 4FBFA 1XNCA 4C90A 2GMEA 3ILFA 1ULCA 1ZRFA 1XE7A 1HRV3 3GF6A 2BGCA 3V0BB 1QH7A 2RS52 3IM0A 3TWIA 5AC91 1BBT2 4ONUA 2B45X 4BHPA 4M3CF 5FCCA 1AR92 4NPRA 4Z1VA 2A6YA 1QF3A 2ZGPA 3ILRA 4AQSA 5A3LA 4LLFA 4CDQC 3T2TA 4HANA 4S2FA 3AM2A 5JOWA 4LNVA 1A3KA 5C9AB 2EA7A 1FMD1 2DCZA 2WNEA 2Y38A 4Q4Y2 5F6LB 5GZGA 1WW5A 4LR4A 2XJPA 1ENRA 3RYPA 5IK4A 5TSWA 1MS3A 1CQ9A 1FV2A 1CN1A 1QHDA 4YRDA 3UKVA 4FSJA 1S2BA 1XXNA 3IBMA 4U2AA 5DG1A 1LB2A 5BNQA 1HLCA 1RUG1 2VNGA 2VMHA 2JJ6A 3WW2A 3KSCA 5CU1A 1FNZA 2IXKA 1FPN2 4PDWB 1F31A 1TME3 1AR91 2W68A 3HN1A 3KGZA 1BYHA 4QGNA 3H1YA 2AUYA 1S0BA 2W39A 3A4UA 4LA2A 5I0TA 4QQOA 3HT2A 5BV6A 1CAXA 4IEPA 1H2LA 1X33A 1EAH3 4N53B 4IEVA 3LA7A 5C8CA 4YGDA 2VH9A 1PIV3 1L3JA 3CU7A 1WW6A 1NA1A 3I59A 4OVEA 4KH9A 2GNDA 1HKDA 1UIJA 4Y4YA 1TNRA 1G9CA 1Q8OA 3BIWE 3HBZA 4HBNA 1A8DA 2A70A 1S2KA 4LT5A 1SBEA 1FPN3 2ZGOA 3POWA 4N7UA 5J37A 3HIFA 5GJ6A 4BCUA 4PIZA 3ZFEB 1EY2A 1AR61 1QQP2 1AL21 4IEQA 2Q1ZB 3GHNA 1H4GA 3R4DB 2WLQA 1MQTA 5D8AB 1I3HA 3JQWA 2WS91 4I2OA 3NWKA 2B8MA 4HKLA 1RUI3 1TQ5A 3NV4A 3V0AA 2CAVA 4HVOA 2JXAA 1RHI2 2H0BA 1YXWA 1QXPA 2VU9A 3D82A 4Y1ZA 5IUQA 1FOD1 3WCSA 1FT9A 5K7PA 3TAYA 1H1IA 4QQPA 4FPOB 5ABJC 4BE3A 1AHSA 4QPGA 4JCKA 1TE1B 2HKXA 2FQPA 1LHNA 4M3CA 1UKRA 3ENRA 4Q0VA 4MGIE 4CP2A 5JSOA 3JQXA 1QNWA 1CAUA 1RC6A 1CGPA 1O4TA 1BK1A 1G7YA 5LK7B 1C5IA 1Z7S3 4Q4V2 4YVWC 1KITA 4Q2FA 1DGWA 1RUI1 4FOQA 2PLV1 4K3UA 1AR83 1YIFA 2A3XA 2XG3A 3DPRA 4WVMA 1UPIA 1RUF3 4CYDA 4P9LA 4MUVA 2E63A 2XVGA 2BQPA 4IEUA 2RM23 3A0KA 1NG0A 3VBOB 1H9PA 2R30A 4U36A 1WA4A 4PLMA 2WA3A 4XFHA 1SFNA 4COZA 1V6NA 2DUOA 3INAA 1QWRA 2JICA 2VMIA 3VKNA 2P3KA 4BH9A 2HWD3 1SBFA 4CDWC 2XHKA 5D1IA 3JBG2 4C0HA 2N7GA 4Y26A 2YZ4A 1BEV3 3ZN5A 1G9DA 4XILA 2GC3A 5DZGA 1BVVA 3OJBA 1VALA 4RQPB 1RJ7A 4YYOA 1VLNA 3KM5A 4Q8KA 4MYEA 1LODA 1B09A 1D4M3 4PJYA 2Z79A 3ZFEA 2C0ZA 2O1QA 3ZYRA 2K9ZA 3U0ZA 4NOTA 4Z8BA 3PMEA 1HX6A 1RUD1 4K9SA 5FRAA 4YFZA 4KGQA 2JG9B 5E16A 3ZO0B 4ZU7A 1G9FA 2D98A 3WW4A 1VBD3 5GLVA 4Q4W3 1AXYA 4KG8A 3ZXKA 4PLNA 2A6VA 2HWC2 1N1YA 4FP2A 4ISQA 4JRLA 4LA3A 2C1FA 3RMXA 2WWSA 3ZSEA 2DFCA 2GC0A 1ULEA 2YMZA 1CPNA 2D40A 1OQDA 2DYCA 4LTAA 4AVCA 3OY8B 4FCAA 2QDNA 1H1AA 2YPJA 2ZGLA 4N43B 5BNNB 2V73A 2E7AA 3AFKA 2V5YA 2ZKNA 5GLUA 2BUKA 3GBWA 1IS6A 2VVDA 3IIAA 1J3RA 3E5XA 3DGTA 4RGGA 4PDWC 1FMD3 3B3QE 3MW3A 4MLOA 1K5MA 1FX5A 2ZZQA 1ND2A 3URFA 1RUNA 1ZVFA 5KXBA 3B5LB 1G9AA 2QQPA 1VP6A 3R05A 1ND3B 2LM3A 3K48A 1EV11 1C1LA 2IXIA 4XBQA 2E6VA 3CF6E 4AEKA 2DUPA 2D3SA 1W6MB 5HCBA 4NWWA 1YCIA 2ARXA 3WVJA 1AX2A 2R072 2DU0A 3VDDC 4QMAA 4KU7A 2PHXA 1DZTA 1WUVA 1HRV1 1MZ5A 1ZZ9A 3LSDA 3KCXA 4IV1C 2TUNA 3I54A 4Q0PA 1MR5A 1RJ8A 2OPKA 3NKGA 4I30A 3E5UA 1DQ4A 1PVC1 1TME1 2DTWA 2OYZA 2HWB3 3HMYA 1QJX2 2JD4A 1UKGA 3ZN6B 4E2QA 4XTPA 4EN7B 4AI0A 4XJZA 2ZX1A 1DF0A 4UW6A 1QY4A 3BPZA 1RUD3 4ZU4A 4XMAA 5AVPA 2HWF2 4Y24A 4IEOA 3RJRA 3WW1A 2EXJA 1KDKA 4HPKA 1J3PA 2D3PA 1U12A 3PNAA 3IDBB 4FPYA 2YDEA 3CJIB 3NV2A 4FPGA 1LJ7A 1OLRA 5EZWA 4JQRA 2CNAA 2OW4A 4FPHA 1NQJA 4QX5A 2RMU1 4Y1UA 3ZMNA 4LHKA 5DDJ3 1ENQA 4V1PA 2D97A 1ZRCA 3RI9A 2D6OX 2GH2A 1JHNA 1TEIA 3N36A 4LEJA 1Y3TA 1Z7S2 1O5UA 3SMHA 3FUOA 4CDWA 5L36A 1SBDA 3ZXGA 5KHGA 1TMF2 4UW3A 1PVC2 1URXA 4OHVA 1X8EA 1QJU3 1I5ZA 3VBRC 3N7JA 4WM7B 2SBAA 4XXAA 4IEYA 4KNCA 5JIAA 3B9CA 2CWSA 1ULFA 2WS93 5K9YA 1S0GA 1WD3A 1WMEA 2ZZJA 3U07A 1RUC2 2WQ4A 4IV1B 3M4FA 1XYPA 2V09A 1G6NA 2WQZC 1KXGA 3RYRA 4LO8A 4PQ9A 1BVP1 2ZGUA 4LUKA 1S0CA 3KD4A 1ZRRA 4YVWB 2R0FA 4CDXA 2NZ9A 3PHMA 1DIWA 3H50A 4KGGA 3MF9A 4Y22A 2WIIB 4WM8B 5JSRA 3HWJA 1H8TA 2ZPXA 1G86A 1Y43B 1PVC3 2XL9A 4FOYA 5DUVA 2GC1A 5I91A 2Q1MA 3MZHA 2DVDA 1NE6A 1POV1 2PELA 1W0PA 4LBKA 3CJIC 4F8AA 2IZWA 4Y1YA 3IT8A 3WG1A 3ELNA 2B5HA 4Q4X3 3AYAA 4BIFA 1SLIA 3AJYA 1AR71 3KGLA 3VHNA 1IGOA 1RUC3 4WVZA 3FZ3A 3ATGA 1YRZA 2BPA2 4MXVA 1OA4A 1S55A 3JBG3 1FOD3 2DCKA 4HPKB 1OSGA 1IOAA 4CZSA 1Y9QA 1MQTC 3LOBA 1E57A 2RJKA 1JOJA 2G9FA 4A7ZA 3FLPA 1NZCA 3WNXA 3AZVA 1LHVA 4OHZA 4ASLA 2WL1A 2D6PA 3VHOA 1KFUL 5LRSA 3MEPA 1DZQA 4LULA 4H3WA 1W6QA 5J36A 1WMDA 3POYA 2UWAA 3WT3A 4B7EA 3S0MA 4RL7A 5H9PA 3ZX7A 4D7TA 2B46X 3BU7A 3ZFFB 1H8TB 3KCYA 2VECA 1B35B 1EV13 1Q5OA 4I3GA 1JYCA 2D43A 2ILMA 1QOTA 2BBVA 1DQ0A 4YM0A 3RNSA 3IDEA 1VAVA 4N43C 1PNFA 3PMSA 1CJDA 2RM22 4IEWA 4ATFA 2XBO1 4QPGB 3PVNA 1JUIA 3VHPA 1J59A 4MZUA 3CO2A 2K0GA 4RS5A 2X29A 3QLQA 5BXXA 3IPVA 1C8NA 4Y20A 4F3JA 5FLHA 2YV8A 3J26N 2ZA9A 1U5YA 1REEA 3WG4A 1OFSA 2JE9A 4AEDC 5T5PA 1JTZX 1DGWX 4L92A 1QJX1 3C3VA 4CEWA 2EF6A 1QOSA 4NHMA 2DVAA 4JV4A 5A33A 2AGSA 2WZR1 1RTVA 2BTVC 2ZX3A 4DS0A 4YZ2A 1UMZA 2QZ2A 3AB0A 3NVCA 1ND3A 2GZWA 1MS0A 3ECQA 2WT2A 1VBA1 4KL1A 4NR1A 5AC93 1H30A 5JMCA 3ILNA 4N90A 2PHDA 3PTYA 4FVVA 3ZXEA 2WFF1 3SH4A 2UYBA 3AYEA 5JZGB 3KT1A 1V9U2 1HQWA 1MZEA 1V6IA 1YIPA 3WX5A 3ZSMA 5JI9A 5K0UB 3TRSB 4H14A 1N1TA 1Z7S1 3DPRC 1ZREA 4P9WA 1LOEA 2X53S 1GNZA 1SLCA 2OUHA 1WW7A 2IXJA 3GBFA 5BNNA 5DDJ2 3N4MA 3CJXA 2WNVB 1VBB2 2EXKA 4QU2A 4E9KA 2XUMA 4FPFA 1A8MA 4OHXA 4BZ4A 1MVQA 3FFZA 1HXS1 2PTMA 1AX0A 4CDXB 1PK6C 1W6MA 1QU0A 4YM1A 2A5ZA 4HVRA 4EWEA 1U5ZA 2UY8A 5GZDA 1CVNA 4FPJA 2PHLA 2ZKLA 4OULA 5I8SA 4Q8LA 4IERA 4RHV3 4AFAA 3ZSJA 5H9QA 5GLTA 1LEDA 1PO22 3WG2A 3WZ1A 5FO7B 1EYBA 4GA9A 3HAGA 3VZOA 1W6OB 1CD3G 4I0WB 1RUH3 2RS11 2CGOA 1QJU2 3GZAA 3OD0A 3WG3A 1NQDA 4ISRA 4BA6A 1O4ZA 3I7DA 1COV3 3RSJA 3KLSA 1XNDA 2OVUA 4XQ4A 4WM8A 3RDIA 2YROA 2IXCA 3CJIA 3CL1A 2QE3A 4AHXA 2ZGTA 5DXDA 1AL22 4YW5A 5FQ0B 1AYM1 1RUE1 5KHKA 2BEOA 2EXHA 2E51A 3VBSB 4FTBA 4AFDA 2XLGA 3J8F3 1AR62 1VBC1 4Y5Z0 1SCSA 1HV1A 2K2SA 1U5IA 2O8OA 2R061 4YG6A 1HRI1 1RMU1 3WXPA 1WLWA 2Z5WA 2R16A 4RFT0 1DYKA 2RS13 2BVBA 5F9TA 5JPMB 3AMMA 3EXUA 1ZZ7A 4XMIA 1WCSA 3MICA 4RQPC 4QD2A 1V00A 3WLUA 1TME2 2GDFA 5H9SA 1RUH1 2PYTA 5FO9B 1FNYA 2EXIA 1QJY3 1Q8VA 3M8LA 4Z2WA 1IKQA 4HSLA 4CP1A 1ZNPA 4I3PA 3LWCA 1UAIA 2VW2A 4P9YA 3TN91 1KJLA 1Q8PA 3TN93 4H7MA 1VBE3 1BMV2 2R043 2PFWA 2XBO3 4DFSA 3B7MA 2QUOA 4KBBA 3FLTA 4RS5B 3MF6A 2HWD2 1ZM1A 3AJZA 3D4KA 1RUH2 3D6EA 2HEWF 2XJVA 3UKTA 2GSYA 4MGYE 3X29B 4CDUB 3HT1A 2A7AA 5GLWA 2XVKA 1VBC2 4GULA 1U5XA 2I45A 1WBLA 1MVEA 3BB6A 5EWSA 4LBQB 1CESA 2I2SA 2A3WA 2A6ZA 1JYIA 4PF5A 1CONA 3N7MA 3RPQA 1SLAA 3H7YA 1ZA4A 4FP3A 1PM7A 3SH5A 1AR73 1HQNA 3T1LA 4JDMA 2XKPA 1ZBA1 5I0UA 1JW6A 2CTVA 1KDMA 3S30A 4BQ1A 3VN4A 2VGDA 4RS5C 2F4PA 3PJQA 3LZZA 1GLHA 1V6KA 4GALA 2BNMA 5KWRA 3H1WA 2WNVC 5FMOL 2ZX0A 5AFBA 2GMMA 2QJVA 2IFRA 4TLFA 2R49A 4DY3A 1V9U3 2PHRA 3RZZA 3AXEA 5F6KA 4S2HA 1YJLA 3AMNA 1I1EA 4HL0A 3EJKA 4QHBA 1F2NA 4NVPA 3NJZA 4P9IA