1UZZA

Erythrina cristagalli bound to n-linked oligosaccharide and lactose
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
239
structure length
239
Chain Sequence
VETISFSFSEFEPGNNDLTLQGAAIITQSGVLQLTKINQNGMPAWDSTGRTLYTKPVHIWDMTTGTVASFETRFSFSIEQPYTRPLPADGLVFFMGPTKSKPAQGYGYLGVFNNSKQDNSYQTLAVEFDTFSNPWDPPQVPHIGIDVNSIRSIKTQPFQLDNGQVANVVIKYDASSKILLAVLVYPSSGAIYTIAEIVDVKQVLPEWVDVGLSGATGAQRDAAETHDVYSWSFHASLPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lectin
molecule keywords Lectin
publication title Crystal structures of Erythrina cristagalli lectin with bound N-linked oligosaccharide and lactose.
pubmed doi rcsb
source organism Erythrina crista-galli
total genus 55
structure length 239
sequence length 239
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2004-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00139 Lectin_legB Legume lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1uzzA00
2ZGOA 1Q8QA 4Y24A 4M00A 1Z0HA 3V0BA 3B01A 3LCPA 3ZXLA 4WV8A 2CY6A 3CNAA 5E89A 3WDVA 1PZ8A 1H9WA 3T2TA 2AUYA 1OQ1A 3NV3A 4XJZA 2CL2A 1RINA 3RMYA 3Q9OA 2DVFA 2WT0A 3A0KA 4I30A 1BJQA 1QF3A 3BOPA 4ITCA 1GBGA 2DV9A 3POWA 1JBCA 3WV6A 1JW6A 1MS5A 4R9AA 4YG6A 4AYUA 1SACA 2DVDA 1ENSA 4L8QA 2EF6A 3WCSA 1BKZA 3MW4A 2ZA9A 4FVVA 4YW3A 1UPSA 1ULCA 4F83A 2R49A 4GA9A 5GZEA 4LBQD 1LOFC 1S0IA 1SLBA 2P3KA 3RSJA 1HLCA 1O4YA 1YI7A 3FLTA 2C9AA 4FPYA 2YROA 3AZWA 5JVVA 3V65A 1GZWA 5H9SA 4AGGA 4FOWA 1DQ5A 2GN3A 4YM2A 3T1MA 4YFZA 1GZCA 2CTVA 5HCBA 3SH5A 2A3WA 1QNWA 4ATEA 1JYIA 1ONAA 3WG4A 1W6NA 3W59A 2A71A 2ZAAA 4BOWA 1W6OA 1LU2A 3APBA 4ASMB 1IS4A 3V0AB 4XBNA 3ZSJA 2A6ZA 2D3SA 1KDKA 1SLIA 2AR6A 3MW2A 1LOFA 2EALA 1N3PA 1WLDA 1QNYA 3R4SA 3AJZA 5EYXA 4BM8A 1W6PB 1S0CA 2PHUA 3PVNA 4K1YA 5L73A 5CAZA 3FBYA 1V6MA 2NMNA 5T5LA 2GNBA 1A78A 3B3QE 1QU0A 2GNDA 1BQPA 2ZGMA 1SCRA 4XDQA 3RMXA 2NN8A 4M01A 2A3XA 4AVTA 3ZXFA 5GZCA 1CN1A 4FOVA 1ZM1A 1AZDA 1O4ZA 1Y7BA 4GWMA 4P9YA 2CWSA 3PVOA 1FNYA 1HQLA 1D2SA 1S0JA 3POSA 4Y1ZA 3R4UA 2ZGLA 4P14A 3ZXKA 5E88A 4OZXA 1GKBA 3WDXA 3KM5A 2WQZC 3RS6A 1UKGA 3OBTA 1FYUA 3WG3A 2A6VA 3IPVB 1W6QB 1UMZA 1C1LA 2ZHNA 1LECA 5FREA 4BLIA 1YRZA 3LSEA 1QOTA 5DZEA 2D7FA 5EWSA 1CPNA 2RHPA 3AP7A 4WZFA 1X50A 3OJBA 4YW1A 2VXRA 2D6NA 1MS4A 4UW3A 1MZ5A 1WBLA 1LEDA 3WHTA 2A6XA 1DQ1A 2ZMKA 1LOGA 4FPFA 3VKLA 3OY8B 1WLCA 3N7JA 3DGTA 5DZFA 3USUB 1LOCA 4FPHA 1SCSA 1QOOA 1W0PA 5DG1A 1C1FA 3NV4A 5E8AA 4BQ1A 4YZ5A 1CESA 1G86A 3NV2A 2DTWA 2WKKA 3AYDA 1OFSA 1S0DA 4GWNA 4M3CB 2ZKNA 2OW4A 3AP6A 2LALA 1QOSA 1UZZA 2ZGTA 5IK8A 1SBDA 4LBJA 2CYFA 5T5JA 1B09A 3PMEA 2R0FA 2YXSA 3PJQA 4XHXA 4YGEA 4XMAA 4JRAA 5CBLA 2ZGRA 1MS8A 1Q8VA 1LULA 1BZWA 1HKDA 1W0OA 1WW5A 1WBFA 2AH2A 3HMYA 2ERFA 2DVGA 3HN1A 2JD4A 5H9PA 3OPZA 1VAVA 4Z8BA 4U2AA 1Q8SA 4HANA 2ZGSA 1QMJA 4BLJA 1LHNA 5H9QA 2UURA 2D6MA 4FOQA 1LOEA 3QCWA 1LTEA 2DWRA 1G7YA 4Q26A 2PHTA 1Q8OA 1KJRA 1MS9A 1LODA 4FPEA 5KXBA 3AJYA 3WG2A 1S0GA 2EXHA 1JXNA 4FQZA 4FPKA 4YZ4A 3A4UA 5CNAA 3ILNA 3SH3A 1J1TA 2NM1A 5GZDA 3WCRA 2I2SA 1LHOA 4XJ8A 2NP0A 1GYKA 2DU0A 3OBRA 3WOGA 3ZPYA 4R9CA 2YV8A 1OKQA 2OVUA 3M1HA 1SLCA 2B7YA 1CJPA 1GZ9A 3BODA 2UWBA 5GZFA 4DRVA 1WUVA 5JMCA 1FNZA 2GMMA 1N47A 1FV3A 3SH4A 2SBAA 4GXLA 5HCAA 3HR9A 5T54A 3SLIA 1VLNA 5BYNA 3AYAA 5GM0A 5KXDA 1G9BA 5GLTA 2D43A 4DQAA 3V0BB 4LBOA 4YW5A 1A8DA 1FAYA 3TB0A 3ZXJA 1MR5A 2R16A 3N7LA 1GICA 1ENQA 4P9WA 3GNEA 4RL7A 4TYSA 2ZGNA 4Y26A 4Y1VA 1GNZA 1ULDA 1SLTA 2E6VA 2E7QA 5AVAA 3NV1A 4XJWA 2WNEA 2PELA 3O0XA 4ISQA 3W58A 2ZMLA 5IT6A 4ZKTB 2ZMNA 1VIWB 3WHUA 1S1AA 1N1YA 2A5ZA 1NLSA 2EIGA 4LBNA 2BQPA 1DQ6A 1LENA 4XIOA 4XHBA 2P34A 2WT2A 4CRQA 3O12A 1N1TA 1GV9A 3POYA 3N7KA 2JE9A 3N36A 4M3CF 2A3YA 2R1DA 1PZ9A 4FP2A 5GALA 4UW5A 2DYCA 3UK9A 1KQRA 2A70A 1GZWB 3FUQA 1CPMA 1YO8A 1SLLA 4PBOA 3UJOA 1KITA 2ZGUA 4KBBA 4W65A 1VAMA 2PHFA 1KJLA 2AGSA 2Z42A 2ZBJA 4HL0A 4XTMA 3GALA 1W6NB 1IOAA 1BYHA 1MS3A 3ZVXA 3R05A 3AZXA 1W6OB 2D3RA 3AK0A 3SITA 2ZZJA 1LGNA 1MS0A 3B69A 1Z78A 3MPPG 4TZDA 1C4RA 3MEPA 4Y1XA 1LU1A 1A3KA 1GSLA 3VUOA 2EXIA 1WLWA 4FPOB 1PZ7A 1YYNA 2LTNA 2P37A 4Y20B 5JOXA 1UX6A 4FOYA 3T1LA 4YM0A 4U36A 2DVAA 3IMNA 2FHRA 4LBQB 1N1SA 2E53A 1WD4A 4K21A 1F5FA 1SFYA 2CWMA 1Q56A 4LBKA 3TAYA 2JKBA 2ZHKA 2ZACA 4XYXA 5EXOA 1N3OA 4XIKA 2A6YA 1LGBA 1WW7A 4C1WA 1IS6A 1I3HA 1S0EA 1AXYA 5SV8A 5GLUA 4XBQA 4XTPA 4AVSA 5EYYA 1R1ZA 4Y1UA 3FFZA 1HDKA 1TEIA 2A6WA 3FLRA 1DGLA 3OY8A 2SLIA 2W52A 4AWDA 2VW2A 3B00A 3PVEA 1DLLA 2PHRA 3JU9A 1CVNA 1AXZA 1MACA 4YLZA 3N35A 5IK5A 2CNAA 1SBFA 5JLVA 1DQ2A 1V6LA 2VH9A 1CIWA 2WSVA 1VALA 5DXDA 1ULGA 5CA6A 3AP4A 2UWCA 1AVBA 4XZPA 2VW0A 4YW2A 5T5PA 1LHVA 2D6PA 3C2UA 2D3PA 1V6KA 4XJAA 1HQWA 1LESA 2TEPA 1MS1A 3OYWA 5F9TA 1LOAA 4LBLA 2ENRA 2D44A 4Y1YA 1D0HA 3AZZA 4YGDA 5GLWA 1NXD1 1V6IA 1V6NA 4DPNA 5DUXA 1W6MA 3O0VA 4Y22A 4K20A 4D69A 4PQ9A 5DUVA 4JC1A 4MYEA 4YZ1A 4ZXKA 2D6OX 5DZGA 2D6KA 1LHUA 3JUUA 4P9XA 1MVQA 3M3OA 1ULFA 2ZGKA 2XG3A 1DYKA 2OUJA 4GALA 2KM2A 4AGRA 2H0BA 2C5DA 1U0AA 1LOBA 2YY1A 3DUIA 4Q2FA 3WG1A 3VKOA 5GZGA 1H30A 2A75A 1SBEA 3VKMA 3MW3A 3WUCA 4XXAA 1V6OA 1WCSA 1MVEA 2JDZA 2DUPA 2P2KA 2YMZA 3ATGA 4YGBA 1Q8PA 3AZVA 1AJOA 1DQ4A 1N3QA 1S0BA 3O0WA 4Q1RA 5H9RA 2GMEA 4YGCA 3VV1A 1QGLA 1UAIA 5IK4A 3SISA 5GLVA 5FRAA 1DBNA 1QDCA 2DTYA 4YG3A 4CZSA 2P3IA 1DIWA 4YZ2A 3WDYA 2GDFA 2V73A 1YXWA 3IKWA 4ISRA 1GANA 1SLAA 3FLPA 4YW4A 2ZHMA 5HCFA 3D4KA 1YIFA 1UL9A 4YM1A 4FP3A 1ENRA 4DS0A 2GNMA 4PBPA 4YZ3A 5JOWA 2R0HA 5JDBA 3UJQA 4BPZA 1LEMA 3U4XA 1N1VA 2JECA 4SLIA 2DU1A 1QDOA 4XE9A 2EXJA 3N7MA 2DURA 2VUAA 4M3CE 1IS5A 4FPGA 1IKPA 3I4IA 1G9FA 3IM0A 3AYEA 3WDTA 3ZSMA 1G9AA 2G4IA 4RA0A 2DVBA 3V0AA 3ENRA 2HYKA 4K1ZA 1LGCA 5T5OA 3KQRA 1WD3A 1AX2A 2VY0A 4Q8KA 2UU8A 3ZYPA 3NWKA 3AP5A 5CB7A 3RG0A 4BMEA 1W6PA 1URXA 3WUDA 4R9BA 1AX0A 2AENA 1WW6A 4JCKA 5LK5A 3M3CA 1G9DA 3D5OA 3AXDA 4YFWA 2PHXA 4C1XA 4AGVA 1FX5A 1DHKB 5T55A 2GNTA 4WVWA 1KDMA 4UW4A 3AYCA 4DRRA 5DUUA 3INAA 3M2MA 3D6EA 4AVVA 1ULEA 4NOTA 1JUIA 1LCLA 5KXCA 4UW6A 4XILA 5IUQA 1DFQA 2ZGQA 3AXEA 1FV2A 4Y20A 2WT1A 2EAKA 3IPVA 1W6QA 4XOGA 4YG0A 4LBQA 4WVVA 3M3EA 4FQ4A 3ZSLA 1JYCA 4XBLA 2OUHA 3WLUA 2W68A 3ILRA 4ATFA 1JN2P 2R1BA 5DUWA 3WDWA 2E51A 2GN7A 5IK7A 1AF9A 4DFSA 1JOJA 3BIWE 3WVJA 4CTEA 3OGGA 1APNA 4H55A 3AX4A 2A7AA 3O5SA 4PF5A 2ARBA 2W08A 2D6LX 2VW1A 2WLQA 2AREA 3ILFA 3L2YA 3USUA 1LHWA 2V5YA 1EPWA 2XB6C 3V64A 1V6JA 1S0FA 1ZA4A 3H0OA 3ZYRA 1WW4A 1XQNA 2UWAA 3SNMA 3WZ1A 5JOYA 3WNXA 3IN9A 3ASIA 3QLQA 3N3HA 5GLZA 3LSDA 3AFKA 2NYYA 5T52A 1CQ9A 2VU9A 1GNHA 1GLHA 2P3JA 2WSUA 2ZGPA 5GJ6A 4R9DA 3VKFC 1CR7A 2ES3A 4Q8LA 3ZSKA 1F31A 1FATA 1DQ0A 2Q5TA 3B9CA 4GKYA 2DUOA 2W39A 4IQPA 5F5QA 3ZXEA 3UL2A 4NO4A 4M3CA 1AX1A 3I8TA 3RRDA 1UZYA 4XJ9A 4Q27A 5DG2A 3FUOA 1RITA 1DZQA 3BTAA 3AP9A 4FPJA 3A0NA 2ZHLA 4GKXA 1H9PA 3VKNA 1QKQA 1CONA 2FMDA 2JJ6A 2GALA 2PHWA 1G8WA 1LJ7A 1V00A 2NZ9A 4BMBA 4YM3A 4FPLA 1I1EA 1IS3A 2YZ4A 3OYWB 2ZABA 2E7TA 5T50A 2ARXA 3RQ0A 1AXKA 1DYPA 3M3QA 1C57A 1G9CA 2NMOA 5JOZA 1W6MB 4FPCA 4Y22B 1IKQA 1KRIA 1F9KA 2WJSA 2AYHA 4XMIA 4XXPA 2JE7A 5KXEA 3WDUA 4Q1PA 4XJUA 2GMPA 3AZYA 2EXKA 1BXHA 1AJKA 1JHNA 4PCRA 1MZ6A 2DUQA 1UN1A 1RIRA 4LBMA
chains in the Genus database with same CATH superfamily
4MX3A 1EAH3 4LIVA 5ABJB 1AR63 5I8SA 4AFDA 1UIKA 3AVSA 3K3OA 4I09A 2HWC3 3ZXLA 3WQ1A 1DYOA 1H8TC 4DEQA 2MNGA 3WDVA 3I3MA 3T2OA 1OQ1A 4JZRA 4E4HA 5LRSA 4CEWB 3W21A 1BEV1 4Y5TA 1JZ2A 4CDUB 3AKQA 1TVGA 4WZCA 4BZ4A 1AYN3 3A0KA 1BJQA 3BOPA 1GBGA 2DV9A 2GP3A 1FPN1 3CLPA 4AEDC 4R9AA 4YG6A 5FBJA 2BPA2 1F8VA 5IVEA 1D7PM 4BH9A 4DOUA 1ENSA 2JEMA 1TMF3 2EF6A 2ZJCA 4L8QA 3VBSC 3OCPA 3P6BA 1B35A 3ZFFC 3KS7A 4HKWA 1IQDC 5FOBB 2DCKA 3G6JB 1S0IA 4K8FA 1O4YA 3VBFA 3O1UA 5A3MA 5AC92 3KQ4B 5FZBA 1PMIA 2VXJA 1ASJ2 1DGRA 2FCVA 1DQ5A 2D5HA 5CFCB 3DPRA 4LEJA 5DQ0A 2CTVA 4HK8A 4RGKA 1OA4A 1XSRA 2A71A 2ZAAA 3C7FA 1VBE3 3HQUA 4ASMB 1FI2A 4KWKA 1K42A 4YWAA 3VHRA 1Q43A 3I2DA 1SLIA 4XDPA 4A4AA 1RHI3 1HN1A 3MW2A 4MUVA 2EALA 2VBBA 1RUH2 2XVKA 2VNOA 3ALQA 2D97A 3AJZA 3J26N 4BM8A 4Q5OA 4XF4A 5C5UA 4L97A 3U07A 3FBYA 1V6MA 5FQ0B 3ORJA 3OGSA 3RMXA 1BQPA 1UOJA 2RDQA 4INDA 4Q4Y1 2NN8A 4M01A 4LJHA 5CZKA 4YVSA 3WR0A 3ZXFA 4AVTA 4B3NA 2O14A 4S2FA 2IVIB 1AZDA 3ZFFB 5CG8A 1QQP3 1DG6A 5CU1A 4P5YA 2BP6A 5HBAA 1YFYA 4KL1A 4P14A 4C0BA 4A44A 1XRUA 3LDBA 5E88A 2YU2A 5F37A 2W1WA 3KM5A 2WQZC 4MHRA 2BV4A 2ET7A 1IPKA 1GMMA 3P5BA 3WNMA 3PL0A 1UMZA 2WLPA 1LECA 2RS52 4YYOA 2HYXA 2XVLA 1BBT2 2RHPA 4WZFA 1FOD1 2XLGA 2W47A 4QGNA 4YW1A 4N53C 3ZN6A 2OZ6A 4XUNA 4A6SA 3UV9A 1HV1A 2PXJA 5IYYA 1MZ5A 3MIEA 4Z1VA 1VRH3 2ZMKA 1DGRN 5LCWL 1ND3B 4RHV1 5CKMA 1J58A 1VBD1 3OY8B 3N7JA 5F32A 5F5IA 1LOCA 4NPLA 1DGWA 2HH9A 2QDRA 2VMCA 3GZAA 1ZRRA 4Y4YA 5DG1A 3MFAA 3TWIA 3VBHA 2ZX2A 3ECQA 4BQ1A 4YZ5A 4YW7A 5B4NA 3AYDA 2GH2A 4CXYA 1VE0A 2ZKNA 4HPKB 2LALA 1RC6A 4QPGB 2R071 2XJUA 4XFCA 3I3QA 1OUSA 1SBDA 1PVC3 4GB32 1PGL2 1RTVA 4X6RB 5FWJA 3H8RA 2G9ZA 2R0FA 4YGEA 3ZN4A 4JRAA 3VD3A 3JB4C 4CDXA 1F5JA 3DECA 1LULA 4M3CB 1HKDA 1HJFA 3CIHA 1WBFA 3CMGA 1MEC2 2ERFA 3K4AA 2JD4A 3VZKA 3OPZA 1OOPA 1VAVA 1VMHA 4JX0A 1SHWB 4HANA 1T6GC 1BVP1 1L7RA 2WQ8A 2ZGSA 3GHNA 4K7JA 1ND2C 3LOIA 3FX3A 2D6MA 2R062 3MUY1 1LOEA 4FOQA 3NNJA 4Q26A 3EHKA 2QQKA 3ETQA 1Q8OA 1KJRA 3N9NA 2HWE1 1K45A 4FPEA 5JAXA 3J7NA 4D6RA 4OMCA 3MZHA 1VRBA 1JU3A 5FPZA 3TEXA 1JXNA 3WF4A 3WW3A 2VCMA 5EJ3A 5F9TA 4GZ9A 4OQ8A 2VVFA 5LA2A 1E57A 3PIJA 4PDWC 1C28A 2ZX0A 2LW8A 5FXWA 4O9EA 3TOJA 1OKQA 5FPXA 1ZBE1 5BY5A 1OHFA 1Y9GA 2VCBA 2JWPA 4RQPB 2HWF2 1D4VB 1W8ZA 1WMEA 1PHMA 1D4M2 3Q8BA 4LORA 1FV3A 2SBAA 1Z7S2 4UFLA 5HCAA 4OHWA 5T54A 5J1XA 1G9BA 3AYAA 5GM0A 4LMFA 3HOBA 3O1RA 4K3UA 4H14A 2G9GA 2QQUA 4LBOA 1A8DA 2E7AA 2LROA 2OX0A 1MR5A 2X10A 3ZFGA 3ZXJA 2R16A 5FWEA 4AI1A 5L9VA 1ND2B 2J1UA 2DFBA 3GNEA 4IEPA 4RL7A 1LAJA 2BVVA 2GZWA 1GNZA 1RVF3 1SLTA 2E6VA 1BLZA 4UI9L 4LKSA 4ZKTB 1AR73 1GOFA 1VIWB 1DZTA 3ZR5A 2V72A 3HN3A 3N9OA 2P6HA 3H3LA 4S2DA 1DU3D 2A5ZA 4LBNA 4EQVA 1DDLA 1MPXA 2BQPA 2WRAA 1O3RA 1RUG3 3R6SA 4CRQA 2ZCWA 3AKPA 1HB1A 3WP6A 4IV1B 1N1TA 5IAXA 5AC91 5LA1A 3HAGA 3N7KA 5DDJ2 4GQ7A 4ARXA 2FD8A 1LNSA 1NZCA 3GYDA 4HXCA 1REDA 3K4ZA 4LR4A 5K8SA 3USSA 2DYCA 1UYXA 2PLV3 1XE0A 1GZWB 2A70A 3FUQA 4RHV3 5FYTA 3PHMA 4HSJA 1KITA 5FYBA 2B8MA 4E9KA 2PHFA 3ELNA 4MXWA 5I93A 4KWJA 3GALA 4ZY9A 1W6NB 1MS3A 4XFAA 2ORXA 3KVBA 4KH9A 1RUH1 5EJZB 3SITA 1POQA 4TTGA 1MS0A 3GBFA 1H6YA 4TZDA 1TZOA 2C6SA 1C4RA 2R073 3IAPA 3QH7A 1A3KA 4QX0A 2EXIA 4COZA 4Y5Z0 3F95A 2FDGA 2WDBA 4FOYA 5A3WA 4YM0A 1W8NA 1J83A 2FHRA 4Q0VA 4YVWB 1N1SA 2CGOA 1WD4A 2E53A 5FLIA 1JZ6A 2FZ1A 3CJIB 3MLJA 2QBXA 4C91A 4FTEA 3ZX7A 5LY1A 3H1MA 4Q0PA 2ADEA 5C9AC 2JIJA 4IGPA 3W5MA 2A6YA 3ACGA 5LASA 1LGBA 4DB5A 3WT3A 1REEA 2RR12 2Q8EA 1UY1A 1XJAA 2DF7A 4IE7A 1BBT1 2X53S 3MYXA 3DL3A 4XTPA 1XYPA 4AVSA 1OVPA 2VCAA 1PMJX 4Y1UA 3DKWA 1HRI2 1U5ZA 4YSFA 2FCUA 2K46A 2WA4A 2CSGA 2W52A 5I8TA 4TN7A 3PVEA 1YFUA 3H1WA 4RFT0 4BHPA 2P4EA 2VMIA 1ZBE3 1MACA 3IWZA 5IK5A 3N35A 3VHNA 2XBO1 4AI8A 1SBFA 2JDAA 5JLVA 1DQ2A 3KCYA 2OQ6A 2Y6KA 3DEMA 5DXDA 2BW8A 2CHHA 2KXLA 3RGBA 2QTWB 2YDEA 4YW2A 5BNPB 1OH4A 1LHVA 3C2UA 2QQPA 4UF0A 3EBRA 5ACA3 2D3PA 1PGL1 1MS1A 1COV2 5FUNA 3URFA 4ZU5A 4DIQA 1YQ5A 3EQEA 3KT7A 4O9GA 4Y1YA 1NG0A 5A6ZA 1GQHA 4ORFA 4QX2A 5DUXA 3IDEA 3O0VA 1MEC1 3GZTB 2VVDA 3LA7A 1J59A 3OUIA 1ST8A 1JOBA 4JC1A 4MYEA 1DCSA 3C7HA 3NNFA 1LHUA 1AYM2 4RR3B 2R061 1ULFA 4BQ3A 2ZGKA 2XG3A 4QKFA 2XH6A 3LWCA 3VD9A 2OUJA 4GALA 4OVEA 3T09A 1JYNA 1ZRDA 1HV0A 2C5DA 1ASJ3 5KHJA 1XC6A 3WW4A 4DXRA 1YJLA 1Y9QA 1GQPA 3OPWA 4NN0A 2K0GA 3VKMA 3MW3A 3PTYA 2ZEYA 2GC2A 1VBC3 1MVEA 1WCSA 5D1IA 1OBNA 3IBMA 4YGBA 4CEWA 2RE9A 3VV1A 1NCRB 3O0WA 4CDUA 4J6GA 5IK4A 3Q8AA 4QKNA 5FRAA 1QDCA 2DTYA 2EICA 1RUH3 1VR3A 2HWF1 2ZX4A 4NVPA 3RYPA 4CZSA 2WR9A 3BALA 2FDKA 1AHSA 1YXWA 3IKWA 3JD71 3UGGA 3FLPA 1Y9MA 4JTOA 4YW4A 5HCFA 2R30A 2W9XA 1ENRA 4V2VA 2XJPA 4OHXA 5JXHA 2GNMA 4PBPA 5FPLA 5FP8A 2J1TA 3O1SA 1W99A 2JECA 4IEXA 4S2HA 5FP3A 1X8EA 2EXJA 5FZOB 2VUAA 5CFCA 2RG4A 4QPWA 1XU2A 3LA3A 5FK7A 1G9FA 4GJYA 2G4IA 1V9U1 4OZOA 1MZEA 2RS53 2HYKA 1EAH2 4AXOA 1BBT3 1QJY3 1W9FA 1ODNA 1AX2A 3T30A 3DPRB 3R4DB 3AB0A 2VOTA 2J22A 4R4ZA 3NWKA 5JIAA 5IFTA 5DDJ1 2ZPXA 3NJXA 2BTVC 5CB7A 3F2ZA 5JWPA 3O1TA 5FZMA 3BCWA 4XC9A 3D5OA 3AXDA 1A34A 5FQ0A 4QQOA 1AR92 2V5DA 2XKOA 2GNTA 2Y38A 5DUUA 5C3QA 3ZFFA 3IIIA 3MGUA 3O1VA 4NOTA 3DXTA 4XF1A 2L9LA 1JUIA 4RS5B 4H2AA 3WW1A 1TMF2 2ORZA 1UKRA 1RUI2 4NHKA 4B7KA 4GB33 2BGPA 3ZSLA 4HVQA 5M0TA 1JYCA 1M4WA 3NNGA 4FO9A 4XBLA 2W68A 1GWLA 3VBUC 4QPIC 3FHIB 4A3ZA 2E51A 1KS4A 4FXKB 3SC7X 5I0UA 4DMIA 1AF9A 1MEC3 2VE1A 4DFSA 5IK7A 1JOJA 1PNGA 3OGGA 4XUOA 5KHGA 4QKDA 3WNKA 2PQSA 1NCQC 2EIBA 2QE3A 2ARBA 2VNGA 2W08A 2WNUC 2Y60A 1ND3A 2VW1A 4JVAA 2RR11 4I0BA 1LHWA 3S57A 2V5YA 3MIHA 1D2QA 1RHI2 5FJHA 3U11A 4CP1A 2XB6C 3H0OA 3ZYRA 1TME1 3ACHA 4CDQC 1HRI1 2UWAA 3SNMA 4XUPA 1S2KA 3WNXA 1TNFA 2X09A 4QPGA 1NZIA 3IMMA 3NJYA 4Q0UA 5T52A 1GNHA 3RI9A 2P3JA 4R9DA 1NA1C 3H42B 1FATA 1LKNA 4SBVA 4OQ9A 2DUOA 3ZXEA 3GF6A 2HWF3 4IQPA 1UIJA 4NR1A 3T3YA 4QX8A 2D93A 3POFA 3I8TA 1D4M3 4M3CA 3UL2A 5K7PA 1UZYA 3VBRC 4S2GA 1Z7S3 3RZJA 1ZZCA 4L11A 4AF9A 1DZQA 4AI2A 3WQ7A 3AP9A 1TE1B 4GKXA 5JI7A 3VKNA 3HJRA 2KA3A 2O8OA 1OMIA 2VMGA 4ZXEA 2RJ2A 4BMBA 5CFDB 5F5AA 3ACFA 3K77A 4FPLA 4UFHA 3H8UA 2G9FA 2ZABA 5HV0A 4CCDA 5T50A 5BNOB 2ARXA 1DYPA 3LDRA 1PNFA 4BIFA 4IEZA 4N43C 4FPCA 2H6CA 1XOYA 2PMWB 4RN5A 1KRIA 4QQLA 5FP7A 2WJSA 5A3TA 2JE7A 1RXGA 2QQWA 2W3JA 1OUXA 3WDUA 3PUHA 2GMPA 1BXHA 2DFCA 4RQPA 1X8MA 1JHNA 4IEWA 3CHXA 3P3NA 2E9QA 4PCRA 4I2OA 4M4PA 3WEZA 4NE9A 4DXZA 3WF3A 4LBMA 2R7EB 2I74A 1Q8QA 2W95A 4UBGA 2PA7A 1PMHX 4I01A 4M00A 1WA6X 3LCPA 5KHKA 2FDFA 4BMEA 1OPMA 4WV8A 2ZTNA 1I5PA 1R1A1 1ZREA 1ND2A 1Q3EA 1RUNA 1PZ8A 2IVJA 3T2TA 5A3PA 2VOXA 2AUYA 3NV3A 4XJZA 4QXKA 1RINA 4LXLA 4GMP3 3RMYA 2PAKA 1XBFA 3LEKA 1CAWB 2J1SA 4Z2WA 1IGOA 1QF3A 2HWD2 3VLBB 3POWA 1T2XA 3BIEA 1JW6A 4D3WA 1F4HA 1NOVA 1VB2A 1RUC2 4ZPIA 3RJRA 1SACA 2DVDA 5DAWA 3WX5A 2GSYA 3IAQA 1WMFA 2XJTA 3DCQA 1ZBA3 5FMDA 4FVVA 2ZA9A 3POEA 4YW3A 1LB2A 1J84A 2OS2A 2BNMA 4BQ2A 2R49A 3BI3A 1XNDA 2C9KA 4GA9A 5FR3A 1XB9A 1LOFC 1W8FA 4LBQD 2B39A 2P3KA 1HLCA 2I07B 2BZDA 2CDPA 2C9AA 5JVVA 2F4PA 2Y6LA 3AZWA 4LITA 3VZNA 1GZWA 5H9SA 1VMJA 3K48A 3KGZA 4BXSV 1EAH1 3KMHA 4KI5M 2A3WA 1WCDJ 1AR61 2ARCA 1PK6C 2OKXA 4KMQA 1JYIA 3WG4A 1IG3A 1W6NA 3HBZA 2HWC1 4KG8A 4ZU7A 3ZDSA 4B1MA 1W8WA 1OVSA 4XBNA 2YC2A 3ZSJA 2BERA 1IG0A 3IDAA 2AR6A 1QH6A 4KGGA 1ULPA 2Q1MA 3AMHA 3EB7A 3AM2A 4IEYA 4NJ4A 3R4SA 1QNYA 4XQDA 4ZHNA 3FFQA 4WVMB 4MG2A 1O91A 3OPTA 4Q29A 2BWCA 1RVF2 2W46A 5L73A 4I02A 1M06G 2I45A 4YVWA 2GNBA 3B3QE 2PYTA 5JMCA 1AR72 1RUD3 2A3XA 2FDIA 4V2WA 3CJIA 5C8CC 1TMF1 4CCCA 5LW9A 2CWSA 2IXCA 1HQLA 1S0JA 2AACA 3POSA 4XQWA 3K4DA 3R4UA 2ZGLA 3ZXKA 1COV3 3FMGA 1GKBA 2WN3A 3RS6A 1FYUA 3HQRA 1W6QB 3HWJA 5FY5A 1MQTC 2EVXA 4P00B 4PHZA 4XF0A 2WZEA 2XGXA 5EWSA 2PLV2 2VD7A 5FZ7A 4Y4RA 1X50A 2EIDA 3OJBA 1IPSA 1WCKA 1XNKA 1VBE1 2VQ0A 3OGJA 5EP9A 3UYJA 1AYM3 2BGOA 4B29A 1R092 1JYTA 1KFUL 5D8AB 3KSCA 1RB8G 3OGVA 4AVBA 1K5MC 1RHI1 3EJKA 1WBLA 3MV01 1LEDA 4QDSA 1DQ1A 2FQPA 1RL3A 3OD0A 5APAA 1WLCA 3USUB 2DBNA 4CXWA 5FLHA 3OG2A 4FPHA 4MGTA 1SCSA 4HK9A 3GJBA 3NV4A 5BNPA 5L19A 2DTWA 4HETA 4QX1A 1OFSA 2Y26A 2OW4A 2CGNA 5FY4A 1QQP1 4BWOA 3HT2A 3SQOA 2BWAA 4GH4C 2OA2A 2ZX1A 3FZ3A 4LKFA 3VZLA 2TBVA 4ES9A 5FPUA 2WIIB 2RMU3 3PMEA 3I2FA 2Z79A 4KNCA 4UF0B 5JUVA 1W8OA 1GWMA 2YXSA 4MGIE 4XHXA 3WF2A 3ZPOA 2GP5A 1MS8A 1Q8VA 3HMYA 1BZWA 4MZUA 3PUQA 5H9PA 5A6YA 4RR3A 3SEPA 1H2KA 4PT6A 2C26A 4U2AA 2B46X 4BLJA 1QMJA 5FZ6A 2UURA 2HKXA 3NW4A 3KF3A 2X5IB 3VGIA 5FCCA 1G7YA 3FHAA 1VRH1 2PHTA 4UWDA 4CE8A 4OLLA 5KXBA 3AJYA 3WG2A 3H8OA 1XNBA 1S0GA 2BDRA 4CP2A 1CZTA 5CNAA 1HXS2 2IXHA 3SH3A 1NCRA 5L7OC 4C0HA 1J1TA 2NM1A 3WCRA 1OC1A 2BJSA 3ZYFA 1EYBA 4JGZB 1I6XA 1QJU3 1GYKA 3ZPYA 4R9CA 3TN93 1OLQA 1UZVA 5A7PA 2OVUA 3GJAA 4MHUA 4HBNA 1ODMA 1P8JA 1S2EA 2B7YA 4IETA 4NMIA 1PVC1 3BODA 4JGYC 5GZFA 4DRVA 5ACA2 3ZKUA 1AR93 1HN0A 1WUVA 3FBMA 1V0AA 4HZFA 4AI3A 1CIYA 2GMMA 5LBCA 5FK8A 3KD4A 3FE5A 3FWEA 5C4WB 3SLIA 4OFGA 2XQRA 5FZLA 5BYNA 5HV4A 3V0BB 2D43A 3GBGA 2ZS6B 4LA3A 4A2UA 1ACCA 1FAYA 2C1FA 2JICA 2W87A 1F15A 1SZBA 4IXLA 4JKMA 3TB0A 5C3SA 5FZOA 4COVA 4P9WA 5IHRA 1JYWA 5AVAA 2E7QA 1RUI3 1X33A 3NV1A 2HWD1 1OH3A 4FSJA 2R6QA 2AEYA 2VZQA 5FYIA 1VBA2 3VBOC 3W58A 1JH5A 1UOFA 1O3TA 1RUC1 3B93A 1X36A 3CO2A 1YEWA 3ZMNA 2EIGA 1YFXA 4QHOA 3LFIA 4XHBA 5LBFA 1H8TB 1VBC2 2QDNA 3O12A 5IAVA 3RNSA 3H1YA 3SCGA 1CAXB 4KQ7A 3AL6A 5A7SA 4F7ZA 5J09A 3C7EA 3N36A 3E6BA 1RUF2 5FO7B 4NIAA 3SCFA 2ZZQA 2R1DA 3OUHA 1PZ9A 3KHCA 1H1AA 2VOKA 3LF7A 2WNVC 1KQRA 3RPQA 3UJOA 1SLLA 2HEWF 2Y6JA 3EYPA 2VO5A 4I3PA 4KBBA 3CF6E 1O8PA 3J7LA 4JTNA 1RUE2 4GIQA 4RS5A 4AEDB 4BQ4A 1ZRFA 2JG9C 2VZPA 3MLKA 5IATA 5IVCA 1IOAA 3WXPA 3O1OA 3VBSB 1W6OB 2VQUA 3AK0A 2RDSA 4CPBA 1LGNA 3AL5A 3B69A 2Q30A 1RVF1 1O6UA 1RMU2 3MPPG 1GUIA 3VD5A 2JENA 1CAUB 3D8CA 4OHVA 3ZXGA 3NKTA 1GSLA 3VUOA 4DXTA 5BNQA 1U5IA 1PZ7A 4FPOB 1AR71 4YRDA 5A3UA 2AEZA 3I2GA 3S6PA 1TG7A 4AHZA 3NQHA 1YJKA 4K21A 4LKDA 1SFYA 1RUG1 4AFCA 1GOHA 1YQ6A 1QJY2 4CUGA 1W04A 3E97A 4XYXA 5EXOA 3U37A 3P3PA 3W20A 2RDRA 1WW7A 3LA2A 1CD3G 1IS6A 4LOTA 1SDWA 1S0EA 2YPJA 3VDDC 5IVJA 2WYFA 1W28A 2PLV1 3CU7A 5SV8A 2OXBA 3NRUA 5GLUA 4CDWC 5LWBA 5CISA 2BFUS 4M0HA 5F5CA 3GBWA 1UO9A 2XHNA 3FFZA 5JZGC 1HDKA 2A6WA 3FLRA 4A42A 4CCOA 2SLIA 5JCTA 3K75B 4Y3OA 5IVYA 2QQMA 3B5LB 3ZXAC 3KHBA 4NRPA 3R0RA 4TLGA 3JU9A 1JODA 1CVNA 4YLZA 3PMSA 4D7TA 4NHLA 1H1MA 1NQDA 1V6LA 2GC0A 3AMMA 2VH9A 3M7AA 4AAXA 3UNPA 1ULGA 1QXPA 2UWCA 1NCQA 3Q8CA 2PHDA 4XZPA 4D7YA 5T5PA 2MEV2 5CFDA 2Q1FA 3HIFA 1SQ4A 3CQOA 2TEPA 4LO6B 1SG3A 4N53B 4WM7C 4O7XA 1C8M2 1UY2A 4LBLA 4BK5A 4D0QA 5BNOA 1D0HA 3AZZA 3TEWA 2QQIA 2UY8A 2VZSA 5GLWA 2HWD3 4L2NA 5FZ3A 5JMOA 2WBKA 4JHZA 1RUC3 4PQ9A 5DZGA 1RJ8A 2D6KA 3ZYGA 4J1WA 3JUUA 1JI6A 5L9BA 3PVBB 2UY9A 5A7WB 4AGRA 3WUDA 3ZKYA 2DBIA 2HLEA 1F4AA 1QIQA 2BOJA 1U0AA 3Q8FA 3FJSA 2XR4A 2PTMA 5JR2A 1H30A 3AKSA 2A75A 5IW0A 1HB4A 5FPBA 4QXHA 3IDBB 1DLCA 5LBBA 2IXJA 4C8DA 5AFBA 4QB1A 5C7GA 3MF6A 4ARYA 5FIXA 2GAUA 2DUPA 4JDOA 4A45A 3MBWA 5DAQA 1AJOA 1DQ4A 1N3QA 4OYUA 4Z92B 3LGRA 3MFCA 1QGLA 1US3A 1CAWA 4A7YA 5ACA1 3SISA 3TYJA 3ZFEC 1OXCA 1SFPA 2YBKA 1H8VA 1DIWA 4BB3A 1XE7A 2ID4A 3HD8B 1PX3A 5J98B 1D0GA 2GDFA 1PVXA 2QNKA 3WDYA 2G19A 4MVTA 3E1F1 4W6XA 1UCXA 5G04L 2ZHMA 1UL9A 3IZOA 3NAPC 5J7MA 5JOWA 3CDZB 4OCTA 4WM8C 1LEMA 3U4XA 3THTA 3E5QA 4HN1A 5DN2A 1N1VA 1JZ5A 4PDWB 3MO4A 3JZVA 1HX6A 2IFRA 3OBZA 4JKLA 1TNRA 4M3CE 3V56A 4BXFA 1A8MA 3B02A 1WLTA 1ASJ1 3I4IA 3IM0A 3QBQA 3RJ2X 4DY5A 4J25A 4CXXA 2YPDA 2VCCA 1NUKA 2DVBA 4RA0A 3DKQA 1REFA 4K1ZA 1LGCA 4HSLA 2JDPA 4AQ2A 1WD3A 2Q1ZB 3H7JA 1VBC1 5JIUA 5C8WA 3DYOA 3RDIA 3WNOA 2JIGA 2UU8A 1UYPA 1R093 4NPMA 4WVMA 2QCSB 1JMUB 1R64A 1JTZX 1RUF1 1QH7A 3D82A 4R9BA 5LA9A 4QAWA 3RWNA 3M3CA 4QX5A 2AZ5A 5JSOA 1G6NA 4YFWA 4TWTA 2YBPA 4C1XA 4AGVA 1FX5A 4LK6A 3INAA 3S0MA 4CUCA 3M2MA 5BNNC 3D6EA 5C3RA 4D8MA 2B45X 3OBAA 3ZYBA 1QXRA 4AZZA 2VUCA 4AI9A 2IUWA 1ZBA2 4XILA 4Y20A 1VBB2 1H4HA 2V4AA 2WT1A 3I3DA 5F2WA 1W6QA 2IXIA 1AL23 4WVVA 1NE6A 1J3PA 4PIYA 5FZ0A 2W1QA 5E6HA 1POV3 3ILRA 3LKJA 2MPFA 2R1BA 1J3RA 1K5JA 5FY0A 3T4HB 2JG8C 2V09A 2GN7A 2RS51 4B4RA 3BIWE 3WVJA 1QJY1 3TEZA 5D8AA 4IERA 2ATFA 4H55A 3ZYJB 1RJ7A 3NNMA 4HLTA 4M4RA 4CEYC 2WLQA 1Q5OA 2Z5WA 4IUGA 3USUA 5FZKA 2J42A 4LE3A 5I0RA 1STMA 1UZWA 2RV9A 4PI2A 4DO0A 2K2SA 5CYYA 5LK7B 3K46A 5C8CA 3LFMA 5JPNB 5E1RA 5BNNB 4P5HA 3WZ1A 3JQXA 4MGQA 1HB2A 1HXS3 3VDCA 3IN9A 3WP3A 2E32A 3LOBA 4FFGA 5GLZA 4QWNA 1RUD2 1OQEA 3ZSEA 3AFKA 3VN4A 4E8CA 2WUHA 5LZ6A 1CQ9A 1GLHA 1AUYA 1C3HA 2WSUA 2ZGPA 5LEJA 4NWWA 2JB8A 1CR7A 2Q4SA 4Q8LA 5C5TA 1MQTA 3CEWA 4GB31 2RM23 3B9CA 3ES4A 4GKYA 4LIUA 3ZMOA 4PF1A 5EPAA 3JBG2 4COUA 5C9AB 3MF9A 3RRDA 3VHOA 4PLNA 4XJ9A 4Q27A 5DG2A 1RITA 3BTAA 1QJX2 4FPJA 5J3UA 5K4LA 1FXZA 2X5IA 3I7DA 4N7IA 4OUMA 2GALA 1HRV3 2WABA 2PHWA 3QOPA 4UFIA 4EZ4A 5ISLA 5IWFA 1VAKA 5BPXA 1ZZ6A 1CGPA 3PTRB 1QWRA 3L9JT 1C5IA 5FPAA 1VBA3 2E7TA 4Q4W2 2V4VA 5EV7A 5FYMA 4FT8A 1AXKA 1K12A 3GXUA 4NHMA 3M3QA 4PIZA 1PGW2 1G9CA 4QM9A 2NMOA 4BQYA 5JOZA 4Y22B 1RUJ3 4JGZA 1EY2A 5KC6A 4QHZA 2W91A 4GH4A 4QQ2A 2NQYA 4GULA 4XJUA 1CAVB 4OI4A 4BQWA 4CU8A 2EXKA 2ZEZA 1AJKA 2N7GA 4OMDA 2LRPA 1RUF3 1UN1A 4FFHA 5FKCA 1NAEA 5EJ1B 3BUCA 3BOWA 2HEYF 5C4WA 1PIV2 2RMU2 1H1IA 4Y24A 2Q8CA 1Z0HA 1D4M1 3B01A 3KV5A 3V0BA 5LRRA 5CVRA 1Z7S1 4OUEA 4MGYE 2VZ1A 4K40A 1RUE3 4QB6A 5E89A 1B35C 1H9WA 2XL7A 2CL2A 4L92A 3H3ZA 2E63A 3U0ZA 4X8PA 1R082 3VBFC 4BYYA 3BTYA 3Q9OA 1RMU3 2BFUL 2J1VA 4QHBA 4ITCA 1JBCA 5FXZA 5FOJB 5FV3A 1L3JA 2XJVA 2LUWA 3A22A 4AYUA 2BEOA 2OQ7A 1ZZ7A 1H8TA 1BKZA 3MW4A 3CZUA 1UPSA 1ULCA 1CAXA 2H0VA 1ZX5A 4Y33A 3SEEA 3POBA 3DN7A 1YIPA 4GD4A 5BUVA 5FPVA 2VQAA 1SLBA 4BDVB 1JZ7A 3RSJA 4FPYA 1YI7A 5F8PA 2B9UA 2OT7A 1QJU2 2YROA 1UPIA 4B4PA 3EXUA 4EZHA 3TN92 3J7MA 1W8TA 4FOWA 4YM2A 3T1MA 3BPSA 1UXZA 4H3WA 1GZCA 3E6CC 4BQXA 4AEDA 1QNWA 3MICA 1W9WA 4XFHA 2W0XA 3N9MA 1ONAA 4P08A 4YVSC 1WCUA 4LK7A 4O61A 3VBSA 1QHDA 1W6OA 3GZEA 1LU2A 4BOWA 5JXGA 1IS4A 3M3IA 3V0AB 5CKNA 2P17A 2A6ZA 2F4LA 4XVHA 4GWJA 3K3NA 5FZ1A 4FTSA 5FDBA 4DEVA 1CAUA 1N3PA 1WLDA 2QVSB 4GMP1 4RGAA 4NIIA 5EYXA 1W6PB 1S0CA 2PHUA 3PVNA 4WVZA 1FMD3 4W6YA 4QD2A 5CAZA 3S7IA 2NMNA 3KZ4C 5T5LA 4G9SB 4LO4B 4ES8A 4KBZA 2GNDA 1SCRA 1X82A 3IIAA 3I3EA 5GZCA 2WO3A 1CN1A 5AFEA 2WZR2 1ZM1A 2FDHA 1O4ZA 4GWMA 1ZBA1 4G3YC 4P9YA 3PVOA 2OIIA 2MEV3 3UKVA 1VBB1 1W9SA 5CIRA 2D5FA 3M8LA 5FMOS 3I2JA 1C8M3 4BCUA 3WDXA 3TNQA 4OHYA 4CA9A 5ANNA 3OBTA 4JDMA 3WG3A 2A6VA 3IPVB 2YU1A 4RFRB 1C1LA 5FREA 4BLIA 1HIXA 3VBHC 1YRZA 1QOTA 4MGKE 2VBPA 1UY3A 2VXRA 5FZ9A 4AVAA 2D6NA 2VMDA 1BCXA 3JQWA 1UU4A 4QM8A 1MS4A 4NAOA 3MDPA 2A6XA 5A80A 4H7MA 1OI6A 2DCZA 3QD6A 2YGLA 3VKLA 4LT5A 5DZFA 4V1PA 3DGTA 3ZLIA 3PJYA 4RYDA 1JHJA 4CDXC 4B1LA 2VAUA 1QOOA 1C1FA 5E8AA 5T3NA 4XACA 1G86A 3NV2A 1QJZA 3VBUB 2WKKA 1RUD1 2W2IA 1OOPC 4HVOA 4QPIB 4N53A 4QB2A 3K2OA 2Y6HA 3AP6A 5FXXA 3RZLA 5D21A 4HMZA 4NROA 2QZ2A 4W4ZA 1NCQB 4LUKA 1COV1 4QQHA 2WNUB 1B09A 4EV0A 4QU2A 4CDWA 4FTBA 4OI0A 1VP6A 2QUOA 3PJQA 4XMAA 2YFUA 4AEKA 3TEYA 1W0OA 2WFPA 2AH2A 3HN1A 1WMXA 2DVGA 3GGLA 3MI8A 2YG0A 5FZDA 1O5UA 2Y6GA 3I49A 4CDQB 4Z8BA 4XETA 2VZRA 3NJZA 4FAHA 5A3NA 5A7WA 1C8NA 5H9QA 4JRLA 1AYM1 2QKDA 1VMFA 1ULOA 3J9SA 3QCWA 1LTEA 4G4FA 2VG9A 4Q4W1 4D6SA 3VDBA 1MS9A 1LODA 1UF2C 1PGW1 1NA1B 5CKQA 2HWB2 5IFPA 4R8HA 3A4UA 5D2AA 3ILNA 4N9HA 3VBRB 4OI1A 3ZFGC 2I2SA 1LHOA 3ES1A 4OI2A 3WOGA 2YV8A 3I2OA 1YLLA 2XLFA 2Y6FA 3B9IA 2AC1A 2TUNA 1DP0A 1GZ9A 2VBDA 2UWBA 1PIV1 2RMU1 4LO5B 2VM9A 3WP4A 5F7UA 2XQXA 3KWVA 1FNZA 3NKGA 1N47A 2D98A 4XEZA 2WQ4A 4LTAA 4GXLA 3SCHA 2D40A 1NT0A 1VLNA 5GLTA 4DQAA 4XUTA 1KS5A 2YC0A 4N43B 4PDWA 4QXBA 3LAGA 3N7LA 4OUSA 1BEV2 2P5BA 1ENQA 3S7EA 5G05L 4TYSA 1XPWA 4Y26A 3TRSB 4JQTA 4AQ6A 1ULDA 1WA4A 1VBB3 4XJWA 3E5UA 4K6BA 1ALYA 2PELA 2WNEA 3O1MA 1FPN2 1GQGA 2ZMLA 2ZMNA 4CSWA 4BU2A 5A33B 3WHUA 3BTZA 5FZ8A 1S1AA 2VMFA 1NLSA 4HT1T 4HVRA 5FYCA 1RGSA 1DQ6A 4D6QA 1W3XA 4XIOA 2P34A 1NKGA 4IL7A 3IB3A 4LPLA 3LEMA 4R52A 4JV4A 4UOJA 4K9SA 1QJU1 4NIHA 3TN91 3WINE 5JSPA 1E5SA 3KV4A 1UYYA 2HJIA 3WY6A 2J1RA 4FP2A 5GALA 4UW5A 5FYUA 1AR91 3UK9A 4DINB 2VZOA 4OULA 4EWDA 4PBOA 2ZGUA 1PO22 4WM8A 1ZZ8A 1H6XA 1VAMA 2NPIA 2Z42A 1KJLA 2AGSA 2EAAA 2RS13 2ZBJA 3POIA 3MPBA 4XAAA 3W9AA 1W90A 3RWKX 4B8EA 1BYHA 3AZXA 4AFAA 2D3RA 3KV9A 5I0TA 3ME2A 2ET1A 1CX1A 4A6OA 1UXXX 1QEXA 4YW6A 1KFXL 1RUI1 5FY7A 4Y1XA 3RZHA 3OF1A 5A32B 2KR2A 3CKHA 1YYNA 1PM7A 3JBG3 2W92A 4Q4Y2 4Y20B 1UX6A 3LIHA 2YBSA 3ZYIB 3NL1A 5HCHA 4UAPA 5K0UC 3IMNA 3DXUA 3SKJE 2H6BA 1QJX3 1F5FA 1PK6B 2BNOA 2IFWA 5FYHA 4LBKA 5C6CA 2JKBA 2Y0IA 2ZHKA 4GAZA 1OD3A 2W5FA 5KHHA 1JU4A 1NE4A 1N3OA 2MHFA 4XIKA 4Q0SA 2WS92 4DUWA 2GC3A 3RZKA 3RZZA 3U1XA 1I3HA 4Q4W3 4E4ZA 5BNNA 1AXYA 3KCCA 5FZFA 3D0JA 2XDVA 3ACLA 2VOVA 1FOD2 5EYYA 4YPJA 3WQBA 4UXAA 4IDZA 5FYYA 1H2NA 3UKNA 1OA3A 5C8CB 4QGLA 1KXGA 4KU8A 4TXWA 2VW2A 3AKRA 1OD5A 1DLLA 5A7NA 5C9AA 4P9IA 4UFJA 3DYPA 3I97A 5JXJA 3NSTA 1AXZA 1J1LA 4IW3A 4XFIA 2XJQA 3L2HA 1OF3A 2CNAA 3VB9A 2BRTA 1GZTA 1AL22 1PIV3 2QQOA 3MIDA 2WSVA 1VALA 2CAUA 2VTXJ 5CA6A 1MQTB 1AVBA 5JSRA 1ENXA 1S4CA 2VW0A 1BVVA 2DCJA 4NAMA 4CEYA 1YQ2A 5ERLA 2BU9A 4AOCA 4XJAA 3X29B 1R083 2B42B 3ETPA 3PU8A 1LOAA 2XWBB 2ENRA 1YI9A 2D44A 3T0BA 5ABJC 4YGDA 1K5MB 2FBEA 5FUIA 3JCIA 2VUJA 1GOGA 4DZGA 3C8XA 3W5NA 3NVCA 3BU7A 4Y22A 4K20A 4D69A 1U12A 4AG4A 4FAGA 1L7QA 5DUVA 3RYKA 4ZXKA 3VL8A 4WBBA 1CAVA 1ZZ9A 4CEWC 3C3VA 3I2HA 4Z07A 4CDUC 4P9XA 3M3OA 1YQCA 4CU6A 1CZVA 5JR7B 3WW2A 4AW7A 1DYKA 4HG6B 4LLFA 5AVPA 3CJXA 1XYNA 2HWE2 1HQNA 4GH4B 2NLRA 3ZYHA 1O3QA 4AFBA 2ETEA 4QGMA 2VZVA 1SMVA 4QKBA 5A1LA 4DUXA 1AR82 3LEGA 2RM22 2JX9A 2G1MA 4PLOA 3WUCA 4CUBA 4Q4X2 1WZXA 1V6OA 4DRRA 2P2KA 2YMZA 2X05A 3H3UA 4XCAA 4F3JA 3WCSA 1Q8PA 3AZVA 4Q1RA 5H9RA 4YGCA 5KHIA 2VC9A 3UGHA 1IPJA 2BGCA 5I8YA 1X9PA 1NQJA 1DBNA 1O7FA 2C24A 3ITQA 5CFCC 4L0PA 2CU5A 1HRV2 1PM4A 4RD7A 4YZ2A 5TSWA 2VNRA 2OPWA 2V73A 3OB8A 1W2TA 1SLAA 3I59A 3ZN5A 5FZAA 4BK4A 1O3SA 3D4KA 2VZUA 1YIFA 4XURA 3B94A 4D94A 2WZR3 2YFZA 2R0HA 2DCYA 3UJQA 3CZJA 1BK1A 5L7OB 1RUJ2 5FZCA 1E5RA 4YARA 2Y8KA 2DU1A 1QDOA 4XE9A 5DAVA 3RZGA 3N7MA 5I91A 2ADDA 2DURA 3A21A 4NWVA 2RVAA 5HXMA 4FPGA 1IKPA 1W39A 3BN6A 4LHNA 4XCBA 3BU0A 2XL9A 1IQAA 4MV2A 1H2LA 3AYEA 4IESA 4JGYB 3WDTA 3ZSMA 3T0AA 4BIOA 1G9AA 2JD9A 4LKEA 2QQJA 4N90A 3V0AA 3MV11 5T5OA 1X7NA 2YGMA 4OHZA 5F39A 4LQRA 4Q8KA 4NIGA 5FY8A 3ZYPA 3AP5A 3RG0A 1OLRA 3ON7A 3PUIA 1W6PA 1URXA 2AENA 1WW6A 4JCKA 3J8F3 3ZR6A 4E2QA 3LB9A 1CZSA 2O1QA 2PHXA 4D7SA 1DHKB 1PO21 2BUKA 4WVWA 3VBOB 4AE2A 1KDMA 1US2A 3AYCA 2BVBA 2P6CA 2X29A 2QQNA 1JYXA 4HOOA 1U5YA 3P1IA 1ULEA 4DY3A 3GCXA 1ZRCA 5FO9B 1QJFA 1TQ5A 3POJA 3T0DA 4COYA 4E4SA 1CJDA 3MIGA 4GJZA 5A70A 1W05A 4LHSA 1DFQA 2ZGQA 1ND3C 1FV2A 4EWAA 4N8MA 4CCKA 3IPVA 4YG0A 4LBQA 3M3EA 3J7HA 3KT1A 3WLUA 4N7UA 1V70A 1JN2P 5FMBA 2DCTA 1RUOA 2PAMA 2WFF3 2WNVB 4NPRA 4XAEA 3U4SA 3WDWA 1OPOA 3NNLA 4QPGC 4CTEA 4XABA 1APNA 3D3AA 1QJEA 4E2SA 2XHKA 3AX4A 3FN9A 4PF5A 2JG9B 2WZ8A 1W8HA 1R091 1GFF2 4AI0A 2WS91 3ILFA 3KB5A 4BISA 4HN0A 1OQDA 3M70A 1EPWA 1E5HA 3LQCA 1V6JA 3CBNA 3FC0A 2HWB3 1CX4A 2F17A 4LULA 3VBUA 2IXKA 1FMD2 4KGQA 3KV6A 4M0NA 2Z69A 4QPIA 4QX3A 1WW4A 3C7GA 4Y5SA 5FXVA 4QMAA 1DF0A 3O14A 3S5QA 4ZS2A 3G7DA 2TNFA 3N3HA 2OPKA 3HNBM 1F35A 3PDQA 5F3EA 2LM3A 2VULA 3LSDA 3T08A 4AFMA 2VU9A 2IZWA 5C3OA 2WNUA 4NIDA 4XFBA 1WGPA 3JB8A 3VKFC 5KWRA 2IXLA 1SPPB 1DQ0A 1I9RA 2CV6A 2XBO2 4GMP0 4MH0E 2W39A 1AL21 3DYMA 5F5QA 1OT5A 1AX1A 2XVGA 4ZONA 1POV1 3EO6A 5DAPA 3VDDB 4CDQA 4E8DA 2RS32 5FP4A 5L9RA 3WNLA 3ZO0B 4IEQA 4AVCA 4CDWB 3A0NA 3KGLA 2ZHLA 3LDKA 2WINB 3WF0A 1H0BA 1H9PA 5F3CA 3SXWA 2DDUA 1QKQA 2FMDA 1BEV3 4Z82A 2JJ6A 4XUQA 2YB7A 4COWA 5JZGB 1G8WA 1LJ7A 5A3OA 1V00A 1EUTA 2NZ9A 4RQPC 3S5AA 3N4MA 4URAA 3RZMA 1NA1A 1S55A 2XJRA 4P02B 4DUVA 1UW8A 2YZ4A 3OYWB 5BXXA 1I1EA 1FPN3 2Y0OA 3RQ0A 5JI9A 3VBRA 1C57A 1XE8A 1ZNPA 4XQ4A 1W6MB 1KGYA 4ET7A 1HXS1 1F9KA 4XMIA 2AYHA 5FTTC 4XXPA 5KBFA 3NJVA 3BGAA 1EP0A 5LY2A 2O8QA 4XZUG 1MZ6A 1OFNA 1AR81 3D0SA 3FHQA 4WM7B 2JDHA 3N9QA 2RM21 4XPVA 4EN8B 3A7QA 2ZGOA 4XF9A 5FUPA 4Q4X1 3C7OA 3I2KA 5I0SA 1PO23 4Q4V2 4N43A 1W9TA 2CY6A 2A73B 2VTFA 3CNAA 1Y4WA 4IV1C 1QXJA 5FKBA 3MIBA 5FZHA 1JYVA 3H8XA 5IJRA 3U75A 3WNNA 4FXGB 3UGFA 3RI8A 1HRV1 4B4QA 3GDBA 4L99A 5A33A 2DVFA 2WT0A 3HBKA 3PUSA 1OLME 2JDMA 2ZAHA 4I30A 3WV6A 3VHPA 1VBA1 3JD72 2Y34A 2ZOEB 1MS5A 1O4TA 4Q4Y3 3WSOA 4CU7A 1XU1A 4QX7A 3J4UH 4KWLA 4UBHA 5ANQA 1RUJ1 2K9ZA 4CCJA 5F3GA 1YFWA 5LBEA 4F83A 3THPA 5GZEA 4A7ZA 1GP4A 3FLTA 3QACA 5FP9A 3H9AA 5EQUA 4AHYA 3V65A 4AGGA 2WS93 4PI0A 3ZFEB 2GN3A 5C71A 4YFZA 1XSQA 2XUEA 1V9U2 2B5HA 2WA3A 4YVWC 3TNPB 5HCBA 3SH5A 1EV12 4X8NA 4ATEA 4FBFA 5HPOA 3VD4A 3U78A 1IHMA 3W59A 1FOD3 3CJIC 3DF0A 4ZZ5A 3WF1A 4DNYA 3APBA 1RUE1 3OEBA 2XPJA 3T4VA 1E5IA 5A6QA 2D3SA 3NAPB 1KDKA 4HKOA 4IE4A 5F6LB 4MGZE 1LOFA 1OURA 1NY72 4WM8B 1KD7A 2R32A 3LD8A 5A32A 2GH8A 2Z4FA 1VBD3 4K1YA 1RMU1 2CGPA 1PGSA 1ZRIA 3HT1A 5LEKA 3LIGA 4CYDA 5A1AA 1UU5A 2WAOA 5HI0A 1A78A 3I2IA 1QU0A 3EMRA 2ZGMA 4XDQA 1PK6A 4AHXA 3AMPA 5F2SA 3MLLA 3ZDVA 1PX4A 4EYUA 4FOVA 1UY0A 1Y7BA 3PNAA 1SFNA 4ZZ8A 1FNYA 1BK0A 1D2SA 3RYRA 4Y1ZA 3JXSA 5J48A 4UYBA 1XNAA 2VUDA 3AMNA 4OZXA 4PIXA 4EROA 1H2MA 4P9GA 2GU9A 1UKGA 2JDYA 3AFGA 2WNOA 2ZHNA 4IV3C 4LE4A 3LSEA 4X6QB 1XXNA 2VMEA 2Y33A 2D7FA 3KLSA 5DZEA 5BNPC 1NLQA 2FMYA 1IZ3A 1CPNA 3AP7A 3WNPA 1DZRA 3VZOA 4XW3A 4H7LA 2CDOA 2RJKA 2RS12 2WWUA 4MADA 1LR5A 2ZX3A 3POGA 4UW3A 4YW5A 3TBDA 3BTXA 2VR4A 2BBVA 3WHTA 2XKPA 2HWE3 3MUZ1 1LOGA 4FPFA 3QH6A 1FMD1 5K0UA 2EIEA 5A1FA 4JHTA 4LUMA 4CP9A 1JZ4A 1TME2 1AR83 1W0PA 4YNIA 1UQXA 1CESA 2VQTA 2JKXA 4Q4X3 4RR3C 1S0DA 4GWNA 2JG8B 4IEVA 5IVBA 4KG0A 2Q8OA 3RFRA 1LRHA 1QOSA 1UZZA 2VGDA 3B7MA 2ZGTA 2MEV1 2R042 4QDRA 3ZM8A 5IK8A 4NHYA 1K5MA 4EJRA 5FO8B 2WZPP 4LBJA 2CYFA 5T5JA 4CEYB 1C8M1 4I3GA 2XXZA 4HONA 5C70A 5EIYB 2W94A 2OYZA 4IV3B 5CBLA 3WP5A 2RS31 1UMIA 2JDNA 2ZGRA 4IE6A 3BKZA 1JUHA 1WW5A 1YNAA 1EUUA 1NCRC 3KCXA 4IGOA 1Q8SA 1LHNA 4E27A 1QY4A 2KD7A 4MLOA 3ZXDA 1PO12 3LPFA 5FBZA 2DWRA 3OEAA 1YWKA 5SV5A 1GU3A 2YC4A 1OF4A 3PIGA 1W0NA 2EXHA 2X8KA 2BNNA 4FQZA 4FPKA 4RGGA 4YZ4A 5BV6A 1WCQA 1JS9A 2B9VA 2XLAA 1BHGA 4LNVA 5GZDA 3O1PA 5FLJA 4XJ8A 2NP0A 5AC93 2DU0A 3OBRA 3LPGA 1NXMA 3KT4A 5F3IA 3RVHA 5ABJA 3M1HA 4HKLA 4BQ5A 2UYBA 1SLCA 2WO2A 1CJPA 1FT9A 3GHMA 1UOBA 2IC1A 4Q4V1 2Q8DA 3SH4A 1BMV2 2JDUA 5CEHA 3HR9A 1R1A2 3CL1A 3VZJA 3DPRC 5KXDA 4ONUA 5L7OA 1XNCA 5KC5A 2YYOA 3HQXA 4KWUA 1GICA 3I59B 2QZ3A 2ZGNA 4Y1VA 5FMCA 4K8RB 1Y43B 4FCAA 4JGYA 4CCEA 3O0XA 4ISQA 5IT6A 2BYVE 3BVCA 3OOXA 4W50A 2C0ZA 3AC0A 5J37A 3BPZA 1UWWA 1N1YA 2C4XA 2VPVA 4I0WB 3U10A 4QXCA 5A6XA 4RS5C 3Q8EA 1LENA 2ZKLA 2WT2A 1RYYA 3VZMA 1I5ZA 2VL4A 1B35B 1GV9A 2ZEXA 3POYA 2QJVA 4J1XA 5A3LA 3AVRA 1J3QA 2JE9A 2RDNA 3S30A 1YHFA 3A23A 3NMBA 2PFWA 2A3YA 1JOPA 2PN5A 4M3CF 3VBOA 3VBFB 4AHWA 4C90A 1ZYBA 1EV11 1WKYA 5I0DA 1AR62 1EPZA 3U14A 1CPMA 1NYWA 1YO8A 2WL1A 2P3YA 2E31A 3LE0A 2ZEWA 2HWC2 4W65A 1SEFA 4HL0A 4XTMA 2BBAA 3HNYM 5HXVA 5LB6A 3ZVXA 3R05A 1NY71 4CU9A 5F1RA 2ZZJA 3SKVA 4CCNA 2VJXA 4QQPA 1Z78A 2FDJA 2EA7A 1AYN2 3MEPA 1LU1A 4JQRA 2XBO3 1SDDB 1WMDA 1WLWA 4A3XA 4AEJA 4XDOA 2LTNA 2WNVA 1WWYA 2P37A 2J1AA 5JOXA 3T1LA 4U36A 2DVAA 1OSGA 1L7LA 2J7MA 3K51A 1UU6A 5FY1A 2RS33 4CP0A 4LBQB 3SHRA 5JPMB 2PHLA 2JG9A 1YCIA 4YVSB 2CWMA 2HBUA 1Q56A 3TAYA 4PJYA 3THDA 4MXVA 3SMHA 2ZACA 4MSVA 2WYSA 1O5LA 1W2OA 4C1WA 2XMLA 4MOAA 3T2PA 3J8F2 4DXSA 4PQQA 1UMHA 2LS6A 4XBQA 5LATA 1R1ZA 4LA2A 1VBE2 1O8SA 1OLMA 2RS11 1UNBA 1TEIA 3FL7A 1XNTA 1DGLA 2R063 3GM8A 3OY8A 4IE5A 4AWDA 5CFDC 3PU3A 3AMQA 3HPNA 1RXFA 5DPNA 3ZN6B 3B00A 4W8JA 1SPPA 5DAXA 4MO3M 4AR2A 2P1BA 2PHRA 3I54A 2WC2A 2WWSA 3LEIA 4LHLA 1YC61 4META 4W6WA 5BNOC 3OUJA 4HPKA 2E26A 4Z2AA 4L9BA 3VDDA 4R4XA 1XYOA 3JBG1 3T2QA 1CIWA 4LOSA 4Q4V3 3AP4A 4BJ0A 3VBHB 1QQP2 5JZGA 1W06A 2D6PA 2R041 1QJX1 2WFF2 2YHJA 3UKTA 4Q0QA 1V6KA 1HQWA 1LESA 2WO1A 3OYWA 1ZVFA 3PLQA 3UESA 4LLOA 5FJKA 1OKOA 5L36A 1NXD1 1NX9A 1V6IA 1V6NA 3JD73 1W6MA 4DPNA 3ZIXA 4AQTA 3ABZA 4NUBA 4CDXB 4YZ1A 5K9YA 2D6OX 5FYSA 4ASKA 3GCWA 3N9PA 3GZUC 2E33A 1MVQA 2VVEA 1PO11 1OOPB 2VMHA 4TLFA 2KM2A 3BB6A 4WM7A 2A1XA 1VRH2 2H0BA 2Z2SB 4CVUA 4A41A 1LOBA 2HBTA 4AAPA 2YY1A 3IDCB 2Y64A 3LZZA 1H4GA 3DUIA 4Q2FA 3WG1A 3VKOA 3UT0A 1V9U3 4IEUA 5GZGA 2VNVA 1SBEA 1AL0G 1EV13 3M4FA 4XXAA 4ASLA 3ATGA 2ARAA 2JDZA 2FCTA 3H7YA 4ZU4A 1S0BA 5DDJ3 2GMEA 5C3PA 4HFSA 2JXAA 1UAIA 1UYZA 5GLVA 2OZJA 1PVC2 5DABA 4YG3A 5A7OA 4EN0A 1HW5A 1R081 4E2GA 3HVDA 2P3IA 1HJGA 3KF5A 3I3BA 5C33A 1BMV1 4O65A 2WWJA 2VECA 1YUDA 3VL9A 4FI9A 4ISRA 5FZIA 1GANA 1UY4A 2XUMA 3NO8A 4F8AA 4AQSA 3MHZA 1POV0 4P9LA 4YM1A 4FP3A 4DS0A 5IVFA 2CAVA 5J96B 2B4KA 2GC1A 2PAEA 3O7OA 4YZ3A 2JB4A 4BPZA 4CPBD 5JDBA 1KEXA 2VTXA 2W1SA 2QFEA 4SLIA 3ZFGB 4E4DX 5EHDA 2RJLA 1GNYA 3ZFEA 1IS5A 4JAAA 3UETA 3E6DA 1K3IA 2XWJB 1DGWX 3WQ0A 4AL9A 4UFKA 1UX7A 4NRQA 5FZ4A 5KR7A 4IV1A 3ROUA 4AK3A 3ENRA 4QU1A 2WAAA 3KQRA 3NAPA 5F6KA 4TSVA 5A7QA 2VY0A 2JE8A 4RSUA 3WD5A 5LA0A 1UD1A 1G9DA 1AX0A 2RR13 5LK5A 4EN6B 5IVVA 1W9YA 5FYZA 1C5HA 1GP6A 3AKTA 1VPHA 5T55A 4MGSA 1TME3 2J1EA 4UW4A 1HRI3 1GR3A 4FFFA 1ZA7A 5E16A 3ST7A 1NLRA 2ILMA 5CADA 4AVVA 4KU7A 5FFOC 5D8AC 4A7KA 4I0AA 2WZR1 1LCLA 1U5XA 4MXWB 5KXCA 1W2AX 3ACIA 3OTFA 4UW6A 1VJ2A 4XFFA 4QDQA 2R043 1AYN1 3AXEA 5EZWA 5IUQA 4EE2A 2QQVA 2FZ2A 2EAKA 2HEVF 4XOGA 1Y3TA 4B7EA 4FQ4A 4AEMA 3DV8A 1F2NA 3OD4A 2OUHA 1JZ8A 1W3VA 3ZIWA 4ATFA 1W8UA 2IWGB 3OGRA 4QPYA 5DUWA 4UFMA 5FYVA 1RUG2 5EFUA 4P9JA 1UOGA 4EN9B 5JXIA 3PURA 4XF3A 3VDAA 2A7AA 2XJSA 3IT8A 3O5SA 4BA6A 3E5XA 5DMYA 1O59A 2D6LX 3HNMA 4EWEA 2AREA 1PO13 4LHKA 4CUAA 3KVAA 3L2YA 4IGQA 3J8F1 3OSDA 4ZS3A 2O0OA 3V64A 1W2UA 1GWKA 1S2BA 4RHV2 1S0FA 1VBD2 1ZA4A 2PQQA 1XQNA 2JG8A 5JOYA 4QT6A 4BE3A 5B2GB 2WN2A 3HEIA 3ASIA 5FZEA 2JDKA 3QLQA 1ZZBA 4JKKA 5K0UB 2X5IC 4CP9B 4XFGA 2NYYA 1T6BX 1W03A 3PUAA 5GJ6A 2ES3A 3ZSKA 2R072 1F31A 3THCA 4IV3A 2Q5TA 4PLMA 5GKAC 2ZXQA 4NO4A 2VZTA 4LO8A 2VZ3A 1R1A3 5FAXA 3FUOA 4JGZC 2WFF1 5B4XA 1GP5A 2YUEA 4NRMA 1HB3A 5J36A 3N9LA 1CONA 2VOWA 1MZFA 4JDNA 4UT5A 1JZ3A 2F6BA 1VB4A 5FY9A 4IEOA 1OA2A 4YM3A 1IS3A 4N9IA 1X9TA 4GWIA 2Q0AA 5C4WC 4FFIA 4NHXA 4CCLA 2QQLA 5FZGA 2XOMA 3MIFA 2HWB1 3H50A 1CWPA 1IKQA 3BYWA 2XONA 4LO7A 5KXEA 5CG9A 2UYAA 4Q1PA 2WO7A 4URTA 5FMOL 3ZOIA 2BOIA 4CCMA 3AZYA 2W1UA 4EN7B 1UZ0A 2DUQA 1A6CA 1ZBE2 3VD7A 1RIRA 1YQ8A 4IE0A 1W2NA
chains in the Genus database with same CATH topology
4MX3A 1EAH3 5ABJB 1AR63 5I8SA 4AFDA 1UIKA 4I09A 2HWC3 3ZXLA 3WQ1A 1H8TC 2MNGA 3WDVA 1OQ1A 5LRSA 4CEWB 1BEV1 4CDUB 3AKQA 4WZCA 4BZ4A 1AYN3 3A0KA 1BJQA 3BOPA 1GBGA 2DV9A 1FPN1 3CLPA 4AEDC 4R9AA 4YG6A 2BPA2 1F8VA 4BH9A 4DOUA 1ENSA 2JEMA 1TMF3 2EF6A 2ZJCA 4L8QA 3VBSC 3OCPA 1B35A 3ZFFC 3KS7A 4HKWA 5FOBB 2DCKA 3G6JB 1S0IA 4K8FA 1O4YA 3VBFA 5A3MA 5AC92 1PMIA 1ASJ2 1DGRA 1DQ5A 2D5HA 5CFCB 3DPRA 4LEJA 2CTVA 4HK8A 1OA4A 2A71A 2ZAAA 1VBE3 4ASMB 1FI2A 4KWKA 3VHRA 1Q43A 3I2DA 1SLIA 1RHI3 3MW2A 4MUVA 2EALA 1RUH2 2XVKA 2VNOA 3ALQA 2D97A 3AJZA 3J26N 4BM8A 4XF4A 4L97A 3U07A 3FBYA 1V6MA 5FQ0B 3RMXA 1BQPA 4Q4Y1 4INDA 2NN8A 4M01A 3WR0A 4YVSA 3ZXFA 4AVTA 4B3NA 4S2FA 5CG8A 1AZDA 3ZFFB 1QQP3 1DG6A 5CU1A 5HBAA 1YFYA 4KL1A 4P14A 4C0BA 1XRUA 5E88A 3KM5A 2WQZC 2ET7A 1IPKA 1UMZA 2WLPA 1LECA 2RS52 4YYOA 2XVLA 1BBT2 2RHPA 4WZFA 1FOD1 2XLGA 4QGNA 4YW1A 4N53C 3ZN6A 2OZ6A 3UV9A 1HV1A 1MZ5A 3MIEA 4Z1VA 1VRH3 2ZMKA 1DGRN 1ND3B 4RHV1 1J58A 1VBD1 3OY8B 3N7JA 1LOCA 1DGWA 2QDRA 5DG1A 3GZAA 4Y4YA 1ZRRA 3TWIA 3VBHA 3MFAA 3VZLA 4BQ1A 2ZX2A 3ECQA 4YZ5A 3AYDA 2GH2A 2ZKNA 4HPKB 2LALA 1RC6A 4QPGB 2R071 2XJUA 4XFCA 1SBDA 1PVC3 4GB32 1PGL2 1RTVA 4X6RB 2R0FA 4YGEA 3ZN4A 4JRAA 4CDXA 3JB4C 1F5JA 1LULA 4M3CB 1HKDA 1WBFA 1MEC2 2ERFA 2JD4A 3VZKA 3OPZA 1OOPA 1VAVA 4HANA 1T6GC 1BVP1 2ZGSA 4K7JA 3GHNA 1ND2C 3LOIA 3FX3A 2D6MA 2R062 4FOQA 1LOEA 4Q26A 3EHKA 3ETQA 1Q8OA 1KJRA 2HWE1 4FPEA 5JAXA 3MZHA 5FPZA 3WW3A 1JXNA 5EJ3A 2VVFA 1E57A 4PDWC 1C28A 2ZX0A 4O9EA 3TOJA 1OKQA 5FPXA 1ZBE1 5BY5A 1OHFA 4RQPB 2HWF2 1D4VB 1WMEA 1PHMA 1D4M2 1FV3A 2SBAA 1Z7S2 5HCAA 4OHWA 5T54A 1G9BA 3AYAA 5GM0A 4K3UA 4H14A 2G9GA 4LBOA 4YW5A 1A8DA 2E7AA 3ZFGA 3ZXJA 1MR5A 4AI1A 2R16A 1ND2B 2DFBA 3GNEA 4IEPA 4RL7A 2BVVA 2GZWA 1GNZA 1RVF3 1SLTA 2E6VA 4ZKTB 1AR73 1VIWB 1DZTA 4S2DA 1DU3D 2A5ZA 4LBNA 1DDLA 2BQPA 1O3RA 1RUG3 3R6SA 4CRQA 2ZCWA 3AKPA 3WP6A 4IV1B 1N1TA 5AC91 3HAGA 3N7KA 5DDJ2 4GQ7A 1NZCA 3GYDA 1REDA 4LR4A 5K8SA 3USSA 2DYCA 2PLV3 2A70A 1GZWB 3FUQA 4RHV3 3PHMA 4HSJA 1KITA 2B8MA 4E9KA 2PHFA 3ELNA 4MXWA 5I93A 4KWJA 3GALA 1W6NB 1MS3A 4XFAA 4KH9A 1RUH1 3SITA 1MS0A 3GBFA 4TZDA 2R073 1C4RA 3QH7A 1A3KA 2EXIA 4COZA 4Y5Z0 4FOYA 4YM0A 4YVWB 2FHRA 4Q0VA 1N1SA 2CGOA 1WD4A 2E53A 5FLIA 2FZ1A 3CJIB 3MLJA 4FTEA 4C91A 3ZX7A 3H1MA 4Q0PA 5C9AC 2A6YA 1LGBA 4DB5A 3WT3A 1REEA 2RR12 2DF7A 1BBT1 2X53S 3MYXA 3DL3A 4XTPA 1XYPA 4AVSA 4Y1UA 3DKWA 1HRI2 1U5ZA 4YSFA 2WA4A 2W52A 5I8TA 3PVEA 1YFUA 3H1WA 4RFT0 4BHPA 2VMIA 1ZBE3 1MACA 3IWZA 5IK5A 3N35A 3VHNA 2XBO1 4AI8A 1SBFA 5JLVA 1DQ2A 3KCYA 5DXDA 2BW8A 2KXLA 2YDEA 4YW2A 5BNPB 1LHVA 3C2UA 2QQPA 3EBRA 5ACA3 2D3PA 1PGL1 1MS1A 1COV2 3URFA 4ZU5A 3EQEA 3KT7A 4O9GA 4Y1YA 1NG0A 1GQHA 4ORFA 5DUXA 3IDEA 3O0VA 1MEC1 3GZTB 2VVDA 3LA7A 1J59A 4JC1A 4MYEA 1LHUA 1AYM2 4RR3B 2R061 1ULFA 2ZGKA 2XG3A 2XH6A 3LWCA 2OUJA 4GALA 4OVEA 1ZRDA 1HV0A 2C5DA 1ASJ3 5KHJA 3WW4A 1YJLA 1Y9QA 4NN0A 2K0GA 3VKMA 3MW3A 3PTYA 1VBC3 1WCSA 1MVEA 2GC2A 5D1IA 3IBMA 4YGBA 4CEWA 2RE9A 3VV1A 1NCRB 3O0WA 4CDUA 4J6GA 5IK4A 5FRAA 1QDCA 2DTYA 4CZSA 1RUH3 1VR3A 2HWF1 2ZX4A 4NVPA 3RYPA 3BALA 1AHSA 1YXWA 3IKWA 3JD71 3FLPA 4JTOA 4YW4A 5HCFA 2R30A 1ENRA 2XJPA 4OHXA 2GNMA 4PBPA 2JECA 4IEXA 4S2HA 1X8EA 2EXJA 2VUAA 5CFCA 1XU2A 3LA3A 1G9FA 2G4IA 1V9U1 1MZEA 2RS53 2HYKA 1EAH2 4AXOA 1BBT3 1QJY3 1AX2A 3DPRB 3R4DB 3AB0A 4R4ZA 3NWKA 5JIAA 5DDJ1 2ZPXA 5CB7A 2BTVC 5JWPA 3BCWA 3D5OA 3AXDA 5FQ0A 4QQOA 1AR92 2XKOA 2GNTA 2Y38A 5DUUA 3ZFFA 3MGUA 4NOTA 4XF1A 1JUIA 4RS5B 3WW1A 1TMF2 1UKRA 1RUI2 4NHKA 4B7KA 4GB33 3ZSLA 4HVQA 1JYCA 1M4WA 4FO9A 4XBLA 2W68A 3VBUC 4QPIC 3FHIB 2E51A 1KS4A 4FXKB 5I0UA 4DMIA 1AF9A 1MEC3 5IK7A 4DFSA 1JOJA 1PNGA 3OGGA 5KHGA 1NCQC 2QE3A 2ARBA 2VNGA 2W08A 2WNUC 1ND3A 2VW1A 4JVAA 2RR11 4I0BA 1LHWA 2V5YA 3MIHA 1D2QA 1RHI2 3U11A 4CP1A 2XB6C 3H0OA 3ZYRA 1TME1 4CDQC 1HRI1 2UWAA 3SNMA 1S2KA 3WNXA 1TNFA 4QPGA 4Q0UA 5T52A 1GNHA 3RI9A 2P3JA 4R9DA 1NA1C 1FATA 1LKNA 4SBVA 3ZXEA 2DUOA 3GF6A 2HWF3 4IQPA 1UIJA 4NR1A 3UL2A 5K7PA 2D93A 4M3CA 3I8TA 1D4M3 1UZYA 3VBRC 4S2GA 1Z7S3 1ZZCA 4L11A 4AF9A 1DZQA 4AI2A 3WQ7A 3AP9A 1TE1B 4GKXA 5JI7A 3VKNA 2KA3A 2O8OA 1OMIA 2VMGA 4BMBA 5CFDB 4FPLA 3H8UA 2G9FA 2ZABA 5T50A 5BNOB 2ARXA 1DYPA 1PNFA 4BIFA 4IEZA 4N43C 4FPCA 2H6CA 1KRIA 4QQLA 2WJSA 2JE7A 3WDUA 2GMPA 1BXHA 2DFCA 4RQPA 1X8MA 1JHNA 4IEWA 3P3NA 2E9QA 4PCRA 4I2OA 4DXZA 4LBMA 2I74A 1Q8QA 4UBGA 2PA7A 4I01A 4M00A 3LCPA 5KHKA 1OPMA 4WV8A 2ZTNA 1R1A1 1ZREA 1ND2A 1Q3EA 1RUNA 1PZ8A 3T2TA 2VOXA 2AUYA 3NV3A 4XJZA 4QXKA 1RINA 4GMP3 3RMYA 2PAKA 1CAWB 4Z2WA 1IGOA 1QF3A 2HWD2 3VLBB 3POWA 1JW6A 4D3WA 1NOVA 1VB2A 1RUC2 3RJRA 1SACA 2DVDA 3WX5A 2GSYA 1WMFA 2XJTA 1ZBA3 4FVVA 2ZA9A 4YW3A 1LB2A 2BNMA 2R49A 1XNDA 4GA9A 4LBQD 1LOFC 1G9DA 2B39A 2P3KA 1HLCA 2I07B 5JVVA 2C9AA 3VZNA 2F4PA 3AZWA 1GZWA 5H9SA 3K48A 3KGZA 1EAH1 3KMHA 2A3WA 1WCDJ 1AR61 1JYIA 1PK6C 3WG4A 1W6NA 3HBZA 2HWC1 4KG8A 4ZU7A 3ZDSA 4XBNA 3ZSJA 2AR6A 1QH6A 4KGGA 3AMHA 2Q1MA 3AM2A 4IEYA 3R4SA 1QNYA 4XQDA 3FFQA 4WVMB 1O91A 4Q29A 2BWCA 1RVF2 5L73A 1M06G 4I02A 2I45A 4YVWA 2GNBA 3B3QE 2PYTA 5JMCA 1AR72 1RUD3 2A3XA 3CJIA 5C8CC 1TMF1 2CWSA 2IXCA 1HQLA 1S0JA 3POSA 4XQWA 3R4UA 2ZGLA 3ZXKA 1COV3 3FMGA 1GKBA 3RS6A 1FYUA 1W6QB 3HWJA 1MQTC 2EVXA 4XF0A 2XGXA 5EWSA 2PLV2 1X50A 3OJBA 1WCKA 1XNKA 1VBE1 2VQ0A 3OGJA 1AYM3 4B29A 1R092 1KFUL 5D8AB 3KSCA 1RB8G 4AVBA 1K5MC 1RHI1 3EJKA 1WBLA 1LEDA 1DQ1A 2FQPA 1RL3A 3OD0A 1WLCA 3USUB 5FLHA 4FPHA 1SCSA 4HK9A 3NV4A 5BNPA 5L19A 2DTWA 4HETA 1OFSA 2Y26A 2OW4A 2CGNA 1QQP1 4BWOA 3HT2A 2BWAA 4GH4C 2OA2A 2ZX1A 3FZ3A 2TBVA 4ES9A 2WIIB 2RMU3 3PMEA 2Z79A 4KNCA 2YXSA 4MGIE 4XHXA 1MS8A 1Q8VA 3HMYA 1BZWA 4MZUA 5H9PA 4RR3A 1H2KA 4U2AA 2B46X 4BLJA 1QMJA 2UURA 2HKXA 3NW4A 2X5IB 3VGIA 5FCCA 1G7YA 1VRH1 2PHTA 4OLLA 5KXBA 3AJYA 3WG2A 1XNBA 1S0GA 4CP2A 5CNAA 1HXS2 2IXHA 3SH3A 1NCRA 5L7OC 4C0HA 1J1TA 2NM1A 3WCRA 1EYBA 4JGZB 1I6XA 1QJU3 1GYKA 3ZPYA 4R9CA 3TN93 1OLQA 2OVUA 4HBNA 2B7YA 4IETA 5ACA2 1PVC1 3BODA 4JGYC 5GZFA 4DRVA 1AR93 1WUVA 3FBMA 4HZFA 4AI3A 2GMMA 3KD4A 3FE5A 3FWEA 5C4WB 3SLIA 4OFGA 5BYNA 3V0BB 2D43A 3GBGA 2ZS6B 4LA3A 4A2UA 4IXLA 1FAYA 2C1FA 2JICA 3TB0A 4COVA 4P9WA 5AVAA 2E7QA 1RUI3 1X33A 3NV1A 2HWD1 4FSJA 2R6QA 1VBA2 3VBOC 3W58A 1JH5A 1O3TA 1RUC1 3B93A 1X36A 3CO2A 3ZMNA 2EIGA 1YFXA 4XHBA 1H8TB 1VBC2 2QDNA 3O12A 3RNSA 3H1YA 3SCGA 1CAXB 4KQ7A 4F7ZA 5J09A 3N36A 3E6BA 1RUF2 5FO7B 3SCFA 2ZZQA 2R1DA 1PZ9A 1H1AA 2VOKA 2WNVC 1KQRA 3RPQA 3UJOA 1SLLA 2HEWF 4KBBA 4I3PA 3CF6E 4JTNA 4RS5A 4AEDB 1RUE2 4GIQA 1ZRFA 2JG9C 3MLKA 1IOAA 3WXPA 3VBSB 1W6OB 3AK0A 1LGNA 3B69A 2Q30A 1RVF1 1RMU2 3MPPG 2JENA 1CAUB 3D8CA 4OHVA 3ZXGA 3NKTA 1GSLA 3VUOA 5BNQA 1U5IA 1PZ7A 4FPOB 1AR71 4YRDA 3S6PA 4AHZA 1YJKA 4K21A 1SFYA 1RUG1 4AFCA 1QJY2 3E97A 4XYXA 5EXOA 3P3PA 1WW7A 3LA2A 1CD3G 1IS6A 1SDWA 1S0EA 2YPJA 3VDDC 2PLV1 3CU7A 5SV8A 4CDWC 5GLUA 2BFUS 4M0HA 3GBWA 3FFZA 5JZGC 1HDKA 2A6WA 3FLRA 5JCTA 2SLIA 3B5LB 3ZXAC 3R0RA 3JU9A 1CVNA 4YLZA 3PMSA 4D7TA 4NHLA 1H1MA 1NQDA 1V6LA 2GC0A 3AMMA 2VH9A 3M7AA 1ULGA 1QXPA 2UWCA 1NCQA 4XZPA 2PHDA 4D7YA 5T5PA 2MEV2 5CFDA 3HIFA 1SQ4A 2TEPA 4LO6B 4N53B 4WM7C 1C8M2 4LBLA 5BNOA 1D0HA 3AZZA 2UY8A 5GLWA 2HWD3 4L2NA 1RUC3 4PQ9A 5DZGA 1RJ8A 2D6KA 3ZYGA 4J1WA 3JUUA 3PVBB 2UY9A 4AGRA 1U0AA 3FJSA 2PTMA 1H30A 3AKSA 2A75A 3IDBB 2IXJA 5AFBA 3MF6A 2GAUA 2DUPA 4JDOA 1AJOA 1DQ4A 1N3QA 4Z92B 3LGRA 3MFCA 1QGLA 1CAWA 4A7YA 5ACA1 3SISA 3TYJA 3ZFEC 1H8VA 1DIWA 1XE7A 3HD8B 5J98B 3WDYA 1D0GA 2GDFA 1PVXA 2QNKA 4MVTA 4W6XA 1UCXA 2ZHMA 1UL9A 3NAPC 5J7MA 5JOWA 4WM8C 1LEMA 3U4XA 3THTA 3E5QA 4HN1A 1N1VA 4PDWB 3JZVA 1HX6A 2IFRA 1TNRA 4M3CE 3V56A 1A8MA 3B02A 1WLTA 1ASJ1 3I4IA 3IM0A 3QBQA 3RJ2X 4DY5A 4RA0A 2DVBA 1REFA 4K1ZA 1LGCA 4HSLA 4AQ2A 1WD3A 2Q1ZB 3H7JA 1VBC1 5JIUA 5C8WA 3RDIA