1UZZA

Erythrina cristagalli bound to n-linked oligosaccharide and lactose
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
239
structure length
239
Chain Sequence
VETISFSFSEFEPGNNDLTLQGAAIITQSGVLQLTKINQNGMPAWDSTGRTLYTKPVHIWDMTTGTVASFETRFSFSIEQPYTRPLPADGLVFFMGPTKSKPAQGYGYLGVFNNSKQDNSYQTLAVEFDTFSNPWDPPQVPHIGIDVNSIRSIKTQPFQLDNGQVANVVIKYDASSKILLAVLVYPSSGAIYTIAEIVDVKQVLPEWVDVGLSGATGAQRDAAETHDVYSWSFHASLPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lectin
publication title Crystal structures of Erythrina cristagalli lectin with bound N-linked oligosaccharide and lactose.
pubmed doi rcsb
source organism Erythrina crista-galli
molecule tags Lectin
total genus 55
structure length 239
sequence length 239
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2004-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00139 Lectin_legB Legume lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1uzzA00
3AYAA 4YZ2A 4FOQA 1BZWA 2ZZJA 4XJWA 1KQRA 2DVFA 3W58A 1D0HA 3ENRA 2NN8A 1WUVA 2R16A 1SLIA 2YROA 2VXRA 4OZXA 1SCSA 3PMEA 1Q8OA 1OFSA 4YGEA 3O0VA 4XJAA 3POWA 4YFZA 3FFZA 2D6LX 2JJ6A 1V00A 5DXDA 4C1WA 2D6PA 3T1LA 1QDOA 4YM2A 1AXYA 1QMJA 3VKNA 2CYFA 1W6NA 3AFKA 4YW3A 4YW4A 2ARBA 1AZDA 2NZ9A 3FLTA 3IN9A 4YZ3A 4XE9A 1G8WA 2JE7A 1DZQA 1PZ7A 1S0IA 2A3YA 1WLWA 2NP0A 3A4UA 4C1XA 5DZFA 5GLZA 1UPSA 4YW2A 1MS8A 1ZA4A 2WSUA 2GMEA 5E89A 3IKWA 2LTNA 1I3HA 4XDQA 3V0AA 1HQWA 2BQPA 5H9PA 2SLIA 4M00A 5GM0A 4P9YA 2C9AA 1HKDA 1SLLA 2ZHLA 1J1TA 4Y1ZA 2Z42A 5JVVA 1LU2A 4R9DA 1S0EA 1SBDA 1QKQA 2XB6C 1WD3A 4LBQD 1SBEA 4SLIA 2D3SA 3M3EA 3POYA 4CZSA 2AREA 1YXWA 1LENA 2ZAAA 3AYDA 1WW4A 3AXEA 1LEDA 5HCBA 5GJ6A 5T55A 1LHVA 2ZKNA 5T5JA 1S1AA 4YG3A 5E88A 1F31A 2AYHA 3V0AB 1FX5A 5JMCA 1D2SA 2EXIA 3BTAA 2D7FA 2E53A 4YGBA 2A3XA 1GNZA 3BODA 3N36A 4ISQA 1ULEA 1AX1A 1N1SA 4UW6A 1G9AA 5GZFA 1B09A 1Q56A 5F9TA 5EXOA 1N1VA 3VKMA 2ZBJA 5DUUA 2W68A 4XHXA 1S0DA 2CL2A 3UK9A 3SLIA 3A0KA 1G86A 4Q26A 1SFYA 4BQ1A 1XQNA 4XBNA 4YM1A 4BPZA 4YGDA 3RQ0A 2XG3A 3AJYA 3O12A 2SBAA 3WUCA 4FPHA 2ZGOA 4XJ9A 4WV8A 1RINA 2R49A 3ZXFA 1URXA 3V64A 2R1BA 3N7LA 4UW3A 3V65A 4YZ1A 2A6YA 5JLVA 1WLDA 2JE9A 1ULGA 1LOFA 4F83A 3MEPA 2NMOA 1LEMA 3GNEA 2PHUA 3WNXA 4AYUA 1YYNA 3FLRA 1V6NA 1S0BA 5GLUA 1CPMA 2ZA9A 1QDCA 2WLQA 1UL9A 2D6OX 2UWAA 3AYEA 4Y1YA 4Q2FA 5GLTA 3OPZA 2P3JA 3SNMA 1DQ4A 5T5PA 1AVBA 1YO8A 4DPNA 5EWSA 3WDTA 1GLHA 4D69A 3WUDA 2WT1A 5CB7A 4YW5A 1C1FA 2ZGTA 4FPKA 1LOFC 3ZYRA 2B7YA 2DU0A 1Y7BA 3PVNA 1W0OA 2P3IA 2GNBA 4Y26A 3N7KA 3V0BA 1IOAA 1U0AA 1IS4A 2GMMA 4FQ4A 4CTEA 3OBRA 5IK5A 2EXHA 2ZGQA 3NWKA 4PBPA 4R9BA 2DVAA 1VLNA 1DQ6A 1F5FA 3OBTA 3MW3A 1FV3A 1LHWA 3WG2A 1SLCA 1W0PA 1HQLA 3O0XA 3Q9OA 4NO4A 4YG0A 1WW6A 2EXJA 4RL7A 1CJPA 5KXDA 2P3KA 1IKPA 3RSJA 4UW5A 1S0JA 2PHTA 3N7JA 3B3QE 4YM0A 1GANA 1MS3A 4YFWA 2DV9A 2GMPA 1AXZA 2WT2A 3WLUA 4IQPA 2W52A 5IT6A 2A75A 1SCRA 3I4IA 4XILA 3ZSLA 1DFQA 1YI7A 1ENSA 5GZDA 2GNTA 4GKYA 4DQAA 3V0BB 3AP6A 3MW2A 4DRRA 3O0WA 4TZDA 3JUUA 2ZGRA 3HMYA 1QU0A 3OJBA 1ULCA 3NV2A 1JOJA 2CWMA 1KRIA 4DFSA 3DGTA 3ATGA 2I2SA 4GXLA 5JOYA 5H9SA 1DGLA 1QNWA 5LK5A 2WQZC 1WBLA 3ILFA 2E6VA 4XIOA 4YZ5A 4FP2A 2PELA 4CRQA 4P9WA 3ZPYA 2ZGLA 1V6MA 1DYPA 2VW0A 3DUIA 1W6QA 3QCWA 2D43A 4FPOB 4K1YA 3IMNA 5E8AA 3SH5A 2ZHKA 5DZGA 1V6OA 4KBBA 1YRZA 1LHUA 2A6ZA 3WCRA 5JOWA 4AGVA 3W59A 2UWCA 3BIWE 4FOYA 1FNZA 1EPWA 2Q5TA 4XXPA 4M01A 4Q1RA 4DRVA 4ATEA 1MZ5A 2DUPA 2A71A 2E7TA 4GALA 5T5OA 1ULDA 2JD4A 3OY8A 1Q8VA 4XJZA 2AUYA 1DQ1A 4YM3A 3VKOA 1W6PA 4XJ8A 1LODA 3ILRA 4GWMA 3NV3A 5BYNA 5KXCA 5CNAA 3AP4A 4ASMB 3OYWA 3VKFC 1LHOA 3D4KA 4FPCA 1VAVA 2ZMKA 3JU9A 3T2TA 1ULFA 3M3OA 2PHRA 5GLWA 1UZZA 1LOAA 2NM1A 4Q1PA 1W6QB 3NV4A 4U36A 1Z78A 1LTEA 5IK4A 1O4YA 1QF3A 2H0BA 1WCSA 3AZWA 4YW1A 4Y1XA 4Y24A 5SV8A 4BOWA 1SACA 4ZKTB 1GBGA 1S0FA 3AZVA 4FPEA 5DUWA 3WOGA 2UURA 2VY0A 3M3QA 1MVQA 1UX6A 1GNHA 1VIWB 4AGRA 4BLJA 4R9AA 4UW4A 5IK8A 4M3CE 3OY8B 2A6XA 4LBJA 4Y1VA 2YXSA 3CNAA 1W6PB 4XMAA 4FQZA 1N3PA 2DWRA 2W08A 1MACA 1PZ9A 2YMZA 3OYWB 3ZYPA 3INAA 4M3CB 4XOGA 1LECA 2PHXA 3D6EA 1GZCA 1R1ZA 1SLBA 2EXKA 1AX2A 3R4SA 1Q8PA 1IKQA 1Q8QA 1BYHA 3AK0A 2DVGA 1APNA 1MS9A 1N1TA 1ENRA 4BM8A 1HDKA 1VAMA 2R0FA 1LHNA 2VW1A 4Q8KA 3D5OA 3FBYA 4ATFA 4W65A 2OUHA 3GALA 2FMDA 2ERFA 3SH4A 1BQPA 2C5DA 2HYKA 1CN1A 1JBCA 1FAYA 5HCFA 1QNYA 3WHUA 4LBKA 5GALA 3WDWA 4BLIA 1LJ7A 1LULA 1JHNA 4FOWA 5T50A 3M3CA 4PBOA 4HANA 1F9KA 1A8DA 2JDZA 1YIFA 1MS0A 4K1ZA 1FATA 4WVWA 5CBLA 3RMYA 1LOBA 1N1YA 2CWSA 2D44A 1A78A 1JXNA 1GZWA 2A70A 1TEIA 2R0HA 1N47A 1DLLA 3AZZA 3ZXEA 3ZXKA 5DUVA 1GYKA 5EYXA 3SITA 1MR5A 2ZHNA 4Y20B 4YZ4A 1C57A 1AJKA 4JRAA 1H9PA 4GWNA 1H30A 4FPGA 1QOOA 1AXKA 2DUOA 2EAKA 2KM2A 4XHBA 3B9CA 4XBLA 3HN1A 3PVEA 3N3HA 2VW2A 4YGCA 2AGSA 1KDMA 4AVTA 4BMEA 1ZM1A 2GALA 3FUOA 3SISA 3LCPA 3RS6A 2DTYA 1GZ9A 1Q8SA 3AYCA 3UL2A 3WCSA 2ZGMA 2CNAA 2DVDA 1LGNA 2TEPA 2ZGPA 3N35A 5DZEA 3WG3A 3IM0A 1N3OA 1PZ8A 1RIRA 3APBA 3B00A 1W6MA 5HCAA 1UN1A 2P34A 4XMIA 5IK7A 1GZWB 4WVVA 1GSLA 4FPFA 1LU1A 1MS1A 1WW5A 2ZMNA 4FPLA 2UWBA 3I8TA 5JOZA 3PVOA 1C4RA 1GICA 4AWDA 1JUIA 1LCLA 1RITA 1DQ5A 1G7YA 2GN7A 5T52A 1DIWA 2ARXA 3TB0A 3U4XA 1OQ1A 4K21A 1C1LA 4XJUA 2G4IA 1IS3A 4TYSA 1UAIA 2V5YA 1CR7A 2VU9A 1LGCA 1ENQA 3AX4A 2A6WA 2CY6A 3KM5A 4MYEA 5GZGA 2ZABA 3B01A 2LALA 5GZCA 1S0CA 1W6MB 3BOPA 1KITA 3QLQA 5DUXA 4XBQA 1VALA 1LGBA 1Z0HA 2D6KA 2EIGA 3L2YA 4FPYA 3WDVA 1LOEA 2GN3A 3ZSKA 1NXD1 1SLTA 3WDYA 3VV1A 3PJQA 5GLVA 3N7MA 3RMXA 2WKKA 1DBNA 1QOTA 1G9CA 1GKBA 3OGGA 4ISRA 4DS0A 3VUOA 3ZSJA 2DYCA 4XXAA 3LSDA 3VKLA 1MS4A 5JDBA 3USUA 5KXBA 4M3CA 3ZSMA 1IS6A 3FLPA 4LBMA 1I1EA 4LBOA 4Q27A 3FUQA 3A0NA 1AF9A 1KDKA 2UU8A 1AJOA 1DHKB 1KJLA 2D6NA 3MW4A 5H9RA 3ASIA 1JN2P 2NMNA 1CPNA 2AH2A 5T5LA 1V6IA 4PF5A 1H9WA 4HL0A 2ZGSA 2E7QA 4LBQA 1V6JA 2ZGNA 1O4ZA 5DG2A 4LBLA 1W6OA 4AVSA 2ES3A 4BMBA 1WD4A 3POSA 1HLCA 1IS5A 3WV6A 4AVVA 1QOSA 1W6NB 2A5ZA 2ENRA 1FV2A 1LOGA 1X50A 2DUQA 4XTMA 2A3WA 1V6LA 3MPPG 3USUB 2WJSA 2DVBA 4GA9A 2V73A 3B69A 1JYIA 1V6KA 2R1DA 2GNMA 4JC1A 1QGLA 1CONA 4Y20A 3M2MA 1LOCA 4FP3A 3WDXA 3IPVA 3AZXA 1DQ2A 1FYUA 2DU1A 2WNEA 2DURA 3WG4A 1S0GA 2A6VA 2PHFA 4LBQB 1AX0A 2ZGKA 3AP9A 1DYKA 2PHWA 3RG0A 3AXDA 2EF6A 1FNYA 2ZGUA 4Y1UA 1W6OB 2P37A 3AJZA 3C2UA 3T1MA 4PQ9A 4L8QA 1NLSA 2RHPA 5L73A 4Q8LA 3UJQA 2GDFA 3KQRA 4FPJA 1UKGA 2AENA 1CIWA 1JYCA 2WT0A 5JOXA 1UMZA 3WVJA 3WZ1A 4LBNA 2OVUA 2VH9A 5CAZA 1G9DA 5FREA 4I30A 1OKQA 1MS5A 2W39A 2YV8A 3ILNA 3WHTA 4FVVA 1G9FA 2GNDA 5F5QA 3ZXJA 5CA6A 2CTVA 1JW6A 2OUJA 3IPVB 3R4UA 5DG1A 1WBFA 2E51A 2ZACA 1DQ0A 3ZVXA 4XYXA 1CVNA 4GKXA 4YG6A 4JCKA 4ZXKA 5H9QA 2JECA 4AGGA 4NOTA 1LESA 2AR6A 3HR9A 3AP5A 4PCRA 5IUQA 5GZEA 2JKBA 2FHRA 2NYYA 4RA0A 4Y22A 5AVAA 1GV9A 1ONAA 3M1HA 3TAYA 1SLAA 4XIKA 3WDUA 1CESA 1WW7A 4WZFA 4ITCA 3SH3A 2A7AA 2WSVA 3R05A 5EYYA 3NV1A 2P2KA 2YY1A 4R9CA 1BKZA 4H55A 3LSEA 1CQ9A 1MZ6A 4P14A 1WLCA 4U2AA 1UZYA 4K20A 2VUAA 1MVEA 2D6MA 2DTWA 2D3RA 4XTPA 1BJQA 1G9BA 2YZ4A 4M3CF 2EALA 5T54A 5KXEA 2ZHMA 1N3QA 3O5SA 4Y22B 2ZMLA 3AZYA 3RRDA 4XZPA 3H0OA 1A3KA 3UJOA 3WG1A 1KJRA 3AP7A 5FRAA 4P9XA 4Z8BA 3ZXLA 2OW4A 4YLZA 1BXHA 1SBFA 2D3PA 4FOVA
chains in the Genus database with same CATH superfamily
4YZ2A 4XJWA 1BZWA 5CFCB 2IXIA 2X8KA 4S2FA 3W58A 5CU1A 1WUVA 2Q0AA 1JS9A 2W92A 3OEBA 5LW9A 1OFSA 3O0VA 4HPKA 4DMIA 3FFZA 3WSOA 3TNPB 2CDPA 1J3PA 4A45A 3KB5A 1QDOA 1ND3C 1JODA 2XJQA 5D8AC 5E6HA 3DKWA 1RMU3 4GMP1 2C4XA 3M7AA 2HEWF 3LEGA 3M8LA 4KWLA 4YZ3A 2VE1A 4QPWA 3J7HA 3J8F2 1G8WA 1BK0A 1S0IA 1AR73 2A3YA 2FBEA 4ET7A 2VTXJ 2NP0A 4GH4C 5A3NA 5K7PA 4OUSA 1BK1A 5GLZA 2OPWA 5IAXA 1RUI3 1QQP2 1ODMA 2WSUA 4Q4W3 3T09A 3ZN5A 3O1PA 1O3QA 5E89A 2ID4A 3O1RA 3BKZA 3U11A 2SLIA 5LZ6A 2Y6GA 1SG3A 3VDAA 2C9AA 1WLTA 5D1IA 2Y60A 4COVA 1J1TA 2Z42A 1LU2A 4EN6B 4MZUA 1S2BA 1SBDA 4XVHA 2DBIA 5FY7A 1AL22 4OQ9A 2DFBA 1OI6A 2BFUS 3TEYA 2ORXA 1AR93 3EO6A 4SLIA 4Z1VA 3OF1A 3M3EA 5I0UA 4CZSA 4I0AA 1JH5A 3T2QA 1MEC1 3AYDA 4H2AA 2OXBA 2B39A 1PMHX 2LROA 5JZGB 1LHVA 4K7JA 5T5JA 5FY9A 1ZBA3 2LW8A 2JB8A 1NKGA 3C7FA 4Y4YA 3I54A 1B35B 2XVLA 1FX5A 2JDNA 5IJRA 4EN0A 3ITQA 1QQP3 3T4VA 4LMFA 4AXOA 3BTAA 2D7FA 1U5YA 4KG0A 3ZFFB 3H7JA 5A6QA 1VBA2 3BODA 2HWC1 2R30A 3NNGA 3H1WA 1KD7A 4X6QB 2OQ7A 1AX1A 4OULA 4YVWA 3PMSA 1N1SA 3UT0A 2G9GA 1Q56A 1AL23 4BYYA 3WX5A 1V0AA 1O8SA 5BNNA 1XE7A 1X36A 4PT6A 3RZZA 3O1MA 1NQJA 3SLIA 2I74A 4G9SB 4AI2A 1QJX3 2BOJA 3NAPC 1SFYA 4NIIA 1JOBA 3VBSA 3ZDVA 4BQ1A 4EZHA 1ZRDA 3RQ0A 2PA7A 3TN92 4IGPA 5FAXA 5FUPA 4FPHA 2ZGOA 4RHV1 1C8NA 1QJEA 2YPJA 1JYXA 1BLZA 5FTTC 2R1BA 4XURA 4WM7A 2A6YA 4Q29A 2RJLA 1E5HA 4XUOA 1YIPA 3FWEA 3U37A 3MEPA 4A6OA 4AYUA 2VULA 4IV1B 1RHI3 4LT5A 2Y33A 3IBMA 1CPMA 3K3OA 4Y1YA 1UL9A 3DPRB 4E2GA 3CMGA 3VBRA 4LORA 2RE9A 2P3JA 4QT6A 1JYWA 1YO8A 3URFA 3WNMA 1QJY1 2W2IA 3I2KA 2QBXA 1PNFA 4XABA 4NIHA 2BBAA 3K3NA 4LK6A 5FMOL 3WUDA 4AAPA 2XL7A 4QXCA 1XC6A 5IVYA 1V9U1 3RDIA 1LOFC 1BHGA 1S4CA 2EA7A 2GNBA 3KSCA 2WS93 4JKLA 1IOAA 2ZTNA 3MDPA 1U0AA 4LLOA 4UFKA 1QJU2 3V0BA 5F6LB 5BY5A 1O3RA 2VUDA 3U78A 2JIGA 1YJLA 4UYBA 1ZNPA 1YC61 2ZEZA 3OPWA 1LHWA 4HONA 2QZ2A 2YHJA 3ZYHA 1HQLA 3OCPA 4JGZC 1CIYA 1WW6A 2CSGA 4EWEA 3ELNA 1RUJ1 1ASJ2 4QXBA 1OFNA 5AC91 4UW5A 1WMEA 4GAZA 1OLQA 4O61A 3BYWA 4YM0A 4LITA 4AI1A 1H1IA 3ZYGA 3WF3A 5FBJA 2BJSA 4I02A 4CXXA 3O1UA 4PIYA 5D21A 3WLUA 2W52A 5IT6A 2A75A 2ZZQA 1DFQA 3HNYM 4QPGC 5FZ1A 1ENSA 1R092 5FY0A 2ZOEB 1JOPA 3LQCA 2GNTA 3AC0A 3P6BA 3KT7A 1NCQC 1QXPA 2ZX3A 4Q4Y2 2J1TA 3ORJA 5FK8A 2EIDA 4P5HA 3DEMA 4LKSA 3OJBA 1ULCA 1JOJA 5LBCA 2QQIA 3I59B 2I2SA 4GXLA 3ZFEA 1GP5A 5JOYA 2W9XA 1DGLA 5H9SA 3VD4A 2C26A 2B46X 5LK5A 1DP0A 5JXJA 2ZJCA 4FP2A 1PK6C 2I45A 4HVOA 3WW4A 3AB0A 4D8MA 5C9AA 4P9WA 2VD7A 3LIGA 4COZA 4J6GA 1V6MA 5EP9A 3DUIA 4FPOB 2D43A 2FZ1A 5E8AA 3IMNA 4KGGA 1ASJ3 1SFPA 5DAPA 5FZEA 4PQQA 4KBBA 1LHUA 4AGVA 2JB4A 3HN3A 3BIWE 2FCVA 3RGBA 4EN9B 4URAA 5ACA1 5ANNA 5FMBA 1R093 1K5MC 4B7EA 1EY2A 1NE4A 1PNGA 5J09A 2DUPA 2E7TA 3JBG2 2WDBA 3PURA 1ULDA 3J7MA 4GALA 3POFA 4XJZA 1GQPA 1UW8A 3VKOA 1UMHA 5BYNA 5IVJA 5FPAA 2V4VA 3BCWA 3WW2A 3R0RA 4B1MA 4BQXA 5CEHA 5KXCA 2CGPA 4XQWA 5F7UA 1NZIA 1Y9MA 4FPCA 2PLV1 1VAVA 4QX7A 4ZS3A 2MHFA 2K2SA 3MICA 3M3OA 4EV0A 2E9QA 2PHRA 3LFMA 5A7WA 4Q1PA 1W6QB 2WZPP 1VRBA 4W8JA 5IK4A 4DUXA 4B8EA 1VBC3 5J36A 3PTRB 3S7IA 1WCSA 5LA2A 3VLBB 2QQJA 2VOKA 2XHNA 3AZWA 1D7PM 2WFF1 2X5IC 4GD4A 4Y24A 1R1A1 5SV8A 4BOWA 1S0FA 4FPEA 1X82A 2O8OA 2XJPA 3VDDC 1ZZ9A 2VY0A 2Y6JA 1MVQA 4BLJA 3GZUC 4R9AA 2E33A 2WZ8A 3KF5A 4M3CE 2WQ4A 1J58A 1DGRA 3OY8B 2CU5A 5FZMA 2RS52 2YXSA 3TWIA 1W6PB 3JBG3 2DWRA 1H6YA 2HWE3 3IAPA 1PZ9A 3OYWB 4XW3A 3I2JA 5J48A 1PVC2 4QQOA 1WKYA 4QX0A 3D6EA 5FZ8A 4LPLA 1GZCA 5K0UA 1OLMA 4UF0B 4ZHNA 3FBMA 3R4SA 4FI9A 3J7LA 4E2SA 3VBUB 5JIAA 1Q8QA 4IEVA 1APNA 2WABA 4QXKA 4PDWA 4CVUA 1LHNA 3H42B 2FMYA 1L7QA 3FBYA 4EZ4A 2W91A 3H7YA 5L7OC 2OUHA 1DGRN 3GALA 3CF6E 4QM8A 2FMDA 2ERFA 3EB7A 2Q8DA 3SH4A 3ZIXA 4A2UA 2HYKA 2BUKA 3BGAA 1CJDA 3RYPA 5LY1A 3KV6A 4KMQA 5HCFA 3T30A 3WXPA 1OLME 5FZIA 1LULA 2B9VA 3MFCA 3ZIWA 4IW3A 2WNUA 4XUPA 2BBVA 1A8DA 2JDZA 1W90A 1VBB1 4OHWA 1YEWA 4JKKA 5CBLA 5JIUA 5C8CA 4K6BA 2X09A 2Z2SB 2D44A 2A70A 1JXNA 3AZZA 3WF2A 1PM7A 1D0GA 2VMHA 4I09A 2HWD1 1GYKA 3SITA 2ZHNA 4WM8C 1BEV2 1C57A 3CQOA 4JRAA 1XNCA 4DXZA 4GWNA 4AFCA 4FTSA 4CCDA 4CCMA 1C8M1 2GP5A 1QIQA 3PVEA 4AHWA 1RUF1 3M3IA 4AVTA 2DCYA 4BMEA 2IZWA 2GALA 3SISA 3FUOA 2OYZA 4I3PA 1RUG1 1Q8SA 1UXXX 2OA2A 2VMCA 2TNFA 2Y0IA 2ATFA 3UL2A 2IXKA 2ZGMA 3WCSA 4FXKB 5DZEA 2DVDA 4QPIA 3HD8B 2PHDA 1QEXA 3MHZA 1RXFA 1W6MA 4Q0SA 5L9BA 3UGGA 2A73B 4V1PA 3RYRA 4CXWA 3POBA 4WVVA 4QDRA 1PX3A 1UIJA 1UZWA 2ZMNA 4N9HA 4FPLA 1Y43B 2BYVE 2R063 3PVOA 1GICA 2ZEYA 2D97A 2G1MA 2GN7A 4RR3A 4META 5FMOS 1CAXB 4UXAA 4OFGA 1F4HA 5T52A 3U14A 2ARXA 1QJZA 2VQTA 3TB0A 1BEV3 3DXUA 3BI3A 3WF0A 4XJUA 3DV8A 4DUVA 1AYN1 4CEWA 1IS3A 3LDKA 2V5YA 2F6BA 1LGCA 1ENQA 2J42A 4HFSA 4A7KA 2A6WA 4CEYB 5CG9A 3LEMA 4IUGA 4MYEA 4RQPB 5FWJA 5A32B 4I0WB 4L0PA 3P1IA 3I49A 1ZBE2 4AVBA 2FCTA 3N9QA 1ZREA 3FMGA 1LGBA 1Z0HA 3D0SA 2G9FA 3L2YA 4FPYA 4QB2A 3LE0A 3RVHA 3WDVA 4HMZA 2WZEA 2YC4A 1VR3A 3OBZA 1Q43A 2LRPA 1D2QA 3MIBA 5ERLA 3VD3A 3WDYA 2FDGA 3N7MA 4B4QA 4DUWA 1HRI2 4RS5C 2RS11 4DS0A 2QNKA 2WWUA 3IT8A 2DYCA 5LEKA 2KA3A 3LSDA 4UBHA 3VKLA 3W21A 1HN1A 1VBA1 5C6CA 5JDBA 2RM21 1FT9A 2R072 1IS6A 4LBMA 4D7SA 1I1EA 3JD73 1RUE2 1QXRA 2HWF2 3FUQA 4KG8A 4Q27A 1ND3B 2OKXA 5D8AB 4IV3A 3ZMNA 2DCKA 4UBGA 4RN5A 2D6NA 4D0QA 1F35A 2FCUA 2V4AA 1JN2P 4IDZA 5C4WC 1GQGA 1ALYA 1CPNA 1UYXA 1HN0A 2XOMA 1V6IA 4XFFA 1H9WA 5E1RA 1GFF2 3KCCA 4Q0PA 2ZGSA 3A23A 4GH4B 4LBQA 1V6JA 1ZBE3 4NHKA 4NRMA 1TE1B 3NMBA 2JE8A 4BMBA 1AR61 1W6OA 3SKJE 3POSA 4MGIE 2BVBA 4QKDA 1GU3A 2JDMA 2UY8A 1FPN3 3FN9A 4AVVA 5FYUA 3NJZA 2KR2A 1WCUA 3FZ3A 1HRI3 2JENA 4IE4A 2AC1A 5IVBA 1CAUA 3H8RA 2VTXA 1NLRA 5KR7A 1WMXA 4OHVA 3USSA 4ASKA 1OA2A 3NNJA 4HVRA 4N43A 4XQ4A 2J1SA 5CFDC 1W2OA 3B9IA 4P9LA 3T2OA 4K3UA 2X10A 3IPVA 4ARXA 2XXZA 1DQ2A 3HWJA 1QH6A 2HYXA 2BNMA 3PTYA 3VZKA 4E4HA 4OLLA 4UFMA 3ZYFA 2EF6A 3HVDA 1FNYA 4Y1UA 3VHOA 3H8OA 5I0SA 2XR4A 1H8TC 3MYXA 4CP1A 1NLSA 1HRV1 2VZ3A 1O91A 4Q8LA 1O3SA 3DXTA 5B4XA 2DFCA 1MEC2 3UGHA 1WGPA 2GDFA 1EUTA 4GMP3 1UKGA 2AENA 2WT0A 1JYCA 2J1RA 4AI9A 4OHYA 3AMQA 5FPZA 3WVJA 2GC1A 5JSRA 2VH9A 4X8PA 1QWRA 4BA6A 2BERA 2YV8A 4XZUG 3WHTA 3PDQA 1TQ5A 2YC2A 3K4DA 3AVSA 1K42A 2HWB1 2JD9A 3AFGA 2RS31 1FOD1 5FP3A 2HWC2 1LB2A 5FZFA 1KS5A 3I3DA 3NAPB 4GKXA 5LRSA 1W8TA 4AHYA 2XVGA 3CLPA 4CDQA 1J3QA 1O5LA 3B7MA 1EV11 3D8CA 4IE5A 3HR9A 4NN0A 2OIIA 5IUQA 2JKBA 2FHRA 2O8QA 2NYYA 3GBWA 5AVAA 2OS2A 1GV9A 4XDOA 1SPPA 3NNFA 3VD9A 2MEV1 1SLAA 3WDUA 4AHXA 1CESA 5FJHA 2A7AA 2B5HA 3R05A 5EYYA 3NV1A 3ZFGA 2YY1A 3MLLA 4DINB 3KMHA 3RPQA 4W4ZA 4H55A 5EQUA 1MQTC 1NA1B 3F95A 4RHV2 3POIA 2F17A 1NOVA 2FD8A 3ES4A 3AKTA 3VBHA 1I5PA 4U2AA 1MPXA 4Z92B 4QQPA 5EFUA 4CU6A 1AR81 1RGSA 5KC5A 3PNAA 2D6MA 1HQNA 5J37A 4XTPA 2VMEA 2VOTA 3CU7A 4H3WA 5EHDA 4P9GA 4BWOA 4JKMA 2ZHMA 5JPMB 4IEOA 1H2LA 2JKXA 1DGWX 1N3QA 2FDHA 1QJY2 4Y22B 1KFUL 4XZPA 5A6XA 2WYSA 3A7QA 3H0OA 3KLSA 4QHZA 3K46A 3I2OA 1V9U2 2GAUA 3UJOA 1HXS1 1KJRA 5FRAA 2OW4A 1VRH3 5CKMA 4YW6A 3WD5A 4C0BA 2DVAA 2GP3A 2XBO3 3AYAA 2P6CA 4FOQA 4NHMA 2QQLA 4UOJA 3T3YA 3BTYA 1SDWA 1SLIA 2BFUL 4OZXA 4AK3A 1CGPA 1Q8OA 4YFZA 3QACA 3KHBA 4QPGB 2D6LX 3GHMA 4FFHA 5DXDA 1EYBA 3HBKA 1COV2 4Z07A 2ET7A 1RUJ2 1NCQB 3T1LA 1UY3A 5AC92 2ZX0A 4YM2A 4ZU4A 2GH8A 2CYFA 1W6NA 3OB8A 4IEXA 4YW4A 4HSLA 2ARBA 3IN9A 1RYYA 2YPDA 3S6PA 3DYOA 5J3UA 1DZQA 2VZRA 2X29A 3WQ1A 5DDJ3 1ZRRA 3G7DA 4IXLA 3A4UA 5CKQA 3VZLA 4C1XA 4RFRB 5DZFA 5JZGA 1XNTA 4MSVA 1IQAA 1PVC1 1WA6X 1NY71 1ZA4A 1PK6B 5A6YA 3DECA 2RG4A 1V9U3 1B35A 1E5SA 1RVF3 1I3HA 2LTNA 1OOPB 1HQWA 2BQPA 3I97A 3CIHA 4XDQA 4CE8A 4COUA 2EIEA 2Y34A 1OA4A 1HV0A 3KHCA 3JZVA 4QQLA 2A1XA 5I0TA 3ZFFA 5LK7B 2ZHLA 3M70A 5JVVA 3RWNA 4F8AA 1S0EA 1Y3TA 2E7AA 1VBD1 1QKQA 5F3GA 4B1LA 1SDDB 2XB6C 3ACFA 1OSGA 1K5MB 5ABJA 4A3XA 3WY6A 4OMCA 2D3SA 2ADEA 3PUIA 2AREA 1YXWA 4KWJA 2ZAAA 1WW4A 1T6BX 1WWYA 2VR4A 1C3HA 4K8FA 5HCBA 4ASLA 4CCKA 4AVCA 5T55A 3VZJA 5ACA2 4ZU7A 1IGOA 1S1AA 3O14A 1IPKA 2VUJA 1AL0G 2OZJA 1F31A 3V0AB 1D2SA 3BVCA 4QQHA 1OF4A 1GWLA 4YGBA 3FFQA 1W2NA 5BUVA 1GNZA 2WA3A 3RWKX 3O1SA 3N36A 4ISQA 5L9VA 2X5IB 2PLV2 1NQDA 3DPRA 3VZMA 4CCLA 2WC2A 3O1OA 3VDDB 4OHZA 3PLQA 2EICA 3NJVA 1TZOA 4R4ZA 4LHKA 3WQBA 5IATA 3THPA 4FXGB 3KGZA 4AQ2A 2W68A 4DO0A 2CL2A 1S2KA 1I9RA 2WFF2 3A0KA 4A3ZA 4Q26A 1R1A2 1IPSA 4YM1A 1X7NA 3AJYA 4PHZA 2SBAA 1LAJA 4AQTA 4JHTA 4P08A 5C5UA 4WV8A 1RINA 2JG9C 2VOVA 4XCBA 4YARA 2YBSA 3V64A 1OC1A 1UOJA 3H9AA 2XJTA 2JDUA 3N7LA 1Q3EA 3AKQA 3BPZA 5JLVA 1PX4A 2NMOA 1LEMA 3WHUA 3WNXA 2XJRA 5F1RA 1YYNA 3FLRA 1V6NA 4OI2A 5DQ0A 1PMIA 5GLUA 2ZA9A 1OKOA 2D6OX 2UWAA 4Q2FA 3VBSC 2Q8CA 2BEOA 5FXVA 4FBFA 5L7OB 1TME3 3N4MA 1DQ4A 5T5PA 4P02B 3THCA 3ZXAC 5F37A 1IPJA 4ZU5A 3GZEA 1HX6A 5CB7A 3RNSA 4UI9L 3EBRA 3HQUA 3JQXA 1I5ZA 4LE3A 4WM7C 4I01A 5EV7A 3RI9A 2MPFA 5CVRA 2DU0A 4ZY9A 1KEXA 3POJA 4IE7A 3DYPA 4FQ4A 4CTEA 5FIXA 3S5AA 1UY2A 2QZ3A 2EXHA 1R1A3 4R9BA 1VLNA 3IDCB 1DQ6A 1XE0A 1QY4A 1XB9A 3I59A 4HSJA 3VBRC 5I8TA 1FV3A 4XQDA 1HJFA 4DEVA 5JUVA 2EXJA 2IUWA 4RL7A 4CPBD 1CJPA 3RZMA 3ON7A 1VBB2 4S2GA 3N7JA 4AEJA 3CBNA 1FMD2 1AXZA 2GMPA 2WT2A 3ACLA 4RYDA 1M06G 1A6CA 2HWD2 3I4IA 2VCCA 1YI7A 2R041 2JG8A 2LM3A 1X9TA 4GQ7A 4DQAA 1NT0A 2HWF1 3Q8EA 1JYVA 4H7MA 4XF0A 3THTA 1C8M2 3NNMA 3BTZA 3MW2A 4W6XA 3O0WA 4TZDA 2B9UA 3JUUA 4JZRA 3HMYA 3UKNA 1RUF2 3NV2A 5IFPA 1NCRC 1KRIA 3DGTA 1F2NA 2QFEA 4LXLA 1RUG2 1PO21 2XQXA 3ILFA 1OUSA 4BE3A 1FI2A 2HBTA 1D4VB 3LZZA 1OT5A 1UU6A 3MF6A 5A3MA 1DYPA 1YWKA 1W6QA 2EIBA 2HH9A 4HBNA 4K1YA 2VMDA 3EJKA 3N9LA 3SH5A 3OUJA 4BXSV 1TMF1 1V6OA 1VBB3 4TXWA 2A6ZA 3WCRA 4QX3A 2UWCA 4OI4A 5DAQA 3W59A 4IE0A 4TN7A 3WNOA 4J1XA 5FZHA 1FNZA 2HWD3 3NVCA 1WMFA 3LEIA 2GC2A 3J26N 4LQRA 1NXMA 4ZONA 5IW0A 4NROA 4Q1RA 3FJSA 3V56A 4E8CA 1UY0A 2QTWB 4GB31 3LAGA 1C8M3 1YFUA 3OY8A 4MGYE 1AYN2 1DQ1A 2VJXA 3I3QA 5FYZA 4XUNA 3ZO0B 1W6PA 4C90A 4XJ8A 4YM3A 4IL7A 1RUF3 5IVEA 5CNAA 4ASMB 3OYWA 4AEKA 3PU3A 1LHOA 4X8NA 4XF1A 2ZMKA 3T2TA 5FKBA 2BVVA 2JDKA 2WZR1 3E6DA 1LTEA 3VBUA 1O4YA 2ZS6B 1QF3A 4NPRA 1DDLA 3L9JT 1GQHA 3J8F3 2IVJA 2G9ZA 2VMIA 4CDXC 2ZX1A 1NUKA 1L7LA 2GZWA 3AZVA 5DUWA 5LCWL 5K9YA 1UX6A 5IK8A 2RS12 1RC6A 4XACA 3ETQA 4JGYB 1W0NA 4N90A 5C4WB 1DCSA 1EAH1 2RM22 1JZ5A 3CNAA 4MGSA 5AFBA 1K3IA 1N3PA 4FQZA 4LKEA 2BW8A 2PQQA 1RJ8A 2W08A 1MACA 1AYN3 3K77A 1PO11 4ZXEA 4AR2A 3AVRA 4E8DA 3B5LB 2FQPA 3S5QA 4NHLA 4ZS2A 3S30A 4RGGA 1XU2A 2DCJA 1AX2A 2VXJA 4KH9A 1IKQA 1ZZCA 3AK0A 1GOFA 4L2NA 2DVGA 1UF2C 1RUC2 3T4HB 2WA4A 4OQ8A 1ENRA 2IXCA 3DCQA 5FY4A 4BM8A 1H8VA 2JDYA 4NHYA 5I8YA 5HXMA 4CCCA 1AR62 3LOBA 5JXGA 2QE3A 3CDZB 4ATFA 4W65A 4QB6A 1WMDA 2C5DA 1FAYA 1H6XA 5K0UC 5BNOA 1O5UA 1BVP1 2LS6A 3LD8A 1REFA 4JVAA 1VJ2A 1U5ZA 2VECA 5FZ4A 5GALA 3WDWA 2RJ2A 1JZ3A 3FL7A 4BH9A 3M3CA 4MOAA 1VBA3 4PBOA 2RM23 3LPFA 4O9GA 1YIFA 1MS0A 2ZXQA 1FATA 3KGLA 4D7YA 2C24A 3RMYA 1N1YA 2YGMA 3CJIC 2W46A 1SZBA 3ZXKA 1N47A 3LIHA 1KS4A 4BCUA 1MR5A 1L3JA 4Y20B 5IAVA 3WNPA 1H9PA 2YFUA 1O6UA 3KS7A 5C71A 1CAXA 4LNVA 3AMMA 1AXKA 2EAKA 3KZ4C 3NKGA 4LK7A 5F3IA 4XBLA 3TN93 2Y6LA 2FDJA 1HRV2 2O0OA 5JPNB 3N3HA 1J3RA 2VW2A 4MH0E 4YGCA 1CWPA 1ZRCA 4MX3A 1ZM1A 2E31A 3HPNA 1COV1 1HIXA 4AL9A 3AYCA 4CEYA 3O1TA 1STMA 4AEDC 3NW4A 2TEPA 3ZKYA 1LGNA 4RQPA 4W6WA 5C33A 2GU9A 4C0HA 1DZTA 5A33B 3UESA 2HWB2 2P34A 4CP9B 5F2SA 1GZWB 1F8VA 4INDA 2RS32 4XPVA 1FOD2 1LU1A 4Z2AA 1AYM1 4XUQA 3OD4A 1C4RA 1GP4A 3THDA 3WP6A 1LCLA 2BRTA 1EV12 3LA3A 1DIWA 1MQTB 3D3AA 5FZBA 3ME2A 4LO8A 3U4XA 4K21A 1QJU3 5FP8A 4QPIC 3BUCA 5FCCA 2CGNA 2MEV2 4EROA 3F2ZA 1JU3A 2K9ZA 1HRV3 3AMPA 4QD2A 2DCZA 5IVCA 3VHPA 1Y9QA 3WQ7A 3AX4A 5D8AA 5FLHA 4NIAA 2JDHA 3KM5A 3OSDA 4PF1A 2ZABA 3B01A 3CZJA 2LALA 4LOTA 1S0CA 3QLQA 1AR82 3AL5A 3PUQA 2B45X 5A70A 1VBE1 1W9FA 3HT2A 5LA9A 4GH4A 5FPLA 2HWB3 1RUH1 1SLTA 2PQSA 2PHLA 4CEWC 3A21A 3PJQA 2RS33 2BGCA 5F8PA 5FYIA 3ZPOA 4Q4Y3 4KWKA 3OGGA 4B3NA 3VUOA 4O7XA 1EV13 3ZSJA 2H6CA 1REDA 4XXAA 1ZZBA 2PFWA 4QX1A 4LO7A 4LO5B 5FZ9A 1HB3A 2VZTA 2PN5A 1Z7S1 1HXS2 2BDRA 4CP2A 4M3CA 3LKJA 2XL9A 5C3SA 3GZAA 1GWMA 2MEV3 3NSTA 4R4XA 2XMLA 2VCAA 1AF9A 1KDKA 2VQ0A 1AJOA 3Q8BA 1W8WA 3ASIA 1X33A 4Q0QA 3ZN6A 5CADA 2Z4FA 4PF5A 3SEPA 4HL0A 2BPA2 4BB3A 4A41A 3T0AA 3ZYBA 2E7QA 3ECQA 1AR83 1GNYA 3KVBA 4AVSA 2XONA 3UGFA 3NO8A 4JX0A 4WVMB 1HLCA 3MV01 4IV3C 3BU0A 1RTVA 3LPGA 3FHAA 2ENRA 2A5ZA 1FV2A 3ACGA 3QH6A 3SCHA 5HPOA 4W6YA 3RFRA 1V6LA 3IWZA 3USUB 2WJSA 4QHOA 4QQ2A 1H2MA 1NY72 2DVBA 2V73A 3B69A 1JYIA 4UFLA 3EMRA 1HXS3 2Z79A 4P9IA 5FYCA 4GJZA 4FFFA 4QHBA 1UWWA 4FP3A 4XFIA 2DU1A 3KT1A 2BWCA 1YQ2A 2NPIA 2PHFA 4R52A 5FYBA 4LE4A 3RZGA 1VBD2 2YBPA 1DYKA 2VCMA 2YG0A 2ZGKA 3AP9A 4UAPA 5T3NA 3C2UA 2HBUA 4PQ9A 3HJRA 2RHPA 5L73A 4DY3A 4FTBA 2TUNA 4WZCA 5FMCA 3U4SA 4IERA 3UJQA 1OUXA 2VMGA 1CIWA 1T2XA 3RYKA 5HXVA 2RS53 1XJAA 3C8XA 3GM8A 3WZ1A 5FLJA 2Y0OA 4BXFA 5FZOA 1NA1A 5CAZA 3VBFB 5FREA 1OKQA 1ULPA 1MS5A 1RL3A 1TNFA 3BTXA 1FMD1 2QQWA 1G9FA 1PVC3 2GNDA 2Y6HA 4OCTA 2VG9A 4ORFA 5F5QA 1H4GA 3ST7A 3ZX7A 4B4RA 1JU4A 3CZUA 2WLPA 4BK5A 1ACCA 2ZACA 1DQ0A 2W47A 3GZTB 1NG0A 1CVNA 4YG6A 4ZXKA 5H9QA 4EN8B 2JECA 3ZM8A 1LESA 1SFNA 2AR6A 1UY1A 3B02A 5GZEA 2JG9B 1YQ6A 4N53C 4SBVA 1VBD3 4Y22A 2O14A 1ND2A 3TAYA 3B94A 4XIKA 3SH3A 4WZFA 2VGDA 4ITCA 5G05L 3VN4A 2KD7A 4GWJA 5K8SA 4QX2A 3U1XA 5D2AA 1W8HA 3HEIA 1XE8A 3VBSB 1CQ9A 3WF4A 4X6RB 4P14A 1US3A 1WLCA 1F5JA 4IETA 5A1LA 4MGKE 1POV1 4URTA 2WNOA 5CKNA 2Y6FA 1G9BA 2QQUA 5F3CA 1NCQA 5IVVA 4M3CF 2EALA 1AR91 5A1FA 3ZFGC 3BIEA 4MLOA 3UKVA 1ULOA 4N7UA 5EJZB 3I3BA 5FPVA 3O5SA 4AW7A 4CU7A 2W87A 5C3RA 2FDKA 1UZVA 3VBRB 4EQVA 5GKAC 3VBHC 3OD0A 3GGLA 4K40A 2PAKA 1A3KA 4CU9A 1JYTA 3AP7A 4P9XA 2Z5WA 3OUHA 4Z8BA 3ZXLA 1PK6A 2L9LA 4D6SA 1OVSA 2YBKA 3A22A 1OOPA 5KHIA 2AACA 2ZZJA 3LA2A 2DVFA 5FV3A 2NN8A 3CEWA 1X8MA 2YROA 3H3LA 3OBAA 1SCSA 3PMEA 2WNVC 5FOJB 4YGEA 4XJAA 3POWA 2YB7A 4XEZA 4HETA 4XF9A 1V00A 2XKPA 5FZKA 4NE9A 3VBOA 1PM4A 3I2FA 3PUHA 4FAGA 1AXYA 1K5MA 1G6NA 1QMJA 3L2HA 3VKNA 4ARYA 4YW3A 4HZFA 2JEMA 2BNOA 3FLTA 3N9OA 4JQRA 4Y5TA 4XCAA 4XE9A 5JXIA 1NCRB 5APAA 2JE7A 4Q0UA 2R042 1QJX1 1W06A 5CG8A 1WLWA 2VBPA 4H7LA 1UPSA 4N8MA 5CISA 2GMEA 4O65A 1OBNA 3P5BA 1ZYBA 2YU2A 3AL6A 3PHMA 4OVEA 4PI0A 3V0AA 2JICA 4XAAA 4CDWC 1XOYA 3E5QA 2XDVA 2WL1A 3GYDA 1HKDA 2QUOA 1RUC1 3CL1A 3I3EA 4KBZA 2XVKA 1PO22 1ZRFA 2X5IA 5FQ0A 4R9DA 3UKTA 2Q8OA 5JZGC 2VZUA 3VDDA 3N9NA 5C3PA 1WD3A 3WW1A 2PYTA 2VO5A 3POYA 1B35C 3ZXGA 4BQ5A 1W9YA 1CAVB 4NHXA 5C8WA 1TMF2 1GZTA 3LF7A 4PLNA 4Z2WA 4KWUA 2ZPXA 1LEDA 2QVSB 1CZSA 2OT7A 5FK7A 4QGLA 2WS91 5DAXA 3ZFFC 4QX8A 4YW7A 2R073 4TWTA 4D7TA 5E88A 2P1BA 4KU7A 1P8JA 1RUE3 3JB4C 2HWF3 4NR1A 4BQ4A 2K46A 4L92A 4GB32 2ORZA 5A7PA 4A7ZA 5ABJC 5FP9A 2G19A 2E53A 3ACHA 4Q4X1 2A3XA 3CJXA 3NKTA 4IEUA 4A4AA 4QGMA 1OLRA 3POEA 4CDXB 5FO8B 1C28A 1ULEA 4ZZ8A 2XJVA 1PO23 4D3WA 4DXTA 5L7OA 1G9AA 5LASA 2WZR2 5GZFA 2FDFA 1ZZ7A 5A7WB 5EIYB 3WP5A 1S0DA 5I8SA 4EYUA 5BNPC 4QB1A 1LRHA 1G86A 4O9EA 3HNMA 5FZDA 5KC6A 4BPZA 4JTNA 4KL1A 4YGDA 4AFBA 2XG3A 4CDUC 4XJ9A 3ZXFA 4ZZ5A 4QKNA 5A1AA 5FZGA 3PU8A 3ETPA 3V65A 1ENXA 1CX4A 1WLDA 2CDOA 1HB4A 1EAH2 1ULGA 5FZ7A 2PHUA 4ONUA 4AG4A 3LWCA 1S0BA 1JI6A 1PO12 3LGRA 2X05A 1PMJX 1VMJA 3OPZA 3SNMA 1AVBA 4DPNA 1RUNA 4DXRA 4YNIA 5LBBA 4DB5A 4YVSA 3IIIA 4CYDA 2WT1A 5B4NA 5K0UB 3GBGA 4BDVB 1BBT1 1MEC3 1C1FA 3MUZ1 2ZGTA 4YW5A 2VOWA 4FPKA 3WW3A 5FZ3A 3ZYRA 1F4AA 1Y7BA 2VAUA 1R081 2P3IA 4E4SA 2YYOA 2C0ZA 2XWBB 3N7KA 3OTFA 5CFCA 2GMMA 3OBRA 1IG3A 5IK5A 5A3UA 1OA3A 4UFIA 5BXXA 2ZGQA 3VL8A 1W2AX 1UNBA 2VUCA 1W04A 1F5FA 1OD5A 1XRUA 1XSQA 3CJIB 2XLAA 4M4PA 1OURA 3WG2A 1SLCA 3O0XA 2W1WA 4YG0A 4F3JA 5I0RA 1VP6A 1SMVA 5E16A 5F3EA 5KXDA 2P3KA 2HWC3 4LHLA 4XC9A 5A7QA 1MS3A 4YFWA 4A42A 4BK4A 2CAUA 4IGOA 1OXCA 3NRUA 4IQPA 2VZSA 4XILA 1TNRA 3HOBA 3SQOA 4JGZB 5GZDA 2QDNA 1W2UA 5LATA 4D6QA 4KNCA 5A80A 4XFCA 4AEDB 3AP6A 3CKHA 4IEPA 4DRRA 3C7EA 4MVTA 4RHV3 2CWMA 2OPKA 2HEYF 4I3GA 4DFSA 3ATGA 3DYMA 4MXWB 2C9KA 3SEEA 3IDEA 1Y9GA 4CP0A 1W8ZA 2WQZC 1WBLA 5I0DA 2JG8C 2E6VA 3T2PA 4YZ5A 2PELA 5J98B 2IVIB 3TEXA 1YQ8A 3W20A 2VW0A 3QCWA 4NMIA 1CD3G 4P5YA 3ZSEA 4QPIB 1H2KA 2D5FA 2WAAA 1QJY3 2ZHKA 5DZGA 4DNYA 2GH2A 1YRZA 1AYM2 3GHNA 4M4RA 5JOWA 4FSJA 5KWRA 2BP6A 4FOYA 5TSWA 1YFWA 2C1FA 4Q0VA 3U10A 1EPWA 4XXPA 1ZX5A 2GSYA 4B29A 5LA1A 2E26A 1RUD1 3HQRA 3AM2A 1MZ5A 4N9IA 3P3NA 1DU3D 3KD4A 4JGYA 2XHKA 3Q8AA 2AUYA 1BCXA 1LODA 4GWMA 3NV3A 5FZLA 2C6SA 2KXLA 4FT8A 3I2GA 3HBZA 3OEAA 2VNRA 4G3YC 1OD3A 4M0NA 1COV3 4CEWB 1RUJ3 1UD1A 2QQMA 5AC93 1ULFA 1W3XA 3AKPA 5FJKA 5HBAA 2NM1A 4U36A 1Z78A 4PLOA 3ZYJB 2H0BA 1VBE2 5AFEA 1XNKA 2IFWA 5FZ6A 5FY5A 3MIEA 4YW1A 1RUH2 4Y1XA 2VZOA 4I2OA 3DL3A 1SACA 4ZKTB 1GBGA 3VZNA 1CAWB 1W9WA 4HN1A 2Y8KA 3KV9A 1VIWB 1GNHA 1JZ2A 5FXZA 3I2HA 3IMMA 4IV1A 2A6XA 4BIFA 1Z7S2 4Y1VA 2WWSA 2W1QA 1W8NA 4FFIA 3WR0A 1NAEA 2RMU1 3ZYPA 3INAA 4DZGA 1LR5A 2RDSA 3VZOA 2PHXA 1SLBA 1R1ZA 2YGLA 2EXKA 3KWVA 4IV3B 2RDNA 3CHXA 5A3OA 1HB1A 2R061 2WUHA 1BYHA 1JYNA 4NRQA 1W8UA 4UFJA 4KGQA 1VB2A 1HDKA 2VW1A 2R0FA 3SXWA 1VBE3 5ACA3 4MO3M 5IHRA 4JTOA 4OUEA 4YVWC 4V2VA 1RUH3 2QJVA 4HK8A 4MV2A 3HQXA 2BWAA 2D5HA 2NQYA 3H3UA 1BQPA 2ZEXA 1K45A 5BNNC 1JBCA 5JI7A 3EHKA 1LKNA 1UPIA 1W03A 1HV1A 1UOGA 1OQDA 1QNYA 3QOPA 1J1LA 4LBKA 3VD5A 4BLIA 1LJ7A 2H0VA 4FOWA 5T50A 1Y4WA 4HANA 4QDQA 1F9KA 5DPNA 4XUTA 1YQCA 5LBEA 4GWIA 3H1MA 4K1ZA 2PLV3 3RZJA 1PGL1 4WVWA 3BN6A 5FZ0A 5F2WA 4CP9A 2CWSA 1GMMA 1GZWA 4GZ9A 3O1VA 1CX1A 3NL1A 5FO7B 4HXCA 5DUVA 3WQ0A 2VNOA 4B4PA 3QD6A 2VNGA 5C5TA 4COYA 1AJKA 2WN3A 5BNOC 1XU1A 2QCSB 4FPGA 1KXGA 2WFF3 3N9MA 1JZ6A 1QOOA 1MQTA 2DUOA 3B9CA 2DCTA 5IVFA 2H6BA 1UCXA 3TRSB 1H2NA 1JUHA 1RJ7A 4I0BA 5KHKA 4WM8B 3MIGA 3J4UH 2VNVA 1Q5OA 3LCPA 4K8RB 4TSVA 2DTYA 3RS6A 2BGOA 2D40A 3VB9A 3ZXDA 4E2QA 5FFOC 4EWAA 4AFMA 5FXXA 4LJHA 2CNAA 2XQRA 1PGW1 2VC9A 2Y6KA 1N3OA 1PZ8A 2WAOA 1RIRA 4N53B 1UN1A 3C3VA 5L19A 2HLEA 4OUMA 2UWBA 3I8TA 2BGPA 5JOZA 5LB6A 1JUIA 1RITA 1YQ5A 1DQ5A 1RMU2 4XF3A 3RI8A 5I91A 4HVQA 1FPN1 2UYAA 1D4M1 1C1LA 1AR72 3IAQA 2G4IA 4S2HA 2IXHA 1O7FA 1JZ7A 5A7NA 3K4ZA 2IXJA 4IGQA 1RUI2 4TYSA 4XF4A 5FO9B 2D98A 4Q4W2 1UAIA 1SEFA 1XBFA 2XLFA 4YRDA 2IFRA 2N7GA 2PMWB 2UY9A 4BJ0A 3E97A 3BOPA 3MPBA 5DUXA 4EE2A 4XBQA 2RDRA 1VALA 1FMD3 2EIGA 1I6XA 2D6KA 3VBHB 3ZFEC 4E27A 2GN3A 1VPHA 3VDBA 3EXUA 2J1EA 2YFZA 3I2IA 3VV1A 1AR92 5GLVA 3UYJA 3MO4A 4NPLA 5C9AC 1JZ4A 1F15A 4WVMA 4PIXA 1G9CA 2OZ6A 5L9RA 5HI0A 4MADA 1UX7A 2WNVB 1MS4A 5HV4A 2RR11 2GC3A 5A3LA 3USUA 2XJUA 5KXBA 1ZBA2 3W9AA 3ZR6A 1RUG3 1CZVA 3MGUA 4LBOA 4QKBA 4RS5B 4UF0A 5A6ZA 1O3TA 1GUIA 2J22A 2UU8A 2XUMA 4AE2A 3MW4A 2ETEA 5H9RA 3FHIB 2YUEA 4L97A 4BZ4A 5JAXA 5T5LA 4AHZA 1RUOA 4RSUA 2WR9A 5CZKA 1VMHA 1POV3 1WD4A 3U0ZA 4XETA 1EP0A 3WV6A 3PIGA 4CDWB 1QOSA 1W6NB 1YHFA 1LOGA 1QJX2 2V5DA 2J1UA 2A3WA 3JB8A 4XTMA 5DABA 3E6CC 1XNBA 3MPPG 3ZDSA 4C8DA 1VMFA 4GA9A 3VBFA 3QBQA 1V6KA 5B2GB 1RB8G 1HW5A 2O1QA 1W2TA 2R1DA 3EQEA 2GNMA 4JQTA 4LA2A 2BU9A 3RZHA 4LHNA 3M2MA 1JTZX 1LOCA 3U75A 1RHI2 2DURA 3VD7A 3WG4A 3OOXA 1S0GA 2A6VA 2WIIB 2X53S 4N7IA 5FP4A 3RG0A 5CFDB 3AXDA 5LEJA 1W99A 2BTVC 2ZGUA 4LO6B 2JG9A 3T1MA 2AEYA 5HV0A 1XPWA 2R32A 1W8FA 2RS13 5ABJB 2V09A 4J25A 4Y3OA 2EVXA 5EJ1B 5BPXA 1UU4A 3BOWA 2WS92 1VRH1 2K0GA 1UKRA 4A44A 1XYOA 5DAVA 4IEWA 4LBNA 4PDWC 2OVUA 1H8TB 2XBO1 4HKLA 3MIFA 1X9PA 2W39A 4IE6A 4FFGA 5FXWA 4AEMA 5JR2A 2RVAA 5FUIA 2JIJA 4Q4X2 2BOIA 1JW6A 2CTVA 2OUJA 3R4UA 1WBFA 2E51A 3NQHA 1AUYA 5BNPB 4XYXA 4QAWA 1RUC3 2W1UA 1YLLA 4NOTA 4AGGA 4MG2A 2WNUC 3G6JB 4CDUB 3O7OA 1AR63 1S2EA 1NA1C 2ZKLA 5C8CC 4CCEA 3UETA 2P3YA 2VTFA 4NAMA 3LB9A 1A34A 5DDJ1 1GOHA 4LA3A 3R6SA 2HJIA 1WW7A 1J83A 3H50A 2VQUA 5HCHA 2VL4A 2WSVA 1PIV1 3PIJA 4R9CA 4P00B 1BKZA 1U5IA 4K9SA 1RVF1 5A32A 1PGSA 3HNBM 1IHMA 3POGA 1MZ6A 5FYTA 4EWDA 1X8EA 3J7NA 4E4ZA 4XFBA 1UZYA 4K20A 4IESA 2VUAA 3LOIA 4CPBA 2J7MA 1S55A 2AZ5A 1O4TA 4J1WA 2XLGA 1ND2C 2VOXA 3SCFA 2YZ4A 4Q4X3 3UV9A 1MZEA 4COWA 5KXEA 1WCDJ 1E5RA 2MNGA 3OGSA 1XNAA 1NCRA 5J1XA 2ZMLA 3GCWA 3LDBA 3RRDA 5C7GA 3E5XA 1BBT2 4BHPA 3WG1A 1ND3A 1R082 4JAAA 4YLZA 1BXHA 1KGYA 1SBFA 3MFAA 4RR3C 3TOJA 2Y38A 4HKWA 5A3PA 4FOVA 4GMP0 3AKSA 1KQRA 2VBDA 1D0HA 2R6QA 3ENRA 4IEQA 4AI0A 2R16A 2VXRA 1W3VA 2VBBA 3U07A 1POQA 1SHWB 2VVEA 2JJ6A 1QJFA 3K48A 3T0DA 1FOD3 2XJSA 1XXNA 4C1WA 3KT4A 2D6PA 1DYOA 4JRLA 3AFKA 2NLRA 3LA7A 4RGKA 3TEZA 1WCQA 1ST8A 1AZDA 1CAVA 1VBC2 1OOPC 2NZ9A 2ILMA 2PTMA 1PZ7A 4ES8A 2BZDA 4QU1A 1UMIA 3MV11 4QMAA 2JG8B 4YW2A 5FWEA 1MS8A 5LA0A 1BBT3 3GXUA 4D6RA 3VBOC 3IKWA 1NE6A 4QXHA 4CCNA 1R083 5H9PA 3QH7A 4M00A 2AEZA 2UYBA 4P9YA 5GM0A 4BQWA 2WBKA 1OH3A 2WFPA 4HN0A 2JDPA 3W5MA 1MZFA 1SLLA 2HWE2 4HPKB 4CDXA 3D82A 4Y1ZA 3H8XA 2W0XA 1GP6A 1TME1 1U5XA 4CU8A 4CXYA 4LBQD 1SBEA 4Q4V1 3D0JA 3SCGA 4XDPA 4Y5Z0 1LENA 3FHQA 1DF0A 3FC0A 3FE5A 2CV6A 1E57A 5AVPA 4BQ2A 3AXEA 5GJ6A 5J96B 3AMNA 2ZKNA 3K75B 2JWPA 1VAKA 4YG3A 4BQ3A 5IFTA 1RUD2 2AYHA 4DIQA 4XFAA 5JMCA 4AZZA 3TNQA 3S0MA 2EXIA 1UOBA 1NX9A 3NAPA 5FUNA 4A7YA 4FO9A 2Q8EA 4LLFA 3I3MA 1J84A 4NIGA 4XFGA 3VGIA 4FTEA 5DN2A 5FKCA 4CA9A 4UW6A 1ZRIA 4N43C 1B09A 5A7OA 5F9TA 2DBNA 5EXOA 1N1VA 3VHRA 3VKMA 4QX5A 2ZBJA 2FZ2A 5DUUA 5F32A 4XHXA 3UK9A 1TVGA 4P9JA 2QDRA 5BNQA 3IDBB 1XQNA 4XBNA 2VVFA 5EPAA 3KCYA 3PJYA 3O12A 3WUCA 4XFHA 3ZLIA 3R4DB 2TBVA 2R49A 1URXA 4L99A 1JZ8A 4OZOA 4UW3A 3CJIA 4YZ1A 1BMV1 2JE9A 1LOFA 1H1MA 4F83A 1RUD3 5FPUA 1ZZ6A 3GNEA 4OI1A 1RMU1 2RMU2 4LR4A 1H1AA 2PAMA 1EPZA 1OF3A 1QDCA 2WLQA 5GLTA 3AYEA 3ZKUA 4EJRA 1OHFA 4YVWB 4HG6B 3MIHA 1AR71 1UIKA 4JHZA 4LUKA 1DG6A 5EWSA 3HAGA 1AHSA 4HKOA 3DKQA 1GLHA 3WDTA 2R062 4JGZA 1RUI1 4D69A 5BNNB 2QQOA 4Q4W1 4QGNA 4JV4A 3PL0A 1VB4A 3WNKA 2ARCA 2B7YA 2PAEA 3PVNA 1W0OA 4PIZA 4Y26A 4NIDA 4AEDA 4CDQC 2R7EB 1IS4A 3GJAA 4BQYA 3NWKA 4PBPA 4FAHA 1K5JA 2IWGB 4MXWA 3OBTA 4QPGA 4WM7B 1BVVA 3AKRA 3SHRA 3MW3A 1C5IA 4XAEA 5FPBA 5FZAA 5ANQA 2LUWA 1OPOA 1W0PA 3GBFA 2VM9A 3Q9OA 4NO4A 4YVSC 4CUCA 2W95A 4AFDA 5BNOB 4V2WA 1E5IA 3ZYIB 1IKPA 1ODNA 1GWKA 2JDAA 3RSJA 1S0JA 2IC1A 3SMHA 2PHTA 4CUGA 3B3QE 1PGL2 1GANA 5CFCC 4C91A 2RMU3 2DV9A 5JSPA 4KI5M 5SV5A 3IDAA 4MGZE 3J8F1 1SCRA 2VPVA 3ZSLA 1ZBA1 4LIUA 2RJKA 3H3ZA 3J9SA 4GKYA 4QDSA 4Y33A 2GC0A 3RZLA 4PI2A 1O59A 4AAXA 1QQP1 2JX9A 3V0BB 4AVAA 2WRAA 4D94A 4LIVA 4CUBA 2ZGRA 1QU0A 3OGJA 3S57A 2WO1A 1QXJA 5KHJA 1UY4A 1HB2A 1QNWA 2WO2A 3JD72 5FY1A 3WP4A 2QQKA 4L9BA 4XIOA 3ZOIA 4CSWA 5LRRA 1AL21 2CHHA 3WINE 1PGW2 4CRQA 3ZPYA 2ZGLA 3ROUA 4L11A 2PXJA 4YYOA 5C3OA 4R8HA 4BISA 2Y64A 5C3QA 4Q5OA 5FY8A 4BIOA 1U12A 4LEJA 4LKDA 1CAWA 2Q30A 2Q5TA 5FR3A 4M01A 1FPN2 4DRVA 1D4M2 4ATEA 4JDNA 5FDBA 5ISLA 5T5OA 2A71A 2B42B 5IYYA 4AF9A 3H8UA 1C5HA 2JD4A 1L7RA 4Y4RA 1Q8VA 1RHI1 1WZXA 3ZFEB 2J1AA 1W39A 4BU2A 3ILRA 3AP4A 2Q1FA 5DAWA 3VKFC 3D4KA 5FPXA 3JU9A 3BB6A 5C9AB 1KFXL 5GLWA 1UZZA 3GCXA 1LOAA 1M4WA 3LDRA 3NV4A 2VZVA 4JGYC 4MXVA 1IG0A 2WO3A 2R043 4NWWA 4LO4B 4MGTA 4NUBA 5FOBB 5DMYA 3TN91 4IEYA 3WOGA 2QQPA 2UURA 3M3QA 2YU1A 4RGAA 5FYMA 2RV9A 3K4AA 4UW4A 1YJKA 4AGRA 3C7HA 1REEA 4ZPIA 3WNLA 3PUSA 4QU2A 3HT1A 2RR12 4LBJA 1D4M3 4RFT0 4XMAA 3TYJA 3KV4A 3CO2A 4CCJA 3SKVA 2YMZA 3MZHA 2VZQA 4LULA 2YC0A 4M3CB 4XOGA 1LECA 4OYUA 4UFHA 3RJRA 2VQAA 5EZWA 3IB3A 4TLFA 1Q8PA 4PJYA 1WCKA 4IV1C 1TMF3 5I93A 3X29B 1MS9A 1N1TA 2Q1MA 3OPTA 3ZN6B 2V72A 4JDMA 1VAMA 4Q8KA 3DPRC 3BPSA 3D5OA 1QJU1 2E63A 3MF9A 1US2A 1OMIA 1VE0A 4ES9A 1CN1A 2Z69A 1NLQA 4WM8A 5J7MA 4GB33 3WEZA 3S7EA 3WP3A 5FP7A 4LHSA 3E1F1 1JHNA 2RR13 3C7GA 1ASJ1 2B4KA 4NJ4A 3MBWA 4YSFA 1FXZA 3GJBA 4N53A 1LOBA 1WA4A 2Q4SA 5JMOA 2R0HA 1A78A 4Z82A 2WZR3 4JDOA 1TEIA 1UZ0A 1UYYA 1DLLA 4LOSA 2F4PA 3ZXEA 1NYWA 1V70A 1NZCA 2W1SA 5EYXA 4YZ4A 1R091 4QWNA 4NWVA 3KVAA 3WNNA 1K12A 1H30A 4PDWB 2KM2A 4Q4Y1 4XHBA 4OI0A 1ZVFA 1GR3A 3HN1A 3OG2A 1PVXA 2AGSA 1KDMA 5CIRA 4HLTA 1EAH3 1VRH2 3ZN4A 5C70A 1GZ9A 3KF3A 5JI9A 5JWPA 4HOOA 1POV0 4A6SA 5BV6A 4WVZA 1UYPA 2XBO2 2OX0A 3MUY1 5FYVA 2ET1A 2ZGPA 2WNUB 3N35A 1PO13 3WG3A 1LNSA 3IM0A 1VBC1 5FYYA 1GOGA 4QPYA 5FZOB 3APBA 3B00A 5C8CB 5HCAA 4XMIA 3Q8CA 2P6HA 5IK7A 3MI8A 1GSLA 1OQEA 1MS1A 4FPFA 1WW5A 3OGRA 5F5AA 5F6KA 2P5BA 5M0TA 4HT1T 5FZCA 4AWDA 4KQ7A 2JXAA 4LTAA 1G7YA 2ADDA 5IWFA 2DF7A 1OQ1A 2CGOA 2WYFA 3FX3A 1ZA7A 3JBG1 1PHMA 3IZOA 2WNVA 5DDJ2 2HWE1 3AMHA 1PIV2 2W94A 2VU9A 1CR7A 1ND2B 4F7ZA 4UWDA 1RVF2 2B8MA 4KU8A 4RS5A 1O8PA 5G04L 2CY6A 3M4FA 3B93A 5GZGA 4GULA 2ZX2A 1YCIA 3I2DA 5GZCA 2XPJA 1W6MB 2QKDA 1KITA 1XNDA 1XSRA 3OUIA 4HK9A 2W5FA 4QKFA 1YFXA 3ES1A 4YPJA 2D93A 3EYPA 1LOEA 3ZSKA 2ARAA 1NXD1 2IXLA 2QQVA 4NAOA 4QM9A 4RR3B 5FYSA 3RMXA 2WKKA 1DBNA 3RJ2X 1QOTA 2VZ1A 1GKBA 5C4WA 4ISRA 5JXHA 3RZKA 3MLJA 4CDWA 4NRPA 2YDEA 2RS51 2VCBA 3N9PA 1IZ3A 3BALA 3K2OA 3FLPA 2D3PA 3ZSMA 3W5NA 5FYHA 1RXGA 3A0NA 3WT3A 1JMUB 2E32A 1PIV3 1DHKB 1KJLA 3DN7A 3ZMOA 2NMNA 4LKFA 3WF1A 2AH2A 1UXZA 4OHXA 4W50A 1OH4A 3TEWA 2F4LA 1AYM3 1R64A 3KV5A 2ZGNA 4IEZA 5CFDA 1TG7A 1J59A 4E9KA 1O4ZA 5DG2A 4LBLA 4LUMA 2ES3A 3GF6A 3VBOB 4AQSA 4DOUA 1IS5A 3SC7X 3VBUC 2DUQA 1X50A 2ZAHA 2WN2A 2WINB 4G4FA 3VDCA 4GJYA 2EAAA 1SQ4A 1IQDC 1H8TA 1OPMA 3T08A 2I07B 1DGWA 1YI9A 3OGVA 5FLIA 5A3WA 1OVPA 4JC1A 1QGLA 1CONA 3PUAA 3JXSA 4Y20A 4YWAA 2XWJB 3WDXA 2Q1ZB 4AQ6A 2WO7A 3AZXA 5BNPA 1FYUA 2P4EA 2RDQA 2VMFA 2WNEA 1W28A 1BEV1 5F39A 4TLGA 3LFIA 4LBQB 1AX0A 1QHDA 2PHWA 4CDUA 1TME2 4EN7B 2XGXA 5FQ0B 1W6OB 2P37A 3AJZA 4NPMA 2CAVA 4Q4V2 3VBFC 4L8QA 2BNNA 2HEVF 4MHUA 4AOCA 4DXSA 1YNAA 2HKXA 5EJ3A 3KQRA 1JHJA 1W8OA 4FPJA 4Y5SA 3UNPA 5JOXA 2XUEA 1UMZA 4OMDA 1Z7S3 1CAUB 3KCXA 1UQXA 4UT5A 1UU5A 5A33A 1W9TA 4I30A 1G9DA 3ILNA 1CZTA 4N43B 2VZPA 4FVVA 5JR7B 2J1VA 3C7OA 2W3JA 4WBBA 3ZXJA 4MUVA 5CA6A 5FBZA 1UYZA 3IPVB 3ACIA 5DG1A 3NJXA 3DF0A 1UO9A 4M0HA 3ZVXA 3K51A 4JCKA 1QH7A 5CYYA 4AI8A 1XYPA 5A3TA 1A8MA 3MLKA 3ABZA 4MGQA 3AP5A 4PCRA 2QQNA 3P3PA 4RA0A 2ZEWA 3TBDA 4AI3A 1ONAA 2OQ6A 2WQ8A 3M1HA 2VVDA 3JD71 4Q4V3 5JSOA 4DY5A 1DLCA 5LBFA 4MHRA 3I7DA 5KHHA 2P2KA 1T6GC 4S2DA 5LWBA 4E4DX 3LSEA 1H4HA 1UOFA 3NJYA 4H14A 5JCTA 2ZX4A 3E6BA 5L36A 3VHNA 1BMV2 4CCOA 1DZRA 1H0BA 2P17A 3H1YA 3Q8FA 1MVEA 1ZBE1 1HJGA 5A7SA 3IIAA 2DTWA 2D3RA 3ALQA 5F5CA 3KQ4B 4B7KA 1BJQA 5K4LA 1ZZ8A 3HIFA 1XYNA 4CEYC 5T54A 4CDQB 2FDIA 3ZR5A 3LEKA 2ZCWA 2XKOA 4CUAA 4RQPC 1YUDA 2WWJA 1W9SA 2Y26A 3GDBA 1HRI1 3JQWA 3NNLA 2XH6A 5FMDA 2BV4A 4PLMA 3AZYA 3MIDA 5F5IA 5LY2A 4DEQA 1EUUA 1SPPB 4FCAA 3T0BA 3PVBB 4GIQA 4YVSB 2R071 3BU7A 3VL9A 3ZFGB 1YFYA 5KHGA 3E5UA 4AFAA 4TTGA 4RD7A 1RUE1 3JCIA 5KBFA 2DDUA 4NVPA 1W05A
chains in the Genus database with same CATH topology
4YZ2A 4XJWA 1BZWA 5CFCB 2IXIA 2X8KA 4S2FA 3W58A 5CU1A 1WUVA 2Q0AA 1OFSA 3O0VA 4HPKA 4DMIA 3FFZA 3TNPB 1J3PA 3KB5A 1QDOA 1ND3C 5D8AC 2XJQA 3DKWA 1RMU3 4GMP1 3M7AA 2HEWF 3M8LA 4KWLA 4YZ3A 3J8F2 1G8WA 1S0IA 2A3YA 1AR73 2FBEA 2NP0A 4GH4C 5K7PA 4OUSA 1BK1A 5GLZA 1RUI3 1QQP2 2WSUA 4Q4W3 1O3QA 3ZN5A 5E89A 3U11A 2SLIA 2C9AA 1WLTA 5D1IA 4COVA 1J1TA 2Z42A 1LU2A 4EN6B 4MZUA 1S2BA 1SBDA 1AL22 2DFBA 1OI6A 2BFUS 1AR93 3EO6A 4SLIA 4Z1VA 3OF1A 3M3EA 5I0UA 4CZSA 4I0AA 1JH5A 1MEC1 3AYDA 2B39A 5JZGB 1LHVA 4K7JA 5T5JA 1ZBA3 4Y4YA 3I54A 1B35B 2XVLA 1FX5A 4EN0A 1QQP3 4AXOA 3BTAA 2D7FA 1U5YA 4KG0A 3ZFFB 3H7JA 1VBA2 3BODA 2HWC1 2R30A 3H1WA 1KD7A 4X6QB 1AX1A 4OULA 4YVWA 3PMSA 1N1SA 2G9GA 1Q56A 1AL23 4BYYA 3WX5A 5BNNA 1XE7A 1X36A 3RZZA 1NQJA 3SLIA 2I74A 4G9SB 4AI2A 1QJX3 3NAPC 1SFYA 4BQ1A 3VBSA 1ZRDA 3RQ0A 2PA7A 3TN92 5FAXA 4FPHA 2ZGOA 4RHV1 1C8NA 2YPJA 5FTTC 2R1BA 4WM7A 2A6YA 4Q29A 2RJLA 1YIPA 3FWEA 3MEPA 4AYUA 2VULA 4IV1B 1RHI3 4LT5A 3IBMA 1CPMA 4Y1YA 1UL9A 3DPRB 4E2GA 3VBRA 2RE9A 2P3JA 4QT6A 1YO8A 3URFA 1QJY1 1PNFA 5FMOL 3WUDA 2XL7A 1V9U1 3RDIA 1LOFC 2EA7A 2GNBA 3KSCA 4LLOA 2WS93 3V0BA 1IOAA 2ZTNA 3MDPA 1U0AA 1QJU2 5F6LB 5BY5A 1O3RA 1YJLA 1ZNPA 1LHWA 2QZ2A 2YHJA 1HQLA 3OCPA 4JGZC 1WW6A 4EWEA 3ELNA 1RUJ1 1ASJ2 1OFNA 5AC91 4UW5A 1WMEA 1OLQA 4YM0A 4AI1A 1H1IA 3ZYGA 4I02A 4PIYA 3WLUA 2W52A 5IT6A 2A75A 2ZZQA 1DFQA 4QPGC 1ENSA 1R092 2ZOEB 2GNTA 3KT7A 1NCQC 1QXPA 2ZX3A 4Q4Y2 4P5HA 3OJBA 1ULCA 1JOJA 3I59B 2I2SA 4GXLA 3ZFEA 5JOYA 5H9SA 1DGLA 2B46X 5LK5A 2ZJCA 4FP2A 1PK6C 2I45A 4HVOA 3WW4A 3AB0A 5C9AA 4P9WA 4COZA 4J6GA 1V6MA 3DUIA 4FPOB 2D43A 2FZ1A 5E8AA 3IMNA 4KGGA 1ASJ3 4KBBA 1LHUA 4AGVA 3BIWE 4EN9B 5ACA1 1R093 1K5MC 4B7EA 1EY2A 1NE4A 1PNGA 5J09A 2DUPA 2E7TA 3JBG2 4GALA 1ULDA 4XJZA 1UW8A 3VKOA 5BYNA 3WW2A 3BCWA 5KXCA 3R0RA 2CGPA 4XQWA 4FPCA 2PLV1 1VAVA 2MHFA 2K2SA 3MICA 3M3OA 4EV0A 2E9QA 2PHRA 4Q1PA 1W6QB 2WZPP 5IK4A 4B8EA 1VBC3 5J36A 3S7IA 1WCSA 3VLBB 2VOKA 3AZWA 2WFF1 4Y24A 2X5IC 5SV8A 1R1A1 4BOWA 1S0FA 4FPEA 1X82A 2O8OA 2XJPA 3VDDC 1ZZ9A 2VY0A 1MVQA 4BLJA 3GZUC 4R9AA 4M3CE 2WQ4A 1J58A 1DGRA 3OY8B 2RS52 2YXSA 3TWIA 1W6PB 3JBG3 2DWRA 2HWE3 1PZ9A 3OYWB 4XW3A 5J48A 1PVC2 4QQOA 3D6EA 1GZCA 5K0UA 3FBMA 3R4SA 4E2SA 3VBUB 5JIAA 1Q8QA 4IEVA 1APNA 4QXKA 4PDWA 1LHNA 2FMYA 3FBYA 3H7YA 5L7OC 2OUHA 1DGRN 3GALA 3CF6E 4QM8A 2FMDA 2ERFA 3SH4A 3ZIXA 4A2UA 2HYKA 2BUKA 1CJDA 3RYPA 5HCFA 3WXPA 1LULA 3MFCA 3ZIWA 2WNUA 2BBVA 1A8DA 2JDZA 1VBB1 4OHWA 5CBLA 5JIUA 5C8CA 4K6BA 2Z2SB 2D44A 1JXNA 2A70A 3AZZA 1PM7A 1D0GA 2VMHA 4I09A 2HWD1 1GYKA 3SITA 2ZHNA 4WM8C 1BEV2 1C57A 4JRAA 1XNCA 4DXZA 4GWNA 4AFCA 4FTSA 1C8M1 3PVEA 4AHWA 1RUF1 3M3IA 4AVTA 2DCYA 4BMEA 2IZWA 2GALA 3SISA 3FUOA 2OYZA 4I3PA 1RUG1 1Q8SA 2Y0IA 2OA2A 2TNFA 2ATFA 3UL2A 2IXKA 2ZGMA 3WCSA 4FXKB 5DZEA 2DVDA 4QPIA 3HD8B 2PHDA 1W6MA 4Q0SA 2A73B 4V1PA 3RYRA 4WVVA 1UIJA 2ZMNA 4N9HA 4FPLA 1Y43B 2BYVE 2R063 3PVOA 1GICA 2D97A 2GN7A 4RR3A 4META 5FMOS 1CAXB 4UXAA 4OFGA 5T52A 2ARXA 1QJZA 3TB0A 1BEV3 4XJUA 3DV8A 1AYN1 4CEWA 1IS3A 2V5YA 2F6BA 1LGCA 1ENQA 4HFSA 4A7KA 2A6WA 4CEYB 5CG9A 4MYEA 4RQPB 5A32B 4I0WB 1ZBE2 4AVBA 1ZREA 3FMGA 1LGBA 1Z0HA 3D0SA 2G9FA 3L2YA 4FPYA 3WDVA 3ZN4A 4HMZA 1VR3A 1Q43A 3WDYA 1D2QA 3MIBA 3N7MA 4B4QA 1HRI2 4RS5C 2RS11 4DS0A 2QNKA 3IT8A 2DYCA 5LEKA 2KA3A 3LSDA 4UBHA 3VKLA 5C6CA 1VBA1 5JDBA 2RM21 1FT9A 2R072 1IS6A 4LBMA 4D7SA 1I1EA 3JD73 1RUE2 1QXRA 2HWF2 3FUQA 4KG8A 4Q27A 1ND3B 3ZMNA 5D8AB 4IV3A 2DCKA 4UBGA 2D6NA 1JN2P 5C4WC 1GQGA 1ALYA 1CPNA 1V6IA 4XFFA 1H9WA 5E1RA 1GFF2 3KCCA 4Q0PA 2ZGSA 4GH4B 4LBQA 1V6JA 1ZBE3 4NHKA 1TE1B 4BMBA 1AR61 1W6OA 3POSA 4MGIE 2BVBA 2UY8A 1FPN3 4AVVA 3NJZA 3FZ3A 1HRI3 2JENA 1CAUA 1NLRA 4OHVA 3USSA 1OA2A 4HVRA 4N43A 5CFDC 4XQ4A 3B9IA 4P9LA 4K3UA 3IPVA 1DQ2A 3HWJA 1QH6A 2BNMA 3PTYA 3VZKA 4OLLA 2EF6A 3VHOA 1FNYA 4Y1UA 5I0SA 1H8TC 3MYXA 4CP1A 1NLSA 1HRV1 1O91A 4Q8LA 1O3SA 2DFCA 1MEC2 1WGPA 2GDFA 4GMP3 1UKGA 2AENA 2WT0A 1JYCA 4OHYA 3AMQA 5FPZA 3WVJA 2GC1A 5JSRA 2VH9A 4X8PA 1QWRA 4BA6A 2YV8A 3WHTA 1TQ5A 2HWB1 3AFGA 2RS31 1FOD1 2HWC2 1LB2A 1KS5A 3NAPB 4GKXA 5LRSA 4AHYA 2XVGA 3CLPA 4CDQA 1J3QA 1O5LA 3B7MA 1EV11 3D8CA 3HR9A 4NN0A 2OIIA 5IUQA 2JKBA 2FHRA 2O8QA 2NYYA 3GBWA 5AVAA 1GV9A 2MEV1 1SLAA 3WDUA 4AHXA 1CESA 2A7AA 2B5HA 3R05A 5EYYA 3NV1A 3ZFGA 2YY1A 3MLLA 4DINB 3KMHA 3RPQA 4H55A 1MQTC 1NA1B 4RHV2 1NOVA 3ES4A 3AKTA 3VBHA 4U2AA 4Z92B 4QQPA 5EFUA 1AR81 1RGSA 5KC5A 3PNAA 2D6MA 1HQNA 5J37A 4XTPA 3CU7A 4H3WA 4P9GA 4BWOA 2ZHMA 5JPMB 4IEOA 1H2LA 1DGWX 1N3QA 1QJY2 4Y22B 1KFUL 4XZPA 3H0OA 3KLSA 1V9U2 2GAUA 3UJOA 1HXS1 1KJRA 5FRAA 2OW4A 1VRH3 3WD5A 4C0BA 2DVAA 2XBO3 3AYAA 4FOQA 4NHMA 1SDWA 1SLIA 2BFUL 4OZXA 4AK3A 1CGPA 1Q8OA 4YFZA 3QACA 4QPGB 2D6LX 3GHMA 5DXDA 1EYBA 1COV2 4Z07A 2ET7A 1RUJ2 1NCQB 3T1LA 5AC92 2ZX0A 4YM2A 4ZU4A 2GH8A 2CYFA 1W6NA 4IEXA 4YW4A 4HSLA 2ARBA 3IN9A 3S6PA 5J3UA 1DZQA 2X29A 3WQ1A 5DDJ3 1ZRRA 3G7DA 4IXLA 3A4UA 3VZLA 4C1XA 5JZGA 5DZFA 4MSVA 1IQAA 1PVC1 1NY71 1ZA4A 1PK6B 1V9U3 1B35A 1RVF3 1I3HA 2LTNA 1OOPB 1HQWA 2BQPA 4XDQA 4COUA 1OA4A 1HV0A 3JZVA 4QQLA 5I0TA 3ZFFA 5LK7B 2ZHLA 3M70A 5JVVA 3RWNA 4F8AA 1S0EA 1Y3TA 2E7AA 1VBD1 1QKQA 2XB6C 1OSGA 1K5MB 5ABJA 4A3XA 3WY6A 2D3SA 2AREA 1YXWA 4KWJA 2ZAAA 1WW4A 1C3HA 4K8FA 5HCBA 4ASLA 4AVCA 5T55A 3VZJA 5ACA2 4ZU7A 1IGOA 1S1AA 3O14A 1IPKA 2VUJA 1AL0G 2OZJA 1F31A 3V0AB 1D2SA 4QQHA 4YGBA 3FFQA 5BUVA 1GNZA 2WA3A 3N36A 4ISQA 2X5IB 2PLV2 1NQDA 3DPRA 3VZMA 2WC2A 3VDDB 4OHZA 3PLQA 4R4ZA 4LHKA 3THPA 4FXGB 3KGZA 4AQ2A 2W68A 2CL2A 1S2KA 1I9RA 2WFF2 3A0KA 4Q26A 1R1A2 4YM1A 1X7NA 3AJYA 2SBAA 4AQTA 4WV8A 1RINA 2JG9C 2VOVA 4YARA 3V64A 3H9AA 2XJTA 3N7LA 1Q3EA 3AKQA 3BPZA 5JLVA 2NMOA 1LEMA 3WNXA 2XJRA 5F1RA 1YYNA 3FLRA 1V6NA 4OI2A 1PMIA 5GLUA 2ZA9A 2D6OX 2UWAA 4Q2FA 3VBSC 4FBFA 2BEOA 3N4MA 5L7OB 1TME3 1DQ4A 5T5PA 3ZXAC 1IPJA 4ZU5A 1HX6A 5CB7A 3RNSA 3EBRA 3JQXA 4WM7C 1I5ZA 4LE3A 5EV7A 4I01A 3RI9A 2MPFA 5CVRA 2DU0A 4FQ4A 4CTEA 2QZ3A 2EXHA 1R1A3 4R9BA 1VLNA 3IDCB 1DQ6A 1QY4A 3I59A 4HSJA 3VBRC 5I8TA 1FV3A 4XQDA 2EXJA 4RL7A 1CJPA 1VBB2 4S2GA 3N7JA 4AEJA 1FMD2 1AXZA 2GMPA 2WT2A 3ACLA 1M06G 1A6CA 2HWD2 3I4IA 1YI7A 2R041 2JG8A 2LM3A 4GQ7A 4DQAA 2HWF1 4H7MA 4XF0A 3THTA 1C8M2 3MW2A 4W6XA 3O0WA 4TZDA 2B9UA 3JUUA 3HMYA 3UKNA 1RUF2 3NV2A 1NCRC 1KRIA 3DGTA 1F2NA 2QFEA 1RUG2 1PO21 3ILFA 4BE3A 1FI2A 1D4VB 3LZZA 1UU6A 3MF6A 5A3MA 1DYPA 1YWKA 1W6QA 4HBNA 4K1YA 3SH5A 3EJKA 1TMF1 1V6OA 1VBB3 2A6ZA 3WCRA 3W59A 2UWCA 4OI4A 4J1XA 1FNZA 2HWD3 3NVCA 1WMFA 2GC2A 3J26N 1NXMA 4Q1RA 3FJSA 3V56A 4GB31 3LAGA 1C8M3 1YFUA 3OY8A 4MGYE 1AYN2 1DQ1A 4DOUA 4C90A 4YM3A 3ZO0B 1W6PA 4XJ8A 4IL7A 1RUF3 5CNAA 4ASMB 3OYWA 4AEKA 1LHOA 4X8NA 4XF1A 2ZMKA 3T2TA 2BVVA 2WZR1 3E6DA 1LTEA 3VBUA 1O4YA 2ZS6B 1QF3A 4NPRA 1DDLA 3L9JT 1GQHA 3J8F3 2VMIA 4CDXC 2ZX1A 3AZVA 2GZWA 5DUWA 5K9YA 1UX6A 5IK8A 2RS12 1RC6A 3ETQA 4JGYB 4N90A 5C4WB 1EAH1 2RM22 3CNAA 5AFBA 4FQZA 1N3PA 2BW8A 2PQQA 1RJ8A 2W08A 1MACA 1AYN3 1PO11 3B5LB 2FQPA 4NHLA 3S30A 4RGGA 1XU2A 2DCJA 1AX2A 4KH9A 1IKQA 1ZZCA 3AK0A 4L2NA 2DVGA 1UF2C 1RUC2 2WA4A 1ENRA 2IXCA 4BM8A 1H8VA 5I8YA 3LOBA 1AR62 2QE3A 4ATFA 4W65A 1WMDA 2C5DA 1FAYA 5K0UC 5BNOA 1O5UA 1BVP1 4JVAA 3WHUA 1REFA 1VJ2A 1U5ZA 2VECA 5GALA 3WDWA 4BH9A 3M3CA 4PBOA 1VBA3 2RM23 4O9GA 1YIFA 1MS0A 1FATA 3KGLA 4D7YA 3RMYA 1N1YA 2YGMA 3CJIC 3ZXKA 1N47A 1KS4A 4BCUA 1MR5A 1L3JA 4Y20B 1H9PA 3KS7A 1CAXA 4LNVA 3AMMA 1AXKA 2EAKA 3KZ4C 3NKGA 4XBLA 3TN93 1HRV2 2O0OA 5JPNB 3N3HA 1J3RA 2VW2A 4MH0E 4YGCA 1ZRCA 4MX3A 1ZM1A 1COV1 1HIXA 3AYCA 4CEYA 4AEDC 3NW4A 2TEPA 1LGNA 4RQPA 4W6WA 5C33A 2GU9A 4C0HA 1DZTA 5A33B 2HWB2 2P34A 1GZWB 1F8VA 4INDA 2RS32 4XPVA 1FOD2 1LU1A 1AYM1 3OD4A 1C4RA 3WP6A 1LCLA 1EV12 3LA3A 1DIWA 1MQTB 3ME2A 4LO8A 3U4XA 4K21A 1QJU3 4QPIC 5FCCA